3B6BA

Crystal structure of acanthamoeba polyphaga mimivirus nucleoside diphosphate kinase complexed with dgdp
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
131
structure length
131
Chain Sequence
GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
total genus 44
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2007-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3b6bA00
1NLKL 3EVMA 3B54A 4ENOA 3EICA 1NDPA 1EHWA 1K44A 1NB2A 3Q86A 3FBBA 3B6BA 4S0MA 5CAAA 1JXVA 1NUEA 2BX6A 3FKBA 2BEFA 4DZ6A 1B99A 3ENAA 1MN7A 3VGVA 3ZTOA 3ELHA 1NDKA 3ZTQA 3Q8YA 3Q8UA 4ANEA 3R9LA 1VYAA 4WBFA 1LEOA 3PRVA 3NGTA 1BHNA 3EM1A 4HR2A 3ZTSA 3Q83A 1NDLA 3L7UA 1PKUA 3VGTA 4W98A 3FC9A 5C7PA 1B4SA 4UOGA 4DUTA 3JS9A 2DXDA 3ETMA 3FCVA 4ANDA 3BBFA 3BBCA 1ZS6A 2AZ1A 1S57A 1BUXA 1WKKA 2ZUAA 3FBCA 4C6AA 2DXFA 4UOHA 3VVUA 3VGUA 1S5ZA 3FCWA 4KPCA 3ZTPA 3DKDA 1U8WA 1KDNA 4DI6A 3NGSA 2VU5A 1WKLA 4UOFA 3FBEA 3WX8A 2HVEA 1NHKL 3EMTA 3BH7B 3BH6B 4F36A 4FKXA 1NSPA 1F3FA 2HURA 4FKYA 2DYAA 3EE3A 3G2XA 1NPKA 2DY9A 3EVWA 1UCNA 3Q89A 3VVTA 1HHQA 1PAEX 2NCKL 2HVDA 5IOLA 3DDIA 2B8PA 3GPAA 1XQIA 5CABA 1NSQA 1NDCA 2DXEA 1WKJA 3GP9A 1BE4A 3PJ9A 1XIQA 3EVOA 3NGRA 2B8QA 2CWKA 4O0NA 1HLWA 1F6TA 1W7WA 3NGUA 3BBBA 3ZTRA 2AZ3A 4F4AA 1HIYA 1MN9A 1NCLA 1NSKL 1S59A 3Q8VA 5BXIA 1LWXA 4ANCA 3FBFA 4CP5A 3VGSA 3MPDA 3EJMA 4EK2A
chains in the Genus database with same CATH superfamily
4DUYF 4LIRA 4CDIA 2ZC4A 3MTKA 5KOWA 2VFTA 2ZWOA 2YNFA 3QQCD 5HATA 2OGUA 2EC2A 1WOOA 2D9PA 5GADI 4EUVA 5GMDA 1N5YA 2JNJA 4G1QB 2JVRA 1RTJA 3Q83A 3VGTA 2YTCA 4HHHA 3B8HA 3DC2A 3ET6B 2OKQA 5E3RA 4P6QA 1U1LA 2WONA 1CQNA 2G2ZA 3MM6A 3SDEB 4ES1A 3QSIA 5EWEA 2ZH1A 2L9NA 1MWZA 2W9BA 1WKLA 4HHJA 1F5AA 1Y10A 5DDQC 3ZO7A 2QLJB 3MM8A 3SQGA 4B3MF 5E3PA 2Z2YB 5KFGA 2V2ZA 2XMVA 2ZE2B 1N56A 4DJBA 3WHIA 1RYSA 3KHGA 3J7A1 5E5NA 3M6VA 1S4FA 1RHQB 2J9CA 3J7YI 2M8HA 2CJAA 4JYAJ 1EETA 1KN6A 3NS5A 3WDOA 2GMJA 1WDDA 1FDDA 1BGXT 3HI9A 2W2NP 2VA2A 2K1RA 1LWEB 1QAIA 5ETNA 2WSEC 1NM2A 3RYLA 1C1CA 4ZJLA 2VHGA 1EAYC 5HROB 3M7VA 4RBUA 4JI0J 1AYEA 4ZIVA 5IWAF 1U2FA 2XZTB 3O1LA 2XSFA 2R42A 1YJ7A 5HLFA 5LXYA 3OLAA 4R0JA 2RILA 2ZH3A 3LQVA 4KRWA 2YH1A 3EMTA 4IG0B 2AKWB 3H4DA 1M5SA 4IR9A 1JXEA 3ZZUA 2IIHA 3OVAA 2OO4A 5T7LA 3T6BA 2EK1A 1NO8A 4LMZA 5T14A 3JXOA 3I87A 1N5SA 2V69A 1FO1A 2W7AA 1SQGA 1NZ8A 1F6TA 5ETMA 2OSRA 1K8AT 3CCRS 3KJNB 3TJ8A 2AF6A 4TQSA 3KG0A 3L4BC 2PN6A 3SYZA 4YR2A 3AA9A 4GO7X 3EVMA 3BDEA 4DR1F 3S01A 3H5YA 1IR0A 3OFFA 2J0XA 5C24B 2Y8YA 3Q86A 2HHPA 4B9MA 3OL9A 2X1BA 1M1GA 4DV5F 3HJFA 3MPYA 4K0KF 3RBZA 3FQLA 4XIUA 4OZ5A 1YSJA 1Y5LB 3F44A 4DCPB 4PPDA 1U6BA 4U8YA 1U1OA 3PW7A 4PYDA 3DGVA 2J0QD 5KT5A 3KLHB 3Q8QB 1S6QB 4Q2MA 1PBUA 3MR6A 1RLDA 2IHR1 1GX6A 4OHVA 4LF5F 8RUCA 4RW8A 2CQ1A 2CVIA 2QA4S 5L9NA 5M2RA 2YNGB 2YNIA 1QLNA 2UUBF 2HS3A 2GNKA 4H4KC 2APOA 2L41A 1DQ9A 1RT6A 4DV2J 1URNA 3LP0B 4K59A 5BXIA 4U96A 3DRSA 3M6WA 2VG7A 2BW7A 5IM0A 2K06A 3VF0B 2NXCA 2HFUA 4NYZA 3OV7A 1CS4A 4R5PA 5I42B 1A0OB 2MJNA 3AQOA 1D9FA 2YWKA 3QJPA 5D6GA 3NEKA 4V1Ak 4CLUA 4X62F 5EGYA 2XHCA 3M9MB 3FZ2A 1FNOA 1C1BB 4RBVA 2DR5A 3THTA 3GSDA 3P4UB 3ENWA 4NLVA 1CJKB 2BRLA 1JJHA 2VASA 4C6AA 3C6UB 4J9QA 3IRXA 1HNVB 3HKZD 3CD5A 1RA6A 5KG4A 2QMWA 1NEEA 4B9NA 4XO0A 2HBRB 2F65A 5FLXU 4LR8A 4ICLB 2ILYA 5A8WA 4PG6A 1F5BA 1F9EB 3VVTA 3DGPB 3QRRA 3TZXA 2LECA 3BO3A 2DRAA 2OPPB 1V5IB 2XLJA 4CM2A 3DCAA 2VOOA 5J2PB 2R8IA 4K4SA 2ZH2A 4JV5F 1JXLA 3UN2A 1BLUA 5J2NA 3GQCA 5DM6Q 2HRTA 2F63A 4DZDA 1U1RA 1WJ9A 2NZ4A 1RAOA 2A6OA 2GJIA 5JUMA 5CZXA 4NLOA 5KFWA 5K8PA 3TAMA 4WXWA 1FCAA 1VQ9S 3A3NB 1R8BA 2ZC3A 2HVHA 5LJ3Y 3Q8YA 1U47A 3LA0A 3T19A 2FLLA 2HHHF 3EM1A 4OZLA 2WVFA 3H98A 2DO0A 4USMA 4ED2A 1I94F 1O6XA 1NB7A 1QE1B 2HAIA 4I6AA 4JI8J 4WK3A 4MMOA 3TR5A 4HH1A 1Q7LB 2NSBA 1RQ0A 3NS7B 4IUFA 2Q66A 1O0PA 2GW8A 4KHMA 1GMWD 4C3KA 3MD3A 3V5RA 5KFTA 3M2RA 1YRXA 3V6HA 4FYXB 2NLWA 3LGHA 3CUNA 1X4BA 2LU1A 3T41A 1HHTP 1XNQF 2UVUA 1VQ4S 1FRLA 4C3MA 3KKFA 4LF9J 2EK6A 4Y2MA 1SUQB 1D3WA 1N8RT 5GAEU 2IA0A 1CSJA 3RB0A 2I5JA 3GJSB 1VRTB 3KUHA 2UU9J 3JAMY 5I3UA 2CADA 2P9EA 2ZVSA 3K58A 1EB0A 1JLBB 5DG9A 3I56S 3OJSA 2M70A 2R7TA 4OJGA 4RJVA 5KFJA 1IM6A 2XZWA 5L1LA 1F60B 3TVZA 1SVDA 1ZPWX 1RISA 1UP1A 4ZP6A 1BQNA 4J37A 4YB6A 1NZAA 3CCTA 1LOUA 4DX8H 3F56A 1S97A 1XNRF 2BJ7A 2UUTA 2ILZA 4C9DA 3HK2A 5I3PA 5AT1B 4ZVUB 4C48A 1FJGJ 1Q78A 1TK0A 2HHQA 2OTJS 2BANA 1WUUA 4KGVB 4F7VA 1P8GA 5CYQA 2E1RA 2GA7A 3MAAA 2QYGA 4NASA 4PPZA 5THWA 3RW7A 2MLXA 1XK8A 4A8OA 2UXCJ 2HIYA 3MM9B 4R8UA 1HFEL 1WC5A 3OFGA 3HP6A 2V2VA 1Y3JA 2V6AA 4I2PA 3TZWA 3OTDA 5KFIA 4KIAA 2RH3A 2FHOB 2DEJA 3OFEA 1ZTTA 4X64J 3TZYA 4ZVGA 4Q43A 2ZKUA 3M4XA 5LMNF 2CDQA 1SC1B 2D9OA 3H0PA 2ZDOA 3EZ5A 1SIZA 2MQ8A 2OPQB 3EGVA 3ZZ0A 4CLSA 2N7CA 3K17A 4I7FB 4KFBA 4P10A 4WKRA 3QWPA 4ES3A 3DU5A 2KRRA 3BGLA 4F4AA 4B3TF 4OZ3A 1SXLA 5J1NA 5FD1A 2DGWA 2XLKA 1YBUA 3FBFA 4AQYF 2N4CA 2MKYA 1X5OA 4A8YA 1TL1B 3UW1A 1N36J 2I8EA 5KOXA 4UZBA 3OL6A 1LWCA 1T9XA 1EKRA 1HA1A 4Y34A 1VIXA 3HT0A 1JLCB 4GKKJ 3QRPA 3ZTQA 3L9ZA 4ANEA 3RRGA 3CD0A 5LXRA 1RAEB 1S0MA 3KYLA 2B6AA 3CJ4A 1BC6A 3UQSA 1HR0F 3BBCA 1H7WA 2ZUAA 2XBPA 2BQ3A 3HFVA 1RBLA 4ZPWR 3OHBA 3ZZZA 3K59A 4ZVOB 4PUOA 2ACMA 3I31A 1WOSA 2DTJA 3NBPA 2BR0A 1N32J 4B3SJ 1CC8A 4IKAA 2DCLA 3D1QA 2RF2A 1OO0B 3M6XA 1VQ7S 2HMIB 1N0VC 1FWPA 2B5JA 2VH7A 2YX4A 3H5SA 2AP6A 4HTIA 3DXBA 1NCLA 1SH3A 1FEEA 2POKA 3T1YF 3HM9A 4LFBJ 2RRBA 2ZFHA 2HHUA 2QIFA 2FVSA 2D7SA 4ZCKA 2HHWA 2V94A 2C2KB 5SUHA 2ERRA 1BD6A 5E2QA 1JK9B 3C66A 2OPSB 3PW5A 2CQIA 2JSXA 4X4PA 3DU6A 1N33J 4M94A 3NCRA 2QA4G 1H74A 4USIA 3D1OA 2AIRB 4IO1A 1VQSA 3O2IA 2BE2B 3MEDB 3FSIA 1WG1A 5F8LA 1IJFB 2HQCA 1Y3KA 3TJAA 3SFUA 2FHJD 1KWMA 2FDNA 2C2EA 1VFJA 2EW9A 2YWFA 2DPIA 2MKIA 2WOMA 2VD3A 1RTHB 3JQJA 4MKBA 2FQQB 2WW4A 3PCOB 4G1QA 1HMVB 4K5RA 3W2VB 2GVZA 3ET6A 4YDDB 3OXLA 2QE5A 2B8QA 5HANA 5A6PA 3PVXA 4P9SA 3O5TB 2UUAF 4Y0FA 4HKQA 2XMUA 3RBDA 2BJ1A 2QFIA 1HHSA 2BW2A 2XMMA 4PWDB 2AWZA 2BEFA 4MIAA 3D7SB 3O44A 3B78A 3VAMA 3ZNJ1 3S8SA 4JV0A 5KT7A 3UR0A 2ZE2A 4HL9A 3W5ZA 3CJ0A 1P27B 3OSNA 2W4DA 1WDTA 3T1HF 5AE3A 4JI6J 1W26A 2LXUA 2JLEA 3VGUA 5EWGA 1H38A 3K5LA 3M32B 4A8MP 3BZQA 2RDJA 4LF7J 2C2DA 4CTAB 1LWEA 2CPHA 2Z0GA 3B4DA 3P5TL 1NPKA 3M8YA 2CPFA 2C3PA 4ILLA 3JQKA 5FDLB 5A0YB 1B70B 2BJ8A 1JLGB 4DQIA 5HROA 2V4QA 4GVLA 1U45A 2XSJB 1F0XA 1H98A 3D4JA 5KFSA 3HSGA 4LFAJ 1F2GA 1HNWJ 3GFZA 1JKHB 3S6EA 3AT1B 1QM9A 2JLGA 4CLWA 2BE7D 4IG0A 3VALA 4DU7A 4NLGA 1JIHA 1K44A 1RB0A 4MK7A 1D8ZA 4EZ6A 1JQGA 3LGNA 1E6YB 5IT9Y 2VBWA 3IN5A 2MZQA 4Q8EA 2HZCA 2HQDA 5H1SV 4WIIA 4DSJA 2MDAA 3NLCA 2KZMA 4DX7A 2ZEJA 5KFOA 1EARA 5ETPA 2KFYA 1UWAA 5M2UA 1FTRA 1R8PA 4C8OA 2V68A 5C24A 4FYVB 5HO4A 1D9DA 4YEAA 1KC8T 2ZBCA 5LJ5Y 5KFVA 2XM3A 3KJVB 1DQAA 5E3CA 2BJDA 4J9OA 4CQ1A 1WF0A 4J9PA 1UW9A 4RBTA 1X4DA 1FTCA 2NXEA 5EN1A 4HACB 1RWMB 4ID5B 3VAFA 2CIMA 1R8HA 1S6QA 4HH0A 4JOUA 5K14B 4WYWA 4B9TA 4C8ZA 2AJQA 4FXWA 1KLMB 2FJAB 1SJ4P 2AEFA 2YNGA 4ZJQA 1D8YA 3G6ES 1UWBB 2V8PA 2M52A 4FF4A 2OIHA 2YQ0A 4RNFA 2RRNA 3HVWA 4KC5A 2FVPA 2BVZA 4DPWA 3C8YA 1LV5A 2NZCA 3LP0A 2Q6CA 2V8HA 2CNNB 1KVKA 4O4GB 3IR7B 3HHLC 1SQEA 2DIUA 7AT1B 4WWSA 2KYXA 1UETA 3GZ7A 2R2RA 4F36A 5L1KA 5F8GA 4OI1A 3C19A 4F4XA 2UVRA 1RT7B 1GTEA 3RGIA 2B56A 3QWUA 2VJUA 1NMEB 2CJKA 1PAUB 1CJKA 4Q0BB 4DV3J 4CNYA 2OUGA 1W7WA 4ED3A 2MZRA 4U7UD 3SI8A 3C6UA 4YP3A 1HNVA 3MCMA 1YVFA 2VDIA 3MMCB 3PM9A 5GAHU 1U1MA 1N5TA 4ICLA 1AXQA 3NWRA 4DV4J 4S0MA 3CMQA 4URGA 4D3HA 2G0CA 2OPPA 3KDOA 4NMLA 4RW4B 4KYZA 3GR1A 1VOMA 5IT0A 5J2PA 3A13A 3D0HE 4AUKA 4A46A 3C3LA 2WVEA 5L9XA 2BMBA 2DJWA 4RNNA 4KJIA 2HNZB 1YX2A 2IBOA 3SCJE 3CJRA 4QPXA 3M6UA 5HP1B 1AW0A 1BQXA 2Z8QA 3D28A 5C5JA 2VB6A 3AOCA 5KFYA 4DSEA 3FEXB 3D54A 3MZIA 1U49A 4YFUA 3NOCA 3T9NA 2EFVA 5K8OA 2W9AA 1J2VA 3GCWP 5D4NA 5KFQA 2NXUA 4USUA 2E7WA 4JP8A 5AXNA 1N48A 1IBMF 2W2OP 2BV3A 1VLYA 1FI4A 1EQ0A 3B54A 3NCPA 3E3XA 3UCGA 2RHQB 4U6PA 2ZD1A 1ZA1B 4WZMA 4L76A 2D41A 2KDOA 2HW3A 3TI0A 4EMDA 3KJQB 1NDLA 1Q8BA 2JH3A 3MEKA 3WC2A 1U26A 1EZZB 5C25B 1U4BA 1YITS 1X4CA 1YQHA 2KVIA 1VRUB 4DSKA 1FK9A 1T3OA 4CO2A 5KG7A 1NBEB 2LA4A 1SUQA 3FCWA 3GJTB 2C3MA 1Q95G 2CJXB 1VRTA 2BQUA 1S12A 1DTQA 3EE3A 1S1UA 2HQIA 1X0PA 2R7QA 2J8SA 1JLBA 2FPHX 2VUGA 3P5BP 4RLEA 4KTQA 1XMOJ 4OV6A 2CQCA 3HFKA 4ZVPB 2RQMA 1U24A 1K9MT 3PJ9A 3EVOA 1B64A 3RAXA 1Q53A 4O0NA 1L3KA 1T8EA 2NSCA 3QATA 4QWAA 1VLOA 4ETXA 5MAOA 1IBKF 3MPDA 3C6TB 1F9HA 1C0UB 2BACA 1C0TA 1OIAA 4JI4F 1JLQB 3CCMS 2W7PA 3JB9k 4O44A 2C3YA 3HMJG 1NDKA 4M5KA 2FJDB 2CPZA 5K8MA 4X65J 1JNZB 1OYDA 2MMYA 1LXJA 2OI2A 1NHUA 1RYRA 2P9GA 4Y28C 4GVBB 4KB7A 3MD1A 3MMJA 5F0WA 4ED1A 4QIGA 4KPCA 5B09A 1GMWA 2MY8A 1LWFB 4ZVTB 5GAHI 2HS0A 1UA0A 3GYXB 2F8EX 1RTIB 1GTHA 2V8GA 4ELTA 3QT7A 2XQCA 5ETTA 5H9FJ 2WTFA 3TAPA 4NZ0A 3UE2A 1XEZA 3DN9A 5KFMA 2V4RA 1X9SA 3QAUA 3JAMU 3IC1A 5DGAA 2JC0A 4WP9A 1O51A 2AV5A 1VC6A 3M1VB 2M5YA 1YJVA 4ZN3A 5LM7E 4CP5A 3PX6A 2H54B 2AQ4A 2WAQD 3LAMA 4LSLB 3BR9A 2YX7A 1KFSA 2OPQA 3M9NB 1I1GA 2RKIA 4I7FA 4UY8T 3TX0A 4DFPA 3ZTOA 2W01A 1RHKB 1CJUB 2B3TB 3CVKA 4I56A 2HLUA 1FE0A 5C42B 4KHPF 2XCAA 3GTYX 3ENQA 3DOKB 1TL1A 3EZUA 3SV3A 3JSRA 3DLGB 3HVRA 1OQ6A 4D3GA 3D3CJ 2ZBIA 2X1GA 1NK6A 2WSFC 2IYIA 3EXYA 2DEIA 3TAQA 1T9WA 2AJ2A 3SFGA 1FNMA 2JC1A 3US5A 1AROP 4DPXA 2QX0A 3G6XA 3QFHA 1UJ4A 5B0GA 3N5FA 1U1QA 2Z2LA 2YWEA 2GFFA 1U1KA 2PEHA 1KONA 4CT9A 4UOCA 3UD3P 4FBUA 2CZVC 1G6BA 4N56A 2XC9A 2UXDF 1UVLA 1FVSA 3MCSA 5DDPC 5K8NA 4M95A 5F8NA 2F7VA 5HMZA 1SCJB 2N7YA 2HFOA 4ECWA 4JI5F 2BXJA 1FJ7A 1HQEA 5KFCA 4F26A 4QWCA 5BR8J 2LU2A 1ZETA 5DETA 4YHHF 4QIEA 2CZ9A 2GGPB 3M8QA 1BUXA 4F2SA 4MH8A 4DN0A 2JX2A 3R3TA 2R7SA 3Q2TC 4LF4F 1PGZA 2WRMA 2MLYA 3W65A 3EPGA 1U8SA 1YJRA 2F40A 2BE2A 4Q2LA 1L3UA 3MEDA 2XS7A 4YB5A 3N6LA 1CG2A 1WC6A 4QJVA 2JEIA 2BQRA 2QJ3A 1UVKA 3NKYA 1UVIA 4WTYA 1UVMA 2KXNB 2E7VA 1FDAA 2KT3A 4X4SA 2IAJA 1RTHA 2ZNYA 4WP3A 3PKYA 4ZP8A 5L39A 4C98A 1TL5A 3C15B 1HMVA 3V81B 3HD2A 2VC1A 2OP5A 2H9ZA 4O3NA 1RT3B 1ULRA 4DN9A 4NA2A 2CUYA 4MAKA 3DRPB 1E6VB 5E3QA 2QT7A 4DMZA 2ZHOA 2BM0A 5D8HB 1IKWA 2GAHC 1WKKA 3FBCA 4DV6F 4NXMJ 1I51B 4DR6F 1U8WA 4PWDA 3TQEA 2DGSA 1XERA 4KY3A 1NDCA 3LH2S 4WCEQ 1GXLA 4RZRA 4FF1A 3OR1B 4O4RA 2O5DA 3MUVP 4HI1A 3PZPA 3LOUA 4IH6A 4XK8C 2YWGA 1MU2B 1VQ6S 3L3CA 3M32A 1R43A 3CJKB 3KK3B 3LW5C 3X3UA 4CYUA 1RGVA 2A1BA 4CTAA 2M0GB 3V6KA 1T95A 2PD1A 2HWTA 3LPEA 1KEKA 3DLLQ 1ICEB 4NYOA 5FDLA 5A0YA 3ENAA 4C97A 3CCVS 1JLGA 4RX6A 3D5MA 1TV6B 4PXDA 1UW4A 2AGOA 4DHVA 1Q1KA 3MFHA 2XSJA 2FHJA 4LRAA 3TO8A 1NJZA 1FFGB 5DDRC 1AFJA 