1FKOB

Crystal structure of nnrti resistant k103n mutant hiv-1 reverse transcriptase in complex with dmp-266(efavirenz)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
426
structure length
403
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 RT, A-CHAIN
publication title Structural basis for the resilience of efavirenz (DMP-266) to drug resistance mutations in HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 107
structure length 403
sequence length 426
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1fkoB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkoB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkoB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkoB03
3I0SB 5HP1B 4IH5A 3C6UA 3I5CA 3TVKA 4TY8B 3MFHA 3OHAA 2AX0A 3NBPB 2GC8A 2AX1A 2UVWA 3N6LA 2HMIB 1W25A 1S9EA 4G1QA 2R8KA 5KFYA 1LW2A 4XPCA 1VRTA 3KJVA 5KFZA 3QLHB 3LALA 1XR7A 3G6VA 4B3OA 3OL9A 2ZE2B 2OPPB 3DOKB 2IM2A 3HVAA 5L9XA 3RAQA 1J5OA 1S49A 5C25A 4EEYA 5KFLA 1YVFA 2CJQA 2YNIA 3D28A 2FVRA 3N6MA 2XGQA 1TP7A 1C1CA 3V6KA 1WNEA 4FS2A 4URGA 4DL5A 5KFTA 4MH8A 3RB4A 2HNYA 4IRDA 4ZPCA 1Z4UA 3RBDA 2D3ZA 5C42B 4IH6A 3GV7B 3BQ2A 4M95A 3DRPB 1ZTWA 4O3RA 4MK9A 4I7FB 4K4SA 5KG2A 4TQSA 2VG7A 2IC3B 4ED8A 4TY9A 4QWBA 5HBMA 2C2EA 4IOBA 4NLRA 5HP1A 1N6QB 4TY8A 2WK4A 5J1EB 3NBPA 2YKNB 2HMIA 2D7SA 2FLLA 2FVSA 2E9TA 4LQ9A 4JV0A 4K4UA 3QLHA 4ICLB 1S97A 2AGPA 2JEGA 4R0EA 2ZE2A 3KOAA 5I3UB 4HKQA 1TV6B 3KLGB 4RW8B 2BQ3A 3GIMA 2W8KA 3NMAA 1KHVA 2RDJA 5F8IA 3C6TB 5KFFA 5KFUA 2R8HA 3T5LA 2ZKUA 4JV2A 2JC1A 5KFCA 5C42A 1HPZA 4EBDA 3V6JA 4KB7A 4PWDA 3DRPA 5EDWA 4I7FA 4YR3A 4ECQA 5KT2A 3OSPA 4O3OA 4DL7A 2IC3A 3NGDA 4RW6B 5KFEA 4NLDA 3KMQA 1TL3B 2YNFB 2HNDB 4IR9A 4WE1B 1TVRB 4PQUA 5J1EA 3GQCA 3I0RA 4U7CA 4IG0B 3TAMB 3IG1B 3LP2B 2HNZB 5EWFA 1C1BA 4NZ0A 4NLVA 5KFGA 4IRKA 1JLCB 2HWHA 2GIQA 4RNFA 2FJXA 5EUHA 4YMEA 4Q8EA 5I3UA 3DDKA 4DG1B 2BRKA 2IAJB 2IJNA 1C0UA 4RW8A 3DYAB 1QE1B 3H4BA 3M8QB 3FDSA 1EP4A 4RW9A 3G86A 3PJXA 4TLRA 2I1RA 1RT7B 3PR4A 4ED2A 1TKZA 1HQUB 3KLIA 3EZUA 3I5AA 2VA2A 4TN2A 1FKPB 2XC9A 3H5XA 4QW8A 2IM0A 1RTIB 3CJ3A 2AQ4A 3MR3A 4RW6A 4F4YA 1HNVB 4KFBB 1TL3A 3E01B 4RZRA 3NAHA 1JKHB 4WYWA 1RTJA 1BQNB 4J9KA 2DPJA 1TVRA 5KFPA 4FS1A 3OL7A 2J6UA 3LAKA 1RT6B 4IG0A 4LSLB 3TAMA 3IN5A 2XI2A 3IG1A 3JSMB 5KG3A 4F4ZA 2RF2B 4QWCA 2HNZA 3PR5B 4KBIA 3MFIA 3IGNA 3IS9A 1JXLA 2EC0A 3ISND 3QYYA 4DG1A 3NKYA 4IDKB 5DLGA 2IAJA 4J9LA 4Y34A 3DYAA 1QE1A 4HYKA 3JYTA 2V9WA 3CVKA 2FVPA 3CDUA 3CO9A 4JV1A 2AGOA 5KFSA 5KT7A 1ZETA 2B5JB 2WCXA 4RNNA 1OS5A 2BQUA 1RT7A 5C24A 3BREA 2IMWP 1HQUA 4O3QA 3MEDB 4ZHRB 4MKBA 3KLEB 1S0MA 2YNHA 4K4VA 4K4ZA 1FKPA 1I6JA 3GV8B 4R5PB 4H4OB 2UUWA 3DI6B 4ZVEA 2R2RA 3UPFA 3M9NB 2V0NA 3CIZA 1GX5A 5KFHA 4IG3A 4EO8A 1RDRA 1HNVA 3BSNA 5D3GB 2WRMA 3KK2B 3D5MA 3MTKA 4M94A 3KNAA 4WXWA 4R8UB 2WTFA 5KFXA 1S1VB 1RT1B 4NCGB 5HROB 5I42B 3G6YA 4MIBA 4K4WA 4ED7A 4G3IA 3JSMA 3PJWA 2RF2A 2QE5A 1TL1B 2OPQA 2BANA 5J2QA 1JLFA 4KV8A 4IRCA 1S1XA 1DLOB 5L1IA 3FQLA 4MIAA 5KT5A 3MF5A 4K4XA 4IDKA 1MMLA 1IM4A 3QIPB 5KG7A 3OL8A 4WFZA 3KK1B 5CYMA 1NNDA 3GIIA 3DRSB 2JEJA 2B5JA 2IJFA 2IBKA 3Q8SB 4IQXA 5FDLA 3MEDA 4ZHRA 5KFNA 3KLEA 3OLBA 5DQHA 3E51A 2QV6A 4O4RA 4EO6A 4R5PA 4H4OA 1RT4B 3DI6A 1MU2A 2J6SA 3DRRB 4ECZA 4F50A 3I0SA 4O3PA 1T05B 4RU9A 4NRUA 2V4RA 4MKAA 5KFOA 2BR0A 4ECSA 5DGAA 5D3GA 3KK2A 3MR6A 5KFIA 5C5JA 2VG6B 4R8UA 5F8LA 5JXSA 1S1VA 4I2PB 1S9GB 1RT1A 4NCGA 3V81B 5DG8A 3MR5A 4J9OA 1TKXB 3VQSA 4QPXA 1UWBB 1TL1A 2OPPA 3DOKA 2JC0A 4KE5A 4RUCA 3GIKA 4IH7A 4ID5B 1DLOA 3PW4A 2I5JB 3H59A 2ATLA 3GV5B 3RBEA 2UUTA 5DLFA 3QIPA 1IKYB 3DMJB 2WB4A 3FRZA 2D41A 1JLGB 5F9NA 4I2QB 1JIHA 3DRSA 4XO0A 2YNGB 2CKWA 2RKIB 4MK7A 2W7PA 2UVVA 1KLMB 2HWIA 3Q8PB 4F4WA 2E9ZA 3BR9A 4EBEA 1IKXB 4K50A 2ZD1B 1QAJA 3UDLA 3SI8A 4ZP8A 4KAIA 5T14A 4FBUA 2ALZA 4U6PA 2FVCA 3DRRA 2OPSB 4MFBB 1S10A 3LP1B 1N6QA 3RAXA 3HVTB 1IKWB 2WONB 1S4FA 5F8NA 2YKNA 2FVQA 3N6NA 4YQWA 3KK3B 2R2SA 3BSCA 3SFUA 3UR0A 4I2PA 1RA7A 2B43A 3CJ0A 5KG6A 4ICLA 1FKOB 4GC6A 2D3UA 5JUMA 3KHLA 1RTHB 1UWBA 1JX4A 1KHWA 2ILZA 1TV6A 3KLGA 4ID5A 1VRUB 4K4TA 1JLBB 2I5JA 1NHVA 4O44B 5F8MA 4RUAA 4Q44A 5KT6A 3MEGB 3IGVA 1IKYA 1JLEB 1ZTTA 1REVB 1JLGA 3C6TA 1DTQB 1SV5B 1IKVB 3LANA 4I2QA 4ZP6A 1S48A 2YNGA 5KFAA 5KFWA 3KMSA 5CYQB 1KLMA 4QWEA 1S1WB 1IKXA 2ZD1A 5KFDA 1SH0A 4IKAA 4YP3A 1CSJA 4NLUA 3DM2B 3RB6A 4ED3A 2XGPA 4FBTA 2B6AB 2OPSA 4MFBA 2YNFA 4URSA 3LP1A 2FJWA 1T3NA 4LSNB 2HNDA 1S1UB 3MEEB 3V6DB 4ZVFA 3T5KA 4WE1A 1EETB 1RA6A 3QO9B 3PVXA 1D0EA 4RNMA 3QGHA 5DQGA 3KK3A 3H40A 3LP2A 4DL3A 3DLEB 1JLAB 1S1TB 3FFIB 2R2TA 5HLFB 1JLCA 2WHOA 1FKOA 4WFYA 3ITHB 5L1KA 5F8GA 4Y2CA 3BJYA 3BGRB 3UQSA 4ZPDA 2VG5B 4QWAA 2RDIA 1VRUA 2WOMB 1LWCB 4TXSA 2C2RA 1JLBA 3FQKA 3GYNA 2OPRB 4O44A 4NLWA 3RB0A 3M8QA 3LP0B 3MEGA 2C28A 1NHUA 4ZPBA 3CDEA 3C6UB 1JLEA 3BSOA 1RT2B 3BSAA 3RB3A 1DTQA 1SV5A 1IKVA 3Q8QB 5F8HA 1S9EB 3IRXB 1SUQB 3T19A 5CYQA 4ZVGA 4ECYA 1FK9B 1S1WA 3V4IB 5DQIA 1RTIA 2O5DA 4Q43A 3H5SA 1C0TB 1RYSA 1BQMB 4KFBA 3QZ8A 3E01A 3KHHA 4WZMA 1JKHA 4LSNA 1S1UA 4LQ3A 1BQNA 3V6DA 3PW5A 5KG1A 4RW7B 