5BJRA

Crystal structure of the n-terminal rrm domain from mec-8
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
86
Chain Sequence
QVRTLFVSGLPMDAKPRELYLLFRGARGYEGALLKMTSKNGKPTSPVGFVTFLSQQDAQDARKMLQGVRFDPEAAQVLRLELAKSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Splicing
molecule keywords Mec-8 protein
publication title Conserved binding of GCAC motifs by MEC-8, couch potato, and the RBPMS protein family.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 15
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5bjrA00
2LEBA 4QQBA 3EX7B 2MKIA 1R8PA 3MI7X 3CULA 1N88A 3BO3A 1U1MA 3MUMP 1YTYA 2LXUA 3DLLQ 2KN4A 2MJNA 4V19X 3CCRS 1S79A 4IO9Q 2E5JA 3I56S 1NJIT 2KU7A 2A3JA 2MMYA 1KOOA 1WHVA 2DNHA 1U1KA 2VOPA 2X1AA 1DZ5A 1WG1A 2RNEA 1NU4A 2LEAA 1X4AA 2NLWA 3JB9k 1Q82T 2M0GB 1VC0A 2KFYA 1H2TZ 2J76E 2LYVA 2DGSA 1VQ8S 2I2YA 2CPFA 2OIHA 1WWHA 2GHPA 1U1QA 5GMKa 2AYEA 1VBYA 2M8DB 3U1LA 4Y00A 2K3KA 2YWKA 2D9OA 5DDOC 3R1HA 2MQQA 2RUGA 2X1BA 4Z2XA 1NO8A 2MQPA 2X1GA 1HL6A 2GO9A 2YTCA 3CMES 3RW7A 5EN1A 4RU2A 2KXHA 1X4HA 3UE2A 2FHOB 3CCVS 3G71S 2E5GA 4P6QA 2DNMA 1DRZA 5IFMA 3MOJB 2DGUA 4YUDA 1WI6A 1AUDA 2KT5A 3G8TA 1S72S 2J0SD 2ZJPQ 1WG5A 3VAHA 3NS5A 1YWXA 5BJRA 4TU7A 2KI2A 2FC9A 3CMAS 3S6EA 5LJ3Y 2YH0A 1FJ7A 3CCLS 4CIOA 1SJRA 2UP1A 1WEZA 1X4FA 3Q2TC 5JVHQ 1FJEB 1M5OC 1F9FA 1X4CA 2CJKA 2DITA 5CA5A 5DDPC 3CC7S 2JVRA 4QU6A 1VQKS 2KRBA 2SXLA 2MZJA 1X4BA 5IQQA 4WFBQ 4CH1A 1URNA 2CQ4A 1FJCA 1ZH5A 2RRAA 2CQGA 3BS9A 1P27B 2MPUA 3UD4P 2M52A 2MKHA 2Q79A 1U1RA 1D8ZA 3CTRA 1U6FA 5LJ5Y 4QU7A 5LXYA 3CXCR 4OZ1A 2FPHX 3FEYB 3TYTA 3K0JA 2AD9A 4FXVA 2YH1A 1JMTA 2OTJS 1VBXA 1X4DA 1SJ3P 3IWNC 2EK6A 5GAEU 2DHSA 4PRFA 4TLQA 2QFJA 4FXWA 1N8RT 2LMIA 2DNKA 4CQ1A 3L3CA 2DNNA 1P1TA 1PGZA 2EVZA 2OJ3A 2QEXS 5HO4A 1FT8A 2CQ1A 3CF5Q 1YJWS 1QVFR 2KVIA 1U1NA 1WHYA 2MQNA 2CQ2A 3PIOQ 1VQ9S 1U2FA 5MLCV 2ERRA 2OTLS 2CPXA 2KG1A 2MZTA 2HZCA 1X5TA 2DGOA 5H1SV 2CPZA 5CYJA 2DNPA 5DETA 3SXLA 2HVZA 2MQLA 3U1MA 4Y0FA 2MKKA 2G4BA 2F9DA 2CPYA 2HYIB 3THPA 2EK1A 2DNRA 2N82B 1UW4A 2HGNA 2JX2A 4A8XA 4C7QA 4YOEA 2DGQA 2DGXA 3G8SA 4C0OC 5D77A 2LECA 3CC4S 1JJ2R 2E5IA 1QVGR 2KXNB 2DK2A 2ADCA 5D78A 4BS2A 3EGNA 2U1AA 2RU3A 3CCUS 1R8HA 1M90T 1WHXA 2CPJA 2M4MA 1ZZNA 2DNLA 4W92B 2M70A 3NNHA 1K73T 1VC6A 5FJ4A 2RS8A 1HA1A 1M5KC 2J8AA 1M1KT 4CH0S 2M8HA 3TP2A 3CCMS 3VAFA 3MDFA 2M9KA 1DBDA 4LIRA 1UFWA 1VQ6S 3S8SA 1FXLA 3CCJS 3UCZP 3ZZYA 2CPEA 2MJUA 4TU9A 3I55S 2XS7A 1VQNS 2RQCA 5ITHA 1WG4A 2YKAA 1U1PA 4ED5A 3VALA 2VOOA 1WELA 1N52B 3ULHA 1OPIA 2KYXA 2MKCA 3CCES 4IOCQ 2CQHA 4F25A 1YJNS 4W90B 1DHMA 2FY1A 2DO0A 3CUNA 2JRSA 3R1LA 1UP1A 2N3LA 2LKZA 3SDEA 4LMZA 2J0QD 5CXTA 2M2BA 2MB0B 2DHXA 4YB1P 3VAKA 2CQBA 1WI8A 4WFAQ 3CPWR 2KXFA 1H2VZ 2M88A 2O3DA 3UWTA 2OSQA 4OZ0A 2MZRA 1YJ9S 4UY8T 2MGZA 1UAWA 2DNQA 2KHCA 1VQ7S 1FHTA 1A9NB 3EGZA 2LA4A 2MXYA 5LSOA 1U6BA 2VONA 2DHAA 2CPIA 3Q2SC 3LPYA 1W2BR 1OIAA 1QM9A 2BOPA 5GVQA 2HGLA 2DISA 2DO4A 1VQLS 2DH7A 1WEXA 1FNXH 1XN9A 3MUVP 3VAGA 4IUFA 1O0PA 2HGMA 2DNOA 2ZJRQ 2MKJA 2RRBA 2M7SA 2DHGA 2CPHA 2NZ4A 2MQMA 1Q81T 4ERDA 5HL7Q 3SMZA 3H2UB 1D9AA 2XNQA 2F9JA 4TU8A 3P6YC 2XS2A 4J5OA 4UQTA 1VBZA 2LXIA 1A7GE 2KG0A 1U1LA 3VAIA 4WF9Q 3CD6S 2BZ2A 1WEYA 3VF0B 2XNRA 2X1FA 2MZSA 3CCSS 3MD3A 3BO2A 2DNZA 2G0CA 1Q86T 3DXBA 2E5HA 3VAMA 3B4DA 1U1OA 2E44A 5DM7Q 2JVOA 2DH9A 2VODA 5LXRA 1YIJS 3NNCA 2PEHA 3G4SS 2FC8A 1PO6A 2MSSA 3NNAA 2WBRA 3MD1A 1OWXA 4ZKAA 2N7CA 1KC8T 1X5SA 3US5A 2AYBA 1K8AT 3BEGB 4WCEQ 1SJQA 2MZQA 2MKSA 3P5TL 1VQOS 1B7FA 1OO0B 3SDEB 5JVGQ 3HHNB 2LCWA 1BY9A 2XB2D 1KD1T 4LJMA 2U2FA 4IOAQ 1VQPS 2AYGA 3RW6A 3UCUP 2B0GA 2CQ3A 3G96A 2DH8A 1SXLA 3MUTP 1WF1A 1X5PA 2CQCA 2MGZB 3BO4A 2F3JA 2L9WA 1ZZFA 1WTBA 2L08A 1SJ4P 1WF0A 2RVJA 1X0FA 1N54B 2CQPA 3UCGA 4WKRA 3V4MA 2AYMA 3PIPQ 2KM8B 2DNYA 1CVJA 1X4EA 3CC2S 2CQ0A 3R27A 2MQOA 1RKJA 2RQ4A 1JJHA 3D2WA 3UD3P 2DGVA 3G9CA 2MHNA 1HD1A 1JJ4A 2LA6A 3NS6A 1X5OA 5LSLA 5DM6Q 3TO8A 4PR6A 3THTA 2KM8C 2ZJQQ 3P49B 4C4WA 4F26A 1X4GA 2MSTA 4U67Q 1RK8A 1L3KA 5DDQC 2V94A 3IRWP 2CQDA 1WHWA 2MY7A 3J7YU 2KRRA 1H6KX 1KOHA 1VC5A 2RT3A 3B4MA 3MURP 2I38A 1YI2S 4WFNQ 2DIVA 3CCQS 5IM0B 3MXHP 2L41A 2XSFA 1SJFA 4F02A 2OSRA 2MY8A 5GADU 4QPTA 2PE8A 3P3DA 2DIUA 2ADBA 2K8GA 4WIIA 4EGLA 1HD0A 3HI9A 2JWNA 2LQ5A 1VQMS 1KQSR 1Q7YT 2CPDA 3S7RA 3ZZZA 3OW2R 2DNGA 2D9PA 3LQVA 5GAHU 1VQ5S 1FO1A 3FEXB 5GAGU 3VAJA 3NMRA 2D3OR 2XS5A 3N9UC 1VQ4S 1H2UX 2CQIA 2DB1A 2RS2A 1WF2A 1M5PC 5DDRC 1K9MT 2N3OA 3J7ZT 2DGWA 2KH9A 1YHQS 1IQTA 1G2EA 4M5DB 3G6ES 2QA4S 3H2VE 3S01A 5IM0A 2G1DA 2MZ1A 1YITS 2DGTA 2MYFA 1M5VC 4PKDB
chains in the Genus database with same CATH superfamily
