5BJRA

Crystal structure of the n-terminal rrm domain from mec-8
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
86
Chain Sequence
QVRTLFVSGLPMDAKPRELYLLFRGARGYEGALLKMTSKNGKPTSPVGFVTFLSQQDAQDARKMLQGVRFDPEAAQVLRLELAKSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mec-8 protein
publication title Conserved binding of GCAC motifs by MEC-8, couch potato, and the RBPMS protein family.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Splicing
total genus 15
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5bjrA00
1X5PA 1A7GE 2JWNA 4PR6A 2QA4S 1AUDA 1JJHA 2RS2A 3S01A 2KVIA 2F9JA 3G6ES 3NMRA 1WEZA 5DM7Q 2KRBA 2KG0A 2VODA 3UCGA 2U2FA 3SXLA 2GHPA 1WF0A 5DDPC 4IOAQ 1WHVA 2CPHA 5IFMA 1OPIA 2DGXA 2AYEA 3UCZP 1VC6A 1N52B 3CCRS 2QEXS 2CQGA 2CQ2A 4QQBA 4F25A 2RRAA 1OO0B 2DISA 3CCSS 5GAHU 4YUDA 1B7FA 4OZ0A 1HD1A 2OTLS 2O3DA 2GO9A 2XS5A 4WKRA 2X1BA 2MQPA 2DHSA 3CMAS 5GAGU 3CPWR 1YIJS 2F9DA 3G71S 4IOCQ 2DNRA 1U1NA 2CPDA 5IQQA 3JB9k 2PE8A 2M9KA 5JVGQ 2DNLA 3TP2A 1U1RA 2DH8A 2MZTA 4OZ1A 2DGVA 1X0FA 3D2WA 4LIRA 1WI8A 2LKZA 1DHMA 3CXCR 2MZSA 2OJ3A 1PGZA 3UE2A 2DGOA 2G1DA 2N82B 3MUTP 4EGLA 4WFNQ 5MLCV 1Q82T 1ZZNA 3VALA 2RT3A 1VQKS 4CQ1A 2L08A 1VBXA 2M8DB 4UQTA 3RW6A 2DH9A 2CPYA 2AYMA 2J0QD 3BO3A 4IUFA 2E5JA 2ZJQQ 5HO4A 2F3JA 2KXFA 2X1AA 2CQ4A 4F26A 2L41A 1VQ8S 1UW4A 2DNHA 3SDEB 1YI2S 4TU8A 2JVOA 3PIOQ 3ZZYA 2DNYA 3SDEA 2LECA 2KHCA 3TO8A 2DNKA 2E44A 2DO4A 4TU7A 2JRSA 4LMZA 2CPXA 3MXHP 1CVJA 1YJNS 2RNEA 1X4EA 5DDQC 3OW2R 1M5KC 3CUNA 3HHNB 2JX2A 3VAKA 4Y0FA 3ULHA 1YHQS 1HA1A 4J5OA 3S6EA 2CQ1A 3DLLQ 1VQ6S 3UCUP 3U1MA 3G8SA 1U1PA 1D8ZA 1SJRA 3LQVA 3ZZZA 3I56S 2CPJA 4C4WA 3J7YU 3N9UC 2M88A 3VAGA 5GMKa 1X4CA 1WI6A 2DGTA 2LA4A 1X4GA 1P1TA 2DNPA 2M0GB 3HI9A 3CMES 2PEHA 2V94A 4ERDA 2A3JA 1U1LA 3I55S 2CPEA 1VQ5S 1F9FA 1NU4A 4WFAQ 3J7ZT 5H1SV 2CQ3A 2ADCA 3VF0B 3MI7X 1OWXA 2MKJA 2KFYA 2HZCA 4ZKAA 2MZJA 2FHOB 4PRFA 2KM8B 1R8HA 2MHNA 1NJIT 4FXWA 1S72S 2CPZA 1M5PC 3NNCA 3SMZA 2LYVA 1KOHA 3B4DA 1N54B 1VBZA 2CQHA 1VQNS 4W90B 1H6KX 1RKJA 2DNQA 2LXUA 4IO9Q 1SJ3P 1FNXH 2KH9A 3FEYB 2DGQA 1JJ2R 3LPYA 1X4FA 3RW7A 4V19X 2CQDA 2RS8A 4QU7A 3CF5Q 5JVHQ 1WEXA 2MSSA 1HL6A 5DETA 4TU9A 1FO1A 2DK2A 2BZ2A 5LSLA 1KD1T 4FXVA 3H2VE 1HD0A 2K8GA 3VAFA 3NNAA 3R1LA 2DITA 2G4BA 2MKIA 2MGZB 3VAMA 2DNNA 2DB1A 1G2EA 2MGZA 5ITHA 5HL7Q 3G96A 2CQPA 3P6YC 3P5TL 1FJ7A 2MZQA 3H2UB 1X4AA 2MQMA 4TLQA 1URNA 5DDRC 1M90T 3NNHA 4F02A 4M5DB 3P3DA 3US5A 1O0PA 5IM0B 2KXHA 2KU7A 2LMIA 3THTA 1VQ7S 3CCQS 1VC5A 3Q2TC 4C0OC 2VOOA 2M2BA 5IM0A 3P49B 3NS5A 1WHYA 1M5OC 3NS6A 2MZ1A 3VAIA 2HGNA 1R8PA 2M52A 1U6FA 2VONA 2DHGA 1WHWA 2OIHA 2MQOA 2B0GA 2YKAA 1QM9A 2LEAA 2DH7A 5GVQA 1WG4A 1JMTA 3MD1A 1WG1A 4WCEQ 1H2VZ 1VQOS 1WF1A 2DGUA 1D9AA 3CCLS 1M5VC 2BOPA 1KQSR 1U2FA 4Y00A 4WIIA 1N88A 1VQLS 4C7QA 1IQTA 4A8XA 3MUMP 2N3LA 2CQCA 1K73T 4WF9Q 2G0CA 2YH0A 1YTYA 1WEYA 2WBRA 2HVZA 3CCES 3B4MA 2EK1A 4P6QA 2MKKA 2MYFA 2DNOA 5GAEU 2OTJS 2KI2A 2KN4A 2XNQA 1VQMS 2MJUA 3CC4S 2KYXA 3CC7S 2DGWA 1PO6A 1SJFA 2N7CA 3CC2S 5DDOC 3EGZA 2FC9A 1VQ9S 2XS7A 5DM6Q 2MPUA 4UY8T 1Q86T 2FPHX 5GADU 2MKSA 2MY8A 2L9WA 1S79A 2M8HA 2DGSA 4QPTA 2RUGA 4PKDB 2HGLA 1U1KA 5D77A 1H2TZ 1WELA 3UD3P 2HYIB 2CPIA 2FC8A 1YJ9S 1NO8A 2KM8C 2YH1A 2LQ5A 1UAWA 2DNGA 3CTRA 2YWKA 1WWHA 2DIVA 2KG1A 2AD9A 1X4HA 3UD4P 4RU2A 1FT8A 3CCMS 2KT5A 3PIPQ 1UP1A 2E5IA 2J8AA 2MQNA 1SJ4P 4ED5A 3MOJB 5LXRA 1WTBA 2DHAA 5LXYA 2J0SD 1P27B 5D78A 3G9CA 2HGMA 2MY7A 5LJ5Y 1M1KT 1U1QA 3L3CA 2RQ4A 2UP1A 4CH1A 1U6BA 2M7SA 3G4SS 2LCWA 2QFJA 2MQLA 2MXYA 2XB2D 2CPFA 2Q79A 3EX7B 2M4MA 2K3KA 3BO4A 3IWNC 1FJEB 1SJQA 2SXLA 2YTCA 4CIOA 2MMYA 4Z2XA 2MB0B 1FJCA 3K0JA 2ZJPQ 1X5TA 1QVGR 2XS2A 2EK6A 2MKHA 3Q2SC 1DRZA 2LXIA 1VC0A 1N8RT 2U1AA 5CA5A 1XN9A 1A9NB 2CJKA 1JJ4A 2AYBA 3UWTA 2DHXA 2JVRA 5CXTA 1X5SA 2MJNA 3CCVS 1U1MA 2EVZA 4YOEA 1DZ5A 3VAHA 2M70A 1KC8T 3V4MA 3DXBA 2MSTA 1X4DA 2NZ4A 3CULA 1K8AT 1YWXA 3CCJS 1UFWA 1VQ4S 2VOPA 1L3KA 2ERRA 1WG5A 2I2YA 3FEXB 2CQIA 1FXLA 1U1OA 2CQBA 3MURP 2LA6A 3S7RA 1SXLA 1VQPS 2E5HA 1OIAA 1ZZFA 1X4BA 2OSRA 2RVJA 2RU3A 2KRRA 2KXNB 1YITS 1YJWS 1DBDA 5BJRA 2RQCA 2E5GA 2OSQA 2D3OR 1WF2A 3U1LA 1BY9A 2I38A 2J76E 1Q7YT 2FY1A 2DO0A 4QU6A 1WHXA 2XSFA 3MUVP 3R27A 4U67Q 2N3OA 2RRBA 2XNRA 3S8SA 2MKCA 1W2BR 3EGNA 3TYTA 4WFBQ 5CYJA 3VAJA 2DNMA 1QVFR 5EN1A 1RK8A 2CQ0A 4YB1P 4W92B 2D9OA 1K9MT 2MZRA 2DNZA 3BO2A 2NLWA 5LSOA 2X1GA 5FJ4A 4LJMA 1H2UX 3G8TA 3IRWP 1X5OA 1KOOA 1ZH5A 2X1FA 2MQQA 1VBYA 1FHTA 5LJ3Y 2DIUA 2ZJRQ 3R1HA 4BS2A 3MD3A 2AYGA 3THPA 2D9PA 3BEGB 4CH0S 3CCUS 3BS9A 2ADBA 2LEBA 3MDFA 1Q81T 3CD6S
chains in the Genus database with same CATH superfamily
