1FKOB

Crystal structure of nnrti resistant k103n mutant hiv-1 reverse transcriptase in complex with dmp-266(efavirenz)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
426
structure length
403
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT, A-CHAIN
publication title Structural basis for the resilience of efavirenz (DMP-266) to drug resistance mutations in HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 107
structure length 403
sequence length 426
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1fkoB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkoB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkoB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkoB03
2D41A 5F8MA 1R0AB 3MF5A 3Q8PB 5KFFA 4KKOA 4ZPAA 2XI3A 3H5YA 4FBTA 1GX5A 3CDWA 1JLAA 5KT3A 2W7OA 5KFSA 1HMVA 1LW0B 1S1UA 3DLGB 1RTHB 3NAIA 4NLDA 4FS2A 3D5MA 1RT3B 4M95A 2AX0A 4WXOA 4Q43A 1S9GA 1S9FA 1K1QA 4ECZA 1MMLA 2OPRA 1SH0A 3MEEB 3IGNA 3LP1A 3T5LA 5HBMA 4Q0BB 5C42B 4NZ0A 2WOMA 3QIPB 2YKNB 5EDWA 3DOKA 5DG9A 3ITHA 3I0SA 4RW8B 3JYTA 5KFMA 5DGBA 3KHHA 4EEYA 1C0UB 1IKYA 4I2PA 3DOLB 3KLIA 1NHUA 1S1TB 5F8NA 1EETA 3LAKA 2YKMA 1C2PA 4PUOB 2XCAA 1JX4A 4RNMA 3H5SA 2C22A 4G1QB 4O3PA 1REVA 2WONB 3I0RB 1RT6A 3KLFB 2BR0A 3DMJA 4ID5A 1ZTTA 3CVKA 1XR5A 4NLUA 4DG1A 2R8IA 2YNFA 2ZE2A 3IRXA 2AX1A 1JKHB 4K4XA 2HNZA 2W8KA 4J9MA 4QWBA 4MK8A 4RW7A 5C24B 2GIRA 4NLTA 1GX6A 2IAJA 2AQ4A 2VG7B 4IRCA 1DTTB 3OHAA 2W9CB 4I7FA 4XO0A 1IM4A 3MTKA 1RYSA 3PW7A 1N6QB 1S97A 2F8EX 4H54A 4IDKB 5C5JA 4EYHB 3MECB 1S1WB 5D3GB 4B3OB 2IJNA 2XI2A 3GV5B 4ECQA 3MR6A 3RAXA 1HARA 4HKQA 5DG8A 1RT5A 3PVXA 4O3NA 2IMWP 2RF2B 1RT4A 4RW6B 3CIZA 4NCGA 3KK1B 1KHWA 4PQUB 5F8JA 5I42A 4RNOA 4O3RA 3PW2A 4NLWA 1S9EB 1C0TA 2QV6A 1JLGB 2R8JA 3BGRA 3DI6A 3E01A 2FJXA 3LP2B 2R2UA 3LP0B 4LSLA 4ZHRA 4J9SA 2R8KA 5KFKA 4KO0A 4O3SA 3GYNA 3KK3A 2C28A 5HP1B 2WRMA 5F8HA 4QWEA 2C2DA 1BQNA 3QO9A 3PR5B 3KHRA 3BSOA 3OLAA 1RYRA 1LWFA 4URGA 3DRPA 4TXSA 1TKZB 5J2MA 4OL8A 2XCPA 3MR2A 2HMIB 3DYAB 4MKBA 4WE1B 1SUQA 1IKXB 1LWEB 3M9OB 3N6LA 3G6VA 4IG3B 5F8LA 4QW8A 1DTQA 4K4TA 5HLFB 3KLVA 3LANA 3V6DB 1XR6A 4F4XA 3C6UA 2JEFA 4Q8EA 4KFBB 2YNIB 4K4SA 1NNDA 4QWDA 1KHVA 4ZMMA 3T5JA 5L1JA 2UVRA 4IFYB 3GIIA 1RT2B 4QWCA 2JEJA 2J6SA 2D7SA 2IM0A 2OPQB 2AGPA 5KFUA 4EYIB 4WFZA 3H5UA 1RTDB 3NL0A 3DLEA 3ICLA 1QE1B 1XR7A 1TKTB 3PR4A 3IN5A 1JLFB 3QYYA 2W7PA 1TL1A 4F50A 4ZVHA 3V81A 1JLCA 1LWCB 2IA6A 1DLOB 3NAHA 3RBDA 4LSNB 3DRRB 2E9TA 3G6XA 4DL6A 2YNGB 3M8QA 4GC7A 1J5OA 4K4WA 1JLQA 3UDLA 4R8UA 3JSMB 2JLEA 4PUOA 2UUTA 2HWIA 2ALZA 2I5JA 1RTJA 3MR5A 4O44A 4R5PA 4IFVB 1SV5B 5KG2A 5DLFA 4K4VA 1QAJA 1HYSB 3CJ5A 3QGIA 3N6MA 4WXWA 3QZ7A 3FRZA 1VRUA 1RA7A 2IM2A 4KV8B 3FSIA 1RTIB 4KBIA 3BQ2A 4TQSA 2VG6A 3CJ2A 3IG1A 4TN2A 2VA3A 4HYKA 3ISNC 4X2BA 2HWHA 3DLKB 1U09A 3CJ4A 5KFTA 3G86A 4ED1A 3RB3A 1HQUB 4IH5A 3H40A 2B6AA 5HROB 3MEGA 4F4WA 3MR3A 2UVWA 5KFAA 1IKVB 4RU9A 3H2LA 4G3IA 2HNDB 3BSNA 1TKXB 5DQIA 1HQEB 2BANA 4YR2A 2ASLA 2OH2A 4DL4A 1T05B 2JEIA 3C6TA 4ED0A 4NLYA 3V6HA 1S6QB 4K4YA 3TAMA 5J2QB 1C1CB 4MK7A 5KFVA 4NRUA 2IC3A 2IBKA 4NRTA 2AU0A 4RNNA 5CYMB 2WHOA 4K4UA 2RKIA 1LW2A 5FDLA 4RW9A 1HNIB 4Y34A 2UVUA 3MEDA 1HNVA 4KHMA 3H98A 5L1IA 3T1AA 3KLEB 2FJVA 3Q8RB 3H4DA 2OPSA 4ZP9A 3KMSA 2ASJA 4GC6A 3HVTA 4R0EA 2FVQA 3SFGA 5F8GA 4RUAA 2ZD1B 1KLMA 4ICLB 4DL3A 3GV8B 4URSA 3HVAA 3KJVB 1TKZA 4EBCA 4WFXA 2HMIA 1C1BB 1OS5A 4ZVGA 5KG3A 1HPZB 1FK9B 2IJFA 4LQ3A 3CJ3A 4NLRA 4ZPCA 5EUHA 5J2NA 4ED3A 1D0EA 4JV2A 4IH6A 3UQSA 3OSPA 2V4QA 4KSEB 4KFBA 1BQMA 2YNIA 5CYQB 5J1EA 2B5JA 2OPPB 4DEZA 3NGDA 3NBPA 4ECRA 3KLGA 3GV7B 3RB4A 3M8PB 4IFYA 5K14A 3CDUA 3RBEA 2BQRA 5C25B 1CSJA 3BREA 3PW5A 4MH8A 4RNFA 4MIAA 4I2QB 3KLHA 4KB7A 5KT2A 3OSNA 3G6YA 4TY8A 2V4RA 4IR1A 1MU2A 3QLHA 4MFBA 5F9LA 5KT4A 3T19A 5EWFA 4RW4A 3FFIB 3OL6A 2BQ3A 3OL8A 4ZPBA 5L1KA 1FKOB 1TV6A 1VRTA 2RDIA 3FQKA 5KFDA 1EP4B 1TVRB 2JC1A 5DQGA 5KG0A 1ZETA 3KHGA 4J9RA 3KK2B 3EPGA 1N5YB 4H4OA 1S1XA 1TL3A 5I3UB 3CJ0A 5J2PB 3BJYA 4ECTA 1SV5A 2BE2A 4IG0A 2V9WA 4YMEA 1FKPA 3DRSA 4KKOB 3CDEA 4Y3CA 1UWBA 4KAIA 4EBDA 3OL9A 1JLAB 2FLNA 1S6PA 2QE5A 4IH7A 1HMVB 4U6PA 1S1VA 3OL7A 3N6NA 1S1UB 3EPIA 3VQSA 4JUZA 1JLBB 1S9GB 4Q8FA 5KFOA 5HROA 3HVWA 3PZPA 2YNHA 4IRKA 4PWDA 3H59A 3LP1B 4EO6A 1IKWA 3HKWA 2FVSA 3T5KA 2AGOA 2WOMB 1TQLA 3QGHA 2HNDA 1R0AA 3DOKB 2GIQA 3ITHB 3I0SB 3JYTB 2CKWA 4H4MB 1IKYB 4WZMA 4I2PB 4NLXA 1T3NA 3KLIB 3EZUA 5L1LA 1EETB 1ZTWA 3UPFA 2YKMB 1LW0A 1TP7A 3DLGA 1RTHA 2WB4A 1RT3A 1N48A 4QW9A 2V0NA 3MEEA 4Q0BA 5C42A 2YKNA 1REVB 3QIPA 3QZ8A 2CJQA 1HNIA 2XWYA 4J9OA 3PW4A 4J9QA 4RW8A 4ECXA 1RT6B 3DMJB 4ID5B 1C0UA 3TQ1A 1JLEB 5L9XA 4DG1B 3DOLA 3Q8SB 2YNFB 2ZE2B 2HNYB 1S1TA 3IRXB 3I5AA 4Y2CA 2ILYA 4ZVFA 4ECWA 4DL7A 2HNZB 4Y2AA 4RW7B 2IAJB 3V4IB 2IM1A 3PJXA 4ECYA 1FK9A 4G1QA 5KFQA 3BSAA 3GIKA 3KNAA 2WONA 5KFLA 3I0RA 3KLFA 2BQUA 4J9LA 1SH2A 3ISND 5KFZA 1JKHA 3T5HA 5KG7A 2I1RA 2UUWA 1RT5B 4FS1A 1WNEA 4O4GB 5C24A 4NCGB 1K1SA 2VG7A 4NLGA 1DTTA 4EBEA 3GQCA 2W9CA 3V6KA 2W9BB 3BGRB 3DI6B 3E01B 4WFYA 4U7CA 4K50A 3KOAA 1N6QA 4LSLB 4IQXA 2R8HA 3NMAA 4WZQA 