1OWXA 2IPOB 2CG4A 3H2UB 1JKHA 4DEZA 2WCXA 3T5JA 1SJ1A 2ZHAA 3CDUA 2E1PA 2VDHA 1S77D 3QZ8A 4NA1A 3BPSP 1KFDA 1TP7A 1E6YA 4LF2A 2LXFA 4BBYA 1K73T 1FX4A 5LMUJ 1TKZB 4W92B 2B8PA 2R2SA 1V6HA 4WXOA 3W1YC 5D0GA 2DNPA 3Q0AA 4F0KA 4UTGA 1HWLA 3HLUA 4OYXA 4ERDA 1Q8LA 3OTOF 4C4WA 1VCTA 5KFKA 2D3OR 3VV2B 3K2YA 3VGSA 1FERA 2EKNA 3I96A 5A6WA 2HG4A 1HYSB 4DV7J 4RUAA 1GFWB 3GFYA 4CCHA 2LXIA 2G0JA 5IS2A 3BJYA 5EWFA 1R7IA 2RU9A 2JVOA 2B9YA 2K2PA 3W66A 4HACA 5HSPA 1XC9A 4ID5A 1VK3A 1ZBTA 1U6FA 4DV2F 4TU7A 2AZ1A 2HZAA 4I6WA 2DR7A 5K14A 1WC0A 2F9DA 4CLLA 2HHXA 1QSYA 2HVEA 4QR1A 4G1IA 3IWXA 4GMKA 2DH9A 4RU9A 4URQU 1UWBA 1XJWB 4NRUA 2IFXA 3W7BA 4BDPA 1NJYA 5AXMA 3UD5A 3TJ9A 2IC3B 5IXUA 2GS8A 5IT9U 2ZH5A 4O4GA 4RNMA 2ZM6J 4Y65A 5L1JA 4LBPA 2E5HA 5HBMB 2O66A 1ACMB 2E5GA 3CXCR 3HO1A 2KG0A 3PTWA 4P7VA 2DCUB 1RT7A 1GNKA 3HD1A 1V5VA 1ZAWA 2XI3A 2DGOA 2DKOB 2MGZB 1RT5B 4USJC 2VG5A 2Q1LA 3IFEA 5J2MB 2CYYA 2G0IA 3FC9A 3RG6A 2PA3A 3BKUA 4PZVA 4LF1A 3MPWA 3MMCA 4X66F 4IFYA 1U0HB 3J80Y 1JX4A 2EFPA 2ZVIA 3BH7B 1HL6A 2R4FA 2OD4A 3MFIA 2QN6B 3QT8A 4NXNF 4ECTA 3V6JA 4JI2F 4RW4A 4Z7YA 3I0RA 3BEGB 1PO6A 4H4MB 1YI2S 3L95X 3J7ZT 2L9DA 3MM5B 3EDRB 2XB2D 4QW8A 4B9LA 4ZPAA 2HNYB 3VAHA 5E41A 2KXHA 2M88A 3ADAC 1RWPB 5HP1A 1HARA 1Q81T 3D67A 2NPIA 2CPEA 2KTQA 4RW7B 3GV7B 4P73A 1J27A 3BSAA 1N5QA 3ENVA 4ZPTR 3P45B 2BOPA 2A2CA 2FLNA 3LGMA 5K20B 2AEMA 4ECSA 1JNRB 4F3OA 3K5MA 4L3NA 4LF6F 2PE8A 2YY3A 5J2QB 2PDAA 4Y6IA 2VQEF 5HK4A 4FF2A 3MECB 2YH0A 3MUTP 2H5IB 4B3MJ 2VBYA 2UU9F 3PEHA 1HQ2A 2E44A 4DV0F 1RKIA 4GKJF 4KGKA 4JV2A 1Y4ZB 1VJQA 1ITPA 1MMDA 3GPAA 2QLWA 5C25A 2HHSA 4HT7A 1O8BA 9RUBA 4LFCF 2WBMA 2YKOA 2VKZG 1U1PA 1UEKA 4K4VA 2AEJA 1NK9A 3QIDA 3R6LB 2EKYA 3T3FA 5B0DA 3HFZB 2RQCA 2ZNZA 5IWAJ 5F0UA 2GQQA 3F0NA 3GLJA 5L8RC 2DNRA 2Z57B 2PEBA 3K5NA 3V6DB 2IM2A 1DQ8A 1FEHA 1QDUB 4OYAA 2KRBA 1VQPS 3QNWB 1RTZA 2VFRA 3C6TA 2AYGA 1C0UA 2DVIA 4ETZA 2ASYA 3KK2B 1WC3A 4K2XA 1JLQA 1S1WB 1U6ZA 3D3BJ 1FFSB 3GG0A 3PW4A 1WEZA 4LF8F 4KHRA 4DR4F 1REGX 1K1QA 4NEYA 2ADBA 2XCPA 5DQIA 4J91A 3W5YA 3UVJB 4GVBA 4USWA 4Z2XA 3A1YG 4LT6A 3RB4A 5L38A 3J81Y 4LJMA 2A2DA 3U1MA 1LWFA 2KFZA 4K0KJ 4O0IA 3O3LA 4ZVRB 4LBIA 3HDSA 1RTIA 3BM7A 2BX6A 3CW2C 3W9IA 4DUZF 1VQOS 5A8RB 3GV5B 3DI6B 2VF3A 3BGUA 3L09A 4N77A 4RW6B 1HNIA 1F1BB 5KFDA 3KLGB 1A9NB 4Y3CA 4AFFA 4ECYA 4E0DA 1PKUA 1HNXF 4I4BA 3M1VA 3SMZA 2H51B 4HEA9 4LF5J 4XAKA 1U02A 1RWUA 4ZMMA 4CRJA 2Y0SD 4LSLA 3N5BA 4NYPA 2GIFA 2R2TA 1R0BG 2UUBJ 5LSLA 2FIUA 4FKYA 3THVA 2XMWA 1NXIA 1CJUA 1TZ0A 3ILLA 1RAIB 3OXGA 4WIQA 4PG8A 5CABA 1SB6A 1VI7A 2DNGA 3KDNA 2VONA 2V50A 1NK8A 1S49A 2C42A 2IJFA 3GIKA 3PRBA 2QL7B 3BS9A 2C2OB 1MNEA 3DOKA 5K5MA 3RB3A 2HGMA 1NSKL 2N4DA 2CDRB 3WQPA 3DLGA 3G82B 2PIIA 2IMWP 4X62J 1KSPA 2ZOMA 1Q7YT 1JJ4A 1AUDA 5IC4B 2MHEA 2MPUA 4QQBA 3VZHA 5SZTA 1PSDA 1RT1B 4F3QA 3GFXA 3ZZOA 1NJWA 3PRVA 1R0AB 4PAAA 2QL9B 1BXNA 1RHMB 5GADU 4ZVEA 3E2EA 2J0SD 1UPPA 2DR6A 4LFBF 2PT0A 3BBFA 4OZ2A 1TL7B 1OSCA 2VZ9A 3I5BA 4Q44A 1IBCB 1PJ6A 1QTMA 1P1LA 4CI0B 4PWUA 4KT0C 3M2VB 2Z30B 1LQ9A 4ZLPA 2DR9A 4JV5J 4QCLA 1FRXA 4EBCA 2BOAA 3UI3A 2DRBA 2JHEA 3CULA 3AQPA 1T02A 2C28A 3ZZPA 3ONQA 1SIWB 2JEJA 4G65A 2GMLA 4R0EA 2V8VA 4DF4A 3J7YU 3PEJA 1NKCA 2HHVA 4W90B 1PCAA 4PQUB 2KJVA 1HBUA 5KG5A 1I94J 4DV1F 1XMBA 3I55S 4DL4A 2VFVA 1OY9A 1P6TA 3CIZA 2HYIB 4DWIA 2VKRA 4MFBB 3FQKA 4KAIA 2V5HG 1VQMS 1JJCB 4C3LA 4M63A 1NJIT 2OEMA 4A8FA 4K50A 2OLWA 4E2FB 4IQMA 1X8DA 2KXFA 1U09A 1WEXA 1J5OB 2F1FA 4OZJA 2FLOA 3C15A 2KYZA 4ILMA 4TLRA 5KG3A 4IG3B 1RT3A 1XNQJ 3LUYA 5ADZA 3DRPA 1E6VA 2DPJA 3KK1B 3T5LA 1W2IA 1HLWA 2JRSA 3HCXA 3GJQB 3C2PA 3DXSX 2VPYB 1C4CA 4ANCA 1QUPA 4TXSA 2M4MA 5RUBA 1CULB 3Q23A 2LDIA 2DNMA 1NB2A 5HMYA 2W4CA 1NUEA 1WHXA 4B9VA 1VDHA 2AJ4A 1VQ5S 2ZH9A 2VA3A 4FN5A 3KMQA 4PCQA 4AL5A 4JI3F 1R6YA 1WG5A 1H6KX 1H72C 2Q3PA 1OY8A 3I4PA 4LFAF 4W98A 4DCOB 2E66A 3OL7A 3JS9A 1MU2A 1UZHA 2EFGA 3KK3A 2O01C 2F4VF 3QGIA 4CNZA 3QT6A 1NSAA 5A76A 1QD1A 1XNRJ 2FJWA 2AX1A 4IOBA 1TV6A 1Y7PA 4HDHA 3CGIA 2ZOFA 1OQ3A 3I5CA 1DFDA 5B0CA 3DLEB 2IRXA 4K2JA 3U1LA 4LR9A 1HBMB 4O23A 1UMJA 4Y00A 4Q5VA 4CLFA 1S6PB 1KQKA 3RR7A 1I3OB 5H9FK 3TUZC 4J9KA 1DLOA 1FHTA 3ZZTA 3NGDA 2AGQA 2M7SA 2KU7A 1TKZA 4MKVA 2EXUA 3CCJS 3CDAA 3RBEA 3ISNC 2OEJA 2BZ2A 1ZAXA 2LEAA 1H0HB 4F2RA 5LMNJ 2DXDA 3OVSA 2HEKA 4KO0B 3TUJC 1SL1A 2L9WA 3WIUA 2CXEA 1HYSA 1NHKL 3C14B 3J7AN 1DTTA 2RB7A 2WSCC 4USVA 5IQ6A 2DYAA 4YS2A 3FEZA 2IRYA 4RUHA 1SKRA 4FXDA 3PX0A 4B3TJ 2FTRA 1WHVA 3Q8RB 4FF3A 3GIIA 2GC8A 4LSNB 4EYHB 4AQYJ 5IT4A 1Y9OA 5CYMB 1Y11A 2OSQA 1ZZFA 1Y5NB 1LK5A 3HHNB 4P2SA 3N6MA 3U02A 4BS2A 3KOAA 1YZ6A 2V0NA 4PYAA 3BN4A 2MSTA 3A8JA 4K4UA 3R5JB 1YJTA 1PYSB 1A6LA 2E29A 2ALZA 3ZZRA 1Q16B 2BJ3A 4DPUA 2B7CB 1HR0J 2IC3A 4LVNP 3CCUS 2MY7A 4CO3A 2IM0A 2R9LA 1N88A 5E7OB 1WHWA 1S5ZA 1TR0A 5HBMA 3ZXWA 4DV4F 3UDVA 3WX8A 5GAGU 2RHSB 2FJEB 3W62A 4B9SA 2MGZA 1YDLA 3G8SA 3GU0A 1VGYA 2J9DE 1OYEA 4B9UA 3NAHA 3PXGa 5J2MA 4UF4A 3T1YJ 1R8CA 3CEDA 4H4OB 4WU2A 3BN7A 3V4IB 2MKHA 2MYFA 5EX3A 1WG4A 4BCAA 2ABYA 1FRHA 1J5EF 1U0HA 3ZNUA 1U2CA 2LKZA 1DY3A 4OQJA 2ZBQA 4HYKA 5DZ7A 3TEHB 5KFNA 5HI7A 3FCHA 2MQNA 2LYVA 2HS4A 3MM5A 4O3OA 3JYTB 2WONB 5DQHA 3MM6B 3Q22A 2CNOB 2HNYA 4AYBD 2W9BB 2B4OA 2C2ZB 5B0FA 4UY85 1XR6A 5D0EA 1TQLA 1GMVA 5D15A 2GCFA 3MM8B 4RW7A 1V3RA 2VG6A 1QAYA 3SSQA 3IWNC 5HN0A 4X4UA 1SJQA 1I5OB 1KS2A 2LQBA 3TP2A 2DGVA 1SH0A 4C8KA 1B3TA 4IO9Q 4DS5A 3NOGA 2G9OA 1AUSL 2V9WA 4FNHA 1UA1A 1SC6A 5J2QA 2NREA 3IMQJ 1BE4A 2GIRA 2UUAJ 3NG8A 2PO4A 2E1MC 2QSFA 4CO0A 4NPOA 3MECA 1RAHB 4MKAA 3VAGA 4DPTA 2QSWA 2K1RB 2ALYB 1H7XA 5AXLA 1WC1A 3BYRA 4J9LA 3QGPA 3DDKA 3R5GA 2AJ0A 2O3DA 5LL6d 2GMHA 3H90A 1XMOF 3R5AA 3M8RA 3FSYA 3T1HJ 3PACA 5HLFB 2YWHA 3R6GB 1B0TA 1BWVA 1HNZF 1G7CB 5C7PA 2KHDA 1B4SA 1HWIA 2V63A 2NYHA 2HSEB 5B0AA 3U7JA 2GJFA 2R3VA 4UT4A 4RUBA 3DM2B 1AFIA 5F3ZA 2XTJP 1NH8A 1EJ7L 2KG1A 1T11A 1IWGA 1KQGB 4NLYA 5F41A 2XS2A 2GQCA 4CLTA 1X9MA 4M5GA 4YN3B 2BM1A 1CJVB 4ZOSA 4X65F 3V6DA 2ZBPA 2WHOA 4Y2KA 3RAQA 1GT8A 4NLUA 3GP9A 2KB2A 2BE9B 3KK2A 4DL5A 3G8QA 2O1PA 1PILA 2N82B 2W8LA 2CQ4A 3G71S 2M2BA 3PO5A 1EHWA 1PJ7A 2E5LF 4TQRA 1HQUB 4OYIA 2L08A 5GAGI 1Q8IA 3MAHA 3Q8PB 3MHYA 2A18A 5B0EA 4MYTA 3UVJA 1K0TA 3PYDA 4EEYA 2D74B 2HAFA 4NX9A 2OFHX 4NLWA 2QLBB 1ROFA 3EGWB 1Q79A 1GMUA 2XS5A 2VQFF 3TUIC 4KKOB 5ETKA 2J8AA 2ZWPA 4YY3F 5L1IA 2KVQE 4KBIA 5A8RA 1FRMA 2GHVC 3DI6A 5EDWA 1SKUB 3EVWA 1WF2A 2DIVA 4RW6A 1RT6B 3D6TB 3BQ2A 3KLGA 1RJJA 2W2MP 4YDXA 1RI7A 2PFFB 2VG7B 1FWLA 2UVVA 2MKCA 1R8AA 2DHSA 5KFRA 4ECZA 1KOHA 8ATCB 4ALZA 3EWGA 4LRCA 1HW9A 4L74A 2LQ5A 1YJNS 4OZNA 1N4LA 3AAWB 2Y0BB 1APSA 2RRAA 3NL0A 1LW0A 2L48A 3R5DA 3OW2R 1JLFB 4OX9F 2AGPA 4EO6A 2F4FA 3UN3A 2HRUA 3KG1A 2BKOA 1H2UX 1SV5B 2I1RA 1TL3B 3L7UA 3M8PB 1RE1B 3BDPA 4UOGA 2NS1B 4KV8B 3D2WA 5CHCB 1YJ9S 2QLFB 2UXBF 2ACYA 3G82A 3H2LA 4FPIA 2JJ4D 4LVOP 3IP0A 5H9EJ 4F4YA 3BGFA 2DHAA 3DLJA 4DR7F 5EHHA 2R8GA 4DR5F 3A8IA 3FBEA 2YPYA 1V3SA 2QEXS 5IV3A 3J81U 4U7CA 4QWBA 4MIBA 4PXBA 1HHQA 5A2QU 1RT1A 4X4QA 3LP2B 3LPYA 1R0AA 2WW8A 5J2NB 2W8KA 2MZJA 3R1LA 4IYQA 4RKUC 3MMAB 1N54B 1RK8A 3M9OB 1RU2A 4K7QA 3JTNA 1RCOB 2HK2A 2FVRA 4NCGB 4QW9A 3OJUA 2IMOA 3FFIB 1LW2B 3U1NA 2N3OA 3NGKA 1RT4B 4UUWA 2EBEA 2CJBA 4QYZK 3M2VA 3PV8A 4CIOA 4NE9C 4YOEA 4ECVA 4JI7F 4DL6A 4UQGA 3FSXA 2Z4PA 7FDRA 1S1TA 4OYBA 5CCMA 5HMXA 3AFGA 4J90A 3G9CA 1ZS6A 1JB0C 2PC6A 3VAKA 3FDSA 3C46A 5L46A 3AJ1A 2J7KA 4LR7A 2ZKTA 4RUCA 1M1HA 3NMRA 4PQUA 2DGQA 2B0GA 2B4VA 4NCBA 5CH7B 4AT1B 1MW7A 3FMBA 1IBMJ 2IA6A 1Q5YA 4K4YA 2GQ2A 1NSQA 1S9FA 3DMJB 2KT5A 3L7OA 1FXLA 2UV8G 1S48A 1K1SA 1FNXH 3BKTA 2XULA 4FYDA 5HJXA 2DRDA 2FJBB 4P52A 5GVQA 1KQFB 1IR1A 3HHLD 2DH7A 4ER8A 2DHXA 3KUEA 1DHMA 1SKSA 4PQAA 3MAQA 4IG3A 5D0HA 5B7WA 1D9AA 2QL5B 1S9EB 1SC4B 4ZIWA 3VQTA 2Y3YA 1N6QB 4NLQA 5B08A 2HVZA 1KKHA 4DQPA 1GXTA 5CXTA 5CQGA 2ROEA 2IY5B 1OJ4A 5D77A 3QIPB 4PXEA 3QLHB 1PJ5A 1CULA 1HWKA 3D66A 2DNLA 2I2YA 5F8MA 2FJXA 4NEZA 3MR3A 2YWWA 2NUHA 1OS5A 4JB8B 4OHYA 2J6SA 5D4LA 1QAXA 3N01A 3IO1A 1HI1A 2YBVA 1IBKJ 2CJYB 2W2PP 4DR3F 4X4VA 1UZDA 2PSZA 2MKJA 1HD0A 5DO2A 3MI7X 3H8YA 4JI4J 3CNQP 3J7Z5 2J9EA 1U2RA 3M30A 4IR1A 2RDIA 4A48A 2HWIA 2UUWA 4DL7A 3EICA 1RZMA 1RUSA 1VHIA 2VFUA 1LFWA 3H7HB 1TK8A 3BO2A 4I2PB 4V19J 4H4KA 2IM1A 4OX6A 3DLEA 4ZPBA 5DQGA 2QV6A 1YTYA 2Z56B 1DARA 5MLCV 3H2VE 4A4JA 1KQSR 2H65B 4P71A 2YQ3A 1PC5A 3HHLB 2X1FA 4KE5A 2HZVA 3MXHP 4K4ZA 3QMQA 2W7OA 3NNCA 2DHHA 4WU3A 3BGOP 4KFBB 1AA1B 5G0RB 1IN0A 4USKA 1VIOA 4CZCA 3R5BA 3FRZA 3SDEA 3IS9B 1YGYA 1MMNA 3HHEA 2BA9A 4WFNQ 4ZLLA 3IG1B 4QR0A 2CJQA 3NGRA 4KO0A 1T03B 4OX7A 1N52B 2JWNA 1S59A 2XO7A 3VWSA 4NWBA 2ADCA 2EI5A 2RIJA 4XDCA 4A8SA 1REVB 2YKAA 1BQMB 4ZA1A 1H2VZ 3TYTA 3CJ5A 1XN9A 4NZ7A 4LSNA 3TEGA 2RVJA 5CYMA 4NLSA 4ZLNA 2DD8S 3BV8A 3QGHA 1JMTA 2D1CA 4NLXA 4X2BA 5IFMA 2HBQB 3DOLB 2BBEA 2XZDB 3KHLA 4DSIA 4WP8A 4OI4A 3CDEA 4C7QA 5FIIA 2RF2B 1IBLF 1L5UA 2WVDA 4RL1A 2YQ1A 1LKZA 1QY7A 2W24A 2FZKB 3QBCA 1N34F 1FKAF 2X1AA 2UXDJ 1RU1A 3AXKA 2RS2A 2J5AA 4ZVQB 1O5JA 4CO1A 4L75A 3UNGC 2E5JA 5CCLA 2ROGA 3CCQS 5M2PA 2F5GA 2P8IA 4OIXA 4DLEA 4Z7CA 4IFVB 1R3NA 4DU8A 4I1TA 3TANA 4YHHJ 1IXKA 4TY8B 4YR3A 2CVEA 2Q6BA 3MMBB 1LEOA 4H4OA 2JEGA 4IDKB 3V4IA 3OHAA 5IC6B 3BO4A 3MOZA 4ED0A 1IKXB 3KHRA 1MROB 2WOMB 3HKWA 4LF4J 3W61A 1WOPA 3GILA 4M5DB 2XI2A 2YKNB 3G96A 3KTQA 2WVCA 2HFNA 4P2XA 2HQ3A 2VU5A 4N7TA 5E3AA 2MZ1A 3AJ2A 4NOHA 1FD2A 1UFKA 2GVZB 1RWKB 1NNDA 3KLHA 3H4BA 3JYTA 2Y1LB 3CMAS 3K5OA 4ZK7M 1T9TA 5ETRA 2WK4A 3NMAA 3DRYA 4DFJA 1XMQJ 1WI8A 5JXSA 4HTJA 4LRBA 3D6HB 2E9RX 2M9KA 4ZP7A 3RRHA 2RU3A 2HGLA 4IQXA 5CA5A 1S72S 2FYXA 1WD6A 2XY7A 2KM8C 4J5OA 1V3ZA 5HQMA 2XWXA 2PMZD 1FESA 1FKPB 3NWGA 2GJ2A 4HHUA 4QIVA 3OL8A 2DGUA 3OLBA 3SQOP 2CZ4A 5I42A 1AZSB 2B43A 4DV6J 3W8GA 4DR6J 1BY9A 3FRYA 4HVZA 3JTOA 4FNIA 3KLIB 2E1CA 2ZUGA 3UCZP 1I6JA 3AOBA 4DR2F 1C1BA 2WBRA 3C16B 2B4UA 5DG8A 2HFVA 3I6PA 1GXUA 2IDEA 4USHA 3R2CJ 1M90T 1TUWA 2QA1A 2XY5A 1HBNB 1M0SA 3GYNA 4I69A 3GR0A 1GAOA 4W4MA 2VPWB 2DXEA 2FHKA 4MIWA 3A8KA 3QFWA 2XO6A 1VBKA 4TU8A 3JSMB 2C22A 3DGPA 3SCKE 1DJ0A 3OTCA 3FEYB 2MB0B 3CCSS 3DM2A 4HLBA 2KN4A 3WZ0A 3UN5A 2P2CB 1G1XA 2R2UA 4FYWB 3HSDA 2ZZTA 3VQSA 1CJVA 4R25A 3PW2A 2CPIA 4DL3A 1R0CB 2ZOGA 3KJFB 2V2QA 1XBWA 5KTQA 2EFOA 4RPFA 4CT8A 2IBKA 3H5UA 1UPMB 2DNYA 5DLGA 2X7IA 4WFYA 1CLFA 2BJ9A 4LSZB 4PG7A 3KXDA 3SEOA 3QGGA 1LNQA 1X9WA 1R27B 1QE1A 1CEZA 4N47A 1HQUA 2VL1A 2J7UA 1MLAA 2ASDA 5IZHA 3DLBA 4YB7A 4KGZB 1PYOB 2UV8A 4C0BA 1S0OA 1RADB 1XQIA 2MHNA 5CZVA 3OTOJ 2H4YB 4C8MA 3MEGB 2A10A 3SCLE 1VBZA 