5BJRA

Crystal structure of the n-terminal rrm domain from mec-8
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
86
Chain Sequence
QVRTLFVSGLPMDAKPRELYLLFRGARGYEGALLKMTSKNGKPTSPVGFVTFLSQQDAQDARKMLQGVRFDPEAAQVLRLELAKSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserved binding of GCAC motifs by MEC-8, couch potato, and the RBPMS protein family.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Splicing
molecule keywords Mec-8 protein
total genus 15
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5bjrA00
1M5OC 2LEBA 4QU6A 5DDOC 3CMES 4LJMA 3PIPQ 2CQDA 2MKSA 4CQ1A 4F26A 1VBYA 1M1KT 1FJ7A 3VAFA 2HVZA 1WI8A 1P1TA 3CF5Q 2VOOA 3UD4P 4WF9Q 2MHNA 3MUMP 3MI7X 1VC0A 2MGZA 3CXCR 1W2BR 2YKAA 3EGZA 3DXBA 1U1QA 5DDRC 4WKRA 2MQNA 5HL7Q 5JVHQ 3CC2S 3VAMA 3N9UC 1F9FA 2CQGA 2X1FA 2BZ2A 2DNZA 3S01A 2CQ4A 2LCWA 2X1BA 2RS2A 3UD3P 5GVQA 2MQLA 1FJEB 2DHAA 2KYXA 1AUDA 1VQ9S 2MB0B 2MQPA 5MLCV 3J7YU 3MXHP 2KFYA 3VAKA 2YWKA 2MKIA 2NLWA 4TU8A 2E5IA 5LSLA 3G8SA 5IQQA 2MZRA 3EX7B 1K73T 2OJ3A 4Y00A 2SXLA 3G6ES 2UP1A 2F3JA 1WWHA 2M8DB 1U6BA 2DNPA 2F9JA 2Q79A 1VBXA 2MKHA 2J0QD 2RRAA 5DDQC 4CH0S 1OIAA 1WG5A 3MUVP 2XB2D 4W90B 1U6FA 2MSSA 1WHVA 3S8SA 5DM6Q 2DNGA 2K8GA 2KU7A 2EVZA 3MUTP 1L3KA 2J0SD 2CPDA 3CD6S 4Z2XA 1K9MT 1VQLS 2DO4A 2A3JA 3P49B 5IM0B 2MQMA 3P6YC 4V19X 3BO3A 4WFAQ 3CCES 2MY7A 4WFNQ 2DGXA 2KHCA 5DDPC 1OPIA 1VQ4S 2E44A 2KXFA 1WEXA 1S79A 1WHWA 2KH9A 2U2FA 1X0FA 1K8AT 1M5KC 1WG1A 1YHQS 2CPEA 2DHXA 2ADCA 2LEAA 2LKZA 2L9WA 3TO8A 1A9NB 3BO4A 2RS8A 3H2VE 1VQPS 2DGQA 2U1AA 5CXTA 2RQ4A 1PGZA 3NNHA 2KM8B 1YJNS 2AYEA 2LMIA 1DZ5A 1PO6A 2EK6A 5LSOA 2MGZB 1SXLA 2MQOA 2M0GB 2CQPA 3CCUS 5LXYA 4F25A 2MJUA 2B0GA 5HO4A 2BOPA 1JMTA 3IRWP 3G71S 2OIHA 5LJ5Y 1WHXA 2DHSA 2N3LA 4LIRA 3CC4S 4IUFA 2DIVA 4TLQA 1QVGR 2AYBA 1WF0A 1IQTA 2G1DA 3MD3A 3S6EA 4EGLA 3CCVS 3UCGA 4W92B 3THPA 1HL6A 3CCSS 3I55S 2I38A 1Q82T 2OSRA 3CCMS 2D3OR 3BS9A 2E5JA 1ZZNA 2OTLS 2HGNA 3MURP 3VAJA 2CPYA 2DNKA 3VF0B 3CCQS 1H2UX 2CPXA 1D8ZA 2K3KA 1Q86T 3VAIA 5D78A 5GAEU 2V94A 2M4MA 3B4DA 1X5SA 1YITS 1CVJA 1U1MA 5IM0A 4WFBQ 2N82B 4BS2A 2DNYA 3G8TA 1G2EA 4IO9Q 1YJWS 1RKJA 1JJHA 2RUGA 5DETA 2HYIB 4YB1P 1M5PC 3IWNC 2CJKA 1B7FA 2DH7A 2LXUA 3MDFA 1M5VC 2DGSA 2CQCA 1SJRA 1M90T 4FXVA 1YI2S 3PIOQ 3NS6A 1VBZA 2MZTA 2JX2A 4PKDB 4QPTA 1DHMA 4A8XA 4F02A 2XNQA 2MQQA 2KM8C 1N52B 2CPZA 4ERDA 1OO0B 2MYFA 1YIJS 3S7RA 1ZH5A 3RW7A 3MOJB 3VAGA 2JWNA 2CQ1A 1FHTA 3VAHA 1VQ5S 2CQ3A 2F9DA 4TU7A 2DNQA 2ZJRQ 2ADBA 2NZ4A 1HD1A 5LJ3Y 3I56S 1U2FA 1YWXA 1VQ8S 3CTRA 3G96A 1FXLA 2XSFA 1UW4A 1WELA 2KG1A 2AYGA 2DNLA 3NMRA 1WF2A 2ZJQQ 2VOPA 1SJQA 2FHOB 2MKJA 2AYMA 3DLLQ 1FJCA 3CUNA 3CMAS 5H1SV 2VONA 2DGVA 2CQBA 3TP2A 2MKCA 5JVGQ 4IOAQ 1HD0A 3HI9A 2DHGA 1WEYA 4QU7A 3CC7S 2HZCA 1U1PA 2YH0A 2CQ2A 2N7CA 1X5OA 1YJ9S 2RRBA 1X4DA 3BO2A 2X1AA 4YUDA 3UCZP 3Q2TC 1X5PA 4C4WA 3RW6A 1UP1A 2DNOA 2EK1A 4P6QA 4UQTA 1U1LA 4PRFA 3JB9k 1VQMS 3SMZA 3SDEB 3HHNB 3SXLA 5GAHU 4UY8T 1NU4A 3CCRS 2FC8A 1BY9A 2CPJA 1DRZA 1N8RT 3U1MA 2VODA 3H2UB 2KG0A 1WG4A 1Q81T 2LA4A 1VQ6S 1UFWA 2MXYA 3B4MA 2FY1A 2MKKA 4RU2A 1HA1A 2MZ1A 1X4HA 1JJ4A 2XS2A 2LQ5A 1QM9A 4ED5A 1NO8A 2OSQA 4ZKAA 3L3CA 1FT8A 2DISA 3THTA 3NS5A 1VQNS 1X4GA 2DK2A 3EGNA 3P5TL 5GADU 1YTYA 1VQKS 3FEYB 5DM7Q 2M88A 3J7ZT 3OW2R 3R1HA 3G9CA 1NJIT 1N88A 2M8HA 1U1RA 2DH9A 2KRRA 1N54B 1A7GE 2FC9A 3TYTA 1KD1T 2MMYA 2G4BA 2DITA 4PR6A 2M52A 5GMKa 1X5TA 4WIIA 4C0OC 2JVOA 1FNXH 3VALA 3Q2SC 2L08A 2E5HA 2DGOA 5EN1A 1U1KA 2DGUA 3D2WA 1VQ7S 3G4SS 1R8PA 2AD9A 1WHYA 2XS7A 1OWXA 2X1GA 4FXWA 2CQ0A 1XN9A 2DNNA 1H2TZ 2OTJS 3UWTA 4QQBA 1D9AA 2HGLA 3CULA 2CQHA 2CQIA 2QA4S 2DB1A 4CH1A 2KN4A 2MZQA 2RU3A 2J76E 4LMZA 1H2VZ 2D9OA 4Y0FA 2CPIA 2D9PA 1X4BA 2M9KA 3V4MA 4OZ0A 5D77A 4CIOA 1WI6A 1RK8A 4OZ1A 1WEZA 3SDEA 3ULHA 2KVIA 2ERRA 2HGMA 5CA5A 2DO0A 5LXRA 3ZZZA 2KI2A 3R27A 2RT3A 1VC6A 2DH8A 2MPUA 1ZZFA 2LYVA 2LA6A 3ZZYA 1KOHA 1X4AA 3MD1A 2QEXS 2M7SA 2CPFA 2J8AA 3U1LA 2GO9A 2YTCA 3P3DA 2YH1A 2N3OA 4TU9A 2MZSA 2KRBA 3K0JA 2CPHA 1X4CA 1DBDA 1FO1A 5IFMA 2L41A 3CPWR 2FPHX 2KXHA 1SJ3P 3NNAA 2DNHA 4YOEA 2QFJA 1X4FA 3US5A 1JJ2R 4IOCQ 3CCLS 3UE2A 2M2BA 2DGWA 5ITHA 1U1NA 2DNRA 5FJ4A 1WF1A 2M70A 1KOOA 4C7QA 5CYJA 1KC8T 3BEGB 4J5OA 2O3DA 1KQSR 1S72S 1O0PA 1P27B 3LPYA 2I2YA 1VC5A 1X4EA 2MY8A 2JVRA 1URNA 1SJFA 2LXIA 2XS5A 2MZJA 2ZJPQ 2DIUA 3CCJS 2KXNB 1U1OA 2XNRA 3LQVA 2DGTA 4WCEQ 5BJRA 3UCUP 2GHPA 1H6KX 2PE8A 2PEHA 2LECA 3R1LA 2E5GA 3NNCA 4U67Q 1Q7YT 2MSTA 4M5DB 2RVJA 1QVFR 5GAGU 2KT5A 2RNEA 2MJNA 2JRSA 2WBRA 1VQOS 1R8HA 2RQCA 2DNMA 1UAWA 3FEXB 1SJ4P 1WTBA 2G0CA
chains in the Genus database with same CATH superfamily
