3UFCX

Characterization of a cas6-related gene from pyrococcus furiosus
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
243
structure length
243
Chain Sequence
GGMRIEIKLLPLQDNPVIPFNYNYELYSQIVEKAGAIEPRIVKLLESPHGYWTFSRIIIRKREIIPEKGIKILSDDISLYISSSNKEIIKGIVEGIEKSPEFKIGDVGFLVADIKALKSKEIKNVNIFSTLSPIVVRTVKFEGDKLKHWDLYPHDELFLDRLRKVMLLRYHEVMGDLPEDKDFRIELIKFKPTRLIVKDSYIRGSLMVFRYYGSKEIAKFGYENGFGEKTNLGFGMVKIIEEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal structure of a Cas6 paralogous protein from Pyrococcus furiosus
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 69
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2011-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01881 Cas_Cas6 CRISPR associated protein Cas6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ufcX01
3.30.70.1900 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ufcX02
3I4HX 4C98A 4ILRA 4C8YA 3UFCX 4C97A 3QJJA 3PKMA 4C9DA 4ILMA 3QJLA 4ILLA 3QJPA 4C8ZA 3ZFVA
chains in the Genus database with same CATH superfamily
4B3OB 4UZBA 2VODA 1RKIA 4A46A 2O3DA 4KSEB 4DHVA 2GVZB 4DSFA 1CPZA 3T6BA 2FJBB 1HI1A 3SV3A 1N5VA 1VQ5S 2FJWA 2XSJB 2HMIB 4NA1A 3OJUA 3CDBA 3BO2A 1YQHA 2R42A 3K8VA 1TAQA 4JI4F 3K5NA 3QT6A 3PY8A 4L3NA 2PO4A 3TRGA 1DY3A 1N5SA 4FYVB 3HKWA 3OL8A 3TX0A 3NP5A 2VBWA 2CIMA 2AYGA 3UNYA 4QCLA 4KC5A 4FPIA 1HBUA 5CQGA 2W4DA 3AFGA 1JQGA 1N5YB 5J2QA 2ZE2B 1ZAWA 1SH2A 5IOLA 3MHYA 4B9MA 1TKTB 4IG0A 2KXNB 3CDEA 4NZ0A 5A2QU 1H0HB 5A0YB 3FMBA 1VC5A 3NOGA 2FGOA 4DBQA 1KQSR 2GQCA 3RU0A 1S57A 2IHR1 2DRBA 2ZH9A 2RILA 1VIOA 2DH7A 1U26A 5DQIA 3SV4A 1OWXA 1K1QA 4C98A 3PO5A 2ZH7A 1CJUB 1F60B 1GNKA 5B0BA 4NASA 4A8OA 3MAAA 1FWKA 3LGHA 4ZP7A 4WZQA 3MEGA 5LL6d 1KLNA 2Z2YB 1CBKA 3MEDB 2EFPA 3KLHA 2CPDA 3TA0A 5KFUA 1FDNA 2QC3A 5JUMA 4MKVA 3CD5A 4KO0A 3UDEA 3D7SB 3DLKB 3WBZA 2HPUA 2VICA 3I31A 3DXSX 3KLEB 1FTCA 5LMNF 5H1SV 4CDIA 4IO1A 1NK5A 1SL2A 3CCQS 3TW0A 3C3LA 2DJWA 3QPIA 4L6V3 2D1CA 4WFBQ 4NI2B 1D9DA 3GYGA 4DSEA 5AXNA 4Y00A 2NR0A 2HHPA 1NK9A 4H4OB 2DGOA 2CNKB 2ZOGA 4J9OA 3CD6S 3DOMA 4C8MA 4F26A 4WE1B 2RUSA 2C1EB 1WC4A 1FERA 4RJVA 2WCXA 3KNGA 1AA1B 3HJFA 4RNNA 1C0TA 2H1YA 5C5JA 2OPRB 4UUWA 5IC4B 2FC8A 2HKEA 2RQCA 1CJTA 4DX5A 2UXBJ 4M94A 2AT1B 1YBUA 3Q8YA 2E5GA 3I0SA 5T7LA 4MYUA 4K0KF 2UUTA 5J2MB 4YB1P 2NYHA 2N7CA 1B64A 2I6WA 3UI3A 1Y5NB 1HBMB 1GX5A 4UUXA 1SVDA 1R0AA 2HVEA 4HVZA 1TAUA 3JS9A 1SQEA 1S77D 3IA0A 4KV8B 2GVDA 3FJ2A 2GW8A 4QU6A 3DXBA 1TFYA 1YSJA 3KMQA 3L4BC 1Q8BA 2ZUGA 4USVA 3CWJA 1U8SA 2KJWA 3DGPA 3DKDA 2Z2MA 2GIFA 6AT1B 2M8DB 2HGNA 3RR8A 3P6YC 5KFDA 1N33J 4ZPCA 4M63A 3W9JA 2F9JA 2KVQE 1K44A 2JL9A 2E9TA 1UW4A 1M0SA 3KHLA 4IKAA 2B5JA 4YOEA 5DLGA 1TL3A 4KGZB 2XB2D 2BBEA 3DRSA 4F2SA 2XY5A 3GJSB 4ID8A 4HYKA 1FK9A 5F8IA 1W2BR 3I5AA 2EG2A 4TYAA 5AJ3F 3SBMA 1LW0A 2YNFA 1RLDA 1NMEB 4KFBB 1FNOA 2KO1A 3ETMA 2GMJA 5K8MA 2LYVA 4DEZA 3BDPA 3CJ3A 4WU3A 4FNIA 2QYCA 3PVXA 2DR6A 2LQ9A 3Q86A 4URGA 1H3DA 1HWLA 1RHJB 2QA4G 4HHHA 2PDAA 1R6YA 2COLA 4P9SA 1UAWA 1K9MT 1VQPS 5MLCV 3CJ4A 3G8QA 2DIUA 1VHFA 3HHNB 4GO7X 3OFEA 4B9VA 1UEUA 1M1GA 5KG4A 1QJHA 2XZDB 3UE2A 1DTQB 3CIZA 3UFCX 3DHXA 5CH7B 3DOLA 3PTWA 3SSRA 4LSLB 4GMKA 4WXOA 3H0PA 5A6PA 5DZ6A 1Q79A 3NMAA 2HFUA 4D3HA 3NGKA 2RVJA 3A3PB 2W2OP 2B6AB 1KHVA 5C24A 1RA7A 1LWCB 1TKZB 2JHEA 4PWUA 3CC2S 2DNQA 4NLSA 1KWMA 3NKYA 5A8KA 2FVCA 2WAQD 1X4HA 4WFZA 4DR3J 2MKSA 2DK2A 3T1HJ 3BN4A 3LP0A 1XMOJ 3OPKA 5H9FJ 2AGOA 2L08A 1VHIA 1T05A 4JV5F 2C3MA 4LF8J 4DV5F 5BYSA 1JKHB 3V6JA 4QWDA 4E98A 1SIZA 3FRYA 3PX6A 4PWDA 1HBOB 1Y10A 1P1TA 5HANA 1BQNB 4RWXA 1RA6A 4MTPA 4ZP8A 3PX0A 3P8BB 1U2FA 1CJKB 4ICLB 2HFOA 2JNJA 4ERDA 3EVOA 3CCTA 3LAMA 2MKIA 4NLVA 3EZOA 2OTJS 4KB7A 1QAXA 3QO9B 3HSZA 3GV5B 3TWZA 2BDPA 3E01B 5CD4H 3MMBB 1UWBB 2YNIB 4ELUA 1F9HA 3BGFA 5B7WA 3H40A 1G3OA 3THPA 2ZBQA 5KOWA 4F4XA 3M2VB 1B0VA 3H98A 5B0CA 3RRHA 2FLLA 5F9LA 2M3DA 4DV3F 3TI0A 4ZA1A 4TXSA 2F4VF 1JLFA 2EK6A 2JC1A 3ZTQA 4RW8B 2MLXA 2HVHA 4ZIVA 3MAQA 1RWOB 2XI3A 4BDPA 3GYNA 3PRBA 3M8QB 4DPXA 2X3GA 3ZZ0A 1WHYA 1U45A 2W9BA 3Q8RB 3PW7A 2CVIA 4OLOA 3NGSA 3A8IA 4R25A 1T9VA 2LQBA 4FYDA 1Q82T 4RW9B 4JOUA 3L7UA 2EBEA 2ZNZA 4USTA 2A2CA 4P2MA 2HFZA 4OZ0A 2IY5B 1X9SA 3GFHA 2DHAA 4OYXA 5DZ7A 4YB5A 2CPHA 3MR5A 3U1MA 3CXCR 1S76D 4FF2A 2HZCA 3TVZA 5C2GA 3CIMA 3EZ5A 2ZWPA 4QYRA 2CG8A 4YMEA 1B7FA 1FX4A 3M8RA 2CPFA 1UJ6A 4CLPA 5G4DA 2V4QA 4K7QA 4C8YA 2V67A 4LR9A 3BQ0A 3HFVA 4LSNB 2QLJB 1D09B 2AV5A 1LEOA 5EX3A 3I87A 1FRHA 4JV2A 4NOHA 1U1NA 2HNYA 3GFXA 5M2UA 3SFGA 4JI3J 2XMJA 1G7CB 5CAAA 5GAGI 2BJ1A 2VD3A 3QSIA 4ZCLA 1T94A 2BW2A 2LU1A 1J2VA 2G4BA 2FVRA 1ZPWX 4Y2MA 3K8WA 1KFSA 3TJ9A 1X4BA 2WONB 1U49A 3D0GE 1EQMA 4S0MA 2BXJA 4FF4A 3M6VA 3E2EA 4ZLLA 2B9EA 2WHOA 2EFVA 3MD3A 4LRBA 4JI5F 1PKUA 1KKHA 4ZPVR 4G6VB 3D28A 2O66A 4OYWA 4N56A 2JSXA 3GZ7A 1XTZA 1RACB 2RRBA 1I6JA 2ZHBA 4TYBA 2M5YA 4OZ3A 4QJVA 3UCGA 2KM8C 2C42A 2Y1JA 4DR5F 2AJ0A 3J81Y 4Q7AA 1HQUB 3AB2B 3E8OA 3VAMA 4DN0A 3T6JA 1CQMA 2NSBA 1PAUB 3N6NA 4PQUA 2QX0A 1SH0A 2KN4A 4CTAA 1RHMB 4OZNA 3BSNA 4IO9Q 2YH1A 1F3VA 4JI0J 1HNXF 2RDIA 3BV8A 1RWNB 2KTQA 2A10A 3FQKA 1S97A 1KSPA 3G4SS 2NPFA 1RHRB 