1IKVB 2IDLA 4CLKA 1HIYA 3CCZA 2Q43A 4KKOA 1IJEB 2RQKA 1S7HA 5C2CA 3D6MB 3EJMA 2NQPA 4OI3A 4JI1F 3PYGA 1F2HA 3AOAA 4C2MA 3N0VA 1FJCA 3W63A 3G86A 4EU0A 2GZOA 3OR2B 4Q7AA 4TYBA 2GHWA 2CFXA 4Y2CA 4ILRA 1ZH5A 5KG1A 1DBDA 4WK1A 4WYLA 3KG4A 4GC6A 3V4MA 1JLFA 1IWAA 4HDGA 4PR6A 4FPRA 1TAUA 2DY9A 1SV5A 2EG2A 3AODA 1KVJA 4ZCIA 1TL3A 4YR0A 3PNIA 4IOCQ 4L3KA 4OYZA 1FXDA 1HWUA 4P7TA 3I0SB 3M8PA 2W9CB 3KLEB 4HI2A 1YRTA 2DHGA 4KV8A 1VMBA 3CCES 2AYBA 2HQGA 3R97A 3IRWP 1MN9A 4ZPDA 1X4AA 2KJWA 3K8WA 2XY6A 1B0VA 2O67A 2YKQA 3CJQA 2PGCA 3ILOA 3CJTA 1VISA 3ETOA 2RS8A 1RAFB 3W8PA 2FD2A 4RW9B 3OPKA 4BC9A 2UUCJ 1B99A 3LP2A 4B3OB 5E33A 4AL7A 1CPZA 1KP6A 5HQLA 3MMAA 4OHXA 1VQYA 4X66J 4ED4A 4OHZA 2CQ2A 4N5SA 3VHQA 1PBAA 3AY0A 3LALA 4NCGA 1RT2B 3PFOA 3MM9A 4M5IA 2BRKA 3FFIA 4NXNJ 3R1HA 4JI2J 1LW2A 4UW2A 3EGZA 1QJHA 1NK5A 1RT4A 3E01B 4FZVA 1UJ5A 5K9FA 1WTBA 2C1EB 3SSSA 1VQ8S 3GG1A 5BJRA 2MKKA 5F9LA 3DHXA 3CF5Q 2Y9HA 1S6UA 4QIWD 3TA2A 3WIVA 3I9ZA 1WI6A 4FBTA 1Y00A 2DNZA 4L73A 3H25A 5AJ3F 3BQ1A 3OFHA 4YUDA 2L3MA 1S99A 2ZD1B 2ZITA 4C0OC 3P6YC 3T1AA 2A6MA 4QU6A 4XPEA 2CQPA 2H48B 1YRUA 1NLKL 3UCUP 4M5JA 4J9UE 4EI2A 4ZPVR 3CO0P 3H40A 2ZJRQ 4EBEA 5CAAA 4LF6J 3T5KA 4DDFA 1RWNB 1T05B 2LFVA 1UJ6A 2LEBA 4I0WA 2DT9A 1FK9B 5HVHA 3DMJA 2MZSA 1QVFR 2VQEJ 3IA0A 3CCWA 1F9FA 1FRKA 2FC9A 2ZHBA 1JLCA 4QIFA 1GH8A 4KH0B 1TKDA 4G3IA 4I67A 1WWHA 1YWXA 2HWHA 2XLIA 6FD1A 1DTQB 4YQWA 1S1UB 4DV0J 4DLGA 4GKJJ 4ZKAA 4CWBA 2NR0A 2J0WA 1OPZA 1S9EA 2JFKA 1N6QA 3R8YA 3VZIA 1PYTA 3CC2S 2OD6A 3A8EA 4OV1A 5JVHQ 5KFBA 4P74A 2DNHA 2XWYA 4LFCJ 4OFZA 5F8HA 2CQHA 4WZQA 1KHVA 1VK8A 3QIPA 1TUVA 1S7IA 1L3SA 3QLHA 1C0TB 4TYAA 2KKHA 5HMWA 4ECUA 4ZPCA 1KOOA 2C2NA 4O44B 1MSWD 4KPYA 4CM0A 4OJ1A 2HMIA 2YNHB 1WSVA 2HFZA 4TU9A 3IR6B 3R7BB 3FKBA 3MF5A 3PDNA 4ES2A 2RJZA 2PI5A 4TNOA 3ISZA 4K8RA 1T9VA 4E8UA 4WFBQ 3PRDA 2OPSA 2P5VA 1VBXA 2LQ8A 1WELA 4DF8A 5B0BA 3THPA 2MQPA 4LF8J 4DR4J 3K5PA 3RRKA 1RSCA 1VRQC 3R7NB 4ZVFA 2CPJA 4UQTA 3PKMA 9ATCB 2HPUA 4AXJA 3I32A 4ZCMA 2JOQA 2HNDB 2V34A 2I9SA 3HVAA 1RCXB 3RU0A 4LREA 3HHLA 4O3RA 5T41A 1P9QC 3A3OB 3TZZA 1X7VA 2GO9A 2RKIB 4DUZJ 3W2VA 2CQBA 5G0RA 2RDDA 3IXQA 2F9JA 4RWWA 4OYWA 4FVCA 4LUBA 3IS9A 4JYAF 2OPRB 5KFLA 5A8KB 5F9NA 2W25A 1HNXJ 2B9EA 1BWEA 3IG1A 2ZZNA 2LCWA 3UWTA 1T03A 3EGNA 2VICA 2DITA 3D1HA 2YX1A 4U67Q 4KQZA 4OZ1A 5KFZA 4ZJOA 1TKTB 2Y8WA 4JI0F 2XHWA 1REVA 2FGCA 1BQMA 1HI8A 4TLQA 3R7SB 2AMCB 1LFPA 4KSEB 4TN2A 3SCIE 3FGVA 2OFGX 2KT2A 3M8SA 2NUUG 2K8GA 5H9EK 1HBOB 2B4PA 1C4AA 5CD4A 2LVWA 2CWKA 5GAEI 3HPOA 3DOLA 2IVFB 4OZ0A 1NK4A 4FS2A 2Z2MA 5E0OA 1IR2A 1QAJA 3R2DJ 2B7BB 1HQEB 2ZH8A 3B6BA 3MM7B 1JXVA 4J9VA 6FDRA 1SKWA 1RWOB 1YJWS 1NRKA 1M5VC 4ED7A 4OYPA 4JBCA 5ITHA 5HVFA 3M8QB 4DL0C 4HR2A 2EBGA 3KMSA 3CC4S 4B3RJ 1EQMA 2QRRA 5F8JA 3LF0A 4JUZA 2CQ0A 3ILJA 2GO8A 1H2TZ 4QPTA 2KL8A 5KFXA 3UO0A 3DLKB 1X4FA 4IFVA 3T5HA 2E7XA 2F8MA 4PG5A 4TY8A 1RHUB 3TWZA 3MMBA 3OXFA 2MTLA 3SV4A 4IDKA 1CVJA 3DYAB 4C8YA 4FDFA 1NU4A 1IKXA 1MROA 3TRGA 2UZAA 4ZN1A 5KAKA 2IAJB 2MKSA 3KJVA 4M5DA 2YKNA 3L7PA 2FJVA 2PMWA 1RBOB 1UVJA 4ED5A 2C3UA 3TVKA 3FNNA 4DV1J 5DLFA 2R8HA 3ITHB 1T9YA 3QYYA 4QBUA 3CDBA 2JLFA 3O8WA 1R6VA 1IKWB 2ZJQQ 1KLMA 1IKYB 4MJKA 2MQLA 2EC0A 1SQFA 2XEXA 1S0VA 2EFNA 2VBZA 2FY1A 1RHJB 2NPFA 3BSNA 3W64A 3KLVA 3KUGA 1FKPA 4DI6A 1XWLA 1HW8A 2MJUA 2VC0A 2CQGA 5D4OA 4A47A 4QWDA 3ZC4A 3CTRA 3MR5A 3DHWC 1PAEX 1WORA 5KG6A 4WKYA 1JWWA 4QYRA 1AZSA 1QUVA 2VJVA 1Q4RA 4NL5A 2OTLS 4CYUB 3WBZA 1KBRA 2AYEA 2ZH7A 4IRDA 2MLZA 3BBBA 3KLIA 1FX2A 3CB4A 4MYUA 4WFXA 2K7JA 3LAKA 5D0RA 4C11B 3C16A 4P2FA 1P1TA 2I0XA 4XTTA 3TA0A 3CIMA 4Q0BA 1GK8A 1ZPVA 2KHCA 5JJBA 4DSFA 1YKWA 4JI3J 5BYSA 3QPIA 4ATNA 1HBNA 2P6SA 2DNKA 1C2PA 1W2BR 3NCQA 1S1XB 2DNOA 3D68A 4J9RA 4FS1A 3ZTSA 3JSMA 2MQMA 2XYGB 2KI2A 2F4VJ 2C3OA 2YPZA 1XR7A 2DY1A 2BKNA 4OYMA 5BYQA 2XMKA 5KFFA 3AB4B 1HPZB 2WZ1A 1FKOB 1NKEA 2QG9B 3BB5A 5GMKa 2OEKA 1T9UA 3EXCX 3GJRB 4FP9A 4QYZJ 4JI8F 2FZCB 2SXLA 4DUYJ 3BH6B 1Z1ZA 3Q89A 2HNZA 1FA0A 2RD5C 2E5IA 4X4NA 2LA6A 2GV1A 2M3DA 2G4BA 3MCOA 3QJLA 1SC3B 3PHTA 1G3OA 4F25A 3WX4A 5KFHA 1G2EA 2GAGC 4ECRA 4PEOA 1N5VA 3VAJA 2LMIA 3GCXP 4IH7A 4EWTA 3HX9A 2MQQA 1ZM9A 1FF2A 4LF9F 4I2QB 5EUHA 1RBAA 3GMGA 3MEGA 3HJVA 1IKVA 3QAEA 1NJXA 3UNYA 3IBCB 3OSPA 3F73A 1ZM3A 2JZ5A 4UOHA 2Y1RI 1KNZA 4ZLJA 3A3PB 4P72A 2EG1A 3A4TA 2QYCA 1VRUA 2VV5A 3RTVA 1FT8A 3HSJA 3DDNA 2GVDB 2OH2A 2ZH4A 2QGFB 3BGRB 2H4WB 3NNAA 3OR2A 4A8WA 4F67A 2OHDA 2WB1D 4BWMA 4URSA 2C2RA 2CPYA 2G2OA 1M5PC 2DB1A 4CH1A 2V4JB 3OTBA 3QJJA 2CPDA 5DM7Q 4DOZA 3M8ZA 2XG8A 4XPCA 2CQDA 2FUG9 1FJGF 1X4EA 2VG5B 1YJUA 1RAAB 3H59A 2IVYA 2XMJA 4NLPA 3CC7S 3I0SA 3M8WA 2W9CA 4U9RA 3KLEA 3IGVA 3UDCA 4QR2A 5F3TA 4DFMA 4QZVB 1ZA2B 4HT5A 2OMLA 4USTA 4ZHRB 4IFYB 3BSCA 2UXCF 3DFEA 5KT3A 4DQQA 4ANDA 1YLXA 2VPXB 4TY9A 2AW0A 2DK2A 3I0RB 4RW9A 4DR1J 4MT1A 3NS6A 4B3OA 4OJHA 1LXNA 4MK8A 4X64F 2DO4A 4DV5J 3SXLA 7FD1A 3ICLA 4RWXA 3VCDA 4WE1B 1J5EJ 1ZM4A 4NLTA 2X3GA 3DRXA 1PC4A 3ISND 1RT2A 1V9OA 2BDPA 4K4TA 2QA2A 2G1HA 3E01A 3BR8A 5DDOC 4KGXB 2ATLA 1VJWA 2D69A 4UUXA 1W25A 4J9MA 4MK9A 3HVTB 3JQMA 1YG0A 3OBIA 4O3PA 2FHMA 3SBMA 2J9DA 3B82A 3GV8B 1WSRA 3RB6A 3CCLS 3MPVA 1N36F 3BKFA 1TVRB 4N8OA 1JLEB 3W5XA 2IM3A 1OMSA 3N4WA 4GKKF 2DR8A 4WPAA 3T9ZA 3MEEB 1S10A 2KH9A 3K89A 1EP4B 3RUBL 2IJNA 5C42A 2WVBA 1K0VA 1T05A 3FK4A 5DRKA 6AT1B 3FJ2A 1VQLS 2BYCA 3PJXA 4OLOA 1N32F 4DBQA 4F04B 4B3SF 4JV1A 4ZVSB 3Q8VA 1F5CA 5HQ8A 2B51A 2PI4A 1CC7A 3HSZA 3POTB 4EK2A 4ED6A 1D1UA 2R8KA 2H5JB 4WTOB 1B7FA 1KTVA 1ZYQA 4A8XA 5AE1A 4L6V3 1JLAB 2AJ1A 3ZZYA 5D3GB 1HNZJ 1MN7A 3VAIA 3MWBA 2GX8A 3W2WB 1UFWA 3TW0A 1RP5A 3MURP 4Q45A 4TKTA 4J9NA 1N33F 3G87A 2DGTA 4DUTA 1TFWA 1YK9A 3ETMA 2D3UA 4YMEA 3CE8A 3NY0A 2J76E 4FXVA 3GIMA 1M5HA 2YNHA 1VR6A 1YZ7A 3PR4A 4AE5A 3U27A 4RU2A 2YKPA 5HJYA 2H5EA 4L72B 4CLZA 2GGPA 2OAUA 2PFDA 3DRRB 3FZBA 2QO3A 3PO4A 2OELA 2RT3A 1S79A 1D0EA 3GIJA 2NCKL 5CD4H 3TA1A 3DDIA 2XNRA 1RLCL 1ELOA 2HHHJ 2HVIA 1DRZA 4RO0A 2E5LJ 2B9XA 2B9WA 3TARA 2AU0A 2MZTA 3CJSA 5CYJA 4X4RA 5ETQA 1NK0A 3PFEA 1PIEA 4BLGA 1HWJA 1NDPA 3KLFB 1HNIB 1VC0A 1NH7A 2HIQA 3CDWA 2DBBA 3P96A 4Z37A 4PKDB 3PIOQ 4IH5A 2HNDA 1BHNA 1SH2A 4WF9Q 3B4MA 2VQFJ 1FDBA 4MTPA 3QO9B 3EX7B 3Q8SB 4YY3J 3V81A 3PX4A 2QMXA 3CD6S 1NPPA 4MKYA 1X5SA 1NK7A 3DNCA 2AT1B 2ZBRA 3DKDA 5J1EB 1KR4A 3DOMB 4ZS6A 1UEUA 4JI6F 4J9SA 2OPRA 5A8KA 1UTAA 4FKXA 3N28A 2HURA 4ECQA 3SIPB 2J7WA 3BPDA 1SI9A 4LF7F 4UZCA 5D4PA 4F4WA 4PRFA 2G1DA 4P75A 2VFSA 1XIQA 5DS7A 4ELUA 2AZ3A 2IVMA 2FVCA 1TKTA 2CAJA 4O3SA 2XMAA 2MSSA 2PA8D 1AT1B 2HKEA 3FVYA 2BJEA 3MDFA 3OR1A 4OX9J 2DGXA 5GMEA 2XYHB 4M5MA 3K8VA 3ZFVA 4F4ZA 1HNWF 1MWQA 1N0UA 2J6UA 4OI6A 1CJTB 3CJKA 2QTWA 4DG1B 2HBZB 2N3LA 5F8IA 3CMES 2JDJA 5AE2A 1HBOA 1S1VB 2UXBJ 2R7VA 3IR5B 2I6WA 1GX5A 1SBRA 2MEWA 4NRTA 2GIQA 2JEFA 4DR7J 2AD9A 4DR5J 2XGPA 2IYGA 4FVMA 3JSBA 1RTDB 2PMHA 4GRSA 3PYFA 5KFUA 3HXMA 1HI0P 4LRFA 3IM8A 1SJRA 2DNNA 1ZOTA 1RAGB 2FB0A 2I38A 2A3JA 3MM7A 3OTEA 1F3FA 4K4XA 4PXCA 2W1BA 3OUYB 2UP1A 1KRPA 1YBTA 1T7PA 5FJ4A 3VTIA 1T3NA 4O3QA 1TKXB 4NMXA 3RW6A 1MWYA 1TELA 5BYRA 3PW0A 3CPWR 1Z2ZA 4DX6A 1UKUA 4IOAQ 1FJEB 1MMLA 2K7KA 4ZCLA 2HGNA 3DLKA 1KD1T 1HBUB 1B0PA 4JI7J 2VBXA 3M2UB 4DQRA 1JJ2R 1TAQA 3BREA 2VODA 1U7LA 5DJBA 4X4TA 2ZDPA 2FLPA 4BHQA 3VGVA 2NXNA 3DYAA 5IV4A 4OLPA 1FRIA 3H20A 2ZH6A 1XMQF 3D6FB 2QFJA 3LP1B 4F3MA 1DAXA 2V2KA 3HZEA 3GIRA 3EZOA 2CNKB 2P6TA 3A12A 3OD2A 1FVQA 2ASLA 3ITHA 1WF1A 4F0HA 3EDQB 1Q86T 2U2FA 1UEVA 3PG9A 3AD9C 2WB4A 1IM4A 2EFQA 1NPRA 2RMLA 4BWJA 1IKYA 1QVGR 1DZ5A 1HKAA 2YKMB 3KWMA 3LWMA 4ID8A 3NNHA 1X0FA 2JFDA 3SZ2A 1R31A 4V19X 1AB8A 3AD8C 4DV3F 3GFHA 2FY8A 1RHRB 1ZTWA 5KT4A 4WFZA 2C2MB 3G8TA 5D78A 1TUGB 1S9GB 2RUSA 3MR2A 3KFWX 2ZJPQ 3IBFB 1SL2A 1FFWB 4EYIB 4WJBA 5LSRA 3HHDA 2CRLA 4NLDA 4DPYA 2HK3A 4NI2B 4C11A 4AD6A 3FCVA 1B7YB 4M5HA 1RT5A 3G4SS 1Q0NA 2KO1A 3NGSA 3KNGA 4NA3A 1X5TA 4DPOA 1FWKA 2AX0A 3W3SA 1KVIA 2YNFB 1LK7A 1S1XA 2LEPA 3E51A 4DR3J 5IQQA 4GO5X 3TUPA 1RAJA 3PR5B 4EO8A 4CO5A 1NKBA 1CQMA 1N5YB 1RWVB 1RTJB 3P3DA 1DLOB 3LANA 3ZTRA 1U25A 1HPZA 4H4MA 1FKOA 3UD4P 1VQNS 3VR1A 2CKWA 1X4HA 1LWXA 3CJ2A 2DNQA 1WC4A 1FE4A 4LIWA 1RWWB 4EBDA 2J6TA 4P2MA 3TQ1A 1CBKA 3TX8A 4RNOA 4DFKA 3T6JA 4OI0A 2R7RA 4C0HA 1VYAA 3X1LB 3NGTA 3SQGB 2HRYA 5HAOA 1IQZA 4CO4A 2DH8A 5C2GA 3IAS9 5DG7A 3W60A 4KR0B 1DTTB 3ILIA 2FC8A 3S7RA 1WTFA 2EPIA 5G4DA 1H73A 4N76A 5U47A 1EETB 3MPUB 2E9TA 2RAQA 4OJ3A 4I2QA 4CLYA 2UVWA 1OY6A 1TU0B 2LQ9A 3AXMA 3FMWA 1C1CB 2CWXA 3IAM9 3KHHA 4OMFG 3MR7A 2XMTA 3J80U 4M5LA 4QWEA 2COLA 3K57A 2H1YA 1VS3A 2P9CA 1U48A 4CH0S 2GVDA 1Q82T 2Z2ZA 3BGRA 4LQ9A 2Q79A 3AJDA 5T7LB 3JSYA 5ETLA 1QSSA 4OL8A 3CO9A 1IQTA 3E8OA 4CH7A 2NXJA 4B02A 1TMJA 1SJFA 1VQKS 2HFSA 3M05A 4BC7A 1IBLJ 2Y1IA 4ITSA 2V4JA 1DURA 5KG0A 1KDNA 5KFEA 4I64A 5LSOA 4UOFA 2UUCF 3CWJA 1N34J 2YVSA 2LQJA 3LTOA 2G13A 3J81j 1OPIA 3RAMA 1M5KC 2ZZMA 4ZHRA 1S1WA 3NGUA 5I4MA 5FLXY 2RE1A 2E1AA 3Q24A 3IBWA 2H3EB 1Q8KA 3DLHA 2OJ3A 4DSLA 2V67A 4ENOA 2A0FB 4GC7A 1KLNA 1HD1A 3I4HX 3F41A 1RACB 2RNEA 2MQOA 1KHWA 4RW8B 1BMQB 4Q8FA 4PWWA 4WE1A 4RR5A 1U1NA 2YNIB 4WBFA 3D0GE 3UPFA 3BSOA 2HHTA 2G2YA 1VHFA 2D3O1 1S0NA 2VG6B 2EEYA 2QMUB 2R7OA 3N6NA 4F50A 3CT9A 2JL9A 5JMNA 2FVQA 4LBHA 2R7UA 3DRSB 3HVTA 5J1PA 4K4WA 1NHVA 5IM0B 5KT2A 4N41A 2NYIA 1NAQA 1CS4B 1NSPA 1SPBP 4R5PB 4N8NA 1TVRA 1JLEA 1S6OA 4M5NA 3D0IE 1Z4UA 4J7CA 2BABA 2KFNA 3MEEA 1FXRA 4H54A 2EVZA 5ETOA 3OT9A 3UDEA 3TOQA 3W9JA 2HBYB 4QU7A 1EP4A 4AXIA 2AYMA 1ZM2A 3QT5A 3IRXB 3BQ0A 2R7XA 5EX0A 2GHPA 5I3QA 4YB1P 1D09B 4LRDA 2BKPA 5ETSA 5A8WB 3MGJA 1XR5A 3CJ8A 3R9LA 2LDYA 4DR2J 4OX8A 4Y2AA 2OMOA 3G6VA 3CJ3A 3IWLA 4EGLA 3RZAA 3CD7A 4WFAQ 4U7UK 3POTA 1EIYB 4DL2A 5BR8F 1QTNB 1RA7A 1JLAA 5D3GA 3LWLA 3V2UC 3W2WA 2QZ8A 1IUJA 3G2XA 3TAMB 1TL7A 2ROPA 3O6QA 3PIPQ 3AB2B 4F8RA 3BYPA 2R8JA 2FGOA 5KFPA 2F8HA 1F3VA 1X4GA 3ULHA 3D9BA 1PG5B 3KNAA 3H5XA 3SSRA 2U1AA 4LQ3A 4ED8A 2XGQA 4G1PA 4I68A 3DRRA 3I9V9 1EKSA 5HL7Q 1X31C 4IRKA 3GWCA 4Y2IA 4KGMA 1VBYA 1Z2LA 2FZGB 1RKJA 4X4OA 3Q8UA 1OSDA 3IM9A 3GSIA 5A2QY 1Y0HA 3M2RB 3GONA 3EPIA 4F4KA 4A8QA 2Z58B 1TTHB 3P49B 4EZ9A 2HLTA 1ZZNA 2QLXA 1RWXB 4MFBA 5DGBA 2W4PA 1VC5A 3I82A 4U8VA 3ZTPA 1UAWA 3UFCX 3KLFA 4NCAA 4FYYB 3PHEA 3QZ7A 4A8KA 1WNEA 1YHQS 1M1KT 2CNLB 4NXMF 2I5JB 1RXOB 2RSQA 5I3UB 2HVDA 1J5OA 3K0JA 3OQ2A 2Y1JA 1S76D 3QO9A 1WKJA 4DX5A 5KG2A 2E9ZA 2ATCB 4JI1J 5LOQA 8AT1B 1LW0B 3PYEA 3HF5A 2CPXA 1UFLA 3PY8A 2CG8A 5J1EA 3DOMA 2X3DA 3KK1A 3AA8A 3OVBA 1Y5IB 4TVAB 1FDNA 5JVGQ 2V8DA 3I5AA 3LO3A 1S4EA 1UVNA 4DCJB 1BQNB 1RDRA 3ELHA 3QRQA 2AJFE 4ZVHA 4DXLA 3N79A 1A7GE 3QSYB 1ZAVA 2X51A 4G6VB 1S57A 2DXFA 3VVUA 4XDDA 2IJRA 3NXZA 4M8LA 3JTPA 2LP4A 2K3KA 4QOTA 2BANB 3UR3C 1CJTA 3EYZA 4OYOA 1GEHA 1MG7A 4DG1A 5CYQB 4E98A 4NZ6A 3MOJB 4C8NA 1S1VA 4M1KA 3MAAB 5HVGA 1YBAA 3UDLA 4R8UB 5AXKA 2V9KA 4B3RF 1TL4A 3S1TA 1SJ3P 3N9UC 4I6YA 4K5SA 1RTDA 1UL3A 5LMUF 2VPZB 3Q2SC 2KM8B 2F3JA 1HBMA 3R27A 3MUMP 2IRUA 3OUYA 1QSLA 3FBBA 2D3ZA 3AHPA 1SL0A 5ETVA 2CQ3A 4DZ6A 1S1TB 1S6PA 2M8DB 3HULA 1TKXA 3WC0A 4ZP9A 4DV7F 1P9YA 5KT6A 4ECXA 4DQSA 4ELVA 1T94A 2AHOB 4CLPA 1WHYA 4B08A 1L3TA 1T0TV 1WEYA 4EFAC 3M2UA 1TK5A 1WACA 3R5CA 1Q5VA 2KZZA 4PABA 3AH6A 1URRA 3GB0A 4C8LA 2VIHA 5KFAA 4OI2A 3NAIA 1LWCB 4F02A 1R89A 1UCNA 3P8BB 1TFYA 3GE9A 5AJ3J 3RBXA 3PJWA 1X60A 5IOLA 1M5OC 4F0MA 3C14A 3LP1A 5LT5A 3RR8A 1X5PA 4ZITA 1K47A 2CJ9A 4RNHA 2MXYA 4B17A 2HQFA 5DZ6A 2B6AB 4AL6A 2EWHA 4KHPJ 4PG4A 3K7RA 1L3VA 2ASJA 3HZGA 3W9HA 1GQEA 2XYPB 2R7WA 4DS4A 2ZM6F 2LLZA 4PUOB 1IVZA 2W2QP 3BF4A 3NBPB 2YKMA 3HHKA 1H3DA 3FUYA 3AD7C 2CA9A 2VOPA 1G4CA 1U0SA 2DISA 3MCNA 2B5JB 4IRCA 4ZDNA 3MTJA 1KTQA 4X84A 3TVYA 3NRBA 3GYGA 3HT3A 2QC3A 1FD8A 3CSKA 2YXLA 3EUNA 3G6YA 1TMMA 1S9GA 2K3IA 3TNVA 4OHWA 2BUNA 4NLRA 4JI5J 1YIJS 4NI2A 1EX8A 3M30B 1RABB 2XNQA 3NP5A 1XTZA 2RUGA 4U95A 4KH1B 3RJMB 2RQ4A 3H42A 3IGNA 1FRJA
