5BJRA

Crystal structure of the n-terminal rrm domain from mec-8
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
86
Chain Sequence
QVRTLFVSGLPMDAKPRELYLLFRGARGYEGALLKMTSKNGKPTSPVGFVTFLSQQDAQDARKMLQGVRFDPEAAQVLRLELAKSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mec-8 protein
publication title Conserved binding of GCAC motifs by MEC-8, couch potato, and the RBPMS protein family.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Splicing
total genus 15
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5bjrA00
2DNGA 2J0QD 2DH7A 2VOOA 2M8DB 1VQNS 4ERDA 1WHXA 2MZSA 2MKCA 2LQ5A 2CPYA 2J8AA 5BJRA 5JVHQ 2LA4A 1VQMS 1NU4A 1X0FA 1H2VZ 1H6KX 2MZQA 1YWXA 1WG4A 2BZ2A 3CC7S 1WI6A 2HGMA 2CPXA 1A9NB 2RS8A 1WI8A 2DNLA 3LPYA 2KHCA 1BY9A 2L41A 2DIUA 1F9FA 2HGNA 4Y0FA 1X4BA 3CCUS 2VONA 3UCGA 2MQOA 3SXLA 4F02A 4YOEA 1H2UX 2OSRA 2KI2A 2KVIA 1CVJA 3FEYB 2DO4A 2MKJA 1W2BR 2M4MA 3R27A 5H1SV 1U1LA 4IUFA 1K73T 5DDQC 2DNYA 1RK8A 2MJUA 5GAGU 5MLCV 4P6QA 2KM8B 1OPIA 2KRRA 2RS2A 1VQ4S 3G6ES 2OSQA 1X4AA 1FO1A 3VAMA 5HL7Q 3LQVA 2D3OR 1AUDA 3Q2SC 1UFWA 1YI2S 3UE2A 2CQ3A 2MMYA 2L08A 1KOHA 1U1QA 1FT8A 2DNZA 2M7SA 3SDEA 2CQHA 4U67Q 1JJHA 3HHNB 4WCEQ 1YIJS 3PIOQ 1M5KC 2JRSA 1X4HA 1N8RT 1X4CA 3MI7X 2N3LA 5DETA 3THTA 1WEXA 2J76E 3UWTA 4WFBQ 1DRZA 1M1KT 3EGNA 2ADCA 3ULHA 2X1BA 5D77A 3B4MA 2CJKA 2CQ2A 3B4DA 3TO8A 3CCQS 2QFJA 1OIAA 1A7GE 1S79A 2YKAA 2CQ0A 1UW4A 1Q86T 3CCVS 3US5A 3P49B 3CXCR 5DM6Q 3ZZYA 5CYJA 1VQ6S 2MZ1A 2VOPA 2CQIA 5LJ5Y 3CCES 3IWNC 1N52B 3TYTA 2YH0A 2CQ4A 1VBZA 1YHQS 1WF1A 2M8HA 2QA4S 3DXBA 2NZ4A 3EGZA 2DHXA 2DIVA 1YJWS 2DH8A 3VAGA 2XS5A 1QM9A 1U6BA 4EGLA 2M9KA 4IO9Q 1H2TZ 1SXLA 2LKZA 4LIRA 5LJ3Y 1Q7YT 2F3JA 2LXIA 1WHWA 2EK1A 4YUDA 1WHYA 3CMAS 2KT5A 3BO3A 5GMKa 1ZZFA 1N54B 4C0OC 5CXTA 2CQGA 1VQLS 3CCJS 1WWHA 4UY8T 1X5OA 3IRWP 2G1DA 2M52A 3G4SS 4C7QA 3CC2S 1YTYA 2D9PA 4WFAQ 2CPZA 2MQMA 2MYFA 3S8SA 3Q2TC 2F9JA 1KOOA 1DZ5A 2O3DA 3U1LA 2B0GA 2G4BA 5GADU 2YH1A 2WBRA 5IFMA 1X4FA 2MSSA 1YITS 3UD3P 3J7ZT 5EN1A 3VAIA 2CQPA 4OZ1A 2E44A 1PGZA 3VAFA 2MB0B 1U1PA 2FY1A 2DHSA 3G71S 4LMZA 2F9DA 2DNNA 2AYMA 4WF9Q 4J5OA 4IOCQ 4V19X 4FXVA 1WELA 1R8HA 3CC4S 1M90T 1FJEB 2A3JA 1UAWA 4UQTA 2K8GA 2LMIA 2DHAA 3S01A 3JB9k 3NNCA 1VBXA 2AYEA 1VQ5S 2MKKA 3I56S 2KG1A 3CULA 2OIHA 5JVGQ 2CPJA 1VBYA 2DK2A 4Y00A 3G96A 3EX7B 4CH0S 2XB2D 5IQQA 2X1FA 4ED5A 2DNKA 3MURP 4BS2A 2JVOA 3MD3A 1SJ3P 1P27B 4ZKAA 3G8TA 2E5IA 1X5TA 2KRBA 2K3KA 3ZZZA 3S6EA 2CQCA 3U1MA 1PO6A 3NNHA 2JWNA 4CH1A 2DGQA 1U1NA 1WF0A 4RU2A 1U1OA 1SJRA 2KXHA 3S7RA 5DM7Q 3UCZP 2RNEA 2NLWA 3VF0B 1VQ8S 2DGUA 5GAHU 1S72S 3CCMS 1VQPS 2CPIA 2ZJQQ 3BO2A 2OTLS 3CTRA 3NNAA 5LSLA 3D2WA 1U1RA 2Q79A 2DGSA 3CCSS 3MDFA 4QU6A 2RU3A 2MQQA 2PEHA 5FJ4A 2VODA 3THPA 2MSTA 2QEXS 1KC8T 2V94A 2MHNA 2DB1A 2RQCA 4W90B 1X5SA 1D8ZA 4W92B 3R1LA 1X4EA 2I2YA 2GHPA 4PKDB 1OO0B 1DBDA 2OTJS 2FC8A 2PE8A 2E5HA 2HGLA 2CPDA 2DNQA 2HVZA 4C4WA 4CQ1A 2KG0A 2HZCA 1U6FA 2GO9A 2DNOA 4PRFA 1D9AA 4PR6A 2MJNA 5DDOC 2KFYA 2DNHA 2MXYA 3UD4P 4IOAQ 1KD1T 1WF2A 1JMTA 2D9OA 2MKHA 4WIIA 3NS6A 1KQSR 2MGZB 2KM8C 2AYBA 4CIOA 3MOJB 2YWKA 3G9CA 2SXLA 1VC5A 2M2BA 2MQLA 2DGWA 3DLLQ 2KXFA 2DGOA 4TLQA 1O0PA 2RRBA 2OJ3A 1FHTA 1FXLA 1M5PC 1IQTA 3N9UC 2EVZA 2M70A 3MUVP 1N88A 2G0CA 3P3DA 3MUMP 2FPHX 2XNRA 3OW2R 1B7FA 2RUGA 1VQ9S 2MKSA 2DHGA 2CPHA 2DGTA 2XS2A 4OZ0A 3CPWR 2KU7A 2EK6A 1U1MA 2RVJA 2N7CA 5LSOA 4M5DB 3K0JA 1WEZA 1SJ4P 3VAJA 1SJQA 5LXYA 3H2UB 5HO4A 3J7YU 1YJ9S 4WKRA 2X1AA 1HL6A 3P5TL 5DDPC 1Q82T 2MZTA 3CCLS 1HD0A 5GVQA 1OWXA 2CQDA 5DDRC 1VQOS 1M5OC 3BS9A 2U2FA 1JJ4A 4QU7A 3MUTP 3SMZA 2JX2A 1X5PA 1DHMA 2J0SD 2AYGA 1M5VC 3NS5A 5IM0B 3P6YC 4QPTA 2N3OA 1HD1A 2E5JA 2DGXA 3VALA 2MQNA 1U1KA 3FEXB 4WFNQ 1XN9A 1ZZNA 1URNA 3MXHP 2ZJPQ 2MGZA 2MPUA 1VC6A 4QQBA 2LEAA 2CQBA 1Q81T 2RQ4A 2XS7A 2LYVA 1P1TA 2L9WA 2DGVA 2LXUA 2ERRA 1VQKS 2MQPA 2MY8A 1K8AT 3VAHA 2U1AA 1YJNS 2XSFA 3TP2A 3V4MA 4Z2XA 4FXWA 2BOPA 1K9MT 3R1HA 4TU9A 2LEBA 1QVFR 3CUNA 1HA1A 3VAKA 1L3KA 3HI9A 3PIPQ 2I38A 2CPFA 2DH9A 3CMES 1ZH5A 2LECA 3NMRA 2ADBA 2DNMA 2MKIA 1JJ2R 2KXNB 2DISA 2HYIB 3UCUP 1WHVA 2ZJRQ 1WTBA 1VQ7S 2E5GA 5ITHA 1RKJA 2DNRA 1WG1A 3MD1A 5GAEU 2CQ1A 3CD6S 4A8XA 2FC9A 4F25A 1SJFA 1NO8A 2DO0A 2UP1A 2MY7A 2RRAA 1WEYA 4TU8A 5LXRA 1QVGR 1FJCA 2JVRA 1X4DA 1U2FA 2RT3A 3BEGB 5D78A 1FNXH 1UP1A 4LJMA 2FHOB 3RW6A 5CA5A 1NJIT 2N82B 3L3CA 4F26A 1R8PA 4YB1P 3I55S 5IM0A 2KN4A 3CF5Q 2AD9A 2DITA 2LCWA 3SDEB 3RW7A 1X4GA 2MZRA 4TU7A 2KYXA 2M0GB 3H2VE 2CPEA 2LA6A 1G2EA 3G8SA 1VC0A 1FJ7A 2X1GA 2KH9A 2XNQA 2M88A 2YTCA 3CCRS 2MZJA 2DNPA 3BO4A 1WG5A
chains in the Genus database with same CATH superfamily