4J9SA 1SJ4P 2IAJB 3MTKA 3CJQA 1NH8A 4O3OA 2CQPA 3ENVA 3DN9A 4M1KA 4GKJJ 4XDCA 2HQIA 1JLQB 5LJ3Y 2JX2A 2OIHA 3ILIA 3D6TB 3MM9B 4X4VA 2AYMA 4TQRA 2YNHB 3NCQA 1T02A 4LRAA 1HNVA 5HBMA 1VQ9S 4CT9A 2J9DA 1YDLA 1FJGF 4I2PB 2GV1A 2OELA 3JSRA 1YGYA 5HROA 4O23A 2RJZA 1S1UB 2BJ7A 3BO4A 4EU0A 4ES2A 3BJYA 1TKXA 1DQ9A 2GHVC 1IKXB 3GV8B 1BE4A 2LQJA 3ZC4A 3GB0A 3GCWP 2NUUG 5KFGA 3HPOA 2CNLB 2KKHA 3NEKA 2AZ1A 4WFYA 1WSRA 2BYCA 1R3NA 3ELHA 4DV6F 3OVSA 2P5VA 1FRMA 3DI6A 3R6LB 2DITA 5HL7Q 2HK3A 2YQ3A 2H5JB 2HURA 3M6UA 4AYBD 2Z2LA 3MR7A 2RH3A 4X62J 2YPZA 2C2RA 1F1BB 2BANB 2CJYB 2CJBA 1NZAA 3A1YG 1S6UA 4B3TJ 4LIRA 1WC0A 1PO6A 1Y3KA 3EGWB 5BR8J 3DRRA 3H5SA 4USIA 1A9NB 4B3MJ 3CJRA 2YKMB 1Q1KA 1Y7PA 4F04B 3UCZP 3MZIA 5H9FK 5L39A 2QLWA 3BYRA 3V2UC 4ZVHA 2R7UA 4B08A 2CKWA 1WHXA 1VQMS 1KP6A 3Q8VA 4WXWA 3X3UA 1ZA1B 2ZH2A 2MKJA 4WJBA 1TFWA 4IG0B 4URSA 2IVMA 5SUHA 4WIIA 2HHHJ 2DKOB 1FKOB 1PJ7A 3MM5A 3OR2A 1NDCA 2ACYA 1HQEA 1XC9A 4R8UA 3ITHB 1NJIT 4DU7A 4YHHF 2VL1A 4OJ3A 4ZCIA 4NLYA 1OMSA 3DC2A 4ID5A 3RB3A 4QZVB 3KHGA 3GQCA 1RI7A 4PG5A 2PI4A 2MGZB 3ZZYA 1YJ9S 4I7FA 2KRBA 2ZM6F 2VC1A 3DYAA 1QVFR 4HDHA 3MAAB 1U1MA 3GIIA 1HBNA 4M8LA 2QL5B 3T9NA 4DL7A 1JB0C 2ZBPA 2A1BA 3KLFA 1I94J 2HQFA 4DV0J 2BEFA 2RHQB 4KO0B 2KVIA 2AZ3A 3D5MA 1T8EA 3MPDA 1XJWB 4ZHRA 3MM8B 1RAEB 1RHUB 1H2UX 1NSKL 4DL6A 3V4IA 5KFFA 2ZHOA 1N36J 2EFNA 1PJ6A 3Q24A 3EM1A 1VLOA 3DLHA 4JI8J 2QMUB 3CF5Q 2XLIA 2JEIA 1VK3A 2CJAA 1YJ7A 1JXVA 5KFRA 1SC6A 4ZKAA 3T1YJ 1R8CA 3VGTA 2E1RA 5FDLB 2GNKA 2YKPA 3MPUB 4F4AA 1AB8A 3GIRA 2FHKA 4J5OA 4RZRA 2KHCA 3DOMB 4OV1A 4NCBA 3SXLA 3EE3A 2VONA 4ZVUB 5LXRA 4DG1A 2ALYB 8RUCA 3A8KA 1C0TB 3EXYA 3J7Z5 1IKVB 2RQKA 4QWCA 3HHLC 1HYSB 1RKJA 4C8NA 5K8OA 3R9LA 2NSCA 2OTLS 1RTJB 3G6YA 4DFJA 2MYFA 4U7CA 3H7HB 3R1HA 5HLFA 4O0IA 2CQ2A 2BRLA 2YX1A 1HPZA 2HBYB 3SMZA 5T7LB 1XERA 4X66F 4RW4B 5D8HB 1U48A 2KZMA 3NXZA 4JI2F 1S0VA 4NMXA 2D9PA 4TQSA 3D2WA 1F5CA 3CO0P 1DFDA 4I6YA 3ZZPA 4K4TA 2XYPB 4K4VA 2C3UA 5FD1A 4P7TA 1R0AB 2UV8A 3S6EA 3SYZA 4DR4J 2QTWA 1R8AA 2QLFB 2GVDB 2ZOFA 2KT2A 1K0VA 4ZPAA 2CDQA 4C2MA 1WKJA 2VFTA 4B3RF 5HJXA 3A3NB 3V4MA 2VASA 5DO2A 3IFEA 1HNZJ 3DGPB 5HMWA 4FVCA 4IOBA 3T9ZA 5GAHI 2F7VA 3MEEA 3BKUA 4FF3A 5K8NA 4ZPDA 5I3PA 4FYWB 3MMCA 5HP1A 5LJ5Y 2HHXA 1C2PA 1TL3B 3MURP 4ED2A 2WBRA 3RAQA 4L75A 2JRSA 4K50A 4ZN3A 5E5NA 1LW0B 2YNFB 3OFHA 3QWUA 5HAOA 3EGZA 2Y9HA 4OX9F 1ZM4A 2HGMA 5I3QA 2FLOA 3BKFA 5HVHA 4W90B 2FVSA 2R7TA 1F9EB 2V68A 3D4JA 4XIUA 4DDFA 1Q86T 3I6PA 2MQQA 2F3JA 3C2PA 1UA1A 5AE1A 1N54B 1HD1A 2UVVA 5HQMA 2JLGA 5C25A 4M5KA 2X7IA 1N32J 3KJNB 1NKEA 4X4RA 1RZMA 1GK8A 1QDUB 2LLZA 1S49A 2E9ZA 5D4PA 1H98A 4ZJQA 2NXUA 1RTHB 4EMDA 3KLGA 4KH1B 4M5DA 2MZJA 1FHTA 1ROFA 3V6DA 3BYPA 2GMHA 3DOLB 5CHCB 3LANA 4AFFA 2G1HA 1UVJA 5D4LA 2X51A 3QATA 1IJFB 3EPIA 1AXQA 3X1LB 1EZZB 3ZZUA 2U2FA 4ZDNA 5GMDA 4ECZA 5C24B 5CYQA 2IVYA 3PEHA 2WBMA 3FRZA 3PR4A 3FFIB 4WFXA 4ECWA 1NZ8A 1JX4A 4YB7A 3C14A 1HL6A 2B56A 5A8KB 3G82A 1APSA 5KTQA 4ZPBA 2DNGA 2LXUA 2SXLA 3OTEA 2UU9J 3QGHA 2K3KA 2CPIA 2CQGA 4X4PA 3CMAS 2WW4A 4M5JA 3NCRA 9ATCB 3EWGA 2I5JA 4ILMA 1RISA 4LQ3A 2CJXB 1R89A 2GQ2A 2FLPA 3OXFA 2EBGA 2GHWA 2KZZA 4NZ6A 3TAPA 2UV8G 3MM7A 4LF7F 3VAJA 2K7KA 3R97A 4X4NA 4CLZA 1XWLA 4OHWA 2OFGX 2AJ1A 4ZCMA 2XY7A 1S59A 4NX9A 1S1WA 3JYTA 2CPJA 1RT3B 1RB0A 3QJPA 1XIQA 2ZC4A 2E44A 4ZJLA 3C8YA 4EK2A 1RT4A 1VQNS 3W9HA 1WG4A 1LWEA 2E5LF 2CQBA 4ZVTB 3K0JA 3CULA 2PGCA 1OSDA 1JLAB 2QV6A 2F9DA 2LEBA 2RKIB 4JI4J 4FYXB 2RU3A 4QIFA 1HNIB 2QRRA 3M1VA 2KH9A 3N79A 3LPEA 1UMJA 3CNQP 3HULA 2RIJA 3ENAA 3OSPA 1TV6B 2A3JA 1B99A 3KUEA 4AT1B 1UVNA 3I4PA 4C8OA 4JV0A 4DL3A 2HHTA 4B9UA 4ZP9A 3WX8A 5KFHA 3DGVA 2MSSA 4IR9A 2R7OA 1T9UA 3IWXA 1K8AT 3AQPA 1NPKA 3GMGA 2W9BB 2ZJPQ 1JLGA 4C9DA 5F8HA 3AA8A 2G2ZA 3C6UB 2U1AA 1IBKF 2ZUAA 1K0TA 2D69A 1BMQB 2AW0A 4HLBA 3PKYA 1RT6A 2D74B 4CLKA 5BXIA 4JP8A 3MI7X 2J0SD 4R5PB 2DGSA 2O5DA 3LO3A 3OTOF 2DO4A 5D4NA 1P27B 4Q44A 1HMVB 1YRXA 3JSMA 5JVHQ 2A6OA 2RQ4A 2V34A 2DEJA 3AAWB 4ETZA 2ZH1A 2HEKA 3M6WA 3EJMA 1X5OA 1BD6A 4ILLA 4YEAA 5SZTA 1X4CA 4BS2A 2PSZA 4CLFA 2EC0A 4F50A 5T14A 1Y5LB 2D9OA 2LEPA 2YVSA 5LMNJ 4FPRA 2HS4A 3CCRS 3O6QA 3TA1A 1C0UA 4C11A 4CT8A 2HZVA 2J8AA 5ETLA 1N4LA 3VF0B 2XC9A 2J5AA 1UJ5A 4MIAA 3K5OA 2KDOA 5D4OA 3OVBA 1SC1B 3IBWA 1LXNA 1K47A 3K89A 1VJQA 1NEEA 4OYMA 4CO5A 3CCSS 3KWMA 2IJFA 1Y0HA 4WBFA 3ZTSA 3PJWA 3T1HF 2UVWA 4UOGA 3UR3C 1G4CA 4E0DA 1VQKS 2FZKB 1MWYA 1X4GA 3HMJG 4ECVA 2XSFA 2O67A 3NAIA 2RF2B 3VAIA 4QBUA 2BW7A 2ZD1A 1T7PA 4K0KJ 5FLXU 4OZ2A 4G1QA 3HKZD 3IGVA 2BACA 3J7YI 1LFWA 1TVRB 5A8RB 2I2YA 4OLPA 3ONQA 2VDIA 4CH1A 4DX8H 3V5RA 2YKNA 1U2RA 1IQZA 2OPQA 2OSQA 4MK9A 3M6XA 3PHEA 1YZ6A 3GSDA 3MTJA 2PT0A 3CCMS 2DY9A 4UY85 3GG0A 4MFBB 2ZH5A 2HQDA 4C8ZA 1NPPA 4AQYF 1D0EA 4KT0C 1I51B 3GIMA 3LP1A 1N88A 4F0HA 1NO8A 2OFHX 1IKYA 5HBMB 3MMAA 4O3RA 2YXLA 5HROB 3ZTPA 4ZVOB 1DURA 2VKRA 3BBCA 1JIHA 1XBWA 3UN2A 4RKUC 3HO1A 1FF2A 3O1LA 2HRUA 4RUAA 3LGMA 2ACMA 3ZZTA 2RS2A 1XR7A 1SKUB 3LOUA 2DGXA 3RBXA 4I64A 4OI2A 4H4MA 3UD4P 5LT5A 2DT9A 2IRYA 1MG7A 2B9WA 2DH9A 1HI0P 4J9VA 2GJ2A 3O44A 3HT0A 3DI6B 2OI2A 4EO8A 2J6SA 3T3FA 2XMVA 1BLUA 3GJTB 