1FRLA

Azotobacter vinelandii ferredoxin i: alteration of individual surface charges and the [4fe-4s] cluster reduction potential
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
b'AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDSCIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title Azotobacter vinelandii ferredoxin I. Alteration of individual surface charges and the [4FE-4S]2+/+ cluster reduction potential.
pubmed rcsb
source organism Azotobacter vinelandii
molecule tags Electron transport
total genus 31
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1993-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1frlA00
2VPYB 2ZVSA 2IVFB 1RGVA 2FGOA 2FD2A 7FDRA 2FJDB 2VKRA 2PA8D 3IR5B 1FRKA 2PMZD 2FJBB 1GTEA 1FDDA 1FF2A 5CHCB 2C3OA 1Y4ZB 3C8YA 1BD6A 1F5CA 4KT0C 2FJEB 2GMJA 2XSJA 2GMHA 1VJWA 1B0TA 1IQZA 1FERA 5E7OB 1Y5LB 1WTFA 4YDDB 1H98A 3MMCA 1FRMA 1FXRA 3OR1B 7FD1A 2Y0SD 2VPZB 5FD1A 1AXQA 1SIWB 2WB1D 1KQFB 1PC4A 1FDNA 3IR7B 2O01C 4XDCA 1D3WA 2C3YA 3MM6A 3OR2B 1A6LA 1FRXA 1HFEL 1BQXA 4XDDA 5BYSA 1Y5NB 1CLFA 1H0HB 3MM9B 6FD1A 1B0PA 2WSEC 2PDAA 1FRJA 1FTCA 3GYXB 3EXYA 3LW5C 1FEHA 1H7WA 2Z8QA 2FDNA 3OR2A 3MMBB 2C3PA 1C4AA 2WSCC 4XK8C 2WSFC 2V4JB 1KQGB 3HKZD 3MM8B 5BYRA 3MMAB 1FDBA 1JNZB 1BC6A 1BWEA 1G6BA 1H7XA 1DFDA 3MM5B 1KEKA 4AYBD 3EGWB 1FRLA 4OV1A 4ID8A 3OR1A 1BLUA 4DHVA 1Q16B 1DAXA 1F5BA 2UZAA 3MMAA 3MM7B 4OMFG 1ROFA 3MM5A 1FCAA 1FXDA 1JB0C 1XERA 2XSJB 4CI0B 2C3MA 1SIZA 5CH7B 4Y28C 1SJ1A 5L8RC 1F2GA 2FJAB 5BYQA 3MM9A 1FD2A 1FDAA 4L6V3 2V2KA 1PC5A 2WAQD 2VPXB 1GTHA 1Y5IB 2C3UA 1C4CA 3MMCB 3MM7A 3EUNA 1R27B 1GAOA 1IR0A 4RKUC 3MMBA 1FRHA 1G3OA 1JNRB 6FDRA 1K0TA 1B0VA 2V4JA 3MM8A 3MM6B 1FRIA 3IR6B 1DURA 3PNIA 2VPWB 1GT8A 2C42A
chains in the Genus database with same CATH superfamily
4J9KA 1EETA 5GAHI 4FKXA 2CVIA 1FD8A 2Z58B 2I9SA 1UTAA 1UWAA 2H9ZA 3TJ8A 4X4OA 3TUPA 1WEZA 3FQKA 1F5CA 1BE4A 3LUYA 1QY7A 2DR9A 1S0OA 1RWPB 3QBCA 3W9HA 4DQSA 1S12A 1P1TA 2VASA 4MAKA 2DD8S 2M4MA 4RNMA 2K7JA 3PYGA 2BXJA 2HLUA 5B0AA 1H0HB 2QYGA 4M5NA 3PIPQ 2PDAA 2KN4A 3QNWB 1X9MA 2RNEA 1SKRA 3MD3A 4KFBB 1NJWA 3KUEA 4NXNF 2R8HA 3JSBA 1WG4A 5I42A 3RTVA 3EGVA 2ZOFA 1OPZA 4NCGB 1FFWB 1JLQB 3AQOA 3T5JA 3QRQA 2HIQA 1N56A 1IBLF 2JEJA 2RDIA 3GJSB 1UVNA 4MKAA 3A12A 3CC4S 2OIHA 2AT1B 1LWXA 5KFNA 3HVTB 1N0UA 4UOGA 4LFAJ 3SSSA 3Q8SB 1RU1A 4LMZA 2OMOA 3TP2A 4MKYA 2GQ2A 2NREA 2LA4A 2G0JA 2HHWA 3KDOA 3UWTA 4DU8A 3R5CA 4FYYB 4AL7A 1S6UA 3E3XA 5EX0A 5L9NA 2ZWPA 4QYZK 2BJ7A 3MM9B 1RBLA 3CJTA 2NXUA 2WSEC 3HVRA 4EBCA 2RS2A 2CXEA 2VG6B 1ZM3A 2LEPA 2LEBA 4ZCLA 4OHXA 2ZHOA 1NAQA 2K1RA 4B9MA 2KXNB 4JI2J 4Q8EA 2QFIA 4FVMA 4O4GB 3MPVA 1XERA 5AXMA 2BA9A 5KAKA 2BOPA 4F26A 2QZ8A 5E3AA 3ELHA 1U8WA 5I3QA 4C4WA 1VQSA 4C48A 1GXTA 4ZVSB 1JXEA 2XG8A 4KKOA 5GMEA 3R1LA 5EWGA 2AHOB 1TQLA 4G1PA 2A2DA 3FBCA 5CD4H 1FRIA 1RWMB 2CZ9A 4F2RA 2F40A 3I4PA 4KH0B 3IC1A 1KNZA 4DFMA 2CQ2A 4H4MA 4RW8B 2BABA 4F4XA 4N5SA 1L3KA 2V69A 3UD4P 1NDLA 2H3EB 1Q8KA 3B4DA 2ZWOA 1D9FA 4BWJA 1AXQA 2EW9A 5IT9U 1UJ5A 2ASJA 3MM6A 1JK9B 1HMVB 4P2SA 2CVEA 1R43A 4JI4J 4NRTA 1Y3JA 1U47A 5KFYA 4DG1A 3OL6A 5DRKA 3VVTA 3RU0A 2EC2A 2QX0A 1CC8A 4DPUA 3EZ5A 1Y7PA 4F4ZA 1WG5A 4K4VA 4P2FA 1T9XA 4YHHF 2B5JA 5A0YA 4DQRA 2CQPA 2OTJS 5CZXA 5E2QA 2BE2A 4OZ2A 3MMJA 2BRLA 4UUXA 4OJHA 4OYZA 4IFVB 2E9TA 2YXLA 3HHNB 3UDCA 2C1EB 2WVFA 3ILIA 3EZOA 1AYEA 1N36F 4WP3A 1CJKA 1HNZF 4B9SA 5I4MA 1DBDA 2KB2A 4DN0A 3CB4A 3QATA 3VWSA 1RTIB 3FQLA 2XO7A 3J81Y 3R7BB 2U2FA 2BJ9A 2OUGA 3D6TB 4Y34A 3TVKA 4A8QA 1U25A 5L46A 1P8GA 2VQEJ 5A8RA 4ES1A 5KT4A 2W7AA 3R9LA 1RT3B 2YNHB 3MM8B 2PO4A 3LTOA 2GO8A 1P27B 5C25B 3LP0A 4QW9A 3POTB 1R8HA 1VLOA 2QA4G 4PYDA 1WOOA 2W4CA 2VFVA 1FWKA 5C24A 1VIXA 4LRCA 3EMTA 6AT1B 2XZWA 1TUGB 1KQKA 1J5OA 4NPOA 4DF4A 3QSYB 5LXRA 1N6QA 1FI4A 1NM2A 1JLAA 3GCWP 3EE3A 5KT5A 2YWHA 4RNHA 3EYZA 3NWRA 4J37A 2C2DA 8RUCA 2CQ0A 4I6WA 1UW9A 3GYNA 1NDCA 2E29A 2DRBA 2Y9HA 5E5NA 3H42A 1QAJA 5KFQA 3Q8RB 1TKXB 2P8IA 3LGNA 5L1LA 4U8VA 2VG7B 3D6FB 2FYXA 4PQUA 4OV1A 5HBMB 3P5TL 4NLVA 2RRBA 3I5CA 2ZITA 2DNQA 3KNAA 3QFHA 2C3MA 1TL3A 1XJWB 3DFEA 3I32A 1G2EA 2FLPA 5LJ3Y 3QYYA 5C7PA 3A8IA 4IDKA 4OHZA 5CZVA 2AYEA 3BREA 3T1AA 1SL0A 1YJ7A 2VPWB 2W8KA 2KRRA 3R5BA 2GC8A 3RRGA 4HR2A 3LAMA 4YFUA 2YKMA 2BKOA 3UVJB 1TK8A 1OYEA 2CJBA 1JJHA 1HI1A 5CAAA 2CQ3A 1RHRB 2KT5A 1RWWB 5F8JA 3THVA 2W7OA 2BOAA 2CFXA 4PG6A 5JVGQ 3BN7A 2FVRA 3UR3C 4YDXA 3ZZ0A 4HT5A 3HK2A 3V81A 4ECZA 1FE4A 3UO0A 4NL5A 3LANA 3N0VA 4RLEA 3MCMA 3PX4A 3PYDA 2K3IA 3WHIA 1XNQJ 1T9WA 5THWA 3OJSA 4IR9A 2OLWA 2UXDJ 2I5JA 3DXBA 1N48A 1RKIA 3HDSA 1N5VA 4X62F 4DWIA 1FJEB 2BUNA 3HJFA 1TL1A 2JWNA 5IT4A 1DARA 4J9PA 3BO3A 3O44A 1BUXA 3NGKA 4NA3A 4QYZJ 2AX1A 1EP4B 1J5EF 4EO8A 3EUNA 2OTLS 3FFIA 2EG1A 3HM9A 1JLFB 4K4UA 3G71S 2XMKA 3QMQA 2V68A 2K8GA 4NCAA 2JJ4D 3H59A 1RTZA 3SSRA 3EDQB 5LSRA 3NCPA 4WFXA 2BBEA 1X4BA 2J6TA 1DLOA 4RX6A 3CCVS 2KTQA 2DNZA 4OJ3A 1RBOB 3M2VA 5CD4A 2Y0SD 2ZNZA 3AOCA 4ZHRB 5DDRC 3O2IA 2GA7A 3ICLA 3TW0A 1BXNA 4DR7F 2M2BA 4DR7J 2YBVA 2G1HA 2AQ4A 3I6PA 3GR0A 5CCLA 2GQQA 4HH0A 4IO9Q 1U02A 5LMNF 4QW8A 3MFIA 