4IDKA 3MECA 4KO0B 1S1WA 5D3GA 4B3OA 5F8IA 4RUCA 2RDJA 4NLSA 2FLPA 2ASDA 5KFGA 5KFEA 1BQNB 3QO9B 2GC8A 2VG5B 1N56A 2RF2A 1YVFA 1LWFB 4RW6A 3DRPB 4TQRA 4ECSA 5J2MB 3KK1A 4PQUA 3SFUA 5KG1A 4QWAA 2J6UA 1S9EA 1RT1B 1JLGA 5KFRA 3LP2A 1DTQB 3LP0A 5J2PA 4FBUA 4ED8A 1JIHA 5KG5A 5KT6A 4ECUA 3C6UB 5HP1A 5EWGA 4LQ9A 2R8GA 3I5CA 3PHEA 1QAIA 3DYAA 4WE1A 3I5BA 1IKXA 1LWEA 1N4LA 1W25A 4IG3A 2WTFA 5DLGA 3NKYA 1JLBA 3DLEB 3BQ0A 5HLFA 4DL2A 4IR9A 3V6DA 3H5XA 5KFWA 1TL1B 5KFNA 3V81B 1JLCB 1RA6A 1JXLA 4F4ZA 4MIBA 3TVKA 2E9RX 4H4MA 4Q44A 4ED7A 5JUMA 3RB6A 1RT2A 3CO9A 3HHKA 2ZKUA 3M8QB 1J5OB 3DM2B 1JLQB 2OPQA 4R8UB 4Q45A 2BRLA 1RTDA 2I5JB 4WYLA 2FVRA 1RTJB 2FVCA 1I6JA 4O44B 4R5PB 3FQLA 1QE1A 2FLLA 3D28A 4NLVA 2XGPA 1TKTA 2JEGA 1JLFA 3KHLA 3IS9B 4XPEA 2B43A 1LWCA 1VRUB 5KFJA 1DLOA 4IOBA 3GILA 4EO8A 2R2TA 3OLBA 5EWEA 1RT7B 1JLEA 3DRRA 4LSNA 2VG6B 4YQWA 1S10A 4ZPDA 3IG1B 1T03B 2HNYA 2YNGA 1D1UA 1S48A 2IM3A 4ZP7A 4JV0A 3JSMA 4KE5A 5DQHA 4TLRA 4TYBA 3CWJA 2W9AA 4IFVA 2B6AB 3V4IA 1T94A 2JC0A 3MEGB 1HYSA 4JV1A 1RDRA 3V6JA 4KV8A 2D3ZA 2ILZA 1RTIA 4MKAA 3PJWA 2BANB 1RAJA 2ATLA 4ZP8A 3GIJA 3C6TB 4NLQA 4O3OA 3BQ1A 5KFBA 3TAMB 4ZP6A 3H4BA 4TY9A 3DLKA 2C2RA 3RB0A 2AGQA 4O4GA 2IC3B 4ECVA 5DG7A 5JXSA 1HQUA 5KFYA 2XC9A 5DGAA 4KHRA 2AWZA 2OPRB 2RKIB 4ZVEA 5HBMB 4YR0A 3KMQA 1IKVA 1LW2B 1NHVA 2W9BA 5FDLB 4DL5A 4RW9B 2FJWA 1QUVA 3M9MB 1TKXA 3MEDB 1HNVB 4IKAA 4QPXA 1HQEA 4J9KA 5KFIA 2O5DA 1T05A 5KFPA 3UR0A 4TYAA 2OPSB 2UVVA 4NLOA 3PW0A 1S6QA 3HVTB 5J2QA 1Z4UA 1C1CA 4WYWA 2VG5A 1KLMB 4MK9A 2DPIA 2FVPA 5CYMA 2BRKA 5KG4A 3E51A 5KFXA 3LAMA 1RT1A 3QIDA 2XGQA 3M9NB 3RAQA 4IRDA 5J2NB 3KLEA 3MFHA 1S49A 4ED6A 2D3UA 1BQMB 5J1EB 5KFCA 5KT7A 2B5JB 2ZD1A 3NBPB 4ICLA 3KLGB 3OHBA 3KJVA 5K14B 1S0OA 2E9ZA 1C1BA 4NYZA 4YP3A 4RZRA 3Q8QB 1HPZA 4J9PA 4URQU 3SI8A 5KT5A 4I7FB 3KLHB 2R2RA 4TY8B 5T14A 4K4ZA 1MU2B 3QLHB 4MFBB 4RW4B 4XPCA 3DDKA 4RNHA 5CYQA 4O3QA 4NLPA 2OPPA 5F9NA 3GIMA 1VRTB 1TV6B 3LALA 1RT4B 3M8PA 1S4FA 3QGGA 4J9NA 5C25A 5KFHA 3DM2A 5I42B 1C0TB 4I2QA 4H4OB 1S1XB 1TL3B 2HAIA 4YR3A 4F4YA 4M94A 4ZHRB 2BE2B 4IG0B 3KK3B 2W8LA 3IS9A 2J6TA 1FKPB 3MFIA 3FFIA 3DRSB 3IGVA 2R2SA 2C2EA 1SH3A 1FKOA 3FDSA 1RT7A 1S0MA 1EP4A 2WCXA 1TVRA 2WK4A 1UWBB 1T03A 2DPJA 1S6PB 1SUQB 3BR9A 1S1VB 1S0NA 3KK2A 2VA2A 4O4RA 2EC0A 1N5YA 4ED2A 5I3UA 5KG6A 2YNHB 3BSCA 4PWDB 1IKWB
chains in the Genus database with same CATH superfamily
2MXYA 2WZ1A 2Y1JA 1XMQJ 3Q22A 4R0JA 2V69A 4DF8A 3ZZTA 3ZXWA 1SL1A 1N54B 1S7IA 1C2PA 2CQBA 3ISZA 2KO1A 1UTAA 4RX6A 1ZS6A 4O3PA 3HHEA 1G4CA 4M5JA 2V6AA 2EBGA 4OYWA 3PW7A 2P6SA 3CCTA 4ZVQB 2Q79A 2W1BA 2G2YA 2MB0B 3Q0AA 3CIZA 5F8JA 3T6BA 1Y3JA 4NE9C 2YKQA 2YWKA 2HHHF 1FTCA 1UAWA 1FJ7A 3QO9A 2XYGB 2DNRA 4DQQA 2PEBA 4EZ9A 2QTWA 3RG6A 3D0HE 4K0KF 2ZH4A 3DLEA 2VDIA 4JI5J 3PR4A 2APOA 2J9DE 3RBDA 1HNXJ 4R8UA 3JSMB 2MYFA 1KNZA 3FBEA 4KBIA 4OZ0A 3H40A 4QYZJ 3PG9A 3M6VA 2V68A 2UU9J 3MPWA 3BDEA 1HQEB 1T05B 3D68A 2DKOB 4DMZA 2KJVA 4CH0S 1N5TA 3CJRA 3MEDA 2FTRA 3RW7A 2OPSA 3LUYA 1X5PA 4UQTA 1MNEA 4USHA 4URSA 1BD6A 2MKSA 1OS5A 4DR3J 4P9SA 4JI1F 3TEHB 2J76E 4ECRA 3TZYA 4OI1A 3U27A 3KYLA 3KUHA 2NR0A 4UQGA 2H5JB 4X4RA 3DGVA 2UUBF 3V5RA 2W4CA 4N56A 1UCNA 4BLGA 3T1HJ 1F9EB 2PA3A 3C14B 2GIFA 2LVWA 5HROA 4A48A 1RQ0A 4ED4A 3ITHB 1SKSA 5CQGA 4HDGA 4PQAA 2KH9A 3C19A 3ZC4A 4OHYA 1Q8BA 1KEKA 4ECXA 2VBWA 3DMJB 2E29A 3G8TA 1TL5A 1U7LA 1S5ZA 2BEFA 4ECWA 2VFUA 1TK0A 2P8IA 1MWZA 5T7LA 5KFZA 2MJUA 4NCGB 2YPYA 2BYCA 2AJ0A 3FMWA 1D3WA 1F5BA 2R8HA 4RUCA 2RDJA 1B7FA 2VG5B 4P75A 3AOAA 5B0AA 1JLGA 1TL7B 4RKUC 1L3KA 4CM2A 2DNQA 4C6AA 2F7VA 3CCWA 4MJKA 3PKYA 4DS4A 1IR2A 2O1PA 3QT7A 3PY8A 2Z2YB 1NSPA 1PCAA 1R8BA 2JFKA 4Q45A 2QT7A 2JZ5A 5L38A 1JXEA 1ZM2A 2LEBA 3TO8A 2W7AA 3UDCA 4C8YA 2IPOB 4FNHA 3UN3A 4L76A 4KV8A 3BF4A 3QQCD 3BQ1A 3J7YI 2NZ4A 4ELTA 3FSXA 1LFPA 2AWZA 3DRYA 5K8NA 4YR0A 2CJAA 1HNVB 1YJ7A 3QJPA 5AXLA 4LFCJ 3OTBA 3EUNA 3KTQA 1ZPWX 3IR7B 3J80Y 5H9EK 1V3SA 4OQJA 3NBPB 2B8PA 4A8YA 1FJCA 1F9HA 2DHAA 3CPWR 5KT5A 4TY8B 3T9ZA 4DPYA 3GU0A 5F9NA 1VRTB 4FF3A 2KT2A 3OFHA 1C0TB 3VQTA 5HANA 1VGYA 3BM7A 1FHTA 2L41A 5AE3A 2DPJA 4USMA 5FD1A 2QA4S 5CCLA 4QJVA 5D77A 4DSFA 1VC0A 4X65J 3H5YA 4QU6A 1Q5YA 3NAIA 4M95A 2V2QA 3W60A 3IGNA 4MKVA 4NZ6A 1R0BG 2L9WA 2HFVA 1NJXA 5E33A 2KN4A 4HT5A 3VAJA 1H6KX 1U1NA 2YKMA 5IM0A 1DRZA 2ZKTA 1FF2A 1XN9A 3DU6A 1KC8T 1VQ5S 1HWLA 1NK8A 4K4XA 4JI7J 3CCLS 1NJWA 3K5LA 2N7YA 4ZA1A 3MECB 2KVQE 1L3VA 1RT5A 5A0YA 4PQUB 4C8NA 2DNGA 3GMGA 2HHTA 4DSLA 4KO0A 4H4KC 4YDXA 4X62F 3U7JA 1D9FA 3UW1A 2B7BB 1NDCA 1QSYA 4IG3B 4OI3A 4F4XA 1NNDA 4FNIA 4ZMMA 3GONA 4L3NA 1FVQA 4CQ1A 1QE1B 2HFUA 3T1YF 1J2VA 4P74A 2WVFA 3N5FA 2QA4G 3QZ7A 4C0HA 2ZNYA 5GAEU 2XZWA 2D9OA 2COLA 1FDBA 3OR1B 3IG1A 4Z37A 2LA4A 1U09A 1TAUA 4ED1A 2ZWOA 3MURP 2V4JA 2W01A 4K59A 2UVWA 1TAQA 4RU9A 2IBOA 4ZCIA 1N36J 2HEKA 2LKZA 1MW7A 2QLXA 2YWEA 3LWMA 5CYMB 1V6HA 2FPHX 2M70A 4NX9A 2ROPA 3DNCA 2C3PA 1OYDA 4DL3A 2ZD1B 3OV7A 3IWXA 1S4EA 1YQHA 2MQNA 4BS2A 3N0VA 3F73A 2MKJA 4JI8J 4F4AA 4DEZA 1ZBTA 5A8RB 2CAJA 1S6UA 1EJ7L 1KFDA 3NLCA 3PW5A 4DR7F 3DCAA 1TMMA 1FEEA 5EWFA 2UXBJ 