2J0QD 1VQNS 3DLBA 4ERDA 2YKNA 3EZOA 2HQGA 1JLEA 1T9XA 1VLYA 1HR0J 2ALZA 2CPXA 2BE9B 3CDBA 3IS9A 2HS0A 1E6YB 2KHCA 5JMNA 1F9FA 4JI7J 4WP9A 2OSRA 1RWWB 4F0MA 3M1VB 2BMBA 1RABB 2DR9A 1K73T 2UXBF 4HACB 2MDAA 3KJFB 5C42B 2DXDA 2F4VF 3M9NB 2HFOA 2QV6A 3UI3A 2IIHA 2OEKA 4WYWA 3MM8A 3AODA 4EZ6A 3F44A 3H2LA 2JDJA 1VR6A 2F1FA 3KJVB 5L1KA 1RE1B 2UXDJ 2YNIA 2CQ0A 4TQSA 3UDLA 2KFNA 4IR1A 3ZZYA 3QIDA 1NXIA 3GFXA 2BE2B 1FRLA 5L9XA 4RW6A 3VGSA 2QLWA 2OFGX 2HVDA 1N33J 1NZAA 3MM9B 4NCAA 2WONA 3OPKA 3W61A 1QSSA 4GO7X 3IC1A 4RBUA 2ZBIA 4K5SA 3Q8SB 1X5OA 2FVSA 2YKMB 2XULA 4WU2A 1SL2A 4WFAQ 2MYFA 2XY6A 5ETTA 1Y3JA 2YNHA 4X66J 4ITSA 1TL4A 4FYDA 4ZHRA 1NK7A 1RTHB 1REVA 5I42B 1U0HA 1JXLA 3G71S 4LMZA 1RTJA 3K2YA 2NQPA 4J5OA 1QSLA 2QFIA 3J81j 1FJEB 1Q8LA 4YR0A 2BE7D 4PQAA 3QJPA 1WNEA 4JI8J 2R7OA 2KG1A 2KJWA 4MYUA 4KC5A 2VHGA 4NYZA 2R8GA 3NMAA 1KEKA 2ZH3A 1V5IB 1NK5A 2PD1A 3R5AA 2JC0A 4QCLA 3OVSA 2HVEA 2CQCA 2GFFA 1GTEA 3PO5A 2CADA 4LF7F 5I3PA 1UL3A 3S7RA 5DM7Q 1UA0A 1WDTA 1N5QA 3LUYA 4Y6IA 4XPEA 5C25B 3Q22A 2QGFB 4F04B 2ROPA 3V5RA 5L9NA 4CWBA 1U8WA 2OH2A 1EQMA 1U6FA 2XY7A 3CDUA 1D9AA 1VBKA 2FVPA 1XTZA 2VA3A 4WZQA 4NASA 1HW8A 1SQGA 3LH2S 4MJKA 3TJAA 2VH7A 2P9CA 1ZTWA 3BH7B 2FPHX 5KT6A 1B7FA 1IM4A 3QT5A 4RNOA 3IR6B 2PMHA 4O3QA 1F3VA 3JSRA 4PYDA 1HBMB 5AXLA 5DG9A 5DJBA 4C2MA 1HW9A 1S7HA 4DXLA 3P5TL 4RW8B 4DU8A 3KXDA 4RWXA 1Z2LA 1IKXA 2XHCA 1T03B 3KMSA 3P6YC 3RU0A 2BKPA 4LF6F 3KK2B 4PQUB 1SC6A 2L9WA 1YJTA 4C8MA 4LQ9A 2WW4A 3Q8VA 4LRCA 3UNYA 1K0TA 3UN2A 2AIRB 2XEXA 3E2EA 4DUYF 3DOLB 3AAWB 1CQNA 3R6GB 4QWCA 2HQ3A 3CMES 5ETVA 5KT7A 2HLTA 1RWKB 4A8QA 3MCOA 4I2QB 4DG1B 2PA8D 5DQGA 1PCAA 4C8NA 4NRUA 5CQGA 1WTBA 2FLPA 2E7XA 5IT9U 3KUEA 2R7WA 2HVIA 5GAGI 5F8HA 5LXRA 3C6UA 3LP0A 3OFGA 2ZM6J 4DQQA 5I3UA 4ZVRB 3BYRA 5KFGA 1R89A 4B9MA 4USUA 4LUBA 2NPIA 1KR4A 5ETQA 4YY3J 1REGX 2J0WA 2XI2A 1BWEA 1KFSA 4O44B 1N36F 1RWXB 1JWWA 2DTJA 2KJVA 3R5CA 2VOOA 3J7A1 1FFWB 1GX6A 1QJHA 3M2VB 1YJ7A 2C2NA 2DT9A 2LDIA 4J9RA 3D6FB 1YRUA 3OR1A 2DIUA 2Q3PA 3R3TA 5HI7A 3CCUS 4YOEA 1DLOA 2Y9HA 2BR0A 2IJFA 2HHHJ 1QDUB 2FY8A 4FPIA 1YG0A 1CULA 5L1JA 4ZPTR 2KM8B 4DUTA 2HS4A 2ZKUA 5LMNF 3KLIA 3PVXA 4OJGA 4UY85 2HHQA 5GADI 3UWTA 4B3OB 4Z37A 1WDDA 2OPPA 3CJQA 5E3PA 4ZPAA 3HLUA 4K4TA 3TO8A 3ILOA 3NCRA 3P4UB 2ZH9A 1CSJA 4PWWA 1S77D 4X65J 1MMDA 1RQ0A 1NDKA 3CCES 3IWNC 1N52B 3TYTA 4KV8A 3DLKA 5K8NA 2RU9A 5F41A 3MM5B 4WBFA 1TV6B 4IO9Q 4LIRA 3I0RB 3MMCB 3BBCA 2LXIA 2EK1A 4I2PA 1IN0A 3RB0A 1UA1A 2CQGA 1NK8A 4DN0A 3RGIA 1KTVA 2G1DA 4E0DA 4DV3F 2H5JB 3JQKA 2GVZA 3GIIA 2LEPA 3ZNJ1 4WXWA 3ZXWA 3X3UA 3R7BB 1DTQA 2XLKA 2D41A 3TR5A 4ZJOA 3BGLA 4B9SA 4FF1A 2JLGA 2R8KA 5F9LA 2HFSA 2E44A 4RNMA 2FY1A 4A48A 5L1LA 4WE1A 4PXEA 4UZBA 3H4DA 3PKMA 3HSJA 1KQKA 2FHKA 4XO0A 1S97A 3PFEA 4NEYA 4HDGA 3FBBA 1G3OA 4LVOP 4OLOA 4K4WA 3JB9k 3NNCA 2MKKA 2QT7A 3NWRA 3LF0A 5HQMA 3X1LB 5E5NA 3PX6A 4JV5J 5KG7A 3SSSA 2JVOA 2MEWA 3MAAB 3S6EA 1PO6A 1FESA 3VZHA 3DYAB 1WF0A 2IC3A 2AJFE 2Q43A 2ZHAA 2HBQB 2PC6A 3I5AA 4XAKA 1U1RA 3AQPA 1UEKA 1RUSA 1CJUB 4N47A 4J9QA 1HHSA 4W90B 2ZEJA 3OTOJ 4DR2F 2LDYA 2KVQE 4PRFA 1SH3A 3OUYB 4KJIA 3I96A 4CLKA 4F2SA 2MGZB 1RT3A 4DV1J 4A8MP 3SCIE 3CEDA 2YWKA 1MNEA 2SXLA 4ED2A 1B99A 4JI3J 1H7XA 2OJ3A 4F0KA 5F8MA 2EFVA 4O0IA 2NUHA 3HF5A 3QIPB 2M70A 4YB5A 3MUVP 2H1YA 2YX1A 3W63A 1VQ9S 1UWAA 4F4WA 3ZTRA 4ED6A 3W2WB 4DV2F 3CJKA 2BUNA 2C2RA 1TAUA 4M5DB 2YBVA 1HL6A 2RMLA 1P6TA 4ILRA 3BKUA 2QG9B 4R5PA 4QU7A 3MUTP 2RDIA 4ECXA 1TKTA 4JYAJ 2HQFA 1PYOB 1RT5A 4NCBA 4DX5A 1TUGB 5HJXA 2LEAA 1Q81T 5IWAF 2W7OA 1P1TA 3AXMA 3M2RB 5KFHA 3KLEA 1S6PA 1U24A 3D0HE 3V4MA 4CO3A 4JI6J 4Y65A 3CUNA 4OJ3A 3RZAA 2R8IA 2VFUA 3DDIA 1HKAA 2MKIA 1S6UA 1XR6A 3A8EA 5DG7A 1S0NA 2RUSA 2IRUA 5A0YB 2B9EA 1RKJA 4USIA 3G2XA 3NGKA 5KFIA 2V2ZA 1UZDA 3R2DJ 2RRAA 3C6TB 1F5CA 2JVRA 1X4DA 3FRYA 5EGYA 5IS2A 4P7TA 1QY7A 3KG1A 2MLXA 3T6JA 2LCWA 3UFCX 3CCWA 3QSIA 3SDEB 1BMQB 1P9QC 3K89A 2WSFC 5A8RB 5D0GA 4NYOA 3CCRS 2RHQB 5DZ6A 4BC7A 2ZH4A 4G1IA 1KLMA 2JL9A 4WK3A 5KFWA 1YWXA 4J9OA 1U2CA 2BKNA 4DL0C 2FUG9 1PJ7A 1DARA 4YDDB 4WFYA 2DXFA 1T05A 3DLEA 3MMBA 2VONA 3UCGA 2WVDA 4RZRA 2ZWOA 4JI4J 3EZ5A 2BM1A 1QAXA 3LTOA 3PKYA 2CZ9A 4ANEA 5GAGU 1HBUA 1RLDA 1S1VA 3VAMA 1AUDA 3CVKA 4X4UA 2CXEA 2ZOMA 5LL6d 2F7VA 2C2DA 4P9SA 1B0TA 2CQHA 1J5OB 2GA7A 2AF6A 3D4JA 1R27B 2VB6A 3V81A 2XTJP 4RUCA 1N8RT 3NP5A 3N6NA 2JNJA 2A6MA 1SKWA 1FKOA 3BGOP 4OI4A 5D4NA 5D77A 4USKA 2CDQA 2CYYA 3TEGA 4DSLA 3ENWA 4C6AA 4HKQA 1TKZA 1FRJA 2UUBF 2MZ1A 4P7VA 5M2RA 1UFLA 5CYQB 1MWZA 3KK3B 1O6XA 2E29A 3HK2A 5K20B 1EKSA 5FDLA 2YWEA 2VDHA 2B9WA 2JLFA 1WHYA 3H98A 2AKWB 2VV5A 4QWBA 2QN6B 4F3OA 3N6MA 4EO6A 3KYLA 2BKOA 4ZVTB 3GSDA 3BGRB 1WC4A 2YWWA 4MFBA 5GADU 1SQEA 3RRGA 5F8IA 4C97A 2NUUG 4M94A 3V4IA 3QLHA 2CZ4A 4K8RA 3OTDA 3OVAA 2AYMA 3EVMA 3HX9A 1NK4A 2K8GA 4X4TA 1IKWA 3JAMY 4CYUB 4N5SA 1FK9A 3PR4A 2BQRA 2X1FA 1WC1A 2QL9B 4ICLB 2QE5A 1RWUA 1XNRJ 1R31A 4ZP6A 4GKKF 2K3KA 5IT4A 4NOHA 2HQCA 4I64A 3BBFA 4NLUA 4DDFA 2BV3A 4WTYA 3VF0B 2CG4A 4GRSA 3NL0A 1RHMB 2ZHBA 4OHXA 1WKJA 4USVA 1NJXA 4M5NA 1RHQB 2JLEA 1NAQA 1HNWF 4N41A 4H4KA 2MQQA 2FLLA 2V2QA 3GZ7A 4C8LA 2R7QA 3KHGA 1RT1B 2W24A 4DPYA 3GYXB 5ETKA 1C0UA 1IM6A 4B02A 2D9OA 1NH7A 1VRUB 3MOJB 3DHXA 3BDEA 3M9OB 3CJTA 3TNVA 2EC0A 3SSRA 5HLFB 4TY9A 5HK4A 3H0PA 3HCXA 3OV7A 2ZBQA 1UEUA 1S1XA 1FF2A 1YBAA 2XS2A 2DY9A 3MZIA 1VK3A 4R0JA 2VPZB 3CPWR 3SV3A 4LFAJ 1DQ9A 1WEZA 1N4LA 4EFAC 5KG5A 1B70B 3MF5A 1JLCB 2BJ3A 1QUVA 1FDBA 4F3MA 5HBMB 3I6PA 2CAJA 4M8LA 4USJC 2NS1B 1VI7A 4DL4A 1K8AT 4BDPA 3GV5B 3GCXP 2OPRB 2Z58B 