3B6BA

Crystal structure of acanthamoeba polyphaga mimivirus nucleoside diphosphate kinase complexed with dgdp
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
131
structure length
131
Chain Sequence
GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
total genus 44
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2007-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3b6bA00
3DDIA 2B8PA 3EM1A 2DYAA 1NDLA 3FBBA 3FC9A 3FCWA 3BBBA 2DXDA 3PRVA 4WBFA 3FCVA 3VGSA 5C7PA 1HLWA 2BX6A 3Q86A 3BBFA 2HVDA 1PKUA 4ANDA 2ZUAA 4EK2A 1WKKA 3BBCA 1ZS6A 3EVMA 1S5ZA 3EVWA 2DXFA 3JS9A 1MN9A 4W98A 4UOGA 3GP9A 3B54A 3FBCA 3ZTQA 3NGSA 1U8WA 1VYAA 3Q89A 1NUEA 1S59A 3R9LA 3BH7B 4ANCA 5CABA 3NGRA 3NGUA 3ZTSA 1EHWA 1HHQA 3ETMA 5BXIA 4HR2A 3GPAA 1KDNA 4UOFA 3VGUA 3DKDA 3BH6B 1UCNA 4DUTA 3EE3A 1LWXA 1B4SA 1NSKL 4UOHA 1W7WA 3ELHA 3ZTOA 3EMTA 4F4AA 3NGTA 1S57A 2DY9A 3EICA 4CP5A 4FKYA 1NLKL 3EJMA 4FKXA 1K44A 1XQIA 4C6AA 2VU5A 3Q8UA 3Q8VA 3VVUA 4O0NA 3G2XA 1NSQA 3MPDA 1XIQA 3L7UA 2HVEA 1WKLA 2HURA 3Q8YA 1NPKA 1BE4A 5IOLA 4DI6A 1NSPA 1F6TA 1WKJA 1BHNA 3ENAA 3VGTA 1MN7A 3VGVA 1HIYA 1NCLA 3Q83A 3WX8A 2B8QA 3FBFA 4KPCA 4F36A 2AZ3A 2BEFA 1NDKA 3ZTRA 1NB2A 3B6BA 1JXVA 1NHKL 3FBEA 4ANEA 1NDCA 2DXEA 3VVTA 1B99A 2CWKA 3PJ9A 1LEOA 3EVOA 4DZ6A 5CAAA 3ZTPA 2AZ1A 4ENOA 3FKBA 1F3FA 1PAEX 4S0MA 1NDPA 2NCKL 1BUXA
chains in the Genus database with same CATH superfamily
3IG1A 3B78A 3R27A 4YHHF 1YVFA 1SKUB 2MKSA 1LW0B 5B0BA 1N0UA 4O44A 3JSYA 2I0XA 3MMCA 3KHHA 4PYDA 4Q5VA 2CJQA 2V63A 4D3GA 3E8OA 5DQIA 4FYXB 1K0TA 2KRBA 2DRAA 3GYGA 3GJQB 1QTMA 3PO5A 3K58A 3C15A 3JSMB 3EICA 4RW9B 2AJFE 2FQQB 4JI8J 4B3SF 1V3SA 1RQ0A 3QYYA 4DZDA 3K5NA 3LH2S 1CVJA 4LVNP 2ZH9A 3HVRA 3MMBB 2Q6BA 4FF2A 2LQ8A 4JOUA 1FESA 4B08A 3E3XA 4Q44A 3HHEA 4X4RA 3MM9B 4FBTA 3BGRB 5LSRA 3CGIA 3O2IA 4PZVA 3N4WA 1M5OC 1KS2A 2D3ZA 2KT3A 3OTCA 1F2GA 2QA2A 1EAYC 3O44A 4Y28C 4P9SA 1FT8A 5ETSA 1NXIA 3HVAA 2DXDA 1EIYB 1B0VA 2HFNA 2CQGA 3GCXP 4LR8A 1S1TB 5CZXA 1RB0A 1AFIA 5IC4B 4CH1A 1S76D 4JI8F 3TJAA 5BXIA 4U7CA 4DV2F 4RW9A 5L8RC 3GU0A 1B4SA 1W7WA 4O3QA 2N82B 5J1NA 5CYQB 4ELTA 2J6SA 3D5MA 3MMBA 3PJXA 1AT1B 4Y34A 4GVBB 1X4HA 3D6MB 4OI3A 4DLEA 3DRSA 3MM9A 2V94A 3BGRA 4DI6A 2ZH8A 5J1EB 3DOMB 4Q8EA 2OTJS 1CEZA 3VGVA 2HK3A 2VFSA 1RTZA 2RRNA 2G9OA 4X84A 4KPCA 3BZQA 3KK1A 3QZ7A 1V3ZA 3W1YC 2O3DA 1EX8A 2ZH1A 5C25A 5KFKA 2D3UA 1OY6A 2QJ3A 4MAKA 3CJQA 2BR0A 3DLGB 2QLFB 2AZ1A 2OPQB 3DLLQ 5A6WA 2EI5A 4C8MA 1HYSB 2XSFA 2JDJA 4QIGA 1T02A 2RB7A 3OL9A 5E5NA 4O0IA 3RUBL 3GFZA 4F0HA 1RU2A 2YNFB 1QAXA 2LEPA 4YS2A 1Q7YT 4DS4A 3CJ3A 4DV0F 4X4VA 2Y1IA 2KVIA 2IRYA 1JJ2R 3NGRA 5CYQA 3BF4A 4B3TJ 4LR7A 2YQ0A 1JNRB 4ZVPB 4F4AA 2OAUA 4GVBA 5AXLA 1EZZB 4YR0A 1B7FA 3KTQA 1NPPA 1IKWB 1JWWA 2YKAA 2BOPA 4BBYA 5CHCB 1TAUA 2R42A 2IM1A 3IWNC 2ZBQA 2W2MP 4NLUA 1S6PB 4OJHA 2Q6CA 1Q86T 2ADCA 2BXJA 2YKNB 3Q22A 1U48A 3ENWA 4FPIA 3J7Z5 4TXSA 2X1AA 3UPFA 3DHXA 2MQOA 2YWHA 1PCAA 2Y0SD 3BGOP 3OSNA 2YNFA 3R97A 2AX0A 3MF5A 2YBVA 4CQ1A 3B54A 5KFWA 4KPYA 1T9YA 3BB5A 2HHHJ 2Y9HA 2XQCA 3PR5B 1Q82T 2CWXA 4PWWA 4ZIVA 4IFYB 1IKYA 3V5RA 2IPOB 2VOOA 2HRYA 5F8IA 2WRMA 4ECTA 3GFHA 4G65A 3W8PA 3TANA 3PO4A 3PIPQ 1RT2B 2DGSA 2FVPA 1LXNA 1KOOA 3Q0AA 1N6QB 4ED0A 3OT9A 1NCLA 5HQ8A 4PPZA 3S6EA 2ZVSA 4ECSA 1G4CA 4ALZA 3KK2A 3H40A 3G8QA 1UFLA 4U7UK 4ENOA 1FFWB 1N36J 1EJ7L 1XNRJ 3CULA 3H90A 1HA1A 4WJBA 2HHVA 1HLWA 3H5YA 2HHHF 1X4GA 2WB4A 2GNKA 1B0TA 4OFZA 2VV5A 2JFDA 3DXBA 5IT4A 2KM8C 1I94J 2E44A 5FD1A 5KFEA 4WU3A 2W4DA 3Q89A 3TZXA 2MZTA 1DARA 3R9LA 1XN9A 2F3JA 4IFYA 3P5TL 3W63A 3SSSA 1S0MA 1CJUB 3OFFA 2PMZD 5K8OA 1T3OA 2LLZA 2R7WA 2UXDJ 1QUPA 2MY7A 2ZH4A 1RWWB 3CTRA 3L95X 3O6QA 1WHVA 4LR9A 5KFYA 2VONA 2OEKA 2XZWA 5CCMA 2HHWA 2Y1LB 2VJUA 1NNDA 4WPAA 2NZ4A 4DPOA 3H4DA 4YY3J 3EGZA 4HKQA 4TNOA 2LECA 4KV8B 4Y2CA 2EG2A 1S79A 1XNRF 1P1TA 1SUQA 4JUZA 1FF2A 1Q79A 1AFJA 3ICLA 1T05B 1LOUA 3VVTA 4ZDNA 1VFJA 2W9BB 2GGPA 3AODA 2BW2A 4FVMA 2GQCA 1VQ6S 1NJIT 3C6UB 5KFNA 1I94F 1UPMB 4FVCA 4M5HA 3CO9A 4Y6IA 4NLPA 1VISA 3V81B 1KN6A 3CJTA 4LBHA 2B7BB 3VAFA 2C3PA 5KT4A 3CT9A 3NLCA 2FLOA 4UY8T 3HHNB 1Z2LA 3DYAB 2DHSA 1QAIA 2DT9A 1R0CB 4WWSA 1CJUA 2UXDF 2WW4A 1KEKA 3SCKE 3VAIA 5HBMB 2G0CA 2AW0A 2XLIA 1T9XA 5DGAA 3IA0A 1HNIB 3EJMA 4FKXA 5CD4A 2HS4A 3X1LB 1S1UB 3DLJA 2JL9A 1TTHB 4CO0A 2K1RB 4WFXA 1UVLA 4KV8A 4CT9A 1VQMS 3GB0A 3UD4P 1R31A 1C0TB 1SL1A 3IXQA 4NASA 5U47A 4UW2A 3GZ7A 2WVBA 1SVDA 2HPUA 2W9BA 5AXNA 1KQFB 2DKOB 5KFDA 4RLEA 4USJC 3C6UA 1TL3B 5FJ4A 3D28A 3M9OB 3FMBA 2R7VA 4GO7X 1GT8A 5F0WA 3MEEB 5E3CA 2V69A 1XR6A 2M0GB 3TUZC 3RYLA 3CJ4A 1C1CB 3NG8A 2C2ZB 4M8LA 2RRBA 2LXIA 2YX4A 1M90T 1WWHA 4DQIA 1SIZA 4YN3B 3DKDA 4EYHB 5MAOA 3G96A 4KTQA 8AT1B 5D0HA 2GQ2A 1GMVA 3HFKA 1PAUB 2FJWA 3T9NA 1FXRA 5HQMA 2H4WB 3G87A 5J1PA 1N52B 1MSWD 4G1PA 3UDVA 1C4CA 4PABA 1YSJA 3P8BB 4F3OA 1KOHA 2O5DA 2O67A 1R0AB 1TL3A 5AE3A 4MIBA 2K7KA 2HK2A 1I3OB 4WXWA 1Q8IA 1L3SA 3PVXA 1BUXA 2FHMA 3MEEA 2K2PA 2VPWB 4NXMJ 2XI2A 1VQ8S 5C24A 2B0GA 1C1CA 1LV5A 4F4XA 2JVOA 1QLNA 3HJFA 4EWTA 2IBOA 1FI4A 1YZ6A 1HR0F 4KO0B 3X3UA 3NXZA 1ULRA 1Q5VA 1RTJB 1S1XB 2RNEA 1WF2A 2RS8A 3QWPA 1T94A 4LF4F 1Q7LB 4NA2A 2YY3A 1TV6B 3TA1A 1IM6A 3LO3A 3VVUA 4O0NA 1XK8A 3SDEA 1VI7A 3ZO7A 3BQ2A 1NK6A 1SKRA 3MUTP 3MXHP 1IJEB 4R25A 3FMWA 2UZAA 2F9JA 2ZD1B 1FTRA 2MHEA 2VHGA 2M88A 2W7AA 4ES3A 1PYSB 3KDNA 1D09B 2HBQB 2B9XA 3IBFB 5IS2A 3NGDA 5FLXU 4LRAA 2E1RA 2OH2A 2OMOA 3N79A 1DTQB 2MYFA 1R6VA 3M2UB 3CDEA 1JLEA 3FBCA 1RTJA 1S1XA 4A46A 4JV1A 1Y3KA 1U4BA 2ZKUA 1YHQS 2KG1A 1U1PA 3BH6B 2CAJA 1ZZFA 3QGGA 4UY85 1TKDA 4CP5A 1VJQA 3MTKA 4QQBA 1KRPA 4MKAA 2ZD1A 3TO8A 3PW2A 3OV7A 2KN4A 1NPKA 2N4DA 5IOLA 2E7WA 1BHNA 3OW2R 3W8GA 2G2YA 1RBAA 2M2BA 2KU7A 4H4OB 4OZJA 5BR8J 1WC6A 2QZ8A 3FEXB 3D9BA 3FZBA 4OYMA 1WI6A 5D0GA 1AB8A 2Q1LA 4CLKA 2DNQA 4WYLA 2X3GA 2QMWA 2GMJA 5KOXA 1PAEX 4DQPA 2OD4A 5IC6B 1RDRA 5EWGA 3M2UA 2LCWA 2XNQA 4Y65A 4ZPCA 1A7GE 1RA7A 2CPFA 3M6XA 1WHWA 2VPZB 5CQGA 5KG4A 1J27A 3QAUA 3RBZA 2XHCA 5ETRA 4B9NA 4PWUA 3BPSP 1WG1A 5DZ7A 1RT1B 4M63A 2W2OP 4B3OB 2C2RA 3UD5A 2ZBPA 3OVAA 3J7AN 4I2PA 1TUGB 2IVMA 4OYWA 1C1BA 3G2XA 4GC6A 5D15A 2W4PA 5BR8F 3Q2TC 3PTWA 4H4OA 1X5SA 4J7CA 2UXCF 2W24A 1F6TA 4G1QA 4ZVSB 2FY8A 5CYJA 5LM7E 4OLPA 3SQGA 3J80U 3RTVA 1RHRB 4RU2A 3B6BA 1R8BA 1WOOA 2DNRA 3FBEA 4IRDA 5DDPC 4FYVB 3NOGA 4KR0B 4ELVA 1SV5A 5HLFB 3GJRB 4CLYA 2KHCA 4KT0C 5JVGQ 1VQPS 3O3LA 1AW0A 4ERDA 4W90B 4OIXA 3CCSS 2HEKA 2IY5B 1ZAXA 1RWUA 3SBMA 1XMOJ 3BBFA 1PSDA 3GR1A 2R7UA 4BWMA 3MECB 4PG8A 4F7VA 4DU7A 4IR9A 3HJVA 1RT1A 1S9EA 3D1QA 4PEOA 1FNOA 3LQVA 5KT5A 5GAEU 4B3OA 2XB2D 4RW7B 2EKNA 3TJ8A 1HHQA 2R7RA 5B08A 2HSEB 1RT7B 2UUTA 4DMZA 5A0YB 4PG7A 4OI2A 3MMAB 2H54B 4MK7A 2R9LA 2N7YA 5E3AA 3M8QA 4U8VA 1VBZA 3N5BA 5CXTA 4WZQA 4AXJA 2DK2A 3M6WA 3P4UB 1FKAF 4GKKJ 2ZOMA 3OTBA 3GV5B 2IYGA 2A6OA 2H9ZA 2IJFA 3ZTRA 2R7SA 1AZSB 3POTB 4QWCA 5HLFA 1N34F 4ZP6A 2AJ0A 3HFZB 1XMOF 4A8QA 2AHOB 1GEHA 3AA9A 3MDFA 3ZZTA 3MECA 2HQ3A 1IBKJ 3WC2A 2YH1A 4DF4A 5GAEI 4UUXA 2A0FB 3HO1A 1ZS6A 4C97A 2QE5A 2FHKA 4RW7A 5IQ6A 3QPIA 3KLIB 1X9MA 3HZGA 1RT7A 4PUOB 2WVCA 2KH9A 2AV5A 3GTYX 3MMAA 4R0JA 2JFKA 2UU9J 4IG3A 4C7QA 3HSZA 4C6AA 2U2FA 1JJHA 4C8NA 4DR2J 3VAKA 4YR2A 2YNGB 3D0HE 2DNLA 1ZTTA 3HVTB 3QT7A 4G3IA 5J2NA 4MTPA 1HW9A 3POTA 1IR0A 4CLLA 1SC6A 1TELA 3Q2SC 2FZGB 4CTAB 4ETXA 2Z2LA 4YB7A 1DQAA 3JXOA 4WE1B 4DUZJ 4I6YA 4CNZA 4OYXA 3UDLA 2ILZA 3W3SA 2MTLA 3EVOA 3R7NB 4ZK7M 4KYZA 4ICLB 1N5TA 3CJKB 4AYBD 4DL7A 4RJVA 1NAQA 2GVZB 1JKHB 5ETLA 4J9NA 3SZ2A 3FCVA 3KHLA 4QWDA 1NH7A 1WDDA 5F8LA 2WONB 1KFDA 1YI2S 3DGPA 4PUOA 2NSBA 2VF3A 3CJSA 3NS5A 1RWKB 4DSJA 1Q95G 1RHJB 3ET6A 3BQ1A 1DQ9A 4IQXA 2UVRA 3I5CA 1NH8A 4UQGA 1IBLJ 3L4BC 2ASYA 2QV6A 4OYIA 4HL9A 2YNGA 3M8PB 1WORA 3GCWP 1C0UB 4PQUB 2HHPA 3T5KA 1VQ7S 4RUHA 2ACMA 4OX6A 4Q45A 4CTAA 4DUZF 2BQUA 2QEXS 3JYTB 3D7SB 1H2UX 5ETMA 3HT0A 2R8GA 2DNKA 1U1RA 4DCJB 4ICLA 3WZ0A 1NHKL 1NKEA 3CJKA 2PDAA 3L9ZA 5KFCA 2ZWOA 3PJ9A 3BGLA 2GVZA 3UR3C 1JKHA 2RUGA 2ZH2A 3IN5A 2BE7D 2O66A 1QUVA 2WONA 1H6KX 4IFVB 2CUYA 1PJ5A 2AEJA 4QR2A 3QT6A 2AEFA 2XYHB 2CQ0A 2J8AA 4RZRA 3MOJB 4CIOA 4OHYA 4KH0B 3MM6B 2DNHA 3EZOA 3TA0A 2E29A 1FHTA 3ZZUA 3EZ5A 5C2GA 2DGXA 1HWLA 2QL7B 4DF8A 1SQGA 4X4OA 5HP1B 4FYYB 2HURA 1TL4A 3NCQA 3M05A 2NZCA 2HQGA 2AT1B 3UFCX 1MROB 2PEBA 4K59A 2ZNZA 1Q8KA 4IH7A 4CO5A 4LJMA 4B3RJ 1O6XA 3ZTPA 4JBCA 5CH7B 5KFSA 2KDOA 3FFIB 2ZZMA 4TQSA 1WEZA 1WTFA 3LP1B 3H20A 1NBEB 1L5UA 5DQGA 4U96A 2IA0A 4J90A 1L3TA 2FVRA 3EVMA 5HVHA 3MM6A 2E5LJ 5I4MA 2XSJB 4PWDA 3GIKA 3TA2A 1BQMB 1YJ7A 2OJ3A 2VQFJ 4N8NA 3AHPA 4JV0A 2J0SD 3MCNA 3FQLA 8RUCA 4B9LA 4USKA 3J7YU 1MROA 4ZKAA 3ILJA 2RQCA 1I1GA 2YX7A 4CZCA 4B3RF 3HD1A 2HVIA 2M9KA 5IT9U 1ZM9A 2BVZA 4OQJA 2PGCA 1AUSL 4JI1F 3LP1A 3LP2A 4QJVA 2RQKA 2VG7B 1S6OA 2VUGA 4ZVTB 3NMAA 2GIQA 4GVLA 2G0IA 1HNXF 3NWGA 3TQ1A 1TKTB 5KFRA 2YKOA 5EGYA 1RAHB 4DR3J 3T1YJ 9RUBA 1VRUB 2XSJA 2UVWA 2XS5A 2EC2A 1U25A 2V8DA 5E0OA 2L9WA 1HARA 2BMBA 3J7YI 4XAKA 4F4YA 4C98A 2V2KA 3NY0A 3OFHA 1N4LA 4ID5A 2OEMA 3KMSA 1EP4A 1S4EA 4Z37A 2FVSA 3PW0A 2FC8A 1SL2A 2LDYA 1YKWA 2VB6A 1VHFA 2W2PP 3UCGA 1U8SA 2PA8D 2V0NA 4AL6A 1UEVA 2XHWA 1LW2B 3TZZA 2MZSA 4QWBA 1K9MT 4WFNQ 1HNVB 4K5RA 1LK7A 3NP5A 4DR3F 3T1YF 4LF2A 3KNGA 1AA1B 5J2MB 1X31C 1VRUA 4GO5X 3RU0A 4NXNF 2MQPA 2IIHA 3BN7A 4DBQA 4W98A 2W9CB 2C3UA 1S59A 3KUEA 2KJVA 4HACB 1TKXA 3C16A 1K1QA 4W4MA 2GJFA 1CQNA 4P10A 3PW4A 2ZDPA 3FRYA 5DJBA 5KFFA 3OLBA 1KSPA 2OEJA 3R7SB 2VA2A 4PKDB 4F4ZA 5KFAA 1B70B 2GVDB 1HNZJ 2ZZTA 2R8HA 2DHGA 1XERA 4C11B 1FX4A 2X1GA 3OVSA 1HW8A 3NNAA 3KLVA 1YQHA 1HBUB 1WC3A 5F41A 5G0RB 2OSQA 3UDCA 2CQIA 4B9SA 3OXGA 1EQ0A 4ZN1A 5DRKA 1P9YA 5J2MA 2QA1A 1Q53A 4ZOSA 3MEKA 3KJVB 4EO8A 3KK3B 5L1IA 1FNXH 4NPOA 5T14A 2MHNA 3D66A 4B3MJ 1U0HB 4CO1A 2W9CA 2IC3B 2M8DB 1TUVA 4OX7A 1UTAA 1NJYA 3GP9A 2G4BA 2GQQA 5JJBA 3R5AA 2XMJA 1I6JA 1L3VA 1BC6A 4KKOB 2W8LA 4X65F 1FVQA 2Q3PA 2ABYA 2R7QA 1U02A 2AGOA 4DHVA 2JRSA 3CPWR 3PG9A 2YNHB 2EPIA 4I6WA 4C11A 4C0BA 1XIQA 3UN2A 1RWOB 4Y3CA 4N76A 1HBUA 4BC7A 2GFFA 4E98A 1J2VA 1KLMA 3I9V9 4KC5A 2DH9A 3HSDA 1X9WA 1XJWB 4C0HA 2IBKA 5E3RA 3ITHB 4JI7J 3KJVA 3HSGA 1VCTA 2I5JA 1QSSA 3KK3A 5D4NA 4KGKA 2FLNA 1ZM4A 2NYIA 2Z0GA 2GX8A 2JHEA 1PC5A 1OY8A 1U0HA 4D3HA 2J0QD 3M2RB 3DMJB 4TY9A 3KLEB 1RXOB 2KT2A 4URQU 2Q66A 2KHDA 2OPPB 4CO2A 4IG0B 4DG1A 1S72S 4QCLA 4F04B 3CCMS 3G86A 5KFJA 1KHWA 2DXFA 1X4AA 5AE1A 5F8HA 4DR7J 4KRWA 2VH7A 3KYLA 3BO2A 2HQFA 4QBUA 3IRXA 4TY8B 2IHR1 1HL6A 3WIUA 1HBMB 2YNHA 4ZITA 3AOAA 1FE0A 3GONA 2UUWA 2M8HA 4EZ6A 