2LEBA 3GWCA 1S1WA 2H5IB 4I56A 5C42B 2P9CA 3QIDA 5DDOC 3CDBA 1ZPVA 4LF5J 2WOMA 4IH7A 2V2ZA 3N79A 1U2RA 4IRKA 4CQ1A 2XMMA 4KGXB 1M1KT 2BQ3A 1KLNA 2ACMA 4L6V3 2HVZA 1WI8A 3F56A 4TYAA 4CYUA 2ROEA 2VOOA 3UD4P 1UFKA 3AFGA 1VIOA 3BPSP 2NR0A 1NSPA 2Q6BA 2CA9A 4OIXA 4UOGA 1EKSA 1LWFA 4CLWA 1R0AA 3DXBA 2E7WA 3MEEB 1U1QA 1HYSB 4LF1A 2ZC4A 3R97A 4WKRA 5KFIA 4DR7F 5HL7Q 2GMHA 3J80Y 2GVDA 2XGQA 1F9FA 1VQSA 2RQMA 3DFEA 2CQGA 3OT9A 4ZITA 5FLXU 2X1FA 2DNZA 2BE2B 1D3WA 3ETMA 2CQ4A 4L75A 1S0VA 1N0UA 3W5XA 3PKYA 3DYAB 4QYZK 2N4DA 3BGFA 3KJVA 2ZH2A 2OD4A 4DPOA 3C14A 4JI6F 3SCIE 4ILRA 4ELUA 1UMJA 2FLNA 4N5SA 3V6KA 1N56A 2EC0A 4K5RA 2DHAA 4CLLA 1HNIA 1VQ9S 1TL3A 1N5YB 1HI0P 3NGSA 1MMLA 2MQPA 5MLCV 3J7YU 3MXHP 3H5XA 1BC6A 1IN0A 1G6BA 2C2MB 2MKIA 1KDNA 3RBEA 2DD8S 1ZAXA 4ICLA 3AJDA 2RSQA 2B4OA 2ZBQA 1RADB 1SBRA 2H5JB 3ENWA 3GE9A 3WHIA 3MR5A 1K73T 3PYDA 2Z57B 3UN5A 4Y00A 2VV5A 3KUEA 2E1AA 5EWGA 3NWRA 5KFLA 3U1NA 5F8JA 1QY7A 2DNPA 3UDEA 2ASLA 4HHJA 3EPGA 2BJEA 1BHNA 2HBQB 2GJ2A 4WXOA 2HWHA 3PJXA 2RRAA 1FKAF 3JS9A 1HI1A 5DZ7A 4X4NA 4KFBB 2XB2D 2ZH5A 2DJWA 2VFUA 1HHSA 2CAJA 3KMQA 2YXLA 4M8LA 2CJXB 1U0HB 3D1HA 2EKNA 4MKAA 4DUTA 3IN5A 3ITHA 4X2BA 3QMQA 2EVZA 4UOCA 5BYQA 3MUTP 1L3KA 3DRPB 4KO0A 4DUYJ 1IKVB 1HNVA 4DV5J 5CYQB 3N01A 1S4FA 4RNOA 5A6WA 1FE0A 4MYUA 2F1FA 2JLFA 4Z2XA 2A3JA 3PFEA 1YX2A 1B7YB 1RT2A 3DRRB 5IM0B 4IRCA 4ZVUB 2MQMA 3ZFVA 1FWKA 2VICA 2H51B 3DCAA 4AL6A 5T14A 1Q4RA 1CQMA 2V63A 4KHRA 5EDWA 2EG1A 3QSIA 4L73A 1HNXF 1JLBB 4OHYA 4LBHA 3BN4A 4WFAQ 2CWKA 2CWXA 1VK3A 1DQAA 1AZSA 1HNWF 5DDPC 4J9PA 3GJSB 4HEA9 1C2PA 1RU2A 1I3OB 1TL5A 3OVAA 3AHPA 1WHWA 3J7Z5 2U2FA 4QW8A 1K8AT 3PJ9A 2IRUA 4LBIA 2YNFA 2ZUAA 3PHEA 4FYYB 2C3PA 4ZN3A 2W7AA 2CPEA 5F8NA 4NZ6A 4K2XA 3GONA 1OS5A 3POTB 4PUOB 1R0BG 2IDEA 4URGA 3NBPA 2VBZA 2K2PA 3GCXP 3H25A 2FIUA 2FYXA 3OBIA 3TO8A 5I3UB 4KHPJ 4K4ZA 2WOMB 3AOCA 2FJXA 1A9NB 4P2MA 2HQCA 2HQGA 1FE4A 1NHUA 4NRUA 4XTTA 1Q8IA 3D1OA 3HJFA 2JZ5A 3H2VE 2NYIA 5GMDA 3QGIA 5HANA 3VVUA 4BLGA 2KM8B 2R2SA 4OHVA 4ID8A 1LWEB 1YJNS 4JI8J 3DOMA 1S0MA 1PO6A 1H72C 2EK6A 3CD5A 2B6AB 2NUHA 3CB4A 1LWFB 2CJ9A 4EK2A 1VRUB 3KFWX 2M0GB 3MMBB 3MWBA 3PXGa 2XCAA 4DR1J 1HQEB 4WXWA 3K58A 2C2RA 3QATA 4ANDA 2CQPA 1EETA 1U4BA 4WYWA 4X84A 2DBBA 4OX9J 4KV8B 4DG1B 4RNNA 3HD2A 2W9BA 2HNDB 2GMLA 4J90A 2HMIB 3OXGA 2FTRA 4U8VA 1KQGB 4O3RA 5HO4A 2AZ1A 2GIFA 2VH7A 4DV4F 2G1HA 1UEKA 1S1VA 3W9IA 2OIHA 1ZAVA 1WOOA 4IUFA 4AL5A 3MAHA 5LL6d 1XNRJ 2AYBA 1HBOA 4K7QA 1IQTA 2G1DA 4AE5A 1DLOB 1TUGB 4RWWA 4GKKF 1TFYA 3BSNA 1XNQJ 4PWDA 1MSWD 2I38A 5C25A 1Y10A 2XYPB 4A8MP 3R7BB 2VPZB 1R0AB 2BKNA 1TK0A 4LF9J 4JV5F 1T8EA 1NHVA 2JC0A 1UVNA 4W4MA 3CCMS 2QO3A 2UVUA 3T3FA 4OV6A 2FQQB 2HHPA 4PYDA 2DPIA 2OTLS 1G7CB 2HGNA 3H42A 2C3OA 5FDLA 4QWCA 1TUWA 2AV5A 2CPYA 3HXMA 3VAJA 2DNKA 3VF0B 2B9YA 3V5RA 4J9NA 2KO1A 4HH1A 2BE2A 2QYCA 4QOTA 2PD1A 3RAXA 3FZ2A 3QJLA 4X4VA 5F0WA 1VLYA 1RT1B 2PN6A 5GAEU 2V94A 2VPXB 4BC7A 3RB4A 1TTHB 2BJ8A 1SKSA 4JI2J 4DX6A 2H65B 2HHUA 1Q5YA 2PEBA 3ISND 1U24A 4R0JA 2ZH7A 1U1MA 3NWGA 4WFBQ 1T03A 1FJGF 3CO0P 4OI3A 1VGYA 3MM9B 5J1EB 3MOZA 3KLIA 4IO9Q 1HNIB 1RKJA 4OZLA 1JJHA 5E0OA 2UXDF 4YB1P 3M8ZA 4KR0B 2R7RA 1M5PC 1B7FA 2LXUA 3LGNA 3Q0AA 1RHJB 2UUBJ 4F4ZA 1B64A 2WSCC 2I1RA 2W01A 3OUYA 2FJWA 4P71A 3Q8SB 3BKFA 3M8QA 4FXVA 4NXMF 2JEGA 1OY8A 3PIOQ 1Y00A 1PC5A 3Q89A 1NJZA 2MZTA 1FDNA 2HVHA 4CDIA 3MMAB 3W63A 4NL5A 2E1CA 2EFGA 4CO1A 3NL0A 1N52B 1YIJS 2VU5A 4FVMA 1OPZA 4OL8A 3MOJB 2I6WA 1RACB 1RTZA 3TAMB 3MF5A 4YHHJ 2IJNA 3VAHA 2EW9A 3WC0A 1XQIA 3BBCA 2DNQA 2ZJRQ 1JKHA 2ADBA 2NZ4A 5LJ3Y 4IG0A 3RB0A 4NI2B 4EYIB 2RH3A 4FS1A 3HDSA 1NKEA 4DPTA 2XSFA 1LK7A 4IR9A 1WELA 1WD6A 4CWBA 2ABYA 3VGTA 2AYGA 2ZJQQ 3AA9A 2R3VA 4FKXA 4KGVB 1SJQA 4L3KA 4L3NA 1IJFB 4OHWA 4DR2J 3TZZA 4DV6J 3PX6A 4RJVA 3JSYA 3ISNC 3DLLQ 3TNVA 5CQGA 1CBKA 1PKUA 2D7SA 4B9UA 5H1SV 3TP2A 2HAIA 3IBFB 2WVBA 1Y3JA 3V2UC 5JVGQ 2H5EA 1OQ3A 4YR0A 1RU1A 3ILIA 1FK9A 1IQZA 2DHHA 3BGUA 5DG9A 3QSYB 1NKBA 1RT4B 4QU7A 4CP5A 3WC2A 3C66A 2CQ2A 4O0IA 5F3TA 2O01C 5EX3A 3ZZ0A 3UW1A 3T1YF 2D69A 4A47A 5HI7A 1XR7A 3TQEA 5KT2A 1GQEA 1KBRA 3D0IE 4DSLA 2O67A 4ZP8A 3JYTA 3T5KA 4C4WA 1TL7A 1S6QB 1DQ8A 4P6QA 3R9LA 3GSDA 3IG1A 5M2UA 5JMNA 5L1KA 5C2GA 1RT5B 4B3SJ 1RA7A 1JWWA 3AXKA 4KV8A 4DG1A 2IC3A 4ICLB 5IOLA 1N4LA 3FBEA 1EJ7L 4MMOA 4UY8T 2UUTA 4C8LA 2CNLB 4OHZA 5A8WA 3W2WA 1NEEA 1QAYA 2Q6CA 1Y5IB 3LOUA 3RR8A 3I5AA 1KP6A 2CPJA 4KKOA 4IR1A 1LW2A 1NSKL 5E5NA 5KT3A 4U6PA 1B4SA 1N8RT 2HRUA 4ES2A 4LREA 5LSRA 2VQFJ 1KQFB 2XY6A 1WACA 1NK0A 2RMLA 3MZIA 2VODA 2HQFA 3DXSX 1FEEA 2QSWA 4ED4A 3MR2A 4ELVA 2KG0A 1RWVB 3H7HB 2LA4A 1XMOF 1Q7LB 3CCZA 4R25A 3TOQA 3G6VA 1L3VA 1JJCB 1IBLJ 5ADZA 1UFWA 2Z2LA 3Q22A 3SYZA 1VQ6S 2OKQA 3F41A 3M30A 4LF4F 1HBNA 2LQJA 3R5CA 5A0YB 4R5PA 5KFGA 1F5BA 5E7OB 2UU9J 4LFBJ 3EMTA 2FZKB 2EFNA 2QZ8A 2ZKTA 2A0FB 4EZ9A 5HJYA 1E6YA 2A18A 2HLTA 4OI4A 1UZHA 4C6AA 5HP1A 3EZ5A 3GIIA 2VA2A 1FRHA 2ZC3A 2B9XA 2HRYA 1FRXA 3THTA 5RUBA 3AQOA 3NS5A 1VQNS 3LH2S 2XC9A 3DRXA 1T7PA 1TAUA 1MU2A 1ZM2A 3M2RB 2FZCB 1YTYA 1VQKS 3GFYA 2JEIA 4HACA 2DRBA 2K06A 3DRSB 1E6VA 2XMUA 4NYOA 4RW4A 5ETPA 5F9LA 3OW2R 2F65A 4ECRA 2IY5B 1FTCA 4MJKA 4DFKA 1NJIT 5D0EA 3C6TA 1LEOA 4HKQA 2RAQA 2JL9A 1H3DA 2KVQE 1LOUA 3ZZOA 2QL5B 2DH9A 4QR1A 3BQ0A 2MEWA 1IBMF 2HHVA 3DRRA 2JEFA 3ENVA 1RAIB 3PX0A 4NXMJ 1NJYA 1FVQA 4F50A 4G65A 2VIHA 2J0XA 2WONB 3TYTA 1S57A 4DR1F 2MMYA 2E66A 4X66F 4OZ5A 2BMBA 3VGUA 2ZVSA 2XO7A 1U45A 2FLPA 5G0RA 1Z2LA 1AA1B 3E01A 2M52A 2H3EB 1LQ9A 3QGHA 3ZC4A 3RYLA 2A2CA 5GMKa 3K57A 1LW0A 1NBEB 1RLCL 5EX0A 