1FFGB 4S0MA 5J2MA 4DQIA 2Z2YB 1PYSB 3PEJA 3DOKA 1LFPA 4OX9F 1VJQA 2V8PA 2JC1A 3PXGa 3UQSA 2ASDA 4OZ3A 2FLOA 2K1RA 2ILZA 3C19A 4G65A 3DLHA 1S1UA 1RGVA 1ZAWA 5EUHA 2VQFJ 2RT3A 3BEGB 2V8DA 1MU2B 1KTQA 4LJMA 4FP9A 1D09B 2V2VA 4G1QB 3DRSA 1G4CA 4XTTA 2H65B 3ET6B 1T9TA 2ZFHA 3KTQA 2YTCA 1WD6A 2DNPA 3RRHA 2ACMA 1T9YA 2DH7A 1JLFA 4C0BA 3MECB 2CPYA 2DRDA 3WIUA 2BZ2A 1AB8A 2VF3A 4IQMA 4FVCA 3PYDA 3QT6A 2OGUA 4F02A 1NNDA 3EICA 3QRQA 3P45B 2GAGC 2HRYA 2KVIA 2RB7A 2NYIA 2IJNA 4IUFA 4MYTA 4WU3A 2NXJA 3GSIA 1FO1A 2GAHC 3K58A 5HROB 4M95A 3E01B 4ECYA 3M8PA 1S9GA 3FK4A 1URRA 3T1YF 2HFZA 4TKTA 1EETB 2W9CB 1G7CB 2JEJA 2B9XA 3MM6B 2IAJA 4H4OB 4KQZA 2PMWA 1QAJA 5A6PA 2W2NP 3PYEA 4ZIWA 3MFIA 3MEGB 2R7TA 1KHVA 2CUYA 2WOMB 3A3PB 3V2UC 3AY0A 5BYRA 2HRTA 2UVVA 4LR7A 2GHWA 2YH0A 4DF4A 3DXBA 3QSYB 5SZTA 2F63A 3RBDA 2OLWA 1GEHA 1IXKA 3PM9A 2XY5A 2YNFB 5LJ3Y 7AT1B 2B9YA 4HACA 2F3JA 3R2CJ 2XGPA 5CH7B 1C1BB 2KT5A 5C42A 4I6AA 5LMUF 5B0GA 3F0NA 3POTB 1V6HA 4B9VA 3Q2TC 1HQ2A 3LALA 2BJ7A 4J90A 3RBEA 5D8HB 3TOQA 2FJEB 1Q5VA 4JI2F 2XYGB 3DKDA 3R5JB 3PEHA 2FQQB 3KJVA 2C3MA 4P52A 2RKIB 1KQFB 4B08A 2QMUB 1N5YA 2I0XA 4KY3A 3VAIA 4IQXA 4NCGB 1Q16B 2BXJA 3H4BA 1JKHB 2G2ZA 2WVBA 3GJRB 1LWEB 2HIQA 1R7IA 4QW9A 3QMQA 4M5LA 2PDAA 1R6YA 4OMFG 4NWBA 2PI4A 2B6AB 4QYRA 1T11A 1P27B 2DR5A 2E5IA 2KRBA 2HHPA 3LP1A 4KHPJ 4JB8B 5AXNA 1ZS6A 3NNHA 2J9EA 2RDDA 1LXNA 1QUPA 2K3IA 3BREA 3GV8B 2C1EB 3NNAA 1RTHA 4WIQA 2VG6A 4CLLA 3HHEA 3R9LA 3GYGA 2BA9A 4DHVA 4FKYA 2IBOA 3SYZA 3B8HA 1WC5A 3L7UA 1UVJA 1OSDA 2HZCA 2QX0A 5KOWA 2KZMA 4QYZJ 4KGMA 1WF2A 3DDNA 4YHHF 3ISZA 4KGXB 3LP2B 4OHVA 3OBIA 2ZHOA 1JNZB 2RRBA 4NLRA 3ZZTA 3MGJA 2VQEJ 2GQQA 3MM8B 4RW4A 3N9UC 4XIUA 4RUHA 1TU0B 1NUEA 5C25A 2UVWA 4LSLB 4LR9A 5KG3A 1LOUA 1WC6A 4DL5A 4HI2A 2MZTA 1HD0A 1OWXA 1IBMF 4IH5A 1XJWB 1CQMA 4QR0A 4RO0A 2GCFA 4L73A 4LBHA 4JI0F 3GTYX 2WZ1A 2GZOA 5AJ3J 2B8PA 5HMYA 4BLGA 4WK1A 4JI5J 3TVZA 2DVIA 3VVUA 1KQGB 3D68A 2R7RA 5D3GA 1Q78A 4AUKA 5KFCA 2R2RA 2LQ9A 2LQBA 3Q8UA 2UU9F 1BD6A 4ZJLA 2HBZB 2HFNA 3M8YA 1AT1B 4A8WA 4ZHRB 3K8VA 2E1MC 4NXNJ 3GFYA 1HBMA 3DI6B 3KHLA 2J9DE 2ZJRQ 1U0HB 1SH0A 4I1TA 4PCQA 2DNRA 3FQKA 1B64A 4RW8A 1RISA 3DDKA 2MY7A 1RLCL 1ZYQA 4O4RA 4OYBA 2Z2ZA 4FYVB 2N82B 3PO4A 3KLVA 4MIAA 2WVFA 1Y7PA 4TU7A 3IA0A 4PQUA 3G8SA 3KUGA 1NPPA 1P9YA 2KH9A 4B3TJ 4FBTA 3MFHA 2HNYB 5KT2A 1RBAA 4K4ZA 3DOLA 5E7OB 1B0VA 4OHYA 2NXCA 1HHQA 2V50A 4I2QA 1YLXA 4DG1A 3MPVA 4X64J 2MQOA 4NLYA 3FEYB 4O3OA 4OZ5A 2C2MB 2OELA 4NLTA 5KAKA 5H9EK 1C0TA 4CO1A 4DR3F 1VQ4S 5EHHA 1X4AA 2B3TB 1UFWA 1GXTA 1KOHA 1R0CB 2KT2A 1U1QA 1M1GA 3W66A 1LWXA 3LGHA 3EGVA 1RWVB 4EEYA 3AJDA 3OL8A 1XR7A 3TI0A 2HBRB 2CJKA 5IV4A 3TAPA 5AE1A 1UPPA 4FYWB 3C16B 2HBYB 1UW4A 3O3LA 3GJTB 5CYJA 1N32J 1NK6A 4JI1F 3M05A 1TL3B 1IBLF 4DBQA 1N34J 4LSNB 3R6LB 3HVRA 4BWMA 2OMLA 1Q7YT 4YUDA 1XMQF 3CMAS 3MCNA 3PNIA 3ZNUA 4DX8H 4AT1B 1RAGB 4RR5A 2EFNA 4CO0A 1W25A 3HD2A 5B0AA 2GQ2A 1U02A 2OPSB 5KFQA 4ZMMA 3D1OA 5GAHI 4Y2KA 5F0WA 1JLAB 2FLNA 1X4FA 2GMHA 4MKAA 4U7UK 1TUVA 1TK8A 4U8YA 2FHJA 3OXGA 4H4MB 1AROP 2OD6A 4ILMA 3W2VB 3C15A 1FX2A 4DJBA 4P71A 1O51A 2NXEA 4NI2A 4CZCA 4NRTA 2POKA 1TV6A 2DHAA 2F8HA 1CJTB 3C6UB 3MMCA 5I3UB 1VBYA 2IVFB 5ETNA 1XR5A 3MD3A 4ZKAA 3I4HX 3QGIA 4HDHA 2EWHA 4UTGA 5I4MA 4F7VA 2VPXB 4KHPF 1MWYA 1G1XA 4A8KA 3G6VA 3NWGA 5KFYA 3OHAA 3K5PA 3I5BA 6FDRA 2KB2A 3H5UA 3NOGA 2QEXS 3OR1B 1QAYA 1YBTA 2C3PA 2XO7A 2BDPA 2D7SA 4YB7A 1TR0A 1LWCB 3QT8A 5FD1A 1DLOB 4ECWA 5IT9Y 5K8PA 4M1KA 4FDFA 4MK8A 5F0UA 3RAXA 3ZTSA 1JMTA 4NA2A 3NS6A 1FRMA 2RQKA 4HH0A 3N5BA 4DSJA 4H54A 4USTA 2QMXA 4ZVHA 1YGYA 2AEJA 3MAAA 4DR7F 3DYAA 3QQCD 3NGSA 4CLTA 1S59A 2CNOB 2EVZA 2VQEF 4RW9A 3P3DA 1PAEX 3OW2R 4Q8FA 4DF8A 3V6HA 4FNIA 2VD3A 1C2PA 1FD8A 3F56A 5GAEI 5HO4A 1YJ9S 3M8RA 5E3RA 3K57A 1Q82T 4KV8B 3CCLS 3J7AN 4U9RA 2H4YB 3DLKB 2OEJA 3L9ZA 2ASLA 2KO1A 1FXRA 3AHPA 1UFKA 2DGXA 3MAHA 5AJ3F 2MGZA 1NMEB 2MTLA 1HNXF 2YWGA 2UXCJ 3IBFB 1EARA 2V9KA 3DCAA 2R2SA 2GVZB 2HPUA 3R1HA 3EDQB 1DTQB 2R7UA 4LF8J 2Y8YA 2CPFA 2HG4A 2IJRA 2ADBA 3AH6A 3W2WA 2XZTB 2HHTA 2DEIA 2DISA 1WC0A 2OPQB 3SFGA 4UT4A 3GWCA 2ZBCA 1U2FA 3L3CA 3D0IE 1RTIB 4LFCJ 2E1RA 3RW7A 2AQ4A 2BABA 1XBWA 3M2RA 3T1AA 2G2OA 2ZOFA 5J1NA 4QW8A 2J8SA 3MPUB 3DU5A 3NY0A 2IC3B 1VQMS 4NLVA 2V4RA 1X9WA 2RS8A 3DRRB 3PHEA 2CDRB 2V69A 1RXOB 4X62J 4EZ9A 4NA1A 3I32A 1NJZA 2IDEA 4X64F 3M30B 1KONA 1N5TA 2DO4A 2CIMA 1FEEA 2FB0A 2W01A 2ROEA 1QTMA 3UR0A 2RQMA 3BSOA 2XMTA 3D6HB 2L08A 4B3SJ 1HLWA 4F8RA 3SDEA 4RBTA 1NPRA 5I3QA 3UO0A 5ETSA 5H9EJ 5A8RA 2IBKA 4MTPA 1RCXB 1VJWA 3M2UB 2R7VA 1S76D 3WBZA 3TRGA 3B4MA 2RD5C 3FZ2A 3BSNA 2W4DA 1FJGF 1I1GA 2JFDA 1IWGA 3CCVS 5DM6Q 2BANB 1JQGA 3CJKB 5D4OA 4CO4A 2D69A 1NK0A 2XC9A 4EBCA 3EGZA 4R8UB 1N34F 3U02A 1UJ6A 4AL6A 1AFJA 2VFVA 3ZZOA 1T9WA 3CCJS 2IA6A 1RAOA 4NL5A 2CPZA 2L9DA 1V9OA 4PEOA 1RTDA 3DLGA 3ILLA 1S6PB 2WBRA 2BQ3A 3M6XA 4DFJA 2E9ZA 1KP6A 2MSSA 2VU5A 2DR7A 2NCKL 4TNOA 1VHIA 3J7ZT 3OFFA 5EN1A 2AEFA 1HFEL 3VAFA 2DHSA 2FJXA 1QE1B 4D3GA 4ENOA 2I1RA 3HDSA 5CYQA 2QJ3A 2YWHA 4OI0A 3PW7A 3KK3A 2Y1LB 5F3TA 1DQ8A 1Q7LB 2Z4PA 1OPZA 5DG8A 2ZDOA 