1FRLA

Azotobacter vinelandii ferredoxin i: alteration of individual surface charges and the [4fe-4s] cluster reduction potential
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDSCIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FERREDOXIN
publication title Azotobacter vinelandii ferredoxin I. Alteration of individual surface charges and the [4FE-4S]2+/+ cluster reduction potential.
pubmed rcsb
source organism Azotobacter vinelandii
total genus 31
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1993-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1frlA00
7FD1A 2WSFC 5L8RC 3MM7B 1FRIA 1FRMA 5BYSA 1Y5NB 2WSCC 1FCAA 2C3UA 1B0PA 1FEHA 1D3WA 1CLFA 1H7WA 1FRXA 1F5BA 4Y28C 1JNZB 4CI0B 1VJWA 2PDAA 1PC5A 2C3OA 5CH7B 2V4JB 2PMZD 3MM9A 1Y4ZB 4OMFG 3MMAB 3MM6B 2FDNA 5BYQA 1FRLA 5E7OB 1FRJA 1KQFB 1SIWB 2VPZB 6FD1A 1R27B 1FRKA 2C3PA 2FJAB 3IR5B 3MM8A 1F5CA 1BWEA 1C4CA 1FDBA 1G3OA 2UZAA 1DAXA 1AXQA 2WSEC 1DURA 2V4JA 3GYXB 1FF2A 2GMHA 2VPXB 3EXYA 3OR1B 1FXRA 3MMBA 2XSJB 3PNIA 4OV1A 3MMCB 3MM5B 2WAQD 4KT0C 5FD1A 1Q16B 1FERA 1GTEA 1WTFA 2IVFB 2VKRA 4L6V3 3MM7A 4YDDB 1IR0A 1FXDA 4RKUC 1BC6A 2V2KA 1C4AA 5CHCB 1GTHA 2WB1D 2C42A 1DFDA 2XSJA 1SIZA 2ZVSA 3IR6B 7FDRA 1H0HB 4DHVA 1G6BA 3C8YA 2VPWB 3MMAA 3MM6A 2C3YA 3IR7B 1FD2A 5BYRA 1FTCA 2O01C 1ROFA 2C3MA 1Y5IB 1BQXA 1JNRB 1GT8A 1FDNA 1GAOA 3LW5C 2GMJA 1RGVA 3MM9B 1B0VA 1IQZA 2VPYB 1FDDA 3OR2B 1HFEL 1PC4A 2Y0SD 1F2GA 1BD6A 1SJ1A 3OR1A 4XDDA 3MMCA 1FRHA 3MM5A 1BLUA 1A6LA 2FGOA 2FJEB 4XK8C 1JB0C 6FDRA 3MM8B 1Y5LB 1XERA 2FJBB 2Z8QA 3EGWB 4ID8A 1B0TA 1K0TA 2FD2A 1H98A 3HKZD 4XDCA 3OR2A 1FDAA 3MMBB 1H7XA 4AYBD 1KQGB 2PA8D 3EUNA 2FJDB 1KEKA
chains in the Genus database with same CATH superfamily
1H73A 3LPYA 4ZVUB 5KFXA 3SEOA 4EEYA 4RW9A 5KFOA 3ENQA 1RT2A 1M5PC 3C2PA 2MQLA 3K7RA 2ZM6J 3PIOQ 2BKNA 4FVCA 3V6DA 1LFPA 4N41A 1DQAA 4A48A 1BQMB 2D1CA 4K2XA 3Q0AA 2E5LJ 4DG1A 1G3OA 2ZH3A 1REVB 1XN9A 1RE1B 4PQAA 4BWJA 3DOLA 3LP1B 3KLGA 3DCAA 1C4AA 3HVTB 3QRRA 5I4MA 4YB5A 1EX8A 2VPWB 4CO0A 4K4WA 5ETKA 1YJNS 1ROFA 2RRAA 1YWXA 2DH8A 1JKHA 2AP6A 2AU0A 1PBAA 2V8GA 4HI1A 1T3OA 3HVAA 2ADBA 1TUWA 3VAJA 3QFHA 4U8YA 1I94J 2YNFB 2N3OA 5LSRA 4CNYA 1LW0A 2G1DA 2FVSA 4DLGA 1IXKA 4FYXB 1IJFB 3JAMU 1VRQC 4ZP7A 2HFSA 5D4OA 2IIHA 4G1QA 1WORA 3AODA 2HPUA 4UZBA 2HW3A 2C3OA 1FWLA 5KFWA 4HH0A 2UUTA 5D0HA 1C1BA 1UA0A 2V9WA 1WC5A 2D69A 2VONA 4X4OA 3GFHA 5D3GB 1R8HA 1S9GA 2FZKB 2ZITA 2BEFA 2V2KA 4B02A 4J9LA 4K4SA 3N01A 4DFMA 1U8SA 1HD1A 4JV5F 4OZJA 3QWPA 5KFFA 3LANA 4ZCIA 3K2YA 1A6LA 1TKZB 4WFYA 5JUMA 1XERA 2RSQA 2HFOA 2QA2A 2FHOB 1FKOB 3KK2A 2GNKA 4DUYF 4QYRA 4RUAA 4F67A 4OHVA 1CSJA 3EDRB 1NSQA 4DV6F 2RILA 1R8AA 5A2QU 2W8KA 2MKJA 4TU9A 4MIBA 1LWCA 3L4BC 3P45B 2MZJA 1VC5A 2MQNA 4WF9Q 4RJVA 4LVOP 4DR6F 3NGKA 2HAFA 4CCHA 2KKHA 4ZPDA 1TZ0A 3I32A 1Q82T 1U1QA 2EWHA 2NS1B 1RTDB 1KR4A 1BC6A 4G1IA 3T6BA 1OSCA 3W7BA 1M1KT 4PEOA 2JL9A 4WP3A 4I7FA 3LW5C 4ZVFA 5E5NA 3SCKE 3CJ4A 4R8UB 4UY85 3EX7B 2OEJA 3BDPA 5HATA 4DPWA 7AT1B 4DPUA 1AZSB 2ZC4A 3UWTA 4WZMA 2WSFC 5AE2A 1Y5NB 4JI6J 1E6VA 2NSCA 4C0HA 4NYOA 2DYAA 1Z2LA 3G82A 4DL5A 1RQ0A 1NJYA 3MUVP 1KLNA 3R6LB 3T19A 3UD3P 4YMEA 3Q2SC 1SV5A 1NK5A 3KTQA 1AXQA 2VUGA 4KFBB 2LYVA 5D0RA 1FE0A 3O2IA 3I55S 2ZDOA 4PG8A 3UW1A 4B3OA 3KG1A 1M5VC 2IDLA 2YNIB 4I2PB 1VC6A 3R5BA 4Q7AA 3D0IE 3FCHA 1QTMA 4QCLA 3OL6A 5FDLB 1P9YA 3UR0A 2JDJA 4FNIA 1RWPB 4O4GA 4QQBA 2ALZA 4X4RA 2Q3PA 5F8HA 2RS2A 1KOOA 1UW9A 1SKUB 3JYTA 2UU9F 3MM8B 3WC2A 4QWCA 4V19J 1RHUB 1FA0A 1NM2A 2XS5A 1RI7A 1VHFA 4RU9A 4HACB 2HQDA 4KE5A 3QLHB 1JLCB 4YR3A 2HQIA 1FJGJ 4UF4A 2DCUB 4I0WA 1RAGB 4AL7A 1AUSL 1Z2ZA 2B4UA 4R5PA 4IQMA 1FRJA 5LMNJ 4E2FB 2BM1A 2UUBF 3MPVA 3OW2R 2LECA 3DRPB 3T1YF 4JI0J 3N0VA 1WOPA 2CNLB 3OL9A 2FVCA 1O0PA 3JSBA 1TKXB 4X4QA 2RQ4A 2NUHA 4M95A 1KDNA 1X8DA 3OVSA 3JTOA 2OD6A 1LOUA 3E3XA 3PACA 1QSYA 3IFEA 1RXOB 4DV5F 4G1PA 4YHHJ 3DI6A 3HT0A 3UCGA 4AQYF 2C3MA 1O6XA 4EYHB 1UEVA 2NXCA 3OJSA 2M7SA 3BSOA 2YNGB 1NU4A 4JOUA 2QIFA 1T9UA 3LP2B 4ITSA 4PYAA 1CBKA 3V81A 1VBYA 2HHWA 3PYGA 2C2ZB 2QL7B 1U7LA 1VQSA 1CC7A 1FWKA 5CABA 3DM2A 2AX0A 4NLGA 1FFWB 1PAUB 4OJ3A 3JAMY 2F8EX 5C42B 1WUUA 1SIWB 1PJ6A 1NEEA 3DMJA 1BUXA 3AY0A 3WBZA 4J5OA 2WAQD 3GIRA 1RYRA 2MSTA 2ASJA 1N6QB 4P73A 3BSCA 3HO1A 1FT8A 1R0BG 1J5OB 2L9NA 2I38A 2ILYA 3TJAA 4F7VA 3NWGA 5B0AA 1X4CA 3R7NB 2FJWA 3VGSA 2FYXA 3Q8YA 1NLKL 3VAGA 3IWNC 2MB0B 4DBQA 3A8KA 5DQIA 4H4OA 2B9WA 4WIIA 1BWVA 1U0HA 3VGUA 3GIJA 3D6TB 1H2TZ 1WWHA 1XIQA 3FFIB 5J2MB 5LL6d 3PW0A 2CJAA 1IKWB 3IM9A 2ATLA 3ZZPA 4DFKA 3IXQA 3VTIA 3HJFA 3AXKA 5J2QA 1IM4A 1FCAA 1H2UX 2VBXA 1U02A 4OYZA 4DV4F 4JI2F 5FIIA 4YEAA 2FDNA 3HHLA 3C16B 5A8WA 2DXDA 2HRUA 2FC8A 1RAIB 2YX1A 2HS0A 1CC8A 4ED3A 5A2QY 5HMYA 1S49A 4KTQA 2BQRA 4CO4A 4LFBF 3W2VB 4L6V3 1CJUB 5EWEA 4DN0A 3NNAA 3FBCA 3MXHP 1SBRA 3HHLC 2KRBA 3D6MB 2V8DA 3MM6A 3H59A 5EUHA 4X4VA 5KFHA 2BZ2A 2BQUA 3D54A 4LRDA 1H2VZ 3MR3A 3M32B 1AYEA 4AUKA 2F65A 1N32J 4OLOA 1HBMB 1ZOTA 3NGTA 2D9PA 2OPSB 5DG9A 2P8IA 1S6PB 2KYZA 4QU7A 4CRJA 2DEJA 1NKBA 3I0SA 5GAGU 3KJQB 4J9QA 2VJVA 3UD5A 2VQFJ 2F40A 2AGPA 