4OYXA 2GIQA 2V9KA 1KEKA 1QY7A 5HMZA 3GP9A 4YN3B 4WFZA 3HHEA 1RSCA 2E5JA 2KU7A 1UPMB 4DV5J 3MR7A 4EBEA 5HMWA 3GIMA 3CCWA 2OLWA 2R9LA 3G8QA 5ADZA 2DGSA 2GMHA 2PA3A 3MEGB 4PXDA 4CLZA 4LSLB 2WVDA 2HZAA 4ES1A 5HJXA 3EDRB 1MN7A 3MM8B 2BRLA 1RT4A 4ZP6A 2L3MA 3D54A 3NGTA 4QYZK 4ES3A 2G0JA 4MTPA 1B0PA 2JDJA 1UJ4A 1YWXA 1FFSB 2YQ1A 3BGRA 3OXFA 1NXIA 2VDHA 3W9HA 4C6AA 2FJDB 3AHPA 2W2PP 3IP0A 2QLWA 1IVZA 4BHQA 1TK8A 1Y00A 5AE2A 3UDCA 2MZJA 3C19A 3GPAA 2BDPA 3N01A 3OTEA 3PRDA 2CQ4A 1ZH5A 3ZZTA 2KZZA 2QGFB 2MKHA 3M6UA 2NXEA 4OYMA 3V6JA 4IQMA 3EPIA 4QU7A 4HHUA 4L72B 4PWWA 2BV3A 5D3GB 1GXTA 4MFBA 1AZSA 2ZH8A 1N8RT 1VK3A 5HO4A 2IRUA 1Y5IB 2QC3A 1LW2A 3IBFB 4Y65A 5LMNJ 4EU0A 1NHUA 3LP2A 3TJ9A 4KGKA 2CJXB 1YBAA 3QT7A 3P8BB 1CQNA 1FVQA 4LF5J 4LF6F 1R8HA 3NNHA 4M5NA 5HROA 2GAGC 2UUBJ 4ZVTB 1RWPB 4RUBA 2K1RB 3PO5A 4J9VA 1QTNB 3ZZYA 3I55S 3KK3A 4YFUA 2YKAA 1U1PA 1NM2A 2VOOA 1N36F 3NXZA 2E1RA 1N52B 1WJ9A 4QYRA 2E9RX 2WW4A 1KQFB 2XTJP 1YJNS 2MKCA 2YKOA 1SV5B 3HPOA 2QA1A 2N3LA 2RDDA 2M2BA 4Q0BB 1ACMB 3T9ZA 3M9OB 1VFJA 2AZ1A 2OSQA 3PR4A 3FFIB 1IWGA 4UY8T 2F4FA 1Y5NB 4IKAA 4ER8A 3NGKA 1SVDA 3FEZA 4LF9F 2VONA 3KOAA 2BOPA 4IYQA 4CNZA 4LFBJ 1H73A 1B0TA 3A3PB 3LGHA 2OEKA 1LWFB 5ETQA 1S4FA 1YDLA 4CLFA 3P6YC 3A8KA 4YR3A 5F0UA 1YJVA 4FXDA 3TJAA 2OMLA 4ZA1A 3CE8A 1PO6A 2MSSA 2OPQA 3CD0A 3UR0A 4ZN1A 1KC8T 1HBOB 3HXMA 3BEGB 3Q8PB 5LM7E 1P9QC 3WX4A 2WSCC 3KXDA 2XB2D 4DDFA 1LWEA 2CZ4A 2FZGB 2ZH9A 5I42B 3V81A 2B0GA 3T5HA 4NLRA 1FKOA 3MR6A 4F67A 2XMJA 2ZC3A 3GZ7A 2CNOB 1FX2A 3W64A 2KM8B 1JLCA 1NDPA 3D2WA 2VFVA 1ZETA 3G87A 1JLGB 2Q6BA 3IR6B 3MMBB 2P6TA 4TQRA 2BX6A 4WWSA 1TU0B 5KT7A 1CJTA 3FBEA 5J2NA 2HVEA 4QPTA 1RWNB 2CJYB 2DIUA 3Q8RB 1MROA 2YPZA 4OJGA 1BWVA 3MAAB 3R2CJ 3RUBL 3OTOF 1YRUA 4BC9A 2V34A 5DDRC 4MAKA 3PW5A 4F4ZA 5DGBA 1RYRA 4G6VB 1P1LA 4PKDB 4QQBA 2GO8A 2B43A 3DOLA 4LREA 1T95A 1RUSA 3DLLQ 1RT1B 4LVNP 3T1HF 3X1LB 4O44B 2HFZA 2NLWA 1HARA 2BKPA 2QYCA 2FUG9 2LYVA 1S5ZA 5H9FJ 4JI0F 1EHWA 3CSKA 5LOQA 4DPUA 2O67A 3H5XA 2YWFA 2VA2A 3BSAA 2A0FB 5T7LB 3Q24A 5EN1A 2J9DE 1NJZA 4ITSA 5J1PA 2KXHA 4ILMA 4PG7A 3GU0A 4NCGB 5KFSA 1QUPA 3QATA 3LPEA 1QD1A 4I1TA 3VV2B 2KKHA 5BJRA 3MEGA 3ZTSA 5B0DA 4LSLA 2HHUA 3P5BP 3BREA 2CDQA 4IR1A 2W4DA 3AAWB 3KJNB 3NEKA 3MM8A 4B9SA 3LAKA 2FHMA 3RG6A 5E3RA 2BM0A 5KG2A 3UD4P 1YK9A 3T19A 2FHJA 2ASDA 4F3OA 2Q79A 1MN9A 5KFLA 4OZ1A 4CM0A 1IKWB 4FXVA 2EXUA 3PXGa 1B4SA 3SIPB 2EK6A 3LANA 2ACYA 3M30B 2KFNA 5D4NA 3HT0A 4FF2A 1KQGB 2GJFA 2MQNA 2GV1A 3PIOQ 4MMOA 2CPXA 4BDPA 4UOHA 2UXBF 1NNDA 2DNPA 3OD2A 2HVZA 4NYPA 5D3GA 2DNRA 2HGNA 3T5KA 3KDNA 4C7QA 3FSIA 1S9GB 4FYDA 2GQCA 3OR2A 5U47A 1AUSL 1ZZNA 2FVQA 2HBZB 4DX5A 4ILRA 4PWUA 1DBDA 3CEDA 4Q5VA 5L39A 3ISNC 1CJVB 1M5HA 1WELA 1FX4A 5KFPA 3J7Z5 1UMJA 5M2PA 4Q8FA 2CQBA 1NMEB 3RR8A 1U8WA 5IT0A 1RBOB 2KXFA 5KG6A 4M1KA 3DLGA 4K50A 3K5NA 4R5PB 1H72C 4QR0A 4N8OA 2OP5A 3OSPA 2AGPA 1DJ0A 5LSOA 2DHAA 1SV5A 2ZM6J 4Y2MA 2ASJA 2HGLA 4Q0BA 2PN6A 3DLKA 2CPHA 2MQMA 1RWKB 1VR6A 3SSRA 3FFIA 3W2WB 1LW0A 1U0HB 2RHQB 4HI1A 2LXIA 2BQUA 4JI4F 1HNWJ 2X1FA 1RAJA 3CCSS 4JYAF 2G0CA 4FP9A 6FD1A 1SKRA 2PEHA 4OMFG 3LP1B 2X3GA 1OWXA 3A13A 3PJ9A 1BC6A 2E1PA 3QO9A 2PI5A 4CLWA 2XULA 1SQGA 3BSCA 1BY9A 2ZHBA 3PRVA 4GKKF 3UCUP 4U96A 2VG7B 1RCOB 2PSZA 1QE1B 4X4TA 1PIEA 1VCTA 3I96A 2RVJA 4MKAA 5HANA 1H0HB 1W25A 1H74A 3LALA 3M2RB 4WYLA 3WX8A 1SL0A 1RAEB 2DGVA 4RW8B 2HLUA 2GVZB 2RKIA 1X60A 3TO8A 2HRUA 4OHXA 1FDBA 1S1WA 4E0DA 2Y1LB 3JSMB 1X0PA 4P2SA 2JC0A 3F56A 1YLXA 4UW2A 4USJC 3SI8A 1KVKA 4NI2B 3M32B 3MXHP 4K7QA 3FCWA 1JNRB 1S59A 2Y0BB 1XC9A 2RJZA 1JLGA 1S0VA 3TZWA 2CG8A 2UXDF 3AQPA 2V50A 3UI3A 4G65A 4ECRA 4HTJA 1N88A 4HACB 1U48A 4OI1A 2V8HA 1ROFA 5KFGA 5C42A 1REGX 2GVDA 3R6LB 4RW7A 2H5JB 4CT9A 3RB3A 5KFNA 1S9FA 2BJ8A 2KFYA 1ZAWA 2VFSA 3HULA 2CPFA 2OIHA 2NREA 1HHTP 5CZVA 4LF2A 3BDEA 3R1HA 1N33F 2MQQA 4Z2XA 1LK7A 3OXGA 1RT1A 2X1GA 2OD6A 5I3PA 4IG0B 5A2QU 4A8QA 2ZZTA 4O44A 1CQMA 2GX8A 2HQFA 3TZZA 3HJVA 3EZOA 2IYGA 2NSCA 2J0SD 4PYDA 3A8JA 5KT5A 2HEKA 1HQEA 3CCLS 4ZLJA 1M0SA 5HI7A 1QAIA 5KG0A 4I6YA 1X7VA 1FJCA 2RRAA 4EI2A 2XWXA 5LJ5Y 3CXCR 1N48A 1M1HA 3GQCA 3RB0A 4OJHA 1U8SA 2ZUAA 4AD6A 4OI6A 1NSPA 4NE9C 5D0RA 1RTHB 1YSJA 5AXNA 4A8KA 1Y5LB 3MAHA 3GG0A 4B9TA 3J7AN 1X5TA 2DGOA 2YQ3A 3QT8A 1NK9A 4DPYA 2ZOFA 1IKWA 5C24B 3U1MA 4CO5A 4YB5A 2LDYA 5D77A 1D0EA 1JJ2R 4M5HA 4BS2A 3GJRB 1HNZJ 2DNLA 1VC6A 5DRKA 2WONA 2XY7A 3PHTA 3BKUA 1M5KC 3HX9A 5K8OA 1V6HA 3S8SA 3MR3A 3W5YA 4KT0C 3RRKA 2V2QA 3VALA 3NL0A 2BQ3A 3QFHA 5GMDA 4DV4J 2HBRB 4FNIA 3O1LA 3TZYA 4GMKA 2C2ZB 3VQTA 5KFQA 1ELOA 4DF4A 2AJ0A 2DNQA 1CJVA 3RYLA 5T14A 3PVXA 4E8UA 1UZDA 2OPSA 2ZWOA 1HW9A 2MKJA 4OX9F 2NZ4A 4C8NA 3D66A 4B3SF 1NDLA 2XM3A 2YNGB 4JI6J 4AFFA 2LDIA 1JK9B 3EDQB 1FKAF 3NGSA 4DR1F 1B99A 4YHHJ 2XNRA 3HHKA 4CLLA 2MZSA 1FWLA 3CDUA 2R2SA 3BKTA 3F41A 3DRRB 4OHZA 3NNCA 2K7JA 4IO1A 4DR5J 1UW9A 3CMQA 5EWEA 3US5A 3W2WA 2D69A 3HVRA 2MKSA 4G1QA 4RW6B 2RQKA 4ED7A 3KLFB 2HIQA 2AGOA 5AJ3F 1FDNA 3IWXA 4JI5J 4AL6A 1E6VB 3SYZA 3BO4A 4RBUA 1FK9B 3LP1A 1HYSB 1SJ4P 3CJTA 1JX4A 1GNKA 3A3OB 3D0GE 3EVOA 4WKRA 1R8AA 2BACA 4DQRA 4RLEA 1CVJA 2VA3A 2FGOA 2E1AA 5F41A 1RKJA 4P74A 1JJHA 4L73A 1RTZA 2VG7A 2JL9A 1JJCB 2W8LA 1QE1A 4U67Q 3Q8VA 3M05A 1WHWA 1QSLA 1XQIA 5KFCA 2P9GA 3DDIA 2G2ZA 4WFNQ 3M2RA 1FESA 3TA1A 4CLUA 4K4XA 4B9LA 3WDOA 4ZPDA 2PE8A 1SBRA 2K8GA 1ZTWA 1WC6A 2R8HA 4J9LA 3S7RA 2DNGA 1FO1A 2MTLA 2DRAA 4P7TA 2L9DA 2XY5A 4DSLA 3UQSA 3M32A 3MEDB 1K0TA 3JSYA 4NA1A 2RILA 1P6TA 5KFOA 2CDRB 4FPIA 2MKIA 2XSJA 3BR9A 1XNQJ 2UU9J 2GA7A 1T3NA 3TUZC 