1FKOB

Crystal structure of nnrti resistant k103n mutant hiv-1 reverse transcriptase in complex with dmp-266(efavirenz)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
426
structure length
403
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the resilience of efavirenz (DMP-266) to drug resistance mutations in HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 RT, A-CHAIN
total genus 107
structure length 403
sequence length 426
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1fkoB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkoB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkoB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkoB03
3NBPA 1NNDA 3D28A 4QWDA 4RW6B 3OLAA 2BRLA 5L9XA 4NLDA 4NLOA 2BE2B 4NZ0A 1C0UA 3DM2B 2CKWA 5CYMA 3KHHA 1FKPB 4O3QA 3RB0A 3DRRB 1R0AB 4RNNA 1S1WB 1VRTB 1YVFA 1NHVA 1IKWA 4IFVB 2HNDA 1S1VB 5KFKA 1LW0A 5KT5A 4MK8A 2D3UA 3BR9A 1JKHA 4WYWA 5FDLB 4GC7A 5KFHA 2FJWA 4MK7A 4Q8FA 2HAIA 1HQUB 4DL4A 1T05A 4LSLB 2OH2A 1U09A 5L1LA 2IC3A 1RT3A 1JLBA 2RF2B 5KG6A 4IFYA 2V4RA 1RT7A 1JLEA 4WE1B 1T03A 4QPXA 5I42B 3E51A 3QGIA 2B43A 4M94A 4O4GA 3QO9B 4I7FB 1JIHA 1KLMB 1DTTB 3DYAA 3DLGA 4MK9A 4PWDB 3HKWA 3DDKA 3Q8PB 3N6NA 2IAJA 2YNHB 1TKZB 2YNFA 1RT4A 2YNIA 2CJQA 4KE5A 2I5JA 3FFIB 5J2NA 5KFFA 4IQXA 3KOAA 1JLAA 1ZTWA 4RNOA 2RDIA 4KO0B 3DOLA 4KKOA 2XGPA 4O3SA 4WFXA 4F4XA 5F8JA 1S9EA 1SH2A 2W7OA 3KHLA 4ID5B 3BSNA 3PW5A 3DRPA 2D3ZA 1S0MA 4IG0A 5KFYA 3PW7A 3DLKA 2WRMA 2FJXA 4ED7A 1C0TB 2ASJA 2OPPA 4WE1A 3QZ8A 4IDKB 1TL1B 1BQNA 5DLFA 4I2QB 4ZHRA 4PQUB 2UVUA 1TL3A 3QO9A 4MFBA 2BQUA 1DTQB 3DLGB 3CDEA 3T5HA 3QGGA 2QV6A 3IGNA 4HKQA 4F4YA 2AGPA 2DPIA 5EUHA 2DPJA 3QLHA 5KT3A 1RDRA 3SFGA 4NLTA 3RB3A 2R8IA 2W9CB 3LP1B 3KJVA 5HROB 2WCXA 2WHOA 3D5MA 3N6MA 3DOKB 2ASDA 3MEDB 3CO9A 4K4ZA 3MEGB 4RNMA 3GIKA 4R8UA 3DLEB 2HNZA 3BSCA 3DLKB 1RTHA 5D3GB 4TY8B 3NL0A 4RW4A 1SUQB 1S1WA 1VRTA 1KHVA 4FS2A 3MECB 4DL5A 2JC1A 4IFVA 1IKWB 3TQ1A 4KAIA 1BQMB 5KT2A 3QZ7A 1FK9B 4EBEA 4WXWA 3H4BA 4QWAA 3OHBA 4ED6A 4IH5A 3CDWA 1HPZB 3ITHB 4RW7A 4ZVFA 4G1QB 1C1CB 3OL7A 5F8MA 4K4TA 1S97A 1JLCA 1HNVB 3BGRA 2I1RA 5C24B 4J9KA 1IKXB 2B5JA 3DI6B 1HYSB 1S48A 3C6UB 3C6TA 3LP0B 1T94A 2IM3A 4R8UB 3DMJB 1LW2A 3V4IB 1K1QA 4KHRA 3Q8QB 4NLQA 4EEYA 3CWJA 2BQRA 1LWCA 2I5JB 5J2NB 2YKNB 5J2MB 4U6PA 3M9NB 3V6JA 2FVQA 2OPQA 5CYQB 1N6QB 3RB4A 2V9WA 3OL8A 1RTIA 4WFYA 1UWBB 3HVTA 4KV8A 4RUCA 3PW2A 1IKVB 5KFVA 3PW4A 2EC0A 3UQSA 1MU2B 4NRTA 2C2DA 5DG9A 3CJ3A 1ZETA 1JLBB 4YMEA 1RT7B 4Q0BA 1JLEB 2OPPB 4Q44A 4NLWA 5C25A 2FVPA 4IG3A 1SH0A 2JEFA 1RT5B 3H98A 4IH6A 5DQHA 1TKXA 3DMJA 1IKYA 3V4IA 2W9BB 4QWBA 2BANA 1QUVA 3IS9A 4EBCA 5I3UA 2R8GA 2E9RX 4R0EA 1C2PA 1JLFB 2IA6A 1QE1B 3IG1A 2AU0A 4IOBA 4MIAA 5C42A 2R2TA 5KT6A 4KV8B 3DOKA 2VA2A 3HHKA 4RW6A 2FJVA 4QWCA 3DM2A 2BE2A 4JV1A 2C22A 5DGAA 3BQ0A 3H40A 1LWFB 4QWEA 2IM2A 3KLEB 2R2UA 4PUOA 4K4UA 3QIDA 1S1VA 5KG1A 2HNDB 2ATLA 1EP4B 4DG1A 5KFEA 1S49A 4H4OB 4KHMA 1K1SA 5FDLA 1S1TA 1HMVA 3LAKA 4TQSA 1HNIA 4ZPBA 4ZVGA 1C1CA 1EETB 4KFBB 4O44B 2UUWA 2ZKUA 5J2PB 2R8JA 1N4LA 3UDLA 3LP1A 5J2QB 4ZPDA 2AQ4A 4NLGA 1FKOA 1S6PA 1SV5B 2HWHA 2OPSA 3T1AA 1DLOB 5I42A 5KFOA 3RBEA 1RTJB 4ECQA 2E9TA 4O3PA 4RW9A 4EO6A 5HLFA 3EZUA 2BR0A 1KLMA 3DYAB 4I7FA 3G6XA 3EPGA 3KLHA 4F50A 3QIPB 4NLPA 1TV6B 2IAJB 2JLEA 2YNHA 3FFIA 1N5YB 1C1BB 3M8PB 4NCGA 5CYQA 1N6QA 2O5DA 1RTIB 1GX6A 3GYNA 2VG6A 3PJXA 3JYTA 4FBTA 2W7PA 3DRPB 4XO0A 4F4ZA 4ID5A 3KLFA 4DEZA 5KFDA 4WZMA 5KFTA 3ISND 3TAMA 4J9QA 4IRDA 2AX0A 4H4MB 4WXOA 5KG0A 4Y2AA 1LWEB 1HYSA 5DGBA 2YKMB 1JLGA 3C6TB 5HP1B 1JX4A 1HARA 1RT5A 1BQNB 3I0RB 1TVRB 4ZVHA 5EWFA 4WFZA 4ECYA 3PW0A 2J6UA 2UVRA 1LW2B 1TQLA 2GC8A 2VG7B 2J6TA 3GQCA 1TV6A 2C28A 3KMSA 4F4WA 4ECUA 4ECZA 1VRUA 4OL8A 3PVXA 3RAXA 4IFYB 3GV5B 3H5YA 1FKPA 2WK4A 4ECTA 4B3OB 1REVB 4Y34A 5KFLA 3MEGA 3G6YA 2ZD1B 3LAMA 2R2SA 4K4VA 2W8LA 3BQ2A 3KK3B 4ECRA 3FQKA 1D0EA 4K4WA 3MECA 2GIQA 3H59A 1TP7A 3H5UA 3G6VA 2C2RA 5KFZA 3I0SA 4O3RA 2HMIA 4QW9A 3FQLA 3SFUA 4XPCA 3M9MB 2JEGA 3TVKA 5DG7A 3GV7B 1RT1A 1RTDA 4FS1A 5J2PA 4R5PB 1DTTA 4K4YA 2OPRB 3QGHA 4IDKA 3C6UA 3CJ5A 3FSIA 4O3NA 1RT2A 5KFAA 4ECWA 2IM0A 3G86A 4MFBB 3KK1B 3LANA 3H5XA 5KT4A 3H4DA 2V0NA 2VG5B 3MEEB 4M95A 1C0UB 1CSJA 5KFUA 5KFCA 2FVCA 4URSA 4IR1A 3LP2A 5KFGA 2WOMB 2HWIA 3V6HA 2YNGB 2D41A 3RAQA 5F9NA 5K14B 3NMAA 4Y3CA 4FBUA 2D7SA 3E01A 4R5PA 4ICLA 3JSMB 3DRRA 5F8IA 5KFWA 2OPRA 4I2PB 3I0RA 3OL9A 4LSLA 5T14A 1RA7A 4YR3A 5HBMA 3Q8SB 1RT3B 1JKHB 3NKYA 3IS9B 3NAIA 3RBDA 2ZE2A 1T03B 1T05B 3DRSB 1N56A 3KMQA 1JLFA 2IC3B 2RF2A 3BSOA 3VQSA 3KHRA 2HNZB 2B6AA 4JV0A 1TKZA 2YNFB 3I5BA 5F9LA 3PR4A 2XWYA 3OHAA 3V81B 4KB7A 3KK3A 2RKIB 4PWDA 1S4FA 4H4MA 3E01B 1LWEA 3KLEA 4PUOB 1S9EB 2V4QA 1TKTA 5KG3A 2JC0A 2HNYB 2WB4A 1HQEB 2W9AA 3DOLB 4DL7A 1NHUA 2VG7A 5C24A 4RUAA 3NGDA 2AX1A 2UVVA 5KFSA 1HNIB 5L1KA 1EETA 4KFBA 4O44A 1S0OA 2XCAA 1SH3A 3LP0A 4TQRA 3KK2B 5KG5A 4NLVA 3I5CA 4ED0A 4X2BA 3HVAA 4ZPAA 2B6AB 1I6JA 5EWGA 5EDWA 3HVWA 1IKXA 2B5JB 3DI6A 4B3OA 5KFPA 4ZP7A 5KG7A 3MR6A 2UVWA 3PJWA 3T19A 5HLFB 3KLVA 1Z4UA 4RW9B 1IKYB 3ISNC 