3UFCX

Characterization of a cas6-related gene from pyrococcus furiosus
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
243
structure length
243
Chain Sequence
GGMRIEIKLLPLQDNPVIPFNYNYELYSQIVEKAGAIEPRIVKLLESPHGYWTFSRIIIRKREIIPEKGIKILSDDISLYISSSNKEIIKGIVEGIEKSPEFKIGDVGFLVADIKALKSKEIKNVNIFSTLSPIVVRTVKFEGDKLKHWDLYPHDELFLDRLRKVMLLRYHEVMGDLPEDKDFRIELIKFKPTRLIVKDSYIRGSLMVFRYYGSKEIAKFGYENGFGEKTNLGFGMVKIIEEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Cas6 paralogous protein from Pyrococcus furiosus
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
molecule keywords Putative uncharacterized protein
total genus 69
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2011-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01881 Cas_Cas6 CRISPR associated protein Cas6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ufcX01
3.30.70.1900 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ufcX02
3ZFVA 4ILLA 4C97A 3PKMA 4ILMA 4ILRA 3QJLA 3QJPA 4C8YA 4C98A 4C9DA 3UFCX 3I4HX 4C8ZA 3QJJA
chains in the Genus database with same CATH superfamily
2MGZB 2GHWA 4I2QB 3BO4A 3OR2A 3V4MA 2P9CA 2VPYB 2ZE2A 1GTEA 1IBMF 1HPZA 1OSCA 1P1TA 3D7SB 1NDCA 2CDQA 3BYPA 4KO0A 3MM6A 4V1Ak 3J80Y 3KYLA 4DV5F 2IAJA 1U8SA 3ZZPA 5EDWA 3SV3A 1VQYA 1K9MT 4UOHA 2UVWA 3OVSA 4AD6A 4USHA 6FDRA 1IBCB 3RAXA 3OTOJ 1RGVA 1FVQA 3ISND 2RSQA 4IR1A 3QRRA 1FRXA 1WSVA 2HNZA 1WF2A 2BR0A 5D15A 5RUBA 3T6JA 4U95A 4ED6A 3G9CA 4I69A 2OPRA 4PG6A 4Z2XA 1FO1A 4K4TA 5KG5A 4M63A 3T1HJ 3Q8UA 1F5AA 5EWFA 3GIMA 2F63A 2DEJA 2YPYA 3LA0A 2OPSB 1UMJA 4ECSA 1CJUA 5E0OA 2Q3PA 5DQGA 2JZ5A 2KO1A 2QYGA 1LW2A 1REVB 3BGOP 4AUKA 2ZH4A 4RNMA 2VIHA 1EJ7L 2CZ9A 3KG4A 4GO5X 4MH8A 4Y2KA 3BREA 4L76A 4ZP7A 5T7LA 5LJ3Y 2MYFA 1XNRJ 3BKFA 2OLWA 1KS2A 3NGRA 2DHHA 4ECVA 1FXDA 2V0NA 1VGYA 2YPZA 3U7JA 4TNOA 1PIEA 1RT2B 3QLHB 4A8OA 5FJ4A 1SC4B 1RTJA 3ZTRA 4UZCA 2IVFB 4NLVA 3K5MA 1KLMA 1U25A 1LFPA 5HL7Q 1I94F 3JB9k 2XGQA 2ZC4A 5A76A 4ZPWR 1KOOA 2VOPA 2DITA 1RAGB 1N36F 1KD1T 3X1LB 2V2VA 4O23A 1F2HA 3VV2B 3AH6A 3R8YA 4G3IA 1SIZA 2W2NP 4RUHA 3GFXA 4NASA 4KQZA 1FD2A 2J6UA 3EYZA 2HVEA 2WVBA 3BB5A 2CRLA 3H0PA 1RABB 3IO1A 1HL6A 3MUMP 4ECYA 2DNOA 2W2QP 3T19A 2FLPA 3IS9B 2PI5A 1FHTA 1YJTA 3F0NA 5KFHA 1Z2ZA 2AWZA 2HEKA 2NXUA 3OL7A 3J7AN 3SYZA 2ZH3A 5C24A 2W9CB 5D0GA 4DFPA 2C28A 2G4BA 1YJ7A 3FQKA 4ZP8A 3JAMY 2OMLA 1E6VA 5L46A 3UW1A 4R5PA 1WDDA 2E5JA 5KFAA 3W9JA 4J9OA 1LWEB 1PILA 2EFGA 4ZVOB 1TMJA 4DPUA 3Q89A 3BS9A 4P75A 4ZDNA 2DCUB 3ETOA 3T5HA 1S6QB 3GLJA 1PAUB 1X7VA 2DY1A 5GAEU 3W5YA 4LFCJ 3KK3A 4DV3F 5H9FK 1FKOA 3D1QA 4ICLA 3CDWA 4ZLPA 4B3RF 1OYDA 2C3YA 4FF1A 4GKKF 1C0TB 2KZMA 3DFEA 3GU0A 3MMAA 5F8GA 1S57A 2DNNA 4C0OC 1LWFA 1IKYB 1SUQA 3TNVA 4CYUB 2F4VF 4QYRA 4PYDA 5HROB 2QTWA 2QIFA 4I56A 5CD4H 1VI7A 3HM9A 4W4MA 1N4LA 2W9CA 4CO1A 4U7CA 4LBHA 3C14A 4ER8A 1VQLS 1FFWB 2H5IB 3KK2B 3OTDA 3TR5A 4USIA 1S9FA 2KT2A 1FRHA 3ZZUA 3V6DA 3NMRA 3LPEA 1HHSA 4ZN3A 3HVTB 3MCOA 2ZH6A 2GMHA 4NLPA 1IKWA 1D0EA 3MM5B 2MKIA 2L48A 1NZAA 3NS7B 4QIEA 1S7HA 2GIFA 4HHUA 4L3KA 4CNZA 3RB0A 5H9EJ 4ANDA 2FZGB 2FHOB 2HURA 2JL9A 3TJ9A 4IOCQ 2ZKTA 2ZHAA 4HT5A 2GIRA 3DDKA 1DAXA 1Q7LB 2LXFA 3QSIA 4IG3B 1URRA 2CPIA 3CJ8A 1RDRA 4LSNA 5H1SV 1UL3A 1VQMS 2OSRA 1CQMA 4LIWA 4A46A 4F7VA 3OR1B 5KFGA 3BGRB 3VWSA 1SJ3P 1QJHA 3CC7S 4UUWA 3AOCA 3D0IE 4LF5F 1S77D 1Q8LA 3GJTB 3P5BP 1UZDA 2YQ0A 3IBFB 4K4XA 4EBCA 1KRPA 4DR4F 4DX5A 4C6AA 3W64A 4X64J 2LXIA 2KXNB 2XO7A 4ILLA 4DQRA 1UVNA 4YUDA 2E5LF 4V19X 2E5GA 2HQFA 3D3BJ 3DOLB 2JRSA 5I3QA 4DFKA 1JLBA 2B8PA 2FHMA 2WHOA 2DHAA 3MEDA 1R8CA 3NWRA 1RTZA 2AGQA 1IBLF 2XB2D 3NNHA 2KHCA 5LMUF 4JI2F 5THWA 3M2VB 3KLFA 2GVDA 2RHSB 4IR9A 2E1RA 2VG6B 3OTCA 5FLXU 4WU2A 5J1PA 2DNMA 4U7UK 4JI6J 3IR6B 2C2OB 3HF5A 4AT1B 2WW8A 5B09A 1X0PA 5G4DA 3RB6A 2XNQA 2HVIA 3VTIA 1HWLA 2M5YA 2CQHA 2KKHA 3ET6A 4DU8A 3CO0P 2LXUA 1ZAXA 3OHBA 3CD6S 5FDLB 3QJPA 1EB0A 5ETRA 1S72S 3TEGA 3V5RA 5I42A 4S0MA 3B6BA 1CG2A 4AYBD 3OUYB 4X4RA 4LF5J 3JAMU 4BCAA 5F8LA 2I9SA 2HSEB 4KHPJ 3ZC4A 2Z0GA 3EGZA 3P6YC 2J9DE 1Q79A 1TKZA 4YQWA 4G65A 3PTWA 2JEJA 2KB2A 3KLEA 4LF4J 2XI2A 2DGUA 3NS6A 3I9V9 1JJCB 1X31C 1TKTB 2QLBB 2VG7B 4ZVFA 2ZH9A 5B0AA 1LOUA 3VGSA 4UY8T 1DTQB 4I68A 1MW7A 4J9NA 4PWDB 4NWBA 4F4KA 2XMAA 4NXNF 1TKXB 4B3OB 2LYVA 5K8NA 2CPZA 4K4ZA 1Y00A 2L9NA 2HFZA 3US5A 2FHJA 4PWWA 1ZYQA 1JQGA 3CB4A 1ULRA 1JB0C 3GG1A 3X3UA 3HT0A 3NMAA 3DDNA 2B0GA 4F4XA 3CDAA 1B4SA 2H65B 2HFOA 2HFVA 2WVDA 1U0HB 2O67A 3N0VA 3CPWR 2KYZA 4HYKA 4LF9J 2J6SA 5EGYA 1S1UB 3IGNA 4WIQA 3W1YC 2EFQA 3VZHA 2APOA 2YX1A 2FD2A 3VGUA 4USUA 2J8AA 4ZCLA 4OFZA 3T1AA 2H5JB 2RDDA 1LQ9A 4PPDA 2V4JA 5T41A 5KFSA 5HSPA 1F3VA 3KLVA 3H5UA 3HULA 2FC9A 1WHWA 5KFVA 1ZTWA 3HLUA 2OPRB 3ZNJ1 2I6WA 3ZTQA 4Q43A 4DR7J 4TVAB 1JWWA 1FJEB 4FF4A 1B7YB 3DLGB 5DLGA 3C19A 4J9QA 2AF6A 3GPAA 1WG4A 3NCPA 4M5KA 1RKJA 2ACMA 3K5LA 3L3CA 1YWXA 4W98A 4CO0A 1NKBA 1G6BA 2FLNA 1DJ0A 2DO4A 2X1BA 4KKOB 4KO0B 3UN5A 2AIRB 3O2IA 1H72C 5HAOA 1TL7B 3F41A 3J81U 3CF5Q 5L1IA 3B78A 3EZ5A 1KFDA 4WXOA 2FIUA 2D9PA 2HKEA 3M4XA 4ZVHA 2MEWA 3Q8RB 3M8SA 2V4RA 5JVGQ 3PW7A 1NK7A 2HAIA 2H51B 2KH9A 2E5IA 2V4JB 4PUOB 