1S76D 1RKIA 2OELA 1UA1A 1H98A 2RNEA 1NLKL 3R8YA 2LEAA 2FB0A 4CLYA 8AT1B 4JI1J 1E6YB 2GHVC 1ZAVA 1H2TZ 3A8IA 1GMWA 3I4PA 1U1QA 5D4LA 1Q95G 2K3KA 2YWKA 2JEIA 4LFAJ 3I5AA 1RHQB 2ROPA 2XEXA 3CCZA 3NCRA 1OYDA 5THWA 2A2DA 2ZJPQ 4MT1A 3WZ0A 3D0IE 1RI7A 1O5JA 5FIIA 1EP4A 2BXJA 3L7UA 1OJ4A 4KHPJ 2IHR1 3ENQA 4ZVOB 4CIOA 4DPXA 1RAFB 4IG0A 3DHXA 4B3OA 3K5LA 4X4RA 4DQIA 4OV1A 4QWAA 4R8UB 4XAKA 4XIUA 1URNA 5E2QA 3IC1A 4M5GA 2XG8A 4O3PA 1YQHA 2O66A 4PXCA 1F3FA 4DR6F 5KAKA 4ZOSA 2IPOB 4RUHA 1W2IA 4M8LA 1FF2A 2DNKA 5KT2A 1HQ2A 1WOOA 3OSNA 1C0UB 5B0CA 3GCWP 3QLHB 1MU2B 4DU7A 2EI5A 1AROP 4ETZA 5D8HB 4Y3CA 1MWZA 1R0BG 1VQSA 5K14B 1RA6A 2OTLS 3W9JA 2CAJA 4NEZA 2VJUA 2I8EA 4Y0FA 4C8YA 2EK1A 2Z0GA 3IS9B 3ZNJ1 2F7VA 2C2KB 3BQ2A 4AL5A 3I4HX 4DQPA 1A0OB 1XMQJ 1G7CB 1M1GA 1RTHA 3HVWA 2XZDB 2M70A 3RBXA 3U27A 2HAFA 4DG1B 3TOQA 1TKZB 4KC5A 4NRUA 3OHBA 2HWIA 1RCXB 3T1AA 1D9FA 3BDPA 5C24A 4DV5F 1S99A 2KL8A 1VQNS 1VRQC 5ITHA 1AXQA 3F0NA 1KHVA 1H7WA 1VK8A 3R1LA 1UP1A 5BYQA 2LKZA 3SDEA 4LMZA 3GIRA 2IMOA 2GC8A 4YDDB 4LBHA 3UWTA 3KLHA 2HHVA 2AIRB 4N7TA 4L74A 2MGZA 2V9WA 4WZQA 4ZLNA 1ICEB 5D0HA 4FVMA 1CJKB 4H4OA 3JTNA 2MXYA 3Q2SC 1SKWA 1GQEA 4XPEA 4IUFA 3GFXA 2HGMA 2ZJRQ 4YB7A 2C1EB 2R2TA 1R6VA 2H1YA 4RNMA 4DR7F 3QZ7A 4UQTA 4KGVB 4UF4A 3PACA 3VF0B 3HFKA 2ILZA 3MD3A 4QZVB 3M8YA 4ED0A 3OFGA 2E5HA 4K8RA 3BQ1A 1CC7A 4K59A 3NNAA 2Q43A 3MD1A 4LIWA 2V2VA 2R7SA 4KE5A 2MLYA 2VH7A 1IBMJ 2VBWA 1OO0B 2YX4A 3BH7B 3O5TB 4YR2A 5E0OA 2OPRB 5K20B 3G96A 1KN6A 4U6PA 5L1LA 3QPIA 2EFNA 4K4YA 2L9WA 1GX6A 2DHHA 5LMNF 3ZC4A 4IH6A 3BR8A 2ZBQA 1T05A 2CQPA 1FE0A 1J5EJ 3TNVA 3I31A 3JTPA 5MAOA 1C4AA 4RW6A 5IC4B 3ILLA 3DDNA 4EO8A 2IA0A 2MQOA 2CVIA 4RPFA 4LF5F 1CBKA 2NYIA 2UUBF 2ATLA 4OYZA 2OFGX 2PGCA 3KYLA 1RU1A 5F3TA 1E6VA 3TUJC 5AE1A 1FK9A 2LU1A 3W2VB 2CQDA 2VKRA 1Q8BA 2KRRA 3B4MA 2WVBA 3C6UB 3FQLA 2V4RA 1RAOA 4J9QA 5A2QY 3JAMU 3AA9A 1JLBB 4FZVA 2Z4PA 1PILA 4WIIA 3W7BA 5E41A 5B0FA 4DR2J 3JXOA 1VQ5S 2IC3A 2LQ8A 1N5QA 4XO0A 1RT7B 1EETB 4R0JA 2QMWA 5EHHA 1EARA 5I3QA 1C4CA 1SC1B 3E01A 4OZJA 1RWXB 3H42A 2PMHA 4ICLA 3HM9A 3CULA 5CH7B 2E7XA 4LFBF 1VLOA 1Q5YA 2MJNA 3IGVA 3Q83A 4FKYA 4DUYF 3DI6A 1WHVA 2RUSA 3GYXB 4ZLLA 1WG1A 3SSQA 2MKYA 3MM6A 1S97A 2VG6B 5HP1B 4ZIWA 1SL1A 1OMSA 4B17A 3SV3A 1X9WA 1F6TA 4EBCA 1JNZB 1YBTA 2ZOMA 2WW8A 2AYEA 3EPGA 4PZVA 5KFWA 3TX0A 4CP5A 2GO9A 2PMZD 5IV4A 2FHOB 3DNCA 3FUYA 2HNDB 1WOPA 2IVYA 2HKEA 4ATNA 3I82A 2BJDA 8ATCB 1E6YA 2AEMA 1C2PA 4OFZA 4C98A 3TX8A 4ZJQA 3VAHA 4DF8A 1FI4A 2VPXB 3W9IA 4OQJA 1HPZB 1NZAA 5ETTA 2HHSA 2UP1A 2ZDPA 5JVHQ 1V5IB 4KR0B 4I6AA 5DDPC 5KFXA 1F2HA 4WXWA 2Y1JA 1HIYA 3FNNA 4C8MA 2LQJA 2CZVC 4QR1A 3TQEA 2POKA 1U4BA 1OSCA 3DYAB 3IG1B 2H65B 4TLQA 4WU3A 2KZMA 2EKYA 3L3CA 4KB7A 2QEXS 4DEZA 4R8UA 4J91A 4HHHA 1O51A 4J7CA 2WZ1A 3A12A 4F3MA 2J9EA 4GVBA 5BYSA 4JI0J 2MQLA 4RJVA 4Q43A 2E1CA 4OZLA 4YOEA 2FVSA 2Y1RI 3ENWA 5LT5A 3NS7B 2E5IA 4KQZA 2W2NP 1FE4A 2KXNB 3LO3A 4FYXB 4LR9A 1C0UA 3QLHA 5IT9U 2VPZB 4CTAB 3NBPB 2RS8A 2B8PA 1P8GA 3BN7A 1NK7A 2J8AA 3NAIA 3TP2A 4ECYA 2MLZA 4DZDA 2KT2A 1SQFA 2K7KA 1NPRA 2N4DA 2CRLA 4LF4J 3IS9A 2ZBRA 2LEPA 1LFPA 1FXRA 4I64A 3LA0A 2RF2A 3CCES 1XJWB 2J7KA 4DCOB 3OHAA 2XHCA 4NCAA 1RXOB 1IBLF 2ZBIA 1RHKB 2APOA 2HZVA 3CIZA 2O3DA 5KOXA 2RDIA 1YJ9S 1UKUA 1UEUA 1SL2A 3M8QB 5C2CA 2QX0A 2OD4A 1TKXB 1Q7LB 1VDHA 4BWJA 1PC4A 1OIAA 4O4RA 4LRCA 2HW3A 3VAGA 2C42A 4M5JA 2RRBA 1ZBTA 3LAMA 4KGXB 4J9KA 3ADAC 4G1PA 3HVTB 2HVDA 2DYAA 1CJKA 2FJWA 3LP0B 5HK4A 3POTB 2EFGA 1S6PB 2ZKUA 3ZTRA 4JP8A 2VODA 4ZHRA 5FD1A 1UWBB 4RNFA 3MEEA 3AA8A 3KK1A 4IRKA 1FNMA 3J80U 3ISZA 3PG9A 3P5TL 1RWMB 4V19J 2O1PA 2YKQA 1HWIA 1H3DA 1XNRJ 3VCDA 3M8SA 2W9CA 1FCAA 4AYBD 3D6MB 3M4XA 3ETOA 3HKWA 3CJRA 3L95X 5BR8J 2G13A 3KMSA 4RKUC 3D1OA 4WKYA 2CVEA 1VIXA 2RQMA 1K44A 4DMZA 4ZP7A 2OPRA 4C4WA 1VLYA 1X4GA 2YVSA 1L3KA 1K1SA 4BBYA 1EX8A 2ZFHA 3ZNUA 3K5OA 2AEJA 4RW9B 4K0KJ 3D9BA 3H40A 4UQGA 4WFXA 1SJFA 4X84A 5K8PA 1C1BB 1C1CB 4B3TF 2HFNA 4JI4J 1L3UA 3PJXA 2B3TB 3ZZZA 3MR5A 1RBAA 5J1EB 2W25A 3NMRA 3PJWA 2RAQA 1D3WA 3C6UA 2AV5A 4FF3A 3QRRA 1CS4A 2G1DA 1JLBA 4M5MA 2ZM6F 4C0HA 1N5YB 2B6AA 1TL5A 1XERA 1REVB 2W9BB 1G6BA 2UUWA 4DV6J 1NEEA 1FFWB 4I2QB 4Q7AA 4IO9Q 3LWMA 4JV2A 4C0BA 4ZVRB 1HNWF 2PA8D 2WAQD 5SUHA 1Q82T 3I0SA 2JEGA 4B08A 3I9V9 4OX7A 1RADB 1I51B 2E7VA 3CJKB 1D8YA 2ZE2B 4RW4B 3H0PA 5E33A 4ZPCA 1S6QB 3EUNA 3PKMA 3WIUA 2VQEF 2J6TA 1IKXB 2AJQA 3H25A 2DTJA 3N6MA 2VG6A 2E5GA 3G71S 1OPZA 1AB8A 1N34F 5H9EK 4WK1A 3MOJB 1OQ6A 3CO0P 1V5VA 4IDKB 2KI2A 2R8JA 2KFZA 1EAYC 3M8WA 4O23A 1Y9OA 4A8MP 1NK8A 1FDAA 2UXCJ 3MMAB 2XWYA 1X4CA 2UXDJ 3M6WA 1HW8A 1VQKS 2G1HA 2IJFA 2IM2A 4CH1A 4L6V3 2OAUA 2XCPA 4WP9A 3TANA 1PJ6A 3QSIA 3Q89A 1HPZA 4NLXA 1SJ3P 4FDFA 3MM9B 1EKSA 2HMIB 2LMIA 3IAM9 4B3MF 3ZZOA 3HZEA 1PG5B 1WC3A 1IKYB 3JQJA 2E9TA 3UO0A 2BJ7A 3FCHA 3H8YA 2I5JB 4TYBA 5MLCV 3QYYA 4CO0A 5LMUJ 2YKPA 5CYMB 1N33J 3FBCA 3DYAA 3IG1A 2Y1IA 4CNYA 4OYPA 2CIMA 2E29A 2RSQA 1TKDA 2ADCA 3P45B 3EGNA 2GQQA 3K57A 5B0BA 3FKBA 1NB7A 4IFYB 4W92B 4D3GA 2M8HA 2RRNA 3DFEA 4GKJJ 4XPCA 4DWIA 2RQCA 4JI8J 5ETKA 3M2UB 3VGUA 1OPIA 1XR5A 