chains in the Genus database with same CATH topology
1NLKL 3EVMA 3B54A 4ENOA 3EICA 1NDPA 1EHWA 1K44A 1NB2A 3Q86A 3FBBA 3B6BA 4S0MA 5CAAA 1JXVA 1NUEA 2BX6A 3FKBA 2BEFA 4DZ6A 1B99A 3ENAA 1MN7A 3VGVA 3ZTOA 3ELHA 1NDKA 3ZTQA 3Q8YA 3Q8UA 4ANEA 3R9LA 1VYAA 4WBFA 1LEOA 3PRVA 3NGTA 1BHNA 3EM1A 4HR2A 3ZTSA 3Q83A 1NDLA 3L7UA 1PKUA 3VGTA 4W98A 3FC9A 5C7PA 1B4SA 4UOGA 4DUTA 3JS9A 2DXDA 3ETMA 3FCVA 4ANDA 3BBFA 3BBCA 1ZS6A 2AZ1A 1S57A 1BUXA 1WKKA 2ZUAA 3FBCA 4C6AA 2DXFA 4UOHA 3VVUA 3VGUA 1S5ZA 3FCWA 4KPCA 3ZTPA 3DKDA 1U8WA 1KDNA 4DI6A 3NGSA 2VU5A 1WKLA 4UOFA 3FBEA 3WX8A 2HVEA 1NHKL 3EMTA 3BH7B 3BH6B 4F36A 4FKXA 1NSPA 1F3FA 2HURA 4FKYA 2DYAA 3EE3A 3G2XA 1NPKA 2DY9A 3EVWA 1UCNA 3Q89A 3VVTA 1HHQA 1PAEX 2NCKL 2HVDA 5IOLA 3DDIA 2B8PA 3GPAA 1XQIA 5CABA 1NSQA 1NDCA 2DXEA 1WKJA 3GP9A 1BE4A 3PJ9A 1XIQA 3EVOA 3NGRA 2B8QA 2CWKA 4O0NA 1HLWA 1F6TA 1W7WA 3NGUA 3BBBA 3ZTRA 2AZ3A 4F4AA 1HIYA 1MN9A 1NCLA 1NSKL 1S59A 3Q8VA 5BXIA 1LWXA 4ANCA 3FBFA 4CP5A 3VGSA 3MPDA 3EJMA 4EK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NLK L;  3EVM A;  3B54 A;  4ENO A;  3EIC A;  1NDP A;  1EHW A;  1K44 A;  1NB2 A;  3Q86 A;  3FBB A;  3B6B A;  4S0M A;  5CAA A;  1JXV A;  1NUE A;  2BX6 A;  3FKB A;  2BEF A;  4DZ6 A;  1B99 A;  3ENA A;  1MN7 A;  3VGV A;  3ZTO A;  3ELH A;  1NDK A;  3ZTQ A;  3Q8Y A;  3Q8U A;  4ANE A;  3R9L A;  1VYA A;  4WBF A;  1LEO A;  3PRV A;  3NGT A;  1BHN A;  3EM1 A;  4HR2 A;  3ZTS A;  3Q83 A;  1NDL A;  3L7U A;  1PKU A;  3VGT A;  4W98 A;  3FC9 A;  5C7P A;  1B4S A;  4UOG A;  4DUT A;  3JS9 A;  2DXD A;  3ETM A;  3FCV A;  4AND A;  3BBF A;  3BBC A;  1ZS6 A;  2AZ1 A;  1S57 A;  1BUX A;  1WKK A;  2ZUA A;  3FBC A;  4C6A A;  2DXF A;  4UOH A;  3VVU A;  3VGU A;  1S5Z A;  3FCW A;  4KPC A;  3ZTP A;  3DKD A;  1U8W A;  1KDN A;  4DI6 A;  3NGS A;  2VU5 A;  1WKL A;  4UOF A;  3FBE A;  3WX8 A;  2HVE A;  1NHK L;  3EMT A;  3BH7 B;  3BH6 B;  4F36 A;  4FKX A;  1NSP A;  1F3F A;  2HUR A;  4FKY A;  2DYA A;  3EE3 A;  3G2X A;  1NPK A;  2DY9 A;  3EVW A;  1UCN A;  3Q89 A;  3VVT A;  1HHQ A;  1PAE X;  2NCK L;  2HVD A;  5IOL A;  3DDI A;  2B8P A;  3GPA A;  1XQI A;  5CAB A;  1NSQ A;  1NDC A;  2DXE A;  1WKJ A;  3GP9 A;  1BE4 A;  3PJ9 A;  1XIQ A;  3EVO A;  3NGR A;  2B8Q A;  2CWK A;  4O0N A;  1HLW A;  1F6T A;  1W7W A;  3NGU A;  3BBB A;  3ZTR A;  2AZ3 A;  4F4A A;  1HIY A;  1MN9 A;  1NCL A;  1NSK L;  1S59 A;  3Q8V A;  5BXI A;  1LWX A;  4ANC A;  3FBF A;  4CP5 A;  3VGS A;  3MPD A;  3EJM A;  4EK2 A; 
#chains in the Genus database with same CATH topology
 4DUY F;  4LIR A;  4CDI A;  2ZC4 A;  3MTK A;  5KOW A;  2VFT A;  2ZWO A;  2YNF A;  3QQC D;  5HAT A;  2OGU A;  2EC2 A;  1WOO A;  2D9P A;  5GAD I;  4EUV A;  5GMD A;  1N5Y A;  2JNJ A;  4G1Q B;  2JVR A;  1RTJ A;  3Q83 A;  3VGT A;  2YTC A;  4HHH A;  3B8H A;  3DC2 A;  3ET6 B;  2OKQ A;  5E3R A;  4P6Q A;  1U1L A;  2WON A;  1CQN A;  2G2Z A;  3MM6 A;  3SDE B;  4ES1 A;  3QSI A;  5EWE A;  2ZH1 A;  2L9N A;  1MWZ A;  2W9B A;  1WKL A;  4HHJ A;  1F5A A;  1Y10 A;  5DDQ C;  3ZO7 A;  2QLJ B;  3MM8 A;  3SQG A;  4B3M F;  5E3P A;  2Z2Y B;  5KFG A;  2V2Z A;  2XMV A;  2ZE2 B;  1N56 A;  4DJB A;  3WHI A;  1RYS A;  3KHG A;  3J7A 1;  5E5N A;  3M6V A;  1S4F A;  1RHQ B;  2J9C A;  3J7Y I;  2M8H A;  2CJA A;  4JYA J;  1EET A;  1KN6 A;  3NS5 A;  3WDO A;  2GMJ A;  1WDD A;  1FDD A;  1BGX T;  3HI9 A;  2W2N P;  2VA2 A;  2K1R A;  1LWE B;  1QAI A;  5ETN A;  2WSE C;  1NM2 A;  3RYL A;  1C1C A;  4ZJL A;  2VHG A;  1EAY C;  5HRO B;  3M7V A;  4RBU A;  4JI0 J;  1AYE A;  4ZIV A;  5IWA F;  1U2F A;  2XZT B;  3O1L A;  2XSF A;  2R42 A;  1YJ7 A;  5HLF A;  5LXY A;  3OLA A;  4R0J A;  2RIL A;  2ZH3 A;  3LQV A;  4KRW A;  2YH1 A;  3EMT A;  4IG0 B;  2AKW B;  3H4D A;  1M5S A;  4IR9 A;  1JXE A;  3ZZU A;  2IIH A;  3OVA A;  2OO4 A;  5T7L A;  3T6B A;  2EK1 A;  1NO8 A;  4LMZ A;  5T14 A;  3JXO A;  3I87 A;  1N5S A;  2V69 A;  1FO1 A;  2W7A A;  1SQG A;  1NZ8 A;  1F6T A;  5ETM A;  2OSR A;  1K8A T;  3CCR S;  3KJN B;  3TJ8 A;  2AF6 A;  4TQS A;  3KG0 A;  3L4B C;  2PN6 A;  3SYZ A;  4YR2 A;  3AA9 A;  4GO7 X;  3EVM A;  3BDE A;  4DR1 F;  3S01 A;  3H5Y A;  1IR0 A;  3OFF A;  2J0X A;  5C24 B;  2Y8Y A;  3Q86 A;  2HHP A;  4B9M A;  3OL9 A;  2X1B A;  1M1G A;  4DV5 F;  3HJF A;  3MPY A;  4K0K F;  3RBZ A;  3FQL A;  4XIU A;  4OZ5 A;  1YSJ A;  1Y5L B;  3F44 A;  4DCP B;  4PPD A;  1U6B A;  4U8Y A;  1U1O A;  3PW7 A;  4PYD A;  3DGV A;  2J0Q D;  5KT5 A;  3KLH B;  3Q8Q B;  1S6Q B;  4Q2M A;  1PBU A;  3MR6 A;  1RLD A;  2IHR 1;  1GX6 A;  4OHV A;  4LF5 F;  8RUC A;  4RW8 A;  2CQ1 A;  2CVI A;  2QA4 S;  5L9N A;  5M2R A;  2YNG B;  2YNI A;  1QLN A;  2UUB F;  2HS3 A;  2GNK A;  4H4K C;  2APO A;  2L41 A;  1DQ9 A;  1RT6 A;  4DV2 J;  1URN A;  3LP0 B;  4K59 A;  5BXI A;  4U96 A;  3DRS A;  3M6W A;  2VG7 A;  2BW7 A;  5IM0 A;  2K06 A;  3VF0 B;  2NXC A;  2HFU A;  4NYZ A;  3OV7 A;  1CS4 A;  4R5P A;  5I42 B;  1A0O B;  2MJN A;  3AQO A;  1D9F A;  2YWK A;  3QJP A;  5D6G A;  3NEK A;  4V1A k;  4CLU A;  4X62 F;  5EGY A;  2XHC A;  3M9M B;  3FZ2 A;  1FNO A;  1C1B B;  4RBV A;  2DR5 A;  3THT A;  3GSD A;  3P4U B;  3ENW A;  4NLV A;  1CJK B;  2BRL A;  1JJH A;  2VAS A;  4C6A A;  3C6U B;  4J9Q A;  3IRX A;  1HNV B;  3HKZ D;  3CD5 A;  1RA6 A;  5KG4 A;  2QMW A;  1NEE A;  4B9N A;  4XO0 A;  2HBR B;  2F65 A;  5FLX U;  4LR8 A;  4ICL B;  2ILY A;  5A8W A;  4PG6 A;  1F5B A;  1F9E B;  3VVT A;  3DGP B;  3QRR A;  3TZX A;  2LEC A;  3BO3 A;  2DRA A;  2OPP B;  1V5I B;  2XLJ A;  4CM2 A;  3DCA A;  2VOO A;  5J2P B;  2R8I A;  4K4S A;  2ZH2 A;  4JV5 F;  1JXL A;  3UN2 A;  1BLU A;  5J2N A;  3GQC A;  5DM6 Q;  2HRT A;  2F63 A;  4DZD A;  1U1R A;  1WJ9 A;  2NZ4 A;  1RAO A;  2A6O A;  2GJI A;  5JUM A;  5CZX A;  4NLO A;  5KFW A;  5K8P A;  3TAM A;  4WXW A;  1FCA A;  1VQ9 S;  3A3N B;  1R8B A;  2ZC3 A;  2HVH A;  5LJ3 Y;  3Q8Y A;  1U47 A;  3LA0 A;  3T19 A;  2FLL A;  2HHH F;  3EM1 A;  4OZL A;  2WVF A;  3H98 A;  2DO0 A;  4USM A;  4ED2 A;  1I94 F;  1O6X A;  1NB7 A;  1QE1 B;  2HAI A;  4I6A A;  4JI8 J;  4WK3 A;  4MMO A;  3TR5 A;  4HH1 A;  1Q7L B;  2NSB A;  1RQ0 A;  3NS7 B;  4IUF A;  2Q66 A;  1O0P A;  2GW8 A;  4KHM A;  1GMW D;  4C3K A;  3MD3 A;  3V5R A;  5KFT A;  3M2R A;  1YRX A;  3V6H A;  4FYX B;  2NLW A;  3LGH A;  3CUN A;  1X4B A;  2LU1 A;  3T41 A;  1HHT P;  1XNQ F;  2UVU A;  1VQ4 S;  1FRL A;  4C3M A;  3KKF A;  4LF9 J;  2EK6 A;  4Y2M A;  1SUQ B;  1D3W A;  1N8R T;  5GAE U;  2IA0 A;  1CSJ A;  3RB0 A;  2I5J A;  3GJS B;  1VRT B;  3KUH A;  2UU9 J;  3JAM Y;  5I3U A;  2CAD A;  2P9E A;  2ZVS A;  3K58 A;  1EB0 A;  1JLB B;  5DG9 A;  3I56 S;  3OJS A;  2M70 A;  2R7T A;  4OJG A;  4RJV A;  5KFJ A;  1IM6 A;  2XZW A;  5L1L A;  1F60 B;  3TVZ A;  1SVD A;  1ZPW X;  1RIS A;  1UP1 A;  4ZP6 A;  1BQN A;  4J37 A;  4YB6 A;  1NZA A;  3CCT A;  1LOU A;  4DX8 H;  3F56 A;  1S97 A;  1XNR F;  2BJ7 A;  2UUT A;  2ILZ A;  4C9D A;  3HK2 A;  5I3P A;  5AT1 B;  4ZVU B;  4C48 A;  1FJG J;  1Q78 A;  1TK0 A;  2HHQ A;  2OTJ S;  2BAN A;  1WUU A;  4KGV B;  4F7V A;  1P8G A;  5CYQ A;  2E1R A;  2GA7 A;  3MAA A;  2QYG A;  4NAS A;  4PPZ A;  5THW A;  3RW7 A;  2MLX A;  1XK8 A;  4A8O A;  2UXC J;  2HIY A;  3MM9 B;  4R8U A;  1HFE L;  1WC5 A;  3OFG A;  3HP6 A;  2V2V A;  1Y3J A;  2V6A A;  4I2P A;  3TZW A;  3OTD A;  5KFI A;  4KIA A;  2RH3 A;  2FHO B;  2DEJ A;  3OFE A;  1ZTT A;  4X64 J;  3TZY A;  4ZVG A;  4Q43 A;  2ZKU A;  3M4X A;  5LMN F;  2CDQ A;  1SC1 B;  2D9O A;  3H0P A;  2ZDO A;  3EZ5 A;  1SIZ A;  2MQ8 A;  2OPQ B;  3EGV A;  3ZZ0 A;  4CLS A;  2N7C A;  3K17 A;  4I7F B;  4KFB A;  4P10 A;  4WKR A;  3QWP A;  4ES3 A;  3DU5 A;  2KRR A;  3BGL A;  4F4A A;  4B3T F;  4OZ3 A;  1SXL A;  5J1N A;  5FD1 A;  2DGW A;  2XLK A;  1YBU A;  3FBF A;  4AQY F;  2N4C A;  2MKY A;  1X5O A;  4A8Y A;  1TL1 B;  3UW1 A;  1N36 J;  2I8E A;  5KOX A;  4UZB A;  3OL6 A;  1LWC A;  1T9X A;  1EKR A;  1HA1 A;  4Y34 A;  1VIX A;  3HT0 A;  1JLC B;  4GKK J;  3QRP A;  3ZTQ A;  3L9Z A;  4ANE A;  3RRG A;  3CD0 A;  5LXR A;  1RAE B;  1S0M A;  3KYL A;  2B6A A;  3CJ4 A;  1BC6 A;  3UQS A;  1HR0 F;  3BBC A;  1H7W A;  2ZUA A;  2XBP A;  2BQ3 A;  3HFV A;  1RBL A;  4ZPW R;  3OHB A;  3ZZZ A;  3K59 A;  4ZVO B;  4PUO A;  2ACM A;  3I31 A;  1WOS A;  2DTJ A;  3NBP A;  2BR0 A;  1N32 J;  4B3S J;  1CC8 A;  4IKA A;  2DCL A;  3D1Q A;  2RF2 A;  1OO0 B;  3M6X A;  1VQ7 S;  2HMI B;  1N0V C;  1FWP A;  2B5J A;  2VH7 A;  2YX4 A;  3H5S A;  2AP6 A;  4HTI A;  3DXB A;  1NCL A;  1SH3 A;  1FEE A;  2POK A;  3T1Y F;  3HM9 A;  4LFB J;  2RRB A;  2ZFH A;  2HHU A;  2QIF A;  2FVS A;  2D7S A;  4ZCK A;  2HHW A;  2V94 A;  2C2K B;  5SUH A;  2ERR A;  1BD6 A;  5E2Q A;  1JK9 B;  3C66 A;  2OPS B;  3PW5 A;  2CQI A;  2JSX A;  4X4P A;  3DU6 A;  1N33 J;  4M94 A;  3NCR A;  2QA4 G;  1H74 A;  4USI A;  3D1O A;  2AIR B;  4IO1 A;  1VQS A;  3O2I A;  2BE2 B;  3MED B;  3FSI A;  1WG1 A;  5F8L A;  1IJF B;  2HQC A;  1Y3K A;  3TJA A;  3SFU A;  2FHJ D;  1KWM A;  2FDN A;  2C2E A;  1VFJ A;  2EW9 A;  2YWF A;  2DPI A;  2MKI A;  2WOM A;  2VD3 A;  1RTH B;  3JQJ A;  4MKB A;  2FQQ B;  2WW4 A;  3PCO B;  4G1Q A;  1HMV B;  4K5R A;  3W2V B;  2GVZ A;  3ET6 A;  4YDD B;  3OXL A;  2QE5 A;  2B8Q A;  5HAN