3UFCX

Characterization of a cas6-related gene from pyrococcus furiosus
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
243
structure length
243
Chain Sequence
b'GGMRIEIKLLPLQDNPVIPFNYNYELYSQIVEKAGAIEPRIVKLLESPHGYWTFSRIIIRKREIIPEKGIKILSDDISLYISSSNKEIIKGIVEGIEKSPEFKIGDVGFLVADIKALKSKEIKNVNIFSTLSPIVVRTVKFEGDKLKHWDLYPHDELFLDRLRKVMLLRYHEVMGDLPEDKDFRIELIKFKPTRLIVKDSYIRGSLMVFRYYGSKEIAKFGYENGFGEKTNLGFGMVKIIEEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal structure of a Cas6 paralogous protein from Pyrococcus furiosus
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 69
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2011-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01881 Cas_Cas6 CRISPR associated protein Cas6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ufcX01
3.30.70.1900 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ufcX02
3UFCX 3I4HX 4ILLA 3PKMA 4ILMA 4C97A 4C98A 3QJJA 3QJLA 4C9DA 4C8ZA 3ZFVA 4C8YA 4ILRA 3QJPA
chains in the Genus database with same CATH superfamily
3FC9A 5KFGA 2R2SA 1U1LA 1S0VA 2R8HA 2BOAA 2E5GA 1TL7A 5IT0A 1SJQA 2GZOA 3DC2A 3CPWR 2NSBA 1I5OB 4YR0A 4DV7F 3MCMA 2JEGA 1U24A 1FXLA 1BWVA 3TA2A 1KVKA 3LWMA 2RAQA 2WONA 4C8KA 3UNYA 3CCMS 2OPQB 3C14A 4WBFA 3ZZYA 3M6UA 2JL9A 1LWEA 1HD0A 1J5OB 4I0WA 3EYZA 1XK8A 2QYCA 2AQ4A 2OLWA 3UD5A 4TLRA 4NXMF 2FLLA 2BDPA 3AQOA 4C11A 1DQ9A 4J9UE 2ZH6A 2MY8A 2APOA 3LOUA 3MM8A 2XCPA 5J2QA 1M5KC 2EBEA 3KUGA 2FJXA 2POKA 5HLFA 2ZJPQ 1RT6B 1T0TV 3PYFA 2I0XA 3M8RA 1JLFA 1X4CA 2P2CB 3VAHA 4O3PA 5ETTA 3D6MB 3AA8A 1JJCB 4HVZA 3M4XA 3FGVA 1YKWA 5J2MB 4ECTA 2GV1A 2EBGA 2HHHJ 2VG5A 2BMBA 4MMOA 2DNYA 4CLZA 3PFOA 4DQIA 2Q1LA 2EFNA 2ZOMA 1T94A 4K4ZA 2BE2B 4LF9F 2ZBIA 5H9FJ 3C66A 4Q5VA 3FMWA 4JV5J 2CQCA 2WAQD 4KIAA 1ROFA 1GMWA 3V4MA 2LXUA 2UVWA 5B0DA 4F2SA 3NAIA 2RQ4A 1F9EB 3M2UB 3MEGA 1G4CA 3OBIA 3HVAA 4B3SF 3CCSS 3SIPB 4Y2AA 1RACB 3GV7B 2MZRA 4RUHA 2G1DA 3J7Z5 3UN5A 4CTAA 4OZJA 2WK4A 4KHRA 3M2VA 1N6QA 2QSFA 3BGFA 4P74A 3K7RA 1KR4A 1BHNA 3MPWA 1XEZA 5C7PA 3A12A 1M90T 3RGIA 1RK8A 2ZH1A 2DRDA 5KFIA 4IG3B 1FJGF 1AFIA 1N34F 4P2SA 4RU2A 1B0TA 2F40A 2UUCF 1IM4A 2GAGC 1NJZA 3KLEB 5L9NA 3G6ES 1WEZA 5HATA 2YNHB 1MN9A 1YSJA 1QSLA 3T1YJ 3MECA 1LWXA 3I87A 4Z7YA 1Y5IB 3V6DB 1I94J 5CD4A 5K14A 1S9EA 2MJNA 4KYZA 2YBVA 1WF1A 1DTQB 4U96A 1NPPA 5BXIA 4PG4A 2OFGX 1ULRA 4QIVA 3W2WB 5L9XA 1T9YA 2G4BA 5I3PA 2HKEA 2E5HA 1TL5A 3HVRA 1UW4A 3B6BA 3KLFB 1WOPA 2CXEA 3ELHA 4OZLA 5L38A 4DL7A 1WORA 5M2UA 1FFWB 2PA8D 4ZVUB 3C16B 2XMJA 1VIOA 1S0OA 4K50A 1YITS 2MKKA 2KG1A 5KFEA 5DZ7A 3FKBA 3FK4A 3MAAB 2JX2A 3RBZA 3SV3A 2R42A 2M8HA 3KG1A 2K06A 2NXNA 3PACA 3Q24A 3CUNA 4I6AA 3HSJA 4WWSA 1VQYA 1NRKA 4PABA 3IR7B 5KOWA 2RMLA 2GHVC 4DFJA 1FRJA 3HLUA 4DR2F 4BDPA 3RAXA 5DLGA 4X4SA 4GC6A 2FHJD 5LXYA 1HQUB 3RU0A 2WW4A 3M9MB 1S6PA 1YIJS 5JVGQ 5JXSA 1IKVB 1S97A 3WBZA 3LQVA 2NPIA 3MCOA 2DNNA 3HSGA 5C2GA 2J6UA 1U02A 2V63A 3HT0A 2RB7A 2V4JB 2H65B 4WFZA 3Q8SB 1EETB 4DF4A 4RBVA 4F02A 2CPEA 1VRTB 4HACA 5DG7A 1Q7YT 4H4KC 4P2XA 1S1VA 2WOMA 5HK4A 2EWHA 4E8UA 2MKHA 4JYAF 4USWA 2NUUG 2C2OB 3TR5A 3AFGA 1K0VA 1SL0A 2W2OP 4RL1A 3OFHA 5KT3A 4IQXA 1TL3B 4F25A 3NS5A 3EZ5A 5IT9U 2J0XA 4DU8A 3UD3P 3DM2A 3WX8A 2MKJA 1XMBA 4NEZA 4EYHB 3UCZP 5DDPC 3OTDA 4P7VA 3BREA 2NCKL 4P2MA 4NCBA 4LSNB 5KFUA 2BV3A 4P73A 4GC7A 1F9FA 3NGSA 4RBTA 4RX6A 3D7SB 2CQ0A 1NXIA 1WG5A 3OLBA 4AL7A 4ECVA 4MJKA 2L9DA 1UEVA 1SJ1A 4NLRA 2CQBA 5CHCB 3QAUA 1X5TA 3C6TA 1NK7A 2NREA 1WI8A 4QQBA 3FFIB 4M95A 2N3LA 4IFYB 5L1IA 3PW0A 2QN6B 4HI2A 3K8WA 1P9YA 2BA9A 2XQCA 1L3UA 2MZ1A 4WFNQ 2ZOGA 3M8ZA 4RU9A 5KT5A 2ASLA 3GPAA 5G0RB 3UPFA 5K8MA 3KHGA 4ANCA 2XZDB 3OSPA 3T1HF 3JAMU 4CQ1A 5EWFA 4O4RA 1SC1B 1WEXA 3CT9A 1E6YA 1XMQF 3BGRA 4F26A 4JI5J 4LBPA 3M8QA 2AZ1A 1FXDA 4B08A 1XERA 4G1QA 2AYGA 3MM6B 2KM8C 4CH0S 3A8EA 1DQAA 2DO4A 1T9UA 5E3QA 1IN0A 1UPMB 1DHMA 1SBRA 1Q8LA 2FPHX 4LQ3A 4TYBA 1KFDA 2B0GA 1T9WA 1JLQB 2LU2A 3ETMA 2ILZA 3JSMA 4Z2XA 1Q16B 2YX1A 1KC8T 2QLJB 1NDCA 4A8WA 4CLYA 3ITHA 2AT1B 4XAKA 1YGYA 3TW0A 2CZ9A 3GE9A 1IR0A 3NY0A 3JSYA 5AXMA 4ECWA 2CNNB 4OYXA 2ZM6J 3AH6A 3LAKA 3TQEA 4J91A 5DS7A 2V2ZA 2GJ2A 1X60A 1OSCA 4WFYA 1S1WA 4F3MA 1RT3B 2KXFA 2E7WA 2J9CA 2WW8A 4M5JA 1HBNA 1VI7A 5KFDA 2HNZB 3PTWA 2B4PA 1KLMA 3D6HB 1IR2A 2IVFB 2Z57B 2E66A 3DYAB 3IAM9 1NM2A 1RT1A 4FYXB 3UR0A 1IBKJ 2HNYB 4K4WA 3PYGA 1P8GA 4ZJLA 2IJNA 5KFMA 2NR0A 2HHPA 2YWFA 1X31C 1UA1A 4FYDA 4XTTA 4DOZA 1DLOA 1N5TA 4ED7A 1CSJA 2F9DA 3SQOP 1PSDA 2ZHOA 3S7RA 1N48A 5F0WA 3H4DA 2DXEA 1W26A 2UUAF 3DMJA 1S6QB 3SZ2A 4OFZA 4CLSA 3SI8A 5GMEA 2E5JA 3GTYX 3RG6A 1HHQA 1RT4B 1IJEB 4DU7A 3W9JA 1QJHA 1JWWA 2UUBF 2Q3PA 4UOGA 5KFPA 3D54A 1N0UA 1XJWB 3BM7A 1IQTA 1H6KX 2KXNB 1M1KT 4LFBJ 2GQQA 3CIZA 1EQ0A 4PQUA 3KLHA 2FHJA 3BB5A 4RWXA 4LF4J 2WTFA 4CP5A 4ZPTR 2HVEA 4USTA 3QJLA 4X4OA 1UETA 4YS2A 1U0HB 4ED8A 4A8YA 4B3TJ 3BBBA 4URQU 1YJUA 4Y2IA 2CNLB 4DPWA 4LRBA 2KFZA 2VV5A 2EKNA 1KBRA 1D3WA 2OJ3A 1RTJB 3BYRA 4GVLA 4DL3A 2MZJA 2HAFA 3FSXA 3MHYA 1MU2A 4IQMA 3MOJB 1SQFA 1Z4UA 1BQMA 5IV4A 1PBAA 1UAWA 1RI7A 2C2NA 4F04B 2MY7A 3TAMB 2V2KA 3HHLC 4DV4F 4RW6B 2MQPA 2J8SA 2K2PA 