3ET6B 3F73A 2R7OA 1DHMA 1F5AA 4D3HA 5GADI 2J0QD 4CTAA 3MCNA 1LEOA 3CO9A 2WBMA 5HJYA 2AGQA 5HQLA 4U8YA 2J8SA 2MQ8A 4LRAA 3D1QA 3K2YA 5KFMA 2UVWA 4DJBA 1VQ7S 3DLEB 4PYAA 4DPOA 5F8MA 2XO6A 3DC2A 2BA9A 2YWHA 2CPIA 3Q86A 4DSKA 4QYZJ 1Y4ZB 3FRYA 3SMZA 4YB6A 2HQ3A 1V3SA 1IM6A 3M8QA 4Q2LA 1U1LA 2BJEA 2HLTA 4MYUA 1R31A 1Q86T 1AYEA 1O6XA 2D74B 1F9HA 5LSRA 2XMAA 1CC8A 1DQ8A 4JV5J 4PAAA 3PEJA 1FEHA 1FD2A 3K17A 4K5RA 4WCEQ 2MZQA 2NR0A 1DTQB 1FKPB 3MECB 3HVTA 4LSNB 2ZBPA 4NOHA 2FLNA 4L3KA 2CQ3A 3CJ5A 2AMCB 5J1NA 1VIOA 1S6PA 3GILA 2CQCA 3SCIE 4PEOA 1ZZFA 2KDOA 2NXUA 1RHJB 3CWJA 4HHJA 4U8VA 4WU2A 3VQSA 3V4MA 2DNYA 5HBMA 1PJ7A 5CCLA 1S1UB 4GC6A 3KHHA 1JJ4A 3H5YA 3MCOA 1HNZF 3HDSA 5D0EA 1RWWB 5LSLA 5FLXU 2VIHA 2Y8WA 4TY8B 3WC2A 2MY7A 3SCJE 3QBCA 2W4PA 4RNOA 1JXVA 3DU5A 2VBYA 5IOLA 4FBUA 2DIVA 4UUXA 4USMA 2XSFA 3HHDA 2DCUB 5GADU 4DR1J 2FJAB 2V4JB 3B78A 4EGLA 3DM2B 3TVYA 1RISA 2PD1A 4N8NA 4FF4A 4U9RA 1SC3B 1GT8A 3N9UC 2JFDA 2XZTB 3HZGA 4M94A 2KH9A 1YHQS 1X31C 1HBNB 1SKSA 1TUVA 3J81U 3G6ES 3H2VE 5A8KB 2XMVA 4USTA 4GVLA 2MEWA 3MI7X 1C1BA 1C1CA 2XHWA 3OLBA 1YZ6A 2ZD1B 4V19X 2OI2A 4PG6A 1NJIT 2EWHA 3AT1B 2UZAA 4JI6F 2JLEA 2KVQE 4Y2CA 1QAXA 4YHHF 1R6YA 3OTBA 2IY5B 3E3XA 2GHPA 2D7SA 3AJ2A 3GFZA 1N5YA 4DR5F 1JKHB 5IV3A 4C8LA 3GB0A 3CIMA 1VRUB 4N5SA 1PYSB 3CMES 1NK5A 1RGVA 1R89A 2QMXA 4RU2A 3KJQB 4I7FB 3RBZA 3R7BB 2DCLA 3KG4A 1UVIA 1NK0A 3CJKA 4JI5F 1Y3JA 3L9ZA 3B82A 4PWDB 1S6QA 3ZZUA 3D28A 2H5IB 2B9WA 4USIA 1IKXA 1IKVA 3CVKA 1HNIB 4ZPWR 1IR1A 3CC7S 3CD5A 4X4UA 1JLQB 2B4VA 4Q44A 2CQGA 4WFYA 3AFGA 2M52A 1MWYA 4ECTA 3CTRA 4MKBA 2NZCA 1KNZA 3BGFA 1R8BA 3UVJB 5K5MA 2ZKTA 1SC4B 4PRFA 1D09B 2GJIA 2GHWA 5A8RB 2ABYA 4ED2A 1VQ9S 4B9MA 3F44A 2ERRA 1RTJB 2CJBA 1S10A 4KGMA 3BBBA 4CRJA 3MM9A 2HMIA 3G6XA 2AU0A 4DL3A 5CHCB 1XR7A 1XNQF 2UU9F 2P6SA 1KLNA 3VAFA 2I5JA 2MJUA 5CYMA 1Z2LA 3GJQB 4JI1F 5C25B 1IWAA 5M2UA 1S9EA 5DG9A 5KFEA 2PEBA 2R2RA 2Z57B 2JRSA 3SQGB 2XMUA 2PT0A 4IFYA 2DHXA 2XGPA 2B51A 4LFAF 1JXEA 1SJ1A 1I6JA 1S77D 2B9XA 5GAGI 1TL3B 1RT3B 2OH2A 2KHCA 4DR6J 1FHTA 3HSJA 3M6XA 2LA4A 1W2BR 2DNOA 3M7VA 4OZNA 4NZ6A 1T9VA 2NPFA 2VPYB 1UJ6A 2F9JA 2XS2A 1VBZA 3VAIA 1RWUA 1RTIB 1IR2A 4KKOB 2Z2YB 1SC6A 2DNZA 3DXBA 3B4DA 3C16B 2XZWA 2FC8A 1KBRA 4ZKAA 1JXLA 3EGVA 1K8AT 3U1NA 1TL1B 1CEZA 3M6VA 1LOUA 2YY3A 2B5JB 3QIPA 1RE1B 1N5SA 1B7FA 3BGOP 2B4OA 1UFKA 1N6QA 2G0IA 4OI3A 3AXMA 1S1TA 2DXFA 4EMDA 4KYZA 2FHJD 2ASLA 2L08A 4DX8H 5L1KA 1TVRB 1B7YB 1ZPVA 3ILIA 2W2QP 3OUYB 3CC2S 1FKPA 4DL7A 3MECA 2BM1A 4FPRA 1XMQF 3G9CA 2MHNA 1T11A 2HWTA 4WE1B 1KFDA 3T5LA 2DR5A 4UUWA 2AEFA 5CCMA 2AWZA 3BV8A 1SCJB 4YMEA 5CYQA 2QL5B 2FZCB 4JI3J 2FTRA 2GZOA 3AD8C 3ZO7A 4I0WA 5KG7A 5HAOA 3A1YG 1XR6A 2A1BA 4HVZA 4DR7J 1D9DA 1I1GA 2QIFA 2J0WA 4QJVA 1BUXA 3N5FA 3AB4B 2R8IA 3NGRA 3B6BA 5GAGU 1RWOB 3OT9A 1T0TV 1H2UX 3DGVA 2B56A 2BQRA 2HHTA 3K8VA 3J7ZT 1QAYA 1G2EA 2E9ZA 4X65J 2LEBA 1OY8A 4KSEB 2V4JA 4F3QA 3GWCA 2C3OA 2VL1A 2R7TA 3R5CA 2DNHA 2VOPA 1U45A 3KLIA 2COLA 2R42A 3HHLD 5A8KA 2M0GB 4F4KA 1YBUA 3T1YJ 3RBEA 1HR0J 4XK8C 4QIEA 4I2PB 2OO4A 1HL6A 2MHEA 1TAQA 2YTCA 4YP3A 1IBMF 2XI2A 4U95A 1YZ7A 4P6QA 3IM8A 1AFIA 2DGUA 4FNHA 3G8TA 1WC4A 3MPYA 1RAAB 4GO7X 3G82B 1JKHA 4USHA 3C15B 1J5EF 1PAEX 1F5BA 2GJ2A 4I7FA 4QU6A 2AX0A 3U7JA 6FDRA 3MFIA 3P96A 2WK4A 5KFIA 3N5BA 3CB4A 1UVLA 4PWDA 1U6FA 2GMLA 3TYTA 3FBFA 3NOGA 3OVSA 1JMTA 1VBXA 2PDAA 3CD7A 4DUYJ 4X4PA 4FXWA 2C2NA 1HNIA 1L3TA 4ECZA 1PGZA 1FT8A 1JLQA 2Y0SD 2JC1A 3RB6A 4DR2F 1U2FA 3V2UC 1A6LA 1JLFB 3SSSA 2HZCA 1Y0HA 5F3ZA 1UL3A 2C3UA 1KVJA 3RBDA 2ZHOA 4DSFA 3THPA 1YGYA 2EFQA 5F8JA 2BBEA 3FJ2A 3KJVA 2YPYA 4TY9A 3I9ZA 3E51A 5A8RA 1ZM4A 3CCTA 1KQKA 2EC2A 3OR1B 3IBWA 3T9NA 4CH0S 1Y10A 4M95A 3KHLA 1NDKA 2M5YA 4LIRA 3AOBA 1VQ6S 2CFXA 2BW7A 1U02A 2CPEA 1C0TA 4AXIA 3RJMB 3IWLA 4I56A 4EWTA 2KYXA 1IJFB 1DTTB 1TKTA 3D5MA 1KTQA 4P52A 4C97A 4KY3A 9ATCB 5ETRA 5GAHI 2MZRA 1JLEB 4O3QA 5DLFA 1KLMB 2IMWP 3Q23A 2AP6A 4DBQA 5C25A 1CJUA 4O0IA 2UUCJ 3V6HA 5GVQA 2DISA 4C11B 4QBUA 1FWPA 1MMLA 3IMQJ 5FLXY 1OQ3A 5A0YB 2ZUGA 2E5LJ 4EZ6A 2K2PA 2OPPA 2M7SA 4ERDA 1TAUA 1D9AA 3CDWA 1TL3A 4J5OA 3LWLA 2KG0A 3SBMA 3ELHA 3AJDA 1F0XA 5KFUA 1WC1A 1UEKA 3T5JA 1U1OA 1WSVA 3D6FB 5LXRA 2J7UA 1X9MA 3G4SS 4DS4A 4QR2A 2XMMA 3TUPA 1PSDA 2J5AA 3PFOA 5LL6d 4W98A 4KJIA 3J81Y 2C3PA 2GGPA 4IOAQ 1VQPS 3DOKB 3BBCA 3MUTP 2FD2A 3C16A 4J9SA 3QZ8A 2VQFJ 1IBLJ 5DG8A 2I0XA 4DFKA 2XQCA 5EDWA 2CQ0A 3EM1A 2JEFA 3LGMA 2YNIB 2XYPB 5I3UB 1EQ0A 3NS6A 1RACB 2KM8C 3THTA 4ID5B 1R43A 2MSTA 1B0VA 1ZA1B 2Y8YA 2V94A 2D41A 2C22A 1TVRA 2RT3A 4LF4F 4J90A 1YI2S 3OUYA 1L3SA 3CCQS 3MEKA 1FNOA 1XWLA 1QSYA 4NLGA 3SCLE 4RUAA 4LFCJ 1HD0A 4KH0B 2JWNA 3MM7B 2WVCA 2KO1A 4B3RF 4CT8A 5GAHU 1RAGB 2YNHB 2IVMA 1N0VC 2RS2A 2DPJA 1I94J 1FVSA 1VRTB 1PKUA 3R7SB 4IFVB 2F8MA 2QTWA 3M8ZA 4RWWA 4NXMJ 1M5VC 3EX7B 3ITHB 1BWEA 1U1MA 1FRHA 1YTYA 3LF0A 5DZ7A 1S79A 4LUBA 3EJMA 5KT3A 2ZHAA 3G6YA 2H51B 2GIFA 4ECQA 4N47A 4M5LA 2CWXA 3V6KA 1TK0A 3PY8A 3NCPA 5ETMA 4DV7F 5KFVA 1DURA 4YR0A 6AT1B 1T02A 1WWHA 4AXJA 3W63A 2C2DA 5SZTA 2QE5A 4DR4J 4KIAA 4Y00A 4DHVA 1S1VB 2H4WB 2QA4G 4AQYJ 