3CB4A 5DLGA 3I32A 1FFGB 5IT0A 3QT8A 4CM2A 4YP3A 1FJ7A 5I3QA 1QVGR 4H54A 2WBMA 3LOUA 1D1UA 4WKYA 3S8SA 1NK8A 3Q8QB 1CS4A 4DN0A 3DMJA 4DV4J 3H2LA 4LSNA 3LF0A 4M94A 1TP7A 4CLWA 3MEGB 4IG0A 5LL6d 3TX0A 1RYSA 3KMQA 3U1LA 2FGOA 4DR7F 4NZ7A 4USTA 2AKWB 3K0JA 2UXBF 5KFGA 2G0JA 4FF4A 2ZBRA 4TY8A 1MW7A 6FDRA 3MPVA 4CWBA 2DB1A 1HBMA 1RT6B 5GAGI 1N5YB 4JV5F 5D4LA 3F41A 4PG4A 2E1AA 4A47A 5KFVA 1FRMA 1ICEB 1TL5A 1S99A 4OZ1A 2CQ3A 2VU5A 4ZVUB 2UUCJ 5CCLA 3HFVA 2G1DA 4WXOA 2JVRA 2JEIA 1ROFA 3ETOA 3OJUA 3DXSX 3ENQA 4DV4F 2GIRA 2IVFB 1ITPA 2XO6A 2J9CA 2EFVA 4PR6A 1YLXA 5AXMA 5C42A 2F9DA 2BOAA 3ILIA 3NBPB 3MR3A 4WK1A 2HYIB 4NRTA 5K8MA 3OUYB 5K8NA 4Q7AA 3FUYA 5B0FA 1F3FA 2HZVA 3TAPA 1BY9A 1IKVB 5A8KB 1SXLA 2BANB 4FXWA 2CQ2A 2HWTA 4ECUA 1RT6A 2UUBJ 3UCZP 1FE4A 1OWXA 3CUNA 3MURP 4NCAA 2HS3A 2MKHA 4DFPA 1TK8A 4EUVA 2BJ8A 4DR6F 2LA6A 3F44A 4IQMA 2B51A 1HFEL 2W01A 1QTNB 1Q78A 1VRTB 3LAMA 2HWHA 3KLFB 3TZWA 3AB4B 2CPEA 3KJQB 3T1AA 1QDUB 3I0SA 3M1VB 3AQPA 3Q8VA 2FHJD 3GSIA 1YRUA 1F60B 3DC2A 4HH1A 1IUJA 5JUMA 2CJXB 2BJ1A 1NO8A 4ZN3A 4ED7A 2P2CB 1NDKA 3KLHB 3K7RA 1N5QA 3VQTA 1NEEA 1IKVA 2YNIB 2BANA 4DXLA 1FJEB 2UUBF 3C6TB 2AYEA 4DQRA 5FLXY 1HQ2A 1ZPVA 3RB0A 2JC0A 2U1AA 3BBBA 5A8RA 2KO1A 2BX6A 3S01A 3NAIA 3OR1B 1JIHA 2XZDB 2F40A 2DGUA 3MWBA 1S0OA 4NLWA 5LJ3Y 4DWIA 4JI0J 3U27A 2DBBA 2NYHA 2V8GA 3ZZOA 5I42A 4PXCA 1QAYA 3PEHA 1N5VA 1VRTA 3IC1A 4QIFA 4C8ZA 3FEZA 1IXKA 2HNYA 3WC0A 1NSAA 5KG7A 5BJRA 2XC9A 4OJGA 2QRRA 5ETQA 4OI1A 2A10A 3NMRA 2I6WA 2ZH3A 3NRBA 1PJ7A 3AJDA 1LWCB 3VQSA 1VLYA 4K4YA 3SEOA 3DNCA 3DOKB 4CH7A 5L38A 2A6MA 3M30A 2MQQA 2Q79A 3TR5A 1RYRA 2JH3A 1PYTA 3LPEA 3FC9A 4M5GA 2WZ1A 5J2PB 4EBEA 3QSYB 4ECYA 2Z2YB 2F8MA 2QGFB 2CDRB 4MMOA 4DSFA 4KY3A 1YX2A 1VRQC 3J7A1 2A18A 2ZH5A 3HHDA 3A12A 1RTHA 3KG4A 2R8IA 1BQNA 3ZZZA 4X4TA 2HIQA 3GE9A 5T41A 3UDEA 3OHAA 3HHLB 2ALZA 2J9DE 3UVJA 2XI3A 2AJ1A 2IM0A 4IOAQ 2P6SA 3CCQS 3FEYB 4O3NA 4NLOA 4B17A 2ZJQQ 2HFOA 2HFUA 1BMQB 1ZTWA 2ZDOA 1LWCA 2DTJA 3KNAA 3VAHA 4X4PA 2ASDA 3ZZRA 4OYZA 1XWLA 2DVIA 2ZE2A 1YGYA 1HBOA 3J80Y 4DV7J 3K2YA 2F4FA 2HQDA 2BJDA 1REVB 4MJKA 3FRZA 2VFRA 1YJUA 1KVIA 1XTZA 3UNYA 2MJUA 2E9ZA 1HQUB 4EBDA 3M8WA 3W2VB 3V4IB 4DR1J 3GFYA 1UEKA 1KHVA 1YBTA 4B9MA 3W66A 4HI1A 4ITSA 2IM3A 4DX7A 4F0MA 1XR7A 4AFFA 1ZYQA 1R89A 2DR7A 3I6PA 3C14A 4AUKA 2WVFA 2VPYB 1P6TA 2VG5A 1KLNA 2ACYA 1TL1B 1FXDA 4B9TA 4NLXA 1S9GB 2ROPA 4JP8A 4DFKA 2QYCA 2DR5A 2DRBA 5H9FJ 2FZCB 2CPIA 1RTIB 2DISA 1TU0B 1REVA 1GMUA 4G1IA 2W1BA 1MU2B 5K14B 1LWEB 1S1WB 4R5PB 4E0DA 1L3UA 1LNQA 2DNPA 4DR1F 2C2MB 2D9OA 2D1CA 1WF1A 2RDJA 3V4IA 5EX0A 5SUHA 3DI6A 1ZOTA 1LFWA 2E1PA 2CQPA 4P74A 1N8RT 1MMDA 4F02A 3V6JA 1XNQJ 2YH0A 1WNEA 4RBUA 4M1KA 3DU6A 4RW4B 4L3NA 1UL3A 2KJWA 1RZMA 3G6ES 4J5OA 1X0PA 1JLCB 2FHOB 2FLLA 4RX6A 2GIFA 1TL1A 3IS9B 4F3QA 4LRCA 3P45B 1R6YA 5KG3A 2PFFB 1RSCA 2HNDB 4KJIA 2OO4A 1OIAA 3KWMA 3N6NA 2AD9A 2XNRA 4USWA 4KHPJ 1UVIA 3HT3A 2RU3A 4ZJLA 1MU2A 2M7SA 4LSLB 2ZWPA 4OYPA 3TVYA 3THPA 3EWGA 2V8PA 1KTQA 3MAAB 1J5EJ 1X4BA 1S1WA 1RT3B 4F26A 4ED6A 4ANEA 3HMJG 3ZNJ1 1MLAA 3I56S 2E5JA 4MK8A 4HYKA 2BJ9A 3R7BB 3IM9A 1VR6A 4C0OC 2XMKA 2G13A 1XMQJ 4F8RA 1KQSR 2NXEA 1UWBB 3JTPA 2LYVA 3PKYA 1IN0A 1HWJA 2MKYA 4G6VB 3UN3A 2PI5A 3FSXA 4RW4A 3HCXA 3R6GB 4Q43A 4MK9A 4HEA9 2CJAA 3S1TA 1EB0A 1JLCA 2G2OA 4ANCA 2GHPA 2HVHA 2YPZA 5FDLB 3CDAA 3IS9A 2V4JB 2VL1A 1R8AA 1HBNA 2XWXA 4I68A 5J2QB 3JTNA 1K44A 1P27B 4KHPF 3PNIA 1NJZA 4HLBA 1YJVA 1NK5A 3DDKA 2BQRA 1CBKA 4IDKA 1J5EF 1T9WA 4YQWA 4BHQA 2IMWP 3MAAA 2FJAB 1WJ9A 4A8KA 3W5XA 2MQMA 1MWYA 4PXEA 3TWZA 4F3MA 1RWXB 1FDNA 4HTIA 2DCUB 2XLKA 1XMQF 1Y4ZB 1U2CA 4DZ6A 2RHSB 1EKSA 5B0AA 2W2NP 5HMZA 2IM2A 2XMUA 3VCDA 1RBLA 5KFXA 4O44B 4FNHA 4DX6A 1U7LA 3VGSA 3JSBA 5EUHA 1VBXA 1SH3A 3DRXA 2HRUA 1K1SA 1F9EB 5FDLA 3BR8A 1U8WA 2MKJA 2V4JA 4NMLA 4Y2AA 4DR4F 1A6LA 5I3UB 4TU9A 1VIXA 3R8YA 4DQSA 5J2QA 5DQHA 4FXDA 3PJWA 4A8XA 1IVZA 1TMMA 2V2ZA 3SFGA 2CADA 1TKZA 1W2BR 2G2ZA 4ZLLA 2WOMA 1CJVA 3IMQJ 3M8SA 3I5AA 2C3YA 3GG0A 3MMJA 5LXRA 2VA3A 3ZC4A 3IR5B 1NK4A 4F36A 1N88A 4LFCF 2VBXA 3JTOA 4HT7A 1Q1KA 3HPOA 3VF0B 4DL6A 3MZIA 4L75A 1I5OB 1YJNS 4K7QA 2V67A 2RQMA 2B6AA 3HLUA 3IBCB 4DV1J 3QGIA 2FVQA 2HHSA 4YR3A 4RUAA 1X4FA 2Z4PA 1UAWA 2B56A 1M0SA 3EPIA 5I3UA 1UVNA 4M5JA 1HHTP 4ES2A 3T1HJ 1RWNB 1H3DA 2MMYA 1OO0B 2KZZA 5ITHA 2LQ5A 4OZ5A 1CJTB 2LDIA 3R5DA 4NRUA 3H0PA 2CZVC 3AY0A 1M5KC 5DDQC 4AQYJ 3DRSB 4F50A 4NLGA 2CG8A 5AT1B 1FRIA 1ZBTA 3OTOJ 3RB6A 3C8YA 3KK1B 1QVFR 3LA0A 1RE1B 2KKHA 5C25B 2ZH7A 2XYPB 4USIA 1SL0A 2QLWA 5IT9Y 2PEHA 5LSOA 1UJ5A 3SMZA 1Z2ZA 4FF1A 2JLEA 1AXQA 3P5BP 4OLOA 5IFMA 1DLOB 3NNHA 1GH8A 2H3EB 2E1MC 4FPRA 3CIZA 5F8NA 4WZMA 1CG2A 4ZJOA 3M8YA 3CDUA 5LXYA 1CJTA 4OHXA 2GO8A 3TX8A 1VJWA 4AQYF 4YEAA 4I0WA 2NUHA 3MD1A 1U2RA 3A3OB 3PX4A 5G4DA 3CF5Q 1KFSA 1KNZA 4DR5J 1SJFA 4CI0B 2CPDA 3MR2A 3OR2A 3CIMA 4ZLJA 2NSCA 2LMIA 2POKA 4N77A 2W8KA 4M5LA 3HXMA 4NE9C 4NYZA 4WIIA 4TYBA 1RT4B 4NZ0A 4C8KA 2DO4A 1DLOA 4EYIB 3R1HA 1RT5A 3A1YG 3K89A 2QLXA 5KT3A 2DY1A 3OD2A 1S6UA 3AJ2A 3ENVA 1U6ZA 2D9PA 3PFOA 4UTGA 4LF8J 2DGOA 3N01A 3KJNB 2J0XA 4KQZA 2QA4G 4LUBA 3J81j 3AJ1A 3Q86A 1VQSA 2HVDA 2R2UA 1FJGJ 3KJFB 4PAAA 3PRDA 2C2KB 4RNOA 2DH7A 2IJRA 2R7OA 4PXDA 3MI7X 4K8RA 1IKYB 2MSTA 1PGZA 1JNZB 1KDNA 3IGVA 4ILLA 1LWXA 1WUUA 4M5DA 4P7VA 1R0BG 5E41A 4RBTA 3QT5A 3A13A 2ZBIA 2XGPA 1N0VC 3BN4A 1RT4A 3QNWB 1XC9A 4OYAA 1UW9A 2MLXA 5KFTA 3CMAS 3D3BJ 3SIPB 3FNNA 1H2TZ 2AJ4A 2RKIB 3PHTA 3KK2B 2H5IB 1S77D 1FKOB 5IV4A 4LF1A 2YX1A 4LF8F 1NB2A 3DFEA 1FEEA 2YVSA 1FFSB 2CQCA 4NEZA 4H4MB 3G82A 4EZ9A 1HI0P 2HQCA 4B3TF 1FJGF 2V5HG 2MGZA 2OIHA 1UFWA 2M4MA 4C8YA 3TYTA 5L46A 1RWVB 1UKUA 4L3KA 4Y2KA 3BBCA 2YKPA 4KAIA 2HBYB 3QJLA 1SJRA 3KUHA 4QPTA 4H4KC 4X2BA 1YJTA 4E8UA 3D0IE 1S7HA 1WACA 4QYRA 3IP0A 3R2DJ 2RF2B 1FD2A 1UA1A 1SI9A 4UOHA 5AJ3J 3BGFA 2CG4A 1WEYA 4RKUC 4ED2A 5M2PA 1Q0NA 1T95A 5GADU 5K20B 2RKIA 3G6VA 1QD1A 1ZM2A 1TK5A 1FKOA 4ER8A 3UN5A 3OTEA 4DL0C 1SUQB 4QIEA 2DPJA 1V9OA 1FK9B 3BSCA 2GGPB 4H4MA 1QY7A 1RUSA 1JXVA 3IBWA 1T03A 4CLZA 5F0UA 4LF9J 3HM9A 2Q43A 2BKOA 2GO9A 1RAFB 4FNIA 2CVEA 3J81U 3C46A 1YDLA 1RKIA 3CC4S 1S4FA 1S7IA 6AT1B 4NCGA 3O8WA 2Z57B 3CD7A 4NLYA 4OX9J 4QWEA 3KOAA 3D6FB 2HQIA 1WEXA 5AJ3F 2DNNA 4DFJA 2RF2A 1GXTA 5DGBA 4XIUA 3DRYA 1GMWA 2B4UA 2RS2A 3FDSA 5GADI 4UT4A 2H48B 4A8FA 3TVKA 2CQ1A 2OSRA 1N36F 2Y8WA 2NXJA 3WHIA 1Y5LB 3EXCX 1DRZA 2ZC3A 4KE5A 1YG0A 3AOCA 2FUG9 1FK9A 4DPWA 3H5SA 2ATCB 2WSEC 4RNMA 4DDFA 3N28A 2RD5C 2OPSA 1C2PA 2FJXA 2YTCA 4OI6A 3QO9A 1T9VA 1NB7A 2JOQA 4OYBA 3RR7A 5A8WB 3I0RB 3HP6A 4J9LA 3D1HA 2CQBA 2VZ9A 2IMOA 3L3CA 1RJJA 2EKYA 4NWBA 3RBXA 3E2EA 5C2CA 1RP5A 5L39A 2IRXA 2B3TB 1GFWB 2RE1A 4YY3F 1J5OB 2N4CA 1HQEA 3ZTSA 1VQNS 2K06A 3M7VA 2HHXA 4K4VA 1BWVA 5H1SV 2RJZA 4PXBA 4HH0A 1U24A 1VHIA 4C9DA 3RBDA 4KBIA 3GSDA 3TNVA 1OYDA 3MPDA 2P5VA 2NQPA 4DX5A 4EFAC 2F8EX 3NS6A 1WG4A 1F0XA 2QL5B 1N32J 5T7LA 4DSIA 4MIAA 2XMTA 5A8WA 3I0RA 4JYAJ 4C8OA 5C24B 2L9NA 2V2QA 1NZ8A 1T7PA 2V6AA 4M5IA 4IH5A 4ZP9A 2DITA 1YBAA 5DDRC 1D0EA 3BSOA 4XO0A 2EVZA 4F4WA 1SJ3P 1FXLA 3U7JA 2LP4A 2VBZA 4WP8A 1J5OA 3SCLE 4X62J 2FIUA 1MN9A 1WG5A 4XPEA 2MY8A 1H38A 2MKCA 1A0OB 3SDEB 3T19A 1VBKA 3QIPB 2CZ4A 2DY9A 2DNOA 4CH0S 5HQLA 3ONQA 1T3NA 4C3LA 5D8HB 3G8SA 1H72C 2OGUA 2EXUA 3PFEA 4TU8A 1Z1ZA 4JYAF 2FTRA 3QRQA 4YFUA 4P2FA 3SV4A 2UUAJ 1WD6A 3A8IA 3HVWA 3PCOB 4WKRA 1N56A 2D41A 3K5PA 3K8WA 5KFQA 2NCKL 3H42A 1Y11A 3CD0A 3RGIA 3PIOQ 2DHXA 3B8HA 2CA9A 1JLEB 5DETA 3SSRA 4ZCLA 2KI2A 4EK2A 2WK4A 3OFEA 3GJTB 2HRTA 5GVQA 8ATCB 5EN1A 4X4SA 4P52A 1UWAA 1A9NB 3NWRA 4ECWA 3FSYA 3L7OA 4C2MA 4KHMA 2CQDA 3QIPA 5HJYA 4GKJJ 5KG6A 2C28A 2MZJA 1IKXA 5EX3A 2HLTA 1WOSA 4UOCA 3MCOA 1BXNA 2KXNB 4RL1A 1RAEB 4NXMF 3G6XA 3CCUS 3DRPB 4F25A 4O4GB 2YWGA 3B82A 4UUWA 5D4OA 4QZVB 1RISA 1TL7B 2QFJA 5A2QU 4WP3A 3IO1A 2MSSA 3NOCA 2L48A 5KT7A 5KG0A 2KB2A 2XULA 1S10A 4AL5A 1VGYA 4A8MP 2N3LA 2XLJA 3GR0A 2EG1A 4A8YA 1UMJA 4ILRA 1GX6A 2D69A 4YDXA 1F3VA 3N6LA 3A3NB 3ZTQA 3PYGA 1Q4RA 3WIVA 4HR2A 4I2PB 4E2FB 1TK0A 3RBEA 1C1BB 2B9WA 1ELOA 4C8LA 3IAM9 1U1LA 2ADBA 4F2RA 3CMQA 4HDGA 3DRPA 1RHMB 4O4GA 3V6DB 1ZA2B 4G1QB 2KXFA 5B09A 4O23A 4CO3A 1TL7A 2HZAA 2AU0A 3SQGB 1JX4A 3NGKA 2LXFA 1UJ6A 3AB2B 3OXFA 3BEGB 3QRRA 2HGLA 2J9EA 1R7IA 1SV5B 3U1MA 1VQLS 3KLGB 3QJJA 3EXYA 4Q0BA 1YJRA 4LFAJ 1RTDB 5F9NA 5HVGA 3QLHA 4X66J 5ETTA 2DEJA 4USUA 4ZHRB 1RCOB 3OBIA 1RABB 1S9EB 3IGNA 1EARA 3AA8A 5LOQA 3A8KA 2QX0A 2VOPA 1U1QA 1Y5IB 2BW7A 2WSFC 2BQ3A 4OV1A 1ZA1B 2Y1JA 4BC9A 3IWXA 4FYDA 1R43A 4LRFA 4NZ6A 1QSYA 1DJ0A 2FY1A 2CPZA 2FLPA 2OTLS 4JI6J 2VICA 3VGUA 2LKZA 5D78A 3V6DA 3M8QB 3L09A 3PYFA 4YHHJ 4WYWA 3D3CJ 4FKYA 4P7TA 1PILA 1DFDA 1IQZA 1VMBA 3AXMA 3KLGA 4LFAF 4ED8A 4NA1A 3RG6A 1RTDA 2MJNA 3W2WB 2LEBA 1OQ6A 1GNKA 3M9MB 7AT1B 1SH2A 4ZHRA 4ZPAA 1K47A 3KXDA 3TJ9A 4J9RA 3H98A 5F9LA 4B3SJ 4RU9A 1RK8A 2LU2A 1L3KA 1WOPA 4Y0FA 2APOA 2A2CA 3QIDA 5E3QA 2YQ1A 1U26A 3OFGA 2ZEJA 1TR0A 4OHZA 4DPUA 2R7TA 3T5HA 1ZAWA 2DD8S 4GC7A 3CW2C 1RACB 2VBYA 3D1OA 3PX0A 4IG3B 5L9XA 1U1MA 2V8VA 1DHMA 4UQTA 2BABA 4TU7A 2CPXA 3PHEA 3C3LA 1JLAA 3W5YA 1X9SA 2BZ2A 1S9FA 3A4TA 5J2NB 1TVRB 3BYRA 3NL0A 1FWPA 3BKTA 1FRXA 2F65A 3AD7C 1S6QB 3U1NA 3W2WA 2IDEA 1NKCA 2CQHA 3P96A 3NAHA 4DV2J 3PV8A 5DZ6A 1HWUA 2W4CA 4ECQA 2E66A 3VAGA 3TAQA 3QQCD 2GJ2A 3PXGa 3CC2S 3AXKA 3DGPB 1BQXA 1IWGA 2NPIA 1DAXA 4L73A 3W64A 2BJ3A 4ZMMA 2ZUAA 2GZOA 3ET6B 4ZVQB 2K7JA 1KC8T 3RB3A 1LW0A 1X7VA 4V19X 4A48A 4NI2B 4OJ1A 4XK8C 5ETKA 4YUDA 4DV5J 1KQKA 3BH7B 4L72B 2HGNA 4GKKF 3NGUA 1VK8A 3SXLA 3TRGA 3H5UA 2ZM6J 2QYGA 3BYPA 4ZPTR 3W9HA 1TVRA 3O5TB 2YKQA 4PQAA 2ALYB 1FTCA 3BREA 2CFXA 4QOTA 1S6QA 3JSMA 1IBKF 2D3OR 3GIRA 2QLBB 2XCPA 2Z2ZA 1ZH5A 4Q2LA 4HI2A 5E7OB 4DV0J 3PY8A 1VQ5S 2EFQA 3N6MA 2B43A 1G3OA 2PC6A 3MGJA 4DU8A 2DNGA 5DDOC 4OHWA 1CPZA 2B8PA 4GRSA 2CPHA 3CCTA 3HHLD 2UU9F 3TOQA 3THVA 4YB6A 5HJXA 3JAMU 4FBUA 4DV5F 4DR2F 2DHHA 5CYMB 3OSPA 1B7YB 4NI2A 2ZM6F 1FVSA 4B02A 3GMGA 1HWIA 2V9KA 1RAAB 3CNQP 1D9AA 4WCEQ 3DLHA 1S1TA 5EWFA 2XY5A 1CSJA 3EE3A 1XMBA 3M8RA 4I4BA 1LXJA 2P8IA 4QU6A 5B7WA 2R2SA 5IM0B 1S97A 1URNA 4TYAA 2B9YA 4GMKA 2E7VA 2HHQA 4J9QA 2FJEB 3PZPA 5SZTA 5A6PA 3MFIA 1R8CA 2EWHA 1BLUA 4KGVB 5J1EA 3DOMA 2OI2A 3TZYA 2C2NA 2G1HA 3TQEA 2QLJB 2Y1RI 1IBLF 2C3MA 3VR1A 5CYMA 1WSRA 3EGVA 3UE2A 3DLGA 4L74A 4KHRA 1FD8A 3PX6A 2OPQA 4P73A 1IJFB 4Y2IA 1VC5A 2ASJA 1HYSA 4PWDB 2EK1A 4DPTA 2X3DA 3ILLA 2PMWA 2GV1A 7FDRA 3GQCA 5HAOA 2VC1A 1IBMJ 3ETMA 2GHVC 4ZPDA 5IM0A 1DURA 4ZCKA 1GXUA 2SXLA 2UVUA 2VODA 2M52A 3T5LA 4PRFA 3CCVS 3NS7B 4NYPA 