5LMNJ 3A3OB 1N33J 4IG0B 1NB7A 1IKXB 1U0HB 4L6V3 3D1QA 4Q2MA 2V34A 4DV4F 3E51A 1RABB 3DNCA 2QT7A 3DRSA 1IUJA 1KVJA 4OZ0A 5F8MA 2HFNA 4H4KA 2ZFHA 3C15A 4YDDB 1WKJA 1F6TA 4NLGA 3DLKA 3KWMA 5D4LA 3KK1A 3KJVB 2XHWA 1RT6A 4KY3A 2VQFF 1HNXJ 1Z1ZA 1IKYB 2V8PA 1NK0A 1X4CA 3HJVA 3NKYA 5J2NB 2FVCA 2Y3YA 4OYMA 3M7VA 3OR2B 4WP8A 2EBEA 2Q1LA 2IFXA 2NLWA 2MZTA 3SI8A 1GX6A 4ED7A 3LAKA 2NCKL 1WI6A 1X4EA 2RQKA 4QWEA 4LR9A 3R97A 5F9NA 1JJ4A 3P49B 4WBFA 3KK2A 4KAIA 1SI9A 2W7PA 4DLGA 3TO8A 2OELA 2MHEA 2VUGA 3IS9B 4K0KF 1B64A 5K5MA 2DPJA 4K0KJ 4K4SA 3BGOP 3P96A 5JJBA 5CYQB 2VF3A 5J2QB 3T6JA 2ZEJA 4ED3A 3W2WB 3D3CJ 4U8YA 4LQ3A 2KZZA 3SV3A 3TOQA 5J1PA 2E5HA 3JSMB 4ZVPB 2C3OA 4K50A 2V8VA 1XNRJ 4EO6A 1KLNA 2VFUA 2ZZTA 2BR0A 2X51A 1FKOB 3MR6A 1RSCA 5IFMA 3VVUA 1WHXA 2H65B 1NDPA 4OYBA 1FHTA 3GE9A 2A0FB 1VDHA 4OYXA 4EBDA 2ZC3A 4WK3A 4ZIVA 2ASLA 3NG8A 3N9UC 4TNOA 2E7VA 4PXCA 1RAAB 3T5HA 4YB7A 4JOUA 4O3RA 5D6GA 2WONB 3KG1A 3QO9A 2O67A 4H4KC 1LWCA 2I2YA 3SMZA 2W25A 1LXNA 2DNPA 3QIPB 1Y5IB 3SZ2A 1JLBA 2HBZB 3WX8A 2ZJPQ 3MEGA 2FZCB 4A8FA 4JI0J 1LWFB 3DLGB 3G87A 1SVDA 1FNOA 4DPOA 4FYWB 2G13A 3P45B 1HQ2A 4NMLA 4MJKA 3JB9k 2X1GA 5DS7A 1X4FA 3F44A 3VGTA 3A3PB 5KFTA 2YKOA 3QGHA 3TAPA 3W63A 3DMJB 2R9LA 1DTQA 3DYAA 1YRXA 2NSBA 3K57A 1EJ7L 3KMQA 1QUPA 3B4MA 3FEZA 2CQDA 3U1NA 1HYSA 1RYRA 1NU4A 5F0WA 1CJVA 5E3QA 2QLBB 3D6MB 1SUQA 4ID8A 4TKTA 5K14B 3MR5A 4JI1J 2WZ1A 1RZMA 3QAEA 4DR5F 1PILA 1S1XA 3ZNJ1 2ZOMA 4UZBA 2W4DA 4QOTA 1GFWB 3NGTA 3OVSA 2WHOA 5IV4A 2PD1A 2VV5A 3PJWA 1QDUB 4ELTA 3BYRA 1X0FA 2PMZD 1HWUA 4L75A 3QLHB 1S0VA 1WG1A 4KT0C 1VK3A 2DBBA 2F9DA 2HZAA 1IQZA 4KV8A 1HBUB 3FBEA 4ED4A 4WIIA 1GXLA 2YX1A 2HURA 1FK9B 3GIJA 3BJYA 3CCLS 1NSAA 3QRRA 4LF8F 2R2TA 4MKBA 1YLXA 2KKHA 3I0SB 4OX7A 5LJ5Y 2AF6A 4ZVEA 5DG8A 3ETOA 5KG2A 3LW5C 4MK9A 1BWEA 3GFHA 4K59A 1W2IA 4PAAA 4KBIA 2MHNA 3VAFA 4MFBB 4X4RA 2IM0A 3VAMA 4TY9A 2QV6A 3TUJC 2C2KB 2JRSA 5EGYA 4L74A 1RCXB 3D68A 3HPOA 2ZBRA 4IQXA 2OEKA 1KVIA 3LA0A 3PRVA 4K2XA 4U7UD 1XR7A 2LA6A 4M5GA 4DL7A 1FRHA 1LW0A 1WUUA 4KHPF 3SQOP 2EVZA 3DGPB 4ZVHA 1RHKB 2A1BA 2JLFA 3W8PA 1TMJA 1S1TA 3FJ2A 4WZQA 3V5RA 1RT7A 5IS2A 2A3JA 2Z2MA 1SJ4P 4ILRA 4QIEA 1MU2B 5B0EA 4J7CA 1RT4A 4KGKA 4FF3A 4KQZA 5BXIA 4OI1A 1RT2B 3QIDA 2XZTB 1RLDA 1CULB 1VHFA 2HWTA 3QSIA 2WTFA 4RW4B 1NSKL 2CQHA 2XYGB 4X4VA 2WVDA 3EGWB 1HW8A 1UW4A 1BLUA 1C1BA 4RW7B 5B0GA 2VBZA 1YIJS 3CDWA 3CCRS 4DX7A 1HD1A 2VU5A 1HQEB 4ZVRB 2XMUA 2MDAA 2FHJA 2V4RA 3T3FA 4NX9A 1B99A 2CNKB 2J76E 1N54B 2UU9F 1TUVA 2JOQA 1YJRA 3KUGA 3D2WA 1PBAA 2IDEA 4FXWA 1T9YA 4AUKA 4DXLA 2B4OA 2E1CA 3D4JA 4LF9J 1HR0F 4YB6A 3PRBA 4JV1A 3M32B 1KC8T 2XS7A 1UZHA 3MECA 2CKWA 3DOMB 4M5DA 4ZA1A 5KG0A 3O3LA 3MR7A 2G2OA 2FVQA 4RW6A 3IGNA 4C0OC 4ERDA 2VH7A 3N28A 3WBZA 1OMSA 1RAFB 4XK8C 2V4JB 4WXOA 1SQFA 2AWZA 3W66A 4QU6A 3FKBA 2Z2YB 2WOMA 1SBRA 2Z2LA 3IO1A 1S1VA 4J9SA 1WC5A 3PHTA 4X65F 5HATA 4OFZA 1KONA 1ZETA 2FY1A 4JI3F 4JI3J 1LWEB 2XMVA 1SQEA 2DISA 2X3GA 1RA6A 3NMRA 1WWHA 2FHMA 1VQNS 3C8YA 3EGZA 2QA2A 3BQ0A 5DO2A 1R3NA 3IGVA 4Y2IA 4U6PA 5J2MB 2HK2A 4PXBA 1FXRA 3PO5A 2F8HA 3CC2S 2WB1D 5LXYA 4RUAA 4ENOA 4ID5A 2U1AA 4NRUA 4DR1J 3IWLA 1K73T 2XY7A 5H9FK 6FD1A 5GADI 1B0PA 3O6QA 1YJWS 4USJC 4DSKA 3BGRB 3BEGB 3KLFB 3VV2B 2DGSA 5MLCV 4FXDA 4J9QA 4ED8A 2J9DA 4LSLB 2OPRB 3N5BA 4L76A 4IRKA 1CPZA 2HMIA 4GC6A 4Y28C 4DSLA 1D09B 4EBEA 1CBKA 2HGLA 3IP0A 1GAOA 2JLEA 1IR0A 3EX7B 4KR0B 1NJXA 1KOHA 1VC5A 3PFEA 1B3TA 2CJQA 2AJ0A 2BYCA 1M5HA 2I38A 2CNLB 2DRDA 1L3TA 2HW3A 4B3RF 4PKDB 3OL9A 4GKJJ 2AJ2A 2XNRA 4HVZA 1URNA 3MEEB 2JNJA 4PWDA 2X7IA 1D9DA 2VD3A 2CYYA 1T05A 3PO4A 5F8GA 4MIAA 1WHWA 3J7Z5 1HMVA 1I3OB 2CJ9A 4DX8H 2WSFC 4FYVB 4P73A 3Q2TC 4FZVA 4PG5A 1TL7B 4CM2A 1UEVA 4CH1A 2PA3A 2EXUA 2YNFB 3NCRA 1QLNA 1HQUA 1EETB 5KG1A 2UZAA 4AFFA 3JS9A 3OQ2A 3GPAA 5E3PA 1MMDA 2D3ZA 2ZH3A 2AJQA 2KZMA 4OLOA 3MI7X 3D66A 5HQ8A 2MLYA 4FVCA 3KXDA 2A6OA 3D5MA 2AEMA 5GADU 2FIUA 3ZNUA 3X3UA 3TQ1A 1NPRA 8AT1B 2QL5B 3D1HA 4C8YA 4F0HA 5E33A 1I51B 4JV5J 1PG5B 4JB8B 2P6SA 2P2CB 5I42B 2QFJA 1VFJA 1YTYA 2OHDA 3GQCA 3D54A 2EFOA 2LXUA 3FMBA 2GO9A 3G8QA 2FVPA 3CW2C 3B82A 4B02A 2G9OA 4I4BA 3UN5A 4FF2A 3CMES 1DQ9A 1OO0B 4DUZJ 4YOEA 2HYIB 1GMWA 4O23A 4ZCIA 5KFDA 3ULHA 3Q89A 1RT3A 2YNHA 4KGZB 2QTWA 2ZD1A 2HQIA 2MMYA 5C25A 2RMLA 1H3DA 1Q7LB 5HQLA 3POTA 2CIMA 1VLYA 1T9VA 1RE1B 3M6WA 5M2PA 2R7WA 2ZDPA 2XI3A 2AIRB 2RIJA 2QSFA 2PE8A 4OHYA 1ZA1B 3BO2A 4JI7F 5KFCA 4NLQA 1U45A 1TFWA 4HI1A 2AJFE 1C0TB 4DSEA 4CZCA 2DEIA 2W2MP 4J91A 5JXSA 4LF4F 4LF4J 3DN9A 2K1RB 3AAWB 4M94A 1S4EA 2DY1A 1M1GA 1JKHB 2BW2A 2W9AA 5B08A 2ZH1A 4PCQA 3OJUA 3MXHP 1NK4A 1WD6A 2HFVA 4N76A 1ZAXA 4DPYA 3CSKA 4KKOB 2HLTA 4JI5J 4EMDA 2Q6CA 4P72A 3BKTA 4P74A 1VBZA 1VQ6S 3W5XA 5LSOA 1PJ7A 4TQRA 3UI3A 3GB0A 3T6BA 5HLFA 4H4MB 3AB4B 3VGUA 5HBMA 1Q95G 4C8ZA 2GHPA 1WC3A 2MQPA 5HVHA 3HSJA 3V4IA 4MIWA 3S01A 1KBRA 3M6VA 1FJGF 3MM6B 2PMWA 3RZAA 4RZRA 1NBEB 1WC0A 4UZCA 5DGBA 1ITPA 2V4QA 5L1IA 1T9TA 3H90A 3U1MA 4LRFA 5K8MA 2GAGC 4DG1B 3TZWA 2MKSA 2R7XA 3IG1A 4XPCA 4RBVA 1SIWB 2QO3A 1PBUA 1N5YA 2O01C 5KFWA 1NK7A 2ZH2A 3A8JA 3MEDB 4OYWA 4W92B 5A0YB 8ATCB 