3TZYA 5CYJA 1RK8A 1KONA 5G0RB 1XR6A 4K4YA 4TN2A 3FK4A 1D9AA 2G2OA 5KOWA 4DSIA 3IS9B 2B8PA 4IG0A 2E1AA 2V6AA 1Q4RA 4PWUA 2FB0A 3M2RB 3SCIE 3ISND 1GTEA 1VQ9S 2NREA 1MROB 4LIWA 4LSNA 4JV0A 4OYXA 2KHDA 2R7XA 1U24A 3HHNB 2M52A 2RE1A 3G6VA 3OFFA 7FDRA 2HVHA 3THPA 2CQ0A 4EBEA 2CQGA 3C66A 2BACA 3HCXA 4ZK7M 2CJBA 4DS5A 2AWZA 4F0HA 2F4FA 3BKUA 1Q95G 2W7PA 4EBCA 2R2TA 4GKJF 4RW7A 4RNFA 1JLAB 1S1UA 1S79A 4ED8A 3BDEA 4DV7F 1NDCA 2DNOA 3J7AN 5F8LA 4DL2A 1NXIA 1B64A 4EWTA 4MAKA 3KXDA 2L9DA 2BJ8A 1I5OB 2ZBQA 4OX9J 4M5DB 2DGUA 3ENWA 2KVQE 4K8RA 3NCQA 5K14A 3CPWR 4NE9C 1UMJA 4P2FA 4NZ0A 4F4ZA 4U7UK 3NS7B 3KJVB 4DL0C 3DGVA 4DCJB 4I6AA 1S1WA 1KHWA 1FERA 3T9ZA 1VQYA 4L3KA 2LXIA 1GK8A 4DV1F 1KS2A 4M1KA 2VV5A 1HNIB 5D4NA 1X4DA 5L46A 1VGYA 3KHHA 4MTPA 4GVBA 5EDWA 3QZ7A 3SQOP 8AT1B 4UOGA 2IAJB 3JSRA 3UR3C 4IH6A 1M5OC 4RW8B 1UFKA 2ZHBA 1UKUA 1FX2A 1RBLA 4USWA 2XI2A 3PX6A 2K8GA 3H40A 5C25B 5KFIA 1HNZJ 4P52A 1GMUA 3OTCA 2OLWA 2CIMA 4RUBA 5EWFA 5MLCV 2BJEA 3QGPA 2RF2A 2DIVA 2W01A 1T7PA 1F0XA 3H2LA 4DJBA 2XSJB 4DDFA 3NNCA 4DFJA 4NLQA 3ZZRA 3CCZA 2GC8A 1P8GA 3AT1B 3QO9A 4JI5F 3HHDA 1VCTA 3W5YA 3CCTA 3KG0A 4Y00A 3BO2A 2NQPA 4L76A 1TMMA 4ZPWR 1UAWA 3PYDA 2DNPA 4ZN3A 1LWFA 2IMWP 3AQPA 1P1LA 2LQBA 3MMCA 2DY1A 5KT3A 3R1HA 3HZGA 5F0WA 2XY7A 1RT6A 2KL8A 4CM0A 2PA8D 3GFXA 4QZVB 2GJFA 1XMOJ 2I9SA 4ZPTR 4CH0S 4WTYA 5IC4B 2H3EB 1T9VA 2GHVC 3L3CA 1F9FA 2Z2LA 3DXBA 1X4FA 1IQTA 5D0GA 3SQGA 2PI4A 1F3VA 1WNEA 4R25A 3KDNA 2DRAA 2JC0A 3N6MA 2UZAA 3J7A1 5KFGA 2ZNYA 2JFDA 5MAOA 4KPYA 4KKOB 2J9EA 1EHWA 1TVRB 1YBUA 1ZM9A 4I68A 2W2NP 4DZDA 2VC1A 2YTCA 1IR0A 3ITHB 3PZPA 3PEHA 3PTWA 2UVVA 1SC4B 4IH5A 4ERDA 2XMAA 2ZWPA 1VC0A 1XMQJ 2GFFA 1O51A 2K7JA 1ZM2A 1Q7YT 2DKOB 2R7RA 4NL5A 2Z2ZA 4NEYA 2OP5A 1YRXA 4PUOB 5KG7A 1SKSA 2VDIA 2GVZB 1QSLA 2FJBB 3H25A 3OUYB 3FKBA 1ZS6A 4OI2A 1JWWA 3H4DA 3CDWA 4RBVA 2HLUA 3MCSA 3GSIA 4NXNJ 4YY3F 4B3SJ 4R0EA 2ZVIA 3MEKA 1P9QC 5J2NB 2PMZD 2MZQA 2GO8A 4GMKA 1QE1A 4CIOA 5F3ZA 2MKHA 1R27B 1HIYA 2C3PA 4OX7A 2RDJA 1TL1A 1C1CA 2RAQA 2AKWB 1BMQB 1N5QA 4O44A 2OHDA 4E8UA 4FXWA 4N47A 1KHVA 3G4SS 3K17A 1FI4A 4WCEQ 2LDYA 3CCQS 2XZWA 3I4PA 4O23A 2JEIA 3MAAB 1DTQB 2F7VA 3V4IB 3V4MA 2KO1A 2XMVA 3KNAA 3RBDA 3B6BA 3BQ0A 3QIPA 2B6AB 5A8KB 4LF6F 3CT9A 3Q8RB 1RU2A 5F8JA 2JHEA 2ZH6A 2K2PA 3LWLA 1LQ9A 3M1VB 5LJ3Y 4ECSA 1FWPA 4ED7A 1JLFA 2ZD1A 1PILA 2XYPB 3CVKA 3SIPB 2QZ8A 5K8PA 3CXCR 3U1NA 3E01A 3VWSA 2DGOA 4LFAJ 1KWMA 2QMXA 1IBMF 3G6XA 4XIUA 5HSPA 3AOAA 1FJEB 3GIMA 5IV3A 1MW7A 1NKEA 5DZ6A 2KXFA 5B0GA 1SC6A 2R7SA 1SC1B 1U26A 4DR3F 5T7LB 4FBTA 3KLFB 1FF2A 3GTYX 4J9KA 3CCJS 2HLTA 3NNHA 5F3TA 3FQLA 2RDDA 2HWTA 4YS2A 1N5VA 1FK9B 2PE8A 2LQ9A 1GTHA 1NZAA 4RWWA 5D78A 4O4RA 5CCMA 2Z2MA 2B43A 3KLEB 2CADA 2D41A 1OSDA 2Y9HA 5GADI 3EGZA 1OY6A 4DSLA 2CPDA 3BGRA 1HNVA 3I5BA 3LP0A 3MGJA 5C24B 3MD1A 2QLFB 2XI3A 1LXJA 2PMHA 3K58A 2V2VA 1RWNB 1KVIA 3OR2A 1URRA 3BSAA 4ZP8A 4B3RF 4AYBD 5DETA 3BYPA 3M8PA 2HKEA 2RIJA 2QMUB 4F36A 1HPZA 4BC7A 1HHQA 2VG6B 1ZETA 3UN5A 4C9DA 2AW0A 2ABYA 1R0AB 3FEXB 3CJ3A 4X4TA 4B9UA 1FRKA 4CYUB 1HKAA 1UJ4A 3HP6A 4B9VA 3CDEA 2MQOA 1QSSA 3OR1B 4B9NA 5KFEA 3TZWA 4U67Q 3M8WA 2XSFA 3BSNA 2KH9A 4DWIA 1WKLA 3KLVA 5K8MA 1Q8BA 4MK9A 3QRPA 3HMJG 1PSDA 5JVGQ 3DLEA 1R7IA 3HFZB 4NLTA 2DR7A 3A8JA 5FLXY 1S6UA 2YY3A 3CJTA 4CLKA 4A47A 4LRAA 4TYAA 2HAIA 2J0WA 2DIUA 5A6PA 5IQ6A 5J2PB 2BM0A 2A1BA 2YKNB 3KUEA 5EHHA 3PEJA 1T05A 3OXFA 1JLGB 1U2RA 1WEXA 3AA9A 1TL3B 1S76D 3DLLQ 4TU7A 2DITA 3HFVA 2FIUA 2RQKA 4FN5A 1EKSA 2QC3A 3PJXA 1S12A 3MM9A 1HLWA 1U1OA 2D3ZA 3A3OB 3OV7A 5IOLA 3EGVA 1CG2A 3LO3A 1U48A 2O1PA 3FSYA 4PXCA 4J90A 3A1YG 1QAJA 1V5IB 4OJGA 1ZAWA 1WTFA 3NAIA 3PYEA 1Y00A 4HLBA 4PXDA 2W9CA 4Q2LA 5LSOA 3W1YC 4YUDA 2C2NA 5HANA 2H1YA 3SFGA 2VBWA 2E1RA 2XWYA 4OZNA 4I67A 4X4SA 1FD8A 1BQMA 5AT1B 4K4TA 2YX4A 5EN1A 1REVA 4RBUA 3OQ2A 4F02A 4DF8A 2AJQA 1XBWA 4ZPAA 4E98A 3LP1A 2Y1IA 1K0TA 3HVTA 2J9DA 2OSRA 5BR8J 1KEKA 3V6JA 1VBKA 3J81U 1RKIA 3AB4B 4DR1F 2ZKTA 2V8PA 2AYEA 4R0JA 4TLQA 2N4CA 6FD1A 1ZTWA 1S1VB 2QLXA 1UVJA 2PFFB 5DG8A 4KRWA 4DV2F 5EX3A 5K20B 4ECVA 1UVLA 2CNKB 5K8OA 2A18A 1S0MA 4J7CA 1SL2A 1J5EF 4IFYA 2E7WA 2HHHJ 3P5BP 3HVRA 2AYGA 5D0EA 2VQEJ 4DI6A 4Z7CA 5ETOA 1GAOA 2JLEA 3TVKA 2FLOA 3B82A 4BDPA 2BR0A 2NPFA 2RJZA 1NK6A 1B3TA 4KHPJ 4CLWA 2E7VA 4I6WA 4S0MA 2CNOB 5D3GA 3KLIA 4BWMA 4CLFA 2ACYA 3QGHA 2ZH9A 4WKRA 1N33J 2H4WB 4PG6A 3SSQA 1TMJA 3NKYA 4IRKA 1V3ZA 5C5JA 1MLAA 1UJ6A 4UOCA 4OHYA 2F63A 1RAAB 2DRDA 2KT3A 2KU7A 5JXSA 1KTVA 3W5XA 3BO4A 1TKZA 2YX7A 2X7IA 4V1Ak 3SZ2A 2X3DA 2D74B 3ENVA 2HSEB 3SDEA 4P2XA 1PYOB 3PW7A 2MQ8A 1NDPA 1Q5YA 1VJQA 3UNGC 3CIMA 4IO9Q 4ILLA 4QIGA 1H72C 1Q0NA 3GFZA 5LOQA 1PJ7A 4RNMA 2GV1A 3FMWA 2QA1A 3I0RB 3ILIA 4OX6A 2XMUA 3VZHA 1RTDA 4N5SA 1S1TB 2BOPA 4DLEA 4JV1A 1HBOB 3C6UA 2J7WA 4F50A 2I0XA 3TRGA 2A6OA 2QGFB 3PXGa 2MMYA 1GFWB 1RBAA 2HHPA 3OSPA 1HQEB 2R7UA 4R8UA 5C2GA 1KSPA 5HO4A 1X4GA 3T1HJ 4JB8B 2AQ4A 2IYIA 5DJBA 3UD4P 2E1MC 1AZSA 1S97A 2QSFA 5IC6B 2D9OA 1EQMA 1QAXA 4USMA 4X64F 3MCNA 2WK4A 4C7QA 3ILJA 3UDLA 1L3UA 4O3RA 5KFVA 2EFQA 3KK1B 3MPUB 4LFCF 1VQOS 3WC0A 3BN4A 4ECUA 2J0XA 