1FRLA

Azotobacter vinelandii ferredoxin i: alteration of individual surface charges and the [4fe-4s] cluster reduction potential
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDSCIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Azotobacter vinelandii ferredoxin I. Alteration of individual surface charges and the [4FE-4S]2+/+ cluster reduction potential.
pubmed rcsb
source organism Azotobacter vinelandii
molecule tags Electron transport
molecule keywords FERREDOXIN
total genus 31
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1993-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1frlA00
1Y5NB 4YDDB 3GYXB 1FF2A 2FGOA 1R27B 1FXDA 1H7WA 3MMAA 2FJAB 2ZVSA 3EGWB 1FRIA 4AYBD 1PC4A 1CLFA 1BQXA 3MMBB 2C3UA 1FTCA 3PNIA 1BWEA 2VPYB 1Y4ZB 1A6LA 1K0TA 4OV1A 1FRKA 5FD1A 3MM7B 5BYQA 4DHVA 3C8YA 3MM5A 3OR1A 2VPWB 3MM6B 3MM9A 2C3MA 1GT8A 5BYSA 2UZAA 1GTHA 1JNZB 1SIZA 2PMZD 3IR7B 3MM9B 3MM6A 1C4AA 2WSEC 1VJWA 3MMBA 1Y5IB 2V4JA 2XSJB 2WB1D 4XK8C 2WAQD 4OMFG 1Q16B 2XSJA 1FERA 1DFDA 6FD1A 1FRXA 1D3WA 2FJBB 1C4CA 5E7OB 2GMJA 1SIWB 1BD6A 1HFEL 1JB0C 3MM5B 3OR1B 5L8RC 5CH7B 2FJEB 1FRLA 1WTFA 1FCAA 7FDRA 1H7XA 4KT0C 1BLUA 1FDDA 4L6V3 2VPXB 1B0TA 2Y0SD 6FDRA 3OR2B 1FDAA 2WSFC 3IR6B 3OR2A 4ID8A 1IQZA 2Z8QA 1GAOA 1JNRB 1KQGB 4RKUC 1FDNA 5BYRA 1GTEA 1FXRA 3MM8B 1Y5LB 1DAXA 3IR5B 1FD2A 3LW5C 3MM8A 1B0PA 2C42A 5CHCB 4CI0B 2C3YA 2IVFB 1FRJA 3EUNA 1F2GA 2FDNA 3EXYA 2VKRA 1F5CA 1H0HB 1B0VA 1KQFB 1DURA 1FRMA 1SJ1A 2V4JB 1RGVA 1KEKA 4Y28C 1FDBA 1FEHA 2C3OA 1F5BA 4XDDA 1BC6A 2V2KA 7FD1A 2C3PA 1H98A 2FJDB 1AXQA 1G3OA 3HKZD 2GMHA 1PC5A 1XERA 3MMAB 1FRHA 1ROFA 2WSCC 2O01C 2VPZB 4XDCA 1G6BA 3MM7A 1IR0A 2PDAA 2PA8D 2FD2A 3MMCA 3MMCB
chains in the Genus database with same CATH superfamily
4V19J 1T02A 2RDIA 4IRCA 4M5DA 4FS2A 1W25A 2CFXA 2ZD1A 5B0FA 2K3IA 5CCMA 2UVVA 5HQ8A 3E01B 4HYKA 1VLYA 1KD1T 3DRRB 3RB3A 2RD5C 1RWOB 3KHGA 2R7WA 1T8EA 4XAKA 2PMWA 1TKTA 3CJ8A 3TEHB 2KH9A 1YQHA 4J9MA 3CJKA 2RKIB 4EFAC 1KTVA 3CT9A 3UNYA 2D9PA 5I3QA 4RBTA 3SQGB 2Z2YB 3FVYA 2KKHA 4P2SA 3PNIA 1IBLJ 1BWEA 2CPJA 3KK1A 2HYIB 2ZWPA 4GC7A 4KHMA 4WYWA 1HWIA 4EBEA 2Z2MA 3KK2A 1J5EF 3QYYA 4MK7A 4Y6IA 3OV7A 4F4ZA 1VQ9S 2UU9F 2W4PA 2VPWB 4R8UB 2JDJA 2C3MA 1NHKL 4ZVEA 3W66A 3FFIB 3CCRS 1JLAA 3MR7A 1RSCA 1F60B 1Q7LB 1S1WA 3HSZA 3T9NA 3F73A 3JB9k 1UA1A 1H38A 4OYZA 5G4DA 2R8KA 2DXEA 1G7CB 3IR7B 2YKNB 1RADB 2C2NA 1RAIB 2BKNA 2V63A 5KG5A 3MM9B 4IFYB 2WSEC 4PYDA 1T9VA 1Z2ZA 2HQIA 5E5NA 4USJC 3W5YA 3T41A 2MKIA 1D1UA 1O0PA 4N5SA 1VISA 3NY0A 2YKNA 5KFSA 4CYUA 2DGXA 2GVDA 4YMEA 4YHHJ 5L1IA 1SV5A 2Z2ZA 3OR1B 2DPJA 1TAUA 1FRLA 1S1UB 1I3OB 2DJWA 3GE9A 4CO5A 4OYBA 3IWLA 3QNWB 4OI4A 5D0HA 3TQEA 4JI8F 1XMBA 1NH8A 3D3BJ 3O8WA 1F9HA 3HULA 5LMUF 5AE2A 2MQ8A 4I7FB 4JI6F 1VK8A 3C66A 3R5BA 4WE1B 3DU6A 3V4IA 1HNIB 2BM0A 3O5TB 6FDRA 3RB0A 4I67A 3ENWA 3M9NB 2XZTB 4DF8A 3X1LB 4E2FB 4NCAA 2KB2A 4ID8A 3WHIA 2QX0A 3FBEA 2QG9B 2RHQB 1QDUB 1SC1B 2DNYA 4WK3A 1NDKA 2ZHAA 3K5LA 4DR3J 2HNYB 3NLCA 4LSNB 3EX7B 2I8EA 1X5SA 4CO0A 2MQPA 3MR5A 3QGIA 4YDXA 2RRBA 1VMBA 4KFBB 1TKTB 1OY8A 1GX6A 2ZHOA 3FQKA 1NPRA 1FRJA 3EUNA 1RJJA 4YY3F 1CJVA 1HWUA 4Y2KA 2MMYA 2RUSA 3TVKA 4NLQA 3KHRA 3OJSA 3ZNUA 3K59A 2VODA 4X4SA 4LT6A 2CYYA 2ZD1B 1QVFR 4DL3A 2R7UA 3DLJA 1B7YB 2MKCA 3R7SB 2BEFA 2KJVA 1XR7A 2F40A 4K2XA 4ER8A 1D9FA 2O1PA 4ZLPA 5A6WA 2OJ3A 1PAEX 1LFPA 1CJTA 2J8AA 1WI8A 1KTQA 2CJQA 1X5TA 3SIPB 8ATCB 3KJQB 3GYGA 4RW6B 3R5AA 1TV6B 3AAWB 5ETRA 3H5UA 1FRHA 2RH3A 3L09A 1ZETA 3RG6A 3AOBA 4M1KA 3QJPA 1RAFB 1Y3KA 1F1BB 2XMKA 5KFRA 3OFHA 1MWZA 2ZBPA 1BQNB 4M5KA 5CAAA 2MJUA 3M2RA 4P72A 3MPWA 3WIVA 3I56S 5DDOC 1T3NA 1RLDA 4P73A 3KLVA 3PKMA 4YOEA 1KONA 4DU8A 1TP7A 3GFHA 4Y34A 4ZVFA 1TFWA 5GAHU 2AEFA 3N01A 4Q8EA 3H40A 2OTJS 2CQGA 1WG4A 1NK6A 3JSMB 3KLFB 2HIQA 2L08A 3HFZB 5JUMA 1RT5B 4USVA 4ECVA 2V8GA 3ET6A 2X1FA 3HSJA 2CQ3A 2M52A 4PG6A 4EI2A 4ILLA 2IA0A 4BWJA 5CXTA 1NK4A 3MWBA 4WXWA 3HI9A 4P7TA 1REGX 4IG3A 3VCDA 1IJFB 2QV6A 4KYZA 5D77A 1V6HA 2VD3A 4NA3A 5T7LB 3LPEA 1WHXA 2FC9A 2M5YA 4M8LA 2I9SA 3G8TA 3AB2B 5AXLA 4C8YA 2PA3A 3KG1A 1TL3B 1CQNA 5E3AA 3KLIB 3M8QB 3PW4A 1WSRA 2J7KA 3HHLA 1HNXF 5IM0A 1LK5A 2BRLA 2LEAA 4DSJA 4DR6F 5DM7Q 1Z2LA 4IOAQ 1HWJA 2LLZA 2B9XA 2H5EA 3KUGA 4NMXA 5B0GA 4C8MA 3KYLA 1BWVA 1G4CA 5IOLA 4MH8A 4IO9Q 3NEKA 4ERDA 1JLQB 1QD1A 1HR0F 1TTHB 2J6SA 5DZ7A 4S0MA 3W62A 3PZPA 2MPUA 3C6TB 5CZVA 2VOOA 4X62F 4OMFG 3OUYB 1BY9A 2AD9A 2C22A 1IBKJ 2XSJA 5FDLB 2CNOB 2NYIA 4RUAA 2B56A 3C16B 5IWAF 2XO7A 1NZAA 1ZOTA 1U6ZA 3MPVA 3Q23A 3LAMA 2B9EA 5HBMA 3Q8QB 2KZMA 3ZTOA 1QSLA 3NWGA 1U1QA 3LANA 4CO3A 2FIUA 2QTWA 4LSZB 1P8GA 4O3OA 4JI7J 4C3LA 4UUXA 2OFGX 3M6XA 3W65A 4LF5J 2FUG9 5D8HB 5KFFA 3CC4S 1EP4A 5CA5A 1LWEB 3LP2A 2R7XA 2FVPA 2ROEA 4PYAA 4CH0S 2QIFA 2CNNB 4IYQA 5ETTA 1G2EA 1VBXA 3F0NA 4L72B 4LIRA 2XHWA 5HATA 2MB0B 2XO6A 1GNKA 2DIUA 3DHXA 3K5NA 4YFUA 2LYVA 3S6EA 1GAOA 2HGNA 1KR4A 3V5RA 3G6ES 5I4MA 2U1AA 1CS4B 2IA6A 2CQIA 1NUEA 2W7AA 1MROA 3LPYA 3QIPB 3QQCD 3CWJA 4ICLA 4M5NA 1V5IB 2EW9A 4F25A 1RWVB 2EG1A 4O44A 4UUWA 1IKYB 3DOKA 3QZ8A 4K4TA 5L1KA 5F8NA 4CLTA 