2ZHAA 5FLXY 4I6WA 3W66A 4JI7F 1S1XB 4P52A 4OV1A 4DV7J 3IBWA 4MYUA 3IGVA 4B17A 3AOBA 3WDOA 3P3DA 2ATCB 3DOLB 3BQ1A 1FE0A 2HG4A 3UDEA 2EW9A 2XS2A 3CCES 4GKKJ 4IG0A 4DQSA 1CULA 2FUG9 4WPAA 2J5AA 3KJNB 2D3O1 4CM0A 2W01A 2EFQA 4ZVTB 4ILRA 4ZCMA 1P1LA 3WQPA 1RWOB 3HSZA 2GCFA 4CO2A 3G6XA 2FZCB 2ASDA 3T1AA 2XYGB 2DR7A 2GHPA 3BDEA 2O5DA 2PO4A 2VASA 1SQGA 5KG7A 5ADZA 4DR3F 2J0SD 2CWKA 1FJ7A 2CJXB 4DR7F 3CJ3A 4RW9A 4F4AA 5HBMB 1ICEB 1X5OA 1XMOJ 1XBWA 3M8WA 3A13A 2GIRA 5KFLA 4OYPA 3ULHA 1LWCA 3CMES 2ZWOA 2Y8WA 3GIKA 2D74B 1RAAB 5LMUJ 4DFKA 4N77A 3VQTA 5B7WA 1NPRA 5GAHI 2B3TB 1NZ8A 2RS2A 3TO8A 1PO6A 4CH1A 5DM7Q 3FRZA 1KQSR 2BANA 3BQ0A 3G86A 5BJRA 4FN5A 2LA4A 1GTHA 2J6TA 2CVIA 3DLGA 3GFXA 8ATCB 3EPIA 2ZNZA 4CM2A 5D15A 2DH9A 1CJTA 2HFOA 1OWXA 3FEYB 2OP5A 3O44A 3CC4S 2XMUA 2YVSA 5I3QA 1FRLA 4B9UA 1NJXA 2BX6A 4W92B 3TQ1A 2CZVC 1GXUA 1RT2A 1F0XA 1XQIA 4JI0J 3QT8A 4L3NA 3EJMA 4ZP6A 5KFAA 1IBLF 1K1QA 2KXHA 4DL6A 4RW7B 4ZCIA 1UTAA 3HT3A 1RA7A 4YDXA 1N5VA 2VA2A 4X4PA 3RRHA 5ETOA 2CQIA 3QJPA 4NXNF 3ZC4A 4N8NA 3V81B 2ZJQQ 4LIRA 3T9NA 5HSPA 3EDQB 4LF6F 1JLGA 2C28A 1HW8A 4YHHJ 2X3GA 2HFVA 1WNEA 4J37A 5IM0B 3BEGB 1VBZA 2AF6A 3CJQA 1VBYA 1Y7PA 1ZA1B 2QGFB 1LWFA 4DPTA 1TMMA 2IMWP 3D1HA 3NOCA 1RBAA 4HDHA 3W2VB 2I5JA 3KK1B 5KFHA 5A8WA 2AD9A 1QLNA 2KO1A 3O3LA 4C3KA 3POTA 1Y4ZB 3T5KA 2V67A 4OYAA 3T5LA 1SUQB 4NI2B 4RW8A 2YWWA 5KG2A 2DGOA 3Q8UA 5EWEA 1NSPA 3G82B 3VAMA 1XTZA 3OVBA 3M8PB 5CYJA 5KT2A 1SJ4P 2HQIA 4WP3A 4LF5J 3NBPA 1I51B 2UVVA 3A8JA 1RQ0A 1RT5B 3D3BJ 3QSYB 1LW0A 3DRRA 1FFGB 2UP1A 1N5SA 2CNKB 1K0TA 1Q79A 4X4TA 1NKCA 4WFAQ 4EWTA 1IBMJ 2LLZA 4FPRA 2IAJA 1R0AB 1BY9A 2HVHA 1YLXA 1R8PA 4MAKA 4IRDA 3R5BA 5B0FA 3VAFA 1SB6A 5ETNA 2HHTA 2MB0B 4OHYA 2JSXA 1SC4B 3TP2A 2IC3A 3SFGA 1S76D 3SV4A 2OUGA 3MR5A 3ENWA 5EUHA 1KVIA 5M2PA 2XLIA 1FT8A 1HA1A 4MT1A 1T9TA 5G4DA 1HL6A 3PO5A 2VDHA 1HBOB 4LF2A 3BSCA 3DRSA 2O67A 4ZCLA 1AUDA 3W60A 1WHVA 4YUDA 2XLJA 2RRNA 4NA3A 2EFGA 4CH7A 6FDRA 5F8HA 3GP9A 1PGZA 3TZYA 4Q0BB 5E3PA 4ERDA 2CJKA 5DDQC 3VZIA 2B9YA 4ES3A 2E9ZA 1JIHA 2EFOA 2ILYA 1S7IA 3ZNUA 4I2PB 4USJC 3FQLA 1F6TA 1FEEA 4PPZA 3LP0B 4B3OB 2HQDA 1CQMA 2PA3A 2UXBF 4RPFA 4DV5J 4DSLA 3SQGB 3KJVB 4EYIB 2FLOA 2YXLA 3PG9A 4X4UA 1KP6A 3HZGA 2R2TA 4KFBA 1UJ6A 5E0OA 2HGLA 1KQKA 3MMCB 7AT1B 5GADU 2RRBA 1LWEB 5HQLA 4EUVA 3DOMB 3P6YC 4LRAA 3K59A 4K0KF 3GB0A 1FXRA 1K73T 3GJRB 3GV5B 4ED5A 1A7GE 1IWGA 2MZTA 1SV5A 2R8IA 3N28A 3EWGA 3K5PA 3RR8A 3NCPA 2W7OA 3IM8A 2HRUA 2WB4A 1JLFB 1C4CA 2J9DE 3T3FA 3L7UA 2YNIB 1NJIT 1X4AA 3CC2S 2I1RA 1G3OA 4EBEA 4OI4A 5I42B 2RQKA 1RTIA 4C6AA 5E33A 3H5XA 3DI6A 2PMWA 4JV1A 4O3RA 4ED6A 7FD1A 1IXKA 3JQJA 2DHSA 1U0SA 2FY1A 3C15A 2JLEA 2Q66A 5F8NA 3BZQA 2C3PA 3QATA 2O01C 3EVOA 2EG2A 4B3MF 4NCGA 2OSQA 3H5SA 2W2PP 3VAKA 1PBUA 5H9FK 1FDAA 1ZBTA 2WRMA 3CDBA 1DQ8A 2VFUA 1VJWA 1L3TA 1QAYA 1N6QB 2RIJA 1FK9B 4ZN3A 2GQ2A 4A8QA 1TR0A 4O4GA 5F8IA 4I69A 4TN2A 2Z2MA 2DCLA 4K2JA 1EKSA 2OPQA 4A8FA 2IMOA 3C2PA 4J7CA 5KAKA 1TTHB 4USHA 1U8SA 3IWXA 1FO1A 1WACA 1J5OA 5ETLA 4G3IA 5HQ8A 2W4PA 4ANEA 1FA0A 4JI6F 1U1KA 2R4FA 2IDLA 5HMXA 5KT7A 2VDIA 1D0EA 4CYUA 4DQPA 4L3KA 4NEYA 4MIBA 2ADBA 4K4UA 3MI7X 4IRKA 4PR6A 2CQ3A 4OI1A 4HH1A 5K14B 5KFYA 2XGPA 4UZCA 5ETPA 4WK1A 4WTOB 3H40A 2DEJA 2I2YA 3K57A 5J2MA 3CCWA 4W4MA 3TUPA 4KHPF 4C9DA 2GVDB 4ER8A 4MIAA 5IQQA 2MEWA 1WC0A 2QC3A 4DCOB 1GX6A 3SCKE 3QGPA 1HI8A 2BE2A 2IJFA 2P9EA 3M1VB 1B64A 3AT1B 4ECSA 2ZZNA 4MIWA 3A3PB 3R7SB 3R5CA 1ZOTA 2CQHA 3PIOQ 2XNQA 2DK2A 4C8LA 2DR8A 3M2UA 3EM1A 2PC6A 4NASA 4XIUA 4ZS6A 4C8YA 2YKOA 1KRPA 2HNDA 1AUSL 3PZPA 3MGJA 3D0IE 1X4EA 3UFCX 1KTVA 1R27B 4NLQA 3MXHP 2P9GA 3IWLA 3JB9k 4IG3A 2P6TA 4ZVPB 4Y0FA 2OD6A 4ECXA 2DY9A 2YWGA 1U48A 3KK2B 3ENVA 3KLEA 2FVSA 1KONA 4TNOA 2XMVA 4EU0A 4NPOA 3N79A 5U47A 1MSWD 4OYZA 4CIOA 2D9OA 2CZ4A 3W62A 4C8NA 1FNOA 2WOMB 1RT7B 1DTQA 2E5LF 1GNKA 2M3DA 4C7QA 3OW2R 4J9SA 2DPIA 2UZAA 2QT7A 2FVPA 5E5NA 3N01A 1HNZF 1V3ZA 3GYGA 2JEJA 1PILA 3IC1A 5ETVA 1Q78A 1MNEA 3OD2A 2IBOA 4FYVB 3TI0A 3KG0A 3DRPB 1RTDB 3I0SB 3DM2B 2Y9HA 1U1RA 2EK6A 4PAAA 4HR2A 3HHNB 3C16A 3BYPA 3IRXB 3H2UB 2FHOB 2KN4A 2P5VA 2LECA 3MAAA 4X66F 2LDIA 2WBRA 5M2RA 4UT4A 3MPDA 1APSA 2F5GA 1TKDA 2QFJA 1H72C 2V34A 1QVGR 2ADCA 2X51A 2VONA 2XY7A 4OX6A 1F5AA 4RNFA 4PXDA 3EPGA 2VBYA 2RF2B 3BO4A 5FLXU 2QX0A 3M6XA 1S77D 3GFYA 4ZHRB 3LGMA 3OXFA 1BE4A 1HQUA 2V6AA 1PAEX 1AW0A 2OGUA 2ZC3A 1UKUA 4ZLLA 1RB0A 4USMA 4J9KA 3FVYA 5EDWA 1V5IB 3ETOA 5LSLA 3NGKA 4K4YA 3R2CJ 2CJAA 2L9WA 2V4JA 1EETA 4KC5A 3GZ7A 5AJ3J 2W9CA 1VRTA 1IVZA 5DDOC 3B4DA 3RR7A 3W8GA 2OHDA 3RB3A 4ZITA 4B9LA 5BYRA 4Z7CA 2VC0A 2HQGA 2PFDA 4G65A 4OX9J 3M32B 3ILLA 2R7SA 2DT9A 3CDAA 3O6QA 3W5ZA 2YKNB 1HD1A 2BRKA 5C42A 1RYSA 5KFXA 2FYXA 5D3GB 2WSFC 2WVEA 4G1QB 3H20A 5HVFA 1RAHB 2CQGA 1URNA 3MEKA 2W8KA 5T7LA 1XNRF 4GO7X 2VODA 3HCXA 4OIXA 2ZKTA 1SH0A 4LSNA 1ZM4A 1YBTA 1UEKA 2BQ3A 2OAUA 1K9MT 3IN5A 3PNIA 3A1YG 3HI9A 3S8SA 1Y9OA 2N7CA 2RKIA 5F3ZA 2HHSA 1S9FA 4KPCA 3DDNA 3ITHB 4FS2A 4R0JA 5CH7B 2SXLA 4MTPA 5LL6d 2VQEF 3MOZA 2CJQA 5H1SV 3FFIA 4QWCA 3I56S 1HLWA 5HVGA 3BSNA 4GVBA 4NLDA 4YFUA 3KWMA 3HXMA 3OT9A 1TZ0A 3DLEB 3ILJA 4ZPDA 2QYGA 3N9UC 