4J91A 3G6YA 4KFBA 2W2MP 4DF4A 2FJEB 3GG1A 4M8LA 4EGLA 1ELOA 2ROGA 4NLDA 1WC3A 3RU0A 3OBIA 4I2PA 3RBXA 4M5HA 1GMWD 2KT2A 1FRMA 1Y3KA 1MWZA 1L5UA 3PW5A 1XNQJ 4RR5A 1IKYB 2DVIA 1NJXA 4DUZF 4ZMMA 1RYSA 2O3DA 1WF1A 4B9MA 5K8NA 3DLGB 4OHZA 1HBNB 4U8VA 3MM8A 2PIIA 1HNXJ 3MPWA 3POTA 2Q79A 2F4VJ 3U7JA 3CJ2A 1G2EA 1X0FA 3VGTA 2MQQA 4HACA 3KKFA 3QLHA 4OI0A 1EZZB 5KOXA 4WYWA 2XGQA 5LXYA 1ULRA 2V2QA 1CJTB 2GJIA 1WHYA 1KLMB 1AA1B 4WXOA 5M2PA 3OXGA 5AXLA 1NBEB 2QRRA 1HFEL 2G2YA 4FZVA 3BR9A 1IR1A 5F8IA 5KG6A 1OPZA 1RT1B 1U8WA 3T9NA 2XB2D 2HNYB 5G4DA 2HS4A 5A8RB 5KG1A 4QPXA 5E3RA 2LXUA 1EAYC 2BABA 3UQSA 2RDIA 5D15A 2W9BA 1VQ7S 4K2JA 1SUQA 2HGNA 5IFMA 3LALA 4IOBA 3J81Y 4QIVA 3JB9k 4QR0A 2F1FA 2MZRA 1WACA 3MAQA 4DS4A 2A0FB 3EYZA 2MHEA 5CYMA 2DNZA 4H4MB 2HNZA 5C42A 3M7VA 2B8QA 3CD6S 4LR9A 1S0OA 1JIHA 1ICEB 1NHUA 4X62J 4F8RA 4F3MA 1N6QA 2RKIB 3BREA 5F8MA 3MMBB 3Q8PB 4Z7YA 2C1EB 1J5OA 2FJDB 1M5HA 2R7OA 3HD1A 2Y1RI 4USTA 4NLWA 1LKZA 3QT6A 4FF2A 1S0VA 3EMTA 1IBKF 1VS3A 1FKAF 1B7FA 1PIEA 4N56A 3QATA 3FBBA 2JC1A 2CAJA 2W2OP 1Z4UA 3FFIA 5J2MA 2V4JA 2XYHB 3QYYA 4Q0BA 2OEMA 1IKWA 3MM5B 3A12A 2YKQA 3ONQA 2RU3A 4AXJA 4DV0J 1HQUB 3TAQA 4LRCA 3OTOJ 2HVIA 1QDUB 4O3OA 4ZVEA 4X4UA 4ZCLA 3C16A 3UVJB 1RGVA 3BH6B 3ZTPA 5C7PA 2WRMA 2VOPA 1AROP 2C22A 2FD2A 2EW9A 1CJUA 3PCOB 2E9TA 1H38A 2MKSA 1SQGA 1EP4B 2MTLA 3UFCX 3MR7A 4K59A 3R2CJ 1F9EB 5DGAA 4J9VA 1R43A 3Q8VA 3M32A 3QFWA 3GWCA 2FJXA 4B08A 1HBMA 1VQPS 2VFSA 2OPSA 3MPYA 2LEPA 2BOAA 2V94A 1X5SA 3JQMA 3NBPB 2N82B 3JSYA 4Y34A 4OI4A 2IFXA 1N56A 4OZLA 3KK3B 3AB2B 4ES3A 2W2PP 4C8OA 1ACMB 5G0RA 4HVZA 4MFBB 1BXNA 2KM8B 1RT4A 1HYSB 2AIRB 4Y2KA 3SSRA 4C8LA 3HHEA 2OGUA 2GCFA 3IS9A 4DR7F 2IM1A 4FYYB 2DNQA 4HHHA 4FYDA 4CLYA 4LF4J 3D67A 3M2RA 4A8WA 5IS2A 3QRQA 4ID8A 1MROA 4JP8A 1FFSB 1RWKB 1URNA 2CUYA 4QJVA 3H98A 1FEEA 1SVDA 3EVOA 1VIOA 4K4UA 4ZP9A 1Y11A 4LJMA 2DT9A 3D1QA 1VOMA 4GO5X 3R5GA 2HWHA 3DDKA 1IJEB 2VL1A 1H7WA 3PR5B 4I69A 2HHXA 2E5JA 4K0KF 1EQ0A 4LUBA 1YIJS 5HP1B 1NJWA 4MMOA 2N7CA 5E41A 1UZDA 5E7OB 3H4BA 4PPDA 2GHPA 1RAFB 3CJ0A 4M5MA 2CZVC 1U25A 1RLDA 5KFKA 1KRPA 4DR5F 2LEBA 1RWUA 1S0NA 3DRRA 4N77A 4ELTA 1JLAA 4OFZA 1DRZA 3D9BA 1WC6A 2QX0A 2WB1D 4F4WA 4F4XA 2I5JB 4M5DA 4DHVA 2G0CA 4DUTA 3AXMA 3NEKA 1GT8A 3VGVA 2GMJA 4RNHA 3KJVA 3JSMA 2RS8A 4PG7A 3TA0A 1FXLA 2H65B 1IWGA 3KUGA 1WDTA 4RW9B 3DKDA 1UA1A 1HNIA 3Q22A 4USKA 3S01A 4QIWD 3AH6A 4IKAA 1AW0A 5DGBA 2DGWA 3C6TB 3CCRS 2ZM6F 2MLYA 4PAAA 1RT5B 1FVQA 2ZFHA 4DG1B 3M2UA 2HHSA 2PDAA 2Y0BB 4OMFG 2RT3A 3PIPQ 2E5LF 5CXTA 1YHQS 4RW8A 3RRGA 3CCUS 4DL6A 3DOLB 1OYDA 4K4XA 3VVUA 4RUHA 3OTBA 4KT0C 2XCPA 1U6ZA 4ES2A 1YJ7A 3RB4A 1RWXB 1BY9A 1YK9A 2ADCA 3BQ2A 2V9KA 1JKHB 3V2UC 1K0VA 2CJYB 2LVWA 3CD7A 3JS9A 1OWXA 4TXSA 1SJFA 3H5YA 2KFYA 4DX7A 1JNRB 3PRVA 2CQIA 4CNZA 2COLA 1I94F 4DX6A 3UE2A 2DNMA 1QVGR 3R5JB 4KV8B 5L9NA 1RHKB 2XEXA 5ADZA 4OJ1A 3HZEA 1NB7A 2YKOA 4MYUA 4ANCA 1S9EB 1N4LA 2E7XA 5KFRA 4Q5VA 5HLFA 1T0TV 5DM7Q 3J7ZT 1C1BB 2AF6A 3PV8A 4HT5A 2HK2A 2BE2B 3IC1A 2V67A 1S99A 2L48A 4ZPVR 1ZM4A 1FRLA 4XAKA 3CJRA 4FBUA 4PQUB 3B78A 3TANA 3SV3A 4YB1P 3THTA 2O67A 3D66A 1NSAA 1Y3JA 1Q8KA 4DL3A 3R7BB 3EZOA 4P6QA 2IPOB 1U45A 3ZO7A 3CB4A 3DLKB 5IWAJ 1IBCB 3QPIA 4ZPBA 1NCLA 4C8MA 1Q78A 2HQ3A 3ZTSA 5LMUJ 2XLIA 4B17A 3IRWP 4CZCA 2W4PA 1NJZA 4QPTA 3DDIA 1W25A 1DQ9A 2F9DA 2E1PA 3MR6A 3KK2B 3BF4A 4ILMA 1UPPA 4KKOA 3RJMB 4QWEA 1TVRA 2MZTA 1SL0A 2CNNB 2LDIA 1V5VA 2QYGA 3ITHA 2XO6A 3BO3A 3B4DA 2VFUA 3GP9A 1TK5A 2G0IA 1LWCB 2HBQB 1YRTA 4P7VA 2A10A 1YRUA 1BE4A 3DLJA 4M63A 2M8HA 2Z30B 1YZ7A 1UVIA 3T5JA 4UQTA 4LBHA 1UWBB 2VDHA 4TNOA 1WC0A 4PUOA 1RBOB 1L3KA 2GVZA 2OSQA 3OUYA 2K3KA 3GJRB 1V6HA 4ER8A 2CQCA 4K50A 3M8SA 1EETB 1RT3B 4UOHA 5B0DA 4WE1B 4NCBA 1RSCA 2BKOA 3KHGA 4ZJLA 4I7FB 3M9OB 4FXDA 5J2NA 3GFYA 1H0HB 3T5LA 1Q1KA 3QGIA 2K1RA 2BANB 4P10A 4DMZA 4C0BA 3TZZA 4MT1A 2ZNZA 2HVEA 2H5JB 2PMWA 2P6TA 2BVZA 1UPMB 1RTJB 3PKYA 4NMXA 1Y0HA 3HDSA 1TU0B 5GADU 4CO1A 1E6VB 3MAAA 1DTQA 4JI6F 2UXBJ 3G82B 3LGMA 4LF6J 3QAUA 4EZ6A 3OD2A 4QW9A 1HR0J 1IUJA 5A8KA 1N48A 2QV6A 2BMBA 1APSA 2GIQA 1SQFA 1YX2A 4OV6A 3AD9C 2KT5A 1U6FA 3M8ZA 3EVMA 4FKXA 2DNNA 2Y8WA 4LR8A 3RB3A 2ZOGA 5ETPA 3ZNJ1 1RHMB 4KH0B 1HWKA 3A8EA 1X5OA 1N5TA 4JI4J 2H4YB 1UCNA 2L41A 4ALZA 5JJBA 3CJ8A 2GZOA 3O5TB 1PYSB 2CPHA 1BQXA 2DNGA 1NJIT 4OL8A 2XO7A 4ZVTB 3M2VB 3OLAA 2RU9A 2GS8A 1OS5A 1M1GA 2EPIA 4L73A 4ED4A 5H9EJ 3BBCA 2X1FA 1RHJB 1GXLA 2LQ8A 4DZ6A 3CCWA 3NWRA 1NPPA 3KLEA 1FJGF 2YH1A 2WVFA 1W2BR 1FRXA 3MDFA 2IBOA 3M4XA 4A46A 4JI0F 1T9TA 4IUFA 5C24A 1TAQA 3CMES 2KN4A 2IVYA 4O0IA 2C28A 2DY9A 3VV2B 1V3RA 1JXEA 1ZPWX 2MY8A 1E6YB 3ZZOA 1SCJB 2VKRA 4F0KA 2GMLA 3DI6B 5HJXA 1XJWB 2POKA 4DPXA 2DHSA 3KWMA 4YHHF 4ZVRB 4Y65A 4Y3CA 3Q8QB 2CQDA 2VFTA 3GJSB 3RRHA 2M2BA 1VQMS 1LV5A 4F3OA 5ETNA 2MSSA 3DC2A 2Y0SD 3V81B 2WHOA 1SJ1A 3OR1A 2MDAA 1S59A 3M8QA 1PG5B 3HT3A 4MYTA 3TEHB 3DM2B 3DGPB 2ZHOA 2LFVA 4BCAA 1GXUA 2VC0A 4OZ0A 1U0SA 4P71A 3DOMB 3WX8A 1U2CA 4C8YA 1FRIA 3CEDA 4DSFA 1VRTA 4M5JA 2OH2A 3DMJB 3RUBL 4X66J 4UOFA 1WG4A 2GJ2A 4TQSA 4PZVA 3RW6A 1H3DA 2X51A 2YKNA 3TP2A 4KH1B 4ILRA 2VODA 