1F2GA 2KN4A 1T9YA 2K7JA 1ZTWA 3BR9A 1MU2A 2V6AA 3KNGA 2CQ0A 5HLFB 2UXDF 4JBCA 3AD8C 1QM9A 4LIWA 4PEOA 2RSQA 2CDQA 4K59A 4XTTA 1FXLA 1NM2A 1R6YA 3M8WA 3BF4A 1VK3A 2HLTA 2P9GA 3M8PA 2BQUA 3QO9A 2WBRA 2W4CA 5BJRA 5DLGA 4N56A 2FVCA 1GH8A 5HP1B 3TVZA 2V2KA 3M9OB 1WDTA 2EK6A 2HIYA 4YB7A 5F8LA 2HVZA 4YEAA 1C0TB 5I3PA 2XCPA 3UVJA 1EKRA 3CJ3A 4ID5B 1FKOB 4UOHA 3SCJE 1OS5A 2KT3A 4LRDA 4OQJA 3T3FA 2IY5B 3HJVA 1ZYQA 1PC5A 1R0AB 1HKAA 2FHMA 4OYWA 4DR1F 1FESA 2IHR1 5D78A 2BVZA 2A0FB 1RT7B 5F0WA 3Q24A 1KLMB 3V6JA 1JXLA 1P1LA 1FKPA 1H73A 2PDAA 4NX9A 2BV3A 2GGPA 3AXMA 2HRTA 2OAUA 2FLPA 1VFJA 2MGZB 1VBZA 1DTTA 2M7SA 2ZEJA 2IFXA 4JV0A 4DG1A 1UVJA 4MKVA 5A2QU 1U2CA 4UF4A 3Q8RB 1FF2A 1FFWB 5JVHQ 2XMMA 1VQPS 4KPYA 2VU5A 1F5AA 5ETNA 1U24A 1RA7A 3LWLA 3Q8SB 3EM1A 4B9NA 3M6UA 1S12A 4DV2J 2HHTA 4F2SA 4CQ1A 5GAEU 1EIYB 2ZDPA 5ETOA 4DL7A 3IFEA 5J2MA 3NNAA 4IQMA 2YXLA 1KWMA 1DTQA 3P5BP 2PEBA 4AFFA 3TWZA 2IM0A 3M30A 2CJXB 2DGUA 2PE8A 4OV1A 2E9ZA 1H2VZ 4EO6A 3CD6S 4DU7A 4C0OC 4EK2A 4X4OA 1FK9A 2UUTA 3BO2A 1GT8A 2BJ3A 1HNVB 2HNDB 1HNVA 1TUGB 2HNDA 1WOOA 3IGNA 5CZXA 1NPKA 2HEKA 1LWFB 3KWMA 4QIEA 3TW0A 5C7PA 3OSPA 2JSXA 3HSDA 5KFEA 4ED2A 4Q5VA 2AYBA 4LF9J 4IH5A 1LV5A 2NR0A 3FMBA 5L1LA 2MZTA 3HCXA 5T41A 5M2RA 3OL8A 2VDHA 3MM6A 4NCGB 1YK9A 3TZZA 2V94A 2IC3A 3FCWA 4GO5X 3T1HJ 1H72C 1YJUA 2WAQD 2YQ0A 2YWKA 1R0CB 1X5OA 4NASA 1TZ0A 2YWWA 3EE3A 3KG0A 4FDFA 2YKQA 2UXDJ 4Y2MA 5D6GA 1A9NB 1SPBP 2COLA 5J2QB 2UUCJ 4DOZA 3GSDA 3P5TL 5LM7E 4C7QA 3LP0A 5DLFA 1CJKA 2P9EA 3IGVA 2AEMA 2CJYB 1YITS 4ZPCA 4DR4F 1ITPA 5MAOA 4WP8A 1K47A 3MMJA 4USUA 4A8MP 3GIMA 4I2QB 1SJFA 4QWDA 2GVZA 5CYQA 2NSCA 2R4FA 2MZ1A 2XGPA 4DL4A 1RAGB 2U2FA 2VPXB 2GO8A 4ED6A 2C1EB 2HVDA 3HHLD 4I0WA 4I69A 4C0BA 4ZPBA 4HHHA 2PO4A 4K2JA 2B5JA 2XYPB 1RTDA 3FBFA 3CCQS 3DLEB 2GW8A 3VZHA 5L38A 2W7OA 3TAQA 4NE9C 2V2ZA 2MDAA 1FVSA 1JQGA 1CJUA 5JMNA 4FKYA 2VG6B 1OYEA 2RU9A 1IKXB 4B3TJ 1OYDA 2DR7A 2V4RA 4DR4J 5F3TA 4ED5A 4LBPA 3CDAA 3PKYA 4DCPB 3GQCA 3B6BA 3CD0A 3V6KA 5DJBA 2F65A 3TNVA 3DRSA 1F5CA 2KVQE 3A13A 2KJWA 1X4GA 3AQPA 1R43A 2IRUA 3TVYA 3CCVS 1LNQA 3NWRA 3MCOA 3QIDA 2NS1B 4PWDB 2BW2A 1AUSL 4X4RA 1IM6A 1UVIA 2YKMA 1ZS6A 1ZPWX 2CZ9A 2B3TB 2HQFA 1BC6A 1YWXA 2ZBIA 1VHIA 3QAEA 4ZN3A 3P4UB 5KFVA 2FJWA 1URNA 3H4DA 4WZMA 4QWEA 1JJ4A 1T3OA 3L3CA 1AXQA 2YKAA 2HG4A 4R5PB 1XBWA 2ZFHA 2CJBA 4YB5A 4OYAA 3TAMB 5KT2A 1GXTA 3UDEA 3FCVA 4KQZA 5K14B 2BE2A 4QJVA 4C8OA 1LFWA 3GONA 4IG0A 4DPOA 4URGA 5DG9A 5K8OA 3RU0A 1O51A 2BE7D 3NS7B 4B3OA 1I94F 3HDSA 1KQKA 1TKXA 2W9BA 3Q8VA 1Q8LA 1RK8A 4ZVRB 2BANB 1N36J 2EPIA 2YNHB 2Y0SD 3IA0A 3MMCB 2MLYA 4KH1B 5GADI 1LXNA 2EC2A 2ZBQA 3VQSA 2F8MA 4NXMF 5IT9Y 1N0VC 2EVZA 2DR5A 3AJ1A 3MAAB 4CM0A 1RAOA 2ZOFA 5HK4A 3MURP 2E1RA 3KOAA 2DNNA 1RZMA 2OEJA 2ZHBA 2YNIA 4JI1J 3TUPA 4FS1A 4GKJJ 5HBMB 4TVAB 3MAHA 3KLEA 5E33A 1KHWA 3DRYA 4JI1F 2JOQA 3BPDA 3DLHA 1UMJA 2LXIA 5LMNJ 1VRUA 2B8QA 2KXFA 4AYBD 4F26A 4NA2A 3W2VB 1U1RA 4ZHRB 3FCHA 3Q0AA 2C3UA 3W60A 5KT4A 4F3MA 3HF5A 4F50A 4V19X 1UEVA 4TXSA 2YTCA 3DGPA 2ATLA 2CPZA 3MXHP 1L3VA 1I94J 3I9ZA 1HNZF 1TL1B 4K4VA 3GCXP 4J9KA 4FPIA 3L7UA 4ZKAA 1HHTP 1HHSA 1XR6A 1RAEB 1T95A 3FMWA 3G2XA 4QW9A 2ZM6F 2YH0A 2GHPA 4X64J 4LF8J 4TN2A 4P2FA 4QQBA 3DYAA 2VL1A 3TX0A 2RMLA 5KFJA 4FF4A 1NDCA 1WEXA 1RQ0A 4HT5A 4R25A 5T7LA 3G6VA 2R9LA 1YG0A 3H20A 5B08A 1OSDA 4QIVA 4TU7A 4WKRA 2VQFF 1TVRB 1VQSA 3NMRA 4DV1F 2AX0A 2P6TA 3I6PA 4NLOA 2KU7A 2V4JA 2B8PA 2BJDA 1M5VC 1D09B 5F41A 4YR3A 3RBZA 2Q79A 2EFQA 3H2LA 1RTJA 5CYMA 4F2RA 3RR7A 4WFYA 1EETB 4WP9A 1B99A 2VICA 3RBEA 1GMWD 2HBRB 1KSPA 1BD6A 4FPRA 1SBRA 3BSCA 4ZPTR 3TYTA 3DDKA 5CQGA 3HHKA 3JQMA 4G1QA 3VGTA 4MJKA 2DNOA 4O3NA 2GS8A 2IMOA 3MUVP 3SSSA 4FF1A 3G9CA 4P10A 1JLCA 2RRNA 4MYUA 4TLRA 3CO0P 1EETA 3OVSA 1NJXA 4OZJA 1RTJB 2N4DA 2H5IB 2A1BA 3QWPA 4OYXA 2H4YB 2HS3A 4W90B 1OWXA 2QMUB 3CCTA 3HZGA 3FGVA 5HL7Q 3JAMU 4C11B 5F8JA 3PO5A 2IAJA 3M32B 3UCGA 3QWUA 4ED7A 1YI2S 4LF4J 5E3CA 3IXQA 5CYJA 4JI8J 1FDNA 2V4QA 1RT2B 3G8QA 3U1LA 3R2CJ 5H1SV 2WCXA 3MM8A 5J2NA 2HKEA 3PJWA 2ADBA 4DS5A 2W4DA 4KGMA 3WQPA 4IRKA 2Z4PA 1UPPA 1XWLA 3TA2A 3S7RA 6AT1B 5DDPC 1PILA 3D0GE 2IRYA 1BHNA 2O67A 2ZJPQ 2XMVA 2AIRB 3C14B 1FRMA 1R0BG 3P8BB 2BA9A 1IR2A 1WC0A 3PRBA 5LSRA 4X62J 2Q6BA 1RDRA 2DY9A 1S9FA 4PQUB 2VQFJ 1CJVB 4I68A 3CCJS 1ZTTA 3RAQA 4ECWA 2Z30B 4D3GA 4Y65A 2KO1A 1HHQA 1TL5A 2G0CA 5C24A 1DLOA 2D74B 3BYRA 4ED1A 3I0RB 3I96A 2FB0A 2M0GB 2CWKA 2PMHA 1U1KA 3BJYA 2J76E 3UN2A 1UAWA 2OUGA 2AZ3A 3IS9B 2OSQA 2XTJP 2G1DA 2V69A 1YLXA 3CIMA 4MMOA 4MK9A 4YB1P 4IR9A 1FWPA 2MLZA 3R5DA 2FJVA 4DV5F 2B4UA 2HK3A 2R7SA 3MEEB 2FD2A 1K1QA 3ITHA 3MMCA 2HHQA 3PYEA 4ZA1A 2NLWA 3ELHA 4FXDA 4ZIVA 4JV1A 1HQEB 4NLWA 1NBEB 3CXCR 2W24A 5LMNF 1YKWA 1M1HA 1FXDA 3GFZA 2N7CA 1H7WA 2LMIA 1OY9A 2M8HA 1WKLA 3MEGB 4KC5A 2QGFB 2EBEA 3QMQA 4NLDA 5K14A 2XMWA 3JSBA 4TQRA 4DSKA 4OZ3A 4EZ6A 2OH2A 2GIQA 4UZCA 3VAFA 4GKJF 3B54A 2CVEA 1QSSA 2HS0A 4CLPA 3G6YA 1RCOB 3UR3C 4X4PA 2VIHA 5DO2A 4ZVQB 3ZO7A 1HQEA 2CADA 3R5CA 2PC6A 1NAQA 1HBUA 3D0HE 1NLKL 1MN7A 2JVOA 1CULA 4GO7X 3N9UC 2FHJD 4P74A 3VF0B 3V81B 1Y4ZB 2WZ1A 1Y0HA 2YKMB 1RWNB 