1CBKA 1FEEA 2RDIA 2FGCA 2QIFA 4DCJB 4ELVA 4WWSA 1KTVA 5IT9U 1OJ4A 1WHVA 4K0KF 3PX4A 3W5YA 1PSDA 3QT5A 1QTMA 4OX9J 5A2QU 4DR5F 3QT8A 1OO0B 3CCSS 4BC7A 1HW9A 5KFYA 2OTLS 3KYLA 4AXIA 1JLCA 4Q8EA 3PJXA 4B9NA 4X64J 1RTDA 4OI0A 4RPFA 1S49A 2V5HG 1F5AA 3D1OA 3HULA 2GQQA 1LW0B 2E7VA 3PKMA 1I1GA 4BWJA 3T5LA 1HNXF 3W66A 4ZPAA 1WI8A 3BDPA 2N82B 3I96A 2BE9B 2V4QA 2W4PA 1AUSL 2C2MB 4CQ1A 2L08A 1XR5A 2C3YA 1S99A 3ZC4A 2EFVA 3X1LB 3JYTB 1HQUA 2CQ4A 4X4SA 2L41A 2XMKA 2VUGA 1HR0F 2W8LA 3H2LA 3MR7A 5E3CA 2IM0A 1X4EA 5KFGA 3J7AN 5KFLA 1SKWA 3CMQA 5DZ7A 4O3SA 2Y1JA 3LQVA 5IV4A 3K58A 3I31A 3ENAA 3QGIA 3L7UA 4NI2A 2E1AA 3OR2A 3VTIA 1WDTA 4B02A 1BQMA 3BGLA 1XMOF 3ET6A 3MPVA 3T19A 4WFXA 3NCPA 5DQIA 4WK1A 4Y3CA 1L3VA 5J2QB 4WFYA 4RW4A 3RB4A 2WAQD 1I3OB 2CPZA 3BV8A 2FTRA 2KT3A 4N8OA 4WP8A 3PM9A 5A8WB 1HMVB 3JQMA 1C4AA 5BYQA 2O01C 3LPYA 3W9JA 1RHQB 3MF5A 3GIIA 2GVZB 7FDRA 2W9CA 4HTIA 2O1PA 3DRYA 4WP9A 2J9DE 3VAFA 5D6GA 3TVKA 1UW9A 3THVA 4JI8F 4DDFA 3OXGA 1SPBP 2FGOA 4ZHRB 5E3RA 3GYXB 4KYZA 3EJMA 5HQ8A 4DSLA 1RU2A 1NB2A 3DMJB 4F36A 4XIUA 5HBMA 1VC5A 3N4WA 3TJAA 2VIHA 4FYDA 3DLKA 4H54A 4CO2A 1WHWA 2B0GA 3BREA 1WG1A 1RHRB 4OQJA 1ZS6A 5L1LA 2HRTA 3FFIA 2LQBA 3M1VA 1KQKA 1N6QA 3AA8A 4RU9A 1V3SA 5K14B 3V6JA 3I5BA 3PX6A 3HSZA 1REVA 2F5GA 2HVZA 4RJVA 4P6QA 2MKKA 1CJKB 3AFGA 4P10A 3M2VA 2EKYA 1GT8A 3M8QB 5KT3A 3GYNA 2XWXA 3CB4A 4P2SA 4LFAJ 5DM6Q 2CIMA 5SZTA 3LP2A 2H4WB 2Y1RI 4ZS6A 2L9WA 1S79A 3FEZA 5D77A 3CWJA 1D8YA 4QR1A 5T7LA 1NO8A 4CI0B 3IAS9 5K9FA 4NZ6A 4JI6J 3R2CJ 4R5PA 2WB1D 2WBMA 1HYSB 1IKYA 5FD1A 4LF6F 2UU9J 4KSEB 2VKZG 4C3MA 2NREA 2BQ3A 2Q79A 2FLLA 1V5VA 5ETVA 2HSEB 5I3PA 3DLBA 3RG6A 3KLGA 4HH1A 3R5GA 4U8YA 3MMBB 1MU2B 3VZHA 4CO5A 5F8IA 1J5EJ 4F2SA 1M0SA 4DV1J 3UWTA 2A18A 3EM1A 4OYIA 2YY3A 3AQPA 5KOWA 1JLEA 2IBKA 5AXKA 1SUQA 2XCPA 4OYBA 1T9UA 1YWXA 5ETTA 3CCJS 1MG7A 3V5RA 1X31C 2GQCA 5JJBA 3OSNA 2I2YA 2CQIA 1UVKA 2VG5A 3MURP 5J2NB 1YITS 3HXMA 2RU3A 2C2EA 2BMBA 4UOFA 1EARA 3I82A 2R7WA 2WB4A 4NLOA 4Q44A 1W2BR 2GO8A 1KDNA 3NCRA 4QR0A 1N33F 5EN1A 2F8MA 1J27A 4IR1A 2PN6A 1RQ0A 3ELHA 3VGTA 3K8VA 3LGNA 1IJEB 3P45B 5CYMB 4I7FA 1C0TB 3V6KA 1RCXB 2KFZA 1RWOB 1B64A 4LF9F 2ADBA 3UN3A 4LUBA 4DR1J 2B9WA 2XMWA 2QLJB 5HROB 5ETNA 2F9JA 4IYQA 3NMRA 2JZ5A 3KNAA 3SBMA 2YNFA 3N01A 4J9VA 1AYEA 1REGX 3ENQA 4NYOA 2BOAA 2MQ8A 2OMLA 3BSAA 5KFCA 2POKA 4GVBA 5B0EA 2QLFB 2CNNB 3CMAS 4C3KA 1Y9OA 3P96A 4CT8A 5D3GA 4ZPDA 2AKWB 1UTAA 2PI4A 1AT1B 1IBLF 3IG1A 1D9FA 3MR3A 2PSZA 3O1LA 2I5JB 4CCHA 2IPOB 1J5OA 1GTEA 4J9PA 3SDEB 1HQEA 3PR4A 1RWMB 3A8IA 1RBOB 4HTJA 3CUNA 2PO4A 2FJAB 1HHQA 2CQ1A 4MKVA 2JNJA 4J91A 2W9AA 1H73A 5ETMA 1U1PA 4AQYJ 2XCAA 3KLHA 3C6UA 4JYAF 3HFKA 3A8JA 4LQ9A 1BQXA 4KGXB 4LRAA 4LT6A 2XO7A 4NCBA 2YNHB 3V4IB 5G4DA 1VBKA 3FKBA 2VG7B 2PEHA 2YWHA 3Q86A 1U1LA 3KK3A 1ACMB 2XY7A 3HP6A 3SMZA 2GNKA 4R8UA 4JI5J 3J7Z5 3G82B 1N54B 4LSNB 4X62J 2BXJA 5IC6B 4N8NA 6FDRA 1RGVA 4IO9Q 2ZD1A 5IWAJ 5D0GA 4M63A 2RS8A 3ONQA 4TU9A 2DPIA 3AXKA 3MMCA 5LSLA 2OHDA 4UZBA 1NRKA 2A2DA 5KT2A 1IKVB 3KLIA 1D0EA 3KJFB 4I69A 3VQTA 3EGVA 3G96A 2HWTA 3P6YC 5FDLA 1UFLA 2B7BB 2DR9A 5IZHA 3ZNUA 4OJHA 4XDCA 2RDDA 2KXHA 3Q2TC 4UF4A 4ECUA 1FJGF 2YWGA 1JXEA 2BKNA 1T94A 2CXEA 3RAXA 5KFEA 2H51B 1NJZA 5F8LA 1OQ3A 2ZH6A 1B3TA 2YKPA 2XMTA 4DF8A 1MMNA 2W2QP 3OL7A 1Q5YA 4LSLA 1S9EA 1H0HB 2N3LA 3G86A 1RU1A 2BJEA 2WBRA 1CSJA 3B4MA 4ZITA 4A8YA 1FDNA 1F9EB 2KI2A 3HF5A 4B3RJ 3NG8A 1YQHA 4QWBA 4UT4A 4LRCA 4OHXA 2HNYA 3MM5A 3H5UA 1U49A 1TAQA 3DOMB 2UXBF 4B9VA 4B9UA 2XY6A 1OMSA 2HHSA 3MHYA 4C8OA 4DG1B 1B4SA 2AD9A 2X7IA 1S9GA 4OZ3A 1OQ6A 1UP1A 3KK1B 3QJJA 1M1KT 2A10A 3G4SS 1GH8A 2BW2A 3QBCA 1TTHB 5M2RA 2CPFA 4YY3J 3M4XA 4NASA 4CRJA 3I5CA 1JK9B 1RJJA 5D4PA 4KKOB 1PC5A 4F0KA 2CJQA 3RJMB 1SKUB 3DLJA 5AT1B 3T3FA 2B51A 5CA5A 5DLFA 2J6UA 3W5ZA 1FNOA 3PV8A 2W7AA 1VISA 2AX1A 4O0NA 2WVEA 1NB7A 5ETSA 1XR6A 1S1WA 2G2OA 2OFHX 4DR2J 2HIQA 4USWA 4M5HA 5IXUA 4USUA 2PEBA 3VGUA 3EGNA 4AE5A 1RT3B 4PWUA 3MECA 1F2GA 4DSKA 1JLAA 2RB7A 3H25A 1FX2A 5L1IA 5LMNJ 1K9MT 2MZRA 4EZ6A 4MIWA 5LSOA 5FJ4A 1VCTA 3JTNA 5AJ3F 2QLXA 4YFUA 4PG7A 2ZBIA 2QLWA 2KJVA 3BM7A 1S0MA 1LFWA 2Z56B 2J6SA 3PX0A 3MTJA 4OYWA 4ED6A 4RNFA 3BQ0A 3G6ES 1FNMA 1WEZA 4OL8A 1KWMA 3UO0A 5DDPC 1WF0A 3RB6A 3TOQA 1Y3KA 1N52B 4K2XA 3B82A 4F25A 5DG7A 1ZPVA 2WTFA 1HD1A 3AHPA 5KFOA 1RTDB 3R9LA 5GAGU 1ZTTA 3H5SA 4LF5F 1NSKL 1JLQB 2FZCB 4A47A 2IBOA 3QAUA 4O3RA 4G65A 2OJ3A 3Q8SB 1IKXB 1JLFA 1TK0A 1KLMA 2DH9A 2HHQA 1FVSA 3I6PA 1HQUB 1ZYQA 5HO4A 2X51A 2X1AA 1U02A 1YDLA 2R7QA 2Z2MA 2GVDA 4G1QB 1S0VA 2ZC3A 4A8WA 3IRXA 3GG0A 3ZZYA 2ZM6F 1X0PA 3KDOA 2H48B 3PACA 1HWLA 1WTFA 3HLUA 2V9WA 4C11A 1KTQA 3HHNB 3ULHA 3MPDA 2NXNA 5LL6d 3K7RA 3OD2A 2ZBRA 3AH6A 2ZEJA 5A8KA 3N9UC 1S57A 4ZMMA 3VAGA 2BANA 2LA4A 4JI0J 3DU5A 3ET6B 2CPEA 2ADCA 3POTA 2EFQA 1OWXA 2FHOB 3DM2A 2AWZA 4PG5A 3TA0A 1TQLA 4F4WA 3DHXA 4AFFA 2H54B 2P8IA 1RKJA 2QV6A 5DGAA 2L9NA 1DJ0A 2YVSA 4KC5A 2HFNA 3EMTA 4KO0B 3RW7A 2ZE2A 2EC2A 2W9CB 2Y1IA 4RNHA 1HL6A 2QA2A 3CO0P 2D3UA 1RDRA 3TR5A 2QMUB 3VAMA 1U8WA 4NOHA 1K0VA 4H4KC 3ILIA 1QAIA 2WK4A 3KHRA 1TAUA 4QIVA 1N34F 4C8KA 1U7LA 5HBMB 2DJWA 1KP6A 1KONA 1CS4A 3CJ5A 3M9NB 3DLKB 2YX1A 1CC7A 2R9LA 1NK0A 3ISNC 1KRPA 4JI4J 1S48A 3FFIB 4ES2A 1N6QB 3CCLS 3Q24A 2VJUA 2ASLA 1RBLA 1K73T 2OPRB 3M2VB 1IBMJ 4LRFA 4KHMA 4K59A 2QZ8A 3GIRA 3I4HX 4U8VA 2DGWA 3HDSA 1SJFA 2LDYA 5DDOC 2KZMA 1JLGA 1QUVA 5GAHI 4JI3J 1T3OA 5T7LB 2HGLA 2IVYA 1U1KA 1FTRA 4R5PB 1XNRJ 3I0SB 4NLTA 3TAMA 4WYLA 4OHZA 4A48A 1E6YA 2KG1A 4DV7F 5M2UA 3DLHA 1D3WA 2PGCA 1RHKB 2VFTA 5LXRA 1WTBA 