2RKIB 2DVIA 4RW9B 2IPOB 2VFTA 1CS4B 3DU5A 4A8WA 3RB6A 2AGPA 4DV4J 2VG6A 4DUZF 1QAXA 2RE1A 3T1YJ 3I31A 3L7PA 3D2WA 1RTIA 3G4SS 1VQ7S 4F2RA 4KBIA 3TUIC 3QT5A 4XDDA 5DG8A 1MMNA 1YDLA 3QQCD 1OWXA 2AD9A 4LQ3A 3LP2A 1ZM4A 2Y8WA 1RDRA 3KUGA 4P2XA 4USUA 2HS4A 1RE1B 4MTPA 5IT4A 4RUAA 1D9AA 2HGLA 1C1BA 1MWYA 1BUXA 2CJYB 4LIWA 4CRJA 3PJWA 4DL0C 4DV6F 3HO1A 1S6PB 2ZE2B 4F2SA 3M6XA 4RW8A 5D0HA 3NRBA 2M3DA 2WAQD 4ID5B 3BGRB 4DPYA 3KOAA 3GG0A 1UL3A 2HNZA 2PA8D 4QJVA 2RU3A 1OQ6A 5HROB 3M8PA 3GJQB 3UPFA 4HR2A 4CZCA 1QSYA 1NK4A 4LMZA 1GTEA 3E8OA 1JLFB 5D3GB 3D0HE 2YX7A 3KJQB 4P9SA 3TZWA 4ZS6A 4PG8A 4DEZA 3Q8PB 5DGBA 2GX8A 1JLCB 4PG5A 2D9PA 2P6TA 2E29A 5KFEA 5H9EK 1S59A 2Z0GA 4DPXA 2V4QA 3MECA 3OTOJ 3IM9A 2PI5A 2KFNA 2FVCA 2W2QP 4F0KA 4LF2A 3K2YA 1EETB 2JHEA 2F4FA 2KVIA 5F8GA 2ASDA 2HGMA 7AT1B 5KT7A 1BQNA 2YKQA 1PYSB 2AX0A 2EEYA 3GYXB 2RT3A 3OL9A 1GMWD 5J1NA 1VC6A 1DARA 2B9WA 3IFEA 3DDNA 3OLBA 4DPUA 4B3MF 1FD2A 2XHWA 5U47A 2UXCJ 4KH1B 2LA6A 1ICEB 1YZ7A 3IR5B 4ZVPB 2J6UA 4XO0A 1QSLA 4KTQA 2HNYA 3L4BC 1KOHA 1LW2B 1WC0A 2V2VA 3MM9A 4ZPAA 5EWEA 2IVMA 4PWDB 1SV5B 4YMEA 1VRQC 5C25B 2QEXS 1X7VA 2CPFA 2IVYA 2R7TA 3DLEA 2ASYA 2L9NA 4YY3F 2N3OA 1YJVA 3MEDB 1N34J 2KRBA 3EDRB 2EBEA 5IWAJ 3NKYA 2XLJA 2O1PA 3GFZA 2KYZA 5IFMA 2L41A 5K8MA 3MM8A 4CM0A 3JTNA 4ECSA 2KXHA 3GJRB 2ILZA 4ZPDA 2E9ZA 4QIWD 3WDOA 5KT5A 2V8GA 2QFJA 4EZ6A 1VOMA 2DXDA 1T3NA 4DN0A 5T7LB 2ZM6F 3QFHA 3CCLS 1H7XA 2VG7B 3IMQJ 2M2BA 4E8UA 2AF6A 3W61A 3GR1A 1MU2B 5AE1A 1Y7PA 4DR4F 2FDNA 2ALYB 2ROPA 3C6UA 1G1XA 4ETZA 3GPAA 1MLAA 4DR6J 3EM1A 3M2UB 2H54B 5HJXA 1PC4A 5M2RA 1VYAA 1IM4A 3HVRA 2GA7A 1QE1B 2HHSA 4JB8B 2RHQB 4LSLA 3TX0A 4RKUC 3N5BA 2HIYA 1X4EA 4AUKA 2G13A 1N36F 3KXDA 2POKA 2HQIA 4J9VA 2BW2A 4KAIA 2CZ4A 1URNA 4DI6A 1SJFA 2B51A 4ED2A 5AXKA 1UPPA 2W2OP 2PMHA 4KRWA 4C0HA 3JAMY 3M8SA 3LPEA 3T5HA 2XS5A 4U7UD 2MZJA 2OMOA 3CCJS 2KXNB 1U1OA 4J9OA 1RWPB 3L09A 1ZYQA 3AB4B 3GG1A 4WCEQ 4ZVFA 3K5OA 3UCUP 3M2RA 4LVNP 3R7SB 2BKPA 2UV8A 3T1AA 2RVJA 3BDEA 1H0HB 3LUYA 3LP0A 4RBVA 2KT5A 2RNEA 4WU2A 4Y65A 4CCHA 1EHWA 3LP2B 4L76A 1VQOS 1IBCB 2XYHB 2ZNYA 3KJNB 4ZPCA 1PSDA 3P8BB 4L72B 1NJXA 3TEHB 5DS7A 4IDKB 3AY0A 4KT0C 4ZVRB 2KJWA 3FC9A 2VASA 1WTBA 4FYDA 3ZTRA 4FBUA 1DTTA 3H90A 5G4DA 1EAYC 4LFCF 1TMJA 3DGPB 4FVCA 2YKMB 4QU6A 5DJBA 3KHRA 4ID5A 1HBMB 3TVZA 1CC7A 4OLOA 4ZJQA 1S6PA 2CADA 2D41A 2UXCF 3MEGA 2W4CA 1SQGA 4M5HA 4QIFA 1SL1A 1UJ6A 2IMOA 2CJBA 2K1RA 3M8PB 2AQ4A 3CF5Q 3OPKA 3MM7A 4WF9Q 2MHNA 3MUMP 1J5OA 5LMUJ 5K14A 2XTJP 5J2QA 1CJKA 2YKAA 3CE8A 1A6LA 3FSYA 3CGIA 5J2NA 2IA6A 4BDPA 2F4VF 4LUBA 5I3QA 2MQNA 4OJ3A 5ETKA 1RT5A 5JVHQ 4LRAA 3N9UC 4MKBA 1S6QA 2OELA 3R6GB 3CCWA 2YNGB 4B9NA 3A8EA 2XMKA 3PZPA 4O4RA 4ZVHA 4YP3A 3CT9A 2BJDA 2B3TB 2LCWA 4TXSA 5DLFA 5K8PA 4ECQA 5HROA 2FLLA 1HIYA 4ZLNA 1KTQA 3HSGA 2YX1A 4HT7A 5KTQA 5KG7A 2RS2A 3TA0A 1T02A 1W25A 2CYYA 2WHOA 1OSCA 3ZO7A 1CPZA 2MQLA 2ZWOA 5HBMB 4DLEA 4OX8A 4JI6J 2R7VA 2B56A 4OYWA 3NGDA 2KYXA 2IAJB 1NB2A 2HFVA 1AUDA 2MB0B 2Q3PA 3JYTB 5LT5A 2OUGA 3PYFA 3L9ZA 3I6PA 3QIPA 3VAKA 2YWKA 4WKYA 2B4PA 1K44A 1IVZA 2FJAB 3D3BJ 3GP9A 3H0PA 2EG2A 3ZTOA 3I32A 5CAAA 4ECUA 5L39A 1N34F 1VFJA 5ETMA 3FGVA 4UZCA 5DG7A 1XJWB 2SXLA 4LRBA 3M4XA 3DN9A 1KEKA 4K4VA 3OTDA 1APSA 4I0WA 5DQHA 4YEAA 2X3DA 3RZAA 2FZGB 3K8VA 1Q1KA 2F9JA 3HF5A 3ONQA 4ZOSA 4JI0F 4M5KA 1U48A 1VBXA 4NYPA 2AJ2A 1WG5A 2IJFA 2WW4A 3I9ZA 4K4XA 2VC0A 1QSSA 4W90B 4EMDA 3HPOA 1GT8A 1DY3A 1T9TA 2V50A 2XZWA 3OD2A 2V4JB 3RAQA 3FK4A 3SSRA 3MMCA 3S1TA 4YR2A 1TV6B 5DM6Q 2J6TA 2HBZB 4DR6F 3MM6A 2UUCF 3B54A 4DX5A 1YBAA 3OL8A 1R8CA 1C1CB 1EP4B 1HNWJ 5B0BA 1OMSA 1K9MT 3H8YA 1IWGA 2DO4A 2XHCA 4AQYF 3DLBA 3UDLA 4M95A 3OQ2A 4FF4A 3G82B 2W7PA 2QA2A 1K0TA 4RNHA 1SUQB 1IKYB 2QRRA 4X4QA 5C2CA 1C0UA 2BM0A 4JI5J 4U8YA 2RKIA 3AJ1A 4EI2A 1RWKB 2Z58B 2R9LA 4N76A 3WX4A 3OR2A 1ULRA 2UUBF 4RL1A 4OMFG 1OPIA 1UTAA 3JQKA 4ANEA 3R5BA 2R2RA 3FUYA 4IH5A 4PEOA 4O3PA 2VC1A 1KFSA 2KXFA 1M5KC 5BXIA 2KH9A 5HMWA 4AYBD 2GGPB 4DU8A 3W8GA 2BA9A 2NXUA 3SFUA 3OHAA 1YHQS 3MPWA 1PIEA 1RTDA 3TEGA 2A10A 4WZMA 2HQ3A 4JI2F 4C11B 2J6SA 1HW8A 3F44A 1ACMB 3SCLE 3H4BA 3LAKA 3MEGB 2HNZB 2MLZA 1AZSB 5KG5A 2VFVA 4Q2LA 2B4UA 1XTZA 2U1AA 1W7WA 4CNYA 5CXTA 4CI0B 4NLUA 1FRLA 4Y3CA 1PGZA 3QBCA 2AJFE 4PYAA 4GKKJ 1URRA 1GXUA 2GJFA 2EFQA 2AYEA 4QW9A 1DZ5A 4LF9F 2YVSA 1HQUB 4KGMA 5LSOA 3BH7B 4O23A 1SXLA 4USIA 4Y6IA 3K59A 2MQOA 1TMMA 4IH6A 4J7CA 5K14B 4JI8F 3UFCX 1VRUA 3V6DB 4A8OA 1FF2A 3UDCA 2VD3A 3GB0A 3CCUS 2YX4A 4QWDA 2HPUA 5HMYA 5LXYA 4K4YA 1F9HA 4JV5J 1R8AA 2GVDB 4F25A 1D9DA 4NOHA 2MJUA 2ZOFA 4X64J 1SPBP 4ZMMA 2BOPA 3IRWP 4F04B 2PO4A 2N3LA 4QZVB 3PR5B 2F40A 1NDKA 2DIVA 4NLVA 3ET6B 4C3LA 3DM2B 3C8YA 1LWEA 3T6JA 4A8SA 1YJUA 2EFOA 4W92B 1HL6A 3CCSS 2LEPA 1R7IA 3I55S 4EBCA 4LSNB 2HRTA 1Q82T 5GMEA 1RXOB 5KFJA 1U7LA 3NAIA 1TELA 2YPYA 1WKJA 3BS9A 3QIPB 3OFFA 4QWBA 4EWTA 3V4IA 1U47A 1T3OA 1AFIA 2UUCJ 1L3SA 2ZBIA 4PCQA 1IBKF 4GC7A 1IKXA 3E51A 3HSDA 2OPPA 3NG8A 3CCQS 2FJEB 2CPXA 2K3KA 1FX2A 1UFLA 2V8PA 3D67A 3MM5B 5B0EA 3OSNA 3JSMB 3VAIA 2O66A 2V2QA 2HHHF 4ZPVR 4JI7J 4PABA 4N77A 3B4DA 4XPEA 4IG3B 