4R25A 3PW2A 2E7WA 3MZIA 5L9NA 1LFWA 4DCPB 3G2XA 4PPZA 5G4DA 2X7IA 1NHKL 9RUBA 2OEJA 3JS9A 1XNRF 4NZ7A 4PQUB 4KV8B 1UA0A 1NJYA 4B3TJ 3RAMA 2ZH6A 3TI0A 1TFYA 4I2PA 4G1IA 1Q8KA 5BR8F 4S0MA 1IBKJ 4HR2A 1UVJA 2K1RA 1TV6B 1WEZA 1WSRA 1URRA 3DRYA 4KH1B 2XCAA 2W7PA 4LF8J 2JVRA 3KHGA 2J9CA 1WD6A 3K59A 3I0RB 4MIAA 3TARA 4P72A 2D1CA 1D8ZA 2QFIA 1BD6A 3AY0A 1QUVA 4FYVB 4B02A 4K0KF 1NCLA 5KFJA 2BUNA 1LWCB 3CF5Q 4DV0J 1DAXA 2DXDA 2YKMB 3PX6A 2KVIA 4PXBA 1KFSA 1LKZA 2CQ2A 1KS2A 2XC9A 2NS1B 3T3FA 4LF7J 4P10A 5CYJA 1RT4B 2F9DA 2HYIB 3WQPA 4YQWA 2FJXA 2XYHB 2VQEJ 1LWFA 3D4JA 1CLFA 4F0MA 2DK2A 4YS2A 3M9MB 3CCUS 4ECXA 1XIQA 3BGRB 4OYBA 1N34J 3BGLA 4DV6F 4X4VA 5KFAA 1JLFA 2XGQA 2X3DA 2QLXA 1LQ9A 3MM5B 2XS7A 4UZBA 1HWJA 2ZBCA 4H4KC 4O3NA 1HBOA 2ZH2A 3KNAA 5FDLB 2XBPA 5KG1A 4DFMA 3OVBA 4W90B 5CXTA 3KLEB 2CZ9A 1B3TA 2MB0B 1HLWA 5I42A 4MFBB 3OR1A 1S0NA 2R7WA 1AA1B 3KNGA 3PM9A 1FFGB 1X8DA 1HKAA 3MR2A 4TQSA 4OI2A 4DI6A 2EBEA 2QL7B 4MK9A 2B9YA 4NMXA 2HFUA 2RMLA 3LPYA 1DTTA 1KHWA 5AE3A 4B3MJ 1SI9A 3LP2B 4CLPA 1UJ5A 2D3ZA 2DHGA 2FLPA 4F8RA 4LR8A 1NBEB 1JLEA 2XNQA 4WYWA 2UXCF 3W8GA 3QGIA 4O3OA 1KLMA 2AJ1A 3MMBA 5F9LA 3R97A 5HROB 5IQ6A 4NA3A 4QWEA 1Y7PA 3GFYA 3TAQA 1HWLA 1VHFA 3DRPB 5KG5A 5ETLA 3KK3B 2FQQB 4GO5X 3QGPA 4QOTA 1U49A 2ZH3A 2CJAA 3MAAA 3QGGA 3PO4A 3R5BA 3HHNB 1DY3A 4NEYA 4YY3F 2AYGA 4FS2A 3UR3C 3BPDA 3KDOA 1CG2A 2HHWA 5LMUF 3Q8QB 2BOAA 3AOAA 2WOMB 5D4PA 2ZITA 4K5SA 3W60A 2CYYA 2VU5A 5KFTA 4N76A 3R27A 3MTJA 2GMJA 4U7UD 1BQNB 2F5GA 4QWDA 5B0AA 4ZVUB 4HEA9 4DS5A 3IRWP 3LOUA 2HS0A 3VZHA 4GKJF 5C7PA 4JI8F 1HWKA 1RU2A 3NWRA 5T7LA 2HVIA 4OYIA 4HYKA 2OSRA 3D3BJ 4Y2KA 3P3DA 2YNIA 5I3UA 3KKFA 3N6NA 4NCGA 2R7RA 3OL6A 3R5AA 2FHKA 4ID5A 2OUGA 4OJ3A 3VAJA 3NOCA 3ETMA 3MOZA 1M5PC 5AXKA 4DR3F 3BH6B 4M5DB 2AT1B 2WRMA 3T41A 4CO2A 3UN2A 3J81j 1YITS 1TZ0A 3AH6A 1L3VA 3DDKA 1R0CB 3K8WA 3VHQA 3EXYA 2KN4A 4OZ5A 1Q5VA 2EFOA 3KG1A 5J2PB 1S6OA 2A3JA 4ZCIA 4AT1B 3FMWA 4RL1A 2YNHA 1TMJA 4QW8A 1DZ5A 4OZ2A 1RJJA 1BMQB 2NPIA 1VRTA 3IO1A 4IFVA 3GV5B 1N32F 4Z7YA 1VC0A 4LRFA 4CM2A 3M30A 4ED8A 3ITHA 4JV5F 1Q53A 1S7HA 3JQMA 1PBAA 1WKKA 1VHIA 2XY6A 2C2RA 4CLTA 3RW7A 3PDNA 1CJTB 2VC1A 1PJ5A 3W62A 1MROB 1JIHA 1BXNA 1S9GA 2K3IA 3FVYA 1NRKA 1S72S 4HT5A 3M2VB 4URQU 4DV2F 4ZVFA 2HHHJ 5K9FA 1RB0A 2Z2ZA 1S1VA 5DG7A 4H4KA 3S6EA 2BE9B 3L7OA 2KTQA 1CPZA 1WDTA 5EX3A 4DFJA 4AUKA 1FJEB 3SEOA 1ITPA 4FS1A 2BE7D 2DITA 4KHMA 1L5UA 2KRBA 3IBCB 5CD4A 2VFTA 4KV8A 1SKUB 2AD9A 1UTAA 2XMTA 4KTQA 4C3MA 1TV6A 1PC5A 3MCMA 4ZIVA 2HVHA 4RO0A 1HQUB 4F7VA 4R5PA 2OGUA 2CJQA 1YJWS 4UTGA 3QGHA 1WTFA 3I0RA 2DJWA 4W4MA 1N4LA 4KGZB 4LRBA 2AX1A 3SXLA 3OFFA 2HHXA 2DGXA 4TVAB 5E3AA 1FXDA 4ES2A 1U0HA 1LWCA 3RTVA 1H38A 1M90T 2YKMA 4DX6A 4A46A 2BEFA 3PW4A 2M9KA 4DV3J 1WUUA 2NUUG 2H48B 2ILYA 1WG4A 4DSEA 2AHOB 4ECSA 4EYHB 3VR1A 4F04B 3DOMB 2LXFA 4F4YA 1TUWA 3D67A 2KYZA 2XLIA 1FRJA 2XI3A 2M88A 3KTQA 2L9NA 4F36A 5A76A 1UAWA 3MM5A 5AT1B 5HATA 1BQXA 3BN4A 5FDLA 4ZVGA 3KLGB 4OI0A 2BE2B 2Y3YA 2F40A 4DL5A 1TR0A 1T9YA 3IRXB 1FNXH 4RW8A 3KLEA 2GVZA 1Q79A 1TK5A 5HMXA 4QCLA 1RT6B 2J6UA 3OR2B 4X4OA 3JSMA 1A7GE 5E3QA 5C2GA 2BZ2A 4RZRA 3W5XA 2IRXA 4NI2A 1EB0A 2PO4A 1YIJS 3GV8B 4I6WA 2P9CA 5F8HA 1MNEA 2HQGA 2IM3A 2AYBA 5EWGA 3PZPA 3IXQA 4MKVA 1NH7A 2D3UA 4BWMA 5DGAA 4C2MA 3W65A 4ZVHA 1DLOB 1Y3KA 3ENVA 5KFFA 2IDEA 1W26A 2JLFA 2WSEC 4PPDA 1RDRA 3ZFVA 3OL9A 3BM7A 1WF1A 3VGSA 3DLGB 3MFHA 3DRPA 3R5GA 1WACA 1NKEA 2ZVIA 3H4DA 2YX7A 2F63A 4HACA 5JMNA 1N54B 2HS3A 4MK8A 1GMVA 3UCGA 3N0VA 3HHLB 4ZPAA 3NP5A 2I6WA 2N4CA 1VJWA 2FLLA 2CKWA 4H54A 2F8HA 2HSEB 3DLKB 4OYWA 4ZDNA 2ZH5A 3CJSA 4F26A 3ONQA 1LW0B 1RK8A 3OQ2A 2W24A 2WOMA 4JV1A 4MKYA 5A6WA 1AW0A 1BHNA 3BPSP 4PG4A 3TR5A 2L41A 3UPFA 5HMYA 4F02A 3HF5A 2MY8A 4HL9A 4L76A 4J9MA 4PUOB 1BQNA 2LQ5A 5L1JA 1SPBP 4JOUA 1SB6A 3QO9B 1LV5A 3K5PA 2R8KA 3OJUA 1F60B 2XS5A 5A8WB 3SQOP 4NLOA 2DGWA 2PI4A 4ZCKA 3MPWA 1YX2A 2MZ1A 2YKNB 4DXLA 5IWAF 3BSOA 5L1IA 1RAHB 3O44A 1S57A 1NB2A 1NU4A 5KFDA 1HWUA 2CG4A 2RKIB 4M5DA 4OYAA 4QIFA 3MF5A 3GYNA 4Y2AA 2I2YA 3ILJA 1VMBA 1S1WB 3M8PB 3PTWA 1T03B 4LVOP 2D9OA 5DDOC 2RUGA 2X1BA 2ASYA 1XK8A 5ETPA 2MQPA 5J2PA 2K06A 5ETOA 2FVRA 1GXUA 3D1HA 3VTIA 3OTCA 3AOCA 2Z30B 3HHLC 7FD1A 1XMOJ 1OYEA 2KT5A 4LF1A 4HT7A 1JLAB 4N56A 3DRSB 2FY8A 4NRTA 3CMAS 4NX9A 5LJ3Y 2YH0A 4TXSA 4CYUB 3RU0A 5KT4A 1X4FA 3Q2TC 4IRCA 5CA5A 1X4BA 2KT3A 3PYDA 2BR0A 3V4IB 5HN0A 3Q8SB 4O3RA 5C42B 2ZH7A 2GVDB 3M2VA 4RW7B 1MSWD 3Q8YA 5KG4A 3HSZA 3FEYB 1OY6A 4K4WA 4JI3F 3D3CJ 2GCFA 3QNWB 4OHYA 2F4VF 2R4FA 3W3SA 5GMEA 1GTHA 4G3IA 2JH3A 2QFJA 2Q6CA 1Q8IA 4PQAA 2CWKA 1PBUA 1YKWA 3NKYA 5HVFA 5T41A 2DPIA 2W7AA 3FRZA 2MZTA 5H1SV 2CPZA 4HH1A 2G4BA 3R5DA 3M1VB 2YWEA 3AXKA 4X65F 3I5CA 1YRTA 2GAHC 1RQ0A 2YNGA 1HQUA 1QVGR 1S0MA 4H4MB 4QIWD 1XEZA 1NJXA 3OLAA 1IN0A 2CA9A 1HQEB 4MH8A 3PW7A 3IGNA 5CQGA 4O0NA 3MDFA 3DRRA 4EEYA 2QRRA 4DUZF 2UUAF 5BYRA 3DLHA 1B70B 4F4XA 2VJVA 3UCZP 2EG1A 4NASA 3H5SA 1YG0A 1U09A 4L75A 3LW5C 1KRPA 5AXMA 2CQHA 3D68A 3T1YF 4P75A 3KLFA 1HR0F 2IM1A 4KFBB 2UVRA 2AQ4A 4WP8A 1TQLA 1GK8A 1HYSA 4FYWB 5ETSA 2W8KA 3GR0A 2RU9A 1TELA 