1FRLA

Azotobacter vinelandii ferredoxin i: alteration of individual surface charges and the [4fe-4s] cluster reduction potential
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDSCIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title Azotobacter vinelandii ferredoxin I. Alteration of individual surface charges and the [4FE-4S]2+/+ cluster reduction potential.
pubmed rcsb
source organism Azotobacter vinelandii
molecule tags Electron transport
total genus 31
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1993-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1frlA00
1Y5LB 1FXRA 3MM5B 3LW5C 2GMJA 3PNIA 5FD1A 3MMBB 4ID8A 4OMFG 2WSEC 2O01C 2FJEB 2VPYB 2WSFC 3IR6B 2XSJA 1PC4A 1FRLA 2FJBB 2PMZD 3OR1B 3C8YA 1C4AA 1XERA 4DHVA 1F5CA 1FDNA 1H7WA 2XSJB 2Y0SD 1DAXA 2C42A 3MMBA 3IR5B 1IR0A 2VPZB 2FGOA 4L6V3 1BD6A 3MMAA 4CI0B 3EGWB 1DFDA 1BWEA 1H7XA 4XDDA 1KEKA 3OR1A 1A6LA 3MMCB 1KQGB 3MMAB 3EUNA 4AYBD 1H98A 1FTCA 1C4CA 1JNRB 1AXQA 2ZVSA 3OR2A 1G6BA 3EXYA 1DURA 4XK8C 1RGVA 1FDAA 1FDBA 1FRIA 1Y5NB 2V2KA 2VPWB 1KQFB 2IVFB 2GMHA 1FDDA 1SJ1A 4KT0C 2UZAA 1Q16B 3OR2B 4OV1A 2VPXB 2WSCC 3MM6B 3MMCA 1B0TA 5E7OB 3HKZD 1FRHA 5BYQA 6FD1A 1D3WA 7FD1A 3IR7B 1Y4ZB 3GYXB 2C3MA 2PA8D 3MM9A 2FD2A 4Y28C 5BYSA 2FJAB 1G3OA 1BC6A 1FCAA 1FRXA 2WB1D 1BLUA 1FEHA 1JNZB 2C3OA 1GAOA 4RKUC 3MM9B 2C3YA 3MM7B 1GT8A 1R27B 3MM6A 1SIWB 1VJWA 1K0TA 1ROFA 1FERA 1IQZA 5L8RC 2C3UA 1B0VA 1FD2A 2FJDB 1PC5A 5CH7B 1WTFA 1FXDA 2Z8QA 1H0HB 3MM8A 1FF2A 6FDRA 1JB0C 4YDDB 2V4JA 5BYRA 1CLFA 1SIZA 1F5BA 5CHCB 1FRMA 2WAQD 3MM8B 3MM7A 7FDRA 1GTEA 4XDCA 2PDAA 1HFEL 1B0PA 1F2GA 2V4JB 3MM5A 1Y5IB 1FRJA 2VKRA 1BQXA 1GTHA 2C3PA 1FRKA 2FDNA
chains in the Genus database with same CATH superfamily
2V94A 2MKYA 4X66F 4O3QA 2HS3A 4H4MB 3M32B 1WC1A 5B0AA 2W4DA 2V8GA 1FVQA 3FSYA 2PI4A 3FFIA 3GFZA 1VCTA 2GV1A 3Q8UA 4FS2A 1IKWB 4P75A 1NH7A 4YS2A 1N5QA 4GKKF 1X5OA 5EUHA 1M5OC 2CWXA 3M1VB 1YG0A 5D0EA 3DLKA 3ZFVA 1UWBB 2QLFB 4QYRA 3PIPQ 1V5VA 4MJKA 4OX8A 4J9SA 1XEZA 2CPYA 3DGVA 4YB7A 4DQQA 4MT1A 3QGPA 4XPCA 5DG8A 1VIOA 4C0BA 2LKZA 3KDNA 1M0SA 3I4PA 4RUHA 1JNZB 2Y1LB 1UA0A 5L1LA 1N36J 2I5JB 4K5RA 1VQ4S 3VAGA 3A4TA 1IKVA 1A7GE 4CT9A 2Z2ZA 1SJ4P 1R7IA 2MZJA 2CPDA 3MM8B 4DUYF 3QPIA 1YBUA 3HDSA 4WYWA 1UA1A 2BE7D 3GTYX 1BQNB 2DNGA 2MZ1A 5DJBA 1PJ6A 1SL1A 4RU9A 2WSFC 4IRKA 2RDIA 4DL5A 2QA4S 3SQGB 4CRJA 4PPDA 4F50A 4DEZA 3RRGA 2BJ9A 2KZZA 4ZMMA 4OJGA 3HFVA 3QO9B 3M30A 4E8UA 2L9DA 4DUTA 2QFJA 3SSSA 1KQFB 1J2VA 3UR0A 5F9LA 5IT9Y 2OELA 4B3TF 3R8YA 4R5PA 2HNYA 3W9JA 4LRBA 1RHUB 3Q0AA 1RT6A 3OL7A 3CJSA 1U49A 1JLAA 1T0TV 2R8KA 2LEBA 3DNCA 3L3CA 2HK3A 5F8IA 2RQ4A 4LF9J 1JLEA 2WBMA 4ED2A 2CQGA 3CGIA 4H4OA 2LXFA 2VFUA 4QWEA 1RWKB 1HFEL 1B0PA 4OZJA 2R7XA 1F3FA 5GADU 3BF4A 2HZCA 1JMTA 1QUPA 4URSA 2LU1A 1VQNS 4KRWA 4MIBA 2VIHA 4ZPVR 1RAGB 2XZDB 3P45B 4B9NA 1F5CA 1FDNA 5IT0A 1MW7A 3TA0A 2RE1A 2HWHA 3MMBA 1FWLA 2HQCA 3BGFA 1P9QC 5J1EA 4Y2IA 2ZJQQ 2FVRA 2DGQA 1U6ZA 3TUPA 4ATNA 2IA6A 1QD1A 3HKZD 2DGVA 4F3MA 5LXRA 3A8KA 3ILLA 3AH6A 1RWMB 4DFKA 4MK9A 1UKUA 4YB1P 3UN3A 4ID5A 3B8HA 1VQ8S 2HBRB 3CB4A 4IOBA 2HYIB 2OPRB 4V1Ak 4HTJA 2HIQA 4UZBA 1FRMA 4I68A 1VJQA 4A46A 3MM5A 4WIIA 2DXFA 5IM0A 1IBCB 4CWBA 4DSIA 3LGNA 3UE2A 4LBIA 3IGVA 5GAEI 4RNNA 4ZVEA 1RQ0A 2ZH1A 3D4JA 3MPDA 2QMWA 4FBTA 4A8FA 4WFXA 4ZVFA 4WK3A 1SC6A 3W5ZA 3Q8RB 3IA0A 3QMQA 4DV2F 3SCLE 5M2RA 1VHIA 2R7RA 3CDBA 2DNMA 4UTGA 5D77A 1IJEB 1P6TA 3CMES 3LO3A 3ET6A 2XMWA 1H6KX 3H98A 3LUYA 4FNIA 1AZSA 3IWXA 4IYQA 3RB6A 2FHOB 4ALZA 4X4RA 3MM6A 