1X5SA 4NMXA 5MAOA 4Q45A 1YITS 2CZ9A 1RAFB 3LGMA 4KHMA 4RW7A 4UT4A 1CVJA 3ZZTA 4YHHF 1PJ5A 1LK5A 5K8OA 3DOLB 4OZ2A 4Z7YA 1TKXB 2JSXA 4DV5F 1T9VA 5GAEI 3VTIA 2HYIB 1HLWA 4RPFA 1W2IA 3PNIA 4P72A 2CJKA 5L1IA 4A8YA 3R2CJ 3MDFA 1RLDA 1M5VC 2DGSA 2QMWA 2V4JA 4WBFA 3DI6A 2CQCA 2KDOA 4DL5A 1SJRA 4GRSA 3ITHB 5IXUA 1M90T 2VF3A 3CIMA 1ZTWA 3RR7A 4K8RA 5H9FK 3ZZPA 2YNFB 2OEKA 1QAJA 3PO4A 4A8XA 3UQSA 3TWZA 5KFKA 2UZAA 4DU7A 4ZIWA 2OJ3A 1JXVA 1OO0B 4DL4A 4USVA 4AQYJ 2WVCA 1ZH5A 3X1LB 3RW7A 2VDHA 2RF2B 3KHHA 3VAGA 2I8EA 1HW9A 2XG8A 4NEZA 4C0BA 2Y8YA 2CQ1A 2AWZA 2NCKL 2NPIA 3AD7C 1VQ5S 3RJMB 4FN5A 1WC5A 4TU7A 4PQUA 1NLKL 3FKBA 1BWEA 3I4PA 3V81A 1HD1A 1U2FA 1YWXA 1VQ8S 1MN7A 1SH0A 3EE3A 1S1XB 2LXFA 2OPQB 3CTRA 5HMXA 2HHWA 1RBLA 1YKWA 4Y2KA 5J2MA 4JI3J 1QLNA 1K47A 1Z1ZA 1FXLA 1UW4A 3P4UB 1IWAA 2QL7B 3B6BA 4DHVA 1KFDA 3VVTA 2KG1A 1UVMA 3D1QA 2DNLA 4DBQA 3B8HA 3G82A 1EQ0A 1BQMB 1M5HA 3GR0A 3WIUA 2HBYB 1FTRA 4DN9A 5F3ZA 3UI3A 2AYMA 3IA0A 4JI1F 1FJCA 4I6WA 3KLHB 3CUNA 1T05B 4GMKA 1HBMA 2F8MA 3I96A 3N6LA 4Z37A 4KE5A 1TKTB 2YKMA 2A1BA 4V19J 4USTA 3M2VA 1GXLA 2JC1A 4WTOB 4QBUA 2GHWA 3T5JA 2BYCA 3EPIA 4MH8A 5KFYA 2WW8A 5DLGA 4MIWA 3QRRA 2EBGA 3L7UA 1RAGB 5ETNA 5HLFB 1U1PA 4B3SF 4IQXA 4K50A 2DY9A 2CZVC 1XC9A 4TVAB 2N7CA 3PACA 4ZLLA 2ZKUA 3MAAB 2WVDA 5E33A 1V3SA 4BC9A 2CUYA 4F3OA 2VOPA 5J2QB 5E3CA 2RRBA 1BMQB 3QGGA 3HFZB 4O44B 4ALZA 2ZZTA 4DQQA 3Q86A 3MAQA 3MR3A 3I0SB 2NREA 2K3IA 2HKEA 3BH6B 4HLBA 3Q2TC 2R7XA 1VS3A 1X5PA 3A13A 2QIFA 4HTJA 3RBZA 1XWLA 2DNOA 5HAOA 4LT6A 5KG2A 3KK2A 2W9CA 2FVQA 4PRFA 2BUNA 3JB9k 1VQMS 3SMZA 5ETLA 3K89A 1KRPA 4LF4J 1D09B 2BM1A 1AW0A 4O4GA 3NEKA 1FVSA 4AL7A 4JUZA 4B3RJ 1DQ9A 2FC8A 1QJHA 1U26A 1ZAWA 2GQQA 4EU0A 2WRMA 1SL0A 3TZXA 2VBYA 3UVJB 5A8WB 5K9FA 2H4WB 4BCAA 3TUPA 1UW9A 4MK8A 1RCOB 1HWJA 3HFKA 3M6VA 2BJ9A 4H4KC 6FD1A 4FF3A 5HVGA 3GU0A 4DZ6A 1C0TA 2QLXA 2UUWA 4WYLA 2ZH8A 4A8QA 3KLIB 3JSBA 3OHBA 3FBCA 3H2UB 1WG4A 1HHQA 1Q81T 4HVZA 4DV0F 4K5SA 3W64A 3OL7A 4F4YA 1RT3B 2C3MA 2X51A 2Y3YA 2HFOA 2GJIA 2VPWB 1HR0J 4H4OA 4B9VA 1TFWA 4RU2A 4ED1A 3CULA 1X4HA 5KFVA 3UR0A 2YWWA 1JJ4A 2XS2A 1HNVB 3JSMA 3D54A 3VR1A 2E1RA 1AT1B 4DS4A 2UU9F 4A48A 3FNNA 2B7CB 1KS2A 4G1QA 2KKHA 4DOZA 2OP5A 4KYZA 1CLFA 3KNGA 1SUQA 2YY3A 3LW5C 1UWAA 1PBAA 2FUG9 2FHJA 4A46A 3KJFB 4NLSA 5DO2A 2ZBRA 4DPWA 5FLXY 3OL6A 2QE5A 2DK2A 5GADU 1AFJA 2WK4A 3BSCA 3DLJA 5E3AA 3HP6A 1ZETA 2OFGX 2V8DA 3AD9C 1RQ0A 2APOA 3SSQA 3BN7A 3W60A 4CO0A 4B02A 3I0RA 3KG1A 4QYRA 2JFDA 4Y34A 4CO2A 5B09A 1NB7A 3G9CA 1TV6A 2RHSB 2V0NA 2M8HA 2WZ1A 3BGOP 3IRXB 4OFZA 4HDGA 4RLEA 2QMUB 3G6XA 2YNIB 2P6SA 2PFDA 4KY3A 3LTOA 2KRRA 5D4OA 2ZITA 3I5BA 1A7GE 4TY9A 4X65J 2NYHA 2QC3A 4I6AA 4NRTA 4J9RA 4CLFA 1KD1T 2UUAF 2UXBF 4B9SA 2G4BA 1J27A 4TN2A 1LWXA 1KKHA 1SH3A 3NAHA 4PR6A 9ATCB 3MEKA 4B3MJ 2JVOA 3WQPA 3JTOA 3CCRS 5CHCB 3B78A 2IYGA 3VALA 4NA2A 2HHTA 3DHWC 3H5YA 2XMJA 2HAFA 4PAAA 4PQUB 1U1KA 4DMZA 2BEFA 4DSJA 4ED3A 3U27A 4XPCA 2NXEA 2C3UA 4ES3A 3T1HF 4K4SA 1N33J 3CJ3A 1EX8A 4Q8EA 4FXWA 1ZOTA 4K4UA 4TQSA 2DNNA 4ITSA 3GV7B 1XIQA 2VZ9A 1RBAA 4U96A 3TAPA 3W3SA 2J7UA 3A12A 1Y11A 2OTJS 1NXIA 3DLGB 2G0JA 1MW7A 5B0AA 1RT6A 1J2VA 3OR1B 1TVRB 2CQIA 2CQHA 2OEJA 2W7OA 3OTEA 4MIAA 1LXNA 1WC1A 2DB1A 3T9NA 2B43A 4ZHRA 3GQCA 1BXNA 3BZQA 3V81B 4DF8A 2MZQA 3C19A 2A6MA 2J76E 1V5IB 2P9GA 4DR4J 4YDXA 1SJ1A 4PPDA 1F60B 4UF4A 3PX4A 3FSXA 3IGNA 1REVA 2G2YA 3CWJA 3QT8A 3GIRA 1JLFA 5D3GA 3BSAA 3MPDA 4G6VB 1I1GA 4KPCA 1JNZB 4DV0J 1HMVA 1X4BA 2M9KA 3QGPA 4OZ0A 4ZVQB 4CIOA 3NS7B 5K8NA 3ADAC 1WI6A 1JB0C 3EYZA 2BACA 3PHTA 2C2NA 2DXEA 4JP8A 4NLYA 1I94J 4CLPA 2XSJA 3OVSA 2ERRA 1FXRA 4HT5A 2DO0A 2E1PA 4TY8A 1Y5NB 4DL3A 4NASA 1V3ZA 4KPYA 1WSVA 3KYLA 3I4HX 5JXSA 2DH8A 4ETXA 4FF1A 3U02A 2MPUA 2BABA 3MTKA 3VWSA 5A2QY 2ZM6J 2Y9HA 1S9EA 1YJTA 3ZZYA 1RWXB 3TA2A 2XBPA 1RISA 4MK9A 2LP4A 4O44A 3EXYA 4LR8A 3KK3B 1XK8A 4DJBA 3TAQA 3RAMA 3MR7A 1S4EA 2J8AA 4J9KA 2VKZG 5LMNJ 4LR7A 1XR5A 2ZDOA 2YH1A 2YTCA 1TL1B 3H20A 1RWMB 2MZSA 2HS0A 1T94A 3C16A 4HACB 3K0JA 2CPHA 1X4CA 3IP0A 3FEZA 4RW6B 1FO1A 1FDAA 4HL9A 1IKXB 1C4CA 1K0VA 3ZTQA 1JIHA 1HBNB 2A6OA 5KOXA 4B3OB 1CEZA 4OYBA 3NNAA 4EO8A 4IO1A 5HP1B 4YOEA 3UD5A 5KG4A 1M0SA 4DR7J 3LWMA 2FVSA 3D3CJ 1C0TB 1FX4A 1U8WA 2QX0A 2YKNB 4F4WA 4U9RA 5KG6A 3TJAA 2HG4A 1JLGA 4C3MA 4ILMA 1UEUA 3R7NB 1U1NA 2KT2A 1WF1A 2GVZA 2AMCB 5EGYA 3BQ1A 4A8KA 3N28A 1CJUA 4J37A 4CT9A 1WNEA 4YDDB 3GLJA 1WDDA 3NOGA 1E6VB 5BYRA 2ZBPA 2BVZA 5KFTA 1NRKA 2PT0A 1NKCA 1KC8T 2O3DA 1L3UA 1KQSR 2EXUA 2Y0BB 4IG0B 2PA3A 1VHFA 3H2LA 4CLKA 2Z56B 4ZCIA 1SKRA 4QWEA 3PFOA 4NLXA 5B08A 5I4MA 1UA1A 1E6YB 2HFZA 1HWIA 3PY8A 2GO8A 2LXIA 4Y2CA 3KTQA 3JSRA 4ENOA 2LLZA 4AD6A 4QR0A 1NK8A 3PW7A 4YR3A 2Q66A 3LQVA 4ED7A 3W9JA 3AODA 1S1WB 6AT1B 1RP5A 5G0RB 2GZOA 3N6NA 1OYDA 1WJ9A 2GHPA 2AEMA 4ZCMA 1T9YA 3EICA 5F8LA 2E5GA 3VV2B 3K7RA 3PW5A 4CH7A 1SQEA 1NK6A 3A8KA 3VZIA 1TZ0A 3IO1A 1YRXA 2D3O1 2MJNA 3B82A 3R5AA 4ZVTB 4GVBB 4FBTA 3H5SA 4XIUA 2F63A 1R8HA 2B8QA 2Z2YB 4C8MA 4XAKA 2W2NP 2VL1A 2DNMA 3HVWA 2F8HA 1XR6A 1FESA 1HYSA 1D0EA 3DLGA 1YZ6A 3EZUA 1NPRA 3ZTPA 5HMZA 4OLPA 4RBTA 