1LEOA 3GU0A 1UEUA 1OQ3A 1CJVA 4AQYJ 2Y3YA 3GG0A 4KE5A 1C1CB 4HHJA 2HFZA 4S0MA 2F4FA 5G0RA 4DF8A 1N52B 4N8OA 3AB4B 1CJUA 4IUFA 3TZWA 3MM9B 5KFRA 3VGUA 3NMRA 1YRTA 3WIUA 1FRIA 4ITSA 4WFBQ 3PJXA 4UY8T 3ENQA 1Y11A 2BJ3A 1RT1B 4F4WA 3IXQA 3E3XA 4DS5A 2BZ2A 3BKUA 4QOTA 3OR1B 1JXLA 3QJJA 2Y1LB 2AX0A 2WBMA 3MM6A 2ALZA 2XI3A 4OHVA 1V3RA 1MN7A 4F3OA 4P2FA 1Q86T 2YQ0A 4DN0A 5GAEI 1FNMA 1KQGB 1NMEB 2D7SA 2VG6B 2FDNA 2MLXA 2W9AA 3VV2B 4DQQA 4QW9A 3HJFA 4LSZB 4B3RJ 3NKYA 2F4VF 2JZ5A 1JLQA 1H2TZ 3VAGA 4LIWA 2VHGA 2QA2A 2ZH3A 3JSBA 4DR6F 3NNHA 4HHUA 4KGZB 4OYBA 2OD4A 2F9JA 2D41A 4PWDB 2LQ5A 1UWBB 3B78A 5DQIA 5HJXA 1W7WA 4Y2MA 3GCWP 3G8TA 3MMAA 3KLHB 1D8YA 4ZPBA 2R8KA 2CJYB 5D4PA 2FC9A 3VQSA 1RA6A 2DGXA 4ZP8A 1UVKA 2AHOB 3CCVS 4UZBA 2ZBRA 4MK8A 2DHHA 2MHEA 3CWJA 4X65J 1RTZA 3E2EA 5BYQA 2A2CA 1ZM9A 3GFHA 4FS1A 4DX7A 3UDCA 1GMUA 1HQ2A 1HNWJ 1RT3A 2DHGA 1QTMA 2UU9J 4OI0A 1FRHA 1Q4RA 4A48A 4O3NA 2HNZA 5DJBA 5KFJA 3J7YU 1XC9A 1GFWB 3AOAA 1XNQF 3DYAA 2CUYA 1MU2B 4WCEQ 1EARA 2HNYA 4OZ3A 4LF1A 3MR3A 5HMWA 3RBXA 1TELA 1R7IA 2QL5B 4I6YA 3PV8A 1M5HA 1NNDA 2QA4S 2Q79A 4AD6A 3MTKA 2EKYA 1YJRA 1WC1A 1YZ6A 3PRBA 4AL6A 1KSPA 1A6LA 1S5ZA 2QL7B 2G0CA 3IS9B 4P10A 2A10A 2AW0A 2EK1A 1S6QA 4TU9A 3BGLA 2RSQA 1OO0B 2MDAA 4ALZA 1RT4A 2PMZD 4QYZJ 4IG0B 4ZVGA 3CNQP 4LFAF 4KV8B 3V5RA 2MYFA 2DH8A 3H5YA 3KMQA 3QGGA 4OQJA 4DR5J 1YBAA 2C2MB 3GMGA 3DRXA 1KD1T 2XS5A 2GC8A 3NWRA 4DX8H 1UFLA 3ZZUA 5KT4A 1SC3B 1S6UA 3JYTB 4TVAB 1VYAA 2ERRA 4K8RA 2MXYA 4NRTA 2PN6A 5D0HA 5A2QU 1OQ6A 3BH6B 3H2LA 2BACA 1U0HA 1GT8A 5A8KA 3LGHA 2DR9A 1F60B 5IT9Y 4PXEA 4CO3A 1JLBA 2J6SA 2CNOB 4DV0F 3OLAA 2HIQA 3JTOA 3G6YA 1RTJA 1EB0A 4U9RA 2HFSA 4IDKB 2R8GA 4Q44A 1NSAA 4IYQA 3OV7A 1LWCB 1HWJA 2HFNA 3WHIA 1GQEA 2JLFA 3D0GE 2DB1A 1YRUA 4RUAA 3H90A 4J9MA 2IM3A 2VQFJ 3TAMA 3LW5C 3AODA 2AYBA 5KOXA 4DQRA 5DGBA 1R89A 3QZ7A 3PW4A 1WC4A 1JB0C 2BANB 4XDDA 3IWNC 3UWTA 4A46A 2PE8A 3VGVA 1TKXB 2MTLA 1SJFA 1S1XA 2DO0A 2YNGB 1TP7A 1ITPA 2YQ3A 2DGVA 1LQ9A 3CJKB 3DLGB 2G2YA 3LP1B 4X64F 1CJTB 2E44A 1EP4A 3LH2S 1JJHA 1YQHA 3MDFA 4MK9A 4A8KA 3X1LB 2GO8A 1N54B 5BR8J 2R7TA 3GR0A 1KHVA 3PW5A 3QAEA 4CLPA 2KRRA 1HNVB 1RBLA 1HWKA 2E1PA 5J1EB 3BKFA 3JAMY 3CF5Q 2FJWA 3OL9A 4QR2A 3NLCA 3TEGA 4KTQA 1N4LA 2HGNA 1H0HB 5HJYA 3LO3A 1MMLA 1H98A 5I4MA 3HMJG 2BR0A 2W9BB 2RQMA 4KJIA 5A0YB 2JVOA 2DVIA 3CULA 1KS2A 5K8PA 1RHQB 5HBMA 4EK2A 2QO3A 2FB0A 1T3NA 3PFEA 3RW6A 4K4VA 1MMNA 1AZSB 2I5JB 5KFWA 2X1GA 1X0PA 4LBHA 3R27A 5A8WB 4AUKA 3POTB 2RDDA 4MYTA 4CO4A 2R7UA 3VWSA 1QSSA 1WKJA 3BGUA 4E98A 1Q8BA 4JB8B 3M2RB 4O3QA 3I55S 2DIUA 3DRRB 3D68A 2V2QA 3MPVA 3RAMA 3I0RB 4YB6A 4M5HA 5EN1A 3O2IA 5GVQA 3TVKA 2M9KA 5D0GA 5ETRA 4DV2F 3QNWB 1HWUA 3DU5A 3GIMA 1FD8A 3BV8A 4GKJJ 1S0MA 5F8GA 1M1GA 3BJYA 2DXDA 1QE1B 4DV6J 2CPDA 2JHEA 3NGDA 3OTBA 4TY9A 4XPEA 3R3TA 1IWAA 4EFAC 5HI7A 2IC3B 1MG7A 1OMSA 9ATCB 4WE1A 1U1QA 2VG7B 4RW7A 1YWXA 3NP5A 1N33F 4LSLB 1N32F 3KFWX 4DDFA 3VR1A 2YKAA 3L4BC 1ZM3A 3F56A 2YPYA 2AMCB 2H5IB 2ZH2A 3Q89A 1EX8A 4UOCA 1VDHA 2VPXB 1NU4A 2GMHA 4DSKA 3FRYA 3MTJA 1JJ4A 4LUBA 2E7XA 4NLGA 2LVWA 3H59A 2V4QA 4FXWA 2LQ9A 1D9AA 3W2VA 1ZPVA 3KK1A 1QAXA 4DV1J 2VL1A 2Y0BB 2KFNA 2LQJA 7FDRA 3AXMA 4JI2F 1RAFB 4NWBA 4Q8FA 1HWLA 3QT6A 2OSRA 4UW2A 3M8PA 4NMLA 3MM7B 2QMWA 2C3YA 3MF5A 2B9XA 4YR3A 1Q8IA 1TMJA 2G0JA 1NK8A 3CC7S 1RT5A 2XI2A 2RUSA 4DSEA 4WTYA 4LF7F 4FF1A 2XS7A 2UXDF 5DLFA 3R5DA 3JXOA 1FTRA 3OSNA 2IY5B 5B0GA 1WG1A 5L8RC 3TUZC 1N88A 1R0AA 4DPOA 4F4XA 3JQMA 2OPRB 1VISA 2OEJA 2MZSA 3C46A 2MQOA 4CZCA 2DKOB 2Y1JA 3B82A 2KHDA 4XK8C 4ZN1A 4ED3A 3JTNA 4IO1A 2VOOA 2H51B 3I9V9 1FDNA 1WHYA 1VRUA 3HK2A 2NLWA 3DXSX 3R9LA 1HBOA 4X62J 1RTIB 5HMYA 1WF0A 4DUYF 4C8MA 3V6JA 3AA9A 3MEDB 1KEKA 4M5LA 1YI2S 2GX8A 3GYNA 2C3OA 1CG2A 4DSIA 2E5IA 3CGIA 5CZVA 1V5VA 5KFSA 4Q0BA 1MWYA 4DR1F 3ZNJ1 4AYBD 1K47A 1X8DA 3U7JA 4URGA 2VPZB 3P49B 4I2PA 4MKYA 1KOHA 3J7ZT 1BQXA 5J2PA 4NCGB 2I6WA 1U49A 1HARA 3LP0A 4B3OA 1QDUB 2XEXA 4NCAA 1X0FA 5IFMA 5EX0A 2B43A 2ALYB 1NPKA 3SQGA 3KJVA 4TU8A 3LAMA 1S1TB 2XLKA 3QLHB 3PIPQ 2EEYA 4U67Q 1UJ5A 2CPYA 2NUHA 3KUHA 4HLBA 4O4GB 3MMCA 3UDVA 2OPPB 3QIDA 4JP8A 3DOMA 5HMZA 1DJ0A 4JI3J 3CMQA 1HIYA 4O23A 2HS0A 2X7IA 3D67A 4J9VA 3L7PA 4CYUB 4KH1B 2P8IA 2B6AA 5KFFA 2FHKA 2V4RA 2H4WB 5IWAF 2DNZA 4USIA 4WKYA 4IKAA 2J0WA 4JI1F 2W8LA 4HTJA 2YNIA 4JI4F 4O44B 2DY1A 1G6BA 2B9WA 5KFVA 3AAWB 4LF8F 1J5EF 5I42A 2XMAA 1VQ5S 1FTCA 4YQWA 4LRCA 1X5PA 3A8KA 3HVTB 3CD5A 3Q8YA 2RQCA 1DRZA 4CLLA 3FCHA 2GGPA 2O66A 2YKMB 3VGTA 1N36J 2DNHA 2ZH8A 2VKRA 3RB0A 3EGNA 2CDQA 1TFWA 2DR6A 4QZVB 4DV3J 1KOOA 3GILA 2XO6A 2BOPA 4WXWA 2OKQA 4ETZA 4U7UK 2AGPA 3EVWA 4RUCA 1SXLA 4YY3J 2HNDB 1IKYB 1FK9A 1OPZA 1RZMA 2V8VA 3K58A 4X84A 4YP3A 4NE9C 2NS1B 2OO4A 4DUZF 3LPEA 4ILLA 3TZXA 5ETQA 2XBPA 4N41A 4Y6IA 2KHCA 1CJKB 1VLYA 4M5KA 3CCJS 1LXNA 1HR0J 2VJUA 2C3MA 2I8EA 3J7YI 2VJVA 5GAHU 2RHSB 3H2VE 2DGQA 4PWUA 1VQ7S 3HX9A 2BKOA 5ITHA 1UVNA 3NNAA 5F3TA 2AIRB 2IM1A 2B8PA 4KO0B 3WX4A 2IFXA 4QIFA 1UJ4A 1TUGB 3I32A 2C2KB 2CAJA 5HP1A 4CO0A 4HT7A 2R7WA 4CO5A 2K1RB 2GVDA 3DKDA 1K1SA 1UL3A 2ZUAA 4ZPVR 2FGCA 2Z0GA 5CYQB 2XMKA 2VPYB 2ZD1A 5GAGU 2JWNA 3MEEB 5HROB 