1DURA 4CLZA 2YNFA 3LW5C 3CIMA 1HHQA 2DNYA 2Z2LA 5IT0A 3CWJA 3I0SA 3MGJA 4G1PA 3JSMA 3ONQA 4UY85 3M2UB 2G2OA 3HJVA 2MKSA 1R6YA 3MOZA 3QNWB 5HBMA 5MLCV 1SH2A 1IBMJ 1P9YA 1MMNA 2HVHA 3RBZA 4K4SA 4ECUA 2HK2A 2E44A 2JSXA 2RJZA 2WW4A 1JJHA 2YKAA 5CYQB 3EX7B 2DGSA 1TK5A 3HHLB 3TYTA 4MT1A 3G82B 3W65A 4J9RA 5LSLA 3PX4A 3PHEA 5CAAA 4KR0B 1VLYA 3W3SA 2NR0A 2PN6A 3VR1A 1RSCA 1TKXA 3UWTA 2UXCF 1HBUB 2AU0A 2HWIA 5CZVA 3UE2A 3VGVA 3BKUA 4DN9A 1HBMA 4EO6A 5MAOA 3JTOA 1VYAA 4P9SA 3V6JA 3LP2B 3UR3C 1MWQA 5IT9Y 1X9MA 3K5OA 2CJXB 3FVYA 4IG3A 4LSNB 4LQ3A 1N32F 1IJFB 1FRLA 2EK6A 1NK4A 1ELOA 2NREA 5KT2A 3QAEA 3LP0A 3MECA 4LF2A 2IC3B 4EBEA 3THVA 1JXLA 1AUDA 1RU1A 1FWLA 3MF5A 2QRRA 1M1GA 1X4FA 1F1BB 1DBDA 4PG4A 4R25A 1LW0B 4ERDA 3IM9A 2EKNA 2LDYA 5KFYA 2LP4A 2CWKA 3DXSX 4EWTA 4U67Q 2OEJA 3J81j 3U02A 1N48A 2LECA 5KT3A 3M8WA 4DWIA 4O3SA 1FJ7A 4O0IA 2OAUA 4ZVQB 3FDSA 3ENQA 5GVQA 1LXNA 2BJ1A 4NMLA 4CP5A 1O8BA 2LQ5A 4X4UA 1ZPWX 2V2QA 3MMBB 3SSSA 4CCHA 1VISA 4X4VA 1AFIA 1QE1A 3M9MB 1SXLA 3G6ES 5B0GA 4URGA 3MFHA 4W92B 3PEHA 2R8HA 3ISNC 4IRKA 1HD0A 2IHR1 2GVDB 1VQOS 1BQNA 5LL6d 1UJ4A 4MAKA 1UWBB 1HBNA 4AQYF 5I3PA 1Q53A 2G9OA 3CE8A 4OYZA 4TQSA 1VQPS 3DI6B 1BXNA 4FP9A 1FKOB 1YKWA 4FVCA 4ZK7M 4I6WA 1JLBB 3NOCA 4C8OA 2UZAA 2LU1A 3R6LB 2EW9A 1KNZA 1N32J 5D77A 1HNXJ 4DQIA 2UUWA 1RHKB 3AB4B 1R43A 9RUBA 3OFFA 4DUYJ 4ED4A 2D74B 3CMQA 5L1JA 2AYMA 4OYMA 4DZDA 4JYAJ 2W9BB 2R8IA 4X4TA 3OL6A 1X9WA 3FQLA 4JI7F 3PYGA 5G0RA 2VASA 3MEEB 2ALZA 1HWKA 3IS9A 2B9EA 1KWMA 4A8XA 4LFCF 2GFFA 1V9OA 3N4WA 3NGTA 1R8BA 4QIFA 1D9DA 1XR6A 1H0HB 5IC4B 5LSRA 3MEGA 1OWXA 1VDHA 2R2SA 2A1BA 2NLWA 2KZZA 1WC5A 2LVWA 2EXUA 3LWLA 4NMXA 1YBUA 4B3OA 4KC5A 2JX2A 2BVZA 1EIYB 1GAOA 2IM0A 3IRXB 3D6FB 5IWAF 3TUIC 3H2UB 3U1LA 3ZO7A 3ZTPA 5J2QB 4F0MA 2FJAB 1AFJA 3Q23A 1S4EA 2ZZNA 1FX2A 3MFIA 3CJSA 4IUFA 1J5OA 4K0KF 1HI8A 3IWLA 2IPOB 4OJGA 4C0BA 4B9MA 8AT1B 1EKSA 2G0JA 2MLXA 3G8QA 5EWEA 4ELVA 1JIHA 1U2RA 2CPJA 3I0RB 3ZFVA 1QSSA 4HHJA 4C11B 3G8SA 1T8EA 4C3MA 2VHGA 2YWGA 1N56A 2PT0A 1YX2A 2IDLA 3I4HX 1CJVA 2ZD1A 3M1VB 1CQNA 3NXZA 1NSAA 4M5LA 1FTRA 1EARA 4AE5A 4QWAA 3R1LA 1JXEA 1NDKA 2XZWA 3EXYA 2DTJA 4TY8A 1JKHB 4A8KA 5KFCA 4F3OA 4BHQA 4C9DA 1CPZA 4DX6A 1D9AA 2AV5A 2CPYA 3EPGA 5B08A 4OI2A 4RKUC 1RBOB 1BQNB 2XWXA 3DYAB 1GEHA 3DOKA 3L7OA 2IA0A 1CS4B 1WC4A 4GRSA 2RHQB 4CWBA 1S1WB 2G1DA 1VIXA 3MM9A 2VFUA 3LQVA 1M1HA 5BYRA 4YS2A 4K5SA 1R0AA 3RW6A 2F9DA 2CADA 4ZCKA 1CC8A 3J81Y 3T9NA 2XYPB 3CNQP 2BXJA 4X62F 2JNJA 2YXLA 3FCHA 5DDQC 3LAKA 3HDSA 2XS7A 1FF2A 2AJ2A 2HIQA 2MDAA 5A0YA 4LSLA 2UUAF 4F2RA 2ZZTA 2HRYA 1S97A 4QYZK 4RZRA 5FLXY 1NAQA 1XMQJ 4E0DA 2KU7A 4OHXA 4PEOA 2CPFA 2W7PA 2OP5A 2I8EA 2HGNA 4ZVUB 2QN6B 2GJ2A 4WE1B 1SKSA 1JJ2R 2E66A 4FDFA 2W7AA 3K89A 2AJ4A 2ZH7A 4R8UB 3MEGB 4HDHA 4DSFA 2K2PA 3JSRA 1U09A 3MAAA 4UOFA 1J5EJ 1FWPA 3OSNA 1S7IA 1RWXB 4ZKAA 2GO9A 1MWYA 3AHPA 2K3KA 4OYAA 3J7ZT 3QMQA 3IRWP 1VC0A 4P73A 4Y3CA 7AT1B 5E3RA 4YFUA 3OHAA 5A8WB 2QGFB 3CCZA 5K20B 4DPOA 2AYGA 1RU2A 1YRTA 1IKVA 3DRRA 4JI8F 3TOQA 2V69A 3R6GB 4JUZA 1RHJB 3IN5A 2RE1A 4QR1A 3SSRA 3W60A 4ECWA 1L3UA 2UUBJ 4NLYA 1LEOA 2ZWPA 3RR7A 1UP1A 2XNRA 1H7WA 3B4DA 1VRQC 4QWDA 1LW2B 1YJUA 3GCXP 4O0NA 2VKZG 3AJDA 2VONA 2RUSA 3GMGA 1GMVA 2R7QA 8RUCA 1S0VA 1TU0B 2HRTA 2RDIA 3DI6A 2VFVA 4X2BA 2RQ4A 1FD8A 5FIIA 4DXLA 3RAMA 5L1KA 1RLDA 4ZVTB 5GMEA 2MY7A 4M5DB 4DMZA 4OZ1A 2Q6CA 3ISZA 4KGZB 2QFJA 3TUPA 1TL3B 2EFOA 3HSDA 3T1YJ 1JKHA 2VQFF 2M4MA 3TP2A 1SKWA 3DOKB 1UWBA 2XY5A 3SCJE 1D8ZA 4FNHA 5KG0A 4OYBA 4TQRA 1K73T 4LF9F 2HLUA 1FDAA 2MHNA 1OQ6A 3OVBA 3SFUA 2AHOB 4U6PA 2GMLA 3G87A 3C8YA 2AMCB 3E51A 4USVA 2PMZD 4F25A 1EAYC 1LWXA 1JNRB 1YK9A 2E7VA 2UXBF 4C48A 4LREA 4FYWB 4Q5VA 2X3GA 4IFVA 2AGPA 3V2UC 1A6LA 2EVZA 1WJ9A 2IC3A 4FXWA 1LWEA 4B17A 4Z37A 1O51A 4WP8A 2DHGA 4QR2A 4IQXA 1Q16B 1X60A 4DLEA 3MI7X 1FCAA 1CLFA 1RT1A 1UVKA 3TAMA 4DV3J 1IQTA 2MKKA 1GMWA 5J2PA 3IBWA 4WP3A 4N8OA 3GE9A 2NXCA 1TL1B 4OYOA 2LEBA 1Y3JA 1S0NA 1VC5A 3UVJB 5C7PA 3HXMA 4J9UE 2KT5A 3IR7B 1FNXH 4KHRA 3H4BA 3OQ2A 1RWVB 4WTYA 3V4IA 1HQUB 1RCXB 2DNRA 2F8HA 4QIGA 2Z8QA 4CLLA 4R0JA 4ZHRB 2LQ8A 1HBMB 2MMYA 2OMOA 1T0TV 2Z56B 3TW0A 1GNKA 3TA0A 4Y28C 4MYTA 3R7BB 2B56A 1H38A 3SBMA 2VZ9A 2DY9A 2WBRA 2KG0A 3KLIA 4LFAJ 1U1MA 3BF4A 3I31A 3DM2B 2H54B 2JWNA 3A12A 3DU6A 2KTQA 2BE2B 2U2FA 2DR9A 4K7QA 1Y0HA 4G1QA 4ZPTR 2DRDA 2UXDJ 1D1UA 2DK2A 5B0FA 3V6KA 1YITS 4NEZA 2RH3A 2OPPB 1HARA 3QATA 4KKOA 4LRBA 2CNNB 2HGMA 2ILYA 3EZOA 4BS2A 3MM9B 2Z4PA 1GK8A 3PR5B 4B3MJ 3HO1A 3BO3A 2N4CA 4K2JA 2Y1JA 4E2FB 2I38A 3IXQA 1UETA 2OJ3A 2F40A 2XBPA 3ELHA 2QEXS 5D0HA 3NLCA 2FLLA 1RHUB 2AYBA 1D3WA 1QTNB 4GVLA 3H42A 3EGNA 1HBNB 5KFMA 4JI8J 4QU7A 2QO3A 3BKTA 3NGKA 3ZZYA 4C3LA 5AE1A 4WFYA 2MGZA 2MPUA 4MFBA 5J2MB 2FB0A 2PEHA 4I2PA 3CCMS 2VKRA 2MQMA 4Y34A 2ZJRQ 3GYXB 3FEYB 3CCSS 4AL7A 2ASDA 2F8EX 3BZQA 3FK4A 2KT3A 2BKPA 2NYIA 4ZPBA 3A8EA 3M05A 1SH3A 1N5YB 3M9OB 1HD1A 2BUNA 2CQ0A 2ZUGA 2R2TA 5LMUJ 4JI2J 2BQUA 4HLBA 1WHVA 1FDNA 3UPFA 2KRRA 1L3VA 2ZDPA 2RF2A 4NCBA 1WC1A 3GIKA 1S49A 3DLKA 4RU2A 1TL1A 2H1YA 2HK3A 5K8OA 3TARA 1REGX 3BQ1A 4JI0J 3SCLE 3TA2A 5HLFB 5DQIA 1V3RA 3HFVA 1KR4A 2J8SA 1HQUA 