5A2QY 1UPMB 4O4GA 1VQ5S 3HXMA 3K5OA 4O0NA 3BM7A 3L09A 2V63A 1SIZA 2CJXB 4KRWA 4F0HA 2UVRA 2E9TA 2Z30B 1AUSL 2JWNA 1U1NA 2F4FA 3FSXA 4A8SA 3BGUA 1UWBA 4F4ZA 4NLQA 1R0AA 1KLMB 5GAHU 2X3DA 1NRKA 4UOGA 5DQHA 2ZJQQ 2OTLS 5LSLA 4NXMF 3WC0A 4YMEA 1IBCB 1KVIA 2KT3A 5LOQA 3WC2A 4U7CA 2DPJA 2Y1JA 2P9EA 3NS7B 1T05B 4D3HA 4BBYA 1NDCA 1MN9A 4E98A 2JFKA 2AT1B 3UDEA 2ZDPA 4QJVA 5DDOC 2RHSB 1KD1T 4DV0J 1HBUB 2E9RX 1S1VB 4DV4J 3AB4B 2A6OA 4ICLA 2K2PA 1KKHA 4K5RA 2F8MA 1VC5A 5BR8F 2FZKB 4DR1J 1PC5A 1FVQA 3D1QA 5G0RA 2CNKB 2AX1A 2HWTA 2W2OP 2DHGA 1LXJA 3JTOA 4ZVOB 2BRKA 1MG7A 2VC1A 3W5YA 2IY5B 2ZBRA 5LXYA 3J7YU 2PI5A 1BQNA 3WIVA 3BS9A 2R7XA 1ZAXA 4P74A 1HNZF 4QPXA 3QATA 3U27A 4ES1A 1JJCB 3HHLB 2VJVA 2LYVA 2OD4A 2WBMA 5B0CA 3FMBA 4DR6J 1FD2A 5HLFA 3IO1A 1RAHB 2HW3A 4MFBB 4DR5J 3MTKA 3I0SB 1Y3KA 1UW9A 2FVCA 4DUZF 1RU2A 4LF4J 4Q2LA 3FCWA 2KXNB 1DTTA 3MD1A 4DS4A 3QLHB 5GAEU 4OI1A 1CJKA 4B9UA 1HHTP 2PN6A 5IQ6A 2I9SA 4B3RJ 1N0UA 5HBMA 5F8NA 1D8YA 1IKWB 2HNZB 4YQWA 1OMSA 3W65A 4DQRA 3LGMA 4ZLJA 3A3NB 1S6QA 3SFUA 2DR8A 1W26A 1MMLA 2CPEA 2XNQA 2MZJA 2J6UA 1WG5A 3DXSX 3OTBA 2W7AA 2MZSA 4PABA 2OPRA 1RT7B 2J8AA 5BJRA 1NU4A 1H2VZ 2O66A 4OIXA 1N0VC 1CPZA 1BQMB 2M5YA 3RB4A 4U7UD 5B0DA 5CHCB 3SCKE 1KBRA 4MIBA 4I0WA 3T9ZA 3QAUA 2ZZTA 5D0RA 2B4PA 2WAQD 1CVJA 4DV6F 2BJ1A 2K06A 3TAMB 3DN9A 5T41A 4G1QA 1C0UB 3NLCA 2MMYA 3GJQB 2E5LJ 1T3OA 4U67Q 1C1CB 1HBOB 3IAS9 4DV5J 4DPWA 2RF2B 3U1NA 2JJ4D 3THTA 3W8GA 3TANA 1HQEB 2H4WB 1Y9OA 1H0HB 1WSVA 3CDWA 2AW0A 3DGVA 1Q95G 4ZVPB 4NA3A 4X4QA 3IG1B 3OSPA 2CQIA 1NSQA 3MPDA 1DURA 2RE1A 2ZVSA 1XQIA 3FSYA 4HTIA 2HRUA 2P8IA 3FMWA 5DGAA 2Z0GA 2LKZA 2V2KA 2PMZD 5HROA 3E01A 3KJQB 3HSZA 5GMKa 3W9JA 4YB6A 4JBCA 3G4SS 2V4JB 5B09A 1EETA 4W4MA 2W9CA 3ZC4A 1WKLA 3H5SA 1PKUA 1HWUA 4H4OA 4UOCA 4CH7A 1IBKJ 3MCSA 3SEOA 4M5IA 1W2IA 1LEOA 4Y2MA 3MEGA 4DZ6A 1F2GA 3N6LA 3SQGB 2WOMA 4EU0A 2XZWA 3QWPA 9RUBA 4FXVA 2K1RB 1HYSB 1JXVA 1OS5A 3M8SA 4ZCIA 2A3JA 4N76A 1YZ6A 4LF9J 1W7WA 3AJ2A 4GKJJ 1A6LA 2YNFA 2BJDA 2CPJA 1UJ4A 1RKIA 3EGWB 4WFXA 2HWIA 4UZCA 3CMQA 2HMIB 4FXDA 3EX7B 4ZJQA 3DRSB 3T41A 3CCZA 2HHVA 3POTA 1MMNA 1X5TA 2B7CB 4DPTA 3RR7A 5L46A 4RU2A 2FD2A 1SJRA 4CNYA 1VQ8S 5B08A 1JLFB 4OFZA 1FX4A 3FSIA 3A13A 3D6MB 3CCSS 2UUCJ 2H5IB 2VODA 2MHNA 2ZWPA 5KG4A 1CJVB 1JLQB 3M8WA 2PE8A 1LWEA 5KFXA 2J0XA 4I7FA 2C42A 4PG4A 3SZ2A 3QWUA 4XDCA 2B6AA 1EHWA 4KPYA 2V9WA 3T1HJ 2YPZA 3TW0A 2XG8A 1IWAA 2QTWA 1S9GB 1O0PA 3JSYA 5D6GA 1NKBA 4DR1F 1Q1KA 2DCLA 1EIYB 1F2HA 3BSAA 5K9FA 2YQ1A 1IJFB 2FJAB 1XNQF 1N88A 3W9HA 3T9NA 3N28A 2FYXA 4WZMA 5KOXA 2JEIA 1RSCA 3TQEA 3OLBA 4K0KJ 3VTIA 1XMOF 2ZH2A 1QD1A 4E2FB 2KTQA 1WOPA 3IFEA 4ZCMA 4QWAA 1B7YB 4RUBA 2CWXA 4I4BA 1ZA1B 2N3OA 2MQNA 1SI9A 3TVYA 3UD5A 3MXHP 3KUHA 1NHKL 4QIGA 2ZOGA 3RAMA 2ERRA 2DGVA 2XMUA 3LP2A 4USMA 1PBUA 1QAIA 4DI6A 2JEGA 4FXWA 2BOPA 5A6WA 1K9MT 5KFPA 2LEBA 2I38A 4NE9C 1KNZA 3KNAA 3R7NB 2WVCA 1N5YB 2V5HG 1JJ2R 4LSLA 2RILA 2F8EX 1VQ7S 4KPCA 3CD6S 4A8XA 1IR1A 3R5GA 3BQ1A 2ZZMA 2J7KA 3TUIC 3W60A 3QZ7A 2CG8A 4AL5A 1YBUA 1LW0A 5CA5A 2KN4A 3PW0A 5IT0A 4U6PA 1X4GA 3BGFA 1FJ7A 2BACA 4MMOA 3DGPA 3F73A 4NLGA 2KZZA 3BO4A 3OL7A 4AQYF 2XWXA 3LP1B 1RP5A 1WHXA 5E3CA 4OZJA 5JVHQ 4RNNA 1H6KX 1OY6A 5DQIA 3KG4A 2DNLA 2XCAA 3M9MB 1X60A 2L41A 1VRTB 3DI6A 2VG6B 3OXLA 3HP6A 3GIJA 5DZ7A 2GQCA 3TQ1A 2VA2A 2B43A 3ILJA 1SL0A 2APOA 5HL7Q 4CDIA 1YI2S 3H5XA 1MSWD 1H38A 1JJHA 4ED0A 1M5KC 8AT1B 1TUWA 3DLJA 5KFOA 2L48A 5KFMA 2BJEA 1RBLA 2HNYA 1EQ0A 1R0BG 1YSJA 3GCWP 4RW4B 1E6VA 3B4DA 5KFRA 1A7GE 1O8BA 1R8AA 3KMQA 5F9NA 3CCTA 2UUAJ 3CXCR 5J2NA 3PX4A 3FBEA 2MHEA 1F5AA 3ETOA 3HT3A 3BQ2A 2CQ4A 3RRKA 2QA4S 4LF5J 3VWSA 4NPOA 3T5HA 2YKQA 1PILA 1YJWS 4EYHB 1VLOA 3J80U 1UVNA 2OMOA 1M5SA 4J9NA 4DR4F 2UV8A 1U4BA 3BR8A 2ZZNA 1WHWA 1LQ9A 1VISA 4EK2A 3BO3A 2ZE2A 2Q66A 4UY8T 3LWLA 4I56A 2D3ZA 3Q24A 4Q8EA 3PJ9A 1B3TA 4OQJA 5D3GB 1GT8A 2GNKA 3CIZA 3ADAC 4DEZA 3RJMB 4TY8B 4C0HA 1O5JA 4RNHA 2DJWA 1UVIA 3BJYA 4G6VB 3C16A 3HULA 4KSEB 2F9DA 1TL3A 4HR2A 3IRXB 1PJ5A 4WF9Q 4V19X 5AXMA 1XEZA 4LSNA 1ZOTA 4EWTA 1R8HA 1Z2ZA 4HHUA 4UQTA 1NBEB 1U25A 3I5CA 3E51A 5THWA 4ES2A 4ETXA 2DRAA 2YNGB 3AFGA 5IQQA 3T5LA 2AV5A 3P5BP 3D67A 3M6UA 5KG6A 4ZPVR 2BOAA 1C4CA 1SQFA 4DPOA 1RYRA 4X2BA 3VQSA 1MW7A 4ZVQB 4PPZA 1Q79A 4PWDA 2DHHA 2Q1LA 2FJVA 3HFZB 4F36A 2OPSA 3TZWA 4TLRA 2YWFA 1JLAA 3TZYA 2CPIA 3DMJA 4ECTA 5ETRA 3MDFA 1YRTA 1FKPB 4H4MA 4DOZA 2DB1A 3W2VA 4UQGA 1X5SA 1Q0NA 3EVWA 2OTJS 5EX0A 2YKPA 2CPDA 1YJUA 3HZGA 4KHRA 2KG0A 3EWGA 2W4PA 1AXQA 2DNOA 2AP6A 1HQUA 3A8KA 1CJTA 1NEEA 2DNHA 3Q86A 3QFWA 1M0SA 1C0TB 4K7QA 4PPDA 1HBNA 3M8QB 2VBWA 3TA2A 1ROFA 3D54A 2WB4A 1RJJA 2A18A 4OHZA 2V68A 1J5EF 2HWHA 2A1BA 3DOMB 1TL5A 4HT7A 4ECSA 3AA9A 4ZS6A 2DGTA 1JB0C 4M5GA 2AWZA 2EK6A 2E1PA 4KIAA 1HR0F 5DDPC 2CQDA 1LWCA 4JI7F 4QIVA 5E41A 2AYGA 3U7JA 1B0PA 2NXUA 3OL6A 1ZM3A 4B3MJ 1EP4A 2MPUA 1VC6A 1FE0A 1FVSA 1VK8A 2ZUGA 2BJ9A 3ZO7A 2HZAA 3C14B 2Y1RI 2HLUA 4OZ2A 2FIUA 1KDNA 4TN2A 1FNMA 3VAKA 5KFSA 5KG0A 2LECA 1RCOB 3TJ9A 2VG7B 1EJ7L 3GONA 4OJHA 5GMDA 2C3UA 2DY1A 2UXDF 3RB6A 3C15B 3PRVA 1RWOB 4KFBB 4X4PA 3E8OA 