3ETOA 2CQ4A 1N36F 5A2QY 3CW2C 4KHPJ 4A46A 5J2PB 1RU2A 1JWWA 2LU1A 4WIQA 5ETLA 4DHVA 3UW1A 3C8YA 4X65J 3S8SA 4DR1J 4OI3A 4JI2F 1TELA 4ZLJA 4ATNA 3N6LA 1UEUA 2ILYA 4DR5F 2ALZA 1NB2A 4QWAA 3OTOF 4NCBA 2K06A 4M5HA 4AL7A 2CNKB 5H9FK 3BQ2A 4FN5A 1DARA 5A6PA 2D3O1 2UZAA 3SXLA 1UVMA 2V8HA 3B4DA 2HFOA 1SIZA 1TAQA 3CDEA 2Y9HA 3NGTA 1NU4A 2DHHA 1GXLA 2YQ3A 4ANEA 3I32A 3CF5Q 3RAMA 3DC2A 2DRAA 1YHQS 2R2TA 1KP6A 4QR0A 2AYMA 1DQ9A 2FVQA 1LW2A 2E5LJ 2DVIA 3THTA 3DOLB 3B8HA 4Q2MA 3OQ2A 5D4PA 2NUUG 4LFCJ 4I2PB 4MIWA 4PXEA 3SSQA 1M1GA 4CT8A 3MFIA 5IV3A 3K5OA 2WHOA 2JFDA 1WHYA 4IDKB 2FJEB 3T5JA 2X7IA 4H4OB 1XK8A 3W7BA 4PPDA 3MR6A 3RAXA 1U09A 1C1CB 2C2DA 2ASLA 1FJGJ 2M3DA 2R3VA 4F36A 3IG1A 4ES1A 3EJMA 3QJJA 2VQEJ 2HBQB 3OTDA 5D0EA 2OPSA 1IQZA 2KZZA 4TU8A 1BE4A 3H2VE 2IC3B 5A8KA 2OD4A 2Z8QA 3GLJA 4NCGA 3U7JA 4B9SA 4NOHA 5L46A 1KQGB 4JI6J 1FJGF 4DUYJ 2D41A 2QL9B 1UVNA 1J27A 4OI1A 5HO4A 1RTHB 2DTJA 3LW5C 4NLYA 1PYOB 5F8IA 3NBPA 5HJXA 2KYXA 2OMLA 5CHCB 3R5GA 4RBUA 4H4KC 4DX6A 4LFCF 3UCZP 2FQQB 3CDWA 2IJRA 2IM1A 4DN9A 2Y1IA 3UNGC 2EFPA 3US5A 2KG1A 3VAMA 5DG7A 1DRZA 2Y8YA 2RU3A 4HKQA 1SVDA 2V4JB 3IBFB 4QZVB 5HMWA 3MPYA 2DRDA 3BZQA 1JK9B 1NCLA 1FTRA 2DNGA 2X3DA 3DLKA 4RX6A 4DL5A 1S77D 1S76D 1Q1KA 3BSAA 4XDDA 4ZLNA 4JI0J 2L3MA 2NCKL 3BGLA 4EZ9A 1TMMA 2DYAA 4C2MA 1IBMJ 2OD6A 2QLXA 2LEBA 5EGYA 2ZC3A 4Q2LA 4NLVA 3W63A 3W9JA 5KT5A 1RT3A 2WB4A 3BSNA 2YNGB 1OPIA 1IJEB 3NRBA 4IRDA 2YX4A 4RNOA 2LDIA 3VZIA 5KG2A 3O2IA 3R6LB 2CQPA 4OFZA 5DZ6A 2YH1A 1G6BA 1REVA 2EXUA 3HVTB 2H3EB 5AE3A 2PA8D 2WSFC 4DG1B 4J9LA 2MGZA 1Z1ZA 5IFMA 1Y5NB 1WC6A 5DM6Q 4ZP7A 3GV5B 4X66J 2JEGA 3PX0A 1X4HA 4OHYA 2V0NA 3CJQA 2EKNA 2J0XA 3D6FB 3PY8A 1S6PB 1E6YB 2VONA 2GX8A 1U0HB 3GR1A 1T05A 3KLEB 5DGAA 1J5OA 4GKKJ 1BQMA 3IO1A 3VGVA 4D3HA 2QA4S 5A8WA 2MKSA 4DLGA 4O3RA 4TKTA 5KT6A 1BQXA 4PZVA 2Z56B 2BRKA 2JHEA 2K1RB 2R42A 3FK4A 4ZOSA 3QO9B 2VPYB 3SDEA 4CT9A 4DQRA 3M8PB 4RW9A 2HPUA 1K0TA 1WG5A 2AZ1A 3DI6B 4DV5J 1NJZA 4B3OB 1CPZA 3AB4B 4U7UK 4JB8B 3DMJA 3PYDA 4U7CA 1MU2B 1V9OA 1WACA 5KFXA 5KG3A 1PO6A 5D4NA 1TL4A 4OHWA 3TAMA 2DNZA 2QFJA 2H51B 4R5PA 4OX9J 1S4EA 4LREA 3U1MA 3SMZA 2DD8S 2K3KA 4B3MJ 3QIPA 3QFHA 2IJNA 3EVWA 5K8MA 1C0UB 3KMQA 4JI0F 2JC0A 2WVFA 3GV7B 2AYGA 1T03A 2WOMA 2J5AA 4RNNA 2FVSA 4EMDA 3SV4A 2GQ2A 2J9EA 2F5GA 4CDIA 1U1LA 1Q5YA 3MGJA 2J9CA 3MD3A 2Z57B 3ZTRA 1SKSA 2CPEA 1VS3A 4U96A 1F9FA 4JI5J 2V67A 1W7WA 3JTNA 1RTIB 1Q78A 6FD1A 3KG4A 5K5MA 2WVEA 4KO0A 4LF7F 1N33J 4DL0C 2HFVA 2W2PP 4YY3J 2DPIA 2D69A 3F41A 2NYHA 3DMJB 4FBTA 4QIWD 2LFVA 2LQJA 2NSBA 3BGFA 4KH0B 4WWSA 5LL6d 1R8PA 1XJWB 1KVJA 1CJUB 1CBKA 1W26A 1SC4B 4L6V3 1E6YA 1RACB 3ENQA 2MKKA 1IKVA 4C0HA 1U2RA 2HFNA 1RP5A 3UDLA 5A8WB 4WZQA 3M8SA 1TFYA 1Y3JA 1JNRB 2BZ2A 2A10A 3OT9A 3H5SA 3L9ZA 2B6AB 3KHHA 2C2EA 4QBUA 4ZPVR 4M95A 1DAXA 3FBBA 2VFUA 1JXEA 3CDBA 2DNRA 2IM2A 3CB4A 3IM8A 4EYIB 1EX8A 2D3OR 1N33F 3MECB 5AE1A 4EEYA 4ZDNA 1PCAA 4AUKA 2E5LF 2DO4A 3TAPA 1UZDA 3WC2A 2GAHC 3NOGA 5CD4H 2IYGA 2VG7B 4DV1J 3UE2A 1FEHA 3DLKB 4BC7A 4YR0A 2R2SA 4PG8A 1RISA 5CABA 1IXKA 4BCAA 1T9WA 3PDNA 2Y1LB 1T9UA 1WC3A 3BPSP 1RT5A 1Q79A 3NNCA 1Q7YT 2N4CA 5ETQA 3ZZPA 2BBEA 4OX9F 3GWCA 3H98A 5E3QA 3FNNA 4DR5J 1FK9B 4HVZA 4DFPA 4WBFA 2CZVC 3JSRA 3NNHA 4K0KF 3ZZUA 1S79A 3QGGA 3EPIA 1FD8A 3D0IE 1B4SA 4ETZA 2E5IA 2QE5A 1M5HA 3DKDA 4CLYA 4L3KA 3FBCA 5A8KB 5J2MB 5KFHA 2GV1A 2HWHA 3PG9A 4IFVA 4J9OA 1P1TA 5EX0A 2YPZA 1UVKA 3QZ7A 1DQ8A 2E1AA 2DCUB 1VRTB 2RE1A 4KPCA 3AJDA 2GAGC 4RNFA 2JWNA 3IG1B 4NLPA 4PWWA 1WWHA 3ZTSA 4DCJB 3QLHB 3PIOQ 2CNLB 3D6MB 3OXLA 1LW0A 3IBCB 4MAKA 1ZBTA 4P9SA 2KFYA 1N34F 1VQKS 4IDKA 3PIPQ 3GFXA 4UOCA 2ZH7A 2A2CA 2MY7A 2NXJA 3J7Z5 4KKOB 1MW7A 2F7VA 1TU0B 3DOLA 3ICLA 4NLXA 4H4MB 3J7ZT 1U4BA 1FKPB 3BS9A 4GMKA 3GZ7A 2IPOB 2OIHA 3R7NB 5IT0A 3MD1A 4ZVTB 3UR0A 3TA1A 3I87A 4OI0A 4ILRA 3EPGA 1SH0A 1FEEA 3IRXA 3MTKA 5KOWA 4FVCA 4I56A 5EX3A 3OLAA 1TL7A 2JVRA 3I9V9 1LW2B 4E8UA 1Q81T 1GTHA 3C19A 4B08A 1K44A 4B9LA 4M5IA 4RBVA 4KRWA 3VWSA 1YTYA 4W92B 3Q2TC 2DR6A 3VTIA 2JZ5A 2XM3A 3MPDA 2BQ3A 1Q82T 2WVCA 3IWNC 5AXKA 4DLEA 2HNZA 2BOPA 1U48A 1WC5A 4RUHA 3HD2A 5L9XA 4U67Q 4P52A 2PSZA 2CQ2A 2C2MB 4YN3B 2VC1A 4EWTA 4MKYA 2M9KA 5E7OB 1HBOA 1B3TA 1BUXA 3EVMA 3CJ2A 3GIJA 3MTJA 2V50A 3Q8UA 4O44B 5LXRA 1JJ2R 1HFEL 1KOOA 3PW2A 4B3TF 2VC0A 3A8KA 2HQDA 4P6QA 5IQ6A 3W3SA 1H7XA 3PX6A 1BLUA 1ZM3A 2ZUGA 4FVMA 3GP9A 4R0EA 4LFAF 1XNRF 3PW0A 3KKFA 3Q8YA 4RW8B 4KGVB 5KFGA 4C48A 3MEGA 3M8RA 4A8SA 2KG0A 3V81A 1OPZA 1PAUB 1FFGB 3OSNA 4G3IA 2RDJA 5B0DA 1JLEA 4P2MA 2EK1A 1JLEB 4X84A 2XS2A 1X9SA 1QSYA 1PJ5A 4OLPA 2RS8A 2ALYB 3NS6A 2UXCJ 4C9DA 1MMLA 3C15B 4RKUC 4LFAJ 1GTEA 3UDCA 3NGSA 3V6DA 3IRWP 1FVQA 3L4BC 2ASDA 1QTNB 2HSEB 3IS9A 3RB4A 2LQ5A 2GZOA 1Q95G 2D9OA 2RQKA 1RBOB 2C3YA 3CJ5A 2Q6CA 1HBOB 2GA7A 3LGHA 2G2ZA 2XCAA 1QTMA 3MEEA 1HNWJ 2BOAA 1L3TA 4PXCA 1YSJA 3C6TA 3CJSA 2HZAA 2I6WA 1A7GE 1P27B 5J1PA 2ZJRQ 5DS7A 4CLUA 2M70A 1JLGB 5DGBA 2XC9A 1T9TA 2C3OA 3ZC4A 2MYFA 3M1VB 1V5VA 4ZMMA 2G0IA 3PRDA 3OVAA 1YZ6A 2YWHA 1DLOB 2RQMA 5F9NA 4LF9F 2G4BA 3TR5A 2QLFB 4QU6A 1FJCA 2RKIA 3CJKB 1VIOA 2R8JA 2QMWA 1OY6A 