2ZBPA 4EK2A 3W8GA 3NG8A 2HHSA 3QZ8A 2BKNA 2V4JA 4ICLB 2GQ2A 4QZVB 2PDAA 2ZBCA 3ZNUA 2BJ8A 4M94A 3OTOJ 5D15A 3G87A 2YKNB 3A12A 4RW8B 2NSBA 3R6LB 2JJ4D 3UNYA 1SKUB 4LF8J 3PVXA 4JV2A 3F73A 3NP5A 1BUXA 2CG4A 2CPIA 1DJ0A 5C24A 3FZBA 2PT0A 5KFXA 1M1HA 3PYGA 1DBDA 5DO2A 1BD6A 4BWMA 3PACA 3VVTA 2ADBA 2DCLA 5EN1A 2W01A 4IR9A 1YKWA 3ILIA 5ETVA 1UJ6A 2QG9B 2A6MA 4WJBA 4HHUA 2QYCA 2D3O1 1NK7A 4MTPA 3KK3B 4DMZA 4ZN1A 2HQGA 1Q4RA 5BYQA 3P8BB 5H9EK 5E3QA 5DZ7A 3S7RA 2ZH5A 3MUVP 5HVFA 3HF5A 3GJSB 1F3VA 4H4KA 1BWVA 3HMJG 3D1HA 1SKWA 1L3UA 1SQFA 1RT3A 3AOCA 5BYRA 5A76A 1F2HA 1C1CB 1NKBA 4NZ7A 2IM0A 1LFWA 3PYEA 3L09A 1QY7A 4CLTA 4B9UA 4GVBB 1FXRA 4WKYA 1IWAA 4FKYA 4QOTA 3AD8C 1WF0A 3KHLA 2DNPA 1HWUA 2V67A 3R27A 4CTAB 3SFUA 2RT3A 1RE1B 3V6KA 2YNHA 3KWMA 4MKAA 1YJVA 2DH9A 1VS3A 4NOHA 3IXQA 2DJWA 4I7FB 3C6TA 3I31A 2OPQB 1JWWA 1YSJA 1TK0A 4X4OA 2HPUA 4DU8A 2FVPA 2IY5B 3B82A 4URQU 1QLNA 3J81j 3DRSA 4IFYB 4P2SA 4PXEA 1S4EA 3CJKB 2F7VA 5HATA 2HRYA 2XEXA 3IGNA 1HKAA 5CYMA 1X9WA 1OSCA 1VR6A 3W2WB 2VKZG 2AEMA 1T95A 5IT9U 2FLPA 4DSEA 1FJ7A 4OLPA 4ZVSB 1N33J 2XSJB 3KXDA 1NSQA 2VQFJ 3MEEA 2GJIA 3QYYA 4FDFA 3W9HA 4C3KA 1MN9A 1SPBP 5KG6A 2QLWA 2Q1LA 2CJXB 3OPKA 1RTIB 4XPEA 1Q8KA 4FXVA 3W63A 5HQ8A 3T5KA 4K50A 1SV5B 2R4FA 4J90A 3GE9A 2ZM6J 2KRBA 4A48A 5D0GA 1NPRA 4J9UE 2YNGA 4P9SA 2KKHA 3TEGA 1HIYA 2O1PA 4AQYF 2DR6A 3CJTA 1MU2A 5KAKA 4KKOA 5HK4A 3MDFA 2NZCA 2GQQA 3UPFA 5B08A 1YQHA 2IM3A 5L46A 4KGZB 4PG7A 1HPZB 4DV4J 3N01A 1HARA 3NGSA 3MAQA 1WEXA 4G1PA 5D4LA 4DPWA 2YH0A 2GA7A 4TLQA 1M5PC 2AEJA 3X1LB 3KMQA 5J1NA 1S6PA 3MCSA 3FBCA 2E9ZA 4DV1F 5CZVA 5E0OA 3BS9A 3RGIA 3GFHA 3M2UB 2G0IA 1KEKA 2G2ZA 1HBOB 1UL3A 4EO6A 1CEZA 5I42B 1WKJA 2VOOA 4NLUA 4Q0BA 2GJ2A 1B3TA 4I1TA 1KLMB 4AL6A 1CS4A 1U6BA 1YBAA 2NPIA 2AYMA 1T03A 1X8DA 4J9VA 1ZBTA 3OTBA 2N3OA 3FKBA 1YJ9S 3H2VE 4ECQA 1N5VA 2BACA 4CLLA 3M8QB 4OZ5A 4DFMA 3IC1A 1HNZJ 4NLPA 5U47A 1RACB 3Q22A 1XMBA 1UVLA 3V4IA 1LWFB 1FNXH 1GTEA 4QPXA 4ZP7A 2I1RA 5ETTA 1GTHA 4G65A 3THVA 5CA5A 1S76D 3KLHB 3U1MA 3THPA 2I2YA 2KFNA 4EU0A 2KJVA 1IJFB 2GGPA 2BMBA 3KTQA 2PMHA 5LMNJ 2MQ8A 4J9NA 3GMGA 2OD6A 4DR3F 3MGJA 2NXCA 3CCJS 2CJQA 4QIVA 2FHJA 1AXQA 1CBKA 1NJWA 4A8SA 2JH3A 3BV8A 1LNQA 3HHLC 3ITHB 4NXNF 1LWEA 1TV6B 1N5SA 3T9ZA 1SB6A 2J9DA 1NLKL 3CJQA 4ELUA 4M5MA 1IQTA 4JI3J 4FP9A 1FD2A 5KT7A 1CJTA 3PY8A 3FNNA 4FF2A 3GPAA 2DXEA 3PR5B 1H38A 2ERRA 5L9NA 3TZWA 2CJYB 2DY1A 1TL1A 1M1GA 4MYUA 1UW4A 5G0RB 2RRBA 2YTCA 3RYLA 2F8EX 1ZA1B 4LVNP 1SKRA 2X3GA 3DLEB 3HHNB 4YP3A 4XAKA 4DV5J 1S4FA 3ZXWA 4KIAA 5A2QU 3OR1A 1MLAA 1A6LA 2DBBA 4LR8A 4Y2CA 4FF1A 5HO4A 3JSMA 3NWGA 3IWLA 4YR2A 4ZN3A 4C7QA 4WXWA 1KHVA 4GC7A 4WE1A 1S6UA 4J5OA 1GMWD 2QYGA 1NB7A 4IFVB 3QAEA 3BSNA 4JI5J 2CRLA 4QU6A 2LU2A 1KDNA 3UFCX 3Q2SC 4DQRA 3MTJA 4TU9A 1LFPA 4F26A 4DZ6A 1NEEA 3GFXA 4K0KJ 4FYWB 5ETQA 2HK2A 2UV8A 4DSLA 2LXIA 2B4VA 4JI6F 4DV3F 2Q3PA 2K1RB 2FJVA 3VZHA 2RUGA 4Y3CA 2NPFA 2P9CA 1BHNA 4R8UA 1HWKA 2FHKA 2QJ3A 1RLCL 2QE5A 4I2QB 4A8XA 5DQGA 1C0TA 3DLJA 4KQZA 2WONA 3PKYA 3BSOA 4BHQA 1B99A 3IWNC 2RQMA 3OW2R 1I94J 2ZVIA 3TJ9A 4FYVB 2M3DA 2V4RA 3FUYA 1J5OA 2J9EA 3HFKA 1Y00A 3A3PB 3EDQB 2H1YA 3HZEA 4O0NA 4K4XA 1Y5NB 2GQCA 2AV5A 4LQ9A 2KB2A 2VPXB 2VDHA 3I0SA 1ZETA 4CLZA 3VF0B 2C3MA 3FK4A 4NLOA 3UW1A 4LRFA 3QLHB 2DHHA 3GSIA 1UWAA 5IQ6A 4KR0B 2UUCF 1CULA 3BGLA 4X84A 1RWOB 1S5ZA 2VFTA 4NE9C 1CG2A 3KHHA 1YJTA 4P7VA 5DETA 2Z8QA 3FCWA 1O8BA 3CDWA 4YEAA 1YJNS 3OL8A 2E5IA 2OEJA 5ETSA 4GO7X 4ITSA 4J9OA 4AL5A 1XMQJ 5J2PB 2G0CA 2R8JA 3MZIA 4YDXA 2F3JA 3MCOA 4J9QA 5L1JA 