1R8PA 2Z8QA 3WZ0A 2Y1LB 5EN1A 3HCXA 1E6YA 3W61A 4KC5A 4LRBA 2ASDA 4JP8A 2RAQA 2BX6A 2J0WA 2M3DA 1UPMB 1X9WA 1S48A 2E5JA 2W8LA 1CJKB 2PEBA 1FX4A 3K5NA 1MWQA 4FPIA 1X5TA 4FP9A 1FESA 2DXEA 3ZTQA 2JHEA 4HTJA 2J9EA 1ZS6A 1SH3A 2HRYA 3EVOA 3K17A 3TR5A 3I96A 4RWXA 1ZPVA 2AMCB 3Q23A 2RQMA 1JLFA 3ET6B 1U6BA 2MLXA 1OYDA 4B9TA 1IJFB 1GEHA 3LP1A 1H98A 4LF1A 4H4OB 2CPYA 2R7SA 1HNIA 1RU2A 3LP0B 4QQBA 1B70B 4EU0A 3C66A 3WQPA 4DUYJ 1DTTB 4ECWA 2HPUA 1S7HA 5C24B 3M8RA 2V0NA 1Q1KA 4WWSA 3WC2A 2IIHA 1NLKL 4B3SJ 2KL8A 3J7ZT 1UP1A 5HJXA 4USIA 1JLAB 1Y00A 2ZBCA 3MURP 2KDOA 5G4DA 1F60B 1U0SA 4RU9A 4F02A 2ZH6A 2DNGA 2EFNA 3Q0AA 2AJ1A 4RBUA 2V2KA 3MUMP 3OTCA 3W3SA 1WACA 4MMOA 3SXLA 3DM2A 2JX2A 4RKUC 1U0HA 2XNQA 1UPPA 3VZHA 3G82A 4L3NA 2QE5A 3GFXA 2HRUA 3GG1A 3V2UC 3HSZA 3L7OA 4NYPA 1XMOJ 3BF4A 2FJBB 2XSFA 4NLRA 2K2PA 2UVUA 5CCMA 2CPHA 2M5YA 1ULRA 3CDBA 4HKQA 2DH9A 1KS2A 2J7WA 1R8BA 2N7YA 4CLYA 4PQUB 4PRFA 2Q79A 1FRMA 1S1WA 1OS5A 2ALZA 3KJVA 1TMMA 3FVYA 1RKJA 5KG4A 1OWXA 2MZ1A 1TL3B 3QT6A 5C42B 3MR3A 4URGA 1ZA2B 4N77A 1AFIA 1GX5A 5J2NA 1FRJA 4DSIA 2RHSB 4X66J 2UUAF 3OR2A 3C2PA 4IDKB 2QA1A 2VJVA 3MMAB 4AYBD 5CYJA 3CUNA 3OR1A 5LM7E 3PKMA 2M9KA 2YWWA 1ZZNA 2PN6A 3AOBA 3SV4A 4WJBA 3ZTSA 2DY9A 3CULA 1EAYC 1U8SA 2DCLA 3IS9A 1PC5A 2XWYA 3ZTOA 4DUTA 5L1KA 3PYFA 2UUCF 4DZ6A 3AODA 2GFFA 5CYQA 3V81B 4A47A 3OSNA 3T1HF 1GTEA 2HBQB 1HNVA 4AD6A 9ATCB 3RBEA 1EQMA 1PAEX 4BHQA 2E66A 2I5JB 4L73A 3VGSA 2R4FA 2BKNA 1Q5YA 1TL1B 4WFAQ 4C98A 1H72C 3TZYA 4NOHA 1TKDA 2V2ZA 2ZH8A 1FKOA 4CT9A 1FRXA 4OX8A 4ETXA 2UVRA 3FFIB 3GJQB 2G4BA 3TA2A 1W25A 2AZ1A 4RWWA 2QC3A 5IT0A 1G1XA 2CZ4A 1QVFR 2WVEA 3D0HE 4E2FB 2P9EA 2SXLA 4F4WA 1DLOB 2WONA 2Z56B 2E9ZA 4X4PA 3M2VB 3R27A 4DX5A 4X84A 1HBNB 3AJDA 3MAQA 3UDEA 4USKA 1ZTWA 5D0GA 3DOLA 2YX4A 1B0VA 1RADB 4HL9A 4ITSA 2BACA 3MUVP 1VYAA 3B8HA 3LH2S 1LKZA 1RK8A 2PI5A 1SC4B 2MZJA 4M5IA 3FDSA 2KO1A 3DLGA 4O3NA 2FJEB 3UN3A 5HMWA 2E5GA 3LO3A 4A8OA 1D1UA 1ZOTA 3A8EA 4OHVA 4NZ0A 3SEOA 1S9GB 3NXZA 1RP5A 2PT0A 5A76A 5JMNA 1Y9OA 3D7SB 4LFCF 1K1SA 4LFCJ 4J9NA 1HIYA 5EWEA 3CEDA 1FJ7A 3DRSB 4IH7A 4GC7A 4ZVQB 4PPZA 4N7TA 2BANB 3ENVA 1OY6A 2Y8YA 5M2UA 4ED0A 2P9GA 4F3OA 3P6YC 3DLKB 4KYZA 4OI3A 2EFQA 4DFJA 3HULA 1LNQA 2RT3A 4U9RA 3PKYA 2GIQA 5KFXA 3AJ2A 3E01A 1JLGB 3R5AA 4A48A 3I5AA 2CPFA 3M05A 1NCLA 2DGOA 1RGVA 2PC6A 4Q7AA 2E1MC 4K4TA 2NR0A 2GVDA 3CC7S 2EKYA 4K5SA 1N34J 2RU3A 2NUHA 2Z57B 5C2CA 4ATNA 5KT7A 4U67Q 1X31C 1IWAA 1RWKB 3H0PA 4WFBQ 4FS1A 3BYPA 5GAEI 4F67A 1HBUA 2VODA 3S7RA 4FPRA 5B0CA 3IN5A 1FK9A 2FHJD 1U2CA 4YMEA 2QA4S 4DV6F 3CJRA 2BJ8A 3EICA 4DV6J 4GKKF 4DV7J 3DC2A 1NK5A 1H7XA 1NRKA 3KLEB 1NJIT 4LFBF 4J9VA 3JQJA 2VICA 5LOQA 2EBGA 3OD2A 4M95A 4GRSA 1HWLA 4MFBA 2QLWA 1NDKA 2KFZA 2L08A 4R5PB 3EZUA 3FSYA 3TUZC 2YNGB 3HO1A 4YY3F 1JLCA 1IN0A 3UN2A 1WDDA 2XQCA 2VOOA 2BE7D 2JH3A 3BZQA 2FGOA 2NZ4A 4QIWD 1M5VC 2W4PA 3TQEA 4CDIA 3LPYA 3ZZZA 1YQHA 1NZAA 3KNGA 2NSCA 3MHYA 4Z2XA 4PG7A 1KSPA 3I9ZA 1MROA 3QO9B 2FC9A 3QQCD 3TVZA 1CG2A 2E7XA 1VQ7S 4ZJQA 3NMAA 5LMUF 5LMUJ 1SV5B 1WC6A 2J8AA 3DHXA 4ECSA 1JLBB 4QBUA 3PW0A 3LALA 3MEGB 4UF4A 4J9OA 2L3MA 2HNYA 2E9RX 1TZ0A 4XTTA 4Y65A 5DQHA 1CULA 4DHVA 4TU9A 3UCZP 3US5A 3T1YJ 4OMFG 9RUBA 4CO4A 2QRRA 1A0OB 2B8PA 1OQ3A 2WAQD 4TXSA 3G6XA 4ZJLA 4XPEA 1U6FA 2HIYA 5GAEU 3UD3P 1DTQB 2IM2A 3DYAB 4NASA 4FDFA 1HQEA 1U7LA 5KFMA 4WTYA 2C42A 3J7YU 3GV7B 1O8BA 2KG1A 3NY0A 3IWNC 2XZDB 3BQ1A 2MKCA 4LRAA 2HWHA 4JV2A 1CJVB 3CPWR 3X1LB 3F41A 1VCTA 4X4UA 1SUQB 5BR8F 3EWGA 4ZP6A 2G0IA 2JL9A 2LDYA 3DDNA 3M32A 1MMLA 4UTGA 5B0FA 5E3RA 4OYIA 1S1XB 4C0BA 1VQMS 2G2ZA 1YHQS 4B3MJ 3SCLE 2LU2A 4F50A 3W60A 2ADCA 4LR7A 1FJCA 1RAOA 3DRRA 5AXKA 1NZ8A 3BPDA 3JSYA 3AFGA 2OFGX 4DX6A 3AXKA 5GMKa 1FKPA 5D4OA 2XGPA 2FJXA 4AQYF 2VC1A 3DU5A 2I8EA 1WELA 4KV8B 2EK1A 5F0UA 3DHWC 4B3OB 3DDIA 1VRTA 3BQ2A 2A6MA 2UP1A 5L9XA 4ZITA 1TU0B 1WC1A 4NA2A 2JVRA 3M4XA 4ANCA 4DR3F 7FDRA 4R0JA 4DOZA 1LWEA 4WKRA 3IRXA 2LEAA 5AXNA 4RW9A 4LVOP 5KG6A 4A8YA 1NMEB 3A13A 4LQ9A 2E1RA 3I9V9 4LBPA 4DV1F 3KHGA 1X8DA 3IM9A 1YZ7A 1FEEA 3G6VA 2DEJA 4DL3A 1D9AA 3D0GE 5C5JA 1WNEA 4K4WA 2IVYA 2YKQA 1EKSA 3BGRA 5F8IA 2KHCA 1S1TB 2GVZA 3R6GB 3GIRA 3AA9A 2DH8A 2XY6A 2QLJB 1WEXA 1JB0C 4G6VB 5CH7B 4MYUA 2VPXB 1HD0A 2DNKA 1AT1B 4QR2A 1RISA 4LVNP 3L3CA 3P5BP 1X60A 1SJFA 1RT4B 4PWWA 3I55S 2VBWA 3GFZA 3QT8A 4X4QA 2R7TA 3DRPA 3U02A 3M8SA 1S0NA 3RUBL 1I5OB 4LF5J 1I94F 2V8DA 3HZEA 1GMWD 1HBOA 2B8QA 1VQ5S 4MKVA 4RNNA 2B9XA 1AW0A 1C1BB 1QAXA 3FCVA 3PTWA 5SZTA 2CWKA 3EXCX 3FSXA 1FO1A 3CMAS 4NLXA 3T5LA 4J9RA 5F8LA 4R8UB 3J80Y 4I67A 3K58A 2XWXA 1NKEA 3R5GA 3KLHB 4DR6J 3RRKA 3MM5B 3R5DA 3NNHA 5D8HB 2WBRA 3JXOA 5IC4B 4OQJA 3SIPB 1BQNA 3IA0A 1RUSA 2IJRA 4HT7A 3R5JB 2YNFA 3DXSX 4EUVA 2LECA 2MPUA 1N88A 1Q78A 2MZRA 1LFPA 4RR5A 3MECB 2CPXA 4BC7A 2M70A 2H5IB 2XBPA 2CPZA 2H48B 2F65A 4M5DB 1PJ5A 2ABYA 3PNIA 4F4AA 3ZZTA 3M9NB 4RW6B 3P8BB 3IR5B 3CWJA 2E7WA 1BHNA 3KLGA 3IBWA 3DGVA 4PUOB 4NXMJ 2XTJP 1Q79A 1H74A 1VC0A 2WOMB 1RWNB 1HPZB 3PIOQ 1S1VB 1R8AA 5IXUA 2CG8A 4RUCA 3BBCA 2UXBJ 4NWBA 1U2FA 3BGUA 4GO7X 4C11A 1NSPA 2Z2ZA 1YSJA 4A8KA 3ZZPA 1RAHB 4P7TA 3NAIA 