2DNGA 3MM8A 4NZ7A 2A18A 3GYGA 4Y2MA 5KFJA 2L41A 4IDKB 1QUPA 4CLSA 1WKLA 2DGVA 1T94A 3CJTA 2VL1A 3LP2A 2HQ3A 2IYIA 3MPWA 2YQ3A 2Z2ZA 3KWMA 3GILA 4OHYA 2LQJA 1V3ZA 4YMEA 4CH1A 1I1GA 3KUGA 2BBEA 2PFDA 4KRWA 2YWHA 4WIIA 1G2EA 4OYWA 3BSAA 4EZ9A 2M0GB 4QWEA 4EUVA 4LBIA 1TELA 1RT7B 3M8YA 4X4QA 2Q79A 4NLQA 4QWCA 4DL4A 2MB0B 2R7SA 5JXSA 4YDDB 5D8HB 4GVBA 1NUEA 3ZTOA 4NRUA 3KHHA 2PA8D 3LWMA 1OY8A 4NCGA 1P9QC 1C1CB 2HAFA 4PWUA 3WC2A 3CULA 2VPXB 3RJMB 3I0SB 1TL7A 3SV4A 1HFEL 3PM9A 3KK1A 2IIHA 3V6DB 1FESA 1WKJA 2CQCA 2GJFA 4DR1J 2BDPA 1FJGF 2MKYA 1CJKA 3POTB 3PJ9A 1K1QA 2DGOA 2V50A 4DSIA 1OQ3A 3KNGA 3DLJA 5CYMB 3HD2A 2JLFA 3SMZA 3H5XA 1H2UX 3EXCX 4CLUA 5HO4A 2ALYB 1N5QA 5E7OB 3QT5A 5GAEI 4XO0A 4EZ6A 2X1FA 4IO1A 1NNDA 1KHVA 2M9KA 2OUGA 1H74A 5C5JA 4OL8A 1YTYA 2DT9A 2ZJQQ 4DPYA 2AD9A 1GH8A 5F8HA 4LFAF 3R5DA 4ZVPB 1RBLA 2X7IA 4ECQA 3OD2A 1DZ5A 2E5HA 3WZ0A 1U8WA 2Z58B 2OHDA 4JV5F 1BC6A 2JEFA 2AW0A 1SL2A 4C8NA 5ETOA 4OZ5A 3GTYX 4GC7A 1XN9A 3R5GA 2MQLA 2Y1RI 1NJWA 3NGDA 1BWVA 5C25A 3OLAA 4UF4A 2VB6A 1RTHB 1S1XA 3PRVA 2NUHA 3IBCB 4C8KA 4DL2A 2J9EA 1WNEA 2I2YA 3UR0A 3LTOA 1NJXA 2QL5B 3FJ2A 5J1EA 4YR2A 3PY8A 3VCDA 1NH8A 4N8NA 4DUZJ 4OQJA 1RA7A 3K2YA 2HHSA 1UFWA 1X4HA 1S9GB 2VBXA 2FZKB 2VC0A 2F8MA 1N5VA 1XEZA 3V6HA 2O66A 3VVUA 1RWUA 4HVZA 4LRCA 1CEZA 5AJ3F 2DR7A 3K8VA 4FKYA 4KPYA 4Q8EA 1HI0P 1OY9A 2ABYA 2RILA 2VDHA 3GSDA 4PXBA 4DV2J 2V34A 1D09B 2WSFC 4PABA 4DSEA 2V8GA 1HR0F 2FJVA 4J9PA 2FGOA 1C1BA 3I55S 3OSPA 2QL7B 2JLEA 2XSJB 1FRMA 2V6AA 4ED8A 3UD3P 1Q82T 4IRCA 1L5UA 2BKNA 3NAHA 4WKYA 4ED3A 4DSKA 2NQPA 5CYJA 2HNZB 3PJWA 1VQSA 4O3PA 2YKMB 1H6KX 3BSCA 1U6ZA 2YNHA 4NI2A 2AX1A 4ANEA 4LRDA 4NLGA 4DUTA 2BM1A 1UA0A 1DTTA 2FJXA 5LSOA 2L3MA 1FI4A 3F56A 3OPKA 2GGPB 4IKAA 4M5DA 5GAGU 1S0MA 1IJEB 1IBKF 1FXRA 4DR6F 2VICA 4OHVA 2MSSA 2HZVA 3CTRA 1KTVA 2B5JA 3AAWB 1QSLA 4LRAA 3OLBA 3HVRA 2KVIA 3H59A 4A8YA 5EX0A 2EPIA 4EFAC 2L08A 5B0EA 5J2NA 3CJ0A 3PZPA 1ITPA 5L1LA 1C2PA 1KONA 2XSJA 4JV2A 2FY8A 2GX8A 3MEKA 1VHFA 3JYTA 1SJFA 3O3LA 2VOOA 5HMWA 3CJKA 5AT1B 3SZ2A 2C3MA 1EHWA 3B4MA 3DRRB 1TQLA 2ZBIA 4OZLA 5CH7B 5CQGA 5KFDA 1Q0NA 2JVOA 4IOBA 2DNHA 3TX0A 1OY6A 2IDEA 1FTCA 1OJ4A 2HS3A 4TYBA 1CSJA 3CUNA 1M1KT 1UJ6A 4B08A 4FXVA 1WEZA 3HKWA 4J90A 3N6MA 4N76A 3C6UA 3CCWA 1U1NA 2E1MC 3UDLA 3M32B 3PACA 4USTA 2JFDA 5H9EK 2V68A 2E7XA 3GWCA 3HCXA 3MR2A 3MR5A 5HATA 3UQSA 2DRAA 1ZM2A 3FSXA 3MEEA 1B99A 1VRUA 3L7PA 3P45B 4HACA 4NPOA 3RGIA 3T41A 1HNXF 1REVA 1ZZNA 3FEZA 2CJ9A 3KJVA 1YZ7A 2RU9A 4QOTA 3KLEB 4CLKA 2IYGA 3DLEB 3MPUB 4KY3A 3FGVA 3QZ8A 3M8QA 2VC1A 2YWKA 3AQOA 2MTLA 2XYHB 3C66A 3CXCR 4B3TF 2U1AA 4ELUA 4TU9A 2AQ4A 2FHJD 1WSRA 4ID5B 4HL9A 3CD5A 2MQQA 5DG7A 2UXCJ 2YKNB 2ZWOA 1SI9A 5KG2A 1V3SA 1FKPA 4USKA 1U24A 5HVHA 1LWFB 2FVCA 2VG5A 3DXBA 4FXDA 3IR5B 3D3CJ 3P8BB 1PG5B 3C14B 3N9UC 1SBRA 3HX9A 1NHUA 1U49A 1SKRA 1JXVA 3DCAA 2WBMA 2OGUA 5L9NA 5DGBA 1IM4A 3PRBA 4NX9A 1R0AB 3W9IA 3GYNA 2I0XA 3QPIA 5ETLA 5K5MA 4WFBQ 2V5HG 4FNIA 4USJC 4DV1J 2HHHF 1IWGA 3IFEA 4Q8FA 3AA9A 4FKXA 4FYXB 2LLZA 3KTQA 4KIAA 1IR2A 2MKJA 4A8QA 3D54A 3MTKA 3KHGA 2O5DA 2B7BB 4F0KA 5AJ3J 1Z4UA 1R0CB 3R5JB 5GMDA 2MLZA 4OMFG 1PC4A 4PCQA 3FUYA 3SDEA 4Q2LA 1QVFR 3DOLA 5K14A 1VOMA 2BJ7A 3O44A 5D4LA 3T9ZA 3VAIA 1SB6A 3NEKA 1TAQA 5F3TA 1W2BR 5L39A 1SV5B 1F6TA 1X4EA 4C11A 4DQSA 4NA3A 2AZ3A 2XZDB 1KQFB 3W2WA 8ATCB 4RLEA 3PO4A 1Q8IA 1G1XA 3DRYA 3OXGA 3BN7A 3E2EA 2C2NA 4MK9A 2RQMA 4RUCA 1H2VZ 3BDPA 4M95A 4N41A 2QLFB 1YQHA 1H3DA 1MN7A 1T3NA 4TYAA 3KXDA 4AL6A 2XQCA 3JSYA 4YDXA 2QG9B 3K59A 4ED7A 3BV8A 3F73A 1M5HA 4KV8A 2PE8A 3C6UB 3I5AA 3T1HF 5E41A 2Y0SD 3HMJG 1V5VA 4IQMA 2BQRA 2FLOA 1WHYA 2GVZB 4OI0A 4PQUB 1S48A 3OXLA 3EVMA 1HKAA 3ITHB 4CLPA 2ZFHA 1ZH5A 2NZ4A 2RQKA 2RS8A 4RUAA 3OL9A 4LUBA 4X62J 2AEFA 4P6QA 3LOUA 2MY8A 4J5OA 2OTJS 1U6BA 2KFZA 2VDIA 1XR7A 3HHLA 4HDGA 2BW7A 1ZM3A 1XMOF 3KMQA 4CLWA 2N7CA 2X1GA 3PR4A 2XS2A 2GAGC 2ZBPA 4YY3J 4YN3B 4WYWA 4IH7A 4HTJA 3H5SA 3Q8PB 2R2RA 5JVHQ 2HVZA 2WCXA 3WIVA 1OS5A 3E8OA 2MKCA 2BOPA 2ASYA 3CCLS 1RACB 1DHMA 4DL0C 4NYOA 4H4MA 3D28A 5KT4A 1GX5A 2B5JB 2J6TA 5HMXA 3RW7A 2MZSA 1CULA 4P52A 4L72B 2A6OA 2W2PP 3C3LA 2DXFA 4HHHA 3ZZTA 5M2UA 4ZPVR 4WWSA 1RKIA 1KVKA 5BYSA 1VC6A 4IO9Q 2PA3A 4ZN1A 1WEYA 2C2EA 4TN2A 4K0KJ 1IVZA 4TY8B 3WX4A 1HPZB 1VRTB 1FT8A 1LKZA 1S6QA 4F3MA 5IFMA 5KFOA 1AUSL 2C2KB 5KFWA 1S10A 3LGMA 2Z30B 2DR6A 1RT4A 4JI5F 2UU9F 4ECTA 2VH7A 3RRGA 3KK1B 3ENVA 3EPIA 4J7CA 3L09A 3CCRS 3KLHA 3S01A 4FYVB 1U0SA 2ZE2B 1E6YB 1Y5LB 4OJHA 5E5NA 2J7KA 2JJ4D 4DF4A 4I2QA 1T11A 4X4NA 4J9SA 5HP1A 4CO4A 2Y9HA 2BRKA 1PO6A 3N01A 2HNYB 4PXCA 1TTHB 3HVAA 1FJGJ 4OV1A 4TLQA 2ZITA 3MCSA 4ZA1A 2JEGA 1IM6A 2JFKA 3GZ7A 2B4VA 2DNKA 2LU2A 1PYTA 2DGQA 1RAIB 2FPHX 2PMHA 4IG0B 2NXEA 1F0XA 3BJYA 3M8ZA 1RYSA 1X4AA 3CCJS 2MQ8A 1AB8A 2B6AA 1WEXA 1HBOB 2W25A 4NLDA 4Q7AA 3ZZZA 3I9ZA 4TU8A 1KVJA 4LIRA 1T9XA 3MM7B 5KAKA 1XK8A 3M6VA 1YDLA 1RT2A 2PO4A 1KHWA 4EGLA 1IN0A 3SIPB 3AODA 2YQ1A 3CCVS 3G8TA 5C25B 2Y1LB 4RJVA 1IR1A 1DQAA 4ED2A 3CCQS 1O6XA 1XJWB 1Z1ZA 3TAMB 1IWAA 3IAS9 2BE9B 2GAHC 2PSZA 2UV8A 4L73A 1U6FA 5KTQA 5GAHU 3QT6A 3LP1B 3SQGB 1VBYA 2RRAA 3Q0AA 3Q8VA 4KYZA 4DHVA 1NB2A 