3SQGB 3OL6A 2Y8YA 1YJRA 1TVRB 5DQGA 1SQEA 2VDHA 3SSRA 3BJYA 1N32J 3RAMA 3MM9B 2VL1A 1Z2LA 4HR2A 3JTOA 2FHOB 1HW9A 3VGSA 3DOKB 2GIQA 2LMIA 4M5KA 4F67A 1CLFA 1RCXB 3NCQA 2HS0A 2MHNA 4QR1A 2YKNA 3PW4A 2OELA 3NGKA 1MN7A 4RW7B 2IAJB 3KNAA 3THVA 4HHHA 2ZH3A 4W90B 4WU2A 1F1BB 5KOXA 4NLGA 3J7A1 4JP8A 2FDNA 2AKWB 1AUSL 1SCJB 5D6GA 4F26A 3DGPA 5KFEA 1N56A 3R6LB 4L6V3 4OI0A 1I94F 2PI5A 2J6UA 3VF0B 3N28A 1JIHA 2QRRA 4KC5A 5CYJA 3MMBA 5D78A 1LWEA 3M30B 3H5XA 5KFWA 1U24A 5IOLA 1Q8LA 3R6GB 1JXLA 4ZVPB 2KT3A 3HHKA 2ZZMA 3VAGA 1WKKA 1L3SA 2XLKA 2FVRA 1UVJA 4P2XA 5HO4A 1YITS 3PO5A 1F5CA 1SJRA 3MPYA 2W9AA 4W92B 1BHNA 2AHOB 1RHRB 3WBZA 2OUGA 1P6TA 2XY5A 4U8YA 1HWIA 5CD4A 3QFWA 2OPRB 2GO9A 2RKIB 1NHVA 3QWUA 4CT9A 1U1LA 3HVTB 1GTHA 3MM7A 4XDDA 5E2QA 1K47A 5KFXA 2XY7A 3K58A 4LFAF 2IHR1 3CJKB 3JQKA 1WI8A 1BQMB 4BDPA 1HPZA 2A18A 4DR2J 3UN5A 1GTEA 2V94A 1UEVA 2XEXA 3CCQS 3Q8UA 2CDQA 5KFHA 5AXKA 2XO7A 2VD3A 1S1XB 3UR3C 3EGNA 3SYZA 1CG2A 3IS9A 1M1GA 3FDSA 1EP4A 2YXLA 5B0CA 1QUPA 4JI3F 1WHWA 3V4MA 3P45B 3MF5A 4S0MA 2R3VA 4IO9Q 1NLKL 1WHVA 2YKAA 1UEUA 2OEJA 3G6ES 1Q81T 2YWHA 4DQIA 4AE5A 2A0FB 4HACA 5F8NA 3UO0A 1JX4A 3W1YC 1ACMB 1WEYA 4L74A 4YFUA 3O8WA 1CS4B 5E5NA 5CXTA 5C24B 1RYSA 4NEYA 4EYHB 1A7GE 4B3OB 4PYDA 3D54A 3VAMA 4YB6A 1U4BA 1HBMB 2DH8A 4CLFA 1BWVA 2FJXA 2RNEA 2R8KA 4BWJA 1JJ4A 3K5OA 3PR5B 4YHHJ 3DRPA 4OL8A 1UJ6A 2R7UA 4AL5A 3TRGA 3GG0A 3G6VA 3CUNA 4QW8A 5HLFB 2HKEA 1FESA 3C6UA 2HPUA 1U1KA 1XWLA 2MKCA 3M32A 1HFEL 3IP0A 2HHSA 1TKTB 3NAHA 3FCVA 1WG1A 3G6XA 1X9WA 1LK7A 4FPRA 4IFVB 4ETZA 4DX6A 1NDPA 3TA0A 4QIEA 2DNNA 3RB3A 1X5TA 4O23A 4C0OC 3BEGB 5CCMA 1AXQA 1HD1A 2PD1A 3X1LB 4W4MA 2OSRA 4P7VA 2XM3A 2FHMA 2CQ3A 2KM8B 2FIUA 2ASYA 2FJVA 4PXBA 3ZZYA 4GC6A 2G0IA 1TKZA 4ZVGA 4ZPCA 1YBAA 4DCOB 2RAQA 3SCIE 1EQ0A 3RB4A 1SPBP 2RQKA 2RRNA 2V2KA 4OYIA 5KT2A 3G6YA 2XQCA 4A8XA 2PIIA 2DBBA 2BM1A 2CWXA 4DFKA 3RR7A 3RW6A 3EVWA 1UL3A 3THPA 2LLZA 3DHXA 2VQEJ 2GMJA 1KR4A 4LF1A 1JNZB 3I31A 4F36A 2EWHA 1JLBB 1S9GB 2L3MA 4IRKA 1NXIA 4EO6A 3C8YA 4H4MB 5HMXA 4I2PB 1EETB 1Q5VA 4Y2KA 4B9UA 1S59A 1W2BR 1HNIA 2IDLA 4LF4J 4Y2CA 2ILYA 4DWIA 1IWAA 3EX7B 2VZ9A 3LGNA 5SZTA 4X4VA 3L7PA 2HBQB 4QU7A 2PEHA 1Y5IB 4RL1A 4JI6J 4C4WA 5BJRA 3MR7A 5ETOA 4YUDA 2UUWA 3MWBA 1K1SA 5AJ3F 4A47A 2JFDA 3VVTA 4UT4A 1FVSA 2DRBA 2ASDA 5DDPC 1CJTB 2K1RB 1U0HB 1KTQA 2NZCA 2R7RA 1RT1B 1FJGJ 5J2PA 2CJYB 5D4NA 3A1YG 2RU3A 3TUZC 3ETOA 2VJUA 5DDRC 3LW5C 2ZKUA 4C8OA 3GP9A 4JI2J 1F3VA 1WKJA 3UD4P 3FQLA 1IQZA 4UW2A 1U8WA 2OD6A 2BKPA 1H73A 3FC9A 2BDPA 3HHLD 4RLEA 3JSMA 4KE5A 4TLRA 4TYBA 4AT1B 4QYZK 1LQ9A 1SC1B 2HGNA 3CNQP 3PJWA 4USVA 4FF2A 3H4BA 3HD1A 4JV5J 5JXSA 4CNYA 4YB5A 2AP6A 2QG9B 4RW9B 1QUVA 2HQFA 3M6XA 1HQEA 1T05A 1NEEA 3UR0A 4NLOA 3W2WB 1Z4UA 4WYWA 1KLMB 2DPIA 1Q7LB 2L9DA 2FVPA 3E51A 4CO0A 1O51A 4CTAB 2DRAA 2MTLA 1PC4A 1T0TV 3E3XA 1JMTA 4C11B 2RU9A 1GXLA 2DNLA 3DM2A 2VQFF 1DBDA 2H4YB 2MLYA 3FEXB 2NPFA 4CWBA 1VLYA 1NZAA 4OX7A 3MOJB 1S1VB 2IJRA 1B99A 4RBVA 2ZH1A 1NPRA 3J7Z5 3Q8PB 1W7WA 5KFSA 3C14A 1I94J 3D1OA 3T5LA 3MEEB 5HBMA 2GQCA 1NSAA 3ITHA 2GVDA 2C1EB 2LQ9A 4DSEA 3CE8A 4G1QB 3V2UC 5DS7A 1S99A 1PJ5A 1EIYB 3DMJA 1ZTTA 4WFBQ 2VODA 3A8EA 5F41A 2OTJS 2DGUA 3AJDA 1H38A 5JJBA 4IUFA 4WP8A 3RAXA 2LQ8A 3SXLA 3OTCA 4FVCA 4DV3J 1IBCB 4NCGA 1FI4A 4EFAC 2OEKA 3LP2B 2R2UA 3Q8VA 3NXZA 1XNQF 5EX0A 1WHXA 1DY3A 3OLAA 4TXSA 1WTFA 1PAUB 1XTZA 2AIRB 1TL7A 3V6DB 3FZBA 2BXJA 2ZZTA 2BA9A 5JVHQ 2ZC4A 3FEYB 2IVMA 3GJQB 1VHIA 1T9WA 3P6YC 2IA6A 1DLOB 3D4JA 1IXKA 1S79A 4RUBA 1RWXB 3MMAB 2HQDA 2VKRA 3EDQB 1WC4A 1T9YA 1Q16B 3OXFA 1SBRA 4ZCLA 1JJHA 5BYSA 1JWWA 6FDRA 4NRUA 3TUJC 2ABYA 3M8SA 4NRTA 1HNVA 1PGZA 3D1HA 4NA1A 3T9NA 1UVNA 3OQ2A 4CZCA 4K5RA 1C1BB 3D6FB 5T41A 2IYGA 2HFNA 2HZAA 1TUWA 3A3OB 1X4GA 2BW2A 3NBPA 2A2CA 3M8PB 3WHIA 3CD5A 2AYEA 2YH0A 4I2QB 2XB2D 2QL5B 4AUKA 4TY8A 1V5VA 2BW7A 2XZTB 1VC5A 5I4MA 3FFIB 1VRTA 2P9GA 3HHLC 2CG4A 1DAXA 1X31C 2Y1LB 3CSKA 4B9SA 2CPDA 1T9UA 1HWJA 3D7SB 2BM0A 4KAIA 1JLAB 3ENQA 4U6PA 1CQMA 2G0CA 3A12A 3HVWA 4DV6F 4N47A 3I0SB 2CKWA 1QSLA 4DQPA 2HRYA 3I56S 3UDVA 5KAKA 1NHKL 2GAGC 3IRXB 4LIWA 3F56A 5MAOA 4DL7A 3FBFA 3MM8B 4FYWB 1QTMA 2I9SA 1REGX 1D8YA 3VGTA 5KG7A 2M52A 2ZOGA 3GQCA 3CW2C 3BGRB 3KUGA 4LR7A 3MECA 1YRUA 5HQ8A 5KFGA 1Q8KA 1G7CB 4A8MP 2UXCF 4ELUA 4ZIWA 4PQUA 1CC7A 1M1HA 5IQQA 5K8MA 4LMZA 1WUUA 2C2OB 4IG3A 3GB0A 3V81B 1W26A 3H25A 3CCSS 3VCDA 1IWGA 3M8QB 2GA7A 2ROGA 4JI0F 4B3RJ 5IWAF 1QE1A 3L7UA 1KP6A 3L9ZA 2ERRA 2VG6B 4KGVB 1PSDA 1D1UA 1KVIA 3U1LA 2RMLA 5IC6B 3MEGB 1ZYQA 3OR1A 2OAUA 4B02A 2RS2A 4DR6J 3S8SA 4DL5A 2PMWA 2LXFA 4JYAF 2DXFA 4WU3A 3EE3A 5CYMA 5KG4A 3LTOA 2HFOA 2NSCA 2HZCA 3SCLE 4WJBA 2HSEB 1FE4A 3AAWB 2ZD1A 2GQ2A 1GXTA 2DYAA 1XIQA 2W2PP 4TU7A 1X9SA 4MFBB 5A8RA 1X4CA 1DZ5A 1O5JA 3US5A 4B3SJ 3OFGA 3ZTRA 3BO4A 3NNHA 4X4NA 3N01A 3KK3B 2DEIA 1IBKF 2SXLA 3SQGA 2LU1A 3NGTA 1U1RA 2ACMA 1TVRA 2EK6A 2G13A 1OPIA 3MM9A 3L4BC 1WHYA 4NZ7A 4DQSA 2RH3A 5KFFA 1HR0F 1GX5A 3K5NA 1MLAA 2Q43A 2EFNA 3DOKA 1AYEA 2Q3PA 4DXLA 2LYVA 2FQQB 3KLFB 5LMNF 3VR1A 2VICA 4EUVA 4MK8A 4RW7A 2IAJA 1NK4A 2I8EA 4Z7CA 4I7FA 3MTKA 4IDKB 1RI7A 