2VA3A 3QO9A 5F8JA 2UVUA 5KFVA 1RT6A 4LSLA 3MECB 4KHMA 1QAIA 3GILA 3KHRA 3DLEA 4URQU 1JLAA 1S1TA 3FFIA 5HLFA 3ITHA 3QGIA 3ISNC 3BGRA 2W9BB 2VG7B 2VG5A 1SH2A 1LWCA 2OPRA 1XR5A 3LP0A 1HQEB 3PHEA 1RT5B 2XI3A 2XCPA 3MR2A 1RT3B 3NL0A 1RT2A 1TKTB 3PW7A 2J6TA 3I5BA 5J2NA 3IRXA 1SUQA 5J2MB 3LAMA 1FK9A 3V4IA 3HHKA 4XPEA 4ECXA 4DL6A 4RNHA 4J9NA 1N5YB 4NLYA 5K14B 1T94A 1C0TA 1N48A 1BQMA 4ED6A 4X2BA 5L1LA 1RTDB 4F4XA 4NLOA 4RW7A 3V6HA 5I42A 4H4MB 5HROA 3DLGB 2V4QA 3DOLB 1GX6A 3PW2A 5DGBA 3MECA 2AWZA 4PUOB 1R0AB 5L1JA 5DG7A 1HPZB 4Q0BB 1S0OA 2R8IA 4PWDB 4DL2A 1HNIB 5KFJA 3CJ5A 2R8GA 3T1AA 2W9BA 1S0NA 4RW4B 3HKWA 5J2PB 4NLSA 2BRLA 4J9PA 3KK1A 4TQRA 4ECTA 1HQEA 1RT5A 5KFBA 1RT3A 4PQUB 1TKTA 3I0RB 2ILYA 3H5UA 3T5JA 5KFRA 1S6QB 4IFYB 4DEZA 5J2MA 2IM3A 5KG5A 4O4GB 3QZ7A 4NLXA 2W9CB 1C1BB 1RYRA 4KHRA 4ZMMA 1DTTB 2JLEA 1N56A 1RT4A 1U09A 2UVRA 2R8JA 4JUZA 2F8EX 2IA6A 4QW9A 1N5YA 1T05A 5K14A 1C0UB 4WFXA 4ZPAA 4ZVHA 4KKOB 3KLFB 3TQ1A 3GIJA 1HYSB 3H2LA 4H54A 3SFGA 3BQ0A 1LW0B 2YKMB 3FSIA 2R2UA 4EYIB 1RTDA 2ASLA 2VG6A 1EP4B 4RW9B 3KHGA 3QGGA 2GIRA 4J9SA 1S9GA 3DLKB 4H4MA 3V81A 3DLGA 1RAJA 1TKZB 3DOLA 1TKXA 3KLIB 3KLHB 2IM1A 1D1UA 4PUOA 1R0AA 2W8LA 3EPIA 4NLPA 4Q0BA 1K1SA 3G6XA 4ECUA 4ED1A 1LWEB 1LWFB 1HNIA 4NRTA 3CJ4A 2AU0A 4WZQA 3H98A 1SH3A 4ZP7A 3OHBA 4RW4A 1S6PB 5J2PA 2ASDA 3DMJA 3OLAA 3EPGA 1RTJB 3M9MB 4ECRA 2HAIA 2RKIA 2BQRA 3BQ1A 4ECVA 2XCAA 4J9MA 4NLTA 4EBCA 1C2PA 1S6QA 4IFYA 2W9AA 4KO0B 4O4GA 3ICLA 2W9CA 5EWGA 4IFVB 1DTTA 3IS9B 2C2DA 3T5HA 4TYAA 4IR1A 4Q45A 3PW0A 1T03B 3HVTA 2ASJA 4KKOA 3KLFA 1IKWA 3JYTB 1HYSA 2WONA 4WYLA 3OL6A 1HMVB 1LW0A 2YKMA 1N4LA 3CWJA 3KLVA 3M8PB 3DLKA 5KFMA 5C24B 3KLHA 5EWEA 2FLNA 3Q8RB 1RTHA 1JLQB 2YNHB 2E9RX 3HVWA 1LWEA 1LWFA 3QIDA 5J2NB 3H4DA 2BE2B 4GC7A 2DPIA 5KG0A 4O3NA 1S6PA 4ECWA 4IG3B 3OSNA 2JEFA 4NYZA 5KFQA 1REVA 4WXOA 3H5YA 5KT3A 4TYBA 4G1QB 4MK8A 5KFKA 4ED0A 2JEIA 1LW2B 3KJVB 1VRTB 2W7OA 4DL4A 4YR2A 2FLPA 4Q8FA 2OH2A 5F9LA 1K1QA 4KO0A 4B3OB 4QWDA 1TQLA 3CJ2A 2OPQB 5DG9A 2BANB 4NLQA 4IFVA 5J2QB 1JLFB 4KV8B 1QUVA 3DM2A 1S1XB 1J5OB 4O3SA 5C25B 3M9OB 2B6AA 4OL8A 2YNIB 3MEEA 4RNOA 1C1CB 1T03A 4YR0A 1EETA 4J9RA 4J9QA 1HMVA 5CYMB 4EYHB 2HNYB 2FJVA 3M8PA 1HARA 4KSEB 4NLGA 4ZP9A 5KG4A 5FDLB 2XWYA 4Y3CA 1JLQA 3CDWA 3PZPA 1S9FA 3NAIA 1XR6A 2C22A 2AGQA 2WOMA 4K4YA 4Y2AA 1MU2B 2BE2A 5KT4A 5HBMB
chains in the Genus database with same CATH superfamily
1V5IB 3BDPA 4FXVA 3P6YC 2KVQE 3N6LA 5KFZA 1X4GA 3LALA 4DR5J 1T9VA 3UVJA 7AT1B 4EEYA 5KFLA 2FC8A 4NASA 5KFTA 4IRDA 1FNOA 2D3ZA 5CABA 3RGIA 5A6WA 2QC3A 3M6VA 3IP0A 4MK9A 3H2VE 2MKCA 4I0WA 2QGFB 2NXCA 2HZAA 3OTBA 4OMFG 2U1AA 4Z2XA 3VGUA 2DHAA 4RBTA 1WOSA 4LFCJ 2JC1A 4DOZA 4Q5VA 2UXDJ 2AF6A 5ETTA 5CA5A 5EDWA 2BXJA 3FBCA 1HHTP 2IPOB 3NGDA 5DS7A 1TVRB 1WI6A 4LIRA 4DHVA 3TI0A 4Q8EA 1NUEA 2BRKA 3VAJA 1FE0A 2GO9A 2EG1A 3PJXA 2QLBB 5DZ6A 4ED2A 4KGMA 3K0JA 1FKPB 1MWZA 5G0RA 3H5XA 2YH0A 3MR3A 5EGYA 4GKKF 4WP8A 4LR7A 3UDCA 4ZVPB 2FJBB 1OY8A 4K59A 1RHUB 5DLGA 5L38A 1FKAF 2F1FA 1U2FA 5C24A 2IMWP 3CCSS 2HBYB 2FHMA 4DPUA 4JI4F 4F2RA 4X4RA 4DR4J 5I42B 4ED7A 3OVAA 2GJFA 2P6TA 1IM4A 4OLPA 2F5GA 2HYIB 2IBKA 3MPVA 5DQHA 1KDNA 2DEIA 2CJXB 1MU2A 2FZKB 4LRAA 4CO5A 4HACA 2VG6B 1RT1A 4ZVOB 4J9OA 1SXLA 3CC4S 4BDPA 5D8HB 4B9TA 2VC0A 5M2RA 1DLOA 2V63A 2I5JB 2ZC4A 1KVJA 2D41A 5CZVA 2UVVA 1FVSA 2HWIA 1A6LA 5AXKA 1QAJA 4U7UK 4ZP8A 4PEOA 1QVGR 4U6PA 2CPZA 2GAGC 1N6QA 3TAQA 2CXEA 3QT7A 1X4DA 1IWAA 5E3AA 1MSWD 4JI3J 3HMJG 1A9NB 4X4NA 1HWJA 4O44B 1OO0B 2J8SA 2V8GA 2QMWA 2DNZA 1ZPVA 1VI7A 3TX8A 2CJAA 3DM2B 2OPSA 4MFBA 2RUSA 4B3SJ 3QO9B 1M1KT 1S1TB 1FKOA 3IM8A 4LF8J 3TUPA 3K89A 2LA4A 4OX8A 2OPRB 1Q5VA 2AYBA 1FRMA 4LFBJ 3U02A 2B9WA 3ZZZA 1RT2B 1IKVA 3T19A 3ILJA 1RTIA 2O5DA 3BBBA 3SCKE 2VQEJ 3DDIA 3E01A 4ZOSA 1JKHA 4CYUA 1YRUA 4X62F 3DLEA 4X4SA 3HK2A 4ILLA 5FD1A 2AMCB 1KOHA 4F0KA 2UXCJ 3AB2B 3RJMB 1F60B 3A8IA 1WC3A 4IO1A 3DHWC 2VFTA 4P52A 2DGSA 3H42A 2VDHA 3ISZA 4DL2A 1S0NA 2DNGA 4WK1A 1DAXA 4OI6A 1BUXA 4JI8F 5KFRA 1YJTA 4TKTA 4QU6A 1XERA 4ZLPA 3GSDA 4AFFA 3TQ1A 3V6KA 2YKMB 2QLWA 2ASLA 4GVLA 4RW9B 2GVDA 4I6WA 2W4DA 5J2PA 4MTPA 3HT3A 3OTEA 4V1Ak 4IOAQ 2XCAA 4L6V3 1DBDA 4LF7F 4X4PA 1HMVB 3Q89A 4JI0F 1TUGB 1X5PA 1LWFA 1I3OB 4U8VA 4IG3B 4ZCMA 4NXMJ 2XY6A 4WXOA 3H5YA 2ZHBA 2DNMA 3DXBA 2NXEA 1BD6A 3MM5A 2ZJQQ 1OQ3A 4AXJA 1C1CB 1KQFB 1KTVA 4P71A 3A3OB 1FJ7A 2RQKA 3AJDA 3D0HE 5GAGU 2GC8A 4L75A 2R7XA 1QAXA 2XHCA 1AA1B 3Q23A 4P9SA 2AX0A 2PMWA 2AX1A 2HIQA 2NCKL 3AHPA 1Q78A 1YBAA 1WSRA 2YNIA 2BJ8A 4CCHA 4FS2A 1SKWA 5J1NA 2HNYA 4NXNF 3D1HA 3EXYA 2JH3A 3GV7B 1CJVA 3LQVA 3UE2A 3O1LA 3J7Z5 2D74B 2VG7A 1IUJA 1VBKA 2MQNA 3TJ8A 3NWRA 4C97A 4TY8A 2IRYA 2AGPA 4R0EA 2ZE2A 3SQGA 3H7HB 1FFSB 4RW8B 1VFJA 4DL0C 1SIWB 3TAPA 5KFFA 4JV2A 5C42A 3LTOA 1NK4A 2FUG9 3HFKA 1T9YA 3Q8UA 1U1NA 2MY8A 1VBXA 3L09A 3W3SA 3LP2B 3D6TB 2Z30B 3N4WA 1YRTA 1YIJS 2C3OA 2V2QA 4OYXA 1EP4A 2CYYA 1ZAVA 2VA2A 2MYFA 4TN2A 4L3NA 1TK8A 1UETA 3OVSA 1E6YB 3A4TA 5KFPA 4A8YA 3CE8A 4DCJB 3O3LA 1ZAWA 2XI2A 1KN6A 3R1HA 4K2XA 1YHQS 3C2PA 4CLFA 1QE1A 3CDUA 5ETRA 1ZETA 3UD4P 3QJLA 1UEKA 2FJDB 2O1PA 