5CA5A 1SL0A 2O01C 1I94J 3AJ1A 4WU3A 3I56S 4A8WA 1W2IA 1LV5A 4DL6A 2AJ0A 4F02A 1WOPA 1N36J 2R7TA 2V9WA 1J5EF 1S6OA 3A3PB 3OTBA 1VQKS 2E1CA 4CTAB 1RHRB 3OJSA 3TI0A 1NK0A 4QR0A 1SJRA 1HNIB 3PKMA 2VG6A 4HTIA 3TUJC 2HHTA 5ETVA 3VHQA 2SXLA 5IXUA 1RE1B 3RBXA 2R7UA 1NRKA 3W8GA 2F3JA 4D3HA 2XSFA 4HI2A 1NHKL 4DR4J 1KBRA 2B4PA 4DG1A 3HT3A 3N28A 2QA2A 3M8RA 4ZITA 2Y0BB 2QX0A 3FKBA 5EWGA 3KMSA 4ATNA 5LMNF 2CFXA 3B82A 3PEJA 1B0VA 1U1PA 2HVDA 4QJVA 3EDRB 3LF0A 1X8DA 4CH0S 1WORA 4R0EA 2KRBA 1PSDA 2BE2A 4LVNP 4WK3A 3R7NB 2N82B 3ZZ0A 4YP3A 1L3SA 4OI4A 4J9KA 3C46A 2CKWA 4LRFA 3PDNA 2QYCA 3HHEA 1ZS6A 1NDPA 3BH6B 3MURP 1KFSA 4KSEB 1M5VC 3FBCA 3JS9A 3TJ8A 2EK1A 3PW0A 5DG9A 3BGRA 5EX3A 1U1RA 1JK9B 4YB5A 2PC6A 2CG4A 2VJVA 3NNCA 2PFFB 3Q8YA 1HMVB 5F9LA 3DOMB 5KFRA 1R0BG 4PQUA 5H9FJ 5C42A 3G96A 1M5KC 2VA3A 4ZLJA 4LFBF 3JXOA 2EFPA 2CJKA 4GKJJ 3AD7C 2BABA 2YBVA 1U2FA 3BQ0A 1HWJA 1T9UA 1YGYA 1NK5A 4DV0F 5J2QA 1LK5A 2DKOB 4O3QA 5KFKA 1FX4A 2GC8A 2P6SA 3GJSB 2GVZA 2XZTB 4TLRA 1S4FA 3PIPQ 1RT6B 4RW7A 1R7IA 1R8HA 3L4BC 3SXLA 2RB7A 5KT6A 5C42B 4F3QA 3TWZA 3P49B 2HHQA 3O6QA 2WB1D 4E98A 4QBUA 5CD4A 1YVFA 3G71S 3H7HB 3BBCA 3HSJA 4OV6A 5LMNJ 3PW2A 1IKWB 2AEJA 2BACA 3KG1A 4O3OA 4QW9A 1NPKA 2HS4A 4WFAQ 3I32A 2FJEB 5E33A 4ECZA 2HIYA 4P2XA 3SI8A 2UP1A 4NXNJ 5KFQA 1N5YA 4RL1A 1K44A 3S8SA 4PZVA 3S1TA 3ET6B 5CABA 3GIJA 1WHXA 3TANA 3AD8C 4WFXA 2Q66A 1HQ2A 2CA9A 3IMQJ 3MCNA 2YWFA 3OW2R 4URSA 3BDEA 3DRPB 1NO8A 3QIPA 3THPA 1JLEA 3T3FA 2KN4A 1VLOA 5DM7Q 3DLLQ 2AJFE 2W7OA 3UCUP 1NKEA 3U27A 1JLFA 2GNKA 1OMSA 1RTDB 3GR0A 4KHMA 3D0GE 1UVLA 3W8PA 1FNOA 2NSBA 2CJAA 4GO7X 1DTTB 2HZAA 4B9UA 2JVRA 3FCVA 1Q8KA 2LKZA 1N0UA 1W25A 5ETSA 3UCZP 2H4WB 5HN0A 1QSYA 2DNPA 1QDUB 4B3TJ 1YHQS 2ADCA 5C24B 2QA4G 4NZ0A 1AROP 3SEOA 3UD4P 4QPXA 1NXIA 3MMCA 1ZZFA 4JI6F 3K57A 1HNZJ 3ILIA 3PRDA 1BY9A 2DIUA 3MXHP 4LR7A 4P2FA 3MDFA 4K50A 3W66A 4D3GA 1KEKA 2VPWB 1L3KA 1X4GA 3TA1A 4ELTA 2NPIA 4ED0A 4K4VA 3C15A 4NL5A 3QGPA 2B4UA 2E29A 5CHCB 1R8PA 3ITHA 1B3TA 2XYGB 3GJRB 5K8PA 4OX9F 2F1FA 4KH0B 3KLGA 1FK9A 2XULA 2C2RA 3MAAB 3AB2B 4DQQA 4JBCA 2DNLA 1S9GA 1MROA 2R3VA 4M5JA 1S9EA 3AY0A 4GKKJ 2WRMA 1RWNB 2IVMA 4ZLNA 3EWGA 3QFHA 2FZCB 3HHKA 2K1RB 3BSOA 4RW6B 1DQ8A 3CDUA 3T5JA 2Z57B 1K47A 1YRUA 1M90T 3RR8A 2HHPA 2I5JA 4O3RA 4RNOA 4O3NA 1GXLA 1ZTTA 1FK9B 2BRLA 5HJYA 1NH7A 5DG8A 4DV6J 4EYIB 2CQ1A 2GZOA 4N5SA 3K5NA 2D3OR 1TFWA 3AFGA 1SV5A 1WI8A 4ZPAA 4DR3J 5J2PB 5J2NB 4C0HA 2CZ4A 1TVRA 2CZVC 5B0DA 4X4PA 5I3UA 2H5EA 3DLHA 7FDRA 2YH1A 4DQPA 2W9AA 4LMZA 3ADAC 1WF1A 4RW4B 2K06A 2XLJA 4WZQA 1ZAVA 2M8DB 4JI0F 4YB7A 2WTFA 5D3GA 2RDJA 2OPSA 1N52B 3NRBA 5IM0B 4F2SA 4B9SA 5CCLA 2IJFA 3PHTA 1HNWJ 4LFBJ 3CDEA 3MMAB 3GV5B 2QSFA 2GW8A 1S1TB 1YLXA 3UNGC 1RQ0A 2CQIA 2GGPA 3MCMA 3WBZA 1NK9A 2MQPA 1CVJA 1BQMB 4DR5J 2CPXA 3VVTA 1BE4A 2DIVA 2VUGA 3QIPB 2CNLB 3U1MA 4OX9J 4OLPA 1RXOB 3BR8A 3ENAA 3W5XA 1NZ8A 2A6MA 1FEEA 1PAEX 2LFVA 3K7RA 1T05A 1NK8A 5HJXA 4C8ZA 1RTDA 4PQAA 3NCQA 3PX0A 2GHPA 4M5HA 1C4CA 4XIUA 3SCKE 2QSWA 4NLTA 1EETB 1K0TA 1QTMA 1G7CB 3AOAA 2LQBA 3I0RA 3DRPA 3KK3B 2VQEJ 4NXMF 4OX7A 1BQMA 1C1CA 4HT7A 2OFGX 4RW4A 4F67A 3CDBA 3MAHA 1CJVB 2ZD1B 2M52A 1PKUA 2G0IA 3EUNA 3MD1A 4F04B 2BJ8A 3EVOA 1RT7A 4WCEQ 1S76D 4DR1F 3A3NB 1C1BB 3RTVA 2DEIA 1HW8A 5A2QU 2GQ2A 1MMDA 3GONA 2XC9A 5F0WA 3K58A 2ERRA 1I6JA 4WZMA 3LP0B 3MECB 2DNZA 3JTNA 2MSTA 1S12A 5IV3A 2Z2MA 3CJ2A 5BR8J 1ZETA 2J0WA 2YVSA 2CQ2A 2HRUA 2EBEA 3M2RA 4L6V3 1PJ6A 3AOBA 2J76E 5F8MA 4JI5J 2C3UA 3D5MA 1U02A 4HEA9 1HWIA 1RAAB 5BJRA 5J1EB 4F4WA 2MLYA 5T7LB 3A13A 4NA2A 5KFIA 4DU7A 4OLOA 4CNYA 1NJZA 4L74A 1WTBA 5ETMA 4OYPA 1BD6A 1Q1KA 3MUVP 4ILRA 1CJUB 4A8MP 4O44B 3GJQB 1IKXB 3E01A 4PG7A 5BXIA 4N77A 3AT1B 1UPMB 1NSPA 1VK8A 4RO0A 3D6HB 5DGAA 4DV5J 2QE5A 1NBEB 2XLIA 2DXEA 3OBIA 5KFZA 3PV8A 4KE5A 1K0VA 1R27B 2IMWP 2NYHA 3D1OA 3J7A1 3NGSA 2E9RX 2W24A 3FMBA 1BWEA 3M8PB 1IKYA 1SUQB 3WC0A 2KVQE 2XMWA 4Y0FA 1J2VA 2EG1A 1MMLA 2C1EB 1RT3B 3LH2S 3CW2C 3PFOA 3UFCX 1T03B 2C42A 2H9ZA 3IGVA 3LGNA 1N33F 1T9TA 1D9FA 4DPTA 4FF3A 2XWYA 4NEYA 4RX6A 1HNIA 5M2RA 1VIOA 4DZ6A 5GMKa 4DUYF 4JI4F 2DBBA 2IY5B 1F60B 1APSA 2YNHB 3A8IA 3B54A 3M6WA 1N5TA 3BBBA 3NWGA 3PYFA 4I7FA 4JYAF 1AT1B 4DV6F 5KG6A 1FKAF 1M0SA 3JSBA 3M6XA 4JOUA 3KDNA 5KG1A 2J0QD 4YHHJ 2VBWA 2B51A 5A6PA 4X4SA 2R7XA 2VJUA 3BM7A 3MPDA 5AXNA 2GS8A 2QZ8A 4ID5A 3M30A 3UDEA 3NGUA 2GO8A 2ZVSA 5SZTA 3DLEA 4O4RA 3W63A 3I6PA 1VHIA 2CWXA 4PXDA 1RT6A 4RW7B 1GMUA 1WACA 4RR5A 5U47A 3KJQB 1NPRA 3NP5A 4FYYB 4DCOB 1R6VA 1J5OB 3I4PA 3GSIA 2M7SA 2GQQA 1K1SA 1HBUA 1UZHA 3W61A 2RAQA 4IG0A 3VAMA 3V4IB 1Q7YT 1U47A 2YNIB 4Y6IA 3W62A 5HMZA 1YIJS 2ZH1A 4ETZA 1PBUA 4IFYA 5GAHI 1SC6A 4ZCIA 2LEAA 1Y4ZB 2B3TB 2M2BA 3HVWA 2BV3A 3R9LA 2ZDOA 1RA6A 3EICA 2RNEA 2XY7A 2CQ3A 1PGZA 2DXDA 3N6LA 4DR2F 1XMBA 4X66J 4J9VA 2MZQA 2Y1IA 4JI4J 1OPZA 1VBKA 4CM2A 1JLAA 2OH2A 2YY3A 2OTLS 1HQEB 4CO3A 2YNGB 1GXTA 2QFIA 3GP9A 1NPPA 1RAEB 1RWMB 4USWA 2E7WA 4ZLLA 3C6TA 1GQEA 5KFLA 3W5ZA 3TAPA 1C0UA 1H2TZ 1X9SA 3AA8A 2BJ3A 4W90B 2J0XA 1RWKB 1G3OA 3QO9B 4NYZA 3R97A 3VZIA 4EMDA 3EDQB 4DV0J 5A8RA 3PFEA 2HQCA 4QPTA 2CYYA 5D4NA 1WOSA 2NZCA 2A0FB 1Y11A 2CUYA 3LAMA 