2IMWP 3RRHA 2HZVA 1F60B 1OIAA 2QV6A 2R8JA 2NS1B 2EFQA 4X64J 1B3TA 4ZHRA 3HULA 3POTB 1X60A 4WIIA 2WRMA 4KPCA 4XTTA 4URGA 3MCNA 3MR2A 2HMIB 2XY6A 1KBRA 3WDOA 4C7QA 4LRCA 1Q53A 2YNIB 3SDEB 2BKNA 1RXOB 3FKBA 3ILLA 2XNRA 3M30A 2AGPA 4K2XA 3Q2SC 3O1LA 3NEKA 5L8RC 3HMJG 1XR7A 5D0GA 5FIIA 3KNGA 2E9TA 4I0WA 4OZNA 4DQRA 4W98A 2GAHC 4HH0A 2CRLA 2CPYA 3B82A 5ETRA 2D3O1 3D3BJ 3HI9A 4I6YA 3H2LA 3TJAA 5FLXU 2BV3A 3GYXB 3MPUB 1H98A 4PG6A 3VAFA 2IBKA 4H4KA 2YX1A 2RKIA 2Z57B 4J9VA 4UUWA 1R8CA 2HQIA 4KHMA 5L1IA 3H4DA 3KMSA 2CNLB 3HVTA 2B56A 3HVAA 3M1VB 3CCZA 2ZDPA 2PFDA 5KG3A 1SJFA 1VC6A 4IH6A 3CJKA 1BQMA 2WBMA 3NGDA 3HM9A 2CQIA 2KXHA 1A9NB 4IR1A 4FYXB 2GV1A 3FQKA 4R25A 4DV2J 4LF6F 1S1XA 2NUUG 3EGVA 3CDEA 2ZVSA 2OFHX 3KJFB 2XLJA 4RWWA 1FDAA 3PHTA 3N6NA 1NK5A 2KKHA 4A8SA 5CAAA 2FZCB 4CDIA 4LT6A 2BJ7A 2QA2A 2HS4A 1NM2A 3BR8A 4C3LA 5LJ5Y 1HKAA 2BE7D 5B0EA 3K2YA 1S76D 2ZOMA 2IM1A 5ETMA 2CPJA 1NPKA 3GIKA 4I69A 1C4AA 1K73T 1CS4A 3FUYA 5C24A 4GMKA 1NH8A 3BPDA 2ZJPQ 2J0QD 4UOCA 3BDPA 3KOAA 4LSLB 4B3OA 2F8MA 4DV7F 1SXLA 1NJZA 1YVFA 3R5JB 1LWFB 1UEKA 1HBMA 3F44A 2DHGA 3R5DA 3MAAB 3MZIA 1AFJA 2HHPA 4JI4J 4DV5J 5EWGA 4IO1A 4UUXA 5AXMA 5DZ6A 3AY0A 1V3RA 3R7BB 1W25A 3OVBA 5HLFA 2XYPB 2AD9A 3FSYA 2XO6A 3RB6A 4GO7X 4WYLA 4O44B 2FLLA 1K44A 2KU7A 1TKTA 1HW8A 2DHHA 2KZZA 1JLEA 1E6YB 2CQ4A 3CWJA 4IFVA 1T94A 2RRAA 3T6JA 1UP1A 1EQMA 1WG4A 1URNA 2BANB 2C2MB 4PWUA 1Z1ZA 3GIJA 3C6TB 1RWKB 2G0JA 4O4GA 2J9DA 1BE4A 3MOZA 5FDLB 3J7ZT 5KFIA 3PDNA 4P10A 4PG5A 4CLKA 2GNKA 3OUYB 3PIPQ 1ZM4A 3QFHA 3S01A 3ILJA 3J81j 5B0BA 5KFCA 1KWMA 5F3ZA 1HL6A 1B0PA 3OHBA 5IXUA 1S0OA 3OTOJ 1LEOA 1ZH5A 2R2RA 4A8QA 3DDKA 1M1KT 4M5DB 5SUHA 2E66A 2VASA 3CDBA 4H4OB 3GZ7A 3NS5A 1YK9A 3IGVA 2R4FA 4QIGA 1T03A 4E98A 2VA2A 3UDEA 1SIWB 5F8MA 2F1FA 5ETNA 2CQ0A 1VQPS 5I3QA 4Q43A 3MUVP 1S9GA 1OJ4A 2N3OA 3KWMA 4I2PA 1EETA 1RHMB 2OFGX 1WF1A 1LNQA 5H9EJ 2F8HA 2VV5A 1U6FA 1H72C 2Z2ZA 2UUCF 2VFSA 4X84A 4IRCA 4CP5A 1RAEB 4WP3A 3DOMB 1FTRA 5LMUF 1RP5A 3PACA 7FDRA 4DOZA 4K8RA 5I42A 2HHVA 4NLWA 1J27A 3EGWB 5HAOA 1CJTA 1UFKA 2K1RA 1U0HA 3GFXA 1RYRA 2DR8A 1IKXB 3NCRA 4V1Ak 3MUMP 3LANA 1TFYA 2FHJA 4KFBB 2IA0A 1CVJA 3RBXA 3PRDA 3QT6A 5D0HA 3DRXA 2E5LF 3RR8A 1G3OA 1HYSB 3G96A 3CJ5A 3N6MA 5CA5A 1RACB 1YWXA 4C8ZA 3CJ2A 3OVAA 2VA3A 3KFWX 2R7VA 4ZS6A 3ILIA 3PXGa 2F4VF 1F2GA 3S7RA 4RNNA 4RW9A 3EYZA 4LF5F 4PXDA 3KLEB 2OJ3A 3W2WA 3ZZZA 1KLMA 5HL7Q 3GV8B 1DQAA 4WFXA 2YWFA 2B9XA 1N0VC 4NLRA 2EKYA 2XWXA 5HJXA 4ED3A 3TA1A 2CNNB 2HIYA 3FEZA 3NP5A 4YDDB 2W2QP 3W5YA 4JBCA 4B3MF 1HD0A 3FK4A 3M05A 5KT4A 4C11A 2A10A 3RRGA 4MIWA 2M9KA 2KTQA 2XHWA 2K3IA 4HI2A 4ZPTR 5ETLA 1Y10A 2DJWA 3EVMA 2R7QA 1QLNA 4ZVTB 4IH7A 4DFJA 1S1VA 1T02A 3KG0A 2LXIA 3H59A 3LP1B 3LWLA 1TQLA 5ETKA 3CMES 4TLQA 1T3NA 1M5PC 1KQFB 1N48A 4UY8T 3MEEA 2CPHA 1REVB 5B08A 4J9QA 3MCSA 2ZE2B 1HWUA 2HNYB 1ZA1B 2V67A 3GWCA 2OI2A 3ILOA 4G1QA 2ZH5A 4CO5A 1UFLA 3ISND 9ATCB 4FS1A 1WNEA 2CZ9A 4B3TF 1PYOB 3DI6B 4IQXA 1R43A 2HIQA 3CCRS 4ZJLA 1SKRA 1BQNB 2GC8A 3GR0A 4OZ3A 5FLXY 4ES3A 3LP2A 5A8KA 2Q6BA 4LQ9A 5ADZA 1JJ2R 1NDKA 3I5BA 3PIOQ 3GTYX 2HFSA 4N8OA 4F0KA 3OW2R 3V6DA 2P2CB 4PKDB 1VQ6S 4DCPB 4Q44A 4OJ1A 4YS2A 1HHQA 5B0DA 2Y0SD 4DLEA 1FRIA 4R5PB 1VBXA 3JTNA 2DCUB 1UJ5A 1DLOA 5BR8F 5GAGU 1RT7B 5LXYA 5CZVA 3A13A 1FO1A 4DV1F 2AYBA 3RZAA 2DO0A 1RDRA 2XSJA 2QIFA 4O3OA 1AW0A 2VIHA 4CLPA 3MMAA 3RB0A 3MD1A 1VBZA 1T9TA 3M9MB 3CC2S 2UVVA 4A4JA 2X7IA 3ZO7A 4X66F 2HHUA 4LVOP 1QVGR 1S49A 5J1EB 2FY8A 3I9V9 1C1BA 3ENWA 4C3MA 4URQU 5B0FA 1VR6A 3UVJB 1RAIB 1QD1A 2ADCA 2ZH2A 4KHPF 4DI6A 1RT4B 3M8PA 1F6TA 4I2QA 1NZ8A 2HHQA 3RGIA 2MQMA 3FFIA 1NDLA 4J90A 1N52B 4DR1F 3TANA 2DH9A 1HLWA 1P27B 2B3TB 2OHDA 4P2SA 2XMMA 1S72S 1TTHB 1YJWS 3CDWA 1JLAA 2W7OA 1RTHB 4FS2A 1VIOA 3D5MA 1NPPA 4WXOA 4GKJJ 4IYQA 3I0SA 3FVYA 1C0UB 3NNCA 2XLIA 1YRTA 4USUA 2J9EA 1T8EA 1HBUB 3H5SA 3VAHA 4AL7A 3IRXA 5K20B 2H4WB 2GIRA 2AQ4A 2JVRA 2EFVA 3TR5A 1ICEB 3HSGA 2ZM6F 1S1WB 2XI2A 3PTWA 3ZZ0A 2CPIA 2QL9B 1KHWA 3O44A 1FT8A 3EDRB 3BGRA 2FLOA 5KFKA 2JVOA 4O3SA 3HFVA 2J7KA 2RIJA 2V8HA 3Q86A 1KLNA 2VFVA 4KRWA 1SJ1A 2C42A 4LBIA 4J7CA 3HJFA 5MLCV 2DRDA 4HTJA 1FFWB 3GIIA 2J6SA 1RJJA 1N0UA 3JAMU 4PZVA 3AD7C 1JLFB 1TK8A 3V81A 4UOFA 4NMLA 4MMOA 3CJQA 4OX9J 3M8QA 2JLEA 3PM9A 3LPEA 1B64A 1U0SA 1SV5B 2DHSA 3UD3P 2VG6A 3JSBA 3ISNC 4PCQA 2BACA 4XK8C 1XNRF 4CH1A 3MEGA 3MR3A 1JQGA 4CO4A 1TKXB 3I9ZA 4ED0A 4Y28C 4DPXA 2V2ZA 3IAS9 2LQ5A 2EK1A 4GVBB 2IRYA 4OHVA 4O0NA 1JK9B 1FK9B 2ATCB 1U1PA 3I82A 3HO1A 3UQSA 2V4QA 4KSEB 1FWPA 3ZZPA 3KDOA 3A4TA 4YY3F 4IFYA 4NPOA 5C25B 3K8WA 2PC6A 3OSNA 1OY8A 2K7JA 4F0HA 2JL9A 2KHDA 4MFBA 1HNWJ 3CJ0A 3CULA 4OYOA 1HI0P 2HQ3A 2J0WA 3AA9A 4OHXA 3W61A 1HMVB 4TVAB 3ET6B 2AGOA 4DR4J 2HNDA 3KLIB 3EZUA 5EGYA 1ZTWA 4CLSA 2HLUA 1LWXA 2CJQA 3UFCX 3JSYA 2V8GA 4ZVFA 1IBMJ 3PJXA 4B17A 1IBLF 1E6VB 2DEJA 3EZ5A 3KLFA 3NS7B 1MWYA 2Y1IA 3A8IA 1RBAA 4NXNJ 2YKPA 2ZEJA 1YIJS 3GFYA 2RJZA 1J5EF 1GAOA 1D09B 5AE2A 4IDKA 3HHLA 4NLSA 2GVZA 5A2QY 3G82A 3LQVA 1YKWA 1NK6A 1ZM9A 3MMCB 4ECUA 2V8DA 3POTA 1G2EA 4KIAA 2CQPA 4QYRA 1F2HA 2GFFA 3LOUA 1YZ6A 1PAEX 3SDEA 1OSCA 2PSZA 