4YUDA 1MLAA 4BC7A 3UNGC 3DDKA 5EUHA 4K2JA 5J2NA 2HLTA 3PJ9A 3DRRB 5DETA 3GG1A 3N5BA 3QZ7A 1YI2S 2MY8A 3IWNC 3OR1A 1XQIA 1OYDA 4CIOA 5KT5A 5GADU 2I1RA 2MQNA 1PBUA 4C3LA 1Z4UA 2V6AA 5F8MA 1B4SA 1F2HA 2KXFA 4PCQA 1IR1A 3CE8A 2CDRB 2K2PA 1M5PC 2XGPA 4JV5J 2AU0A 2HZAA 3JAMU 4DV5J 3R7NB 2Q1LA 1Q7YT 4LT6A 1F5AA 1T03A 3CEDA 4R8UB 2LA6A 4QWBA 2G9OA 5KG0A 1KQFB 2AIRB 4KR0B 1Z2LA 2Z2ZA 3OT9A 2VKZG 2ZZMA 2DRDA 3UDLA 3G96A 4GVBA 4I7FB 1GH8A 5DDQC 3GTYX 3SCIE 1WG5A 3DYAB 3O2IA 2VA2A 2QMWA 1HBNB 1Q78A 3IR7B 1V3ZA 4I68A 3UO0A 5F3TA 3AHPA 5KG3A 2F8HA 1H72C 2E5HA 1FJCA 2FIUA 1WOOA 5KFZA 4YY3F 4LUBA 2P6TA 2AX0A 2AGPA 4M5IA 2AP6A 4A8WA 3QLHA 4NA3A 2XMWA 3CC7S 2MKYA 5D3GB 3HVRA 2JJ4D 5JXSA 2W01A 1KLMA 4KE5A 2MZQA 5JJBA 1VI7A 2VOPA 4DV3J 2FGCA 4U95A 4K2XA 3BGOP 3RW7A 3TUJC 1PILA 2M2BA 3R27A 5KT4A 2F4VJ 2IRXA 4X4TA 2P2CB 4UZCA 3LA0A 1RTDA 4PWWA 5ETQA 3NS6A 2ROEA 4DFPA 4ZCKA 2WVCA 2M4MA 3RBZA 4ECSA 1U1KA 4OYIA 4EYIB 4ED8A 5IV3A 3CJ0A 1NJZA 4EUVA 5KT2A 2BJ9A 3C15A 1YJRA 2R4FA 3DFEA 5I42A 2OEJA 5ETRA 2OH2A 2GFFA 2DNPA 4U8YA 2V8GA 2IBOA 2XHWA 3OTDA 1HHQA 4NCAA 2IC3A 3R6GB 2MQPA 3IM9A 3QRQA 4EBEA 1JJ4A 3BM7A 2CA9A 2CRLA 5CCLA 1YKWA 4I0WA 4G65A 3WX4A 1WHVA 4MK8A 2RRAA 3HXMA 1GX6A 5KFMA 3C46A 1X31C 3KLIB 4HEA9 3W64A 5CYMA 2HRTA 4JI6F 1DTTA 2XY6A 1NUEA 1S7HA 1S0NA 5KFYA 3G86A 5MAOA 4B9LA 1REVB 1BGXT 3F41A 1HR0F 3CCLS 2AJFE 1KS2A 1NK6A 3M30A 4DV2F 4OX8A 4OX7A 1P9QC 3PEJA 2WSEC 4NXMF 4P71A 4P73A 3MMCB 1H2TZ 3I96A 5HP1B 2B0GA 1AROP 2FJXA 2DISA 3HDSA 2ZWOA 3W63A 1JXEA 1N34F 1CSJA 2CPXA 4DPTA 1PIEA 2ABYA 3NAHA 4HACA 1ZAXA 4ZLJA 2A2DA 2XMUA 4PXEA 2NXJA 3L7PA 3EICA 3JTOA 1U4BA 5L1KA 5C42A 1RADB 5F0UA 1Q8KA 4JI5J 1GMWA 4QR0A 4RL1A 4NRTA 3AOBA 2MSTA 2QLXA 3ET6A 3KK2A 2EFGA 2Z4PA 5IT4A 1OJ4A 4B9TA 3MXHP 2XBPA 5H9EJ 4DPYA 4HTIA 1AFIA 2VBXA 1N5QA 1A7GE 4DR5J 4USWA 3IO1A 2V9WA 4W4MA 3OXGA 3SQGA 4DFMA 4UY8T 4M5DB 1T0TV 3V6DB 4ZVSB 2IYIA 1TUWA 3JQJA 1M90T 1FO1A 2HAFA 2FHJA 1XNQF 5J1EA 1HNXJ 4C6AA 1FFWB 1LFPA 3G6XA 4Y65A 2BR0A 4PG4A 4LBIA 1TTHB 4I2QA 1RABB 4Y6IA 3KK1A 1ZPVA 2YWGA 2ZBIA 1EKRA 1LK7A 3D0IE 2EK1A 3PFEA 2FYXA 2M0GB 2EVZA 3KFWX 4O0NA 3D9BA 2B9XA 1RHQB 4CP5A 4K5RA 2Y0BB 4ZVEA 2D41A 4IFVB 2VQEF 5E3AA 2R7SA 2D3ZA 2FC9A 1EX8A 1QSSA 1NBEB 2BZ2A 4FKYA 5IZHA 3EVWA 1VBYA 3MPWA 1FJGJ 2HBRB 2OUGA 4I69A 5I3UA 2G0CA 4HH1A 3PO4A 3MM7B 2RSQA 2W7OA 1WEXA 4NCGA 4MAKA 2HIQA 2VG7A 2DH8A 2YWKA 4K4SA 2AJ4A 1S1WB 5D77A 3MPVA 4OYPA 2I0XA 2AD9A 2OPSA 1FJEB 3DU6A 4CYUB 4TY8A 1UVLA 2EEYA 4MK7A 3EGNA 1S9EA 4DV6J 5ETMA 1LWEB 3U02A 4AXIA 3K17A 3KJQB 1IWGA 4DL0C 4PABA 2DNHA 4NRUA 2LECA 4N5SA 3HP6A 5KAKA 3C16A 4W98A 3IG1B 5EGYA 3M1VB 3ENQA 2ASDA 1X5SA 1VQ6S 3A4TA 2L48A 4F4YA 1XK8A 3NNHA 3DLEB 4OHZA 2V94A 3OW2R 2C3OA 2HFNA 2MJNA 4DR1F 4FN5A 5L46A 5DLFA 4A48A 4NLUA 4DX7A 1RTIA 2CZVC 2CVEA 1F3FA 4A4JA 2WK4A 3CPWR 1JLGB 3LPYA 3VQSA 5FJ4A 4Q2LA 2V8DA 4J9RA 1AT1B 2ZNYA 4DR7F 2F40A 3K5LA 1C4CA 3QIPA 2HRYA 4I56A 2UXCF 4YHHJ 1KDNA 3D66A 2IDEA 1H2VZ 4EYHB 4U6PA 3SDEA 2VB6A 5L38A 3OTBA 4ZIWA 2XWYA 4I6WA 1MMNA 2DXDA 3H4BA 1FNXH 2ZM6J 1U25A 2XYGB 2B51A 4BCAA 2AX1A 2K1RB 2J0QD 3DOKA 2DNZA 2J0XA 2XG8A 3THTA 2R8JA 4DSJA 2QSWA 3C6TA 1U1QA 3MUMP 1PAEX 5EHHA 3MECA 2W4PA 1RT5A 4J9KA 3SEOA 3BBFA 1MWZA 3B4DA 3PW5A 1WHWA 1C0UB 1GAOA 4MKBA 4X4OA 4KKOA 1UL3A 2VFSA 4QW8A 1YJUA 4HTJA 3KDOA 3CCWA 1HW8A 4OJGA 4Q45A 2LXFA 1Z2ZA 2ROGA 1RBLA 1BHNA 1H7WA 3QGPA 3M32A 3PYGA 4WYWA 2YTCA 5F8LA 4X65F 1B3TA 2Q43A 5K5MA 4RPFA 1P9YA 5E3PA 4R0EA 4AUKA 5LOQA 3B4MA 4LR8A 1R7IA 1ZBTA 4KPYA 4OHVA 5HMZA 3OUYA 1VBXA 1U0HB 2DNYA 1WJ9A 4F02A 1E6VA 3EDRB 4RBVA 1T11A 3NLCA 4DJBA 2ZD1B 4X66J 1S99A 4Q5VA 1LK5A 4JI2J 3NGRA 5IXUA 1IN0A 4J9NA 3BGLA 4CM2A 4KHPF 1EAYC 1RCXB 2J9DE 4J7CA 2PMWA 1X60A 3MD1A 5IFMA 4A8KA 3BSOA 3ZXWA 3J7AN 1REGX 3UR0A 4U67Q 2J9EA 1VBZA 2E29A 3P96A 4B3RJ 1NSPA 2XO6A 1S79A 1VQ4S 2ATCB 1FRKA 3R5CA 5IT9U 2IVFB 1S72S 2QA4S 4DUZF 3W66A 5ETPA 5K20B 3NY0A 4NYZA 3Q8UA 1N56A 5DDOC 1NK4A 4Q8FA 1WTBA 4PEOA 3LP1B 1O0PA 4TU7A 2C2KB 1KNZA 1PYSB 1HI8A 3IS9A 1FI4A 5GAEI 3MR6A 1UVMA 3IBCB 3D1OA 5ETOA 1ZM9A 3QGIA 1KRPA 5KFQA 4JYAF 2G13A 3FEXB 2JFKA 5H9EK 1RU2A 4F3OA 4OX9J 2GZOA 3K5MA 1Q81T 2DHHA 4EBCA 1GT8A 2JH3A 3IMQJ 1CQNA 4H4MB 2FQQB 1S4FA 1NH7A 2M88A 1LWFA 1FD8A 4UQTA 3LP2A 4P2SA 2NXCA 2WW8A 3S7RA 3KG0A 3NGDA 3POTB 1ZAVA 4JV1A 1U09A 3R7BB 4CLLA 2ZBCA 2W9CA 4PYAA 1FXDA 5J2NB 1NKBA 1YJWS 4OIXA 1ZM3A 1VLYA 1FE4A 2HHUA 1XNRJ 3M2UB 4K8RA 3I82A 5G0RA 2CZ4A 4QW9A 2GVZA 4HI2A 2XI2A 3OR1B 2XTJP 3M9NB 2J7WA 2WZ1A 1X4DA 2YPYA 3OLBA 1BQXA 3T5JA 1R8BA 3CCVS 4DQIA 1HNWJ 2JVRA 5IWAF 1EKSA 1ELOA 4OYBA 3PX4A 2HMIA 1KTQA 2XCPA 2ADCA 1YJTA 5GAGU 3KKFA 3NBPA 3PCOB 5D0GA 2E1CA 3L9ZA 4RNHA 4A8XA 1KEKA 1MROB 1QAYA 2JEJA 3A8EA 1PC5A 2BM0A 4QU7A 1ZA2B 3GCXP 3QFHA 1N5TA 4YQWA 1RAGB 1VQOS 3QT7A 1T03B 2DGVA 3N4WA 3ZZOA 2J6TA 1T3NA 5F8JA 1M1HA 5D0RA 2VQFF 2VA3A 1VBKA 4DLEA 1IQTA 5KFEA 3QRRA 2Q6CA 1N5YA 3LQVA 4LF7J 1OY8A 2ZBRA 4GVBB 2CJ9A 2YNGB 2B8PA 1TKTA 1LV5A 2MQ8A 4F25A 4P74A 4IFYA 1U02A 1HWIA 2W2MP 1S9GB 3HHLA 1KR4A 1ZH5A 3PACA 3UN3A 3V81A 1SJQA 1SH3A 3H5UA 1FDBA 2KI2A 3B8HA 2E5LJ 4C48A 1VQSA 3MMJA 3DHWC 5ITHA 