3MEDB 2Q1LA 2DKOB 5F0WA 2E66A 1PJ6A 5B0FA 1X31C 3RU0A 5D3GB 2DTJA 3CC2S 1JJ4A 2WTFA 2NZCA 3KYLA 2GMHA 2SXLA 1AZSA 1Y0HA 2JEJA 3MCOA 2ADCA 1TMJA 2H54B 3KUHA 3DI6A 2V67A 2FJEB 4OZ0A 1S1VA 3QQCD 3HPOA 3K8WA 4MK7A 4FYVB 1IQTA 2L08A 3HSZA 2DGWA 5I4MA 2RIJA 4DQQA 3LP1B 3H2UB 2ZZTA 2Y1LB 3BSCA 1VK8A 1X4HA 2XHWA 1UVKA 3K7RA 4ID5A 1VRUB 5A8RA 3MEGB 2OHDA 4DX8H 1S76D 2XO7A 4OZLA 4EI2A 1WKJA 1U7LA 2CZ9A 3JAMY 2CPHA 1VC0A 4LSNB 3W8GA 3PVXA 5CXTA 5C7PA 4HDHA 2RB7A 4DFPA 3OTOF 2VG5B 3GG1A 1NHUA 3CDEA 1FNMA 1SV5A 1N33F 5CYQA 2LU2A 1MNEA 4KR0B 1I94J 1BQMB 4UUXA 4JI1F 1S1UA 3FNNA 5F8JA 1WF2A 1KC8T 5FJ4A 3FFIA 4DV2J 2MQLA 1UJ4A 3MAHA 3J7AN 1UVMA 1SH2A 2DXDA 1BE4A 4LF5F 3HO1A 1SUQA 1NM2A 3V4IA 2NUHA 1IBMJ 4J9NA 1HWLA 4CTAB 3K2YA 3AY0A 1RHQB 4CZCA 1VLYA 1YJRA 3T1AA 3HKWA 4TQRA 2CQHA 4KHPF 1RT5A 1URRA 3H5UA 2BOAA 3T5JA 4LFAF 5J2MA 1M5HA 2VKZG 3R5GA 4N7TA 4JUZA 2ZBIA 3HJVA 3QGGA 3T5LA 5KFCA 4PUOA 2FZGB 4WZQA 3TJAA 4RW4A 3BGUA 2BDPA 3R6LB 4OV6A 4EBCA 2DIVA 1FRXA 2XMAA 4IFVB 2QN6B 1UEUA 1GAOA 5DRKA 5LMNJ 2IFXA 4BHQA 1SC1B 2XG8A 5C24B 4DF4A 5CQGA 2B56A 3H90A 2E9RX 5J2NB 4OHZA 1N54B 4ECWA 1T7PA 2MQQA 1LW2B 3VCDA 4C9DA 3NGUA 3SMZA 3GU0A 3OBIA 1RAGB 2P9CA 3J80U 2I2YA 2OMOA 4FPRA 5CH7B 5A8WB 4EYHB 3ENVA 1E6VB 4KRWA 1X8DA 1OQ6A 5GMKa 2FYXA 3MM8A 1MU2B 2BYCA 3D3CJ 3MFHA 2COLA 1W25A 2A3JA 3AOBA 2PA3A 3RAQA 3VVTA 1K0VA 3QAUA 5D0GA 3VV2B 2VBXA 2KN4A 2F65A 1U0SA 1R0CB 2CQ2A 1H2UX 3AD9C 4DU7A 4ED8A 1N6QB 2V5HG 4YDXA 2IJRA 2DNHA 3QLHA 2NXJA 4JI7F 2ZM6F 3K58A 4YEAA 1NHKL 2XS7A 2A0FB 4JV5J 5K8NA 2PEBA 4DV1J 3T6JA 1B99A 5HVHA 1C1BA 3NP5A 4RNFA 2FJXA 4YMEA 1RE1B 3OTCA 1XMQF 1RI7A 1KRPA 4U8YA 2E1AA 3MHYA 2MXYA 2GO8A 2CJ9A 2X51A 1RTIB 2ZBQA 4CT8A 3E01B 1JKHB 1RTJA 2KYXA 2FGCA 2V8PA 1S59A 2RF2B 3MFIA 2BBEA 1U6FA 1OIAA 1ZPWX 2VUGA 2AGOA 1S0MA 4K4ZA 2B7BB 5GAEI 2R2RA 3K8VA 2E1RA 2XMKA 4M1KA 3T1YJ 2BKNA 4LVNP 2NSCA 2R7QA 2WRMA 2E5LF 3I82A 3BV8A 2WSCC 1WI8A 2F63A 4MIBA 1Q82T 1Y3JA 3FQLA 4MIAA 3P96A 5AE3A 5KG7A 4PG7A 4ES1A 3PYEA 4IQXA 5CAAA 1MLAA 1VRQC 5ETLA 3KLEA 3OLBA 2GQ2A 3SXLA 3AD7C 4O4RA 2V8VA 4JI2J 2EFPA 5THWA 4DR2F 4I2PB 4Y2MA 3CC7S 3MD3A 2VF3A 2CDRB 4DX7A 3N5FA 3MUMP 2H51B 3ILLA 2I9SA 4KT0C 4OV1A 3UNYA 5A2QY 1HNWJ 1RB0A 3BS9A 2W25A 2PSZA 2W7PA 2LXUA 3DDNA 4D3GA 3A8JA 1T95A 3SI8A 3SZ2A 1GMUA 2Z4PA 3CCMS 3JS9A 4HH1A 3AXKA 3A8EA 3Q8VA 3D54A 1VQ9S 3LUYA 4GC6A 4X64J 3KLGA 1NHVA 5B7WA 3TP2A 3GJQB 1HW9A 3CIMA 3MM5B 4YP3A 1CSJA 2GVZA 3BR8A 1WC1A 1TL4A 1IBCB 1FWLA 1JLAB 2VPXB 1GMWA 1WKLA 4QWAA 1JLBA 4ZVTB 1TK0A 1DTQA 3C14A 1OPZA 3M8ZA 4DV4F 2EKNA 1C0TB 3HULA 3EWGA 2D1CA 1S6OA 4F3QA 2BACA 1FJGF 3M1VA 1CJVB 1FI4A 2WZ1A 4XDDA 3W65A 1HBMB 2VG7B 4W92B 2RRNA 4DV5F 4DV7J 2BZ2A 2G1DA 3EXCX 2HKEA 3Q83A 5AJ3J 3QSYB 3VR1A 1KNZA 1T9TA 3V6HA 2J0SD 2VL1A 2XQCA 3CJ5A 4V19J 2VFRA 3JXOA 1F9HA 4DR7J 2ILYA 5KG5A 3QZ7A 1FVQA 3C16A 4ZMMA 2R8JA 1U09A 4C6AA 3I87A 2VFVA 3MMCA 4H54A 3KOAA 2XLKA 1EP4B 3TARA 1TL5A 2Y1JA 5A76A 1EQMA 4ECUA 3DU6A 4CRJA 3CJ4A 2WBRA 4F02A 4ZP7A 4Z7CA 1RWOB 3F41A 4J9MA 1G3OA 2VFUA 2W9CA 5BR8J 1DTTA 1FT8A 4IR1A 4N77A 3HVTA 1HD0A 2WONA 4B9NA 2FLNA 4RWXA 2GCFA 1VHFA 2QYGA 4C0HA 3QIDA 1H2TZ 4OHVA 4NYZA 4OYAA 1H98A 2FLPA 1SQFA 4OYZA 2IMOA 5HL7Q 4RNOA 1AZSB 3GIRA 5RUBA 5FLXY 3M2UA 4J9QA 2PIIA 7FDRA 2KL8A 2CRLA 3UDVA 1JLQA 1NLKL 2WSEC 4Y2AA 5HBMB 5L9NA 4CLKA 2XMUA 2UVWA 4G1QA 2R8KA 4YB1P 1S7HA 3G6VA 1QAYA 1L5UA 5L8RC 4M63A 4M5LA 5B0GA 1SJ4P 3L7PA 4TQSA 3SCIE 3BGOP 2LQ9A 4Y28C 1U1QA 4B9VA 2KTQA 1TFWA 3FZBA 2QA4S 2FVSA 4USUA 4DX5A 4K4UA 3VZHA 3PRVA 4HKQA 2EBEA 2CPJA 4BCAA 5A8RB 2KXNB 1WDDA 3EMTA 3W8PA 4DR1J 4F4KA 3C8YA 3NCRA 3P5TL 4DL7A 4KJIA 2HVHA 1N0VC 4DN0A 1KVIA 3R2DJ 4IG0B 3IG1B 2HNZB 2XTJP 3OXFA 4CO4A 1CJTB 3H4BA 2JVOA 3CTRA 3R5JB 3VAIA 2AYMA 4MYUA 1IXKA 2M88A 2VASA 1D9AA 2N82B 3F44A 3GG0A 2YVSA 2LQ8A 2X1GA 4DSJA 1VDHA 4USWA 3U27A 2MMYA 2P2CB 1QLNA 1URNA 3CVKA 1OS5A 2BQUA 1BC6A 2KKHA 1I6JA 1SPBP 2UU9F 1IR0A 2ZEJA 4X65F 1L3SA 2BANA 2YKAA 1NK5A 2DXFA 5KT5A 3MF5A 2KFZA 1Q53A 4AL7A 4USIA 1Q5YA 5HJYA 2JZ5A 3G71S 2ZH7A 3HHLC 1P6TA 4H4OA 3CCTA 2R4FA 3BBFA 4NRUA 2KXFA 1NK7A 2QL5B 5JVGQ 2LQ5A 4TU7A 4X4TA 1YJNS 4MKVA 4UQGA 1FO1A 5F9NA 4K50A 4HR2A 4LREA 2FVCA 4PYAA 2XMJA 2DY9A 1NZAA 3KTQA 4DZDA 4Y2KA 2B43A 4YFUA 1UWBA 1QSYA 3R7NB 2MLXA 1IKYA 1NK6A 3WIUA 2HFNA 2BJEA 1W2IA 2Z2YB 4DQRA 3CT9A 3MXHP 1D0EA 2C2MB 2KT2A 4P2SA 3UN2A 2Z8QA 4DV0J 5L1KA 3BGRB 3CPWR 3QRPA 2WVEA 5K8OA 4F3MA 2HHWA 4ZVQB 1SL2A 3OR1A 1PJ5A 2CQDA 1SVDA 4N41A 3VAKA 3M8YA 5IWAJ 3AODA 3KHRA 3I55S 1FTCA 1WHXA 2HVIA 1LWCA 3DLHA 4HT5A 1RT3B 5EN1A 3SSSA 2DNQA 1RWXB 4G1IA 3GLJA 5B0BA 5T7LA 2MKKA 5L1LA 3FSYA 5HVGA 3G9CA 1HNIB 4KQZA 2W9BA 2H5EA 1F5AA 5LM7E 3R97A 4WKRA 1JMTA 4FF3A 1C1BB 4A8OA 2M9KA 1UP1A 2MDAA 4TU9A 3BQ0A 1LW0B 3R8YA 4LF9F 3MM6A 1LWEB 1XEZA 2LQJA 3DNCA 2GJIA 3OJSA 3GYXB 3TA2A 1RTJB 2JVRA 2F4VJ 2HAIA 3D68A 4ELVA 3P4UB 2BQRA 4ECVA 3TQEA 2W9AA 1R3NA 4O4GA 4NZ6A 2J9CA 1CS4B 3FSXA 2CZVC 1H72C 5KFMA 1NXIA 3O8WA 3Q8RB 1RTHA 2E29A 1Q4RA 2NREA 4O3NA 2K7KA 1DZ5A 3W2VA 1U1LA 4WTYA 1HBNB 3SDEB 1VRTB 5B09A 3CJ2A 1L3VA 3CD5A 4X4VA 1S99A 3R5CA 