1M0SA 3P6YC 4QOTA 4ANCA 1PKUA 2OLWA 4QPXA 1ZA1B 5FLXU 3A3NB 1WC1A 1TL3A 4GVLA 4Q43A 4DSEA 4IUFA 4HLBA 3HK2A 2E66A 4U6PA 3HVAA 2UU9J 2ZH3A 4GVBA 4X65F 2CPHA 3IMQJ 1RYRA 2UUAF 3H42A 3BB5A 2Z0GA 3MEKA 5ETKA 4XDCA 2RUGA 4K4YA 1U1OA 2Q1LA 3JQKA 3J81Y 2IAJB 3M32A 1P9YA 4XIUA 3Q22A 4C11A 2YPYA 4DQPA 2P5VA 4KKOA 2ACMA 1KFSA 5EHHA 3UFCX 3D3CJ 1NJIT 3ET6B 4HHJA 3QT6A 2EFVA 2BDPA 3DDIA 3MMAA 3QBCA 4FXVA 2HVEA 3CGIA 2A3JA 3ADAC 3LF0A 4DI6A 4A8WA 4WK1A 1LW0B 4AQYJ 4OHZA 2HMIB 4LRAA 2HQ3A 4G1QB 1FFSB 4A8OA 3LALA 3OXFA 3VGUA 2EC0A 3W61A 1RAJA 5H9FJ 1RI7A 1GQEA 3M8ZA 2XWYA 2KM8B 3SV3A 3L95X 4NEYA 3CMES 3PYFA 3DM2B 3N6MA 2F9JA 4CO2A 4UQGA 4EGLA 3POTB 1FTCA 1SQFA 2O66A 1X4DA 4ECTA 2UUBJ 2ZBRA 2KVIA 4KGXB 1IWGA 5BR8F 1LQ9A 2CAJA 5F8GA 3RYLA 2HHUA 3AFGA 4DUZF 1X4AA 4O0IA 5BYSA 2Y1RI 4RU9A 1SH3A 4RNMA 5I42A 2W8LA 1RHRB 1UETA 3ZZOA 1S57A 2LXFA 2MKJA 3FQLA 3T5LA 2PI5A 3BR8A 2ABYA 4Z37A 3H90A 3WDOA 4M5MA 1AT1B 2RQ4A 2AU0A 1C1BA 2HZVA 4AL6A 4AD6A 5AXMA 2XMTA 1MLAA 3C6UB 3MMBA 4ZJOA 3BKUA 3RZAA 1JKHA 5G0RA 4N41A 3C2PA 4P75A 5THWA 5EWFA 2BW7A 3DGPB 2AYEA 2BJ9A 3DYAB 3ILLA 4OHVA 5J1EA 2FJBB 3ENAA 4MT1A 1SC3B 1UVLA 1Q8IA 2IDEA 3NCQA 3PEHA 4WP3A 2J6UA 2QEXS 4H54A 4LF2A 3SFUA 3SYZA 4C8KA 1JB0C 1IM4A 4F04B 4LSNA 1U02A 7FDRA 4WFAQ 1AFJA 3K89A 2G2OA 4TY8B 2KFZA 4OZNA 3BN4A 2HVIA 3KXDA 3CCLS 4DUYF 4QYZJ 3NCRA 4WPAA 4F0HA 1JLGA 2UXCF 2CA9A 4A8QA 1TMJA 4DV3F 2A6OA 4ECZA 4CM2A 4YS2A 2RT3A 4YR2A 1IKVB 1IN0A 2D1CA 2N7YA 2YX1A 2UUWA 3CSKA 2PEHA 4NPOA 1NZ8A 2YNHA 4I64A 9RUBA 1KRPA 4M63A 1UJ6A 1HWLA 3AODA 2VB6A 5JJBA 3JYTB 4ECSA 4JV5F 2LCWA 1YVFA 2YNIB 3MI7X 3W2WA 4ECYA 2W25A 3FZBA 2VZ9A 3R3TA 4F3QA 2OEMA 3FRZA 2AJ0A 3T6BA 5EN1A 1AW0A 1RE1B 1KN6A 1RLCL 3HVWA 2AGPA 3MF5A 1M1KT 4NZ7A 4KO0B 4CO1A 4ED4A 3ZZZA 1M5SA 3BKTA 2YKOA 3UQSA 1FX2A 2B0GA 2W2MP 1LOUA 1UWBA 1SI9A 1WNEA 2RQCA 2DH7A 3AA9A 4NLUA 2UVRA 1U26A 4IG0B 4Y28C 4HH0A 3ZTPA 2BE2B 3TQ1A 3SFGA 4RW8A 4MFBB 4A47A 4B3RJ 4CLZA 1ZZFA 4ELVA 2AV5A 3RRKA 4U8YA 4ECRA 2FVRA 1R89A 2C3PA 2Q3PA 4N8NA 3FZ2A 5GVQA 1D8YA 1XQIA 1VQMS 3O44A 4OHXA 4DEZA 3JS9A 3FFIA 1UW4A 2CQDA 2MEWA 4FYYB 1HBMB 2JNJA 3D1QA 4P2XA 4DPWA 1HNXJ 1G1XA 3MEDA 4N77A 4BC9A 4MIBA 3MUMP 4ENOA 4PG7A 4KIAA 2RS2A 1IKXA 2J6TA 1YRTA 3JTOA 1UW9A 1T0TV 1R8CA 2ZE2A 2NREA 4JI4F 1IR0A 3PTWA 3BQ0A 3DI6A 4B17A 3PW5A 2BE9B 3B82A 3DRSB 3ILJA 4O3PA 4TY9A 3SCLE 1DHMA 3CE8A 1X4FA 2K1RA 2H9ZA 1TUVA 2FZGB 2OI2A 2X3GA 3CCZA 4MYTA 4WJBA 1AROP 3A3PB 3GYXB 4CH7A 5IT4A 2FGOA 2V8DA 1D9AA 2L41A 1TL7B 3DDNA 2VJVA 4K4XA 2VG6A 3D5MA 2FJAB 2XQCA 2JH3A 2QFIA 1J5OB 4ELUA 4GKKF 1AA1B 1NKEA 1N5VA 2I5JA 3DRRA 3D2WA 2FGCA 2PGCA 3PCOB 3R1LA 1T05B 2QC3A 3DLEA 1N48A 4RW4B 4ZK7M 3NS5A 2Z58B 1S0NA 3ILIA 1NRKA 4P71A 5KFNA 1H2TZ 3R5JB 2XLIA 1RKIA 3D7SB 2BJEA 5AJ3J 2GVZB 5CYQB 2KI2A 1PIEA 2AF6A 4B9VA 3NAHA 2WVBA 1REVB 3HVTA 5HMZA 4JI4J 1GX5A 2L9WA 2QL7B 2ATCB 4K0KJ 3MM6B 2UV8A 3DXSX 5SUHA 2QZ8A 2GC8A 3GJTB 1SKUB 3ZZRA 5J2QA 4DWIA 4O4GB 1XMQF 1F2HA 2ZC4A 1NDLA 5DQIA 1JNZB 2GJFA 2MZSA 4DSLA 1Y9OA 2XMUA 3IP0A 1U1MA 3NL0A 4M5GA 4Y2IA 3GPAA 1Q8BA 5H9EK 2VV5A 1VJWA 1APSA 1F3VA 5B7WA 1KFDA 3DFEA 3DXBA 3EMTA 2Q43A 1WOSA 3M30B 3VGSA 1DTQB 3PHTA 1PYSB 4FZVA 2GMJA 5LOQA 2MJNA 4I4BA 2PIIA 2DHSA 2R7QA 3RJMB 1WF2A 1NNDA 4ZP9A 2X1BA 3MUTP 2JLEA 1RXOB 1WC4A 4KT0C 4NYZA 4O4GA 4K4WA 1YJVA 1EARA 3HO1A 2MXYA 2XZWA 2KRBA 4Y2AA 5KG6A 1Q5VA 1FDAA 5B0CA 2Y1JA 3NG8A 2POKA 3EYZA 4CTAB 3LTOA 2OKQA 2IVYA 2DB1A 1T11A 1DTTB 3GU0A 1WD6A 3N5BA 4WU2A 1YBTA 1KS2A 2HS4A 2ROGA 3MECA 3UN3A 2R7VA 2HHXA 2HHSA 1N52B 3QPIA 3GB0A 4OI2A 3U27A 1UA0A 1M90T 1NKBA 2ZH5A 1BGXT 3GTYX 4FXWA 3MOJB 1FD2A 4DV4F 4FYVB 1I1GA 2Y3YA 1T94A 4OLOA 2I5JB 2E1CA 2FDNA 3GR0A 2XY7A 2HAFA 2DNPA 1MN9A 3MAQA 1RHKB 3A1YG 1TKZB 2GGPB 1QJHA 2FZKB 5M2PA 4HH1A 1NKCA 1EHWA 4DL6A 2H5JB 4J9PA 4K4SA 1KEKA 2J0SD 4QPTA 1EQ0A 4A4JA 3OFGA 1H3DA 1RHQB 1F5BA 1YJRA 2GQQA 4DPXA 3E2EA 3R1HA 4F3OA 7FD1A 4PABA 2IVMA 2LDYA 2QLWA 4ID5A 5K8PA 1WUUA 5IQQA 2I1RA 4ZPAA 3KLGB 3T5KA 3D67A 3ZFVA 2R2UA 2UUAJ 1HBMA 3BN7A 1RTIA 2B7BB 4PWUA 1X4CA 3BGUA 1B64A 4F4KA 1ROFA 4I6YA 4JI2J 5GADU 5DQHA 4FNIA 1XTZA 2G13A 3BKFA 3N28A 4Q44A 2CDRB 1JLFA 2YWEA 4IOCQ 4ECUA 5J2PA 2KTQA 3JXOA 3PHEA 2W8KA 1D8ZA 2GCFA 5IZHA 1I5OB 2WOMB 1K9MT 4LMZA 5KFQA 4X4VA 5DETA 1F6TA 1CULB 2J8SA 1RKJA 2VBZA 1HBUB 1L3SA 4A48A 1HPZA 4ICLB 1R3NA 3TEGA 4B9TA 1HLWA 3D54A 3JQJA 2ADCA 3PM9A 5B09A 4NZ0A 3HM9A 4RW7A 2KYZA 2PD1A 1RWKB 3OXGA 3C3LA 4NLGA 4MTPA 4JUZA 4CLSA 2MQMA 2EI5A 2FYXA 2IYIA 1NSAA 2QO3A 1ZAVA 3W2WB 3J80U 1CLFA 3JYTA 2JX2A 3NCPA 1Y7PA 4NXMJ 4WTYA 2CQ1A 3SDEB 3UDVA 3C16A 3MCSA 4ANDA 4UY8T 5AT1B 3FSYA 4BBYA 4EUVA 3UN5A 5M2UA 3PACA 3N6NA 2F1FA 2KFNA 1RHJB 2DEJA 3F56A 1JLQA 1N5SA 1O6XA 1S1VB 4RPFA 4CLKA 1YGYA 4ES2A 5C5JA 4DFJA 3DOMA 3HJFA 4ETXA 3I0RA 4MK8A 1S6PA 3GFYA 3VVTA 4DR2F 2OO4A 4X4NA 4TU9A 5KT7A 5JVGQ 5L39A 2ASYA 5GMDA 3IAS9 1F9EB 3ILOA 5B0EA 4DZ6A 1C4AA 1NH7A 3NOCA 3UO0A 4PUOA 1VQOS 5A0YA 3WIUA 3BH7B 4XK8C 2XULA 3H7HB 2HWIA 3C14A 3CJ0A 2YQ1A 3PRVA 4CO4A 4DV3J 4IG3B 4ZCLA 1N88A 1WF1A 5C25A 1Y10A 3HP6A 4V1Ak 5F3ZA 1RBAA 1EQMA 1SIWB 3GSIA 4TYAA 