3ICLA 2PMHA 3QLHB 3RGIA 2QZ8A 5IC6B 1RAFB 1FRIA 4NZ7A 2RUGA 4OI0A 4OZ5A 1J27A 3B54A 1RUSA 3H8YA 4GVLA 3MEDA 5LXYA 3C66A 4LJMA 1F5BA 4FXVA 1UZDA 1Q4RA 4ER8A 3TUIC 2CQ1A 3DDIA 4GC6A 3CDWA 1DHMA 2FHOB 4KGMA 1RTDB 4U8VA 4LIWA 3OFGA 1JLBA 2LQ8A 5F41A 3W61A 4YR2A 1FKPA 4DL4A 4PRFA 4IH5A 3FEZA 4ZITA 2CZ9A 3C15B 3Q22A 3EZUA 1RT1A 1IM6A 4PYDA 3VZHA 2WB1D 4Q0BA 3J80Y 4M5HA 1IBKJ 4H4OA 1XMQF 2MHEA 3OBIA 2DNNA 3RB0A 1GXLA 4WE1A 1RXOB 2Y3YA 3KNAA 4YP3A 4NLDA 1OSCA 2UP1A 1KQKA 5IQ6A 3VAHA 3OTOJ 3TAQA 1SL0A 1OYEA 4RNFA 1QVGR 2OPRA 3OV7A 1PBAA 8ATCB 2R8KA 2F65A 1O5JA 2M9KA 1KVJA 1D9AA 2ASJA 5CYJA 2GAHC 2RDDA 5DQHA 1X9WA 1DTTB 2QA2A 2EG1A 2KT5A 1Q8IA 2N4CA 4FVMA 1CJVA 3O3LA 3UPFA 2YWFA 5J2MA 2E66A 2ZFHA 1EETA 3CO9A 2PC6A 1UETA 3KG4A 4DOZA 3CVKA 2WSFC 3UW1A 4RW6B 3M30B 1RWVB 1HBMA 4RUCA 1UA0A 1IBCB 3UVJB 2VOOA 1JLCB 3CB4A 1N0UA 3GONA 1LW2A 1J5OA 2QIFA 1GEHA 2OEMA 3D6HB 1IR2A 2FPHX 2IRUA 2DNRA 2CNOB 4C0HA 3FBBA 4DXLA 4WK1A 5A8WA 2QEXS 2DGQA 4EWTA 1CS4B 2B7CB 2HS3A 1YBAA 4USKA 4QPXA 2E7VA 3I0RA 5E41A 1S0OA 3IP0A 1IBLF 3F44A 1WKKA 1TL1B 1DQ8A 4OYOA 3ET6B 5KFCA 3ISNC 3P4UB 3IR6B 3H59A 2NUHA 3BH7B 2XM3A 3AH6A 1WACA 1ZZFA 1PYTA 3KUHA 2WVBA 1RCOB 4L73A 2CJQA 1RDRA 4PXDA 1SV5B 1UJ4A 3QWPA 2N4DA 4DS5A 3PRVA 4KFBA 1F0XA 1F2GA 3MOJB 3O8WA 2EPIA 2UUWA 2N3OA 3NNCA 3T5LA 5IM0A 4B3SF 4ETXA 4O3SA 2N3LA 3KJVA 2NYIA 3EMTA 4DR2F 2XEXA 5LSRA 4I2QB 1L3UA 3G2XA 5DG7A 2XHCA 2EI5A 4J37A 2XQCA 2VG6A 2Q6BA 5HN0A 4FDFA 3Q23A 1DTQA 1P1LA 1ZM2A 3L95X 2BKNA 4J90A 2XULA 4WTYA 2M70A 5F9NA 1U24A 1Q5YA 4LSLA 4AQYJ 3FEYB 2CWXA 2R7WA 1NDKA 4OJHA 4HL9A 4PZVA 2IM2A 2B6AA 4I1TA 3DLGB 3HLUA 3GLJA 1UP1A 1LWCA 2Q3PA 5KT3A 4FF1A 4WZMA 2UVRA 4BBYA 2DR8A 4CRJA 4CH0S 2R2TA 3QJLA 2CQHA 4NCGB 2DTJA 5BYRA 1S1XB 1RTZA 4EEYA 5L1LA 1NK0A 3R1LA 3G6ES 1WNEA 2KB2A 4M5GA 1RE1B 3BGRB 4LF2A 4WK3A 1R0CB 3LALA 2HVIA 1JLEA 1BWVA 4WU2A 1JKHA 4HT5A 4Y2IA 3GV7B 3DLBA 3AXMA 3M05A 3A13A 2DR7A 1BQNA 2DCLA 2R7XA 5HK4A 3BSAA 1SUQA 3HFKA 2F8EX 3QMQA 3KTQA 4J9MA 4RBTA 5D78A 1ZTTA 1SQGA 3JQMA 3IXQA 1CJKA 3HZEA 4ICLA 4ZVGA 2XWXA 5K8PA 1SL1A 5DJBA 3C16B 4NPOA 4KYZA 4XO0A 5CD4A 2W2NP 3M2RB 5THWA 1RWMB 3HD1A 3QO9A 2XNQA 1S12A 5E3CA 4MIBA 4DLGA 2B3TB 1Y3JA 1G1XA 5GAHU 3MMBA 3IC1A 3TQ1A 4KTQA 4ZOSA 3RB4A 5DG8A 2RB7A 2YNIA 3LTOA 3PYEA 2HHQA 5A2QY 4DCPB 4PG7A 2UUAF 2CAJA 3OSNA 2GQQA 3MUTP 3EDQB 1B70B 4O4RA 4I4BA 1I5OB 3N28A 2Z30B 4ZLNA 5CABA 1C4AA 4Z37A 1SC3B 4NA2A 3HHDA 1OS5A 3KDNA 5F3ZA 3PJXA 3VALA 4USJC 2JOQA 1NJYA 4RW8A 2GJIA 3R5BA 3PFOA 3M8QA 2VJVA 1W26A 1C1BB 4NLTA 2O01C 3SQOP 3QZ8A 3D1HA 2QJ3A 3DOKB 4UT4A 3FBCA 1QY7A 2VFUA 2E5JA 2PIIA 2E7XA 4MH8A 2VBYA 4RW9A 4LMZA 1TQLA 2HFSA 2DHXA 4LBPA 1FD2A 3MDFA 2R8GA 3CSKA 4YY3J 3HI9A 3R5GA 1UFKA 1IWAA 2KRRA 4DPWA 3W8GA 1HFEL 5J2PA 4KKOB 3FUYA 3JSBA 3I55S 1IJEB 4FXWA 4LF9F 3VR1A 5KFNA 2H9ZA 2J9CA 3TVYA 4DU8A 3J81j 4DQSA 3AJ2A 4ED4A 4LSNA 1S1VA 4OYAA 1FDDA 2NXEA 4OZLA 3M32B 2VFVA 1TL7A 2LXIA 4HKQA 3VV2B 2EFOA 1RGVA 2QYGA 3PXGa 4HHJA 3LWLA 3HJVA 3M8PA 5LMUF 2GAGC 1YVFA 1GXTA 1Y4ZB 5ETVA 4P7VA 3OUYB 4L3KA 2DR9A 2QLBB 2ZEJA 2VPYB 5B0DA 1WI6A 3W2VB 2WONA 3UWTA 3T1AA 4ZPWR 3R3TA 4EO6A 2CQIA 3DM2A 1NPRA 1U0SA 1U1LA 1G2EA 2OP5A 3VHQA 1VYAA 2M7SA 2OLWA 1IM4A 1NXIA 3QGGA 1RYSA 5KFKA 2NREA 1QSLA 1V5VA 2ZZNA 1YJVA 1F6TA 1CVJA 2VDHA 3RR7A 4KHMA 3HF5A 1TP7A 1VIXA 1WDTA 3FCWA 4JI6J 2QG9B 4UW2A 2DB1A 4NYOA 1KVIA 3HCXA 2YWHA 1Q8LA 1WOPA 5KFOA 4RR5A 4PXBA 1HR0J 4LVNP 4J9LA 4DV2J 1GMWD 1KOHA 1SKWA 4DUYJ 4NXMJ 2YKAA 2LFVA 4PPZA 2PFDA 4F7VA 3PW2A 2D3OR 1FTRA 3HHEA 3TOQA 1QM9A 3K59A 2C3PA 2NZCA 3G87A 1N34J 2VPWB 3MR2A 1U7LA 2HSEB 3RAXA 3GFZA 2AYBA 3S1TA 4WKYA 2UXDF 1YLXA 1FE0A 4X64F 5EN1A 1RAIB 3Q2SC 4O3NA 1L3VA 3TJ8A 4B9SA 1HBUB 4K59A 2ZC3A 1YWXA 5J2QB 1HWUA 1FRJA 3L09A 3MM9A 3BS9A 1RHKB 2PA8D 1LWFB 3LP2B 2BABA 2HFVA 5EWGA 2QL9B 1U2CA 3VZIA 1S1UA 1T95A 1T9WA 1TELA 1MU2A 3NOCA 2W9CB 2M52A 1AW0A 4OL8A 2CQCA 4ES1A 3IWLA 2Y1IA 4N8NA 3ZO7A 1CEZA 4RU2A 3FVYA 5DQGA 4WYLA 5E7OB 1KHWA 2BJ8A 5G0RB 1EP4A 3DNCA 4FZVA 1S5ZA 2K3IA 3RRGA 2B4UA 3OQ2A 2DXFA 3UQSA 1XNQJ 4PKDB 2DNOA 3B82A 1YITS 4IQXA 2VJUA 3HD2A 7FDRA 3ZTOA 3MEGB 2ADBA 1NU4A 2AMCB 2NQPA 3EVMA 2GO8A 3N9UC 1Q5VA 2RAQA 2PE8A 2C2MB 3KLHB 1U6ZA 4PAAA 2IJRA 3W5YA 2HNDA 2X3DA 3NBPB 3RG6A 2BANA 4Y2CA 2XYHB 2QN6B 2R8HA 1U6BA 2HWHA 2HW3A 2W1BA 3CGIA 5L9NA 1S48A 4H4KC 3P49B 2VQEJ 2YKMA 1I3OB 2G0JA 1UFWA 1VCTA 2AYEA 3LAKA 3LW5C 2XS7A 4G1PA 4Y2KA 2NXNA 3I56S 3TZYA 2XMKA 1RJJA 2H54B 4DR6F 3VWSA 1UVIA 2AWZA 3D0HE 1O51A 1P8GA 4X2BA 1FRXA 4U7UK 3M8WA 1DBDA 4IFYB 4AL6A 2MLYA 2OJ3A 5DDRC 2G2YA 1FKOA 3HHLB 4J9QA 3F56A 3KUGA 4IYQA 3ITHA 3FQLA 4FKXA 4EBDA 3V81B 4TU8A 4ED5A 3FZBA 4FXDA 4FBUA 3J7YU 4N41A 5HVGA 3IRWP 1CJTB 2KYZA 2D7SA 2A18A 4IH6A 2PA3A 2JEGA 3I0SB 4OFZA 4ELTA 2MGZA 4C7QA 4DF8A 5DG9A 3RW6A 4JI1F 1KTVA 4Q43A 2HS0A 3EX7B 3OL7A 2DD8S 2V50A 1JJHA 1VQLS 4EFAC 2DGWA 4PQAA 2XGQA 3BQ2A 2HNZA 3IR5B 1QUPA 1HHTP 2QT7A 4LREA 5D6GA 4CCHA 1XR6A 4DR1J 4DV7F 2Q66A 4IOCQ 1JLBB 3MM8A 2RD5C 3DRPA 2MEWA 4ECUA 4P2XA 2H48B 3M8YA 2Z58B 2XLJA 1PC4A 5HATA 2LDYA 1FKPB 5LM7E 1RAOA 3AQOA 2BA9A 3TO8A 1EJ7L 4BLGA 2XNRA 4XAKA 2GS8A 3BEGB 