1HD1A 2DGXA 2PA8D 1F0XA 3R6GB 4J9RA 2GMLA 3PJ9A 2FDNA 3W5YA 2XWYA 2RU9A 3MPUB 1XR6A 2YTCA 4BBYA 1X4CA 4RUBA 3C15A 3I5CA 2G4BA 3CDAA 1S9EA 5KFYA 3KJVA 2MZRA 2YX1A 4O0IA 4C3LA 2CQPA 3OL9A 1M5KC 4CLPA 1WNEA 1WWHA 1UFKA 1UJ5A 2ZFHA 2BM1A 4GMKA 3WDOA 3FCVA 3GP9A 4NLRA 3M7VA 2H5IB 2VPYB 4JV0A 3KLGB 5ETOA 3I9ZA 2M4MA 2MY7A 2ZJPQ 4KB7A 2UUBJ 4YR3A 3TNVA 3OSPA 2MKSA 1TL3B 1T9WA 4EK2A 3BO2A 1RK8A 1D3WA 1AUSL 3T3FA 2GIQA 4NA2A 2ZKTA 3DDKA 1NBEB 2B4OA 1QM9A 1Y11A 1LFWA 1WF0A 4LR9A 1HQUB 1X0PA 1SIZA 3D1QA 2VOOA 3S8SA 3G8SA 4ETZA 4RZRA 3DLLQ 4F8RA 2ZUAA 3JSMB 3W9JA 2NPIA 3GPAA 4IDKB 2IAJA 3DYAA 2CJYB 1F3FA 2B5JB 4K4VA 4ZVEA 2WBMA 1U02A 1QVFR 4KY3A 2GFFA 4DWIA 1X7VA 4M94A 1XNRJ 5KFXA 1AT1B 2E1MC 1VGYA 3EE3A 5J2QA 4KV8A 4ES2A 2EK1A 1FRIA 3R27A 4JI6F 5FDLA 1N32J 2Q79A 2MPUA 3JTNA 5SZTA 4WBFA 4EFAC 1XNQF 3ZNJ1 2AEFA 3MR7A 3I0SA 3MMCB 1NB7A 2A2CA 5F8LA 2DH9A 1XWLA 4M5HA 4PPDA 3M2RA 4ZS6A 4C7QA 2BOPA 1JLGB 1M5OC 1X9MA 1GXUA 1Q79A 3BR9A 4B3TJ 4FF2A 2DCUB 4FP9A 2VU5A 3W2WB 3PYFA 3HVTB 2WONB 1RZMA 2FD2A 2E7WA 2ALYB 4OFZA 1EAYC 2D9OA 3EVOA 3MMAA 2R7UA 3SV3A 4QWEA 1S1WB 1K0TA 2HS4A 4GKJJ 5KFDA 5ITHA 4C8LA 5KTQA 2EWHA 4CLUA 4QIGA 2E7VA 3M2UB 3H40A 2GS8A 1YKWA 4PG6A 1TMMA 3BJYA 3PX0A 3RB0A 2C28A 3LP0B 1RWPB 3IWNC 2NR0A 1Y5NB 4L74A 1G1XA 5KFVA 3M4XA 1GQEA 4EZ9A 2LVWA 3GWCA 1M5SA 2DXEA 1PBUA 4MYTA 1HQEB 3EM1A 1J27A 2VFSA 3NCPA 1QDUB 2I0XA 1OMSA 1FK9A 4ER8A 3J81j 5K14B 3UDEA 2RAQA 2CZ4A 1YJWS 1YSJA 1N34F 4ZDNA 3JTOA 4FNHA 3BN4A 1BLUA 2GQCA 1S0OA 2R8IA 4DUZJ 3BPSP 1CPZA 2UUAJ 2YQ0A 4LRBA 2YKPA 4AL6A 2RRAA 1S6QB 1UPMB 1AW0A 2P6SA 4G1PA 2F8EX 4QW9A 1HYSB 2BUNA 2I38A 3KXDA 1RCOB 3DLKB 2IM1A 3EPIA 3HD1A 2XO6A 2ZZMA 2AU0A 3H98A 2IDEA 4FZVA 3OHBA 3OLAA 3I32A 2K3KA 2DH7A 2KZMA 3MM9A 4A47A 1J5EF 1T03B 4DI6A 2H48B 1V5VA 3HX9A 4HI1A 3PCOB 4PPZA 4YY3F 2JEFA 3AD8C 3ETMA 1N5TA 4TYBA 2JEIA 4Q8FA 2RU3A 3G8TA 3P8BB 2BANB 4DQPA 1QUVA 2QSFA 4NA3A 2B8QA 4X66F 1EETA 2CPXA 4M5DA 1VIXA 2GJ2A 4ETXA 2AGQA 2C22A 1HR0J 1NMEB 3DRXA 2V50A 2NPFA 2HZCA 4FKXA 1TL7B 3FBEA 4EU0A 3RR7A 3THTA 1NKEA 1HNZF 2RJZA 1YVFA 2WSFC 3JQJA 4ZPCA 1Z4UA 3L9ZA 3NGKA 1MWQA 3DRPB 1JXVA 5B08A 4QU7A 4X4OA 2R42A 1XC9A 4DFKA 4QWBA 5SUHA 1WJ9A 4DUYJ 4QYZJ 3S1TA 1OYEA 3UFCX 4FF1A 3GFXA 5AXLA 3TZXA 5I3UB 4QBUA 2EXUA 4LF4J 2RNEA 2MKIA 2J7UA 2XZTB 3ZZYA 1R31A 3KMQA 2O3DA 4ZIWA 1H6KX 4DR6F 4WFBQ 2EW9A 1Q7LB 4YHHJ 2HHHF 2J0XA 3EGVA 5EUHA 4YUDA 1HIYA 3IC1A 4PKDB 1V3SA 2VD3A 4E0DA 1APSA 3OR1B 4QIVA 4E8UA 4WFAQ 2ZH3A 3HCXA 1HNVB 1XN9A 1TVRA 1FXRA 3OL7A 3F56A 3IR7B 4F4ZA 1CVJA 1V9OA 5ETVA 1H0HB 3ISND 1TTHB 4HVZA 3MCSA 1OYDA 2WCXA 4ZN1A 4S0MA 2HGLA 2VPZB 4PWUA 2HRUA 1FKPA 2BJ3A 4CM0A 4NCGB 2LXIA 2RVJA 2OPQA 2G13A 1VC5A 2ZHOA 1MMDA 5KOWA 4ZJOA 3Q8SB 3E2EA 4DV6F 1HWIA 4RU9A 2V68A 1FDNA 3J7YI 2BA9A 2LEAA 1B0VA 3FGVA 2ATLA 2UUTA 5HMWA 3FRZA 3ZNUA 3Q0AA 4AQYF 2W2QP 2E9ZA 4ITSA 4LT6A 2R7SA 4KAIA 3M6UA 4UY8T 2KFYA 2R2SA 4RBVA 2HLTA 1RA7A 5KG6A 4CM2A 3C3LA 1RTHB 2ZDPA 1PBAA 2I5JA 1K8AT 4DSKA 5ETSA 1YJVA 2ZOGA 4A8FA 3RB6A 1H74A 3FCWA 3V6DB 2K3IA 1H7WA 2HFOA 4OI4A 2Z56B 2WVDA 4LBHA 3TWZA 2DEJA 2G9OA 4O44A 5D4NA 3IXQA 3PXGa 4Y65A 1S9EB 4WCEQ 2DCLA 2HHVA 3IO1A 1RSCA 4PXCA 1S79A 4N8NA 4O23A 4G6VB 2VQFF 4F4AA 3QO9A 2MZSA 4OYOA 2OO4A 3OV7A 4URQU 4HHJA 1S1TA 1ZM2A 3K5PA 2OPRA 3CJTA 4A8XA 3MR2A 1B64A 1RT2A 1DRZA 3M30B 5IZHA 4DPTA 2RHQB 2LA6A 2KJWA 4H4MB 4H4KC 3TEGA 1J2VA 3NG8A 4LF6F 5GAHI 3T1HF 2IM3A 2ZBRA 2BE9B 3QWPA 1CJKA 1SL1A 1OWXA 3SFGA 5GAHU 1WKKA 4C0OC 3KLHB 2B0GA 3G6XA 5C2GA 4IOCQ 1FD8A 1UW9A 2G0IA 4NLTA 1CQMA 5I3PA 1QSSA 2CQIA 3B4MA 3PW0A 1SC6A 2MLYA 2YKMA 3M8PB 3A12A 8RUCA 1RUSA 5MAOA 4KYZA 4KC5A 4GC7A 3NRBA 2ZH1A 1VQ6S 2MZTA 4YR2A 1V6HA 4IO9Q 3HDSA 5J2QB 4KV8B 1ACMB 3M9OB 5ETNA 1IVZA 1HMVA 3LGHA 5KG4A 5FDLB 5D0RA 1AFJA 2F8MA 2WOMA 4DLEA 3I0SB 1VBZA 3NBPB 4DPXA 4KGVB 1ZA1B 3HHDA 4K5SA 3M2RB 3M8RA 4LBPA 3X3UA 2FVRA 1C1CA 5IXUA 2NUUG 1CJUA 4C2MA 4XAKA 1UVLA 4USKA 3FMWA 2L3MA 1F9FA 2UXBF 4DN9A 3ELHA 2RT3A 3QT5A 2DISA 4WTOB 1VQOS 1ULRA 1YBUA 3G96A 3MMAB 5KT2A 1MG7A 4YB7A 1IJFB 4RW6B 4NLDA 3ZTQA 2DB1A 4OZJA 1YX2A 2MTLA 5JVHQ 4NLVA 4PG8A 2DNLA 3MCMA 1PAEX 3SCLE 4RW8A 3D3BJ 4P75A 2LXFA 3FC9A 3G86A 1RT7B 3KLIA 3EZUA 1KD1T 3CJ3A 1BQXA 2NYIA 3H8YA 3NAHA 4ELTA 3VGTA 4B3MJ 1BHNA 1Q0NA 2HPUA 3BH6B 1WG4A 4QYZK 3HLUA 3IA0A 5AXNA 2YPZA 1EX8A 3PV8A 3BREA 3RBXA 1U8WA 2YNHA 2GMJA 3CIZA 2XSJA 5GVQA 1YG0A 5KFHA 4EO8A 4U9RA 3MTKA 1E6YA 4R8UB 1WC0A 4OJHA 4DDFA 3PJWA 4IRCA 2X1FA 4B9MA 3QJPA 1P1LA 2KB2A 3MEDA 2JX2A 2V4RA 2OUGA 4RLEA 3DFEA 5D3GA 2XBPA 2NLWA 3MR6A 5KFIA 1IBLJ 1MROA 2HBRB 1OSDA 4CO1A 3QRQA 2DR5A 2QO3A 3H59A 4DV3F 4ZPWR 4OI2A 5IFMA 4ZCLA 3MOJB 4I2QB 3R5BA 1KLMB 4F4WA 3BKTA 4B9UA 2CQ3A 1H73A 3T9ZA 4I6YA 4NPOA 1RJJA 2Y0BB 3KK3B 2D3UA 4B9SA 4OI0A 4RUAA 5F8MA 4Q44A 2K06A 4QIEA 3NS6A 1HNXF 4I4BA 2E44A 5HN0A 1NJXA 3LP1A 1VBYA 2FJWA 1T3NA 4WE1A 1EETB 1XMOJ 4USTA 2GIFA 4NMLA 3CCLS 1A0OB 5LXYA 1FD2A 4ZPDA 1VRUA 1OJ4A 3FQKA 3MEGA 2YX7A 2MSSA 4CI0B 3OVBA 3M05A 3RB3A 2CQ1A 3Q8QB 5F8HA 2LFVA 1Q8IA 1CEZA 2HHTA 1XMBA 1RYSA 3QZ8A 4WZMA 2VH7A 4LSNA 5B0EA 1R8BA 4R0JA 4RW7B 2XMVA 