2C2EA 1T03A 3IFEA 3K0JA 3LWLA 5L38A 5ETKA 1FXDA 3DLHA 2KM8B 4LFAF 5KFKA 1SKUB 2BQRA 1M5KC 3OFFA 1U6ZA 2MSSA 2YY3A 3CO0P 2ZKUA 4USWA 4ID5B 1UETA 1NPKA 2KI2A 2HHHJ 1AUSL 1M1KT 3TANA 3C6TA 4LUBA 4CNYA 2L41A 1VISA 4LF6F 4C7QA 4LF6J 4ZLJA 2QG9B 1PYOB 2ILYA 1HKAA 4D3GA 4FYDA 3G6ES 4FYXB 4XIUA 2LLZA 3RYLA 1UAWA 3EJMA 1C0TA 4N8OA 2HHQA 5FD1A 5KG5A 1IVZA 2DVIA 1ZAVA 2HMIB 1HHQA 2ZDOA 4JI2F 2IJNA 4TU7A 2D3O1 1JKHA 2FY8A 5HVGA 2ASYA 1T3NA 4IR1A 3KK3B 4V19J 2M52A 1RBAA 1YG0A 2F7VA 4C8KA 1SH0A 1YBUA 5KFVA 5F9LA 1S79A 2XM3A 1DAXA 2FHOB 4DCPB 3N6LA 2IMWP 1WC4A 3M2UA 1CQMA 3MPYA 2L9WA 4H54A 2F8MA 3C16B 1IXKA 5ETPA 3KG4A 2JFKA 5KFOA 3S1TA 3GV5B 4PWDB 2YQ3A 2MEWA 1RHMB 2O5DA 1T05B 2WW8A 4ED6A 4ELUA 2UUWA 2PI4A 3UDLA 4JI4F 1HQUB 4MH8A 1VJQA 1RHJB 2VPZB 4Q5VA 4X4TA 3ETMA 3GP9A 2F3JA 4NLUA 3A4TA 2P6TA 3OUYA 5KFGA 3M30A 3AA8A 4ZIWA 3RBDA 4FS2A 4IG3A 4O3SA 3PCOB 1WI8A 2LXFA 3VAIA 3MEDA 2RB7A 3MOZA 5F3ZA 4TQSA 1JIHA 1U1MA 3AD8C 2MQQA 4G1QA 1U1LA 4OZ5A 1LEOA 1FCAA 3R7SB 2Z4PA 5K8PA 3HT3A 3R6LB 4HHJA 2HQGA 5ETVA 1XC9A 4TY8A 2DNHA 2AEFA 2DNMA 4KTQA 3CDEA 1Q8LA 1KR4A 3FUYA 5HQMA 1R0AA 1FXLA 3MUTP 3NCQA 3UR0A 2IRUA 2MJNA 3NS5A 2KT3A 4USTA 1Y10A 2D74B 2VQEF 4DL5A 3ET6A 4KHMA 1V5IB 4IH6A 5IOLA 1SPBP 4GO5X 3BV8A 1KQFB 2ZD1B 5D0RA 4OYPA 3RRHA 1U1KA 4H4OA 5C2GA 2VFTA 1BQXA 2W01A 4LF7J 3HX9A 1HI0P 3OVBA 4LRDA 1DTTA 4KO0A 1BY9A 4IO1A 1JXLA 1DRZA 5DZ7A 4HACA 2B4PA 2DHGA 1I1GA 4Z7YA 2HFUA 4PYAA 2OFHX 1WF1A 1TL4A 3HXMA 4MIBA 2BKPA 4F0MA 2ZM6J 1R31A 2DGVA 2VKZG 5HN0A 2NZCA 4YS2A 3CCJS 2DRAA 1GK8A 4C6AA 5KFEA 3OXFA 4A4JA 4CTAA 2LU1A 3OLAA 2JVOA 3UPFA 2WVBA 5DM7Q 3H2LA 4RU2A 2VC0A 2D7SA 3H5YA 3Q22A 4ECUA 4CO3A 3IMQJ 4U95A 3TWZA 4AXJA 1HHTP 5HMXA 3A3NB 5HLFB 5LT5A 1N32J 1N5SA 3ENQA 3CJQA 4HHUA 2RRAA 3RAXA 2OD6A 2Q43A 3V4IB 5C42A 2EEYA 2ZBQA 1VMBA 1VR6A 3AHPA 3D0IE 1IQTA 3MPWA 2XMTA 4JI6J 3QJLA 1HA1A 3DLJA 1SL1A 1UFWA 3Q8UA 2EG2A 5KFRA 5AE3A 4F3MA 3MMAA 4YUDA 4MK8A 5K8OA 1V3ZA 3MCSA 5T7LA 5DQIA 4DBQA 3IG1B 5BYQA 1FDAA 4C3KA 2VHGA 3K5PA 1NSQA 3VR1A 1YJTA 1N5YB 5JVHQ 3PM9A 1HI8A 2HHXA 3EVWA 4QWCA 1ZPWX 2HZCA 2XEXA 3CJ0A 2OPPA 3Q8PB 5HJYA 2OD4A 2HVDA 4USVA 1E6YB 4BC9A 1FERA 2WB4A 3I0RB 1KTQA 1WTFA 1XNQF 3HHLC 4IUFA 2UXDF 3OTOJ 2C28A 2VOPA 3DLEA 4ZPWR 1DQAA 3CD7A 1A6LA 3TEHB 1CLFA 1IJEB 3TI0A 5HK4A 3V6DA 1NEEA 3M6UA 4OZLA 1YRTA 2CNOB 1KEKA 3B78A 1U1NA 3CCTA 4IKAA 3WDOA 2R3VA 3W1YC 2YWKA 1X5SA 4KIAA 3N5FA 2MKIA 2HZVA 2LQBA 1RCOB 3LP1B 1RT5A 3ZZOA 1HNIB 2B6AA 4UQTA 2RKIA 5D77A 4AL6A 1T94A 1HBNA 5HSPA 1MWZA 5GAGU 4OV6A 2HHUA 1OSCA 3JTPA 1S99A 4HDHA 1MG7A 1XMQJ 4Q43A 4YB1P 1WJ9A 3OFHA 3IAM9 4FF1A 4WTOB 4FN5A 2ZZMA 4KPYA 4ICLA 4CLPA 4QPTA 1Z2ZA 2D69A 3UNYA 4UW2A 1N33F 2MKHA 5DG7A 2QEXS 2H4WB 5KT3A 1L5UA 3DM2B 3QZ7A 1Q82T 1S9GA 3G82B 2B51A 2J0SD 1EARA 1JLEB 4HEA9 2UUTA 2XS2A 1REGX 4ED5A 2BANA 5T41A 2MZQA 2OSRA 2Y1RI 3KLIA 2HWIA 3RAQA 1CSJA 1F9FA 1S1WB 1S77D 1HNXF 3K8WA 1S4FA 1KKHA 1JLGA 2E5LJ 4P7VA 2B0GA 2F63A 3PEJA 2JEGA 1HNWF 2HNDA 1HNWJ 2CADA 3OTDA 3U27A 4F04B 2ATCB 1JXVA 3GIKA 1SQGA 1S6OA 2J0XA 3PX6A 3OR1B 2KG0A 2CDRB 4TVAB 3VALA 4XDCA 4B3TJ 3BDEA 4U96A 4YB5A 3IBFB 5KFZA 3GTYX 4CP5A 2ZH5A 3L7UA 1TVRA 2V8HA 5HMYA 2VFSA 1VQ9S 3IM8A 4QIFA 5K20B 2ZBIA 2DGXA 4C0HA 1LW2B 1FRLA 3DKDA 4L3KA 2J7UA 1HNVB 5ETNA 4ECXA 3RB0A 1E6VA 2IMOA 4UT4A 2N4CA 1UJ6A 3KLEA 2ERRA 3QAUA 4WK1A 3LF0A 3RBXA 1X4HA 4YR2A 1BMQB 2QGFB 4RO0A 1XNRF 3HFZB 3R8YA 3R2CJ 3JQKA 1S9FA 2DHXA 2DKOB 1KFSA 4IFYB 2C2OB 4DV3J 5IT9Y 1SXLA 4R5PA 2YNGA 1C0UA 4XAKA 4PWUA 4LSNA 1EQ0A 2MLZA 1X4GA 4CLKA 2RD5C 4PPDA 2VBYA 3SFGA 2BV3A 3UNGC 3H40A 1HL6A 1O51A 4I68A 1Q8IA 2I0XA 3Q8QB 4RL1A 2DO0A 3SFUA 1N5QA 4NI2A 1CC7A 1RT1A 4Z37A 1GNKA 4JYAJ 2HBYB 5B0DA 5A2QU 4OI4A 2Q3PA 3DOLB 4QIGA 2AYMA 3RGIA 4B9NA 1SV5A 1TR0A 5HVFA 1RWXB 4P75A 4Y0FA 4PXDA 1U48A 4JI0F 2DTJA 1OY8A 4HTIA 1M5OC 2OPQA 3Q8YA 2DT9A 3SSQA 4CI0B 4C8LA 1SJ1A 4NLSA 3H25A 5L8RC 3CTRA 2RHQB 4CLSA 1QE1A 3ZZYA 1Q81T 3TJ9A 3Q8VA 1UVIA 5DGAA 1DURA 1HHSA 1T02A 1FDDA 4FNHA 3GSIA 2XC9A 1UL3A 3QGGA 1VJWA 3TX8A 1YBAA 1YBTA 4DFPA 2DR6A 3QT7A 2DHAA 1IKWA 2C3YA 4NYOA 3DOKB 1TL5A 4JI1F 1CS4B 2XMJA 5EHHA 2RUSA 3OXLA 4YN3B 2PSZA 3HHEA 3E01B 3J7AN 4KJIA 1RAGB 3VTIA 3TA1A 5KFJA 4ZP8A 3LP2B 1KLMA 2H54B 5D3GA 2LXIA 3G6YA 4QIVA 2PFDA 2KYZA 2GVDB 3K2YA 2HKEA 2HBRB 3GIIA 4ZN1A 2MKJA 2QSWA 3CXCR 2LMIA 3ZC4A 4ZMMA 4DFKA 4NEZA 3EDRB 4DV2J 4JI8F 3SDEA 2AV5A 2JC0A 4JI8J 4O4RA 3KFWX 4X2BA 1O6XA 3MGJA 1LOUA 1D8YA 1R6VA 5IC6B 4B3OA 2UVVA 2R2SA 3E8OA 2B9YA 2ZUGA 3H20A 2CJAA 1B0TA 3NWGA 3RR7A 2IRYA 3C19A 3DDKA 4K4YA 1YK9A 3M8WA 2N7CA 4QPXA 3FK4A 4NLWA 2YNIB 2YKAA 1VQKS 1AA1B 1T9UA 2XCPA 1Y5NB 1TP7A 2E5IA 1OJ4A 2VJUA 1NK6A 4P10A 4LJMA 1S72S 2WCXA 3MF5A 1JLCB 5SUHA 1VBXA 1G4CA 1KFDA 2XMAA 1NH7A 3T5KA 3C6UA 2X3DA 4LR8A 3MOJB 1K8AT 2NPIA 2ZNYA 2C2ZB 3M8QB 1VRUA 1S97A 2X1FA 1MROB 1CJUA 3W2VB 1APSA 2KJVA 3KKFA 2GV1A 4NXNJ 5F8NA 2PGCA 1XBWA 2FGCA 2E44A 3QWUA 3EPIA 4X4NA 1HBMB 3BS9A 3H7HB 1IBLJ 4WE1B 2HNYB 3HFVA 3M8PB 2V2QA 2R2RA 4LBHA 4B9UA 4DPWA 4QYRA 1U49A 1UCNA 3N79A 4DJBA 5EDWA 4CT8A 3CJ8A 4OIXA 3IWXA 5KFLA 1ZTTA 4ZCMA 1GMVA 1RHUB 