2W9BA 3H2LA 4IH7A 2XC9A 3NBPB 4RNFA 4NLSA 3BJYA 5F8GA 4JV2A 4URQU 1RAJA 3BREA 3T5LA 2VG5A 3MEEA 3OSPA 2ASLA 4MH8A 4NCGB 4MIBA 3DLEA 4TLRA 3RB6A 3FDSA 5C42B 1J5OB 2FLNA 2HMIB 4TXSA 5HROA 1C0TA 2C2EA 4RW4B 2AWZA 4Q43A 3V6KA 1R0AA 2XI3A 5K14A 3FRZA 3KLFB 2QE5A 4ZP9A 3MF5A 3MFHA 1QAJA 1TKXB 4KBIA 4EBDA 3CJ2A 2JEIA 2GIRA 3M8QA 2XI2A 4YQWA 1JLGB 3CJ4A 2E9ZA 2YKMA 1HQUA 3ITHA 4IG3B 4EO8A 2R8HA 2FLPA 4TYAA 5KFQA 5HBMB 4QW8A 2UUTA 2WONA 1JLCB 1HNVA 3BGRB 4ZVEA 4H4OA 1S1TB 3PHEA 4RNHA 5KT7A 2W9CA 3N6LA 5F8LA 3GIIA 4J9PA 1VRUB 5L1JA 2XGQA 4O4GB 4NYZA 3IN5A 4ECVA 1J5OA 4ED1A 4KSEB 1S1XA 2WOMA 3OSNA 2IJNA 1FKOB 1S1UA 2YNGA 1DLOA 2IMWP 2YKNA 5J2MA 4IKAA 2FLLA 2ZD1A 1KHWA 1RA6A 1JLAB 5KFRA 4DL6A 4WZQA 4ZP8A 5KFNA 3M8QB 4Y2CA 3MFIA 1QAIA 1S0NA 5J1EB 1MU2A 2FVRA 1JXLA 1S9GA 3KLGA 4IG0B 4J9RA 1RYSA 1JLQB 4NLRA 3PR5B 3JYTB 1XR5A 5DLGA 1IKVA 3CIZA 4LQ3A 4K50A 5KFXA 4XPEA 1RTDB 1RT1B 3I5AA 3ICLA 4YR2A 3T5JA 2VA3A 4ECXA 4ED2A 2FVSA 3GIJA 1TL3B 4Q0BB 5DQIA 1RT6A 4TY9A 5J2QA 3IGVA 2R8KA 1S6PB 1SV5A 3SI8A 2ALZA 3MR3A 4K4XA 4RW8A 1QE1A 3IG1B 3KK1A 4LSNA 4ED8A 2JEJA 2BANB 2VG6B 4IR9A 5KFMA 4IRKA 3HVTB 2WTFA 4WYLA 3OL6A 4O3OA 3MEDA 2ILYA 1W25A 5JUMA 3QYYA 4ZPCA 4NLYA 4TN2A 4U7CA 1JLQA 4J9OA 4Q45A 3KHGA 2RDJA 1MMLA 1S6QB 3IRXA 3KLIB 1REVA 1RT4B 4NLUA 1FK9A 1BQMA 4JUZA 4KKOB 1LWFA 4KO0A 3PZPA 1RT6B 4NRUA 2J6SA 3V6DA 4I2PA 4LQ9A 1HMVB 5HP1A 3CDUA 4RW7B 4EYHB 1TVRA 3GILA 3LALA 4MKBA 4G1QA 3NAHA 4RZRA 3OLBA 3EPIA 4J9NA 5DQGA 4DL2A 5F8NA 5KFJA 4J9LA 5L1IA 2ZE2B 1XR7A 4Q8EA 4MKAA 2OPSB 2W8KA 3DRSA 1ZTTA 1RTJA 3CVKA 3H5SA 2BQ3A 2F8EX 3MR2A 2IJFA 4J9SA 3GIMA 4H54A 1N48A 1DTQA 2ILZA 3KLIA 1S6QA 1S1UB 3IRXB 4URGA 5JXSA 3GV8B 4ECSA 4EYIB 1LWCB 2YNIB 3V81A 1C1BA 5KG2A 2RKIA 4HYKA 1WNEA 2OPQB 1D1UA 5KFBA 1EP4A 4DG1B 3KLHB 3KNAA 3QIPA 2BRKA 3KJVB 1N5YA 1UWBA 4ED3A 3V6DB 5J1EA 2R2RA 1S9GB 3KLGB 1TKTB 4GC6A 4RU9A 1HQEA 4ZP6A 2AGOA 2HNYA 3UPFA 3LP2B 5CYMB 3TAMB 2WONB 3BSAA 3I0SB 2XCPA 3M9OB 2IBKA 4G3IA 1RTHB 5D3GA 4NLXA 4TY8A 1GX5A 5KFIA 5EWEA 1SUQA 3UR0A 5C25B 1S9FA 4J9MA 1TL1A 3CJ0A 5F8HA 3KK2A 4I2QA 4ZHRB 1LW0B 4PQUA 1XR6A 5C5JA 3MR5A 1S10A 4ICLB 3JSMA 4TYBA 1S1XB 5KG4A 4O4RA 4IRCA 4K4SA 3MTKA 3T5KA 1HPZA 2IM1A 5I3UB 1RT2B 4RW8B 1OS5A 1T3NA 4LSNB 3M8PA 1IM4A 3QLHB 4ZMMA 3BQ1A 4DL3A 2AGQA 1RYRA 5DG8A 3Q8RB 4YR0A 4YP3A
chains in the Genus database with same CATH superfamily
3D28A 2BZ2A 4QWDA 4DPUA 3LW5C 2V9KA 5H9FJ 4NLOA 1PBUA 1TELA 4NZ0A 1C0UA 3DM2B 5AXLA 4JI4F 3H2UB 4F26A 2CAJA 1O5JA 5CHCB 2CJYB 3R5AA 1F3VA 2MQNA 5A8RA 2V5HG 5KOXA 4RNNA 4EU0A 4C8ZA 2MKJA 3NGUA 3T41A 5CABA 5IV4A 4Q2LA 5KT5A 2A2CA 3W65A 3BR9A 3QQCD 4WYWA 1O0PA 3M6XA 2VOPA 2OD6A 3NRBA 1HQUB 2DGWA 2LEPA 4P7VA 5DRKA 4LSLB 3G8SA 4F7VA 2R9LA 4U9RA 4M5LA 1U09A 4OHVA 2K2PA 5EX3A 5AE2A 1JLBA 2Q6CA 2R3VA 4MYTA 4OIXA 1JLEA 3H0PA 3I96A 3NNCA 1WHYA 1T03A 2ASYA 5B0FA 4DV3F 2QJ3A 2X7IA 2MLXA 4M94A 1FRKA 4DCPB 4DV0J 1UEKA 2IJRA 5LL6d 1TFYA 3POTB 1KLMB 2IRXA 4OJ1A 5GAGU 3BN7A 4GO5X 4DL7A 4ZVQB 4IQXA 4PYDA 5I3QA 4F0MA 1K44A 3TA2A 1JLAA 4DV1F 2FJEB 2XSJB 4KKOA 4ZVPB 5F8JA 4FF4A 1SH2A 3S1TA 2HZVA 3SYZA 1VK8A 4AD6A 5L38A 5KFYA 2G9OA 1XMOJ 1C0TB 3FZ2A 1HBMA 2UV8A 4JI6F 2ASJA 2OPPA 3OQ2A 3T6BA 5JMNA 3CCSS 1HNXJ 4IDKB 1NZ8A 4NL5A 5D6GA 4JI1F 4K2JA 5CZXA 4CP5A 3QO9A 4DV3J 1S5ZA 2JWNA 3T5HA 1KTVA 4F3QA 2Y8WA 2DEJA 3DOMA 1RXOB 3CJSA 3AOCA 1WC1A 2X3DA 5D77A 4X4QA 3M8RA 2NSBA 1RAHB 2JFDA 2MY8A 1X4HA 2M52A 1RDRA 5LMNF 3UCUP 4A8YA 3MCSA 2CJKA 2W9CB 2XLKA 3KJVA 5HROB 3D5MA 4DPYA 1TK8A 2XMUA 1AFJA 4PG5A 4LUBA 2GAHC 3IFEA 3MPUB 3MEGB 2DGTA 4RNMA 4R8UA 2MKKA 4C6AA 1CJTA 2HNZA 3PY8A 1AXQA 3X1LB 2H9ZA 2Y1RI 1RTHA 1KS2A 3NL0A 2H3EB 2HQ3A 3FSYA 3P96A 3MECB 2XO7A 2CNNB 1SL2A 4MKVA 2I38A 5LXYA 5LMUF 1ZZFA 4WXWA 1A7GE 2OD4A 1JJ4A 4QWAA 4UQGA 1L3TA 5AE1A 2BACA 4QYZK 3CDWA 1PG5B 1SJ1A 4R0JA 4RWWA 4RW7A 4P71A 2MQOA 3MAQA 2ZH1A 2Y9HA 5D0EA 2R7WA 3QJLA 3ENAA 4JV5J 5LT5A 2I1RA 5C24B 5DO2A 2B5JA 1MWQA 4I56A 2AHOB 1HD0A 3OXFA 2HHXA 1O6XA 4JYAF 5DS7A 3D3CJ 1MWZA 4LFCF 1YJUA 5L39A 4DV2J 4LRBA 4OV1A 4WF9Q 2CXEA 2I5JB 2HQFA 3QSYB 5J2MB 2K3IA 1NSAA 5KOWA 2M8DB 2DNQA 2GMJA 3D67A 4USHA 5CYQB 4F0HA 3G8QA 2VQEF 3RB4A 1GH8A 1RTIA 1B0VA 4UUXA 1B7FA 5AJ3F 3QJPA 3HVTA 5D8HB 1QM9A 1NMEB 1MNEA 4JI5J 4X4SA 1DBDA 3UCZP 1MU2B 2CA9A 3VAHA 3A8IA 3R5BA 5DG9A 3BN4A 4NCAA 3LTOA 3IXQA 3MR7A 3N4WA 4KYZA 3AAWB 1JLEB 4H4KC 2WSEC 2DGVA 4RR5A 5BYQA 3MMJA 5E3AA 2FPHX 3Q8YA 3IR5B 3DCAA 4OI3A 2Z58B 3NGSA 1V3ZA 2HFSA 4ZJQA 2IPOB 4GVBA 4AT1B 1CG2A 2L48A 1FRXA 1GEHA 3P8BB 4DR4F 3VTIA 2DKOB 1F5CA 2GX8A 4CYUA 1BWEA 5JJBA 4DS5A 3O5TB 3HHKA 4N41A 3DM2A 2BE2A 5AJ3J 3FBEA 4Z37A 3DC2A 2BJ3A 3BQ0A 3OR1A 5LSLA 4LVOP 5LMUJ 4IO9Q 4B3MF 3PKYA 2N7YA 2UXBF 3KLEB 1V6HA 3D6FB 4B3SJ 2VKZG 4DG1A 2C3OA 2WVBA 1D3WA 4KHMA 5ETMA 3R6GB 5HSPA 4DV7J 4TQSA 3HP6A 1C1CA 1TZ0A 1P9YA 1EETB 4KFBB 1KQGB 2F3JA 2GO8A 1SQGA 2K06A 4QR2A 3LQVA 2Y1LB 9RUBA 4FXVA 1N4LA 2JFKA 3UN5A 3ZZ0A 2B4UA 2H54B 4KQZA 1FKOA 1S6PA 1R6VA 2HWHA 2OPSA 2OMLA 3LGNA 5GAEU 3RBEA 3KMQA 1RAIB 3THVA 2H51B 4OZ1A 1NSPA 1U1QA 4KHPJ 1KWMA 3DYAB 2HHTA 4I7FA 4WTOB 3MOJB 