3M1VA 5D6GA 1ZETA 1TAUA 2GIQA 4M5IA 1EAYC 3AQPA 1VBXA 3KNGA 4C3LA 2X1AA 1N5YB 3FBEA 2CPZA 4Y65A 5LMNJ 5EWGA 4FNIA 4R5PB 2HHHF 2Z58B 1BD6A 1TL4A 3CE8A 2QEXS 2JLGA 4EZ6A 3VZHA 3QO9B 4N76A 1HNXJ 5GMDA 1RXOB 2FVRA 4JV5F 3ET6B 4ZVRB 4QPTA 1M5PC 2V9KA 4C0BA 2O1PA 4YR2A 4DR4J 2L41A 3KLGA 3IAS9 2Q43A 2UVRA 3LTOA 3KUEA 2IRXA 4MKBA 2NXUA 1FI4A 1RAOA 5FDLA 3RBDA 2UVUA 2NXEA 4ED1A 2ZNYA 3KK2A 4NLPA 3J80U 3NMAA 3RJMB 1DURA 4KT0C 1YHQS 4J9OA 5KFKA 4FXVA 3G71S 4ZP9A 5IT4A 3Q8RB 4HL9A 4R25A 4JI8J 4ILMA 1TVRB 2GFFA 2F7VA 3H25A 2W9CB 3D9BA 1YZ7A 3IMQJ 2FVQA 2RH3A 1XR7A 1RT7A 4ZVOB 2C1EB 3FZBA 1VK8A 4A4JA 4DZ6A 1S6OA 3NS6A 2VZ9A 2HWHA 3CSKA 3LANA 3Q2TC 3H4BA 1UFWA 1S4FA 1SH3A 5C42B 3GJQB 3T1YF 3DRPA 1RTDA 3I0SA 4J9LA 2PFFB 1I94F 3EZUA 1S0NA 1U2CA 3IRXA 1VHFA 5T7LB 1Q53A 5IC6B 2B5JB 2OFHX 2JJ4D 3IO1A 5L39A 2CIMA 1U6FA 2HQFA 3CJSA 4WU2A 3I5CA 3AOCA 2KB2A 5K5MA 2OEMA 2KU7A 2DNMA 2RKIB 4ECZA 5ETSA 2HW3A 2HVIA 4WIIA 3NRBA 2RF2A 4X2BA 4F2RA 2NPFA 4MKAA 2CG4A 4ZHRA 3PO4A 3RW7A 1CC8A 2JEIA 4PPDA 5AXLA 4GVBB 3KLIB 4HT5A 4DMZA 3WZ0A 4USUA 3AJDA 4FF4A 1CPZA 3IFEA 1WWHA 3H7HB 4FYYB 4WYWA 2GO9A 3QT7A 3QQCD 1UMJA 1CJVB 5B08A 1EZZB 3HHEA 4OZ5A 1PYSB 2OELA 2WVFA 3P96A 2GNKA 1CJUB 2F1FA 1WKKA 2LFVA 2QL9B 1HW9A 2C42A 2FZGB 2ZH7A 3M32A 5KFBA 3VAIA 2RDJA 2IDEA 1YJTA 4ICLB 4O3OA 4KKOA 1YDLA 1QUPA 4NYZA 2YKNA 2DNKA 3ADAC 4LFCJ 4M8LA 1XIQA 4BS2A 3JTPA 5D3GA 4RR5A 3M7VA 4KGVB 1RWXB 2W2NP 3KG4A 1T9XA 3O5TB 4RBUA 1H74A 4FDFA 1T02A 1Q95G 1JLEB 4F4KA 1ZYQA 3DCAA 1SI9A 2QRRA 1UW9A 2VBXA 2WVDA 4KY3A 1P27B 2XYHB 3K17A 4KRWA 2D1CA 3MR7A 1RHJB 1KN6A 2BABA 4EI2A 1TKZB 4U8YA 3U1MA 2XO7A 2AWZA 5RUBA 1ACMB 5KFZA 2E29A 1X5SA 1RSCA 3Q8PB 2OPSB 2WB1D 1HMVA 3QRQA 1NAQA 3QWPA 3ZTQA 1R8AA 4LREA 2HYIB 4LBIA 4DLEA 1HNIA 1PJ6A 3WC0A 4ZVQB 3MMAB 2BQUA 3J7A1 4A8MP 3OVAA 2O3DA 2V8HA 3S6EA 3IG1B 1NK9A 3E01B 1HHSA 3DLEA 4YN3B 3IBFB 3OJSA 1SKWA 1XWLA 4CO1A 2XC9A 1WELA 2GAHC 3TANA 2ROEA 4Q8EA 2BYCA 1C1CA 5C2CA 5LJ5Y 3MM5B 2LEBA 3IR5B 4M5NA 1YTYA 3MM9A 1VHIA 3CB4A 3OQ2A 1B7FA 2E9TA 1BMQB 3ONQA 4R8UB 5CA5A 1AXQA 4H4OB 2P9CA 3SDEA 4DCPB 2VIHA 3OR1A 2UXCJ 2QZ8A 2YTCA 4FF2A 4PYDA 3BR9A 3KDNA 2KVQE 1GH8A 3LALA 2FJVA 1K44A 2VFSA 1LKZA 4IH7A 2VG6A 4OJ1A 4RKUC 3VTIA 5F8LA 4ZIVA 3G8QA 4IOCQ 2JEFA 4A47A 4BHQA 4JI5F 4M63A 4PXBA 3OR2B 2CDRB 1C0TB 2PI4A 3RBEA 4QWDA 3W5XA 5C25B 1SJ3P 4UQGA 3SYZA 1CLFA 3W61A 4RWWA 4PWDA 4WF9Q 1UWBA 4UTGA 3J81U 1VC0A 4ZDNA 4OZ1A 1BQNB 4YOEA 4X4RA 4USVA 3UCGA 2MJUA 4L73A 1ELOA 4DG1B 1R6VA 5CQGA 4QCLA 2CQPA 3DFEA 5C24B 1U4BA 3M6WA 3M05A 4DFPA 3THTA 1NHVA 4WK3A 2AU0A 2ABYA 4QYZK 4ECQA 4UQTA 5A8KB 4BBYA 4KGMA 5IS2A 1JLBB 2A3JA 1OY8A 4ZVEA 3BDPA 3GR1A 3HULA 4ED0A 3UI3A 1GEHA 2YNFA 1AFJA 5C5JA 2Y0SD 2X3DA 1JK9B 1X4HA 1GTEA 5K8NA 1WC3A 1Q0NA 2XWYA 2ZM6F 3PVXA 1RE1B 4TKTA 3H8YA 3NGUA 2BRLA 3Q2SC 3D6TB 3RRGA 3QIPB 4FYWB 3SCLE 3ISND 3K5NA 4FBTA 3K89A 5F8JA 5AXNA 2ZBPA 3PYDA 5B0EA 1UPPA 3TAQA 2N3OA 4C4WA 2HK2A 1NHKL 3PYEA 3IS9A 2CKWA 2JRSA 3OL8A 5K9FA 5CYMA 1IBKF 3QT5A 3KKFA 1EP4B 4MKVA 4UUXA 3N6LA 3FMBA 3PRDA 1EHWA 2KJVA 1NZAA 2JDJA 2E1MC 3C8YA 3W64A 2IVYA 3I31A 4KV8A 5CCMA 3UCUP 5D4LA 1D09B 3OTEA 4NXMJ 1SIWB 5F9NA 4KAIA 3CDUA 3A3OB 4Q7AA 3QZ8A 2BJDA 3JYTA 2WVCA 3GIIA 2ACMA 2XTJP 3NCQA 1RHUB 3C3LA 1F9HA 2DTJA 2A6MA 2B7BB 5K20B 4URSA 1FDBA 1UZHA 2PSZA 1C1BB 2J8AA 3I5AA 1IM6A 5L1JA 1SH2A 2L08A 2XG8A 1IUJA 2BEFA 1BC6A 4BCAA 4TY8A 3AHPA 4U6PA 4LFBF 4IDKA 2CQ1A 2XHWA 1FJEB 5FIIA 1REVA 2R7XA 4LF9J 5A6PA 4PEOA 4LF4F 1OYDA 4QIWD 3CJRA 4C98A 4K4TA 1GAOA 2YWEA 1VOMA 2K7KA 3NAHA 3N5BA 4B3TF 1H3DA 1ZAWA 4KB7A 1WDTA 4ZP7A 3W3SA 1LFPA 3D2WA 2ZVSA 3KNAA 1FDDA 5D8HB 1TKXA 2YNGA 1O51A 4B3SJ 1HBUB 2IRUA 3CEDA 3CJKA 4N47A 1SPBP 2NZ4A 3LP1A 1QAJA 4ELUA 1FESA 3OPKA 3D4JA 3KYLA 2XZTB 3HKWA 1IKXB 5F41A 2BW7A 3E51A 4B9VA 1J27A 2A6OA 1RDRA 4HH0A 5DG9A 3CW2C 4UF4A 5GAGI 1FKOB 4C8OA 4DXLA 1HNVA 3ZTPA 3TJ8A 4DX6A 4DFMA 1NJYA 1DFDA 1FJGJ 1N34J 5J1EA 3BN4A 3TNVA 2HPUA 2UUCJ 1OY6A 4WE1B 3ZZ0A 1FX4A 4EGLA 2RILA 2OEKA 1T05A 2BVZA 3BR8A 2YPZA 1ZS6A 4TQRA 4F50A 1BUXA 3M30B 3CCQS 2W9BA 5A0YA 3RYLA 3CCLS 4OI3A 4GKKF 1NJWA 1FX2A 1GX5A 5E3CA 1LK7A 1VQNS 3RB6A 3L09A 4NLUA 1Q7LB 2ZKUA 3EMTA 5BYSA 4CLTA 1J2VA 3DXBA 5L1LA 1QM9A 2QA1A 1AZSA 4D3GA 1VQ4S 1RWMB 2UV8A 2ZHBA 2JC1A 4C0HA 1CS4A 4NRUA 3ZTSA 3MPUB 1RISA 2FY8A 3GCXP 2D9PA 1VS3A 2VFTA 1DTTA 2YY3A 5FJ4A 2DHXA 2KT3A 2COLA 1R0CB 3D5MA 1XMOF 3DLJA 3EX7B 3M2RA 3MD3A 4PYAA 3CJ2A 3I0RA 4EMDA 3PRVA 2GJFA 1UZDA 3IA0A 5DG8A 3KK3B 1RU2A 5KTQA 4IR1A 5LMUF 4PUOB 5LSRA 4DR2J 2R7VA 2JFKA 3HVWA 2ASJA 2G2ZA 1QE1A 2MQMA 5ETMA 4G1IA 3CCTA 2QSWA 5GAEU 3GQCA 2AYEA 4HYKA 2VG7A 2MKYA 3DN9A 3FCWA 3BO3A 2V9WA 4LSLA 1VRUB 4ETXA 3V6KA 3KMSA 3GWCA 1QTNB 5KT6A 2AEMA 3A3NB 2D3OR 3DLKA 3IP0A 3U02A 4IH6A 5H9EK 2MKCA 3DRYA 4I56A 5KG0A 3N0VA 4JYAJ 1X9MA 4L75A 4FP9A 4JI0F 4NX9A 1NLKL 1VR6A 2AYMA 2CJ9A 3CIMA 2VB6A 2LP4A 1WD6A 2BM0A 2RU9A 5DZ6A 5J2PB 2DXFA 4ZLNA 4ZIWA 4ZJQA 2XYPB 2XWXA 1YRXA 4ZPAA 4OYIA 4OYWA 4OHWA 3DDKA 3MM7A 3AD9C 5KG1A 5E41A 4YHHF 2RRAA 3OTOF 2YX7A 2W2QP 3W9HA 1JJ2R 2RD5C 1HFEL 3MAHA 2GVZA 1S48A 4OJ3A 4ZK7M 4QU6A 3Q83A 5A2QY 3BKTA 3DU6A 2VFRA 