4USTA 1TK5A 4Z7CA 1VRTA 4LF7F 3C16A 1L3UA 4FYWB 3OSPA 3LP0A 2QFJA 1F5BA 4J37A 3KLGB 1SL2A 1SJQA 2YTCA 4CLLA 2QG9B 4GKKJ 1BGXT 3SFUA 3GFHA 4LR9A 2QYGA 1JLEB 3HSJA 1X5SA 3OPKA 4ZVPB 1DZ5A 3PHTA 4TKTA 2EBGA 3V4MA 4PYDA 5F9NA 4OJGA 4UOCA 2VG5B 3BGFA 1E6VA 4DFJA 4DR4F 5J1NA 2LA6A 2KXNB 1VLYA 4K4VA 2KRRA 4D3HA 1HPZA 4JV0A 5A6WA 1BY9A 3D3BJ 3TQEA 3QFWA 3R27A 4URGA 4B3OA 2AMCB 2FJXA 1GAOA 3NLCA 5EHHA 5ETRA 3G2XA 1GMWD 2DNZA 3BB5A 1MWZA 3PEJA 3BBCA 4PG6A 3LF0A 4QWAA 4CLWA 3OUYA 2BBEA 3JSMA 1VRUB 4RL1A 2LEBA 1Q81T 2JLEA 3C6TA 1U6ZA 1WSRA 3RZAA 3ZZ0A 2YNFB 5DQHA 2FVCA 4P74A 4KFBB 3GG1A 4K4TA 3OVSA 3D0GE 3CCRS 1ZM2A 1FERA 2L9DA 4ZDNA 4GVBB 3R3TA 4BWMA 4KB7A 3DDNA 3HVTA 3NAHA 3F73A 1KVJA 3W60A 3OTEA 2JHEA 4ZIWA 5HP1A 3V81A 1XMQF 2FJWA 2RAQA 2H3EB 2QA4G 5LMUJ 3D2WA 1FDBA 3CXCR 3NOCA 2V4RA 2ALYB 1PGZA 2VV5A 4ZOSA 1WOOA 4ANDA 3MEDB 5I3UA 4AYBD 1EETA 2DNHA 4WYWA 4RNMA 1GXTA 4OX9F 3DYAA 1SVDA 1S0OA 2YKOA 1GQEA 3GV5B 2DT9A 2VQFF 1F0XA 3VWSA 4IDKB 1FKPA 3ILLA 3KLHB 3C6UB 4X64F 4ED3A 4ZN3A 2HFZA 4C4WA 3T1YF 1SIWB 3VGSA 4F3QA 3IBCB 5IT4A 5D4LA 3KK3B 2V8PA 4ERDA 4USHA 3TAQA 4UW2A 1FDAA 2CWKA 2Z2LA 3HO1A 2VFUA 2HZCA 1GXUA 3JTOA 4JI2J 4JV2A 4R8UB 3G6VA 1RWWB 4ICLA 4PYAA 4B08A 1R0BG 2HEKA 3AQOA 4QW9A 2ZD1B 2K1RA 4O4GA 3BQ1A 2C2RA 1UVNA 2DGQA 3B78A 1T7PA 3UQSA 4DF4A 2GV1A 1D1UA 5JVHQ 3MMCB 2P9CA 2HAFA 2R7UA 2V34A 5E3AA 3TJ9A 5KTQA 3QSIA 3KDNA 4FXVA 3KLIB 1G1XA 2DD8S 2K8GA 1BMQB 4MAKA 1T05B 1EP4B 3ZTQA 2HQGA 3BPSP 2HZVA 4KT0C 4OFZA 3W2VB 1SH0A 1RUSA 1URNA 4EMDA 2G2ZA 1LWCA 4DL4A 1L5UA 2VQEJ 4PUOB 1KFDA 4C0OC 5B0BA 3CCWA 1HBNA 5IM0A 2FY8A 1TV6A 1JQGA 2HGNA 3ZTSA 2DH7A 1JMTA 2V68A 2XO6A 4DN9A 2RF2A 4JBCA 3GQCA 5IS2A 4LSLB 2CJXB 4ZN1A 4CWBA 4WZQA 4DR5J 3Q83A 5KFXA 3O3LA 1KVKA 4DL5A 5K5MA 2FD2A 4OI4A 4RBTA 3KKFA 1F3VA 2RUSA 2XULA 3EGZA 1VQ9S 1YKWA 1NKEA 3C66A 4WXOA 3KJVB 3D54A 1HNXJ 5CYQA 2DR7A 4LF1A 1YJ9S 3FZBA 3GFXA 2EFPA 4QIGA 2E9ZA 1RT2B 2IJFA 5J2MB 4KHPF 4C8ZA 1RAGB 1DY3A 2IM2A 3QT6A 1IJFB 1HR0J 1BWEA 3EVWA 1X9MA 3C2PA 4ZVSB 3KOAA 5KFQA 3E51A 3IR6B 2MMYA 2JEJA 2WZ1A 2MB0B 4M5KA 4AL6A 3NCQA 1Z1ZA 3Q2SC 2VFVA 3V6DA 2RHSB 3LO3A 4BC9A 3TUJC 2GJFA 5CXTA 2MJNA 2DHHA 1XMOJ 4EBDA 3T5JA 2CJBA 2V8DA 1S0NA 1FXDA 1U1OA 2BV3A 4DQSA 4LFBF 1DBDA 3D7SB 4C8MA 2OEKA 3J80Y 2RU9A 2V6AA 3EYZA 1TL7A 1U26A 2ZBCA 3MECB 2CDQA 2AX0A 3S8SA 1JLAB 3TYTA 3WIVA 2X1GA 3G8TA 1HNZF 3QO9A 4DV1F 1MMLA 3OLAA 2GC8A 3NBPA 2WOMA 2HS3A 3KJQB 3BS9A 5DGBA 3CJ3A 2RKIA 3FQLA 4A46A 3LWLA 3K2YA 3T9ZA 4NLYA 4DSJA 1WDDA 4WU2A 2KG0A 3MOZA 3VR1A 4CM0A 2C2OB 3IA0A 3LUYA 4F2RA 2ZHBA 1DTTA 2AGPA 2HBRB 1JNZB 2YWFA 1B7FA 2O3DA 2R42A 2B4UA 4URSA 3IXQA 1NLKL 4R0EA 3CCZA 4IOCQ 1QTNB 4N47A 1ZOTA 1Z4UA 2PE8A 3WX8A 1NM2A 3QMQA 1AXQA 2C3OA 2ATLA 2A6MA 4RNNA 1R27B 1JLFB 1KLMB 4F4ZA 1HLWA 1V3ZA 1Q5VA 4PXDA 2APOA 5D0EA 1IKWA 1FTCA 2GVDB 2GX8A 2R8GA 1YI2S 3MM7A 4DPWA 3MPUB 3MM6A 1UEUA 4E0DA 1EZZB 4DFPA 4KAIA 5H9EK 4C8YA 1R0AB 3MXHP 1WKKA 4X4NA 1CJUA 5GADI 4C8NA 4X65J 2NPIA 4J9NA 4LF6J 1TFWA 3T5KA 3A8EA 3U1MA 5A8KB 1KS2A 2XGPA 2DRAA 2VC0A 2BANB 4ECVA 5KG7A 1UZHA 1OSDA 2DR8A 4AT1B 3FCVA 1N5SA 5LT5A 1ZM4A 3POTB 5E2QA 1BLUA 3CEDA 4ZJQA 2OGUA 2KM8B 5DQGA 1S72S 1NBEB 1NZ8A 1BWVA 3RBEA 1WC3A 2EW9A 1UL3A 1SJ1A 2LXUA 1TL4A 4AQYF 4WK3A 4M5MA 4P52A 2E1MC 1Y4ZB 3M2RA 3GILA 2A0FB 1MWYA 3N0VA 4ZLPA 1N33J 3NGUA 4WKYA 3UNYA 1NJXA 2R8KA 2Q3PA 4ECWA 1X4AA 5HK4A 1CS4B 2DXDA 4ED0A 1O0PA 1UFKA 1SQGA 3QZ7A 3CT9A 2UVWA 4LF9J 4JI5F 4OYMA 2C22A 3L7OA 4NLWA 5HLFA 1GNKA 1WG4A 3MD1A 3UN5A 4WCEQ 1NHKL 2G9OA 3FNNA 4OYZA 2BR0A 4NCAA 3IM8A 5CAAA 2XMAA 2XYPB 1NSQA 3HHKA 6FD1A 1VQMS 2KYXA 2FVSA 4CZCA 3CC2S 1RHUB 1N5QA 4RUCA 2FC9A 1C1CA 1UPMB 4O3NA 1HNWF 2ASYA 3TX8A 3TAMB 4Q8FA 4ZVRB 1E6YB 4Y2IA 2DNGA 1V5IB 4KTQA 2E5IA 1SJ4P 1VRTB 3C16B 3MR2A 4YR0A 1OSCA 5LSRA 3G9CA 1YRXA 3M6WA 4M5LA 2RQ4A 1XJWB 1RTZA 4ZVOB 4ECSA 3QZ8A 1RT6A 1SIZA 3ISZA 3NP5A 5K8MA 4CIOA 2XEXA 3SV3A 2QGFB 2V2KA 1Q79A 2JDJA 2AU0A 4EFAC 4EEYA 3M7VA 1T02A 4JYAJ 4CO3A 3TEGA 4P71A 1XN9A 2GGPA 2ZOGA 2ZOFA 4DPXA 2V0NA 2XI2A 3VV2B 2BM0A 1E6VB 3AY0A 2GCFA 1CULB 2E7WA 3QT7A 4OYPA 4O0IA 1WG5A 3HJVA 2VD3A 1T9TA 1HBUA 4K4UA 5BJRA 1T9WA 2E5GA 2NSBA 3U1LA 2FZKB 2I38A 3B6BA 1DQ8A 4QU6A 1PG5B 2PI5A 1ITPA 1HARA 4V19J 3N28A 2AJ0A 1RT1B 3KLEA 5KFUA 2NLWA 3LGMA 4DX7A 4JI1F 1UJ4A 1S76D 1RAJA 3CD7A 1TUGB 3OUYB 1VMBA 3JSMB 2ZVSA 1RXOB 2UUCF 2ZWOA 2GMJA 4HVZA 2HRYA 3MDFA 4Q2MA 3CD6S 2RD5C 2DRDA 4F7VA 2WSEC 2V4JA 3OTBA 3ENVA 4OI1A 1UVMA 4DR2F 1FJGJ 3UCZP 2FLNA 3H59A 2QEXS 2WHOA 3M05A 2GHVC 1RA6A 3A3NB 4NPOA 1TP7A 2GO9A 5F8HA 5LMNF 5HP1B 3CPWR 3V81B 3IFEA 2F9DA 2MLZA 4L6V3 2VL1A 2GVZA 3DLGA 1U1RA 2DH8A 2IDEA 2RDJA 4DV2J 3UE2A 1FFGB 3GWCA 4WFNQ 5MLCV 1ZZNA 1Y0HA 4NE9C 2XHWA 2WONA 2QLBB 4IUFA 1EETB 1ZAWA 4E2FB 4UZCA 4FP9A 4ED2A 3MAHA 4KH0B 3IS9B 4PZVA 5BYRA 4DLEA 2JVOA 3DYAB 2NPFA 2RILA 4Q5VA 5L1JA 4P73A 1ZA1B 1FKPB 2Q6CA 2JSXA 2ASDA 4ZVEA 4EI2A 1LEOA 4ECRA 2CNKB 3MPYA 4X4TA 5GMKa 1S59A 3QGPA 4XK8C 1KN6A 4UTGA 2AJ4A 4ID8A 2YQ0A 5EWFA 4RBVA 1CJKA 2FHJD 3CMES 3PVXA 2RIJA 3M8QA 2ALZA 2CG4A 4AL7A 1TR0A 3EGWB 2UUBF 4PXCA 4ED7A 