2KJVA 4WFNQ 1T02A 4LFAF 3KLHA 1UVJA 4X4VA 2IAJB 2YNHA 2ZDOA 1XQIA 3CDBA 2HRYA 4HHHA 2HFUA 1CJVB 4NEZA 4B9UA 4DF4A 3M8PB 4NCGA 3GYGA 1PJ6A 2K7JA 3K5NA 1ZPWX 2CVEA 2VG6A 1FXRA 4NOHA 1RSCA 1ZA2B 3TUIC 3ZNJ1 2KDOA 4QIFA 1YHQS 3ILJA 4DSLA 3D4JA 3FEXB 2V34A 5KFTA 3FEYB 2SXLA 1G4CA 1PYOB 1H6KX 4NA1A 2CZ4A 3RUBL 2AX0A 4WXOA 4U67Q 4O0IA 2MSSA 1LWEB 1U0HB 5DGBA 2YKMB 3M2UB 3WHIA 4EZ9A 1HARA 4CLKA 1V9OA 5EWFA 4QIVA 1XN9A 2QA1A 3OTBA 1O8BA 5E3QA 2CYYA 5E3RA 1LW2B 2UVRA 2IA0A 4DCJB 3UN2A 1GT8A 3DGVA 3KFWX 4A47A 3LOUA 4CO0A 2N82B 3QNWB 1FX4A 3IBWA 4OJGA 1N34F 2XS5A 3KMSA 4E2FB 4OL8A 4M5KA 3PVXA 1LNQA 4IFYB 2DBBA 2XY5A 2QZ8A 2WK4A 3ENVA 3SSSA 2QIFA 4Y34A 2IDEA 2MY7A 1LFWA 4AYBD 3T1HJ 5B0EA 3G6YA 4Y6IA 2CQ4A 1KFSA 1VC0A 3MMBA 3P6YC 2FHJA 1WD6A 2QL7B 3EICA 4RBVA 4XK8C 5GMEA 2YX4A 1ZH5A 1TP7A 3H5UA 2YWHA 2C2RA 3BO3A 2KXHA 5KFZA 3LH2S 1XC9A 1Q81T 3I0SA 3KUGA 3MM5A 2NSCA 3CO0P 2N3LA 4U8VA 1R43A 4XDDA 4A4JA 4XPCA 4LF7J 1RT1A 2RT3A 3ELHA 3M6WA 4MTPA 2DRDA 2XMKA 4I6YA 1OSDA 2VKRA 4A8KA 2F4FA 3N5FA 4LF6F 3K5LA 3D0IE 3CJ5A 3FSIA 4QYRA 4ECWA 2IM0A 1ZAVA 1P27B 4ZCMA 4N8OA 2B9YA 4RUHA 3WC2A 1IBKF 2OEJA 1FNMA 1I51B 4DR1J 2HRTA 2V2VA 2GS8A 3D7SB 2MKCA 3OFHA 5KT4A 3H4DA 2DY9A 4USWA 3MEEB 3H25A 1CSJA 2QLBB 2WW8A 5KFCA 4M5MA 4URSA 2A6OA 3LP2A 1FT8A 4IR1A 3BB5A 2H48B 2ZKTA 5A8KB 3OVSA 1VJQA 3ZZTA 4RBTA 4QJVA 3V6HA 2YNGB 2D41A 1MG7A 4ZLLA 5AE3A 3J80U 1NK6A 2RH3A 5F9NA 2DNGA 3O44A 3NMAA 4RX6A 3HFKA 3NLCA 4KT0C 4JOUA 3UNYA 3PEJA 1W26A 5KFWA 2OPRA 4V19J 4DSFA 1M5PC 1TUGB 2OJ3A 2K1RB 4DSIA 3OL9A 1R8AA 4YN3B 5IT4A 3TWZA 5HBMA 1HNXF 1JKHB 4UZCA 4DSEA 1ZA1B 2GVZB 1V3SA 1OPZA 1Q16B 2UP1A 3D6TB 3RBDA 1UPMB 3RBZA 2OEMA 1CJUA 2OSQA 3C14A 3EVOA 1GTHA 3W8GA 3FJ2A 1N0UA 2IC3B 2QA4S 3E8OA 3CCUS 3SXLA 4OLPA 1B4SA 4LF1A 4JV0A 4IOAQ 2A1BA 3VAJA 3RTVA 2H5JB 3I5BA 4ZCLA 3OHAA 4G1PA 3TEGA 4DQPA 1RI7A 3KK3A 4CLSA 2EKNA 4Q5VA 1S0VA 2AJFE 3EM1A 2RHSB 3ZTQA 1VHFA 4H4MA 3E01B 1VQNS 2G2ZA 1LWEA 1PKUA 3KLEA 4C11B 1S9EB 5A2QY 3E3XA 3O6QA 2QYCA 4I69A 3OJUA 2JC0A 2HNYB 3NXZA 2UUCF 3K2YA 2BW7A 3VALA 3HVRA 1S4EA 2QSWA 5A8WA 1WKKA 5C24A 3NGDA 3HHLC 2ZHBA 1RE1B 2PC6A 3W5YA 1NKEA 1SJ3P 4DR6F 1S0OA 2KKHA 1IN0A 2XCAA 1OYEA 1SH3A 4ED5A 1GXTA 2XHWA 1YDLA 3I5CA 3HVAA 1JNZB 4J5OA 1I6JA 3V4MA 1VQPS 4P2MA 1NJYA 5KFPA 4I68A 3MXHP 2LXIA 4ZP7A 2DR5A 4W4MA 3PJWA 2DD8S 3CD5A 1Z4UA 4FVMA 4CRJA 3KLVA 3ISNC 4OYMA 4CM0A 1X9SA 4F8RA 2RU9A 4F04B 4IH7A 1M5VC 3K17A 5F8GA 1WDDA 1RAJA 2ASLA 4P7TA 3OSPA 3PO4A 4MH8A 4MIBA 3DLEA 4TLRA 3ZNUA 5DDOC 5BYSA 3CMAS 3A12A 3MOZA 1APSA 5HROA 1GMVA 2VL1A 4JI8J 1RJJA 4RW4B 2MSTA 1U25A 2BE9B 2PMZD 3VAMA 1REGX 3NS5A 4QPTA 5HQMA 4NX9A 4JI7J 3OVAA 1F3FA 3EDQB 2QN6B 2JEIA 2GIRA 2KG1A 2XI2A 1LFPA 2QLXA 1JLGB 1KEKA 3CC2S 1J5EJ 4CLWA 1S77D 1UJ4A 2FLPA 4TYAA 3Q83A 2V4JA 5KFQA 5HBMB 1PYSB 2WONA 2I6WA 1JLCB 1HNVA 2LA4A 4H4OA 1IWAA 3TX8A 3VGTA 1S1TB 3KJNB 4RNHA 4C3LA 3N79A 1C4CA 2W1BA 1VRUB 3FKBA 3MM7B 4NASA 4BC7A 2O1PA 2G0CA 2HZAA 3GJSB 3U27A 4ZLPA 4O4GB 1PILA 3KG4A 4CTAB 2IJNA 3M32B 2MXYA 1I94J 2YNGA 4YS2A 2IMWP 4DR3F 5J2MA 2CDQA 4IKAA 1FDDA 2ZD1A 1VQ8S 3AD8C 1JLAB 3GWCA 5B0AA 4F3MA 3OBIA 1HA1A 4ZP8A 4DV7F 1DHMA 2OAUA 2EFNA 3JXOA 3ADAC 3NWGA 2AF6A 3U1NA 3A8EA 4XIUA 2RQCA 2J8AA 9ATCB 2DXFA 3KLGA 1JXLA 3GYXB 3I55S 4J7CA 1JLQB 1JJCB 1WOSA 2J0XA 3MTJA 1Z2ZA 3UN3A 3QJJA 3DKDA 3CIZA 1RYRA 4K0KF 1FEEA 2Q66A 4XPEA 2AKWB 3I5AA 3ICLA 1Q79A 4YR2A 1SJQA 2EC2A 2V50A 1R6YA 4ZCIA 3TZZA 2XNQA 2FVSA 1TL3B 2ERRA 4TY9A 4KH0B 3DXSX 3SQGA 3BDPA 5J2QA 5A76A 1SV5A 3DOMB 5ETTA 3PIOQ 2M4MA 2P9GA 2F4VF 2E5LJ 4DX8H 1HR0F 4RW8A 2CPYA 1QE1A 3MMCB 3KK1A 1CQMA 4DR1F 3JSBA 1YZ6A 1TL7A 2DTJA 3KUEA 1S99A 4X66J 4DX7A 5KFMA 4IRKA 4DR4J 3EVWA 1PBAA 2BKNA 3ZTOA 2DO4A 2MZ1A 1XBWA 4FBUA 5LMNJ 2ILYA 4YY3J 1NJIT 1FJCA 4TN2A 1RACB 1CVJA 3C8YA 3TARA 3FEZA 5CH7B 5T7LA 1X8DA 4DR6J 1M1KT 3J81U 2CJAA 1NRKA 1TUWA 3GLJA 1TUVA 5IT9Y 1FTCA 4NLUA 2DH7A 1WKJA 1HQ2A 2OGUA 2HVZA 4B3TF 1RHMB 4UTGA 4JUZA 2MKIA 4DQSA 4LF4F 1M1GA 4ZJOA 1AROP 2HLTA 3UE2A 2ZZTA 1ZPVA 3CDUA 1S9FA 2QYGA 2KRRA 3NAHA 4J9NA 1FNXH 2HW3A 3MZIA 2VJUA 1NJZA 4HT7A 5BJRA 2DITA 3M2RA 4J9LA 1OQ3A 1UKUA 3Q8UA 1UEUA 1XR7A 4MKAA 1PC5A 4DX6A 2W8KA 2DR6A 1R8PA 3J7ZT 1R8CA 2IJFA 1KTQA 4X4PA 4ZLNA 3KLIA 3IRXB 1S1UB 3BGFA 4OI2A 5JXSA 4DPTA 1SVDA 5BXIA 4URGA 3CCLS 4EYIB 4DFKA 4P10A 4DDFA 2W4CA 5GADU 3G71S 2MQQA 2DIUA 4A8MP 2UU9F 2P9EA 2V94A 3C15A 2MZRA 1YRUA 3M30B 1D1UA 1WG5A 1E6YA 5KFBA 3NWRA 3KLHB 2FY1A 4NXNJ 5IS2A 3Q0AA 1UWBA 2MJUA 2R2RA 1RWOB 2U2FA 1S9GB 3GFXA 2BQ3A 2HNYA 2Y3YA 3LP2B 3BSAA 3TVYA 2WONB 3I0SB 1GNKA 3MM5B 3TJ8A 3KXDA 1RTHB 2FYXA 2XSFA 5KFIA 4FXDA 5IT0A 2MJNA 3IR6B 3GCXP 5LOQA 3T1YJ 4J9MA 1TL1A 3CF5Q 3KK2A 3PFOA 4I2QA 4ZHRB 3K7RA 2DB1A 2W4PA 4ZVTB 5C5JA 4IRCA 4TYBA 1S1XB 1HBUB 2BJ1A 2XY6A 5A0YA 2Y1IA 1QUPA 5CQGA 2P6SA 1FESA 1RAEB 2KT2A 3HD2A 4AUKA 3T5KA 2V2ZA 3HD1A 2MKYA 3M8PA 1WC3A 4QR1A 1B0PA 5DG8A 3Q8RB 2D69A 2BJ9A 2NZ4A 3CD6S 3NBPA 1NNDA 3ET6B 3F44A 4OZLA 1IBMF 2PI5A 4RW6B 1WC6A 4NLDA 3BO4A 2BE2B 1Y9OA 2ZM6F 4FZVA 2CKWA 3J80Y 4MIWA 5CYMA 2XBPA 2E1CA 2IIHA 3VHQA 2PFFB 4O3QA 3RB0A 