4F4XA 1K73T 3PFOA 2RF2A 4QR2A 1S6QA 3SBMA 2DISA 3KLFA 1SC6A 3HD1A 3SSRA 1RT2A 4ALZA 5I42B 1HYSA 1GMUA 5KFUA 2OPRA 2QLBB 1ICEB 2HHHF 2DGWA 2MZRA 3BGRB 1R8AA 3QSYB 4NI2A 2BM1A 2FY8A 1S9GB 3H5XA 1N32F 2MKYA 3M2VA 4RUBA 2CPIA 1CC7A 4H4KA 1BQNA 1XIQA 2G2YA 4QIFA 4PKDB 1JLCB 2HHHJ 4DV0J 3POTA 2V9WA 3QRQA 4F02A 2UXBF 3DM2A 5JXSA 2DEIA 4USKA 2JLFA 4Z7CA 1Y5LB 4AXJA 3N79A 2A18A 1YZ7A 3P96A 2E7VA 3CCUS 1VYAA 4CLLA 4OZ0A 4OJHA 3KK3A 2HMIA 2J7UA 1VQYA 5FIIA 3TUIC 3A8IA 3D66A 3M2RB 1AYEA 4UW2A 4GC6A 1RT1A 5DG8A 2UUCF 1UFWA 1YJ7A 1CG2A 2OPSB 4I6AA 1PSDA 1KQFB 1VBKA 3RW7A 1OJ4A 5L1JA 2C2RA 3AD9C 3KJVA 5EDWA 1BMQB 1N5QA 1UJ5A 4WIIA 3T1HF 4DQQA 2G1HA 3AT1B 3W8PA 4ECQA 3P49B 4RW6A 3TO8A 1N6QB 1A0OB 1HIYA 1UJ4A 3IAM9 4H4OA 1NO8A 1H98A 2GNKA 1VQ4S 1CJTB 4CIOA 5EUHA 1AZSA 1QY7A 2ILZA 2NZCA 4RWXA 1WKKA 2MQOA 2AGOA 1QVGR 1G3OA 3X3UA 2VBYA 1QAJA 5ETSA 3KDNA 5HVGA 4KFBA 3FDSA 2QA4G 2XS7A 1FNOA 3DNCA 3CC7S 4KB7A 1HD0A 2HVHA 2B43A 2F8HA 4OJGA 2YWGA 3TUJC 1S1XB 2LVWA 4DDFA 5A76A 3M1VA 1GK8A 2C2OB 2WVDA 1UZHA 4IKAA 4PXDA 4MKBA 1VOMA 3PJ9A 1X7VA 1VLOA 4J7CA 5RUBA 2M4MA 4JP8A 4YDDB 4L76A 4ELTA 4HI1A 4YP3A 1KQSR 1RAHB 3LP1B 2JEIA 3CO9A 5B0AA 4WE1A 3V4IB 2DH9A 1N34J 2HNYA 1M5KC 2BXJA 4IH6A 2QL5B 3CPWR 1YRUA 2JL9A 3UWTA 5KAKA 5E0OA 5GAHI 4FF2A 5KFWA 1TK5A 2CIMA 4EBCA 4C8NA 5SZTA 5B0BA 1LWCA 3I31A 1U1PA 2WBMA 3FJ2A 5KFKA 3V6DB 2OPQB 3MAAA 1JMTA 1HNIA 2L48A 3GG0A 2C2KB 3VHQA 4M5LA 1XMOF 4QU7A 4OI6A 4L74A 4J9UE 1A6LA 1HI1A 2OHDA 1HMVA 4F0KA 3FUYA 1PJ6A 3PR4A 1FX4A 1MG7A 4XPCA 1SV5B 3OR1A 4IFYA 3MM9A 5KTQA 5I3UA 3VQTA 4YUDA 4J9NA 2CVIA 1X5PA 2OELA 4LRFA 5KFMA 1NDPA 4QCLA 4Z7YA 4I6WA 2CXEA 1S1WB 3KUEA 4PG5A 3GMGA 5FJ4A 2DY1A 4ZVGA 3VR1A 4K4ZA 2DNLA 4K5RA 3N0VA 3T19A 2NUHA 3ITHB 2W2NP 1S99A 1NXIA 2E7XA 4R8UA 1DY3A 2D7SA 1UP1A 1WJ9A 1WSVA 3CJRA 2CPYA 3EDQB 1RT4A 2EBGA 2KT2A 2OPQA 3NXZA 5HAOA 3K5MA 2JFKA 4PWDA 2GFFA 2JLGA 2HNZB 2XS5A 1XEZA 2AX1A 2HGLA 1FERA 3K2YA 4K7QA 4XPEA 3KK1B 3EZUA 1HNWF 1D3WA 1JLAB 4NLSA 5EWGA 1EB0A 2JJ4D 3N4WA 2L9NA 3HHEA 4ZCMA 1S0OA 2ZWOA 3VAGA 4ZN1A 2R7OA 4NRUA 4JI3F 5C24B 5KFPA 4NMLA 5L8RC 1GEHA 1KVKA 4DV4J 1K8AT 2F4VF 1N0UA 3I82A 4FNHA 4URSA 1RWMB 2DGQA 2DITA 2SXLA 4DX8H 5DDRC 1VQ7S 2R8GA 3IRXB 1WEZA 2YNFB 2XGQA 4LF4F 2MQNA 2V8PA 4PQUA 2E9TA 1DJ0A 3SQGA 4FYXB 2BJ7A 1S1XA 2B5JB 3ENVA 5BXIA 3LA0A 5GAGU 3BH6B 4RLEA 3V2UC 2YWFA 1QUVA 2WW4A 4TLQA 3C46A 1HQ2A 3OTCA 3TZYA 3NGDA 2ZNZA 3QAUA 5KFAA 3QATA 3V6HA 2HHPA 3CJTA 3B4MA 4I2QA 1VC5A 2LQ8A 2P2CB 3MM8B 3O1LA 4NLTA 3E01A 3FRYA 2A6MA 5J2NB 1OMSA 3H2UB 2JEJA 4LQ3A 3P45B 3NAIA 2F9DA 4CI0B 3PXGa 3LGNA 2MHEA 1CJKB 3WZ0A 5KFLA 2P6SA 3BEGB 5IWAJ 1KHVA 1WORA 1OIAA 3EGNA 1B70B 4CCHA 2J9DE 3WX4A 4RNHA 1VRTA 4ED0A 2HRUA 3DRPB 2MLXA 2HQCA 4O0NA 1ACMB 4ZP6A 2K2PA 3H59A 2ZH2A 1VQ8S 4HDGA 2N3LA 3E8OA 4HR2A 2WTFA 4J37A 3W8GA 3CNQP 4A8KA 3GJQB 2UVWA 3R27A 4K8RA 3RTVA 2B9YA 3EDRB 2MZJA 2VOPA 5ETVA 3FSXA 4YQWA 1U6FA 2W1BA 3DU5A 1W2IA 4DV6J 4NXNJ 1E6VB 2KHCA 1M5PC 4ZCIA 3KHLA 2LA4A 4G1IA 1RWWB 4Q45A 3M8YA 4Z2XA 4ZVUB 1S9GA 1XNQF 3VAJA 5BR8J 3BGRA 3IM9A 2DNQA 2QRRA 1TVRA 4AE5A 3CDUA 1Q8KA 2VG7A 2HFUA 2UVUA 2FY1A 2XLKA 2BKPA 1LWXA 2G9OA 4KGZB 1R27B 1OQ6A 1L3KA 3I5CA 3Q2SC 3HPOA 3I4PA 5KFYA 3EGWB 2XNQA 5C25B 2P8IA 4PCQA 2DGVA 3ZZ0A 2LP4A 2WW8A 3QT5A 3KLHB 4DZDA 3GIIA 4EO8A 1TL1A 1FT8A 1V3SA 3P3DA 5A0YB 2JRSA 4PUOB 2DXDA 3SEOA 2FTRA 2IBOA 5HQMA 2RB7A 3J81U 2R2RA 1S9EB 1S97A 3KJNB 3SQOP 4DFKA 2F3JA 1XNQJ 2XI2A 1VRUB 3MOZA 1KLMA 1CEZA 2R7RA 2DKOB 3L7PA 2E5GA 4HACA 1HD1A 3W5XA 2K8GA 3CVKA 2HAIA 4USHA 1NJWA 3QRPA 2HGMA 4DV6F 3OLBA 3PO4A 1WELA 2MSSA 1FNMA 2BKOA 3A12A 4B9UA 1YBUA 1D9DA 3G82B 2W9AA 3BQ1A 2H1YA 4FKXA 4ITSA 3GV8B 2XMAA 2DK2A 5HP1A 4DQSA 1X9WA 4LBHA 3KNAA 4LFBF 2BANA 3AH6A 3H5YA 4AL5A 1GMWA 1Y5IB 2AP6A 3TANA 2RRAA 3W1YC 3K5PA 3G71S 3ONQA 4Q0BA 2MQQA 1KBRA 1N8RT 1RWPB 2CQHA 1DFDA 2X1AA 1S48A 4CLFA 4AT1B 1N5YA 2B9WA 1T03B 3CC2S 5KG1A 3K8VA 1IUJA 1IKYA 3DOKB 3DLGB 1C0UA 1Y11A 1TR0A 2ROPA 2OFHX 1FE4A 2VBWA 1SJRA 2VFVA 1VJQA 3CEDA 1WTFA 3KFWX 5CH7B 3RUBL 1WHVA 5E3RA 4TQSA 4JV5J 1CS4A 1B7FA 1RWUA 1KLNA 2XI3A 1YIJS 3R6GB 2FPHX 3OR2B 2XZDB 1AB8A 4NL5A 3SCIE 2AEJA 3TA0A 3J80Y 4CH1A 2CJKA 5HMXA 4U7UD 2VFTA 3MZIA 5AXNA 3TP2A 3CCES 4DN0A 1GXUA 4LR9A 3DGVA 2BX6A 1LWEA 1WG1A 1ZPVA 2EWHA 3LP2B 4RU2A 2XB2D 4ED3A 1SL2A 2ASJA 2ERRA 5ADZA 2BQRA 5D15A 2HBYB 1CC8A 1PYTA 1TKDA 3J7YI 1BQMB 3OHAA 4M94A 1Q4RA 4LF7J 3VAIA 5KG0A 3T1AA 3H8YA 1H0HB 4JV2A 2XG8A 3BREA 2J0QD 2J7WA 4L3NA 5D0RA 3F44A 2ZITA 4B9MA 4ZVOB 2FLLA 3MDFA 1HR0J 1QAIA 5HSPA 1F0XA 1I6JA 4W98A 3R8YA 4QWCA 2KHDA 3K57A 3QRRA 2H65B 4NA1A 4FBUA 4QYZK 5D4OA 4O3QA 3KLHA 3CMAS 1XMQJ 3OTOJ 4CZCA 2AJ2A 4LRCA 3IBWA 3HHLB 4HL9A 1C2PA 2DH8A 3KLIA 3OFEA 4NYOA 2V34A 3TRGA 4J91A 4USMA 4C4WA 2WRMA 4QR1A 2VPZB 1RWXB 1NHUA 3CIZA 4CTAA 4CLWA 2V68A 5CD4A 4A8FA 2ZOMA 1K1SA 1XR5A 1H6KX 1S5ZA 1Y00A 2F8EX 3I5AA 3ISNC 1VQ6S 3IC1A 2EEYA 1RUSA 1IBLF 1XMOJ 2QT7A 3K7RA 4DUTA 1RT6B 5A8RA 1WEYA 4F0MA 3D4JA 4TNOA 2HBZB 1YDLA 1W2BR 2GIRA 3BO3A 3LO3A 3BO4A 1NHVA 2ZZNA 3M2UA 4HHUA 5K8NA 2H4WB 4QWBA 4LVNP 2X1GA 3TJAA 5KFOA 1NK9A 