3A8IA 3EGZA 3PXGa 3OFHA 1UVKA 1QM9A 2YX1A 5KFUA 4JUZA 4PR6A 2CQIA 2E1AA 4CO4A 3HM9A 2XYHB 3ENQA 4EYIB 4DR4J 4QWAA 4ZVGA 3D0HE 1LWCB 1DLOB 3FEZA 4KT0C 4KGXB 3D6HB 4C2MA 1PJ5A 2XMUA 1NJZA 3MAHA 2QL9B 4QU7A 3K5OA 2F4FA 5E3CA 2GVZA 2NLWA 1TAUA 1SH2A 1K73T 2DR8A 3JQMA 3HO1A 4URGA 1X4AA 3EWGA 1NRKA 1UEUA 2NREA 2KYZA 2XMJA 2UXDJ 3HZGA 2J0SD 2X1FA 2ASYA 4TNOA 2UXCJ 1NHVA 3MOZA 3UO0A 5DDOC 1CSJA 1FTRA 2QL7B 1EETA 3U1LA 2MKHA 4PWDB 4A4JA 5GAGU 5HBMA 1D8YA 3NNCA 3MOJB 3GJRB 4DV7J 1U0HA 5I3PA 4B3OA 1R8CA 2VODA 4F4KA 3R5JB 2E5GA 3IN5A 4ECSA 5A8KA 2RDJA 1Q86T 3JB9k 5DQHA 2HWIA 4CO2A 2V9WA 2VH7A 2O66A 3K5LA 2GIFA 4CLWA 4NA2A 1VQ5S 1DTQB 1YITS 2W4PA 2LQ5A 2LA4A 2AJFE 4K7QA 4PUOB 5L1IA 4OI3A 2XBPA 5DDPC 1TL4A 2F65A 2R8GA 1N36F 2Y0BB 4J9MA 2HQDA 2BZ2A 2BRLA 2YNFB 3PM9A 5KFLA 4DUZJ 1U1NA 1FA0A 1F5BA 3K5NA 4KPCA 5D0HA 1RYRA 4KYZA 1RTJA 3M32A 1XNRJ 4CDIA 2ZH8A 3HD2A 2XI3A 2FUG9 2YX7A 3W7BA 2W2MP 2BQRA 3FVYA 3LP0B 4V19J 5F8LA 1QSSA 4HDGA 3GIIA 1W7WA 1IKWA 2BKOA 4I2PB 2R2RA 3C46A 2V8PA 3M1VA 4KGMA 2RF2B 3BYRA 1UWBA 3MTKA 3FDSA 3HHDA 4TVAB 2LP4A 1T3NA 2BW7A 4L73A 3PJ9A 3TARA 1EARA 2IVMA 4EBEA 2DNKA 1SJ1A 3D28A 2CQ2A 2WZ1A 3V6HA 2Y3YA 1FKOB 4NI2B 3LP2B 2FD2A 1WACA 3T19A 3HPOA 3SV4A 3A3NB 4RW9B 4ECTA 3ILJA 2MQPA 1RKIA 4LF9F 4OYWA 3RBXA 3M8PB 1RTHB 1WF1A 3PW2A 3MM8A 1FF2A 2NZ4A 4JP8A 1FXLA 4KSEB 2CXEA 5GADI 4DL7A 2KVIA 2ZNZA 4ED7A 2XWXA 3LA0A 2VKRA 1HI1A 1R8AA 2VL1A 2C2NA 5BJRA 5F8MA 3DRYA 4OZ3A 4QYZK 3SQGA 2VU5A 3UI3A 3AHPA 3AOAA 4LFCF 3C2PA 3DYAB 3D0IE 3DLKB 2DNOA 2HQFA 3RRKA 2NR0A 3IMQJ 1Y3KA 2DXDA 4M5IA 1Y0HA 3J7A1 4DV6J 3U1NA 2DHXA 5AE2A 4JV5J 3TAMB 5THWA 4U95A 4LFAJ 4PWWA 5B0BA 1TR0A 5HJYA 2QTWA 5HP1B 2YXLA 3HD1A 1R6YA 2HFVA 5K8NA 4U8YA 2FLLA 4FS1A 1XTZA 3C19A 5K14A 1IVZA 2CFXA 3WC2A 1D09B 2L41A 2RQCA 2FDNA 1Y5LB 2W2OP 2B5JB 4W92B 4L72B 1WEZA 2KTQA 1LK7A 2DIUA 1IXKA 3PG9A 3M30B 2M9KA 3ULHA 2C42A 4OLOA 4CH0S 5KG2A 3OXLA 3OFGA 2ROPA 3D3CJ 1S1VA 2GHPA 1XBWA 1S1UA 3IM8A 4I6YA 4R5PB 1FKAF 2NCKL 2CNOB 1HWLA 4BC7A 4DSJA 1WHWA 2EK1A 2C28A 1JLAB 3OR2B 3LANA 2FGCA 5E3PA 1JLCB 3GONA 2IMWP 1HI8A 3V81B 4NXMJ 1X4EA 1KD1T 2XULA 3UWTA 3H90A 4H4OB 4ANCA 1CC8A 2R7WA 3RR8A 2JEJA 5CD4H 4P2XA 1HBNA 2FY8A 2CUYA 1K0TA 3GV7B 3GV8B 2MZSA 5EX3A 2OPRA 5IC6B 1TK8A 1VI7A 4P71A 5J2QA 2V2VA 4N47A 3H25A 2GS8A 1TMJA 4IKAA 5ETRA 2MQQA 3FEXB 3QT8A 1HHSA 2EG1A 4M5KA 1FHTA 2ZOGA 3OTOF 3W3SA 4ZCLA 1TKDA 4NCBA 1NK5A 5K8OA 1ULRA 3MMBB 1JX4A 3U02A 1P1TA 5J1EB 4UT4A 2ZH2A 3OD2A 4LF8F 1XNQJ 3CUNA 4DHVA 2MKJA 4DQPA 5ETKA 3V2UC 1MWYA 2F5GA 6AT1B 4F4WA 2FYXA 2I8EA 2DB1A 2O5DA 3EICA 3H8YA 2X1BA 3QSYB 2M2BA 3NOCA 3CCVS 4WKRA 2OPPA 2XLKA 3QJJA 1RA7A 2UUWA 3KNAA 4PEOA 4PABA 4RNFA 1BLUA 3AA8A 1F1BB 2QRRA 1SIWB 1C0UA 1WTFA 4ICLA 1O51A 4OZLA 3Q8QB 1RWUA 2E1RA 3QGGA 3BO3A 3SV3A 4C9DA 4F25A 2G1DA 5KT3A 1N56A 5LT5A 4G3IA 2EFPA 1FRKA 4RW8A 3OVAA 1QJHA 1RAOA 1NH8A 2CQ4A 3Q86A 1S9GA 3M2VB 4CYUA 3JSBA 1X7VA 3ZZTA 4I69A 1VQ6S 4V19X 2KVQE 4B3MJ 4WFYA 1V5IB 3R7SB 1RB0A 2W9BB 3IBWA 4RLEA 1UVNA 1ZM2A 3M9NB 1IKXA 3VZIA 1KKHA 4RUAA 1M1KT 3M6XA 2D74B 3ET6B 4EI2A 4DCOB 4S0MA 1OJ4A 3KK3A 4CH7A 3G86A 3IBFB 2FPHX 4TXSA 2DITA 1Q82T 1JLFA 3AY0A 1RWNB 4OV1A 1R6VA 3JQJA 1X4DA 3MM6B 1TAQA 4I6AA 3H40A 4IG0B 1RWXB 2M88A 4P2FA 2HZAA 1FCAA 5B7WA 5JJBA 1CQMA 2B4PA 2C3YA 3LH2S 3VQTA 4KHPJ 1QTNB 3F0NA 1LW0A 4LSLB 1TL5A 2VUGA 5HQLA 1FJEB 1F0XA 4J7CA 5D4OA 1C1CA 1U2CA 4DX8H 1SVDA 2DNYA 4U96A 3HHLD 4GVBA 4C8OA 4P2MA 5F0UA 4UOGA 2MPUA 2YY3A 3QJPA 1PJ7A 5C24B 3PRDA 4D3HA 1YK9A 2EFOA 1SI9A 2IRUA 2GC8A 3CCTA 2E5HA 