5F3TA 2XYHB 1UEUA 1VQ4S 5CABA 1U1PA 1MN7A 4M5MA 3ONQA 1NHUA 1R0BG 5FDLB 4F3QA 1VS3A 3H2UB 1AUDA 2YKPA 4R8UA 4BCAA 1W7WA 3MTKA 3M1VA 1L3VA 1T3OA 3M8YA 3QJPA 3KLHA 3MM5A 2HQFA 3SCKE 4HLBA 4BLGA 4LF9F 3UE2A 1RJJA 1P9YA 1GTHA 1KN6A 5CYMA 4W98A 1OSDA 4I7FA 4WPAA 2DGTA 5GAHU 2OJ3A 5KT6A 2W9CA 5J2PB 5J1EA 2BE9B 1VQOS 3HI9A 2IC3A 3KTQA 3CJ2A 2NYIA 1XN9A 1V3SA 2JEIA 4USUA 2W1BA 2GMHA 2NUUG 2M88A 4RBTA 1PYSB 4KSEB 1LFWA 1RACB 2QJ3A 2MZSA 1RTDB 3DRRB 3ZXWA 1RAIB 3VQTA 4PUOA 1GXUA 3JTNA 4DQPA 3MFHA 1FKPB 1KP6A 3D3BJ 1REVB 3NBPA 5IM0B 3TNVA 4B17A 4A8XA 2VDIA 1U09A 3SCJE 3GLJA 1VRTB 1ELOA 2AJ4A 1HPZA 3CD0A 3OLBA 1TV6A 1S6PA 4RJVA 1IKVA 5IQ6A 2OKQA 3K7RA 1U1RA 4EEYA 4ILMA 3OFGA 1RWVB 3IRXB 2MB0B 4RW9B 3QFWA 5IWAF 5ETMA 1FWLA 5IWAJ 3H4DA 2OI2A 4I2PA 2XMMA 3I87A 4CLTA 3EPGA 2OPSB 2CQCA 5T14A 5CXTA 4HHHA 3ZO7A 3S6EA 4O3QA 2G1DA 4DR1F 2XS5A 2RQ4A 2A10A 1FKAF 4M5KA 4YHHJ 4G65A 3OVAA 4YP3A 2YH1A 2C22A 2YVSA 3W65A 4ZVTB 1Y5LB 1R0CB 4DS5A 2GVZB 3AJ1A 3M2RA 3G2XA 5ETOA 2GJFA 4YR3A 4DSFA 3PW4A 3R1HA 3HLUA 4DPXA 4CWBA 4EWTA 2AEJA 1JMTA 1N36J 1GQEA 4J9LA 3QGPA 3HFKA 2IPOB 1HNZJ 4K5RA 4O44A 2J8SA 3CVKA 3H5UA 5KOXA 2J0QD 1YJUA 1DZ5A 3NGRA 1QTNB 2WRMA 3ENAA 3DRPB 3GIMA 3J7A1 3KK3A 2W2OP 4OI2A 5ETSA 3W5YA 3PFOA 3GILA 4C3MA 3DRYA 1IM6A 2HHSA 2LYVA 2NXNA 1YGYA 1HBOB 5DDPC 4TLRA 2BJ3A 2APOA 1WDTA 2UUBF 2UUBJ 3TRGA 2VZ9A 1TAUA 4GKJF 2BM1A 3C16A 2ILZA 1LV5A 1M0SA 3PRDA 4CLFA 2LQ9A 3DI6A 4PG4A 1ZZFA 5A8KA 4USHA 4NLOA 2ZHAA 3HHLD 4USMA 3F73A 2XSJA 3IBCB 3CCWA 4CRJA 2MY7A 2R8KA 3MMCA 1BQNB 2XMWA 4U7UK 4LF2A 1QSSA 2B9WA 4IYQA 4WCEQ 1CJTA 2M8HA 5KFUA 2GNKA 2EKNA 4X4SA 1FX2A 5A2QY 1AZSB 1M5PC 4NLYA 4MTPA 2ZZNA 3Q24A 3C14B 4DEZA 4C97A 4EFAC 1NK9A 4ZOSA 2GJIA 2OMLA 5AXLA 4OYOA 4F4KA 5D4NA 4BS2A 3AT1B 2KJWA 3CT9A 3UD5A 3KLGB 3QT5A 2B56A 4E0DA 2IM3A 4FNIA 4B9LA 3CIZA 2UV8A 2VDHA 3BPSP 4BDPA 4DZDA 2OAUA 3K89A 3MMBA 3UCUP 3QZ8A 1I6JA 4JV5F 3OTBA 1YDLA 1H38A 2H1YA 2K3KA 1HARA 1G7CB 1VC6A 4ZCKA 5KG7A 4C11B 5F8HA 3GR1A 2DNYA 1N4LA 1S6QB 3L09A 1TK0A 5L39A 4FKYA 4GVBB 1SJRA 4X64F 4X64J 5ETQA 1JWWA 2J6UA 1T03B 4DUZF 3S8SA 3MEKA 4KE5A 1PC4A 2FUG9 3H2VE 1WF0A 1SJ3P 3ITHB 2D41A 5BYSA 1F2HA 1H7WA 3PJ9A 3V6HA 1X5OA 2GIFA 4J9MA 1N5TA 2LP4A 3OL8A 3Q86A 4QR0A 3C6TB 1TKZB 1JX4A 2F1FA 3FNNA 5D78A 5I3PA 5GMDA 4CO2A 2IJFA 2POKA 2AGPA 3HVWA 2MXYA 3SQGB 2FLNA 2RVJA 1N52B 1UA0A 4I0WA 2YKNA 1FFGB 1OY9A 4X62J 1R6YA 2CRLA 2VBXA 1X7VA 1X0PA 5E3CA 1MLAA 3PXGa 2XULA 4DS4A 2R8IA 4NLPA 1T95A 2YWEA 1J5EJ 2K7KA 3JYTB 4ZLPA 4JI5F 2CZVC 2XI2A 5DQGA 2DNOA 3AB2B 1B7FA 1UVMA 2NYHA 2ZBPA 3M2UB 4JUZA 1EKRA 2W9BB 2YTCA 1FWPA 4WXWA 4DU7A 4TYAA 2DHSA 3CO9A 3FZBA 5K9FA 1EIYB 1PYTA 4ZVOB 1BQMB 3OTEA 4KB7A 3I5BA 5B7WA 3MM7B 1RA7A 2J9CA 3BGFA 2KHDA 1FD2A 4K2JA 1AFJA 3LGMA 2X1BA 2COLA 2HRTA 3WIUA 2ZH9A 2O1PA 4PXEA 3NOGA 3VGVA 1EZZB 3OUYB 1RDRA 2PEHA 3M30B 3KHLA 2ZVSA 2EPIA 4L72B 2HS4A 4IG3B 3CCMS 5MAOA 5FIIA 4DV4J 1ZAWA 3FZ2A 2O3DA 2ALYB 3AOAA 4A8MP 4CYUB 4G1QB 3H4BA 4IQMA 4LSZB 2DJWA 2GCFA 2ACYA 4I64A 3I0RA 2ROGA 2J5AA 1HFEL 5A6WA 3MWBA 4I6AA 3O1LA 4ZVUB 2P5VA 2VQFJ 3CNQP 1LQ9A 2BEFA 4TY8B 3ZTPA 2H4YB 5H9EK 3NAHA 5H9FJ 5A8WA 1G6BA 3MDFA 1R0AB 2XB2D 4P2MA 2I1RA 4TN2A 2HK3A 4ETZA 5G0RA 4EI2A 2IA0A 3AH6A 1V9OA 1Q5VA 3CIMA 3BH7B 3BSAA 2VG5B 2FLLA 1FT8A 4OJGA 2N4DA 3V6KA 3PX0A 2IY5B 1XEZA 4OLPA 3CJ5A 2HVZA 4OYAA 5HAOA 1Q0NA 3WIVA 4DUYF 1SKWA 3K5OA 4WZMA 4KO0B 3MZIA 3T41A 1F0XA 1NH8A 3MAAB 3HHLB 1MWYA 3KHRA 4DCJB 3NGUA 4C9DA 4HACB 4C2MA 1NKBA 3NEKA 4P52A 3O5TB 2B9EA 1A7GE 4B3SF 2R8JA 1ICEB 4ECYA 4TLQA 4NZ6A 3IR7B 1ZH5A 4ELVA 2JLGA 2KYXA 2IVMA 4UUWA 4KHRA 5KOWA 1K9MT 3PY8A 3MCNA 3TAQA 4WFYA 1HWKA 4DL6A 3G8SA 1SB6A 3OL7A 4CTAB 1J2VA 4DR4F 1RTJA 4WYLA 4DR4J 5KFBA 4N56A 1NXIA 2HVEA 1JLEA 1XMOF 2O66A 1KHWA 3P3DA 1EX8A 5IQQA 3C3LA 2QMUB 2ZE2A 2AU0A 3A8KA 1IR2A 4Q2LA 2G0CA 2RE1A 3PYEA 2V6AA 3HD2A 3WC0A 3VAHA 3QWPA 1TKTB 1QSLA 4CLLA 2ACMA 5FJ4A 4YQWA 2GS8A 1YITS 2KT2A 3THTA 4UOHA 4ZN3A 1WKKA 4X66F 3VAJA 3LQVA 1N0VC 3N6MA 4RPFA 1AROP 5T7LB 1NKCA 1ZYQA 2WW4A 4PG8A 3R7NB 3LPEA 3PHEA 4ECTA 3BBBA 2CNNB 1RHQB 3D67A 2IM1A 2B4UA 2KFNA 2MGZA 1YJVA 2BZ2A 3G4SS 4OX9F 4TU8A 3BSCA 2OPPB 4I6YA 4OX9J 2CJYB 3LWMA 4R0EA 1JJCB 3GG0A 2N3OA 3N4WA 1LW2A 2RQCA 3OT9A 1C1CB 5DDQC 3BGLA 1URRA 2UV8G 4TYBA 3DRXA 1NK8A 1JNRB 5EWFA 5L1JA 3DLEB 3V6JA 4WYWA 1R89A 2VKRA 1FFSB 4DR5J 4IFYA 1DY3A 3W7BA 3V6DB 2GGPA 1VOMA 4DN9A 2EFGA 1DHMA 4I1TA 4IH5A 2LDIA 2V2VA 2ZOGA 2IAJB 3KDNA 2YQ1A 5LL6d 3E2EA 1RT5B 4DL0C 2B6AB 2KU7A 4DLEA 5ETTA 4QWDA 2RKIB 1S49A 3BKUA 2IYGA 1ZM9A 4ZPAA 4WU3A 3HKZD 4WU2A 4QZVB 2C2MB 2DNLA 3DLBA 4LF8J 2VFRA 4LIWA 1W26A 4Q0BA 4M5JA 2MKKA 4URSA 3V4MA 3CD5A 2DR5A 2IBOA 4NYZA 1FNXH 1DJ0A 4E98A 3KMSA 4ICLB 1QAIA 2YQ0A 4GVLA 1NB2A 4N47A 3NLCA 2RH3A 2CPIA 1TTHB 3CE8A 2DO4A 3OPKA 1TK5A 3PDNA 4WF9Q 2DXFA 3JQMA 4ZP9A 4KHPJ 4I2QA 1O5JA 2V9WA 1H2VZ 1OIAA 3FMWA 3CJKA 5AT1B 1K47A 3FBBA 4Y3CA 4WFZA 4EGLA 3KLIB 2L9DA 2RDDA 5I3UA 4YR0A 3ZZRA 1S1UB 1S9EA 2MSTA 3TAMA 5RUBA 3DOKA 1C4AA 1CS4A 2MQMA 4MK7A 2C2NA 1AB8A 1Z2LA 4W4MA 4DSJA 2HVIA 2CAJA 1VQPS 3LP2A 2RF2B 2HNDB 3TVYA 3SCIE 5HROB 