A;  5A6P A;  3PVX A;  4P9S A;  3O5T B;  2UUA F;  4Y0F A;  4HKQ A;  2XMU A;  3RBD A;  2BJ1 A;  2QFI A;  1HHS A;  2BW2 A;  2XMM A;  4PWD B;  2AWZ A;  2BEF A;  4MIA A;  3D7S B;  3O44 A;  3B78 A;  3VAM A;  3ZNJ 1;  3S8S A;  4JV0 A;  5KT7 A;  3UR0 A;  2ZE2 A;  4HL9 A;  3W5Z A;  3CJ0 A;  1P27 B;  3OSN A;  2W4D A;  1WDT A;  3T1H F;  5AE3 A;  4JI6 J;  1W26 A;  2LXU A;  2JLE A;  3VGU A;  5EWG A;  1H38 A;  3K5L A;  3M32 B;  4A8M P;  3BZQ A;  2RDJ A;  4LF7 J;  2C2D A;  4CTA B;  1LWE A;  2CPH A;  2Z0G A;  3B4D A;  3P5T L;  1NPK A;  3M8Y A;  2CPF A;  2C3P A;  4ILL A;  3JQK A;  5FDL B;  5A0Y B;  1B70 B;  2BJ8 A;  1JLG B;  4DQI A;  5HRO A;  2V4Q A;  4GVL A;  1U45 A;  2XSJ B;  1F0X A;  1H98 A;  3D4J A;  5KFS A;  3HSG A;  4LFA J;  1F2G A;  1HNW J;  3GFZ A;  1JKH B;  3S6E A;  3AT1 B;  1QM9 A;  2JLG A;  4CLW A;  2BE7 D;  4IG0 A;  3VAL A;  4DU7 A;  4NLG A;  1JIH A;  1K44 A;  1RB0 A;  4MK7 A;  1D8Z A;  4EZ6 A;  1JQG A;  3LGN A;  1E6Y B;  5IT9 Y;  2VBW A;  3IN5 A;  2MZQ A;  4Q8E A;  2HZC A;  2HQD A;  5H1S V;  4WII A;  4DSJ A;  2MDA A;  3NLC A;  2KZM A;  4DX7 A;  2ZEJ A;  5KFO A;  1EAR A;  5ETP A;  2KFY A;  1UWA A;  5M2U A;  1FTR A;  1R8P A;  4C8O A;  2V68 A;  5C24 A;  4FYV B;  5HO4 A;  1D9D A;  4YEA A;  1KC8 T;  2ZBC A;  5LJ5 Y;  5KFV A;  2XM3 A;  3KJV B;  1DQA A;  5E3C A;  2BJD A;  4J9O A;  4CQ1 A;  1WF0 A;  4J9P A;  1UW9 A;  4RBT A;  1X4D A;  1FTC A;  2NXE A;  5EN1 A;  4HAC B;  1RWM B;  4ID5 B;  3VAF A;  2CIM A;  1R8H A;  1S6Q A;  4HH0 A;  4JOU A;  5K14 B;  4WYW A;  4B9T A;  4C8Z A;  2AJQ A;  4FXW A;  1KLM B;  2FJA B;  1SJ4 P;  2AEF A;  2YNG A;  4ZJQ A;  1D8Y A;  3G6E S;  1UWB B;  2V8P A;  2M52 A;  4FF4 A;  2OIH A;  2YQ0 A;  4RNF A;  2RRN A;  3HVW A;  4KC5 A;  2FVP A;  2BVZ A;  4DPW A;  3C8Y A;  1LV5 A;  2NZC A;  3LP0 A;  2Q6C A;  2V8H A;  2CNN B;  1KVK A;  4O4G B;  3IR7 B;  3HHL C;  1SQE A;  2DIU A;  7AT1 B;  4WWS A;  2KYX A;  1UET A;  3GZ7 A;  2R2R A;  4F36 A;  5L1K A;  5F8G A;  4OI1 A;  3C19 A;  4F4X A;  2UVR A;  1RT7 B;  1GTE A;  3RGI A;  2B56 A;  3QWU A;  2VJU A;  1NME B;  2CJK A;  1PAU B;  1CJK A;  4Q0B B;  4DV3 J;  4CNY A;  2OUG A;  1W7W A;  4ED3 A;  2MZR A;  4U7U D;  3SI8 A;  3C6U A;  4YP3 A;  1HNV A;  3MCM A;  1YVF A;  2VDI A;  3MMC B;  3PM9 A;  5GAH U;  1U1M A;  1N5T A;  4ICL A;  1AXQ A;  3NWR A;  4DV4 J;  4S0M A;  3CMQ A;  4URG A;  4D3H A;  2G0C A;  2OPP A;  3KDO A;  4NML A;  4RW4 B;  4KYZ A;  3GR1 A;  1VOM A;  5IT0 A;  5J2P A;  3A13 A;  3D0H E;  4AUK A;  4A46 A;  3C3L A;  2WVE A;  5L9X A;  2BMB A;  2DJW A;  4RNN A;  4KJI A;  2HNZ B;  1YX2 A;  2IBO A;  3SCJ E;  3CJR A;  4QPX A;  3M6U A;  5HP1 B;  1AW0 A;  1BQX A;  2Z8Q A;  3D28 A;  5C5J A;  2VB6 A;  3AOC A;  5KFY A;  4DSE A;  3FEX B;  3D54 A;  3MZI A;  1U49 A;  4YFU A;  3NOC A;  3T9N A;  2EFV A;  5K8O A;  2W9A A;  1J2V A;  3GCW P;  5D4N A;  5KFQ A;  2NXU A;  4USU A;  2E7W A;  4JP8 A;  5AXN A;  1N48 A;  1IBM F;  2W2O P;  2BV3 A;  1VLY A;  1FI4 A;  1EQ0 A;  3B54 A;  3NCP A;  3E3X A;  3UCG A;  2RHQ B;  4U6P A;  2ZD1 A;  1ZA1 B;  4WZM A;  4L76 A;  2D41 A;  2KDO A;  2HW3 A;  3TI0 A;  4EMD A;  3KJQ B;  1NDL A;  1Q8B A;  2JH3 A;  3MEK A;  3WC2 A;  1U26 A;  1EZZ B;  5C25 B;  1U4B A;  1YIT S;  1X4C A;  1YQH A;  2KVI A;  1VRU B;  4DSK A;  1FK9 A;  1T3O A;  4CO2 A;  5KG7 A;  1NBE B;  2LA4 A;  1SUQ A;  3FCW A;  3GJT B;  2C3M A;  1Q95 G;  2CJX B;  1VRT A;  2BQU A;  1S12 A;  1DTQ A;  3EE3 A;  1S1U A;  2HQI A;  1X0P A;  2R7Q A;  2J8S A;  1JLB A;  2FPH X;  2VUG A;  3P5B P;  4RLE A;  4KTQ A;  1XMO J;  4OV6 A;  2CQC A;  3HFK A;  4ZVP B;  2RQM A;  1U24 A;  1K9M T;  3PJ9 A;  3EVO A;  1B64 A;  3RAX A;  1Q53 A;  4O0N A;  1L3K A;  1T8E A;  2NSC A;  3QAT A;  4QWA A;  1VLO A;  4ETX A;  5MAO A;  1IBK F;  3MPD A;  3C6T B;  1F9H A;  1C0U B;  2BAC A;  1C0T A;  1OIA A;  4JI4 F;  1JLQ B;  3CCM S;  2W7P A;  3JB9 k;  4O44 A;  2C3Y A;  3HMJ G;  1NDK A;  4M5K A;  2FJD B;  2CPZ A;  5K8M A;  4X65 J;  1JNZ B;  1OYD A;  2MMY A;  1LXJ A;  2OI2 A;  1NHU A;  1RYR A;  2P9G A;  4Y28 C;  4GVB B;  4KB7 A;  3MD1 A;  3MMJ A;  5F0W A;  4ED1 A;  4QIG A;  4KPC A;  5B09 A;  1GMW A;  2MY8 A;  1LWF B;  4ZVT B;  5GAH I;  2HS0 A;  1UA0 A;  3GYX B;  2F8E X;  1RTI B;  1GTH A;  2V8G A;  4ELT A;  3QT7 A;  2XQC A;  5ETT A;  5H9F J;  2WTF A;  3TAP A;  4NZ0 A;  3UE2 A;  1XEZ A;  3DN9 A;  5KFM A;  2V4R A;  1X9S A;  3QAU A;  3JAM U;  3IC1 A;  5DGA A;  2JC0 A;  4WP9 A;  1O51 A;  2AV5 A;  1VC6 A;  3M1V B;  2M5Y A;  1YJV A;  4ZN3 A;  5LM7 E;  4CP5 A;  3PX6 A;  2H54 B;  2AQ4 A;  2WAQ D;  3LAM A;  4LSL B;  3BR9 A;  2YX7 A;  1KFS A;  2OPQ A;  3M9N B;  1I1G A;  2RKI A;  4I7F A;  4UY8 T;  3TX0 A;  4DFP A;  3ZTO A;  2W01 A;  1RHK B;  1CJU B;  2B3T B;  3CVK A;  4I56 A;  2HLU A;  1FE0 A;  5C42 B;  4KHP F;  2XCA A;  3GTY X;  3ENQ A;  3DOK B;  1TL1 A;  3EZU A;  3SV3 A;  3JSR A;  3DLG B;  3HVR A;  1OQ6 A;  4D3G A;  3D3C J;  2ZBI A;  2X1G A;  1NK6 A;  2WSF C;  2IYI A;  3EXY A;  2DEI A;  3TAQ A;  1T9W A;  2AJ2 A;  3SFG A;  1FNM A;  2JC1 A;  3US5 A;  1ARO P;  4DPX A;  2QX0 A;  3G6X A;  3QFH A;  1UJ4 A;  5B0G A;  3N5F A;  1U1Q A;  2Z2L A;  2YWE A;  2GFF A;  1U1K A;  2PEH A;  1KON A;  4CT9 A;  4UOC A;  3UD3 P;  4FBU A;  2CZV C;  1G6B A;  4N56 A;  2XC9 A;  2UXD F;  1UVL A;  1FVS A;  3MCS A;  5DDP C;  5K8N A;  4M95 A;  5F8N A;  2F7V A;  5HMZ A;  1SCJ B;  2N7Y A;  2HFO A;  4ECW A;  4JI5 F;  2BXJ A;  1FJ7 A;  1HQE A;  5KFC A;  4F26 A;  4QWC A;  5BR8 J;  2LU2 A;  1ZET A;  5DET A;  4YHH F;  4QIE A;  2CZ9 A;  2GGP B;  3M8Q A;  1BUX A;  4F2S A;  4MH8 A;  4DN0 A;  2JX2 A;  3R3T A;  2R7S A;  3Q2T C;  4LF4 F;  1PGZ A;  2WRM A;  2MLY A;  3W65 A;  3EPG A;  1U8S A;  1YJR A;  2F40 A;  2BE2 A;  4Q2L A;  1L3U A;  3MED A;  2XS7 A;  4YB5 A;  3N6L A;  1CG2 A;  1WC6 A;  4QJV A;  2JEI A;  2BQR A;  2QJ3 A;  1UVK A;  3NKY A;  1UVI A;  4WTY A;  1UVM A;  2KXN B;  2E7V A;  1FDA A;  2KT3 A;  4X4S A;  2IAJ A;  1RTH A;  2ZNY A;  4WP3 A;  3PKY A;  4ZP8 A;  5L39 A;  4C98 A;  1TL5 A;  3C15 B;  1HMV A;  3V81 B;  3HD2 A;  2VC1 A;  2OP5 A;  2H9Z A;  4O3N A;  1RT3 B;  1ULR A;  4DN9 A;  4NA2 A;  2CUY A;  4MAK A;  3DRP B;  1E6V B;  5E3Q A;  2QT7 A;  4DMZ A;  2ZHO A;  2BM0 A;  5D8H B;  1IKW A;  2GAH C;  1WKK A;  3FBC A;  4DV6 F;  4NXM J;  1I51 B;  4DR6 F;  1U8W A;  4PWD A;  3TQE A;  2DGS A;  1XER A;  4KY3 A;  1NDC A;  3LH2 S;  4WCE Q;  1GXL A;  4RZR A;  4FF1 A;  3OR1 B;  4O4R A;  2O5D A;  3MUV P;  4HI1 A;  3PZP A;  3LOU A;  4IH6 A;  4XK8 C;  2YWG A;  1MU2 B;  1VQ6 S;  3L3C A;  3M32 A;  1R43 A;  3CJK B;  3KK3 B;  3LW5 C;  3X3U A;  4CYU A;  1RGV A;  2A1B A;  4CTA A;  2M0G B;  3V6K A;  1T95 A;  2PD1 A;  2HWT A;  3LPE A;  1KEK A;  3DLL Q;  1ICE B;  4NYO A;  5FDL A;  5A0Y A;  3ENA A;  4C97 A;  3CCV S;  1JLG A;  4RX6 A;  3D5M A;  1TV6 B;  4PXD A;  1UW4 A;  2AGO A;  4DHV A;  1Q1K A;  3MFH A;  2XSJ A;  2FHJ A;  4LRA A;  3TO8 A;  1NJZ A;  1FFG B;  5DDR C;  1AFJ A;  1OWX A;  2IPO B;  2CG4 A;  3H2U B;  1JKH A;  4DEZ A;  2WCX A;  3T5J A;  1SJ1 A;  2ZHA A;  3CDU A;  2E1P A;  2VDH A;  1S77 D;  3QZ8 A;  4NA1 A;  3BPS P;  1KFD A;  1TP7 A;  1E6Y A;  4LF2 A;  2LXF A;  4BBY A;  1K73 T;  1FX4 A;  5LMU J;  1TKZ B;  4W92 B;  2B8P A;  2R2S A;  1V6H A;  4WXO A;  3W1Y C;  5D0G A;  2DNP A;  3Q0A A;  4F0K A;  4UTG A;  1HWL A;  3HLU A;  4OYX A;  4ERD A;  1Q8L A;  3OTO F;  4C4W A;  1VCT A;  5KFK A;  2D3O R;  3VV2 B;  3K2Y A;  3VGS A;  1FER A;  2EKN A;  3I96 A;  5A6W A;  2HG4 A;  1HYS B;  4DV7 J;  4RUA A;  1GFW B;  3GFY A;  4CCH A;  2LXI A;  2G0J A;  5IS2 A;  3BJY A;  5EWF A;  1R7I A;  2RU9 A;  2JVO A;  2B9Y A;  2K2P A;  3W66 A;  4HAC A;  5HSP A;  1XC9 A;  4ID5 A;  1VK3 A;  1ZBT A;  1U6F A;  4DV2 F;  4TU7 A;  2AZ1 A;  2HZA A;  4I6W A;  2DR7 A;  5K14 A;  1WC0 A;  2F9D A;  4CLL A;  2HHX A;  1QSY A;  2HVE A;  4QR1 A;  4G1I A;  3IWX A;  4GMK A;  2DH9 A;  4RU9 A;  4URQ U;  1UWB A;  1XJW B;  4NRU A;  2IFX A;  3W7B A;  4BDP A;  1NJY A;  5AXM A;  3UD5 A;  3TJ9 A;  2IC3 B;  5IXU A;  2GS8 A;  5IT9 U;  2ZH5 A;  4O4G A;  4RNM A;  2ZM6 J;  4Y65 A;  5L1J A;  4LBP A;  2E5H A;  5HBM B;  2O66 A;  1ACM B;  2E5G A;  3CXC R;  3HO1 A;  2KG0 A;  3PTW A;  4P7V A;  2DCU B;  1RT7 A;  1GNK A;  3HD1 A;  1V5V A;  1ZAW A;  2XI3 A;  2DGO A;  2DKO B;  2MGZ B;  1RT5 B;  4USJ C;  2VG5 A;  2Q1L A;  3IFE A;  5J2M B;  2CYY A;  2G0I A;  3FC9 A;  3RG6 A;  2PA3 A;  3BKU A;  4PZV A;  4LF1 A;  3MPW A;  3MMC A;  4X66 F;  4IFY A;  1U0H B;  3J80 Y;  1JX4 A;  2EFP A;  2ZVI A;  3BH7 B;  1HL6 A;  2R4F A;  2OD4 A;  3MFI A;  2QN6 B;  3QT8 A;  4NXN F;  4ECT A;  3V6J A;  4JI2 F;  4RW4 A;  4Z7Y A;  3I0R A;  3BEG B;  1PO6 A;  4H4M B;  1YI2 S;  3L95 X;  3J7Z T;  2L9D A;  3MM5 B;  3EDR B;  2XB2 D;  4QW8 A;  4B9L A;  4ZPA A;  2HNY B;  3VAH A;  5E41 A;  2KXH A;  2M88 A;  3ADA C;  1RWP B;  5HP1 A;  1HAR A;  1Q81 T;  3D67 A;  2NPI A;  2CPE A;  2KTQ A;  4RW7 B;  3GV7 B;  4P73 A;  1J27 A;  3BSA A;  1N5Q A;  3ENV A;  4ZPT R;  3P45 B;  2BOP A;  2A2C A;  2FLN A;  3LGM A;  5K20 B;  2AEM A;  4ECS A;  1JNR B;  4F3O A;  3K5M A;  4L3N A;  4LF6 F;  2PE8 A;  2YY3 A;  5J2Q B;  2PDA A;  4Y6I A;  2VQE F;  5HK4 A;  4FF2 A;  3MEC B;  2YH0 A;  3MUT P;  2H5I B;  4B3M J;  2VBY A;  2UU9 F;  3PEH A;  1HQ2 A;  2E44 A;  4DV0 F;  1RKI A;  4GKJ F;  4KGK A;  4JV2 A;  1Y4Z B;  1VJQ A;  1ITP A;  1MMD A;  3GPA A;  2QLW A;  5C25 A;  2HHS A;  4HT7 A;  1O8B A;  9RUB A;  4LFC F;  2WBM A;  2YKO A;  2VKZ G;  1U1P A;  1UEK A;  4K4V A;  2AEJ A;  1NK9 A;  3QID A;  3R6L B;  2EKY A;  3T3F A;  5B0D A;  3HFZ B;  2RQC A;  2ZNZ A;  5IWA J;  5F0U A;  2GQQ A;  3F0N A;  3GLJ A;  5L8R C;  2DNR A;  2Z57 B;  2PEB A;  3K5N A;  3V6D B;  2IM2 A;  1DQ8 A;  1FEH A;  1QDU B;  4OYA A;  2KRB A;  1VQP S;  3QNW B;  1RTZ A;  2VFR A;  3C6T A;  2AYG A;  1C0U A;  2DVI A;  4ETZ A;  2ASY A;  3KK2 B;  1WC3 A;  4K2X A;  1JLQ A;  1S1W B;  1U6Z A;  3D3B J;  1FFS B;  3GG0 A;  3PW4 A;  1WEZ A;  4LF8 F;  4KHR A;  4DR4 F;  1REG X;  1K1Q A;  4NEY A;  2ADB A;  2XCP A;  5DQI A;  4J91 A;  3W5Y A;  3UVJ B;  4GVB A;  4USW A;  4Z2X A;  3A1Y G;  4LT6 A;  3RB4 A;  5L38 A;  3J81 Y;  4LJM A;  2A2D A;  3U1M A;  1LWF A;  2KFZ A;  4K0K J;  4O0I A;  3O3L A;  4ZVR B;  4LBI A;  3HDS A;  1RTI A;  3BM7 A;  2BX6 A;  3CW2 C;  3W9I A;  4DUZ F;  1VQO S;  5A8R B;  3GV5 B;  3DI6 B;  2VF3 A;  3BGU A;  3L09 A;  4N77 A;  4RW6 B;  1HNI A;  1F1B B;  5KFD A;  3KLG B;  1A9N B;  4Y3C A;  4AFF A;  4ECY A;  4E0D A;  1PKU