2W9CB 2WB1D 1LW0B 5A2QU 2DXFA 2IM2A 4AFFA 2DKOB 3UNYA 1C1BB 5IT9Y 4TNOA 3BYPA 1H7WA 2COLA 1AXQA 2W24A 3CDEA 4Q2MA 2K7KA 2MKSA 3Q8YA 4K2JA 4F26A 3PW4A 1VBYA 1J5EJ 2W4DA 2NQPA 3QAEA 5KFFA 1VK8A 3LGHA 4TQRA 3PR4A 4N7TA 1D8YA 1R6VA 2OMLA 3DKDA 4X65F 4X4OA 4NWBA 3MI7X 1G4CA 2E9RX 1VC0A 2BDPA 3CXCR 1W2BR 4Q0BB 2EWHA 3LA0A 2OGUA 4O3SA 4K0KF 1KLMA 1RUSA 5DDRC 1UJ4A 1JX4A 2V8HA 4ILLA 4J9LA 3VAMA 3Q8RB 3CC2S 1TKDA 4X4RA 2AJQA 2HW3A 2CDQA 4ZLPA 2DTJA 2V6AA 3D28A 4UOHA 2BANB 3GZ7A 3BR8A 3TZYA 4DS5A 1M5SA 3S01A 3J80U 5A8KA 3MM8B 4BWJA 5KFUA 4USMA 5HK4A 5IV3A 3JQMA 1WDTA 3DGVA 2K1RB 5B0DA 3OV7A 3UVJA 2V9KA 1S10A 2ILYA 3DLHA 2HLUA 5CCLA 2ZWPA 3AJ2A 3TR5A 4QR2A 4KHPF 3SSSA 4Z7CA 3KNAA 3IBCB 4WTYA 4MYTA 3HKWA 4NCAA 3CJ8A 2FHJD 4LFAF 3HSZA 4F3MA 2CJQA 1RA6A 4DWIA 4CO4A 2NLWA 1B0VA 1U0HA 2FJDB 4XK8C 1TP7A 4PXBA 2E5IA 4DR2F 3R5JB 1X9WA 5LSLA 1NSAA 3G8SA 1MG7A 4RW6A 3EX7B 3MPYA 1TKZB 2CNNB 3BPDA 3IS9B 1O5JA 1VRTA 1RAAB 2GNKA 3DYAA 5L9XA 4DXLA 4PQAA 4RU9A 3FBBA 2UP1A 4PXEA 1WWHA 2M8DB 2Z2ZA 3RTVA 2GFFA 1F5AA 4I4BA 4NZ0A 2Q79A 1NK7A 5HBMA 2MKHA 2VKRA 3GFXA 3KK3A 3A1YG 1IR0A 1OIAA 2CNKB 3RGIA 1CSJA 4PG7A 2B8PA 1FFSB 2BX6A 4OX6A 2NSBA 2DT9A 4PXCA 2MSSA 3OFEA 4NYZA 1IBKJ 5IC4B 5AJ3F 3S8SA 4B9MA 2DNGA 2K8GA 3CD7A 5F41A 2Y1JA 3W9HA 5CD4A 3IRXA 2J0SD 2CPDA 1RHMB 2RQKA 3F0NA 3G6YA 2R8GA 2R8JA 3KUHA 2M5YA 3J7A1 3P49B 1T9XA 2CIMA 3X3UA 8ATCB 3PW2A 3HULA 3QLHA 3P6YC 4ANCA 4RUCA 3OSPA 4V19X 1JLGB 2QL9B 1S12A 4ECWA 1QD1A 3OFGA 4UUWA 3MCSA 4NLRA 5KT4A 3SZ2A 4QIVA 3OR1A 5J2PA 1XMQF 5A6PA 5KFBA 3QO9B 1OY6A 3SQGB 2QT7A 2MY7A 5CD4H 1NPPA 2GIQA 4WFNQ 1ZPWX 2DGXA 1GMUA 2HVDA 2AJ0A 3MMCB 5KFAA 3EWGA 4GVBA 1NMEB 4CLUA 1VQ4S 3T9ZA 1VJWA 1EB0A 3FFIB 1TR0A 5KG3A 3DOMB 2MLYA 4M63A 1HNXJ 1RZMA 3CEDA 3HHLA 1UWBA 2IA0A 4NLTA 3PYEA 4YS2A 3D6HB 3MFIA 1HMVB 4FPRA 2BRKA 2Q1LA 4X66J 2Z8QA 2ASJA 3POTA 2J7KA 5AXMA 3N5FA 2V69A 2LEAA 2LKZA 3TAMA 1JLBA 3TUJC 2W9BB 2ZD1B 3T5LA 5BR8J 4Q44A 5I3UA 2JEJA 2RS8A 4O3OA 2EFVA 2VB6A 1B70B 1VI7A 4KH0B 2AW0A 4W98A 3VQSA 4ZHRB 1ZBTA 2DGQA 3D6FB 4YY3J 2R8KA 2RQ4A 4DL6A 1WOPA 2RILA 4P52A 5C5JA 1YJRA 2LMIA 3BKTA 2NXNA 2FD2A 2FLOA 3PEHA 4Q0BA 2QG9B 4CLYA 1B99A 2C2OB 5LM7E 4UW2A 3QFWA 4GO7X 2DR7A 4LVOP 2XLKA 2W4PA 2B9EA 2CVIA 5AXLA 4JI1J 2W8KA 4C11A 1PYTA 1S99A 1S1TA 4I2QA 5D4LA 1UKUA 1O6XA 3FCHA 4DR3F 4GKJF 4RR5A 4K59A 3AA8A 4FP9A 2CG4A 5ETRA 5B0GA 4Q8FA 1JMTA 4DV2F 5LJ5Y 1WHXA 2XZDB 3GJTB 3D66A 4DSIA 1S76D 1WF0A 2N7YA 2HK2A 5D0GA 4ZVGA 1FDBA 4K4WA 1S7IA 3MD3A 3S6EA 3CDAA 4EGLA 1IJEB 4M1KA 1M1HA 4NA3A 4EUVA 3K8WA 3CCVS 3FQKA 1H74A 3THPA 4DQSA 3KLGA 5ETSA 2Y1LB 3ISZA 3GSIA 4JI7F 1CJVA 3C15B 4C8NA 2OSRA 2RRNA 1QTNB 2VUGA 4UUXA 3M6WA 3KG4A 1UPMB 1RHKB 5D4NA 4M5IA 3HZGA 2VJUA 2W25A 5CZVA 2MHEA 4I67A 1RTJB 4ZPTR 4O3QA 2RU9A 1YSJA 3UDVA 2RDJA 2GAGC 2NS1B 2GHVC 3C16B 2AKWB 1H98A 1NDCA 3EGWB 5AE3A 1JQGA 1TKZA 1Q86T 1Q78A 2WVFA 4LSLB 3M32B 3CJKA 3U7JA 4RUHA 3G8QA 3IWXA 5D78A 1EARA 1C1CA 2ALZA 1RT1A 1HBOB 1NCLA 4ECZA 1RAOA 3PO5A 2BOAA 4PWUA 3E3XA 2ZVIA 4I1TA 5IM0A 2N82B 4ZPWR 2XULA 1IKYA 4DSFA 1SCJB 2CDRB 2DNYA 3DLKA 1YRTA 2YKPA 3M05A 2FVRA 1NDPA 5DETA 1Y4ZB 2DRDA 1UA0A 1N32F 1TKXA 2R4FA 1U25A 2HSEB 1DJ0A 3IWNC 2G2ZA 4OI2A 3PVXA 3T6BA 2OH2A 3GIMA 3NXZA 5C24A 2XGPA 5B0CA 4ZDNA 3NNCA 2AGOA 4R5PB 3AOAA 1SC1B 3ZNUA 2FHKA 5KFHA 1VBZA 3QNWB 3GIJA 1Q5VA 3MMAA 2LQ9A 3KDOA 2JX2A 5CZXA 3OTCA 3K5MA 3DOKA 1Y9OA 2XNQA 4OZ3A 4ZK7M 2DR5A 1YG0A 2MQQA 1UEVA 3FQLA 4P10A 2AEFA 4FYWB 4M5NA 3OFHA 3S7RA 2KM8C 4P7TA 4ZCKA 1PJ6A 2OFHX 3CO9A 2JWNA 1FRJA 3HM9A 1QUVA 4D3GA 1V6HA 3IC1A 2E7VA 3M8QB 4USKA 2ZFHA 3QJPA 4DFJA 3G96A 3V6JA 2IM0A 4KGKA 2L48A 1EP4A 1HFEL 3ELHA 3UN3A 1GH8A 2GW8A 2W2PP 1CG2A 2V9WA 4NMLA 1WF2A 4NX9A 3F73A 2WONA 1KHVA 2J7WA 4IFVB 2FHOB 4NPOA 5EWFA 1L3TA 1N5SA 1G3OA 1BQMA 4P75A 5HVHA 1F1BB 2GIRA 4J9UE 1VJQA 1MNEA 4DX8H 1UVJA 2VG5A 5KFNA 2CQBA 1GK8A 2AEJA 2KL8A 2MKCA 1RCXB 3EVWA 3IR6B 1N6QA 3C46A 1HD0A 3IXQA 4GO5X 3HI9A 1S1VB 2DHGA 1FD8A 2KJVA 2QLFB 5L8RC 4ZIVA 3CC7S 1NK5A 2PFFB 2I0XA 2PMZD 2YH0A 4NI2A 1EZZB 1RT4A 2J8SA 3RRGA 4P2SA 2X3GA 4I64A 3FFIA 1T11A 1YJ9S 3BR9A 1N33F 1X4DA 4USJC 1RYRA 3ZNJ1 4LF6F 2P9EA 1PCAA 2B5JA 3CDUA 1IKWA 1T9WA 3V4IB 1UP1A 2EK1A 4DUZJ 3EDQB 4UQTA 4ZJLA 2HIQA 4MKYA 4JI0J 4GC6A 2HBRB 4LBPA 5E41A 3HHNB 4H4MB 2VQFF 3SXLA 5GAHU 2UUAJ 4IRDA 1NU4A 1S0OA 4C2MA 1ZA2B 2HVEA 3A8JA 4HHHA 4LSZB 4OZNA 3FCVA 2DR8A 3ET6A 5IV4A 1KVIA 2OHDA 3DM2A 5L46A 4UQGA 4LRDA 4DV3F 1PAEX 4IG3A 5D0RA 1Q8BA 1FRKA 3HVTB 2V5HG 2WB4A 3D7SB 2WTFA 1DRZA 1JLCA 4WE1A 4D3HA 4X4SA 2AX1A 5K20B 3EVOA 4M94A 2V34A 4YB5A 4N56A 4ELTA 4ZA1A 1YBUA 2WVEA 1RAJA 1SI9A 1ZM9A 1PBUA 1F9EB 2P8IA 4TKTA 2EKYA 5DQIA 2R7UA 1REGX 5E3RA 2KFZA 3SBMA 1FRMA 1NHKL 1RT3A 1BQNB 4NE9C 2FB0A 2IC3B 3OXLA 1T0TV 2HVIA 3UNGC 4JBCA 5E3QA 3C6TB 2GCFA 3EJMA 2AP6A 2XMWA 3KLEA 1FI4A 4LFCJ 4ED5A 1NO8A 3CJKB 2OSQA 3IS9A 3KJVB 2AGQA 4I68A 4ZKAA 3L3CA 2Y0SD 3DMJA 4IKAA 1FT8A 3QWPA 3EUNA 2UVVA 2BKOA 2DISA 4OYZA 4ZN1A 4LSNA 2ZNZA 4XDCA 3RRKA 4DLGA 2VHGA 1X4GA 2YQ1A 3EGNA 1JLEA 3P5TL 4IQMA 3TJ8A 2F7VA 3H98A 3K5NA 1CS4A 3FEYB 3D4JA 