5HMYA 3N6LA 1IBMF 1V5IB 4XDDA 2BJDA 2IMWP 1RT1B 3HVTA 4DR7J 2E1MC 2G1DA 3J81U 3QIDA 4Q0BB 5FDLA 4D3GA 5K14A 1NDPA 2B5JB 2QFJA 2UXCJ 2B4PA 3DRSB 2V9KA 3OL6A 3ZFVA 1VDHA 4A8FA 1BQMA 1FK9B 4NE9C 3AA9A 2G0IA 2H4YB 5ETSA 3UDCA 2JEFA 1HLWA 1RWPB 4NLWA 1DRZA 3FSXA 4TKTA 2P9GA 1IKVA 4FNHA 1HYSA 2RDJA 2UUCF 2Y0SD 3HK2A 1RTJA 2DGUA 1OY6A 2RNEA 2HBZB 2EFQA 1CJVB 2FZCB 3IRXA 1E6YA 2GGPA 4RW4A 1JMTA 1EETB 3BGUA 3HHKA 3W65A 1QTMA 3CD7A 5DGBA 4NLOA 4ECQA 3R5DA 3SZ2A 2DR5A 1M5OC 1J5EF 3CC4S 2DNMA 2ZH4A 2JC0A 1RT2A 1WF1A 1LW2B 1XNRF 1J5OB 4C97A 2L9NA 1S4EA 2J7UA 2VV5A 2C2EA 2HHSA 4DCJB 1YRUA 3RRKA 3NG8A 5F0WA 5A8WB 2Z0GA 2LP4A 2DBBA 1N8RT 1HNWF 4I67A 3NWRA 5B0FA 2FY1A 5KFVA 4ALZA 1HIYA 1IUJA 3I0RB 1NNDA 4X65J 1RT7A 4RUHA 3MCSA 3WC2A 2VH7A 4K4XA 1PGZA 4PUOA 1FESA 2W2PP 3LP0B 2APOA 3O5TB 2GHPA 1T05B 4QYZJ 3GIKA 3HM9A 2B43A 8AT1B 2HHWA 2VPZB 4NL5A 4YR3A 4PWDB 4U96A 4OI6A 4ZVRB 4Q2MA 2DHGA 3WIUA 3MWBA 3SIPB 2J6UA 2BQRA 2ZVIA 3E3XA 3RBDA 4LFCF 4KHPJ 2B7BB 3UD3P 2Z57B 3K5PA 4JI7F 5IM0B 2YWWA 2W9AA 4FYYB 2WSCC 3BR9A 1OQ6A 3KJVB 2KFZA 3Q8SB 1DLOA 2B4OA 1FX2A 4ES3A 4P72A 2V69A 4RX6A 3N0VA 2IPOB 2GX8A 2VG6B 4K4UA 4ANEA 1YX2A 2LQ5A 4K4WA 1KOOA 1RTHA 4WFNQ 4DUZJ 2XCAA 3DCAA 3VQTA 2AQ4A 4O3PA 1N0VC 1YTYA 2QSFA 1FEHA 4DL5A 2F1FA 2YWEA 3E51A 3RJMB 2E7WA 1ITPA 2KG1A 3TAMA 3FFIA 4WCEQ 1R8PA 4JYAJ 1JLFB 4LF1A 3CCUS 3ILOA 1HWJA 1NK8A 3R5JB 4C0BA 4QIGA 4PG6A 4G1IA 2P9EA 5T41A 4OI4A 2FVQA 5M2RA 2C2OB 2L9DA 1JLEB 2W24A 3JTPA 1Y9OA 1RBAA 3PDNA 4GKKF 3PIPQ 1SJRA 3BH6B 3ULHA 4YDXA 2PEBA 5B0GA 2BRKA 2MZ1A 4AD6A 5U47A 1JWWA 2VIHA 1SUQB 3LF0A 2AHOB 2LMIA 1NHKL 4Q8EA 3PW4A 3QSYB 4LVOP 5KT6A 4MIWA 3FCVA 1XEZA 2ZITA 4HHUA 4DWIA 2IM0A 1NJXA 2FZGB 5CA5A 1RT3A 1OPZA 2MPUA 4C3KA 1HQ2A 3CCES 4MYTA 2DO0A 2DGTA 1R0BG 1TL4A 1F9FA 3NCPA 1WI8A 3VGSA 4ED7A 2MLZA 3CT9A 1PJ5A 3VCDA 3AD9C 5IWAJ 1ZYQA 5A76A 2VC0A 3HSJA 4BC9A 6FDRA 3DMJA 3MFIA 1JLAA 3US5A 4RW7A 3GILA 2ZH6A 2RKIA 1FFGB 1HNIA 1RBOB 1SJ3P 1X4EA 4HDGA 4CLYA 2HNYB 2HWTA 3CJKA 1V3SA 4TY9A 1TV6A 3HHLD 2I8EA 2H65B 1EB0A 4LF5F 1FCAA 1FVSA 1ZTWA 2H51B 2RS8A 3K58A 3IAS9 4DQRA 2VQFJ 5HMXA 4YB6A 4DF4A 1B0PA 5CZVA 2R8IA 1Y5IB 4U7UD 1LWXA 4FP9A 2J76E 4RO0A 4LFAJ 3RZAA 1FVQA 5IQQA 4OX6A 3CW2C 4KGVB 4MKAA 4L76A 2Q79A 1KONA 1S6PA 2PI5A 3WDOA 1HW9A 2N7YA 4DV1F 2L9WA 3OXLA 1Q53A 3C6UA 2MTLA 2CXEA 4WIQA 2VBZA 3PRDA 2OMLA 2WOMA 3A8JA 3AXKA 4DQQA 1DJ0A 1UW9A 3OD2A 1UTAA 3M7VA 1IR0A 4OZ1A 2V5HG 3ZNJ1 5J2PB 4R5PA 4J9PA 1HMVA 4GRSA 4PQUB 1NCLA 4Z2XA 4CTAB 2FD2A 4L72B 3IM8A 1JXLA 3EGVA 4PXCA 1CLFA 3TUZC 5E0OA 2HAIA 1S1VB 4CO4A 4I6AA 2N82B 3FNNA 3VVUA 3JTNA 4DSKA 2GA7A 2XS5A 1TL7B 1MMDA 2BOPA 1P6TA 1TU0B 5E2QA 3T5HA 3M8PB 3NNAA 3Q2TC 4DQPA 4IQMA 1JJCB 2NCKL 1FXLA 4IRCA 3MUVP 3G71S 1MSWD 3JSYA 5KFAA 4LF6F 1EHWA 2KXHA 4O44A 3NGTA 4N8OA 4WF9Q 2ZH8A 3DM2B 1XMQJ 2AJ2A 1HNVB 5KFJA 7AT1B 3NS7B 3IGNA 3QAEA 4HI1A 1WUUA 4Y3CA 3GIJA 2MY7A 1TKXB 1TMJA 2WVEA 3G8SA 3FDSA 3K2YA 2IM3A 4DZ6A 3W8PA 3PHTA 2KFNA 5F8GA 4ZVQB 1YZ7A 5DGAA 2RF2A 3VGVA 2FY8A 3I9V9 3W9IA 1X5PA 2YKQA 3QAUA 3Q8QB 2BJ3A 4RWWA 4ITSA 3W5XA 3LH2S 3T5KA 2DIVA 1AUSL 3R7SB 1ZS6A 2EKYA 3PKMA 3BBBA 1TVRA 2JFDA 5A8RA 3SSQA 2MB0B 4JBCA 3QT8A 1VR6A 4IDKA 3UN5A 2QE5A 2IIHA 2D3O1 4DUTA 4A8YA 1QUVA 1JK9B 1FJ7A 5DS7A 2YH0A 2NLWA 3HT3A 1M5KC 4H54A 4RNOA 2GC8A 2ZHAA 1LNQA 3W62A 1L3KA 4DPUA 4QYZK 4X84A 2BVZA 3U1NA 3MFHA 2CNNB 2BE2A 4ZPTR 4MFBA 1CULA 1C1CA 5AE2A 4OHXA 1IBLJ 4IRDA 3PZPA 5EWFA 5ADZA 3D6MB 2HGLA 4BWJA 1TZ0A 2ZZTA 2PEHA 1QE1A 4LR7A 4ELVA 2KHDA 1H73A 1X0PA 3MM5B 3OR2B 1SBRA 4KGXB 1TL5A 3RTVA 3DRYA 1HQEB 4ECRA 1VS3A 1V6HA 5F8NA 1MU2B 4LFBF 3GFYA 1MN7A 1TMMA 4ID5B 2CQ3A 4CO3A 1VRQC 2AGQA 1X9MA 1EP4B 5HI7A 5KG7A 1NHUA 4F3MA 1NJWA 2UUBF 4CM0A 4B3SJ 2IA6A 2ZOMA 4LF4F 4NXNF 1FT8A 4DR2J 4WTOB 2HBQB 4OHYA 3KLFB 3FBEA 4J91A 3ZTRA 1U47A 1BC6A 2HNDB 4FBTA 2RT3A 3VTIA 4A8SA 3K57A 2CYYA 1M1KT 3KK3A 5M2PA 4YS2A 2VF3A 4CO2A 4ZHRB 3V4IB 2AKWB 5ETNA 3KXDA 2CPEA 1AYEA 4F0MA 2BQ3A 1RAHB 1EQ0A 1RP5A 3GR1A 1Q16B 4N7TA 1S1TA 4BHQA 2QO3A 4DFKA 3F73A 3V6KA 3K7RA 1OQ3A 1UVKA 5EDWA 3TZXA 4JUZA 4P6QA 3MCMA 2PD1A 4DG1B 3TYTA 4M5LA 3W60A 4TLRA 2DNKA 4DSIA 4ANDA 1HKAA 3BPSP 1NHVA 5ETKA 1TUGB 3BPDA 5HLFB 2ZJQQ 4ED6A 1MNEA 2BOAA 4KJIA 1HPZB 5AXLA 3KHHA 3M4XA 3UDVA 3GP9A 2B8QA 3M8SA 2R2RA 3TARA 1BXNA 2IYGA 1VMBA 2GMLA 3CUNA 2YKOA 3BF4A 2OPPA 7FD1A 2HNZB 1UKUA 1IKWA 2FUG9 1WC1A 2HQGA 3DLLQ 2H5EA 1ZETA 3R8YA 1ACMB 2DPJA 2J0WA 3QRPA 4QQBA 2IMOA 3DRPB 2OGUA 2FJDB 1NAQA 1RAJA 1KQGB 2UUAJ 3B78A 5D3GA 2EKNA 1GTHA 5GAEU 2YX7A 3F0NA 5CXTA 2V4JA 4OZJA 3D67A 3MEEB 3KMSA 1HARA 4DV4F 3RYLA 5HSPA 2VG5A 1GXUA 2DEIA 3BO3A 4ENOA 4USHA 4DUYF 2YQ0A 3HVTB 1V9OA 1D8ZA 1N48A 1PCAA 3D3BJ 1WELA 5C7PA 1WG1A 5K14B 3KHRA 2B9YA 3SCKE 3VAGA 5D0HA 1OIAA 3RBEA 2E9RX 3HVAA 1BQMB 4DPOA 3Q83A 1A6LA 3TR5A 4N47A 4F4ZA 2C2ZB 1N52B 3EXCX 2DRAA 4LBHA 4P2FA 2MZRA 1T3OA 3MR3A 1K1SA 1N6QA 1QSYA 4JB8B 4Y34A 4IRKA 2LKZA 3THVA 1WKLA 1Y11A 3IRXB 5C25B 1E6YB 2GGPB 4IOAQ 4OMFG 2AF6A 4UF4A 1YIJS 5K9FA 3PW0A 3QBCA 2O1PA 1QAJA 5KFIA 1GQEA 3KLGB 1FXRA 1NDLA 3NL0A 1RT2B 4ZVPB 1K73T 3HX9A 1HD0A 4USMA 3KLIA 4LF9J 4IR1A 3H2LA 4O3QA 2V2KA 