1A9NB 3EGZA 1MLAA 4DLEA 3DOMA 2LVWA 1FA0A 4PABA 4ZVQB 1QM9A 2DO4A 4C8ZA 5H9EJ 3TEGA 1R7IA 2W4CA 3H2UB 4WXOA 4QWBA 4ELTA 3Q0AA 4WTYA 2OEMA 2QL9B 4ED3A 1M5SA 3KLGA 2WONB 1NJWA 4HKQA 2BE2A 4OYOA 4ANCA 4ECVA 4EUVA 3IRXA 1T3OA 2YX1A 2UV8G 4DZ6A 5I4MA 1NPPA 1X5SA 2JFKA 3JQKA 1RT6A 1YJ7A 2ATCB 2FZKB 7AT1B 4E2FB 1RHRB 1VQOS 4RR5A 1O8BA 2P2CB 3FBBA 2MDAA 3MEDA 2J6SA 5IXUA 1BLUA 4P71A 3WBZA 1AFJA 2HQCA 3PIPQ 7FDRA 3R3TA 3MPVA 5HVHA 5RUBA 2OPSB 1LNQA 3UD3P 1DLOA 1FRIA 5DM6Q 1FWKA 4ZLPA 5KT6A 4K4VA 1ZAXA 3NCQA 1WC0A 2VD3A 4DOZA 4DL0C 1GH8A 4ZK7M 3N4WA 3AD9C 1SUQB 5BXIA 4URGA 3HHLA 1KONA 5E5NA 2IJRA 3B8HA 4KBIA 4QIGA 3TZXA 3W1YC 3QWPA 2OKQA 2FJVA 1OS5A 2QLJB 4G1QB 1V9OA 4A4JA 5B09A 1QAJA 1KVIA 4ECWA 4WZMA 1T9TA 1S49A 3O8WA 3M9NB 4UOGA 3GR1A 4DQSA 1DQAA 3FZ2A 5IS2A 1TMMA 3GFHA 2UUCF 1PYTA 4PUOA 2E5LF 3MUMP 2LXUA 2QJ3A 4OL8A 4I4BA 5CAAA 4P73A 4X62J 3RRHA 2VZ9A 5HLFB 5A8WA 1NH8A 3RRGA 2YXLA 1LXNA 3ICLA 1KDNA 1HNXF 1B64A 4K2JA 4ENOA 3JB9k 4AE5A 4OJ1A 4UY85 1SH0A 4DN9A 2F1FA 2YKNA 1S6UA 1TP7A 4WBFA 1MU2A 2HAIA 3QAUA 1NO8A 4X64F 4F0HA 2B4PA 5K14A 1T94A 4Q45A 4NA2A 1YJUA 3C46A 2ZVSA 3QT6A 1T9UA 3M8RA 4J9NA 2DNMA 2HK3A 1DRZA 3I32A 2CUYA 2HURA 3M8PA 3VGVA 3FDSA 2VQFF 1AT1B 1T03A 4IOBA 2H9ZA 2GW8A 4DG1A 1TKZA 4RUCA 4B3RJ 4JI7J 2XSJB 2R3VA 4NXNJ 3ILOA 1NK6A 5F0WA 3CNQP 1MG7A 4OZ3A 3BS9A 2W01A 1JLAA 4Y28C 3IM9A 1DARA 3O3LA 2CADA 2VFRA 3DRSA 2IIHA 2OTJS 3NGUA 3BKFA 1X4DA 3IWNC 2V4QA 4CYUA 2DHSA 1VS3A 2XYGB 1WC5A 4NCBA 4YDXA 2EVZA 2OJ3A 3QRQA 4A8SA 4JI2J 2HIYA 3V4IA 1QVFR 1U1NA 3JSRA 4DV7J 4LFCF 3PV8A 3UDLA 4Y2IA 2AZ3A 3EZUA 4A48A 1EIYB 1BE4A 3IR5B 1I94F 2W2MP 1NUEA 2JX2A 4A8XA 1Q1KA 1GXLA 2UVUA 3CDBA 3UW1A 1FEEA 4NLUA 3CC4S 4NXMF 2UUTA 3PKYA 2R8GA 2V2KA 4NYZA 1EP4B 2CPJA 4Y34A 4B9VA 2VASA 3CW2C 1U24A 4UOFA 3TAPA 2F8EX 4B3OB 2I9SA 5L9XA 3BB5A 1UFWA 3UFCX 3M1VA 3FC9A 4P2MA 3R9LA 4P2FA 2B8QA 3GIJA 1EKRA 2DO0A 2ZNZA 4H4MA 3H20A 1H7XA 1KP6A 1UFLA 3NG8A 1ZM2A 3NWGA 4YB1P 1WI8A 4DR4F 4FBTA 4WFAQ 4Z37A 3T6JA 1NPKA 3DGPB 4AQYF 2QV6A 4HDGA 1NZ8A 3FMBA 1UWAA 4U7UK 3S1TA 2O01C 4DU8A 3HP6A 1FTRA 4X4SA 1V3RA 2LFVA 4TNOA 4CLKA 2JEJA 4PG5A 2DH7A 2P8IA 3OPKA 4KFBA 5ETNA 3IFEA 1Q81T 2C3YA 1IBKF 2QT7A 1SH2A 4TU8A 3W2VA 4C9DA 1N56A 4LF8F 5E3CA 3EWGA 5H9FK 3CD6S 2DEJA 1NSKL 3BO2A 2GFFA 1JQGA 2DR8A 5L8RC 2J7WA 2DR6A 2HFSA 1QLNA 3HSDA 2EG2A 3D6TB 4MK7A 2PC6A 4BCAA 3SDEB 4DV0F 1RT7A 1EETA 4AL7A 3KLHB 2DH8A 2DXEA 2MGZB 4ED6A 2FJBB 2IJNA 1WTBA 4RWXA 4LF7F 4M63A 3N28A 3HMJG 3HCXA 4H4OB 4A8WA 3UNGC 1X4EA 4DUTA 2ZWPA 2QSFA 1APSA 2RQ4A 3GSDA 5F9NA 1HD1A 5B0EA 1FRKA 5HP1A 3C8YA 3V6DB 1H6KX 3TWZA 4ZN3A 3NMAA 4BC7A 2DY1A 1KSPA 2AKWB 1ZM9A 4BLGA 2BRKA 2VFUA 4EFAC 3QSYB 2P5VA 3MPUB 3EZ5A 2HNDA 2VF3A 1KQSR 2CPDA 4RU9A 2ZZMA 1U2RA 5L46A 4K4TA 4DV1J 1SUQA 3DHWC 1WF2A 2BKOA 3IAS9 1K9MT 3TUIC 4LQ9A 2DD8S 3THVA 2QSWA 3K58A 3R5JB 3OV7A 4IR9A 1R8PA 3VZIA 2EFVA 2EBGA 4YY3J 1T05B 1ZYQA 3TA0A 3DLBA 4ZPTR 2WVFA 3I56S 2LQBA 3BSNA 1KOOA 3MWBA 2IM0A 1SIZA 3KK2B 3EE3A 3UNYA 2Y9HA 3K7RA 1ZOTA 1ZPWX 1J2VA 4P7VA 2VC0A 2V2ZA 2LP4A 3AD7C 2N7YA 3X3UA 1V3ZA 3P4UB 3RR7A 2ZOGA 4CI0B 5HLFA 4ETXA 1RZMA 2E66A 3CCVS 2HFOA 1RA7A 8RUCA 3GMGA 1R8CA 4YUDA 5EUHA 5IZHA 2IC3B 2HWHA 2ZH4A 2FC9A 3O6QA 3NBPA 1Z2ZA 2R7UA 1FTCA 2C2EA 1BGXT 3E01B 4I67A 4NL5A 1IBCB 2VHGA 4ICLB 5IQQA 4DR3J 1G3OA 3GSIA 1P27B 4NLYA 2HNYB 3DI6B 1U1RA 2RHSB 3DMJB 3MM6B 2YH1A 2JSXA 3FQKA 4P2XA 4DN0A 3GV7B 1Y11A 2Z2LA 5B7WA 1P1TA 3W5ZA 4EBDA 1TKXA 1QJHA 3KLVA 1K0VA 1FJGJ 1N32J 3C66A 4MIBA 2KG1A 3EICA 5K8NA 4GRSA 5DETA 2MKKA 3BGUA 2A2CA 2LECA 1HBMB 3PW0A 4EYIB 2U1AA 1YJTA 3VVTA 1S7IA 2QG9B 3LP0A 2E1MC 3LTOA 3POTA 3CCMS 2H4YB 1HI0P 2LQ9A 1RLDA 4DV2J 1UWBA 3CCJS 2B4UA 3KWMA 3ZTQA 1NHVA 4CDIA 4DPTA 2AJ4A 1R3NA 4ED5A 2NYHA 5B08A 1KKHA 2V67A 4NLDA 4ALZA 1J5OB 2QN6B 3HKZD 3OL7A 3ZZPA 4X66J 1J27A 1UCNA 5E7OB 5KFRA 3G6VA 2BKNA 4KPYA 3J7A1 2QA2A 3PYFA 1EJ7L 1UVNA 1PYOB 5KFYA 1JWWA 1Q16B 4F50A 4O4GB 4GVBB 2HHHF 2Z58B 4X4NA 4HDHA 3DGPA 5HL7Q 2QMUB 3OFEA 4ZJLA 1XTZA 1IJEB 2QO3A 3DU6A 1N0UA 3QIDA 5DS7A 2W9AA 5JJBA 3QT5A 2YWGA 3PYEA 5DLGA 4RW9A 4DFPA 2OHDA 2E44A 5E3PA 1NDCA 3CJQA 2N7CA 2B9EA 3FSXA 3C6TB 4Z7CA 2RF2B 5J1EA 1K47A 2DY9A 2V6AA 2RB7A 4ID8A 2VPWB 5EGYA 1X5PA 5DQIA 2F3JA 1N5VA 3DN9A 1GMUA 2KJWA 2IBOA 2DRBA 2VV5A 1X0FA 1REVA 4J37A 2W9BA 3U02A 2B7BB 4P9SA 4I2QA 3W8PA 2BJ1A 1QTMA 3EGWB 4LRDA 3OTDA 3SFGA 4DL2A 3JTOA 3VVUA 5DQHA 1HMVB 1WKLA 3C14B 4M5IA 3KFWX 2ZE2A 5KG3A 4RW4A 4DV3F 2NXJA 4I69A 4KRWA 2AW0A 2HK2A 1HFEL 3BYPA 5GAEI 2GQ2A 2XLJA 3DLJA 3QJJA 5IM0B 4ZCLA 4ZHRB 5A6PA 5D15A 3MEEB 3K5MA 3KK1B 4WPAA 4USWA 5KTQA 3GG1A 4XTTA 3MMJA 3V6DA 3LQVA 1WORA 4IDKA 1UZHA 2RE1A 1PCAA 2EC0A 2J9DA 2N3OA 4URSA 4ZMMA 3S01A 5DQGA 2W9CB 3MMAA 1YVFA 1RBLA 5D0GA 3TVZA 3G86A 4LF6J 3PR5B 2VB6A 1RWVB 3HLUA 3HK2A 2KHDA 4GC7A 2VBZA 3AJ1A 4JV0A 1PAUB 2ZZNA 3VWSA 3KJFB 2AF6A 3TJ8A 1X4AA 1F3VA 2BMBA 2FDNA 2VKZG 1N36J 2DEIA 2NXCA 4LR7A 2J76E 2EPIA 3A4TA 2Z8QA 1FRMA 4FKXA 4EO6A 1RHMB 2WB4A 1VBYA 2M8DB 3U1LA 3CDEA 1IKYA 1LWXA 1EZZB 3KG0A 4ZVSB 2HNZB 4CO3A 4WIQA 3QMQA 3NLCA 4QW9A 3KK2A 1U2CA 5J2QB 