3V2UC 1F2GA 3T9ZA 2B6AB 2OPRA 1FJCA 1P9QC 1R3NA 2VICA 4DS4A 4LF5F 1Z1ZA 2NZCA 1DY3A 4QIGA 1D9FA 3QRRA 2XB2D 2DYAA 3HKZD 2DNPA 5KFNA 2DCUB 3UN3A 2N4DA 5IC4B 5LSOA 4OHXA 1TV6A 1VQOS 4OL8A 2B56A 2YWHA 3MEDA 2Y1RI 1IBMF 1T3OA 2XMTA 3ZTOA 2QJ3A 2DEIA 3Q22A 2YKPA 2FC8A 2IHR1 4NZ0A 4CDIA 3T1HJ 1AT1B 5DRKA 4F4ZA 3U1NA 3TJAA 1B0PA 2GGPB 5AE2A 2CQ2A 2H5EA 2B4OA 1XMQJ 2KT5A 4K5RA 4LRDA 4WU3A 2MQLA 4ES2A 3L95X 5DETA 2HQCA 3QGIA 1W25A 3OJUA 4DL2A 1X9WA 1S1UB 4IOAQ 3BPDA 2GMJA 2PMHA 2W4CA 3U27A 4BLGA 1WHWA 1S1TA 4FBUA 3QLHA 1ZA2B 1FRKA 4OX7A 2KM8B 3EVMA 3J81j 2LXIA 2EG1A 2AZ3A 3US5A 4FPIA 2ZJRQ 2OPPA 5B0CA 2W1BA 2E1CA 2V2VA 1PC5A 3PHEA 1RTHA 1FRMA 3H0PA 2VPWB 1VCTA 4DV5F 3CDEA 2YWKA 2AGQA 1C0UB 4TLQA 3G96A 2E9RX 4KSEB 1TU0B 5IOLA 1DARA 1X4GA 1DAXA 1B4SA 2J7WA 1V6HA 1LW2A 5HP1B 4O44A 2LDYA 4W98A 4I2QB 4AT1B 1HKAA 3CTRA 1NK5A 2J7KA 1KNZA 4ES1A 1T03A 4DPXA 2MLZA 2HK3A 1K8AT 3HVTA 2ZD1B 5F0UA 3MPYA 3PXGa 3CD7A 4EO6A 2YKMA 1NUEA 1UVMA 3W65A 3OUYA 3DDIA 2LA6A 2N82B 5HANA 3LUYA 2L48A 2H5JB 2LQBA 4K7QA 4DJBA 3HHDA 1IKWB 2QLWA 3DGPB 2PIIA 1WJ9A 4FNHA 1KFSA 3L3CA 1VJQA 3KHHA 2KDOA 2RS8A 2R9LA 2CPFA 1IKYA 4QU7A 4OZ0A 3R2DJ 3OFGA 3CD0A 4CWBA 1U1NA 1U7LA 2W2MP 4ED2A 2AJ0A 3HD2A 2UUAJ 2FJDB 3H5UA 1CJKA 3KLGB 2Z2LA 3UVJB 2ZZMA 4DBQA 2HAIA 2DGTA 5FDLB 4C2MA 2BQRA 2X1FA 2MQQA 1KVJA 2BJ8A 1U6ZA 3BN7A 2UUBJ 3TZZA 2NXCA 1H7XA 1YJ9S 1DBDA 1R6YA 4KO0A 2Q6BA 5KG6A 4NLXA 3K5OA 1KDNA 1VK3A 1NB7A 5HQMA 2KVIA 3T5JA 1Q5VA 3GIJA 2ZBQA 3D6FB 1XR5A 3PKMA 3CJ4A 4OHZA 2DHAA 2VUGA 4H54A 3SMZA 4DSFA 3T6JA 1OIAA 2K1RA 1HYSB 2YKQA 1RKIA 1U6BA 3HHKA 3UW1A 5CYQA 3G9CA 3MEEA 3M8SA 5HROA 1S12A 2CRLA 1Q5YA 3EZOA 4TU7A 4CT8A 3PR4A 2GQCA 3K5MA 1N5YA 4ZJOA 5J1PA 2N4CA 3GJTB 2R3VA 4NLOA 3H98A 4R5PA 4J5OA 2QMXA 5LJ3Y 5KG3A 1M0SA 4DV4J 4J9NA 3OXGA 4KHMA 2DJWA 2JOQA 3U1LA 3QO9A 1D1UA 1TL1A 4JI7J 3HHLB 3N6NA 3ET6A 2HHQA 4FVCA 5HVHA 1UWAA 3R1HA 2DGWA 1LFWA 5E3AA 2I9SA 4FF3A 1A9NB 2HS4A 1YJ7A 2DIVA 5E3RA 2DRAA 1AA1B 4NL5A 3UR3C 4V1Ak 1HBMA 4OYMA 2DNQA 2HFUA 3PX4A 3D1QA 2MQ8A 3B8HA 2V8DA 2K7JA 3I82A 4P7TA 2BM1A 2F63A 3UE2A 1VLOA 3PCOB 1TVRA 3TUJC 3V4IB 1MLAA 2D3ZA 3NS7B 5D77A 1RCXB 1HPZB 2MKSA 4I68A 1B3TA 2VH7A 1VIXA 1M5VC 3BBFA 3TVZA 2KJWA 1P1TA 4KQZA 1E6VA 4DR3J 3M8YA 3L9ZA 4DR7J 4KKOB 2IYIA 2BE9B 4ZA1A 4OI6A 1JNZB 1FE4A 3R6GB 3EICA 1QSYA 1NHUA 2YQ1A 1PG5B 3MAQA 3KOAA 1O0PA 1U45A 1S79A 4RO0A 1VQMS 4DHVA 1Z2LA 3NOGA 3UN2A 3IBCB 2VA3A 2IM0A 3WIVA 1WTFA 2GMLA 3QPIA 2B5JA 2QE5A 3ILIA 4CLKA 4NLTA 4OV6A 5HL7Q 3CJ5A 4DLGA 4BWMA 1EQMA 2KH9A 1FNXH 4OLPA 2DD8S 2ZEJA 1QY7A 2Y1IA 5I3UB 2CWXA 4IFVB 1SKRA 2XGQA 3H42A 3TEHB 4NLVA 1FRXA 1G2EA 5SUHA 1HMVB 3TX0A 4DPUA 2EC0A 3UD4P 4E2FB 2ZDPA 3DOKB 3Q23A 5A8RA 1HNIB 1JNRB 3KLIA 1CBKA 3PR5B 4GO5X 1XN9A 1FCAA 2HZAA 2R2RA 1O8BA 3J7AN 1IBLJ 2XY5A 5IXUA 2ATLA 5AXKA 1OS5A 1SIZA 3HPOA 2VKZG 3T19A 2Z4PA 2YH0A 3EXYA 3HFVA 5LM7E 3LGNA 1ZZNA 3RZAA 1T95A 4F8RA 4ELVA 4NXNJ 1PCAA 2KYZA 4ICLA 1RUSA 5HAOA 4UUWA 4F0HA 4ZKAA 4LF6J 5CCLA 3IR6B 3SDEB 4C8ZA 1VMBA 1ZZFA 4K59A 2NQPA 3BO2A 3FZ2A 1KWMA 4PWWA 1URRA 2G2OA 1FKPB 4DEZA 2W25A 2CPJA 5AJ3F 2EFVA 2Z2ZA 4EBDA 4Y3CA 1RAGB 3NL0A 1WKLA 1JLEA 3SSSA 2NSCA 3PDNA 4OX9F 1YVFA 2MGZB 4OI2A 4CLUA 2IPOB 4JV2A 4M5MA 1JLCB 1TKZA 5CZXA 2C2ZB 2G1HA 4KPYA 2QG9B 4MFBA 2RE1A 1NDPA 2XSJA 2L9NA 2D3UA 3TAPA 1RYRA 4ZOSA 1VC5A 1KHWA 5J2NB 3SSQA 2MMYA 2OPSA 4H4MA 4ZPWR 3ZZOA 3ZXWA 1H73A 3PKYA 1NBEB 2HQ3A 4G6VB 4QWEA 1QAIA 2ZOFA 4M1KA 1IR1A 4PQAA 3IM9A 2OMOA 2F3JA 3GG1A 4WXOA 1TK5A 3IG1A 1PC4A 3E01A 1FVQA 1MWQA 1B7YB 2A0FB 2ZITA 1ZM2A 3GJSB 2H48B 3CCUS 4E0DA 3R7NB 1R31A 2HBZB 3MM5A 1HQEB 1FWKA 1S99A 1RHRB 1WF2A 4U7CA 1W2IA 5IQ6A 1I1GA 1F1BB 1S9GA 2FTRA 2YNFB 4RLEA 2AV5A 3KTQA 1FEHA 3GFZA 5A76A 4O0NA 4HEA9 2L3MA 3PHTA 1LK5A 8AT1B 3CJ8A 4R8UA 4WP8A 4H4OA 3RRKA 2RHQB 1WSRA 1H2UX 3CVKA 3HFKA 2PD1A 3EXCX 1JKHB 1LOUA 5DQGA 1YG0A 4AQYF 2BUNA 2VU5A 4ID8A 3OTCA 2QLXA 3FSYA 4WFXA 3MFHA 3I4HX 2M52A 2ZE2A 5KFTA 5F9LA 4AFFA 3BBCA 1NDLA 4CNZA 3HD1A 3RTVA 2OTJS 2UXBJ 3D66A 1HWIA 1RWVB 5CYMB 3ISZA 5JJBA 1VRQC 3D28A 1IBCB 3ZZTA 3J80Y 4C97A 3OR2A 4NA2A 1C0TA 3OTOJ 2RT3A 5C25A 4DWIA 2XMMA 1S59A 3TX8A 3C6UB 1PIEA 4NYPA 3MZIA 3B54A 2B8QA 1BQNA 4RJVA 3GYXB 4K0KJ 3Q0AA 3AB2B 3LP2B 2ASYA 1RABB 3QBCA 4CLFA 2K8GA 4DG1A 4K4XA 1I3OB 1XR6A 1RLDA 1R8CA 4LR8A 5C24A 1M5OC 2V5HG 3VVUA 4AXIA 4WYLA 2A1BA 3R8YA 4B3RF 2PDAA 2G13A 2EC2A 4DX5A 2B7CB 4XO0A 1QVFR 2UUTA 1SVDA 4QIEA 3DLBA 4PG5A 2HMIA 1KTQA 3UDLA 1M5SA 2QMUB 2F8MA 3CCRS 3VF0B 2OMLA 4TY8B 3OHAA 4CCHA 3QYYA 1TK8A 1REVB 5DM6Q 4RW4B 2RU3A 2KFYA 5D4NA 4C0OC 1GXTA 1TKTB 3ZZPA 1OYEA 2DNGA 1HI1A 1SC6A 1JX4A 3G87A 1WC5A 4ID5B 3PW7A 1VGYA 2U1AA 3O8WA 3RUBL 1ZTTA 3I96A 2R7RA 4QWBA 3MMBB 4CI0B 3TVYA 4X65F 2HIYA 3QIPA 1YJWS 4ECUA 4I7FB 4NLWA 3UNGC 4B3MJ 1HNWF 4ECYA 4M5DA 4ATNA 1JLAB 2FD2A 2QIFA 5KFQA 2UU9F 4LRFA 3KJFB 3R5JB 4RNHA 3T41A 1Z2ZA 1HHTP 3RAQA 2ZC4A 2FJEB 4F0MA 3QWUA 4QYRA 4Y28C 3HO1A 3N5FA 2CPHA 2M88A 2LEPA 1I6JA 4NZ6A 4ZLJA 1NSKL 2X1BA 2J76E 3MR6A 4JI6J 1TL7B 3HSDA 5GMKa 4I67A 4RNNA 1U2FA 4PG8A 3P5TL 4XPCA 2BBEA 1T05B 2CJBA 4X4VA 4EBCA 1YX2A 1R0BG 2WONB 2DITA 3C14B 2FZKB 