2C2DA 1N6QB 3D6MB 3OXFA 1Q81T 1VQNS 1SC1B 3N79A 4DL7A 1FRKA 2VPZB 2V2ZA 1C0UB 1PC5A 1ZA1B 2EBGA 4UQTA 5DS7A 4DDFA 1VJQA 2COLA 3A3OB 3RRKA 1KDNA 1JX4A 4C8LA 3OR2B 4MK7A 2DGTA 5GAGI 1LFWA 3LPYA 1GT8A 2PI4A 1JLAB 5GADI 4B3RJ 1FDBA 1TV6A 4MK8A 2BJEA 3D9BA 4RW8A 3HD1A 4TKTA 1NK6A 3Q24A 4ZP6A 3C6TB 2XHWA 4RWXA 2HMIA 4C2MA 1OYEA 2ILZA 4EEYA 3DKDA 3R27A 1HYSB 3AXKA 5HQ8A 1JLCA 1S1VA 4DPXA 4U8VA 3H4DA 2IA6A 3CIZA 1WOOA 2N3OA 3PW5A 4Y2CA 1UVJA 2QMXA 4AL5A 3HSZA 1IKVB 5B0CA 2YWWA 2P9GA 3CJ4A 3PJXA 4FS2A 2P8IA 3BGFA 5A8WA 2BANB 3T6BA 2BJ9A 3QAUA 2D41A 3R5AA 4KGKA 2MQOA 4KFBA 3OVAA 5HLFA 2UUAJ 2PIIA 5A2QY 3D1HA 4CI0B 1HIYA 3DMJA 4J91A 4CLYA 1S5ZA 5DZ6A 4NLOA 2UUBF 1RT1B 1TUWA 3D68A 5LOQA 4TU7A 2UXBJ 2V67A 3DRSB 1TL5A 3RRHA 5DZ7A 2UU9J 2L9DA 3FBEA 1SJQA 3JQJA 3BGLA 4RBUA 2FHKA 1HNZF 2ZNZA 3TJAA 3EMTA 3KUHA 5LM7E 4UOGA 4DSLA 1HNWF 4KFBB 2LEPA 1UW4A 3N6NA 1SQGA 1TR0A 1U26A 3PYEA 2QL9B 4RWWA 4ES3A 4A8SA 3P4UB 1AZSA 1PJ5A 3TZWA 3HVTA 4BBYA 2GJIA 3D0HE 3KJNB 5DLFA 4WK1A 5I42B 1MU2A 4NOHA 4NLRA 4MKAA 2Q1LA 5HP1B 1WELA 1RT4B 2KXHA 3BGUA 1T7PA 3TO8A 3KLHB 1EZZB 5DJBA 4LF8F 4ZIVA 4KPCA 2JOQA 4GC6A 1RAJA 1XERA 5L38A 4PUOA 5F8JA 2JEIA 2DGWA 2YKPA 5CYMA 1X0FA 2E5LJ 4QIVA 1YSJA 5E3QA 3UDVA 4DEZA 5LJ5Y 4P10A 1ZOTA 1NB7A 2K3IA 5E3PA 3MEDB 1CJTB 2FJDB 1GTHA 3BPSP 2YKNA 1TZ0A 1I51B 2GHVC 4GMKA 4I0WA 4OX6A 3VAJA 4CTAA 4DR3F 4ECXA 6AT1B 1SVDA 3I87A 3W7BA 1S1TA 2B43A 3RAQA 1M5SA 2HG4A 1RT3A 1N6QA 4ITSA 1H98A 3GG0A 4ES2A 1HQEA 1M5OC 2R8JA 2NS1B 2ROEA 3E01B 3T1YF 2Y8YA 1FVSA 2OD4A 2C2MB 2GCFA 4CT8A 2CQGA 1CBKA 2EKYA 1F5CA 3KLIB 3NBPA 4F0HA 1MNEA 3KJFB 2MZJA 1LXJA 2R9LA 4B9NA 2VF3A 2KXFA 2OKQA 4F26A 4MIAA 1RT5B 3IG1A 3NS5A 5A8KB 4XPCA 4G1QB 1Y10A 2CVEA 2O3DA 3MOJB 1SPBP 1IKXA 4OI1A 5KFNA 1NJYA 4A8FA 2FC8A 2P6TA 4PKDB 2M88A 4NYPA 4ES1A 4X64F 5M2PA 3O5TB 3TRGA 3OV7A 4MKYA 1JLQB 2I5JB 2WZ1A 5EHHA 1VCTA 5DDRC 4HACB 3FBFA 2RRNA 5IQQA 1U0HA 1XTZA 4HKQA 1KKHA 1VMBA 1JJ4A 3MTJA 3DGVA 4LF7F 4IYQA 4MIBA 3VGTA 2RIJA 3HPOA 2VQEF 3TAQA 1S9EB 2R42A 4DFMA 3HFZB 3H8YA 1R3NA 3I5CA 1Y5IB 3MM5A 4XDDA 3UO0A 5ETQA 2IVYA 2FJWA 2HBQB 4FPIA 1RWWB 3Q8SB 3UVJA 3DLBA 2BX6A 1TUVA 3ENWA 3MWBA 4LSLB 4NLUA 2CNKB 4M94A 4PRFA 4V19J 1KQKA 1DTQA 4PWDA 5ITHA 1BUXA 2KI2A 1WC0A 5JMNA 2B9WA 1T02A 4B3MF 2OO4A 2BW2A 1N5SA 3NY0A 4ANCA 5ETKA 4WYLA 5KG7A 3QIDA 5HROA 3H20A 2ZH2A 4NLSA 2YKOA 5KG3A 4DCJB 3R1HA 1KQSR 4ED5A 5DDPC 2P9EA 4JV0A 1XBWA 1S59A 3DYAA 1AW0A 1P6TA 4ZPDA 2W01A 2CDRB 2DISA 2CQBA 4HH1A 1BHNA 3MMJA 5LT5A 4DF8A 1N34J 1SJ1A 1WG1A 1F9HA 3AJ2A 2HQIA 1UW9A 3NKYA 1N0VC 2MZRA 4ZVEA 4RNHA 3JTPA 5ETPA 1U4BA 2J7UA 2A2DA 2UXDF 2VODA 1RK8A 4QU6A 2HFNA 3WX8A 2FDNA 2ZC3A 2XEXA 1SQFA 2G13A 3MM6B 4H4KA 5D0EA 4Y2AA 3NNAA 3CD7A 1GMWD 5IM0A 5ETTA 2EFVA 3A8JA 4E8UA 1VQ5S 1GFWB 4ZJQA 2MQNA 1AYEA 2OEMA 1RZMA 4OYIA 2W2MP 3M2VA 4X4OA 5AXKA 2DVIA 1TVRB 2IM1A 2CIMA 2NSCA 5KG4A 1EP4B 1P27B 4RPFA 5IV4A 4LQ9A 4R5PB 2VD3A 3DM2A 1UKUA 1SJ4P 1VK3A 4RU9A 1LW0A 5HANA 2HQDA 2RUGA 3ILJA 3RUBL 2YH0A 3SQOP 2ZZMA 4UTGA 1KTQA 1X4BA 2F5GA 1VRUB 3UI3A 4ZJOA 4PR6A 3VQSA 5AE3A 1BGXT 2K8GA 1RJJA 4DFJA 2XG8A 4UW2A 4CM0A 1QUVA 3CCES 3PCOB 3QZ7A 4DN0A 3QLHA 2ZOFA 2DB1A 2AP6A 2FVQA 4DR7F 3KUEA 1VS3A 4RW9B 2IRUA 4QIWD 2EEYA 2DGXA 1Q5YA 3IM8A 1KN6A 1C4AA 4X84A 3TVYA 1ICEB 2V2KA 2QA1A 1RYRA 1X5OA 2G2YA 1PYSB 3DHXA 4R8UA 2CG8A 3QBCA 2ZVIA 3HFKA 1RWOB 1QAIA 3PKYA 2MZTA 1LWCB 3OJUA 4DV4J 1VFJA 4J37A 3G4SS 5HBMB 1VBZA 3DGPA 1U1OA 5G0RB 3Q83A 3KNAA 1HYSA 3L9ZA 1NJIT 4NZ6A 2WB4A 4TXSA 4KTQA 2ZKUA 4GKJF 4AQYJ 1MLAA 7FD1A 3CJKB 4BC7A 3AD9C 2IJNA 3MR7A 1RBAA 1UCNA 3KKFA 5A0YB 5KT5A 3CC2S 1S1WA 2BA9A 1EX8A 3MMCB 3QWPA 2E1AA 1CS4A 5HK4A 3KHRA 2R7RA 2IM2A 2KFYA 4JP8A 4ZP9A 4JV1A 1HNVB 3HI9A 5HMYA 2OELA 3H2LA 4X65F 1T05B 3CC4S 2KHDA 2VBYA 3QYYA 3CJQA 1YJNS 1Q4RA 1YBAA 3QT7A 3MR6A 3ZNUA 3CT9A 3OFHA 1FNMA 3FSIA 3L95X 4DV2F 2YX4A 3GFHA 2IRXA 3QGGA 2DR5A 2KM8B 4ZVGA 4DR2J 4I6YA 1JLFB 3FMWA 4DL3A 1PCAA 2DPJA 4CQ1A 3QO9A 2V63A 3MUTP 2FUG9 4OI3A 3FBBA 4CT9A 2D3UA 4I1TA 4WF9Q 1AZSB 2ZBCA 4C8MA 2UUCF 2VFSA 5L9XA 2A10A 2RMLA 1WI6A 2XMVA 5E3CA 1FRJA 1KVIA 3J80U 5K8MA 1HI1A 2QT7A 2QC3A 3WIUA 1JLGA 3FZBA 4ED1A 4LF1A 4MKVA 4L3NA 4CLFA 5D3GB 2J0SD 1IBKJ 4BC9A 4C8YA 4U8YA 1IQZA 4DR6J 1UPPA 1URNA 2IMOA 2QV6A 2EC2A 5JJBA 3BSNA 1ZM9A 1FFGB 1DARA 4LT6A 4UUXA 3I82A 4I6AA 3TEHB 2RS2A 3KDOA 1BQXA 2IM3A 4O4GB 3P5TL 2W4PA 3R3TA 2BANA 2R4FA 2ROGA 2GQCA 1RTJB 1R8AA 3MM8B 3OT9A 1KC8T 4LR8A 1RTHA 3UD5A 2E9ZA 2CVIA 2OSQA 2Z2YB 5DO2A 2UUTA 2EI5A 2D7SA 2ZEJA 3DLKB 4OZ0A 4DX8H 3C15B 2VG7A 4Q44A 3DC2A 3IWXA 2X3DA 1VR6A 4QYZJ 4K4YA 2HMIB 2RT3A 2HGLA 4OJ1A 2OIHA 2CJYB 2HNYA 1B70B 2WVEA 3N5BA 3KLGB 4NXMJ 4KH1B 4P2MA 3UDCA 2PMWA 4DSJA 9ATCB 5DRKA 4H4KC 1S6UA 1RT5A 5DQHA 2HWHA 1DY3A 5DM6Q 1UVIA 4TY9A 1RTIB 1XQIA 4CLTA 2XMUA 3OUYA 4RW8B 2AJQA 4UZBA 5J1NA 2CNOB 2CXEA 2YNFB 1CJTA 3LALA 4F4YA 3U1NA 5KFFA 2HBZB 4K8RA 3GIIA 1N54B 3HHLD 5IS2A 3W2VB 1KSPA 5IQ6A 5A8RB 3RB4A 3FEXB 2XY6A 1XNRF 1B64A 1ZPVA 2HNDB 4MKBA 1JLEB 1O5JA 1RAHB 3SSQA 2HW3A 3MHYA 3OFGA 2V8PA 1CC7A 2CJQA 2G2ZA 2JC1A 2LQ9A 3ICLA 4NI2B 3ETMA 3G6VA 4LF7J 3BEGB 2NUUG 3FNNA 3N5FA 1QLNA 