2FLOA 4LF9J 3B54A 1WG5A 3H7HB 2JNJA 1MMNA 5AXLA 4MIWA 2Z56B 2YNFB 4IH7A 2C28A 2IAJB 1CS4B 3I87A 3QQCD 1F9FA 1M5OC 2IRYA 4L3NA 3GLJA 2F65A 1IQZA 2B6AB 4ZITA 2WVEA 2HQDA 2PFDA 2EKNA 3M2UA 2C3MA 1NSQA 3ET6A 3UDEA 5JXSA 5L38A 3OL8A 1MW7A 2V5HG 2FGCA 2FPHX 3K0JA 1HBUB 1U26A 5IWAJ 5GAEU 2HRYA 3I0SB 4FYYB 4USKA 4HLBA 3RZAA 2ZC4A 3DLEA 1NSAA 1TL4A 2HRTA 2V63A 2HNYA 1RHUB 1VBKA 3H90A 3DMJA 2CPYA 3DCAA 2HFVA 1Q0NA 2MLXA 3GE9A 2ZNYA 4C0OC 2IFXA 3EYZA 2A6MA 1U47A 3FGVA 2KJVA 5D78A 4DL4A 2HHQA 1HI1A 2CNLB 3H98A 1DFDA 2BJ3A 3E2EA 1M1KT 2DKOB 3HT3A 4CH7A 4RNHA 3D0HE 1FXLA 1GEHA 3ENAA 5HVGA 3OXLA 1Q78A 4UT4A 4V1Ak 3HFVA 5KFKA 1DTQA 1HBMA 3CJ4A 2Q66A 1S12A 2FY1A 3CUNA 1UETA 4HH0A 3K89A 4LSNA 3EVWA 1XBWA 1H2VZ 4ILLA 4IRDA 4FVCA 3OTOJ 2V8DA 3SCKE 3MTKA 4NLPA 2DR7A 3PX0A 2F4VJ 2CNKB 4CO4A 2QLBB 1J5OA 1U6BA 1WKJA 1XMOF 4ANDA 1VQLS 1S1UA 1VOMA 1XN9A 3MUVP 1O0PA 3NY0A 4ZJOA 4CZCA 2RIJA 4CCHA 3T1HJ 1RT5B 4E98A 1NKCA 3H59A 3N6LA 1GFWB 4TY8A 3IR7B 1KTVA 3ZTPA 4DX7A 1GTEA 1VQYA 4IG3B 4TN2A 5DM7Q 3SV4A 5F8LA 2DH9A 4N77A 4O4GA 4FN5A 1N5TA 2BANB 3DM2A 2G2YA 1F1BB 2BVZA 2V8VA 2EFPA 4DLGA 4XDDA 1HHQA 4DUZJ 2UUAJ 3QRPA 3QWUA 1KD1T 4LJMA 4J9PA 2U2FA 4ED4A 3FK4A 3PFEA 3D7SB 1HBNA 1VJQA 1HHSA 2IYIA 2HG4A 2FIUA 1WF0A 4JUZA 3UN5A 2ZEJA 1IXKA 2ZD1A 3C6TA 4ELUA 2H5EA 4USUA 4ANEA 5C5JA 3DXSX 2RDJA 4N41A 1S1XB 3FCVA 5IT4A 1T9XA 2GIRA 1RT2B 2GS8A 3P49B 4UZCA 2NCKL 1LK5A 1IUJA 1KOHA 1VC5A 3MURP 1VRUA 4B9UA 5F8GA 2I1RA 1RTDB 3HVAA 4KPCA 3A3NB 4QWCA 4JBCA 3H4BA 5B0GA 3KMQA 3HI9A 4CO1A 3HD1A 4PG8A 1VQMS 2V8PA 1HMVA 3OW2R 2D9PA 3C14A 3Q22A 2UXBJ 3AQOA 2D3OR 1VQ4S 2CQIA 2V0NA 2CNNB 1HNVB 2PFFB 4ELVA 4ZVPB 2R7VA 3VGTA 5IM0A 1VI7A 3TW0A 2VG5B 3LGNA 3BO3A 3SZ2A 5KFZA 3CCRS 4J9RA 3CT9A 3KUEA 5HBMB 3C3LA 4C3KA 2J0XA 2X1AA 4K4ZA 3UVJA 2FJEB 1Q4RA 4YEAA 1UPPA 1UVKA 4WJBA 4WP3A 2D3O1 3GIKA 1FDDA 5DO2A 3TQ1A 5F8IA 4DL6A 5CABA 2ROEA 1RTJA 1ULRA 1X4HA 1RYSA 3MPDA 4CWBA 1UEVA 2YQ0A 1WI6A 3I5BA 3NS5A 1R27B 3MCSA 5CZXA 5J2MB 2DR9A 3UDVA 1TL7B 4ZVEA 4KO0B 1FJ7A 3HJFA 3BZQA 1SJRA 2HNZA 3R7NB 1HI8A 4RX6A 2CJKA 3UD5A 4B9NA 2SXLA 1T7PA 4F2RA 2NQPA 3AB2B 4WFBQ 2YWWA 3GONA 3H2LA 5J2QA 3EMTA 4JYAJ 2BYCA 4XDCA 4IH5A 4F4AA 2MPUA 1K1QA 3SQGA 3WC0A 3HD2A 3OFHA 5LXYA 2YNFA 4OLPA 2IAJA 3N79A 2CXEA 1RP5A 3JYTB 2OMOA 3JSBA 1CULB 3SFUA 4CQ1A 1U0SA 2DNNA 1BQMB 3PCOB 2WB1D 4ZPBA 1RT3A 2O5DA 2CQ1A 2VBXA 1ZS6A 4GKKJ 2KB2A 1HNXJ 1D1UA 1WHYA 2VICA 4ECUA 5F8NA 2YBVA 4PCQA 2HS4A 1HBUA 3ISND 4JB8B 1ZTTA 2N82B 1UW4A 4X64J 3LH2S 3R6GB 3R2DJ 2X51A 2RU3A 1WDDA 2M4MA 1RTIA 4KKOA 1HA1A 1RAIB 3TAMB 3GJTB 1IKVB 2M3DA 4X62F 1YJRA 2GNKA 4TYAA 4TU9A 1NKBA 1T9WA 3KHRA 2IVFB 1KR4A 1Q8LA 3BYRA 1TL1A 2RD5C 2B5JA 2FVPA 4OV6A 4F25A 3RB4A 3TVKA 3W66A 3GJSB 1SH3A 4KAIA 3O2IA 3CPWR 4USVA 3GTYX 1Z4UA 4C3LA 2ZH1A 4M5KA 4X4QA 3W61A 3Q8UA 5G0RB 5HSPA 5EX0A 1RLCL 3L09A 4WE1A 4ZP9A 4JI7F 4A8YA 3L4BC 3MMCB 1TUGB 4OIXA 4CLSA 4ED1A 1FRXA 4NXNF 3QFWA 4WF9Q 4NWBA 4C48A 3VAMA 2Q3PA 4QIVA 2L48A 4LT6A 3CJ3A 1SIWB 2V8GA 5DZ6A 1SJQA 1S9EB 1RT5A 2LCWA 4JI2F 1G1XA 4IG3A 1SXLA 1QSSA 3T6BA 4TLRA 2XO7A 1S0OA 2CJ9A 2FVCA 4NLTA 2BANA 1F2GA 1X9SA 4OLOA 2IA6A 3DRXA 2AYMA 1S4EA 3QJLA 2DT9A 4OI4A 2W7OA 3ZTOA 2LA6A 2AJFE 2Z2MA 5DDQC 1R0AB 4DSJA 2V69A 5D4OA 2NUHA 4HI2A 2A18A 3BJYA 1W7WA 2XMKA 1S1XA 3PX4A 1RT2A 3OBIA 1Q7YT 2QZ8A 3FZBA 3QIPB 5DJBA 2W2OP 1WOSA 3G82A 4ZPVR 3WIVA 4A8OA 1TFWA 3C15A 3JAMY 1GX5A 1N6QB 1IQTA 2HBYB 1S1TB 3KUGA 3OJSA 1RTDA 2IBKA 2DGTA 2MYFA 4DQQA 4I68A 2R2UA 4O3SA 1GAOA 2H3EB 3BF4A 1ZM3A 2MMYA 5EWFA 5HQMA 1U1KA 1IR0A 1HNVA 3CGIA 3MHYA 1OSDA 4C8OA 3H5UA 3TRGA 4A47A 2WTFA 1VQ8S 4U7CA 2VG5A 5HQ8A 2ACMA 5GMKa 5CYQB 2NSBA 4LQ3A 3RAQA 3QJPA 2RH3A 3L7PA 1I3OB 3OVAA 3RAXA 3UE2A 3BQ0A 2ZDOA 2UVVA 2VUGA 3ZZ0A 5IFMA 3IA0A 4HTIA 2A10A 2A6OA 1AUDA 4R0EA 2LLZA 2VDIA 4TU7A 2ALZA 2G2OA 1FRLA 4LSZB 4OX9J 4FF1A 4B3SJ 1AZSB 1OY9A 3KUHA 4DV4F 3NRBA 4NLQA 1LW2B 1VGYA 3PNIA 2HBQB 1GMWD 4OHVA 3HO1A 5M2RA 3WHIA 5J2MA 1QDUB 3KLIB 1XMBA 1TL7A 3PRBA 2G9OA 4KO0A 1JB0C 4PXEA 5JUMA 2EEYA 4QPXA 4MJKA 5KFBA 5AJ3J 3HSGA 3GIIA 1MWQA 1MMDA 3TEHB 1T8EA 1CSJA 4Q2MA 4C11A 4DV1F 4X2BA 2IDLA 5A0YA 4WK3A 3RGIA 3CJ0A 1IM4A 2DGQA 3UN3A 3G8SA 3CJ8A 3JYTA 1KWMA 3D6HB 2AJ2A 4C8KA 1CULA 1I5OB 1BQMA 1RABB 4OX6A 1G4CA 1WHXA 1K73T 5FJ4A 4DPWA 4F4WA 4MYTA 2R7XA 2BW2A 3J7YI 4EK2A 3PYGA 1DQ9A 3ULHA 2C2OB 4IOCQ 5IT9Y 4RNNA 3V5RA 3HFZB 3VAKA 4LBPA 3NGDA 4DSIA 3DOKA 1F5CA 2JLGA 3TAMA 2PMWA 4OZ0A 2JOQA 3PEHA 4KHRA 4NLVA 3E8OA 1EQMA 2V68A 4F2SA 1ZA2B 3BBFA 4ZP8A 2OFHX 3EVMA 3I6PA 1WEXA 2OPQB 3ZXWA 2JJ4D 1NK4A 4NLWA 4WTOB 3ZZRA 3NAHA 3KJVB 3QAEA 3MGJA 1WEYA 1LWEB 2NXNA 1U6ZA 2DVIA 2BABA 2XMWA 3V81B 1FKOB 2JVOA 2Q1LA 5G0RA 2HQIA 1WNEA 1YRXA 3FSYA 2WBRA 5KOWA 4OHWA 3C2PA 1C0TB 3MM7A 4IQXA 3GCXP 5D6GA 4NYOA 1JLCB 3MMCA 2B7CB 1TKTB 5JVGQ 2FYXA 1TTHB 2DRDA 3CJ2A 3AODA 3RW6A 5K8MA 1FJGF 1S48A 3MAQA 2HPUA 3TA2A 3J80Y 1VYAA 1P9YA 1FERA 2BJ9A 1Z1ZA 2W1BA 4RBVA 3EXCX 2DBBA 2ROGA 4NZ0A 4RBTA 1CJUB 1LXJA 4LBIA 2H54B 1U25A 2LU2A 4F0KA 2UV8A 5CD4H 4UOCA 5J2NB 4OX8A 1NAQA 2OPPB 1X5OA 3LUYA 4PR6A 2ZJQQ 4J9OA 1U7LA 4EZ9A 4J9UE 2QYGA 4K4SA 5IC6B 3DKDA 3J7YU 2PIIA 2WSFC 1FD8A 2R7QA 4NPOA 2I38A 3CDAA 4A8FA 1UVMA 4NLSA 4Y6IA 4Q8EA 4ZS6A 2P9EA 3IN5A 4X66F 2ALYB 2ADBA 5ETVA 3DOLB 4KHPF 1SQEA 3GYGA 2HHPA 4K4UA 2EW9A 5KFHA 4K2XA 4NMLA 3PHEA 4PQUA 1F9EB 3FEXB 2QLFB 1R0AA 2XLKA 2DB1A 2WHOA 2GGPB 4DCJB 1VISA 2C2MB 3A8EA 2QA4S 4TKTA 2JZ5A 4ZCMA 2JHEA 2WCXA