1C1BA 3THVA 2EI5A 4F7VA 4JOUA 2JC0A 3TWZA 4KHPJ 2M4MA 3OVSA 3LWLA 3P5BP 1MROA 1T7PA 1RU1A 5B0BA 4DR5F 3FJ2A 4C11B 3CJTA 2XM3A 3MM8B 4GMKA 5J2QB 4U7UD 1RAEB 1BWEA 4Y34A 1CS4B 1NCLA 2VBZA 5HLFB 5SZTA 1N0VC 2AJFE 2VD3A 1TUVA 1U2RA 3PW2A 2V8PA 1DTTB 3NCRA 3PEHA 2E7VA 2YH1A 2BE7D 2B4UA 1Y00A 2HHXA 5JUMA 2JVRA 2VG5B 4QR1A 4V19J 2GIFA 1SKUB 1HBUA 4ANDA 3VHQA 4NMXA 2AGOA 2PGCA 2OTLS 4EO8A 3TJ9A 4F4YA 4J9RA 3VALA 1OJ4A 1Q8KA 2I38A 1IKXA 4NOHA 5B0AA 1NK0A 1WTBA 5B09A 4OMFG 5CD4H 2VQFF 5EHHA 4DUTA 3E8OA 2UV8G 4YB1P 4RNMA 1FKOA 2OIHA 4M94A 3GLJA 1Y5NB 4LR9A 3MEGB 1F3VA 2GW8A 3G8SA 3D0HE 3BH7B 3CO9A 2V68A 2GHWA 3NGRA 2AJ2A 4CTAB 4DN9A 3M2VB 3P4UB 1BXNA 3JSRA 4AE5A 3M30A 2HSEB 2HWIA 2D69A 3HM9A 3DLKB 4LVNP 1U09A 3ZO7A 5BR8F 3MWBA 3A8IA 3QGHA 2H54B 1SQEA 2E5LJ 1IJFB 4TQSA 2M0GB 2QLBB 5D0RA 2AJ4A 2U2FA 4B9SA 3DLHA 1F2HA 1HNZJ 2W7PA 2DRBA 1WHXA 2KRBA 3FCVA 4ED4A 2XY6A 1T11A 4FZVA 1V3SA 4BC9A 1H38A 3MECB 5LXRA 3V6HA 2MPUA 2AEFA 1RT6A 4A8OA 3W9IA 1S9EB 1GMVA 1VQSA 1WUUA 3I6PA 1RADB 2AJ1A 2RNEA 3K8VA 3IGNA 4R0EA 4X66J 2J9DA 3PX6A 3J81Y 4OLOA 3O1LA 4WKRA 3FBBA 4KGKA 2VC1A 1L3SA 3HZEA 2R7QA 1FF2A 2GVZB 1U1MA 2JFDA 3TUIC 3T5HA 3QMQA 1KLNA 5ETKA 3AY0A 1YJNS 2Z56B 4HKQA 2Q6CA 3KK3A 3KHRA 4PUOA 4UOHA 2E1RA 3VGSA 1RJJA 4C3MA 3GONA 3SEOA 3DNCA 4P75A 5H9EJ 4IRCA 3G2XA 4YB7A 2QV6A 1MWZA 3R5AA 2ZH5A 4BWJA 2AEJA 1X4BA 1Y5LB 1TV6B 3MUVP 1SL2A 3QFHA 3CXCR 4M5GA 1ZTWA 4L72B 3FEXB 2IJRA 5CAAA 3FNNA 1TAQA 4GKJF 2ZFHA 4O0IA 4DV6F 4XDCA 4H4KA 1L3KA 4IO9Q 1S6PB 3MR2A 4P71A 3T6BA 3X3UA 1Y10A 1S57A 2R2UA 2LYVA 1M1HA 3PJ9A 3N6MA 1REGX 4IR9A 2J9EA 2K3KA 1VQKS 2YNHA 3HHLD 3V6DA 2AJQA 1XNRJ 4HACB 4K2XA 1PYOB 1S1VB 2ZH4A 2HBRB 2AKWB 2B4VA 1H7WA 4Q43A 1VQPS 2XULA 2H1YA 5K8OA 4L76A 3S1TA 2ZUGA 3W2WA 3EGWB 3HP6A 2HZCA 2UUWA 1VQ9S 3KLFA 1T9VA 2HVZA 4DV1F 3FQKA 1RHKB 1RLCL 4RUBA 1RTHB 2RJZA 2PT0A 1L5UA 3PM9A 4NLSA 3TRGA 3W5YA 4JV0A 2VQEJ 1UFKA 3ZFVA 2CADA 3ISNC 4ELTA 3UO0A 4DI6A 2OH2A 1V9OA 2WVBA 4Y00A 1LW2B 1FHTA 1F3FA 4L74A 1T03B 5L46A 3I5BA 1IQZA 5EX3A 3EGZA 1OPIA 4QWAA 4LR7A 3C6TB 2V0NA 3TOQA 1RWKB 3KHLA 3ENAA 3ZZZA 1WEYA 3DLLQ 2BJ1A 3OUYB 3Q86A 3R7BB 2BKNA 4NLYA 2Z30B 1IKVA 4NYOA 4A8SA 4DSJA 1H2VZ 3LPYA 2N7YA 4F0KA 4X62F 1S10A 1S1UA 1UCNA 5AT1B 2BXJA 2XMWA 6AT1B 1CQNA 2C3UA 1R8BA 3LA0A 4YEAA 4LT6A 3THPA 3FBCA 4KH0B 2A2DA 1E6YB 3QRPA 2ROGA 3BGRB 2F4VJ 1AB8A 3M8QB 2HRYA 2DNRA 2QLFB 2KYXA 1TL3A 2IIHA 5HN0A 1OY9A 4ENOA 2CQ4A 2C22A 3W63A 9RUBA 4WJBA 4DR6J 3KDOA 2XHCA 2EXUA 2R8JA 4AXJA 5CXTA 1C0UA 4F3QA 2XNRA 1RP5A 2KL8A 5D0EA 2YX4A 4OZ2A 1NO8A 2EPIA 4YMEA 1KKHA 2IRYA 3GSDA 1RBOB 3EDRB 2MSSA 4J9QA 1SKSA 1VQ8S 4CRJA 4I2QA 4QJVA 3JSMB 4JI3F 2KKHA 2WSCC 2M5YA 3OL6A 4NZ7A 2KZMA 4FXDA 4PXCA 3K0JA 3SCIE 5HO4A 1AROP 2IYGA 4IFYA 2FLNA 4TXSA 1XNQJ 2WHOA 4ZVFA 3FEZA 2IBKA 4CLWA 3AXKA 2FQQB 3IRWP 1WI6A 2VFVA 2HS3A 5DDRC 2M7SA 1C2PA 2XSFA 2VBWA 2IVMA 4OYOA 2Y8YA 5J1NA 3R6LB 2DGUA 3LF0A 3Q8QB 5E2QA 1IKWA 2MHNA 3DGPA 3K2YA 4DL4A 4WZQA 1G1XA 2LU1A 3TARA 2MQNA 1S1WB 3PJWA 4AL5A 3M9NB 4WZMA 1TL1B 4N7TA 1HBNB 3P8BB 2DNOA 2HZVA 1F5CA 1KLMB 4P9SA 4K4SA 4FKYA 1N36F 2LCWA 2FVCA 2V50A 2DPJA 2QTWA 2Z8QA 5KFOA 3BSAA 1BGXT 3S01A 4YDDB 5EGYA 4N56A 1O5JA 3UVJA 4QBUA 4DV3F 3D1OA 1HBMB 2W4DA 1AYEA 4LFAJ 2KZZA 4QW8A 3NNCA 2ZWPA 1NH7A 1DLOB 2FHMA 3JS9A 4J9PA 2HGMA 4YY3F 4FKXA 4G1PA 4U8VA 1T8EA 2V94A 1S72S 8RUCA 4LQ9A 3R5GA 1SJRA 2W7AA 3DMJB 3OHBA 2LEAA 1SCJB 2HHVA 1TK0A 1E6VB 1HYSA 4X4NA 3AD8C 4RZRA 1HR0F 4ZPCA 4U95A 2GJIA 1R43A 4JBCA 1U1OA 2KTQA 4DV0J 3PEJA 3UQSA 5D4OA 1RWPB 3OXLA 3ZTRA 2NYHA 1S7HA 4L6V3 4PCQA 5E7OB 4PQUB 2HURA 4O3SA 4MK7A 2ZBCA 3CJ0A 3CD6S 4KGXB 3Q8VA 3B4MA 3GSIA 3NWGA 4QR0A 2RUGA 1VBKA 4PRFA 1KQFB 2BJ9A 4HTIA 2LXFA 4LVOP 2C2RA 3OL7A 2F65A 4GRSA 1N8RT 3L7OA 3C19A 3KLVA 3HHLA 1X4FA 1EIYB 3KXDA 1RWWB 2B9EA 2F8HA 5GADI 4X64J 2FIUA 3HJVA 2ZDOA 1BQMB 5A8RB 5LMNF 4ZVSB 2WSEC 3EE3A 3F44A 5LOQA 1Y3KA 4UY85 5F8MA 1PYTA 2ZH9A 1HI0P 2J7UA 1HNXF 4ZLPA 3FSIA 5JMNA 3MMJA 4P6QA 3F0NA 3V4IA 4NA1A 1CC7A 1HPZA 4C48A 1WDDA 3D3CJ 4DR4F 2FJAB 3ILOA 4JUZA 4DL5A 2AX1A 3R97A 2KI2A 4PZVA 3MCNA 4I4BA 3VAJA 4I1TA 3W7BA 3BPSP 4Q2MA 4USKA 4B02A 1DZ5A 3DHWC 1D9DA 4DCJB 1LXJA 3HFZB 1CULB 5KG5A 1JQGA 2A18A 3DHXA 4Y2CA 4B9MA 2DH7A 3NEKA 3EGVA 1NKEA 1BLUA 2K3IA 1UA0A 3A4TA 3RB4A 2CQDA 3KJQB 2IM2A 4DPYA 1F5BA 4JI8F 1QD1A 3CDWA 2HWTA 3I4PA 4CT9A 3QFWA 2XCAA 1CEZA 1PJ7A 4ZVHA 1N56A 3MCSA 1ZH5A 4KBIA 1N5QA 3DGVA 1PKUA 4MH8A 2CPXA 1NDKA 1UP1A 1FKAF 1NB2A 4RW9B 1D8ZA 4IOBA 4MFBB 2XSJB 2HVDA 4UOFA 2MKIA 1RCOB 2HLUA 5I3UA 4YB5A 5T41A 4IFVA 1NSQA 2PEHA 2AP6A 2W24A 1RKJA 3AJ1A 3I9ZA 4H4MB 3OFEA 3EUNA 3DOKA 1UVIA 4DV2J 5THWA 4J90A 3VCDA 4RW6A 1QUVA 5CABA 1Y3JA 2HBYB 5A6WA 1X7VA 5AE1A 2C2DA 2FJBB 3NG8A 1UVLA 2LMIA 1EKRA 3TA1A 1YJVA 1PJ5A 2CPIA 2ZVIA 2HHWA 3DOLA 1N33J 2HRTA 6FD1A 2RDIA 1N32J 3NGTA 4W90B 1FFSB 2GA7A 1WOSA 1S9GB 4WP9A 2M2BA 2HHUA 3VVTA 4TYAA 4D3HA 5MAOA 3BF4A 4Q45A 1GK8A 1WSVA 1RT2B 1Y0HA 1RAIB 2NXJA 1FKPA 1O6XA 1U26A 1WOOA 4WIQA 2HEKA 1S49A 3GV8B 5KFCA 2BJEA 2HLTA 3WC2A 1MMDA 4F67A 2ZE2B 3G4SS 4JI2J 1WC6A 1EJ7L 1TFYA 2MGZA 2GS8A 1B0VA 3ZZRA 2KT2A 1P6TA 5JVHQ 1GMWD 1JLGB 