3AA9A 2CG8A 1XMQF 4CLUA 4HHUA 2C42A 1R0AB 1Z1ZA 1S1WB 2GA7A 4ES2A 4JI7F 1IKWA 4IFVB 1SXLA 2XQCA 5DJBA 5KFKA 3NCPA 2QMUB 1LW0A 1Y7PA 1VBYA 2MEWA 3WX8A 1HFEL 1HIYA 1VK3A 2H4YB 2D3UA 2GCFA 4MK8A 1CC8A 5A0YB 5FLXU 3MMAA 4K5RA 4DUZJ 4GC7A 2FJWA 1NK7A 1HHSA 2HAIA 1FE4A 1HNWF 3R2DJ 5HVFA 1I5OB 2KM8B 3AXKA 2OH2A 4UY8T 4ES1A 2P2CB 1V5IB 2BKOA 3EVMA 4WFBQ 4ZDNA 2V4RA 1SKSA 2Q6BA 1QVFR 1GK8A 2MB0B 3C66A 1H38A 3MM7A 3WDOA 3E51A 1U48A 1EQ0A 1LXJA 5IWAF 3CMQA 3Q2SC 2E1PA 2KT3A 2YPZA 4MT1A 4WKYA 2KU7A 5GADI 1CS4B 4I7FB 3IWXA 1JIHA 3DYAA 1DTTB 2DHAA 3DLGA 1KFDA 2B8QA 1N5VA 1X4DA 2LQ9A 2WVEA 3G82A 3PYFA 4MK9A 4DUTA 4EBEA 5J2NA 3FFIB 1VQ5S 1BUXA 2M9KA 1ZTWA 4J9VA 5ETLA 4RNOA 4CI0B 1PYTA 3OFEA 3JQMA 2HHVA 2BM1A 1H74A 4C8KA 1UJ6A 2CPJA 1U47A 4F4XA 3GU0A 2W7OA 3KHLA 2N4DA 4ID5B 3MPYA 1BGXT 3DRPA 4PAAA 2KJWA 3EX7B 3BSNA 4OYPA 2CFXA 3T3FA 4QU6A 2JNJA 3DLKA 3NY0A 3BYRA 1GXLA 4PZVA 4DHVA 3TW0A 1FDBA 1DQ9A 1B7YB 1SKUB 4NI2A 3QZ8A 3HHLD 1TL1B 5DLFA 4N56A 2OTLS 3BF4A 1Y10A 2AJ0A 4OLOA 3VR1A 4ANEA 2UVUA 2RSQA 2X51A 3CNQP 1DTQB 3OTEA 4HKQA 1YJ7A 2D9PA 2MGZA 3CCMS 4DU7A 3JQKA 5EUHA 3QRQA 1RADB 4JI6J 4QCLA 3O1LA 2E5JA 2M5YA 1YBAA 2PI4A 3SFGA 1WELA 2XSJA 3A8KA 6AT1B 4WP9A 5K8MA 3RB3A 3HZGA 2R8IA 3QRRA 2MHEA 3LP1B 4HR2A 4B17A 3ZTPA 2WHOA 4HI1A 4USTA 4EFAC 1X9WA 3ZC4A 3C16A 3MEDB 4ZVUB 2W2MP 3IM8A 1LWXA 1MSWD 2XZDB 4TY8B 1GMWA 3HFZB 1VRTA 2PMHA 4FS2A 2M7SA 1YK9A 2NPFA 4F3OA 4KAIA 3IMQJ 1CULB 1A9NB 3GP9A 2LU2A 4HH0A 2P8IA 3OHBA 1WEYA 3V5RA 1U02A 1ICEB 2N4CA 2JLGA 5JVGQ 1HPZB 2L9NA 2YWEA 1H2TZ 2UXCJ 4K5SA 2B4VA 4ZVFA 3OL7A 4LREA 3MWBA 1HWJA 3BGRA 2GQ2A 3I82A 3HSDA 2PD1A 1VC5A 1L3SA 3QRPA 4A8XA 1IKXB 3DI6B 1HYSB 1Q8IA 3D6HB 3JQJA 1XK8A 3OD2A 1T7PA 4DUZF 5KAKA 1LQ9A 4LRCA 4NEYA 5GMDA 4PR6A 4R8UB 1K1QA 1VQMS 3IBCB 2DNMA 2ROGA 4NWBA 3Q8QB 4L73A 1LWCA 3B8HA 2UXDJ 1SPBP 3TJ9A 3M9NB 3N28A 3B4MA 2RQKA 1N6QB 2AMCB 5CAAA 1HBNB 1VIXA 1FXDA 8AT1B 1XMBA 1YLXA 4CYUB 4WFYA 3FBCA 1UWBB 3OL8A 4KV8A 3PW2A 4JI3J 5KFVA 2EC0A 1VS3A 3GFZA 3UQSA 4NRTA 2C2DA 2LDIA 1ZETA 4YMEA 1V3RA 3CEDA 2OPPB 3CCJS 5BR8J 1NDKA 2OEKA 2FVPA 4DV2F 1TKXA 2XHCA 1M5HA 5HJXA 5HL7Q 4EMDA 3IS9A 1NDLA 1U6FA 2B8PA 4N8NA 5I3UA 1OIAA 2ZFHA 4OHZA 4AE5A 4X64J 1B0TA 1IR2A 1HI8A 1JLFB 3D66A 1QE1B 2BJ8A 2ZOMA 4IOBA 4L76A 4MIAA 5C42A 1S72S 4KV8B 2QSFA 1YBUA 3SDEB 1ULRA 1BQXA 2Q3PA 3FNNA 2MQPA 1U1MA 1WF1A 1KQKA 2QTWA 5DGAA 3SBMA 4FN5A 4CTAA 1Y5NB 2QG9B 2RS8A 3VGUA 4HT5A 5CCLA 3QATA 2H5IB 2VPZB 3VAGA 2R2UA 1U2RA 4K4UA 4NXMJ 2EBGA 2WBMA 3QIDA 4C11A 1S1VA 3OR2B 3LWMA 2HNDB 4OX6A 4DN0A 1AUSL 3OT9A 3TI0A 4K4SA 3Q89A 2ZOFA 3R5CA 5KFEA 1UVNA 4H4OB 1U7LA 3BR8A 4K7QA 3G87A 5DZ6A 1KSPA 2HS4A 2R7OA 3UO0A 1HMVA 3LAKA 2EXUA 1NK8A 2BBEA 2DGSA 2G1DA 2ZJRQ 1NM2A 3OVBA 3DGPB 3U1LA 2UUWA 2YKQA 5J2PB 1VJWA 4B02A 4DR7F 1KVJA 2CPHA 2OP5A 2ROPA 4CZCA 5J2QB 4ZPDA 4CLYA 3M6VA 1DLOB 3AQOA 3FCWA 4C8MA 4RW9A 4ELTA 1KLMA 2DHGA 2QC3A 1QVGR 5GVQA 4B9MA 1BD6A 3MGJA 4CM2A 3EPGA 1AUDA 4F50A 4NLPA 3LWLA 1HBOA 1TV6B 4N7TA 1N5YB 1CC7A 3AQPA 2YWKA 4DF8A 3L9ZA 4UQTA 4O0NA 2O5DA 3DLLQ 4FXWA 1RTIB 1GX6A 3GYNA 3NS7B 2CIMA 1FHTA 4OX7A 4LBIA 1NJXA 2HBRB 2HS0A 4FBTA 2W7PA 3DRPB 4XO0A 4F4ZA 4ID5A 3OJSA 2OHDA 4PKDB 1YWXA 3W66A 2GW8A 3ISND 1P1LA 4EK2A 1J5EF 3TAMA 3HHDA 1E6VA 4J9QA 4IRDA 1RCOB 4B3SF 2F8HA 4LF8F 1KVIA 2G1HA 4IO1A 1MROA 2XZTB 2QFJA 1VISA 5DETA 4M8LA 1ZS6A 2NYHA 2CJBA 2VJVA 2J6UA 1TVRB 1N0VC 1TQLA 2D9OA 2IBOA 5G0RA 5CZVA 2ACMA 2J6TA 3GQCA 1SC4B 1K47A 5A6PA 4JI3F 1FWKA 2BJDA 4ECUA 2DGUA 2RHQB 1ZM4A 2JLFA 1QAXA 3HF5A 4C7QA 2DXDA 1RWXB 4TKTA 2HBZB 5H9FK 2DCLA 1FXLA 2FGCA 4HH1A 1X9MA 3SDEA 2CNKB 1TR0A 2R7SA 4DXLA 5LXRA 2J0QD 2RILA 3C15B 3M30A 4GKKF 3CCWA 1OO0B 1Y5IB 2E66A 2C2NA 3SCKE 1X5SA 1HKAA 2GNKA 3AT1B 4ITSA 3UWTA 5A8RB 2GIQA 2I0XA 2UZAA 2WBRA 4KGXB 5IFMA 2KH9A 2RRAA 2B9WA 3ZXWA 3ZZUA 2KYXA 4O3RA 2MHNA 2YVSA 2HMIA 4PQAA 4QW9A 3Q22A 3FQLA 3SFUA 3HXMA 4LVNP 1FNOA 4USUA 2IVFB 2FGOA 1RTDA 1D9AA 1SKWA 1QY7A 4FS1A 1YITS 5J2PA 3BGOP 3NP5A 4K0KJ 4ANCA 3R97A 2ATCB 2EBEA 1IUJA 4KRWA 5EN1A 2CZ9A 4IDKA 2OLWA 3C6UA 4LFCJ 5KFAA 2BOPA 1FO1A 2COLA 3X3UA 1M5OC 1D8YA 1T0TV 4J9UE 5DDRC 1HBUA 3EZOA 3EWGA 2DJWA 4JB8B 1HR0J 2MLZA 1U49A 1Q78A 4USVA 2ZJQQ 4M5DA 4CDIA 2VG5B 2LU1A 2A18A 2DNKA 1R7IA 2FVCA 2PFDA 3CW2C 2ZH8A 1U4BA 1VQLS 4LBHA 5AXKA 5KFGA 1VI7A 1ZM9A 3ET6A 2HWIA 2NUHA 4GVLA 4P2XA 3A3PB 7AT1B 4NI2B 3D2WA 4KH1B 2UUBF 2HVEA 4PPZA 3TR5A 2KVIA 5U47A 1ZM2A 2EFVA 2J7WA 3L7PA 3RYLA 5HQLA 4DS4A 1XNRJ 2KXNB 1FJEB 3JSMB 2DHXA 2NXJA 3I4PA 2DNOA 4ETZA 4YDXA 2VONA 3PHTA 2AD9A 4M5NA 4C97A 3HJFA 2K7KA 2C3PA 4TNOA 2KT5A 1VDHA 1TMMA 3HLUA 1WORA 4ZVRB 3W62A 4UOGA 2NS1B 3JAMU 3Q8VA 4YR3A 4NZ7A 4C0BA 1A6LA 1U0SA 3IAM9 4DPXA 4L6V3 1RHQB 3DRSB 2AEJA 2IRYA 5B09A 3MUTP 4Z7CA 3L09A 3ONQA 3TP2A 4ATNA 4AL7A 2AYGA 1SJRA 2UV8G 4PG8A 1VQYA 2E5HA 1XMOF 3PR4A 3C16B 1XJWB 4M5HA 3V81B 3CCVS 4KB7A 1YJTA 5IQQA 4ELVA 2OTJS 2Y1JA 4DR2F 2R7UA 3POTA 3MMCA 2ZH2A 3O2IA 4FNIA 1AYEA 2C2OB 1NBEB 3MMAB 5ETQA 2L9WA 5DM6Q 1U2FA 1TKTA 5K5MA 2O67A 4YDDB 1WHVA 4CLPA 3DOLB 4FF2A 4J37A 2FJAB 1NHUA 2DK2A 3Q24A 3BDEA 1M0SA 2VG7A 1WI6A 