4ICLB 2H65B 1VI7A 4GKJF 3PW5A 5ETOA 2K1RB 4K5RA 2CUYA 1XNQF 5L9NA 2ASJA 1FNXH 3SSRA 3CVKA 5KFHA 1UCNA 5F8JA 1HYSA 3HHLA 1JJ2R 2BQRA 3NY0A 3SCJE 2W01A 3CF5Q 1WEXA 1FK9B 1N56A 4ELTA 1H7WA 3GJRB 4ECZA 3QWPA 1T11A 2Y9HA 1HD0A 2H5JB 1FE0A 1RHMB 5AJ3J 1LWCB 2KKHA 5DDRC 4FVCA 4TYBA 3MMBA 3US5A 3GIMA 1RAAB 5IM0B 1HBNB 2LMIA 3CCQS 2PFFB 4AD6A 2ABYA 3EE3A 3MCNA 4DV3F 2MZ1A 1LKZA 2RF2B 5LOQA 3QATA 4Y34A 2OPQB 1N48A 2YKNA 4DX5A 2RSQA 2EPIA 3SSSA 2O66A 4NYPA 1RP5A 5J2NA 3GFZA 3IMQJ 1MROB 2FDNA 2CQCA 4UOGA 1PIEA 1NHUA 3FVYA 4PCQA 5CHCB 4C97A 2UVUA 1QAXA 2YWWA 1RLDA 4QIWD 5CYQB 4UY8T 4NXMF 2BABA 2N4CA 1Q4RA 5CYMA 4RUHA 2MKSA 1H2TZ 3UD3P 1Q8KA 4HI2A 5DG8A 5J1PA 1BQNA 2BE2B 2FIUA 1P27B 1ZAVA 4QCLA 4WPAA 3OVBA 1DTQA 4HHJA 3FQKA 1WC1A 4DSFA 1IBMF 3EX7B 1RTIA 3JS9A 4MKYA 1FJEB 2NS1B 3M8RA 3V6DB 2PC6A 4TY8A 1U48A 1VC0A 3HK2A 4DQQA 2FVRA 1OPZA 1NDCA 3DXBA 3DRRB 2B9YA 3CULA 1TVRB 1SB6A 1VQ4S 1UFWA 4K8RA 3A3OB 5JMNA 3LP1B 3BN7A 3EPIA 2IYIA 4HEA9 2I5JA 4K4WA 3S7RA 2PDAA 1ZBTA 3D9BA 4RX6A 3G6YA 1TL7B 3T5HA 1LW2B 2FY1A 3OFGA 3ZZPA 1IWGA 1U45A 3MEGA 2ZZTA 1FF2A 2B4OA 2IC3B 1NJWA 1XMBA 3ZZOA 2D9OA 3EVMA 5AE3A 4YHHJ 3QO9B 4LJMA 1H2UX 1TELA 3BBFA 4TLRA 4B17A 1NK4A 3NBPB 2WOMB 4ECTA 3M8PA 3OLBA 2D9PA 4EUVA 4OZNA 2ZITA 2RKIB 3W7BA 3BSNA 2C2ZB 1FX4A 1S1UA 3ILOA 2XSJA 2YNHA 4FNHA 3V4IA 1S12A 3WZ0A 3RB0A 1KNZA 4QWCA 1MNEA 3OV7A 2CJAA 4KQZA 3D67A 3UCGA 2U2FA 2C2DA 4P7TA 1DTTB 5IFMA 4YN3B 5KFWA 4IG0B 4ZPWR 2AYEA 4PPZA 2V2ZA 4DN0A 4YB5A 3KK2B 1UWBA 3T41A 3PDNA 4X4RA 3RTVA 4L75A 4U9RA 1FXRA 5GAHU 2XG8A 4XPCA 3DRPA 1C2PA 4E98A 5A0YB 3MR6A 4Y28C 5I4MA 1CC8A 3GCXP 4OZ1A 4DI6A 4NCGA 2BACA 1HKAA 3X3UA 1L3TA 2G2YA 1VQKS 2JFKA 5FLXY 2YPYA 3G8QA 2UVRA 3HD1A 3MM7B 3U27A 5A6PA 2XZDB 3MM6B 3Q22A 4RZRA 4NLXA 1RWXB 2E44A 4H4OA 2V9KA 1CJUB 3F56A 3T1HF 4DV7J 2I0XA 2XMUA 2C42A 1C0UA 4IR9A 3WX4A 5DDQC 4OI3A 4QW8A 3AJDA 4ZP6A 4HKQA 5DZ6A 4USKA 4LF7J 3HM9A 5J1EB 1S4FA 4KGMA 1V6HA 1KQFB 4ZCLA 1NPKA 2C2KB 4WBFA 3I55S 4M5JA 1NK9A 3Q8VA 2DRBA 4PRFA 2CJ9A 4NLUA 1YJTA 2LYVA 4MIBA 5HQLA 2CQHA 4W90B 4DG1A 4ZPBA 4J90A 1AB8A 4DR4J 1HIYA 3HKZD 5DETA 3M2RB 1FO1A 4QZVB 2FZGB 3AOBA 1X9WA 3AODA 4OZJA 3H2VE 4CO4A 3SZ2A 3NNAA 1C1BB 2XHCA 4F8RA 1FJ7A 3PKYA 2MQMA 4TLQA 1Q53A 4JI2F 2ZBQA 4F4AA 3THTA 2F1FA 2RJZA 1VDHA 1H98A 4ED1A 1R8PA 2M52A 4IH5A 4MTPA 2LEAA 2K2PA 4X4UA 2F63A 4ZVTB 1OS5A 2QFIA 4BCAA 4ES1A 1Q8LA 1HFEL 3A3PB 3HHEA 1HHSA 5E5NA 2B4VA 4OYOA 1RYSA 1RT3A 2HBZB 1C1CB 2N7CA 2DXFA 2DCLA 3EVOA 4A8QA 2DR5A 3OT9A 1RABB 1KKHA 1XMQJ 2FPHX 1K44A 3I4PA 2XTJP 2YH1A 5E0OA 2VU5A 1WACA 1HNVA 3V2UC 1CQMA 3UD4P 4DS4A 2QMWA 2UUAJ 3MOJB 1S1TB 3GZ7A 1Q95G 2K7JA 1SC3B 3BH6B 3SSQA 1ZM9A 2R4FA 3FCWA 5AXMA 4CH1A 1U6BA 1RT6B 4DQRA 2XM3A 1UPPA 4F0HA 5CABA 1NDPA 2VQFJ 1RLCL 3J81j 1EIYB 2V69A 4Z2XA 2CVIA 4X2BA 4P75A 5HMWA 2LXIA 3QIPA 3T1YJ 2GGPB 4HHHA 4KGZB 4HACB 1JLQA 2BDPA 1UKUA 1ZPWX 1IKXA 2HQCA 1VJWA 1HBUB 2VOPA 2DCUB 1OIAA 1ZZFA 1X4BA 4NMXA 1RCOB 4G1QA 5KG6A 2XSFA 1DQAA 2RRBA 5CZXA 3KLEB 5IV3A 3EXCX 4FS2A 3NS7B 1R7IA 3EZ5A 5KFTA 4AL5A 1S1VB 5LJ3Y 2DIUA 1IR1A 3R1HA 4EBCA 3IO1A 3THPA 3SYZA 2HZAA 2KZZA 4FPRA 1TMMA 2IM1A 3FZ2A 5K8OA 2NXEA 2HK3A 2V4JB 1JX4A 5U47A 4ID5B 1RE1B 3RB3A 4I2QA 4TN2A 5A76A 1IUJA 1DARA 1P1LA 2DXEA 3QWUA 5L39A 4X84A 4OZ0A 3MGJA 4WKRA 1SC1B 3R5BA 4OJ1A 4KO0A 2F8EX 3DCAA 3DLGB 2OMOA 3HSGA 3D68A 4B3SF 2MDAA 1T95A 4GO7X 1HBMA 4OX6A 3ZTRA 1DHMA 2MKYA 1RAOA 1DURA 1TZ0A 2WONB 3MPWA 1Q82T 2RH3A 3H8YA 3UFCX 3BO3A 3UVJA 3MCSA 1WC5A 2HVEA 2XWYA 1UW4A 2H4YB 4C98A 2LECA 2ROGA 1H3DA 2JRSA 2R7SA 3IC1A 3QYYA 5B08A 2RNEA 4IOBA 4KHPJ 2L48A 1YHQS 1VIXA 2BEFA 1R8AA 4J5OA 2AGOA 4DS5A 1FD2A 4RW9B 2YKMA 4ZIVA 1WOPA 2NXCA 1D8ZA 3ZZZA 5F9LA 1XQIA 2B43A 4UOHA 3PW0A 3J7YU 3TWZA 2M88A 4ZVHA 4URQU 2EFGA 2OPRA 4J9QA 4MK7A 5C2GA 2HNZB 4DV4J 1OYEA 3D1HA 2YKQA 1NU4A 3QIDA 2AP6A 4N7TA 2DPJA 4DL2A 4ZCIA 2KFYA 3WBZA 2W2NP 3EDRB 1U47A 3NNCA 4ED8A 1RZMA 1KOHA 2LQ8A 4BDPA 3I9V9 3C19A 2YX7A 3I0SA 5LM7E 2KHDA 3HKWA 3FSIA 1G7CB 3HHLB 4P72A 4EYHB 4X65F 4K4SA 4LFBJ 4NL5A 4ECXA 2KDOA 2VH7A 4I56A 3DRSB 2BZ2A 1B70B 1I94J 2G4BA 1GMVA 1S6QA 5F8MA 1G2EA 2IJNA 1HHTP 3GYGA 5HL7Q 3P5TL 3AT1B 2PA8D 3G87A 2EKNA 2XGQA 4GC7A 3BDEA 3OR1A 3PJ9A 1HNZJ 1RT5A 3CIMA 3BKFA 5ETKA 2E7XA 4M8LA 4ZLLA 2QL7B 3TQ1A 4FF4A 1Y3JA 1QLNA 2DVIA 2OIHA 4IO1A 2YKNB 4GVLA 2R3VA 2XMMA 2XMVA 3DOLB 2K3IA 2FJVA 4K4XA 2GMLA 2XQCA 5KFPA 2OEJA 5KG5A 4J7CA 2QX0A 3FUYA 2QN6B 4LBHA 3I32A 3OTDA 2OO4A 2J0XA 1KFSA 4ZPCA 4IG3B 3GJQB 2DY9A 4B3MF 1FI4A 3WC0A 1S9FA 4ZJOA 3J7A1 4DWIA 1YZ7A 3S1TA 4CLTA 5C24B 5GADU 4Q45A 2FQQB 3FC9A 4OIXA 3I87A 4CYUB 1O51A 5F8NA 2JL9A 4A8FA 1RHJB 2LQ5A 1AW0A 2GAHC 4UY85 1VRUA 2DIVA 1BQNB 3R7SB 3CCMS 1VJQA 4L3NA 2MQNA 1VS3A 4FBUA 1DTQB 3DOKB 2HHPA 2HGMA 1U1QA 3L3CA 3M6XA 4CLPA 3C15A 3GPAA 3BKUA 1RTIB 4KFBA 3UR3C 3QGGA 4HR2A 3TVZA 3IP0A 1XC9A 3ISND 4NYZA 4PAAA 5G0RA 3CIZA 4DV6F 5EGYA 4TY8B 4DQPA 4PQUB 1YK9A 2UXDF 4CO1A 3M32A 4S0MA 3CCVS 1GX5A 3D6FB 3K17A 4USJC 4DL0C 2GFFA 2R7RA 1KC8T 1V9OA 2ZNZA 2AF6A 1K8AT 5JUMA 3D6HB 3PYDA 3N5BA 3MEDA 2VPYB 3E01B 1V3RA 5KFMA 3MEGB 