1MWQA 3D4JA 2RDIA 3MR6A 3LUYA 3H7HB 3MUMP 2FD2A 4AL7A 1RWMB 2VC0A 4RO0A 5EHHA 3BO3A 3BV8A 3W65A 1O5JA 2R3VA 3LP2B 3G8TA 1WELA 3MR5A 2CNNB 5D0EA 2XS2A 2O1PA 1IKWA 2AIRB 3KG1A 4URSA 1S6PA 5CD4H 3GG1A 3HDSA 4F2SA 4OHVA 2YKNA 3T6BA 3A8JA 2K8GA 1H0HB 3KHRA 1DY3A 2X7IA 2F4VJ 1D8YA 3VZIA 5HO4A 4ZLNA 5DG8A 1WKKA 2HS0A 1IBMF 1QAJA 3JQKA 4O3SA 1SQEA 1PG5B 1V5VA 2AYGA 2DNZA 3CE8A 1NK9A 2QC3A 5HROB 3I87A 1NKBA 4ID5B 2HZCA 1S48A 5LMUJ 2XG8A 1SB6A 3IAS9 4LQ3A 1EP4B 4O3PA 1RHKB 1Y0HA 4OYOA 2DGVA 1HI8A 1X4DA 2DCLA 4LFBJ 1JQGA 2OFHX 3RJMB 4CLSA 4RUCA 3UNGC 3WX8A 2F8HA 4J9SA 1M5VC 3KFWX 2E5LF 2RVJA 1RT2A 2X1FA 2VJVA 2F4VF 4P75A 1N6QA 1D9FA 1ZZNA 1Q5YA 2EFPA 2VQFF 2J8SA 4JV2A 4I67A 3UW1A 4P2SA 4ED5A 1NDLA 1LKZA 3H4BA 3HX9A 2FHJA 3LP0B 1FX2A 2M70A 2Y0BB 1S5ZA 2IA6A 1SIWB 1TKXB 3C16B 1PJ6A 5LMUF 5HROA 1GTHA 2PN6A 2NS1B 1JLGB 1VBYA 2WHOA 1UP1A 4UOFA 4LFBF 3QFHA 2MKKA 1U45A 3SFUA 1FRKA 3Q8SB 3OL8A 2PIIA 4ZVRB 1MMLA 3Q8UA 3Q23A 1WI8A 4DL2A 4IKAA 5ETOA 1NRKA 4LQ9A 5D4PA 5HMWA 2NPFA 1BE4A 2ZHAA 1VIOA 4WFZA 3Q24A 3MCMA 1YK9A 4OX8A 3E01B 4ZVGA 3CJ8A 2ZZNA 2QA4S 2IDLA 2ZUGA 1KBRA 3MM7B 4KB7A 5BYQA 1NHVA 3LP0A 1T05A 2ZBCA 5C7PA 2JC1A 5K9FA 1RHQB 1IQTA 1QSLA 2VDHA 2KT5A 2B5JB 4NL5A 2YWEA 3V2UC 2E1CA 1JLGA 3D0GE 2BA9A 4XDCA 2VASA 2AYMA 3V81A 5L1JA 3CCZA 1NUEA 3PKMA 1REGX 3DYAA 3C19A 3G4SS 2PA3A 3W7BA 2RUSA 3PRBA 2NREA 3N9UC 1TUWA 3ISZA 2HG4A 2JEGA 1M5HA 2BJ7A 1RAJA 1OMSA 5HBMA 3VTIA 4J9MA 4A8SA 1KLMB 4JI4J 3BJYA 1Y10A 3DDNA 2I38A 5B0CA 1HNIA 4O3OA 1FDAA 1HR0J 3E01A 2DO0A 3HHLC 1S1UA 1CC8A 1FCAA 3CCRS 3ENAA 3VGTA 5IXUA 2I5JB 2K1RA 1KTVA 3MM7A 3DLKB 4TLQA 1C0TA 4QU7A 1YZ7A 3CVKA 3GILA 2P9EA 3CCLS 4LF4J 4ZP8A 2KXHA 3BPDA 3N0VA 1T8EA 2Z56B 4DG1B 2JNJA 3J81Y 3KDOA 2QFIA 3GFXA 4K2XA 2B5JA 2KFZA 3SSQA 2BACA 2FJDB 2M3DA 3D54A 3BSAA 2FPHX 3FK4A 1HNZF 1VC0A 3E51A 2B4VA 2E9TA 3IRXB 1KWMA 3WBZA 1F9HA 2XO7A 1U2FA 1CLFA 2QSFA 3K5OA 3LANA 4ATNA 2DH8A 1WSVA 3W62A 4LIRA 1JLFB 4K4XA 2XTJP 3TAMB 3LW5C 2NXNA 4JI4F 1D3WA 3W5ZA 2OHDA 1S0VA 4MKBA 5D0RA 3W9JA 1SC3B 1KVJA 4I1TA 4L76A 3GIMA 3ADAC 2HNZB 4YB5A 1GTEA 3FGVA 1CS4B 3WX4A 4B3MF 3DLKA 3T9ZA 4J91A 4QYZK 2H4YB 3Q8RB 4BDPA 4LSNB 1B64A 2DGQA 2GC8A 3P3DA 1B0PA 1H74A 3CDBA 3I9ZA 4DX8H 1UZHA 1K8AT 5F3TA 4ZPWR 1R0AA 3RRGA 1VC6A 4K0KJ 4WF9Q 1OPIA 1H7WA 1X60A 1JJCB 3A3PB 5LJ5Y 2B4PA 1MG7A 2WVDA 5GAGU 4IUFA 1HI1A 4CNYA 1JLFA 4ZPBA 3PYEA 1UA0A 3TAMA 1KONA 2V50A 5IZHA 3IR7B 1X0FA 1W25A 2WSCC 2HVZA 4KO0A 1SJQA 1OS5A 3R3TA 4WIQA 4JI7F 4EGLA 2HNZA 1W26A 2HLUA 5IQQA 3MOZA 5KT2A 3GIIA 4LVOP 3M32B 1TV6A 2QO3A 3ILOA 4EBCA 2VKRA 3MM5B 1WC5A 2Z8QA 5C42B 2GS8A 4ID8A 3CEDA 1VK3A 3TW0A 1WTBA 1GAOA 4K0KF 3JB9k 3BO4A 2NLWA 1FDDA 4DV6J 2LU1A 3V6HA 3QAEA 5DM6Q 2H51B 1YITS 4QIVA 3OLAA 1RADB 5D77A 3UR0A 3MAQA 1SKSA 2Y8YA 1PKUA 2UXCJ 2PFDA 2CVIA 3K5MA 2ROEA 3RAXA 1F2HA 1NK0A 4K4TA 2ZITA 3ZZPA 5MLCV 4RBVA 3NCRA 1VQKS 1VYAA 4WTYA 4U6PA 1DTQA 4C3MA 3AD9C 1UJ4A 1NZAA 1YJ9S 4AE5A 3AT1B 3I0SB 1JLBB 2AYBA 4ELUA 2IJNA 2VG6B 3QZ8A 3H8YA 3OQ2A 3M32A 1ZM3A 1NLKL 3AQOA 5HI7A 3H2UB 4EEYA 4Y2MA 1T9TA 2WW8A 2IRUA 3MM5A 4EO6A 5KFOA 1EETB 1U49A 1GQEA 3N5FA 1E6YB 3FQKA 4NYOA 3I55S 4DV6F 4I69A 4P2XA 3VAMA 1ZAVA 4I56A 1Y3JA 1NU4A 1IWAA 2OUGA 4PPDA 4NEYA 3EX7B 5A8RB 2BE2B 5JMNA 4YDDB 4C48A 1SH0A 2KM8B 1GMWD 3W9IA 2XZTB 1W2IA 5I42B 2UUCF 2CZ9A 2OKQA 3K59A 2X51A 1Z4UA 2FVCA 2ZVIA 1DTTB 3JS9A 3PW5A 2RH3A 1H7XA 4H4KA 1JLBA 2VG6A 3GYXB 2HNYB 3JQMA 1N34J 3HSJA 1EHWA 3OTDA 2UV8A 3LPYA 1FJCA 1RCXB 1P1LA 3D6HB 1OY9A 1NSKL 1HNWJ 2FYXA 2A2DA 4MYTA 5KFPA 2L08A 1EETA 4LT6A 2BUNA 3HF5A 4ZVEA 2E5IA 1E6YA 1UFKA 4ETZA 4K4SA 3D67A 1F5CA 2V34A 1UVJA 4X4QA 2KFYA 1UVMA 1S1VB 1U09A 1VOMA 3M30B 5A2QY 3SYZA 2EK6A 1Y9OA 2BE2A 3LTOA 3O1LA 4CLFA 2HHUA 2DXEA 3MR7A 4NLSA 4KGMA 3JSRA 1FRHA 4O4RA 1S49A 1N33J 1B3TA 1DTTA 4OZLA 2OMLA 2JEJA 4USVA 1RTHB 2ZOFA 2IYIA 1BQNB 1HNWF 1HMVB 1U6FA 1YRXA 3HKWA 4OZ2A 3UVJB 3R1LA 1VQ4S 4WP9A 2C3OA 2FB0A 4CT8A 4Q2MA 1ZPWX 2KG0A 2R7XA 2YQ3A 5B0EA 2OP5A 1FRJA 1JJ4A 3SQOP 4EMDA 1Q81T 2W7OA 3NEKA 1HD0A 2VFTA 2WVEA 2I1RA 5A0YA 2C42A 3MAHA 2ZE2B 5LMNJ 1S1VA 1HBOB 3Q8YA 2XMWA 4L6V3 5CA5A 2CJKA 1SJ1A 2FDNA 4FZVA 2QMXA 1HD1A 4M5NA 4JI0F 4FXVA 4OJ3A 3R5BA 4HHUA 5DG7A 2RT3A 3ISND 1N33F 2PE8A 1UW4A 2GMHA 5KFUA 1MMNA 4Z2XA 3BR9A 3C66A 2BBEA 1AZSA 5AXKA 2CPJA 1BGXT 4QYZJ 3GIJA 4UZCA 3GWCA 1HMVA 3H2VE 2ZNYA 1FNMA 4DJBA 2MLZA 5DM7Q 5GMDA 3QBCA 3C14B 3KLIA 4ZVOB 2WAQD 2EW9A 3OHBA 2VG5B 5LMNF 2F7VA 5KFLA 2J9DA 2AGPA 3AD8C 2AX1A 2CKWA 3EDQB 4JB8B 3L7UA 4YOEA 4OZ0A 4RNHA 3DRRB 2R2RA 1HPZB 4PG6A 1TMJA 2OD6A 2DNMA 2BRKA 3QGPA 4MKYA 1DBDA 3HVTA 3OXLA 2OLWA 1M1GA 5KOWA 4U9RA 1KP6A 1Q8LA 4K4ZA 4USMA 4QR0A 2BKPA 5EDWA 2HBRB 4NLQA 2MKIA 3DCAA 3DI6B 3EM1A 2QG9B 1P9QC 2ZOGA 4I64A 4WE1A 3CSKA 3CCWA 4ANDA 1VQ9S 4JI5J 4ED1A 5H9EK 4JI2J 2VIHA 5M2UA 4U7UD 3VALA 1RAOA 4DOZA 3NGSA 3CD6S 2Z2MA 3OVBA 1VS3A 4CRJA 1JK9B 2JWNA 4J9VA 2H1YA 4DV7F 2ZKTA 2AMCB 4M5MA 2EFOA 3LGHA 2ERRA 1FA0A 1G1XA 3BQ0A 4J9UE 1LQ9A 2QIFA 3DRRA 4J9KA 2MZ1A 1HPZA 4OL8A 4DUYJ 2LFVA 2AWZA 1RHUB 2BE9B 3KG0A 1RA6A 3UD3P 3M8PA 3NCPA 2C2DA 1DZ5A 1C0UA 1MN7A 4AXIA 2EEYA 3I31A 4PQUA 3Q83A 4DLGA 1N54B 3T5JA 1EKRA 4RNNA 1SQFA 4X4UA 3FZ2A 2KYZA 1U47A 4NLTA 3JYTA 3EZUA 3A8EA 1T9UA 4JI5F 4LBIA 2W7PA 3DN9A 4JI2F 1O8BA 2NXCA 2J7KA 4RUBA 2OFGX 1NJXA 1U1OA 1RGVA 2DEIA 4Z7YA 4IFVA 5KFBA 2W2QP 4DSEA 4KIAA 1CC7A 2MXYA 2XGQA 2KVQE 3DOLB 1S12A 3BDPA 4JI1J 1HBNB 3TEGA 1KD1T 2W9AA 3P49B 4I7FB 4DUYF 2ZJRQ 1HNXJ 4P72A 4MFBB 1GK8A 2FZKB 2OPRB 3K5LA 4IDKB 2E9RX 1XQIA 2MPUA 4P6QA 3WQPA 1U6BA 2H5EA 5M2RA 1WDTA 3QFWA 3GLJA 2D74B 4FP9A 3OPKA 1FEHA 5F8GA 4ZLPA 5HP1A 1BD6A 3KUGA 3RB4A 3HZEA 2AZ3A 1XNQF 4FYWB 2JSXA 3TUPA 4MT1A 3EPGA 3T3FA 3PYDA 3DM2B 2P9CA 2B4OA 5K8PA 2DJWA 2ZJPQ 3DLBA 2XMAA 2V68A 3TP2A 4LBPA 1FWKA 3JAMY 3NNCA 3FFIA 5C5JA 2BRLA 2HW3A 3HI9A 2LQ9A 5HMYA 3RW6A 2AF6A 3DOLA 4PYAA 2RRAA 3AH6A 4I7FA 1UEUA 4J9OA 1JMTA 3I82A 4M5KA 4MFBA 4K2JA 1C4AA 4C3KA 2OPRA 4FS1A 1TKZB 3RW7A 2WOMB 2Z30B 3ZFVA 1CJVB 2AJ2A 2MB0B 2HKEA 5HSPA 1BQMA 2J76E 4NXNJ 1V5IB 4NA3A 2RAQA 3TUJC 2C22A 1P8GA 4J9PA 3UQSA 1DQ8A 2XY7A 1MWZA 5B0GA 3DM2A 3V4MA 2GW8A 2RSQA 4WFAQ 2DNYA 4KFBB 2AGQA 2C2OB 5HN0A 5DO2A 2I9SA 5IV3A 2HWIA 2B6AB 1X5TA 2XM3A 2PI4A 2MDAA 3FKBA 3VZHA 3LWMA 3QJPA 4S0MA 4U95A 2K3IA 3RAQA 4USHA 2CNOB 4WBFA 1ACMB 2I2YA 2VG7A 4LF5J 4NLDA 4ZJQA 2J7UA 4DV3J 1TKTA 2QL9B 1LWFB 1GX5A 4HTJA 1HHSA 2JZ5A 2RILA 3MEDB 1AYEA 1YJWS 3QMQA 5KFZA 4DFMA 2KZMA 1M5SA 6FD1A 2GA7A 2XBPA 4DN9A 3TI0A 3ISNC 2WBRA 4ECVA 4DEZA 1JXEA 1SBRA 2L3MA 3L7PA 1PIEA 4AD6A 1FO1A 2PT0A 4MH8A 4ECZA 3ULHA 2BM0A 4CCHA 2BKNA 1H98A 1CQMA 5LT5A 3MPUB 2ASLA 4IRCA 4KFBA 2WCXA 2GAGC 2ZFHA 4MIWA 1HKAA 3R5CA 5DS7A 5KFIA 4X65J 1XR5A 4LRDA 3R5GA 1IBCB 2LQJA 3H59A 5L1LA 3TARA 3CCJS 4LF5F 2DGTA 5CAAA 1LW2A 5DLFA 3B4DA 3ZXWA 4N7TA 1NDPA 4DV3F 3AAWB 3TUIC 1HNVA 2DYAA 1CJKB 4C4WA 3PRVA 1TFWA 1LWFA 2XWYA 2HBZB 2C1EB 3QSIA 4ECXA 4YMEA 3MEDA 1G7CB 2CIMA 2VPXB 1OJ4A 3EUNA 5KFHA 4EI2A 4P71A 1EQMA 3CDWA 2MQLA 3FCHA 3GPAA 5GMKa 1XBWA 1WF0A 3OR2B 3GJSB 2RU9A 4KH1B 4HT5A 4HACA 1IR1A 3U02A 3QGHA 2HHTA 2XMVA 5H9EJ 1YBUA 4OI4A 2GHWA 1D8ZA 1G6BA 2QT7A 4DV1F 2GVDA 1TZ0A 3LAKA 3H5XA 1H2VZ 2AQ4A 1RT5B 4DL4A 1N5SA 4NX9A 4CDIA 2NUUG 1K0VA 1F5AA 2VQEJ 1SC1B 3T1HF 3THTA 2RQ4A 4ZVHA 5G0RA 2D3O1 1LEOA 1CJKA 2MLYA 5F8MA 3DLEB 4I6AA 4MYUA 4Z7CA 3M4XA 3FBBA 3FCWA 3HULA 2I8EA 4K4WA 4LMZA 3T6JA 5FIIA 1NMEB 2D7SA 4IR1A 3OL6A 4U67Q 5KT6A 4N41A 1WC4A 4Y00A 3OTOF 4YB1P 2PD1A 2RDDA 3CJ2A 2DR8A 4UOGA 2OELA 4LIWA 4ES1A 5EWEA 2IC3A 4M5DB 1TQLA 3UI3A 4HDHA 4N8OA 1APSA 4DUTA 4DSLA 5ADZA 4X4NA 3CWJA 1Q8BA 1S57A 4KKOA 4F4KA 1RLDA 2UXBJ 2JLFA 4RWXA 4DCOB 4R0EA 2VQEF 2DIVA 2F63A 2MQ8A 2CJYB 5GMEA 3MM8B 1YTYA 4TVAB 4JV5J 2LA4A 4DL3A 1VLOA 2B8QA 3G82B 2MGZB 3DLEA 2VD3A 1FKPB 5B0DA 2RIJA 1B99A 1VDHA 3MTJA 4WU2A 1FERA 1SC4B 3PW7A 4F0KA 1X4EA 1ZETA 5I3PA 3ITHA 3P6YC 5CZVA 3R6LB 2HFZA 4RW8B 2KTQA 4DR5F 5HVFA 4NLRA 2E5GA 3IRWP 2AEMA 3SI8A 4TN2A 3M2RA 4HHHA 1NM2A 3D2WA 1PBAA 3EVWA 2ROGA 3KLEA 2OPPA 1I51B 4NLVA 4K5SA 1FDBA 3RRHA 1WHYA 2KYXA 1NK7A 3UCUP 4DPYA 3OJSA 2J6TA 3CJ5A 1U1NA 3I96A 2CYYA 3UWTA 4ECRA 1YIJS 2J0WA 2KL8A 1WC1A 2ZHBA 5K5MA 2CJ9A 1QE1B 3MM8A 3OL7A 1YRTA 2J7WA 5H9FK 1X5OA 1WHXA 3G71S 3MHYA 1U1KA 1FKPA 2NXUA 1T03B 3G9CA 4LRBA 4DR6J 1M1HA 4ZCMA 4V19J 2BEFA 2R8JA 1FRLA 4OMFG 3HKZD 4RW8A 2IAJB 4M95A 4ZVFA 1RAGB 3FSIA 4NCGB 7FD1A 2P6TA 1F1BB 4F67A 2N3OA 1SPBP 3CMES 3MEGA 3MPWA 3BDEA 2Y3YA 4A8OA 3FVYA 3MPYA 5HATA 2RMLA 2CQ4A 4UZBA 4Q8FA 2EBEA 5JVHQ 1AROP 2V4RA 2MZQA 1RLCL 3K8VA 3EYZA 2XS7A 4PCQA 1UCNA 4RW6B 1N5YA 4DL5A 3QWUA 3R2CJ 9ATCB 3EMTA 1QE1A 1T0TV 1Y5NB 3B4MA 3MUVP 3KHGA 4FS2A 1NHUA 5BYRA 3BM7A 5JXSA 4ZPVR 2N7CA 3R5JB 1QM9A 4CM0A 4CLPA 4ZIWA 2WTFA 3RZAA 3LGMA 2E7XA 4DCPB 4RNFA 2OPSB 5KAKA 3CJ0A 2PMHA 3QO9B 2IAJA 3FBFA 2O01C 4CLUA 2HFVA 1VQYA 3I4PA 2PSZA 4RWWA 4KSEB 5E2QA 2CNKB 4IYQA 3MFHA 2LEAA 1WC0A 1G2EA 3KKFA 1PO6A 2A1BA 3F73A 4ZP7A 1JB0C 2EFNA 3NBPA 4LSZB 3AOBA 2CPYA 3OUYA 1Q16B 5L9NA 3EDRB 2QTWA 2M5YA 1HQEB 4A4JA 5A8KA 3PACA 2XY6A 2V9WA 2FC9A 2BYCA 2DR6A 5A76A 2R2TA 1R8HA 1RKJA 1FWLA 4RW6A 4P2MA 2GJIA 5CABA 5AE2A 3DU5A 4PG5A 4LF6J 3BSNA 4FDFA 4TLRA 3F0NA 3ZTOA 2ATLA 2YPYA 2B7CB 2VKZG 4LF9F 3IR6B 2GCFA 5ETNA 2R8KA 3UO0A 3IFEA 2L41A 3DHWC 3GYNA 3KLFA 2LVWA 5T7LB 3M1VA 1KQGB 2EBGA 3EGNA 3C2PA 4NCBA 1NPRA 4OX9F 4U8YA 3SV3A 4IRKA 2YKMB 4QW8A 4QWAA 3T41A 3CC7S 3W61A 3VV2B 4RPFA 1RBOB 3KLHA 2PO4A 5IWAJ 2VDIA 5GAHU 4UF4A 2MQNA 5L1KA 3SCIE 2YWWA 2IVYA 2YNIA 3PR4A 4QW9A 2DGWA 2HAFA 3C6TA 5KFMA 3G6YA 1Y00A 2BV3A 3PDNA 4LF6F 1KKHA 3AFGA 2HMIB 3OR1A 2P9GA 3PEJA 3WDOA 1JXLA 5THWA 1LK5A 2H5JB 2HIYA 5BYSA 3HD2A 2GMLA 4IH6A 2XYGB 3ELHA 4CYUB 3CCES 4K50A 3BGUA 3HK2A 4DQQA 1UZDA 1NSQA 1URRA 3ZNUA 1OQ3A 3W60A 4QIWD 2R4FA 1OSCA 3BKFA 2FJVA 3M2VB 1K73T 4V1Ak 2YKMA 3NKYA 4WFYA 1H73A 3BS9A 5IWAF 4BCAA 5GAHI 3DGVA 2CWKA 1UPPA 1M1KT 1VQOS 1XEZA 2EFGA 1PC4A 5F8JA 3DOKA 3M9NB 1NJWA 4OZNA 1IM4A 2QN6B 1SKWA 1RU1A 4B9VA 2HMIA 2DHAA 2H65B 4R8UB 2XCAA 3I5BA 3JQJA 4O3RA 2X1BA 4XPCA 2MEWA 4KGZB 5J2PA 4X64J 2JJ4D 1N48A 1IKXB 1BWEA 1N32F 3D68A 4CYUA 2FGCA 2XEXA 2E5HA 4N47A 4DPXA 3NGTA 2BDPA 4ED4A 1KR4A 3M2VA 4ZA1A 4BS2A 3LALA 2HFSA 3PM9A 3HHLA 3M6VA 4BWJA 2AP6A 1GXLA 4NMXA 3QATA 4QPXA 4K4UA 3H25A 1U0SA 1LFPA 2KRRA 3VWSA 4X62F 5F3ZA 3QRPA 4EU0A 1X8DA 1HWKA 1PBUA 1X4CA 4W92B 4DS5A 3S7RA 2IFXA 2YXLA 4CO4A 5KG5A 2NR0A 5HANA 3M8ZA 4R8UA 4X64F 1TAQA 2VBWA 4ED3A 2DR9A 3D6TB 5HK4A 3VAJA 1Y7PA 4IOBA 4J37A 2JX2A 3F56A 4I2QB 2QMUB 4BLGA 3VHQA 1HQUA 3CJRA 4TQRA 3RAMA 1CULB 1OYEA 3W2VA 2UUAF 3V6KA 5KG1A 4WTOB 1JLQB 2J5AA 1TFYA 1IR2A 1X5PA 2UP1A 4HHJA 3ZZ0A 5KG2A 2B9EA 1NSPA 1R27B 4Q0BB 2QSWA 4RR5A 2CDQA 1SCJB 2YWKA 2EC0A 1T11A 1S9GA 3QLHB 2HGMA 2LQBA 1MNEA 4IO1A 2V2VA 1RTIA 2K3KA 3Q8PB 4GKJF 2AJQA 2F5GA 4WFBQ 3SCJE 2JEFA 1PYOB 3CD5A 5RUBA 2ZHOA 2XMMA 5K14A 1O0PA 4I2QA 4LREA 1LWEA 4ZCIA 3EGWB 4R5PA 2YWFA 1CULA 1RWPB 2CNLB 2DIUA 4DSKA 3TVZA 1D9DA 2F1FA 1R8PA 3IM8A 1V6HA 1JLQA 2ZC4A 1QJHA 2V4QA 3CO0P 2CXEA 5KTQA 3ZZYA 1SJ4P 2V8HA 1RAIB 4MKVA 2LXUA 4N5SA 1KVKA 3FJ2A 2HVEA 1WKLA 2COLA 5D3GB 1UVKA 2C2EA 4IOCQ 2HAIA 2CJBA 2VFVA 2VFUA 3RR8A 1WKJA 2GAHC 2L9DA 2BJEA 5E33A 1HIYA 2HNDA 4OV6A 1F5BA 4DR4J 2FJBB 4B9UA 5D6GA 4XDDA 1F9FA 1E6VB 4NOHA 1YWXA 3BKUA 1V3RA 3IWLA 4LSLA 2MZRA 4QR1A 4JI3J 4FF3A 1M5PC 5DG9A 4ILMA 2Z58B 3DDIA 1RT3A 3MCSA 2W25A 5LSLA 5HL7Q 2RHQB 1OPZA 1AUDA 5ETPA 4LF7J 2DPIA 2JLGA 3IG1B 1O51A 3GV7B 3GV8B 2WB1D 3M6UA 2ZH6A 4LFCJ 4OZ3A 3US5A 1R3NA 2KFNA 3MD3A 1UWBA 4HVZA 4ZS6A 3CXCR 5ETVA 2UVVA 4AT1B 1JLAB 3MMCB 3I4HX 2UV8G 1UETA 4CLTA 2CRLA 2ILYA 1RI7A 1S0NA 5D3GA 4OI0A 4A8WA 3LWLA 4X66F 2J6UA 3K57A 3C15B 4IO9Q 3HHKA 5HMXA 1E6VA 3LGNA 2DRDA 4XTTA 2BM1A 3J7ZT 4URGA 4N56A 4JI3F 2A3JA 3TEHB 4FN5A 5E3PA 4TKTA 4WK3A 4KGXB 1NDCA 4LF7F 4JI6F 3RRKA 1OSDA 3K17A