A;  1HNX F;  4I4B A;  3M1V A;  3SMZ A;  2H51 B;  4HEA 9;  4LF5 J;  4XAK A;  1U02 A;  1RWU A;  4ZMM A;  4CRJ A;  2Y0S D;  4LSL A;  3N5B A;  4NYP A;  2GIF A;  2R2T A;  1R0B G;  2UUB J;  5LSL A;  2FIU A;  4FKY A;  3THV A;  2XMW A;  1NXI A;  1CJU A;  1TZ0 A;  3ILL A;  1RAI B;  3OXG A;  4WIQ A;  4PG8 A;  5CAB A;  1SB6 A;  1VI7 A;  2DNG A;  3KDN A;  2VON A;  2V50 A;  1NK8 A;  1S49 A;  2C42 A;  2IJF A;  3GIK A;  3PRB A;  2QL7 B;  3BS9 A;  2C2O B;  1MNE A;  3DOK A;  5K5M A;  3RB3 A;  2HGM A;  1NSK L;  2N4D A;  2CDR B;  3WQP A;  3DLG A;  3G82 B;  2PII A;  2IMW P;  4X62 J;  1KSP A;  2ZOM A;  1Q7Y T;  1JJ4 A;  1AUD A;  5IC4 B;  2MHE A;  2MPU A;  4QQB A;  3VZH A;  5SZT A;  1PSD A;  1RT1 B;  4F3Q A;  3GFX A;  3ZZO A;  1NJW A;  3PRV A;  1R0A B;  4PAA A;  2QL9 B;  1BXN A;  1RHM B;  5GAD U;  4ZVE A;  3E2E A;  2J0S D;  1UPP A;  2DR6 A;  4LFB F;  2PT0 A;  3BBF A;  4OZ2 A;  1TL7 B;  1OSC A;  2VZ9 A;  3I5B A;  4Q44 A;  1IBC B;  1PJ6 A;  1QTM A;  1P1L A;  4CI0 B;  4PWU A;  4KT0 C;  3M2V B;  2Z30 B;  1LQ9 A;  4ZLP A;  2DR9 A;  4JV5 J;  4QCL A;  1FRX A;  4EBC A;  2BOA A;  3UI3 A;  2DRB A;  2JHE A;  3CUL A;  3AQP A;  1T02 A;  2C28 A;  3ZZP A;  3ONQ A;  1SIW B;  2JEJ A;  4G65 A;  2GML A;  4R0E A;  2V8V A;  4DF4 A;  3J7Y U;  3PEJ A;  1NKC A;  2HHV A;  4W90 B;  1PCA A;  4PQU B;  2KJV A;  1HBU A;  5KG5 A;  1I94 J;  4DV1 F;  1XMB A;  3I55 S;  4DL4 A;  2VFV A;  1OY9 A;  1P6T A;  3CIZ A;  2HYI B;  4DWI A;  2VKR A;  4MFB B;  3FQK A;  4KAI A;  2V5H G;  1VQM S;  1JJC B;  4C3L A;  4M63 A;  1NJI T;  2OEM A;  4A8F A;  4K50 A;  2OLW A;  4E2F B;  4IQM A;  1X8D A;  2KXF A;  1U09 A;  1WEX A;  1J5O B;  2F1F A;  4OZJ A;  2FLO A;  3C15 A;  2KYZ A;  4ILM A;  4TLR A;  5KG3 A;  4IG3 B;  1RT3 A;  1XNQ J;  3LUY A;  5ADZ A;  3DRP A;  1E6V A;  2DPJ A;  3KK1 B;  3T5L A;  1W2I A;  1HLW A;  2JRS A;  3HCX A;  3GJQ B;  3C2P A;  3DXS X;  2VPY B;  1C4C A;  4ANC A;  1QUP A;  4TXS A;  2M4M A;  5RUB A;  1CUL B;  3Q23 A;  2LDI A;  2DNM A;  1NB2 A;  5HMY A;  2W4C A;  1NUE A;  1WHX A;  4B9V A;  1VDH A;  2AJ4 A;  1VQ5 S;  2ZH9 A;  2VA3 A;  4FN5 A;  3KMQ A;  4PCQ A;  4AL5 A;  4JI3 F;  1R6Y A;  1WG5 A;  1H6K X;  1H72 C;  2Q3P A;  1OY8 A;  3I4P A;  4LFA F;  4W98 A;  4DCO B;  2E66 A;  3OL7 A;  3JS9 A;  1MU2 A;  1UZH A;  2EFG A;  3KK3 A;  2O01 C;  2F4V F;  3QGI A;  4CNZ A;  3QT6 A;  1NSA A;  5A76 A;  1QD1 A;  1XNR J;  2FJW A;  2AX1 A;  4IOB A;  1TV6 A;  1Y7P A;  4HDH A;  3CGI A;  2ZOF A;  1OQ3 A;  3I5C A;  1DFD A;  5B0C A;  3DLE B;  2IRX A;  4K2J A;  3U1L A;  4LR9 A;  1HBM B;  4O23 A;  1UMJ A;  4Y00 A;  4Q5V A;  4CLF A;  1S6P B;  1KQK A;  3RR7 A;  1I3O B;  5H9F K;  3TUZ C;  4J9K A;  1DLO A;  1FHT A;  3ZZT A;  3NGD A;  2AGQ A;  2M7S A;  2KU7 A;  1TKZ A;  4MKV A;  2EXU A;  3CCJ S;  3CDA A;  3RBE A;  3ISN C;  2OEJ A;  2BZ2 A;  1ZAX A;  2LEA A;  1H0H B;  4F2R A;  5LMN J;  2DXD A;  3OVS A;  2HEK A;  4KO0 B;  3TUJ C;  1SL1 A;  2L9W A;  3WIU A;  2CXE A;  1HYS A;  1NHK L;  3C14 B;  3J7A N;  1DTT A;  2RB7 A;  2WSC C;  4USV A;  5IQ6 A;  2DYA A;  4YS2 A;  3FEZ A;  2IRY A;  4RUH A;  1SKR A;  4FXD A;  3PX0 A;  4B3T J;  2FTR A;  1WHV A;  3Q8R B;  4FF3 A;  3GII A;  2GC8 A;  4LSN B;  4EYH B;  4AQY J;  5IT4 A;  1Y9O A;  5CYM B;  1Y11 A;  2OSQ A;  1ZZF A;  1Y5N B;  1LK5 A;  3HHN B;  4P2S A;  3N6M A;  3U02 A;  4BS2 A;  3KOA A;  1YZ6 A;  2V0N A;  4PYA A;  3BN4 A;  2MST A;  3A8J A;  4K4U A;  3R5J B;  1YJT A;  1PYS B;  1A6L A;  2E29 A;  2ALZ A;  3ZZR A;  1Q16 B;  2BJ3 A;  4DPU A;  2B7C B;  1HR0 J;  2IC3 A;  4LVN P;  3CCU S;  2MY7 A;  4CO3 A;  2IM0 A;  2R9L A;  1N88 A;  5E7O B;  1WHW A;  1S5Z A;  1TR0 A;  5HBM A;  3ZXW A;  4DV4 F;  3UDV A;  3WX8 A;  5GAG U;  2RHS B;  2FJE B;  3W62 A;  4B9S A;  2MGZ A;  1YDL A;  3G8S A;  3GU0 A;  1VGY A;  2J9D E;  1OYE A;  4B9U A;  3NAH A;  3PXG a;  5J2M A;  4UF4 A;  3T1Y J;  1R8C A;  3CED A;  4H4O B;  4WU2 A;  3BN7 A;  3V4I B;  2MKH A;  2MYF A;  5EX3 A;  1WG4 A;  4BCA A;  2ABY A;  1FRH A;  1J5E F;  1U0H A;  3ZNU A;  1U2C A;  2LKZ A;  1DY3 A;  4OQJ A;  2ZBQ A;  4HYK A;  5DZ7 A;  3TEH B;  5KFN A;  5HI7 A;  3FCH A;  2MQN A;  2LYV A;  2HS4 A;  3MM5 A;  4O3O A;  3JYT B;  2WON B;  5DQH A;  3MM6 B;  3Q22 A;  2CNO B;  2HNY A;  4AYB D;  2W9B B;  2B4O A;  2C2Z B;  5B0F A;  4UY8 5;  1XR6 A;  5D0E A;  1TQL A;  1GMV A;  5D15 A;  2GCF A;  3MM8 B;  4RW7 A;  1V3R A;  2VG6 A;  1QAY A;  3SSQ A;  3IWN C;  5HN0 A;  4X4U A;  1SJQ A;  1I5O B;  1KS2 A;  2LQB A;  3TP2 A;  2DGV A;  1SH0 A;  4C8K A;  1B3T A;  4IO9 Q;  4DS5 A;  3NOG A;  2G9O A;  1AUS L;  2V9W A;  4FNH A;  1UA1 A;  1SC6 A;  5J2Q A;  2NRE A;  3IMQ J;  1BE4 A;  2GIR A;  2UUA J;  3NG8 A;  2PO4 A;  2E1M C;  2QSF A;  4CO0 A;  4NPO A;  3MEC A;  1RAH B;  4MKA A;  3VAG A;  4DPT A;  2QSW A;  2K1R B;  2ALY B;  1H7X A;  5AXL A;  1WC1 A;  3BYR A;  4J9L A;  3QGP A;  3DDK A;  3R5G A;  2AJ0 A;  2O3D A;  5LL6 d;  2GMH A;  3H90 A;  1XMO F;  3R5A A;  3M8R A;  3FSY A;  3T1H J;  3PAC A;  5HLF B;  2YWH A;  3R6G B;  1B0T A;  1BWV A;  1HNZ F;  1G7C B;  5C7P A;  2KHD A;  1B4S A;  1HWI A;  2V63 A;  2NYH A;  2HSE B;  5B0A A;  3U7J A;  2GJF A;  2R3V A;  4UT4 A;  4RUB A;  3DM2 B;  1AFI A;  5F3Z A;  2XTJ P;  1NH8 A;  1EJ7 L;  2KG1 A;  1T11 A;  1IWG A;  1KQG B;  4NLY A;  5F41 A;  2XS2 A;  2GQC A;  4CLT A;  1X9M A;  4M5G A;  4YN3 B;  2BM1 A;  1CJV B;  4ZOS A;  4X65 F;  3V6D A;  2ZBP A;  2WHO A;  4Y2K A;  3RAQ A;  1GT8 A;  4NLU A;  3GP9 A;  2KB2 A;  2BE9 B;  3KK2 A;  4DL5 A;  3G8Q A;  2O1P A;  1PIL A;  2N82 B;  2W8L A;  2CQ4 A;  3G71 S;  2M2B A;  3PO5 A;  1EHW A;  1PJ7 A;  2E5L F;  4TQR A;  1HQU B;  4OYI A;  2L08 A;  5GAG I;  1Q8I A;  3MAH A;  3Q8P B;  3MHY A;  2A18 A;  5B0E A;  4MYT A;  3UVJ A;  1K0T A;  3PYD A;  4EEY A;  2D74 B;  2HAF A;  4NX9 A;  2OFH X;  4NLW A;  2QLB B;  1ROF A;  3EGW B;  1Q79 A;  1GMU A;  2XS5 A;  2VQF F;  3TUI C;  4KKO B;  5ETK A;  2J8A A;  2ZWP A;  4YY3 F;  5L1I A;  2KVQ E;  4KBI A;  5A8R A;  1FRM A;  2GHV C;  3DI6 A;  5EDW A;  1SKU B;  3EVW A;  1WF2 A;  2DIV A;  4RW6 A;  1RT6 B;  3D6T B;  3BQ2 A;  3KLG A;  1RJJ A;  2W2M P;  4YDX A;  1RI7 A;  2PFF B;  2VG7 B;  1FWL A;  2UVV A;  2MKC A;  1R8A A;  2DHS A;  5KFR A;  4ECZ A;  1KOH A;  8ATC B;  4ALZ A;  3EWG A;  4LRC A;  1HW9 A;  4L74 A;  2LQ5 A;  1YJN S;  4OZN A;  1N4L A;  3AAW B;  2Y0B B;  1APS A;  2RRA A;  3NL0 A;  1LW0 A;  2L48 A;  3R5D A;  3OW2 R;  1JLF B;  4OX9 F;  2AGP A;  4EO6 A;  2F4F A;  3UN3 A;  2HRU A;  3KG1 A;  2BKO A;  1H2U X;  1SV5 B;  2I1R A;  1TL3 B;  3L7U A;  3M8P B;  1RE1 B;  3BDP A;  4UOG A;  2NS1 B;  4KV8 B;  3D2W A;  5CHC B;  1YJ9 S;  2QLF B;  2UXB F;  2ACY A;  3G82 A;  3H2L A;  4FPI A;  2JJ4 D;  4LVO P;  3IP0 A;  5H9E J;  4F4Y A;  3BGF A;  2DHA A;  3DLJ A;  4DR7 F;  5EHH A;  2R8G A;  4DR5 F;  3A8I A;  3FBE A;  2YPY A;  1V3S A;  2QEX S;  5IV3 A;  3J81 U;  4U7C A;  4QWB A;  4MIB A;  4PXB A;  1HHQ A;  5A2Q U;  1RT1 A;  4X4Q A;  3LP2 B;  3LPY A;  1R0A A;  2WW8 A;  5J2N B;  2W8K A;  2MZJ A;  3R1L A;  4IYQ A;  4RKU C;  3MMA B;  1N54 B;  1RK8 A;  3M9O B;  1RU2 A;  4K7Q A;  3JTN A;  1RCO B;  2HK2 A;  2FVR A;  4NCG B;  4QW9 A;  3OJU A;  2IMO A;  3FFI B;  1LW2 B;  3U1N A;  2N3O A;  3NGK A;  1RT4 B;  4UUW A;  2EBE A;  2CJB A;  4QYZ K;  3M2V A;  3PV8 A;  4CIO A;  4NE9 C;  4YOE A;  4ECV A;  4JI7 F;  4DL6 A;  4UQG A;  3FSX A;  2Z4P A;  7FDR A;  1S1T A;  4OYB A;  5CCM A;  5HMX A;  3AFG A;  4J90 A;  3G9C A;  1ZS6 A;  1JB0 C;  2PC6 A;  3VAK A;  3FDS A;  3C46 A;  5L46 A;  3AJ1 A;  2J7K A;  4LR7 A;  2ZKT A;  4RUC A;  1M1H A;  3NMR A;  4PQU A;  2DGQ A;  2B0G A;  2B4V A;  4NCB A;  5CH7 B;  4AT1 B;  1MW7 A;  3FMB A;  1IBM J;  2IA6 A;  1Q5Y A;  4K4Y A;  2GQ2 A;  1NSQ A;  1S9F A;  3DMJ B;  2KT5 A;  3L7O A;  1FXL A;  2UV8 G;  1S48 A;  1K1S A;  1FNX H;  3BKT A;  2XUL A;  4FYD A;  5HJX A;  2DRD A;  2FJB B;  4P52 A;  5GVQ A;  1KQF B;  1IR1 A;  3HHL D;  2DH7 A;  4ER8 A;  2DHX A;  3KUE A;  1DHM A;  1SKS A;  4PQA A;  3MAQ A;  4IG3 A;  5D0H A;  5B7W A;  1D9A A;  2QL5 B;  1S9E B;  1SC4 B;  4ZIW A;  3VQT A;  2Y3Y A;  1N6Q B;  4NLQ A;  5B08 A;  2HVZ A;  1KKH A;  4DQP A;  1GXT A;  5CXT A;  5CQG A;  2ROE A;  2IY5 B;  1OJ4 A;  5D77 A;  3QIP B;  4PXE A;  3QLH B;  1PJ5 A;  1CUL A;  1HWK A;  3D66 A;  2DNL A;  2I2Y A;  5F8M A;  2FJX A;  4NEZ A;  3MR3 A;  2YWW A;  2NUH A;  1OS5 A;  4JB8 B;  4OHY A;  2J6S A;  5D4L A;  1QAX A;  3N01 A;  3IO1 A;  1HI1 A;  2YBV A;  1IBK J;  2CJY B;  2W2P P;  4DR3 F;  4X4V A;  1UZD A;  2PSZ A;  2MKJ A;  1HD0 A;  5DO2 A;  3MI7 X;  3H8Y A;  4JI4 J;  3CNQ P;  3J7Z 5;  2J9E A;  1U2R A;  3M30 A;  4IR1 A;  2RDI A;  4A48 A;  2HWI A;  2UUW A;  4DL7 A;  3EIC A;  1RZM A;  1RUS A;  1VHI A;  2VFU A;  1LFW A;  3H7H B;  1TK8 A;  3BO2 A;  4I2P B;  4V19 J;  4H4K A;  2IM1 A;  4OX6 A;  3DLE A;  4ZPB A;  5DQG A;  2QV6 A;  1YTY A;  2Z56 B;  1DAR A;  5MLC V;  3H2V E;  4A4J A;  1KQS R;  2H65 B;  4P71 A;  2YQ3 A;  1PC5 A;  3HHL B;  2X1F A;  4KE5 A;  2HZV A;  3MXH P;  4K4Z A;  3QMQ A;  2W7O A;  3NNC A;  2DHH A;  4WU3 A;  3BGO P;  4KFB B;  1AA1 B;  5G0R B;  1IN0 A;  4USK A;  1VIO A;  4CZC A;  3R5B A;  3FRZ A;  3SDE A;  3IS9 B;  1YGY A;  1MMN A;  3HHE A;  2BA9 A;  4WFN Q;  4ZLL A;  3IG1 B;  4QR0 A;  2CJQ A;  3NGR A;  4KO0 A;  1T03 B;  4OX7 A;  1N52 B;  2JWN A;  1S59 A;  2XO7 A;  3VWS A;  4NWB A;  2ADC A;  2EI5 A;  2RIJ A;  4XDC A;  4A8S A;  1REV B;  2YKA A;  1BQM B;  4ZA1 A;  1H2V Z;  3TYT A;  3CJ5 A;  1XN9 A;  4NZ7 A;  4LSN A;  3TEG A;  2RVJ A;  5CYM A;  4NLS A;  4ZLN A;  2DD8 S;  3BV8 A;  3QGH A;  1JMT A;  2D1C A;  4NLX A;  4X2B A;  5IFM A;  2HBQ B;  3DOL B;  2BBE A;  2XZD B;  3KHL A;  4DSI A;  4WP8 A;  4OI4 A;  3CDE A;  4C7Q A;  5FII A;  2RF2 B;  1IBL F;  1L5U A;  2WVD A;  4RL1 A;  2YQ1 A;  1LKZ A;  1QY7 A;  2W24 A;  2FZK B;  3QBC A;  1N34 F;  1FKA F;  2X1A A;  2UXD J;  1RU1 A;  3AXK A;  2RS2 A;  2J5A A;  4ZVQ B;  1O5J A;  4CO1 A;  4L75 A;  3UNG C;  2E5J A;  5CCL A;  2ROG A;  3CCQ S;  5M2P A;  2F5G A;  2P8I A;  4OIX A;  4DLE A;  4Z7C A;  4IFV B;  1R3N A;  4DU8 A;  4I1T A;  3TAN A;  4YHH J;  1IXK A;  4TY8 B;  4YR3 A;  2CVE A;  2Q6B A;  3MMB B;  1LEO A;  4H4O A;  2JEG A;  4IDK B;  3V4I A;  3OHA A;  5IC6 B;  3BO4 A;  3MOZ A;  4ED0 A;  1IKX B;  3KHR A;  1MRO B;  2WOM B;  3HKW A;  4LF4 J;  3W61 A;  1WOP A;  3GIL A;  4M5D B;  2XI2 A;  2YKN B;  3G96 A;  3KTQ A;  2WVC A;  2HFN A;  4P2X A;  2HQ3 A;  2VU5 A;  4N7T A;  5E3A A;  2MZ1 A;  3AJ2 A;  4NOH