4TQRA 1EAYC 4NI2B 2BQUA 1TVRB 2VJUA 2CVIA 3OXFA 1N33F 4KE5A 4GVLA 3H7HB 3RUBL 4RBVA 2CA9A 2ASYA 1CS4B 3KDNA 4LF1A 1F1BB 3IGNA 2VBZA 5HMZA 3EXYA 2BBEA 2ZD1B 1RHUB 4CLZA 1F9EB 1H73A 4X66F 2QLXA 1SIWB 3IBCB 3VCDA 3CJ5A 4ZPWR 2F65A 4NMLA 3BKTA 1PBAA 3TWZA 3BQ0A 3OT9A 2OPQA 5E2QA 1S48A 4M5JA 4EO8A 2KI2A 5CYMA 4KH0B 3ISNC 2MKJA 4DL7A 2M4MA 5H1SV 4KKOA 2DNYA 2XLJA 3DNCA 3FNNA 1RTIA 4JOUA 1LW2A 4ZVSB 2M7SA 4J9SA 5RUBA 1VHFA 3WHIA 2XHWA 3D9BA 4RWWA 1EKRA 4JI8F 3MI7X 4DV7J 2HAIA 3AOCA 4KBIA 4IH7A 3NBPA 1SC3B 3IM9A 2AEMA 4F50A 2OKQA 4NLWA 4I67A 3CD5A 2HNDB 5DO2A 1IQZA 2QFJA 4RW9B 1HI0P 1VQSA 3GB0A 1DY3A 5KTQA 3KLHA 3DRRA 3QZ8A 4NZ0A 5AE2A 4HHJA 3OTCA 3M7VA 5A8KB 4P2XA 9ATCB 2DHXA 1TFWA 2DIVA 1RI7A 3MTJA 3VAGA 3M30A 3CT9A 1QM9A 4LBIA 3M6VA 5U47A 4DCOB 4HT5A 1ZA2B 2DD8S 3CC2S 3OJUA 3S8SA 3DHWC 2O3DA 2OUGA 1FCAA 4PUOA 2R7SA 1I5OB 3MMAB 3W7BA 1FWLA 3M2UA 3HPOA 1R3NA 3KDOA 2V8GA 3NG8A 2YXLA 4CLUA 4OZ1A 2BANA 3W3SA 3GP9A 2UXBJ 2HVHA 4MT1A 2IM3A 5K8OA 2B4OA 4R8UA 2J7UA 1Y5IB 1VDHA 2XCPA 5A2QU 2F4VJ 2B8QA 5CCMA 1VBXA 2KYZA 2XBPA 3PZPA 2HK2A 3G96A 4BS2A 2EEYA 1PSDA 2CJBA 4ILLA 1S9FA 2P9GA 2YQ0A 5E33A 2JOQA 2GJFA 3LANA 5K5MA 4IYQA 1WJ9A 3RAQA 4IRCA 2CKWA 4LRAA 1Q4RA 2ZBPA 3MM7B 4BWJA 3Q83A 1SPBP 1ZBTA 1HNVB 2DGSA 3DRPA 1T0TV 2PEHA 1S4FA 1QE1A 3EMTA 2MKYA 1JLBB 1ZM9A 1D8ZA 2HS3A 2JSXA 2AJ4A 4LSZB 4USHA 2DNQA 1UZHA 4KYZA 4FPRA 1GQEA 5CAAA 4WP8A 2H5EA 4LR8A 1S9EB 2UZAA 2ZM6F 1RWMB 4CCHA 4C3KA 3PX0A 2KXFA 1UTAA 4DL2A 3QGPA 3O5TB 2VFRA 3SV4A 1YX2A 1RA7A 4YY3F 2IFXA 2PA3A 5T14A 3C46A 1SC4B 3ZZ0A 1YJVA 2L3MA 1RAEB 4WKRA 3RYLA 5J2QA 3VV2B 2V0NA 1VQOS 4A8OA 2LLZA 2IDLA 3W5XA 2JX2A 5L8RC 2KKHA 2J0SD 3NS5A 3CDAA 5KFZA 4OX7A 4QPTA 2HHHF 1U1KA 2ATCB 4CO5A 1KRPA 3PW2A 5CZVA 4X4SA 2OO4A 2BEFA 4LF7J 1RAIB 4CI0B 5MAOA 4FZVA 5AE3A 1FI4A 3VHQA 4NLDA 2XSFA 1K1SA 5F8LA 4ZP8A 3PYGA 1RTDB 3DLGB 1HA1A 4ZN3A 4R0EA 3PIPQ 2XWYA 2VBXA 2G0JA 4F4YA 3AA8A 3N0VA 3HJFA 4A4JA 1IKVA 1RT4B 1WHVA 3S1TA 4FS1A 4X65F 1BXNA 4TYBA 2DO0A 2R2UA 1FJCA 1EZZB 1BLUA 4F4KA 1RU1A 3C8YA 1ZPVA 4NYPA 3I55S 3NCQA 4O4GB 1SKSA 3HHLA 2FHJD 2M0GB 2IYGA 2GIFA 2QA2A 3I9V9 3VZIA 3ZZPA 1L3UA 2DNGA 2HSEB 2LQ5A 3I0SA 1UWBB 3HZEA 4C3MA 1R0AB 2BW7A 2J9CA 1RDRA 5KFLA 4DCPB 2GJ2A 2Z2MA 1X4BA 2LQJA 4QOTA 3D1HA 3OQ2A 1KVKA 1FXDA 3MEDA 4CM0A 3HFVA 4NX9A 1U1LA 1JIHA 4K2XA 4LF6J 1Z4UA 3KK1B 2FJBB 3TZZA 2D3OR 2HNZA 3LQVA 2G2YA 2W2MP 3C66A 1MLAA 5M2UA 3EM1A 4DUYJ 3CSKA 2IM2A 2J76E 4JV5F 1M1KT 3EGNA 1TKXB 1PJ6A 5G0RB 3FCHA 2BVZA 1RT7A 2CQ2A 3CCQS 2BX6A 3BYPA 1OIAA 4L72B 4PXBA 4CRJA 1BQMA 2GJIA 3WX8A 4X4VA 4C8YA 2NZ4A 2W8KA 1TL7A 1CG2A 4QYZK 3W64A 4ID5B 3EPIA 1BQNB 2M9KA 3TAMA 2FVQA 3OTOF 3GG1A 5IC4B 3PRDA 4Q5VA 2W25A 1N36J 4P75A 1C1CA 1HBOA 4CM2A 2WRMA 2RF2A 2F9JA 1KOOA 2N7YA 2EBEA 4ECZA 2HFUA 4C8ZA 1GAOA 3JXOA 4DV1F 2I8EA 3PYFA 3D28A 1HQEA 3D66A 4JI3F 5IFMA 2J5AA 2PGCA 4DQPA 5IZHA 2Q6CA 4X4OA 3IG1A 2O1PA 4URQU 5KT4A 4DPUA 3L7OA 4IOCQ 1DTTB 3SCJE 3MEEB 5LMNJ 2EBGA 3K5LA 1YVFA 3KWMA 1NDPA 4QR2A 1U47A 1CJKB 3S01A 3GG0A 2FTRA 5JVGQ 2HKEA 2QO3A 4ZK7M 4Y00A 2EFPA 3MURP 3O6QA 5J1PA 1HWKA 4JYAF 3QAEA 2RAQA 3UN3A 1S6QB 2V4JA 5A8WA 1YKWA 2YX7A 3GIKA 1GMWD 1LK7A 4DFKA 2DGQA 3AD9C 1SV5A 4MKBA 4V19J 2RNEA 4PG6A 1VQPS 5E3QA 4IRKA 4JI6F 3SQGA 1H74A 3FQLA 2LFVA 4I6WA 4W92B 2GHPA 3TUPA 4QBUA 2Y8WA 1J2VA 1HYSA 5IOLA 1A0OB 4HHHA 4O3RA 2AGOA 2JEFA 4XDDA 5HJYA 2ZNZA 3LWMA 2KFYA 5IC6B 3H5YA 3UD4P 1YDLA 4DV3J 4EUVA 2MKHA 4B9TA 4R25A 3BBBA 2HMIA 2KM8C 1GTHA 3G6XA 3WDOA 3G82A 2MQLA 1HWIA 1F9HA 4FNHA 4RU9A 3CNQP 4PG5A 1RYSA 2HFVA 3MUMP 3NOCA 4Q44A 2RUGA 3VVTA 3OTEA 1CBKA 5HMWA 2KU7A 1U1MA 2AZ3A 3IMQJ 4ER8A 1SJ4P 2CJYB 1SJQA 1U6ZA 3H20A 1R6VA 2X1AA 3LO3A 5E0OA 1CJVA 1JLQA 5GVQA 4J7CA 1X5PA 2C2OB 1YRXA 4JI4F 4WKYA 2CNLB 3PJWA 1UVKA 4XK8C 2ZC3A 4QQBA 3ILIA 3N5FA 2ZVIA 2J9DA 4BHQA 4Y34A 3B82A 1U48A 1H3DA 4ETZA 2MLZA 4J9MA 2CVEA 4N8NA 1OY8A 4O23A 3DRYA 1FEHA 1PG5B 1G6BA 4DR2J 4IO1A 2GGPB 3W1YC 5B0FA 3UCUP 1WG1A 4U8VA 4EMDA 3HVAA 4OJ1A 3UNGC 3QO9B 5AXKA 1UETA 4AXIA 1UP1A 4L3KA 3BSCA 3RW6A 3MMJA 2X7IA 3OD2A 3PV8A 3GR0A 2KDOA 1G2EA 4P72A 5K8MA 1ZM2A 5FLXU 4KH1B 1NH8A 3IXQA 4URGA 1X7VA 2XYHB 4DV2J 2MKCA 1RB0A 4OYAA 5J1EB 3OJSA 1X0FA 2LA4A 2PT0A 4GC7A 1F3FA 1WKKA 2V67A 2CFXA 1PAUB 3BZQA 1PC4A 2EW9A 5EX3A 1CC7A 2K7JA 4IRDA 5L38A 1NHUA 2I5JA 2H48B 3JYTB 1FWKA 2E66A 4P6QA 3OR2A 5ETPA 1OPIA 2IM1A 3ENVA 5IWAJ 4I7FB 1VIOA 1GFWB 3N01A 4DLGA 1YIJS 2WTFA 2N3LA 4ZLLA 4WFBQ 1DRZA 4L75A 4OI3A 1XNRF 2QRRA 3WX4A 3D7SB 3QBCA 1MROB 2MQ8A 3US5A 1VOMA 2ZH5A 1VRTA 5CD4H 1VBZA 3K59A 4G3IA 3KLFB 2EKNA 3FEZA 5HQLA 4YDXA 4DU7A 1U45A 3B54A 4C0OC 2EXUA 2M52A 2XMMA 1YTYA 1D3WA 3ITHB 5HVFA 1R43A 3RBXA 1JLGB 3QGHA 3CJ8A 3FDSA 3NCPA 4YEAA 1IR2A 1I94J 3J81Y 1YITS 1S57A 4RW7A 2W9AA 4RUAA 4C8KA 3UD3P 1JK9B 5HP1B 3B78A 2PIIA 2MB0B 1ZETA 3KLGB 3OSNA 4DFPA 3PHTA 3IR5B 3GR1A 4Y3CA 4LFAF 2RRNA 5HN0A 1M90T 1NKCA 2C22A 5B0BA 1UEVA 2LMIA 5ADZA 3N79A 3I56S 1LW0B 2CRLA 1KLNA 4M5MA 4ED5A 4DL3A 2OHDA 1Y5NB 3NRBA 3IWXA 1SJ3P 4ZVFA 3R7SB 4MIWA 3U1MA 2LQ8A 3D0GE 3DGPB 4EYIB 3EDRB 2GVDB 2UUBJ 3H8YA 2NLWA 2UUWA 