chains in the Genus database with same CATH topology
3DDIA 2B8PA 3EM1A 2DYAA 1NDLA 3FBBA 3FC9A 3FCWA 3BBBA 2DXDA 3PRVA 4WBFA 3FCVA 3VGSA 5C7PA 1HLWA 2BX6A 3Q86A 3BBFA 2HVDA 1PKUA 4ANDA 2ZUAA 4EK2A 1WKKA 3BBCA 1ZS6A 3EVMA 1S5ZA 3EVWA 2DXFA 3JS9A 1MN9A 4W98A 4UOGA 3GP9A 3B54A 3FBCA 3ZTQA 3NGSA 1U8WA 1VYAA 3Q89A 1NUEA 1S59A 3R9LA 3BH7B 4ANCA 5CABA 3NGRA 3NGUA 3ZTSA 1EHWA 1HHQA 3ETMA 5BXIA 4HR2A 3GPAA 1KDNA 4UOFA 3VGUA 3DKDA 3BH6B 1UCNA 4DUTA 3EE3A 1LWXA 1B4SA 1NSKL 4UOHA 1W7WA 3ELHA 3ZTOA 3EMTA 4F4AA 3NGTA 1S57A 2DY9A 3EICA 4CP5A 4FKYA 1NLKL 3EJMA 4FKXA 1K44A 1XQIA 4C6AA 2VU5A 3Q8UA 3Q8VA 3VVUA 4O0NA 3G2XA 1NSQA 3MPDA 1XIQA 3L7UA 2HVEA 1WKLA 2HURA 3Q8YA 1NPKA 1BE4A 5IOLA 4DI6A 1NSPA 1F6TA 1WKJA 1BHNA 3ENAA 3VGTA 1MN7A 3VGVA 1HIYA 1NCLA 3Q83A 3WX8A 2B8QA 3FBFA 4KPCA 4F36A 2AZ3A 2BEFA 1NDKA 3ZTRA 1NB2A 3B6BA 1JXVA 1NHKL 3FBEA 4ANEA 1NDCA 2DXEA 3VVTA 1B99A 2CWKA 3PJ9A 1LEOA 3EVOA 4DZ6A 5CAAA 3ZTPA 2AZ1A 4ENOA 3FKBA 1F3FA 1PAEX 4S0MA 1NDPA 2NCKL 1BUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DDI A;  2B8P A;  3EM1 A;  2DYA A;  1NDL A;  3FBB A;  3FC9 A;  3FCW A;  3BBB A;  2DXD A;  3PRV A;  4WBF A;  3FCV A;  3VGS A;  5C7P A;  1HLW A;  2BX6 A;  3Q86 A;  3BBF A;  2HVD A;  1PKU A;  4AND A;  2ZUA A;  4EK2 A;  1WKK A;  3BBC A;  1ZS6 A;  3EVM A;  1S5Z A;  3EVW A;  2DXF A;  3JS9 A;  1MN9 A;  4W98 A;  4UOG A;  3GP9 A;  3B54 A;  3FBC A;  3ZTQ A;  3NGS A;  1U8W A;  1VYA A;  3Q89 A;  1NUE A;  1S59 A;  3R9L A;  3BH7 B;  4ANC A;  5CAB A;  3NGR A;  3NGU A;  3ZTS A;  1EHW A;  1HHQ A;  3ETM A;  5BXI A;  4HR2 A;  3GPA A;  1KDN A;  4UOF A;  3VGU A;  3DKD A;  3BH6 B;  1UCN A;  4DUT A;  3EE3 A;  1LWX A;  1B4S A;  1NSK L;  4UOH A;  1W7W A;  3ELH A;  3ZTO A;  3EMT A;  4F4A A;  3NGT A;  1S57 A;  2DY9 A;  3EIC A;  4CP5 A;  4FKY A;  1NLK L;  3EJM A;  4FKX A;  1K44 A;  1XQI A;  4C6A A;  2VU5 A;  3Q8U A;  3Q8V A;  3VVU A;  4O0N A;  3G2X A;  1NSQ A;  3MPD A;  1XIQ A;  3L7U A;  2HVE A;  1WKL A;  2HUR A;  3Q8Y A;  1NPK A;  1BE4 A;  5IOL A;  4DI6 A;  1NSP A;  1F6T A;  1WKJ A;  1BHN A;  3ENA A;  3VGT A;  1MN7 A;  3VGV A;  1HIY A;  1NCL A;  3Q83 A;  3WX8 A;  2B8Q A;  3FBF A;  4KPC A;  4F36 A;  2AZ3 A;  2BEF A;  1NDK A;  3ZTR A;  1NB2 A;  3B6B A;  1JXV A;  1NHK L;  3FBE A;  4ANE A;  1NDC A;  2DXE A;  3VVT A;  1B99 A;  2CWK A;  3PJ9 A;  1LEO A;  3EVO A;  4DZ6 A;  5CAA A;  3ZTP A;  2AZ1 A;  4ENO A;  3FKB A;  1F3F A;  1PAE X;  4S0M A;  1NDP A;  2NCK L;  1BUX A; 
#chains in the Genus database with same CATH topology
 3IG1 A;  3B78 A;  3R27 A;  4YHH F;  1YVF A;  1SKU B;  2MKS A;  1LW0 B;  5B0B A;  1N0U A;  4O44 A;  3JSY A;  2I0X A;  3MMC A;  3KHH A;  4PYD A;  4Q5V A;  2CJQ A;  2V63 A;  4D3G A;  3E8O A;  5DQI A;  4FYX B;  1K0T A;  2KRB A;  2DRA A;  3GYG A;  3GJQ B;  1QTM A;  3PO5 A;  3K58 A;  3C15 A;  3JSM B;  3EIC A;  4RW9 B;  2AJF E;  2FQQ B;  4JI8 J;  4B3S F;  1V3S A;  1RQ0 A;  3QYY A;  4DZD A;  3K5N A;  3LH2 S;  1CVJ A;  4LVN P;  2ZH9 A;  3HVR A;  3MMB B;  2Q6B A;  4FF2 A;  2LQ8 A;  4JOU A;  1FES A;  4B08 A;  3E3X A;  4Q44 A;  3HHE A;  4X4R A;  3MM9 B;  4FBT A;  3BGR B;  5LSR A;  3CGI A;  3O2I A;  4PZV A;  3N4W A;  1M5O C;  1KS2 A;  2D3Z A;  2KT3 A;  3OTC A;  1F2G A;  2QA2 A;  1EAY C;  3O44 A;  4Y28 C;  4P9S A;  1FT8 A;  5ETS A;  1NXI A;  3HVA A;  2DXD A;  1EIY B;  1B0V A;  2HFN A;  2CQG A;  3GCX P;  4LR8 A;  1S1T B;  5CZX A;  1RB0 A;  1AFI A;  5IC4 B;  4CH1 A;  1S76 D;  4JI8 F;  3TJA A;  5BXI A;  4U7C A;  4DV2 F;  4RW9 A;  5L8R C;  3GU0 A;  1B4S A;  1W7W A;  4O3Q A;  2N82 B;  5J1N A;  5CYQ B;  4ELT A;  2J6S A;  3D5M A;  3MMB A;  3PJX A;  1AT1 B;  4Y34 A;  4GVB B;  1X4H A;  3D6M B;  4OI3 A;  4DLE A;  3DRS A;  3MM9 A;  2V94 A;  3BGR A;  4DI6 A;  2ZH8 A;  5J1E B;  3DOM B;  4Q8E A;  2OTJ S;  1CEZ A;  3VGV A;  2HK3 A;  2VFS A;  1RTZ A;  2RRN A;  2G9O A;  4X84 A;  4KPC A;  3BZQ A;  3KK1 A;  3QZ7 A;  1V3Z A;  3W1Y C;  2O3D A;  1EX8 A;  2ZH1 A;  5C25 A;  5KFK A;  2D3U A;  1OY6 A;  2QJ3 A;  4MAK A;  3CJQ A;  2BR0 A;  3DLG B;  2QLF B;  2AZ1 A;  2OPQ B;  3DLL Q;  5A6W A;  2EI5 A;  4C8M A;  1HYS B;  2XSF A;  2JDJ A;  4QIG A;  1T02 A;  2RB7 A;  3OL9 A;  5E5N A;  4O0I A;  3RUB L;  3GFZ A;  4F0H A;  1RU2 A;  2YNF B;  1QAX A;  2LEP A;  4YS2 A;  1Q7Y T;  4DS4 A;  3CJ3 A;  4DV0 F;  4X4V A;  2Y1I A;  2KVI A;  2IRY A;  1JJ2 R;  3NGR A;  5CYQ A;  3BF4 A;  4B3T J;  4LR7 A;  2YQ0 A;  1JNR B;  4ZVP B;  4F4A A;  2OAU A;  4GVB A;  5AXL A;  1EZZ B;  4YR0 A;  1B7F A;  3KTQ A;  1NPP A;  1IKW B;  1JWW A;  2YKA A;  2BOP A;  4BBY A;  5CHC B;  1TAU A;  2R42 A;  2IM1 A;  3IWN C;  2ZBQ A;  2W2M P;  4NLU A;  1S6P B;  4OJH A;  2Q6C A;  1Q86 T;  2ADC A;  2BXJ A;  2YKN B;  3Q22 A;  1U48 A;  3ENW A;  4FPI A;  3J7Z 5;  4TXS A;  2X1A A;  3UPF A;  3DHX A;  2MQO A;  2YWH A;  1PCA A;  2Y0S D;  3BGO P;  3OSN A;  2YNF A;  3R97 A;  2AX0 A;  3MF5 A;  2YBV A;  4CQ1 A;  3B54 A;  5KFW A;  4KPY A;  1T9Y A;  3BB5 A;  2HHH J;  2Y9H A;  2XQC A;  3PR5 B;  1Q82 T;  2CWX A;  4PWW A;  4ZIV A;  4IFY B;  1IKY A;  3V5R A;  2IPO B;  2VOO A;  2HRY A;  5F8I A;  2WRM A;  4ECT A;  3GFH A;  4G65 A;  3W8P A;  3TAN A;  3PO4 A;  3PIP Q;  1RT2 B;  2DGS A;  2FVP A;  1LXN A;  1KOO A;  3Q0A A;  1N6Q B;  4ED0 A;  3OT9 A;  1NCL A;  5HQ8 A;  4PPZ A;  3S6E A;  2ZVS A;  4ECS A;  1G4C A;  4ALZ A;  3KK2 A;  3H40 A;  3G8Q A;  1UFL A;  4U7U K;  4ENO A;  1FFW B;  1N36 J;  1EJ7 L;  1XNR J;  3CUL A;  3H90 A;  1HA1 A;  4WJB A;  2HHV A;  1HLW A;  3H5Y A;  2HHH F;  1X4G A;  2WB4 A;  2GNK A;  1B0T A;  4OFZ A;  2VV5 A;  2JFD A;  3DXB A;  5IT4 A;  2KM8 C;  1I94 J;  2E44 A;  5FD1 A;  5KFE A;  4WU3 A;  2W4D A;  3Q89 A;  3TZX A;  2MZT A;  1DAR A;  3R9L A;  1XN9 A;  2F3J A;  4IFY A;  3P5T L;  3W63 A;  3SSS A;  1S0M A;  1CJU B;  3OFF A;  2PMZ D;  5K8O A;  1T3O A;  2LLZ A;  2R7W A;  2UXD J;  1QUP A;  2MY7 A;  2ZH4 A;  1RWW B;  3CTR A;  3L95 X;  3O6Q A;  1WHV A;  4LR9 A;  5KFY A;  2VON A;  2OEK A;  2XZW A;  5CCM A;  2HHW A;  2Y1L B;  2VJU A;  1NND A;  4WPA A;  2NZ4 A;  4DPO A;  3H4D A;  4YY3 J;  3EGZ A;  4HKQ A;  4TNO A;  2LEC A;  4KV8 B;  4Y2C A;  2EG2 A;  1S79 A;  1XNR F;  1P1T A;  1SUQ A;  4JUZ A;  1FF2 A;  1Q79 A;  1AFJ A;  3ICL A;  1T05 B;  1LOU A;  3VVT A;  4ZDN A;  1VFJ A;  2W9B B;  2GGP A;  3AOD A;  2BW2 A;  4FVM A;  2GQC A;  1VQ6 S;  1NJI T;  3C6U B;  5KFN A;  1I94 F;  1UPM B;  4FVC A;  4M5H A;  3CO9 A;  4Y6I A;  4NLP A;  1VIS A;  3V81 B;  1KN6 A;  3CJT A;  4LBH A;  2B7B B;  3VAF A;  2C3P A;  5KT4 A;  3CT9 A;  3NLC A;  2FLO A;  4UY8 T;  3HHN B;  1Z2L A;  3DYA B;  2DHS A;  1QAI A;  2DT9 A;  1R0C B;  4WWS A;  1CJU A;  2UXD F;  2WW4 A;  1KEK A;  3SCK E;  3VAI A;  5HBM B;  2G0C A;  2AW0 A;  2XLI A;  1T9X A;  5DGA A;  3IA0 A;  1HNI B;  3EJM A;  4FKX A;  5CD4 A;  2HS4 A;  3X1L B;  1S1U B;  3DLJ A;  2JL9 A;  1TTH B;  4CO0 A;  2K1R B;  4WFX A;  1UVL A;  4KV8 A;  4CT9 A;  1VQM S;  3GB0 A;  3UD4 P;  1R31 A;  1C0T B;  1SL1 A;  3IXQ A;  4NAS A;  5U47 A;  4UW2 A;  3GZ7 A;  2WVB A;  1SVD A;  2HPU A;  2W9B A;  5AXN A;  1KQF B;  2DKO B;  5KFD A;  4RLE A;  4USJ C;  3C6U A;  1TL3 B;  5FJ4 A;  3D28 A;  3M9O B;  3FMB A;  2R7V A;  4GO7 X;  1GT8 A;  5F0W A;  3MEE B;  5E3C A;  2V69 A;  1XR6 A;  2M0G B;  3TUZ C;  3RYL A;  3CJ4 A;  1C1C B;  3NG8 A;  2C2Z B;  4M8L A;  2RRB A;  2LXI A;  2YX4 A;  1M90 T;  1WWH A;  4DQI A;  1SIZ A;  4YN3 B;  3DKD A;  4EYH B;  5MAO A;  3G96 A;  4KTQ A;  8AT1 B;  5D0H A;  2GQ2 A;  1GMV A;  3HFK A;  1PAU B;  2FJW A;  3T9N A;  1FXR A;  5HQM A;  2H4W B;  3G87 A;  5J1P A;  1N52 B;  1MSW D;  4G1P A;  3UDV A;  1C4C A;  4PAB A;  1YSJ A;  3P8B B;  4F3O A;  1KOH A;  2O5D A;  2O67 A;  1R0A B;  1TL3 A;  5AE3 A;  4MIB A;  2K7K A;  2HK2 A;  1I3O B;  4WXW A;  1Q8I A;  1L3S A;  3PVX A;  1BUX A;  2FHM A;  3MEE A;  2K2P A;  2VPW B;  4NXM J;  2XI2 A;  1VQ8 S;  5C24 A;  2B0G A;  1C1C A;  1LV5 A;  4F4X A;  2JVO A;  1QLN A;  3HJF A;  4EWT A;  2IBO A;  1FI4 A;  1YZ6 A;  1HR0 F;  4KO0 B;  3X3U A;  3NXZ A;  1ULR A;  1Q5V A;  1RTJ B;  1S1X B;  2RNE A;  1WF2 A;  2RS8 A;  3QWP A;  1T94 A;  4LF4 F;  1Q7L B;  4NA2 A;  2YY3 A;  1TV6 B;  3TA1 A;  1IM6 A;  3LO3 A;  3VVU A;  4O0N A;  1XK8 A;  3SDE A;  1VI7 A;  3ZO7 A;  3BQ2 A;  1NK6 A;  1SKR A;  3MUT P;  3MXH P;  1IJE B;  4R25 A;  3FMW A;  2UZA A;  2F9J A;  2ZD1 B;  1FTR A;  2MHE A;  2VHG A;  2M88 A;  2W7A A;  4ES3 A;  1PYS B;  3KDN A;  1D09 B;  2HBQ B;  2B9X A;  3IBF B;  5IS2 A;  3NGD A;  5FLX U;  4LRA A;  2E1R A;  2OH2 A;  2OMO A;  3N79 A;  1DTQ B;  2MYF A;  1R6V A;  3M2U B;  3CDE A;  1JLE A;  3FBC A;  1RTJ A;  1S1X A;  4A46 A;  4JV1 A;  1Y3K A;  1U4B A;  2ZKU A;  1YHQ S;  2KG1 A;  1U1P A;  3BH6 B;  2CAJ A;  1ZZF A;  3QGG A;  4UY8 5;  1TKD A;  4CP5 A;  1VJQ A;  3MTK A;  4QQB A;  1KRP A;  4MKA A;  2ZD1 A;  3TO8 A;  3PW2 A;  3OV7 A;  2KN4 A;  1NPK A;  2N4D A;  5IOL A;  2E7W A;  1BHN A;  3OW2 R;  3W8G A;  2G2Y A;  1RBA A;  2M2B A;  2KU7 A;  4H4O B;  4OZJ A;  5BR8 J;  1WC6 A;  2QZ8 A;  3FEX B;  3D9B A;  3FZB A;  4OYM A;  1WI6 A;  5D0G A;  1AB8 A;  2Q1L A;  4CLK A;  2DNQ A;  4WYL A;  2X3G A;  2QMW A;  2GMJ A;  5KOX A;  1PAE X;  4DQP