5KG1A 5LMUF 4NA1A 4RWWA 4PR6A 2ZJRQ 1QAIA 2L48A 3QGIA 2HBZB 1JJCB 4HTJA 4QR2A 2VG5A 2ROEA 1FEEA 2V2ZA 5HQ8A 3S6EA 3NWGA 1TKTB 1RGVA 1U2RA 2F8HA 2IA0A 2AJFE 2WW8A 1VQKS 4RNHA 3VAHA 3BH7B 1BQMA 4JI5J 3DGVA 3DOLB 1GX6A 3W61A 5KFJA 1Y5LB 4B3RJ 2PDAA 4W4MA 3EYZA 1FRLA 4C98A 2J0WA 1PC5A 1RYRA 4M5MA 4DQIA 4KHRA 4GVBB 1NZ8A 1RISA 1QSLA 4CTAA 1R8CA 2XLJA 1RAJA 3CJRA 3V2UC 2HQIA 4MJKA 1SH3A 1S6PB 2GAHC 2HG4A 2PFDA 4OX9F 2LECA 4JOUA 5G4DA 2FB0A 3PTWA 3KLVA 3I4PA 3VVUA 2MQMA 1YTYA 3GE9A 5KG0A 2DNPA 3K57A 2XY5A 4A8KA 4PWWA 5IC4B 4CDIA 4NYOA 2HHSA 4MK8A 4F3OA 4B3OB 2OPQB 4IFVA 1P1TA 4NEZA 3NS5A 3IBCB 2J9DA 2P8IA 1KOOA 3PM9A 1WOOA 5J2NA 1ROFA 3CSKA 3TVKA 3OHAA 2H3EB 1LW2A 2FLOA 4J7CA 1O51A 3OT9A 4HHHA 4A46A 3TZZA 2HQGA 3D28A 5A8WA 1CG2A 4PXDA 2OFHX 4IH6A 1E6VA 3BQ2A 4O3RA 2IHR1 4I7FB 2A6OA 2IC3B 2C3MA 2BW7A 3QFWA 4U95A 2PN6A 2HRTA 1GMWD 4UW2A 1S97A 4CLWA 3DGPB 2G2ZA 5IOLA 1X5OA 1Q95G 3FCHA 4J5OA 4CO2A 4A8SA 1SI9A 3FJ2A 2L9DA 1VS3A 4HHUA 3EZOA 3JAMU 2HQDA 1IM6A 1GK8A 1UTAA 3M2VB 4UOFA 4DG1B 1HI0P 1Q1KA 3HZGA 5LJ3Y 3ZO7A 3PX6A 1IJEB 4GKKJ 2CQGA 2QSWA 2ZNZA 3G87A 4ZVSB 2XEXA 3IRWP 2V2KA 1ICEB 3IS9A 2EC0A 3PYDA 1FDAA 4OYIA 3JYTA 3Q8YA 4YN3B 4A8WA 1G2EA 1U49A 3ZTRA 4JI4J 4R5PB 2OIHA 2MGZB 4DBQA 3UPFA 2V0NA 2KHDA 3BSNA 1VQ4S 3UR3C 2AJ2A 4FNIA 2RF2A 3MAQA 2RQ4A 1JLFA 4OYPA 2N4DA 3HT0A 3M8SA 1FX4A 1NDPA 2QJ3A 4LF1A 4K0KF 1X5TA 1CJKB 3DRRB 2BR0A 5KFOA 2CPIA 4USHA 2GHVC 3VQSA 4EMDA 1FEHA 2W4PA 1UZHA 1Z1ZA 1H7XA 1JIHA 5E3RA 5GADU 1IKXB 1U47A 5K5MA 2Q6CA 2Y8YA 3N6NA 2CQCA 4I2PA 2I6WA 3FBBA 3CJ0A 2CPDA 3ZXWA 1JX4A 3ZZRA 1VHIA 1NJIT 2AW0A 2HHPA 2OFGX 2R9LA 3JSRA 4DFJA 2P9EA 3QRRA 4OX7A 4BS2A 2KFNA 3I9V9 4L76A 4Y2CA 3D9BA 4Q2LA 4RJVA 3UQSA 2WOMB 3QSIA 4CIOA 2H5JB 3PIOQ 1IR2A 5GAGI 1HW8A 4F0MA 4KGKA 3NNHA 4X62J 4K5RA 1UWAA 3U1NA 1N36F 1CJUB 1FCAA 1RWNB 4M5JA 1JLAA 3CD7A 3B54A 3U1MA 5EX3A 2OAUA 1MN7A 5L39A 5E7OB 4C8NA 3VAFA 2OKQA 2KDOA 3W66A 1N5YB 1C0TA 4DF8A 2XSFA 1A7GE 1BMQB 3DLGB 3VGSA 4Q0BB 2A10A 2M8HA 1HBMA 2EFOA 1YJUA 4JI8J 3GR0A 3KG4A 2RILA 2PT0A 5KFBA 3F0NA 3KKFA 2FJAB 1F3VA 4ZJQA 2VB6A 2YWKA 4X4UA 1D09B 3DLJA 1N56A 2E7XA 2OD6A 2DR9A 2DY1A 3KLIB 2M52A 4NRTA 2W2MP 1RHMB 2LEBA 2QEXS 1RKJA 5T41A 3M9MB 4DSLA 3NY0A 3LWLA 1Q81T 4LF7J 2CAJA 2HW3A 4JI0J 2U2FA 1IKWA 3VAGA 1AFIA 4N8OA 5K9FA 2YNHB 1NK9A 1DURA 1RP5A 1EKRA 1HI8A 2DHGA 2XSJB 1GMVA 5KT3A 2HQ3A 1F2GA 1SBRA 4YB5A 4DCPB 2NXNA 3TVYA 1NPKA 3D0IE 1HARA 1LNQA 3OTDA 5D4PA 3PZPA 3W62A 2DHSA 4LIWA 2E5IA 4PCQA 3QATA 2XMWA 5HP1B 3Q86A 1U0HB 2BABA 1D8YA 1MROB 4XPCA 1TUWA 2VKRA 4QPTA 2QLXA 5DDQC 5IQQA 1S49A 1REGX 4FYDA 3N6MA 4NXNJ 4QQBA 2ZUGA 4C8YA 4M95A 2K8GA 1O8BA 1F9EB 2DITA 3EZ5A 4TY9A 5HBMA 5J1EB 1UJ6A 5D0EA 2FLLA 1TFYA 2FHOB 4ILMA 1NJYA 2BJ9A 3MWBA 5ETPA 3T41A 3LA0A 3PY8A 4FYXB 3GIMA 1Y10A 2CG8A 1RCXB 4ZN3A 1LKZA 3NGTA 2QLJB 3VAMA 2JSXA 4CQ1A 4WE1B 4U7CA 1HQ2A 4LSZB 4QOTA 5KFGA 2WVFA 2VICA 1WEZA 1WORA 2QX0A 4RX6A 3FDSA 2RQMA 3PR4A 2B4PA 3QFHA 3CJSA 4Y6IA 3GJSB 3SBMA 4WYWA 4XTTA 4FYYB 4IG0A 3WHIA 2VBZA 3IG1A 4QWCA 2HNZA 3PR5B 4KBIA 1VC6A 1HBUA 3IGNA 1WEXA 3QT6A 1ZAXA 1JXLA 1CJTA 1JQGA 3UCZP 5KFSA 3TZWA 4ZHRB 1C4CA 4DZ6A 3TANA 3GV8B 2ZZNA 4LBIA 3C66A 2CFXA 3KK2B 2DO0A 4K4WA 3JTPA 1FRHA 4IYQA 4K4XA 2I8EA 2R3VA 3OL8A 2ACMA 2FY8A 2C2NA 3E51A 5HI7A 3ZTSA 2EFNA 2K1RB 2XMTA 1D9DA 5C5JA 1ZH5A 2RHSB 2OPPA 4RUCA 3MDFA 1TZ0A 1PYTA 2WB4A 3R3TA 3BO4A 1X5SA 3ONQA 4TNOA 3Q8PB 4P2FA 2ZD1B 2L9NA 4RBUA 3WC2A 3PYGA 1EZZB 4YQWA 2H9ZA 2HVZA 2IRUA 2VONA 1JNZB 4QZVB 4K4TA 5IT9Y 5IS2A 1UKUA 5DDRC 3C6TA 1HBOB 1XQIA 3MGJA 4FBTA 3T6BA 3EGZA 1RA6A 3K5LA 5HVFA 1TK5A 2APOA 1PGZA 5FLXU 3OTOJ 1Q7YT 3ITHB 5F8GA 1JJHA 1NAQA 3FEXB 2RDIA 2ROGA 2C2RA 3GYNA 1PJ7A 5CYJA 3M8QA 4OI1A 1N33J 5B0DA 3CGIA 3HSGA 5A6PA 3ET6B 3OW2R 5MLCV 4FXWA 5D77A 4M8LA 4JI1J 3CJKB 2FQQB 3KHHA 2FHJD 3PW5A 1RAOA 4O0NA 2KM8C 4JYAF 1PC4A 2NS1B 2E5JA 3BGRA 1VCTA 1XR5A 2Y0SD 4LF5J 2OI2A 2H1YA 5LL6d 3NNAA 4UOGA 1IN0A 3D67A 4XPEA 2E5HA 2Z58B 4QJVA 5IM0B 1S7IA 3VZIA 4X2BA 2NSBA 1IBLF 2QA2A 1R0AB 2FIUA 3IAS9 4ID8A 1U45A 3QNWB 4WP9A 1DQ8A 4C3MA 1DQ9A 2R8GA 4KHPJ 3F73A 3OFHA 4LFAJ 1RT3A 5DJBA 2VOPA 3L4BC 1HWKA 1ITPA 4J91A 4WFXA 4ZPAA 4KKOB 3KLFB 2KT3A 3U7JA 3EVMA 3TA0A 4TVAB 2XS2A 4G65A 3KHGA 1G7CB 4J9SA 3V81A 2OEJA 2IY5B 2N3LA 1F1BB 4EUVA 1HNIA 1SB6A 3PO4A 4DUTA 4EGLA 1SJ1A 4KO0B 1RTZA 3BPDA 3IS9B 2EI5A 2AZ3A 1S12A 3JYTB 2DNYA 2HFZA 1NDLA 1LW0A 5LT5A 2CQ4A 4NMXA 3MAAA 1LWEA 2YXLA 2X1AA 3HJFA 1REVA 1W7WA 5D78A 3IR6B 1VR6A 4ED0A 4A8QA 1NSKL 2OH2A 2DRDA 1TQLA 1Y3KA 2VZ9A 1R27B 1JLFB 2CJKA 1J5OB 4IUFA 4DR3F 4YR0A 2VBWA 4CT9A 1CS4A 1IBKF 2FY1A 2RMLA 4Y3CA 3NAIA 2E5GA 1WHYA 2DO4A 2V4JA 5A0YA 3Q24A 1HBNA 3SDEA 1VRTA 2A1BA 2XYGB 4DR5F 2CJQA 1ZYQA 5L46A 5CHCB 2B9XA 1UFWA 2HHQA 1X4FA 3ZZPA 2B51A 2EG2A 4CNYA 2G0CA 1UEVA 4NEYA 2WVBA 2VDIA 3VALA 1KS2A 2D7SA 4OZ3A 4JI7J 3B6BA 2ZM6J 4RR5A 1HKAA 1PYOB 3GCXP 1TU0B 1KHVA 2DT9A 1XIQA 3E3XA 4LFCF 4AYBD 1R89A 4OIXA 1HPZA 3SQOP 4EBDA 5HAOA 4OZNA 3R5AA 2CPYA 2XULA 2UXDF 2JOQA 2AZ1A 4WU2A 4C0BA 3B4DA 4HL9A 4PQUA 3I0RA 3P5BP 4BC7A 4DJBA 1VISA 1XMQJ 5IC6B 3BYRA 1L3TA 