4W98A 1Q7YT 1DFDA 3TA1A 2XZTB 1FRHA 3A1YG 4DOZA 1ICEB 2HLUA 4WFBQ 5CYJA 2QSWA 1TL3B 1RK8A 2QL9B 2ROPA 4IDKA 1QSSA 1RAEB 3W1YC 1Y5LB 3M8PB 3FBEA 3HHDA 1VBYA 3H4DA 3RAMA 3MD3A 1S1UB 2XSJB 2Y8YA 2VPWB 3CJ2A 3GTYX 3LANA 1RAIB 4PR6A 2I6WA 2RS2A 2W8KA 2J6TA 5DM7Q 1FFWB 1UWBB 3KUHA 4QR2A 4NXNF 3RRGA 1F60B 4MFBA 1WORA 3DRPB 3VZIA 4OLOA 2OUGA 3OL8A 3LOUA 2IHR1 3MFHA 2DKOB 2BJ1A 3BR8A 4WP3A 3OXLA 2X1BA 3QGHA 4WXWA 1S10A 3N6LA 2HVIA 2IRXA 3ETMA 4NCGB 2AEFA 3R6GB 4C6AA 3CJKB 5BYSA 4UQGA 3R97A 1T05A 2H1YA 1EP4A 1Q8BA 1PAEX 3LPEA 2XLJA 2HLTA 4K4ZA 2OH2A 2E5JA 1T8EA 3W2VA 2F3JA 3MCMA 1HNWJ 4DL6A 4TU8A 5EX3A 4H4OB 2XZWA 4PUOA 1C0UB 2I8EA 4LR8A 3FDSA 3W61A 3H90A 3NWGA 4QJVA 2N7YA 2JEFA 3VAKA 3CDAA 5J2PA 2H5EA 3MEEA 4CLUA 1SJRA 3UPFA 4DL3A 1YSJA 3M8ZA 4DV2F 2B8PA 1RB0A 1ZA2B 4XO0A 4RW7B 1TKTB 3P5BP 2N4DA 4YEAA 2V8VA 4RW8B 1QY7A 3MM8B 4C48A 4Y2CA 3GIJA 4DJBA 1SC4B 3VHQA 2JEGA 3KJVA 1PYOB 3W3SA 3DHWC 4KIAA 3MZIA 3BGOP 1KQGB 2BJ7A 4DUYF 1RT2A 5J2MA 2AJ1A 3J81U 3LWMA 3NGRA 2W25A 2VF3A 3BN4A 1KD1T 3N5FA 1NCLA 5KG0A 3R1LA 4D3GA 2VBXA 2HHHF 4A8OA 5KFFA 2ZUAA 2VDIA 1Y5IB 1YGYA 3M8SA 4JI1J 1M90T 4F02A 2ILZA 1QE1A 3UDVA 1JB0C 5H9FJ 2HWIA 4M5DA 2P6SA 2UUCJ 4A8MP 2HHXA 2M2BA 3GJSB 1XERA 1XBWA 1M5OC 2YX4A 2ZWPA 2MQOA 1TU0B 3OTOJ 1U0SA 1CEZA 1UETA 1H2VZ 5DO2A 4KJIA 3TW0A 5F0UA 3FMWA 2E9TA 2HFOA 1IQTA 5CD4A 9ATCB 1YTYA 1PC4A 2HW3A 3LW5C 2XNQA 3D5MA 3RBZA 5D4NA 2P6TA 1P9QC 4DQIA 2HG4A 2MY8A 4CH7A 3O8WA 3CW2C 1HNVB 4MMOA 3KTQA 2CPIA 4U7UK 3OHAA 2C1EB 1AA1B 3MMAA 2C3UA 2FLOA 3OJUA 2J8AA 1S1XB 1EB0A 2HHUA 4DU7A 4OV1A 3DGPB 3VCDA 2MQLA 3GIKA 1T9YA 1M5HA 4B3TF 1S6UA 1XWLA 4I6YA 3SCKE 4DL7A 2CRLA 4FF3A 1N5TA 4IFYA 1XEZA 1VK3A 1GX6A 3QIPB 4FYYB 2MKHA 2NXUA 4U6PA 4WIQA 1G4CA 4I67A 2CJKA 5KOXA 4C0BA 2JVRA 2QRRA 4JI7F 2NZ4A 1X4DA 3TZWA 3GLJA 2E1CA 2CKWA 2UUBJ 2CQBA 3BGRA 1RTHB 2E5HA 2YNIB 1EJ7L 4GKJJ 3L4BC 3BR9A 2VJVA 1KHWA 2GAGC 5IC4B 2XNRA 1XNQJ 1R0AA 5AE2A 2PMWA 2DNMA 4J9MA 2CNLB 2IMOA 3GR1A 5HAOA 1FFSB 3FJ2A 3JAMY 3BO2A 3RAQA 4KH1B 1LWFA 2HHVA 2P9EA 2D74B 4BS2A 4DPOA 1R31A 5C2CA 5KFDA 2Z8QA 4F50A 3DI6B 4KPYA 4ZVGA 1HWUA 4I64A 4F3OA 1Y00A 4I2QB 1MLAA 5KFVA 1B0TA 5FLXU 4TYAA 3L09A 4DV5J 4C0HA 1WKLA 4DV3J 2CQGA 1LWEA 2GJIA 4DFKA 2NR0A 1A6LA 3M30A 4ELUA 1AZSB 1JXLA 2K06A 1CJTA 2XLKA 2ZH9A 2BW7A 3DU6A 5F41A 4YHHF 1HBOA 2RQKA 1NH7A 1M1HA 3RBDA 1HBMB 4LF4F 2NCKL 3FSXA 2DGOA 2G1DA 3VQSA 1NK7A 4EGLA 3UVJB 2ZJQQ 5EUHA 4NXMJ 2HBQB 2RMLA 4USMA 1SL0A 1APSA 4JV5F 3A12A 4K2JA 3QSYB 5HATA 3PIOQ 3WDOA 3SCLE 2AT1B 5L9XA 4U96A 3MFIA 4TU7A 1P8GA 2CPXA 4WTYA 1PKUA 1YJNS 1H72C 2ATCB 5EX0A 2JX2A 2YKMB 3OTCA 4G6VB 3TX0A 3UR0A 2FJEB 3AXMA 2HS4A 2HS0A 3ITHA 4NA3A 3KJNB 1DLOB 3PJWA 2HFSA 4U7UD 3MAAA 3E2EA 2BJ9A 1MSWD 1OYDA 1T0TV 2NUHA 5KG3A 1U0HA 3M8YA 4MT1A 3A13A 2FVPA 5I42A 3ZZTA 4I1TA 2M5YA 3UI3A 5AXNA 1VBZA 1NKBA 2F4VF 3FEYB 4N41A 1N0UA 4X4QA 1VQYA 3FSYA 3U7JA 2ROEA 4ZCMA 1MN9A 2E5LF 4CLFA 2CNOB 4JP8A 1S6QB 4C2MA 2YNGA 2LLZA 1MN7A 2OEMA 2NYIA 4L73A 3OR1B 8ATCB 2OD6A 5KG4A 4M5GA 1RT5B 2IIHA 8RUCA 2B9XA 4ZPVR 1FKOA 1FKAF 3EUNA 3Q23A 3B8HA 3RUBL 3NS5A 3PW2A 4YQWA 3FCHA 4O3PA 1SKSA 3AJ1A 2YKAA 5C7PA 1CULA 1EHWA 3L9ZA 4Y00A 3DDIA 4K4YA 3W2WA 2FUG9 4C7QA 2Z30B 3L95X 2YH0A 4PG4A 1Q0NA 2W2OP 4CTAB 4DCPB 5GMDA 5E3QA 2LP4A 2MYFA 3Q8QB 5SUHA 4LQ3A 2CFXA 3W8PA 1RT1A 1B99A 1YJUA 2OPPA 3EXYA 4PEOA 3A4TA 2DGSA 1W7WA 5HJXA 1LNQA 1WELA 5B0FA 4P2FA 2HQFA 1WWHA 1FT8A 1S6PA 3HVWA 2IAJA 2JH3A 1R43A 4ED5A 1VHIA 2J9CA 3C15B 4ZA1A 1QUPA 3HZGA 2OD4A 1R0CB 2UP1A 1VYAA 3EZOA 3T1HJ 1RAFB 5G0RB 3QNWB 1U2CA 3QPIA 2JEIA 4WE1A 2BJ3A 3RRHA 1IM4A 3PYFA 3UDCA 1G3OA 1DRZA 3M32B 3HFZB 4YB7A 2P5VA 1JLBB 2AYBA 4ZJLA 3H0PA 2CZ9A 4FVMA 4RKUC 4X4VA 2M70A 2BA9A 1NH8A 1VQSA 1WD6A 4P2XA 2DEJA 2R7VA 2UUAF 2HNDA 2ZKUA 1FXLA 3MEKA 1YJVA 2PT0A 4CLKA 5KFZA 1QAYA 3IS9A 3GCWP 4QOTA 3TZZA 1H38A 1SC6A 5IOLA 3IR7B 4ZLNA 4HI1A 3VAJA 4NLDA 4JV1A 2F40A 5C5JA 3M2UA 1N36F 1MMDA 2FJBB 5THWA 3ZZUA 2ZJRQ 3O44A 5KFNA 3OJSA 1NPRA 3CJ0A 4YR3A 3QAEA 4IRDA 2X3GA 3ZZRA 3R2DJ 2JLFA 5K20B 5L46A 3S01A 5KT5A 4IOAQ 1NZAA 4NZ7A 4MK8A 4OHWA 3C8YA 2W24A 2EG2A 4MFBB 3CSKA 2UZAA 4DR3J 4WZMA 4Y2MA 3LTOA 1N32J 1FDDA 4ETZA 2XYGB 3EWGA 3UNGC 1BHNA 2KJWA 5HVHA 1OY9A 2PIIA 2DNRA 5IQQA 3JB9k 1HI1A 4QIEA 1FK9A 1S7IA 2DNLA 1Z2ZA 2UXCF 4DCOB 3P4UB 2LKZA 1FEHA 5DS7A 2B3TB 4KGKA 1URRA 4H4KA 1UA0A 3MUTP 2G13A 3RW6A 2GIQA 1PBUA 4EWTA 2OI2A 3PY8A 2B5JA 3JSBA 8AT1B 2DNYA 3MWBA 4ANEA 2C28A 3OXFA 4LMZA 1A0OB 1CVJA 1Y10A 3OL6A 5J2PB 1IN0A 3MEEB 2OPQA 3UCUP 1NKCA 4FYVB 1U24A 2BVZA 1MROA 5KFRA 1X4CA 3I9ZA 3VGVA 2DGTA 2QO3A 1YX2A 3FK4A 2NYHA 4WU3A 4GMKA 4IQMA 1F3FA 2W4DA 4WFAQ 3WC2A 5H1SV 1YRTA 3JQKA 3MI7X 1SH3A 3LAMA 1T9XA 3IR5B 1NJIT 4K7QA 3BZQA 2F7VA 1JWWA 3SQGA 1WC4A 3N6NA 5B0AA 3R5JB 2V63A 4QWDA 2H9ZA 1Y11A 2HMIA 1YG0A 1FWPA 2AZ3A 2BE2A 4J9OA 4DPYA 1UEKA 2KO1A 2EFOA 3PR5B 2R8IA 1QSLA 4OZ2A 4ZP7A 3GP9A 2JC1A 3CJTA 2YWEA 1YRUA 3QFHA 5ITHA 4NLPA 4DV4F 2GMHA 1S77D 2ZUGA 1QE1B 2P2CB 3NNHA 4M5DB 2IRUA 2NZCA 3SIPB 2D69A 3AAWB 2V8GA 4DXLA 3NS6A 2VONA 1QD1A 3DRRA 4V1Ak 3J7YI 2ZH3A 1GTHA 4M94A 1TUWA 