1VFJA 1YJNS 1YG0A 3TEGA 2GIRA 3FSYA 1REVA 5CYQB 4EZ9A 3BN7A 4N76A 1BY9A 3CJSA 4E8UA 3D6FB 1URNA 1X4FA 1RT7B 3C14B 3G82B 2MMYA 1FKAF 5KFTA 4NLGA 4PUOB 3AODA 5FLXY 1NRKA 5LMUJ 3SFUA 2BKPA 2HQ3A 3PR5B 1RQ0A 3AY0A 4CO0A 2X1FA 1TUVA 4WFAQ 2XMMA 3FZ2A 4ZMMA 3VAFA 3AJDA 2I5JB 1ZZNA 2RU9A 3PM9A 4CO1A 2VFRA 3FSIA 2WVFA 2FLNA 3BR8A 1O6XA 3HVWA 4DZDA 5B0AA 2P8IA 4ILRA 4X4SA 2C2DA 3DLJA 2MQMA 4CLWA 4OYZA 3JYTB 3P5BP 1DLOB 5B08A 1WORA 3ZNUA 2BE9B 2ALZA 3R2CJ 4AXJA 4C4WA 5AT1B 1RT4B 2PN6A 1FFSB 1UCNA 1WDDA 3C19A 2R3VA 4ZP6A 4ED1A 4P52A 2KJVA 1ULRA 3MM6A 5JMNA 1U8WA 5L8RC 3DU5A 4DSLA 1SXLA 3TANA 4F0KA 3H25A 2HK2A 2ILZA 1OY9A 1VJWA 2Y8YA 4L74A 1HWKA 4ECTA 4Z7YA 1VQ8S 2MQOA 1SJ1A 2Y1RI 3TAMB 3AT1B 5GMKa 2V63A 3MAHA 3V6HA 2Y1LB 2WTFA 3CJ8A 2CQ0A 3Q0AA 2UXDJ 1RWXB 3OFFA 1TKDA 4X64J 1OO0B 3W3SA 2YX4A 1VOMA 4LRFA 2YBVA 4NLQA 1AZSA 1NKCA 1UEVA 2C28A 3UCUP 4IFVA 3FKBA 2CUYA 2XZTB 1EARA 4O4GA 4NLPA 3WQPA 3RUBL 2OKQA 1M5HA 1S6QA 1WF0A 2GCFA 2UZAA 5AXMA 3IN5A 4EGLA 2ZKTA 3OTCA 2G2OA 4NLRA 1U1PA 5IT0A 2MJUA 1RT6B 1Q7LB 4RBUA 2XMAA 5L9XA 1RYRA 4K4YA 3H2UB 1GMUA 3JB9k 4CYUA 1MWQA 2AEJA 1VC6A 2OO4A 2CQ4A 2IDLA 2E1PA 3JSMB 2Y8WA 1FDAA 2KU7A 1CC8A 4NYPA 3JAMY 2UXBF 2DYAA 4A8MP 4MKYA 3DMJB 1DZ5A 3AB4B 4RW7B 4NMLA 2V8VA 2R2SA 1KFDA 1X8DA 4ED0A 1FWLA 1JNZB 2WVDA 4ECXA 1RWUA 3IG1A 3U27A 5LSLA 3MCNA 2BMBA 3FCHA 3IBFB 1VRUA 3SCJE 2WB4A 3CJKB 1NB7A 4DS4A 2W4CA 3NRBA 3SCLE 4C11B 3M9MB 3DLEA 1PG5B 2JLEA 3OLAA 3CCJS 2BQUA 1SIWB 2IJNA 4FS1A 1WF2A 4XPEA 2IFXA 4IUFA 4A8QA 5BYQA 3PIOQ 4DR6J 5KFWA 5I4MA 5IV4A 2FHMA 9RUBA 3ZZRA 3D3CJ 4WP3A 1S7IA 4TU9A 2HQCA 1N33F 2M8HA 4IG3A 1H7XA 1GTEA 1S6PB 4C8KA 1YHQS 1FA0A 4QR2A 1WEYA 2LU2A 2F63A 2W8KA 2RMLA 3S8SA 4USUA 3OHAA 2WOMB 1QD1A 1YBTA 4F8RA 1SC4B 2FDNA 3WC0A 4ZK7M 2AEMA 4OQJA 2W8LA 4EI2A 4G1QB 4JI1J 2OAUA 4C8LA 3H20A 2BE7D 4TN2A 2K1RA 3DRXA 3RB6A 4AL5A 1OPIA 4F4WA 2MZSA 3GE9A 2YKNB 3PYDA 2KFYA 2HVZA 2OPQB 2W25A 4RNMA 3W7BA 2LVWA 5HQLA 4OV6A 2EC2A 4DV7J 3Q8PB 3W5ZA 3J7ZT 2R7VA 2OHDA 1TK5A 1X7VA 1M5VC 1DAXA 3MF5A 1HA1A 2E5IA 2FVPA 5EWEA 1ICEB 1IBMJ 2VPXB 3R2DJ 4Y28C 3VVTA 1X0FA 5CCMA 4O44B 2W7AA 5KG2A 5RUBA 3QQCD 1IKYB 5IS2A 4KAIA 3MMAB 1A0OB 2V2QA 4OI1A 4CLTA 4WKRA 1Y00A 2KT3A 4DR3F 2MQLA 4NEYA 1D3WA 3CJTA 1XMOF 4TNOA 2CJKA 2UUCJ 3WZ0A 4LF8F 1U0HA 1LKZA 2DXEA 3ZZZA 2DY1A 3G8TA 2Z56B 1KC8T 3QJJA 2IA0A 4HH0A 4TVAB 3KJFB 2BV3A 3EPGA 3SI8A 6FD1A 5E33A 3L3CA 4V19X 4QIWD 3VGUA 2GIQA 4QPTA 1VRTA 4KIAA 2DHSA 3N5FA 3H2VE 3WHIA 3PYFA 3W2WA 3DDNA 2ZVSA 4CNYA 4IDKB 1J5EJ 2V2ZA 4B3OA 2OD4A 1UPMB 3D68A 5J1PA 2EW9A 3OL9A 4RLEA 1WSVA 4CZCA 1H74A 2Z8QA 3PG9A 2MKCA 2OMOA 2L3MA 3PV8A 1QAIA 1H6KX 2BE2B 2XSJA 1CULB 1WEZA 2GJFA 1C1CB 1Q0NA 2QFIA 3ENWA 4QIEA 3NWGA 4RUBA 4HT7A 2K7JA 4H4KA 4KPCA 3ADAC 1VC0A 2AJQA 1QE1B 4XTTA 2X1GA 2NPIA 3MGJA 3W1YC 2H4WB 2GO9A 4WPAA 4ECYA 3KOAA 4MMOA 2ATLA 5AJ3J 5KFXA 3N01A 1NSQA 1LQ9A 4UOCA 4QWAA 1UFLA 3H5YA 4LFAF 2ZE2A 4LFCJ 2JVOA 5B0EA 4JI7J 5D15A 3WIVA 4GO5X 5LSOA 2BX6A 2UVUA 1RWKB 4AL7A 4UOFA 3KYLA 2X1BA 2WRMA 3POTA 5A0YA 3ILJA 5CZXA 3LGNA 1W25A 3ETOA 4UTGA 1KN6A 3KK3B 3CJ5A 5DM6Q 4KGKA 2DPIA 2FJEB 3M2UA 2R7RA 4QIVA 1XMBA 3OJSA 2DVIA 1CJUA 3AOAA 4LRDA 4YFUA 5J1NA 4EZ6A 1T9XA 4C0OC 1S1TB 3MCOA 1KLMB 3D1QA 4MT1A 1ZOTA 3CD0A 3GYXB 3FGVA 3CCZA 4KQZA 3GWCA 2P9CA 2C2NA 2F4FA 3DLKA 1RAAB 1MROA 1YK9A 2H5IB 1LOUA 2I9SA 2VUGA 1WC6A 3J7A1 4FS2A 5HJYA 3BQ1A 4JI3F 2EWHA 3KLEA 4DCOB 4GKKJ 2KL8A 4GC7A 1TK8A 4P75A 1UZHA 3CDUA 2F5GA 3LUYA 4NI2A 5I42B 1R6VA 1KVKA 4M5NA 1M5SA 5DM7Q 5HO4A 4IH7A 3KG1A 3TX8A 2IC3B 4ZLPA 3MEKA 3JQKA 2YNGA 4F67A 1GFWB 2A6MA 2MHNA 2HWIA 1DQAA 3FK4A 4N77A 1W7WA 2OPPB 2CPYA 3TZZA 1S9GA 3H42A 1VQ7S 1IVZA 3GSIA 1IKWB 4W92B 2BJEA 1KD1T 2MZTA 1RU1A 1D1UA 4DMZA 2ZKUA 3BSCA 2ILYA 4B02A 1EIYB 3CMES 2B4VA 5CYMB 3H4DA 3FBFA 1S10A 2POKA 3B6BA 3P5TL 5KG1A 2QA1A 4KBIA 4DL2A 1DARA 1R27B 2V4JB 5L1IA 2VG5B 2CADA 4M95A 2F8MA 1TK0A 3PNIA 1MMLA 4JI0F 3FMWA 1XR5A 5D0EA 3M8ZA 3NS5A 1S9FA 4KV8A 4LF5J 1IXKA 3G9CA 5JVGQ 5L1JA 5KFSA 3ISZA 1GMVA 2A0FB 4J9UE 5KG5A 4R0JA 4HACB 2QGFB 1S0MA 4CLUA 5C42B 4CLSA 2V8HA 3TNVA 4GKJF 1N6QB 3TUPA 3Q89A 1B0TA 3KK2B 4DV1J 3I9ZA 5KFPA 4TLQA 4QR1A 3I5CA 2V0NA 4KHRA 4MJKA 5C2CA 4CNZA 1NSAA 1JNRB 2HLUA 1WD6A 3SQGB 2JDJA 3SSSA 2BKOA 2ERRA 1RWWB 3CJ2A 2VZ9A 2HHVA 2BUNA 3QYYA 3CTRA 2K06A 1RLCL 1VGYA 3TJAA 3QFWA 4CWBA 2NS1B 5AXKA 2LEAA 5J1EB 3JXOA 3QNWB 4ZN1A 3S01A 4ZVFA 1X4AA 2ZH3A 1U1OA 4RW6A 5KT7A 4X62F 2D3UA 3KK1B 4V1Ak 3T41A 3UVJA 4A47A 4B3TF 4K4ZA 4YDDB 2FJVA 1R43A 5BR8F 1JLCA 2NZ4A 3GU0A 4B3MF 3HZGA 2J8SA 2K8GA 4X4UA 4LF6J 2FB0A 1R8HA 2KYXA 4CI0B 1MW7A 4AE5A 1CS4A 1SPBP 3GJRB 4XK8C 1QLNA 2HG4A 2KG0A 1TKZA 1SCJB 2J7KA 5I3UB 2ASLA 3AOCA 3TQEA 3G6VA 3A3OB 1T9YA 4XPCA 1AUDA 2V8PA 1TL1A 1WC5A 2VG7B 4B9NA 5IT9Y 4DN9A 5KFBA 4LQ9A 4E2FB 1WTFA 2HHHF 2HIYA 2JWNA 2OPSB 2ZDPA 4M5MA 5E3RA 2HVDA 2CG4A 4TY8B 3U7JA 3M9OB 1SKSA 1SV5A 1HBOA 1S9EB 3I5BA 1VISA 2W2QP 2FTRA 3MM6B 3AJ1A 1XN9A 4Y0FA 1NB2A 4V19J 5HQ8A 3I32A 2PMZD 4PR6A 2EXUA 2VU5A 4KY3A 4DI6A 1T9TA 2XZWA 5EX0A 2RHSB 3EUNA 5KOXA 4U9RA 3IAM9 5KG6A 2CQDA 5AE3A 1NK7A 1MN9A 1L3TA 2P6SA 5ETTA 1I94F 4YN3B 