2VH7A 2F9JA 3G4SS 2B7CB 4DUZJ 4NEZA 3ZZOA 3KHLA 4F4KA 3OBIA 1VRUB 1VJWA 5DRKA 4USWA 2FD2A 3V4IA 2CQDA 1H7WA 1N33F 2D69A 4MKAA 1PBUA 2OEMA 3FBBA 4GKKJ 3P49B 4NLQA 5KFBA 1R6YA 3CMQA 4L72B 3QRPA 2IC3B 3RTVA 1WF2A 4YN3B 2D74B 2FJWA 4LF7F 1FWKA 5KFPA 1EAYC 2UZAA 4CYUA 3MAQA 5HN0A 2KXNB 3LAMA 3QIDA 5CD4H 4IRDA 3K8VA 2LXUA 2UXDF 3MFHA 2IFXA 2CPEA 2K2PA 3M1VA 1KVKA 1FCAA 3KLHB 4I68A 2A6OA 1VQ4S 4O3QA 1B7YB 3LALA 3N4WA 4ZKAA 1S4FA 1WC3A 4NXMF 3IM9A 4DV0F 4I67A 2W8LA 1FNOA 1F5AA 2XNQA 4OYZA 2WSEC 4HHJA 4I56A 2CQ2A 1FRKA 2IYIA 2YNHB 4FPIA 4OMFG 1R0AB 1RE1B 5IT0A 2P9EA 5K8PA 3R7NB 3EMTA 2E1MC 4C98A 2CPFA 2VBYA 1LW0B 3H90A 4LUBA 2HVDA 4X4SA 3TOQA 4RW8B 4LF8F 1CPZA 2XS7A 2XCAA 2D3OR 2AT1B 5C2GA 4XDCA 2Z0GA 4NCBA 2BR0A 4NLUA 1OWXA 3QRRA 4LFBF 2KVIA 3C46A 3R2CJ 1SI9A 1SB6A 3QATA 5K9FA 4C97A 4HKQA 1V5IB 2X1AA 3D6TB 2W4PA 4LSLA 4RU2A 1RWWB 2C28A 2HGLA 4F3QA 3BSOA 2MY7A 1LWFA 1HNZF 1OSDA 3MAAA 3M9OB 1WOPA 3H2VE 1PIEA 1RB0A 1R8AA 2UVRA 4OYXA 2ZUAA 4WP9A 4WFZA 3C15B 2CPXA 2HVEA 2Z4PA 3QYYA 2W7PA 4PG8A 1QDUB 4OZJA 1TL4A 2ZFHA 3SZ2A 3FRYA 2RVJA 2MQLA 4PUOA 1IM6A 2UUTA 1EKRA 4O44A 2NXEA 1QAJA 2A3JA 3IR5B 3QAUA 2QFJA 2B4OA 1OO0B 1E6YA 2DR7A 4DX5A 5HROB 3BO2A 2G4BA 2OSQA 1H2VZ 2NQPA 2BANA 2ASLA 2OH2A 2R42A 2JEIA 3C6TA 4OYPA 4DR5F 3PRBA 1S7HA 5FDLA 4OI2A 4MTPA 2QX0A 1FEHA 3K59A 1SJ4P 2J9CA 3SFGA 2Z2LA 1U2FA 3HZGA 1VCTA 3OUYA 3HKZD 4LQ3A 4P6QA 4IOCQ 4Y65A 5A8WB 1CSJA 2H51B 2GJIA 3K17A 4KB7A 2A1BA 2MZTA 4M5DA 2RDIA 3K0JA 1T7PA 3G8SA 1X4DA 3KHGA 5IT9Y 1RLDA 3KK2B 1X4HA 4WWSA 4H4OA 3M2RB 1G6BA 5HI7A 1YJNS 1VBKA 3ONQA 4CO2A 1GMWD 4Q8FA 1N34J 4CI0B 2DNPA 1NKCA 3HKWA 3T5KA 2WOMB 4M5NA 4WFAQ 3QGHA 2UUAF 4ZDNA 1IKYB 3Q8YA 5L1LA 4B9VA 2XMKA 3AXKA 4AL6A 3W2VB 1RBOB 2MKYA 2XWYA 2CADA 4J9OA 4ILRA 3M8YA 1OYEA 2K3KA 2BZ2A 4FN5A 4LF9F 3SCKE 1CJVB 1UPPA 2AJ1A 2W24A 5RUBA 2CNKB 2KI2A 4ED5A 3M2UA 1RWOB 1YBTA 3ZTPA 1RWUA 2EG1A 3T5HA 2GS8A 2ZC3A 5D15A 3CJTA 3CGIA 1L3UA 4K50A 3DOMA 5F8IA 3DFEA 2F65A 2VPYB 5CHCB 1FERA 2VC0A 4QWAA 4ED8A 4DPUA 1LOUA 3VVUA 1NJYA 3MEKA 1IKXA 2VJVA 4OYBA 2LDIA 3P5BP 1U2CA 1KTVA 2QSWA 1X0FA 2DGOA 3CO9A 3LO3A 1JLQB 2BRLA 4P7TA 2C2KB 4U96A 3D28A 4NLVA 1XMOF 2WW8A 5EWEA 4FKXA 1KQKA 1S48A 1LKZA 4ZLNA 1H2TZ 1SVDA 1SJQA 2EKNA 5DQHA 4AQYF 1HYSA 4ZOSA 2HLTA 4JV1A 4ZP6A 4QPTA 2HHXA 1JNRB 4ZVEA 5DJBA 4OZ1A 2PMZD 3ZTQA 5G4DA 4DV4F 2QC3A 1WG5A 4D3GA 3KLEA 3K7RA 4ZIVA 4DSJA 4NYZA 3U1MA 4J9UE 1KD1T 5A0YB 4USJC 4OHZA 1VS3A 1TL3B 1YG0A 2CUYA 1XMQF 5M2UA 4ED2A 5JMNA 1R6VA 4PWDB 1IKWB 2HQCA 1YRXA 3BBFA 3IA0A 2VB6A 2XI3A 3FJ2A 5J1NA 2FHJD 3W65A 4LRBA 2Y0BB 3LP1A 3MGJA 4DUYJ 3VAKA 1A0OB 4G1PA 1M5HA 3WX8A 4ALZA 1G1XA 1Y3KA 1REVA 1M5KC 4DBQA 2MQQA 3OD2A 5F0WA 3C3LA 4OYMA 2ZHBA 2ZE2A 3DN9A 3JS9A 1LXNA 4NLTA 3HSJA 3W7BA 3BGLA 3GV5B 2E5JA 1HARA 4QQBA 3CJ8A 4C8LA 3PW2A 3DI6A 1U1MA 1YBUA 3CCMS 5F8HA 1BQNA 2DGSA 3LPYA 4WE1B 1SUQA 1F3FA 4PPZA 1BMQB 4JI5F 4C48A 1HNXF 1AT1B 2HHHJ 2HAFA 1RT2B 2JEJA 2FJAB 2OPQB 3BKFA 1IUJA 2CA9A 3ICLA 4DLGA 2QO3A 1WOSA 1M5SA 2J7WA 3VHQA 3GJSB 3GFZA 3DRRB 3DC2A 3E8OA 1SL0A 4K0KJ 4R5PA 2UU9F 2QMUB 4ZPWR 3QGIA 2IM2A 3VGVA 2FGOA 4TN2A 2W2MP 2HGMA 2HWHA 3J81U 4PEOA 1WSVA 1X4FA 2BX6A 3UNGC 1NB7A 4ZPVR 3BSNA 4YR2A 3PX6A 3G71S 4MK7A 4DR3F 2H5IB 3QT8A 1YLXA 2WHOA 2NPIA 3KG4A 3R5BA 5CH7B 3Q8RB 1BY9A 2ASJA 2KM8C 2LQBA 1RHJB 1M5OC 2D1CA 4ENOA 5J1EA 2E7VA 2WSCC 2AZ1A 1S77D 1LXJA 4E2FB 1YTYA 3R8YA 2G2OA 4LR9A 1OY9A 4JI1J 1MSWD 2KJWA 3C2PA 3TARA 1LV5A 3T1HF 1VBYA 3QWPA 1N5YB 3I4PA 4B9TA 2E7XA 2OO4A 4KKOB 3JTPA 1M5VC 5IV3A 2A6MA 4EBDA 3GSIA 3OL7A 1S1UB 2ZH9A 3VQSA 2R7OA 3RUBL 2Y1RI 1SL2A 2UUBJ 1XEZA 1CJKA 4WZMA 1CULB 4NLXA 2ZJQQ 3EWGA 4C0BA 3M8RA 1RTHA 2X3DA 1SQGA 2V8VA 1C0UA 2BJEA 4Y2AA 5E3AA 1KS2A 2WVBA 1HBUA 4GO5X 2MKHA 2VBXA 4E8UA 1NBEB 3AD8C 4Q2MA 3CD7A 1VQYA 2I1RA 4TU9A 1NKEA 4O0IA 2VUGA 2HURA 3ADAC 3MM5B 3E01B 1R0CB 3NMAA 1V9OA 1S1WA 3E2EA 2ROEA 3GYGA 3HT3A 5KTQA 5EX3A 5KG1A 4MYTA 2A2DA 2EEYA 2BJ1A 1T95A 3IWNC 1VQ9S 2I38A 1U2RA 3I6PA 4B9NA 2KG0A 3AQOA 3PFOA 2IIHA 2BOPA 2PE8A 4QR2A 3NKYA 3W8PA 3UCUP 2ZH7A 2NXCA 1RAFB 1TL1B 4MIBA 3LA0A 5H1SV 3B4DA 1U02A 1U8SA 2F5GA 1RTJB 2KFNA 2QZ8A 1RCOB 3IXQA 1JLFA 3IS9B 2O3DA 4EO8A 2R2TA 3U1NA 2DCLA 1IJFB 3D0IE 5B09A 1U26A 3MM6B 3B4MA 1Q78A 4LFCF 3H20A 4ZP8A 2CG8A 3ZFVA 3D2WA 2C2RA 2RILA 4ECVA 5DGAA 2XC9A 1RUSA 4Q2LA 1FKAF 2W9BA 1TKXA 1GMVA 5E3CA 3J80U 1RK8A 2L48A 1MG7A 3FGVA 4CIOA 1KQGB 3NOCA 1CQNA 2IDEA 3O6QA 1PC5A 1FXLA 4OYAA 4GVBA 2J7UA 5KT7A 1O6XA 3WIUA 3WQPA 1ROFA 4J9PA 2EPIA 1UWAA 2BJ3A 3GIMA 5C25A 2FYXA 1RWMB 2HAIA 4X65F 1QY7A 1FD8A 3DLJA 2V34A 1FKPB 5LSLA 2PMHA 4LVNP 2JLFA 1UWBB 3QAEA 1S6PB 1VOMA 4BCAA 2CQ1A 5DLFA 5H9FK 4UZBA 2OLWA 4DS5A 1MROA 2LECA 5KT3A 1HMVA 4NLDA 1TU0B 3N5BA 4RJVA 3WZ0A 3ET6A 4NZ0A 5C42B 1B70B 4ILLA 5EDWA 5KFMA 4U67Q 1PYSB 4JI7F 3DOLB 3KLIA 3LAKA 2VKZG 4RNMA 3FCHA 2AJ4A 3EVOA 2NLWA 3SSSA 2F9DA 3I0RB 4U7UK 1JKHB 2DNYA 3SEOA 4QWBA 1GX6A 2XSFA 1E6VA 2HVZA 2YY3A 5GAHU 2KT5A 5D3GB 2YQ0A 1RU2A 4E0DA 5EN1A 1NKBA 1YJUA 1P9QC 4GVLA 1TKZB 2XCPA 2DB1A 3BH7B 5F8LA 4K4TA 3MMCA 3CC7S 1Q95G 1XR6A 4LF2A 2HK3A 4QWDA 4X62J 