1K1QA 4WWSA 1RT7B 2GC8A 3J7ZT 5LMUF 5E2QA 1X31C 4OV1A 1S0NA 1BE4A 1N88A 1PYOB 3UD3P 5J2MB 3A3NB 3M32A 1MROB 3KLFB 3BV8A 7FD1A 2YPZA 3HCXA 3Q8QB 4DQPA 3KWMA 3ETOA 1N54B 2WBMA 1A0OB 1UZDA 3IGVA 3I9V9 3G86A 3C2PA 1RWNB 5CYMB 3DOKB 2OI2A 2IBKA 5T7LA 4WFZA 2DITA 2HZVA 3HHLD 1RWOB 3GFHA 4DR5J 1TQLA 3DOLA 2C2EA 1PAUB 4UOFA 4C0OC 3MHYA 3PTWA 3C6UB 3N4WA 1FNXH 1U09A 4C97A 5EHHA 2L08A 1TK8A 2IDLA 3BGRA 3P5BP 2E5HA 3JQJA 4C3KA 1X9MA 3O5TB 5AXNA 5EN1A 3HD1A 1GX5A 1O51A 1NPKA 1R8PA 1HARA 1S1XA 3DDKA 3JTPA 1KSPA 1JLAB 5KT6A 3CJRA 2DCLA 2XS7A 1HWKA 2D1CA 2C2ZB 2X1GA 3SQOP 3R8YA 4JV1A 4Y28C 4BWMA 3SFGA 5F8IA 3I0SA 2PIIA 5L9NA 1KN6A 1U6ZA 3ZXWA 3KKFA 4DCOB 3UWTA 4NCGB 4QQBA 3W7BA 5C42A 1WORA 2ZHBA 4O0NA 1WUUA 4OX9F 2OD6A 1RHUB 3N0VA 4QIEA 3SCJE 3HHKA 2RDIA 3M6UA 4DCJB 1RBOB 5F9NA 4DUYF 4P73A 2BXJA 1YGYA 1TKTA 5A76A 3M8RA 1FJGJ 2VG6B 2QTWA 4NEYA 2KN4A 2GV1A 3CJ2A 2BJ7A 2AHOB 3TW0A 4EBEA 4ZLJA 5HATA 4CYUB 4PWWA 4JOUA 4OX7A 2QGFB 4KKOB 2D9OA 2R7OA 3TUZC 2ZEJA 3KLGB 4LF5F 1KNZA 3MEEA 1NK9A 4LF8J 2LVWA 3NOCA 4OYIA 1Z2ZA 2QV6A 3CJ5A 1RTHB 5DZ6A 3CJ4A 3CVKA 3CW2C 4DL2A 2HQDA 1FNMA 3M1VB 1DTTB 1RK8A 3HX9A 3AT1B 2RB7A 4IFYA 2UV8G 1Z4UA 1WEZA 4OZ1A 2QLBB 3ENQA 4QWAA 3BQ2A 3ULHA 1GFWB 1TVRA 3J81j 1RAHB 4DF4A 5CA5A 1KR4A 4CM2A 2HHQA 3O1LA 3M2VB 1FFGB 2KI2A 3ZZZA 3N6MA 5CCMA 2KHDA 1B3TA 4FPIA 2QJ3A 1J5EF 2WSEC 2LQBA 5KG0A 3JXOA 3CMQA 3RBDA 3FJ2A 3NCQA 4MKVA 4B3TJ 4I6YA 4FDFA 2HZAA 2FY8A 1TL4A 4CLTA 4FF2A 3BDPA 3MD1A 1N5YA 4C8ZA 3I5CA 1WC6A 3TARA 3D9BA 4R0EA 1YJ7A 2GAHC 2UXDJ 4YB6A 2OPRB 4RNMA 3U1LA 3EVMA 2QSFA 1TUVA 4URQU 3RBXA 1OYEA 5KFRA 4DDFA 1JXEA 2FGOA 2C42A 3Q83A 3FDSA 2BR0A 3DRSA 4H4MA 3DI6B 8RUCA 2BW7A 4QIGA 2FVPA 4PG4A 3DRPA 1SVDA 4G1IA 3HHLC 4I7FB 3SV3A 1D1UA 2FPHX 4ZP7A 4DQIA 4NCBA 1S77D 1P1LA 1SJ3P 4LF7F 4B3OA 2H48B 4OI1A 1DURA 5THWA 1ZM3A 5M2PA 5L1LA 1GAOA 4E98A 3NP5A 5L1JA 2MKYA 2ZH4A 1F2GA 3QT7A 4EO6A 4S0MA 1S6OA 5AT1B 2YQ0A 4Q7AA 3UN2A 1ZA1B 2DGWA 5ITHA 1TL3B 2DNRA 2KT3A 3DLKB 3QWUA 5DRKA 5KFPA 2W8LA 5FJ4A 1KOOA 3VHQA 4OQJA 1YLXA 4B17A 4RW9A 2GVZB 4C7QA 1RI7A 1NM2A 2YWHA 1HNZJ 3GCWP 4ES1A 2IVFB 1NDLA 2FJBB 5C7PA 1HQ2A 5DQGA 3TVKA 5F0UA 2XLIA 3LALA 2C22A 4ED0A 1UETA 4FKYA 1O0PA 1P27B 2YWEA 3LPYA 5KFQA 3RRHA 2MY8A 1X0PA 2F8EX 5LOQA 3ILJA 1IR2A 4ZP6A 3MR6A 4FXDA 4KJIA 3GV5B 4WFXA 4C48A 4G1QB 4OI6A 1SL2A 4UY85 3HK2A 4J9SA 1V5VA 1RT2B 3HHEA 3L95X 3LF0A 1S1UA 3OXFA 1MWZA 2DGTA 3A4TA 2VBXA 2ZOGA 5IC6B 4KFBA 5BJRA 1JLEB 2ZH6A 4DR5F 1H6KX 2PE8A 2PEHA 2XWYA 2Z2MA 3G87A 2V67A 3Q8UA 2LECA 3THVA 1CULA 1S9GA 2NZCA 2W2MP 3CDWA 4HHUA 3ZZUA 4U67Q 3Q8VA 1Q7YT 4M5DB 2OPSB 1F2HA 5HLFA 1HHTP 2B7BB 1GMWA 5GAGU 4RNFA 2C28A 1QTMA 2DCUB 2D3UA 3TA1A 3KG0A 1DTQA 3OTBA 2JRSA 1LKZA 2BQRA 4USWA 2PSZA 4MK7A 1JLAA 2JH3A 3PM9A 5JJBA 2RQCA 3CCES 4F3QA 2KZZA 1UAWA 3FEXB 4NXNF 4NCGA 1B0TA 3BSOA 1HKAA 1ELOA 1FRIA 2G0CA 1M5OC 2OEMA 2R7SA 3H59A 1SIWB 3NCPA 3CMES 2RJZA 2H4YB 3HSJA 4LJMA 4DFPA 4EBDA 1YK9A 3MPVA 4KIAA 3E2EA 4K0KJ 2F4VJ 3PIPQ 1FWLA 4CT8A 2CQDA 2E9TA 4YN3B 4PG6A 1FJ7A 1LNQA 3VAFA 2DR6A 5HQ8A 3DHXA 3IR7B 4Y2MA 4EYHB 1NZ8A 2ZZMA 3TI0A 1P1TA 3CD0A 2O5DA 4G1PA 4NA1A 4OJHA 3V6HA 2GGPA 4OYPA 2MGZA 1R89A 3ICLA 4X62F 4X4TA 4Q43A 2IAJA 3EGZA 4F4XA 3M1VA 3MMBA 1WC3A 4Y2AA 4C8YA 3DLEB 1RTHA 5BYSA 2AU0A 2FJVA 2HMIA 2CNOB 1RT6B 1Q79A 3HT0A 3KK1B 1F3VA 3GIKA 1S97A 5IS2A 1Q8LA 3CCTA 2PDAA 3D68A 2BZ2A 2QA4G 3QT6A 1UVLA 4IOBA 1FK9B 3MMJA 3UO0A 3M7VA 2X1BA 4LFBF 5B0FA 1JK9B 4RX6A 3D5MA 2VFSA 2C2KB 2AJ4A 4F0MA 4YFUA 4I69A 1IXKA 2G0IA 3WZ0A 4ER8A 2MTLA 3KMSA 5ETQA 3HVTA 2XY5A 5GVQA 2B6AA 4ECVA 2ATCB 1AYEA 2FHMA 4U7CA 1Y3KA 1FJEB 2VG7A 3IAM9 8AT1B 1NUEA 1FNOA 2CRLA 5J2NB 4B3TF 2OPRA 1FERA 4JI3F 4M5GA 2IM3A 2NXJA 5AJ3J 1WTFA 4IFYB 2KFYA 3IG1B 3I87A 4B08A 4TU8A 2E5LF 3FVYA 1SC6A 2HNDA 2BQUA 2ATLA 2P5VA 2BANA 4RWXA 1YQHA 1SIZA 2CXEA 5ETOA 3M8WA 1OY9A 4KB7A 5IQQA 2MZRA 4Q5VA 1LV5A 3KLFA 1HNZF 1MMDA 3G6ES 4ECTA 2N4CA 2YQ3A 3J81Y 2R8IA 1SC4B 2F3JA 2XMVA 4KSEB 5BR8F 1FFWB 2HS3A 2UVWA 1U6BA 2VDIA 1RAEB 1RWUA 1XMQJ 4F7VA 4HDHA 4F36A 2J0QD 5DDQC 4CLZA 4CH0S 3FMWA 1CJUB 3O6QA 3W5ZA 3MUVP 1JLQB 3TJ9A 1U6FA 4J91A 3T19A 1Q8KA 1SKUB 4C9DA 3BF4A 1AROP 2X7IA 3MM6B 1WHVA 2GQ2A 2RDDA 4WJBA 5I3PA 3SCKE 2XQCA 2Q43A 2KU7A 2BBEA 1MROA 4ECXA 3PKMA 2DPJA 2JOQA 2LFVA 3CIZA 4DV7F 3J7AN 3NGRA 3CD6S 2R2TA 1VQLS 4BBYA 1KTVA 1VQYA 1SC3B 2YNHA 4FNHA 2AIRB 2J9DA 4NLWA 4RW7B 4I2PB 4WK3A 3SIPB 4LF8F 1C0UB 2VPYB 3HHDA 1IBLF 2HK3A 1QUPA 4R8UA 3BO3A 4PPZA 2YWFA 1FKPB 2YBVA 2R7WA 3Q23A 4WP8A 1QDUB 1YBTA 5HQLA 4NXNJ 3HJVA 2QLWA 3LAMA 4V1Ak 1N5QA 2KHCA 2XM3A 3QAUA 1X8DA 2RD5C 4DV1F 4ECYA 1AB8A 1EQMA 3V6DA 3TVYA 1I94F 2HHXA 4ED6A 2IJRA 2E44A 4OYOA 1WEXA 1S79A 1X0FA 1BQXA 1GXTA 1PILA 2G2OA 3QZ7A 1J5OB 3HZEA 1WG1A 5L38A 4UTGA 1HWUA 2HFNA 3PEJA 1F3FA 4H54A 3K5LA 4WIQA 1KLMB 1Y0HA 2DHXA 4GKJJ 1TL7B 2ADCA 4H4KA 1WSRA 2L9WA 4HTIA 4DV2J 5J1PA 3H40A 3BO4A 4AT1B 1Q53A 2WSFC 2YNGA 2ZDPA 3CJ0A 3C3LA 2FGCA 3CSKA 2PC6A 1VQPS 3AQPA 3NCRA 3WIVA 3NNHA 3WBZA 1BLUA 4OYXA 1DLOA 4HI2A 1FKOB 1P9QC 4CTAA 2MGZB 2I9SA 3KHGA 2W1BA 1UWBB 1HQUA 2IHR1 3QRPA 3A3PB 