A;  2OD4 A;  5IC6 B;  1RDR A;  5EWG A;  3M2U A;  2LCW A;  2XNQ A;  4Y65 A;  4ZPC A;  1A7G E;  1RA7 A;  2CPF A;  3M6X A;  1WHW A;  2VPZ B;  5CQG A;  5KG4 A;  1J27 A;  3QAU A;  3RBZ A;  2XHC A;  5ETR A;  4B9N A;  4PWU A;  3BPS P;  1WG1 A;  5DZ7 A;  1RT1 B;  4M63 A;  2W2O P;  4B3O B;  2C2R A;  3UD5 A;  2ZBP A;  3OVA A;  3J7A N;  4I2P A;  1TUG B;  2IVM A;  4OYW A;  1C1B A;  3G2X A;  4GC6 A;  5D15 A;  2W4P A;  5BR8 F;  3Q2T C;  3PTW A;  4H4O A;  1X5S A;  4J7C A;  2UXC F;  2W24 A;  1F6T A;  4G1Q A;  4ZVS B;  2FY8 A;  5CYJ A;  5LM7 E;  4OLP A;  3SQG A;  3J80 U;  3RTV A;  1RHR B;  4RU2 A;  3B6B A;  1R8B A;  1WOO A;  2DNR A;  3FBE A;  4IRD A;  5DDP C;  4FYV B;  3NOG A;  4KR0 B;  4ELV A;  1SV5 A;  5HLF B;  3GJR B;  4CLY A;  2KHC A;  4KT0 C;  5JVG Q;  1VQP S;  3O3L A;  1AW0 A;  4ERD A;  4W90 B;  4OIX A;  3CCS S;  2HEK A;  2IY5 B;  1ZAX A;  1RWU A;  3SBM A;  1XMO J;  3BBF A;  1PSD A;  3GR1 A;  2R7U A;  4BWM A;  3MEC B;  4PG8 A;  4F7V A;  4DU7 A;  4IR9 A;  3HJV A;  1RT1 A;  1S9E A;  3D1Q A;  4PEO A;  1FNO A;  3LQV A;  5KT5 A;  5GAE U;  4B3O A;  2XB2 D;  4RW7 B;  2EKN A;  3TJ8 A;  1HHQ A;  2R7R A;  5B08 A;  2HSE B;  1RT7 B;  2UUT A;  4DMZ A;  5A0Y B;  4PG7 A;  4OI2 A;  3MMA B;  2H54 B;  4MK7 A;  2R9L A;  2N7Y A;  5E3A A;  3M8Q A;  4U8V A;  1VBZ A;  3N5B A;  5CXT A;  4WZQ A;  4AXJ A;  2DK2 A;  3M6W A;  3P4U B;  1FKA F;  4GKK J;  2ZOM A;  3OTB A;  3GV5 B;  2IYG A;  2A6O A;  2H9Z A;  2IJF A;  3ZTR A;  2R7S A;  1AZS B;  3POT B;  4QWC A;  5HLF A;  1N34 F;  4ZP6 A;  2AJ0 A;  3HFZ B;  1XMO F;  4A8Q A;  2AHO B;  1GEH A;  3AA9 A;  3MDF A;  3ZZT A;  3MEC A;  2HQ3 A;  1IBK J;  3WC2 A;  2YH1 A;  4DF4 A;  5GAE I;  4UUX A;  2A0F B;  3HO1 A;  1ZS6 A;  4C97 A;  2QE5 A;  2FHK A;  4RW7 A;  5IQ6 A;  3QPI A;  3KLI B;  1X9M A;  3HZG A;  1RT7 A;  4PUO B;  2WVC A;  2KH9 A;  2AV5 A;  3GTY X;  3MMA A;  4R0J A;  2JFK A;  2UU9 J;  4IG3 A;  4C7Q A;  3HSZ A;  4C6A A;  2U2F A;  1JJH A;  4C8N A;  4DR2 J;  3VAK A;  4YR2 A;  2YNG B;  3D0H E;  2DNL A;  1ZTT A;  3HVT B;  3QT7 A;  4G3I A;  5J2N A;  4MTP A;  1HW9 A;  3POT A;  1IR0 A;  4CLL A;  1SC6 A;  1TEL A;  3Q2S C;  2FZG B;  4CTA B;  4ETX A;  2Z2L A;  4YB7 A;  1DQA A;  3JXO A;  4WE1 B;  4DUZ J;  4I6Y A;  4CNZ A;  4OYX A;  3UDL A;  2ILZ A;  3W3S A;  2MTL A;  3EVO A;  3R7N B;  4ZK7 M;  4KYZ A;  4ICL B;  1N5T A;  3CJK B;  4AYB D;  4DL7 A;  4RJV A;  1NAQ A;  2GVZ B;  1JKH B;  5ETL A;  4J9N A;  3SZ2 A;  3FCV A;  3KHL A;  4QWD A;  1NH7 A;  1WDD A;  5F8L A;  2WON B;  1KFD A;  1YI2 S;  3DGP A;  4PUO A;  2NSB A;  2VF3 A;  3CJS A;  3NS5 A;  1RWK B;  4DSJ A;  1Q95 G;  1RHJ B;  3ET6 A;  3BQ1 A;  1DQ9 A;  4IQX A;  2UVR A;  3I5C A;  1NH8 A;  4UQG A;  1IBL J;  3L4B C;  2ASY A;  2QV6 A;  4OYI A;  4HL9 A;  2YNG A;  3M8P B;  1WOR A;  3GCW P;  1C0U B;  4PQU B;  2HHP A;  3T5K A;  1VQ7 S;  4RUH A;  2ACM A;  4OX6 A;  4Q45 A;  4CTA A;  4DUZ F;  2BQU A;  2QEX S;  3JYT B;  3D7S B;  1H2U X;  5ETM A;  3HT0 A;  2R8G A;  2DNK A;  1U1R A;  4DCJ B;  4ICL A;  3WZ0 A;  1NHK L;  1NKE A;  3CJK A;  2PDA A;  3L9Z A;  5KFC A;  2ZWO A;  3PJ9 A;  3BGL A;  2GVZ A;  3UR3 C;  1JKH A;  2RUG A;  2ZH2 A;  3IN5 A;  2BE7 D;  2O66 A;  1QUV A;  2WON A;  1H6K X;  4IFV B;  2CUY A;  1PJ5 A;  2AEJ A;  4QR2 A;  3QT6 A;  2AEF A;  2XYH B;  2CQ0 A;  2J8A A;  4RZR A;  3MOJ B;  4CIO A;  4OHY A;  4KH0 B;  3MM6 B;  2DNH A;  3EZO A;  3TA0 A;  2E29 A;  1FHT A;  3ZZU A;  3EZ5 A;  5C2G A;  2DGX A;  1HWL A;  2QL7 B;  4DF8 A;  1SQG A;  4X4O A;  5HP1 B;  4FYY B;  2HUR A;  1TL4 A;  3NCQ A;  3M05 A;  2NZC A;  2HQG A;  2AT1 B;  3UFC X;  1MRO B;  2PEB A;  4K59 A;  2ZNZ A;  1Q8K A;  4IH7 A;  4CO5 A;  4LJM A;  4B3R J;  1O6X A;  3ZTP A;  4JBC A;  5CH7 B;  5KFS A;  2KDO A;  3FFI B;  2ZZM A;  4TQS A;  1WEZ A;  1WTF A;  3LP1 B;  3H20 A;  1NBE B;  1L5U A;  5DQG A;  4U96 A;  2IA0 A;  4J90 A;  1L3T A;  2FVR A;  3EVM A;  5HVH A;  3MM6 A;  2E5L J;  5I4M A;  2XSJ B;  4PWD A;  3GIK A;  3TA2 A;  1BQM B;  1YJ7 A;  2OJ3 A;  2VQF J;  4N8N A;  3AHP A;  4JV0 A;  2J0S D;  3MCN A;  3FQL A;  8RUC A;  4B9L A;  4USK A;  3J7Y U;  1MRO A;  4ZKA A;  3ILJ A;  2RQC A;  1I1G A;  2YX7 A;  4CZC A;  4B3R F;  3HD1 A;  2HVI A;  2M9K A;  5IT9 U;  1ZM9 A;  2BVZ A;  4OQJ A;  2PGC A;  1AUS L;  4JI1 F;  3LP1 A;  3LP2 A;  4QJV A;  2RQK A;  2VG7 B;  1S6O A;  2VUG A;  4ZVT B;  3NMA A;  2GIQ A;  4GVL A;  2G0I A;  1HNX F;  3NWG A;  3TQ1 A;  1TKT B;  5KFR A;  2YKO A;  5EGY A;  1RAH B;  4DR3 J;  3T1Y J;  9RUB A;  1VRU B;  2XSJ A;  2UVW A;  2XS5 A;  2EC2 A;  1U25 A;  2V8D A;  5E0O A;  2L9W A;  1HAR A;  2BMB A;  3J7Y I;  4XAK A;  4F4Y A;  4C98 A;  2V2K A;  3NY0 A;  3OFH A;  1N4L A;  4ID5 A;  2OEM A;  3KMS A;  1EP4 A;  1S4E A;  4Z37 A;  2FVS A;  3PW0 A;  2FC8 A;  1SL2 A;  2LDY A;  1YKW A;  2VB6 A;  1VHF A;  2W2P P;  3UCG A;  1U8S A;  2PA8 D;  2V0N A;  4AL6 A;  1UEV A;  2XHW A;  1LW2 B;  3TZZ A;  2MZS A;  4QWB A;  1K9M T;  4WFN Q;  1HNV B;  4K5R A;  1LK7 A;  3NP5 A;  4DR3 F;  3T1Y F;  4LF2 A;  3KNG A;  1AA1 B;  5J2M B;  1X31 C;  1VRU A;  4GO5 X;  3RU0 A;  4NXN F;  2MQP A;  2IIH A;  3BN7 A;  4DBQ A;  4W98 A;  2W9C B;  2C3U A;  1S59 A;  3KUE A;  2KJV A;  4HAC B;  1TKX A;  3C16 A;  1K1Q A;  4W4M A;  2GJF A;  1CQN A;  4P10 A;  3PW4 A;  2ZDP A;  3FRY A;  5DJB A;  5KFF A;  3OLB A;  1KSP A;  2OEJ A;  3R7S B;  2VA2 A;  4PKD B;  4F4Z A;  5KFA A;  1B70 B;  2GVD B;  1HNZ J;  2ZZT A;  2R8H A;  2DHG A;  1XER A;  4C11 B;  1FX4 A;  2X1G A;  3OVS A;  1HW8 A;  3NNA A;  3KLV A;  1YQH A;  1HBU B;  1WC3 A;  5F41 A;  5G0R B;  2OSQ A;  3UDC A;  2CQI A;  4B9S A;  3OXG A;  1EQ0 A;  4ZN1 A;  5DRK A;  1P9Y A;  5J2M A;  2QA1 A;  1Q53 A;  4ZOS A;  3MEK A;  3KJV B;  4EO8 A;  3KK3 B;  5L1I A;  1FNX H;  4NPO A;  5T14 A;  2MHN A;  3D66 A;  4B3M J;  1U0H B;  4CO1 A;  2W9C A;  2IC3 B;  2M8D B;  1TUV A;  4OX7 A;  1UTA A;  1NJY A;  3GP9 A;  2G4B A;  2GQQ A;  5JJB A;  3R5A A;  2XMJ A;  1I6J A;  1L3V A;  1BC6 A;  4KKO B;  2W8L A;  4X65 F;  1FVQ A;  2Q3P A;  2ABY A;  2R7Q A;  1U02 A;  2AGO A;  4DHV A;  2JRS A;  3CPW R;  3PG9 A;  2YNH B;  2EPI A;  4I6W A;  4C11 A;  4C0B A;  1XIQ A;  3UN2 A;  1RWO B;  4Y3C A;  4N76 A;  1HBU A;  4BC7 A;  2GFF A;  4E98 A;  1J2V A;  1KLM A;  3I9V 9;  4KC5 A;  2DH9 A;  3HSD A;  1X9W A;  1XJW B;  4C0H A;  2IBK A;  5E3R A;  3ITH B;  4JI7 J;  3KJV A;  3HSG A;  1VCT A;  2I5J A;  1QSS A;  3KK3 A;  5D4N A;  4KGK A;  2FLN A;  1ZM4 A;  2NYI A;  2Z0G A;  2GX8 A;  2JHE A;  1PC5 A;  1OY8 A;  1U0H A;  4D3H A;  2J0Q D;  3M2R B;  3DMJ B;  4TY9 A;  3KLE B;  1RXO B;  2KT2 A;  4URQ U;  2Q66 A;  2KHD A;  2OPP B;  4CO2 A;  4IG0 B;  4DG1 A;  1S72 S;  4QCL A;  4F04 B;  3CCM S;  3G86 A;  5KFJ A;  1KHW A;  2DXF A;  1X4A A;  5AE1 A;  5F8H A;  4DR7 J;  4KRW A;  2VH7 A;  3KYL A;  3BO2 A;  2HQF A;  4QBU A;  3IRX A;  4TY8 B;  2IHR 1;  1HL6 A;  3WIU A;  1HBM B;  2YNH A;  4ZIT A;  3AOA A;  1FE0 A;  3GON A;  2UUW A;  2M8H A;  4EZ6 A;  3CB4 A;  5DLG A;  3I32 A;  1FFG B;  5IT0 A;  3QT8 A;  4CM2 A;  4YP3 A;  1FJ7 A;  5I3Q A;  1QVG R;  4H54 A;  2WBM A;  3LOU A;  1D1U A;  4WKY A;  3S8S A;  1NK8 A;  3Q8Q B;  1CS4 A;  4DN0 A;  3DMJ A;  4DV4 J;  3H2L A;  4LSN A;  3LF0 A;  4M94 A;  1TP7 A;  4CLW A;  3MEG B;  4IG0 A;  5LL6 d;  3TX0 A;  1RYS A;  3KMQ A;  3U1L A;  2FGO A;  4DR7 F;  4NZ7 A;  4UST A;  2AKW B;  3K0J A;  2UXB F;  5KFG A;  2G0J A;  4FF4 A;  2ZBR A;  4TY8 A;  1MW7 A;  6FDR A;  3MPV A;  4CWB A;  2DB1 A;  1HBM A;  1RT6 B;  5GAG I;  1N5Y B;  4JV5 F;  5D4L A;  3F41 A;  4PG4 A;  2E1A A;  4A47 A;  5KFV A;  1FRM A;  1ICE B;  1TL5 A;  1S99 A;  4OZ1 A;  2CQ3 A;  2VU5 A;  4ZVU B;  2UUC J;  5CCL A;  3HFV A;  2G1D A;  4WXO A;  2JVR A;  2JEI A;  1ROF A;  3ETO A;  3OJU A;  3DXS X;  3ENQ A;  4DV4 F;  2GIR A;  2IVF B;  1ITP A;  2XO6 A;  2J9C A;  2EFV A;  4PR6 A;  1YLX A;  5AXM A;  5C42 A;  2F9D A;  2BOA A;  3ILI A;  3NBP B;  3MR3 A;  4WK1 A;  2HYI B;  4NRT A;  5K8M A;  3OUY B;  5K8N A;  4Q7A A;  3FUY A;  5B0F A;  1F3F A;  2HZV A;  3TAP A;  1BY9 A;  1IKV B;  5A8K B;  1SXL A;  2BAN B;  4FXW A;  2CQ2 A;  2HWT A;  4ECU A;  1RT6 A;  2UUB J;  3UCZ P;  1FE4 A;  1OWX A;  3CUN A;  3MUR P;  4NCA A;  2HS3 A;  2MKH A;  4DFP A;  1TK8 A;  4EUV A;  2BJ8 A;  4DR6 F;  2LA6 A;  3F44 A;  4IQM A;  2B51 A;  1HFE L;  2W01 A;  1QTN B;  1Q78 A;  1VRT B;  3LAM A;  2HWH A;  3KLF B;  3TZW A;  3AB4 B;  2CPE A;  3KJQ B;  3T1A A;  1QDU B;  3I0S A;  3M1V B;  3AQP A;  3Q8V A;  2FHJ D;  3GSI A;  1YRU A;  1F60 B;  3DC2 A;  4HH1 A;  1IUJ A;  5JUM A;  2CJX B;  2BJ1 A;  1NO8 A;  4ZN3 A;  4ED7 A;  2P2C B;  1NDK A;  3KLH B;  3K7R A;  1N5Q A;  3VQT A;  1NEE A;  1IKV A;  2YNI B;  2BAN A;  4DXL A;  1FJE B;  2UUB F;  3C6T B;  2AYE A;  4DQR A;  5FLX Y;  1HQ2 A;  1ZPV A;  3RB0 A;  2JC0 A;  2U1A A;  3BBB A;  5A8R A;  2KO1 A;  2BX6 A;  3S01 A;  3NAI A;  3OR1 B;  1JIH A;  2XZD B;  2F40 A;  2DGU A;  3MWB A;  1S0O A;  4NLW A;  5LJ3 Y;  4DWI A;  4JI0 J;  3U27 A;  2DBB A;  2NYH A;  2V8G A;  3ZZO A;  5I42 A;  4PXC A;  1QAY A;  3PEH A;  1N5V A;  1VRT A;  3IC1 A;  4QIF A;  4C8Z A;  3FEZ A;  1IXK A;  2HNY A;  3WC0 A;  1NSA A;  5KG7 A;  5BJR A;  2XC9 A;  4OJG A;  2QRR A;  5ETQ A;  4OI1 A;  2A10 A;  3NMR A;  2I6W A;  2ZH3 A;  3NRB A;  1PJ7 A;  3AJD A;  1LWC B;  3VQS A;  1VLY A;  4K4Y A;  3SEO A;  3DNC A;  3DOK B;  4CH7 A;  5L38 A;  2A6M A;  3M30 A;  2MQQ A;  2Q79 A;  3TR5 A;  1RYR A;  2JH3 A;  1PYT A;  3LPE A;  3FC9 A;  4M5G A;  2WZ1 A;  5J2P B;  4EBE A;  3QSY B;  4ECY A;  2Z2Y B;  2F8M A;  2QGF B;  2CDR B;  4MMO A;  4DSF A;  4KY3 A;  1YX2 A;  1VRQ C;  3J7A 1;  2A18 A;  2ZH5 A;  3HHD A;  3A12 A;  1RTH A;  3KG4 A;  2R8I A;  1BQN A;  3ZZZ A;  4X4T A;  2HIQ A;  3GE9 A;  5T41 A;  3UDE A;  3OHA A;  3HHL B;  2ALZ A;  2J9D E;  3UVJ A;  2XI3 A;  2AJ1 A;  2IM0 A;  4IOA Q;  2P6S A;  3CCQ S;  3FEY B;  4O3N A;  4NLO A;  4B17 A;  2ZJQ Q;  2HFO A;  2HFU A;  1BMQ B;  1ZTW A;  2ZDO A;  1LWC A;  2DTJ A;  3KNA A;  3VAH A;  4X4P A;  2ASD A;  3ZZR A;  4OYZ A;  1XWL A;  2DVI A;  2ZE2 A;  1YGY A;  1HBO A;  3J80 Y;  4DV7 J;  3K2Y A;  2F4F A;  2HQD A;  2BJD A;  1REV B;  4MJK A;  3FRZ A;  2VFR A;  1YJU A;  1KVI A;  1XTZ A;  3UNY A;  2MJU A;  2E9Z A;  1HQU B;  4EBD A;  3M8W A;  3W2V B;  3V4I B;  4DR1 J;  3GFY A;  1UEK A;  1KHV A;  1YBT A;  4B9M A;  3W66 A;  4HI1 A;  4ITS A;  2IM3 A;  4DX7 A;  4F0M A;  1XR7 A;  4AFF A;  1ZYQ A;  1R89 A;  2DR7 A;  3I6P A;  3C14 A;  4AUK A;  2WVF A;  2VPY B;  1P6T A;  2VG5 