3HSDA 2CFXA 5A6WA 4DV0F 3E01A 2QL7B 1WOSA 1UWBA 1SKRA 2C22A 1AZSB 1N36F 2YQ1A 1RTIB 4CQ1A 2OSRA 2R9LA 4OJ1A 3P45B 3M2VA 1SJFA 4O4GB 1CG2A 1V3RA 1S6QB 4JI8F 1LXJA 4C3MA 4WP9A 3DLGA 1PYOB 2MKKA 1SB6A 3TA2A 1D9FA 2PFFB 5E3QA 3QIPB 3T1YF 3H90A 4F2RA 1SQFA 4Z7CA 3TEHB 4LFBJ 3CMQA 4F4KA 1S1XA 3TVKA 3P3DA 5KFLA 2R2UA 4ED3A 3AD7C 3SDEB 2XO7A 4PPDA 3BGRA 3TZWA 4UQGA 3TP2A 2UUBJ 2MDAA 3I4HX 2AEFA 4LF4J 4YR0A 5B09A 2IBKA 4NXNJ 3C6TB 3KLVA 4ZS6A 3L7OA 5FIIA 1Z1ZA 2KM8B 3BREA 3MECB 2LCWA 2ZDOA 3MPYA 2VHGA 1RT5B 4K5SA 2HYIB 1KBRA 2LDIA 1VRUB 3ILLA 3M2RA 1URRA 3J80U 4BWMA 4OI3A 3U1LA 2RE1A 4DR4F 3GR0A 2XLKA 1I1GA 2V2VA 2ROPA 4X4QA 1JJ2R 4WWSA 3A12A 2H3EB 2RQMA 2DNLA 3AD8C 1RSCA 4F3QA 1FEEA 4URQU 1D8YA 2FJAB 1HNZF 1U6FA 1X5TA 2YY3A 4QWEA 4DX6A 1UEKA 4CH7A 3MOZA 3N6MA 5GADI 1B7YB 5GMEA 4IG3B 2MKHA 1WWHA 1R31A 1RK8A 3RAMA 1QTNB 1L5UA 4G3IA 1UWAA 1Q95G 2L41A 2CPZA 3BDEA 3BKTA 2I38A 1E6VB 2V4RA 1U1RA 3OHBA 3HFZB 1BUXA 3HSGA 1HHSA 1S6OA 3QT5A 1WC3A 2E1AA 1C1BA 2XMTA 4HR2A 1SI9A 5DRKA 3BB5A 2JZ5A 1O8BA 4KRWA 1N32F 3VAKA 2W7PA 4WP8A 4NLXA 3LWMA 4RU9A 1HQUA 1G6BA 1PSDA 2MXYA 3H5XA 1FWPA 4ANCA 4F36A 3CDAA 4Y2AA 2ZJRQ 4PG8A 2JLFA 4LSZB 4DV4J 4ZJOA 4B17A 4KH0B 1AFJA 3ISND 4NWBA 1L3SA 2OEKA 3GJQB 1VK8A 3R5AA 5DDPC 1VQYA 3IS9B 1FNMA 4P10A 3OVAA 1NM2A 3FC9A 5GVQA 1H38A 2IAJA 2X1AA 2CWKA 2OD6A 1TR0A 4NEZA 1FRLA 3BZQA 2UU9F 1CC7A 3EYZA 2IM1A 1JLQA 2XS2A 2C3YA 4UOHA 2BM1A 3W2VA 2FHJD 3NMRA 3T19A 1NLKL 2R7QA 5HVFA 2YNHA 3GPAA 2RRNA 5BJRA 1YRTA 4I2PA 4ATNA 1VRTB 4LRCA 1BWEA 3NGUA 3D54A 2LA4A 1UPPA 3W2WB 1W2IA 2ASYA 2QMXA 2DCUB 4QOTA 1IKXA 3UD5A
chains in the Genus database with same CATH topology
4Q44A 1HMVB 3BF4A 4B3OB 1YRXA 2OPPA 5IM0A 3T5LA 4B3SF 3JSMA 5JVHQ 2VODA 7FD1A 1RKIA 4A46A 2O3DA 4KSEB 4ETXA 4O3SA 2RQ4A 2HNZB 2N3LA 3KJVA 4DHVA 1UKUA 1IKWA 4DSFA 2FUG9 1CPZA 3AAWB 4ETZA 3DLLQ 2NYIA 3T6BA 2ZH1A 3M6WA 1X5OA 2FJBB 2H5EA 4DR2F 1ZETA 2XEXA 5LSRA 4I2QB 1BD6A 1HI1A 2DPJA 2J0WA 1L3UA 3SV3A 1N5VA 4ILLA 5DG7A 4YEAA 4QQBA 2EI5A 4J37A 5SZTA 1VQ5S 1X4CA 2FJWA 4BS2A 2VG6A 2PSZA 2Q6BA 2XSJB 2IMOA 3DRPB 2HMIB 2EC0A 2FJDB 5HN0A 4F50A 1NAQA 1RAJA 3Q23A 1KQGB 1DTQA 4NA1A 1P1LA 1ZM2A 3L95X 1Y5LB 5T14A 3OJUA 3B78A 3CDBA 5D3GA 3BO2A 2XULA 1YQHA 4WTYA 2M70A 1GTHA 3K8VA 5F9NA 1TAQA 4JI4F 2D9OA 1U24A 2LEPA 5GAEU 2YX7A 5CXTA 2YVSA 2V4JA 3FEYB 4LSLA 3MEEB 4OZJA 4FPRA 2HS4A 3K5NA 3CCRS 3O6QA 1HARA 3TA1A 4L3NA 1C0UA 2PO4A 3RYLA 3KMSA 2R7WA 4DV4F 2VG5A 3TRGA 4C11A 1GXUA 3BO3A 4OJHA 4CT8A 1N5SA 3HKWA 4USHA 4DUYF 3OL8A 3HVTB 4HL9A 2J8AA 1V9OA 1D8ZA 2IM2A 1N48A 1N4LA 3VF0B 2B6AA 3NP5A 2J5AA 2XC9A 4I1TA 1WELA 3DLGB 2VBWA 2CIMA 3HLUA 1WG1A 1UP1A 1LWCA 1UJ5A 2Q3PA 5K14B 4MIAA 5KT3A 3KHRA 2AYGA 4FF1A 2B9YA 3SCKE 3K5OA 2KDOA 4WZMA 3VAGA 2UVRA 4BBYA 5D4OA 3OVBA 1OIAA 2DR8A 4QCLA 3IBWA 3RBEA 2E9RX 4KC5A 1LXNA 4CH0S 3HVAA 1BQMB 1HBUA 5CQGA 2W4DA 2R2TA 3QJLA 4DPOA 1A6LA 1NEEA 2CQHA 2DTJA 4NCGB 4CO5A 5BYRA 3TR5A 1S1XB 3CCSS 3KWMA 4EEYA 2IJFA 1N5YB 5L1LA 1Y0HA 4N47A 3R1LA 1NK0A 5J2QA 2ZE2B 4F4ZA 3G6ES 1WNEA 1ZAWA 1N52B 1SH2A 3EXCX 2DRAA 3PJWA 2KB2A 2MZRA 3MHYA 3T1HF 3BGRB 4B9MA 4WK3A 2UVWA 1TKTB 3LALA 4IG0A 2HVIA 2KXNB 1T3OA 3MR3A 1K1SA 1JLEA 1N6QA 4WU2A 1JKHA 3UR3C 4HT5A 4Y2IA 4E0DA 3GV7B 1QSYA 4Y34A 1VQKS 3DLBA 1MWYA 4IRKA 2LKZA 3M05A 1X4GA 3CDEA 3HMJG 4NZ0A 3THVA 1H0HB 5A0YB 2DR7A 3FMBA 4ECVA 3IRXB 1BQNA 1VC5A 2XSFA 5C25B 1E6YB 2DCLA 2O67A 3NAIA 2R7XA 2RF2B 3VAIA 2GGPB 4QBUA 3BSAA 4IOAQ 1SUQA 4OMFG 3HFKA 2F8EX 3QMQA 2AF6A 2FGOA 2ZD1A 1T7PA 4DBQA 4J9MA 1YIJS 3KTQA 5K9FA 1KQSR 4RBTA 2GQCA 5D78A 1ZTTA 3RU0A 4G1QA 2IHR1 3IXQA 2ZH9A 3PW0A 2DRBA 3HZEA 4ICLA 2O1PA 2RILA 4ZVGA 2XWXA 1VIOA 5K8PA 3HKZD 1QAJA 3IGVA 1SL1A 5KFIA 2BACA 3J7YI 1GQEA 2DH7A 5DJBA 3KLGB 1U26A 1LFWA 1TVRB 5DQIA 3SV4A 1OWXA 5A8RB 1K1QA 4C98A 4OLPA 2I2YA 4NPOA 3ONQA 3PO5A 1FXRA 2ZH7A 4CH1A 4XO0A 4DX8H 3V5RA 2YKNA 1F60B 1GNKA 3NL0A 5B0BA 1RT2B 1K73T 3HX9A 3M2RB 1HD0A 5THWA 4A8OA 3KLIA 4WZQA 4ZP7A 1U2RA 4IR1A 3H2LA 3MEGA 1IQZA 2OPQA 2OSQA 4O3QA 2V2KA 5LL6d 3QO9A 1VFJA 2XNQA 1KLNA 1YJNS 1YG0A 5E3CA 4MIBA 4DLGA 4MK9A 2B3TB 1Y3JA 3M6XA 3MEDB 2EFPA 3KLHA 3PHEA 2CPDA 3TA0A 1G1XA 2GIRA 3GSDA 3MTJA 5GAHU 3FSYA 5KFUA 3MMBA 1FDNA 3IC1A 5JUMA 3TQ1A 1REVA 2PT0A 3CD5A 5CYQB 4KTQA 4ZOSA 3RB4A 4KO0A 2RB7A 2YNIA 3BN7A 5DG8A 4EZ9A 4N76A 1BY9A 3CCMS 2HHQA 5A2QY 4E8UA 3DLKB 1URNA 3WBZA 1X4FA 2HPUA 4PG7A 1RT7B 2UUAF 3OSNA 2GQQA 3MUTP 2MMYA 4UY85 3GG0A 1FKAF 5KFTA 3I31A 4MFBB 3DXSX 2ZH5A 4NLGA 4PUOB 4C8ZA 4O4RA 5FLXY 1NRKA 4AQYF 3KLEB 1FTCA 4I4BA 5LMNF 3SFUA 1D0EA 3N28A 5H1SV 2HQ3A 4IO1A 4KT0C 3PR5B 1RQ0A 1NK5A 3GIMA 1SL2A 3CCQS 3AY0A 1C4AA 4Z37A 3LP1A 3TW0A 4NA2A 1TUVA 4CO0A 2X1FA 1N88A 3C3LA 4WFAQ 2DJWA 2XMMA 3QPIA 3HHDA 3FZ2A 1NO8A 4ZMMA 4L6V3 2D1CA 4WFBQ 2OFHX 3VAFA 1D9DA 4DSEA 1OS5A 1IKYA 5F3ZA 3PJXA 2I5JB 5AXNA 3VALA 4USJC 5HBMB 2RU9A 2JOQA 1ZZNA 3MMAA 3PM9A 4Y00A 4O3RA 1NJYA 4CO1A 2NR0A 4RW8A 2GJIA 2HHPA 1NK9A 2VFRA 5HROB 3R5BA 4H4OB 3FSIA 2DGOA 2FLNA 1DURA 3BR8A 2VKRA 2ZOGA 3PFOA 3HVWA 1JIHA 4J9OA 3CD6S 1XBWA 3DOMA 4C8MA 4F26A 3M8QA 4RKUC 4WE1B 3HO1A 1FF2A 1FERA 5B0AA 3O1LA 1C1BB 4ILRA 4X4SA 