3MEKA 4YOEA 4CTAA 3ZO7A 4DPOA 1JLBA 1N33F 2VQFF 3CJ3A 4C3LA 2ZC4A 3C14A 4Z7CA 4FPRA 2KT5A 4DV0F 3VVUA 5DS7A 3W2VA 4M8LA 1AUDA 5A0YA 3VAKA 2B51A 4Y00A 4I7FA 3H4DA 3MR2A 3E2EA 2W2NP 1GXTA 2FY1A 2ZM6F 3KJQB 2OPQA 4DQIA 1NNDA 2H4WB 9RUBA 2AT1B 2CJKA 3M2RA 1RT3B 3NWRA 1T94A 3QQCD 2KXHA 1KONA 4NLQA 4IFYA 1VQSA 2W8LA 3CJKA 1FE0A 1RAFB 4X4VA 4A8QA 4O3SA 1V9OA 4L74A 4DV4F 4PG6A 5KT4A 3GG0A 5IXUA 4W90B 4RWWA 1HR0J 3W2WA 4OHWA 4ETZA 1L3TA 3SCIE 1JXLA 3TAPA 1RHJB 2M0GB 4UQGA 2CQ1A 2XGPA 2XSJA 3SCKE 2LQBA 4PXDA 4OV6A 4OI4A 2HBQB 4JI4J 4OYXA 4RBVA 4ES1A 4J9KA 1RT4B 5KFZA 4JYAF 2I38A 2LXUA 1RTIA 3PV8A 1SJQA 1XJWB 4DR2J 2D69A 3N79A 2GO9A 2WVEA 3C6TB 1AFIA 4ZS6A 3OVSA 2RU3A 2B9WA 3TW0A 5F41A 5D3GB 5KFOA 2I0XA 2DRAA 3HSZA 4AE5A 5C25B 1KRPA 3VAJA 5L9XA 3CCUS 3AOBA 2BV3A 2F9JA 4OYMA 4QIFA 1M90T 3GB0A 3B54A 5CYMB 2OFHX 1WDTA 3H4BA 3S1TA 1HPZA 1R8PA 1XK8A 4NASA 1VRUA 1OQ6A 4RU2A 4WWSA 3P5BP 4QIEA 4WTOB 4DL2A 3C6UB 3X3UA 3PJWA 4C48A 1TZ0A 1DY3A 4OHVA 1T7PA 1ZM9A 3D7SB 2W9AA 2AQ4A 4CLPA 4WFAQ 3CJ5A 2DT9A 4QIGA 2HRTA 4JV0A 2GJFA 3VAIA 4O4RA 1LK5A 1HBOA 3FRZA 3QWPA 1UFKA 5KFNA 2YNGB 4Q45A 3LP1A 2YNIA 1FDDA 1UP1A 2AEFA 4QPTA 4KKOB 3G9CA 1RADB 2DY9A 3KLVA 2G13A 5ETLA 1NKEA 3MCMA 3M8QA 1U1RA 3AD9C 1VDHA 2WVBA 1SL0A 2FJDB 1FEEA 3TR5A 1ZOTA 5CH7B 1MNEA 4EBCA 2OKQA 4FBUA 4J91A 2Z4PA 3W8PA 1N32J 1FRJA 5M2PA 2VA2A 2CJAA 3IBCB 2ACYA 4KH1B 2J7WA 4MMOA 2HFOA 2APOA 5B09A 1M5SA 3GQCA 4ZVTB 3QGIA 2QLXA 2MHEA 2ASLA 4OZ1A 2LDYA 5GAHI 2R7QA 4NLTA 4DV5F 2FGOA 5DLFA 2V2ZA 4NZ0A 3HP6A 2BX6A 3ISNC 1D9FA 4X4PA 1ZTWA 1QSLA 1S1TB 2CVIA 3BEGB 1T03B 3GP9A 2ZEJA 3G71S 2XZWA 5IT4A 2RHQB 4Y6IA 4O0IA 1B70B 2FZGB 3KUEA 4OZ2A 4MYTA 4JI5F 3DC2A 4B9LA 4LMZA 1SC3B 3ETMA 3V4IB 1R27B 2GAGC 4ED1A 1FFWB 2LA6A 4K0KF 2XY7A 2DVIA 1RHRB 2DISA 1TUVA 9ATCB 1BQXA 5G0RA 7FD1A 1FNMA 4B3RJ 4KTQA 4ID8A 3AJDA 2BABA 2UXBJ 1G2EA 4PXCA 2P6SA 4UOCA 2MZQA 4ZPCA 1JJCB 4CM2A 2VICA 4DCJB 1HHTP 1I94F 3OXGA 2EG2A 2IJFA 4KBIA 2MZTA 2BE2A 2WVFA 2X7IA 2OLWA 4Q5VA 1H98A 1LWEB 4KGVB 3EXYA 1MROA 1RGVA 4IFVA 2W25A 4MIAA 2R7SA 2VDIA 4F04B 1U4BA 3D1OA 5F8NA 3FBEA 4N56A 3FJ2A 3ZTSA 4LIWA 4RW4B 1VRTB 4ZIWA 2I6WA 1B0VA 4LSZB 4DN0A 1YX2A 2JFKA 2ZZTA 1ICEB 3PYDA 1TL1B 3NCPA 3QAUA 5EWFA 4DWIA 4IO9Q 2J0WA 4DI6A 1HNIA 2IA0A 2AGOA 2HLTA 4I2QA 2AYBA 3JTNA 1X4HA 4WZMA 4OMFG 2IRYA 2O01C 4ZLJA 1KNZA 3NGDA 4ECWA 3HVAA 5ITHA 3OR1B 3HHKA 3JSMB 3QT6A 3QZ7A 3PHTA 2DEIA 4WE1B 2OMLA 1N54B 3TX0A 4DR4F 2ZE2B 4AFFA 4DF8A 1KFSA 1VOMA 3WX8A 3GYGA 1CJUA 4YB6A 5B0DA 1OSDA 4HH0A 1Q7LB 3SCJE 4C0OC 1WG1A 1E6VA 3QLHA 2A0FB 4FXWA 3MUMP 3OJUA 4DR1J 4OYPA 2RSQA 2J0XA 2LECA 4WBFA 2V8HA 4NLRA 1Q7YT 1AW0A 2VASA 4LBHA 2IYIA 1NCLA 4PAAA 2UXDF 3CJ2A 2F8HA 4O3OA 3PJXA 4DN9A 2MDAA 5KFIA 2UXCF 1R0CB 5GAGI 4P10A 1NJIT 3PKMA 3D5MA 4FYDA 3TOQA 1IKYB 3VAMA 4DF4A 3I32A 5B0EA 2JDJA 5DG7A 3L4BC 1NPKA 4DV7F 5A8RA 3H2UB 4OHYA 4OX6A 4DG1B 3H5XA 4PG8A 4NLYA 3IS9A 2FZKB 1LWCA 2BJ7A 1KQGB 5F3ZA 1CPZA 3ENVA 4EEYA 3I0SB 3BN7A 1XC9A 2XQCA 3EMTA 2ZH4A 1YIJS 2E1PA 5LSLA 4DDFA 4IO1A 4X64J 2NSCA 2KFYA 1FRXA 4C8MA 4LBPA 3MR3A 5AJ3J 5KFFA 2IM2A 3T6JA 1WI6A 2MMYA 2PMWA 3BGUA 2XG8A 4O4GA 4MIWA 2VG6B 4PPZA 3DMJA 3QGHA 3VWSA 3ILOA 5D0RA 5K8PA 2AJ0A 1XNRF 1WEYA 3GIRA 1XR6A 1U6FA 1U1KA 4CZCA 3OL6A 2G0JA 3MPYA 2B4UA 2AWZA 2ZOMA 2CDRB 3AD7C 4A8MP 1NBEB 1HA1A 3TI0A 3TVYA 3ENWA 1T9WA 2VQEF 1MMDA 4UF4A 3S6EA 1WC6A 2CQCA 2DGXA 3EUNA 3OTEA 2HMIA 3ZTPA 1DURA 3W66A 5GMKa 3WZ0A 1WC4A 1WC3A 4ELVA 4PUOA 2HHTA 4ETXA 1EAYC 4GKKJ 2UVUA 3RAQA 3AXMA 1U1OA 2AP6A 3NAHA 4JI1J 1G3OA 2HVDA 