A;  1KLN A;  2ACY A;  1TL1 B;  1FXD A;  4B9T A;  4NLX A;  1S9G B;  2ROP A;  4JP8 A;  4DFK A;  2QYC A;  2DR5 A;  2DRB A;  5H9F J;  2FZC B;  2CPI A;  1RTI B;  2DIS A;  1TU0 B;  1REV A;  1GMU A;  4G1I A;  2W1B A;  1MU2 B;  5K14 B;  1LWE B;  1S1W B;  4R5P B;  4E0D A;  1L3U A;  1LNQ A;  2DNP A;  4DR1 F;  2C2M B;  2D9O A;  2D1C A;  1WF1 A;  2RDJ A;  3V4I A;  5EX0 A;  5SUH A;  3DI6 A;  1ZOT A;  1LFW A;  2E1P A;  2CQP A;  4P74 A;  1N8R T;  1MMD A;  4F02 A;  3V6J A;  1XNQ J;  2YH0 A;  1WNE A;  4RBU A;  4M1K A;  3DU6 A;  4RW4 B;  4L3N A;  1UL3 A;  2KJW A;  1RZM A;  3G6E S;  4J5O A;  1X0P A;  1JLC B;  2FHO B;  2FLL A;  4RX6 A;  2GIF A;  1TL1 A;  3IS9 B;  4F3Q A;  4LRC A;  3P45 B;  1R6Y A;  5KG3 A;  2PFF B;  1RSC A;  2HND B;  4KJI A;  2OO4 A;  1OIA A;  3KWM A;  3N6N A;  2AD9 A;  2XNR A;  4USW A;  4KHP J;  1UVI A;  3HT3 A;  2RU3 A;  4ZJL A;  1MU2 A;  2M7S A;  4LSL B;  2ZWP A;  4OYP A;  3TVY A;  3THP A;  3EWG A;  2V8P A;  1KTQ A;  3MAA B;  1J5E J;  1X4B A;  1S1W A;  1RT3 B;  4F26 A;  4ED6 A;  4ANE A;  3HMJ G;  3ZNJ 1;  1MLA A;  3I56 S;  2E5J A;  4MK8 A;  4HYK A;  2BJ9 A;  3R7B B;  3IM9 A;  1VR6 A;  4C0O C;  2XMK A;  2G13 A;  1XMQ J;  4F8R A;  1KQS R;  2NXE A;  1UWB B;  3JTP A;  2LYV A;  3PKY A;  1IN0 A;  1HWJ A;  2MKY A;  4G6V B;  3UN3 A;  2PI5 A;  3FSX A;  4RW4 A;  3HCX A;  3R6G B;  4Q43 A;  4MK9 A;  4HEA 9;  2CJA A;  3S1T A;  1EB0 A;  1JLC A;  2G2O A;  4ANC A;  2GHP A;  2HVH A;  2YPZ A;  5FDL B;  3CDA A;  3IS9 A;  2V4J B;  2VL1 A;  1R8A A;  1HBN A;  2XWX A;  4I68 A;  5J2Q B;  3JTN A;  1K44 A;  1P27 B;  4KHP F;  3PNI A;  1NJZ A;  4HLB A;  1YJV A;  1NK5 A;  3DDK A;  2BQR A;  1CBK A;  4IDK A;  1J5E F;  1T9W A;  4YQW A;  4BHQ A;  2IMW P;  3MAA A;  2FJA B;  1WJ9 A;  4A8K A;  3W5X A;  2MQM A;  1MWY A;  4PXE A;  3TWZ A;  4F3M A;  1RWX B;  1FDN A;  4HTI A;  2DCU B;  2XLK A;  1XMQ F;  1Y4Z B;  1U2C A;  4DZ6 A;  2RHS B;  1EKS A;  5B0A A;  2W2N P;  5HMZ A;  2IM2 A;  2XMU A;  3VCD A;  1RBL A;  5KFX A;  4O44 B;  4FNH A;  4DX6 A;  1U7L A;  3VGS A;  3JSB A;  5EUH A;  1VBX A;  1SH3 A;  3DRX A;  2HRU A;  1K1S A;  1F9E B;  5FDL A;  3BR8 A;  1U8W A;  2MKJ A;  2V4J A;  4NML A;  4Y2A A;  4DR4 F;  1A6L A;  5I3U B;  4TU9 A;  1VIX A;  3R8Y A;  4DQS A;  5J2Q A;  5DQH A;  4FXD A;  3PJW A;  4A8X A;  1IVZ A;  1TMM A;  2V2Z A;  3SFG A;  2CAD A;  1TKZ A;  1W2B R;  2G2Z A;  4ZLL A;  2WOM A;  1CJV A;  3IMQ J;  3M8S A;  3I5A A;  2C3Y A;  3GG0 A;  3MMJ A;  5LXR A;  2VA3 A;  3ZC4 A;  3IR5 B;  1NK4 A;  4F36 A;  1N88 A;  4LFC F;  2VBX A;  3JTO A;  4HT7 A;  1Q1K A;  3HPO A;  3VF0 B;  4DL6 A;  3MZI A;  4L75 A;  1I5O B;  1YJN S;  4K7Q A;  2V67 A;  2RQM A;  2B6A A;  3HLU A;  3IBC B;  4DV1 J;  3QGI A;  2FVQ A;  2HHS A;  4YR3 A;  4RUA A;  1X4F A;  2Z4P A;  1UAW A;  2B56 A;  1M0S A;  3EPI A;  5I3U A;  1UVN A;  4M5J A;  1HHT P;  4ES2 A;  3T1H J;  1RWN B;  1H3D A;  2MMY A;  1OO0 B;  2KZZ A;  5ITH A;  2LQ5 A;  4OZ5 A;  1CJT B;  2LDI A;  3R5D A;  4NRU A;  3H0P A;  2CZV C;  3AY0 A;  1M5K C;  5DDQ C;  4AQY J;  3DRS B;  4F50 A;  4NLG A;  2CG8 A;  5AT1 B;  1FRI A;  1ZBT A;  3OTO J;  3RB6 A;  3C8Y A;  3KK1 B;  1QVF R;  3LA0 A;  1RE1 B;  2KKH A;  5C25 B;  2ZH7 A;  2XYP B;  4USI A;  1SL0 A;  2QLW A;  5IT9 Y;  2PEH A;  5LSO A;  1UJ5 A;  3SMZ A;  1Z2Z A;  4FF1 A;  2JLE A;  1AXQ A;  3P5B P;  4OLO A;  5IFM A;  1DLO B;  3NNH A;  1GH8 A;  2H3E B;  2E1M C;  4FPR A;  3CIZ A;  5F8N A;  4WZM A;  1CG2 A;  4ZJO A;  3M8Y A;  3CDU A;  5LXY A;  1CJT A;  4OHX A;  2GO8 A;  3TX8 A;  1VJW A;  4AQY F;  4YEA A;  4I0W A;  2NUH A;  3MD1 A;  1U2R A;  3A3O B;  3PX4 A;  5G4D A;  3CF5 Q;  1KFS A;  1KNZ A;  4DR5 J;  1SJF A;  4CI0 B;  2CPD A;  3MR2 A;  3OR2 A;  3CIM A;  4ZLJ A;  2NSC A;  2LMI A;  2POK A;  4N77 A;  2W8K A;  4M5L A;  3HXM A;  4NE9 C;  4NYZ A;  4WII A;  4TYB A;  1RT4 B;  4NZ0 A;  4C8K A;  2DO4 A;  1DLO A;  4EYI B;  3R1H A;  1RT5 A;  3A1Y G;  3K89 A;  2QLX A;  5KT3 A;  2DY1 A;  3OD2 A;  1S6U A;  3AJ2 A;  3ENV A;  1U6Z A;  2D9P A;  3PFO A;  4UTG A;  4LF8 J;  2DGO A;  3N01 A;  3KJN B;  2J0X A;  4KQZ A;  2QA4 G;  4LUB A;  3J81 j;  3AJ1 A;  3Q86 A;  1VQS A;  2HVD A;  2R2U A;  1FJG J;  3KJF B;  4PAA A;  3PRD A;  2C2K B;  4RNO A;  2DH7 A;  2IJR A;  2R7O A;  4PXD A;  3MI7 X;  4K8R A;  1IKY B;  2MST A;  1PGZ A;  1JNZ B;  1KDN A;  3IGV A;  4ILL A;  1LWX A;  1WUU A;  4M5D A;  4P7V A;  1R0B G;  5E41 A;  4RBT A;  3QT5 A;  3A13 A;  2ZBI A;  2XGP A;  1N0V C;  3BN4 A;  1RT4 A;  3QNW B;  1XC9 A;  4OYA A;  1UW9 A;  2MLX A;  5KFT A;  3CMA S;  3D3B J;  3SIP B;  3FNN A;  1H2T Z;  2AJ4 A;  2RKI B;  3PHT A;  3KK2 B;  2H5I B;  1S77 D;  1FKO B;  5IV4 A;  4LF1 A;  2YX1 A;  4LF8 F;  1NB2 A;  3DFE A;  1FEE A;  2YVS A;  1FFS B;  2CQC A;  4NEZ A;  4H4M B;  3G82 A;  4EZ9 A;  1HI0 P;  2HQC A;  4B3T F;  1FJG F;  2V5H G;  2MGZ A;  2OIH A;  1UFW A;  2M4M A;  4C8Y A;  3TYT A;  5L46 A;  1RWV B;  1UKU A;  4L3K A;  4Y2K A;  3BBC A;  2YKP A;  4KAI A;  2HBY B;  3QJL A;  1SJR A;  3KUH A;  4QPT A;  4H4K C;  4X2B A;  1YJT A;  4E8U A;  3D0I E;  1S7H A;  1WAC A;  4QYR A;  3IP0 A;  3R2D J;  2RF2 B;  1FD2 A;  1UA1 A;  1SI9 A;  4UOH A;  5AJ3 J;  3BGF A;  2CG4 A;  1WEY A;  4RKU C;  4ED2 A;  5M2P A;  1Q0N A;  1T95 A;  5GAD U;  5K20 B;  2RKI A;  3G6V A;  1QD1 A;  1ZM2 A;  1TK5 A;  1FKO A;  4ER8 A;  3UN5 A;  3OTE A;  4DL0 C;  1SUQ B;  4QIE A;  2DPJ A;  1V9O A;  1FK9 B;  3BSC A;  2GGP B;  4H4M A;  1QY7 A;  1RUS A;  1JXV A;  3IBW A;  1T03 A;  4CLZ A;  5F0U A;  4LF9 J;  3HM9 A;  2Q43 A;  2BKO A;  2GO9 A;  1RAF B;  4FNI A;  2CVE A;  3J81 U;  3C46 A;  1YDL A;  1RKI A;  3CC4 S;  1S4F A;  1S7I A;  6AT1 B;  4NCG A;  3O8W A;  2Z57 B;  3CD7 A;  4NLY A;  4OX9 J;  4QWE A;  3KOA A;  3D6F B;  2HQI A;  1WEX A;  5AJ3 F;  2DNN A;  4DFJ A;  2RF2 A;  1GXT A;  5DGB A;  4XIU A;  3DRY A;  1GMW A;  2B4U A;  2RS2 A;  3FDS A;  5GAD I;  4UT4 A;  2H48 B;  4A8F A;  3TVK A;  2CQ1 A;  2OSR A;  1N36 F;  2Y8W A;  2NXJ A;  3WHI A;  1Y5L B;  3EXC X;  1DRZ A;  2ZC3 A;  4KE5 A;  1YG0 A;  3AOC A;  2FUG 9;  1FK9 A;  4DPW A;  3H5S A;  2ATC B;  2WSE C;  4RNM A;  4DDF A;  3N28 A;  2RD5 C;  2OPS A;  1C2P A;  2FJX A;  2YTC A;  4OI6 A;  3QO9 A;  1T9V A;  1NB7 A;  2JOQ A;  4OYB A;  3RR7 A;  5A8W B;  3I0R B;  3HP6 A;  4J9L A;  3D1H A;  2CQB A;  2VZ9 A;  2IMO A;  3L3C A;  1RJJ A;  2EKY A;  4NWB A;  3RBX A;  3E2E A;  5C2C A;  1RP5 A;  5L39 A;  2IRX A;  2B3T B;  1GFW B;  2RE1 A;  4YY3 F;  1J5O B;  2N4C A;  1HQE A;  3ZTS A;  1VQN S;  2K06 A;  3M7V A;  2HHX A;  4K4V A;  1BWV A;  5H1S V;  2RJZ A;  4PXB A;  4HH0 A;  1U24 A;  1VHI A;  4C9D A;  3RBD A;  4KBI A;  3GSD A;  3TNV A;  1OYD A;  3MPD A;  2P5V A;  2NQP A;  4DX5 A;  4EFA C;  2F8E X;  3NS6 A;  1WG4 A;  1F0X A;  2QL5 B;  1N32 J;  5T7L A;  4DSI A;  4MIA A;  2XMT A;  5A8W A;  3I0R A;  4JYA J;  4C8O A;  5C24 B;  2L9N A;  2V2Q A;  1NZ8 A;  1T7P A;  2V6A A;  4M5I A;  4IH5 A;  4ZP9 A;  2DIT A;  1YBA A;  5DDR C;  1D0E A;  3BSO A;  4XO0 A;  2EVZ A;  4F4W A;  1SJ3 P;  1FXL A;  3U7J A;  2LP4 A;  2VBZ A;  4WP8 A;  1J5O A;  3SCL E;  4X62 J;  2FIU A;  1MN9 A;  1WG5 A;  4XPE A;  2MY8 A;  1H38 A;  2MKC A;  1A0O B;  3SDE B;  3T19 A;  1VBK A;  3QIP B;  2CZ4 A;  2DY9 A;  2DNO A;  4CH0 S;  5HQL A;  3ONQ A;  1T3N A;  4C3L A;  5D8H B;  3G8S A;  1H72 C;  2OGU A;  2EXU A;  3PFE A;  4TU8 A;  1Z1Z A;  4JYA F;  2FTR A;  3QRQ A;  4YFU A;  4P2F A;  3SV4 A;  2UUA J;  1WD6 A;  3A8I A;  3HVW A;  3PCO B;  4WKR A;  1N56 A;  2D41 A;  3K5P A;  3K8W A;  5KFQ A;  2NCK L;  3H42 A;  1Y11 A;  3CD0 A;  3RGI A;  3PIO Q;  2DHX A;  3B8H A;  2CA9 A;  1JLE B;  5DET A;  3SSR A;  4ZCL A;  2KI2 A;  4EK2 A;  2WK4 A;  3OFE A;  3GJT B;  2HRT A;  5GVQ A;  8ATC B;  5EN1 A;  4X4S A;  4P52 A;  1UWA A;  1A9N B;  3NWR A;  4ECW A;  3FSY A;  3L7O A;  4C2M A;  4KHM A;  2CQD A;  3QIP A;  5HJY A;  4GKJ J;  5KG6 A;  2C28 A;  2MZJ A;  1IKX A;  5EX3 A;  2HLT A;  1WOS A;  4UOC A;  3MCO A;  1BXN A;  2KXN B;  4RL1 A;  1RAE B;  4NXM F;  3G6X A;  3CCU S;  3DRP B;  4F25 A;  4O4G B;  2YWG A;  3B82 A;  4UUW A;  5D4O A;  4QZV B;  1RIS A;  1TL7 B;  2QFJ A;  5A2Q U;  4WP3 A;  3IO1 A;  2MSS A;  3NOC A;  2L48 A;  5KT7 A;  5KG0 A;  2KB2 A;  2XUL A;  1S10 A;  4AL5 A;  1VGY A;  4A8M P;  2N3L A;  2XLJ A;  3GR0 A;  2EG1 A;  4A8Y A;  1UMJ A;  4ILR A;  1GX6 A;  2D69 A;  4YDX A;  1F3V A;  3N6L A;  3A3N B;  3ZTQ A;  3PYG A;  1Q4R A;  3WIV A;  4HR2 A;  4I2P B;  4E2F B;  1TK0 A;  3RBE A;  1C1B B;  2B9W A;  1ELO A;  4C8L A;  3IAM 9;  1U1L A;  2ADB A;  4F2R A;  3CMQ A;  4HDG A;  3DRP A;  1RHM B;  4O4G A;  3V6D B;  1ZA2 B;  4G1Q B;  2KXF A;  5B09 A;  4O23 A;  4CO3 A;  1TL7 A;  2HZA A;  2AU0 A;  3SQG B;  1JX4 A;  3NGK A;  2LXF A;  1UJ6 A;  3AB2 B;  3OXF A;  3BEG B;  3QRR A;  2HGL A;  2J9E A;  1R7I A;  1SV5 B;  3U1M A;  1VQL S;  3KLG B;  3QJJ A;  3EXY A;  4Q0B A;  1YJR A;  4LFA J;  1RTD B;  5F9N A;  5HVG A;  3QLH A;  4X66 J;  5ETT A;  2DEJ A;  4USU A;  4ZHR B;  1RCO B;  3OBI A;  1RAB B;  1S9E B;  3IGN A;  1EAR A;  3AA8 A;  5LOQ A;  3A8K A;  2QX0 A;  2VOP A;  1U1Q A;  1Y5I B;  2BW7 A;  2WSF C;  2BQ3 A;  4OV1 A;  1ZA1 B;  2Y1J A;  4BC9 A;  3IWX A;  4FYD A;  1R43 A;  4LRF A;  4NZ6 A;  1QSY A;  1DJ0 A;  2FY1 A;  2CPZ A;  2FLP A;  2OTL S;  4JI6 J;  2VIC A;  3VGU A;  2LKZ A;  5D78 A;  3V6D A;  3M8Q B;  3L09 A;  3PYF A;  4YHH J;  4WYW A;  3D3C J;  4FKY A;  4P7T A;  1PIL A;  1DFD A;  1IQZ A;  1VMB A;  3AXM A;  3KLG A;  4LFA F;  4ED8 A;  4NA1 A;  3RG6 A;  1RTD A;  2MJN A;  3W2W B;  2LEB A;  1OQ6 A;  1GNK A;  3M9M B;  7AT1 B;  1SH2 A;  4ZHR A;  4ZPA A;  1K47 A;  3KXD A;  3TJ9 A;  4J9R A;  3H98 A;  5F9L A;  4B3S J;  4RU9 A;  1RK8 A;  2LU2 A;  1L3K A;  1WOP A;  4Y0F A;  2APO A;  2A2C A;  3QID A;  5E3Q A;  2YQ1 A;  1U26 A;  3OFG A;  2ZEJ A;  1TR0 A;  4OHZ A;  4DPU A;  2R7T A;  3T5H A;  1ZAW A;  2DD8 S;  4GC7 A;  3CW2 C;  1RAC B;  2VBY A;  3D1O A;  3PX0 A;  4IG3 B;  5L9X A;  1U1M A;  2V8V A;  1DHM A;  4UQT A;  2BAB A;  4TU7 A;  2CPX A;  3PHE A;  3C3L A;  1JLA A;  3W5Y A;  1X9S A;  2BZ2 A;  1S9F A;  3A4T A;  5J2N B;  1TVR B;  3BYR A;  3NL0 A;  1FWP A;  3BKT A;  1FRX A;  2F65 A;  3AD7 C;  1S6Q B;  3U1N A;  3W2W A;  2IDE A;  1NKC A;  2CQH A;  3P96 A;  3NAH A;  4DV2 J;  3PV8 A;  5DZ6 A;  1HWU A;  2W4C A;  4ECQ A;  2E66 A;  3VAG A;  3TAQ A;  3QQC D;  2GJ2 A;  3PXG a;  3CC2 S;  3AXK A;  3DGP B;  1BQX A;  1IWG A;  2NPI A;  1DAX A;  4L73 A;  3W64 A;  2BJ3 A;  4ZMM A;  2ZUA A;  2GZO A;  3ET6 