1JLCA 4K5SA 3NXZA 2G9OA 4DZDA 2MSTA 4LFCF 2WCXA 1C4AA 1S4EA 2DGSA 3FUYA 1FWPA 1L3VA 2VOPA 1LWFB 2IA0A 3BSOA 4LF7J 1G7CB 4KR0B 2LKZA 1RAJA 5J2NA 2VF3A 3BQ2A 2UXDJ 1NKBA 3K5LA 2ZZTA 3FDSA 5L1KA 2HBQB 5DQHA 2NYIA 3M6VA 4IH5A 1W2BR 5MLCV 4RW8B 1ZAXA 1VQLS 2V8GA 4V19X 2BKPA 1CVJA 4HHHA 2M70A 4EZ9A 2PEBA 4Q2LA 2H9ZA 2C2EA 3NBPB 1LW0B 1NEEA 3BS9A 3HDSA 3CMAS 4B9TA 1GXLA 2HMIB 2MZQA 1HQEA 4Z37A 3R1LA 1SL1A 4OZNA 1A0OB 2B51A 1PAUB 1FERA 4DUYJ 2M8DB 3MUTP 5FD1A 2ROPA 2ACYA 2G0IA 4DL0C 4LMZA 4CNYA 1NK6A 2IAJB 4F36A 3ICLA 2IA6A 2FGOA 3PX0A 2DBBA 4OJHA 4OJGA 4N5SA 5T14A 3JQKA 1B70B 5DGAA 4QPXA 4DR1J 2J0QD 2CVEA 2JH3A 1JKHA 1LV5A 1VC6A 2RVJA 2F8EX 4HDGA 1B99A 1VQ6S 4M5DB 2CFXA 1NK4A 2R7OA 3P45B 2FLPA 3DRSB 1NH8A 4ZCKA 1YBUA 3V81A 3MD1A 1RWUA 1X9SA 3OFFA 3MFIA 3GIRA 1YK9A 1R8HA 4EEYA 2DNLA 5IZHA 2LQ8A 1U47A 2QA4G 2JNJA 1Q82T 2Z2YB 5IM0A 2UXCF 1OSDA 3W1YC 3C6UA 3MUMP 4FVMA 5DO2A 4HI1A 5LT5A 1WG4A 2WZ1A 3LP2A 1SUQA 1TQLA 1JXEA 4NI2A 4I64A 1U8WA 3G82A 3MURP 3PY8A 3BGOP 1JMTA 2OI2A 5IWAJ 3F41A 2MLYA 3AD7C 4KFBB 5AE3A 1VFJA 3W8PA 4JI1J 4BC7A 1LNQA 1RGVA 1TUWA 2CG8A 4PKDB 3SXLA 3N4WA 4JI4J 1FD2A 4PG6A 2QFIA 2DR5A 4LF8J 3CO0P 1J5EJ 2H4YB 2V69A 1MROB 2CA9A 2XZWA 1X4DA 3AJ2A 1SV5B 2PI5A 4RW4A 1Q1KA 3SFUA 1ZAVA 2EFPA 1RHMB 4RNOA 1TKTA 2CYYA 1U1PA 3F73A 3G6VA 1RWNB 3SSRA 2E1AA 4ID5A 1FWLA 3MMBA 1Q81T 3QSIA 2P6SA 4ECRA 3CCZA 4I7FA 4LJMA 3FBFA 3HF5A 1JXVA 2BW2A 4P72A 1JLAA 1UVJA 1MW7A 1FVSA 2EVZA 3SBMA 3TA0A 5D78A 5IV3A 3SCJE 3DI6B 4Y2KA 4X4QA 4PG7A 4B9NA 1ZPWX 5KG4A 2H3EB 4DUZJ 4OX8A 3C15B 2KG0A 2BJ7A 3TYTA 2DISA 1U25A 4ZMMA 4A8XA 3M9OB
chains in the Genus database with same CATH topology
1R27B 4NLQA 3MXHP 2P9GA 2F1FA 2QLXA 3FSYA 3IWLA 5KFGA 4WFXA 2R2SA 1U1LA 1S0VA 2R8HA 3MFHA 2E5GA 5IT0A 1HW9A 3I4HX 3JB9k 4IG3A 2P6TA 1SJQA 2C42A 3DC2A 2M52A 2ZE2A 3CPWR 2NSBA 2ZH7A 4Y0FA 5KFTA 5F9LA 3M32A 5KFBA 2OD6A 4AFFA 4YR0A 2RDJA 4ICLB 1YJTA 3VAIA 4CNZA 4ECXA 2OTJS 3RTVA 4DV7F 2JEGA 1HWIA 1U24A 4O3OA 2YWGA 1FXLA 4KKOA 1U48A 3KK2B 1QUPA 3ENVA 3KLEA 2FVSA 1KONA 5CYMB 4TNOA 3ISZA 4NYZA 5JJBA 3D28A 2YKNA 3TA2A 2XMVA 3ZZTA 2DNKA 4EU0A 3J80Y 4M8LA 4C97A 4BS2A 3OR2A 3LWMA 4NA2A 1C0TA 4NPOA 3N79A 5U47A 3JTPA 5D3GA 2WONA 2RT3A 5C25A 4C8KA 4DWIA 1MSWD 2XMMA 3CCMS 4CIOA 2D9OA 2CZ4A 2OPQB 4C8NA 3TX8A 3C6UB 3KG4A 3ZZYA 3M6UA 2JL9A 4NYPA 3MZIA 3O5TB 1FNOA 2WOMB 1LWEA 1HD0A 1RT7B 4RBUA 1BQNA 1J5OB 3GYXB 1DTQA 1T02A 2E5LF 4I0WA 1GNKA 3EYZA 1XK8A 3AB2B 3Q0AA 1JLEB 2QYCA 4F4KA 2AQ4A 1ZYQA 2OLWA 3LP2B 3DCAA 1SI9A 2QRRA 2M3DA 4C7QA 3OW2R 4TLRA 4NXMF 2FLLA 2VBXA 2ASYA 4DG1A 2BDPA 2K8GA 4K4XA 1P27B 3AQOA 4J9SA 2DPIA 4C11A 1XR6A 1DQ9A 2UZAA 2QT7A 2FVPA 5E5NA 4KRWA 2ZH6A 2MY8A 2APOA 1R8CA 3N01A 5C24A 1HNZF 1V3ZA 2D1CA 3LOUA 3MM8A 2V5HG 2XCPA 1M5OC 2JEJA 4AXIA 4WYLA 1PILA 2A1BA 2BABA 1KN6A 5J2QA 3IC1A 4B3RF 1M5KC 1TKZB 1Q78A 2EBEA 3U1MA 2PDAA 2XO7A 1MNEA 2G13A 2AWZA 2FJXA 2IBOA 2POKA 5HLFA 2ZJPQ 3TI0A 2B7CB 1RT6B 3KG0A 4XO0A 3DRPB 1RTDB 2I0XA 3M8RA 1JLFA 5KFZA 3I0SB 3DM2B 1X4CA 1U1RA 2EK6A 2E29A 1QVFR 3HHNB 1X5SA 2UUTA 3IRXB 4QIEA 3Q8PB 3DLBA 3VAHA 4O3PA 2OPSB 3H2UB 2WB1D 1HMVA 4PG5A 3AA8A 1NAQA 3QWPA 2HMIA 2FHOB 1R8AA 2HYIB 2KN4A 4HVZA 1KTQA 3M4XA 1M5SA 2P5VA 3FGVA 3UDLA 5J2MB 4ECTA 2LECA 2F8MA 4DLEA 3CCRS 2GV1A 3VF0B 4X66F 2OMLA 1HNIA 2EBGA 2LDIA 4TY8B 3OHAA 2VG5A 4CCHA 3QYYA 2WBRA 3WC0A 5M2RA 4MMOA 2DNYA 3MMAB 1TK8A 1REVB 5DM6Q 4RW4B 3PFOA 1APSA 2BQUA 2RU3A 3J7A1 1TKDA 2QFJA 2Q1LA 4A8MP 3OVAA 4DQIA 2EFNA 2O3DA 2V8HA 3S6EA 2ZOMA 3IG1B 2KFYA 1NK9A 1T94A 1HHSA 3E01B 1QVGR 2BE2B 5D4NA 4C0OC 2ZBIA 3DLEA 2X51A 5H9FJ 2ADCA 1GXTA 4LF9F 3C66A 1TKTB 2VONA 3OJSA 1SKWA 4Q5VA 1XWLA 3FMWA 4OX6A 3ZZPA 2XY7A 4CO1A 1F5AA 2DNGA 1HI1A 1SC6A 2CQCA 1JX4A 4RNFA 2WAQD 4ID5B 4PXDA 1VGYA 2U1AA 3O8WA 2XC9A 3EPGA 3I96A 3PW7A 1ZTTA 2R7RA 1WELA 4QWBA 3MMBB 4CI0B 3TANA 2VBYA 2ROEA 3TVYA 4X65F 4Q8EA 4KIAA 1ROFA 3QIPA 2BYCA 3V4MA 1C1CA 1YJWS 5LJ5Y 2LXUA 2RF2B 4I7FB 3BO4A 4ECUA 5B0DA 2UVWA 4F2SA 3NAIA 3M6XA 2RQ4A 4NLWA 1S77D 3GFYA 3MM5B 3IR5B 3UNGC 4ZHRB 3LGMA 2LEBA 1HNWF 3OXFA 4ECYA 3M2UB 4M5DA 4ATNA 1HQUA 3MEGA 1JLAB 1YTYA 2FD2A 2QIFA 5KFQA 2UU9F 1AW0A 2ZC3A 3MM9A 1UKUA 3CB4A 3OBIA 4J9KA 3HVAA 3FVYA 3OQ2A 4B3SF 3CCSS 4RNHA 4Y2AA 5EDWA 3GV7B 1B7FA 2E9TA 3ETOA 1Z2ZA 2MZRA 4RUHA 2G1DA 5LSLA 3J7Z5 1HHTP 3RAQA 3ONQA 4CTAA 4OZJA 4R8UB 2WK4A 2ZC4A 5CA5A 1AXQA 3NGKA 4H4OB 4K4YA 2FJEB 2P9CA 4KHRA 3M2VA 3SDEA 1N6QA 2QSFA 2CJAA 2L9WA 3BGFA 3QWUA 4QYRA 4Y28C 3HO1A 3OR1A 3K7RA 3N5FA 1KR4A 2V4JA 3MPWA 1EETA 2CPHA 4KC5A 2M88A 3GZ7A 1XEZA 2QZ8A 2YTCA 4FF2A 2LEPA 1M90T 2W9CA 1I6JA 4NZ6A 1VRTA 5DDOC 3BR9A 1RK8A 1GH8A 2ZH1A 3B4DA 3RR7A 2X1BA 2J76E 3LALA 3MR6A 3RB3A 2FJVA 4B9LA 5KFIA 5BYRA 4IG3B 2VFSA 1FJGF 1AFIA 2VC0A 1LKZA 1N34F 4IH7A 2VG6A 5GMKa 4P2SA 3M32B 4I67A 4RU2A 2R7SA 1B0TA 2F40A 4OJ1A 1U2FA 4PG8A 4RNNA 2UUCF 2DT9A 1IM4A 4RKUC 3VTIA 3CDAA 3O6QA 3P5TL 5F8LA 4XPCA 1NJZA 3KLEB 2BBEA 3G8QA 4IOCQ 2JEFA 4A47A 4BHQA 4JI5F 1T05B 2YKNB 5L9NA 4M63A 2CJBA 1HD1A 3G6ES 1WEZA 2BRKA 2YNHB 1YSJA 4PXBA 3OR2B 2PI4A 1C0TB 3RBEA 4X4VA 5C42A 4EBCA 1QSLA 3MECA 1RYSA 3I87A 5KFXA 2WONB 4QWDA 5C25B 