1VHFA 2QT7A 2P6TA 2KXFA 2DNHA 3K7RA 1EETB 4C98A 2AX0A 2ILZA 4OHXA 1TUWA 5FLXU 1EKSA 2W7OA 5HLFA 2PEBA 3G6VA 4B3OB 2PN6A 3OFEA 3DGPB 3A1YG 1H2UX 1SC4B 3PNIA 5A8KB 3LP0A 1RUSA 4DR5J 2E7VA 4U9RA 5CD4A 2U1AA 1IUJA 4I2PA 2A1BA 2Y1IA 3E8OA 4M1KA 2GIQA 2IC3A 1YZ7A 3US5A 2RF2A 1SUQA 3PCOB 4FN5A 1RISA 3H0PA 2ZOFA 3CC2S 5KFBA 3C15B 5T14A 4XK8C 4NWBA 5LM7E 5KFCA 3NAIA 1FKOA 3BH6B 4Z37A 3LP2A 3R5DA 4DV6F 3DXSX 1Q53A 2MYFA 3IRWP 2EBEA 3W5YA 1J5EF 4JV5F 1U2RA 3E01B 4RW9A 3HSGA 5K5MA 4JI2J 4LFAF 3OHAA 3MURP 3MFIA 1LQ9A 1RT1B 2EFNA 3ZZ0A 2MLXA 3MM9B 1RTHA 1VRQC 1YJUA 2ZNYA 3HCXA 4RBUA 1YTYA 1RTJB 3K57A 5I4MA 1X5PA 2V50A 3CCRS 2KM8C 4C8ZA 2GIRA 4TYAA 4DFPA 4WP9A 2V34A 2ZBRA 2Y1RI 4O3PA 1LWXA 2VZ9A 2D3ZA 4CO5A 2HHHJ 3CO0P 3DYAA 5KT5A 3P4UB 4YR0A 1U26A 1MSWD 4L76A 3RB4A 3IR5B 1RT2B 4USHA 4A8WA 4GC6A 1PILA 2E9TA 4NZ6A 3LPEA 5C2CA 1T02A 1V6HA 1MMLA 4AD6A 3MMAB 1Q81T 3T1AA 4QBUA 1G6BA 5HVGA 3UCZP 4HHHA 1KC8T 3TAMA 2QSFA 1U7LA 1JXEA 4OI0A 2YKMA 2RKIB 2EK6A 5KG1A 2W2PP 2J9DE 2JEIA 4NXMF 2ZZMA 5DDQC 1UEKA 3WBZA 5HP1A 1V3RA 1BGXT 2WRMA 2IMOA 3D6FB 2DRDA 2NS1B 3FCVA 4DSFA 3CD7A 3L9ZA 1U02A 3PX6A 5J2NB 1ZAVA 3GG1A 3OXFA 3B4MA 2ZITA 4USUA 2B5JA 2AYGA 4RX6A 4LT6A 2DO4A 2WTFA 1ELOA 1HW9A 2RILA 3DDIA 2B6AA 3DU5A 5BR8J 4YB5A 5HMYA 2HS4A 2VJUA 3NS5A 4KHMA 3TJ8A 2IPOB 2OFGX 2AGQA 1XNQF 1ZPVA 2HFZA 3J81Y 1NDCA 2VG5B 1IR0A 2YKAA 1FJGJ 2AJ2A 4UW2A 5IS2A 3OHBA 1YRXA 3KG0A 1LKZA 3K89A 3SMZA 4IUFA 2MLYA 4WZQA 2EKNA 3OR2A 1SCJB 3OLAA 1HYSB 2RH3A 4HKQA 1JLCA 2VBZA 2ZZNA 3J7Z5 5GAEU 3V81A 4ZJLA 1PCAA 1BY9A 2UUTA 5IWAJ 3A13A 2C2EA 1KS2A 5SZTA 3OUYB 4PYDA 5K14B 4MK7A 1WG5A 2C3OA 2A3JA 4KAIA 3P6YC 3CJ4A 4QW9A 4ZP6A 3SSQA 4WU2A 3CMAS 4FVMA 1NJYA 1S48A 2ZD1B 4LF7F 3B4DA 3MECA 1RXOB 1Q5VA 1B4SA 5HMWA 2V5HG 3NY0A 2B7CB 3IR6B 1S1VB 3N5BA 1S1UB 3VALA 2Z58B 4B3MF 1GEHA 3AQOA 3DDKA 3DOMA 4O23A 4UOFA 2N7YA 3MD3A 1X4BA 3M6VA 1VK8A 4NEYA 1Q95G 4MKVA 2IDLA 1A9NB 4ED3A 1VQMS 4F02A 1HBNB 5L39A 4KHRA 4ZVRB 4A8KA 4C8NA 1JLQB 1YRTA 3GR1A 3QBCA 2HFNA 5J2QB 4LSNB 2AX1A 5A8WB 4KHPF 1WDDA 4IDKA 4HACA 2R7VA 1FK9A 1KR4A 5KFEA 3T1HJ 4PG4A 3BQ2A 1NK0A 3FGVA 2BRKA 3RZAA 2WAQD 2MQLA 2VG7B 5LJ3Y 2XYGB 3PO4A 3VGSA 2SXLA 3M2VA 3CSKA 3NMRA 3KLGB 2YBVA 2HIYA 2Q6BA 3AB2B 3SEOA 2HEKA 4C4WA 3WHIA 1TVRA 4P74A 2W9BA 5HMXA 1SC1B 3JAMY 2P8IA 1F6TA 4NMLA 1XERA 3M9MB 2AD9A 3DM2B 1HBUB 1TMMA 2CQHA 3GILA 2LEPA 8AT1B 4K4TA 4LF5J 2HQ3A 2FLNA 2D9OA 3R6GB 3TO8A 1H7XA 2OPPB 3QJLA 3BB5A 5F3TA 4AYBD 4A8YA 2ZVSA 1RWPB 3CPWR 2Z30B 4NYOA 4KH0B 3TQEA 5D6GA 4IG0A 4NPOA 2MKIA 1FWKA 1C0UB 1S72S 5D4PA 4OQJA 2O67A 1S97A 3BYPA 3EVWA 4LSLA 1Y9OA 4IH5A 1FEHA 3EVOA 3UN2A 3DXBA 3MFHA 5KG7A 2KT3A 4FYXB 1SQEA 1K9MT 3VHQA 5DZ6A 3OLBA 2H48B 3J7YU 1S9GB 4CYUB 2FJWA 5HI7A 3P49B 3TUJC 2ZC3A 1HR0F 2HNZB 4WIQA 1SXLA 2DPIA 1IKXB 2OSRA 4JI7J 4R0JA 1FRLA 3BBBA 1RU1A 1JLGA 1DHMA 1N5TA 2RRNA 4DLEA 3H20A 5SUHA 4JI4F 2GX8A 1JLFB 1Y7PA 3O3LA 4HVZA 2ACMA 4C97A 1REGX 4UZCA 1JNRB 4DR2F 4X62J 1LV5A 1OY6A 5T41A 5HANA 3RW7A 4DL3A 4GRSA 4JI0J 3CULA 1LXNA 2POKA 4XTTA 1WI8A 4H4KC 4K4VA 3IG1B 1LW0B 1X5SA 4RWXA 3MEGB 4RL1A 5J1PA 4EZ6A 4DFJA 2YWKA 1PBUA 5HROB 2B7BB 2R2UA 2BKPA 4OX7A 3TZZA 3QIPB 3I0RB 2BXJA 1NSKL 3AAWB 4KPYA 2CQ3A 2BR0A 4NRUA 2VHGA 3CCLS 3EZOA 1NK6A 4H54A 1BXNA 1JKHB 4UUXA 3MAAA 5DGBA 1IBMJ 4TQSA 1JLBB 1D9DA 3CC7S 3C14B 1S0OA 2OTJS 3G82B 4QWDA 3KJVA 2IAJB 2IBOA 5EX0A 1FT8A 1RT4A 3W2VB 3U7JA 4G1IA 3ZZRA 3PEHA 3FQLA 2OP5A 5A0YB 3WDOA 3BO4A 1SL2A 3NMAA 3QT5A 2OEMA 1HNWJ 2VFSA 2ZHOA 3TX8A 3RUBL 3M4XA 5ADZA 1UVJA 1FESA 2N3LA 