A;  1FD2 A;  1UFK A;  2GVZ B;  1RWK B;  1NND A;  3KLH A;  3H4B A;  3JYT A;  2Y1L B;  3CMA S;  3K5O A;  4ZK7 M;  1T9T A;  5ETR A;  2WK4 A;  3NMA A;  3DRY A;  4DFJ A;  1XMQ J;  1WI8 A;  5JXS A;  4HTJ A;  4LRB A;  3D6H B;  2E9R X;  2M9K A;  4ZP7 A;  3RRH A;  2RU3 A;  2HGL A;  4IQX A;  5CA5 A;  1S72 S;  2FYX A;  1WD6 A;  2XY7 A;  2KM8 C;  4J5O A;  1V3Z A;  5HQM A;  2XWX A;  2PMZ D;  1FES A;  1FKP B;  3NWG A;  2GJ2 A;  4HHU A;  4QIV A;  3OL8 A;  2DGU A;  3OLB A;  3SQO P;  2CZ4 A;  5I42 A;  1AZS B;  2B43 A;  4DV6 J;  3W8G A;  4DR6 J;  1BY9 A;  3FRY A;  4HVZ A;  3JTO A;  4FNI A;  3KLI B;  2E1C A;  2ZUG A;  3UCZ P;  1I6J A;  3AOB A;  4DR2 F;  1C1B A;  2WBR A;  3C16 B;  2B4U A;  5DG8 A;  2HFV A;  3I6P A;  1GXU A;  2IDE A;  4USH A;  3R2C J;  1M90 T;  1TUW A;  2QA1 A;  2XY5 A;  1HBN B;  1M0S A;  3GYN A;  4I69 A;  3GR0 A;  1GAO A;  4W4M A;  2VPW B;  2DXE A;  2FHK A;  4MIW A;  3A8K A;  3QFW A;  2XO6 A;  1VBK A;  4TU8 A;  3JSM B;  2C22 A;  3DGP A;  3SCK E;  1DJ0 A;  3OTC A;  3FEY B;  2MB0 B;  3CCS S;  3DM2 A;  4HLB A;  2KN4 A;  3WZ0 A;  3UN5 A;  2P2C B;  1G1X A;  2R2U A;  4FYW B;  3HSD A;  2ZZT A;  3VQS A;  1CJV A;  4R25 A;  3PW2 A;  2CPI A;  4DL3 A;  1R0C B;  2ZOG A;  3KJF B;  2V2Q A;  1XBW A;  5KTQ A;  2EFO A;  4RPF A;  4CT8 A;  2IBK A;  3H5U A;  1UPM B;  2DNY A;  5DLG A;  2X7I A;  4WFY A;  1CLF A;  2BJ9 A;  4LSZ B;  4PG7 A;  3KXD A;  3SEO A;  3QGG A;  1LNQ A;  1X9W A;  1R27 B;  1QE1 A;  1CEZ A;  4N47 A;  1HQU A;  2VL1 A;  2J7U A;  1MLA A;  2ASD A;  5IZH A;  3DLB A;  4YB7 A;  4KGZ B;  1PYO B;  2UV8 A;  4C0B A;  1S0O A;  1RAD B;  1XQI A;  2MHN A;  5CZV A;  3OTO J;  2H4Y B;  4C8M A;  3MEG B;  2A10 A;  3SCL E;  1VBZ A;  1IKV B;  2IDL A;  4CLK A;  1HIY A;  3CCZ A;  2Q43 A;  4KKO A;  1IJE B;  2RQK A;  1S7H A;  5C2C A;  3D6M B;  3EJM A;  2NQP A;  4OI3 A;  4JI1 F;  3PYG A;  1F2H A;  3AOA A;  4C2M A;  3N0V A;  1FJC A;  3W63 A;  3G86 A;  4EU0 A;  2GZO A;  3OR2 B;  4Q7A A;  4TYB A;  2GHW A;  2CFX A;  4Y2C A;  4ILR A;  1ZH5 A;  5KG1 A;  1DBD A;  4WK1 A;  4WYL A;  3KG4 A;  4GC6 A;  3V4M A;  1JLF A;  1IWA A;  4HDG A;  4PR6 A;  4FPR A;  1TAU A;  2DY9 A;  1SV5 A;  2EG2 A;  3AOD A;  1KVJ A;  4ZCI A;  1TL3 A;  4YR0 A;  3PNI A;  4IOC Q;  4L3K A;  4OYZ A;  1FXD A;  1HWU A;  4P7T A;  3I0S B;  3M8P A;  2W9C B;  3KLE B;  4HI2 A;  1YRT A;  2DHG A;  4KV8 A;  1VMB A;  3CCE S;  2AYB A;  2HQG A;  3R97 A;  3IRW P;  1MN9 A;  4ZPD A;  1X4A A;  2KJW A;  3K8W A;  2XY6 A;  1B0V A;  2O67 A;  2YKQ A;  3CJQ A;  2PGC A;  3ILO A;  3CJT A;  1VIS A;  3ETO A;  2RS8 A;  1RAF B;  3W8P A;  2FD2 A;  4RW9 B;  3OPK A;  4BC9 A;  2UUC J;  1B99 A;  3LP2 A;  4B3O B;  5E33 A;  4AL7 A;  1CPZ A;  1KP6 A;  5HQL A;  3MMA A;  4OHX A;  1VQY A;  4X66 J;  4ED4 A;  4OHZ A;  2CQ2 A;  4N5S A;  3VHQ A;  1PBA A;  3AY0 A;  3LAL A;  4NCG A;  1RT2 B;  3PFO A;  3MM9 A;  4M5I A;  2BRK A;  3FFI A;  4NXN J;  3R1H A;  4JI2 J;  1LW2 A;  4UW2 A;  3EGZ A;  1QJH A;  1NK5 A;  1RT4 A;  3E01 B;  4FZV A;  1UJ5 A;  5K9F A;  1WTB A;  2C1E B;  3SSS A;  1VQ8 S;  3GG1 A;  5BJR A;  2MKK A;  5F9L A;  3DHX A;  3CF5 Q;  2Y9H A;  1S6U A;  4QIW D;  3TA2 A;  3WIV A;  3I9Z A;  1WI6 A;  4FBT A;  1Y00 A;  2DNZ A;  4L73 A;  3H25 A;  5AJ3 F;  3BQ1 A;  3OFH A;  4YUD A;  2L3M A;  1S99 A;  2ZD1 B;  2ZIT A;  4C0O C;  3P6Y C;  3T1A A;  2A6M A;  4QU6 A;  4XPE A;  2CQP A;  2H48 B;  1YRU A;  1NLK L;  3UCU P;  4M5J A;  4J9U E;  4EI2 A;  4ZPV R;  3CO0 P;  3H40 A;  2ZJR Q;  4EBE A;  5CAA A;  4LF6 J;  3T5K A;  4DDF A;  1RWN B;  1T05 B;  2LFV A;  1UJ6 A;  2LEB A;  4I0W A;  2DT9 A;  1FK9 B;  5HVH A;  3DMJ A;  2MZS A;  1QVF R;  2VQE J;  3IA0 A;  3CCW A;  1F9F A;  1FRK A;  2FC9 A;  2ZHB A;  1JLC A;  4QIF A;  1GH8 A;  4KH0 B;  1TKD A;  4G3I A;  4I67 A;  1WWH A;  1YWX A;  2HWH A;  2XLI A;  6FD1 A;  1DTQ B;  4YQW A;  1S1U B;  4DV0 J;  4DLG A;  4GKJ J;  4ZKA A;  4CWB A;  2NR0 A;  2J0W A;  1OPZ A;  1S9E A;  2JFK A;  1N6Q A;  3R8Y A;  3VZI A;  1PYT A;  3CC2 S;  2OD6 A;  3A8E A;  4OV1 A;  5JVH Q;  5KFB A;  4P74 A;  2DNH A;  2XWY A;  4LFC J;  4OFZ A;  5F8H A;  2CQH A;  4WZQ A;  1KHV A;  1VK8 A;  3QIP A;  1TUV A;  1S7I A;  1L3S A;  3QLH A;  1C0T B;  4TYA A;  2KKH A;  5HMW A;  4ECU A;  4ZPC A;  1KOO A;  2C2N A;  4O44 B;  1MSW D;  4KPY A;  4CM0 A;  4OJ1 A;  2HMI A;  2YNH B;  1WSV A;  2HFZ A;  4TU9 A;  3IR6 B;  3R7B B;  3FKB A;  3MF5 A;  3PDN A;  4ES2 A;  2RJZ A;  2PI5 A;  4TNO A;  3ISZ A;  4K8R A;  1T9V A;  4E8U A;  4WFB Q;  3PRD A;  2OPS A;  2P5V A;  1VBX A;  2LQ8 A;  1WEL A;  4DF8 A;  5B0B A;  3THP A;  2MQP A;  4LF8 J;  4DR4 J;  3K5P A;  3RRK A;  1RSC A;  1VRQ C;  3R7N B;  4ZVF A;  2CPJ A;  4UQT A;  3PKM A;  9ATC B;  2HPU A;  4AXJ A;  3I32 A;  4ZCM A;  2JOQ A;  2HND B;  2V34 A;  2I9S A;  3HVA A;  1RCX B;  3RU0 A;  4LRE A;  3HHL A;  4O3R A;  5T41 A;  1P9Q C;  3A3O B;  3TZZ A;  1X7V A;  2GO9 A;  2RKI B;  4DUZ J;  3W2V A;  2CQB A;  5G0R A;  2RDD A;  3IXQ A;  2F9J A;  4RWW A;  4OYW A;  4FVC A;  4LUB A;  3IS9 A;  4JYA F;  2OPR B;  5KFL A;  5A8K B;  5F9N A;  2W25 A;  1HNX J;  2B9E A;  1BWE A;  3IG1 A;  2ZZN A;  2LCW A;  3UWT A;  1T03 A;  3EGN A;  2VIC A;  2DIT A;  3D1H A;  2YX1 A;  4U67 Q;  4KQZ A;  4OZ1 A;  5KFZ A;  4ZJO A;  1TKT B;  2Y8W A;  4JI0 F;  2XHW A;  1REV A;  2FGC A;  1BQM A;  1HI8 A;  4TLQ A;  3R7S B;  2AMC B;  1LFP A;  4KSE B;  4TN2 A;  3SCI E;  3FGV A;  2OFG X;  2KT2 A;  3M8S A;  2NUU G;  2K8G A;  5H9E K;  1HBO B;  2B4P A;  1C4A A;  5CD4 A;  2LVW A;  2CWK A;  5GAE I;  3HPO A;  3DOL A;  2IVF B;  4OZ0 A;  1NK4 A;  4FS2 A;  2Z2M A;  5E0O A;  1IR2 A;  1QAJ A;  3R2D J;  2B7B B;  1HQE B;  2ZH8 A;  3B6B A;  3MM7 B;  1JXV A;  4J9V A;  6FDR A;  1SKW A;  1RWO B;  1YJW S;  1NRK A;  1M5V C;  4ED7 A;  4OYP A;  4JBC A;  5ITH A;  5HVF A;  3M8Q B;  4DL0 C;  4HR2 A;  2EBG A;  3KMS A;  3CC4 S;  4B3R J;  1EQM A;  2QRR A;  5F8J A;  3LF0 A;  4JUZ A;  2CQ0 A;  3ILJ A;  2GO8 A;  1H2T Z;  4QPT A;  2KL8 A;  5KFX A;  3UO0 A;  3DLK B;  1X4F A;  4IFV A;  3T5H A;  2E7X A;  2F8M A;  4PG5 A;  4TY8 A;  1RHU B;  3TWZ A;  3MMB A;  3OXF A;  2MTL A;  3SV4 A;  4IDK A;  1CVJ A;  3DYA B;  4C8Y A;  4FDF A;  1NU4 A;  1IKX A;  1MRO A;  3TRG A;  2UZA A;  4ZN1 A;  5KAK A;  2IAJ B;  2MKS A;  3KJV A;  4M5D A;  2YKN A;  3L7P A;  2FJV A;  2PMW A;  1RBO B;  1UVJ A;  4ED5 A;  2C3U A;  3TVK A;  3FNN A;  4DV1 J;  5DLF A;  2R8H A;  3ITH B;  1T9Y A;  3QYY A;  4QBU A;  3CDB A;  2JLF A;  3O8W A;  1R6V A;  1IKW B;  2ZJQ Q;  1KLM A;  1IKY B;  4MJK A;  2MQL A;  2EC0 A;  1SQF A;  2XEX A;  1S0V A;  2EFN A;  2VBZ A;  2FY1 A;  1RHJ B;  2NPF A;  3BSN A;  3W64 A;  3KLV A;  3KUG A;  1FKP A;  4DI6 A;  1XWL A;  1HW8 A;  2MJU A;  2VC0 A;  2CQG A;  5D4O A;  4A47 A;  4QWD A;  3ZC4 A;  3CTR A;  3MR5 A;  3DHW C;  1PAE X;  1WOR A;  5KG6 A;  4WKY A;  1JWW A;  4QYR A;  1AZS A;  1QUV A;  2VJV A;  1Q4R A;  4NL5 A;  2OTL S;  4CYU B;  3WBZ A;  1KBR A;  2AYE A;  2ZH7 A;  4IRD A;  2MLZ A;  3BBB A;  3KLI A;  1FX2 A;  3CB4 A;  4MYU A;  4WFX A;  2K7J A;  3LAK A;  5D0R A;  4C11 B;  3C16 A;  4P2F A;  1P1T A;  2I0X A;  4XTT A;  3TA0 A;  3CIM A;  4Q0B A;  1GK8 A;  1ZPV A;  2KHC A;  5JJB A;  4DSF A;  1YKW A;  4JI3 J;  5BYS A;  3QPI A;  4ATN A;  1HBN A;  2P6S A;  2DNK A;  1C2P A;  1W2B R;  3NCQ A;  1S1X B;  2DNO A;  3D68 A;  4J9R A;  4FS1 A;  3ZTS A;  3JSM A;  2MQM A;  2XYG B;  2KI2 A;  2F4V J;  2C3O A;  2YPZ A;  1XR7 A;  2DY1 A;  2BKN A;  4OYM A;  5BYQ A;  2XMK A;  5KFF A;  3AB4 B;  1HPZ B;  2WZ1 A;  1FKO B;  1NKE A;  2QG9 B;  3BB5 A;  5GMK a;  2OEK A;  1T9U A;  3EXC X;  3GJR B;  4FP9 A;  4QYZ J;  4JI8 F;  2FZC B;  2SXL A;  4DUY J;  3BH6 B;  1Z1Z A;  3Q89 A;  2HNZ A;  1FA0 A;  2RD5 C;  2E5I A;  4X4N A;  2LA6 A;  2GV1 A;  2M3D A;  2G4B A;  3MCO A;  3QJL A;  1SC3 B;  3PHT A;  1G3O A;  4F25 A;  3WX4 A;  5KFH A;  1G2E A;  2GAG C;  4ECR A;  4PEO A;  1N5V A;  3VAJ A;  2LMI A;  3GCX P;  4IH7 A;  4EWT A;  3HX9 A;  2MQQ A;  1ZM9 A;  1FF2 A;  4LF9 F;  4I2Q B;  5EUH A;  1RBA A;  3GMG A;  3MEG A;  3HJV A;  1IKV A;  3QAE A;  1NJX A;  3UNY A;  3IBC B;  3OSP A;  3F73 A;  1ZM3 A;  2JZ5 A;  4UOH A;  2Y1R I;  1KNZ A;  4ZLJ A;  3A3P B;  4P72 A;  2EG1 A;  3A4T A;  2QYC A;  1VRU A;  2VV5 A;  3RTV A;  1FT8 A;  3HSJ A;  3DDN A;  2GVD B;  2OH2 A;  2ZH4 A;  2QGF B;  3BGR B;  2H4W B;  3NNA A;  3OR2 A;  4A8W A;  4F67 A;  2OHD A;  2WB1 D;  4BWM A;  4URS A;  2C2R A;  2CPY A;  2G2O A;  1M5P C;  2DB1 A;  4CH1 A;  2V4J B;  3OTB A;  3QJJ A;  2CPD A;  5DM7 Q;  4DOZ A;  3M8Z A;  2XG8 A;  4XPC A;  2CQD A;  2FUG 9;  1FJG F;  1X4E A;  2VG5 B;  1YJU A;  1RAA B;  3H59 A;  2IVY A;  2XMJ A;  4NLP A;  3CC7 S;  3I0S A;  3M8W A;  2W9C A;  4U9R A;  3KLE A;  3IGV A;  3UDC A;  4QR2 A;  5F3T A;  4DFM A;  4QZV B;  1ZA2 B;  4HT5 A;  2OML A;  4UST A;  4ZHR B;  4IFY B;  3BSC A;  2UXC F;  3DFE A;  5KT3 A;  4DQQ A;  4AND A;  1YLX A;  2VPX B;  4TY9 A;  2AW0 A;  2DK2 A;  3I0R B;  4RW9 A;  4DR1 J;  4MT1 A;  3NS6 A;  4B3O A;  4OJH A;  1LXN A;  4MK8 A;  4X64 F;  2DO4 A;  4DV5 J;  3SXL A;  7FD1 A;  3ICL A;  4RWX A;  3VCD A;  4WE1 B;  1J5E J;  1ZM4 A;  4NLT A;  2X3G A;  3DRX A;  1PC4 A;  3ISN D;  1RT2 A;  1V9O A;  2BDP A;  4K4T A;  2QA2 A;  2G1H A;  3E01 A;  3BR8 A;  5DDO C;  4KGX B;  2ATL A;  1VJW A;  2D69 A;  4UUX A;  1W25 A;  4J9M A;  4MK9 A;  3HVT B;  3JQM A;  1YG0 A;  3OBI A;  4O3P A;  2FHM A;  3SBM A;  2J9D A;  3B82 A;  3GV8 B;  1WSR A;  3RB6 A;  3CCL S;  3MPV A;  1N36 F;  3BKF A;  1TVR B;  4N8O A;  1JLE B;  3W5X A;  2IM3 A;  1OMS A;  3N4W A;  4GKK F;  2DR8 A;  4WPA A;  3T9Z A;  3MEE B;  1S10 A;  2KH9 A;  3K89 A;  1EP4 B;  3RUB L;  2IJN A;  5C42 A;  2WVB A;  1K0V A;  1T05 A;  3FK4 A;  5DRK A;  6AT1 B;  3FJ2 A;  1VQL S;  2BYC A;  3PJX A;  4OLO A;  1N32 F;  4DBQ A;  4F04 B;  4B3S F;  4JV1 A;  4ZVS B;  3Q8V A;  1F5C A;  5HQ8 A;  2B51 A;  2PI4 A;  1CC7 A;  3HSZ A;  3POT B;  4EK2 A;  4ED6 A;  1D1U A;  2R8K A;  2H5J B;  4WTO B;  1B7F A;  1KTV A;  1ZYQ A;  4A8X A;  5AE1 A;  4L6V 3;  1JLA B;  2AJ1 A;  3ZZY A;  5D3G B;  1HNZ J;  1MN7 A;  3VAI A;  3MWB A;  2GX8 A;  3W2W B;  1UFW A;  3TW0 A;  1RP5 A;  3MUR P;  4Q45 A;  4TKT A;  4J9N A;  1N33 F;  3G87 A;  2DGT A;  4DUT A;  1TFW A;  1YK9 A;  3ETM A;  2D3U A;  4YME A;  3CE8 A;  3NY0 A;  2J76 E;  4FXV A;  3GIM A;  1M5H A;  2YNH A;  1VR6 A;  1YZ7 A;  3PR4 A;  4AE5 A;  3U27 A;  4RU2 A;  2YKP A;  5HJY A;  2H5E A;  4L72 B;  4CLZ A;  2GGP A;  2OAU A;  2PFD A;  3DRR B;  3FZB A;  2QO3 