1CJKB 3POTA 4BDPA 2CQPA 4JI3F 1MSWD 2ACYA 1MU2B 1RADB 4XPEA 1T3OA 4WJBA 3AQPA 4H4OA 1FJCA 2M8HA 4JI1J 5DETA 4QW8A 3SQGA 4NCGB 5IWAJ 2RKIA 1YG0A 5D0RA 3M6UA 2A3JA 4Z7YA 4DS4A 4QWBA 3EZUA 4F50A 3H5YA 4LF8J 3B8HA 5KFPA 1T9YA 1OPIA 1U7LA 2ZBRA 3BN4A 4HI1A 1FWKA 4DCPB 2NCKL 4ID8A 4RBTA 2ZH5A 4DV7F 2V4QA 4OZJA 2DCLA 5KOWA 1B0PA 4DS5A 4WPAA 2YNIA 1N33J 3QQCD 5JUMA 2B6AB 2ZH8A 1ROFA 1V6HA 4OIXA 1WTFA 5ADZA 2R2UA 2FVRA 1UJ5A 3EM1A 3HZEA 2UV8G 3M7VA 4IDKA 3W9HA 4Q2MA 1HWUA 1TMMA 4N7TA 1KQGB 1S1XB 4YHHF 3NCRA 1TKZB 1FE0A 4F4ZA 4K4UA 1TFYA 1TL4A 4EU0A 3OTOF 3C16A 3IP0A 5DDOC 2DPIA 2UUCJ 4ZPCA 1RCOB 1TKTA 1GXUA 1T9VA 3MPVA 5IOLA 4CO2A 2HZCA 2WK4A 1I3OB 2WONB 3M2UA 4NRTA 2MJUA 2QLWA 4B02A 3HP6A 1NEEA 4I2PB 5BR8F 3M9NB 4WXWA 1JLCB 1S1VB 3TX8A 1N8RT 3ZZRA 1YI2S 4RNFA 2DRBA 3QRQA 3T5KA 2W4CA 3UN3A 3Q2TC 1RHQB 2CPEA 4JV5J 1RI7A 4A48A 3SDEB 4J9LA 5F41A 3RB3A 2HLTA 5D78A 3MD3A 4CZCA 4MFBB 1S99A 1X5SA 4ZMMA 2BM0A 2Q43A 1NSKL 5J2MA 3R2DJ 3H98A 2ASLA 2XLKA 1XMOJ 2BZ2A 2HFUA 5AXMA 1T03A 1VRTA 3QSYB 3EGWB 4IRDA 3PYDA 2HNDA 1TK8A 1W7WA 2OPPA 3PXGa 1HHTP 5LXRA 1UWAA 4X66F 5CZXA 3MR3A 3D6TB 2QJ3A 3BYRA 2UVRA 2J9CA 1ACMB 2C22A 3TZYA 1YBTA 4M5GA 2X1AA 3TUZC 1Q86T 4DOZA 2VA2A 3OTEA 2AJ1A 1HLWA 3K5PA 3CCTA 1FE4A 3QFWA 3H25A 3VAKA 2HHHJ 2QLXA 1FDDA 4DX7A 2EC0A 3IWNC 2O1PA 4XDCA 4QCLA 2RVJA 5LXYA 3AXMA 1X4CA 2YNGA 4I64A 4C98A 2P5VA 3WDOA 1N34F 1LWCA 2J9DA 3QGHA 3QGIA 4C97A 3DRXA 4ZHRA 3CVKA 2XHCA 4OZ3A 3OL8A 1WD6A 2OEKA 3LP1A 1KP6A 5KOXA 3PX6A 1RLCL 5KFEA 4RW6A 2K7KA 4XTTA 1SC3B 2K1RA 2PGCA 4MYUA 2MXYA 3GV8B 5F3ZA 5D6GA 1Q5VA 2OI2A 2IRYA 1VQ8S 3DDIA 3M32A 5HQMA 3Q2SC 2MZ1A 1KLNA 1DLOA 5EUHA 1N88A 4HH0A 4HR2A 5AXLA 2R7OA 3F44A 3G6YA 1M5PC 5B7WA 1Q78A 1YJRA 2MJNA 3D66A 3D67A 3O1LA 2R7WA 1W26A 2LMIA 1U1KA 1HBOA 3W2WB 4DI6A 4A47A 1EP4A 1A0OB 2ZOMA 4FVMA 2RD5C 2B9XA 2VV5A 3HHNB 2HWTA 2ZNYA 1U45A 3CGIA 3FFIB 4ECRA 2BKOA 4Y65A 2PD1A 2I1RA 3GR1A 3HJFA 1EETA 1UFKA 2RU3A 4C7QA 1RAOA 4DV7J 2HPUA 3P3DA 1YRXA 2KDOA 4MJKA 4ZIWA 2AEMA 5T14A 1NM2A 4OI6A 5L8RC 3L7UA 3ZTSA 2K7JA 1R89A 3NAIA 2G1HA 2XTJP 3J7YI 2FVPA 1NLKL 4KHPF 1UEUA 3G6XA 2KJWA 4N47A 4NLXA 2D3O1 2XI3A 2WSCC 2VG5B 1CULB 2NXJA 1VQ9S 3S7RA 1Y9OA 3BPDA 2D3ZA 4ICLB 3PG9A 4EI2A 4UQGA 1X5TA 3LANA 1UA1A 1QAXA 1NKCA 4IOAQ 1E6VB 4DV4F 3RBDA 1J27A 1HNVA 1WWHA 3M1VA 3O8WA 4NA1A 4WFNQ 4M5IA 4ZOSA 2M3DA 5K9FA 1LK7A 2JC0A 2M70A 5C2GA 2XM3A 3UCGA 4IH5A 1FKPB 1VQ4S 2R8GA 4C4WA 4I67A 1OIAA 2CJBA 4H4MB 4P72A 4RUBA 1ZBTA 4DBQA 2DH9A 4U9RA 1FXLA 2EWHA 2JDJA 3S6EA 3CJRA 1S1UA 1NSQA 2KL8A 4JB8B 4ZVSB 3RU0A 1KOHA 1S6PA 4M1KA 2GMJA 3D4JA 5BYQA 3MPYA 5KT7A 2CPDA 2HYIB 5KFUA 4F36A 4A4JA 1F5BA 2F9JA 4O44A 2FVSA 3M2RB 4FBTA 1UEKA 1MROB 1EQMA 3TQ1A 3KJVB 4IFYB 2J5AA 4OX8A 3H2VE 2BJDA 3VALA 4FYDA 1O0PA 4Q0BB 1GX6A 2V94A 3EVWA 1AA1B 3ZZOA 4O4GA 5IZHA 2Y3YA 3BR9A 3D2WA 2ATCB 1FFSB 1L3TA 1QVGR 1DQ9A 2IBKA 1S6PB 1RISA 1WUUA 3FRYA 3IG1B 1T95A 3HHLC 2VBZA 3GIRA 3K17A 2OFHX 2OPQA 1NDLA 3K0JA 3G2XA 1T9WA 4ZCMA 4J9MA 5HQLA 4FPRA 4OZNA 4KV8B 1XNQF 3NOGA 1X5PA 2P2CB 3FZ2A 4DPWA 4WE1A 3H90A 4IFVB 1RAFB 3KK2A 3BO2A 1VBXA 2Y8WA 4PG5A 1SH0A 3Q86A 5AE2A 1Z2LA 1FA0A 1UEVA 3NBPB 2QMUB 2G0CA 2ZOGA 1ZM4A 4P7TA 1F9EB 2IJRA 3R7SB 4CRJA 4FS1A 5C2CA 1FEHA 2D69A 4CYUA 5F9NA 2V9KA 3EJMA 3J7Z5 2KM8C 1UFLA 5FDLA 1YJWS 1U48A 4PG8A 2MKHA 3V81B 2ROPA 5ETNA 1QAJA 4LF4F 2IAJB 2DH7A 3HZGA 3FCWA 3RYLA 2WVCA 1WG5A 2H4YB 2Q6BA 2XMMA 3CEDA 4I7FB 4EK2A 3TZZA 3CSKA 4K4WA 2YWEA 3PVXA 2W2OP 3PW4A 2F4FA 1UTAA 2C2ZB 2BEFA 3Q22A 2ZJPQ 4KB7A 3ULHA 4B9VA 3TVKA 4LF6J 2UVVA 2N3LA 3HKZD 4NE9C 3IC1A 2FY1A 3MAQA 4Q45A 4MMOA 3R2CJ 2HHWA 4DJBA 2LA4A 1NCLA 2N7YA 4ZVRB 2YKMA 2R8KA 2ZHBA 3UN2A 2AZ1A 4P71A 3R5BA 1D8YA 2B9YA 1H7XA 2DO0A 2WOMA 3IA0A 4GVBB 3DGPB 5EN1A 5IT9U 2HFSA 2YKQA 1P8GA 5KFXA 3GFYA 1SL1A 3M8QB 5IT4A 1WC3A 4DUZF 5GADU 1BLUA 2KG1A 4G1IA 2V8VA 2HBRB 3JQMA 2QA4S 1IUJA 2AT1B 1WDTA 4EBDA 2JLGA 4Z7CA 4LR9A 2EFNA 4B9LA 4RW9A 4XK8C 3FSYA 3CJ5A 1PYOB 5KFTA 2W4DA 3HSGA 4C3KA 3PO5A 4Q0BA 3DRSA 1MN9A 2NXNA 2ZHOA 4YEAA 3GV7B 3QWUA 4F8RA 1DLOB 5IC6B 2HQGA 1HR0J 2B8QA 2R7VA 2RQCA 4ZS6A 4USMA 1YJVA 2BYCA 5F8IA 4JI3J 2D1CA 4DLGA 2GA7A 2KYXA 2LDIA 2V8HA 1YJ9S 1NU4A 5I4MA 4FF2A 5E2QA 4LF6F 2H48B 4MIWA 5E3AA 2PEBA 1VQ7S 2X51A 5CYQA 2F4VJ 3CJ3A 4QQBA 3DOMA 2HHUA 4YOEA 3C2PA 2B4OA 2CQDA 3GFZA 2ZBQA 3A4TA 1SIWB 4KT0C 2FJBB 2POKA 4K59A 3HHDA 2FTRA 2YTCA 2XS5A 1OSDA 1UVMA 3CCUS 4UT4A 2DH8A 2DD8S 3R5CA 4B3SF 4ZJLA 3JYTB 1A7GE 1U2CA 2JH3A 4NLWA 2NPFA 2AX0A 2BE7D 5D4OA 1RUSA 1F2GA 2QMWA 2W1BA 4YR0A 2IBOA 4M5MA 1OO0B 3SCIE 1LNQA 2VFRA 3TVZA 1C0TA 4JI7J 3BH7B 3DNCA 1FERA 3QJJA 3ILOA 2FGCA 5CCMA 5HVGA 2IFXA 3MZIA 3CO9A 4RNNA 4L75A 4Y00A 3W2VA 1ZAWA 4ALZA 3OFEA 4ENOA 3FC9A 5A8KA 6FD1A 1JNZB 2HBYB 4DL5A 1XNQJ 3GB0A 2WAQD 2F7VA 1HA1A 5HI7A 1Y5NB 2MHEA 3KHLA 2ASJA 4MTPA 4WKRA 1SQEA 3HK2A 4XAKA 3P96A 3DLGA 1TUGB 3MMBA 5D4PA 2AGOA 3FFIA 5FD1A 3QJLA 2YX7A 1TAUA 2HHXA 1SCJB 2XMKA 5B0BA 1DRZA 5I3UB 1PBAA 2GIQA 1QAYA 2WSEC 3CMAS 4H54A 3T5LA 2DHSA 1A9NB 1I5OB 4FN5A 2J7WA 1TP7A 2KFNA 4AXIA 1Y7PA 2WONA 3ZXWA 3MM7A 3H40A 1F3FA 4B3SJ 4PYAA 2KJVA 2OD6A 2CAJA 3G86A 4WTOB 3DMJB 3IRXA 