3M2RB 5D3GA 1VQPS 4B3SJ 1N6QB 1Z2ZA 2DHAA 2V9KA 1LW2A 3NL0A 3D66A 3MPWA 5C25A 5E7OB 4HI1A 5AXNA 3KFWX 1FRHA 3B78A 3KG1A 2MY7A 5E3AA 4TY9A 5GVQA 2MZRA 4OL8A 4ZP8A 1SQGA 2YKPA 4TQRA 2FB0A 1A0OB 3PR4A 5KFDA 2NYHA 1IQZA 1RT7A 1URRA 3HHLB 1T9YA 1X31C 3J81U 3C6UA 3Q23A 3MR7A 1VQKS 1VQ7S 1KOHA 2KU7A 1VYAA 3T3FA 1N32F 1OPZA 2XHCA 1O6XA 4MKYA 1WNEA 4ZPWR 2UVVA 2CQDA 4FF3A 4LF2A 1QSYA 2V2QA 1TKZA 2Q66A 1YI2S 2L9NA 1IM6A 2ZWOA 5KOXA 2HQIA 4Q43A 1HWJA 5AXLA 1FO1A 1WKKA 1RU2A 3N28A 2K7JA 2HHWA 1OWXA 2C2KB 3JYTA 1HMVB 1IBLJ 2M8DB 4HH1A 3QIDA 1RBAA 3TUIC 3M8RA 1Q1KA 2PI5A 3SYZA 2UZAA 3CD0A 5CXTA 2QLJB 2ZFHA 1AUSL 3BGRB 5EWGA 2YVSA 3TA1A 1ZPWX 4ZVPB 5LSRA 5EGYA 2WB4A 3DU6A 1VRUB 1DARA 1RAIB 1QUVA 3D0GE 2XMTA 2MXYA 4TY8B 1WUUA 3Q8SB 4QQBA 2A10A 3HVTA 3TUZC 3QRPA 3QATA 3MR6A 2W1BA 4YMEA 1L3KA 3CCSS 2ZUGA 3EGVA 4ZPTR 1WSRA 1YJ7A 4F2RA 3TANA 3JTOA 4B3RF 3LALA 2XTJP 4EFAC 2DIVA 2R8IA 3CDAA 2FJEB 2UXBF 2F4VF 1PC4A 3I87A 4BCAA 2IM1A 1KWMA 5F8HA 4OI1A 3D68A 3LP1B 2RS2A 2YNIB 4Q8FA 3KOAA 1S0NA 4XDDA 2PFFB 1LXJA 1S1TA 2AGPA 2PD1A 2DNRA 2VONA 4PZVA 4N77A 2MKKA 2XHWA 4J9LA 3A8JA 1G1XA 4XIUA 1RBLA 2VPWB 1VBXA 1NSAA 3UD4P 4L3NA 3DLGA 2NXJA 2VB6A 1FI4A 1VQLS 4OX9J 5LSOA 2N7CA 5BYSA 3AXKA 1CJKA 2MB0B 1Q8IA 4ED0A 3DLLQ 2BM0A 2LQ9A 1V3ZA 3L7OA 1FKPA 1EKRA 4YDDB 5IOLA 1S77D 4P52A 3MEDA 1UW9A 1UMJA 2XS7A 3JTPA 2CQ0A 3G8QA 5CYJA 4JI6J 4DV3J 2VFRA 4PCQA 2IFXA 2HVZA 3OSNA 3M8YA 1JQGA 5D8HB 1Z2LA 3G8SA 1MG7A 4DXLA 1HQUB 4WF9Q 4DLGA 2DR9A 3BKUA 1JXVA 2E29A 2XO7A 4YFUA 4DPXA 4F4AA 1SH3A 2JSXA 4USKA 4K4ZA 3NOGA 3RAMA 2H5IB 2GAHC 2FLOA 1AB8A 4RW4A 1VRTA 4DCPB 2DGOA 4DR1F 1XIQA 2B8PA 4U8VA 3PFEA 3GCWP 3ZTOA 1HQEA 2C3UA 4A8OA 1U1MA 4ZDNA 1HD0A 2W7PA 1IBKF 4W98A 4QJVA 4OYIA 4ZP9A 2LMIA 4ZCKA 1AFJA 3F44A 1P8GA 4LIRA 3UVJA 4JV1A 2UUCJ 5KFKA 3BQ0A 1U0SA 3PYFA 3FSXA 1K8AT 3KDOA 3PTWA 4ES2A 1HLWA 2CQBA 3M6WA 1EHWA 2BE2B 1SBRA 4IOAQ 2YWEA 2DRBA 4F0KA 4UQTA 1RTZA 1MROB 3GLJA 3EGNA 1SJFA 3CDUA 2ZE2A 2IBKA 2CAJA 2HHVA 2CADA 1YJRA 1MMNA 4W4MA 1C4CA 4ZPDA 1PAEX 1FDBA 4NLSA 2B9XA 4QW8A 1S10A 1S79A 2XS5A 4RPFA 5IQQA 1KQSR 3IRXA 2AKWB 2Z57B 1CJVB 1UVMA 4X64F 2GVDA 3EX7B 3R5BA 2PIIA 4Q7AA 4AL7A 5HQMA 2A2DA 4ECXA 4WP3A 3WIVA 5AJ3F 1S7IA 1QAYA 1HNIB 4ED8A 1G7CB 3TNVA 4F67A 3BDPA 1IKYA 2BM1A 5CAAA 2UUBJ 2XYPB 2M5YA 4KV8B 2R7OA 2OSQA 2MHNA 3UQSA 2JX2A 2DGUA 2X1AA 4F4YA 3ZTRA 1RA6A 4DG1A 1RTDA 1NDLA 2GCFA 1NZ8A 3HX9A 3V6JA 1NJXA 2QMUB 2K8GA 3Q8PB 4C11B 1GMWA 2MJUA 1CJUB 3OL9A 4MFBA 4DJBA 1E6VB 1U2FA 3M8SA 1FRIA 1TKTA 3HHEA 3K0JA 3W1YC 2FIUA 1UAWA 4CH1A 1X9MA 3PX4A 1WHXA 1HL6A 4JI1F 4NCGB 1W25A 3I96A 4B08A 2J6UA 3CD6S 2VG6A 4ZJOA 2HZVA 4L3KA 5B0CA 1RDRA 2HFSA 2YX4A 4X2BA 2AHOB 4CLYA 2OPSA 2DGWA 4RJVA 2HWTA 2CJ9A 5KG4A 2J6TA 1F2GA 3W61A 5A8RB 3FBFA 4OHZA 1U48A 4KO0B 4DR5F 3H2LA 2K3KA 3IS9B 2X3DA 1C4AA 3HXMA 5JUMA 3D6MB 3MCNA 1D0EA 5JMNA 3NNAA 3BREA 1N34J 2CZVC 2K2PA 4G1QB 3D1QA 2L3MA 4I64A 1HNVA 2J9CA 2OHDA 4ANEA 4HT7A 1KVIA 1WHVA 2E5LJ 2AJ1A 2DK2A 3V5RA 3AJ1A 3QNWB 1IN0A 5B0GA 4IR1A 5I3UA 4E98A 5CYQA 4JI2F 2YQ3A 2J76E 2HGNA 2YWWA 2YWFA 4O4GB 3TYTA 3DMJB 1ROFA 2AJ4A 3DRRB 3VTIA 3S01A 1BE4A 2KZMA 2KYXA 2HG4A 4YN3B 1R0AB 1TELA 2NXEA 2R9LA 4EWTA 4MK8A 3DGPA 4CLUA 3R2DJ 4DR6J 3BO2A 2YWGA 1RK8A 3ICLA 5KFAA 4FPIA 2ZUAA 3UR3C 1S57A 2CG8A 2HHHF 5BXIA 2CPXA 5KFVA 3GV5B 4DQSA 3D2WA 4Y34A 3TVKA 2QO3A 2HMIB 2HRUA 3CXCR 2XB2D 2RQKA 4LRAA 3C15A 3GFYA 3QFWA 3ADAC 4M5GA 3CCMS 3EZUA 1XR5A 2M8HA 4LFCJ 2G9OA 1UJ4A 2VBYA 3L7UA 1QAXA 5LXYA 2JHEA 1HWIA 3E01A 2BOAA 3OVBA 1PG5B 1RT1A 3DCAA 3MM9A 