4MIAA 5CZXA 1H6KX 4P9SA 2XULA 4HH1A 3VAIA 3C3LA 3CNQP 1NUEA 4G3IA 1JLGA 1TL3A 1B7YB 2RD5C 4YDDB 3IM8A 4WU2A 1JXLA 4XTTA 1ZH5A 1M90T 4CT8A 2WBMA 1JX4A 4HT7A 5DQHA 3B54A 2ZUGA 3R9LA 4NI2B 1KTQA 2C2EA 3PO5A 1U0HB 1KKHA 1Y10A 4B3MJ 2DNRA 2W25A 2V63A 2LMIA 4ZVPB 3CULA 1D8YA 3ISNC 2GAHC 3UDEA 1HMVB 5AXNA 2R8IA 2A6MA 2CQ4A 1NPKA 3W8GA 2W4DA 1FTRA 3P4UB 1X7VA 4DQPA 1T9WA 3HHLB 4ED0A 2GA7A 5HQLA 1MU2B 2BQ3A 4LF7J 2AX1A 4UQGA 3RB0A 2UVWA 2P2CB 2NXJA 3MTJA 4PR6A 4O0NA 2CWXA 4QBUA 1RDRA 5KFTA 2OTLS 1VQNS 5HVFA 2CPFA 5J1EB 1NMEB 5J1PA 4JI1J 2H5IB 1LNQA 5A0YB 3QSIA 4DR2J 4LF9J 4ETXA 2M9KA 3CC7S 2CPZA 3H5XA 3K0JA 4DV3J 1T94A 4L72B 4DV2J 2KI2A 3OTDA 3SSSA 1S1VA 2BRKA 2OUGA 1D1UA 1N32F 2OPPB 1TL5A 2R2UA 3I0SB 4CLUA 1QVFR 1PJ5A 1A0OB 1BQNA 5HVGA 3RRKA 1XNRJ 2FGCA 2JLGA 2VQFF 2DJWA 2HVZA 1KQGB 2YQ0A 1RT7B 1UZHA 2UXCJ 4FDFA 3UPFA 2AEJA 3EXCX 3CMQA 1DLOA 5IT0A 3RBEA 2E5HA 4C48A 2QMWA 1NO8A 2DH7A 5IT4A 4LR7A 1XMBA 2EK1A 3R7SB 4F04B 4LSNB 2OMLA 1I1GA 1OMSA 2B7CB 1JJ4A 1X9MA 2V34A 3TR5A 4DU8A 5ETMA 5ETQA 4RKUC 1UVMA 2VBZA 2KDOA 3N6LA 3PR4A 3OHAA 4CDIA 3HHKA 4LSLA 3MECB 3W65A 3RYLA 2DB1A 3OL8A 5EX0A 2QG9B 1ITPA 4GC6A 2A3JA 3TAPA 3UCZP 2CZ4A 3W62A 3L7OA 1B99A 4C11A 2WW4A 3IBCB 3WDOA 3RBZA 3KMQA 2DNYA 1HA1A 2OD4A 2IA0A 5HQMA 2JWNA 2XMTA 6AT1B 2VB6A 2FUG9 2BX6A 2ASYA 1RA6A 3QT7A 3MCMA 2R4FA 5H9FJ 2C3UA 4JI7J 4KR0B 4LF2A 1VQLS 3AOBA 4K4VA 1GNKA 5H1SV 4A8YA 1CVJA 5DDQC 3I0RA 4NMLA 5H9FK 2UUCF 5DDPC 2RUGA 1S1TA 1JJCB 1YJVA 3V5RA 3LAKA 3AA8A 2HQGA 4RBTA 4GVBB 2R2RA 4WP9A 4ID5A 3LGNA 3CGIA 3R5AA 1HQEA 3HVWA 3FMBA 1LK7A 4NA1A 2MGZB 3TAMB 4U95A 1WD6A 2WTFA 3NOGA 3GE9A 4AT1B 3QT5A 1OQ3A 2B5JB 3UN2A 2ZZNA 4DSKA 2EFOA 3PFEA 4ZLLA 4IH7A 4H54A 4CTAB 2NR0A 2BRLA 3DRXA 4Z37A 2A2CA 3S8SA 2DHHA 2OELA 2QYCA 4CH1A 1HNZF 2GX8A 4EI2A 5CQGA 3D2WA 2H5EA 5ITHA 5DLFA 2E9ZA 2XNRA 2RF2B 2FZGB 2Y1JA 3BBBA 2W7AA 4ES1A 4QIEA 2BV3A 2ZWOA 4D3GA 2FJAB 3NXZA 1PKUA 3J7YU 2R9LA 4ED5A 3WIVA 3EXYA 4F2SA 2ZE2B 2QEXS 1HHSA 3MD3A 1RJJA 3TJ9A 2H51B 1K8AT 2BKPA 4IRDA 5KFCA 4I56A 4F25A 1WJ9A 3QQCD 4NPOA 1ZPVA 2ZVSA 3Q8SB 3TWZA 3PG9A 3IR6B 2HQFA 3MUMP 1YLXA 2OJ3A 5BJRA 3EZ5A 3DLGA 1HWUA 1S4EA 1A9NB 1HBNA 4U9RA 4IFVA 1RAOA 3D6FB 1RT6B 1R31A 4A8OA 3Q8UA 2B9EA 2EKYA 2WW8A 3AJ1A 4I2QA 3KLHB 4FXVA 1XMOF 1MWQA 4LT6A 3ULHA 1WSRA 5A6WA 4JBCA 1U1NA 1CS4B 4KSEB 4QYZJ 4M5KA 3EGNA 1KLMA 2ZZTA 5AXKA 2QSWA 2L9WA 1JLQA 4JI3J 2EK6A 1Y4ZB 4ZITA 4F4KA 2XMJA 2HQCA 4D3HA 2HFUA 4WFAQ 4C97A 4NCAA 4BC9A 4QYZK 1FNXH 4YR0A 3VAKA 1YJTA 2WONA 3Q2TC 1RKJA 3PNIA 2XYGB 1RT1A 2HNYA 2M70A 1C0TB 3I4HX 1XMQF 1LWEB 4YB7A 3C14B 1W2IA 3QBCA 1Q79A 1HL6A 4AXIA 1RISA 4FNHA 3GB0A 1PCAA 3H0PA 1Y5IB 1N54B 2BBEA 1V3SA 1SC3B 2XZDB 4W98A 4DFPA 5LXRA 4ZPCA 1LXNA 2Q6BA 2AGQA 2OPQA 5SUHA 2AJFE 2FJVA 1UFWA 4XDCA 3NMRA 3VAFA 1HNWJ 4RW6B 2VFVA 2ALYB 4NXNF 3D0HE 3FNNA 4FPRA 4NX9A 5L8RC 4B3SF 1QE1B 2RUSA 4OYWA 1S6QB 4KHRA 1HWIA 1D9DA 4DPTA 2G1HA 2FHJD 3TVZA 1GMVA 3TQ1A 4O44B 5CA5A 1RWVB 2XM3A 3HSJA 2Y3YA 3IN5A 3BS9A 2DR6A 1WELA 4ELUA 4J9UE 4Q44A 3S1TA 2RKIA 4F3QA 3MMBA 1S9FA 5F8GA 1QTNB 4GKKJ 3CF5Q 2HNDB 2HGLA 4IG3B 2KZZA 2H9ZA 4USHA 4ZVHA 5ETRA 3QIPB 5AXMA 2LKZA 3ELHA 1SH3A 3MPDA 5KG4A 2MKIA 1X5TA 1U1MA 3BPSP 2RRBA 3BV8A 3R5DA 5GVQA 2PA3A 2KJVA 4NRTA 3NGSA 1WSVA 1JLFB 2W9AA 4RO0A 4MK7A 2D3OR 3K8VA 3N6NA 3CE8A 1YITS 1MNEA 2CPIA 5KFSA 3MM5A 4OI1A 1NK8A 4LFAF 3HKZD 1HD0A 1A7GE 1XWLA 4NYPA 3HSGA 2ZC3A 5B7WA 3PO4A 1DTTA 1OY8A 5K9FA 1S5ZA 4WWSA 3FCWA 2MKKA 3PY8A 3W8PA 3IWXA 2WOMA 3N5FA 1RUSA 3T41A 2YPYA 3UVJA 3LPEA 2YNHB 2KG1A 3FVYA 2XLKA 1QD1A 1KQFB 2QN6B 4PYDA 2OO4A 3MAHA 2CJXB 3MEDB 4WFXA 3DRSB 4ECZA 2J7KA 4MKAA 3PJWA 3I6PA 2ZOFA 2C42A 5I3PA 5HL7Q 5KFDA 4NLPA 5ETTA 1HNVB 3GU0A 3DYAA 3LP0B 2BW2A 5T14A 4KGKA 1QUVA 3OR2B 4M5GA 3AD8C 2HRTA 1TV6A 4NLOA 5E2QA 1F2GA 3T3FA 3PJ9A 2DTJA 3W3SA 4HR2A 1QJHA 2BE9B 4FPIA 2P9CA 1GEHA 2CQ1A 3PW4A 1NZ8A 1RCXB 1VK3A 3N28A 4MFBA 2IY5B 2ROPA 2NXNA 7FD1A 2BA9A 2ROEA 3R6GB 4DU7A 4JYAJ 1NK7A 3K5LA 3TEGA 3QZ8A 3GYNA 3GMGA 3CD0A 2DR8A 1JJHA 3J7Z5 4O3PA 1RTHB 2KM8C 1J27A 2CRLA 5AJ3J 2B4OA 4N7TA 1L3VA 3CC2S 3P96A 2YWWA 1T8EA 1SJRA 1D9FA 2AV5A 4CLZA 3TW0A 4FS2A 4HKQA 4PRFA 5HP1A 3FBFA 3GJTB 3G71S 4EO6A 1VI7A 1FNMA 3S6EA 4LBIA 1S72S 2I6WA 4P72A 3OFEA 1F60B 4LF5J 1IVZA 2VPYB 3IRXB 2OEKA 1YJRA 4L75A 1T05B 2V8VA 3H42A 4C8KA 3LQVA 1NK9A 1OIAA 3HFKA 2HYIB 2CG4A 2J76E 3WX4A 1F5AA 2QFJA 3NOCA 2UUAJ 3EM1A 2V50A 1TP7A 2I5JA 4WTOB 2C2KB 4F4YA 1S1XB 2KRRA 4ZCMA 2FHMA 1DARA 5AE3A 1XR5A 4YDXA 1NHKL 1TQLA 3QIDA 1DZ5A 3PYFA 1MWYA 2VPZB 3R27A 1T03B 5THWA 4ANDA 1FESA 4Q43A 1AFIA 5B09A 1Q5VA 2W9CB 1Q86T 2XMMA 5U47A 2ZJQQ 2VH7A 3C6TA 2ZZMA 4H4KA 3I5CA 2ZDPA 3FCVA 5KT2A 4BS2A 1RT5A 3MHYA 3T5HA 3O44A 4C8ZA 1SIZA 4G65A 2Q66A 3EVWA 2VICA 5KFNA 4J9NA 2ZH4A 3U1LA 2HMIA 3BB5A 4RPFA 2UUWA 5DO2A 2X1AA 1AB8A 4PWDA 1BGXT 4J9PA 5ETSA 4BHQA 2H48B 4UW2A 1BLUA 3IBWA 4KQZA 3IBFB 4ZJOA 3LWMA 4NRUA 1JB0C 1VBXA 4H4KC 3FGVA 3CCSS 2LXFA 1FDAA 4TY9A 5BR8F 4URQU 2CKWA 3EJMA 2ZBPA 4WJBA 5KFPA 2MKYA 1B0PA 2IRUA 2R8KA 2ILZA 4JV2A 3FSXA 2XS2A 3EICA 4EMDA 3HSDA 4U6PA 4KV8A 5E3CA 1IKVA 4IFYB 