1Q0NA 2ZZTA 5E41A 3AQOA 5F8HA 1QE1A 3L7OA 7AT1B 1EKSA 3NGKA 1SJQA 1RTHA 2CRLA 4KE5A 3LH2S 1RT6A 5A8RB 3QGHA 4X66F 3RGIA 2W7PA 1FHTA 3I5BA 1OO0B 5DQGA 3O6QA 5GMKa 3GILA 4OJ3A 4KTQA 3ZNJ1 2W2OP 3AA8A 1SQEA 4HTIA 3OTBA 1D0EA 2N82B 2HHVA 2EFNA 2MHNA 4KGKA 1O5JA 2MSTA 1X8DA 1C1CA 4LQ9A 2R7TA 2D3ZA 1U45A 3SI8A 4I1TA 1QAXA 2HFSA 4P7VA 4KV8A 3JAMY 2XYGB 2XY6A 2AGQA 5LXYA 4A8YA 1DZ5A 2KXHA 2MZQA 2PFDA 1NEEA 2YBVA 4I2PA 4LF6F 1S7IA 5D0GA 2QYGA 3EGVA 3OL7A 3T1YJ 1S7HA 2XYHB 2VF3A 2E29A 2OSRA 4J9SA 3RR8A 3ULHA 4EBDA 1EZZB 2OPPA 1R0AA 2R8IA 2VG5B 3LAKA 2C28A 2X51A 2AQ4A 3UCUP 3VALA 1S0MA 4IR1A 4RO0A 2DNMA 2YNFA 5K9FA 3AD7C 3A8EA 2RDDA 4KSEB 1JJCB 1R6VA 1ZM4A 1FKOA 2V5HG 4UOGA 2UP1A 3N5FA 1H2UX 3UVJB 5C2CA 2QYCA 3MM5B 1S10A 1C0TA 1R31A 4CWBA 4C6AA 2AKWB 5IV4A 3PR5B 5U47A 3QJLA 1S6OA 4DV0F 2UXBJ 1TQLA 1SXLA 2DHAA 1ZAWA 3EXCX 2OTLS 1HA1A 2DGTA 4W4MA 4LR8A 5MLCV 3A8JA 1PGZA 1JLBB 3FSIA 4E0DA 4JYAJ 3ZZTA 1SQGA 2Z2LA 2ZE2B 1Q53A 3IR6B 1EAYC 2CUYA 3OR2A 4PG4A 4OZ2A 4WXOA 3Q89A 5KFCA 5HROB 5HLFA 2NZ4A 2MY8A 1LKZA 2RNEA 4ZP8A 5E2QA 2ZKTA 5HVFA 3CTRA 3VVUA 3AY0A 3I0SB 3PVXA 4FF3A 3HKWA 2H48B 2VA3A 4OX7A 2MKHA 2PN6A 5BYRA 4RWWA 1FXRA 5KFZA 5KG4A 2UV8G 4LF5F 1MROB 3FC9A 2FHJA 4MIAA 1F3FA 2E9RX 1S72S 1B0PA 5IC6B 4ED8A 4B3SF 2F4VJ 2QJ3A 3D28A 3CULA 4CYUB 5H9EJ 3EXYA 3PW7A 1SUQB 2DRBA 4BS2A 3RBXA 3UI3A 4JI5F 1IKWB 2PI4A 3CD5A 4LF1A 4WKYA 1IBKF 2ZZMA 3BV8A 1UWBB 1SJ1A 2CG4A 1RGVA 5F0UA 1SH2A 4CNZA 4OJ1A 1HMVB 3G6XA 1SL0A 2DO0A 1HL6A 1FDBA 1TK8A 1FNXH 3FEXB 1NJYA 1PBAA 2KRRA 2QLJB 1J2VA 1LXJA 1WOPA 3E51A 1T7PA 1IVZA 1NK7A 4OX8A 5C42A 3HT3A 1S0VA 2IIHA 3NGUA 3OBIA 4J5OA 4LF8F 4G6VB 1V3RA 2VHGA 1YBAA 4J9QA 1U6BA 4LBIA 1YJWS 2ZM6J 2O5DA 2AJ4A 5FDLA 3HXMA 4URQU 1FE0A 3DCAA 4OYIA 3LP1A 2NPIA 5LSOA 1HNZJ 2DXFA 1RYSA 4O23A 3KK2B 2LA6A 2GHVC 3ZTQA 1H74A 1WDDA 2UUBF 4DQIA 4QW8A 3DN9A 2D3UA 3MHYA 3GJRB 1NSKL 3A3OB 1MNEA 4HTJA 2ZNYA 1OSCA 2NXEA 4TY8A 2ZH9A 2A2DA 3CJ4A 3I4HX 4DL2A 2DR9A 3K0JA 4OZ1A 3HHLC 1Z4UA 5IM0B 2G0JA 1JXVA 3BGOP 5GMEA 1KC8T 4UQTA 2FC8A 2H54B 3BBBA 1HI0P 1HBNB 1JIHA 1WKJA 2LQBA 2V9KA 1X4BA 5D3GB 1AZSB 2ZDOA 2I2YA 1JKHB 1FRIA 4NRTA 4OV6A 2BUNA 5G0RB 8AT1B 4F4WA 3C6UA 3MMBB 2N3OA 4ILMA 1HWKA 1VR6A 1N6QA 4M5DB 2WONA 1IWAA 4RL1A 4KJIA 2OGUA 4X4QA 1WHWA 1C1BB 1VCTA 2KM8C 1K0VA 2CPDA 3PFEA 4ZPDA 2VFRA 1FRKA 1RA6A 5BYQA 4UY85 2YVSA 3QGPA 3HVRA 2Q66A 2V8VA 4DV7F 3JTPA 3JSMA 1RT1B 2DBBA 4G1PA 1FJEB 3DLBA 3FKBA 1PBUA 2DGOA 3W9IA 3AOCA 1SL1A 3CMQA 2GO9A 4ZS6A 4B02A 1QAYA 3AXKA 4C3KA 1CSJA 4F7VA 1S4FA 3ISND 4FYWB 2DT9A 4DX7A 3EZ5A 2VQEF 1L5UA 1KOHA 2FHOB 4X2BA 3M2VB 3DRPA 5CYMB 3OHBA 2AJ1A 4Q7AA 1U47A 4BDPA 1P6TA 3M05A 4NI2B 1X60A 2OP5A 3M6WA 2HLUA 3SZ2A 1FRXA 1TV6A 1U25A 1VQLS 1C4CA 2E5HA 2HRYA 2WONB 3KDOA 3LOUA 2VH7A 4NEZA 3J7YU 3K17A 1S6QB 2GJIA 2QSFA 2NPFA 2RF2B 2LU2A 3HMJG 2KXNB 5D3GA 2B4VA 1HBNA 2EFGA 2NQPA 5DRKA 2ZH6A 4J9RA 2DR8A 1SCJB 1FWKA 3ETMA 1R7IA 3KUHA 1B0TA 2IDLA 4LJMA 1VBYA 1N32J 2W01A 1KKHA 2HQGA 4GVBB 4JYAF 1UFKA 2CG8A 1QLNA 1SKWA 4E98A 2EG2A 2IRXA 5DDQC 1UTAA 4DJBA 4ZITA 5LMUJ 4CNYA 3G96A 4ZHRA 1YJNS 1XNRJ 1HQUB 4KHRA 3W2VA 1LK7A 1UCNA 3IR5B 4OYPA 2B4OA 4KY3A 4NLRA 1OQ3A 2IMWP 1WTBA 3MR3A 2C42A 4DSFA 3BBCA 4JI7F 4OYOA 3H4BA 3TX8A 3QFWA 1PG5B 2IVFB 3G87A 4PR6A 4DS4A 1RHUB 3GCWP 3R9LA 3W9HA 3RRGA 4WU3A 4ZCKA 5F8MA 3D9BA 4C97A 2J9DA 1DURA 3W64A 1RT4B 1XN9A 4YB6A 1BXNA 3KJFB 1SJ3P 1ZH5A 3Q83A 2XBPA 4I7FA 5KFBA 2XLJA 2CKWA 3MFHA 3CCSS 3PX4A 4USTA 2OEKA 2E44A 1SJ4P 2FJXA 1TKXB 2VKZG 2W9BB 1S1UA 2KT5A 3R2DJ 3BYPA 5C42B 3D6HB 4UT4A 1MWQA 4J90A 4U9RA 5F9LA 2GVDB 1VGYA 2PFFB 1I51B 4CP5A 2DIVA 2APOA 4L75A 3C15A 1S1TA 3TJ8A 1QUPA 2B51A 2GMHA 4BHQA 1RCXB 4EU0A 5I3UB 2CZ4A 2M88A 2WSCC 4DUZJ 5KG7A 1YJ9S 4DF4A 2VASA 1RAAB 2XWXA 2BJ8A 2L9DA 2XMJA 2W9CB 4EYHB 1Q86T 1IKWA 3I0SA 5CCLA 3WBZA 1SUQA 3TARA 4PAAA 4LR7A 4YHHF 3HFVA 2RVJA 2R8HA 1L3UA 1AUDA 2BABA 1U7LA 1LWCB 3ISZA 3O3LA 2GJ2A 1ZM2A 2M2BA 4IOBA 3OJUA 3T9ZA 4PRFA 1N54B 2ZVSA 2BYCA 4AQYF 2E7WA 2AHOB 1R8HA 4DPTA 2B4PA 4JOUA 2F63A 2DGSA 3NP5A 3KLGA 2C2ZB 3U02A 5KFIA 1PC4A 3RW6A 3M9MB 3PV8A 3EGZA 2CPFA 4KBIA 1NK0A 1JLBA 5HI7A 3S01A 1VQNS 4XO0A 4OYMA 1DQAA 3V4MA 2QA2A 2BACA 2HHWA 4ZJLA 2OPPB 3HSGA 4LVOP 3THPA 1RTDB 4Y0FA 1FWLA 3CD7A 2CJAA 3MM7B 4PXBA 2J0WA 3OTEA 3MM5A 4IH7A 1TKZA 2DNHA 2NXNA 4J9VA 4KAIA 4MKAA 4OZLA 4LSLB 3CCWA 3T6JA 3DLLQ 4NXNF 2AW0A 3EVOA 4Y2CA 2RAQA 1GFWB 1SKRA 4WCEQ 1YX2A 2VG5A 3LUYA 4KV8B 3KMSA 4F8RA 3JSYA 3OVBA 1IBMF 1KVIA 2I38A 2IM3A 4RJVA 2HFZA 4ES3A 2PMZD 1PJ7A 1VIXA 2BJ1A 3OFFA 3LP0B 5E3PA 1FA0A 3IWXA 4H4MA 4IO1A 4ZLLA 2RHSB 5LJ5Y 2XY5A 4B3RF 1VC0A 1VQ5S 3KJVB 2WB1D 2JC1A 2RILA 1S49A 1Q16B 5KFTA 3BSOA 3OL9A 2W2QP 2YY3A 1RTZA 5T14A 3GG1A 3KK3B 3QLHA 4M5JA 3M7VA 4X4UA 4B3SJ 4F4AA 2HZCA 2Y0BB 4ZVHA 1FCAA 4WFNQ 1QE1B 3NGRA 1LWFA 4O3SA 3M6VA 2LKZA 4HT7A 4IFVB 3HHNB 2RIJA 2ZBCA 3D1OA 3RBDA 2BMBA 1VI7A 3M2UB 4FYDA 3TOQA 2AJQA 3TI0A 4U8VA 4DMZA 4ECXA 5HN0A 4N7TA 4DPUA 2VA2A 3ZXWA 2XEXA 4CRJA 3WC0A 3J7A1 4N47A 2VBXA 5IS2A 1EJ7L 1UKUA 2EFOA 2LQ9A 2CQBA 3AJ2A 4WFZA 2OPRB 2ZH8A 1HYSB 2DHXA 2XNRA 1HW9A 4QYRA 