3RBEA 1XC9A 1MWZA 1VJWA 2C3PA 1IBLJ 2D9OA 1Q95G 1K8AT 3KFWX 1KLMB 3THTA 3E3XA 1YZ6A 2GV1A 1UAWA 1JLQA 2FYXA 3G82A 3DU5A 3LUYA 3UNYA 4P74A 4ETXA 3LO3A 2XCPA 2BQ3A 4K2XA 3CMES 2DJWA 3VAGA 2DYAA 1XR5A 3FRZA 1U1QA 2A2CA 1DFDA 2DNQA 3DHWC 2XO6A 4OYXA 2CQ4A 3QT8A 4LSZB 2RF2B 2HS0A 3I5BA 2N4DA 1BMQB 4H4OB 3VQTA 2XMJA 2XCAA 1Y3KA 3JSMB 2W9BA 2ATLA 3KOAA 4DR5F 1HMVA 4UOCA 1F9FA 1WC6A 4PPZA 1JMTA 1XWLA 3M30B 1VQ6S 1U1LA 4DV1F 2CPHA 3GQCA 2ZM6F 4KBIA 1E6YA 2LCWA 5HVFA 1RHMB 5K14B 2PDAA 3JQKA 3RG6A 3Q8QB 4B9TA 2AKWB 4G6VB 5CXTA 4EYHB 3ILLA 4Y2IA 1SKUB 1TV6B 4OHWA 4BWMA 4IH6A 4DG1B 3SFGA 3CD0A 3LGHA 2VFTA 1V5IB 4QZVB 2AYEA 1S0OA 4LVOP 3I96A 3PNIA 1XMQF 1R31A 2RRBA 4LJMA 4PXEA 4EO8A 1MG7A 1QD1A 3M8PA 1HW9A 3A1YG 2QLJB 4KGVB 1H73A 1TL3A 2B7CB 1X4DA 1QE1B 2EG2A 3EGVA 3IAM9 3BQ2A 4YR3A 2V8DA 1G4CA 3NG8A 4FZVA 1QY7A 1RWPB 4PAAA 3KLFB 3V81A 3WHIA 4ILMA 3NL0A 4OZ2A 4KJIA 1ZA2B 3DN9A 4K5RA 5F0UA 2UVUA 2W8KA 4YB6A 3KG0A 4URQU 3BBFA 4U7UD 4AXJA 1AXQA 4KGXB 1RTIA 3TZXA 4X65J 2BMBA 4N56A 4BLGA 4CO5A 3RZAA 1NHVA 3C16B 3OR1A 4CDIA 2XGPA 1NMEB 2W8LA 4RBVA 3PIOQ 4F4AA 1S79A 4KGMA 3QRPA 3WQPA 3A8KA 3VF0B 2ZM6J 2DHXA 1WF0A 1TK0A 2OPQB 4AFFA 1B0TA 2F65A 3TQEA 3K8WA 1Q8BA 2ZUAA 4WP9A 1EQ0A 2H3EB 4CIOA 3VAHA 4M8LA 1RB0A 1WKKA 4NCAA 2WVFA 2ADBA 1P1LA 2VU5A 1XIQA 2BOAA 4YY3F 5KFBA 5F8NA 3GCWP 2L9WA 5SUHA 2JHEA 1IXKA 2LA6A 4I4BA 2E9TA 4BWJA 1TKDA 2E1PA 1JLGB 4OHZA 4WBFA 2C3OA 4U96A 2DR8A 3VAFA 1FRIA 4JI1F 2VQFJ 1QM9A 4LBPA 2FQQB 5A6WA 2WOMB 4KAIA 4OJ3A 1EKRA 2HHVA 2RKIB 2XMTA 4CH7A 1B7FA 4P7VA 4WFZA 1PJ7A 4YB1P 4M5NA 3EE3A 1RP5A 3J7YU 4P2SA 1IR0A 4FBUA
chains in the Genus database with same CATH topology
2MGZB 2GHWA 4I2QB 3BO4A 3OR2A 3V4MA 2P9CA 2VPYB 2ZE2A 1GTEA 1IBMF 1HPZA 1OSCA 1P1TA 4KO0A 2CDQA 3MM6A 3J80Y 3KYLA 4DV5F 2IAJA 1U8SA 3ZZPA 5EDWA 3SV3A 1VQYA 1K9MT 2UVWA 3OVSA 4USHA 6FDRA 3RAXA 1RGVA 1FVQA 3ISND 2RSQA 4IR1A 1FRXA 2HNZA 1WF2A 2BR0A 3T6JA 3G9CA 4ED6A 4I69A 2OPRA 4PG6A 4Z2XA 1FO1A 4K4TA 5KG5A 4M63A 1F5AA 5EWFA 3GIMA 4ECSA 2OPSB 1UMJA 5E0OA 2Q3PA 5DQGA 2JZ5A 2KO1A 1LW2A 1REVB 4AUKA 2ZH4A 4RNMA 3KG4A 4GO5X 4MH8A 4Y2KA 3BREA 4ZP7A 5T7LA 5LJ3Y 2MYFA 2OLWA 1KS2A 4ECVA 1FXDA 2V0NA 1VGYA 3U7JA 4A8OA 4TNOA 1RT2B 3QLHB 5FJ4A 1RTJA 2IVFB 4NLVA 3K5MA 1KLMA 1U25A 1LFPA 5HL7Q 1I94F 3JB9k 2XGQA 2ZC4A 4ZPWR 1KOOA 2VOPA 2DITA 1N36F 1KD1T 3X1LB 4O23A 3AH6A 4G3IA 1SIZA 4RUHA 2J6UA 3GFXA 4KQZA 1FD2A 3EYZA 3BB5A 2CRLA 4ECYA 3IO1A 1HL6A 3MUMP 2PI5A 2DNOA 2FLPA 3T19A 1FHTA 3IS9B 1YJTA 5KFHA 1Z2ZA 2AWZA 2NXUA 3OL7A 3SYZA 2ZH3A 5C24A 2W9CB 4DFPA 2C28A 2G4BA 3FQKA 4ZP8A 3JAMY 2OMLA 1E6VA 3UW1A 4R5PA 2E5JA 5KFAA 4J9OA 1LWEB 1PILA 2EFGA 3BS9A 4ZDNA 2DCUB 3ETOA 3T5HA 1S6QB 1X7VA 5GAEU 3KK3A 4DV3F 1FKOA 3D1QA 4ICLA 3CDWA 4ZLPA 4B3RF 2C3YA 4FF1A 4GKKF 1C0TB 2KZMA 3DFEA 3MMAA 5F8GA 2DNNA 4C0OC 1LWFA 1IKYB 1SUQA 3TNVA 2F4VF 4QYRA 5HROB 2QIFA 4I56A 5CD4H 1VI7A 3HM9A 1N4LA 2W9CA 4CO1A 4U7CA 1VQLS 3KK2B 3OTDA 3TR5A 4USIA 1S9FA 2KT2A 1FRHA 3ZZUA 3NMRA 1HHSA 3HVTB 2ZH6A 2GMHA 4NLPA 1IKWA 1D0EA 3MM5B 2MKIA 2L48A 1NZAA 4QIEA 3RB0A 1S7HA 4QU6A 4CNZA 5H9EJ 2FHOB 2JL9A 4IOCQ 2ZKTA 2ZHAA 4HT5A 2GIRA 3DDKA 1DAXA 1Q7LB 2LXFA 4IG3B 4LSNA 1URRA 2CPIA 1VQMS 1RDRA 5H1SV 1UL3A 2OSRA 1CQMA 4LIWA 4A46A 3OR1B 5KFGA 3BGRB 3VWSA 1SJ3P 1QJHA 3CC7S 4UUWA 3D0IE 4LF5F 1S77D 1Q8LA 4K4XA 4EBCA 1KRPA 4DR4F 2LXIA 2KXNB 2XO7A 4ILLA 4DQRA 1UVNA 4YUDA 2E5LF 4V19X 2E5GA 5I3QA 3DOLB 2JRSA 4DFKA 1JLBA 2FHMA 2WHOA 2DHAA 3MEDA 1R8CA 1IBLF 2AGQA 3NNHA 2XB2D 2KHCA 5LMUF 4JI2F 5THWA 3M2VB 3KLFA 4IR9A 2E1RA 2VG6B 3OTCA 4WU2A 5J1PA 2DNMA 4U7UK 3IR6B 5B09A 3HF5A 2WW8A 3RB6A 1X0PA 5G4DA 2XNQA 2HVIA 3VTIA 1HWLA 2M5YA 2CQHA 2KKHA 3QJPA 2LXUA 1ZAXA 3OHBA 3CD6S 5FDLB 1S72S 3V5RA 5I42A 1CG2A 4AYBD 3OUYB 4X4RA 4BCAA 5F8LA 2I9SA 3ZC4A 2Z0GA 3EGZA 3P6YC 2J9DE 1Q79A 1TKZA 4YQWA 2JEJA 2KB2A 3KLEA 2XI2A 2DGUA 3NS6A 3I9V9 4ZVFA 2ZH9A 1TKTB 4UY8T 2VG7B 5B0AA 1LOUA 1DTQB 4I68A 1MW7A 4J9NA 4PWDB 4NWBA 4F4KA 4NXNF 4B3OB 1TKXB 2LYVA 5K8NA 2CPZA 4K4ZA 1Y00A 2L9NA 2HFZA 3US5A 2FHJA 1ZYQA 3CB4A 1ULRA 1JB0C 3GG1A 3X3UA 3NMAA 3DDNA 2B0GA 4F4XA 3CDAA 2HFOA 3CPWR 2O67A 4HYKA 3N0VA 2KYZA 2J6SA 5EGYA 1S1UB 3IGNA 2EFQA 3VZHA 2APOA 2YX1A 2FD2A 4Q5VA 1T7PA 2J8AA 4ZCLA 4OFZA 3T1AA 1AFJA 1LQ9A 4PPDA 2V4JA 5T41A 5KFSA 3KLVA 3H5UA 2FC9A 1WHWA 5KFVA 1ZTWA 3HLUA 2OPRB 4Q43A 1JWWA 1FJEB 4FF4A 3DLGB 5DLGA 4J9QA 2AF6A 1RKJA 1WG4A 3NCPA 3K5LA 3L3CA 1YWXA 4CO0A 1NKBA 1G6BA 2FLNA 1DJ0A 2DO4A 2X1BA 4KKOB 4KO0B 3V6DA 3O2IA 3CF5Q 5L1IA 3F41A 3B78A 3EZ5A 1KFDA 4WXOA 2D9PA 2FIUA 3M4XA 4ZVHA 3M8SA 3Q8RB 2V4RA 5JVGQ 3PW7A 1NK7A 2HAIA 2KH9A 2E5IA 2V4JB 4PUOB 1DURA 2YNFA 3LW5C 3CIMA 2DNYA 2Z2LA 5IT0A 3CWJA 3I0SA 3MGJA 4G1PA 3JSMA 3ONQA 4UY85 3M2UB 2MKSA 1R6YA 3MOZA 5HBMA 5MLCV 1SH2A 2HVHA 1MMNA 4ECUA 2E44A 2JSXA 2RJZA 3EX7B 2YKAA 1JJHA 5CYQB 2DGSA 1TK5A 3HHLB 3TYTA 4J9RA 3PX4A 5LSLA 3PHEA 4KR0B 1VLYA 3W3SA 2NR0A 2PN6A 3VR1A 1TKXA 3UWTA 2UXCF 1HBUB 2AU0A 2HWIA 5CZVA 3UE2A 4DN9A 5MAOA 1HBMA 4EO6A 3V6JA 3JTOA 5IT9Y 3LP2B 3UR3C 1X9MA 3K5OA 3FVYA 4IG3A 4LSNB 4LQ3A 1N32F 1IJFB 1FRLA 2EK6A 1NK4A 1ELOA 2NREA 5KT2A 3QAEA 3LP0A 3MECA 4EBEA 