3GFYA 3PRBA 4ID8A 2AX1A 3NG8A 4ZN1A 2E7XA 5HMYA 4RUAA 1TAUA 1HNIB 2F5GA 1EETA 4KFBA 5ETRA 1YKWA 4RUBA 1J27A 3LP0A 1X4BA 4NLVA 2FDNA 1RKJA 2YQ0A 4ZPAA 2ZHOA 5EDWA 2AT1B 2KO1A 3PACA 1U1LA 2A3JA 5KG7A 3MR6A 4X62J 1H72C 4P72A 1X4GA 3GSIA 3V2UC 2NXUA 3BBCA 3H2LA 1K8AT 1VQKS 1JJHA 1IBLJ 2XWXA 4C0HA 4KR0B 2WSFC 4NLSA 4RNFA 5M2PA 2C1EB 3FVYA 2V8HA 3W9IA 3BJYA 4P6QA 3BREA 3A8JA 2VG5A 3T5LA 1VHIA 4OHXA 2VODA 3D68A 2BXJA 2K8GA 4DV0F 1J5OB 1WUUA 4PG4A 2R7TA 1BXNA 3V6KA 1YG0A 2XI3A 3CJ8A 3DFEA 3KLFB 2M88A 3FRZA 4Q2MA 3QFHA 4ZP9A 3P5TL 4NE9C 4B9LA 2ZBCA 3MFHA 4KBIA 1N33F 3M8YA 3T1YF 3M8QA 2UUCJ 1VLYA 2E9ZA 1WHWA 1VMBA 3D0GE 4IG3B 4EO8A 3R2CJ 1WDTA 3R3TA 1T9YA 2UUTA 1K0TA 3ULHA 1NXIA 2M3DA 4ZKAA 1XNRF 2B7BB 3GIIA 4WPAA 3K5MA 3MPDA 4LF5J 1N88A 1R0BG 5L1JA 4JI1J 1MN7A 3IN5A 1MLAA 4ED1A 2VUGA 2JOQA 2WOMA 1JQGA 3OR1B 4DMZA 3TOQA 1FKOB 2F8MA 2K3KA 1DLOA 3BKTA 2W4DA 2FTRA 2RQMA 4WZQA 1ZAXA 2FZKB 3KDNA 1YJ9S 2LP4A 2ZH9A 1UA0A 4LRDA 3M8QB 3EGWB 6FD1A 5KFNA 2R4FA 3GJTB 2ZWPA 2XYPB 3MFIA 1QAIA 3GFHA 2YH0A 3KNGA 4DLGA 4IG0B 3NOCA 3ILIA 4X66F 1RYSA 3H90A 3PR5B 3JYTB 5DLGA 3KKFA 5B0CA 2E5LF 1RTDB 3GONA 2HKEA 3T5JA 1FA0A 1WC4A 2ZUGA 4ED2A 1VQOS 3GIJA 1F5BA 3P5BP 5C7PA 2RRBA 4KC5A 2CPEA 1QJHA 2OO4A 4BWMA 1PGZA 3HK2A 3ENQA 2BM0A 4X4OA 1CLFA 1OJ4A 4TU7A 2ZBPA 3K5PA 2MDAA 4ED8A 2BJEA 2CPZA 3A1YG 2JEJA 4EZ6A 3IC1A 2MMYA 2BANB 4HTIA 2DNZA 5HJYA 3PKMA 3D54A 4FYVB 2ABYA 1F9FA 1H2UX 2VV5A 4PG6A 2HYIB 4O3OA 2GHPA 3AJ1A 2YQ3A 4G65A 3R7NB 2RD5C 2AEMA 3RAMA 4NLYA 3GJQB 5JUMA 1JLQA 4U7CA 2HVHA 3RR7A 4LIWA 1N33J 4WKRA 4C9DA 1REVA 3GSDA 1G3OA 1UW9A 2E1AA 1N5QA 1RT4B 2GQQA 4PWUA 1JJ2R 3GTYX 5AT1B 3R7SB 3OTDA 4KHPF 4UW2A 5K8PA 1BQMA 3FK4A 1CJKA 4M63A 1VBKA 4KKOB 1LWFA 1HWIA 2H5EA 3MCOA 3T9NA 4F25A 1JWWA 2ZUAA 4LQ9A 5CA5A 1TU0B 2ZJPQ 4RW7B 4EYHB 3PYEA 3GILA 3LALA 1L3UA 4G1QA 4WTYA 2MKSA 1SC3B 3BPDA 4ZIVA 4XTTA 2KTQA 2V69A 3TANA 2C3UA 4V1Ak 2HWTA 5F3TA 1EARA 4BLGA 2HHQA 3HHLB 2AZ3A 3DRSA 2NLWA 3US5A 4CLTA 3L95X 3Q2TC 3MR2A 3KYLA 1YRTA 2V2KA 3K59A 2CWXA 3GIMA 1PAUB 3NCRA 1DTQA 2ILZA 2X1AA 5E5NA 3GV8B 2M8HA 4PWWA 2YNIB 1C1BA 1F9EB 5L46A 5KG2A 2MZSA 2VICA 2OPQB 3TZXA 4AFFA 2ZH3A 1EP4A 3QIPA 5JVHQ 1BHNA 3MURP 4Y65A 3EYZA 1T9XA 4YB6A 1UFLA 3J7YU 3UD4P 5BYRA 2BX6A 2VH7A 1N52B 3TX0A 2Y0SD 4C3KA 4ZP6A 5IV3A 1NB7A 4AL5A 4ZK7M 3CIMA 2IBKA 3EJMA 2ROEA 5B0GA 5D3GA 3F56A 4RJVA 1P9QC 1YZ7A 1RWWB 5C25B 2FQQB 2JH3A 2XMVA 3BH6B 2DGOA 4LIRA 3TZWA 3VF0B 5F8HA 2OSRA 3UDCA 2DEIA 4PQUA 1DURA 2FZCB 1XERA 3CJTA 3IP0A 3PEHA 3PM9A 1Y0HA 4ICLB 1YBTA 2B51A 4NMXA 3UR3C 1U0HA 4O4RA 4OX9F 4C0OC 3CDAA 2ZOGA 1UZDA 3ZFVA 4DZ6A 2V68A 3R8YA 2ZZNA 1K0VA 4ILRA 4CCHA 1OS5A 2C3MA 4RW8B 1IBKJ 4DQIA 1FVSA 2AV5A 4DL3A 2GGPA 2AGQA 1E6YB 5HAOA 4CNYA 5E33A 1R8BA 3ILOA 4RO0A 5MLCV 4DL4A 1N36J 3LPYA 3BGLA 3O3LA 5L9XA 4MAKA 1HI0P 1FKPB 1TTHB 3T9ZA 1RWKB 5E7OB 3BBFA 1ZOTA 3R5GA 1VRTB 2J0WA 1NHVA 1S79A 5FLXY 4M5JA 1W2BR 2HNDA 3HX9A 1VQ6S 1S1VB 5C2CA 2NREA 2P6TA 2QA4G 1DFDA 1Q95G 2BEFA 2LCWA 3ZTSA 1T9VA 1UA1A 1NDCA 3GJRB 4MK7A 4Q8FA 2HS3A 2VFTA 3AFGA 5B0DA 1TK5A 2YY3A 2QO3A 2XULA 4OV6A 4ZVOB 4YEAA 2IC3A 5L1LA 1MW7A 3HSZA 5KG6A 2DNHA 2HBYB 2LXFA 3RGIA 4P73A 4LF5F 4WE1B 2CNLB 2EI5A 2KL8A 4QPXA 5I4MA 4LSZB 1UVKA 4HI2A 4I6WA 4U96A 2B43A 4LBPA 1HHTP 5T7LB 2BVZA 1T9WA 2LLZA 3HKWA 5HMZA 3DDKA 3Q8PB 3N6NA 2IAJA 2YNHB 2YNFA 1NO8A 1RT4A 2CJQA 3DXBA 3MCNA 4KE5A 1YTYA 3KOAA 3KWMA 4DR5J 3BH7B 4OYBA 2RDIA 4DFPA 2KFZA 1NSKL 1MN9A 3DOLA 4L72B 3RRKA 5ADZA 2EPIA 4PXCA 2WZ1A 1TKDA 4OZ0A 4FDFA 2N3OA 3PW5A 1VC6A 3PJ9A 2D3ZA 3RG6A 2RS2A 4IG0A 2FB0A 4R25A 1U1KA 3PW7A 4P2SA 1ITPA 2FJXA 4UOCA 4ED7A 1RHRB 4KIAA 3DLBA 3NNAA 1NKBA 1HL6A 1OY8A 1FI4A 3DHXA 2PE8A 3JTPA 4OYZA 4UOHA 1XNQF 1FJGF 1IBLF 2EK6A 4PQUB 1Q53A 2IFXA 2VBYA 4OI6A 5F0UA 1EIYB 1KRPA 2ZBRA 4O3SA 2KM8C 4X65J 2DPIA 3IGNA 2LVWA 2QLFB 1RGVA 3R6LB 3OUYB 2CQCA 3THTA 1QAYA 1IM6A 4NLTA 2CQGA 3TEHB 4CWBA 2WCXA 2ASDA 2DNLA 2HHUA 2QFIA 3CO9A 4K4ZA 4CH0S 3GIKA 4B3RF 3DLEB 5ITHA 1KQFB 1RISA 1Y5LB 2I8EA 2MQLA 4DV4F 2VFUA 1FE0A 2VC0A 3DU5A 1SUQB 1S1WA 1KHVA 2RAQA 1WTFA 2WVCA 3DDIA 1NKCA 1QSYA 3TQ1A 5KT2A 1FK9B 2BUNA 3OR2A 4QQBA 5BR8F 3LGHA 3H4BA 1AW0A 3CJRA 2E1MC 2XMJA 3J7AN 1VBXA 1PO6A 1JXVA 4C98A 1UETA 2J0SD 1FD8A 2VHGA 3AH6A 1CPZA 1XWLA 1NZAA 1SQFA 3SEOA 4B9SA 4G1QB 1C1CB 1ROFA 5F8MA 1AT1B 1S97A 2HGLA 3JSRA 4F36A 5DZ7A 2B7CB 4WWSA 5F3ZA 2VPXB 2XO6A 1YSJA 5IZHA 3E2EA 4YHHJ 3C6UB 3C6TA 3LP0B 1NH8A 4KGKA 1WKLA 3DMJB 1LW2A 2HFNA 3T6JA 2ZVIA 4S0MA 3AOAA 4KHRA 3SQGB 4NLQA 4EEYA 3CWJA 3VAIA 3HCXA 1R89A 1ZZNA 5G4DA 2IHR1 2BQRA 3QT7A 5J2NB 3LO3A 3UI3A 2YKNB 4HACB 4U6PA 2ADCA 3DLHA 1G1XA 1GFWB 4M5DB 3O8WA 5A2QU 2UXCF 3D1OA 4M1KA 4U7UD 4RUCA 1KQSR 1IKVB 1D09B 3DRYA 2R7RA 3I31A 3PYDA 2PO4A 1D8ZA 4HLBA 2DNYA 1SIZA 2OFGX 2W25A 4WP3A 3HMJG 1RT7B 4Q44A 1MROB 4WK1A 4NLWA 2ZHAA 1SH0A 1Y00A 2FJBB 5AXMA 1RT5B 2DR9A 3H98A 4IH6A 2G13A 3N01A 5DQHA 3V4IA 1IKYA 3DLJA 3M8SA 2W9BB 2HEKA 2LEBA 2G2YA 3T1HF 4QWBA 2V2QA 4DUYF 2QL9B 2EEYA 2W2QP 3ILLA 4LRAA 1KOHA 1PAEX 2MZTA 1FFGB 1C2PA 4R0EA 4FPIA 4ANDA 3R9LA 2AU0A 2ADBA 5J1NA 4L74A 4N76A 1OY6A 