chains in the Genus database with same CATH topology
3EX7B 2GIQA 3OV7A 3ITHB 4IR9A 2V9KA 4ICLA 1R8PA 1KEKA 3HM9A 3VZIA 3CULA 1BWEA 5CH7B 1U1MA 1QY7A 5HMZA 1FRHA 2E7XA 2EFVA 2EBGA 4LFBF 1T05B 1ZYQA 1YTYA 3TA0A 3DLBA 3LF0A 4WFZA 2MJNA 3HHEA 4ZPTR 1S79A 3IGVA 2E5JA 3I56S 4DUYF 2KU7A 4LUBA 2LQBA 3BSNA 1KOOA 3DI6A 1WHVA 5KT3A 2ZHAA 3MWBA 3G6YA 3GYXB 4ECQA 2IM0A 1WG1A 4N47A 3SSQA 3V6KA 1TK0A 3PY8A 3MM6A 1S97A 2VG6B 1SIZA 4EBEA 3KK2B 3NCPA 5HMWA 5HP1B 3GIMA 4DV7F 3CCWA 5KFVA 1DURA 4YR0A 1SL1A 2OLWA 1T02A 4B17A 3SV3A 1X9WA 2R9LA 3K7RA 1ZOTA 1ZPWX 3G8QA 4EBCA 5ADZA 1JNZB 2DGSA 2GMHA 2PA3A 1WWHA 3MEGB 4AXJA 2ZOMA 1J2VA 4PXDA 4P7VA 2VC0A 2WW8A 5SZTA 2AYEA 2C2DA 4LSLB 2QE5A 3EPGA 4KIAA 4Y00A 4DHVA 5KFWA 1S1VB 2N7YA 2QA4G 3X3UA 4R25A 1V3ZA 3PW2A 4ES1A 2E7WA 3RR7A 2GO9A 3MZIA 5L9NA 2ZOGA 1LFWA 4CI0B 5HLFA 4ETXA 3MM8B 4PPZA 5G4DA 2PMZD 2BRLA 2E66A 1RT4A 2FHOB 4ZP6A 2L3MA 3D54A 3CCVS 3DNCA 2HNDB 2IVYA 2HFOA 4ATNA 1RA7A 2BJDA 3I82A 4ES3A 1E6YA 3GMGA 1R8CA 1C2PA 4OFZA 4C98A 3TX8A 4MTPA 4YUDA 5EUHA 4NZ7A 1XNRF 1B0PA 5IZHA 2JDJA 4PQUB 3VAHA 2IC3B 1UJ4A 1YWXA 4KV8B 1UA0A 1NJYA 2HWHA 2ZH4A 2FC9A 4DF8A 3O6QA 3RAMA 2VPXB 3BGRA 2ZH6A 4OQJA 1HPZB 3TI0A 3OXFA 1NZAA 3NBPA 4G1IA 4I2PA 1TFYA 1Z2ZA 2R7UA 1FTCA 5BR8F 2C2EA 1UVJA 2FJDB 2K1RA 3AHPA 1TV6B 2HHSA 1BGXT 2UP1A 1WEZA 2ZDPA 3E01B 5JVHQ 4KR0B 1URRA 2QLWA 3DRYA 4I67A 4NL5A 4ICLB 2XCAA 4I6AA 5DDPC 5KFXA 4BHQA 2W7PA 2JVRA 1TK8A 1Y00A 5AE2A 2J9CA 3UDCA 1WD6A 2MZJA 3KHGA 5IQQA 4WXWA 2Y1JA 2BDPA 3N01A 3FNNA 3OTEA 3PRDA 2CQ4A 3K59A 1G3OA 3I0RB 1ZH5A 4C8MA 1P27B 2LQJA 4MIAA 4NLYA 3ZZTA 2KZZA 2HNYB 3TARA 2MKHA 3M6UA 3DI6B 2D1CA 1U1RA 2CZVC 1D8ZA 3V6JA 4IQMA 3EPIA 4QU7A 1BD6A 3AY0A 4QR1A 3DMJB 4L72B 1QUVA 3MM6B 2YH1A 2BV3A 2JSXA 5D3GB 1GXTA 4MFBA 2POKA 1U4BA 1OSCA 3DYAB 4B02A 2ZH8A 3IG1B 3FQKA 4TLQA 4DN0A 4WU3A 3GV7B 1N8RT 4K0KF 2KZMA 2EKYA 5KFJA 2Z2LA 5B7WA 3L3CA 1P1TA 1VK3A 2BUNA 4KB7A 2QEXS 1LWCB 5HO4A 2IRUA 3CF5Q 1Y5IB 4DEZA 4R8UA 1DAXA 2YKMB 4EBDA 1LW2A 1TKXA 3PX6A 2KVIA 4PXBA 1KFSA 1O51A 1QJHA 1LKZA 2CQ2A 1KS2A 3KLVA 1K0VA 2XC9A 2NS1B 4Y65A 3C66A 4MIBA 4F3MA 3T3FA 2KG1A 2J9EA 5CYJA 5BYSA 5K8NA 5DETA 1RT4B 2MQLA 4EU0A 2MKKA 1NHUA 3LP2A 4Q43A 2F9DA 2HYIB 3BGUA 2E1CA 4KGKA 1YBAA 4YQWA 4OZLA 2A2CA 2FJXA 4YOEA 2FVSA 1LWFA 2Y1RI 3ENWA 5LT5A 2LECA 1HBMB 1CLFA 2E5IA 4KQZA 3PW0A 1FE4A 1CQNA 2DK2A 2KXNB 1FVQA 4EYIB 3LO3A 2U1AA 3M9MB 1C0UA 1YJTA 3QLHA 3CCUS 4ECXA 4LF6F 1R8HA 3BGRB 3NNHA 2VPZB 4CTAB 3NBPB 5HROA 2RS8A 3BGLA 1P8GA 3BN7A 3LP0A 4DV6F 2E1MC 1NK7A 2J8AA 3NAIA 4X4VA 3POTA 2K1RB 3TP2A 3CCMS 5KFAA 3PO5A 1JLFA 2LQ9A 4ECYA 1HI0P 2XGQA 2KT2A 2K7KA 1UWBA 2QLXA 1LQ9A 2B4UA 2N4DA 3KWMA 3MM5B 3ZZYA 3CCJS 1NHVA 3I55S 3KK3A 2CRLA 2XS7A 3IS9A 2YKAA 2AJ4A 1R3NA 1HWJA 4YFUA 2ZBCA 4H4KC 4O3NA 1HBOA 4ED5A 2ZH2A 3KNAA 2LEPA 2VOOA 5FDLB 2XBPA 5B08A 1LFPA 1FXRA 4I64A 5KG1A 2E1RA 4DFMA 1N52B 3OVBA 2RF2A 4QYRA 2E9RX 1KQFB 3CCES 2MKCA 4NLDA 4ALZA 1YJNS 2YKOA 1J5OB 4W90B 1SV5B 3HKZD 3HPOA 2J7KA 3OL7A 3ZZPA 2QA1A 2N3LA 3OHAA 5CXTA 2M2BA 4NCAA 3KLEB 4Q0BB 2MB0B 1IBLF 2ZBIA 5E7OB 5KFRA 3G6VA 5I42A 4MFBB 2APOA 3CIZA 3OR1A 3T9ZA 3M9OB 2O3DA 5KOXA 2RDIA 1VFJA 1S0NA 2OSQA 3PR4A 2R7WA 3KNGA 3FFIB 3PM9A 1YJ9S 1UKUA 1UEUA 4UY8T 4KPYA 3J7A1 1SL2A 3M8QB 1Y5NB 1X8DA 2QA2A 4IKAA 1UVNA 2OD4A 3MR2A 4TQSA 4OI2A 1TKXB 2EBEA 1Q7LB 3NGKA 4MK9A 5KFYA 2B9YA 3FEZA 1JWWA 1Q16B 4BWJA 4LF9F 2VONA 3KOAA 2RMLA 1PC4A 3LPYA 1DTTA 1KHWA 5AE3A 1OIAA 4O4RA 4IYQA 4F50A 2BOPA 2HW3A 4O4GB 2HHHF 4CNZA 1SI9A 3LP2B 3VAGA 2C42A 2RRBA 1UJ5A 1ZBTA 4X4NA 1B0TA 2D3ZA 2DHGA 4HDHA 2FLPA 3DGPA 3LAMA 5HL7Q 4F8RA 1LWFB 3OFEA 1S4FA 4J9KA 1JLEA 2XNQA 4WYWA 2UXCF 3P6YC 1XTZA 3QGIA 1IJEB 4O3OA 1KLMA 2AJ1A 2QO3A 3DU6A 3MMBA 1N0UA 4G1PA 3HVTB 5F9LA 4YR3A 5F0UA 3QIDA 5DS7A 1YJVA 5HROB 5IQ6A 2W9AA 4FXDA 5JJBA 2YWGA 2FJWA 5DLGA 4NA3A 3LP0B 1Y7PA 3GFYA 4RW9A 4QWEA 4DFPA 2OMLA 3POTB 2EFGA 1S6PB 2ZKUA 2E44A 3TAQA 2VODA 4ZA1A 1HWLA 1VHFA 4ZHRA 3CE8A 3DRPB 5KG5A 5E3PA 1UWBB 5FD1A 1PO6A 2MSSA 2OPQA 4RNFA 3CD0A 3MEEA 3AA8A 3KK3B 3KK1A 3UR0A 4IRKA 1FNMA 2N7CA 1KC8T 1HBOB 3FSXA 3C6TB 3HXMA 3ISZA 3BEGB 4GO5X 3QGPA 4QOTA 2RF2B 3Q8PB 1U49A 2ZH3A 2CJAA 1P9QC 3WX4A 2WSCC 3P5TL 5J1EA 3QGGA 4V19J 3PO4A 2O1PA 2YKQA 3R5BA 3HHNB 2XB2D 4DDFA 1LWEA 2CZ4A 4YY3F 2ZH9A 5I42B 3V81A 2AYGA 2RB7A 1HWIA 4ID8A 4FS2A 2B0GA 2VPWB 3UR3C 3T5HA 1H3DA 4NLRA 5EGYA 1FKOA 3VCDA 1CG2A 3MR6A 1X5PA 3M8SA 2W9CA 4F67A 5DQIA 2HHWA 2F3JA 5LMUF 2XMJA 1FCAA 1N5VA 4AYBD 2ZC3A 2KJWA 3DN9A 2IBOA 2DRBA 3GZ7A 3Q8QB 3M4XA 3ETOA 2VV5A 3HKWA 1X0FA 3L95X 1REVA 4J37A 2W9BA 3U02A 2WOMB 2B7BB 2KM8B 1JLCA 4I2QA 5D4PA 2ZITA 2G13A 4K5SA 2CYYA 5KFTA 1QTMA 4N76A 3R27A 3MTJA 3KMSA 2GMJA 4RKUC 3D1OA 3EGWB 3D2WA 3OTDA 4WKYA 2CVEA 1VIXA