2IC3B 3THVA 1AUDA 1JXLA 3MF5A 2QRRA 1X4FA 1DBDA 4PG4A 4R25A 1LW0B 4ERDA 2LDYA 5KFYA 3DXSX 4U67Q 4EWTA 4DWIA 1N48A 3U02A 2LECA 5KT3A 4O3SA 1FJ7A 4O0IA 2OAUA 3FDSA 3ENQA 5GVQA 1LXNA 4NMLA 4X4UA 1O8BA 2LQ5A 1ZPWX 3MMBB 3SSSA 4CCHA 1AFIA 4X4VA 1QE1A 3M9MB 1SXLA 3G6ES 5B0GA 4URGA 3MFHA 4W92B 3PEHA 2R8HA 3ISNC 4IRKA 1HD0A 2IHR1 1VQOS 1BQNA 5LL6d 1UJ4A 4MAKA 1UWBB 1HBNA 4AQYF 5I3PA 1Q53A 2G9OA 3CE8A 1VQPS 4TQSA 3DI6B 4FP9A 4FVCA 1FKOB 4ZK7M 4I6WA 1JLBB 4C8OA 2UZAA 2LU1A 2EW9A 1KNZA 5D77A 4DQIA 2UUWA 3AB4B 1R43A 3OFFA 2D74B 5L1JA 2AYMA 2W9BB 2R8IA 4X4TA 3OL6A 1X9WA 3FQLA 4JI7F 5G0RA 2ALZA 2VASA 3MEEB 1HWKA 3IS9A 4A8XA 4LFCF 2GFFA 1V9OA 3N4WA 1R8BA 4QIFA 1D9DA 1XR6A 1H0HB 5LSRA 3MEGA 1OWXA 2R2SA 2KZZA 2A1BA 2NLWA 2LVWA 3LWLA 4B3OA 4KC5A 2JX2A 2BVZA 1GAOA 2IM0A 3IRXB 5IWAF 3TUIC 3H2UB 3U1LA 5J2QB 2FJAB 3Q23A 2ZZNA 3MFIA 4IUFA 1J5OA 4K0KF 1HI8A 3IWLA 4OJGA 4C0BA 4B9MA 3G8QA 5EWEA 4ELVA 1JIHA 1U2RA 2CPJA 3I0RB 3ZFVA 1QSSA 4HHJA 4C11B 3G8SA 1T8EA 4C3MA 2YWGA 1N56A 2PT0A 3I4HX 2ZD1A 3M1VB 1CQNA 4QWAA 4AE5A 1FTRA 3R1LA 1JXEA 4TY8A 2XZWA 3EXYA 2DTJA 4A8KA 1JKHB 4NXMF 5KFCA 4F3OA 4BHQA 4C9DA 1CPZA 1D9AA 2AV5A 2CPYA 3EPGA 5B08A 4OI2A 4RKUC 1BQNB 2XWXA 3DYAB 3DOKA 3L7OA 2IA0A 1S1WB 2G1DA 1VIXA 3MM9A 2VFUA 3LQVA 5BYRA 1R0AA 4K5SA 3RW6A 2F9DA 4ZCKA 1CC8A 3J81Y 3T9NA 4X62F 2BXJA 5DDQC 3FCHA 3LAKA 3HDSA 2XS7A 1FF2A 2MDAA 2HIQA 5A0YA 4LSLA 2UUAF 4F2RA 2HRYA 1S97A 4RZRA 5FLXY 1NAQA 4E0DA 2KU7A 4OHXA 2W7PA 2CPFA 2OP5A 2I8EA 2HGNA 2GJ2A 4WE1B 1SKSA 1JJ2R 2E66A 2W7AA 2AJ4A 2ZH7A 4R8UB 3MEGB 4HDHA 4DSFA 2K2PA 3JSRA 1U09A 3OSNA 4ZKAA 2GO9A 1MWYA 3AHPA 2K3KA 3J7ZT 3IRWP 3QMQA 1VC0A 4Y3CA 3OHAA 5E3RA 4YFUA 5A8WB 3CCZA 4DPOA 2AYGA 1YRTA 1IKVA 3DRRA 4JI8F 3TOQA 4JUZA 3IN5A 2RE1A 4QR1A 3SSRA 4ECWA 1L3UA 3RR7A 3NNCA 4NLYA 1UP1A 2XNRA 1H7WA 3B4DA 4QWDA 1LW2B 1YJUA 2VKZG 2VONA 3GMGA 2R7QA 1S0VA 2RDIA 3DI6A 2VFVA 4X2BA 2RQ4A 1FD8A 5FIIA 5L1KA 3RAMA 2MY7A 4M5DB 4DMZA 4OZ1A 2Q6CA 3ISZA 2QFJA 1TL3B 2EFOA 1JKHA 2VQFF 2M4MA 3TP2A 1SKWA 3DOKB 1UWBA 2XY5A 3SCJE 1D8ZA 4FNHA 5KG0A 4TQRA 1K73T 4LF9F 2HLUA 1FDAA 2MHNA 1OQ6A 3OVBA 3SFUA 4U6PA 2GMLA 3C8YA 3E51A 2PMZD 4F25A 1JNRB 2UXBF 2X3GA 4IFVA 2AGPA 3V2UC 1A6LA 2EVZA 4FXWA 2IC3A 4B17A 1LWEA 4Z37A 1O51A 2DHGA 4QR2A 4IQXA 1Q16B 4DLEA 3MI7X 1FCAA 1CLFA 1RT1A 1UVKA 3TAMA 1IQTA 2MKKA 5J2PA 3IBWA 4N8OA 3GE9A 1TL1B 2LEBA 1Y3JA 1S0NA 1VC5A 3HXMA 2KT5A 3IR7B 1FNXH 4KHRA 3H4BA 3OQ2A 4WTYA 3V4IA 1HQUB 2DNRA 2F8HA 4QIGA 2Z8QA 4ZHRB 4R0JA 2MMYA 1HBMB 2OMOA 3TW0A 1GNKA 3TA0A 4Y28C 4MYTA 2B56A 1H38A 2VZ9A 2WBRA 2KG0A 3KLIA 1U1MA 3BF4A 3I31A 3DM2B 2JWNA 3DU6A 2KTQA 2BE2B 2U2FA 1Y0HA 4G1QA 4ZPTR 1D1UA 2DK2A 5B0FA 3V6KA 1YITS 2RH3A 2OPPB 1HARA 4KKOA 2HGMA 2ILYA 4BS2A 3MM9B 2Z4PA 3PR5B 3HO1A 3BO3A 2N4CA 2Y1JA 2I38A 3IXQA 1UETA 2OJ3A 2F40A 2XBPA 2QEXS 3NLCA 2FLLA 2AYBA 1D3WA 3EGNA 1HBNB 5KFMA 4QU7A 2QO3A 3NGKA 3ZZYA 4C3LA 5AE1A 4WFYA 2MGZA 2MPUA 4MFBA 5J2MB 2FB0A 2PEHA 4I2PA 3CCMS 2VKRA 2MQMA 4Y34A 2ZJRQ 3GYXB 3FEYB 3CCSS 4AL7A 2ASDA 2F8EX 3BZQA 2KT3A 2NYIA 4ZPBA 3A8EA 3M05A 1SH3A 1N5YB 3M9OB 1HD1A 2BUNA 2CQ0A 2ZUGA 2R2TA 4HLBA 1WHVA 1FDNA 3UPFA 2KRRA 1L3VA 2ZDPA 2RF2A 4NCBA 3GIKA 1S49A 3DLKA 4RU2A 1TL1A 3TARA 5K8OA 3BQ1A 3SCLE 3TA2A 5HLFB 5DQIA 1V3RA 1KR4A 1HQUA 2DNGA 3MM8A 4NZ7A 2A18A 4Y2MA 5KFJA 2L41A 4IDKB 1QUPA 2DGVA 1T94A 2VL1A 3LP2A 2HQ3A 2IYIA 3MPWA 2YQ3A 3KWMA 3GILA 4OHYA 2LQJA 1V3ZA 4YMEA 4CH1A 1I1GA 2BBEA 4KRWA 2YWHA 4WIIA 1G2EA 3BSAA 4EZ9A 2M0GB 4QWEA 4EUVA 1RT7B 4X4QA 4DL4A 2Q79A 4NLQA 4QWCA 2MB0B 2R7SA 5D8HB 5JXSA 4YDDB 3KHHA 4NRUA 2PA8D 3LWMA 4NCGA 1P9QC 1C1CB 4PWUA 3WC2A 3CULA 2VPXB 3I0SB 3SV4A 1HFEL 3PM9A 3KK1A 3V6DB 1FESA 2CQCA 1FJGF 3POTB 1K1QA 2DGOA 4DSIA 1OQ3A 3KNGA 3DLJA 5CYMB 3H5XA 2JLFA 3SMZA 1H2UX 3EXCX 5HO4A 5E7OB 1N5QA 5GAEI 2X1FA 4XO0A 4EZ6A 4IO1A 1NNDA 1KHVA 2M9KA 5C5JA 4OL8A 1YTYA 2DT9A 2ZJQQ 2AD9A 1GH8A 5F8HA 4LFAF 3R5DA 4ECQA 1DZ5A 2E5HA 3WZ0A 1BC6A 2JEFA 2AW0A 1SL2A 4C8NA 4OZ5A 4GC7A 1XN9A 1NJWA 2MQLA 2Y1RI 3NGDA 5C25A 3OLAA 2VB6A 1RTHB 1S1XA 2NUHA 4C8KA 2J9EA 1WNEA 2I2YA 3UR0A 1NJXA 3FJ2A 5J1EA 4YR2A 3PY8A 3VCDA 1NH8A 4N8NA 4OQJA 1RA7A 3K2YA 2HHSA 1UFWA 1X4HA 1S9GB 2VBXA 2VC0A 2F8MA 1N5VA 1XEZA 3V6HA 2O66A 1RWUA 4HVZA 1CEZA 5AJ3F 2DR7A 3K8VA 4Q8EA 4KPYA 1HI0P 2ABYA 2RILA 3GSDA 4PXBA 2WSFC 4DSEA 2V8GA 1HR0F 2FJVA 4J9PA 2FGOA 1C1BA 3I55S 3OSPA 1Q82T 2JLEA 2XSJB 1FRMA 4ED8A 3UD3P 1L5UA 3NAHA 4WKYA 4ED3A 4DSKA 2NQPA 5CYJA 2HNZB 3PJWA 1VQSA 4O3PA 2YKMB 1H6KX 3BSCA 1U6ZA 2YNHA 4NLGA 2AX1A 4K4SA 2BM1A 1UA0A 1DTTA 2FJXA 5LSOA 2L3MA 3F56A 4IKAA 3OPKA 2GGPB 4M5DA 5GAGU 1S0MA 1IBKF 1IJEB 4DR6F 1FXRA 4OHVA 2MSSA 3CTRA 1KTVA 2B5JA 3AAWB 1QSLA 3OLBA 3HVRA 2KVIA 3H59A 4A8YA 5EX0A 2EPIA 4EFAC 2L08A 5B0EA 5J2NA 3CJ0A 3PZPA 5L1LA 1C2PA 1KONA 2XSJA 4JV2A 2GX8A 2VOOA 3MEKA 1VHFA 3JYTA 1SJFA 3O3LA 5HMWA 3CJKA 3SZ2A 4DL2A 2C3MA 3DRRB 3B4MA 4OZLA 1TQLA 2ZBIA 5CQGA 5CH7B 5J2QA 5KFDA 4IOBA 2JVOA 2DNHA 1FTCA 4TYBA 2HS3A 1CSJA 3CUNA 1M1KT 1UJ6A 4B08A 4FXVA 1WEZA 3HKWA 3N6MA 4N76A 3C6UA 3CCWA 1U1NA 2E1MC 3UDLA 3M32B 3PACA 2JFDA 2E7XA 3GWCA 3MR2A 3MR5A 3UQSA 1ZM2A 3FSXA 3MEEA 1VRUA 3L7PA 4NPOA