1N5VA 3DDIA 1I6JA 2RIJA 2PI4A 3MGJA 3AAWB 5I42B 2JNJA 3PRBA 5DGAA 4PUOA 3KLHA 4HYKA 4DL7A 4E0DA 2CG8A 3K17A 3GYGA 1CJTB 1V3RA 4FYVB 3NGTA 3HMJG 3NGUA 2OPPB 2B0GA 3FBFA 5IWAF 4EEYA 2P2CB 1FXDA 3G71S 3LO3A 4DR3J 3TQ1A 2DHSA 2LU1A 3BM7A 4LIRA 4P2FA 3CC4S 4WP9A 1HPZB 4TLQA 5KFDA 4M5LA 1QVGR 3R2DJ 2IIHA 3W2WB 1S7HA 3VGVA 1R31A 2AJ1A 3CJQA 2JFKA 2PGCA 2K7JA 4N8OA 3UCGA 5E3PA 4A4JA 1S5ZA 5KFXA 4DCPB 5EUHA 4WZQA 1GTHA 3R5DA 2BRLA 2HFSA 3PRVA 3AD8C 2E5JA 2QYGA 2D3OR 1ZZNA 2J5AA 1VR6A 3ILOA 3MURP 1S1TB 2AT1B 2IFXA 3R5GA 4I2QB 4J9MA 2KB2A 1NH7A 3LP1B 2I5JB 1H2UX 3AH6A 5A0YA 1N32J 1D8ZA 2XMTA 3W62A 1HBUA 4RZRA 2E5LJ 3M30B 2EI5A 3D0GE 3QJJA 2M4MA 3OTOF 4CNZA 3VQTA 4EFAC 1XMBA 3HVAA 5KFOA 2D3ZA 1VIXA 2XO6A 2R8HA 4BS2A 5CABA 3WX8A 3QLHB 1F6TA 3G8TA 1G2EA 1CJVB 3PCOB 1YJWS 2RUGA 3A8IA 3ILLA 1VCTA 3MCOA 5F8MA 4JYAJ 5J2PB 2XY7A 3SQGA 3O8WA 1BD6A 2ZUGA 3OR2B 1GEHA 2DH7A 1VDHA 2EC2A 3EZOA 4NZ7A 2VA3A 1CQNA 1N48A 1WOSA 3FRZA 2OPSA 3BYRA 3PG9A 3PRDA 4RBUA 4ZVSB 1P9YA 3M8YA 2V2KA 1YI2S 3QZ8A 1VRTB 2J0WA 2ROGA 3NS6A 4LRCA 2HWTA 1LWCB 2RUSA 4CO5A 1FA0A 1XEZA 1YVFA 1DHMA 4QPTA 4PKDB 4DFMA 4MFBA 3TANA 4F02A 5GAHI 1U0SA 2XYGB 4X62J 4ERDA 2CPZA 3E01B 2MYFA 3O3LA 4P7VA 2RF2A 5IZHA 2R2UA 1FKPA 2ZHAA 3Q24A 1CC8A 1Q16B 2C2DA 1OJ4A 4R8UB 3QO9A 4DV3J 4WK1A 1FEHA 1FHTA 2ZD1A 4C8OA 1RWWB 2OLWA 2XEXA 1WC4A 2CQ3A 2F9DA 2BV3A 3CJTA 1XNQF 3I82A 4M5DA 3I0RB 3I56S 2OPQA 5KFMA 1CULB 1S9GB 4QPXA 4OYMA 3ZTSA 3MFHA 4NLGA 1RTIB 1H73A 1OSDA 4K4TA 4DV1J 1WKKA 3RG6A 1DTQB 3P96A 1U8SA 2ACYA 1XERA 4HI1A 3KLVA 1O8BA 2Z4PA 1TK5A 4I2PA 1U2CA 4ZCLA 3M9OB 2MKJA 3KK2B 1T05A 3NY0A 3W66A 2NUUG 2J9DE 2V8VA 3LANA 4ZJOA 2ZH9A 1DFDA 3CMAS 2XCPA 2AZ3A 2WCXA 3HT3A 2VONA 2DGVA 2MQ8A 1R0CB 4L74A 3GILA 4KQZA 5KFZA 4IOAQ 1SQFA 1XBWA 2R7QA 1WEYA 3GTYX 5A8KB 5HSPA 4JI4F 4FS2A 2HZCA 4LFAJ 4E2FB 4X4UA 3NMRA 1LFPA 3MAAA 1FKOA 1X5OA 1AUSL 2QFIA 4CTAB 7FDRA 4N8NA 4YQWA 1KVJA 4WPAA 2QA1A 5D4PA 3W8PA 3BO2A 3D6MB 3HHLB 3MECB 3DNCA 3SV4A 4DQRA 3KDNA 3FZBA 2X1AA 2V68A 1SV5A 4IFVA 4YUDA 1HI8A 5IT0A 3UCZP 3PW0A 2Y1RI 4DZDA 3OLAA 3GMGA 1IKWB 2BJ1A 3RW6A 1Q95G 4LQ9A 1U1LA 3PV8A 1CJTA 3SDEB 3KK1A 3EGVA 5KFWA 3BKUA 3SEOA 2DEIA 4MIBA 3HFVA 4O4GB 1RSCA 5FD1A 5K5MA 1HPZA 3W5YA 3DC2A 3T1HJ 1ZTTA 4JI5F 1VISA 4OI0A 1X9SA 3LWLA 4DV7J 2ZH1A 1UJ5A 2EPIA 2G9OA 5SUHA 4WU3A 2H1YA 4CO3A 1GNKA 1BY9A 1REVB 4F8RA 3RB3A 1R3NA 2HWIA 2YWGA 3UR3C 3PYGA 5FIIA 3U1MA 1IR1A 1R6YA 2HNYB 3A3OB 4PXDA 2DEJA 1T95A 3RU0A 2MDAA 1JLQA 2CKWA 1RTJA 3MCNA 2XI2A 2MXYA 1TU0B 3B4MA 2IBOA 1P8GA 2JLEA 4TY8B 2MKKA 2FY1A 5C24B 1HA1A 2GS8A 4F4AA 3DU6A 4JV0A 4H4OB 2MZ1A 2QLJB 2LQ5A 1HBUB 1QM9A 2IYIA 1NNDA 3P45B 1JXLA 2KTQA 3L7OA 3C14B 2C3YA 4KGZB 3RUBL 4N41A 2W9AA 3HKZD 1X60A 5AE2A 1NZAA 1MN9A 2HFUA 3KHLA 1HR0F 5KFCA 2XMAA 1H38A 4M5MA 5IT9U 3ENAA 2DRAA 1RHQB 2LDYA 2XWXA 3OVBA 2IRXA 1SKWA 3M2UA 1NH8A 1P6TA 1ITPA 2VJVA 2UXBJ 3MEDA 4RW4B 2CJAA 4YB7A 2M88A 5DM7Q 4URSA 3R6LB 3R1HA 1XMOJ 1RT7A 3BGLA 2L3MA 1IKVA 5GAGI 2CVEA 2EFPA 4MAKA 6FDRA 1Q0NA 4LRFA 4AXJA 2L9DA 1U1RA 4LF7J 2E1MC 2YNHB 3W2VB 1RB0A 5A8RB 1B0PA 1IUJA 5B7WA 4KC5A 2FC9A 1QAIA 4IDKA 1RABB 2VFRA 4NLPA 1VLOA 3PDNA 4MFBB 4TLRA 3ZZRA 2MLXA 2YKNA 1M1GA 5CYMA 4FYXB 3W65A 2J9CA 4F67A 1X5TA 4WIIA 3QRQA 1UVIA 1BGXT 3NMAA 3NGKA 4M5JA 1PJ7A 4X4PA 3VCDA 2VBWA 3H5UA 3Q2SC 2DY1A 5D6GA 1D9FA 5F8HA 2YKOA 3M9NB 1IBMJ 2IMWP 4G3IA 3FRYA 1LFWA 5T41A 1RJJA 2DGOA 2V4RA 3SI8A 2ZOMA 4AXIA 2DGUA 4B9TA 2QN6B 2LDIA 3MPUB 5H9EJ 5KAKA 2OAUA 5CH7B 5CYQA 5D15A 2DYAA 1FCAA 1WHYA 4JI4J 5IQ6A 2CQ0A 1XN9A 1SB6A 5KFSA 3TX8A 1L5UA 1H2TZ 5KG1A 3QYYA 1F5CA 1R43A 2C1EB 3BBFA 5I42A 2GQCA 1KQKA 4OHXA 3DGPA 4PZVA 3NLCA 3GV8B 4N47A 2NXCA 4JYAF 1FWPA 2ZZNA 1S6UA 2LU2A 2ZE2A 3O44A 4ZVOB 1KVKA 2F5GA 4RW8B 1RYSA 2KZMA 4LF6J 2OO4A 4X64F 4LR9A 2QA4S 1N6QB 1HWLA 3D6TB 4ZP9A 4CH1A 2XZTB 1N0VC 1T9UA 2IRYA 4Y2IA 3H4DA 5D8HB 5ETVA 5HVFA 3MM7B 4J9QA 4O3NA 2HURA 1H2VZ 2VQEJ 4Y0FA 2CPIA 1RHRB 2B5JB 1EKRA 3BB5A 3BBBA 3C15A 3V4MA 1CJKB 3HLUA 3MCMA 5D77A 3QPIA 4ATNA 4TYBA 2UVRA 4JV2A 1HQEA 3MTJA 4FNIA 1EIYB 3OJSA 2JLGA 2XSJB 3K5PA 3SDEA 2H9ZA 4OJ1A 1V9OA 1YRUA 4FZVA 4USHA 1KWMA 3G2XA 2I5JA 3VGSA 2JDJA 5LXRA 3R27A 1FDDA 1N5TA 4RUBA 5GADI 1UVKA 3BREA 1GX6A 3J7YI 5LMNF 2HHHJ 1ZZFA 4B3RF 4C98A 2LYVA 4A8FA 2IM1A 4QCLA 2JJ4D 1DAXA 1GMVA 3VZHA 1I51B 1X4AA 1W26A 4WP3A 2NPFA 5HQMA 4WE1B 1NJWA 3W1YC 2M7SA 3BJYA 4F4KA 3FCWA 3IBWA 4ZVEA 2R42A 4P74A 1SH2A 1JNRB 2GO9A 3P3DA 4NLQA 4TU9A 5JUMA 3R3TA 1TL1A 5H9FJ 3T41A 5SZTA 1DBDA 1RGVA 4DX7A 3KLEB 3LP1A 1UCNA 4OJGA 3DRYA 4B9LA 3CPWR 4ZPBA 2YNIA 4I7FA 3DMJB 2DNHA 3AXMA 5KOWA 1S9EB 1VBKA 4F0HA 1T03B 1X4FA 4CLSA 3US5A 1JJ2R 5J1EA 2XI3A 4OZJA 4IOCQ 2PMWA 1Y5LB 1VHIA 3UE2A 1I5OB 1MWQA 4IYQA 3EXCX 2A2DA 2B4VA 1KONA 2M70A 2J9EA 2NSCA 2QMXA 2CFXA 4MT1A 3AOBA 4RO0A 4DSEA 5CYJA 4OYAA 3BEGB 4J5OA 3CJSA 2BJ3A 5FDLB 1QE1A 2D74B 5HN0A 2ZBCA 1S72S 1N36J 4KO0B 1K1SA 3J81U 2ZHOA 2I2YA 3MM5A 3IWLA 1VC5A 4UZBA 1IM6A 1NAQA 2E7XA 3CNQP 5A8RA 3AB2B 5ETTA 3W2VA 4U95A 2HEKA 2JVRA 1KHWA 9RUBA 3OJUA 1LWCA 1ROFA 1ZS6A 3TRGA 2LQ8A 3IM8A 4GVLA 1RTDB 1S49A 2DIUA 2ZJPQ 1U49A 2XNRA 3IAS9 1VMBA 3NBPB 3O2IA 2ZH3A 1BWVA 3FMBA 1R27B 2GMJA 1R8BA 2VG5B 1RKIA 4C8KA 3R1LA 1S48A 1C4AA 3JAMU 2MSTA 3LP0B 1JKHB 1LXJA 4NLOA 3OUYB 3FSIA 2VQEF 1S9FA 4NLDA 2DR9A 1QVFR 1XNRF 1WKLA 4BHQA 2BE9B 4WFYA 2WBRA 3GYNA 4DSKA 2Y1IA 4U7UK 1TAQA 1PG5B 2Z30B 4HH0A 2BE7D 1NSQA 4QYZJ 4ED8A 1SJ4P 1F0XA 3M9MB 1S1UB 1U02A