4IFVA 1TVRA 5HMYA 1VQOS 1WF1A 1D9AA 3LP1A 1RACB 2B7CB 2V2VA 4O23A 4LBIA 2G0CA 1I94F 4HL9A 1RI7A 1LW2A 2EK1A 5GAEU 3SQOP 2IC3A 2Y0SD 2XYHB 2BJDA 3JSRA 4UUWA 4B3SJ 4ZVFA 2CVEA 3FBFA 4OI2A 2D7SA 1QDUB 3VVUA 3Q0AA 4O3QA 4LRBA 4ED4A 1B7YB 3MMAB 2KM8C 3CTRA 2V50A 5A8RA 2J5AA 3TUZC 2QL5B 1N5YA 4O4RA 1Q16B 5FIIA 2VBYA 3D66A 1NSAA 2ZH4A 5D78A 1NK8A 4IG0A 3F41A 2HFUA 3KK2A 3QRQA 2XB2D 2AW0A 1EKSA 1VK8A 4IRCA 1YVFA 2KB2A 4IFYB 3NAIA 3BO4A 3IWNC 3H5YA 2SXLA 4CLSA 3K0JA 2J9DA 2XS2A 5A0YA 1LFPA 2AJ2A 2U1AA 3T9NA 4NRTA 1U1MA 4YOEA 2EVZA 2VA2A 3DFEA 4M5NA 3K59A 3N6MA 3CJQA 4NA1A 5B7WA 2ZZNA 5D4OA 3BGRB 1L3KA 5B0DA 2RVJA 1YJWS 3SFGA 3MMJA 1UEVA 2D3OR 1F6TA 2BM1A 3W9HA 3GV7B 2R2RA 2DO0A 2LQJA 1TUVA 5HQMA 1JKHA 1LWFB 1PJ7A 2B9EA 4YB1P 1LV5A 3N79A 3HCXA 3HMJG 5DRKA 5J1EA 2BRLA 1FD8A 2HKEA 3TUPA 3KXDA 2ZDPA 3IGVA 4I2PA 1S7HA 4H4MB 1ZETA 1AUDA 3R5DA 1GEHA 4RNOA 4NEZA 3O5TB 1LWEB 4CLYA 3BBBA 3MAQA 2XY5A 3PXGa 3M30B 2X3DA 4FF2A 2O5DA 1CJTB 1HBOB 5D0HA 2VHGA 3OBIA 2DHSA 4DR7J 2HQIA 3G71S 2B6AA 4L76A 2M9KA 4N5SA 2UVVA 2VDHA 1IBCB 4X66F 2J9EA 4FYXB 4MKBA 1FRKA 4XDDA 1C1BA 2OP5A 1N5VA 4B3MJ 2BJ8A 3VALA 2WRMA 2YQ1A 1VBXA 4UQTA 2CPYA 1SI9A 1VLOA 1KR4A 4I4BA 5E7OB 5K8PA 1RTJB 2R8HA 3TO8A 4ES3A 1C4CA 5F0WA 1UJ6A 1VHFA 4Y0FA 4P9SA 5F3ZA 3QLHA 1WC0A 3ITHB 2W2MP 3H20A 1O6XA 3MAAB 4KPCA 1WI6A 3MTKA 4FKYA 2FJDB 4DV6J 1X4GA 3CNQP 2E1RA 1RWKB 3ADAC 2CDRB 3HI9A 2ILYA 3TARA 1U0HB 2B8QA 2UXDJ 4ECQA 3GSDA 2AEJA 5I42B 3FRYA 2UV8A 1T3NA 2OAUA 3EPGA 2IRYA 3H7HB 3WHIA 3FBCA 1IBKJ 1S6OA 4DR6F 1SJ3P 1KLNA 1JLCB 3CGIA 3H5XA 1RAHB 1TKZA 1BC6A 2WVDA 2V8HA 1S1TA 4JOUA 4OHYA 4ECYA 2CYYA 2YNGB 5DLGA 2IDLA 4DBQA 5BR8F 3TUIC 2MGZA 4ZVQB 3IBFB 2CQPA 4ZPTR 3H2UB 4ANCA 4YR2A 4GRSA 3C14A 1N4LA 1FKOB 4DSIA 1ZTWA 3K5NA 2HVDA 3D28A 2KU7A 2VOOA 4HACA 2IY5B 2FYXA 2I1RA 2ACYA 3FGVA 1U2RA 1QM9A 1SBRA 4OHVA 4J9SA 1M5VC 3BSCA 5CH7B 3W2WB 1KQSR 4MIAA 1WOSA 2LVWA 4NXNJ 3O6QA 1D9DA 4YB6A 4NI2B 4YP3A 3R7NB 3W9IA 3OR2B 2PA3A 1GXLA 1RWNB 1BQMB 3K89A 1F9HA 3BYRA 4P2MA 2OPPB 4ZP9A 2KL8A 4DUZF 4RW4B 1Q86T 1S1VA 1HWKA 1I6JA 3DGVA 4QPTA 5EDWA 4X4PA 1S6PB 1UAWA 2IAJB 3TA2A 2HQDA 4N56A 3OTOF 3W62A 3PIPQ 3QQCD 5ETLA 4ID5A 3CD5A 5LXYA 4A8KA 4U95A 2ZOMA 4Z7YA 1MWQA 3GE9A 3NGSA 5HMZA 4WE1B 4KGVB 2OPSA 3KMSA 1QSYA 3IN5A 1F2HA 2DTJA 1FJCA 2ZJPQ 1X5TA 2R8JA 3R7BB 2AV5A 1TFYA 1RWPB 4G3IA 3OFFA 4LR7A 1JJ4A 1TL1A 2DHXA 3JAMU 3DC2A 1PBAA 4KRWA 3H4BA 3OL9A 4YDXA 4EU0A 1VGYA 1NMEB 2MSTA 1F5CA 4L74A 5B09A 2HNDB 2VPXB 3KNGA 2G1HA 3M1VB 1SXLA 4ZK7M 2VZ9A 1EAYC 4TNOA 3P8BB 2AHOB 2QC3A 4LFCF 2OSQA 1REVB 3PZPA 1DAXA 3IWLA 3CO9A 4R0JA 1LK7A 2M3DA 5DJBA 2VBWA 1XIQA 4DUYJ 3M2UB 4NX9A 1Z2LA 3GU0A 4RW9A 3H40A 3LP2B 4DU8A 2ZNYA 2X1FA 4K5SA 2MQQA 3I0RA 3TEHB 3Q8RB 4NLGA 2ZZMA 2HHHJ 3F0NA 1SL1A 1Y7PA 4RO0A 4F67A 1IKYB 2HNZA 3JTPA 1NDLA 2KVIA 2KRBA 3KG1A 3W5XA 2DGXA 4DPTA 1RA7A 1FE4A 3TRGA 4FBTA 1GMWA 1R6YA 3HZEA 1RISA 3EZUA 4PABA 4IRKA 4BLGA 2CPDA 5JVGQ 3TP2A 3BPDA 4OI6A 3DRSA 5KT7A 4OZ5A 3UD5A 2Y1LB 2JFDA 4CO0A 1SUQB 4LF2A 3W8GA 2HVHA 2M8DB 2AYMA 4ILMA 2ZH1A 2B5JB 4RUAA 4DUTA 3GSIA 3AB2B 4DV5F 4FNIA 3HVAA 3PW4A 2BYCA 2FHMA 5HI7A 3S6EA 1VQ6S 2D41A 4I7FB 3BH7B 3DOLA 3HHLD 4GO5X 4EYIB 3TANA 5RUBA 3PG9A 3D1QA 4C9DA 2Z4PA 2YXLA 4EBEA 4B3TJ 4ILLA 1YJRA 2M0GB 3UDLA 4LRDA 4F4KA 1R89A 2MLYA 3BGUA 4IG3A 3HX9A 3TVYA 1F9FA 2NSCA 3GMGA 2RRNA 3QRPA 4ZKAA 3NGTA 3SQGB 1I51B 4JI7J 5C24A 4OYAA 4CYUA 3GV8B 1SQFA 3CDUA 2MEWA 3AD7C 4BBYA 2HMIB 4U7CA 5C25A 2KH9A 2OKQA 4FXDA 2CZ4A 5D3GB 5KFKA 1UVLA 4DZDA 2LXFA 1GK8A 2KVQE 3DOKA 4DV0F 2FVQA 2PD1A 4PG8A 2DB1A 4DZ6A 1W2IA 2B56A 4F4YA 3IG1B 5JXSA 3KLFA 4Q7AA 2G0JA 2P9GA 4PQUA 2ZHOA 3NRBA 1J5OB 5T41A 3O2IA 2AQ4A 1MW7A 2VG6A 2Y0BB 1HQEB 3NOGA 3P49B 4N77A 1WHYA 1IQZA 1PILA 3HPOA 4G1IA 5L38A 2DHGA 4IFVB 2D1CA 3DDKA 1S5ZA 1W26A 2DGUA 3GFYA 4KE5A 1FRMA 4AUKA 4NLQA 2ZFHA 4DX8H 1TK8A 1NHVA 4BHQA 4CP5A 3NWRA 5MAOA 3E01A 1IR0A 3ZFVA 2EXUA 2HK2A 3RR8A 2WVFA 3BJYA 4NA2A 1TL3A 1RBAA 1Q1KA 5HVGA 2MPUA 4LF4J 2XBPA 3K57A 1KEKA 1EQMA 1BD6A 4PKDB 5KFBA 2LEPA 2DR6A 2VA3A 1KVIA 2HYIB 2FC8A 1T03A 4I6WA 5A8RB 3GJTB 4Y6IA 1IXKA 1RT4A 4HDHA 1N5YB 2DHAA 4JV5J 1NXIA 4O3OA 2JC0A 3R8YA 4PWDA 1WC6A 2Y8WA 2LCWA 1LWXA 2W9BA 2MXYA 3PRVA 3NGKA 4LF8J 4Q2LA 2QMXA 2M4MA 3NL0A 5FDLB 3D4JA 2KT2A 5IQ6A 3I5AA 1N8RT 1NNDA 3A8KA 3CJKA 5C42A 2XLIA 4EO6A 1ROFA 1FWLA 2FLPA 4QWEA 5ETQA 1RT7A 3DNCA 3JQJA 2C2NA 5EWEA 3CJ4A 3FRZA 4CLZA 2ZDOA 1VQPS 1K1QA 1YZ6A 2RQCA 4K0KJ 1S9EB 4MKAA 1YLXA 1WHXA 3MUVP 3R6LB 2Z2YB 4U67Q 1SV5A 2XC9A 2F4VJ 1JKHB 4FF1A 1UMJA 4CM2A 4J9LA 1QVFR 4L3KA 2R2UA 1NUEA 3T6JA 2CQ0A 2HNYB 5KFJA 3MM5B 2PFDA 1HI8A 2Q1LA 4J9RA 2E5LJ 3ICLA 1ZH5A 2GIFA 3Q89A 4F4XA 4I2PB 3TJ8A 5CCMA 3CCUS 5F8GA 1S4EA 4XPEA 3PNIA 4NRUA 1S9GB 4RW7A 2IM3A 4FZVA 1TKTA 2VFSA 4QPXA 1O8BA 4RW8A 2FHKA 3MM8A 3SXLA 4MH8A 1UA1A 2R2TA 1OPIA 1CJVA 1VC6A 3DXSX 4WTOB 2QSFA 3KHLA 3NEKA 2ZH8A 4KY3A 5KFIA 4QBUA 4YUDA 1S97A 2XS5A 5K8NA 1SH2A 2B6AB 2W2PP 4LFAF 2COLA 2DGVA 4HHUA 3QRRA 5IT9Y 3PYGA 4JI6F 4Q0BA 1S1WB 3RRKA 5AE1A 2J0QD 4AXJA 1K0TA 1VOMA 5A2QY 4QYZK 2KXFA 4YDDB 2UU9F 2Z0GA 1VQ8S 