5KFTA 2H9ZA 1S72S 4TY8A 3CCMS 2QLBB 4MH8A 1FTCA 2Q79A 1FWPA 3ZTOA 3QRRA 4KAIA 5L39A 3IRXA 3R1LA 1X4EA 2I2YA 4WWSA 1SCJB 3ZZUA 4E8UA 2HGLA 4C4WA 3SIPB 4PR6A 3D3CJ 3FUYA 1HMVA 1N5SA 1U8SA 4I6YA 2YNGA 2VQFF 3PACA 1YZ7A 3SQOP 2XMAA 2M2BA 4MKYA 1KS2A 4TLQA 3T5JA 2VG5A 3ZFVA 1FHTA 3IN5A 1RT6A 4JV0A 2VFSA 2HHUA 2A2CA 3D3BJ 2DBBA 7FDRA 1RAAB 4YP3A 1E6VB 2HZVA 2LU1A 2CJQA 2RVJA 2N7CA 1YJRA 3FKBA 3R8YA 1FKPA 4KGKA 1MN7A 5J2NB 4URSA 3VAJA 2BYCA 1VRQC 3H2UB 4LQ3A 1WOSA 2R2TA 3MAQA 4DL6A 1HPZB 3K5MA 1WOOA 1AW0A 1AA1B 5IM0B 2NXNA 4GKKJ 2ZKTA 1XN9A 2HQIA 3M8QA 1Y5LB 3IWLA 2XS7A 4LRDA 2ZE2B 2G0IA 2EPIA 2DXEA 4OLPA 2HIYA 4Q43A 1HNWJ 2QYCA 3DOMA 5KFJA 1ZPWX 2ROGA 1ZH5A 3FJ2A 3UPFA 1NSKL 3DU6A 4NMXA 5KG2A 4C48A 2V4QA 4EI2A 2GS8A 2HYIB 4ECVA 1UCNA 2E5GA 4MK9A 5ITHA 2FC9A 1SJFA 1NZ8A 1QVGR 1YK9A 1FNXH 3NGTA 2FHOB 5B7WA 2WHOA 1NJIT 5EWEA 1KHWA 5J2PB 4YB1P 3J80Y 2AD9A 2DITA 2VDIA 2LA6A 1VC0A 3C14A 3IP0A 4DSIA 4IG0B 3SBMA 4PWDB 4NZ7A 4Q2MA 2QIFA 2VC0A 3CC7S 1WI6A 4OI6A 2HGMA 3PY8A 1X9MA 3LPYA 2VG7A 3DMJB 3G6YA 2HGNA 1D1UA 3C2PA 4CNZA 4LBPA 1AZSA 2DEJA 2R42A 2DKOB 3A1YG 4KFBA 3H40A 2ZUAA 2XMVA 3JSMA 1TMJA 4O3SA 3PTWA 1RACB 5F8GA 1GXLA 3T6BA 1TVRA 1OSCA 3PG9A 1L3TA 4PXCA 5ETLA 1HQUB 3I87A 4NLPA 3UE2A 2CQ3A 1WUUA 5D0EA 2JZ5A 2AX0A 4WCEQ 1HBNB 2AHOB 1X4CA 1FRKA 5DETA 1WEXA 1CS4A 1I3OB 2N4DA 4OX9J 1FNOA 4ALZA 4DS5A 4DX7A 4QWEA 3HVWA 5T7LB 1RT2A 2ZD1A 3QJLA 4OI2A 3E3XA 3HSGA 1S1TA 1EX8A 1P1LA 4KO0B 3J7YI 3IBWA 4KGZB 3A8IA 3ONQA 2XS5A 3PW5A 2VFTA 4FN5A 1SXLA 1FFSB 1TQLA 5HVHA 4PG7A 2Y1IA 1V3ZA 1VQLS 4OYIA 3IRWP 1EP4B 4ED1A 4FKXA 1CC8A 3DRXA 1NCLA 1XWLA 1Y10A 4C9DA 4QZVB 2G4BA 1APSA 5LM7E 4M5HA 1DJ0A 2HNDA 2AJ1A 3BF4A 4HVZA 1I94F 2WB1D 1X0PA 2GIRA 3TARA 1PGZA 2E7WA 1WACA 2DNNA 1NSPA 4JUZA 5A8KA 1GX5A 1NJWA 1RHRB 2LXFA 3V6DB 4BCAA 3KHRA 3I4PA 3T1YJ 2V8HA 3GE9A 2I6WA 1OY9A 5EWFA 4IH6A 5KT5A 2D1CA 2W4CA 1R8CA 2AJ0A 4JI5F 3MMAA 3M32B 5KFAA 3GMGA 1KFDA 3CD7A 2O5DA 3BO2A 4ELUA 1SB6A 1QSYA 5M2PA 4UW2A 2QSWA 5CZXA 4ZA1A 4PWUA 3THPA 1KC8T 1SC1B 4IDKB 4PKDB 3CJ4A 2AGPA 1HNIB 1K47A 1NM2A 6AT1B 4NXNF 1X31C 1HIYA 5CYMB 5LMUJ 4KKOB 4KB7A 4A46A 2MXYA 3GFZA 5KFEA 1VIXA 2G1HA 3BKFA 1LW2B 4JI2J 1NLKL 1U09A 1UMJA 3KKFA 1TP7A 5HSPA 3NBPB 4DZDA 3KHHA 4OV6A 4J91A 2J7WA 4B3TF 5GMEA 3FC9A 4LIWA 3HVTA 3R97A 2CPHA 4P2FA 3MM7A 2M3DA 4OZ0A 4ZOSA 1HNVA 1K44A 2A10A 3K0JA 3KLHB 2NR0A 1JLBA 1NHVA 1KWMA 2F40A 1D0EA 3EE3A 4Y28C 1M5OC 3G86A 1GK8A 1SVDA 5CCLA 3SMZA 1RA6A 2Y0BB 1M5VC 2IRYA 1H72C 3BDPA 3GYNA 4F4XA 1URNA 3F41A 1QLNA 3HT0A 1S9EA 1BHNA 4ZIVA 2MQPA 3VAHA 2XLIA 1YJNS 4LFBJ 1S10A 7FD1A 2VPWB 4K4UA 1RHJB 4PUOB 4TU9A 1QVFR 4X4NA 3LAKA 1TFYA 4IKAA 5C2GA 5C5JA 1TL1B 1IJEB 3NEKA 3WQPA 3MR7A 4RX6A 2CQ1A 2KFZA 3FFIB 1NO8A 1T9VA 2UP1A 1N32F 3RBZA 3A3OB 2PFDA 5HANA 3QPIA 5SUHA 3N4WA 4YHHJ 4IFYA 2FJWA 3M4XA 4K50A 4HLBA 1T9UA 3HHDA 2D3O1 4KHMA 2KL8A 2MZRA 2KYXA 3H2VE 1FRXA 4AD6A 2ZH7A 4OZNA 2M88A 3V6KA 1NB2A 3BV8A 1WC3A 4CT8A 1FERA 2J6TA 4RLEA 1LWFB 1BGXT 1BC6A 3O44A 2MZQA 1P8GA 1WORA 2B4UA 4IFVA 1RZMA 5FIIA 1IBMJ 4DCJB 3DRPB 1RT4A 4IG3B 3EZUA 5KG1A 4JI0J 1H2UX 3KOAA 2XO6A 4ED8A 4N8OA 3H42A 3JQJA 3O1LA 3KG0A 1RK8A 2MJUA 4FYYB 2KRRA 3PR5B 4GVBA 3Q2SC 2JHEA 2UU9J 2E7VA 5B0EA 5C24A 2JRSA 1X4HA 2YQ3A 5K14B 2W9BB 4LRBA 4ECUA 3ULHA 2Z57B 3UVJB 3NXZA 3TJ8A 2H51B 3Q8RB 4NLSA 2LU2A 1ULRA 4ZPCA 5KFBA 3PJXA 1R8BA 2WW8A 2XMJA 1Z1ZA 2CZVC 1FRIA 1WF1A 2M8HA 5IXUA 5J2QB 2YY3A 1SL1A 2ASJA 2DR6A 2Y0SD 4MAKA 3KK1A 2XGQA 1H2TZ 3TUJC 3CO0P 2NSBA 1FDAA 2XQCA 1VS3A 1B4SA 2QZ8A 1TTHB 4FF2A 1WWHA 4NZ6A 2XMKA 2D9PA 4A47A 5KFNA 2ZH6A 3K8WA 4KTQA 2AJ2A 3U1LA 1ELOA 2B0GA 4ZLPA 1GNKA 1TKXA 4L74A 4P10A 2MLYA 1N6QB 1S99A 4LREA 2COLA 4HTJA 1F6TA 2CQPA 3CJ3A 1KN6A 2P2CB 4K4XA 1IKYB 1IKVB 3DM2B 4DR3J 8RUCA 3FGVA 2BW2A 3OFEA 2XSJB 4ID5A 2IMWP 5F3ZA 3AD7C 1T8EA 2Z8QA 5CD4A 3OL9A 5EDWA 4XPCA 1OQ3A 4NLXA 4C11A 3TEHB 2D74B 4NLOA 3G8TA 2RDJA 1DFDA 4OYWA 3BPDA 1CLFA 4CTAB 2B5JB 4CLPA 4WPAA 3UCZP 3EVOA 1LKZA 4JI1J 2DGUA 1IBLJ 1GXUA 2UXCF 3NGDA 1E6YA 2Z2LA 4ID8A 3D2WA 3JSBA 1XC9A 5BXIA 2WVEA 4LF8F 2MSTA 5D15A 3CIMA 3FCVA 1F60B 3M1VA 4AFFA 2L9NA 2GC8A 2FC8A 3MEEA 1XMQJ 4OX8A 3MEDB 1RADB 2GO9A 1S1WB 2QL5B 2MJNA 2IA0A 2IVMA 5DS7A 1OYDA 2FHMA 4WIIA 4U96A 4DLEA 3L7PA 2VKZG 2AYBA 2N4CA 3DLLQ 3AJ1A 2XYPB 2G9OA 1S12A 3QFHA 4LFCF 1FXLA 1XIQA 2EG2A 2FGOA 4QWDA 4HEA9 3VGUA 2VUGA 2BE2A 1U26A 1J27A 3HHKA 3Q23A 1X8DA 4ELTA 3MM9A 3H59A 1TL7B 4X62F 3LW5C 1SUQB 2P5VA 1TZ0A 4Z7YA 4OYMA 2R4FA 1HD1A 3MPWA 2GW8A 2ATLA 2A0FB 5G4DA 2YKMA 4DFMA 4RNFA 3PFOA 5HVGA 4B3SF 3ICLA 4K4YA 4Q0BB 2AU0A 3LA0A 3LGNA 1SBRA 4F67A 2YKNB 4LFBF 2QMWA 3KFWX 1JLEB 1L3KA 3PCOB 3HI9A 2PO4A 2ZITA 1V3RA 1JXEA 3IS9B 5I42A 1Y0HA 5IV3A 3MR5A 1TMMA 1NKEA 2V8VA 1JX4A 4I69A 1M1HA 3A4TA 2NSCA 3CGIA 3Q0AA 4OYPA 3FBCA 1R8PA 1V5VA 1Y00A 3Q89A 1N5VA 3I9ZA 4DR7J 1NPKA 1TELA 3GILA 4ZVGA 1SH2A 1VFJA 4KGVB 5A8WB 1U0SA 5BYQA 3HMJG 5JJBA 5AT1B 1SV5B 1WG4A 3B6BA 4DX6A 1NK9A 2YNIB 3OLAA 3SSQA 2XZDB 2H3EB 1BQXA 3I82A 2GGPA 4Y0FA 2GMLA 1U2RA 4LRFA 4RW6B 1VGYA 1FDNA 3MCMA 5DLFA 2QA4G 3QO9A 1FTRA 3UN5A 2UV8G 3GLJA 