5K9FA 4Y28C 2Q43A 4RW6B 1GAOA 1IWGA 3U27A 5HLFB 3FEYB 2BJ1A 2EPIA 1UEVA 1FNOA 2D3UA 5HJXA 4A47A 2BYCA 2ZWPA 3J7AN 1VC0A 1S59A 2NUUG 1VIXA 2R7TA 3KKFA 1I3OB 3KYLA 1UTAA 2J6SA 4WPAA 3E51A 1S7HA 1T05B 1S9EB 2ALYB 3Q89A 2IC3B 4M5NA 3LW5C 3W9IA 5E3RA 5BR8F 4X65J 2HAFA 4O44B 1SUQB 2XMMA 1RT2A 2OGUA 2Y0SD 1RAHB 1VLOA 1PSDA 4PRFA 5E5NA 5G4DA 2G4BA 3MMAA 1FJGF 3NXZA 1L3VA 4ZVHA 1NHKL 2Z2MA 3TQ1A 2DNZA 3K59A 3LGHA 1R43A 2HHUA 2RKIA 1DQ8A 2RU9A 2X1GA 2XZTB 3UDVA 1VISA 3TRGA 5IWAF 5B0FA 1ZAXA 5EHHA 4USMA 3CIMA 4WTYA 5H9EJ 1FXDA 4B02A 3SZ2A 5J2NA 4FF4A 2ZHAA 2WOMA 5HL7Q 4UUWA 3OQ2A 4ILLA 1I6JA 1RT5A 3J7ZT 4CP5A 4F2SA 2EVZA 3N6MA 5JVGQ 4MAKA 2B43A 5KG5A 1RLDA 2J7KA 1PGZA 1Q79A 4P73A 4N76A 2VG5A 1GNKA 2UVRA 4TLRA 2F63A 2LQ8A 1NO8A 1TL3B 3KJFB 1E6YA 2DHSA 2YKMB 1HYSA 3I9ZA 1XMOJ 1HW8A 4P7TA 1WTBA 3MD1A 3DN9A 1S0VA 1F5AA 3MMCA 3KMSA 1S1XA 2QL5B 1C1BA 3OUYA 2PE8A 2ALZA 3HVRA 4IRDA 2BOPA 1BC6A 1RCOB 2BQ3A 3T1HF 2X51A 3DHXA 3I4HX 6FDRA 2ZD1A 2B6AB 3HSJA 2EKYA 2CPJA 4N41A 4U6PA 3KLFA 2J0QD 4CT8A 5A2QY 4ILRA 3RJMB 2DGSA 4WFNQ 5L38A 3HT3A 3ZC4A 3EE3A 4F0MA 2DR5A 1NM2A 3HULA 2AIRB 3PFOA 3GYNA 3G6ES 3R2CJ 2YH1A 2CZ4A 3ONQA 4LF5F 2G1HA 3FZ2A 5A6WA 4WK1A 1XQIA 2QA4G 1DTTA 1FDAA 4NLDA 1JLQA 1Q16B 2D1CA 2XMVA 3R5AA 2L08A 2XCPA 1B0TA 1R0BG 4HEA9 4LSNA 3H5SA 5A8WA 1KVKA 4UOHA 4DOZA 2OEKA 4RUBA 3SDEB 4X4NA 4M63A 3J7YI 2P9EA 3MECB 4Y65A 2JWNA 2MJNA 3N6NA 3QRQA 2VG7A 5DRKA 4B9VA 5CHCB 4LR7A 4OJHA 1U45A 2XWYA 3KLGA 3EJMA 1UFWA 2EEYA 2RJZA 3MPVA 3O44A 1DZ5A 4WXOA 4IH7A 4LF6J 3DOMB 4C3MA 5EDWA 3BSAA 4M5HA 4F36A 3KHRA 2E1CA 3DM2A 4JI7F 3KG4A 3KUHA 4ZVQB 5KFGA 2HHPA 1HBUA 2FJBB 2WVDA 4QR0A 3BZQA 4OJ3A 4IOCQ 1X4CA 3A8EA 2P5VA 3I6PA 2JFDA 4J9RA 2B8QA 2XSFA 3BR9A 2XMAA 4CM0A 2LFVA 1FFGB 2MQMA 2H65B 1X5TA 4FXDA 4X62F 1KBRA 1YRUA 1MWZA 4I6WA 2MY8A 4JI0F 3MXHP 1WELA 4ZPBA 3ZZUA 4IDKB 4M5DA 4HACB 2HAIA 1FK9B 1C2PA 4DV0J 2PO4A 4DR7J 1NDPA 1O5JA 1QTMA 3C16B 3CJ0A 1GH8A 5CABA 2JVOA 4X4SA 3R1HA 1S6QA 2V8DA 4GKJJ 2H51B 3EYZA 1CLFA 1S1WA 2HNZA 2PFDA 2IYGA 1TVRB 1PAUB 4CO3A 2KG1A 1WORA 5DDRC 4U7UK 1IBMF 2XLJA 4I4BA 2UU9J 3UD3P 2GMJA 2IRXA 2F40A 3D67A 3JS9A 2DH7A 3PDNA 3K17A 3GSDA 2R2SA 4K4YA 1NAQA 4USJC 3RR7A 3MHYA 1BWEA 1S12A 3LGMA 3D54A 1Q78A 4C6AA 2VC1A 3R3TA 2XM3A 4ER8A 1WWHA 1HI0P 1HNWF 4R25A 1RI7A 2HGLA 2BDPA 3UCUP 1JK9B 5KFMA 2GMHA 5DLGA 2MGZB 3IG1A 4B3SF 3RAXA 2WSCC 4EBDA 3MEGA 4BLGA 3IFEA 4K4SA 1U25A 4JYAJ 5FDLB 3EVMA 2FHJD 2DCUB 3SFGA 3V4MA 3B6BA 3DLBA 2AF6A 5HROA 3CWJA 3ELHA 3LF0A 3QIPA 3I0RA 2ASJA 2GNKA 3CCES 3FMWA 2AMCB 5LMUJ 1JB0C 1JKHA 3KK2A 2LLZA 2YKQA 2GW8A 3SBMA 1RWWB 1AROP 2GMLA 2OIHA 1JLGB 4K8RA 3G82A 3UDCA 2IAJA 3ZNJ1 2PC6A 3GIMA 2CKWA 2N4DA 2QGFB 3T1YJ 3FCHA 5T7LB 1RP5A 5IV4A 3P96A 2CPHA 2DTJA 1T3OA 1YHQS 2HGMA 1X4FA 1K47A 5HAOA 4CI0B 2ATLA 3DRPB 2MTLA 1BQMB 1IBLF 4UY85 3IM9A 5IFMA 2WW8A 1N6QA 3K58A 4ZITA 1URNA 3FC9A 4ZHRA 2DEJA 2CNKB 1HNXJ 2PSZA 3NS7B 4QWCA 2UUAJ 2EXUA 5LOQA 2RVJA 1WF2A 2GZOA 3HHLA 3CCZA 2R8HA 4DPUA 3MAAB 5IC4B 2GHVC 3R9LA 2HLUA 1Q8BA 1N0UA 1VQYA 1ZZNA 4K5SA 4C0HA 1S99A 3SIPB 3L95X 3T41A 3KJVB 2AYEA 3GJQB 3I5AA 3Q8VA 4Y0FA 1X0PA 1ZS6A 2KXNB 3BQ1A 2LCWA 2FTRA 4ED5A 1UVIA 4KE5A 5KG3A 2MKSA 3CD5A 2A2CA 1M5KC 1S9FA 4RO0A 4JI8J 4F0HA 1HMVA 1VQ9S 3OBIA 2I9SA 2VD3A 1EQMA 2KG0A 1VC6A 1LW2B 1TKXB 2OUGA 4LVOP 4ZIVA 1JJ2R 4HHJA 2L48A 2E44A 1CQNA 4RBTA 3BGRA 2IJRA 3KJNB 1XWLA 2Z0GA 3DI6B 1TK5A 1RT7B 2BANA 5KFPA 1HNZF 1UZHA 5I3QA 4OX9F 5GAHU 2XCAA 2VA3A 1T9TA 1JJHA 3LTOA 4LF4J 4C8YA 4TY8A 1LOUA 2QA2A 3GJTB 3PX0A 4B9MA 4LRCA 4CO1A 