2Y8YA 5KT6A 2YX1A 1FRHA 4FNHA 1RP5A 2VZ9A 1NSQA 4RW6A 2GVDA 2J9DE 4AXJA 4QWCA 4JV1A 2C22A 3PX0A 3WIVA 4OQJA 1XNQJ 2FLOA 2NCKL 1LWFB 1FWLA 1NDPA 2NXEA 2VFVA 2QEXS 5EGYA 3P49B 2IM2A 2CQ0A 4PUOA 3UVJA 3UD5A 1YX2A 1MWYA 1P6TA 2QL5B 5KG1A 3AB2B 4ETXA 2ATLA 2FHMA 2R7VA 1KONA 1EP4B 1F2HA 1WJ9A 2YWFA 5D4LA 2XEXA 1TL4A 3GZ7A 5FDLA 1FCAA 2DY1A 2Z57B 1HNIA 3CCRS 2AEFA 2F1FA 1NCLA 4O44B 2ZKUA 4DWIA 1RLDA 4G1IA 1KD1T 4DLEA 1MMNA 1R31A 3AD7C 3GG0A 4D3HA 4OHYA 3LP1A 4JBCA 4Z2XA 1JMTA 1SB6A 3LF0A 4JI4J 1SV5B 4OYAA 2VD3A 5I42A 3EXYA 4IYQA 1VBZA 4ZCKA 1RTJB 4ECQA 1EHWA 4O3PA 5HLFA 2Z2MA 3EZUA 2J76E 4WJBA 4D3GA 2BR0A 1SJ4P 4NXMF 1FTRA 4P74A 4DCOB 4DPWA 1R0CB 3QIPB 2L08A 2JLEA 1NK4A 1G7CB 2WSCC 3I9V9 1VYAA 2X3GA 4Z7YA 1L5UA 4PEOA 2G4BA 1N6QA 5H9EJ 2L41A 2AP6A 2BE7D 2C2KB 2F9JA 3PJXA 4WK3A 3S01A 3MDFA 3JYTA 4CO2A 5E41A 4KJIA 2QMWA 2B9XA 1RUSA 3SCIE 3IBFB 5KFDA 5D15A 1N5TA 4C2MA 4DR3J 2DR7A 1N32F 4H4MB 4OYWA 3RZAA 3WZ0A 1O51A 1HYSA 2L3MA 1JX4A 5SUHA 1VQ7S 3I0RB 1BQNB 4ECYA 2LFVA 3EGVA 3RR8A 4WFZA 2AYBA 2LECA 4A48A 2X1FA 3D6MB 3F0NA 3GG1A 2GC8A 2VG7B 4B3TJ 2JRSA 2BYCA 1TV6A 5I3PA 2C28A 4F4WA 1X4CA 2LQJA 1RU2A 2FHJD 2H1YA 2KN4A 4FF3A 3U02A 2BW2A 2YX7A 3H5YA 1FKPA 3UFCX 4K2XA 3JTNA 2WB1D 3HHLA 2EKYA 4FF1A 1FJ7A 5KFLA 3WQPA 3NCQA 3J81Y 1RWPB 2ZD1B 3LAMA 2R2SA 3W5ZA 5GMKa 2UUAF 3H7HB 3BQ2A 4ILLA 1QSLA 3FQKA 2XLJA 3PG9A 3RW6A 1D0EA 4K4WA 3TAQA 4FKXA 5M2RA 5L8RC 3MECA 4CLZA 1AFIA 2Z2ZA 4K8RA 4CT9A 1Q82T 4OZ5A 3G6VA 3ZZRA 4DUYJ 1AZSB 1Y3KA 1RAFB 5RUBA 1FWPA 3ENWA 4X65F 1OY9A 3BS9A 4TU9A 2IVYA 4RPFA 1SIWB 1SCJB 5A8KA 4DV1J 1R3NA 3M9MB 1NK5A 3TA1A 3K8VA 3MM8B 3TVKA 3K58A 2JEGA 3GV7B 1DY3A 2YWGA 3H8YA 2V67A 3VWSA 2HHWA 3G96A 1FDAA 4R5PB 2LEAA 4ZA1A 1QTMA 4I1TA 2XB2D 4ZN3A 2PEHA 3QGHA 1R27B 1K73T 4JYAJ 5DDQC 3G86A 1Y4ZB 2GMLA 2KXFA 1QTNB 2LYVA 2V6AA 4ES3A 1NU4A 2HFVA 4PYAA 4GRSA 3VAKA 2JL9A 1UP1A 3BBBA 3S8SA 4DQQA 3LANA 1WEZA 2B3TB 3MI7X 4LFBJ 2BDPA 3H5XA 1RK8A 4OZ3A 3WC0A 1XMQJ 4DSKA 4P75A 3UD3P 1C0UB 1FRIA 1HW8A 1BWVA 1Q0NA 4J91A 1B70B 2GJ2A 2DRAA 2NR0A 1UPPA 2EFOA 3THPA 2GIFA 3S7RA 4KGMA 3KJQB 3UNGC 1D9DA 4FYWB 1OSCA 1U6BA 2P5VA 4CT8A 3HSJA 3QAUA 3DRRA 2RJZA 2ZITA 1DARA 1X0FA 3I0RA 3HSGA 1RKIA 2F65A 3I9ZA 1F6TA 3ISZA 3KJFB 5T14A 2DVIA 1RA7A 2AJ1A 4JI0F 4UT4A 5K8OA 4C8OA 1ELOA 5EHHA 1RT3B 2D3OR 2B4OA 4N47A 3IS9B 2ZE2A 1T03B 1T05B 1V5VA 2NPIA 2GO9A 1X31C 3AOBA 1N56A 1KVKA 1NK9A 3BZQA 1LEOA 1JLFA 1RAOA 3MCMA 4DJBA 5ETNA 3BSOA 4LFBF 2Z56B 3M2VA 2HNZB 4XAKA 3HT3A 2ZZMA 1QSSA 3R27A 1M1HA 3AB4B 4MMOA 1Q5YA 1TKZA 4OZJA 4ZS6A 5F0WA 2XWYA 4DBQA 3PXGa 2WW4A 3Q23A 2V8VA 2RKIB 5IC4B 3B6BA 4HEA9 4PWDA 1S4FA 3CD7A 3S6EA 5IWAJ 2EG2A 4PUOB 1CQNA 2V4QA 3EGZA 1AZSA 3PYGA 4I0WA 2RUSA 1HQEB 2W9AA 4RLEA 5ETVA 1PJ7A 4CH7A 1F1BB 5C2GA 2UVVA 1ZAWA 5KFSA 1M5KC 1UTAA 5L1KA 2E5GA 4TQRA 3KK2B 1CS4A 2NXNA 3OUYA 1X5OA 2NYIA 2B6AB 5EWGA 4JI2J 2B0GA 3HVWA 1IKXA 3DI6A 4B3OA 1JK9B 2CPDA 3IAS9 3UDVA 2UVWA 2ZC3A 2RB7A 4QIEA 4RL1A 4DQRA 4X2BA 5HLFB 1VIOA 1WC5A 2ZBIA 5HVHA 1IKYB 1NLKL 5MAOA 3DRXA 2G2OA 2W9BA 1NK0A 1HW9A 2UXBJ 2APOA 2POKA 2J7KA 1GMUA 3NBPB 3RJMB 5CCMA 4DSJA 3QFWA 4JV2A 4URQU 1IR0A 3MEEA 3AHPA 3FMWA 1YRXA 1YJWS 4KPYA 1HBNA 2Z2LA 1F9HA 2QRRA 3FDSA 3PRVA 2HMIB 1FEHA 2KHDA 1C0TA 4UUWA 2C2EA 4LF8J 2YH1A 1SBRA 2AWZA 8ATCB 1LV5A 1R0AA 2VC1A 5K14A 4QYZJ 1CULA 3MF5A 4C8LA 1N5SA 3MAAA 1QAJA 1TKXB 1RBLA 5K9FA 3OTOF 4L75A 1TAQA 2AJ2A 4YQWA 4DV5F 1OPIA 2J9CA 4B9VA 4PXDA 1HQUA 4WCEQ 3M6UA 4UOFA 1UFKA 4AXIA 4N77A 2KZZA 3QT6A 4QW8A 3W63A 3B54A 3BGRB 1LKZA 3EE3A 4ZVEA 1Q7LB 5GAHU 4QU7A 2HVDA 5HANA 1EKRA 2ACYA 2RUGA 3PHEA 5KT7A 3N6LA 5F8LA 1SJFA 4ZOSA 4EWTA 4ZJLA 1NJWA 1LXNA 2HGNA 2XGQA 5HI7A 4ECVA 4NYZA 1J5OA 2VU5A 2L9DA 3B82A 3OSNA 2I2YA 3NNHA 1S1UA 2UUBJ 2JHEA 5LM7E 2YKNA 3LGMA 4HACA 4OJ3A 1SL0A 2CRLA 1Q86T 1TFWA 2RRNA 3MAAB 4X84A 2KFNA 5GAHI 1TL7B 3BYPA 3FMBA 2KZMA 3FRYA 4Y2CA 4UF4A 1RBOB 1S0NA 1KBRA 1MU2A 3W2WB 3HDSA 3CJQA 1H0HB 3DGPA 4I64A 3R1HA 3CCES 1XR5A 3SMZA 4USKA 1IKVA 4G6VB 4LQ3A 3N5BA 1PSDA 4OHWA 1DQ8A 2FZGB 5KFXA 1RT1B 2KG0A 2X1GA 2VA3A 4USIA 2GQCA 4ECXA 1HI1A 5FD1A 3M2VB 4Q0BB 4GO7X 1RT6A 4LJMA 4ZVSB 5DQIA 2HK3A 1ACMB 2AZ1A 1IR1A 2EG1A 3R5DA 2AJQA 2R8KA 1S6PB 3SI8A 3MR3A 4K4XA 3ZZZA 3CXCR 3AXMA 2MQ8A 1WHXA 3CD0A 3IG1B 5F41A 1WG4A 2CQIA 2VG6B 4IR9A 1D9FA 5KTQA 3NS6A 2CQ1A 3FCVA 4WYLA 3OL6A 2VQFF 4A8WA 2KRBA 1B3TA 2HVIA 2G0IA 3MEDA 2FHKA 1FRLA 3A3OB 3QGPA 3QYYA 4J9OA 3RRGA 4CLFA 2JVOA 1NPKA 3KHGA 2JSXA 1E6VB 2LDYA 3C2PA 3IRXA 3KLIB 1RZMA 2F4VJ 2QX0A 1T11A 4OI4A 1RWNB 3JS9A 4LF9F 2B4PA 1FK9A 4DOZA 2E5IA 4KO0A 1FFWB 2ZNYA 1IQZA 1RT6B 4I6AA 2C2ZB 1QD1A 3PZPA 5G0RB 2J6SA 4I2PA 2ZNZA 1VGYA 1WACA 3EMTA 1S7HA 2AIRB 3TA0A 5DQGA 2J5AA 2RDDA 3SV3A 3CC7S 1WEXA 2XS2A 1EX8A 5L1IA 1UZHA 2ZE2B 3N9UC 2OELA 4A8QA 1U1PA 3QWUA 1CJUB 3C14B 4Q8EA 3H5SA 1FDNA 1F0XA 4W92B 4H54A 4OFZA 1FF2A 4U95A 3DDNA 3MD1A 5M2UA 4FVCA 1LWCB 2E7WA 4K59A 2KI2A 3DU6A 4HYKA 2YXLA 2OI2A 4MYUA 3H42A 3U1MA 4LF7F 1WC0A 1L3VA 2HFOA 3PV8A 4LR9A 1RB0A 4TLQA 6FDRA 1YI2S 1TKTB 4GC6A 4RU9A 1HQEA 3PIPQ 2V4JB 3ZZOA 4F2RA 5FIIA 3TAMB 4G3IA 4DU8A 