2WSFC 1Y5IB 3V6DB 5D3GB 1SJ3P 4UQGA 4G1QB 2DITA 3SYZA 5K14A 1S9EA 1CLFA 4RWWA 2MJNA 3H20A 1C1BA 3THVA 4PWDA 2CQGA 2EI5A 1URNA 3MEKA 4WF9Q 2W8KA 5T7LA 1XNRF 1UWBA 4GO7X 1VC0A 4ZDNA 4OZ1A 4JOUA 2VODA 1BQNB 2JC0A 1WF1A 1DTQB 4YOEA 4X4RA 2M4MA 4OIXA 3OVSA 3LWLA 2ZKTA 4PG4A 2OFGX 1MROA 1T7PA 1SH0A 3UCGA 4LSNA 2MJUA 1ULRA 1ELOA 5B0BA 1ZM4A 4DR5F 4DG1B 4QIVA 2BQ3A 3FJ2A 5CQGA 5L9XA 3W2WB 4C11B 2G4BA 5I3PA 2E5HA 4QCLA 2CQPA 2OAUA 1TL5A 3DFEA 5C24B 3MM8B 1U4BA 3M6WA 3M05A 4GMKA 3HVRA 5J2QB 1UW4A 1K9MT 3KLFB 4DFPA 3THTA 4Y34A 1NHVA 4WK3A 3IN5A 3PNIA 1BWEA 3A1YG 3HI9A 4OZLA 3S8SA 5L38A 1Y9OA 2AU0A 2ABYA 2VBZA 2N7CA 4ECQA 4UQTA 5A8KB 5HLFB 5SZTA 2RKIA 5F3ZA 2HHSA 1N0VC 2AJFE 1S9FA 4BBYA 3DDNA 4DL7A 2VD3A 4KGMA 3ITHB 5M2UA 1TUVA 5IS2A 1U2RA 3PW2A 2PA8D 1JLBB 4FS2A 2XMJA 1DTTB 1VIOA 3NCRA 4R0JA 5CH7B 1S0OA 4K50A 3PEHA 2SXLA 4MTPA 5LL6d 2VQEF 1YITS 3MOZA 2MKKA 2A3JA 5KFEA 2KG1A 2CJQA 5H1SV 2YH1A 2B4UA 1Y00A 4ZVEA 3BDPA 3GR1A 2JX2A 2HHXA 3FFIA 5JUMA 2JVRA 2VG5B 4QWCA 3SV3A 4ED0A 3I56S 3UI3A 4QR1A 4V19J 2YNFA 3BSNA 1HBUA 2M8HA 4NLDA 1AFJA 4YFUA 5C5JA 2AGOA 2Y0SD 3KG1A 2PGCA 3KWMA 3HXMA 3PACA 2OTLS 3Q24A 3CUNA 1JK9B 4EO8A 1TZ0A 4I6AA 1X4HA 3DLEB 1GTEA 1VQYA 5K8NA 4J9RA 4F4YA 3VALA 1NRKA 4ZPDA 2XWYA 3N9UC 2ZM6F 3IR7B 5KOWA 3PVXA 2RMLA 2GHVC 2I38A 1IKXA 1UEUA 4NOHA 4TKTA 1OQ3A 5B0AA 1NK0A 3H8YA 4DFJA 1WTBA 5B09A 3GG0A 2BRLA 3Q2SC 1FRJA 3RRGA 4KE5A 4OMFG 3QIPB 5CD4H 2VQFF 1C1CB 3HLUA 5EHHA 4HHJA 2HFZA 3E8OA 5G0RA 2UV8G 4DR2F 4DF8A 3SCLE 3ISND 4YB1P 1N52B 4RNMA 1FKOA 3K5NA 3RAXA 5DLGA 4X4SA 4BDPA 4GC6A 4FBTA 2FHJD 4N8OA 2OIHA 4M94A 3AB4B 5F8JA 3KNAA 5AXNA 1Y5NB 5LXYA 4IUFA 5B0EA 1HQUB 3MEGB 3RU0A 2GW8A 3M9MB 3MM9B 5KFRA 3NMRA 1YRTA 1S6PA 3TAQA 2N3OA 4C4WA 3G8SA 1FRIA 1YIJS 3D0HE 3CO9A 4ITSA 5JVGQ 4WFBQ 3PJXA 2GHWA 5JXSA 4UY8T 3IS9A 3ENQA 1IKVB 1S97A 2CKWA 2JRSA 1RT1B 3WBZA 4CTAB 5K9FA 4DN9A 3OL8A 4F4WA 5CYMA 3IXQA 3E3XA 3LQVA 2NPIA 4DS5A 2DNNA 1IBKF 2BZ2A 3M2VB 3KKFA 1EP4B 4UUXA 3N6LA 2J6UA 3JSRA 3FMBA 3PRDA 4QOTA 4AE5A 3OR1B 2RB7A 2V4JB 3Q8SB 4WFZA 1EETB 3M30A 2HWIA 2KJVA 1JXLA 3QJJA 1NZAA 3HM9A 3DLKB 2AX0A 1U09A 2JDJA 4LVNP 4RBVA 4DF4A 2WBMA 5BR8F 4F02A 3MM6A 2CPEA 2E1MC 1VRTB 2ALZA 2XI3A 3C8YA 2IVYA 5DG7A 3I31A 3MWBA 4OHVA 1Q7YT 1V3RA 4H4KC 3QGHA 4F3OA 4KV8A 1S1VA 1SQEA 1IJFB 5CCMA 2WOMA 1Q86T 3UCUP 4TQSA 2EWHA 5D4LA 4E8UA 2MKHA 4JYAF 2NUUG 3OTEA 4DN0A 1SIWB 2M0GB 3TR5A 4K4ZA 5GAEI 1FNMA 2VG6B 1KQGB 2D7SA 5F9NA 2FDNA 4KAIA 3CDUA 2AJ4A 4Q7AA 2U2FA 3QZ8A 2W9AA 4B9SA 3DLHA 2BJDA 1K0VA 4DQQA 2W7PA 1SL0A 2DRBA 4QW9A 3HJFA 1WHXA 2KRBA 3NKYA 3OFHA 5KT3A 2F4VF 3JYTA 2XY6A 4IQXA 3GIIA 2JZ5A 1JLQA 1H2TZ 1TL3B 3VAGA 4LIWA 3NCQA 4F25A 4FZVA 3NS5A 3EZ5A 3C3LA 1V3SA 4BC9A 1H38A 3MECB 2DTJA 2B7BB 5LXRA 2QA2A 3V6HA 2MPUA 2ZH3A 4URSA 2J0XA 3JSBA 1RT6A 1FDBA 4A8OA 2PSZA 3UD3P 4DR6F 3NNHA 3DM2A 2OD4A 1S9EB 1VQSA 3I6PA 2F9JA 2D41A 1C1BB 4PWDB 2MKJA 1XMBA 2J8AA 3UCZP 4EYHB 2LQ5A 5DDPC 1UWBB 3I5AA 3OTDA 5L1JA 2AJ1A 4P7VA 2RNEA 3B78A 3K8VA 3IGNA 1SH2A 4R0EA 3BREA 2L08A 2XG8A 1IUJA 2J9DA 5DQIA 1BC6A 3PX6A 4BCAA 4OLOA 3J81Y 4NCBA 3O1LA 4TY8A 3AHPA 4Y2MA 4LSNB 4WKRA 4U6PA 5KFUA 4LFBF 2BV3A 4KGKA 3G8TA 4GC7A 2VC1A 4IDKA 2CQ1A 1F9FA 2XHWA 1FJEB 3MMAA 1L3SA 3HZEA 2R7QA 3KLHB 1FF2A 5FIIA 1REVA 4RBTA 2R7XA 4RX6A 1D8YA 4ZPBA 2CQ0A 5A6PA 1U1MA 2R8KA 4LF4F 2JFDA 1WG5A 5D4PA 2FC9A 3TUIC 3OLBA 3T5HA 3QMQA 3VQSA 1KLNA 1RA6A 2DGXA 4QIWD 3AY0A 4ZP8A 1UVKA 3CCVS 1YJNS 4C98A 4K4TA 1GAOA 4HKQA 2YWEA 2Q6CA 4MK8A 3KK3A 4AL7A 4ECVA 2MHEA 1VOMA 3CWJA 4MJKA 2K7KA 3NAHA 5BYQA 3E2EA 3N5BA 2A2CA 4B3TF 3KHRA 1ZM9A 4PUOA 3GFHA 2E1RA 4FS1A 1H3DA 1ZAWA 2L9DA 1RJJA 4KB7A 3UDCA 4C3MA 1UEVA 1SJ1A 1RT3A 2DHGA 4NLRA 2CQBA 4ZP7A 5CHCB 3SEOA 3DNCA 3QAUA 1X5TA 3C6TA 1NK7A 1QTMA 4OI0A 5H9EJ 1FRHA 1LFPA 4IRCA 3W3SA 1Q4RA 2NREA 1WI8A 3D2WA 2ZVSA 4QQBA 1FDDA 3FFIB 4YB7A 2QV6A 4O3NA 1TKXA 4A48A 2HNZA 4M95A 1MWZA 5D8HB 2YNGA 3R5AA 2N3LA 4IFYB 2ZH5A 1O51A 5L1IA 5DJBA 5KFJA 1HBUB 3J7YU 1XC9A 2IRUA 4BWJA 3CEDA 1XNQF 3CJKA 3DYAA 3PW0A 4N47A 2NZ4A 3LP1A 1MU2B 4HI2A 1QAJA 4WCEQ 4ELUA 3K8WA 2BA9A 1FESA 1X4BA 2HNYA 3MR3A 1Y5LB 1TV6B 5HMWA 1L3UA 3OPKA 2MZ1A 3KYLA 3HKWA 1IKXB 4WFNQ 5F41A 2ZOGA 4RU9A 3MUVP 5KT5A 2ASLA 3E51A 1SL2A 4B9VA 3CXCR 1R7IA 1RDRA 4HH0A 5DG9A 1ZTWA 4L72B 3FEXB 4I6YA 3PV8A 1M5HA 5G0RB 5GAGI 1FKOB 3UPFA 3FNNA 5K8MA 3KHGA 1NNDA 1TAQA 2QA4S 1HNVA 4C8OA 4GKJF 2ZFHA 4DFMA 2Q79A 1NJYA 1DFDA 3OSPA 3T1HF 3MTKA 2EKYA 4O0IA 1YJRA 4CQ1A 4DV6F 4XDCA 4H4KA 5EWFA 1L3KA 5J1EA 4O4RA 3BN4A 3TNVA 4IO9Q 3PRBA 1WEXA 1S6PB 4AL6A 1KSPA 2HPUA 1A6LA 3CT9A 3MR2A 1E6YA 2G0CA 4WE1B 3T6BA 3X3UA 3BGRA 1XMQF 3IS9B 4F26A 3ZZ0A 2A10A 2AW0A 2R2UA 2EK1A 4EGLA 2LYVA 2RILA 1S6QA 3M8QA 3N6MA 4TU9A 1T05A 2BVZA 1FXDA 4B08A 4IR9A 2J9EA 2K3KA 2RSQA 3BGLA 1VQKS 2YNHA 3BR8A 1OO0B 1XERA 2MDAA 4TQRA 3HHLD 4ALZA 4F50A 3V6DA 1RT4A 3M30B 2PMZD 4G1QA 3CCQS 2W9BA 5A0YA 3RYLA 3CCLS 2AYGA 4QYZJ 2AJQA 4IG0B 3MM6B 4OI3A 4ZVGA 4K2XA 4LFAF 4GKKF 1NJWA 2KM8C 4KV8B 3V5RA 1S1VB 2MYFA 2DH8A 5E3CA 1GX5A 4CH0S 1LK7A 1VQNS 2ZH4A 3RB6A 3H5YA 3L09A 3A8EA 4NLUA 3KMQA 1DQAA 1Q7LB 2ZKUA 5BYSA 2DO4A 3QGGA 4OQJA 2B4VA