4AE5A 1HL6A 3TA1A 4NI2A 1TL3A 1FE4A 2YKQA 2ZVIA 1HHQA 1SKSA 3MMJA 2KHCA 1QTNB 3VWSA 2V9WA 4ALZA 4N5SA 4UY85 1HQUA 1EARA 4QR1A 2DGOA 2ABYA 3HFZB 4LVOP 2E5LJ 2NXUA 4DR4F 4NL5A 1FNXH 5LSLA 3KDOA 1FXDA 3JSMA 3DCAA 1TL1B 1S1XA 1WSVA 5DDPC 3M6WA 2EFQA 4IDKA 3QIPB 3QMQA 2B5JA 2N7YA 5KFNA 3GB0A 3MM7B 2J6SA 2V8HA 4DR2J 4C8MA 3IR5B 2LDIA 5BXIA 5JXSA 4QPXA 1FA0A 4KE5A 3DOMB 1XJWB 4DPOA 3PKMA 3PW4A 4B17A 1VQMS 3AXMA 2IVMA 1OSCA 4XO0A 2M0GB 4K8RA 5M2UA 5HMXA 5T14A 8AT1B 1ZM4A 3RAXA 1IKWB 5F8NA 3SFUA 1UVNA 2YKOA 3KHLA 4JI3F 3DN9A 1TV6A 2MEWA 3OFGA 2M8DB 1JLGA 4PQAA 1RWWB 5KFAA 4X4QA 3KMSA 3AFGA 3TUJC 3D4JA 4ED3A 4OJ3A 4ZJLA 3W2WA 4ZLLA 4DPWA 4BC9A 2IYIA 2R7OA 4B3SF 3ULHA 3S7RA 2ZWOA 3OXLA 2DNRA 4LF8F 2ZH4A 1WC5A 4LFBF 1FF2A 1VQ8S 4DV4J 1S1WA 1PKUA 3CCQS 3B82A 2B4VA 4Q43A 2W2PP 2GGPA 2JL9A 2CNOB 2VQEF 1BQNA 1FJGJ 1RT6A 3RBZA 3VF0B 4KTQA 8ATCB 3J81U 1I5OB 3R5DA 4DV5J 1U4BA 3LP0A 3W9HA 2ZC3A 3X1LB 3LWMA 3Q22A 2UXCF 3LAMA 1RADB 1FRKA 1KQKA 3NXZA 4ES3A 1ZZNA 1T94A 5CCLA 3SYZA 1U26A 2B3TB 2AWZA 1WTBA 2JDJA 2J76E 1HQEA 4NLXA 3KJFB 4C8KA 1M5VC 1PYSB 2O67A 3KG0A 4AL5A 5K14A 4MKYA 3GJTB 1B3TA 3QPIA 2VIHA 1S9GA 1TKXA 2C3UA 3D2WA 1YLXA 3SV4A 1Y9OA 3DMJA 1NDKA 3EPGA 3HHNB 4M5NA 3MTJA 4FYWB 1SQEA 1S6QA 3QJJA 3ICLA 2LEPA 1HBUB 2M2BA 2JRSA 3UWTA 3C19A 1NB2A 1HYSA 3OL6A 1P9QC 1DARA 5AE2A 2HFUA 3DLKA 2DNOA 4XK8C 5HK4A 5IT0A 1U6BA 4Z37A 3HVWA 2BE2B 2QG9B 5E0OA 2MKJA 2KZZA 1S0VA 3L7UA 4MT1A 4NXMF 4C11A 2EPIA 5F9LA 4NLQA 2DNKA 2AYEA 5C25B 3TJ9A 1FFGB 1T03A 2MQPA 1S9FA 1BWVA 4K4YA 4IH5A 2HMIB 2WB1D 3D6FB 4CO0A 2OPPB 4KPYA 4FVCA 4F7VA 5K8MA 3SSQA 3W1YC 2XGQA 2QIFA 2ZH6A 1YI2S 2OTJS 3AH6A 1JK9B 2HSEB 3I31A 1WC6A 1UA1A 1FRJA 1X4AA 1NPRA 2WK4A 2ZWPA 1TL7A 2HK2A 4MIWA 5E5NA 3ENQA 4ZLNA 1U1PA 3G8QA 3C6TB 1QD1A 3DRPA 1U48A 3BYPA 2OGUA 2CQBA 2EFGA 3UO0A 3TAMB 3D7SB 1VYAA 4OJGA 4GRSA 5I3UA 1C0UA 4WK3A 3UN3A 3M8QB 2CUYA 2QT7A 1Q8BA 2W4CA 4TLRA 3TW0A 5AT1B 1LFPA 2BKPA 4F4YA 2N3OA 2RD5C 1FDBA 4Z7YA 2XM3A 1X9WA 2HAFA 5C2CA 4YOEA 3QYYA 4HYKA 1F5BA 3JQMA 5KT7A 5DZ7A 1VQLS 4GO5X 2E1CA 3LPEA 4UOHA 4OHYA 1HNVA 2UU9J 3TVZA 3D5MA 4X65J 2QTWA 2Q43A 4EWTA 3VGVA 1MMLA 4WIQA 5CYMA 1WG5A 3DRSB 4WF9Q 2FPHX 4A48A 2M70A 5K20B 1W2BR 4P2MA 4MKAA 3CB4A 3CCWA 3N79A 3O5TB 5IT4A 4NCGA 3V81B 3GFYA 3DOKA 1B4SA 1EJ7L 5F41A 3PHTA 5DLFA 4A8MP 1N8RT 5GMEA 2YNGB 1KP6A 4ZCKA 4EBEA 3BB5A 2ZBPA 1W26A 2YKNA 1ZA2B 3QT8A 5JUMA 3MAAB 2PI5A 2AV5A 4DSFA 3R9LA 1JLEB 1REVB 1CQNA 2OSQA 5BYRA 2ZH9A 4HLBA 1R6VA 2MKHA 3DU5A 3HHEA 3FEZA 3D6HB 3CUNA 2HURA 2HNDA 3LOUA 4FKYA 2GZOA 4DL3A 4PZVA 5HLFB 3MMBB 2D9PA 1NKBA 1KSPA 4ERDA 3UD3P 4KGZB 4OYMA 4UQTA 3BSOA 2V4JB 5A0YB 3IRXB 1DQAA 4DXLA 1FHTA 2YPYA 1CC8A 4KFBA 1I94F 3V6DA 1KFSA 2HGNA 3MECB 4DV2F 1VOMA 1VJWA 2RRBA 3HSDA 1WC4A 2C3PA 1RWMB 3RYLA 1GEHA 4NCBA 5LXRA 1IBMF 3TO8A 1RTDB 4F4XA 2IVYA 2UV8A 5DG7A 1HPZB 2CVIA 2W2NP 2BE7D 4I1TA 3K5OA 4NZ7A 4CLLA 3P45B 2E1PA 2VPWB 4PQUB 3I0RB 2OSRA 3PFOA 4IFYB 2EFVA 3M30A 3RRHA 2DHHA 1RT4A 2AD9A 1T05A 4LF9J 1T11A 3FSIA 3PACA 4H4MA 2OMLA 2FHJA 4F0HA 1DY3A 3GR1A 2OD4A 1H38A 1UZDA 2ASDA 4NI2B 3MUTP 2CNNB 5A8KA 3BQ1A 3BZQA 1FJCA 5EX0A 3T5HA 1KQGB 3VTIA 5LMNF 3CWJA 5IV4A 2BX6A 3EGWB 3KLHA 1YJ9S 3AJ2A 2QFJA 2DRAA 5CCMA 2XS5A 2JFDA 4RPFA 2CJBA 2QA4G 2Z2MA 2W01A 2ACYA 5DG9A 3UVJB 3BM7A 2PGCA 1S1XB 2B6AA 4OL8A 2XY7A 3GFHA 1WF1A 4L3KA 3M8PA 1EHWA 2DK2A 4ZK7M 2V34A 1LEOA 4PRFA 4WIIA 1NJZA 2CPEA 3IFEA 4HEA9 3PO5A 3LO3A 1B7YB 3L7OA 1R8PA 3POTA 2IM2A 3HVAA 2CWKA 1R6YA 4MH8A 5E33A 3ZTOA 4J37A 1ZTWA 3BDEA 3G6ES 1R0BG 4PXBA 1KEKA 5KG2A 1HLWA 2GHPA 2Y8WA 5DM7Q 3WQPA 1LQ9A 3NBPA 4B02A 2KJVA 4ED5A 2CNLB 1UCNA 1TV6B 2BEFA 2DGTA 2KG0A 1VLOA 1Q86T 3OR2A 1KR4A 5KFUA 3UCGA 2ZKUA 4PWDA 5G0RB 4JV5F 3JB9k 3HHLA 3TRGA 1Y7PA 4DV1F 2Z57B 1FESA 1YRXA 1N5QA 1OY6A 3BGLA 4LF2A 4L73A 4DLGA 2POKA 4QW8A 5D0HA 2AQ4A 4RW6A 2GGPB 3UI3A 1BQNB 3EX7B 4FS1A 1RT6B 3QGPA 1TAQA 2DHXA 3WIVA 2B9EA 2HWTA 3IMQJ 2FVPA 3LF0A 1RLCL 1T9UA 4LJMA 4RNNA 1RT7A 4OHWA 4O3QA 3M9NB 4ILRA 4HACB 3T1YF 5HJXA 1RT1B 3CJ8A 3KDNA 2KM8B 1DLOB 1NH7A 4WKYA 4JI6J 2DGUA 2BVZA 3EGNA 2IJFA 2KYZA 3IBWA 1XNQJ 1UAWA 1X4BA 2FHKA 4JI2F 4ECSA 4R8UA 3MR5A 1S9GB 1TKXB 2G1HA 9RUBA 5CZXA 1LXJA 2F9JA 4OZ1A 2IDLA 3RBEA 2ATCB 2IVFB 3DMJB 1HNWF 4BWMA 3OFEA 4PABA 3P49B 3Q2SC 3UD5A 2YWFA 2LCWA 2OPSB 4MFBB 3CCZA 2KXHA 4ICLA 4PYDA 1FKOB 1Y4ZB 1UW4A 1QY7A 1M90T 1WDTA 2CADA 4X64F 4TU8A 5IQ6A 2BJ7A 4ZVUB 1IKVB 4I2QA 4ZP6A 1S48A 1KLMA 2QZ8A 3BN7A 4C11B 2BW2A 3MOZA 3FZ2A 4IKAA 4NLUA 2QMUB 2UV8G 1OPIA 2YNFA 3R7SB 5I3QA 3T5KA 3W5ZA 2A18A 4CYUB 4RU2A 4NOHA 3KK3A 3DLEB 3GMGA 2PD1A 3JSBA 1VIOA 2F4FA 4OZ2A 2YWEA 3HFVA 3BKUA 3BBCA 4HI2A 1M1HA 1QTMA 4N47A 2GA7A 1KFDA 1ZM3A 2GHWA 2XLIA 1RHRB 4GO7X 3IBFB 1QJHA 3KNGA 1U8SA 1S57A 4AUKA 4KHMA 1N5VA 5GAEU 3CD0A 2CG4A 2Y3YA 2XI3A 1X0FA 2JLFA 4AD6A 4DV7F 3HHKA 5H1SV 1ZBTA 3TEHB 5AJ3F 4UT4A 1N34J 2KG1A 1MN9A 2OJ3A 4RW7A 1FFWB 2GVDB 3PW2A 2K7JA 2KH9A 3M32A 2Q6BA 3UW1A 5J2PB 1O6XA 1RU2A 3EJMA 2UUCJ 1X4EA 1TKTA 2AJQA 3TZYA 6AT1B 4DR7F 2JLEA 1N0UA 3CCES 3T9NA 1C0UB 1RU1A 3BEGB 1NO8A 1KKHA 2Y1IA 3D1OA 3PX4A 1R8AA 3L3CA 