3T5JA 2CQHA 2NREA 2I0XA 4F50A 2X3GA 4L73A 4LSNB 5L39A 2O66A 1W2IA 4DL6A 2YNGB 4FXDA 2H3EB 4K4WA 4DJBA 3MR5A 1QSSA 2MHEA 1N36F 1VRUA 3LH2S 3TNVA 1WSRA 3T1YJ 1Q0NA 3CJ4A 5ETSA 3G86A 2XMVA 5ETPA 4DF4A 2IC3A 3CJSA 2AU0A 4JI8F 1HNIB 4Y34A 2UVUA 3T1AA 4WTYA 4WPAA 2IVFB 4NYPA 2J8AA 3KJVB 2RHQB 1U6ZA 2OP5A 4DX8H 2IJFA 2UXBF 2L9NA 2HK2A 4JV2A 2JRSA 4X4PA 1RWPB 1N32F 1PYTA 3KLHA 5CZXA 5KFDA 1U49A 2Z56B 1Q1KA 1M90T 4DR7J 5J2PB 3PKMA 3TEGA 1KSPA 4LBPA 2DXDA 2YNHA 2W2NP 1R8HA 1R0AA 2AEJA 2R9LA 3JYTB 3MXHP 4FVMA 1LW0A 1ZOTA 2DR5A 4RW8A 3TQ1A 2V2VA 4DG1B 2YNFB 2BABA 2VPXB 5KFQA 3KUEA 2WVDA 1YGYA 3AODA 1K8AT 5LXRA 4J9LA 5A6WA 5M2RA 1X4BA 3VWSA 2CXEA 4L75A 2DT9A 3V6KA 3J81Y 4KQZA 4V19J 1LK5A 2BMBA 5J2MB 4I6WA 4XAKA 5KG5A 2IMOA 1VIXA 3OJSA 1N4LA 2WTFA 5DLGA 2M7SA 4IR9A 3SCJE 1WORA 3GLJA 1JLCB 2H9ZA 4ED7A 3TW0A 4DU7A 3DM2B 4WK1A 3C15A 3ZNUA 2JEGA 2XGPA 3NCPA 1WC1A 1Y0HA 3DDIA 3OLBA 1S10A 4ZP7A 5LJ3Y 3ELHA 2XHCA 3QSIA 2MZRA 3K5MA 2ZBIA 2QMXA 2ATLA 2DXEA 1ZAXA 2R7SA 3TAMB 3WC2A 4J5OA 1SQFA 1UPMB 4KHRA 2AF6A 4C9DA 5HBMB 2RUSA 4G65A 1NK9A 2GVDB 4TYAA 4NWBA 3PW0A 2DNMA 1U1OA 2VG5A 4DR2F 4DPWA 1KKHA 3NGUA 5J2NB 1LFWA 3EM1A 3KLGB 4NA3A 2M8HA 3PCOB 4YP3A 4ZVSB 1X4AA 3QLHB 4J37A 2RHSB 4XPCA 4RNHA 4LFAJ 3JXOA 4NLPA 2Z2MA 1D8ZA 4J9NA 5A8WA 4AFFA 3R9LA 1U25A 2C3MA 4IG0B 2DHXA 2FJEB 1UMJA 4I6AA 2YQ3A 1DHMA 3KK2A 4O4RA 3UWTA 4OV1A 4PG4A 3M2RA 4QIWD 1FA0A 3BSCA 3NWRA 4ZPAA 3ZNJ1 1WC5A 1WOOA 3DLGB 4QOTA 2GMLA 1S9FA 1BWEA 3H42A 4Q0BB 2WOMA 3QIPB 1FDNA 4JI3J 3PEHA 2CNOB 1IKYA 3R1HA 2CPZA 4CLZA 3W2VA 2GO8A 2DGVA 4HI1A 3GFHA 2VFRA 1XR5A 3DXSX 1K0TA 1CJVA 2RS8A 2VG7B 3B54A 1MN9A 3OHAA 2W9CB 1N6QB 3DLBA 1T3OA 4YHHF 4QIFA 5DG8A 3PVXA 2EVZA 4RNOA 4OFZA 2PDAA 1C0TA 1U1QA 2IY5B 5HATA 4ANEA 2G1HA 2HS3A 2YX7A 3IRWP 1VQ8S 3KLVA 2YPZA 4KH1B 3ZTOA 5GAGI 1EB0A 2QLFB 1KHVA 3HHDA 1A6LA 3H5UA 3NL0A 3KG1A 5C7PA 3M8WA 3A3PB 3C16B 4P2FA 4ZVHA 5HMZA 4ELVA 2CZ4A 1JLQA 2CFXA 2NXJA 1OPZA 3PRVA 2MJNA 1Q86T 3IWLA 4Y2IA 3DLKB 2EG2A 2AMCB 1HQUB 1RU1A 4X4UA 3AOCA 3NGSA 5DQIA 1I1GA 3IR6B 4NLYA 1S6QB 4TNOA 3BYPA 4CLUA 4ETXA 3L95X 1HBNB 2ZNZA 2RE1A 1IVZA 2EI5A 1D0EA 2VBZA 2EFOA 3I4HX 3GV7B 4G6VB 4AYBD 3RBEA 4U8VA 2VQEF 3T19A 2GGPB 2VPZB 4ZPBA 5L1KA 5KG0A 3MTJA 4J9RA 2E5IA 2XMUA 1TL3A 3M2VB 2DGWA 2DD8S 1HI8A 3AJ2A 1YJTA 2RDDA 4Y3CA 3OL9A 2DR6A 3QRQA 5KFOA 3PZPA 4PWDA 1OQ3A 4WBFA 1IKWA 4LF4F 2MKKA 4CM0A 1WF0A 2WB4A 4DX7A 1V3ZA 4QW9A 2LDYA 2RQ4A 4JI6F 3W63A 2Q1LA 2MMYA 2HNZB 4DU8A 1N5QA 2W2OP 4K7QA 2Z8QA 2EFPA 3TZZA 1AZSB 2ZBQA 1FJGF 1X5OA 3TZWA 1VRQC 4CCHA 4U7CA 4Q7AA 5I3PA 4FZVA 2PGCA 2ZBPA 2QGFB 4USKA 1DTQB 4UZCA 2FC8A 5AJ3J 4BBYA 5HMWA 1RTZA 2J5AA 4MAKA 4JI2F 3M7VA 1QAIA 4KTQA 4WE1A 1AA1B 3F0NA 3JSRA 4Q5VA 3D9BA 3PYEA 2B51A 1RT2A 5KOWA 2OPQA 2JOQA 2KHCA 1K9MT 2CJBA 2I5JB 2FVCA 1KN6A 4Z2XA 1UETA 4XPEA 2B43A 4IOBA 3AA8A 3DRRA 2YWWA 4DPTA 4JV5F 1XJWB 3MI7X 2B6AB 1RGVA 5D0RA 5L46A 3LGHA 4TY9A 4P2MA 4IQMA 1CJUB 1Y5NB 5D4OA 3G9CA 1B0TA 5HVFA 3D6MB 4ZK7M 1HIYA 2NXUA 4MK9A 3W5ZA 3RAQA 4WKRA 2D3UA 2XMWA 3BBBA 1DURA 4I7FB 1Y11A 1NUEA 3I32A 4QR0A 1YSJA 2MZSA 1TV6B 1P9YA 3DU5A 3AFGA 2MPUA 2MEWA 3P8BB 4ZHRB 4ILMA 1PO6A 5DM7Q 3MFIA 2C2EA 4OZ2A 2RUGA 4HHUA 2NUHA 1S0NA 1N5YA 2U2FA 3O2IA 2VQFJ 3B8HA 1NH7A 2KFZA 1U6BA 4KKOA 2NCKL 3BKUA 4ANCA 4FBTA 1L5UA 4F02A 4EWTA 1S1UA 3GIRA 2OPRA 1RAHB 2RSQA 5DG9A 3EXYA 1VQNS 1CULA 1AFIA 1S1TB 3BGUA 4N76A 1VQLS 3OT9A 3CMAS 3MUTP 5ETQA 2JSXA 1ZZNA 3MD3A 4I4BA 3CVKA 4DV3F 3EJMA 3I96A 2B0GA 3UNYA 4YOEA 5C5JA 4RW6B 3KK1B 1RAOA 1UVKA 3MM5A 3E01A 4CO3A 3LP0B 3WIVA 3GYNA 3D6HB 2P5VA 4QWEA 2E1CA 1WKLA 1UW4A 1GK8A 4Q8EA 4FYDA 4K4SA 1XNQJ 4ZJOA 4FXWA 4FDFA 3GJRB 4F8RA 1RTDB 3L7OA 2IRXA 3P96A 1TL1A 1N5VA 2BE9B 2VOPA 4RBTA 1FX4A 2MQ8A 4GC7A 4BHQA 2ALZA 1S12A 3FNNA 4DFPA 1RTJA 2P6TA 3IBCB 4K4VA 4WXWA 1FX2A 4ERDA 4U7UD 1RTIB 3LF0A 1TR0A 2WVEA 4HT7A 2DVIA 2DY1A 4EU0A 3UD5A 3KKFA 3MM6A 5KFAA 2JWNA 2Y8WA 4DL4A 4YB1P 4K4YA 2YTCA 1C1CB 5KFVA 4K4UA 4KPYA 1NJIT 1WTBA 5HVGA 4PAAA 2DNKA 3R27A 2R7WA 4RUAA 4ICLB 1GMWA 4LRAA 2RD5C 2EW9A 4N77A 2OPPB 1M0SA 4X4TA 1NSQA 3BREA 3IFEA 1DFDA 4MIAA 2VHGA 2K06A 1VYAA 1HWKA 5B0GA 1VLOA 2FJBB 4DL0C 5I3UB 5G0RB 4NMXA 1FKPA 4CRJA 1VQOS 3NNAA 1UWBA 1S6PA 2QE5A 3R7SB 3EPIA 1CEZA 2E1RA 2X1BA 3ULHA 3OJUA 5EHHA 5BYQA 3TWZA 4KY3A 4A8FA 1RHQB 4LSZB 1EX8A 1X0PA 1FFGB 3BZQA 2GCFA 2AZ3A 2VONA 1S57A 1U45A 1VQSA 2R7XA 5K8OA 5C42A 1F0XA 1YX2A 2XULA 5L9XA 4DV6J 1JLEB 3BGOP 4OX8A 3DOLA 4P52A 1PILA 4JB8B 2HW3A 3M4XA 1ULRA 3I0RA 1JKHA 2VC1A 4PWWA 4O4GB 2MSSA 4DSKA 4B9MA 3OTDA 3QT5A 2MZ1A 4WZQA 5D3GA 5D4LA 2FLPA 3UI3A 1SIZA 3P3DA 5DO2A 4YEAA 3FCWA 5KFRA 3K57A 2ZH6A 4OZLA 3PHEA 4B3RF 1XMBA 5GMEA 2UXCJ 2OD4A 1JLBA 4PRFA 4IOAQ 1H2UX 2QYCA 3VALA 2HVIA 5KFNA 2BOAA 2RQCA 4H4MA 2XS5A 1J5OB 1KQSR 4F7VA 3CCES 2X1FA 4J91A 5HK4A 4LSNA 4DR6F 1T03B 2YNGA 1Q82T 4U9RA 3X3UA 4JI0J 5IWAJ 1VJQA 1YZ7A 2R7TA 1U47A 2FC9A 5DG7A 5JVGQ 4KGXB 3A8JA 3Q89A 3VTIA 5AE1A 2CIMA 3BO3A 3JQJA 1HBOB 1X5SA 3MPDA 3T3FA 3H8YA 4HLBA 2BRKA 7FD1A 1RT1A 2XGQA 2CVIA 4P71A 2QJ3A 1SKUB 4B3SF 4F04B 3S6EA 4ZLLA 3KJVA 1T9XA 1XQIA 4JYAJ 1KONA 