B;  4ZVQ B;  2K7J A;  1KC8 T;  3RB3 A;  1LW0 A;  1X7V A;  4V19 X;  4A48 A;  4NI2 B;  4OJ1 A;  4XK8 C;  5ETK A;  4YUD A;  4DV5 J;  1KQK A;  3BH7 B;  4L72 B;  2HGN A;  4GKK F;  3NGU A;  1VK8 A;  3SXL A;  3TRG A;  3H5U A;  2ZM6 J;  2QYG A;  3BYP A;  4ZPT R;  3W9H A;  1TVR A;  3O5T B;  2YKQ A;  4PQA A;  2ALY B;  1FTC A;  3BRE A;  2CFX A;  4QOT A;  1S6Q A;  3JSM A;  1IBK F;  2D3O R;  3GIR A;  2QLB B;  2XCP A;  2Z2Z A;  1ZH5 A;  4Q2L A;  4HI2 A;  5E7O B;  4DV0 J;  3PY8 A;  1VQ5 S;  2EFQ A;  3N6M A;  2B43 A;  1G3O A;  2PC6 A;  3MGJ A;  4DU8 A;  2DNG A;  5DDO C;  4OHW A;  1CPZ A;  2B8P A;  4GRS A;  2CPH A;  3CCT A;  3HHL D;  2UU9 F;  3TOQ A;  3THV A;  4YB6 A;  5HJX A;  3JAM U;  4FBU A;  4DV5 F;  4DR2 F;  2DHH A;  5CYM B;  3OSP A;  1B7Y B;  4NI2 A;  2ZM6 F;  1FVS A;  4B02 A;  3GMG A;  1HWI A;  2V9K A;  1RAA B;  3CNQ P;  1D9A A;  4WCE Q;  3DLH A;  1S1T A;  5EWF A;  2XY5 A;  1CSJ A;  3EE3 A;  1XMB A;  3M8R A;  4I4B A;  1LXJ A;  2P8I A;  4QU6 A;  5B7W A;  2R2S A;  5IM0 B;  1S97 A;  1URN A;  4TYA A;  2B9Y A;  4GMK A;  2E7V A;  2HHQ A;  4J9Q A;  2FJE B;  3PZP A;  5SZT A;  5A6P A;  3MFI A;  1R8C A;  2EWH A;  1BLU A;  4KGV B;  5J1E A;  3DOM A;  2OI2 A;  3TZY A;  2C2N A;  2G1H A;  3TQE A;  2QLJ B;  2Y1R I;  1IBL F;  2C3M A;  3VR1 A;  5CYM A;  1WSR A;  3EGV A;  3UE2 A;  3DLG A;  4L74 A;  4KHR A;  1FD8 A;  3PX6 A;  2OPQ A;  4P73 A;  1IJF B;  4Y2I A;  1VC5 A;  2ASJ A;  1HYS A;  4PWD B;  2EK1 A;  4DPT A;  2X3D A;  3ILL A;  2PMW A;  2GV1 A;  7FDR A;  3GQC A;  5HAO A;  2VC1 A;  1IBM J;  3ETM A;  2GHV C;  4ZPD A;  5IM0 A;  1DUR A;  4ZCK A;  1GXU A;  2SXL A;  2UVU A;  2VOD A;  2M52 A;  3T5L A;  4PRF A;  3CCV S;  3NS7 B;  4NYP A;  1MWQ A;  3D4J A;  2RDI A;  3MR6 A;  3LUY A;  3H7H B;  3MUM P;  2FD2 A;  4AL7 A;  1RWM B;  2VC0 A;  4RO0 A;  5EHH A;  3BO3 A;  3BV8 A;  3W65 A;  1O5J A;  2R3V A;  3LP2 B;  3G8T A;  1WEL A;  3MR5 A;  2CNN B;  5D0E A;  2XS2 A;  2O1P A;  1IKW A;  2AIR B;  3KG1 A;  4URS A;  1S6P A;  5CD4 H;  3GG1 A;  3HDS A;  4F2S A;  4OHV A;  2YKN A;  3T6B A;  3A8J A;  2K8G A;  1H0H B;  3KHR A;  1DY3 A;  2X7I A;  2F4V J;  1D8Y A;  3VZI A;  5HO4 A;  4ZLN A;  5DG8 A;  1WKK A;  2HS0 A;  1IBM F;  1QAJ A;  3JQK A;  4O3S A;  1SQE A;  1PG5 B;  1V5V A;  2AYG A;  2DNZ A;  3CE8 A;  1NK9 A;  2QC3 A;  5HRO B;  3I87 A;  1NKB A;  4ID5 B;  2HZC A;  1S48 A;  5LMU J;  2XG8 A;  1SB6 A;  3IAS 9;  4LQ3 A;  1EP4 B;  4O3P A;  1RHK B;  1Y0H A;  4OYO A;  2DGV A;  1HI8 A;  1X4D A;  2DCL A;  4LFB J;  1JQG A;  2OFH X;  3RJM B;  4CLS A;  4RUC A;  3UNG C;  3WX8 A;  2F8H A;  4J9S A;  1M5V C;  3KFW X;  2E5L F;  2RVJ A;  1RT2 A;  2X1F A;  2VJV A;  2F4V F;  4P75 A;  1N6Q A;  1D9F A;  1ZZN A;  1Q5Y A;  2EFP A;  2VQF F;  2J8S A;  4JV2 A;  4I67 A;  3UW1 A;  4P2S A;  4ED5 A;  1NDL A;  1LKZ A;  3H4B A;  3HX9 A;  2FHJ A;  3LP0 B;  1FX2 A;  2M70 A;  2Y0B B;  1S5Z A;  2IA6 A;  1SIW B;  1TKX B;  3C16 B;  1PJ6 A;  5LMU F;  5HRO A;  1GTH A;  2PN6 A;  2NS1 B;  1JLG B;  1VBY A;  2WHO A;  1UP1 A;  4UOF A;  4LFB F;  3QFH A;  2MKK A;  1U45 A;  3SFU A;  1FRK A;  3Q8S B;  3OL8 A;  2PII A;  4ZVR B;  1MML A;  3Q8U A;  3Q23 A;  1WI8 A;  4DL2 A;  4IKA A;  5ETO A;  1NRK A;  4LQ9 A;  5D4P A;  5HMW A;  2NPF A;  1BE4 A;  2ZHA A;  1VIO A;  4WFZ A;  3Q24 A;  3MCM A;  1YK9 A;  4OX8 A;  3E01 B;  4ZVG A;  3CJ8 A;  2ZZN A;  2QA4 S;  2IDL A;  2ZUG A;  1KBR A;  3MM7 B;  4KB7 A;  5BYQ A;  1NHV A;  3LP0 A;  1T05 A;  2ZBC A;  5C7P A;  2JC1 A;  5K9F A;  1RHQ B;  1IQT A;  1QSL A;  2VDH A;  2KT5 A;  2B5J B;  4NL5 A;  2YWE A;  3V2U C;  2E1C A;  1JLG A;  3D0G E;  2BA9 A;  4XDC A;  2VAS A;  2AYM A;  3V81 A;  5L1J A;  3CCZ A;  1NUE A;  3PKM A;  1REG X;  3DYA A;  3C19 A;  3G4S S;  2PA3 A;  3W7B A;  2RUS A;  3PRB A;  2NRE A;  3N9U C;  1TUW A;  3ISZ A;  2HG4 A;  2JEG A;  1M5H A;  2BJ7 A;  1RAJ A;  1OMS A;  5HBM A;  3VTI A;  4J9M A;  4A8S A;  1KLM B;  4JI4 J;  3BJY A;  1Y10 A;  3DDN A;  2I38 A;  5B0C A;  1HNI A;  4O3O A;  1FDA A;  1HR0 J;  3E01 A;  2DO0 A;  3HHL C;  1S1U A;  1CC8 A;  1FCA A;  3CCR S;  3ENA A;  3VGT A;  5IXU A;  2I5J B;  2K1R A;  1KTV A;  3MM7 A;  3DLK B;  4TLQ A;  1C0T A;  4QU7 A;  1YZ7 A;  3CVK A;  3GIL A;  2P9E A;  3CCL S;  4LF4 J;  4ZP8 A;  2KXH A;  3BPD A;  3N0V A;  1T8E A;  2Z56 B;  4DG1 B;  2JNJ A;  3J81 Y;  3KDO A;  2QFI A;  3GFX A;  4K2X A;  2B5J A;  2KFZ A;  3SSQ A;  2BAC A;  2FJD B;  2M3D A;  3D54 A;  3BSA A;  2FPH X;  3FK4 A;  1HNZ F;  1VC0 A;  3E51 A;  2B4V A;  2E9T A;  3IRX B;  1KWM A;  3WBZ A;  1F9H A;  2XO7 A;  1U2F A;  1CLF A;  2QSF A;  3K5O A;  3LAN A;  4ATN A;  2DH8 A;  1WSV A;  3W62 A;  4LIR A;  1JLF B;  4K4X A;  2XTJ P;  3TAM B;  3LW5 C;  2NXN A;  4JI4 F;  1D3W A;  3W5Z A;  2OHD A;  1S0V A;  4MKB A;  5D0R A;  3W9J A;  1SC3 B;  1KVJ A;  4I1T A;  4L76 A;  3GIM A;  3ADA C;  2HNZ B;  4YB5 A;  1GTE A;  3FGV A;  1CS4 B;  3WX4 A;  4B3M F;  3DLK A;  3T9Z A;  4J91 A;  4QYZ K;  2H4Y B;  3Q8R B;  4BDP A;  4LSN B;  1B64 A;  2DGQ A;  2GC8 A;  3P3D A;  1B0P A;  1H74 A;  3CDB A;  3I9Z A;  4DX8 H;  1UZH A;  1K8A T;  5F3T A;  4ZPW R;  1R0A A;  3RRG A;  1VC6 A;  4K0K J;  4WF9 Q;  1OPI A;  1H7W A;  1X60 A;  1JJC B;  3A3P B;  5LJ5 Y;  2B4P A;  1MG7 A;  2WVD A;  5GAG U;  4IUF A;  1HI1 A;  4CNY A;  1JLF A;  4ZPB A;  3PYE A;  1UA0 A;  3TAM A;  1KON A;  2V50 A;  5IZH A;  3IR7 B;  1X0F A;  1W25 A;  2WSC C;  2HVZ A;  4KO0 A;  1SJQ A;  1OS5 A;  3R3T A;  4WIQ A;  4JI7 F;  4EGL A;  2HNZ A;  1W26 A;  2HLU A;  5IQQ A;  3MOZ A;  5KT2 A;  3GII A;  4LVO P;  3M32 B;  1TV6 A;  2QO3 A;  3ILO A;  4EBC A;  2VKR A;  3MM5 B;  1WC5 A;  2Z8Q A;  5C42 B;  2GS8 A;  4ID8 A;  3CED A;  1VK3 A;  3TW0 A;  1WTB A;  1GAO A;  4K0K F;  3JB9 k;  3BO4 A;  2NLW A;  1FDD A;  4DV6 J;  2LU1 A;  3V6H A;  3QAE A;  5DM6 Q;  2H51 B;  1YIT S;  4QIV A;  3OLA A;  1RAD B;  5D77 A;  3UR0 A;  3MAQ A;  1SKS A;  2Y8Y A;  1PKU A;  2UXC J;  2PFD A;  2CVI A;  3K5M A;  2ROE A;  3RAX A;  1F2H A;  1NK0 A;  4K4T A;  2ZIT A;  3ZZP A;  5MLC V;  4RBV A;  3NCR A;  1VQK S;  1VYA A;  4WTY A;  4U6P A;  1DTQ A;  4C3M A;  3AD9 C;  1UJ4 A;  1NZA A;  1YJ9 S;  4AE5 A;  3AT1 B;  3I0S B;  1JLB B;  2AYB A;  4ELU A;  2IJN A;  2VG6 B;  3QZ8 A;  3H8Y A;  3OQ2 A;  3M32 A;  1ZM3 A;  1NLK L;  3AQO A;  5HI7 A;  3H2U B;  4EEY A;  4Y2M A;  1T9T A;  2WW8 A;  2IRU A;  3MM5 A;  4EO6 A;  5KFO A;  1EET B;  1U49 A;  1GQE A;  3N5F A;  1E6Y B;  3FQK A;  4NYO A;  3I55 S;  4DV6 F;  4I69 A;  4P2X A;  3VAM A;  1ZAV A;  4I56 A;  1Y3J A;  1NU4 A;  1IWA A;  2OUG A;  4PPD A;  4NEY A;  3EX7 B;  5A8R B;  2BE2 B;  5JMN A;  4YDD B;  4C48 A;  1SH0 A;  2KM8 B;  1GMW D;  3W9I A;  2XZT B;  1W2I A;  5I42 B;  2UUC F;  2CZ9 A;  2OKQ A;  3K59 A;  2X51 A;  1Z4U A;  2FVC A;  2ZVI A;  1DTT B;  3JS9 A;  3PW5 A;  2RH3 A;  1H7X A;  4H4K A;  1JLB A;  2VG6 A;  3GYX B;  2HNY B;  3JQM A;  1N34 J;  3HSJ A;  1EHW A;  3OTD A;  2UV8 A;  3LPY A;  1FJC A;  1RCX B;  1P1L A;  3D6H B;  1OY9 A;  1NSK L;  1HNW J;  2FYX A;  2A2D A;  4MYT A;  5KFP A;  2L08 A;  1EET A;  4LT6 A;  2BUN A;  3HF5 A;  4ZVE A;  2E5I A;  1E6Y A;  1UFK A;  4ETZ A;  4K4S A;  3D67 A;  1F5C A;  2V34 A;  1UVJ A;  4X4Q A;  2KFY A;  1UVM A;  1S1V B;  1U09 A;  1VOM A;  3M30 B;  5A2Q Y;  3SYZ A;  2EK6 A;  1Y9O A;  2BE2 A;  3LTO A;  3O1L A;  4CLF A;  2HHU A;  2DXE A;  3MR7 A;  4NLS A;  4KGM A;  3JSR A;  1FRH A;  4O4R A;  1S49 A;  1N33 J;  1B3T A;  1DTT A;  4OZL A;  2OML A;  2JEJ A;  4USV A;  1RTH B;  2ZOF A;  2IYI A;  1BQN B;  1HNW F;  1HMV B;  1U6F A;  1YRX A;  3HKW A;  4OZ2 A;  3UVJ B;  3R1L A;  1VQ4 S;  4WP9 A;  2C3O A;  2FB0 A;  4CT8 A;  4Q2M A;  1ZPW X;  2KG0 A;  2R7X A;  2YQ3 A;  5B0E A;  2OP5 A;  1FRJ A;  1JJ4 A;  3SQO P;  4EMD A;  1Q81 T;  2W7O A;  3NEK A;  1HD0 A;  2VFT A;  2WVE A;  2I1R A;  5A0Y A;  2C42 A;  3MAH A;  2ZE2 B;  5LMN J;  1S1V A;  1HBO B;  3Q8Y A;  2XMW A;  4L6V 3;  5CA5 A;  2CJK A;  1SJ1 A;  2FDN A;  4FZV A;  2QMX A;  1HD1 A;  4M5N A;  4JI0 F;  4FXV A;  4OJ3 A;  3R5B A;  4HHU A;  5DG7 A;  2RT3 A;  3ISN D;  1N33 F;  2PE8 A;  1UW4 A;  2GMH A;  5KFU A;  1MMN A;  4Z2X A;  3BR9 A;  3C66 A;  2BBE A;  1AZS A;  5AXK A;  2CPJ A;  1BGX T;  4QYZ J;  3GIJ A;  4UZC A;  3GWC A;  1HMV A;  3H2V E;  2ZNY A;  1FNM A;  4DJB A;  2MLZ A;  5DM7 Q;  5GMD A;  3QBC A;  3C14 B;  3KLI A;  4ZVO B;  2WAQ D;  2EW9 A;  3OHB A;  2VG5 B;  5LMN F;  2F7V A;  5KFL A;  2J9D A;  2AGP A;  3AD8 C;  2AX1 A;  2CKW A;  3EDQ B;  4JB8 B;  3L7U A;  4YOE A;  4OZ0 A;  4RNH A;  3DRR B;  2R2R A;  1HPZ B;  4PG6 A;  1TMJ A;  2OD6 A;  2DNM A;  2BRK A;  3QGP A;  4MKY A;  1DBD A;  3HVT A;  3OXL A;  2OLW A;  1M1G A;  5KOW A;  4U9R A;  1KP6 A;  1Q8L A;  4K4Z A;  4USM A;  4QR0 A;  2BKP A;  5EDW A;  2HBR B;  4NLQ A;  2MKI A;  3DCA A;  3DI6 B;  3EM1 A;  2QG9 B;  1P9Q C;  2ZOG A;  4I64 A;  4WE1 A;  3CSK A;  3CCW A;  4AND A;  1VQ9 S;  4JI5 J;  4ED1 A;  5H9E K;  4JI2 J;  2VIH A;  5M2U A;  4U7U D;  3VAL A;  1RAO A;  4DOZ A;  3NGS A;  3CD6 S;  2Z2M A;  3OVB A;  1VS3 A;  4CRJ A;  1JK9 B;  2JWN A;  4J9V A;  2H1Y A;  4DV7 F;  2ZKT A;  2AMC B;  4M5M A;  2EFO A;  3LGH A;  2ERR A;  1FA0 A;  1G1X A;  3BQ0 A;  4J9U E;  1LQ9 A;  2QIF A;  3DRR A;  4J9K A;  2MZ1 A;  1HPZ A;  4OL8 A;  4DUY J;  2LFV A;  2AWZ A;  1RHU B;  2BE9 B;  3KG0 A;  1RA6 A;  3UD3 P;  3M8P A;  3NCP A;  2C2D A;  1DZ5 A;  1C0U A;  1MN7 A;  4AXI A;  2EEY A;  3I31 A;  4PQU A;  3Q83 A;  4DLG A;  1N54 B;  3T5J A;  1EKR A;  4RNN A;  1SQF A;  4X4U A;  3FZ2 A;  2KYZ A;  1U47 A;  4NLT A;  3JYT A;  3EZU A;  3A8E A;  1T9U A;  4JI5 F;  4LBI A;  2W7P A;  3DN9 A;  4JI2 F;  1O8B A;  2NXC A;  2J7K A;  4RUB A;  2OFG X;  1NJX A;  1U1O A;  1RGV A;  2DEI A;  4Z7Y A;  4IFV A;  5KFB A;  2W2Q P;  4DSE A;  4KIA A;  1CC7 A;  2MXY A;  2XGQ A;  2KVQ E;  3DOL B;  1S12 A;  3BDP A;  4JI1 J;  1HBN B;  3TEG A;  1KD1 T;  2W9A A;  3P49 B;  4I7F B;  4DUY F;  2ZJR Q;  1HNX J;  4P72 A;  4MFB B;  1GK8 A;  2FZK B;  2OPR B;  3K5L A;  4IDK B;  2E9R X;  1XQI A;  2MPU A;  4P6Q A;  3WQP A;  1U6B A;  2H5E A;  5M2R A;  1WDT A;  3QFW A;  3GLJ A;  2D74 B;  4FP9 A;  3OPK A;  1FEH A;  5F8G A;  4ZLP A;  5HP1 A;  1BD6 A;  3KUG A;  3RB4 A;  3HZE A;  2AZ3 A;  1XNQ F;  4FYW B;  2JSX A;  3TUP A;  4MT1 A;  3EPG A;  3T3F A;  3PYD A;  3DM2 B;  2P9C A;  2B4O A;  5K8P A;  2DJW A;  2ZJP Q;  3DLB A;  2XMA A;  2V68 A;  3TP2 A;  4LBP A;  1FWK A;  3JAM Y;  3NNC A;  3FFI A;  5C5J A;  2BRL A;  2HW3 A;  3HI9 A;  2LQ9 A;  5HMY A;  3RW6 A;  2AF6 