1IWAA 3Q8PB 3ILJA 1UVJA 4DR3F 2DNKA 2VC1A 2DO4A 1UVIA 2B4PA 2UUTA 4LVNP 1TL5A 1N32F 4F3MA 3QLHB 4NWBA 3DLLQ 3G8SA 3D0IE 1YBUA 5CCLA 1FCAA 2CPJA 3JXOA 2HPUA 1J5EF 1ZM3A 2VPZB 1K1SA 6AT1B 3W65A 4JI8J 2KYZA 2NXJA 4A8SA 3K5LA 1P1TA 2V67A 1CPZA 2V94A 3GONA 1HQ2A 4I68A 2O67A 1NK5A 2CQ3A 3AD9C 3VF0B 4FXWA 5M2PA 3B4DA 3UDEA 1QAJA 2WW8A 4DMZA 1TKZB 1PYSB 3K5OA 5KT4A 4N76A 3PW7A 3PFOA 2KTQA 4TQSA 3D6TB 4CNZA 4RW6A 3RYLA 2Z57B 1S1XA 2CWXA 5CQGA 1M5SA 4B9TA 3DGPA 4JB8B 1JXVA 2IYGA 1J2VA 2MGZB 2C3MA 1RWUA 3MCOA 3J80U 4DR1F 2F4FA 3C14B 3OQ2A 4NLRA 1N36J 2QE5A 4DSEA 4XAKA 4O44A 4I0WA 1NEEA 1HNIA 3IRXB 2Y3YA 2VBZA 2BX6A 2ZH2A 1U6FA 4C11B 5GVQA 5KFSA 4HT5A 3ZNJ1 2BOPA 1WSVA 4E8UA 3HVRA 1RTHA 4WIIA 1N88A 2HHTA 2YNIA 1VQLS 4A8XA 2OTJS 2V2QA 2Z58B 2KN4A 4B9LA 2MJUA 3CC7S 1SQEA 2WCXA 5HANA 3IM9A 2GQ2A 2XS7A 1Y5NB 3DM2B 4QIFA 5EWGA 1VIOA 4HH0A 2UXCJ 1AROP 1YBAA 5ETPA 4KV8A 3DI6A 2J7KA 2YWKA 3QJLA 3KUGA 1X4HA 5KG2A 4B9SA 1DQ9A 1PYTA 5CD4H 4MYUA 2ZE2B 4A4JA 3HHLC 2AZ1A 2CG8A 3AOCA 2ZKTA 2M7SA 3KUEA 2OPSB 2J7WA 2GA7A 1EKRA 1AZSA 5T14A 2GZOA 1QVGR 3CJRA 2JLGA 4DLGA 1R8CA 2JOQA 4HLBA 4IQXA 4LBPA 1TL1B 3DLEA 1HWJA 4L72B 1FRLA 4FN5A 5B0CA 3OVAA 3SV4A 5B0GA 1TKXA 4X62F 1WNEA 5E3PA 3DKDA 3ZO7A 4OV6A 4DHVA 5IWAF 1UWAA 5GAEI 3CD0A 5CZVA 5ADZA 4XTTA 3MM9A 4OX7A 3PHEA 2WVBA 1OY8A 5H9FK 4NLSA 1B0PA 5BXIA 3GR0A 4W92B 2EFNA 1JLGB 1FRIA 3I0RB 4DEZA 1X60A 1KOOA 1XTZA 3TNVA 5HJYA 4Q43A 1F1BB 2ACMA 1DLOA 4HYKA 1IBLJ 3MR5A 3TAPA 2A1BA 3BF4A 1JJHA 3K5MA 3AD8C 4ENOA 4R25A 3IGNA 3KMQA 1Q8IA 2BUNA 4F04B 2BKPA 2CPHA 2OLWA 3LP0B 3LALA 1XR7A 2CQ2A 4QQBA 2PMHA 1GMUA 4NLVA 4B3RF 2MQPA 1RSCA 4RUBA 2YPZA 3CE8A 3HD2A 5KFAA 2GJ2A 1U1NA 4GC6A 2J0WA 2MZTA 1X0FA 3KG0A 1LW0A 1G6BA 4LIRA 4KHRA 3C3LA 3LAKA 2MZSA 2WSFC 1P9YA 3VVTA 3AJ2A 2RT3A 7FD1A 2G0IA 3NXZA 3D0HE 3HT3A 1HPZB 3KLVA 3JYTA 4F26A 4M95A 1NSPA 3Q8YA 1NJYA 2WW4A 4B3OB 3KHHA 3RR7A 2BRKA 2R7OA 3PFEA 2CA9A 2EBEA 2W1BA 4YY3F 3OW2R 1UZDA 3LGHA 2NQPA 4LSZB 3CDEA 2BKOA 2EI5A 4PXBA 4DR7F 1Q78A 2WVCA 2RHQB 4RWXA 2E29A 1NK6A 3NMAA 2ZHAA 4CTAA 3C6TB 1VRQC 1IM6A 4YS2A 3PRBA 4IH7A 3SCIE 1VQ5S 4K50A 1P6TA 1UJ5A 4WFZA 5E33A 3LH2S 2MZJA 1R8HA 3R5AA 3C46A 2HRUA 5AXLA 5J2QA 1ZAXA 1YBTA 4RR5A 3TZYA 5C25B 3HJFA 5A8WA 3HVTB 1HMVA 2OFGX 2F8HA 2D3O1 1U8SA 2OELA 2HHWA 2MSSA 4FS1A 2DK2A 3HT0A 4FKXA 2ZBPA 4P7VA 1PCAA 3EICA 4TQRA 4EO8A 2DITA 1FA0A 4PQAA 2FHJA 2QYCA 1U4BA 2CJYB 2E9RX 3KLFB 4QYZJ 4Y2AA 2DYAA 4QYRA 4RBUA 1SCJB 2EWHA 2GIRA 5I3UB 4ZHRA 2VG6B 1NPPA 2MLXA 2KFNA 2CADA 1VR6A 2UXBJ 1VQ7S 1JLBA 2IA0A 2HAIA 3DMJA 4EK2A 3BSOA 2ZH5A 3PEHA 1IBKF 2XI3A 4I6AA 2IFXA 3NGDA 5HVFA 1U2FA 4DX6A 3L7PA 4NZ0A 3MUMP 1WEYA 3W64A 5E41A 2IVMA 5K14A 2WSCC 2DNOA 1K47A 3OHBA 1NDKA 3CC4S 3ZXWA 4OZLA 4KBIA 2PMZD 2DEIA 3JSYA 5F3TA 1JJCB 1Q7LB 2R7TA 4X66J 2M8HA 2W7PA 4LREA 2MHEA 1FRXA 2RUGA 3H98A 5GAGI 1T03B 1RT4B 4W4MA 1HI0P 4O4GB 4YMEA 4RU2A 2LFVA 4CDIA 1WJ9A 1I5OB 4ALZA 4PWDB 3IAM9 3K5PA 2W9BB 1LOUA 2IJRA 2LU1A 4OMFG 2K3KA 4JI0F 2E1PA 3PYEA 2GW8A 5IT0A 1X9SA 5D0RA 4OX8A 2EK6A 3PO5A 3KG4A 2L3MA 3AA9A 4UUXA 1PJ5A 5H9EJ 1MU2A 1A9NB 1U09A 3W63A 4USVA 1FVQA 3B54A 5C42B 4CNYA 2EG1A 2HWHA 3NKYA 1TV6B 4TY9A 4OLPA 2AIRB 3SEOA 4B9MA 1B0VA 1RT7B 2J8SA 3D6MB 3J81Y 2VASA 4OYXA 2F65A 4TXSA 2GS8A 2OSRA 1X8DA 1U25A 3PRDA 3BQ2A 2GHWA 1JNRB 1SV5B 2J76E 3DRXA 4G1PA 2I9SA 4DR6J 1W25A 1HW8A 3KWMA 2HQ3A 1H7XA 4M1KA 2HURA 3CDWA 4LF5J 3G6XA 3IRWP 1X5OA 4NMLA 4X4OA 1FHTA 3M8WA 2CZVC 5BR8J 1C0TA 4DPUA 1TKDA 2LU2A 3BEGB 4CH0S 3PO4A 3HFVA 2BQUA 1YJ7A 1X5PA 1A7GE 2JWNA 2QA4S 4JI4F 2HIYA 4ZLJA 1PJ6A 5HROA 9RUBA 2VODA 3IBWA 1CJVB 2GHPA 4ZVUB 4J9KA 2VKRA 1JIHA 4ZCKA 1KHVA 2ZM6J 4MJKA 2RE1A 2RRAA 3AOAA 2DISA 3BYPA 3FMBA 1BXNA 1XK8A 2FB0A 1YIJS 3ETOA 2DY1A 3R5CA 1N0VC 4EZ9A 4MYTA 4JI3F 4C8LA 2E66A 4Z37A 4ILRA 1AFIA 2LDIA 4Q0BB 1XNRF 4ATNA 2UV8G 2J7UA 1R6VA 4DUZJ 2NUUG 3H42A 4ITSA 3DN9A 3GB0A 2DBBA 3SDEA 2KHCA 3M6UA 1EQ0A 2AGQA 1M5KC 5KAKA 1HA1A 2VB6A 1CQNA 4GKKF 2W4CA 3I56S 1PAUB 2C3PA 1L3SA 3KHGA 3U02A 1WKJA 1LK5A 2EC0A 3CJSA 4DFMA 4RWWA 2RQMA 2Q43A 4CT9A 1FWKA 2DNPA 1H74A 3UW1A 3RU0A 3K8WA 2A3JA 4JUZA 2VG7A 1QJHA 3J7ZT 2QT7A 4M5IA 1D09B 2MKJA 1N34J 5GMEA 3KFWX 1CG2A 3SI8A 2MHNA 1M5PC 1R8BA 3OFEA 1BE4A 1VQNS 1H6KX 2DNQA 3G82A 4LSNA 4RW6B 1X4FA 5HMXA 4V19X 2IMWP 2CQDA 4QU7A 3T6BA 4LFCJ 3RGIA 3WQPA 2MKIA 2DNNA 1IKVA 5L1KA 3EDQB 1RADB 3PTWA 2W7OA 2MZQA 4ZP8A 4IH6A 1IKWB 3M6VA 2QJ3A 1RWVB 4O44B 3PCOB 1HNIB 4ER8A 5DG9A 3P3DA 4PWWA 7AT1B 3TI0A 1GFWB 4IKAA 4MK9A 1LXJA 2A6OA 3VAIA 5HN0A 2ZC4A 3ZTOA 4F0MA 2MTLA 4WJBA 2ZVIA 2Z2ZA 2AJFE 2K7KA 4OJ3A 3CDBA 5HSPA 4WF9Q 3Q8UA 3CCES 3IWXA 5LMUF 4USIA 2Q66A 5D15A 3D3CJ 2HFVA 3UN2A 1ULRA 1ELOA 3ZTPA 3WIUA 1PO6A 2VICA 2Q6BA 3HSDA 3E3XA 3LA0A 1TMJA 1KBRA 3M9MB 4Y65A 1LXNA 1IR2A 4PXEA 2ZH7A 5I3QA 3DOMA 4KV8B 2QA1A 1NAQA 4Y2KA 2AEMA 3TZXA 1AFJA 4H4MA 4FDFA 2H5IB 4C3LA 3AB4B 2KT5A 2CAJA 3QJPA 2YBVA 3CCTA 2J0SD 5KG1A 1SKRA 2MY7A 3KK1A 5LJ5Y 4FPIA 3BKTA 1LQ9A 4KR0B 3FBBA 3F44A 4LIWA 3OFHA 5L8RC 1OY6A 2LQ9A 2IA6A 3E8OA 2R2SA 1O5JA 2AJQA 2JJ4D 1BUXA 5KT6A 3DLEB 4KKOA 1RKIA 5D8HB 2QTWA 4J9UE 3VAHA 5HLFB 1TKXB 4TVAB 1CLFA 3RBXA 3M9OB 3T1AA 2ERRA 1VFJA 2VFRA 3FEXB 3CJ8A 1WUUA 3ENWA 1RYRA 2YQ3A 3MM9B 1FESA 1WF2A 1RTJA 1EX8A 2N3OA 4NEYA 2BE7D 2UUWA 4LF8F 2EEYA 2MKCA 2IVFB 1KSPA 4HDGA 2R7XA 1T9VA 4PPDA 3U1NA 4DV0J 1R3NA 1X7VA 2D3ZA 2XMJA 1HWIA 2VQEF 2AYGA 4LVOP 3V6HA 4ETXA 2HBYB 2A2CA 1IVZA 1FRJA 4HT7A 4RLEA 1M1GA