3GYNA 3J7AN 1NK5A 1HI8A 3DRXA 4WTOB 4ZVSB 4UZBA 2I0XA 1KNZA 2QA1A 4N8OA 1RB0A 5KFDA 3EZOA 1LEOA 3CCMS 3BDEA 4Y3CA 1NSQA 5HROA 3BM7A 1IR1A 2FZCB 1VHFA 2ZUAA 1SB6A 2NXUA 3HX9A 1RBLA 2CQCA 2KDOA 2ZOGA 1X4EA 4DR7J 2VUGA 2P9CA 4ZVPB 5GAGI 3K58A 1VC6A 1UPMB 3OL6A 5D4LA 3TUZC 4IQXA 3B78A 2YX7A 5KT3A 1VDHA 2FJDB 1RT7A 3W5ZA 3T5HA 5C2GA 4B3MF 1NSPA 4RW4A 1U0SA 2NXCA 3DOMB 4DR6J 4BWMA 2B6AA 4R0JA 2O3DA 5IC4B 1S1VA 2GIFA 4HDHA 1FO1A 1HARA 3S1TA 3VAHA 5ITHA 4LSLA 1JX4A 3GIKA 1HW8A 4A8XA 1X0FA 1YJTA 1P9QC 3D6TB 2IJFA 5J1NA 2FLOA 3A4TA 3MM7A 4L73A 2LECA 3HFKA 2PT0A 1X9MA 4K5SA 4N76A 4X4TA 2KL8A 4Q8FA 4KR0B 4C3MA 4F4YA 3H0PA 4HEA9 2QSWA 1RABB 2ZKUA 3TJ9A 3EWGA 8RUCA 2E1PA 2LXUA 2ZH4A 4DV2F 1NPPA 3MEDB 2AT1B 4RW7B 5HMYA 3Q8PB 4F67A 1N4LA 1UWAA 4O4RA 3R97A 5KOXA 1M5OC 1HPZB 3NKYA 2HWTA 1FJ7A 3DLGA 4UTGA 1NB7A 2HURA 2E1MC 5LT5A 3DHWC 2GQCA 3EICA 1N5YB 4MFBA 1RHMB 2FHKA 5IT9U 1JLFB 1DBDA 5FD1A 1NK8A 2W9CA 3HHDA 1UFLA 4RR5A 3UPFA 3IN5A 4OZ5A 4OIXA 3MCMA 4NYPA 3I55S 1WF0A 1R8BA 3Q86A 4ZJQA 4DXLA 2BR0A 1URRA 4RUCA 1EP4B 3UD5A 1S1TB 5HANA 5GAEI 1ELOA 3G82A 1S6UA 3G86A 3K8WA 2MTLA 1MSWD 4Q0BB 1U49A 5K20B 5FLXY 4QIGA 2FLNA 2JEFA 4FP9A 4C8ZA 4WF9Q 4RW9B 3ZZYA 3WX8A 4GRSA 4DCOB 2VJUA 3TZWA 4DR7F 1GMVA 3OPKA 1O8BA 2XSJB 4WYLA 2ACYA 3PJXA 3OUYA 1T9XA 2V2VA 3RB6A 3GIRA 3NMAA 2IBKA 4C8LA 1X31C 1ULRA 3RRHA 1V3ZA 2CPXA 4USIA 1MMDA 1U0HA 3VAKA 1N5TA 1ZZNA 2AWZA 1N56A 3MR2A 2XHCA 4HACB 3AOAA 4U95A 1JJHA 4PQAA 2OMOA 3TZXA 4LRBA 1MWYA 2ZVIA 3LQVA 4DR3F 2AJFE 1HQUA 2DNKA 3R7BB 3BDPA 1S9EA 1U1NA 1MMNA 1KDNA 3M8QA 4K4UA 3QT8A 1FDDA 4ZPWR 5J1EB 1WI6A 3M4XA 1U8SA 2ZJQQ 3OD2A 3D1HA 4NWBA 3H25A 4DX5A 4AXIA 2LEPA 5ETMA 2HW3A 4LUBA 3BBFA 3U1NA 4G65A 5L9NA 3E3XA 2YNGA 2QMXA 3AHPA 1UL3A 3HLUA 1RT3B 1TUWA 4NZ6A 4OX6A 4RZRA 5EWEA 3CUNA 2RJZA 5HJYA 2M8DB 2WK4A 3FEZA 2XSFA 3QSIA 3MPUB 4DSIA 3SCKE 5LSLA 1FI4A 1ZA2B 1X0PA 1ZAXA 2CWXA 2VFSA 4HI2A 2VDIA 2VKRA 1CQMA 4JI3J 4C98A 1U8WA 2F4FA 5ETPA 3FEYB 1IBCB 3QT7A 4DFMA 1B0VA 2Y8WA 3D68A 4BLGA 1S59A 3PEJA 3THVA 2GMLA 4OL8A 2DHGA 4UOFA 1XC9A 3T1YF 1CVJA 2GHWA 4WFXA 5IXUA 1E6VA 2QN6B 4LFBJ 1RU1A 1U2FA 4LF6J 3HT0A 2YKPA 3PYGA 4K50A 2CJ9A 5LJ3Y 3NBPB 4WFBQ 3MCNA 4TYBA 3LGMA 4DR2J 1VRQC 2EKYA 1YRXA 1UEKA 3HZEA 2MQLA 4DBQA 4X64F 1TK0A 3KTQA 4Y00A 3HKZD 3UD3P 1IQTA 1NMEB 2ZH1A 4DV7J 1XERA 2AMCB 2E5JA 2HK2A 3MMAB 9ATCB 1ZM9A 2O01C 4PPZA 3G8SA 1AFIA 2B7CB 2V2QA 3G4SS 4DPYA 5HQLA 3LWMA 3UD4P 4USWA 4ZIWA 1J5EJ 3VV2B 2DCLA 3GJSB 3J81j 4KHPF 5HVHA 5AJ3F 2K7KA 1FKAF 3OW2R
chains in the Genus database with same CATH topology
4V19J 1T02A 2RDIA 4IRCA 4M5DA 4FS2A 1W25A 2CFXA 2ZD1A 5B0FA 2K3IA 5CCMA 2UVVA 5HQ8A 3E01B 4HYKA 1VLYA 1KD1T 3DRRB 2RD5C 3KHGA 2R7WA 1T8EA 4XAKA 1TKTA 2KH9A 1YQHA 4J9MA 3CJKA 2RKIB 4EFAC 1KTVA 3CT9A 2D9PA 5I3QA 4RBTA 3SQGB 3FVYA 2KKHA 4P2SA 3PNIA 1BWEA 2CPJA 3KK1A 2HYIB 4GC7A 4KHMA 4WYWA 1HWIA 4EBEA 2Z2MA 3KK2A 1J5EF 3QYYA 4MK7A 4Y6IA 3OV7A 4F4ZA 1VQ9S 2UU9F 2W4PA 2VPWB 4R8UB 2JDJA 2C3MA 4ZVEA 3FFIB 3CCRS 1JLAA 1F60B 1Q7LB 1S1WA 3T9NA 3F73A 1UA1A 3JB9k 1H38A 5G4DA 2R8KA 1G7CB 3IR7B 2YKNB 5KG5A 3MM9B 4IFYB 2WSEC 1Z2ZA 2HQIA 5E5NA 4USJC 2MKIA 1D1UA 1O0PA 4N5SA 2YKNA 5KFSA 2DGXA 4YMEA 5L1IA 1SV5A 3OR1B 2DPJA 1TAUA 1FRLA 1S1UB 2DJWA 3GE9A 4CO5A 3IWLA 4OI4A 1VQKS 4JI8F 1XMBA 1NH8A 5LMUF 3O8WA 4DQRA 5AE2A 4I7FB 4JI6F 1VK8A 3C66A 3R5BA 4WE1B 3DU6A 3V4IA 1HNIB 2BM0A 3O5TB 6FDRA 3RB0A 4I67A 3ENWA 3M9NB 4DF8A 3X1LB 4NCAA 2KB2A 4ID8A 4WK3A 2DNYA 2ZHAA 3K5LA 2HNYB 3NLCA 4LSNB 3EX7B 2I8EA 1X5SA 4CO0A 2MQPA 3MR5A 3QGIA 4YDXA 2RRBA 1VMBA 4KFBB 1TKTB 2ZHOA 1GX6A 3FQKA 4YY3F 4YHHF 1FRJA 3EUNA 1RJJA 1HWUA 4Y2KA 2MMYA 3TVKA 4NLQA 3KHRA 3OJSA 3K59A 2VODA 4X4SA 4LT6A 2CYYA 2ZD1B 1QVFR 4DL3A 2R7UA 3DLJA 2MKCA 2KJVA 1XR7A 2F40A 4K2XA 1D9FA 2O1PA 4ZLPA 5A6WA 2OJ3A 1LFPA 2J8AA 1WI8A 1KTQA 2CJQA 1X5TA 4RW6B 3R5AA 1TV6B 3AAWB 3H5UA 1FRHA 2RH3A 3L09A 1ZETA 4M1KA 3QJPA 1Y3KA 2XMKA 5KFRA 3OFHA 1MWZA 1BQNB 2MJUA 3M2RA 3MPWA 3I56S 5DDOC 1T3NA 3KLVA 3PKMA 4YOEA 1KONA 1TP7A 3GFHA 4Y34A 4ZVFA 1TFWA 5GAHU 3N01A 4Q8EA 3H40A 2OTJS 2CQGA 1WG4A 1NK6A 3JSMB 3KLFB 2HIQA 2L08A 5JUMA 1RT5B 4ECVA 2V8GA 2CQ3A 2M52A 4PG6A 4ILLA 2IA0A 4BWJA 5CXTA 1NK4A 3MWBA 4WXWA 3HI9A 4P7TA 4IG3A 3VCDA 1IJFB 2QV6A 5D77A 1V6HA 2VD3A 4NA3A 5T7LB 1WHXA 2FC9A 2M5YA 4M8LA 2I9SA 3G8TA 3AB2B 5AXLA 4C8YA 2PA3A 3KG1A 1TL3B 1CQNA 5E3AA 3KLIB 3M8QB 3PW4A 2J7KA 3HHLA 1HNXF 5IM0A 1LK5A 2BRLA 2LEAA 4DSJA 4DR6F 5DM7Q 1Z2LA 4IOAQ 1HWJA 2LLZA 2B9XA 2H5EA 5B0GA 3KYLA 4C8MA 4MH8A 4IO9Q 4ERDA 1JLQB 1HR0F 2J6SA 3PZPA 2MPUA 3C6TB 5CZVA 2VOOA 4X62F 4OMFG 3OUYB 1BY9A 2AD9A 2XSJA 5FDLB 2NYIA 4RUAA 2B56A 5IWAF 2XO7A 1NZAA 1ZOTA 1U6ZA 3MPVA 3Q23A 3LAMA 3Q8QB 5HBMA 2KZMA 1QSLA 3NWGA 1U1QA 3LANA 4CO3A 2FIUA 1P8GA 4O3OA 4C3LA 4UUXA 2OFGX 3M6XA 2FUG9 5D8HB 5KFFA 3CC4S 1EP4A 5CA5A 1LWEB 3LP2A 2R7XA 2FVPA 2ROEA 4CH0S 2QIFA 4IYQA 1VBXA 4LIRA 4L72B 2XHWA 2MB0B 1GNKA 2DIUA 3DHXA 3K5NA 4YFUA 2LYVA 3S6EA 1GAOA 2HGNA 1KR4A 3V5RA 3G6ES 5I4MA 2U1AA 2IA6A 2CQIA 2W7AA 1MROA 3LPYA 3QIPB 4ICLA 3CWJA 4F25A 5KG2A 2EW9A 3QZ8A 3PX6A 4O44A 2EG1A 4UUWA 1IKYB 