2RS2A 2WONB 1HNXJ 2OSQA 2QLFB 3A8JA 2LP4A 2EI5A 3PIOQ 2YNHB 2GO8A 3G82B 4ATNA 3CWJA 4ED3A 2OI2A 5KFUA 2ZH8A 5J1EA 5KT3A 2CJ9A 4QIWD 5L1IA 5DLGA 4ED7A 1S79A 2YKAA 3P49B 2CJAA 1REVB 1VQ6S 1Q8KA 1RTJB 5C2CA 3RTVA 1GMUA 4FYXB 4ED4A 2C2EA 3BR9A 1ZTTA 4C98A 1T03A 1U6BA 4J9VA 3JYTA 1SKUB 1T3NA 2JH3A 3K7RA 3KNGA 3KK2A 3CDEA 1N54B 5CXTA 3GQCA 2OEMA 4FBUA 4K4SA 4ZLNA 4DV0F 4Q45A 1C4AA 4DV4F 4F3QA 3NAHA 2IM0A 1Q53A 3J81U 3Q8PB 2EG1A 2HEKA 4X84A 2B4VA 1MROA 1U1PA 3OHBA 2BJ8A 3CC4S 2HQDA 4WJBA 4J9PA 2UVUA 4OV1A 2VIHA 3KLFA 1T95A 2DK2A 1X9SA 4JP8A 3JTPA 2GHVC 3G87A 4MKVA 4O44A 3ITHA 3C3LA 5D4LA 2LVWA 1JLGA 1FJGJ 3CJ2A 4J37A 3M2VA 2VBYA 2RJZA 4DR6F 2PSZA 4YR3A 3BN7A 3HHLD 4HH1A 5HP1A 4DR5F 5HATA 3MHYA 3KLGA 3MOZA 2QA1A 4OZLA 4LF4F 1NDLA 2HVZA 1IKXB 2ABYA 2C2ZB 2EFQA 2I5JB 4KR0B 3GU0A 5HMXA 1S0OA 4IOAQ 3OR2B 1LK5A 1NSAA 4ZVUB 5H9FK 1KSPA 4B3RF 3OFHA 3G9CA 1JNRB 1U49A 1FRHA 2F5GA 2DGOA 4B17A 4B3OA 3DC2A 2P6TA 1H98A 2ZH1A 3LOUA 3G8QA 5FLXY 2GVDA 4UUXA 3CJSA 1TK0A 2XNRA 3UDCA 3FVYA 4A8FA 2CWKA 1VCTA 4AXJA 1HWLA 3MM5A 1RAFB 5DDRC 2EC2A 1JJ4A 4YS2A 3I0RA 3LP0B 2E1CA 4PAAA 2RH3A 2B56A 3VALA 3FEXB 4NEZA 2HHWA 2NPFA 1UVMA 3CB4A 4TVAB 2A2DA 2NREA 3CW2C 3TP2A 2E5LF 2O67A 4NXMJ 6FD1A 3EPGA 4DV5F 2IYIA 5CABA 2DH9A 2NZCA 4FVMA 4RW7B 1Q8BA 2BRLA 2HURA 4U95A 4HYKA 2VASA 4EBEA 4Y2IA 3P96A 4EBDA 2VPYB 3RG6A 1HPZA 1CULB 4K2JA 3NGUA 4TXSA 4DPXA 4USWA 2IVYA 5BR8J 5IM0A 3KLIB 1FE4A 5KFFA 1GMVA 3MEKA 4KT0C 4PXDA 3NGRA 4M5KA 4GMKA 2O01C 2X1GA 1I6JA 2XI3A 4PZVA 4CP5A 1Q8IA 2V6AA 3ISND 2R3VA 2OPPB 4J9UE 2M8DB 4Y2CA 1T7PA 3HKZD 4PYAA 4AE5A 4F2RA 1CJUA 1A9NB 1WI8A 2HAFA 1BY9A 1IBKF 3FRZA 1DAXA 1S6OA 2X51A 2IRXA 1K0VA 1HNZJ 3SXLA 2OP5A 3TAQA 4F4AA 3HO1A 2QYGA 3WZ0A 4V1Ak 1W2BR 2Z56B 2GMJA 3OUYA 3EXCX 3VGVA 3GV7B 3G6ES 5J2PA 3QGGA 4I2PB 1HMVB 3SI8A 2WSEC 4LF9F 4GKJF 2DNZA 3AOBA 2WSCC 2FVRA 4QR1A 4C8OA 4J9LA 3QIPA 1NJYA 4Q7AA 1IR0A 4IG0A 2VG5B 3R5DA 2ADCA 4DUZJ 1NB7A 2X1BA 3GIRA 3Q8YA 3JTNA 2GV1A 4UF4A 1RT6B 4QIFA 3ZZRA 2R8JA 4OYOA 2IHR1 3BPSP 4M5DA 3RB3A 1GMWA 2UUTA 4WE1B 4DSFA 1Y11A 5JUMA 1FKAF 3JQMA 2C28A 1ITPA 3K17A 5ETOA 4ZVEA 2UUCF 3TX0A 3RR8A 5ETMA 3FBFA 3T5KA 3P8BB 3TUZC 3W8PA 4C7QA 3HHLC 4P2MA 2MQMA 2VICA 1K1QA 1HARA 3T1HF 4ELVA 2YH1A 1IVZA 5T7LA 3CJRA 3EUNA 2C3OA 5KFDA 3M8ZA 1S4EA 5A0YA 4DV6J 3MR2A 1VQYA 4KO0A 1TAQA 3IAM9 1L5UA 3C6TA 4K0KF 3D6TB 2ALYB 1UAWA 2AYEA 3IGVA 4DSEA 3CULA 4FF3A 3FZBA 2PEBA 5DGBA 3TA1A 4ANCA 3QYYA 2XB2D 1RT3B 1RHKB 3TA0A 1LFWA 4P73A 4PG8A 4LVNP 4LF2A 1TK5A 3H90A 2EFOA 1OJ4A 2YX4A 3ZZZA 4CH1A 4CLWA 2XM3A 4I68A 4HL9A 2KXHA 4QIEA 1D9FA 2FZGB 2ILYA 2GX8A 2VKRA 4HI1A 3CTRA 3TX8A 1LV5A 4ZCKA 4OHWA 4QU6A 5FJ4A 4JV1A 2J6SA 2V94A 4WP3A 3GFHA 3HD1A 1IUJA 4DWIA 5LT5A 1OO0B 1DBDA 2E5HA 4L76A 2W2QP 4R5PB 3QRPA 4H4KC 2AJQA 1AZSB 3V6DA 1TKTB 2B51A 1RT5B 3SCLE 3JSMB 5JXSA 4UOFA 4C3LA 1J5OA 2Q6BA 2WCXA 5A76A 3TZXA 2DGWA 4FF4A 1BE4A 3KLEB 1BUXA 1IQTA 3UW1A 2E1AA 5H9FJ 5KFKA 2H54B 2NYHA 3M32A 4RJVA 1AYEA 2G0CA 2FJDB 2PFFB 4CT9A 2MKSA 4WXOA 1RT2B 3GPAA 4M63A 1HI8A 4ES3A 2QL7B 1MWQA 1DQAA 2D3UA 2V34A 3O8WA 4P2SA 8ATCB 4IDKA 1S1TB 3JAMU 4ZCLA 1D9DA 4AL7A 4YN3B 4IOBA 1HNIA 1TKDA 3CO9A 3AOAA 1DHMA 2W1BA 3O2IA 3MR3A 3ENQA 2E5JA 4CLYA 4DSKA 4WFNQ 1ZZNA 3MPYA 2YVSA 2CQBA 4RKUC 2YKOA 1VQKS 3BGRA 4CLSA 3KJNB 1CEZA 1F5BA 3AXKA 3IM8A 4YR2A 4IR9A 2B7BB 3VGTA 2FGCA 3HM9A 4O3PA 4ECRA 2DNMA 5KFVA 2HHSA 1Y4ZB 3DLEB 3MMBB 2W7PA 2UUAF 1OYEA 2FZCB 4CYUA 1WEYA 3QNWB 4TU8A 3QJJA 1PIEA 4W98A 4LF5F 4F26A 3VQTA 4L3NA 3CF5Q 4Y2AA 3UDVA 3V81B 2VL1A 1VYAA 1XNQJ 3W9IA 1FKOB 1XMOJ 3ENAA 4AYBD 5BYSA 1TKZB 4WYLA 2EKYA 3LAMA 2OAUA 1FA0A 1TL1A 1RT1A 2AGQA 4DN9A 1AFIA 4ANDA 4JV2A 3I31A 1ZAVA 1L3VA 3VR1A 1N48A 2CNNB 3FFIA 4UUWA 3R27A 3BB5A 3TVKA 3H25A 5FDLB 5DDQC 2AMCB 4TYAA 3L95X 5MLCV 2QSFA 1L3SA 2QLJB 1VRUA 3EYZA 1FT8A 4ZDNA 3HHNB 3PDNA 4LT6A 1RAJA 2VZ9A 5C7PA 2KHDA 1S0VA 1LWFA 2C2KB 4O3NA 3ETMA 4FS2A 3J7Z5 5D0HA 3HVTB 3V4IB 1Q86T 2VOPA 5LJ5Y 1UVLA 2FDNA 4IG3A 2W2PP 1YHQS 1JLCA 5LSRA 4L6V3 2DH8A 5EWGA 4EGLA 2XMWA 4RL1A 1UKUA 1FK9B 3AD8C 3HFKA 4OYXA 2ZNYA 1VMBA 4AQYJ 3A12A 1ZZFA 3BN4A 1DZ5A 1XK8A 5K14A 1Q5YA 2W9BA 1U7LA 3QT7A 3UVJA 1M5HA 2EFGA 3PRBA 5HAOA 2C3YA 2K7KA 1BWVA 1S7IA 2HK3A 1WTFA 2BM0A 4ZN1A 1WELA 3R5BA 1MU2A 3W5ZA 2DCUB 1FDDA 2OIHA 3ET6A 4WTOB 4IFYB 4CH0S 2DNKA 4Z7CA 4BC9A 3MR6A 4OL8A 1ICEB 1PYTA 4B3MF 3CJ0A 3GIMA 1V3SA 3AB2B 3MECA 2RIJA 3W62A 1U1OA 2IPOB 4UOHA 3ZTQA 4OYZA 4YFUA 1S49A 3DFEA 1RTZA 3MWBA 1N6QA 5DRKA 2P6SA 1S1XB 2HHXA 1UJ5A 4GC6A 1GH8A 4DMZA 3EJMA 2IMOA 4IFVB 4B9LA 2RU3A 1T02A 4DR4J 3NKYA 2RQCA 1IKYA 3DM2A 3NAIA 4CQ1A 4B9NA 2XSJA 5F8JA 4ZP7A 3HJVA 1SJ1A 2Y3YA 1SKRA 4ZP9A 1KQSR 1HWJA 5HQ8A 2X3GA 4GVBB 4CIOA 3ZTPA 2ACYA 4RPFA 3MM6A 1OQ6A 3M6WA 4CO2A 4K59A 4N7TA 1RWNB 2QC3A 2W8LA 4N77A 5C24B 1M5PC 2DYAA 4WFZA 4CTAA 1RWPB 4X4RA 2B5JA 5D4PA 1KVJA 5J2MB 1HI1A 2YPYA 4A8YA 1LNQA 3ELHA 3HKWA 3DOKB 4ZITA 3AQOA 3LPEA 5LSOA 1H7WA 2G13A 1I51B 1S1UB 4N56A 2U2FA 3OVBA 1QTNB 1T94A 1S1WA 1C1BA 1XERA 1S0MA 1EB0A 2ZJPQ 4G1PA 2RQ4A 3THVA 2LXUA 3PW4A 2OFHX 2MY8A 1WSRA 3UR3C 3IR7B 2U1AA 3AT1B 4Z2XA 1S5ZA 4ZPDA 1YQHA 2R8HA 2RKIA 4J9KA 4DV7F 2ZC4A 1RBOB 4GO5X 4NCGA 4K4VA 3JS9A 3NMRA 2WK4A 1JKHA 1F0XA 2RSQA 2DPIA 4OX6A 3Q8QB 3BH6B 3CE8A 2GIQA 5E3AA 4F25A 3T3FA 1N56A 3V6JA 4MK7A 4CLFA 3CD0A 5D78A 1SUQA 3HSDA 3GJSB 4ZPBA 1XMBA 4ECQA 3D5MA 4DQSA 3M8PB 3L4BC 1J5EJ 4C11B 2R9LA 3T19A 3K5NA 2IAJB 2DRBA 2AZ1A 1ZM4A 1ACMB 4Q0BA