3CJKB 3RTVA 2JNJA 1S9EA 2HHHF 5LM7E 3OXLA 4KC5A 3GR1A 2VQEF 2BE2A 4MH8A 1XQIA 3HD2A 3HULA 2NXEA 2DRBA 2XC9A 2VU5A 2UXDJ 3DRYA 2VKZG 3KLIB 3PRBA 2QO3A 4PQUA 4KHPF 4W4MA 1QAIA 2OPRB 3ADAC 2MQMA 4FF1A 4DOZA 3FUYA 4ZP6A 1UTAA 3DLHA 2B9XA 4ECRA 4FF4A 1CJKB 4U7CA 2LQJA 3DLKA 3AAWB 1N33F 2ZH5A 2YKMA 1YJ9S 1MMNA 5M2RA 1JMTA 2R7TA 1GMWA 1TKTA 4DQRA 3VQSA 3QAEA 3US5A 4DN9A 3VZIA 1HARA 1W7WA 2AJ1A 3CIZA 2PEHA 4B3TJ 3SDEB 1R8CA 4QR1A 2BJ3A 4A8SA 2W8LA 3RZAA 3M6UA 4WZQA 1HWLA 3R5CA 3F73A 2OFHX 4OJHA 2HBYB 3IMQJ 2CQ2A 2NCKL 3GSDA 1HW8A 3TZXA 3W64A 2QLJB 1UWBA 4MK8A 2EBGA 4ZVGA 2E66A 4QWBA 1PAEX 3L7PA 4DPYA 4WYLA 5GMDA 4XPEA 4J9RA 4CLTA 3UNYA 1EETA 1RT3A 2M88A 4WE1A 3C6UB 3U27A 1X9SA 2DGVA 2IBKA 3M6VA 3AQOA 2ZBCA 2K3IA 4OYAA 3PVXA 4Y0FA 4NXMJ 4KGXB 1WG1A 1N34J 4X65J 2XTJP 4NOHA 3J80U 5LT5A 3T1HF 1KNZA 2BANA 2V8HA 3GR0A 2AD9A 1EIYB 1D09B 4J9MA 1SH2A 1DHMA 3KG4A 1DURA 3CDAA 1RTJA 2GMHA 4ELVA 4OZ5A 5L1IA 4ZOSA 4ZIVA 4K7QA 2B56A 2VZ9A 2HK3A 2GVDA 2GQ2A 1XEZA 1FKPB 4WKYA 3MEEA 4J9SA 1ZA1B 2JRSA 4CO5A 5KFAA 2J5AA 4NLXA 3MEGB 3NLCA 2J0QD 1PC4A 3ZTRA 1IBLF 4BBYA 4NLUA 4Y2MA 4OQJA 3W2WB 1RHQB 4LF8J 2Y1LB 4N76A 2I1RA 5HI7A 2PO4A 1YDLA 2WVCA 4JI8J 1F6TA 4KO0B 2J7UA 4DR4J 4NCGB 2WCXA 2VASA 3F0NA 3ET6B 3TX8A 2R7QA 1XNQF 1UWAA 1KP6A 2FC9A 3H5SA 1SI9A 2FPHX 3POTB 5CYQB 3M2VA 5KT4A 3MR2A 1HNXF 1AFJA 2F4VF 2IYGA 1OY9A 2MQPA 2KTQA 4USUA 4ECTA 3NL0A 3NAHA 4UT4A 5D8HB 2V2ZA 5HMZA 2Q6CA 5KFMA 3D4JA 3FRYA 2W1BA 1Z1ZA 4ICLB 3S7RA 3IR7B 3LTOA 3QNWB 3TYTA 2HG4A 2ZUAA 1VRUB 1T9YA 1YTYA 3K59A 2DEIA 5AE1A 5KAKA 2IM2A 4RUCA 3CWJA 4W90B 1L3SA 2RNEA 1AUDA 2AYBA 2KB2A 1E6YA 5GAEI 5F9NA 2CJ9A 4P74A 1L3TA 3CCVS 2YWGA 2BUNA 2YNFA 2DBBA 3F41A 1VYAA 1YJUA 5A76A 2W9BB 4ED2A 4CO2A 1RADB 2FQQB 4ZKAA 1SUQB 3RR8A 3BH7B 4CP5A 1T11A 2AGOA 1NNDA 1C0UB 5E3AA 3NGUA 1HQ2A 4ZLPA 5HQ8A 3VF0B 3GV7B 2F8HA 2DGTA 3CW2C 4XPCA 2U1AA 3GCXP 1R6VA 3I5AA 3OL7A 1DY3A 1YZ6A 3D3CJ 2YWHA 1W26A 3DFEA 3DGPA 5CYMB 2HGMA 4FYVB 2VA2A 4CQ1A 3KHLA 3DOMA 2HNZB 3M6WA 4CLPA 3VVTA 3TOQA 2QL9B 4GRSA 9RUBA 3FDSA 4IDKB 3K5OA 3RAMA 2LEAA 2CJQA 2AJ4A 3SCLE 2ZBIA 2J0SD 4X62F 2EC0A 2U2FA 1WHVA 4NZ7A 4JV5J 8ATCB 1XC9A 2EG1A 3E8OA 4CM2A 4A8XA 3G9CA 5CZVA 4EYIB 2HHQA 1KQSR 3ZXWA 1UVNA 2EKNA 1V9OA 2JOQA 2F3JA 1H7XA 3QJLA 3IP0A 2LA6A 2RHQB 2XGPA 3I56S 2B51A 4C6AA 1BHNA 4P2MA 2VG5B 3H20A 4DUYJ 4NI2A 1FKOA 4DV6J 2V4JB 4Q0BB 1MMDA 3RB6A 2AJ2A 4K4ZA 4URSA 1DQ8A 1HMVA 1YQHA 2FVPA 3BM7A 2W24A 1NKCA 2E29A 1OQ6A 5L38A 4LREA 3O8WA 3BEGB 4DR6J 4DV0F 5KFQA 1RTIB 5KT5A 3OTOF 2O66A 3IGNA 1U49A 1LK5A 1R8BA 1MU2A 2XY6A 3LA0A 4K5SA 4DXLA 4Q2MA 3PHTA 4M94A 2AYMA 2CPXA 3SYZA 1WOOA 4DQQA 2GHWA 1HBUB 1IQZA 3ETMA 1UEUA 5J1EA 1VQ4S 5HROB 5B08A 1X4HA 1JJ2R 3E51A 3O6QA 4IYQA 5A0YA 3G8TA 4UZCA 4KY3A 2WVBA 4YFUA 3D68A 3DLBA 3FJ2A 3P5TL 1S10A 4NA2A 3DXSX 5IQQA 3MM7B 3LUYA 1SKRA 2D3O1 2OPPA 2ZH8A 2V5HG 1PO6A 2YVSA 5ETVA 5T41A 2JEFA 1F5CA 2LLZA 4XO0A 2XHCA 4ZVQB 2IC3B 3J80Y 1SL1A 2EEYA 2NYIA 1RT4B 5F8NA 1RT7A 2LU2A 1CULB 5GAHI 1S6OA 4ED1A 3OTEA 2HFNA 5M2UA 1TUVA 1UL3A 3GZ7A 1UVKA 4DX5A 2DXEA 5DS7A 2YNIA 1P6TA 2KXNB 4LF4F 3NCRA 1T3NA 1RAJA 5HBMB 4HDHA 4EZ9A 5IM0B 4XDDA 5FDLA 4LMZA 4F0MA 2PI5A 3WHIA 1H98A 1WOSA 4WBFA 2UU9J 2JVRA 3M05A 1M5SA 5KFUA 3MECA 1J2VA 3PRDA 1YBAA 5BYSA 3TARA 4DX8H 4LIRA 2M8DB 5IXUA 1JNZB 1TTHB 5D4PA 1S4FA 3DRRB 3MMAB 2MEWA 2R8GA 4C2MA 2DNKA 1JLBB 3BKFA 4BLGA 2CDRB 4RW4B 1JLCA 2A2DA 3HPOA 5IZHA 3WZ0A 2UUBJ 5I3UB 3LOUA 4HI2A 3T1YJ 4O3NA 4Q8FA 2KJWA 3FSIA 5F0UA 3PHEA 3DRPA 3IWLA 1TKXA 1X4AA 3M30B 3ZNUA 3JSMB 3C46A 1F2HA 4IRCA 5I42B 4DV5J 2UUCJ 1FDDA 4AQYJ 1QLNA 3VQTA 2CXEA 3H90A 2JH3A 4Y2IA 4PCQA 3DU6A 3M6XA 2YKAA 1WKKA 3N5BA 3A3NB 2GIFA 3M2UB 3DN9A 1VQ8S 2YNGA 4EK2A 3FZBA 3C15B 5ETLA 3TA1A 2MGZA 1T9XA 3TAMA 1X4BA 2RRNA 2P9EA 3LP2A 5KG5A 2B5JA 4U96A 2MZ1A 3HF5A 1C2PA 3QMQA 3A8IA 4ZA1A 3IR5B 4MKBA 1DAXA 4NLYA 2FVRA 4CTAA 3BQ1A 1EJ7L 1VIXA 3TQEA 2PEBA 5E3PA 2IVFB 1N36F 4B9TA 3NY0A 5KT7A 5B0EA 2ZEJA 3VAMA 1GXTA 1ZTTA 5D6GA 2HFZA 3BGUA 3UCUP 3D3BJ 2VBYA 3MCOA 1WDDA 2NPIA 5FLXU 2YWFA 2V68A 3TI0A 4DSJA 4ATNA 2DD8S 4WIQA 1JLEB 2ZE2A 1Y7PA 1U1LA 5HLFB 2DHGA 1SB6A 3P6YC 2D7SA 3D5MA 3NG8A 3GQCA 4DL7A 3GYGA 1TK0A 1N5YB 3GILA 3EUNA 1CJVB 4TYBA 4EU0A 1ZA2B 4FKYA 2R8JA 1YJWS 1D3WA 3SV4A 2CPYA 2BW7A 2EC2A 1VJWA 1M1HA 2ZKUA 3P3DA 1REGX 3D1OA 2I2YA 4DV4J 4JI2J 1LW2B 5KTQA 3KLHA 1UEKA 1TKDA 5IWAF 5HMXA 1NK0A 2QA4S 3R3TA 1CS4A 4X84A 1F3FA 4USJC 1OO0B 5LMUF 4CT9A 2NUUG 4LFBJ 3SXLA 2EXUA 3IGVA 5LJ5Y 4OYPA 4F26A 1TFWA 3ISZA 4WPAA 3W2VA 1PBUA 1RWMB 4EFAC 4ZHRB 3IG1B 1KBRA 2J6TA 3N79A 9ATCB 2DHAA 3TX0A 4Z2XA 3BPDA 2GIRA 3UO0A 3MFIA 1TUGB 2CQPA 1C0TA 3AJDA 3D28A 1LWEA 1TL7B 4ZJQA 1VLYA 2GGPB 2E44A 3C14A 2Z2YB 1TR0A 1S6PA 3O1LA 2VD3A 2YXLA 2ZJPQ 2XHWA 4PG4A 1U1PA 2M4MA 1FVSA 3I96A 4CLLA 2N4DA 1ZZFA 2AEFA 2MYFA 4O3SA 2J9CA 4HHUA 4HEA9 1XR7A 3ZTQA 4L74A 2XCAA 1SKWA 2EFNA 2IRXA 4C3LA 4RW6A 1QM9A 2DCLA 1WI8A 1S6QA 3Q83A 4FS1A 3W9JA 4YN3B 2K1RB 2GQCA 2XG8A 4RU2A 3VCDA 4LRBA 1FE4A 1VDHA 3HJVA 2L3MA 3PW2A 1P1TA 1NH8A 2EVZA 1WC4A 1D0EA 1IR2A 2WBRA 3JXOA 1YBTA 2VFRA 2FLLA 4KGZB 4MIWA 