2CPDA 3RB3A 2R2UA 2AW0A 1FVQA 1CEZA 3PR4A 4FXVA 1WEYA 1PJ6A 2MJUA 1N34F 1UWBA 1YWXA 2XLJA 6FDRA 2HNZA 3HZGA 4C8MA 5H9EJ 3GCXP 2F9JA 2Q6BA 5JUMA 2L9NA 2W2QP 3QRPA 2UVWA 2ZKTA 3T9ZA 1TVRB 2HVHA 4ZVGA 3HSDA 5E41A 3UQSA 2KXFA 3RBZA 3J7YI 4YEAA 3VZIA 2P9CA 4EK2A 5D0HA 2UU9J 3AXMA 1U4BA 2AGOA 1QTMA 4DQIA 2CQ1A 1A9NB 4DV7F 1RB0A 4KGVB 2ZC4A 5H1SV 1SCJB 5HP1B 2FTRA 1E6VB 4ANEA 4C8OA 3FBFA 4I56A 1HR0J 2YX7A 2YNIA 1FTCA 2XGQA 1FEHA 2ZJQQ 4KH1B 2FC8A 4OZ1A 3P4UB 4PQAA 4O3OA 1PCAA 4OZNA 3M9MB 1C0UB 2AZ3A 4LSNB 5D0EA 2LQJA 4WFNQ 1H2TZ 3L9ZA 4F7VA 3HT0A 1ROFA 3I31A 1S0MA 3MPUB 3FEXB 3C46A 1PSDA 3NOCA 4NEYA 3JAMU 2BMBA 1J27A 1MN9A 4DL2A 1X4AA 2GIRA 2BQUA 2BQ3A 4NI2B 2MYFA 4KFBA 3M8QA 4QR1A 1RT1B 3CGIA 2DIUA 2HG4A 3W2VA 2OEJA 2IVFB 1F3VA 2D9PA 1XWLA 4ZDNA 1OPIA 4KRWA 3BBFA 4X65J 3KJFB 3GJTB 4NCGA 3BR9A 1JLQA 3W64A 1HBMA 2ROPA 3QPIA 4P9SA 4Q8FA 2V9KA 4ZLNA 1R8CA 4J90A 4WE1A 4IOAQ 1UFLA 3F0NA 3M8PA 2OPQB 1TELA 4WP9A 1D3WA 4CQ1A 3HVTA 2DNNA 2DK2A 4Y2AA 3T1YF 1QE1B 2FZGB 4HH1A 3FCWA 2B7CB 1NNDA 3H8YA 2V67A 2CUYA 2XHCA 1UA1A 4ZK7M 5FDLA 2V50A 5HANA 1KVKA 4N41A 3H5XA 3MM9A 1Q8BA 1VQLS 1CQNA 1Q7YT 3VF0B 3L7PA 3MAHA 2VG6A 1K0TA 2XLKA 3M8ZA 1YRUA 1IKWB 3G8TA 2BJEA 2EK6A 4ALZA 2PA8D 3BDPA 4NA1A 1FF2A 2IHR1 1RTHB 4O4GA 3TZZA 5J2PA 1KLMB 1F1BB 3OW2R 2NPFA 5D3GB 3KG0A 3ZFVA 4B3MF 2OSQA 2F8EX 3O8WA 3ILOA 1VBYA 4NLDA 4FBUA 1XR6A 1RTDA 4ES3A 1H73A 4XDDA 4B3RJ 1QD1A 2BJDA 4E8UA 3SDEB 1REVA 2DNRA 4RW8A 4WKYA 3KJNB 5IM0A 2Q66A 5BYRA 1FDBA 1R7IA 4ZPTR 4URQU 7AT1B 4NLTA 2VONA 4A8WA 4OZ3A 1T8EA 2Y1IA 2D3UA 1UEKA 3RB4A 2IA6A 1SIZA 1RXOB 1TUWA 3FC9A 1VQYA 4V19X 2C3UA 3I4HX 2X1AA 3GFYA 2RU9A 5KFHA 3OV7A 2VIHA 2QMWA 3F56A 1FA0A 1S59A 2OPSA 2FJDB 3OBIA 4LBIA 3D1OA 4DI6A 2KM8C 4M5HA 2NXEA 3UDVA 1SL2A 4B9VA 4S0MA 4ZLLA 1YI2S 2J9DE 4XO0A 2MY8A 4KGXB 3C6UB 3TZXA 2F4FA 4IFVA 1VRUB 3VCDA 4KPCA 2GHWA 1CJUB 3GYXB 4CLWA 1NJYA 3G9CA 3GZ7A 2MKYA 2WSCC 3CDUA 3CMQA 3MD1A 3PW7A 4NCBA 1JJ2R 2ZH7A 4UQGA 3D28A 3VAKA 1RTIA 3CJ3A 2JEFA 3ISNC 3W5ZA 1EB0A 1MSWD 2LCWA 1QUVA 1WOPA 5M2RA 2RILA 4MYTA 4LF5F 4Z7CA 1S57A 3ILLA 3MM8A 3IR6B 1RAJA 3NGSA 5CA5A 4DQQA 5CHCB 4FF4A 1U24A 4Q45A 1NHKL 2HFOA 4DMZA 2EWHA 3M1VB 2IDLA 1RLCL 1M1HA 1YJ9S 2K06A 4DR6F 1LXJA 1UVLA 4ILLA 1KHVA 4JI7J 5AE1A 2XY5A 4ZPCA 1KOOA 2D3OR 4OHWA 3HHKA 1QAYA 2KXHA 3LGHA 5CYMB 2HQDA 2HQ3A 3MR2A 2OO4A 4I7FB 3DU6A 1SJQA 1T0TV 1V5VA 2YWFA 3H98A 2N3LA 5IZHA 2W9CB 3H5SA 2Z0GA 1OQ6A 3CCZA 2HQCA 2KH9A 1KQSR 4ZVFA 1AZSA 2ZJRQ 2CQ4A 2QLXA 5J1EB 3GONA 3C14A 4O3PA 3BN4A 2IC3B 3CDAA 4Q44A 4DCOB 1F2GA 2W2PP 2HSEB 4P71A 2IRXA 3RB6A 4UY85 2J7KA 3OHAA 1TKXA 2FHKA 4NXMF 3AQPA 2CQBA 3NBPB 2VG7A 3U1LA 3NP5A 2OEMA 2GQCA 5E0OA 3FCHA 2UXBF 1BD6A 1TV6B 1S6PB 1IKVB 2RS8A 3R2DJ 3RAMA 2XYPB 1FJGJ 1S7IA 4NMXA 1S6QA 5LSLA 4GVBA 2R7VA 1VQ8S 2QL9B 2CG4A 4K7QA 3QGIA 4P6QA 4I2PB 4Y2CA 2DXDA 3BM7A 3ITHA 3UVJA 2BJ1A 1X5PA 2HFZA 1KQGB 4CLZA 2ADBA 3I56S 3KLVA 4P2XA 3RW7A 1XMBA 4R25A 2DH7A 2G2YA 3KHHA 5HI7A 3ZZUA 2YWGA 2HHVA 2HHHF 2B5JB 1UZDA 2OP5A 2BE2B 2E1PA 1TKZA 2MQNA 4CNZA 2HAIA 5DJBA 4ZP7A 4CCHA 1L3UA 3IRWP 2EFPA 3M2RB 3G86A 2Y1JA 2NQPA 3KYLA 4EZ6A 4ECVA 1UVKA 3SQGA 3I82A 2W24A 3CD6S 2AYBA 2XO6A 4CO1A 1GT8A 1HLWA 1V6HA 2CJKA 4FBTA 4OJ1A 4O44B 1WHYA 3OHBA 4MT1A 1WTBA 3GU0A 4LREA 1UKUA 2IYIA 2GW8A 1P1LA 1EP4A 3NNCA 3DCAA 1K0VA 5ADZA 2KVIA 3FEYB 3JYTA 3B54A 1NUEA 5A8RB 2BW7A 4D3HA 3K8VA 3NS7B 4K4ZA 1NHVA 2FDNA 1U1OA 1SC3B 2W9BA 3HHDA 2JDJA 1JNZB 3K5MA 3OSPA 3DI6B 2PMHA 3FRZA 5A8KB 2ZH4A 2MTLA 4ZHRA 1IWGA 1BQMA 2CPEA 2W2NP 5BJRA 1J5OB 2QL7B 2CJXB 2XSJB 4K4XA 2XCAA 3JAMY 1N6QB 3MMCB 3MM7A 2RDJA 1RI7A 2JSXA 4ZS6A 1CJTB 2YPZA 4U7CA 3OFEA 5ITHA 2NXJA 4DPTA 1WSVA 2QIFA 4IG0A 2XLIA 4K8RA 1IKXA 2Y8WA 1VI7A 1KRPA 3N6NA 3BH6B 1SC1B 5E7OB 4V1Ak 3G96A 3FGVA 1F9EB 4PABA 3PW2A 2NS1B 2JC1A 1WSRA 5A6PA 3ILJA 3PW5A 4ZPVR 4IRDA 3BO4A 4CYUA 4O0NA 5DG9A 1ZM2A 1KD1T 2WBMA 4Y2MA 3MMBB 4HDGA 2MQLA 1H6KX 1IKYA 4F4YA 4F2SA 2R8GA 3U7JA 2AP6A 2R7RA 4QCLA 2BDPA 1T11A 2LKZA 2ZVIA 2UUAJ 2FJAB 1F5AA 3IAS9 3CCSS 3CCQS 4ZPBA 4WIQA 4JBCA 1G3OA 3AY0A 3VHQA 1YX2A 2VG5A 2YKMB 4DF8A 2AD9A 3CJ4A 4CIOA 2DITA 3TUIC 3GWCA 1K44A 1WKLA 2DIVA 2LQ5A 2JFDA 2JZ5A 4LF7F 1VK8A 1SKSA 2D1CA 2UUCJ 1Y0HA 4OI0A 5ETLA 1M90T 4F25A 3EGNA 1RYSA 3MAAA 7FD1A 3HHLA 5K8NA 4C8NA 5J2QA 3W2WA 4AE5A 1SC6A 2YPYA 3SBMA 1FTRA 3T1HJ 4RUBA 4KGMA 1Y3KA 2RJZA 4GMKA 4DV5F 4DV5J 3JSMA 4F0KA 2M0GB 2ZM6F 2YKNB 2ATLA 4UOFA 2PFFB 2DGQA 1YKWA 2CWXA 5KFFA 1V3RA 2VA2A 3PZPA 3QJJA 3D9BA 1B4SA 1F5BA 4OZJA 1P6TA 3GJRB 2CDQA 1QJHA 3J80U 4CH0S 1VIOA 1T7PA 1FE0A 5KFPA 4UY8T 3RG6A 4CM0A 1QM9A 3PJXA 1ACMB 2BVZA 3MTJA 5FLXU 2HS3A 2FD2A 1MNEA 1N32F 4B08A 1FRKA 2DHHA 2I6WA 2C2RA 1Y4ZB 3W8GA 1YVFA 3RJMB 1TKTA 3KUHA 5GAGI 2LQ8A 4J9UE 3GYGA 3CF5Q 3QIPA 3NRBA 3GMGA 3BSNA 4JI6F 2H5JB 3UFCX 1KDNA 1LK5A 1LWFA 2V63A 1X9SA 2VL1A 4C3LA 2HS0A 5HO4A 2V94A 1L3SA 4DL4A 5CQGA 3R3TA 1U1QA 1S10A 2M8DB 3K5LA 4G3IA 5F41A 5U47A 3DMJA 5AJ3F 3BB5A 2DGWA 3BR8A 5AJ3J 2EI5A 4AL5A 2FZKB 4QJVA 1C4CA 3PG9A 1MW7A 3B6BA 3C15B 3CCUS 1VRQC 3K59A 4G1IA 5ETRA 1F3FA 2R42A 1C1CA 3KK1B 3W9IA 3OTOF 4A8SA 3A1YG 2VPYB 