chains in the Genus database with same CATH topology
2HNYB 2J0QD 5HMZA 2J6TA 1VQNS 3DLBA 3EXYA 4ERDA 5KT2A 2YKNA 4RLEA 1LWFB 1BGXT 4K4ZA 1BC6A 2BBEA 1JLEA 3O44A 2ZD1B 1VLYA 3DOLA 5E7OB 2MZQA 1P8GA 2ALZA 4X66F 1B0VA 2QLXA 4OHYA 1SIWB 2B4UA 4IFVA 2CPXA 3VCDA 3CDBA 3CJ5A 3IS9A 4ZPWR 2HS0A 4NMLA 1E6YB 2KHCA 5FIIA 1F9FA 3DRPB 4I2QA 4DG1A 1RT4A 3BQ0A 3MPVA 4IG3B 3EZUA 5KG1A 2MQOA 2OPQA 1H2UX 3KOAA 2OSRA 5E2QA 4ED8A 1S48A 4EO8A 2KI2A 5CYMA 3M1VB 4NLYA 3FEYB 3ISNC 4O3OA 4N8OA 2MKJA 4DL7A 2M4MA 4OZ5A 4KKOA 5H1SV 3O1LA 2DR9A 1K73T 4NLTA 2UXBF 3KG0A 2DNYA 1RK8A 2MJUA 5KAKA 2KRRA 1C0TA 2XLJA 4CO1A 4DR3F 1VQ4S 5EHHA 3PR5B 3DNCA 2MDAA 1X4AA 3FNNA 2B3TB 1RTIA 3Q2SC 1UFWA 1GXTA 4JOUA 1KOHA 1LW2A 2KT2A 5C42B 1U1QA 2M7SA 4J9SA 1VHFA 2JHEA 2F4VF 3M9NB 2XHWA 2HFOA 4RWWA 5B0EA 5C24A 2JRSA 2QV6A 4JI8F 1X4HA 3UI3A 4EEYA 3MI7X 2YQ3A 4WYWA 2HAIA 4KBIA 3MM8A 4IH7A 3NBPA 5K14B 4EZ6A 3OL8A 1XR7A 3F44A 2W9BB 3TI0A 4ECUA 4F50A 3ULHA 3H2LA 2OKQA 4NLWA 2JDJA 4I67A 3CD5A 2HNDB 3Q8RB 2F1FA 2CJKA 4NLSA 5DO2A 3KJVB 3TAPA 5L1KA 5AE1A 1IQZA 2QFJA 4RW9B 1HI0P 1VQSA 2LU2A 2YNIA 3GB0A 1ULRA 2CQ0A 4TQSA 1UW4A 3UDLA 4ZPCA 3O3LA 2KFNA 5KTQA 3KLHA 4IR1A 3DRRA 3ZZYA 5CYJA 3QIDA 5KFBA 3PJXA 1R8BA 3GFXA 1NK6A 2BE2B 4JI1F 3M05A 1TL3B 3QZ8A 1IBLF 2WW8A 4NZ0A 4DBQA 5AE2A 2XMJA 4HHJA 1Z1ZA 2CZVC 3OTCA 1FRLA 4LSNB 5L9XA 1FRIA 1WF1A 2M8HA 5A8KB 4RW6A 2DHXA 5IXUA 2DIVA 1RI7A 1TFWA 5J2QB 2YY3A 3MTJA 3VAGA 1SL1A 3M30A 2ASJA 3CT9A 2QLWA 2Y0SD 3HVRA 1QM9A 2OFGX 3M6VA 4MAKA 1NZAA 3MM9B 2XGQA 5U47A 3KK1A 1H2TZ 4BWMA 4HT5A 2OMLA 4NCAA 2WONA 3TUJC 1Q7YT 3OPKA 4YUDA 1XMQF 1QSSA 4GO7X 2NSBA 1FDAA 2DD8S 1VS3A 3PNIA 3CMAS 3IC1A 2QZ8A 4RBUA 4FF2A 2ZBIA 4K5SA 1WWHA 3Q8SB 1X5OA 4NZ6A 2FVSA 3CC2S 2YKMB 2XMKA 4DX8H 2D9PA 2XULA 4WU2A 4A47A 5KFNA 4WFAQ 3OJUA 2MYFA 3S8SA 2ZH6A 2EFNA 3K8WA 2XY6A 4KTQA 4CO0A 3DHWC 1Y3JA 2O3DA 1W25A 2YNHA 3U1LA 1FCAA 5B0AA 1ELOA 2B0GA 4ZLPA 4PUOA 2R7SA 2GQ2A 4ITSA 1GNKA 3MMAB 2OPSB 5KFQA 3W7BA 4ZMMA 3M2UA 3D1OA 1TL4A 1TKXA 5GAHI 3HPOA 1R3NA 4FYDA 4Y2KA 5F0WA 4ZHRA 1JLAB 1N6QB 2FLNA 1X4FA 2V8GA 2GMHA 1S99A 3NG8A 4MKAA 2COLA 4HTJA 4U7UK 1NK7A 1TUVA 1TK8A 2CQPA 3CJ3A 1RTHB 2FHJA 4OZ1A 3OXGA 1KN6A 1REVA 4H4MB 5I42B 2BANA 1AROP 2OD6A 1JXLA 3G71S 4ILMA 3W3SA 4LMZA 1RTJA 3W2VB 3K2YA 4K4XA 1IKYB 1IKVB 2NQPA 2HVHA 4J5OA 3DM2B 4DJBA 2IM3A 5K8OA 1QSLA 2B4OA 4R8UA 1O51A 2J7UA 3FGVA 2BW2A 1FJEB 1Y5IB 3OFEA 1Q8LA 2XSJB 2XCPA 4ID5A 4YR0A 4CZCA 4NRTA 4PQAA 2IMWP 5F3ZA 2POKA 3QJPA 1TV6A 2DHAA 5CCMA 1T8EA 2Z8QA 1VBXA 2F8HA 3OL9A 3C6UB 5EDWA 1WNEA 2R7OA 2KG1A 2KJWA 2KYZA 3MMCA 4MYUA 5I3UB 2XBPA 4XPCA 1OQ3A 1VBYA 4KC5A 4NLXA 2IVFB 4NYZA 3PZPA 3G96A 2R8GA 4C11A 3NMAA 4BS2A 4ILLA 1PSDA 2CJBA 1KEKA 2ZH3A 1XR5A 1S9FA 2P9GA 3MD3A 1NK5A 2PD1A 5E33A 3R5AA 2D74B 4ZKAA 4NLOA 3G8TA 2JOQA 2JC0A 2RDJA 4QCLA 3I4HX 3LANA 3OVSA 3QGIA 4HDHA 1DFDA 2EWHA 2CQCA 5K5MA 4IYQA 2GFFA 1GTEA 3RAQA 5I4MA 3PO5A 2VPXB 4IRCA 4LF7F 4KHPF 1CLFA 4CTAB 1MWYA 2B5JB 1UL3A 5I3PA 3S7RA 1G1XA 5DM7Q 4A8KA 2CKWA 3UCZP 1LKZA 3G6VA 1UA0A 1N5QA 2DGUA 1GXUA 3LUYA 2UXCF 1Q4RA 4Y6IA 3NGDA 1E6YA 2Z2LA 4ID8A 3MM7B 4BWJA 3NWGA 3D2WA 5KFYA 3JSBA 3OHAA 1XC9A 3DRPA 1ZBTA 1HNVB 2DGSA 3K5PA 5C25B 4XPEA 3Q22A 3I5BA 2PEHA 6FDRA 2KB2A 2ROPA 4LF8F 1S4FA 2MSTA 3H5UA 1QE1A 2QEXS 3CIMA 3OR1B 1JLBB 3V5RA 5L9NA 1F60B 1QAYA 1ZM9A 1D8ZA 2HS3A 3M1VA 2JSXA 2AJ4A 2C3PA 4AFFA 2D7SA 2XO7A 2BDPA 4YB7A 1TR0A 2L9NA 2OH2A 2GC8A 2FC8A 4USHA 1LWCB 3MEEA 5FD1A 2DNQA 1DLOB 4ECWA 4OX8A 1U6FA 2XY7A 5IT9Y 5K8PA 4M1KA 3MEDB 4MK8A 5F0UA 2GO9A 3CDUA 1S1WB 1D9AA 3RAXA 4FPRA 2FVPA 2MJNA 1GQEA 2IA0A 2IVMA 1XTZA 2VA3A 5DS7A 1JMTA 2FHMA 4WIIA 4NA2A 3NS6A 4WZQA 1FRMA 2H5EA 2RQKA 4HH0A 3N5BA 3L7PA 4DLEA 4DSJA 1HW8A 1S9EB 2UZAA 2VKZG 2AYBA 2ZM6F 2N4CA 3LH2S 4CCHA 4C3KA 4H54A 3DLLQ 3AJ1A 2KXFA 2QMXA 4DL2A 3PX0A 3QGPA 2G9OA 3O5TB 2VFRA 1YGYA 4ZVHA 4LFCF 4DR7F 3SV4A 1FXLA 4MJKA 2VH7A 1RA7A 2P9CA 3DYAA 1ZTWA 2EVZA 2EG2A 2FGOA 2VQEF 4QWDA 4RW9A 4HEA9 4YY3F 2IFXA 3P3DA 2PA3A 5T14A 2FPHX 5KT6A 3OW2R 4Q8FA 1B7FA 3C46A 1IM4A 3ZZ0A 4RNOA 3IR6B 2PMHA 2VUGA 4DF8A 4O3QA 2BE2A 3V6HA 1U26A 4FNIA 2VD3A 1YJVA 1C2PA 3JSRA 1FD8A 3F56A 1HBMB 5AXLA 5DG9A 2L3MA 5DJBA 5GAEI 4C2MA 1HW9A 5HO4A 1YJ9S 3M8RA 3HHKA 5E3RA 4WKRA 3RYLA 1S7HA 5J2QA 3P5TL 3Q23A 1X8DA 3K57A 4RW8B 1Q82T 4KV8B 3CCLS 4ELTA 4U9RA 3DLKB 2V0NA 1VQOS 4A8OA 3MM9A 3H59A 2LLZA 4RWXA 2JX2A 1Z2LA 4X62F 3LW5C 2ASLA 1SUQB 1IKXA 2KKHA 1TZ0A 2P5VA 2KO1A 5L8RC 1FXRA 3AHPA 2J0SD 3NS5A 3CDAA 2R4FA 1T03B 5KFZA 4OX7A 3KMSA 4QPTA 3P6YC 1HD1A 3RU0A 2DGXA 3MAHA 3MPWA 2GW8A 2ATLA 1U1KA 2HHHF 4CO5A 1KRPA 3PW2A 5CZVA 5G4DA 2YKMA 5AJ3F 4LF6F 4X4SA 2MGZA 2OO4A 3KK2B 4PQUB 4CI0B 5MAOA 1SC6A 2L9WA 1YJTA 4FZVA 4DFMA 5AE3A 4RNFA 4C8MA 1HNXF 2YWGA