1FO1A 3UI3A 4TY8B 2HNDA 4IG3A 5RUBA 2J8SA 2UXBF 3EPIA 1IKXB 1D8ZA 2K7KA 4GKJJ 2R8HA 2HHTA 5CD4H 4DV7J 1HR0F 1CPZA 4MJKA 1LWXA 3JTNA 4ETZA 3T6JA 3PKMA 2JX2A 3ENAA 2DR5A 2EFPA 3HHLD 1NHVA 1DJ0A 3FRZA 4Q45A 3DOKB 3GV5B 2VG7B 5DLGA 5KFLA 2EFVA 4OV1A 3JQKA 1Q16B 3AD7C 2IDEA 1KN6A 4JI4F 2VA3A 1FXDA 3M8YA 3FZ2A 3RGIA 2YPZA 4YB6A 4DV1J 2QJ3A 4ENOA 1K73T 3H8YA 2MY7A 1KQKA 3G96A 2YNHA 1UW4A 2X1BA 1FD2A 1RT2B 3CD5A 2JSXA 2FZCB 2B9YA 4PXBA 2MJNA 2W7OA 2EI5A 3TUJC 5SZTA 4J37A 2FLPA 3CJ5A 3V6DB 3MURP 2UVRA 4HTIA 4TVAB 1VQ6S 3MEDA 1WHXA 6FDRA 3GIKA 4DL4A 3DRSA 3LF0A 2IAJA 3CUNA 1F9HA 2KHCA 2JJ4D 2CQ3A 2BJ9A 4KB7A 2CDQA 3L7UA 3RAXA 3KLGB 4HL9A 2HHVA 1G1XA 4RWXA 1RHRB 3JTPA 4RNNA 4EO8A 1PYTA 1Q8LA 1JXVA 2AJ0A 5C25A 4WU3A 3G2XA 2PGCA 2CA9A 5IV4A 4PWWA 3HSZA 2P6SA 2YH0A 4A8FA 3OFHA 3DU5A 3NP5A 3A3PB 1LW0B 3I9V9 2N3LA 2J6SA 3ETOA 1DFDA 2XSJA 1GQEA 3C19A 1WC1A 2HIYA 1VHIA 4G1QB 1N8RT 3RAQA 4JI5J 3M8QB 2LP4A 5L39A 2UVUA 2IRYA 2M5YA 1RTHA 4PABA 1U47A 2CPJA 1S77D 3LGHA 3Q89A 1KC8T 1AT1B 3EWGA 1VRTB 3EPGA 3SMZA 2V69A 1NB2A 1S9GB 2ZBRA 1NDKA 2LCWA 1RB0A 4EUVA 4WK1A 2M0GB 4X66F 2DISA 5DDRC 4P7TA 4QWDA 4P2SA 3IO1A 1R3NA 3IRXA 3R1LA 2RQCA 3OVBA 4FF3A 3UDVA 3NCPA 1TAUA 3SFUA 2WSEC 2YQ1A 3MF5A 1S7HA 5DQGA 4LVNP 2FVQA 2CG8A 3NGDA 3VALA 1S1XA 1NDLA 2APOA 4C8NA 3CJQA 1YVFA 3F44A 3VHQA 4B3MF 1LFWA 4HDGA 1T03A 4KHMA 1HI0P 2B4VA 4ED6A 3G8QA 3B4MA 3ZZUA 5I3QA 1NAQA 3T5KA 1Y9OA 1HWJA 3VR1A 1IN0A 4P75A 4NLVA 3ZC4A 1WHWA 2MLXA 2C2MB 2FTRA 5HJYA 1MN9A 2OMOA 3SCJE 5BXIA 2RB7A 4UTGA 1R6YA 2IJRA 2NZCA 4LF7F 3QSYB 1DBDA 1T02A 4PG5A 1F5BA 4OYBA 4YOEA 1FHTA 2VHGA 3HM9A 4YY3J 4IQXA 2RVJA 4ZS6A 3VAHA 3M9MB 4JI1F 3BYRA 1VFJA 3BGLA 4NLSA 2HWIA 1TK8A 4DR2F 4LF9F 3HX9A 1EKRA 1XTZA 1RP5A 3A13A 1WTBA 1KFDA 1U6BA 1R89A 1M0SA 1EARA 4DV3F 1QAYA 2C2OB 3FBEA 1G6BA 3TJ8A 3FC9A 1SJQA 4OHWA 5DZ7A 3H7HB 1BQNB 4YP3A 5KFYA 2AMCB 4QIFA 3CJKA 3V4IA 2AZ3A 4GC7A 1XNRF 3OJUA 1SV5B 2B6AA 2H54B 3BZQA 1JQGA 2UXCF 1DLOB 5JVHQ 1VLOA 3M1VA 3CSKA 4B3OB 2XMWA 3P49B 3ZZZA 2XY5A 4RX6A 1IBMJ 2WSCC 2HS3A 2FY1A 1YKWA 5CH7B 4CO3A 2OPRA 2ZJRQ 2VF3A 4X4PA 1GX6A 1X31C 1CJKA 4NA3A 4O4GB 5DM6Q 1WG5A 3WIUA 2NXUA 4ANEA 1UJ5A 4DR3J 3J81j 4LSLB 4UUXA 3JYTB 4RL1A 2WZ1A 2KYXA 3MR5A 1RA7A 5T7LA 3PFOA 3KLFA 5FJ4A 3X1LB 5B0FA 1K1QA 4I64A 4DCPB 2R3VA 2E9RX 4I6YA 2LU1A 5IT9U 4C11B 3KYLA 1FK9A 2F5GA 3V6HA 4WP8A 2HURA 1U1RA 2BJ7A 2O01C 1FNOA 4N8OA 2RMLA 1VK8A 2O5DA 2RQMA 4DSEA 3R97A 4IR9A 4LF1A 2XS7A 4R5PB 4M5NA 5KFBA 1NK4A 4GO7X 1EB0A 2BJDA 2BXJA 5H9EK 5LMNF 3N9UC 1I51B 4CWBA 4B3RJ 4LBPA 4JI7F 5L1KA 3HKWA 3O3LA 3GLJA 1PC5A 2AHOB 1VISA 3HLUA 4MKYA 3ZTOA 3KNGA 2Z0GA 2VG6A 2HZCA 2JFKA 8RUCA 2HRYA 2UP1A 1BWEA 1C4CA 2QFIA 3TUIC 1RCOB 2KXHA 1KD1T 4URGA 4A4JA 3P8BB 1RACB 4DEZA 3W60A 3MMJA 1T95A 4ID5B 1R0AA 3K5PA 4ECYA 5E0OA 2CFXA 2DNLA 4CYUA 2E1CA 1SJ3P 2MKCA 2HVDA 3K5NA 3AJ2A 2B0GA 4UY8T 3KFWX 2DPIA 3V6KA 3W63A 2DH9A 2IM0A 2FLNA 2F9JA 3LAMA 2C3YA 4OX8A 4ZVOB 2MXYA 4Y2AA 4C3KA 1B70B 2ZH1A 4OLPA 5KG0A 2V0NA 1UETA 2GQQA 3TVYA 1RLCL 1LEOA 1SPBP 2KFZA 4FVMA 5HVHA 1FX4A 3N4WA 3MWBA 3F56A 3W9IA 3AFGA 3NMAA 5F9LA 5J2PA 2R7VA 1FKPA 2WVEA 2X3GA 3G6ES 4DQSA 4KGMA 2NYHA 3CC4S 3MEGA 2DO0A 1IBLJ 1NSPA 2FHJA 5DG7A 2X1GA 3OT9A 5GAEU 1WKJA 1WEYA 4NZ6A 3G8SA 3W2WA 1FDBA 2K06A 2XBPA 3WQPA 2Z56B 2FY8A 4H4OB 4OYIA 2R7WA 1ZYQA 1X5PA 2XQCA 4KO0A 4NCGA 2JEJA 1Q81T 1FJ7A 3U1MA 4F4AA 1K1SA 4K5RA 3D7SB 3ET6A 3E2EA 4N8NA 2HZVA 1ZAVA 3FQKA 4IFVB 1N88A 2B7BB 1NPRA 1JK9B 5CYQA 4AL6A 5J2QB 2BE7D 3BR8A 3D1HA 2VOOA 4IOAQ 4NLRA 1ZAXA 4I4BA 4I2QB 1B0VA 1F1BB 1YG0A 3OVAA 3CDUA 4HYKA 5A8WB 2KFNA 3K8WA 1KVKA 3ZFVA 3EGWB 1N5SA 3HK2A 2ASDA 4ZIWA 1HI1A 4HHJA 1JLQB 2XWXA 1SJ4P 3D0GE 1IM6A 4ICLA 3EDQB 2HFVA 2HBRB 2G9OA 1KFSA 1VBZA 4JI3F 1VRUA 2D3UA 4O3QA 2LA4A 2ATCB 2WONB 2CYYA 3MM6B 2F8MA 4DR1J 2XMKA 3J7YI 1WF0A 1X60A 1UFLA 3KMSA 5LSLA 4KGVB 2DK2A 1Q53A 2QLWA 2YBVA 5B0CA 2PSZA 4ZLJA 2CJKA 2Z57B 2IHR1 1J5EJ 2DNHA 4C0OC 2AZ1A 4OIXA 1RABB 1RWWB 1C0UA 2OKQA 5CCLA 3W66A 2OPQB 5KG3A 1OYEA 5HN0A 3NS6A 2N7YA 4Y6IA 2MLZA 2UV8G 4PPZA 4IG0B 2VJUA 3RG6A 4XK8C 2DO4A 2Z8QA 5J1NA 1HNWF 2MPUA 4WFNQ 4EBDA 2OTJS 2EBEA 5E33A 2P5VA 1U4BA 4LQ3A 3L95X 1NH7A 2AEMA 4IDKA 2J6UA 2NSBA 3GPAA 2OI2A 4Y28C 3OLBA 2QT7A 2ZOMA 1VMBA 2BDPA 4NWBA 2XNQA 2ACMA 4GKKF 2RHSB 2E5GA 2C2DA 3K5MA 5FD1A 2NZ4A 2FHKA 2LQ5A 3T1AA 2SXLA 4FP9A 2VG5A 4RW7B 1S1UB 3CCLS 2PD1A 3I31A 2G0JA 5DRKA 3I82A 4MKVA 5GAGI 3KUHA 3W5ZA 2ZH7A 1K9MT 1RWOB 3RW7A 1GH8A 4AD6A 4RLEA 1S57A 3IA0A 5GAHU 4OX9F 5K14B 2W2QP 5IT9Y 1MMLA 2G13A 1DTTB 1OJ4A 2IVMA 1HHTP 1RTIA 3L9ZA 2WOMB 3FEZA 2BJ1A 3THVA 1SXLA 1X4EA 3MTKA 4WK3A 1S1WB 3AHPA 3TA2A 4V19X 4KJIA 3DNCA 3CJSA 3IAM9 3CDBA 4M5IA 4AE5A 1FFGB 4IOCQ 3DHXA 1HBUA 1HBOA 3H2UB 2CWKA 5HROA 3IAS9 1GX5A 1RAEB 3QJJA 1YGYA 2Q1LA 2CZ9A 4GVLA 2DGSA 2Z4PA 4Q8EA 2CQHA 2V4QA 3DYAB 3MM7A 2KZMA 5CHCB 3OHBA 2JVOA 4IO1A 3JQJA 4X64J 2NLWA 3KJNB 1RU1A 1KOHA 1TV6B 2ZH2A 4USVA 3MFHA 5KG2A 2GO9A 5EWGA 3BKTA 3CO0P 1N0VC 4U7UD 2DPJA 4PXEA 4LFCJ 3GONA 3M8RA 1U09A 3KK1A 1BD6A 2I8EA 2IC3A 4DQIA 4ECQA 5GMEA 1CULA 2PC6A 2BYCA 5D77A 5K5MA 3TO8A 