2HRUA 2WCXA 4NLTA 4RUAA 2C2DA 3LGMA 2O01C 3KNGA 3QZ8A 3D1HA 3ZZTA 3DLJA 2MQMA 3HJFA 2RS2A 1XR7A 4RNNA 3LOUA 2DGXA 1C0TA 3DOKB 4I64A 4OI2A 4H4MA 3UD4P 3JYTB 5LT5A 5C5JA 2OPRB 1QY7A 2DT9A 2IRYA 1DLOB 2VFUA 4UUWA 5B08A 2FC8A 2B9WA 2E5JA 2DH9A 2E7XA 2PIIA 1HI0P 4MH8A 2ALZA 2RQCA 2GJ2A 3O44A 4AXJA 2VBYA 4RW9A 4LMZA 1TQLA 4C4WA 3DI6B 4M94A 1RT4B 2PN6A 4EO8A 2J6SA 2DHXA 1FD2A 3T3FA 2XMVA 1BLUA 2E5GA 3MDFA 3I0SA 2R8GA 4YUDA 5T7LA 4MYUA 4K0KF 4BC7A 2UUTA 4ZP6A 3UNGC 3CSKA 5J2MB 4ED1A 3HI9A 3DDKA 2KJVA 5EUHA 4YB1P 2KRRA 1ULRA 3MM6A 5L8RC 1HFEL 3DU5A 2N7CA 1B64A 4DSLA 1SXLA 3UI3A 5J2NA 5J2PA 2HLTA 3TANA 3H25A 1Y5NB 2ILZA 4KKOB 1HBMB 3DRRB 3JSBA 5DETA 1GX5A 4UUXA 3GG1A 3I55S 1IJEB 1VJWA 4FXWA 3N5BA 1HWKA 1R0AA 3QZ7A 4ECTA 1YI2S 4HVZA 1TAUA 4LF9F 3VR1A 2MQOA 1VQ8S 1SQEA 5KFNA 1S77D 2MY8A 3IWNC 2N3OA 3OR1A 3IA0A 4KV8B 2H9ZA 2J9CA 3TVYA 3FJ2A 1SJ1A 2Y1RI 4DQSA 2GW8A 3TAMB 3AJ2A 4LSNA 1S1VA 5GMKa 4QU6A 3DXBA 3MAHA 3V6HA 4CIOA 2WTFA 5KT5A 1FDDA 1YSJA 1TFYA 5GADU 4OZLA 3KMQA 3M32B 2I1RA 1Q8BA 2CQ0A 2VFVA 2LXIA 2ZUGA 2MQNA 3Q0AA 3CWJA 4HKQA 3OFFA 1TKDA 1U8SA 1OO0B 2KJWA 4C3LA 3W3SA 3DGPA 2YX4A 1VOMA 2EFOA 1RGVA 1Z4UA 2Z2MA 4NLQA 3PXGa 1NKCA 5F8MA 4HHJA 3LWLA 2KXFA 1UEVA 4PCQA 2C28A 2M8DB 2HGNA 3CE8A 3M8PA 3RR8A 3P6YC 5KFDA 3UCUP 5LMUF 4IFVA 2K2PA 1YVFA 1M5PC 1GXTA 2XGPA 1Y4ZB 2AU0A 4ZPCA 2Q1LA 4O4GA 4NLPA 4M63A 4P7VA 2OKQA 3OUYB 1Q7YT 1M5HA 1S6QA 2F9JA 2DR9A 4LT6A 1F5AA 1T03A 2JL9A 3CEDA 2E9TA 1UW4A 1M0SA 1WF0A 3KHLA 2VPYB 4IKAA 4R8UB 2B5JA 4YOEA 2LA6A 5DLGA 5B0DA 1WI6A 3W2VB 2WONA 4QWBA 3UWTA 2GCFA 1TL3A 2G9OA 2UZAA 5AXMA 3IN5A 3T1AA 5KG0A 2XB2D 4ZPWR 2BBEA 3DRSA 3R3TA 1KQFB 4EO6A 4F2SA 4EGLA 2XY5A 2CQIA 3DM2A 4KR0B 2ZKTA 3OTCA 4ID8A 4NLRA 4HYKA 1FK9A 1U1PA 5F8IA 1W2BR 5IT0A 1Z2LA 3I5AA 2EG2A 4TYAA 2MJUA 1U1LA 2OP5A 1G2EA 1RT6B 5AJ3F 2VKZG 1LW0A 2YNFA 1Q7LB 2ZZMA 4RBUA 2M7SA 2OLWA 4KFBB 1IM4A 3UDLA 5L9XA 3G96A 1RYRA 1FNOA 4K4YA 2KO1A 4I7FB 3QGGA 3H2UB 1RYSA 1GH8A 5KFKA 5DDQC 3SCIE 2GMJA 5K8MA 2NREA 2LYVA 1WG5A 3DYAB 4DEZA 1QSLA 1YJVA 3O2IA 3BDPA 2ZZNA 3JB9k 2VA2A 3CJ3A 4WU3A 4FNIA 2QYCA 3PVXA 2QMWA 1VC6A 2OO4A 2LQ9A 1HBNB 1CVJA 2CQ4A 1Q78A 3RR7A 4URGA 1H3DA 4KHMA 3IR7B 1HWLA 1V3ZA 3HF5A 2QA4G 1TP7A 3JSMB 4I68A 1VIXA 1FDAA 2PDAA 2KU7A 1R6YA 2COLA 1CC8A 5F3TA 4NYPA 3JAMY 1UAWA 2UXBF 4A8MP 4UW2A 1K9MT 1VQPS 2DB1A 3AHPA 4NYOA 1KVIA 2YWHA 5KG3A 5MLCV 4MKYA 2F8HA 1Q8LA 3CJ4A 3G8QA 2DIUA 1VHFA 3HHNB 4GO7X 5KFOA 2E5HA 3OFEA 1FJCA 2FIUA 4B9VA 5KFZA 3DMJB 1UEUA 1DZ5A 3AB4B 4YY3F 4LUBA 4RW7B 4NMLA 2P6TA 2V8VA 2AX0A 4PXBA 2R2SA 1KFDA 2AGPA 1X8DA 5KG4A 2AP6A 4A8WA 4ED0A 3QLHA 1QJHA 4LVNP 1JNZB 4NA3A 2XMWA 3UE2A 1DTQB 3CIZA 1RWUA 3IG1A 3U27A 3UFCX 5LSLA 3FCHA 3DHXA 4J9LA 5CH7B 1KOHA 3DOLA 5D3GB 1VRUA 3SCJE 2WB4A 3SSRA 1SKWA 3CJKB 1NB7A 3HVRA 4DS4A 2W4CA 2YKAA 4LSLB 4GMKA 4PPZA 2JJ4D 3NRBA 3PW2A 2D3OR 4WXOA 3SCLE 5JXSA 1FTRA 4C11B 5A6PA 1KLMA 3HHEA 4KE5A 3TOQA 2MZQA 5JJBA 1Q79A 1VI7A 3DLEA 3M9MB 3NMAA 2JLEA 3OLAA 1QM9A 2VOPA 4D3HA 3K59A 2C3PA 3NGKA 2RVJA 2FGCA 4K2XA 3RW7A 2VPWB 2B6AB 3MR2A 1KHVA 5C24A 1PILA 1U7LA 3TUJC 2M2BA 3R27A 3RAXA 1RA7A 3CCJS 1LWCB 1SIWB 1TKZB 2JHEA 2IJNA 5KT4A 2BQUA 4PWUA 4FS1A 1WF2A 3CC2S 3GFZA 2AYBA 2IRXA 3S1TA 4WKYA 2IFXA 4XPEA 4X4TA 4IUFA 4A8QA 2UXDF 1FE0A 5BYQA 4X64F 1RTDA 2DNQA 4NLSA 3PIOQ 5EN1A 5KFWA 3NKYA 3Q2SC 4O3NA 5A8KA 2FVCA 1L3VA 4B9SA 2WAQD 2ROEA 3NS6A 1X4HA 1HBUB 4WFZA 4ZCKA 5I4MA 2FHMA 4DFPA 2MKSA 2DK2A 2M4MA 4ECSA 4K59A 1U1KA 3ZZRA 2ZC3A 3BN4A 3LP0A 3OPKA 1YWXA 5J2QB 5H9FJ 4EYIB 4ED8A 4TU9A 2AGOA 1HWUA 1FRJA 1N33F 2L08A 2M8HA 4IG3A 1T05A 3L09A 4JV5F 1H7XA 1GTEA 3CJ0A 1S6PB 2C3MA 4C8KA 3MM9A 4DV5F 1YHQS 1NJZA 4EUVA 3BS9A 5KT2A 1FA0A 4QR2A 1WEYA 1YJRA 2LU2A 5BYSA 2PA8D 2R4FA 1JKHB 3V6JA 1LWFB 3DFEA 5I42A 4QWDA 4E98A 3LP2B 1SIZA 3FRYA 2W8KA 3PX6A 2BABA 2RMLA 3S8SA 5EWGA 3OHAA 2OH2A 2GFFA 4PWDA 1HBOB 2DNPA 2V8GA 2WOMB 2IBOA 1P1TA 2XHWA 3OTDA 1BQNB 4NCAA 2IC3A 4F8RA 4RWXA 3VZIA 1RA6A 1S1UA 1T95A 2FDNA 4MTPA 3WC0A 1MU2A 4ZP8A 4ZK7M 2W9CB 2M52A 1AW0A 4OL8A 2MQPA 2CQCA 4ES1A 4OQJA 3IWLA 4EBEA 2W8LA 3PX0A 4G1QB 1JJ4A 2Y1IA 4N8NA 3BM7A 1CEZA 1U2FA 2CRLA 4ICLB 2OAUA 4C8LA 2HFOA 3H20A 4RU2A 4ERDA 5CCLA 4I0WA 3FVYA 3WX4A 5DQGA 1WHVA 4WYLA 5E7OB 4MK8A 1KHWA 4TN2A 2K1RA 5G0RB 1EP4A 3DNCA 3DRXA 3CCTA 3LAMA 3RB6A 4FZVA 3HXMA 2RRAA 1OPIA 2K3IA 4AL5A 2MKIA 2B4UA 3OQ2A 4F4WA 4NLVA 3RRGA 1GX6A 2MZSA 3GE9A 3UQSA 2YKNB 4PKDB 2DNOA 3B82A 2KFYA 1YITS 4IQXA 5KFMA 3C46A 2OTJS 3KLIB 4KB7A 4HEA9 7FDRA 2HVZA 3MEGB 2OPQB 1NU4A 2W25A 4RNMA 2ADBA 2NQPA 1QAXA 3QO9B 2GO8A 5CYMA 4JI6F 3N9UC 3GV5B 1DTTA 2XY6A 1S7HA 1S0NA 2PE8A 3W7BA 5KFYA 3KLHB 2BDPA 1U6ZA 3E01B 2LVWA 3G86A 5MAOA 5CD4H 3MMBB 1UWBB 2HNDA 4B9LA 1REVB 3NBPB 3Q8PB 1BGXT 3F41A 2YNIB 4ELUA 2BANA 3BGFA 1HR0F 4Y2CA 3CCLS 3J7ZT 2AJFE 5B7WA 3H40A 2R8HA 1KS2A 1U6BA 2R7VA 2HWHA 2HW3A 1TK5A 1X7VA 1NK6A 3M30A 1M5VC 1DAXA 3MF5A 1G3OA 4DV2F 1HA1A 3THPA 3CGIA 4OX8A 4OX7A 5KOWA 4F4XA 1P9QC 3PEJA 5L9NA 2E5IA 1S48A 2WSEC 4H4KC 2FVPA 3M2VB 4NXMF 1B0VA 3P49B 5EWEA 2YKMA 2VPXB 3H98A 5B0CA 3MMCB 1H2TZ 3I96A 3RRHA 1UFWA 5HP1B 4Y28C 2FLLA 1X0FA 2B0GA 1AROP 5CCMA