3Q8QB 3AB4B 1NRKA 2JDJA 3VZIA 2M2BA 5I42B 3O5TB 5AXNA 4MYUA 3HSDA 1F9FA 1UJ4A 4FP9A 3DRSB 2R2SA 1R3NA 3OXLA 2G2ZA 4P72A 5KG6A 2PFFB 1IBKJ 4Z7YA 4WIQA 1PJ7A 1RISA 1RT3B 2AX0A 1K1QA 4ECZA 4K2JA 1MMLA 1NCLA 2XG8A 5DGBA 3KHHA 3JYTA 1Q7YT 1EHWA 1HR0J 2HG4A 2MDAA 3OXGA 4KH0B 3PNIA 1R89A 2C22A 1WEZA 3RJMB 4ZVRB 2WONB 4CTAA 3OVSA 4DG1A 2YNFA 4X64F 2F8EX 3N79A 2QYGA 2K7KA 5LMNJ 3GPAA 4O3NA 2RF2B 3WC0A 3R1LA 1S9EB 1PBAA 5LL6d 4J9SA 2LQJA 2FUG9 5HP1B 2FGCA 4V19X 2H48B 4CH7A 5J2MA 2NXNA 1O0PA 2AEMA 3GE9A 2JEFA 2X1GA 8RUCA 3DKDA 3G8QA 1IR0A 4EK2A 5LSOA 5KFUA 4USIA 5HMYA 1JLCA 1MMDA 2G1DA 3EXCX 3UDLA 4F25A 3VZHA 5HQMA 3BPSP 5D8HB 1GEHA 1RA7A 2JJ4D 3BQ2A 4TQSA 1UA0A 3PX4A 1H0HB 1FXDA 3C66A 2B8QA 2HHWA 4IH5A 1IKVB 3TAMA 2UV8G 1HHTP 7AT1B 3IMQJ 5ITHA 3PYFA 1T11A 3TZXA 3H98A 1NU4A 1RZMA 3R97A 3LGMA 3IO1A 3J7YU 2ZVIA 4ID8A 2B9YA 3KDNA 2AJ2A 4NI2B 3TVYA 2H5EA 5J2NA 1Q79A 4DZ6A 3KLGA 3VV2B 4DV2F 2BQRA 3D67A 2DO4A 2F40A 4PABA 1FRHA 3QLHA 2MY8A 2ZWPA 3VGUA 1UFWA 1FKOB 2JC1A 5IFMA 1UW9A 5A8KB 2GQQA 4IG0A 1XK8A 3PJ9A 1SJ3P 5B7WA 3D3CJ 3CTRA 2O67A 4LF6J 2GMHA 2E5HA 2FVSA 4CLLA 2BJDA 2DTJA 6AT1B 4F2SA 2HBRB 1RAGB 3DLGA 2HWTA 3HD2A 2LP4A 4Q0BA 3QIPA 3CCUS 1RT6B 2QSFA 4ID5B 4OLPA 3CEDA 5ETTA 3DHWC 1YJ9S 2XSJB 3BV8A 2RB7A 2QLWA 2BQUA 2ZBRA 4UOHA 2VFTA 3M6WA 2VG7A 1WEXA 2W9CA 4JI4F 1ZAWA 2NYHA 4DV5F 1N6QA 4Y2MA 1WDDA 3BS9A 1EKSA 3AOBA 4TQRA 1GNKA 4NL5A 4EI2A 3CF5Q 1HA1A 4X4QA 4FBUA 3D0GE 3KXDA 2WBRA 4DV7J 3BH6B 3BN7A 2XMAA 3MDFA 5M2PA 2E9RX 1P8GA 4FYYB 4EGLA 5LSRA 3C16A 3GILA 1K0VA 4YQWA 4ATNA 3SQOP 4B08A 2PT0A 3MM8A 2CYYA 2ZOFA 2JC0A 4ES1A 5HSPA 1BC6A 3V6JA 2D3ZA 3I87A 1RAJA 3F41A 3R3TA 2DK2A 3DLKA 1X7VA 2WW4A 1ZZFA 1HQUA 1LW2B 2NSBA 2XMJA 4BWMA 2NYIA 1S6QA 2VF3A 2PO4A 3OTOF 4OJHA 4PG7A 3TJ9A 3M9NB 1FRLA 3TP2A 1HBNA 2DIVA 2GHVC 2B5JB 5K14B 4FKYA 5DDQC 2P9CA 5J1PA 1KRPA 3W9HA 1KDNA 5T14A 1BXNA 1GMUA 1MU2B 4RW4B 1CBKA 2J0SD 1MWQA 4ZVUB 4LJMA 3N9UC 3NG8A 1B4SA 2BE2B 3CT9A 2GGPA 2J6TA 4Y0FA 1SH3A 2UV8A 3RU0A 4ZLPA 3B78A 3M2VA 4TU8A 2ZBCA 3PYDA 2WAQD 4U95A 4UY85 4RWXA 4Y00A 3SSQA 4DCJB 1DQ9A 4LIRA 4EEYA 1NHUA 2AW0A 2C3YA 1XC9A 4OI6A 4KGZB 2HNZA 2W8KA 4J9MA 1YHQS 1H3DA 2MGZB 1DTTB 1Q8IA 2MZJA 1AZSA 3ENAA 1NB2A 3DLLQ 1FDDA 4ZLJA 5HQLA 2UUCJ 4JOUA 2LCWA 2MZQA 2JX2A 3KK3A 4WK3A 1BGXT 5E7OB 3KHRA 1RKJA 1VI7A 4XIUA 5LMUJ 3DYAB 1Z2ZA 1FFSB 1SC3B 1JJCB 3SV3A 1DTQA 2B4UA 5H9FJ 3TYTA 1Q4RA 4HDHA 4LREA 2VU5A 2MQOA 1P1LA 1VISA 3TX0A 2YBVA 4IFYB 5ETVA 4EYIB 2AYGA 2N4DA 3IN5A 4WCEQ 3H0PA 1LWCB 4ZCMA 3AH6A 2AV5A 2I5JA 1BUXA 4NA2A 1RHKB 2ZDOA 1B0VA 2W25A 3FSIA 2E5LJ 3T41A 3AQPA 3B6BA 4C8KA 2B6AA 1WWHA 4F4WA 2B9WA 5DETA 3JQMA 2HNDB 3HXMA 1Y5LB 4LRDA 5J2QB 1FE0A 2KYZA 1CJUA 2K8GA 2N82B 2X51A 1TUVA 2IVYA 3FMBA 2F4VJ 3HJVA 2GJFA 1DARA 4EZ6A 2HMIA 2G9OA 1OQ6A 1GH8A 2ZZNA 3OSPA 4LF5J 2CJKA 2RT3A 2YNIA 3UE2A 5CYQB 1CC8A 1GQEA 1IQTA 2EC2A 2ZHAA 1FNXH 4I1TA 1PJ6A 1C4CA 4A8WA 2V4RA 1OMSA 1Y7PA 3IM8A 3HHLB 2GHPA 2V5HG 2GVZB 3OR2B 1TV6A 3G82B 2BJ8A 5IT4A 2YH1A 3EPGA 2XTJP 3I55S 4B3MJ 2IRUA 1R31A 4OZ5A 1X8DA 2YX4A 2FLNA 1O8BA 2B4VA 1DQ8A 2WVCA 3A8KA 1FXRA 2I6WA 3UPFA 2OMLA 3HCXA 2ALYB 5GAHI 4ZJQA 3OTEA 1ZPVA 1WC0A 3QZ8A 2GX8A 2WSFC 1S1TA 2MLXA 3V4IB 2KRRA 3GJTB 2KFYA 3CC4S 1ELOA 3UN2A 2RQMA 1URRA 4OJGA 4F2RA 1VHFA 1WACA 4LBHA 1FRMA 3HDSA 1WJ9A 4NYOA 3W62A 1Y00A 4A8OA 2PI4A 4C3KA 4EBEA 3TI0A 1VFJA 3SMZA 1NAQA 3QBCA 2Z30B 3QO9B 4CYUB 4DFMA 1BQXA 4RW6A 3KK1A 1QAXA 4D3HA 4B3TJ 3LP0A 4RO0A 4L3KA 4CLWA 3I5CA 2BJ9A 4ITSA 3DLEB 6FD1A 1WDTA 3ZTSA 2HRUA 2ZH8A 5GADI 1RA6A 2AYMA 2N7CA 4WTOB 1R7IA 4R8UB 1UA1A 1RTDA 2HRTA 3HFZB 1TKDA 2DISA 5KFJA 4ZCKA 1I3OB 3PO4A 3PFEA 5GMKa 3HPOA 1QAYA 2IM3A 4JV0A 4CO1A 5BXIA 5L9NA 4LR8A 4CLTA 1RTIA 3OFEA 2ZJRQ 5BR8J 2AGQA 3SIPB 5LM7E 4BC9A 5KFYA 5DM6Q 4K5SA 4DV1J 4C2MA 4QPXA 3MEDB 2OPSB 4N41A 1C1CA 2HFZA 3QSYB 2H1YA 1AUDA 3CCVS 3TAPA 3AJ1A 4ICLA 3HLUA 4UTGA 4X66J 4RZRA 3SI8A 1RKIA 4K4ZA 4PXEA 2V9KA 1RABB 4WFNQ 3TUPA 1X9MA 2OPPA 2J0XA 2XS2A 1APSA 1IR1A 4HL9A 3QGGA 5IZHA 3EICA 1UZDA 1ZM3A 2LA6A 4M94A 3BYRA 3QPIA 1VK8A 3ZZUA 4N8NA 4FXVA 1S0MA 2EBEA 2HBYB 2WK4A 4KHPJ 4G1IA 4RPFA 4GKJF 5I3UA 4ES2A 5G0RA 2D41A 2DH7A 2W4DA 3GG1A 4DR1J 3TJ8A 2EFGA 1KOOA 3R5AA 1HHSA 4PUOB 4M5LA 3D66A 2C3UA 1S6OA 2UP1A 3R5CA 1KFSA 2CQGA 5T7LB 3GCXP 3VAIA 1HI1A 2E1AA 4NCAA 3TX8A 4XO0A 1IM4A 4H54A 2IJNA 4DSIA 4AXIA 2QL7B 4O3RA 5DDOC 4Y6IA 1JLGB 3KJNB 3ENVA 1YDLA 2ZM6J 2KXFA 2Z58B 4ZVOB 2HVHA 1WELA 4MKBA 3P4UB 5F3TA 2CQCA 4OX9F 4KJIA 2GJ2A 1FJEB 3HF5A 3EGZA 4QWCA 2D7SA 2IM0A 3AHPA 2AEFA 3M8ZA 2QFIA 4KT0C 2KRBA 2MLZA 4RUHA 3JAMY 2DGTA 4KGKA 1J5OA 3QJJA 2CJ9A 5KG2A 3FRZA 4KV8B 1L3TA 3SBMA 1SC6A 1RADB 1VMBA 2QLBB 4M5IA 5E3PA 4HYKA 3JB9k 2Y3YA 5KFTA 2DY9A 4DZDA 1P1TA 4ZN3A 2H65B 2LEAA 3AT1B 3PYGA 3CIMA 3V6HA 3IBWA 2QA1A 1UZHA 4CT8A 3BKTA 1XNRJ 4OHWA 3K5PA 5FJ4A 1RHUB 4R0EA 2JNJA 4G3IA 1HBOA 5U47A 3CJ3A 4N5SA 5EUHA 3M2UB 4QBUA 1UKUA 2YQ1A 4KFBA 1HNWF 2XZDB 2DGQA 2E1PA 3NRBA 4FYVB 4RNFA 4HEA9 3TA2A 3RBZA 3HZEA 1IJEB 1UVIA 2N4CA 1KVJA 1GFWB 4QZVB 1EARA 4KGMA 1FRXA 3L09A 2POKA 4OIXA 3O3LA 1ZETA 4YY3J 2VOOA 4DR4F 4ZN1A 