4LQ9A 2YQ3A 1ZZNA 2IMOA 2E5IA 4QW8A 4JYAF 4C4WA 4KYZA 5DDOC 2V4RA 3ILLA 1Q8IA 5HMWA 4TLRA 1FEHA 4AL5A 4CH7A 3ZZ0A 2EG2A 1OPIA 3QO9B 4CI0B 3QT8A 4OI3A 4DPOA 4X4NA 5HBMA 1HI8A 3R8YA 3NRBA 1ZBTA 3W61A 4F2RA 4OHXA 5IM0A 1CEZA 4DUZJ 1YSJA 5AJ3F 1IKYA 1LWFB 2HEKA 3KOAA 3G86A 3M9NB 4A8MP 1WF2A 3MMCB 3TUPA 2KG0A 4DCOB 2HBZB 2OFGX 4WXWA 2KVIA 1WEZA 1QUPA 1I3OB 2DXFA 3BGFA 2B4PA 1FJCA 2PT0A 3MMAA 2Y8YA 1UP1A 5BYRA 4AFFA 4LF5F 1TFYA 1JLBA 4KPCA 4RW4A 3BN7A 3GG0A 4YR2A 1CJTA 3SQGB 3KHRA 3I87A 5I3UA 4UUWA 4NEZA 3GIIA 3G87A 3ICLA 4J9OA 2UUAF 3ZZTA 2OAUA 1RAHB 2CQBA 3M30A 2IJNA 1R0CB 1K47A 2M3DA 2J8AA 3Q23A 5I42A 1YI2S 4OI6A 2G4BA 3CCMS 2B3TB 3LH2S 3NGRA 5L1JA 4TQRA 3I9ZA 4HTJA 4YQWA 5A8RA 2DGQA 4LRFA 4B9SA 2YWKA 2YWEA 3MZIA 4IR1A 3Q24A 1NRKA 3C15A 4X2BA 3ZZYA 3MUTP 1QY7A 4TU8A 2MHNA 3SBMA 4ZN1A 2HMIB 3MOJB 2IM3A 2ASLA 4RNOA 1G7CB 4PWDB 3C8YA 4OZ2A 1FTCA 1I6JA 3MOZA 2EFGA 5HAOA 2YKPA 1N36J 2UV8A 4H4MA 4USIA 1FRHA 2XZTB 1Y5LB 5KFJA 1PGZA 1TL1B 1C1CB 4WFBQ 4WFZA 3X3UA 3A4TA 1NSKL 1G4CA 4KAIA 4PKDB 1IKVB 1H74A 2VIHA 5JMNA 1RTZA 1X9WA 2QLBB 1N52B 2GAGC 4ZVSB 1IBKJ 2JLFA 2R2SA 2PFDA 1JLEA 3BJYA 2DHXA 1R8PA 2OIHA 1FXRA 3H5UA 3PDNA 1N5YA 1K44A 1CJVA 5C2CA 2IA6A 3GJQB 3BBFA 2ZD1B 2XLJA 2ERRA 4A8KA 4JUZA 3L09A 4ZDNA 4I1TA 1CQNA 3E01B 2UXDF 4Y2CA 1IWAA 1WI6A 4ZLNA 1VR6A 3GCWP 1HQUA 4NYZA 1SQEA 4ECXA 1LW2A 2PN6A 2YKMB 2P9GA 1MG7A 3MI7X 3QWUA 3HI9A 1TKTB 4QU6A 2IJFA 1P27B 2DGXA 2JZ5A 1X0PA 1XK8A 4G6VB 1ZM3A 3TNVA 4B9LA 2AT1B 1CLFA 4ZHRA 2CPEA 3IG1A 2HZAA 3AOCA 4B3TF 1EP4A 1O8BA 5BYQA 3QJPA 1MSWD 5GMKa 3B8HA 4TKTA 4A8QA 1U2FA 1S7IA 3NS5A 3BGRB 5D4LA 1CQMA 2VPXB 3FEYB 1TL7A 2GGPA 5CD4A 1VQ5S 2J9DE 3NBPA 1TL4A 2QE5A 3M8PB 4FYWB 3DDNA 4KBIA 4CLSA 3PX0A 2HIQA 3DHWC 3KK3A 3CCES 1HPZB 3D6HB 2HHUA 4L3NA 4OZ1A 2RH3A 1FDNA 1KVJA 1B4SA 3RR7A 3QGGA 1HYSA 4DR7J 2L08A 3BGOP 3OSNA 5L9XA 3K57A 2WVDA 2MJUA 4M5LA 5L1LA 3KJFB 4QR2A 3KDOA 1Q7LB 5KFZA 4NXMF 3UN3A 1S48A 3TUZC 4OZ3A 1N34F 3H2VE 4X65F 4KIAA 3HXMA 4QWAA 4ECWA 1N0UA 3DLEB 5KT6A 2R42A 4K0KJ 5HK4A 2CVEA 5CAAA 4W92B 3CMAS 2DR9A 4QOTA 2CVIA 2MZSA 4E0DA 3OPKA 4TY8A 3SI8A 1U1KA 2C2RA 3Q86A 2GVDB 3GYXB 1M5KC 2WB4A 3R2DJ 1IKXA 3CO9A 3MEEB 4DR5J 1MN7A 4NASA 3EE3A 5E3QA 4C98A 1SH0A 2W4CA 2QTWA 3EZUA 4ZCKA 1RZMA 1TELA 4C3MA 3OFGA 1O5JA 4OYMA 3W9HA 2G2ZA 3K89A 2QA4G 2Z58B 3DOKA 3GV8B 3MM9B 2JEGA 2VG7A 4LSZB 5B0BA 4LF8F 2GW8A 3ILOA 3UDCA 2FGOA 1VQKS 5F41A 5EGYA 4JI8F 1HW9A 1B0TA 2QL5B 4DR4F 2Q43A 3CTRA 3PX4A 4OYOA 3PM9A 3U02A 4RZRA 2ZHAA
chains in the Genus database with same CATH topology
1TR0A 2GX8A 3LPYA 1S6PA 3O1LA 3SEOA 5KFXA 5CQGA 3D2WA 4EEYA 4RW9A 2H5EA 2VD3A 4PG6A 3SSQA 3ENQA 1RT2A 5KFOA 5ITHA 3NKYA 4IRKA 2ZJPQ 1V3ZA 2XHWA 4PG4A 2MQLA 5C5JA 5DLFA 1U1PA 1M5PC 3C2PA 2E9ZA 2XNRA 1UJ6A 4UOCA 2RF2B 3K7RA 2M4MA 4OHYA 1FVSA 3I96A 3PIOQ 4FVCA 2KT3A 2KU7A 2Y1JA 3V6DA 1LFPA 1ZZFA 2N4DA 2W7AA 4ES1A 4N41A 4QIEA 1DQAA 2MYFA 4A48A 1BQMB 5JXSA 1KTVA 2BV3A 3BO4A 1TKZA 2D1CA 2FJAB 4D3GA 2YX7A 2J9CA 4K2XA 4O3SA 3Q0AA 4DG1A 1G3OA 4HEA9 2ZH3A 3SZ2A 1REVB 3J7YU 2R9LA 1XR7A 4ED5A 2XCAA 1SKWA 1XN9A 3EXYA 2EFNA 2D74B 2IRXA 4C3LA 4F2SA 4RW6A 1QM9A 4BWJA 4PQAA 2ZE2B 2QEXS 2DCLA 1HHSA 3MD3A 1RJJA 3ENVA 3DOLA 3SDEA 3LP1B 1K8AT 3KLGA 3PW7A 1WI8A 4IRDA 5KFCA 3DCAA 1S6QA 1C4AA 3HVTB 4I56A 4F25A 4FS1A 2K1RB 2GQCA 2XG8A 4NPOA 1ZPVA 4RU2A 3UNGC 2ZVSA 3Q8SB 5I4MA 3IR6B 3VCDA 4YB5A 3MUMP 1FE4A 2VPWB 4CO0A 3CIMA 2OJ3A 5BJRA 3EZ5A 3DLGA 2L3MA 4K4WA 4IO9Q 1HWUA 1P1TA 1ROFA 1NH8A 4QIGA 3PW2A 2EVZA 2RRAA 1YJNS 1A9NB 1HBNA 1D0EA 2WBRA 1YWXA 4U9RA 4IFVA 2DH8A 1JKHA 2AP6A 2AU0A 1RT6B 2V8GA 4HI1A 1R31A 1T3OA 4A8OA 3GFZA 3HVAA 2ADBA 2VFRA 3VAJA 2FLLA 4MIWA 2EKYA 4RNMA 2WW8A 2YNFB 2N3OA 3AJ1A 2GV1A 5LSRA 3FMWA 2QA1A 4CNYA 1FO1A 3I0RB 4I2QA 1LW0A 3KLHB 3UI3A 4OX6A 4TY8B 2XMUA 2HNDA 3VZHA 4IG3A 4FXVA 1RTDA 1XMOF 4N5SA 2G1DA 2FVSA 4DLGA 2UXBF 3EPIA 1IKXB 1S1TB 2BOPA 1IXKA 1D8ZA 4DLEA 1IJFB 4LT6A 3ULHA 2K7KA 4JV1A 2R8HA 5A6WA 4JBCA 1HBOB 1U1NA 4ZP7A 4KSEB 5D4OA 4QYZJ 3C6UA 2J7WA 4F50A 2HHTA 2I0XA 3TRGA 5CD4H 1HR0F 3EGNA 4G1QA 1CPZA 4MJKA 1KLMA 5AXKA 2QSWA 3PXGa 3JTNA 4ETZA 2MMYA 2HPUA 3T6JA 2HHPA 2L9WA 3PKMA 3OSPA 1JLQA 2C3OA 2JX2A 2HW3A 1HQEB 2EK6A 1Y4ZB 5KFWA 4HH0A 2UUTA 4R8UA 2DR5A 2R7UA 4F4KA 2EFPA 2XMJA 4D3HA 1KSPA 5HO4A 1X4GA 3HHLD 4WFAQ 1NHVA 1C1BA 1DJ0A 3FRZA 4C97A 1UA0A 2V9WA 2AQ4A 4NCAA 2IYIA 4Q45A 3DOKB 5DJBA 4BC9A 3GV5B 3UD4P 1FNXH 2VG7B 4YR0A 2E1MC 5DLGA 3VAKA 1YJTA 2WONA 5KFLA 3Q2TC 2EFVA 1RKJA 2VONA 3PNIA 4OV1A 1S97A 4X4OA 1Q16B 3GFHA 5D3GB 1R8HA 1S9GA 2QSFA 1KN6A 1RT1A 2D9OA 2ZITA 4JI4F 1QAXA 2HNYA 4X64F 2VA3A 2M70A 1FXDA 3FZ2A 1C0TB 2V2KA 4B02A 4J9LA 2WK4A 4YB6A 3I4HX 1XMQF 1LWEB 3N01A 4C7QA 4K4SA 4YB7A 1K73T 3H8YA 3UDLA 1L3UA 2MY7A 1KQKA 1W2IA 2EFQA 5KFVA 3KK1B 4DFMA 4O3RA 3G96A 2YNHA 1UW4A 2X1BA 1FD2A 1U8SA 1Q79A 1HL6A 4AXIA 1RISA 1RT2B 3CD5A 1VQOS 4LFCF 1HD1A 4FNHA 2JSXA 3GB0A 2B9YA 4PXBA 2MJNA 3WC0A 1Y5IB 3BN4A 1N54B 4ECUA 4JV5F 2BBEA 1V3SA 4OZJA 3QWPA 2W7OA 2EI5A 4DFPA 5LXRA 3TUJC 5SZTA 2J0XA 3G6YA 4J37A 2FLPA 4KFBA 5KFFA 3CJ5A 3V6DB 3MURP 4DF4A 2UVRA 3LANA 