4ALZA 3M8WA 4NLXA 3HULA 1BY9A 2RVJA 1EZZB 2JX2A 3VVUA 3AD9C 4LMZA 1SKRA 1HWUA 3CJ0A 2OKQA 1LW0B 1RWUA 1S10A 4M5IA 4ENOA 3TYTA 2E1RA 3W1YC 1NH7A 3ETMA 4HTJA 1W7WA 3MTKA 2W2PP 4UY85 4LR7A 3VCDA 1HBOB 2QT7A 1JB0C 3MHYA 2HGMA 5I3UB 1RT2B 2JVRA 5D0RA 2Q43A 4ZMMA 1G6BA 3QLHB 2BABA 2LKZA 5E3CA 4LR8A 5IQ6A 3TUZC 3BQ1A 2CNOB 3SSRA 4Y2MA 4YR0A 2XS7A 3GR0A 1WOPA 2BRLA 3OLAA 2D3O1 4YFUA 2GVDB 3J7A1 4LF9J 3KHHA 1KC8T 1H7XA 5H1SV 1Q8BA 3DRRB 1YGYA 2CPIA 3L7OA 3W61A 1YVFA 2IRUA 2YTCA 2A2DA 4WIQA 2PN6A 3PCOB 2ALYB 1UWAA 1VLOA 2VBWA 1P8GA 3L4BC 3MM6B 2VOOA 3D1HA 4EGLA 4FKYA 4QIWD 1RWMB 1JKHA 2BV3A 5FDLB 1Q1KA 1DJ0A 2GZOA 2HURA 5KFHA 3PO5A 1T05A 3I4HX 3FBBA 2CQPA 2F40A 4PXBA 4RWXA 2RF2B 1RT3A 4X4UA 4IFYA 1RT7A 2CPFA 2HFZA 1X4EA 2O3DA 3EXCX 3CGIA 4FYXB 3NGRA 4TVAB 5I42B 1FERA 3BGUA 3M8ZA 3QGIA 2ZH4A 1NHKL 4LF6J 5E0OA 5B7WA 4O4GA 1H98A 5L9NA 2NXCA 3QO9B 3TUJC 4OYOA 4KY3A 1UMJA 4CO5A 3NMRA 4PWDB 1GTEA 2QGFB 2YWWA 3CE8A 4PCQA 1TKZB 4NPOA 3BO2A 2YNIA 2HPUA 2XM3A 2I5JA 1UJ5A 3SSQA 5KFFA 2EWHA 4DV4J 4W90B 1AA1B 5LSOA 3OV7A 4KO0B 2ZBQA 2AYMA 4ELUA 4HDGA 4LRFA 2CJXB 2XGPA 2PA3A 3HHNB 1DRZA 4WFXA 1S9EA 2GJIA 1S0MA 2WAQD 3JSYA 1X0PA 3QPIA 2KFYA 2WRMA 1JNRB 4QOTA 1T9TA 4OYXA 2Q79A 2HBQB 4WE1A 5HATA 3UVJB 2Z30B 1BQNA 2HIYA 1N34J 5CXTA 4I2QB 4ZHRA 1S6UA 5HMXA 5CD4A 1URNA 1TL3A 4ZITA 4MFBA 1IQTA 2J7UA 2LXUA 2BQUA 3TUPA 3DLGB 1IBCB 3CDEA 3QGGA 2QV6A 5ETSA 4F4YA 2AGPA 4MKYA 3VVTA 3A4TA 4YOEA 4P52A 2DPJA 2GFFA 3QLHA 4WP8A 2HLUA 5KT3A 2VPYB 4PPDA 2VQFJ 3G2XA 3EDRB 3N6MA 4CO3A 4C8YA 3DOKB 3BEGB 2QLWA 4OZ2A 3OTOJ 2KYZA 2V8DA 4DV5J 1SI9A 2V8PA 3BSCA 1FX2A 3DLKB 3TNVA 5D3GB 2JZ5A 4RW4A 2WVDA 2W24A 3D9BA 3CCQS 4DL5A 2UUAJ 1N32J 1BC6A 3UW1A 2JC1A 4IFVA 1IKWB 1NPRA 3OW2R 1BQMB 1KKHA 4FPRA 2HAFA 1OYDA 3QZ7A 3IWLA 2DNNA 4ED6A 4IH5A 3JAMY 2MKHA 3K57A 1RAAB 4QR0A 1Y11A 1H73A 1SQEA 3ITHB 3MM8A 3VZHA 2VQEJ 2HHSA 2IY5B 1RHJB 2FD2A 5THWA 2DNPA 4K4TA 1IBMJ 4X62F 2HHHF 2HHPA 1JLCA 1HNVB 3D0HE 3QT8A 3RBXA 4PG7A 1N36F 2Z4PA 2MTLA 2CVIA 2PT0A 1T95A 4FYYB 1S48A 1U24A 4J9KA 4B3RJ 4YY3F 4AL6A 2XMWA 3EGNA 3OPKA 1S7IA 1T94A 2IM3A 2VF3A 3V4IB 3B78A 3RU0A 4B08A 1OMSA 5K20B 1N54B 5IM0B 4A8SA 4GVBB 4ZPVR 4DFJA 1DZ5A 1SL1A 1ZM3A 4JV5F 8RUCA 5T41A 5D4NA 3CPWR 4B3MJ 1CJVA 2CQHA 2FVQA 2HG4A 2OPQA 1WWHA 2VBXA 3V6JA 2YKOA 3DN9A 4PXEA 2V9WA 2KVQE 2O01C 4E0DA 3SCLE 3PW4A 1S6OA 1FVQA 3R7BB 5A8WB 1Q8KA 1M5SA 4BS2A 1G2EA 2CQDA 1X5TA 3A3NB 1WF2A 1X60A 3FCHA 5HMWA 1VFJA 4A8OA 3SQOP 3I56S 1IXKA 3BPSP 1H7WA 4P2FA 3CJ3A 4CO1A 3IRWP 4L3KA 1WTBA 1JLBB 2WVFA 5IT9U 4YB1P 4DR2J 2XY7A 1KN6A 4Q0BA 1FFSB 1T8EA 2HQGA 2VFSA 1S12A 3GE9A 3P4UB 4M5GA 4WU2A 4ZLJA 5C25A 3HM9A 4IG3A 2JEFA 5FJ4A 1H3DA 2VDIA 2AJ4A 3FUYA 3DMJA 1FKAF 2VBZA 2ZVSA 2CJ9A 1XEZA 2BANA 1QUVA 3BV8A 3FC9A 3VGVA 5IM0A 2GVZA 1KDNA 4EBCA 2YBVA 2R8GA 2E9RX 2XLIA 3MEKA 2IA6A 2DR8A 3IG1A 4TU8A 1M90T 3ETOA 2PMWA 2R2TA 2M2BA 4YB7A 3DOKA 1VQSA 3D1QA 3W2VB 4XDCA 4Y28C 2ZH6A 2VA2A 4LF4J 2KB2A 2FJVA 3KDOA 3K5OA 2DGQA 3VV2B 1RLCL 2C3YA 5HO4A 1UL3A 3H40A 3LA0A 1OQ6A 1WI8A 4QWEA 2OMOA 4WU3A 3OXLA 1UAWA 3DNCA 4HHJA 3WBZA 1EKSA 2PEBA 2ZH5A 3CMES 4GKJJ 1S49A 1K1SA 4A46A 1S1TA 2GMHA 2QMXA 5GAEI 1WG1A 2DIVA 2EFGA 3MAHA 4ZPBA 5ETKA 1UCNA 4ZVGA 1HNZF 1MMDA 3EUNA 7FD1A 3CT9A 2R8JA 1S76D 2PA8D 3GR1A 2ZEJA 3UDLA 2IMOA 2MPUA 2AQ4A 4BCAA 4NLGA 3HKZD 1CBKA 2LMIA 2X1BA 3W2VA 3J7Z5 5B08A 3T1AA 5KFOA 5HK4A 2W2OP 2E9TA 2DT9A 4HDHA 4EO6A 5ETOA 1U26A 1XTZA 3G6XA 2HHHJ 2HRUA 4NYPA 3K8WA 3GCWP 3QSIA 3VAFA 1TMJA 3I6PA 2NQPA 3FFIA 3SV4A 1SC1B 3MM9A 4RU2A 2GAGC 1C1BB 1IJEB 1LK7A 2CG4A 5CYQA 1NB2A 4YUDA 1PCAA 3CCZA 1HNWJ 2CQBA 2XYHB 5K8NA 1VQ9S 2UU9J 1FD2A 4C3MA 1KR4A 4WZMA 3KLFA 4DEZA 1U1NA 3MMBB 5D0HA 1T9UA 5E3PA 4DL0C 4E98A 2PDAA 5KG0A 4ILMA 4Y2AA 1GMWD 2MZJA 4BDPA 1JLGA 3C6TB 5HP1B 1RT5A 2LQ8A 4ZVHA 1WSRA 3GB0A 3GPAA 3MPVA 4LFAJ 4QZVB 3OFGA 3MM6A 3PW0A 3IA0A 1BMQB 1VQ4S 4RBUA 3OTCA 4E8UA 2AYEA 2Y0BB 3AA8A 4ECZA 1VRUA 2ZWOA 3NGTA 2ZC4A 2GGPB 2QA2A 3GV5B 3RAXA 3IWNC 1X5PA 2CDRB 4CIOA 4ECTA 2I9SA 4KTQA 4B3OB 2B56A 2GHWA 1REVB 3MEGA 5DDPC 4K4VA 1CJTB 4QBUA 3KK3B 2HSEB 2PSZA 3PRDA 2W8LA 3W9JA 4ECRA 2E7VA 2XNRA 4GKJF 3BKUA 2KHCA 1EAYC 3KUHA 3F73A 2DCUB 1RBAA 3H59A 3DHWC 4NMLA 3W2WA 3MD3A 5LJ3Y 4DZDA 2CZVC 2Z0GA 3SIPB 2PGCA 5LSRA 1W2IA 2AGOA 1RAGB 3CSKA 4LT6A 5HQ8A 4DX5A 4I67A 2DHHA 2GHVC 4FYDA 5DG7A 1WOOA 4P9SA 4EUVA 4HL9A 2VFRA 3OXGA 2AW0A 4Y2KA 3ZZPA 1YJNS 1LOUA 3BM7A 3AODA 4BWJA 2A6MA 1HBMB 1DTTA 4K4YA 2OPRB 2W01A 5IC6B 4O3NA 1RT2A 2P9CA 2Q1LA 4C48A 3PX6A 2J8SA 4MFBB 3KK1B 1VCTA 2GV1A 2UXDF 5H9EK 4CH1A 4BBYA 2CUYA 4DR5F 3PTWA 2N7CA 3UCGA 2V0NA 1LK5A 1HWLA 5D4OA 4M95A 1KNZA 5KFUA 2BMBA 3FZBA 1OWXA 2DNRA 3BKFA 3MUVP 3CJKB 2ZM6J 4MJKA 2WOMB 2DXEA 3M32A 4BC9A 3J7YI 4PABA 2OUGA 2EK1A 4U8YA 3M05A 5J1PA 4JI0J 4CO4A 3RRHA 3RAQA 1UVLA 3I87A 1YQHA 5K14B 3FSXA 4C8NA 2D74B 4Y3CA 1P1TA 1UVMA 3P3DA 3VQTA 2HQDA 2D7SA 3E01A 4R5PA 4ICLA 2XTJP 1RHKB 2XG8A 3CCTA 5F8IA 4I2PB 1ZBTA 3C19A 2E44A 3W8PA 2H4WB 4LSLA 4OMFG 1X4FA 4JI2F 3ZZYA 2M0GB 3W7BA 4ZIWA 3PFEA 2W2NP 2LQ5A 3Q8SB 4OI0A 3IO1A 2E29A 4OZNA 2EVZA 1AB8A 3PNIA 1VOMA 