3DOKA 4K4TA 5F8NA 5L1KA 1F2GA 2KN4A 2K7JA 1ZTWA 3BR9A 1MU2A 3KNGA 2CQ0A 5HLFB 2UXDF 4JBCA 4LIWA 1QM9A 2RSQA 2CDQA 4K59A 1FXLA 1R6YA 3BF4A 1VK3A 2HLTA 2P9GA 3M8PA 2BQUA 3QO9A 2WBRA 2W4CA 5BJRA 5DLGA 4N56A 2FVCA 1GH8A 5HP1B 3TVZA 2V2KA 3M9OB 2EK6A 4YB7A 5F8LA 2HVZA 4YEAA 1C0TB 5I3PA 2XCPA 3CJ3A 4ID5B 1FKOB 3SCJE 1OS5A 2KT3A 4OQJA 3T3FA 1ZYQA 1PC5A 1R0AB 2FHMA 4DR1F 1FESA 2IHR1 5D78A 2BVZA 5F0WA 1RT7B 3Q24A 1KLMB 3V6JA 1JXLA 1P1LA 1FKPA 2PDAA 4NX9A 2BV3A 2GGPA 2OAUA 2FLPA 1VFJA 2MGZB 1VBZA 1DTTA 2M7SA 1UVJA 2IFXA 4JV0A 4DG1A 3Q8RB 1FF2A 5JVHQ 2XMMA 1VQPS 4KPYA 1F5AA 1U24A 1RA7A 3LWLA 3Q8SB 4B9NA 3M6UA 2HHTA 4F2SA 4CQ1A 5GAEU 2ZDPA 4DL7A 3IFEA 5J2MA 3NNAA 4IQMA 4AFFA 1DTQA 2IM0A 3M30A 2DGUA 2PE8A 4OV1A 2E9ZA 1H2VZ 4EO6A 3CD6S 4X4OA 4C0OC 1FK9A 2UUTA 3BO2A 1GT8A 1HNVB 1HNVA 2HNDB 2HNDA 3IGNA 5CZXA 5K8OA 2UUAF 1LWFB 3KWMA 4QIEA 3TW0A 3OSPA 2JSXA 5KFEA 4ED2A 4Q5VA 2AYBA 4IH5A 1LV5A 2NR0A 3FMBA 5L1LA 2MZTA 5T41A 5M2RA 3OL8A 3MM6A 4NCGB 2V94A 2IC3A 4GO5X 1YJUA 2WAQD 2YWKA 1X5OA 1TZ0A 3KG0A 2YKQA 4Y2MA 5D6GA 1A9NB 2COLA 5J2QB 4DOZA 3GSDA 3P5TL 4C7QA 3LP0A 5DLFA 2P9EA 3IGVA 4DR4F 1YITS 4ZPCA 5MAOA 3MMJA 4A8MP 3GIMA 4I2QB 1SJFA 4QWDA 5CYQA 2NSCA 2R4FA 2MZ1A 2XGPA 4DL4A 2U2FA 2VPXB 2GO8A 4ED6A 4I0WA 4I69A 3HHLD 4C0BA 4ZPBA 2PO4A 2B5JA 1RTDA 3CCQS 3DLEB 2GW8A 3VZHA 5L38A 2W7OA 3TAQA 2MDAA 1FVSA 2VG6B 2RU9A 1IKXB 2DR7A 2V4RA 5F3TA 3CDAA 3PKYA 3GQCA 3CD0A 3V6KA 5DJBA 3TNVA 4QW9A 3DRSA 1F5CA 2KJWA 1X4GA 3AQPA 1R43A 2IRUA 3TVYA 3CCVS 3QIDA 2NS1B 4PWDB 2BW2A 4X4RA 1UVIA 2YKMA 1ZPWX 2B3TB 1BC6A 1YWXA 2ZBIA 3QAEA 1URNA 5KFVA 2FJWA 3H4DA 4WZMA 4QWEA 1JJ4A 1T3OA 3L3CA 1AXQA 2YKAA 2HG4A 4R5PB 1XBWA 2ZFHA 2CJBA 4YB5A 3TAMB 5KT2A 1GXTA 4KQZA 5K14B 2BE2A 4QJVA 4C8OA 1LFWA 5DG9A 4IG0A 4DPOA 4URGA 3RU0A 1O51A 4B3OA 1I94F 3HDSA 1KQKA 1TKXA 2W9BA 1Q8LA 1RK8A 2BANB 2EPIA 2YNHB 2Y0SD 3IA0A 3MMCB 5GADI 1LXNA 3VQSA 4NXMF 2F8MA 5IT9Y 1N0VC 2EVZA 2DR5A 3AJ1A 2ZOFA 3MURP 3KOAA 2E1RA 2DNNA 2ZHBA 2YNIA 4FS1A 5HBMB 3KLEA 3MAHA 5E33A 1KHWA 3DRYA 4JI1F 2JOQA 3DLHA 1UMJA 2LXIA 1VRUA 2KXFA 4AYBD 4F26A 4NA2A 3W2VB 1U1RA 4ZHRB 3FCHA 3Q0AA 2C3UA 5KT4A 4F3MA 3HF5A 4F50A 4V19X 1UEVA 4TXSA 2YTCA 3DGPA 2ATLA 2CPZA 3MXHP 1L3VA 1HNZF 3I9ZA 1TL1B 4K4VA 4J9KA 4ZKAA 1HHTP 1HHSA 1XR6A 2ZM6F 1T95A 3FMWA 2YH0A 2GHPA 4TN2A 4QQBA 3DYAA 2VL1A 2RMLA 5KFJA 4FF4A 1WEXA 4HT5A 1RQ0A 4R25A 5T7LA 3G6VA 2R9LA 1YG0A 3H20A 5B08A 1OSDA 4QIVA 4TU7A 4WKRA 2VQFF 1TVRB 1VQSA 3NMRA 4DV1F 2AX0A 2P6TA 3I6PA 4NLOA 2KU7A 2V4JA 1M5VC 2BJDA 5F41A 4YR3A 2Q79A 2EFQA 3H2LA 1RTJA 5CYMA 4F2RA 3RR7A 4WFYA 1EETB 3RBEA 1KSPA 1BD6A 4FPRA 3BSCA 1SBRA 4ZPTR 3TYTA 3DDKA 5CQGA 3HHKA 4G1QA 3MUVP 4MJKA 2DNOA 4O3NA 2IMOA 4FF1A 3SSSA 3G9CA 1JLCA 2RRNA 4MYUA 4TLRA 3OVSA 1EETA 1NJXA 4OZJA 1RTJB 2N4DA 2A1BA 3QWPA 2HS3A 4W90B 1OWXA 3CCTA 3HZGA 3FGVA 5HL7Q 4C11B 5F8JA 3PO5A 2IAJA 3M32B 3UCGA 3QWUA 4ED7A 1YI2S 5E3CA 3IXQA 5CYJA 1FDNA 2V4QA 1RT2B 3G8QA 3U1LA 5H1SV 2WCXA 3MM8A 5J2NA 4IRKA 3PJWA 2ADBA 4DS5A 2W4DA 4KGMA 2Z4PA 3TA2A 1XWLA 3S7RA 5DDPC 1PILA 3D0GE 2IRYA 2O67A 2ZJPQ 2XMVA 1FRMA 2BA9A 5LSRA 1S9FA 3PRBA 1AFJA 2Q6BA 1RDRA 4PQUB 4I68A 3CCJS 1ZTTA 3RAQA 4ECWA 4D3GA 4Y65A 2KO1A 1TL5A 2G0CA 5C24A 1DLOA 2D74B 4ED1A 3I0RB 3I96A 2FB0A 2M0GB 1U1KA 2PMHA 3BJYA 2J76E 1UAWA 4MMOA 4Y2CA 3IS9B 2OSQA 5DS7A 2G1DA 3CIMA 4YB1P 4IR9A 4MK9A 3R5DA 2FJVA 4DV5F 2B4UA 2R7SA 3MEEB 2FD2A 1K1QA 3ITHA 3MMCA 2HHQA 4ZA1A 2NLWA 4FXDA 4JV1A 1HQEB 4NLWA 3CXCR 2W24A 5LMNF 1FXDA 3GFZA 2N7CA 1H7WA 2LMIA 2M8HA 4NLDA 4KC5A 3MEGB 2EBEA 3QMQA 5K14A 4TQRA 2XMWA 3JSBA 4EZ6A 4DSKA 2OH2A 2GIQA 3VAFA 4GKJF 2CVEA 1QSSA 2HS0A 3G6YA 3UR3C 4X4PA 5DO2A 1HQEA 3R5CA 2PC6A 1NAQA 1HBUA 3D0HE 2JVOA 4GO7X 3V81B 3N9UC 2FHJD 3VF0B 1Y4ZB 2YKMB 1Y0HA 3ETOA 1N36F 2CQ4A 5A2QY 4A46A 5J2PB 1JWWA 2LU1A 4DHVA 3UW1A 3C8YA 3S8SA 4OI3A 4JI2F 4ATNA 3N6LA 1UEUA 2ILYA 4DR5F 2ALZA 4QWAA 3OTOF 4NCBA 4AL7A 3BQ2A 4FN5A 1DARA 5A6PA 2UZAA 3SXLA 1UVMA 2V8HA 3B4DA 2HFOA 1SIZA 1TAQA 3CDEA 1NU4A 2YQ3A 1GXLA 3CF5Q 3I32A 3RAMA 3DC2A 2DRAA 1YHQS 2R2TA 4QR0A 2AYMA 1DQ9A 2FVQA 1LW2A 2DVIA 3THTA 3DOLB 3B8HA 4Q2MA 3OQ2A 5D4PA 2NUUG 4I2PB 4MIWA 4PXEA 3SSQA 4CT8A 3MFIA 3K5OA 2WHOA 2JFDA 1WHYA 4IDKB 2FJEB 3T5JA 4H4OB 1XK8A 3W7BA 4PPDA 3MR6A 3RAXA 1U09A 1C1CB 2C2DA 2ASLA 2M3DA 3IG1A 4ES1A 3QJJA 3OTDA 2OPSA 1IQZA 2KZZA 4TU8A 3H2VE 2IC3B 5A8KA 2OD4A 2Z8QA 4NCGA 3U7JA 4B9SA 1FJGF 4NOHA 1KQGB 2D41A 1UVNA 4OI1A 5HO4A 1RTHB 2DTJA 3LW5C 4NLYA 5F8IA 3NBPA 2KYXA 2OMLA 5CHCB 4RBUA 4H4KC 4LFCF 3UCZP 3CDWA 2IM1A 4DN9A 2Y1IA 3UNGC 2EFPA 3US5A 2KG1A 3VAMA 5DG7A 1DRZA 4HKQA 2RU3A 2V4JB 4QZVB 5HMWA 3MPYA 3BZQA 1JK9B 4RX6A 1FTRA 2DNGA 4DL5A 3DLKA 1S77D 1S76D 1Q1KA 3BSAA 4XDDA 2L3MA 3BGLA 4EZ9A 4C2MA 2OD6A 2QLXA 2LEBA 5EGYA 2ZC3A 4Q2LA 4NLVA 5KT5A 1RT3A 2WB4A 3BSNA 2YNGB 1OPIA 1IJEB 3NRBA 4IRDA 2YX4A 4RNOA 2LDIA 3VZIA 3O2IA 2CQPA 4OFZA 2YH1A 1G6BA 1REVA 3HVTB 5AE3A 2PA8D 2WSFC 4DG1B 4J9LA 2MGZA 1Z1ZA 5IFMA 1Y5NB 5DM6Q 3GV5B 4ZP7A 2JEGA 3PX0A 1X4HA 4OHYA 2V0NA 2J0XA 3PY8A 1S6PB 1E6YB 2VONA 2GX8A 3GR1A 1T05A 3KLEB 5DGAA 1J5OA 1BQMA 3IO1A 4D3HA 2QA4S 5A8WA