chains in the Genus database with same CATH topology
2LEBA 3GWCA 1S1WA 4I56A 5C42B 2P9CA 3QIDA 5DDOC 3CDBA 1ZPVA 2WOMA 4IH7A 3N79A 1U2RA 4IRKA 4CQ1A 2XMMA 1M1KT 2BQ3A 1KLNA 4L6V3 2HVZA 1WI8A 3F56A 4TYAA 2ROEA 2VOOA 3UD4P 1VIOA 2NR0A 2Q6BA 4OIXA 1R0AA 1HYSB 1LWFA 3DXBA 2E7WA 3MEEB 1U1QA 2ZC4A 4WKRA 5KFIA 4DR7F 5HL7Q 2GMHA 3J80Y 2XGQA 1F9FA 1VQSA 2RQMA 3DFEA 2CQGA 2X1FA 2DNZA 2BE2B 1D3WA 1S0VA 2CQ4A 1N0UA 3PKYA 3DYAB 2N4DA 3BGFA 3KJVA 2OD4A 4DPOA 4JI6F 3SCIE 4ILRA 4ELUA 1UMJA 2FLNA 4N5SA 3V6KA 1N56A 2EC0A 4K5RA 2DHAA 1HNIA 1VQ9S 1TL3A 1N5YB 1HI0P 2MQPA 1MMLA 5MLCV 3J7YU 3MXHP 3H5XA 1BC6A 1IN0A 1G6BA 2MKIA 3RBEA 2DD8S 1ZAXA 4ICLA 2RSQA 2B4OA 3ENWA 1SBRA 3GE9A 3MR5A 1K73T 4Y00A 2VV5A 2E1AA 5EWGA 5KFLA 3U1NA 5F8JA 1QY7A 2DNPA 2ASLA 4HHJA 3EPGA 2BJEA 2RRAA 2GJ2A 4WXOA 2HWHA 3PJXA 1FKAF 1HI1A 4X4NA 4KFBB 2XB2D 2ZH5A 2DJWA 2VFUA 1HHSA 3KMQA 4M8LA 3D1HA 4MKAA 3IN5A 4X2BA 3ITHA 3QMQA 2EVZA 4UOCA 5BYQA 3MUTP 1L3KA 3DRPB 4KO0A 1IKVB 1HNVA 5CYQB 3N01A 1S4FA 4RNOA 5A6WA 1FE0A 4MYUA 2F1FA 2JLFA 4Z2XA 2A3JA 3PFEA 3DRRB 1RT2A 4IRCA 5IM0B 2MQMA 3ZFVA 3DCAA 4AL6A 5T14A 1Q4RA 1CQMA 4KHRA 5EDWA 2EG1A 1HNXF 1JLBB 3BN4A 4WFAQ 1VK3A 1DQAA 1HNWF 5DDPC 4J9PA 4HEA9 1C2PA 1TL5A 3OVAA 3AHPA 1WHWA 3J7Z5 2U2FA 4QW8A 1K8AT 2IRUA 2YNFA 3PHEA 2C3PA 2W7AA 2CPEA 5F8NA 4NZ6A 4K2XA 3POTB 1OS5A 4URGA 3NBPA 2VBZA 2K2PA 3H25A 2FIUA 3OBIA 3TO8A 5I3UB 4K4ZA 2WOMB 2FJXA 1A9NB 3HJFA 1FE4A 1NHUA 4NRUA 1Q8IA 3D1OA 2JZ5A 3H2VE 2NYIA 3QGIA 2KM8B 2R2SA 4OHVA 4ID8A 1LWEB 1YJNS 3DOMA 1S0MA 1PO6A 2EK6A 3CD5A 2B6AB 2NUHA 3CB4A 1LWFB 2CJ9A 1VRUB 3KFWX 2M0GB 3MMBB 3MWBA 3PXGa 2XCAA 3V6DA 1HQEB 4WXWA 3K58A 2C2RA 2CQPA 1EETA 1U4BA 4WYWA 4X84A 2DBBA 4KV8B 4DG1B 4RNNA 2W9BA 2HNDB 2GMLA 2HMIB 3OXGA 2FTRA 1KQGB 4O3RA 5HO4A 4DV4F 2VH7A 1S1VA 2OIHA 1ZAVA 4IUFA 4AL5A 3MAHA 5LL6d 2AYBA 1HBOA 1IQTA 2G1DA 4AE5A 1DLOB 4RWWA 4GKKF 1TFYA 3BSNA 4PWDA 1MSWD 2I38A 5C25A 4A8MP 4JV5F 1R0AB 2VPZB 1TK0A 1T8EA 1NHVA 2JC0A 1UVNA 3CCMS 2QO3A 2UVUA 3T3FA 4PUOB 2DPIA 2HHPA 2OTLS 1G7CB 2HGNA 4QWCA 2C3OA 5FDLA 3VAJA 2AV5A 2CPYA 3HXMA 4OHYA 2DNKA 3VF0B 2B9YA 3V5RA 4J9NA 2KO1A 4HH1A 2BE2A 2QYCA 4QOTA 2PD1A 3RAXA 3FZ2A 3QJLA 4X4VA 5F0WA 1VLYA 1RT1B 2PN6A 5GAEU 2V94A 2VPXB 4BC7A 3RB4A 1SKSA 2HHUA 3ISND 2ZH7A 1U24A 4R0JA 1U1MA 3NWGA 4WFBQ 1T03A 1FJGF 4OI3A 1VGYA 3MM9B 5J1EB 3MOZA 3KLIA 4IO9Q 1HNIB 1RKJA 4OZLA 1JJHA 5E0OA 2UXDF 4YB1P 4KR0B 2R7RA 1M5PC 1B7FA 2LXUA 3LGNA 3Q0AA 1B64A 4F4ZA 2WSCC 2I1RA 3OUYA 2FJWA 3Q8SB 3M8QA 4FXVA 4NXMF 2JEGA 3PIOQ 1Y00A 1PC5A 1NJZA 2MZTA 1FDNA 2HVHA 3MMAB 4NL5A 2E1CA 2EFGA 4CO1A 3NL0A 1N52B 1YIJS 4FVMA 1OPZA 4OL8A 3MOJB 3TAMB 3MF5A 2IJNA 3VAHA 2EW9A 3WC0A 2DNQA 2ZJRQ 1JKHA 2ADBA 2NZ4A 5LJ3Y 4IG0A 3RB0A 4EYIB 2RH3A 4FS1A 3HDSA 1NKEA 2XSFA 1LK7A 4IR9A 1WELA 1WD6A 2ABYA 2AYGA 2ZJQQ 3AA9A 4OHWA 1SJQA 4L3NA 3PX6A 1IJFB 3JSYA 3ISNC 3DLLQ 3TNVA 5CQGA 4B9UA 2D7SA 5H1SV 3TP2A 2HAIA 5JVGQ 1Y3JA 3V2UC 2H5EA 1OQ3A 4YR0A 1FK9A 1IQZA 3BGUA 5DG9A 1NKBA 4QU7A 1RT4B 3WC2A 3C66A 2CQ2A 4O0IA 5F3TA 2O01C 5EX3A 3ZZ0A 3UW1A 3T1YF 4A47A 5HI7A 1XR7A 5KT2A 1GQEA 3D0IE 4DSLA 2O67A 4ZP8A 3T5KA 4C4WA 1S6QB 1DQ8A 4P6QA 5M2UA 3GSDA 3IG1A 5L1KA 1RT5B 1RA7A 1JWWA 4KV8A 4DG1A 2IC3A 4ICLB 1N4LA 4UY8T 4MMOA 2UUTA 4C8LA 4OHZA 5A8WA 3W2WA 1NEEA 1QAYA 2Q6CA 1Y5IB 3LOUA 3RR8A 3I5AA 2CPJA 4KKOA 4IR1A 1LW2A 5KT3A 5E5NA 4U6PA 1N8RT 2HRUA 4ES2A 5LSRA 2XY6A 1KQFB 1WACA 1NK0A 2RMLA 3MZIA 2VODA 3DXSX 1FEEA 2QSWA 3MR2A 4ELVA 2KG0A 2LA4A 1XMOF 1Q7LB 3CCZA 4R25A 3TOQA 3G6VA 1L3VA 1VQ6S 5ADZA 1UFWA 2Z2LA 3Q22A 3SYZA 2OKQA 3F41A 3M30A 4LF4F 1HBNA 2LQJA 3R5CA 5A0YB 4R5PA 5KFGA 1F5BA 5E7OB 2EFNA 2QZ8A 2ZKTA 4EZ9A 1E6YA 2A18A 2HLTA 4OI4A 5HP1A 3EZ5A 3GIIA 2VA2A 1FRHA 2ZC3A 2B9XA 2HRYA 1FRXA 3THTA 3AQOA 3NS5A 1VQNS 3LH2S 2XC9A 3DRXA 1T7PA 1TAUA 1MU2A 1ZM2A 3M2RB 1YTYA 1VQKS 3GFYA 2JEIA 2DRBA 3DRSB 1E6VA 2XMUA 4NYOA 4RW4A 3OW2R 5F9LA 4ECRA 1FTCA 4MJKA 4DFKA 1NJIT 3C6TA 4HKQA 2JL9A 1H3DA 3ZZOA 1LOUA 3BQ0A 2HHVA 2DH9A 4QR1A 1IBMF 3DRRA 2JEFA 3ENVA 3PX0A 1NJYA 1FVQA 4F50A 2J0XA 2WONB 3TYTA 4DR1F 2MMYA 2E66A 4X66F 4OZ5A 2XO7A 2ZVSA 1U45A 2FLPA 5G0RA 1Z2LA 3E01A 2M52A 3QGHA 1LQ9A 3ZC4A 5GMKa 3RYLA 2A2CA 3K57A 1LW0A 5EX0A 2RKIB 2DVIA 4RW9B 3RB6A 2VFTA 4A8WA 3DU5A 2AGPA 2VG6A 4DUZF 1QAXA 2RE1A 3I31A 3L7PA 3D2WA 1RTIA 3G4SS 1VQ7S 4F2RA 4KBIA 3TUIC 4XDDA 5DG8A 1MMNA 2AD9A 1OWXA 4LQ3A 3LP2A 1ZM4A 1RDRA 2HS4A 4MTPA 5IT4A 4RUAA 1D9AA 2HGLA 1C1BA 1MWYA 4DL0C 4LIWA 3HO1A 3PJWA 4DV6F 1S6PB 2ZE2B 4F2SA 3M6XA 4RW8A 3NRBA 2M3DA 2WAQD 4ID5B 3BGRB 3KOAA 3GG0A 1UL3A 2HNZA 2PA8D 4QJVA 2RU3A 1OQ6A 5HROB 3M8PA 3UPFA 4CZCA 1QSYA 4LMZA 1NK4A 1GTEA 3E8OA 1JLFB 5D3GB 3D0HE 2YX7A 4PG8A 3Q8PB 4ZS6A 4DEZA 5DGBA 1JLCB 2GX8A 4PG5A 2D9PA 2P6TA 2E29A 5KFEA