A;  3PO4 A;  2OEL A;  2RT3 A;  1S79 A;  1D0E A;  3GIJ A;  2NCK L;  5CD4 H;  3TA1 A;  3DDI A;  2XNR A;  1RLC L;  1ELO A;  2HHH J;  2HVI A;  1DRZ A;  4RO0 A;  2E5L J;  2B9X A;  2B9W A;  3TAR A;  2AU0 A;  2MZT A;  3CJS A;  5CYJ A;  4X4R A;  5ETQ A;  1NK0 A;  3PFE A;  1PIE A;  4BLG A;  1HWJ A;  1NDP A;  3KLF B;  1HNI B;  1VC0 A;  1NH7 A;  2HIQ A;  3CDW A;  2DBB A;  3P96 A;  4Z37 A;  4PKD B;  3PIO Q;  4IH5 A;  2HND A;  1BHN A;  1SH2 A;  4WF9 Q;  3B4M A;  2VQF J;  1FDB A;  4MTP A;  3QO9 B;  3EX7 B;  3Q8S B;  4YY3 J;  3V81 A;  3PX4 A;  2QMX A;  3CD6 S;  1NPP A;  4MKY A;  1X5S A;  1NK7 A;  3DNC A;  2AT1 B;  2ZBR A;  3DKD A;  5J1E B;  1KR4 A;  3DOM B;  4ZS6 A;  1UEU A;  4JI6 F;  4J9S A;  2OPR A;  5A8K A;  1UTA A;  4FKX A;  3N28 A;  2HUR A;  4ECQ A;  3SIP B;  2J7W A;  3BPD A;  1SI9 A;  4LF7 F;  4UZC A;  5D4P A;  4F4W A;  4PRF A;  2G1D A;  4P75 A;  2VFS A;  1XIQ A;  5DS7 A;  4ELU A;  2AZ3 A;  2IVM A;  2FVC A;  1TKT A;  2CAJ A;  4O3S A;  2XMA A;  2MSS A;  2PA8 D;  1AT1 B;  2HKE A;  3FVY A;  2BJE A;  3MDF A;  3OR1 A;  4OX9 J;  2DGX A;  5GME A;  2XYH B;  4M5M A;  3K8V A;  3ZFV A;  4F4Z A;  1HNW F;  1MWQ A;  1N0U A;  2J6U A;  4OI6 A;  1CJT B;  3CJK A;  2QTW A;  4DG1 B;  2HBZ B;  2N3L A;  5F8I A;  3CME S;  2JDJ A;  5AE2 A;  1HBO A;  1S1V B;  2UXB J;  2R7V A;  3IR5 B;  2I6W A;  1GX5 A;  1SBR A;  2MEW A;  4NRT A;  2GIQ A;  2JEF A;  4DR7 J;  2AD9 A;  4DR5 J;  2XGP A;  2IYG A;  4FVM A;  3JSB A;  1RTD B;  2PMH A;  4GRS A;  3PYF A;  5KFU A;  3HXM A;  1HI0 P;  4LRF A;  3IM8 A;  1SJR A;  2DNN A;  1ZOT A;  1RAG B;  2FB0 A;  2I38 A;  2A3J A;  3MM7 A;  3OTE A;  1F3F A;  4K4X A;  4PXC A;  2W1B A;  3OUY B;  2UP1 A;  1KRP A;  1YBT A;  1T7P A;  5FJ4 A;  3VTI A;  1T3N A;  4O3Q A;  1TKX B;  4NMX A;  3RW6 A;  1MWY A;  1TEL A;  5BYR A;  3PW0 A;  3CPW R;  1Z2Z A;  4DX6 A;  1UKU A;  4IOA Q;  1FJE B;  1MML A;  2K7K A;  4ZCL A;  2HGN A;  3DLK A;  1KD1 T;  1HBU B;  1B0P A;  4JI7 J;  2VBX A;  3M2U B;  4DQR A;  1JJ2 R;  1TAQ A;  3BRE A;  2VOD A;  1U7L A;  5DJB A;  4X4T A;  2ZDP A;  2FLP A;  4BHQ A;  3VGV A;  2NXN A;  3DYA A;  5IV4 A;  4OLP A;  1FRI A;  3H20 A;  2ZH6 A;  1XMQ F;  3D6F B;  2QFJ A;  3LP1 B;  4F3M A;  1DAX A;  2V2K A;  3HZE A;  3GIR A;  3EZO A;  2CNK B;  2P6T A;  3A12 A;  3OD2 A;  1FVQ A;  2ASL A;  3ITH A;  1WF1 A;  4F0H A;  3EDQ B;  1Q86 T;  2U2F A;  1UEV A;  3PG9 A;  3AD9 C;  2WB4 A;  1IM4 A;  2EFQ A;  1NPR A;  2RML A;  4BWJ A;  1IKY A;  1QVG R;  1DZ5 A;  1HKA A;  2YKM B;  3KWM A;  3LWM A;  4ID8 A;  3NNH A;  1X0F A;  2JFD A;  3SZ2 A;  1R31 A;  4V19 X;  1AB8 A;  3AD8 C;  4DV3 F;  3GFH A;  2FY8 A;  1RHR B;  1ZTW A;  5KT4 A;  4WFZ A;  2C2M B;  3G8T A;  5D78 A;  1TUG B;  1S9G B;  2RUS A;  3MR2 A;  3KFW X;  2ZJP Q;  3IBF B;  1SL2 A;  1FFW B;  4EYI B;  4WJB A;  5LSR A;  3HHD A;  2CRL A;  4NLD A;  4DPY A;  2HK3 A;  4NI2 B;  4C11 A;  4AD6 A;  3FCV A;  1B7Y B;  4M5H A;  1RT5 A;  3G4S S;  1Q0N A;  2KO1 A;  3NGS A;  3KNG A;  4NA3 A;  1X5T A;  4DPO A;  1FWK A;  2AX0 A;  3W3S A;  1KVI A;  2YNF B;  1LK7 A;  1S1X A;  2LEP A;  3E51 A;  4DR3 J;  5IQQ A;  4GO5 X;  3TUP A;  1RAJ A;  3PR5 B;  4EO8 A;  4CO5 A;  1NKB A;  1CQM A;  1N5Y B;  1RWV B;  1RTJ B;  3P3D A;  1DLO B;  3LAN A;  3ZTR A;  1U25 A;  1HPZ A;  4H4M A;  1FKO A;  3UD4 P;  1VQN S;  3VR1 A;  2CKW A;  1X4H A;  1LWX A;  3CJ2 A;  2DNQ A;  1WC4 A;  1FE4 A;  4LIW A;  1RWW B;  4EBD A;  2J6T A;  4P2M A;  3TQ1 A;  1CBK A;  3TX8 A;  4RNO A;  4DFK A;  3T6J A;  4OI0 A;  2R7R A;  4C0H A;  1VYA A;  3X1L B;  3NGT A;  3SQG B;  2HRY A;  5HAO A;  1IQZ A;  4CO4 A;  2DH8 A;  5C2G A;  3IAS 9;  5DG7 A;  3W60 A;  4KR0 B;  1DTT B;  3ILI A;  2FC8 A;  3S7R A;  1WTF A;  2EPI A;  5G4D A;  1H73 A;  4N76 A;  5U47 A;  1EET B;  3MPU B;  2E9T A;  2RAQ A;  4OJ3 A;  4I2Q A;  4CLY A;  2UVW A;  1OY6 A;  1TU0 B;  2LQ9 A;  3AXM A;  3FMW A;  1C1C B;  2CWX A;  3IAM 9;  3KHH A;  4OMF G;  3MR7 A;  2XMT A;  3J80 U;  4M5L A;  4QWE A;  2COL A;  3K57 A;  2H1Y A;  1VS3 A;  2P9C A;  1U48 A;  4CH0 S;  2GVD A;  1Q82 T;  2Z2Z A;  3BGR A;  4LQ9 A;  2Q79 A;  3AJD A;  5T7L B;  3JSY A;  5ETL A;  1QSS A;  4OL8 A;  3CO9 A;  1IQT A;  3E8O A;  4CH7 A;  2NXJ A;  4B02 A;  1TMJ A;  1SJF A;  1VQK S;  2HFS A;  3M05 A;  4BC7 A;  1IBL J;  2Y1I A;  4ITS A;  2V4J A;  1DUR A;  5KG0 A;  1KDN A;  5KFE A;  4I64 A;  5LSO A;  4UOF A;  2UUC F;  3CWJ A;  1N34 J;  2YVS A;  2LQJ A;  3LTO A;  2G13 A;  3J81 j;  1OPI A;  3RAM A;  1M5K C;  2ZZM A;  4ZHR A;  1S1W A;  3NGU A;  5I4M A;  5FLX Y;  2RE1 A;  2E1A A;  3Q24 A;  3IBW A;  2H3E B;  1Q8K A;  3DLH A;  2OJ3 A;  4DSL A;  2V67 A;  4ENO A;  2A0F B;  4GC7 A;  1KLN A;  1HD1 A;  3I4H X;  3F41 A;  1RAC B;  2RNE A;  2MQO A;  1KHW A;  4RW8 B;  1BMQ B;  4Q8F A;  4PWW A;  4WE1 A;  4RR5 A;  1U1N A;  2YNI B;  4WBF A;  3D0G E;  3UPF A;  3BSO A;  2HHT A;  2G2Y A;  1VHF A;  2D3O 1;  1S0N A;  2VG6 B;  2EEY A;  2QMU B;  2R7O A;  3N6N A;  4F50 A;  3CT9 A;  2JL9 A;  5JMN A;  2FVQ A;  4LBH A;  2R7U A;  3DRS B;  3HVT A;  5J1P A;  4K4W A;  1NHV A;  5IM0 B;  5KT2 A;  4N41 A;  2NYI A;  1NAQ A;  1CS4 B;  1NSP A;  1SPB P;  4R5P B;  4N8N A;  1TVR A;  1JLE A;  1S6O A;  4M5N A;  3D0I E;  1Z4U A;  4J7C A;  2BAB A;  2KFN A;  3MEE A;  1FXR A;  4H54 A;  2EVZ A;  5ETO A;  3OT9 A;  3UDE A;  3TOQ A;  3W9J A;  2HBY B;  4QU7 A;  1EP4 A;  4AXI A;  2AYM A;  1ZM2 A;  3QT5 A;  3IRX B;  3BQ0 A;  2R7X A;  5EX0 A;  2GHP A;  5I3Q A;  4YB1 P;  1D09 B;  4LRD A;  2BKP A;  5ETS A;  5A8W B;  3MGJ A;  1XR5 A;  3CJ8 A;  3R9L A;  2LDY A;  4DR2 J;  4OX8 A;  4Y2A A;  2OMO A;  3G6V A;  3CJ3 A;  3IWL A;  4EGL A;  3RZA A;  3CD7 A;  4WFA Q;  4U7U K;  3POT A;  1EIY B;  4DL2 A;  5BR8 F;  1QTN B;  1RA7 A;  1JLA A;  5D3G A;  3LWL A;  3V2U C;  3W2W A;  2QZ8 A;  1IUJ A;  3G2X A;  3TAM B;  1TL7 A;  2ROP A;  3O6Q A;  3PIP Q;  3AB2 B;  4F8R A;  3BYP A;  2R8J A;  2FGO A;  5KFP A;  2F8H A;  1F3V A;  1X4G A;  3ULH A;  3D9B A;  1PG5 B;  3KNA A;  3H5X A;  3SSR A;  2U1A A;  4LQ3 A;  4ED8 A;  2XGQ A;  4G1P A;  4I68 A;  3DRR A;  3I9V 9;  1EKS A;  5HL7 Q;  1X31 C;  4IRK A;  3GWC A;  4Y2I A;  4KGM A;  1VBY A;  1Z2L A;  2FZG B;  1RKJ A;  4X4O A;  3Q8U A;  1OSD A;  3IM9 A;  3GSI A;  5A2Q Y;  1Y0H A;  3M2R B;  3GON A;  3EPI A;  4F4K A;  4A8Q A;  2Z58 B;  1TTH B;  3P49 B;  4EZ9 A;  2HLT A;  1ZZN A;  2QLX A;  1RWX B;  4MFB A;  5DGB A;  2W4P A;  1VC5 A;  3I82 A;  4U8V A;  3ZTP A;  1UAW A;  3UFC X;  3KLF A;  4NCA A;  4FYY B;  3PHE A;  3QZ7 A;  4A8K A;  1WNE A;  1YHQ S;  1M1K T;  2CNL B;  4NXM F;  2I5J B;  1RXO B;  2RSQ A;  5I3U B;  2HVD A;  1J5O A;  3K0J A;  3OQ2 A;  2Y1J A;  1S76 D;  3QO9 A;  1WKJ A;  4DX5 A;  5KG2 A;  2E9Z A;  2ATC B;  4JI1 J;  5LOQ A;  8AT1 B;  1LW0 B;  3PYE A;  3HF5 A;  2CPX A;  1UFL A;  3PY8 A;  2CG8 A;  5J1E A;  3DOM A;  2X3D A;  3KK1 A;  3AA8 A;  3OVB A;  1Y5I B;  4TVA B;  1FDN A;  5JVG Q;  2V8D A;  3I5A A;  3LO3 A;  1S4E A;  1UVN A;  4DCJ B;  1BQN B;  1RDR A;  3ELH A;  3QRQ A;  2AJF E;  4ZVH A;  4DXL A;  3N79 A;  1A7G E;  3QSY B;  1ZAV A;  2X51 A;  4G6V B;  1S57 A;  2DXF A;  3VVU A;  4XDD A;  2IJR A;  3NXZ A;  4M8L A;  3JTP A;  2LP4 A;  2K3K A;  4QOT A;  2BAN B;  3UR3 C;  1CJT A;  3EYZ A;  4OYO A;  1GEH A;  1MG7 A;  4DG1 A;  5CYQ B;  4E98 A;  4NZ6 A;  3MOJ B;  4C8N A;  1S1V A;  4M1K A;  3MAA B;  5HVG A;  1YBA A;  3UDL A;  4R8U B;  5AXK A;  2V9K A;  4B3R F;  1TL4 A;  3S1T A;  1SJ3 P;  3N9U C;  4I6Y A;  4K5S A;  1RTD A;  1UL3 A;  5LMU F;  2VPZ B;  3Q2S C;  2KM8 B;  2F3J A;  1HBM A;  3R27 A;  3MUM P;  2IRU A;  3OUY A;  1QSL A;  3FBB A;  2D3Z A;  3AHP A;  1SL0 A;  5ETV A;  2CQ3 A;  4DZ6 A;  1S1T B;  1S6P A;  2M8D B;  3HUL A;  1TKX A;  3WC0 A;  4ZP9 A;  4DV7 F;  1P9Y A;  5KT6 A;  4ECX A;  4DQS A;  4ELV A;  1T94 A;  2AHO B;  4CLP A;  1WHY A;  4B08 A;  1L3T A;  1T0T V;  1WEY A;  4EFA C;  3M2U A;  1TK5 A;  1WAC A;  3R5C A;  1Q5V A;  2KZZ A;  4PAB A;  3AH6 A;  1URR A;  3GB0 A;  4C8L A;  2VIH A;  5KFA A;  4OI2 A;  3NAI A;  1LWC B;  4F02 A;  1R89 A;  1UCN A;  3P8B B;  1TFY A;  3GE9 A;  5AJ3 J;  3RBX A;  3PJW A;  1X60 A;  5IOL A;  1M5O C;  4F0M A;  3C14 A;  3LP1 A;  5LT5 A;  3RR8 A;  1X5P A;  4ZIT A;  1K47 A;  2CJ9 A;  4RNH A;  2MXY A;  4B17 A;  2HQF A;  5DZ6 A;  2B6A B;  4AL6 A;  2EWH A;  4KHP J;  4PG4 A;  3K7R A;  1L3V A;  2ASJ A;  3HZG A;  3W9H A;  1GQE A;  2XYP B;  2R7W A;  4DS4 A;  2ZM6 F;  2LLZ A;  4PUO B;  1IVZ A;  2W2Q P;  3BF4 A;  3NBP B;  2YKM A;  3HHK A;  1H3D A;  3FUY A;  3AD7 C;  2CA9 A;  2VOP A;  1G4C A;  1U0S A;  2DIS A;  3MCN A;  2B5J B;  4IRC A;  4ZDN A;  3MTJ A;  1KTQ A;  4X84 A;  3TVY A;  3NRB A;  3GYG A;  3HT3 A;  2QC3 A;  1FD8 A;  3CSK A;  2YXL A;  3EUN A;  3G6Y A;  1TMM A;  1S9G A;  2K3I A;  3TNV A;  4OHW A;  2BUN A;  4NLR A;  4JI5 J;  1YIJ S;  4NI2 A;  1EX8 A;  3M30 B;  1RAB B;  2XNQ A;  3NP5 A;  1XTZ A;  2RUG A;  4U95 A;  4KH1 B;  3RJM B;  2RQ4 A;  3H42 A;  3IGN A;  1FRJ A; 
#chains in the Genus database with same CATH homology
 1NLK L;  3EVM A;  3B54 A;  4ENO A;  3EIC A;  1NDP A;  1EHW A;  1K44 A;  1NB2 A;  3Q86 A;  3FBB A;  3B6B A;  4S0M A;  5CAA A;  1JXV A;  1NUE A;  2BX6 A;  3FKB A;  2BEF A;  4DZ6 A;  1B99 A;  3ENA A;  1MN7 A;  3VGV A;  3ZTO A;  3ELH A;  1NDK A;  3ZTQ A;  3Q8Y A;  3Q8U A;  4ANE A;  3R9L A;  1VYA A;  4WBF A;  1LEO A;  3PRV A;  3NGT A;  1BHN A;  3EM1 A;  4HR2 A;  3ZTS A;  3Q83 A;  1NDL A;  3L7U A;  1PKU A;  3VGT A;  4W98 A;  3FC9 A;  5C7P A;  1B4S A;  4UOG A;  4DUT A;  3JS9 A;  2DXD A;  3ETM A;  3FCV A;  4AND A;  3BBF A;  3BBC A;  1ZS6 A;  2AZ1 A;  1S57 A;  1BUX A;  1WKK A;  2ZUA A;  3FBC A;  4C6A A;  2DXF A;  4UOH A;  3VVU A;  3VGU A;  1S5Z A;  3FCW A;  4KPC A;  3ZTP A;  3DKD A;  1U8W A;  1KDN A;  4DI6 A;  3NGS A;  2VU5 A;  1WKL A;  4UOF A;  3FBE A;  3WX8 A;  2HVE A;  1NHK L;  3EMT A;  3BH7 B;  3BH6 B;  4F36 A;  4FKX A;  1NSP A;  1F3F A;  2HUR A;  4FKY A;  2DYA A;  3EE3 A;  3G2X A;  1NPK A;  2DY9 A;  3EVW A;  1UCN A;  3Q89 A;  3VVT A;  1HHQ A;  1PAE X;  2NCK L;  2HVD A;  5IOL A;  3DDI A;  2B8P A;  3GPA A;  1XQI A;  5CAB A;  1NSQ A;  1NDC A;  2DXE A;  1WKJ A;  3GP9 A;  1BE4 A;  3PJ9 A;  1XIQ A;  3EVO A;  3NGR A;  2B8Q A;  2CWK A;  4O0N A;  1HLW A;  1F6T A;  1W7W A;  3NGU A;  3BBB A;  3ZTR A;  2AZ3 A;  4F4A A;  1HIY A;  1MN9 A;  1NCL A;  1NSK L;  1S59 A;  3Q8V A;  5BXI A;  1LWX A;  4ANC A;  3FBF A;  4CP5 A;  3VGS A;  3MPD A;  3EJM A;  4EK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...