chains in the Genus database with same CATH topology
1FEEA 1Y7PA 2RDIA 3K2YA 4JV1A 4F67A 2FGCA 1IKYB 4PR6A 3T9ZA 2QIFA 2HNZA 3JTPA 4NLYA 2RS2A 2W8KA 4ELVA 2KVIA 2J6TA 4DSJA 1KTVA 4WU2A 5DM7Q 2KRBA 2KG0A 3MOZA 3KG1A 3VR1A 1WHVA 3IA0A 3LUYA 1UWBB 4K0KF 2DGXA 4F2RA 1RA7A 3PX4A 1FE4A 2ZHBA 1DTTA 4QR2A 4NXNF 1PSDA 1QTMA 3TRGA 3RRGA 2AGPA 1JNZB 1F60B 4MFBA 4DR5F 4FBTA 1OO0B 3DRPB 3VZIA 3CCSS 4OLOA 3OL8A 3LOUA 4BC7A 2IHR1 1HW9A 3MFHA 1R6YA 3HZEA 2YWFA 1B7FA 3BR8A 5KFYA 2OTLS 2O3DA 3KYLA 3OXLA 4AXIA 2X1BA 1JLCA 1RISA 2B4UA 4URSA 4Q8EA 3PJXA 3EZUA 3IXQA 3QGHA 4B9NA 4IRKA 4WXWA 4R0EA 3CCZA 1S10A 4IOCQ 3N6LA 1RTDA 4OI0A 2HVIA 1S49A 2CPDA 2IRXA 2V5HG 4NCGB 1F5AA 1ZOTA 1Z4UA 3D1OA 4N47A 2GQQA 1LW0B 2PE8A 5JVGQ 3TP2A 3PKMA 4OI6A 1I1GA 4BWJA 3QMQA 3DRSA 3T5LA 1AXQA 1HNXF 2C3OA 5KT7A 3CJKB 5BYSA 4OZ5A 4ZPAA 1WI8A 2ATLA 3BDPA 4UQGA 4RNNA 1R27B 1JLFB 2N82B 3I96A 2JFDA 1KLMB 1T05A 4CO0A 1SUQB 1EP4A 4F4ZA 1Q8BA 2W4PA 2V4QA 2HVHA 1V3ZA 2XLJA 4CQ1A 2HLTA 2L08A 2M8DB 4K4ZA 1XR5A 2OH2A 2AYMA 2C3YA 1S99A 3ZC4A 4PXDA 2EFVA 2APOA 3X1LB 3JYTB 1IKWA 1FTCA 2E5JA 1T8EA 4ILMA 3W2VA 2ZH1A 2F3JA 2GX8A 1HQUA 2B5JB 2CQ4A 4X4SA 2L41A 4RUAA 2XMKA 2R8GA 4DL6A 1YI2S 4TU8A 5EX3A 4H4OB 3MM7A 2XZWA 4PUOA 3AB2B 2VUGA 4DV5F 1HR0F 3MM6A 1UEUA 2W8LA 4E0DA 4DFPA 1C0UB 2I8EA 3H2LA 4FNIA 3FDSA 4KAIA 5E3CA 4C8YA 3HVAA 1R0AB 3PW4A 2BYCA 3MXHP 3NWGA 4QJVA 2IM0A 4X4NA 1X4EA 5GADI 5KFGA 4C8NA 2N7YA 2JEFA 2FHMA 3VAKA 2NPIA 4J9NA 5KFLA 5HI7A 1TFWA 3CDAA 3S6EA 5J2PA 1SKWA 3T5KA 1VQ6S 3A8EA 2H5EA 3U1MA 5A8KB 2D41A 3MEEA 4I7FB 4O3SA 3DOLA 1KS2A 3HHLD 4GO5X 2XGPA 2Y1JA 4EYIB 2DRAA 3LQVA 1SJRA 3TANA 3UPFA 3K58A 3I31A 4DL3A 2VC0A 2BANB 3QGIA 1YSJA 4ECVA 4DV2F 5KG7A 3D1QA 4C9DA 2Z4PA 4EBEA 1OSDA 2E1AA 2DR8A 4ILLA 3OR2A 3VTIA 4XO0A 4RW7B 1N5SA 4B02A 1BQMA 1TKTB 1YJRA 2M0GB 3UDLA 3BGLA 5LT5A 1XMOF 1ZM4A 4F4KA 1R89A 2N4DA 3BGUA 3HX9A 3POTB 4IG3A 3TVYA 3MPVA 4YEAA 3T19A 4WFXA 5E2QA 2V8VA 3NCPA 1F9FA 2NSCA 1QY7A 3MM8B 3GMGA 4RW8B 4WK1A 4Y3CA 1BLUA 4Y2CA 3GIJA 3CEDA 4DJBA 2RRNA 1L3VA 5J2QB 4WFYA 4ZKAA 4TXSA 2JEGA 4RW4A 3SQGB 2KM8B 5DQGA 3RB4A 2WAQD 3KJVA 1S72S 5C24A 2CPZA 3RBEA 2FTRA 3W3SA 3DHWC 4KIAA 2KT3A 3GV8B 4N8OA 2EW9A 3CDUA 1UL3A 3PM9A 5A8WB 1HMVB 3MZIA 1SJ1A 4BBYA 2HMIB 4U7CA 2LXUA 5C25A 1C4AA 2KH9A 5BYQA 1KQGB 4DUYF 1TL4A 2O01C 2OKQA 3LPYA 1RT2A 5J2MA 2AJ1A 4FXDA 2CZ4A 5D3GB 5KFKA 3LWMA 1UVLA 3MF5A 2W25A 2LXFA 4AQYF 4WK3A 3DOKA 7FDRA 3GIIA 4DV0F 2W9CA 2E1MC 3BN4A 3N5FA 4HTIA 1Y4ZB 2O1PA 3DRYA 3M2RA 1KD1T 2FVQA 3GILA 2J9DE 5KG0A 3VAFA 3R1LA 4D3GA 5D6GA 1MWYA 2PD1A 2VBXA 2HHHF 3N0VA 4A8OA 3TVKA 2DB1A 4PG8A 3THVA 5KFFA 4JI8F 1W2IA 2B56A 4DDFA 4ZLPA 3OXGA 4F4YA 3IG1B 4WKYA 5JXSA 2FGOA 1Y5IB 1NJXA 3KLFA 2R8KA 4Q7AA 1YGYA 4ZHRB 5E3RA 3M8SA 2P9GA 2Q3PA 3GYXB 4PQUA 4ECWA 1X4AA 2ZHOA 3NRBA 5HQ8A 4ED0A 1J5OB 1M90T 5T41A 4DSLA 3O2IA 4F02A 2ILZA 2AQ4A 1O0PA 1MW7A 1QE1A 2VG6A 3DMJB 1JB0C 4XIUA 5H9FJ 3QZ7A 2HWIA 3CT9A 2P6SA 4M5DA 5HBMA 1HQEB 1VC5A 4A8MP 2HHXA 2M2BA 3N4WA 2UVWA 4FYDA 1XERA 4JI5F 4N77A 3P49B 1WHYA 1XBWA 1M5OC 1IQZA 3DLKA 2C22A 3L7OA 1PILA 4NLWA 3HPOA 2YX4A 4G1IA 5HLFA 4H54A 4CO2A 1GNKA 2DHGA 1WHWA 4IFVB 5L38A 2B0GA 2MQOA 3BREA 1WG4A 1CEZA 3MD1A 1WG1A 2D1CA 4WCEQ 1UETA 4OQJA 1H2VZ 3DDKA 5DO2A 5L1LA 4KJIA 2DGUA 3GFYA 2G9OA 3FFIA 3FNNA 3TW0A 2LQBA 3M1VA 5F0UA 4KE5A 1FRMA 3FMWA 2BR0A 2E9TA 4AUKA 1KQKA 4NLQA 1N6QA 2ZFHA 3AA8A 4RU9A 4DX8H 1TK8A 1NHVA 4BHQA 2HFOA 4NCAA 1V3SA 1IQTA 5K14B 3V6JA 3I5BA 3E01A 5MAOA 3PX6A 1YTYA 1REVA 1PC4A 2HW3A 2HVZA 3LW5C 1IR0A 3ZFVA 4P6QA 2MKKA 3HHKA 3M2VA 2EKYA 2XNQA 1GT8A 6FD1A 1VQMS 3RR8A 3M8QB 2KYXA 3BJYA 4NA2A 1TL3A 2FVSA 5KT3A 3GYNA 4CZCA 2XWXA 3D5MA 3CB4A 3CC2S 4P2SA 1Q1KA 1N5QA 4RUCA 2FC9A 5DM6Q 5D4NA 2P6TA 2MPUA 1P9QC 2CIMA 5SZTA 1C1CA 3LP2A 2XBPA 4O3NA 4DQIA 2Y1RI 4ZS6A 2HG4A 3K57A 2MY8A 2L9WA 1KEKA 1S79A 1HNWF 4CH7A 3O8WA 2ASYA 3TX8A 1BD6A 4PKDB 3TAMB 5KFBA 3FEZA 2LEPA 5D77A 2VA3A 4Q8FA 3CWJA 1HNVB 4MMOA 1KVIA 2HYIB 1D8YA 4QR1A 1E6YB 5T7LA 3KTQA 2CPIA 2FC8A 4Y2IA 4U7UK 1NO8A 4CI0B 3IAS9 3OHAA 5K9FA 4NZ6A 2DNGA 1T03A 4I6WA 4R5PA 5A8RB 2WB1D 4Y6IA 3MMAA 1IXKA 1RT4A 4HDHA 2WBMA 1N5YB 2C3UA 1HYSB 2FLOA 1IKYA 4KTQA 3OJUA 2E5IA 2J8AA 5FD1A 1SJ4P 4LF6F 1S1XB 1VRTB 3MR2A 4YR0A 1OSCA 2DHAA 5LSRA 4O3OA 4KSEB 2JC0A 3G9CA 1YRXA 2VKZG 4PWDA 2HHUA 3M6WA 4C3MA 2RQ4A 4OV1A 3VCDA 2LCWA 4ECSA 2W9BA 3QZ8A 2MQLA 2MXYA 2NREA 2BQ3A 3GIKA 1RT6A 3NGKA 2Q79A 1M5HA 1SIZA 3ISZA 2FLLA 4Q2LA 4B3TF 1S6UA 2QMXA 3NP5A 2M4MA 1XWLA 4I6YA 3SCKE 3NL0A 5FDLB 5K8MA 4DL7A 5I3PA 3DLBA 3KLGA 2CRLA 4CIOA 1N5TA 4FF3A 2XEXA 4IFYA 1XEZA 2KT2A 2V2KA 3SV3A 1Q79A 2JDJA 1VK3A 2AU0A 1GX6A 4EFAC 3QIPB 4EEYA 4HH1A 2MKHA 2NXUA 1T02A 3MMBB 1MU2B 3VZHA 4CO5A 4CO3A 5IQ6A 5F8IA 4U6PA 3I5AA