3DRSA 8AT1B 3M6UA 3GCWP 3ZZRA 1TMJA 1RBLA 1TFWA 3MCMA 4FF4A 4HVZA 5C2CA 2BBEA 3NGRA 2V50A 3RRKA 3Q83A 2YKMB 1TP7A 1IBMF 1NK0A 5IM0B 1RT3A 2H54B 2LU2A 1NSKL 2D9PA 2CJXB 4NXNF 4PR6A 3Q8SB 2GW8A 4WF9Q 2M88A 4ECYA 3CCJS 2WONA 1HQ2A 2F4FA 5E41A 1ITPA 3MPVA 4CLYA 1RT5B 5HVHA 2RRBA 5A2QU 4WFYA 2KDOA 3W9JA 1IBLJ 4KO0B 2KL8A 4ANDA 2J8SA 2RF2A 4ECSA 3CO0P 2DNHA 1RWNB 2BUNA 2OIHA 2GHWA 3HP6A 1S9EA 5CABA 1J5EJ 4M8LA 5KT6A 1PG5B 2Q6CA 5HP1A 3HSZA 1JB0C 4DUZF 1OY6A 1AB8A 4DL2A 5D4PA 9RUBA 3TVKA 3G2XA 3DDNA 2XYHB 3K89A 3CB4A 5JUMA 5IV4A 3TUIC 3W66A 3AD9C 2M8DB 4GKKF 4DN9A 2ZITA 1FNMA 2OKQA 4ZPDA 3IG1B 3S1TA 2HNYA 1RSCA 4RR5A 5K5MA 2ZUGA 1I51B 3BBCA 1Y9OA 1D9AA 3H2UB 2V4JB 2KB2A 4KR0B 1WD6A 2CVEA 1SC4B 2CDRB 5IQ6A 1IKVA 2F63A 2FHKA 1QTNB 1N33J 4F3OA 3HX9A 2F3JA 4B9LA 4HH1A 1NMEB 2OGUA 1TELA 4ED6A 4LF7J 2LFVA 1VK3A 5F0UA 1R8PA 2YVSA 4NI2A 1QJHA 2QN6B 5THWA 2UXDJ 2Y9HA 3GSDA 3TQEA 3W8GA 4BC7A 3Q23A 1SKWA 1T9VA 1FKOA 1RT7A 5A6PA 2HYIB 3BR9A 1SUQB 5IC4B 4NXMJ 3UCGA 3NY0A 4DV0J 3HFKA 2YKOA 3EZOA 1YI2S 3IC1A 5GAEI 1SH0A 2OTLS 4QCLA 2YKNB 4QIVA 1U48A 3W5XA 2HQGA 3P5TL 3QJLA 3R5GA 3D1QA 4NASA 1RT6A 4ID5A 4DPOA 2B4PA 4I64A 2R8IA 2AX1A 5E0OA 1JXVA 4LF8J 2PA8D 4X4OA 3UVJA 4OV6A 1S97A 3IBFB 2DIUA 4ECQA 5IS2A 3MR6A 4MKYA 2KYXA 3DGPB 1RT4A 1XBWA 3CXCR 4LFBJ 3L3CA 1I5OB 2AJFE 4DN0A 1VQ7S 2C2DA 3FBCA 3MMBB 1LWEB 3N6LA 1S0VA 4MT1A 2FZGB 2C2ZB 2QLJB 3NOGA 3IAM9 4KYZA 4NOHA 4UOGA 3W9IA 4OI4A 3Q2TC 3HT0A 5L1JA 1H74A 1HNZJ 4TKTA 4M5MA 3FZ2A 3R2DJ 5GVQA 5LT5A 2HWIA 3MMJA 1FD2A 2M5YA 3QGPA 2CZVC 3BGFA 3NS6A 3NWGA 4X2BA 1ZA2B 3W64A 1FWLA 5BYRA 4LRFA 2U1AA 1CJKB 3HVRA 4F0MA 5DZ7A 3MM7B 1Y4ZB 1LW2A 4ZP9A 2FVQA 5F8GA 2FY1A 2FZKB 4EBCA 2DITA 4A46A 2DNZA 4DR5J 2C3OA 1RLCL 1HPZB 1KOHA 4P73A 3DXBA 3NMRA 5A76A 2BVZA 2B5JA 4M5HA 5K14A 3CDUA 3HHNB 2B9EA 4CNZA 2Q66A 1R27B 4MH8A 1QVFR 5IT9U 1MU2A 2CWKA 5F9LA 4RW4A 2BQ3A 3OL8A 1TZ0A 1EP4B 5E3RA 1N34F 4N7TA 3MAHA 4ECTA 1SV5A 2BE2A 3OPKA 3PEJA 4PPDA 2M4MA 2V9WA 4YMEA 3G87A 2JHEA 3OFFA 2DNOA 4OJ3A 1N8RT 3DLHA 4JUZA 5D0EA 1ZAVA 2FB0A 2DR9A 3HK2A 4DHVA 1GT8A 4HACB 3MHYA 3CDAA 3SV4A 2LEPA 2DGXA 2V0NA 2C2NA 1UVMA 1X4EA 2L08A 3Q24A 1RWVB 3RYLA 4M5GA 4M1KA 2UUAJ 3I5AA 4WKYA 1VQKS 2EXUA 2MKIA 3UCZP 2XBPA 2M0GB 1FK9A 2GZOA 3BSAA 1N88A 5KFLA 3TVZA 1TUGB 1SH2A 1YJVA 3ETMA 2ADBA 4AD6A 4LF9J 2MGZA 1DTTA 4HTIA 2W9BB 3WX4A 2OMOA 2O01C 2KG1A 2JH3A 2E5GA 1VDHA 3QNWB 3DRPB 1DJ0A 3SFUA 5LOQA 1EZZB 4DUTA 1WI6A 2FJDB 1VQMS 2JLGA 3MCOA 4AXJA 3C6UB 2R8GA 2PN6A 3DYAA 3M32B 4C8MA 3PV8A 4ER8A 3QMQA 3BQ0A 1PKUA 5E3QA 4OX6A 1D9DA 2AJQA 1TK5A 1RAAB 4F4ZA 2I2YA 2YWGA 2VPWB 1H7XA 4PXCA 5HJYA 2MSTA 3U02A 1I6JA 3GR1A 2ACYA 8ATCB 1LWCA 2E7WA 3THTA 4A8KA 2MQPA 1XERA 2N3LA 2WB1D 5AT1B 2QEXS 2ILZA 1MROB 1XMOJ 2BKOA 1AROP 2V63A 1N5SA 1IN0A 2V8PA 2QMWA 1GXUA 1UVLA 4PYAA 2E44A 4AQYJ 3KMQA 5GMDA 3BB5A 4J9KA 2M3DA 4IKAA 2XMTA 4ZITA 2O5DA 3A3NB 5J2QA 4RBUA 4M63A 4UF4A 4FF1A 3CD6S 3CD0A 1QM9A 3PX0A 4GRSA 1NO8A 2HBZB 2E9ZA 1WC6A 4OLOA 4DV4J 1FRJA 1MMNA 4DDFA 3W3SA 5CYQA 3AB2B 3AXMA 3H7HB 4YB7A 3KJQB 1BLUA 1NK7A 4EMDA 3BN4A 4F3MA 4YR3A 4F4YA 2KZMA 3J7AN 3OR2A 5GADU 2WCXA 4USTA 2ZHOA 2EC0A 3TAQA 4DUYF
chains in the Genus database with same CATH topology
4DQSA 1YRXA 2MXYA 2RH3A 3IA0A 5KFFA 1HR0F 2VB6A 2XI3A 2PFFB 3FJ2A 5J1NA 2Y1JA 1GX5A 3K5NA 2FHJD 1RISA 1RT3B 2AX0A 2Q43A 3Q22A 1K1QA 4ECZA 2EFNA 1MMLA 3LP1A 2XG8A 3MGJA 4R0JA 3DOKA 5DGBA 3KHHA 3JYTA 3VAKA 1Q7YT 4DF8A 3ZZTA 1SL1A 1N54B 1C2PA 2HG4A 2MDAA 3OXGA 2CQBA 3ISZA 2KO1A 4G1PA 1M5HA 4ALZA 3PNIA 1G1XA 2Q3PA 1R89A 2LYVA 1WEZA 4RX6A 2C22A 1Y3KA 4O3PA 1REVA 2WONB 3HHEA 1M5KC 3KLFB 4DBQA 4CTAA 5F0WA 2MQQA 3OVSA 5LMNF 3C3LA 4DG1A 2ZHBA 3VR1A 2YNFA 2ZE2A 3DN9A 4EUVA 4MK8A 4RW7A 1LXNA 4NLTA 2IAJA 4X64F 1NK4A 2I8EA 2EBGA 4I7FA 3MTKA 3PW7A 2F8EX 2P6SA 4IDKB 3N79A 3W7BA 3BGLA 3GV5B 2E5JA 3CCTA 1HARA 2K7KA 2Q79A 4QQBA 1RI7A 4O3NA 2IMWP 2MB0B 2RF2B 3Q0AA 3CIZA 3RRHA 3WC0A 3R1LA 1F60B 5F8JA 1OIAA 4C8LA 3T6BA 3PW2A 1S9EB 2QV6A 5LL6d 2R8JA 1Y3JA 2EFQA 2NS1B 3DI6A 4ZHRA 4J9SA 2LQJA 2YKQA 2YWKA 2FUG9 2HHHF 1FTCA 3POTB 1UAWA 1U1MA 3CCMS 5HP1B 4WIIA 2WRMA 5F8HA 1FJ7A 2FGCA 4V19X 1BQNA 3QO9A 2DGSA 4CH7A 4URGA 3LPYA 5J2MA 3MR2A 2HMIB 2DNRA 4WE1B 1O0PA 1SUQA 4DQQA 2XY6A 4PPZA 4JI5F 4EZ9A 3WDOA 4C7QA 3GE9A 1Q53A 2JEFA 1HNXF 2YNIB 3SDEB 2X1GA 1RT2B 3D0HE 2JEJA 3G8QA 4K0KF 2FJAB 2OPQB 1IR0A 5LSOA 3M30A 2AGPA 1IUJA 5KFUA 2XNRA 4K2XA 4USIA 5HMYA 2ZH4A 3DLEA 3ICLA 3Q2SC 3O1LA 5L8RC 3HMJG 1XR7A 2APOA 3PR4A 4DLGA 2J9DE 2QO3A 1JLCA 1M5SA 2J7WA 3RBDA 5FIIA 3GFZA 3KNGA 3DRRB 1MMDA 3DC2A 2E9TA 2G1DA 3EXCX 4I0WA 3UDLA 4R8UA 3JSMB 3E8OA 3VZHA 4F25A 4OZNA 1SL0A 2MYFA 4DQRA 4R5PA 2UU9F 5D8HB 1KNZA 4ZPWR 3QGIA 1RA7A 2JJ4D 2IM2A 4KBIA 3BQ2A 4HH0A 4TQSA 2CRLA 2FGOA 4TN2A 1UA0A 2CPYA 3PX4A 4OZ0A 3B82A 1H0HB 1FXDA 2HGMA 3C66A 2HWHA 3HI9A 2HHWA 4IH5A 3H40A 4QYZJ 3M6VA 1X4FA 1IKVB 4I6YA 3UNGC 1NB7A 3H2LA 3MPWA 4ZPVR 3BSNA 3BDEA 1HQEB 4YR2A 1T05B 3G71S 3PX6A 2BV3A 3TAMA 4DMZA 2UV8G 3GYXB 4MK7A 4DR3F 1HHTP 1H98A 4PG6A 2KJVA 4CH0S 3VAFA 2IBKA 4H4KA 2YX1A 5ITHA 2WHOA 2NPIA 2RKIA 1N5TA 3KG4A