1RT6B 2FB0A 2F4VF 3PR5B 1W2BR 4LT6A 2F4VJ 1IR1A 1LK7A 2B43A 3MCOA 5K14A 1Q86T 1IBKF 2QN6B 1IBKJ 1D0EA 2GZOA 1PAUB 5D4PA 2D9OA 4CH7A 5A8WB 3HSGA 5B0BA 2GJ2A 3RR8A 1WF2A 1DQ8A 2NXCA 3GV8B 1P9QC 2YH0A 2DB1A 5G0RB 4UOCA 1JQGA 4O0IA 2ZHBA 5J1NA 4BWMA 3JTOA 1Q4RA 3VAGA 2BM0A 2Y0BB 2Z30B 1C2PA 4F36A 3QLHA 5DLGA 4RNOA 3KK2B 1GMUA 2IAJA 3CCES 3TA0A 1WOSA 4M8LA 2CPJA 1CVJA 2F5GA 5D15A 4AT1B 4PZVA 4OL8A 5DDOC 1F9HA 1D8ZA 2LFVA 4RUHA 4EYHB 5B09A 3NL0A 4HYKA 3I0SA 1XTZA 1S5ZA 2LVWA 4EZ9A 4GKKJ 1Q53A 1ZBTA 2QMXA 3ENWA 1XMQF 4EYIB 3L95X 5GVQA 3ADAC 1O0PA 3NNAA 4LFBJ 4Y00A 5DM6Q 1FVSA 1PGZA 3KJQB 4BBYA 5KTQA 4ED2A 5IV3A 1YJNS 2WK4A 1KTVA 2QYCA 4YY3J 1RTJB 5EX3A 1H2UX 3M6XA 4M63A 1KWMA 4OI6A 4Y2KA 3DGPA 4PR6A 3J81j 5KFIA 1TFYA 4CLUA 2ZE2B 4QU7A 2KVQE 2DPIA 2DR7A 2C3PA 1LWCB 2OH2A 3SYZA 1S1UA 3UW1A 3KOAA 3TJAA 1IBMF 2RSQA 1MU2A 1RAEB 1EHWA 1IBMJ 3ZTRA 2E5LF 2DR8A 1RQ0A 2DCUB 2WVCA 1K1QA 3LOUA 3PACA 2KRBA 2RF2A 4QWAA 1RT2A 4ZJOA 5HROA 2FJWA 2VA3A 5DETA 3BSOA 4CO0A 3ISZA 3D6HB 4RW4A 4ANDA 1XR5A 5HL7Q 2FQQB 3PEHA 3N01A 3UCGA 4DV0F 4B3TF 1X4DA 3HF5A 2B3TB 4DV0J 3PV8A 1SH2A 3OXGA 4RW7A 3GSDA 2MGZB 4HI2A 3RW6A 1NPPA 3Q2SC 2V8GA 1M5SA 3IXQA 2KFYA 3FSIA 2EFVA 5DZ6A 1HYSB 1VGYA 4JV0A 2FPHX 1TAQA 2AYGA 4NZ7A 3J81U 4Y6IA 1ZM4A 1PO6A 1N8RT 2R7UA 4J5OA 2RUGA 5HP1A 2FLOA 2ZUAA 4F8RA 2RRNA 1WORA 2BRKA 1XIQA 3T9NA 1XQIA 4RNFA 5BR8J 3Q83A 3ISND 1QVGR 4OX6A 4N8NA 2FVSA 4DV3F 2HFSA 2R7QA 3DOMA 4PEOA 3WX4A 2ROEA 3NS6A 2GGPB 1IM4A 2GHVC 1B7YB 1BGXT 4A46A 1UFKA 2V5HG 4I69A 3AD9C 2H51B 3DLLQ 3TEGA 1RWUA 2V4JA 1U26A 4AXIA 3HVAA 3M9OB 1RWOB 3CJSA 1BWVA 4IOBA 4AQYJ 1HWJA 5HMZA 2AGQA 2E1AA 1S76D 3MPDA 4ECRA 4JYAF 2B7BB 1HW9A 1PIEA 2OGUA 5KFSA 4CO5A 4DR3J 4ZKAA 1NO8A 4Q0BB 1FDNA 3EM1A 2J6SA 2FJVA 2N82B 3T19A 2M7SA 1NJZA 2GAHC 1U2RA 2A2CA 2HGNA 2A18A 2VB6A 1PKUA 3HMJG 4DV1J 3VQSA 5J2MA 2AKWB 2HEKA 3HP6A 5KG3A 2HGMA 2B4VA 1UMJA 1Z4UA 4W90B 3JSRA 1LW0B 1VHIA 2HAFA 2DGUA 2QLFB 2CQIA 4I2QB 1R27B 1Y11A 1QSYA 4NE9C 3TARA 2HHPA 2R7OA 3CJKB 2DYAA 3W9JA 3KLFA 2IBKA 1VBKA 1HWIA 3HKWA 4IRCA 1RT7B 4LSLA 1XK8A 5I3UB 2OPRA 1MMNA 4DR2F 2GX8A 4DR2J 1S9EB 3TAMB 5KT2A 4LIRA 2GMJA 2MQ8A 3W62A 3PVXA 4ER8A 1RTHA 4QWBA 2L48A 2H5EA 2AX0A 3THPA 3TYTA 2GMLA 1GH8A 2CA9A 1I94J 1UWBB 2UXCF 3EXYA 2UXCJ 2CQGA 3FRYA 3HD1A 4ECQA 2HNZB 4DV2F 5DLFA 1BC6A 2MQOA 2EC0A 1DFDA 4M1KA 1IBCB 1Q16B 3L4BC 4ZPDA 4DDFA 1WHVA 4M5LA 3MEEA 5EUHA 4ED1A 5AE2A 1UVJA 3BKFA 1UJ4A 4ES2A 2PIIA 4IOCQ 5KFAA 5FLXY 3NGDA 3TX0A 1YZ6A 3AD7C 3EVMA 2HHTA 1FNMA 1TL7A
chains in the Genus database with same CATH topology
1ZPWX 2HZCA 2XEXA 3NLCA 4J9KA 1EETA 3CJ0A 2RH3A 5GAHI 3BO2A 2OPPA 4JI7F 5KFCA 2CVIA 2CPIA 4NLQA 3Q8PB 1FD8A 2I9SA 1U45A 3CE8A 1TFWA 2DO4A 2H9ZA 2AJFE 4HI1A 3OPKA 1C0TB 4X4OA 2OD4A 1WEZA 4DSEA 1TK5A 4CZCA 3FQKA 1F5CA 3PDNA 5JXSA 4WF9Q 1E6YB 3LUYA 4BC9A 1FERA 4LF4F 2WB4A 3I0RB 1QY7A 1KTQA 1WTFA 2DR9A 3HHLC 1XNQF 4ZP9A 1S0OA 3DN9A 2K1RB 4I2QA 4IUFA 3AAWB 1O5JA 2UXDF 4DQSA 4M94A 2C28A 2V9WA 1P1TA 1H2VZ 2VASA 1OIAA 3FMWA 4MAKA 2DD8S 2M4MA 4RNMA 1JKHB 3CJKA 2K7JA 2VOPA 2BW2A 2BXJA 3DLEA 2W9AA 4ZPWR 5B08A 1DQAA 2HLUA 3CD7A 4PCQA 5B0AA 2ZH1A 1A6LA 3OJUA 3MXHP 4Y3CA 1NK4A 1WD6A 4WFZA 1CLFA 1H0HB 4EGLA 4N76A 1ZAXA 1IJEB 3KLIB 3PIPQ 2PDAA 2L9DA 2KN4A 5I3UA 3CSKA 4KKOB 2HLTA 4YR0A 1X9MA 3ZZRA 2RNEA 1S1UB 2Q6CA 3TI0A 1SKRA 3V6DA 1S9EA 2MSTA 1VBZA 3TAMA 1NEEA 1C4AA 3DOKA 3M6UA 1VQ6S 2MQMA 4MK7A 3MD3A 4KFBB 5LSOA 4OZLA 1NJWA 1YRTA 1Z2LA 4DSJA 1KEKA 3B78A 1U1NA 3CCTA 4NXNF 2R8HA 4IKAA 2HVIA 3JSBA 3WDOA 1WG4A 1VQPS 4TQRA 3UI3A 5I42A 3GB0A 3LP2A 3RTVA 3T6BA 2RF2B 2HNDB 5HLFA 2ZOFA 3TVYA 4H4MB 1OPZA 2YWKA 3SCIE 2CPDA 1X5SA 5HROB 2R2UA 3RB3A 4KIAA 4NCGB 2AW0A 3AB4B 3N5FA 2MKIA 1JLQB 3AQOA 5HBMA 1FVQA 3T5JA 1CEZA 2HIQA 2LQBA 3LP1B 1N56A 1RT5A 2GHPA 4FXVA 3PR4A 1WEYA 4C8ZA 2MJUA 2MQPA 1N34F 1IBLF 2JEJA 3ZZOA 1HNIB 2B6AA 1UWBA 4UQTA 2RDIA 1UVNA 1YWXA 3V4IA 4MIWA 4MKAA 2XLJA 2RKIA 3CC4S 5D77A 4AL6A 2OIHA 3S01A 6FDRA 2HNZA 3HZGA 3M6VA 4C8MA 5H9EJ 1FJGF 5KFNA 3HVTB 1N0UA 3MM6B 2F9JA 1T94A 2Q6BA 5JUMA 1HBNA 2L9NA 1MWZA 2UVWA 5GAGU 2ZKTA 3RZAA 3T9ZA 4RZRA 3SSSA 3Q8SB 2HHUA 5DGBA 4LMZA 1OSCA 1TVRB 2HVHA 4ZVGA 5E41A 3JTPA 2V4QA 1S99A 2OMOA 3TP2A 5L1IA 4HDHA 4MKYA 2GQ2A 2NREA 3U1MA 4Q43A 5K8MA 4DG1B 2LA4A 3UQSA 2KXFA 2MKSA 3J7YI 4YB1P 4YEAA 3VZIA 2R7XA 3IG1A 4XPCA 2P9CA 2HHWA 1U4BA 2AGOA 1QTMA 4DQIA 2CQ1A 1A9NB 3UWTA 4RBVA 4DV7F 2ZC4A 3OFHA 3IAM9 4FF1A 5H1SV 1SIWB 4FN5A 2QO3A 5HP1B 3R5CA 1N5YA 4KPYA 2ZZMA 2FTRA 4ICLA 1E6VB 4C8OA 2O01C 1S6UA 4AL7A 3E3XA 4QPTA 1Z2ZA 5KFWA 1NK7A 4UW2A 5EX0A 1N33F 5L9NA 4I56A 2ZH2A 2MKHA 3MM9B 5DG7A 2YX7A 2NXUA 2QEXS 3MEDB 2WSEC 2YNIA 3HVRA 4W92B 4EBCA 1FTCA 5KT3A 2XGQA 1L5UA 5A0YB 2RS2A 1FEHA 1R8PA 3DM2B 2Z8QA 3WZ0A 2ZJQQ 2VG6B 3QZ7A 1ZM3A 1Q82T 5EN1A 1S9GA 2FC8A 4OZ1A 4PQAA 2LEPA 2LEBA 2B51A 4O3OA 1E6YA 2J0SD 4KC5A 2ASDA 1JLEB 4ZCLA 4OHXA 4OZNA 3M9MB 2ZHOA 1NAQA 1C0UB 2K1RA 4B9MA 4LSNB 2KXNB 4HEA9 2UUTA 2J0WA 2LQJA 4WFNQ 2XS2A 4Q8EA 1H2TZ 2M3DA 4FVMA 1X9WA 1S48A 4O4GB 3MPVA 4ED5A 1ROFA 2BANA 2E5JA 3I31A 2W8LA 1S0MA 1XERA 5AXMA 2BA9A 5T41A 