3DOLA 1NDCA 1EB0A 1LWFB 2ERRA 2QL7B 2DRBA 3M6XA 1R7IA 2HK3A 4ED4A 6FD1A 2RKIA 2RE1A 3KWMA 4U7UD 1VQ5S 1IQZA 2M7SA 1NH8A 1J5EJ 1KQSR 1DJ0A 4GVBA 1I1GA 5BR8F 2EBGA 2ASJA 4PG5A 2IA6A 5HQLA 3IWXA 4YY3J 4OYWA 1NRKA 2DPIA 3MI7X 1S6PA 1LK5A 2ZITA 3FMBA 1KONA 4X66J 2YNIB 1VJQA 5CYMB 2HNYB 1RKIA 3K5NA 4KSEB 2QL9B 2W1BA 3GJRB 1HA1A 2J5AA 1ZZFA 5KT4A 5BYQA 3C6UA 1U1RA 4TY8B 2VJUA 2GX8A 3CMAS 2V69A 2DVIA 1HNZJ 4B3OA 3AB4B 2ZE2B 3SQGB 3DOKB 5L9XA 4EZ6A 2J9EA 1PIEA 2YQ1A 1TP7A 4URGA 4DL5A 3RBDA 1B7FA 5C42B 4NWBA 1GTEA 1SQGA 2L9WA 2D69A 2YKNB 2E9TA 1RBLA 2CNKB 5K8PA 2KU7A 4IQMA 3HP6A 2MHNA 1YGYA 3G82A 2W8KA 2R8HA 3L95X 4DR1F 3RW7A 4I7FA 3HI9A 4DR6J 4C48A 2IC3A 4CLZA 2HHHJ 4FF4A 1U6ZA 2HNDB 3US5A 2HFSA 4PAAA 5EWFA 2YY3A 3ENAA 3ZZ0A 4IRKA 2Q66A 3DGPA 3HKZD 1QE1B 1K47A 1X60A 2HHUA 2I1RA 1P27B 2FC9A 3I5AA 4JB8B 1SJQA 2C2OB 5LOQA 2IM0A 4I67A 1UMJA 4KFBB 4U96A 2J6UA 3LAKA 2C1EB 5J1PA 4QIWD 4DMZA 1PSDA 4CO3A 3M2VA 4DG1A 4J9LA 2OELA 2V2VA 3ENWA 2VJVA 2RQCA 3DI6B 1HHSA 1SJFA 2EKYA 1GX5A 4J90A 1AYEA 1RDRA 1PG5B 1S1VB 3J80Y 3UCUP 4JBCA 1P8GA 1UPPA 1PCAA 3HXMA 4Y00A 3H25A 2MZQA 1EQ0A 2BJDA 4WFZA 4RL1A 3WBZA 1O0PA 4XIUA 4DV6J 4R5PA 3B8HA 1RT4B 2MGZA 1T05B 3PFEA 2KVIA 4DQSA 3DLBA 4K7QA 1RAIB 2VV5A 4ID5B 5D15A 2RS2A 3EUNA 2IIHA 2HRYA 4AQYJ 3CCJS 5A8KB 2CKWA 1H3DA 3NGSA 4FBUA 3DRRA 1VQ7S 2AP6A 3M8WA 1S4FA 1RAHB 3WC0A 1SL0A 4WPAA 3MZIA 2BJ1A 1ELOA 5AE1A 4MMOA 3WZ0A 5GMDA 5KT6A 1SV5B 3LANA 2UP1A 5CYQB 1IKXA 1YJ7A 1LWXA 1SH0A 3WX4A 1D9FA 2XGPA 2B6AB 1RACB 1S1UB 2HFVA 4RNMA 5DQGA 3FFIB 1JLCA 4DV0F 2VHGA 1UA0A 4NLWA 1Y00A 2Z0GA 5CD4A 4A4JA 2WAQD 1SUQB 4YS2A 4ECYA 3V4IB 5DQIA 2QRRA 3POTB 2D3OR 1NSQA 2KT5A 3H20A 2VQFJ 3AT1B 5IWAF 2MLZA 4C4WA 2FTRA 1NJWA 5B0CA 3RTVA 4QYRA 1JJ2R 1WOPA 2K2PA 2A2DA 5JMNA 2BM0A 2Q3PA 3ILOA 3BF4A 3G4SS 2UZAA 1SC4B 2AT1B 1BY9A 1RT5B 3I5BA 5J2MB 1WHVA 4NLYA 3MPWA 3FRYA 2QYCA 4LRFA 4C8ZA 3OR2B 2V4QA 5HROA 2JJ4D 4PUOB 5L1JA 1GFWB 4LF6J 3DC2A 4PWDB 3T1HJ 3DKDA 4RW4B 3HHLB 3KK1A 4ECTA 1LXNA 5E3QA 1MMNA 2R7VA 2LQBA 4DEZA 2GQQA 2UVRA 5F3ZA 1N5YA 1DFDA 3W63A 4EYIB 1ZS6A 3PG9A 2R2UA 5ETMA 4F04B 3DLGA 1GNKA 4Q0BA 3PRBA 1QUPA 1N5SA 3OUYA 4NX9A 1S77D 1T3OA 3MURP 4QCLA 1TELA 5E41A 2DYAA 2F4VF 4ZKAA 5E3PA 3PEHA 4Q45A 3AAWB 2LLZA 1Q8LA 1S72S 2PEHA 2KRBA 5EWEA 1R43A 3LH2S 4CLTA 4HDGA 3MM8B 2BMBA 3WX8A 3CEDA 2F3JA 4CLSA 1YBTA 2DH8A 4ANCA 3N5BA 2ZOMA 3OXGA 2ZOFA 2PE8A 1PAUB 3NCQA 5HMYA 2B9YA 3ZZUA 3FUYA 4NE9C 4DSIA 4X84A 3QLHB 3PEJA 3JQKA 3FK4A 5HANA 3RB4A 2LU1A 4DCOB 3CCVS 4K4SA 3HSJA 2XYPB 2M3DA 4DS5A 3ZFVA 5HP1A 4ATNA 2UXBJ 1U0HA 3CULA 2ZVSA 3A8KA 2C42A 4LQ9A 4ICLB 2JEGA 2AYGA 1WUUA 2AJ1A 2AKWB 1IWGA 1RAEB 4JP8A 3N0VA 2UUBF 4P74A 1SJ3P 2YNFB 3DRYA 2V8DA 3PNIA 2CIMA 3AOAA 2MJUA 2Z2ZA 7FD1A 5J1EA 4W90B 4NZ0A 1YWXA 2H65B 3FVYA 2IJNA 5ETKA 5JJBA 1RHKB 1RWVB 1TKZA 1U25A 4YB6A 3A3NB 2PC6A 1YQHA 2X3GA 1V3ZA 4J9KA 4UZBA 1YZ6A 3IN5A 1KTQA 3J7ZT 3OFFA 2ZH8A 3MD1A 2V6AA 1S4EA 3J7A1 2F7VA 3CO9A 4CH1A 3QAEA 4FPIA 2C3YA 3KLEB 1SKUB 2QMXA 3K17A 3HD2A 2UUWA 1NSAA 3N9UC 4Y2IA 1WELA 1XNRF 2XZWA 1YITS 3M32B 5LSRA 3CCUS 2LP4A 4ZITA 4LRDA 1SCJB 3J81Y 4ZA1A 1NNDA 3GIIA 5E2QA 5H9FJ 4ELUA 3HM9A 4ZHRA 2VBYA 2QV6A 4EO6A 1XTZA 1N32F 2AJ4A 5ADZA 5DGAA 3KK2A 3W60A 3BO3A 1FDDA 3SEOA 5DG8A 3OPKA 5HO4A 4DV3J 3BKFA 2G2YA 4I64A 3KG1A 2RKIB 4P10A 4ANDA 1L3KA 2GVZB 4B3TF 1TUVA 4KGXB 1VQNS 2K1RA 3HF5A 4RO0A 3NS7B 1RHJB 3W9IA 2HQFA 2L41A 4H4KA 1KHWA 1HNXJ 1JLBB 3G2XA 2R7RA 1DTQB 3C14B 5KFWA 1B0PA 1RBAA 6FDRA 3TX0A 1X9SA 2ZD1A 2VC1A 4GKJF 1CLFA 4ZVFA 1FX2A 2NZ4A 3QGHA 1HI1A 3M1VB 4KH0B 4N76A 4WFNQ 3C6UB 4L72B 1N88A 3AQPA 2AEMA 1HBOA 5HSPA 5LMUJ 2D3O1 4LQ3A 2F9DA 5KAKA 4PG4A 2VA3A 4ZPVR 4LSLA 3GILA 1JWWA 3IWLA 2MKYA 3ITHA 4DSEA 1Z2ZA 3R7BB 3NGRA 3PHEA 2YQ3A 1UVJA 4DX6A 2DNNA 2W7AA 3I56S 3OJUA 3C16B 3ET6A 2IBOA 4ECXA 3EDRB 4DL6A 4E98A 5DDOC 2JHEA 3CJKA 4HTIA 3G82B 4N56A 4NLOA 3MPYA 3UN5A 5AXMA 1JB0C 2LKZA 2RDDA 3N28A 5ETQA 5D6GA 4DUZF 1FWPA 1FJEB 4J9PA 2UUAF 4WJBA 3CNQP 3RZAA 1RLDA 2W9CB 2NYHA 2C2ZB 1DTTB 1R8HA 4OI3A 2OEMA 5IM0A 2X7IA 3D66A 3H2LA 1ZM9A 3W64A 3A13A 4CP5A 5DETA 3KFWX 1R0AA 4YDDB 4ED1A 2XNRA 3CMQA 3AA8A 4DFMA 2HHXA 4ECRA 1VQPS 5D4OA 2GV1A 3P3DA 4W98A 4OX9J 1M0SA 5EWGA 2GNKA 3H0PA 1CC7A 1HWUA 4KKOA 3KLFA 3RRKA 2GW8A 4D3HA 1XK8A 2DJWA 1JLQB 1G6BA 5D4LA 4LR8A 3PIPQ 1VMBA 1AXQA 3OSNA 4U67Q 2WW4A 4G1QB 5KFKA 4OLOA 4KO0A 4O3SA 3MEEA 4I68A 2MHEA 2IYGA 2N7CA 3C46A 2J9DE 2F40A 1HR0F 3QWUA 3E8OA 2MZ1A 2P9GA 1J5OA 2CWXA 2DBBA 2AHOB 2OP5A 4M5GA 3CDBA 2KRRA 1Y5IB 2HLUA 2XNQA 3FEYB 1RWUA 3O44A 2BKOA 2LDYA 3HVRA 3RR8A 2M5YA 1GXTA 1RAFB 4CNZA 5GADI 4IOBA 5DM6Q 1JNRB 4ZCIA 2UUCF 3KJNB 1V3RA 2IRXA 3EVWA 3TR5A 4DUYF 1AUDA 2PFFB 5LJ5Y 2DR7A 1B70B 1VQYA 3A1YG 1NKCA 3NMAA 5IT9U 4ANEA 4LF4F 2RDJA 4USVA 5F8IA 2JFKA 1TR0A 2CA9A 3ADAC 4R25A 3GZ7A 4O3OA 4KIAA 4KPCA 3N01A 4BLGA 2MQ8A 3MUVP 2EK6A 4YHHF 2ZH5A 1JLCB 2HWHA 2X1BA 1U24A 5IV3A 3CJQA 3JSYA 2G0JA 2QA1A 4AXIA 1KWMA 3FBFA 4DU8A 4BWJA 5F3TA 3O6QA 3NNCA 2RSQA 3D6MB 5KG3A 3RAMA 4F67A 3NKYA 4Y34A 4E2FB 1GH8A 4MKBA 3I96A 1U1OA 4H4OB 5B0AA 1T02A 3TYTA 1WACA 3KUEA 3AOCA 