3NKYA 3NAIA 1FRJA 2IYGA 2JJ4D 4KGVB 5IOLA 5CYJA 2JDJA 5A6WA 1PJ5A 2HZCA 2HQCA 2M70A 3H2VE 2RF2A 4FP9A 2RQ4A 4WIIA 1R8HA 3VQSA 3KHRA 1HWKA 5HVGA 2B6AA 1J2VA 3G9CA 2XYGB 3HT0A 5GAGI 4A8FA 2YNFB 5F9LA 3ZO7A 1VR6A 3AJDA 4ED4A 4NXNF 2FUG9 1U2CA 5E2QA 4JI8F 1DQAA 3TZYA 1Q7YT 2YQ1A 4HVZA 2DYAA 3PDNA 1U45A 3N0VA 4DV6F 4GMKA 1EJ7L 1ZYQA 3WX4A 3G4SS 2DHSA 2YPYA 1CEZA 3CUNA 1B99A 5KG3A 1NEEA 1WF0A 2WB4A 2ZH7A 4CNZA 2W7AA 1FJGJ 2YKAA 3FGVA 2F7VA 3M1VB 3NEKA 3G8TA 3C46A 4U7UK 4O44A 4F2SA 2R42A 4B9TA 1HLWA 4F0KA 4F4KA 1QLNA 1S57A 5KG5A 4ED0A 3CC4S 4WFAQ 2G0JA 2CADA 3G82B 1F60B 2B5JB 4W98A 5D0GA 1I3OB 2IVMA 1X7VA 4GKKJ 4JP8A 4DI6A 2IYIA 3T19A 3NGKA 4RW9B 1NPPA 2DH8A 2RIJA 3L7UA 4WBFA 2EFQA 3W64A 3HFVA 4F67A 1UFWA 5ETPA 4AQYJ 2XC9A 4UZBA 1URRA 3K0JA 3I32A 2VDHA 4B9NA 4IUFA 1DAXA 4NCGB 1BLUA 5IXUA 5LJ5Y 2FLNA 3RB6A 5C42B 3P45B 4TXSA 2YKPA 3TVZA 3M1VA 1U1OA 3CULA 2U1AA 1A0OB 4Q43A 4DN9A 1HHQA 2GJFA 2QE5A 2RE1A 3SZ2A 4X4TA 1IVZA 1PC4A 3CJ2A 3G6ES 4IOCQ 4NA3A 4EBDA 4CLLA 4L3NA 1EQMA 3FBFA 3CJ4A 1YIJS 2YKMA 2FC8A 3M2UA 2R8HA 3ITHA 1K9MT 2DRBA 1SC6A 1B64A 1Q4RA 1FRMA 3GMGA 1VRQC 2MYFA 3HJVA 4X4RA 1UVIA 4DPOA 3TO8A 2W9CA 3KG0A 4AQYF 2NZCA 1U1RA 4J9PA 4OX8A 3C3LA 1YJRA 3ZTRA 3VGSA 4ERDA 2OFHX 2XMMA 3OFFA 1GXUA 4KSEB 1S1XA 2PIIA 2FIUA 3UDEA 3HPOA 4PRFA 2MLYA 1GAOA 3MUMP 2FLLA 4J90A 3TAPA 1KHWA 4DL6A 1RA6A 1KOOA 5KFRA 3U7JA 1RWVB 3AY0A 3EZ5A 5DM7Q 2F63A 3L3CA 1Y3JA 2RNEA 4DR7J 1EB0A 5HN0A 5J1EB 2CQ3A 3F41A 1GQEA 2FVRA 2B9EA 1S9GA 2MQMA 3LUYA 3QAEA 4BHQA 4J9RA 3JB9k 4YHHF 4NLRA 4OI1A 2ZDPA 1BE4A 1RABB 3QT5A 5D78A 4K50A 1NUEA 3W60A 3HI9A 4ZPWR 2CPXA 1UEVA 3CTRA 4DV6J 2R7XA 3QMQA 3IM9A 4QIGA 1CJKB 3B4DA 3TQEA 3W5XA 2XMTA 1H2VZ 4EI2A 3IGVA 3SCJE 2MGZB 1HNZJ 2ALZA 2FC9A 4USMA 2HK2A 2FHOB 2MZQA 4LSNA 3HZEA 2BOAA 2IDLA 2CWKA 1RHUB 1IJFB 4X4NA 1F2GA 3W9HA 3HVTB 3MPWA 2WTFA 2CQ2A 3KG1A 4H4KA 2J9EA 1PIEA 7FDRA 4NCBA 4V19X 3R1LA 1RCXB 1W25A 3A13A 2VASA 4ZPCA 1U8WA 1I94F 1Z2LA 3WIUA 3TJAA 4Q45A 3LPEA 2RDJA 1MMLA 1S6QB 2Z2YB 3R5JB 1RU1A 2LA6A 1RTZA 3GIRA 2BJ7A 1U8SA 1HD1A 4CQ1A 3K89A 1XIQA 2VIHA 1I1GA 4ER8A 1S59A 1N8RT 4NRUA 2DISA 2A10A 5EX0A 1KP6A 2OIHA 3V6DA 2R7QA 5AXNA 2F9DA 1HMVB 5HP1A 2K1RA 3QBCA 1KLNA 1T3OA 1F5AA 1TVRA 4DFMA 1RQ0A 4MKBA 3EPIA 4RZRA 5F8NA 3OLBA 1U6ZA 2V8GA 2VB6A 2FY8A 3NOGA 4Y2IA 4Y0FA 4DL2A 5KFJA 1Q8LA 1Q5VA 2EW9A 2DH9A 2A0FB 2RMLA 2OPSB 2D1CA 1X4AA 1ZTTA 1RTJA 2BA9A 2DO0A 3CVKA 2F8EX 3M4XA 4O23A 5B0BA 5SZTA 1UW4A 4J9SA 4OX9J 4C4WA 3IR7B 1N48A 1S6QA 2C2MB 4ECSA 3TRGA 3M7VA 2XMAA 3MM9B 1C4AA 1L3KA 3V81A 1TL5A 2RKIA 1WNEA 3D3BJ 3CB4A 2HIQA 1TK0A 4DG1B 1JXEA 4IQMA 3RW7A 3KNAA 3QWPA 2BRKA 2QLJB 3KJVB 1N5YA 2Z8QA 3V6DB 4USJC 5J1EA 4LF2A 4ED3A 4F02A 2XZWA 3Q86A 3KLGB 4KPCA 2RU3A 3JTOA 4OJHA 2HQIA 2NUUG 4KGZB 4F4AA 3UPFA 2XCPA 5CYMB 4JI5F 3M9OB 2FJDB 2O66A 3CJKA 4TY8A 4Y00A 1GX5A 3M2RB 5EWEA 1SUQA 3UR0A 2VPWB 1IWGA 4YB5A 4OYIA 2DGXA 3AJ2A 1QDUB 4NA2A 5CD4H 4NZ6A 1XR6A 1NAQA 4X64F 5D4PA 3MR5A 3KTQA 4NYOA 4N5SA 3JSMA 5KG4A 2H65B 3W3SA 2LQBA 4Q7AA 3HHEA 4RKUC 1HPZA 1WSVA 2BKPA 2EFPA 2J9DA 3J81j 2IM1A 1T3NA 3VZIA 1YJVA 3HO1A 4LSNB 1IM4A 3H20A 3PX4A 4I4BA 2V63A 4ZPTR 4YP3A
chains in the Genus database with same CATH topology
3D28A 2BZ2A 4QWDA 3LW5C 2V9KA 5H9FJ 4NLOA 4NZ0A 4JI4F 1C0UA 3DM2B 5AXLA 3H2UB 4F26A 1O5JA 5CHCB 3R5AA 2MQNA 5KOXA 5A8RA 2V5HG 4RNNA 4EU0A 4C8ZA 2MKJA 4Q2LA 5KT5A 2A2CA 3BR9A 4WYWA 1O0PA 3M6XA 2VOPA 2OD6A 3NRBA 1HQUB 2DGWA 2LEPA 4P7VA 5DRKA 4LSLB 3G8SA 2R9LA 4U9RA 1U09A 4OHVA 2K2PA 5EX3A 5AE2A 1JLBA 2Q6CA 4MYTA 4OIXA 1JLEA 3I96A 3NNCA 1WHYA 1T03A 2ASYA 5B0FA 4DV3F 4M94A 1FRKA 5LL6d 1TFYA 3POTB 1KLMB 2IRXA 4OJ1A 5GAGU 3BN7A 4GO5X 4DL7A 4IQXA 5I3QA 3TA2A 4DV1F 1JLAA 2FJEB 2XSJB 4KKOA 5F8JA 4FF4A 1SH2A 3S1TA 3SYZA 1VK8A 5L38A 5KFYA 2G9OA 1C0TB 3FZ2A 1HBMA 2UV8A 4JI6F 2ASJA 2OPPA 3OQ2A 3T6BA 3CCSS 4IDKB 4NL5A 5D6GA 4JI1F 5CZXA 3QO9A 2JWNA 3T5HA 1KTVA 4F3QA 3DOMA 5D77A 4X4QA 3M8RA 2NSBA 2JFDA 2MY8A 1X4HA 2M52A 1RDRA 5LMNF 3UCUP 4A8YA 3MCSA 2CJKA 2W9CB 2XLKA 3KJVA 5HROB 3D5MA 1TK8A 2XMUA 4PG5A 4LUBA 3IFEA 2MKKA 3MEGB 2DGTA 4RNMA 4R8UA 3PY8A 2HNZA 1AXQA 3X1LB 2H9ZA 2Y1RI 1RTHA 1KS2A 3NL0A 3P96A 2HQ3A 3FSYA 3MECB 2XO7A 1SL2A 2I38A 5LXYA 5LMUF 1ZZFA 4WXWA 1A7GE 2OD4A 1JJ4A 4QWAA 4UQGA 1L3TA 5AE1A 2BACA 3CDWA 1SJ1A 4R0JA 4RWWA 4RW7A 2MQOA 3MAQA 2ZH1A 2R7WA 3QJLA 5LT5A 2I1RA 5C24B 5DO2A 2B5JA 4I56A 3OXFA 1HD0A 2HHXA 4JYAF 5DS7A 1MWZA 4LFCF 1YJUA 5L39A 4OV1A 4WF9Q 2I5JB 5J2MB 2K3IA 5KOWA 2M8DB 2DNQA 2GMJA 4USHA 2VQEF 5CYQB 3G8QA 3RB4A 1GH8A 1RTIA 1B0VA 4UUXA 1B7FA 5AJ3F 3QJPA 3HVTA 5D8HB 1QM9A 1MNEA 4X4SA 1DBDA 3UCZP 1MU2B 3VAHA 3R5BA 5DG9A 3BN4A 4NCAA 3IXQA 3N4WA 3AAWB 1JLEB 4H4KC 2WSEC 2DGVA 5BYQA 3MMJA 5E3AA 2FPHX 3IR5B 3DCAA 4OI3A 1V3ZA 1CG2A 2L48A 1FRXA 4DR4F 3VTIA 1F5CA 2GX8A 1BWEA 5JJBA 4DS5A 3O5TB 3HHKA 4N41A 3DM2A 2BE2A 4Z37A 3DC2A 3BQ0A 4IO9Q 3OR1A 5LSLA 4LVOP 4B3MF 3PKYA 2N7YA 2UXBF 3KLEB 1V6HA 2VKZG 4DG1A 2C3OA 1D3WA 4KHMA 4TQSA 3HP6A 1C1CA 1TZ0A 1EETB 4KFBB 1KQGB 2F3JA 2GO8A 4QR2A 3LQVA 4FXVA 1N4LA 2JFKA 3ZZ0A 2B4UA 4KQZA 5GAEU 1FKOA 1S6PA 3LGNA