5KAKA 2MZQA 2BOPA 3FEXB 4F26A 2QZ8A 3K5NA 5E3AA 2OSRA 5I3QA 4C4WA 3C46A 1VQSA 1PSDA 2Y1RI 3KLIA 1GXTA 2HWIA 1CSJA 1F9FA 1S1WB 1JXEA 1X5TA 1FESA 4FP9A 2XG8A 2JHEA 4KKOA 4HTJA 2J9EA 1SH3A 3R1LA 5EWGA 4DL2A 1TQLA 4G1PA 1S77D 1HNXF 1X4AA 2GIRA 2BQUA 2HRYA 2A2DA 3K8WA 2BQ3A 2MYFA 1S4FA 4KFBA 3M8QA 5CD4H 4QR1A 1RT1B 1FRIA 3CGIA 3TR5A 2DIUA 3I96A 2HG4A 1JLGA 4RWXA 4F2RA 3W2VA 1ZPVA 2F40A 3I4PA 2IVFB 3Q23A 2D9PA 2B0GA 3IC1A 2RQMA 4P7VA 1XWLA 1JLFA 3PEJA 4ZDNA 2JEGA 1HNWF 1OPIA 2HNDA 4KRWA 1KNZA 4DFMA 2CQ2A 4H4MA 3OTDA 1U6BA 4RW8B 2BABA 4F4XA 4NCGA 3U27A 4B9TA 3BR9A 4N5SA 1L3KA 1JLQA 3UD4P 1IJFB 3GIKA 1S6OA 3LP1A 1HBMA 2J0XA 1H98A 2ROPA 3QPIA 4H4OB 3PX6A 2CPYA 4Q8FA 2V9KA 3OR1B 3B4DA 1HNIA 2R7SA 3LP0B 4QQBA 2KG0A 1R8CA 1D9FA 4WE1A 4IOAQ 1UFLA 4BWJA 1AXQA 3M8PA 2EW9A 2OPQB 4EU0A 3VALA 3C66A 1UJ5A 2ASJA 4XDCA 1DTTB 4ECWA 3BDEA 1D3WA 2HPUA 4CQ1A 4YB5A 1S7HA 2DNNA 3HVTA 2DK2A 3MM6A 5C24B 4Y2AA 1JK9B 1HMVB 4P2SA 3M8RA 5KFZA 3T1YF 2CVEA 2V0NA 1R43A 1Q1KA 3WC2A 2ZH5A 1QE1B 1TVRA 4NRTA 1Y3JA 1U47A 2V8HA 4HH1A 5HMYA 2B7CB 2VFSA 1VQ9S 1NNDA 3H8YA 5KFYA 3J7ZT 4DG1A 4QIFA 1UP1A 3OL6A 5DRKA 2ZBIA 2DGXA 3RU0A 4C0HA 4USIA 1JLAB 1LW2B 1FRLA 1Y00A 1UA1A 4ZK7M 2ZBCA 5FDLA 3MURP 2J7UA 1CC8A 1HNVB 2KDOA 4ECXA 3EZ5A 5G4DA 1Y7PA 4F4ZA 1E6VA 3RB0A 1F60B 1WG5A 2IMOA 2N4CA 4RU9A 4F02A 1UJ6A 4K4VA 3KLEA 2ERRA 3QAUA 4N41A 4WK1A 2ZH6A 2DNGA 3LF0A 2EFNA 3Q0AA 1X4HA 2AJ1A 3MM9A 3H5XA 4YR2A 4RBUA 2V2KA 3MUMP 3OTCA 4YHHF 1Q8BA 1XNRF 1VQLS 2B5JA 1CQNA 3W3SA 1WACA 4MMOA 5A0YA 4DQRA 1Q7YT 3SXLA 2CQPA 3DM2A 3VF0B 2JX2A 4RKUC 2OTJS 3L7PA 3MAHA 5CZXA 5E2QA 2BE2A 2XNQA 2VG6A 3VZHA 1S9FA 1K0TA 2DHXA 3MMJA 2XLKA 2BRLA 1YRUA 4UUXA 1IKWB 1KFSA 4IFYB 4OJHA 4L3NA 2QE5A 3GFXA 3G8TA 2HRUA 3GG1A 3V2UC 3L7OA 5IT9Y 1SXLA 4IFVB 4NYPA 2BJEA 4R5PA 2YNGA 2EK6A 2E9TA 1C0UA 3BF4A 3HHNB 4XAKA 4PWUA 3UDCA 2PA8D 4ALZA 4LSNA 3BDPA 2FJBB 4NA1A 1FF2A 2XSFA 2IHR1 4NLRA 1N36F 1X4GA 1RTHB 4O4GA 2RD5C 2K2PA 5J2PA 2UVUA 5CCMA 2CPHA 1KLMB 2M5YA 1ULRA 1HNZF 4B9SA 3CDBA 4PPDA 5I4MA 2VBYA 3OW2R 3SFGA 4HKQA 2NPFA 5D3GB 1DBDA 2BV3A 2KB2A 4DN0A 2DH9A 1KS2A 3CB4A 2J7WA 1R8BA 2N7YA 3KG0A 3UNGC 3ZFVA 4B3MF 2Q79A 4PQUB 3H40A 4PRFA 2OSQA 2F8EX 1FRMA 1S1WA 1HL6A 1O51A 4I68A 1OS5A 3O8WA 1Q8IA 2I0XA 3VWSA 3KJVA 4NLDA 2ALZA 1RTIB 1XR6A 1VBYA 4FBUA 3FQLA 3FVYA 2XO7A 3Q8QB 1RKJA 2DO0A 3SFUA 3J81Y 2U2FA 5KG4A 1OWXA 1N5QA 2MZ1A 1CC7A 1RTDA 4Y34A 1RT1A 1TL3B 3TVKA 4ES3A 4Z37A 5C42B 3MR3A 4URGA 4A8QA 1GNKA 4XDDA 1U25A 1P8GA 2BJDA 4N77A 1AFIA 4E8UA 1GX5A 3SDEB 1FRJA 5B0DA 5J2NA 4DSIA 5A8RA 4ES1A 2UUAF 4OI4A 2Q3PA 3DOLB 3OR2A 5KT4A 1REVA 2DNRA 2W7AA 4QIGA 4RW8A 4IDKB 4WKYA 3C2PA 5IM0A 2AYMA 1RT3B 4B9NA 2YNHB 2Q66A 1SV5A 2QA1A 1TR0A 3MM8B 5BYRA 2PO4A 3MMAB 1FDBA 4Y0FA 4AYBD 1R7IA 4PXDA 4ZPTR 5CYJA 3CUNA 1U48A 2GO8A 3OR1A 1P27B 4URQU 5C25B 3LP0A 4JI0F 2DTJA 4NLTA 4QW9A 2VONA 3POTB 4HTIA 4A8WA 3PKMA 1M5OC 1T8EA 2M9KA 2OPQA 2Y1IA 1R8HA 2D3UA 2DT9A 2QA4G 3RB4A 2W4CA 1ZZNA 2PN6A 3SSQA 3SV4A 2IA6A 4WJBA 2VFVA 5C24A 4CI0B 1SIZA 4C8LA 3CULA 1SJ1A 4NLSA 1VIXA 5L8RC 3H25A 1U8SA 2DCLA 3IS9A 3CTRA 2XZWA 1PC5A 1VQYA 4V19X 2C3UA 1KQKA 2XWYA 3I4HX 1QE1A 5L1KA 1J5OA 2X1AA 2UUCF 3ZZYA 3GFYA 4NPOA 1Q81T 4DF4A 5LXRA 2RU9A 5KFHA 3OV7A 1N6QA 1UVIA 2GFFA 5CYQA 5DGAA 2QMWA 3F56A 3V81B 1DURA 1FA0A 4A47A 1JLAA 1HHSA 2OPSA 2FJDB 3OBIA 3OSNA 3T1HF 1GTEA 1T02A 1FDDA 4FNHA 1HNVA 3D1OA 5KT5A 2YWHA 2XC9A 1UL3A 4RNHA 2KM8C 3QGGA 3RBEA 4BHQA 2E66A 3EYZA 1VJWA 3TX8A 2I5JB 1YBAA 4J37A 2C2DA 1SL2A 2CQ0A 2R4FA 4I6WA 4B9VA 4DFPA 3GYNA 1TL1B 4WFAQ 1YI2S 2J9DE 4C98A 4XO0A 2E29A 2DRBA 2MY8A 4NOHA 1TKDA 2DHAA 3C6UB 5E5NA 2ZH8A 1FKOA 1IKWA 2C3YA 4NYOA 4CT9A 1FRXA 3DOKB 4OX8A 4IFVA 1TL5A 4ETXA 4JI1F 2XMJA 5EHHA 1QAJA 1VRUB 5KFQA 3VCDA 3OXLA 2GHWA 2PSZA 3FFIB 3HHEA 3E01B 3GYXB 2UVRA 1NJYA 2G4BA 4KJIA 3VTIA 3G9CA 3Q8RB 3TA1A 3GZ7A 5KFJA 1TKXB 4ZP8A 3LP2B 2WSCC 3CDUA 1KLMA 3LGNA 5L1LA 3TA2A 3MD1A 3PW7A 4NCBA 1JJ2R 1W25A 2ZH7A 2LXIA 5D3GA 2VG7B 3G6YA 4PQUA 4UQGA 4OV1A 4RWWA 4QIVA 3D28A 3VAKA 5HBMB 2KYZA 3P5TL 5IT0A 1RTIA 3K2YA 4NLVA 3CJ3A 2RRBA 3I5CA 2JEFA 3ISNC 3GIIA 2ZITA 1G1XA 2DNQA 2CZ4A 3KNAA 2MKJA 2QSWA 3CXCR 3D0HE 1QVFR 2C3MA 1MSWD 1TL3A 2P9EA 2SXLA 4F4WA 2LCWA 1DLOB 3DFEA 2WONA 3I32A 1G2EA 2LMIA 3ZC4A 1QUVA 2E9ZA 5M2RA 2FLPA 4ZMMA 4X4PA 3M2VB 5LJ3Y 2RILA 4DFKA 4MYTA 4LF5F 3R27A 4X84A 4JI8F 3SDEA 2AV5A 1HBNB 3QYYA 3MAQA 2JC0A 4O4RA 1ZTWA 3KFWX 3DOLA 2YX4A 4IDKA 4X2BA 1B0VA 4HL9A 3MGJA 4ITSA 1LOUA 4OHZA 1D8YA 5CZVA 3MM8A 2AYEA 3BREA 4B3OA 3IR6B 2UVVA 3T1AA 1RAJA 2BACA 2R2SA 1SL0A 3E8OA 2VPWB 2W8KA 2KRRA 2B9YA 3R5BA 2ZUGA 2GC8A 3MUVP 3RRGA 3B8HA 3LH2S 1LKZA 5CA5A 3LAMA 1RK8A 4DQQA 4YFUA 2YKMA 5CHCB 2PI5A 4FF4A 2MZJA 3FDSA 1U24A 2KO1A 1TK8A 2CJBA 3DLGA 3H20A 2CJAA 1JJHA 2FJEB 2HFOA 4O3NA 4Q45A 1B0TA 2EWHA 4DMZA 1HI1A 2CQ3A 3NWGA 2KT5A 3RR7A 2IRYA 3M1VB 5F8JA 3THVA 2W7OA 5HMWA 2E5GA 3LO3A 2CFXA 3DDKA 1YJ9S 4PG6A 4K4YA 4A8OA 2N7CA 1ZOTA 5JVGQ 3BN7A 1D1UA 2FVRA 1LXJA 4QPXA 1UVLA 4DR6F 3A8EA 3UR3C 4ILLA 4NLWA 1KHVA 2YNIB 2YKAA 4NZ0A 4OHVA 4YDXA 3ZZ0A 5AE1A 2XY5A 1VQKS 4HT5A 4ZPCA 3HK2A 3V81A 3SEOA