3GSIA 4B9LA 2XWXA 3KNAA 1EKSA 1S6UA 5HROB 2Z2LA 1UFLA 2QE5A 1KVKA 2HIYA 3RRGA 1FXLA 3LGNA 1CULA 4PXEA 3KK1B 1F6TA 3VQTA 4ZPTR 3S01A 1RWKB 4K0KJ 2HVDA 1Q8KA 4F50A 2B4UA 4P73A 5HATA 1UWBB 1TL1A 2JC0A 3GIKA 1SJRA 1MWYA 4IH7A 1AB8A 2O01C 4Q2MA 3OUYB 3RG6A 1U2CA 3QIPA 1IKYB 2HGMA 3D0GE 1IR1A 4OYBA 2EC2A 3MM7A 1LK7A 2ALZA 2HEKA 1S10A 1NEEA 3I4HX 2XB2D 2H4WB 4UUWA 1M5PC 3UR0A 1B0TA 1NCLA 3DOMA 4J9VA 4P2XA 3IGVA 1EIYB 1H2VZ 3CO0P 3PRDA 3ZTPA 2C2KB 3GCWP 5H9FK 3GONA 1C4AA 3DXSX 2OTLS 1UL3A 4WFYA 2WHOA 1T8EA 4TXSA 1LWCB 1GXLA 3BSAA 1RQ0A 1RABB 4ZVGA 5HQMA 3IAM9 3THVA 3H5SA 1L3UA 3ZC4A 2W2OP 5T7LB 1N36J 4C8OA 1PO6A 2UVUA 3W7BA 4F25A 5LSOA 3ZZOA 1WHWA 1YDLA 2W9BB 4Y0FA 4OQJA 4OX6A 4M5IA 2XCPA 3PW7A 1O5JA 1KLNA 3TUZC 2MJNA 1YZ7A 4M5KA 1VK3A 1HFEL 2J7KA 2BV3A 5I42A 2CDQA 5A2QU 3MM6B 3OD2A 4Q7AA 4HH0A 3W5XA 4NLSA 2BRLA 3K59A 5F0UA 4DPYA 4O4GB 2JWNA 3J7YU 2ZHAA 5H9EJ 2ZBCA 2DR6A 3GIJA 2OEKA 2VG6A 5DO2A 1TKZB 2W8LA 1TKDA 1D1UA 4ENOA 1K1SA 2WVCA 1YK9A 3ETOA 2KI2A 3RW6A 3W2VB 2QFIA 4B08A 1Q16B 2MSTA 3HZEA 2DIUA 2C2DA 3I6PA 3QBCA 4TLQA 3KJQB 2ROPA 2ASYA 1N4LA 3V5RA 5CD4H 3C15B 5KFQA 1FWKA 1WEYA 3MPDA 4QR0A 3KJVB 4DL4A 1NK8A 4QWDA 3EICA 2HS3A 1NU4A 3DM2A 3A3PB 1S5ZA 4NYPA 1AROP 2MZJA 2FJVA 2A6MA 2FZCB 1WTFA 4F36A 4NLGA 4ZP9A 3CXCR 3NOGA 1F2HA 2BE2A 2R7TA 2V9KA 1RAAB 1SC3B 2V94A 1OY9A 1XR7A 2JLGA 3V4MA 5C25A 4UF4A 1D8ZA 1LV5A 2CQ0A 4AT1B 4HT7A 4P72A 1UVIA 2C2EA 4C3KA 3CMES 1I51B 2HMIA 1K9MT 4OZ5A 3AJ1A 4NCAA 1K73T 4P7VA 3RUBL 4OHXA 2YX4A 4QIFA 2AIRB 2BQ3A 4USMA 3EDQB 4USJC 3BGFA 1VQSA 1WD6A 2PMZD 3THPA 3V6JA 4LUBA 2H4YB 4MAKA 4ECQA 5KFEA 2YWWA 2HS0A 2DR8A 4IR9A 4KH1B 4I56A 3GQCA 2ADBA 2HVEA 3K5MA 1SKRA 3CW2C 2FGOA 2IAJB 2RS8A 4WP3A 3DYAB 4CLYA 4RW9A 4WU3A 1F5CA 2LMIA 5EHHA 2XC9A 1K44A 3DHXA 3U1LA 2DPJA 3NLCA 4LSLB 3TAMA 2R7WA 4B3MF 3OQ2A 1DHMA 5BYSA 3PDNA 4CH0S 2AEJA 3GTYX 4JV1A 4V19X 4I69A 2JNJA 1ZOTA 3GYGA 4OJ1A 3TUIC 1RBOB 3AQOA 2XZDB 1MW7A 4IG3A 2MQOA 1Z2LA 4WXWA 4G3IA 3G6YA 3AA9A 5L1IA 2RH3A 3TOQA 3CD6S 2N4CA 5E3CA 1WG1A 5M2PA 4P7TA 4ECZA 4O3PA 2P5VA 2W24A 2CVEA 4I6AA 4FDFA 3FKBA 5U47A 2PMHA 1BWEA 2AJ0A 3GV5B 1XBWA 3DRSA 3B78A 3KUGA 1FTRA 2LYVA 1T0TV 3UDLA 2CPFA 3MEKA 3VHQA 4F2SA 4FN5A 2FVQA 1NSPA 4ZLJA 2O66A 2ILZA 9ATCB 1ZTTA 2YNGA 2DGVA 1BGXT 4LRCA 2ZDOA 2DGQA 4URSA 1GTHA 2PO4A 3Q2TC 3MEEB 2HQCA 3UNGC 4ZIVA 3R1LA 1XMOF 3LP2A 4F26A 2R2TA 4FXDA 4J9UE 4LMZA 2EEYA 3SSRA 4ZPBA 1JLEA 1FERA 3CF5Q 1M1GA 1FK9B 4UZCA 2J7WA 2PI4A 4XDCA 1T9XA 3ILIA 1U1MA 4JYAJ 1P9YA 2VODA 1U1KA 1CBKA 5HLFA 2MB0B 3MMBA 3HHLD 3ISNC 1RXOB 2YBVA 3R2CJ 1N52B 5HMZA 3NL0A 4UOCA 2HZVA 2J6TA 2OLWA 3MCNA 3IRXA 3O2IA 3SCJE 3ZZTA 1N48A 2HBQB 2EVZA 4ZVRB 4ED6A 4JI5F 4CH7A 5DGBA 3MECA 3PKYA 1TAUA 2B8PA 2DD8S 4P6QA 1GT8A 3IM9A 2YH1A 4B3RF 2XYHB 3MM9B 2XMMA 4K2JA 3NMRA 5KOXA 2NQPA 2Y9HA 4ZVHA 3NOCA 2B7CB 1RTDA 1G4CA 2GIRA 1PILA 2J8AA 4NLPA 4UTGA 4WWSA 3CCRS 2ZNYA 5FIIA 4CWBA 2X3DA 2YWGA 2G2OA 1C2PA 4IFYA 2YWHA 3GFZA 4DS4A 4TYAA 2ZH2A 2J0QD 4WYLA 4M5DB 4FVMA 3H4DA 4RUHA 1NK0A 2RUGA 3NEKA 1KBRA 3SIPB 3LW5C 2W7OA 5BJRA 1K1QA 2KO1A 2QLFB 4RKUC 4DR3J 1LOUA 3LGMA 1IBKJ 1CULB 3LPYA 2Y1RI 1BXNA 5H9EK 3CDWA 1NPPA 1JXEA
chains in the Genus database with same CATH topology
5HP1B 3BDPA 3C6UA 3I5CA 1U1RA 4TY8B 4FXVA 2G4BA 2GX8A 3P6YC 2BABA 3CDAA 3N6LA 3CMAS 1D8YA 1S9EA 1MROB 2DVIA 5KFYA 4XPCA 3KJVA 2VKRA 2MZRA 4QPTA 2YX1A 5KFZA 1X4GA 4O0IA 3LALA 4C3LA 4B3OA 2CQPA 2ZE2B 3AB4B 3DOKB 5L9XA 2QLXA 2J9EA 3SQGB 4EZ6A 3OL9A 5DDQC 1M5KC 5IQQA 1S49A 4EEYA 5KFLA 4FYDA 3N6MA 1WNEA 1WWHA 1TP7A 4QQBA 2FC8A 4URGA 4DL5A 5KFTA 4IRDA 1FNOA 3RBDA 2D3ZA 1B7FA 5C42B 2ZUGA 4C8YA 1UJ5A 2ZFHA 4NWBA 4M95A 5A6WA 3M6VA 2BM1A 4GMKA 4MK9A 3WDOA 2K8GA 1O8BA 3H2VE 2MKCA 4I0WA 1GTEA 2L9WA 2DITA 4OMFG 3OTBA 4TY9A 5HBMA 3EZ5A 4NLRA 2U1AA 5J1EB 4Z2XA 2YKNB 1UJ6A 2FLLA 1TFYA 2FHOB 4ILMA 2E9TA 2VPYB 4JV0A 1NJYA 3MWBA 5K8PA 2KU7A 3PY8A 4IQMA 3HP6A 2DHAA 2MHNA 3KLGB 1YGYA 3I9ZA 3GIMA 4RBTA 2W8KA 2M4MA 2R8HA 3L95X 2MY7A 2JC1A 4DOZA 4Q5VA 2ZJPQ 4KB7A 1LKZA 2AF6A 4DR1F 3RW7A 5CA5A 5EDWA 2BXJA 4I7FA 3HI9A 4YR3A 3TNVA 3OSPA 2IC3A 4LQ3A 2MKSA 1HHTP 3NGDA 3VAMA 1TL3B 4FF4A 5DS7A 1U6ZA 2HNDB 2JSXA 4CQ1A 4WE1B 1TVRB 3US5A 1WI6A 4LIRA 4DHVA 1RK8A 1D3WA 4U7CA 4QOTA 3BO2A 5EWFA 3T3FA 2YY3A 5KFGA 3ZZ0A 4IRKA 2GIQA 1WEZA 3TI0A 2Q66A 4Q8EA 4NA2A 2ZKTA 3DDKA 4RX6A 2BRKA 3DGPA 3HKZD 1QE1B 2B4OA 1QM9A 3VAJA 1FE0A 1LFWA 3FDSA 2GO9A 2EG1A 2HHUA 3PJXA 2I1RA 1P27B 2RQMA 1WF0A 3PR4A 4ED2A 1HQUB 2FC9A 3I5AA 2B4PA 1X0PA 4KGMA 1SIZA 1SJQA 1FKPB 4Y6IA 3K0JA 1MWZA 5G0RA 3D1QA 3H5XA 2VOOA 3S8SA 2IM0A 2YH0A 4I67A 3MR3A 3G8SA 5EGYA 1UMJA 4KFBB 4ETZA 4RZRA 4GKKF 4WYWA 3DLLQ 2J6UA 3LAKA 5J1PA 4IG0A 2VBZA 4QIWD 4DMZA 3IG1A 3UDCA 3JSMB 4F8RA 4QWCA 2HNZA 3PR5B 4KBIA 1VC6A 1HBUA 3IGNA 1WEXA 1ZAXA 1JXLA 1PSDA 2FJBB 4CO3A 2NPIA 3M2VA 4K59A 3UCZP 4DG1A 5DLGA 4IDKB 5L38A 2IAJA 4J9LA 1FKAF 3DYAA 2F1FA 1U2FA 5KFSA 2B5JB 5C24A 2IMWP 4ZHRB 1C4CA 4K4VA 3CCSS 3TANA 3GV8B 3ENWA 2FHMA 2RQCA 3DI6B 4ZVEA 1HHSA 1SJFA 2EKYA 1GX5A 2WBMA 4JI4F 4F2RA 1QVFR 2ZZNA 4X4RA 3C66A 1RDRA 2CFXA 2GFFA 4DWIA 3KK2B 1X7VA