A;  3DOL A;  4PYA A;  2RRA A;  3AH6 A;  4I7F A;  1UEU A;  4J9O A;  1JMT A;  3I82 A;  4M5K A;  4MFB A;  4K2J A;  1C4A A;  4C3K A;  2OPR A;  4FS1 A;  1TKZ B;  3RW7 A;  2WOM B;  2Z30 B;  3ZFV A;  1CJV B;  2AJ2 A;  2MB0 B;  2HKE A;  5HSP A;  1BQM A;  2J76 E;  4NXN J;  1V5I B;  4NA3 A;  2RAQ A;  3TUJ C;  2C22 A;  1P8G A;  4J9P A;  3UQS A;  1DQ8 A;  2XY7 A;  1MWZ A;  5B0G A;  3DM2 A;  3V4M A;  2GW8 A;  2RSQ A;  4WFA Q;  2DNY A;  4KFB B;  2AGQ A;  2C2O B;  5HN0 A;  5DO2 A;  2I9S A;  5IV3 A;  2HWI A;  2B6A B;  1X5T A;  2XM3 A;  2PI4 A;  2MDA A;  3FKB A;  3VZH A;  3LWM A;  3QJP A;  4S0M A;  4U95 A;  2K3I A;  3RAQ A;  4USH A;  2CNO B;  4WBF A;  1ACM B;  2I2Y A;  2VG7 A;  4LF5 J;  4NLD A;  4ZJQ A;  2J7U A;  4DV3 J;  1TKT A;  2QL9 B;  1LWF B;  1GX5 A;  4HTJ A;  1HHS A;  2JZ5 A;  2RIL A;  3MED B;  1AYE A;  1YJW S;  3QMQ A;  5KFZ A;  4DFM A;  2KZM A;  1M5S A;  6FD1 A;  2GA7 A;  2XBP A;  4DN9 A;  3TI0 A;  3ISN C;  2WBR A;  4ECV A;  4DEZ A;  1JXE A;  1SBR A;  2L3M A;  3L7P A;  1PIE A;  4AD6 A;  1FO1 A;  2PT0 A;  4MH8 A;  4ECZ A;  3ULH A;  2BM0 A;  4CCH A;  2BKN A;  1H98 A;  1CQM A;  5LT5 A;  3MPU B;  2ASL A;  4IRC A;  4KFB A;  2WCX A;  2GAG C;  2ZFH A;  4MIW A;  1HKA A;  3R5C A;  5DS7 A;  5KFI A;  4X65 J;  1XR5 A;  4LRD A;  3R5G A;  1IBC B;  2LQJ A;  3H59 A;  5L1L A;  3TAR A;  3CCJ S;  4LF5 F;  2DGT A;  5CAA A;  1LW2 A;  5DLF A;  3B4D A;  3ZXW A;  4N7T A;  1NDP A;  4DV3 F;  3AAW B;  3TUI C;  1HNV A;  2DYA A;  1CJK B;  4C4W A;  3PRV A;  1TFW A;  1LWF A;  2XWY A;  2HBZ B;  2C1E B;  3QSI A;  4ECX A;  4YME A;  3MED A;  1G7C B;  2CIM A;  2VPX B;  1OJ4 A;  3EUN A;  5KFH A;  4EI2 A;  4P71 A;  1EQM A;  3CDW A;  2MQL A;  3FCH A;  3GPA A;  5GMK a;  1XBW A;  1WF0 A;  3OR2 B;  3GJS B;  2RU9 A;  4KH1 B;  4HT5 A;  4HAC A;  1IR1 A;  3U02 A;  3QGH A;  2HHT A;  2XMV A;  5H9E J;  1YBU A;  4OI4 A;  2GHW A;  1D8Z A;  1G6B A;  2QT7 A;  4DV1 F;  2GVD A;  1TZ0 A;  3LAK A;  3H5X A;  1H2V Z;  2AQ4 A;  1RT5 B;  4DL4 A;  1N5S A;  4NX9 A;  4CDI A;  2NUU G;  1K0V A;  1F5A A;  2VQE J;  1SC1 B;  3T1H F;  3THT A;  2RQ4 A;  4ZVH A;  5G0R A;  2D3O 1;  1LEO A;  1CJK A;  2MLY A;  5F8M A;  3DLE B;  4I6A A;  4MYU A;  4Z7C A;  3M4X A;  3FBB A;  3FCW A;  3HUL A;  2I8E A;  4K4W A;  4LMZ A;  3T6J A;  5FII A;  1NME B;  2D7S A;  4IR1 A;  3OL6 A;  4U67 Q;  5KT6 A;  4N41 A;  1WC4 A;  4Y00 A;  3OTO F;  4YB1 P;  2PD1 A;  2RDD A;  3CJ2 A;  2DR8 A;  4UOG A;  2OEL A;  4LIW A;  4ES1 A;  5EWE A;  2IC3 A;  4M5D B;  1TQL A;  3UI3 A;  4HDH A;  4N8O A;  1APS A;  4DUT A;  4DSL A;  5ADZ A;  4X4N A;  3CWJ A;  1Q8B A;  1S57 A;  4KKO A;  4F4K A;  1RLD A;  2UXB J;  2JLF A;  4RWX A;  4DCO B;  4R0E A;  2VQE F;  2DIV A;  2F63 A;  2MQ8 A;  2CJY B;  5GME A;  3MM8 B;  1YTY A;  4TVA B;  4JV5 J;  2LA4 A;  4DL3 A;  1VLO A;  2B8Q A;  3G82 B;  2MGZ B;  3DLE A;  2VD3 A;  1FKP B;  5B0D A;  2RIJ A;  1B99 A;  1VDH A;  3MTJ A;  4WU2 A;  1FER A;  1SC4 B;  3PW7 A;  4F0K A;  1X4E A;  1ZET A;  5I3P A;  3ITH A;  3P6Y C;  5CZV A;  3R6L B;  2HFZ A;  4RW8 B;  2KTQ A;  4DR5 F;  5HVF A;  4NLR A;  2E5G A;  3IRW P;  2AEM A;  3SI8 A;  4TN2 A;  3M2R A;  4HHH A;  1NM2 A;  3D2W A;  1PBA A;  3EVW A;  2ROG A;  3KLE A;  2OPP A;  1I51 B;  4NLV A;  4K5S A;  1FDB A;  3RRH A;  1WHY A;  2KYX A;  1NK7 A;  3UCU P;  4DPY A;  3OJS A;  2J6T A;  3CJ5 A;  1U1N A;  3I96 A;  2CYY A;  3UWT A;  4ECR A;  1YIJ S;  2J0W A;  2KL8 A;  1WC1 A;  2ZHB A;  5K5M A;  2CJ9 A;  1QE1 B;  3MM8 A;  3OL7 A;  1YRT A;  2J7W A;  5H9F K;  1X5O A;  1WHX A;  3G71 S;  3MHY A;  1U1K A;  1FKP A;  2NXU A;  1T03 B;  3G9C A;  4LRB A;  4DR6 J;  1M1H A;  4ZCM A;  4V19 J;  2BEF A;  2R8J A;  1FRL A;  4OMF G;  3HKZ D;  4RW8 A;  2IAJ B;  4M95 A;  4ZVF A;  1RAG B;  3FSI A;  4NCG B;  7FD1 A;  2P6T A;  1F1B B;  4F67 A;  2N3O A;  1SPB P;  3CME S;  3MEG A;  3MPW A;  3BDE A;  2Y3Y A;  4A8O A;  3FVY A;  3MPY A;  5HAT A;  2RML A;  2CQ4 A;  4UZB A;  4Q8F A;  2EBE A;  5JVH Q;  1ARO P;  2V4R A;  2MZQ A;  1RLC L;  3K8V A;  3EYZ A;  2XS7 A;  4PCQ A;  1UCN A;  4RW6 B;  1N5Y A;  4DL5 A;  3QWU A;  3R2C J;  9ATC B;  3EMT A;  1QE1 A;  1T0T V;  1Y5N B;  3B4M A;  3MUV P;  3KHG A;  4FS2 A;  1NHU A;  5BYR A;  3BM7 A;  5JXS A;  4ZPV R;  2N7C A;  3R5J B;  1QM9 A;  4CM0 A;  4CLP A;  4ZIW A;  2WTF A;  3RZA A;  3LGM A;  2E7X A;  4DCP B;  4RNF A;  2OPS B;  5KAK A;  3CJ0 A;  2PMH A;  3QO9 B;  2IAJ A;  3FBF A;  2O01 C;  4CLU A;  2HFV A;  1VQY A;  3I4P A;  2PSZ A;  4RWW A;  4KSE B;  5E2Q A;  2CNK B;  4IYQ A;  3MFH A;  2LEA A;  1WC0 A;  1G2E A;  3KKF A;  1PO6 A;  2A1B A;  3F73 A;  4ZP7 A;  1JB0 C;  2EFN A;  3NBP A;  4LSZ B;  3AOB A;  2CPY A;  3OUY A;  1Q16 B;  5L9N A;  3EDR B;  2QTW A;  2M5Y A;  1HQE B;  4A4J A;  5A8K A;  3PAC A;  2XY6 A;  2V9W A;  2FC9 A;  2BYC A;  2DR6 A;  5A76 A;  2R2T A;  1R8H A;  1RKJ A;  1FWL A;  4RW6 A;  4P2M A;  2GJI A;  5CAB A;  5AE2 A;  3DU5 A;  4PG5 A;  4LF6 J;  3BSN A;  4FDF A;  4TLR A;  3F0N A;  3ZTO A;  2ATL A;  2YPY A;  2B7C B;  2VKZ G;  4LF9 F;  3IR6 B;  2GCF A;  5ETN A;  2R8K A;  3UO0 A;  3IFE A;  2L41 A;  3DHW C;  3GYN A;  3KLF A;  2LVW A;  5T7L B;  3M1V A;  1KQG B;  2EBG A;  3EGN A;  3C2P A;  4NCB A;  1NPR A;  4OX9 F;  4U8Y A;  3SV3 A;  4IRK A;  2YKM B;  4QW8 A;  4QWA A;  3T41 A;  3CC7 S;  3W61 A;  3VV2 B;  4RPF A;  1RBO B;  3KLH A;  2PO4 A;  5IWA J;  2VDI A;  5GAH U;  4UF4 A;  2MQN A;  5L1K A;  3SCI E;  2YWW A;  2IVY A;  2YNI A;  3PR4 A;  4QW9 A;  2DGW A;  2HAF A;  3C6T A;  5KFM A;  3G6Y A;  1Y00 A;  2BV3 A;  3PDN A;  4LF6 F;  1KKH A;  3AFG A;  2HMI B;  3OR1 A;  2P9G A;  3PEJ A;  3WDO A;  1JXL A;  5THW A;  1LK5 A;  2H5J B;  2HIY A;  5BYS A;  3HD2 A;  2GML A;  4IH6 A;  2XYG B;  3ELH A;  4CYU B;  3CCE S;  4K50 A;  3BGU A;  3HK2 A;  4DQQ A;  1UZD A;  1NSQ A;  1URR A;  3ZNU A;  1OQ3 A;  3W60 A;  4QIW D;  2R4F A;  1OSC A;  3BKF A;  2FJV A;  3M2V B;  1K73 T;  4V1A k;  2YKM A;  3NKY A;  4WFY A;  1H73 A;  3BS9 A;  5IWA F;  4BCA A;  5GAH I;  3DGV A;  2CWK A;  1UPP A;  1M1K T;  1VQO S;  1XEZ A;  2EFG A;  1PC4 A;  5F8J A;  3DOK A;  3M9N B;  1NJW A;  4OZN A;  1IM4 A;  2QN6 B;  1SKW A;  1RU1 A;  4B9V A;  2HMI A;  2DHA A;  2H65 B;  4R8U B;  2XCA A;  3I5B A;  3JQJ A;  4O3R A;  2X1B A;  4XPC A;  2MEW A;  4KGZ B;  5J2P A;  4X64 J;  2JJ4 D;  1N48 A;  1IKX B;  1BWE A;  1N32 F;  3D68 A;  4CYU A;  2FGC A;  2XEX A;  2E5H A;  4N47 A;  4DPX A;  3NGT A;  2BDP A;  4ED4 A;  1KR4 A;  3M2V A;  4ZA1 A;  4BS2 A;  3LAL A;  2HFS A;  3PM9 A;  3HHL A;  3M6V A;  4BWJ A;  2AP6 A;  1GXL A;  4NMX A;  3QAT A;  4QPX A;  4K4U A;  3H25 A;  1U0S A;  1LFP A;  2KRR A;  3VWS A;  4X62 F;  5F3Z A;  3QRP A;  4EU0 A;  1X8D A;  1HWK A;  1PBU A;  1X4C A;  4W92 B;  4DS5 A;  3S7R A;  2IFX A;  2YXL A;  4CO4 A;  5KG5 A;  2NR0 A;  5HAN A;  3M8Z A;  4R8U A;  4X64 F;  1TAQ A;  2VBW A;  4ED3 A;  2DR9 A;  3D6T B;  5HK4 A;  3VAJ A;  1Y7P A;  4IOB A;  4J37 A;  2JX2 A;  3F56 A;  4I2Q B;  2QMU B;  4BLG A;  3VHQ A;  1HQU A;  3CJR A;  4TQR A;  3RAM A;  1CUL B;  1OYE A;  3W2V A;  2UUA F;  3V6K A;  5KG1 A;  4WTO B;  1JLQ B;  2J5A A;  1TFY A;  1IR2 A;  1X5P A;  2UP1 A;  4HHJ A;  3ZZ0 A;  5KG2 A;  2B9E A;  1NSP A;  1R27 B;  4Q0B B;  2QSW A;  4RR5 A;  2CDQ A;  1SCJ B;  2YWK A;  2EC0 A;  1T11 A;  1S9G A;  3QLH B;  2HGM A;  2LQB A;  1MNE A;  4IO1 A;  2V2V A;  1RTI A;  2K3K A;  3Q8P B;  4GKJ F;  2AJQ A;  2F5G A;  4WFB Q;  3SCJ E;  2JEF A;  1PYO B;  3CD5 A;  5RUB A;  2ZHO A;  2XMM A;  5K14 A;  1O0P A;  4I2Q A;  4LRE A;  1LWE A;  4ZCI A;  3EGW B;  4R5P A;  2YWF A;  1CUL A;  1RWP B;  2CNL B;  2DIU A;  4DSK A;  3TVZ A;  1D9D A;  2F1F A;  1R8P A;  3IM8 A;  1V6H A;  1JLQ A;  2ZC4 A;  1QJH A;  2V4Q A;  3CO0 P;  2CXE A;  5KTQ A;  3ZZY A;  1SJ4 P;  2V8H A;  1RAI B;  4MKV A;  2LXU A;  4N5S A;  1KVK A;  3FJ2 A;  2HVE A;  1WKL A;  2COL A;  5D3G B;  1UVK A;  2C2E A;  4IOC Q;  2HAI A;  2CJB A;  2VFV A;  2VFU A;  3RR8 A;  1WKJ A;  2GAH C;  2L9D A;  2BJE A;  5E33 A;  1HIY A;  2HND A;  4OV6 A;  1F5B A;  4DR4 J;  2FJB B;  4B9U A;  5D6G A;  4XDD A;  1F9F A;  1E6V B;  4NOH A;  1YWX A;  3BKU A;  1V3R A;  3IWL A;  4LSL A;  2MZR A;  4QR1 A;  4JI3 J;  4FF3 A;  1M5P C;  5DG9 A;  4ILM A;  2Z58 B;  3DDI A;  1RT3 A;  3MCS A;  2W25 A;  5LSL A;  5HL7 Q;  2RHQ B;  1OPZ A;  1AUD A;  5ETP A;  4LF7 J;  2DPI A;  2JLG A;  3IG1 B;  1O51 A;  3GV7 B;  3GV8 B;  2WB1 D;  3M6U A;  2ZH6 A;  4LFC J;  4OZ3 A;  3US5 A;  1R3N A;  2KFN A;  3MD3 A;  1UWB A;  4HVZ A;  4ZS6 A;  3CXC R;  5ETV A;  2UVV A;  4AT1 B;  1JLA B;  3MMC B;  3I4H X;  2UV8 G;  1UET A;  4CLT A;  2CRL A;  2ILY A;  1RI7 A;  1S0N A;  5D3G A;  4OI0 A;  4A8W A;  3LWL A;  4X66 F;  2J6U A;  3K57 A;  3C15 B;  4IO9 Q;  3HHK A;  5HMX A;  1E6V A;  3LGN A;  2DRD A;  4XTT A;  2BM1 A;  3J7Z T;  4URG A;  4N56 A;  4JI3 F;  2A3J A;  3TEH B;  4FN5 A;  5E3P A;  4TKT A;  4WK3 A;  4KGX B;  1NDC A;  4LF7 F;  4JI6 F;  3RRK A;  1OSD A;  3K17 A; 
#chains in the Genus database with same CATH homology
 3DDI A;  2B8P A;  3EM1 A;  2DYA A;  1NDL A;  3FBB A;  3FC9 A;  3FCW A;  3BBB A;  2DXD A;  3PRV A;  4WBF A;  3FCV A;  3VGS A;  5C7P A;  1HLW A;  2BX6 A;  3Q86 A;  3BBF A;  2HVD A;  1PKU A;  4AND A;  2ZUA A;  4EK2 A;  1WKK A;  3BBC A;  1ZS6 A;  3EVM A;  1S5Z A;  3EVW A;  2DXF A;  3JS9 A;  1MN9 A;  4W98 A;  4UOG A;  3GP9 A;  3B54 A;  3FBC A;  3ZTQ A;  3NGS A;  1U8W A;  1VYA A;  3Q89 A;  1NUE A;  1S59 A;  3R9L A;  3BH7 B;  4ANC A;  5CAB A;  3NGR A;  3NGU A;  3ZTS A;  1EHW A;  1HHQ A;  3ETM A;  5BXI A;  4HR2 A;  3GPA A;  1KDN A;  4UOF A;  3VGU A;  3DKD A;  3BH6 B;  1UCN A;  4DUT A;  3EE3 A;  1LWX A;  1B4S A;  1NSK L;  4UOH A;  1W7W A;  3ELH A;  3ZTO A;  3EMT A;  4F4A A;  3NGT A;  1S57 A;  2DY9 A;  3EIC A;  4CP5 A;  4FKY A;  1NLK L;  3EJM A;  4FKX A;  1K44 A;  1XQI A;  4C6A A;  2VU5 A;  3Q8U A;  3Q8V A;  3VVU A;  4O0N A;  3G2X A;  1NSQ A;  3MPD A;  1XIQ A;  3L7U A;  2HVE A;  1WKL A;  2HUR A;  3Q8Y A;  1NPK A;  1BE4 A;  5IOL A;  4DI6 A;  1NSP A;  1F6T A;  1WKJ A;  1BHN A;  3ENA A;  3VGT A;  1MN7 A;  3VGV A;  1HIY A;  1NCL A;  3Q83 A;  3WX8 A;  2B8Q A;  3FBF A;  4KPC A;  4F36 A;  2AZ3 A;  2BEF A;  1NDK A;  3ZTR A;  1NB2 A;  3B6B A;  1JXV A;  1NHK L;  3FBE A;  4ANE A;  1NDC A;  2DXE A;  3VVT A;  1B99 A;  2CWK A;  3PJ9 A;  1LEO A;  3EVO A;  4DZ6 A;  5CAA A;  3ZTP A;  2AZ1 A;  4ENO A;  3FKB A;  1F3F A;  1PAE X;  4S0M A;  1NDP A;  2NCK L;  1BUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...