4HTIA 4ZCIA 3K2YA 1VQ6S 1A6LA 4ZPCA 3MEDA 2FJEB 1TKZB 1WHXA 6FDRA 3GIKA 3GG1A 4M8LA 4WFYA 4EGLA 5JUMA 2ROGA 1ELOA 1LXNA 1XERA 2Q6BA 3DRSA 2AGQA 2OPQA 5SUHA 4NLDA 2AJFE 2RSQA 2FJVA 2HFOA 1UFWA 2QA2A 3LF0A 4XDCA 3RU0A 2IAJA 2FHOB 3CUNA 1FKOB 3OBIA 3NMRA 3KK2A 2KHCA 3VAFA 4I2PA 4RW6B 2JJ4D 2VFVA 2GNKA 2CQ3A 4KB7A 4DUYF 4QYRA 4NXNF 3D0HE 2CDQA 3FNNA 4FPRA 4RUAA 4F67A 4NX9A 4OHVA 1CSJA 2KT2A 5L8RC 3RAXA 4B3SF 1QE1B 3KLGB 1FRMA 1S6QB 1Y3KA 4KHRA 1MWZA 4HL9A 2RILA 4DV6F 1L5UA 1HWIA 1R8AA 2HHVA 3PW5A 1D9DA 4RWXA 1G1XA 2W8KA 1IKYB 2MKJA 4TU9A 3JTPA 2FHJD 4MIBA 4DUZF 1NJXA 3TVZA 2DVIA 1LWCA 4ZMMA 4EO8A 4RNNA 1RYSA 1Q8LA 3TQ1A 4O44B 2O3DA 1WF1A 4B9MA 5CA5A 5K8NA 3DLGB 2MZJA 2AJ0A 4OHZA 5C25A 4WU3A 1HBNB 3IN5A 3BS9A 1VC5A 1WELA 2MQNA 4WF9Q 2PGCA 3MM8A 4LVOP 2PIIA 4ELUA 4DR6F 3NGKA 3MPWA 3POTA 4CCHA 4Q44A 3S1TA 2Q79A 2RKIA 2KKHA 3U7JA 4ZPDA 1TZ0A 4F3QA 3I32A 1Q82T 3CJ2A 3MMBA 2P6SA 1S9FA 2YH0A 5F8GA 4A8FA 1G2EA 3OFHA 1X0FA 3DU5A 3NP5A 2MQQA 1LW0B 1U1QA 3CF5Q 3I9V9 2HNDB 2HGLA 2EWHA 3KKFA 3QLHA 2NS1B 4IG3B 1RTDB 4OI0A 2N3LA 2KZZA 1KR4A 1BC6A 2H9ZA 4USHA 5KOXA 2J6SA 4WYWA 4ZVHA 2XGQA 5LXYA 3ETOA 3QIPB 1DFDA 4G1IA 3T6BA 2XSJA 5AXMA 1OSCA 2LKZA 1GQEA 1SH3A 1ULRA 3W7BA 5KG4A 2MKIA 1M1KT 1X5TA 1U1MA 2RRBA 3R5DA 2GJIA 4G1QB 1N8RT 1WHYA 1KLMB 5GVQA 3RAQA 2JL9A 4WXOA 3M8QB 2PA3A 2KJVA 4NRTA 5L39A 2UVUA 5M2PA 3OXGA 1JLFB 4I7FA 2W9AA 3LW5C 4ZVFA 5AXLA 5E5NA 4MK7A 3SCKE 2QRRA 3CJ4A 2IRYA 4R8UB 2D3OR 1HFEL 4UY85 2M5YA 3K8VA 3EX7B 1RTHA 3N6NA 3CE8A 1U47A 1YITS 4FZVA 1MNEA 2CPIA 5KFSA 2CPJA 1S77D 3MM5A 3BR9A 1KC8T 3BDPA 4OI1A 1NK8A 5F8IA 5KG6A 4LFAF 3HKZD 1VRTB 3EPGA 1HD0A 3SMZA 1A7GE 1XWLA 4NYPA 2ZC3A 1OPZA 1S9GB 2ZC4A 3UWTA 5B7WA 3PO4A 1DTTA 1RT1B 4WZMA 2LCWA 3T9NA 2WSFC 5K9FA 2XB2D 4EUVA 2HNYB 5AE2A 4WK1A 2M0GB 4X66F 2MKKA 1Y5NB 3PY8A 5G4DA 3IWXA 2WOMA 2DISA 3N5FA 2HS4A 5A8RB 5DDRC 5KG1A 4QPXA 5E3RA 2LXUA 4P7TA 4QWDA 2BABA 4P2SA 3UQSA 2RDIA 1E6VA 1R3NA 2NSCA 3IO1A 2YNHB 4C0HA 3IRXA 4NYOA 2KG1A 3R1LA 3FVYA 2RQCA 2XLKA 3OVBA 1Z2LA 4DL5A 2W9BA 1RQ0A 1KQFB 1VQ7S 1NJYA 3MUVP 1KLNA 3T19A 3UD3P 1SUQA 4FF3A 3NCPA 2HGNA 3Q2SC 4YMEA 3LALA 5IFMA 1SV5A 1NK5A 1TAUA 3KTQA 1AXQA 2VUGA 4IOBA 3SFUA 3J81Y 4QIVA 2WSEC 4KFBB 2LYVA 2OO4A 1FE0A 3MAHA 3MF5A 3JB9k 3O2IA 3I55S 1S7HA 2ZDOA 4QR0A 3MEDB 4PG8A 4WFXA 3UW1A 3DRSB 5DQGA 4B3OA 4LVNP 2F1FA 2MZRA 3KG1A 2FVQA 4ECZA 1M5VC 2J7KA 3NGDA 4MKAA 3PJWA 3VALA 1S1XA 1WACA 2YNIB 3I6PA 3MAQA 2ZOFA 4I2PB 4DS4A 1VC6A 2APOA 2C42A 3EYZA 3R5BA 2MHEA 5CYMA 5I3PA 5HL7Q 2DNZA 4C8NA 5KFDA 4Q7AA 3D0IE 3FCHA 1QTMA 1YVFA 4NLPA 3F44A 1HNVB 4QCLA 4B3MF 3DYAA 4H4MB 3LP0B 3OL6A 2BW2A 2HNZA 1LFWA 5FDLB 5C42A 4HDGA 3UR0A 1T03A 2JDJA 4KHMA 5T14A 4KGKA 3CD6S 1QUVA 4FNIA 3OR2B 4O4GA 1HI0P 1TV6A 2B4VA 4QQBA 4ED6A 2ALZA 3G8QA 3B4MA 4NLOA 5E2QA 1JIHA 3ZZUA 1NHUA 2Q3PA 4X4RA 1S0OA 1F2GA 5F8HA 5I3QA 3T3FA 2RS2A 1NAQA 3T5KA 2DTJA 1KOOA 3W3SA 1Y9OA 1HWJA 3VR1A 3JYTA 2UU9F 1IN0A 3MM8B 3WC2A 4NLVA 1QJHA 4QWCA 4F8RA 4V19J 3ZC4A 4F3MA 1N6QA 2RKIB 1WHWA 3BREA 1FA0A 5F8MA 2FTRA 2XS5A 2P9CA 2CQ1A 3MMBB 3PW4A 3Q8PB 1VK3A 3N28A 1RI7A 2OMOA 1VHFA 4MFBA 3SCJE 2RB7A 4RU9A 1J5OA 2R7OA 1M5HA 2FJDB 1R6YA 2ROPA 2Y1RI 7FD1A 4NLWA 2BA9A 4KE5A 2ROEA 3QLHB 1LKZA 4FF2A 1S0VA 4LF7F 1DBDA 1T02A 4PG5A 1NK7A 1F5BA 1JLCB 3K5LA 4YR3A 1IBKF 1VS3A 2HQIA 1FKAF 2DCUB 4YOEA 4I0WA 3QZ8A 1FHTA 3GYNA 4AL7A 1B7FA 3GMGA 3HM9A 1Z2ZA 2B4UA 4N56A 4IQXA 4R5PA 2RVJA 4IQMA 1FRJA 2JC1A 3CD0A 4ZS6A 2BM1A 2UUBF 2DR8A 3VAHA 3MPVA 1JJHA 3OW2R 3M9MB 2LECA 4JI1F 3DRPB 3T1YF 3J7Z5 3N0VA 1Z4UA 3FFIA 5J2MA 2V4JA 3QYYA 1VFJA 4O3PA 4Q0BA 1RTHB 1IKWA 2KM8C 3OL9A 2CRLA 3BGLA 2FVCA 1O0PA 3JSBA 1TKXB 3MM5B 4NLSA 2B4OA 2YKQA 2HWIA 3ONQA 1TK8A 1L3VA 3CC2S 4X4QA 4DR2F 4LF9F 3HX9A 2RQ4A 2NUHA 2RU3A 3P96A 4M95A 4AXJA 1HQUB 1X8DA 3OVSA 3TAQA 1XTZA 1T8EA 1RP5A 1SJRA 1WTBA 2AV5A 1D9FA 1KFDA 1U6BA 1R89A 3JTOA 2OD6A 1LOUA 3E3XA 3TW0A 3PACA 1M0SA 1QSYA 3IFEA 4DV3F 4FS2A 4HKQA 4PRFA 5HP1A 1QAYA 2HVIA 4O3OA 4DV5F 1G6BA 3G71S 4G1PA 4ZVEA 4X4UA 4EO6A 1VI7A 1FNMA 3DI6A 3UCGA 3S6EA 4ZCLA 1SJQA 4AQYF 4OHWA 2C3MA 4EYHB 1S72S 1BQNB 1UEVA 1F60B 3OFEA 3OJSA 4YP3A 1RGVA 5KFYA 4DL4A 2VPYB 2M7SA 3IRXB 1YJRA 4QIFA 1T05B 2V8VA 3CJKA 3V4IA 4C8KA 3BSOA 3LQVA 4GC7A 1XNRF 2YNGB 1OIAA 1NK9A 2WRMA 1NU4A 4JOUA 2VOPA 2QIFA 3HFKA 3OJUA 1AROP 2HYIB 1SV5B 2C22A 2B6AA 3BZQA 2FD2A 2UXCF 3LP2B 4ITSA 1DLOB 2CG4A 2EW9A 2J76E 3WX4A 1F5AA 2QFJA 3V81A 2E9TA 1VBYA 2HHWA 5JVHQ 1H38A 2MKSA 1TP7A 2I5JA 3M1VA 3CSKA 1EP4B 3UFCX 4B3OB 2XMWA 3P49B 4K59A 1U7LA 1VQSA 4F4YA 3ZZZA 1CC7A 2XY5A 1S1XB 4RX6A 5DGAA 2WSCC 2HS3A 2FY1A 2KRRA 4ZCMA 3DM2A 2FHMA 1DARA 5AE3A 2AX0A 1R43A 1XR5A 4YDXA 4NLGA 5CH7B 4CO3A 2OPRA 3M32A 1TQLA 3QIDA 2ZJRQ 3GWCA 4OJ3A 1DZ5A 2FJXA 1MWYA 3JAMY 2F8EX 4B08A 5C42B 1SIWB 2VPZB 1HBMA 1VQPS 3R27A 1T03B 5THWA 4X4PA 2VFSA 1FESA 1GX6A 1NEEA 2OPSA 3MPYA 2LEPA 2V94A 3DMJA 1X5SA 3NBPB 4Q43A 1AFIA 4NA3A 2N82B 4O4GB 5B09A 5DM6Q 1WG5A 2NXUA 3AY0A 3JSYA 4Y34A 1UJ5A 3WBZA 2W9CB 1Q86T 4J5OA 2WAQD 2XMMA 4LSLB 5U47A 2ZJQQ 4UUXA 4OI4A 2IFXA 3JYTB 1N56A 2VH7A 1RYRA 2MSTA 4OZLA 3KK3B