3IAM9 4BDPA 2M4MA 3ZTQA 2HVHA 2BEFA 4FNHA 2HSEB 1SIZA 4ZCMA 3NCRA 5CZXA 2RNEA 1TKZB 1OMSA 1GX5A 1KQKA 3UD5A 2LDIA 4IG3B 1EP4B 5LMNF 2AJQA 2HVIA 2BBEA 2RUSA 5CCLA 4KFBB 3C8YA 4LQ3A 2OD4A 3FQKA 3JYTB 1N5YB 3DHWC 4TU8A 2XO6A 1EZZB 2DD8S 2ZH6A 2QMXA 3KLEB 2CDQA 4DZDA 3R5CA 3RTVA 3POTB 2QC3A 2B56A 4ERDA 2YPYA 2K06A 4JI3F 4USIA 4E0DA 2FJXA 3RBDA 2ZJPQ 1MN7A 2D9PA 1KN6A 2H54B 2FJAB 1YDLA 4GVLA 3HVTB 2OJ3A 4HI2A 1TUGB 1PIEA 2C1EB 2K3IA 2C2MB 5AXKA 2MKCA 3H5UA 4ECVA 1R8BA 1RYSA 2FZCB 4WP8A 1R89A 1WOSA 1W26A 1REVB 3A3OB 2MQOA 1U09A 2XC9A 1RHMB 2VBWA 4PXBA 2BA9A 1FWPA 1T9VA 2BQUA 1FX4A 3CTRA 1H2TZ 1HD1A 2G2OA 4DL4A 1HQUA 2KH9A 1P9YA 3G2XA 4FVCA 3JXOA 3RB3A 2FC8A 5E41A 5E2QA 3DLGB 4Q2MA 5C42B 4PQUB 2C2RA 1D8ZA 2BJDA 1OO0B 4J37A 3BSCA 4OZNA 4PQAA 3M8ZA 3KK1A 3VAHA 1KLNA 3WX4A 1CJKB 4BS2A 3HVWA 4JB8B 3PZPA 3NBPB 5EWEA 1FKPB 2FQQB 3CEDA 1R31A 4M95A 2YQ0A 1VMBA 3UDEA 4DS4A 4N8OA 3MEDB 1RHQB 4K4UA 1RCXB 2LQJA 5IZHA 1H0HB 4RW7B 3O5TB 3W5XA 2ABYA 3JSRA 4D3GA 3DDNA 5FJ4A 3V6DB 5KFJA 3MM7A 1IR2A 4TU7A 2VV5A 1RAAB 4TYBA 2UUBF 1ZAWA 3W64A 3I55S 4CLFA 2E7XA 2UV8G 2CQPA 3UCGA 1UZDA 1XR7A 2WCXA 1SJRA 3DOKB 4NLGA 3BJYA 3LAKA 1NUEA 2N82B 1WSVA 2V8VA 5GMEA 4HYKA 3BPDA 1YZ6A 3VCDA 3N9UC 1QE1A 1D1UA 4LR9A 3CF5Q 2CPEA 1FE4A 1Z4UA 3NNHA 1X4GA 2F1FA 4M5LA 1J27A 1QAIA 3AODA 1I51B 1CJVA 1HQEB 3CC4S 1UJ5A 1GMVA 3R7BB 4ZA1A 1NXIA 1XN9A 2AU0A 2CJBA 2QFIA 2XNRA 1TL7B 3CJ8A 4ECUA 2V68A 1XMQF 4OYOA 3UDLA 4P72A 4LUBA 3NLCA 1EQ0A 1X9SA 3JQKA 1PC5A 7AT1B 1HBMB 3UVJB 2ILYA 1VBKA 1APSA 1H73A 4OYBA 4LFBJ 5C2GA 1S6OA 4YY3J 4KV8A 1F9FA 3HLUA 1WHYA 4NEZA 3H42A 4WFBQ 4YHHJ 3G8TA 3ZZZA 1KHWA 5KTQA 4B9SA 2B3TB 3DOLA 2FVCA 3PRVA 4QYZJ 2QX0A 1WKLA 4H4MA 4C11A 1PBAA 1N34F 2ZKUA 4AT1B 1EJ7L 2FVSA 2PA3A 2JOQA 3IRXB 2E5LF 1WC5A 2GVDB 3JSYA 1F9EB 1Z1ZA 3H5YA 1OY8A 5K20B 2HNDB 1U47A 2H3EB 2W9CB 3NRBA 2O3DA 2VQEJ 3IR7B 4NCGA 4RNOA 3G6XA 8ATCB 4ECYA 3KLIB 5ETPA 2HS0A 1SKSA 3N6LA 3MUTP 4KC5A 5J2MB 2DO0A 2AZ1A 3BH7B 1AYEA 3TA2A 2JL9A 3TP2A 3MMJA 4DR6F 2I5JA 1RTDB 2PEHA 1Y11A 3IO1A 4KO0A 1S0MA 4USVA 2M70A 2ZKTA 4F4ZA 1VFJA 1ZA2B 4Q2LA 4OFZA 1P1LA 4L75A 3MR5A 1T9UA 1RZMA 2KM8B 4MFBB 1YBTA 2MQNA 1BQNA 4G1QA 4RUCA 3Q24A 2D7SA 3LOUA 2KO1A 2VPZB 5RUBA 2WVCA 2KHDA 1W2IA 3FFIB 1TKTB 2Y8WA 2MLZA 5KFQA 1FTCA 2M7SA 3R7NB 2LEAA 3KNGA 2IVFB 2W2QP 4N7TA 2XS2A 4DBQA 4Q44A 5CQGA 4NX9A 3QO9A 4DUZF 3AB4B 6FD1A 4JBCA 2V63A 1YGYA 3THTA 3DRRA 4MH8A 1TTHB 2J8AA 2OPSB 3AA9A 4DPYA 3I82A 1R0AA 2P2CB 3HFZB 1J5EJ 2DH8A 4ZK7M 1IKVB 4RZRA 1IM4A 4EO8A 2C3PA 4X66J 4ZKAA 5JVHQ 4NA1A 1WG4A 4I56A 4X65F 2BUNA 1HHQA 2DPJA 1HNVB 1FFSB 2WW4A 4EYHB 3O1LA 1N88A 2C2OB 2D3OR 3DRXA 1RJJA 5I3UB 5JXSA 3FBBA 3PEJA 5CYQB 4EUVA 2GO8A 4DSKA 1S49A 3NGKA 2HKEA 4F3QA 3PW4A 3RW6A 1TU0B 2QSWA 3BBFA 4RW6A 3EDRB 3GU0A 2HNYB 3CJRA 1RT6B 4PWUA 4B17A 1EB0A 2DNLA 2ATCB 3PRBA 1JLEB 3VGTA 1NSPA 1YJWS 1NZAA 1N4LA 4DUYJ 1ITPA 2RS8A 1T05A 1S9EA 4ES3A 4GO5X 2RDDA 4NCAA 3KHGA 4N8NA 2KJWA 4O44A 5KFRA 4AUKA 5KOWA 2GHWA 2VC0A 4C8KA 3D9BA 1U8WA 5KT2A 3G6YA 1V3SA 3GIJA 3LAMA 3RBZA 1DFDA 2RIJA 3CO9A 3VR1A 2BE9B 1RABB 3NEKA 5KFWA 1OS5A 3DLHA 1XMOF 1Y3JA 4OYZA 3C3LA 3QSIA 2EBGA 2HHXA 1VQOS 4B3TJ 3M7VA 2JNJA 3KUGA 4LREA 4Y2MA 2P9GA 3T9NA 3I5BA 4EGLA 3FMBA 5HSPA 2VF3A 3CT9A 4NLWA 1RAJA 3IP0A 1ZYQA 3P5TL 5H1SV 1P27B 2RMLA 1QAJA 4F3OA 1B64A 4ID5B 1TFYA 3AJ2A 4CCHA 5M2UA 4KGKA 1GQEA 3MI7X 3MM5B 3TEHB 5IM0B 1T11A 3OT9A 2EW9A 4BBYA 1CVJA 1KP6A 2R7UA 1TL3A 4LF7J 1X60A 4ILMA 3ENAA 3J80Y 1NB2A 1RBOB 2ROEA 2YKNA 2NUHA 1U1PA 4OI6A 3M8WA 1N8RT 2CVEA 4X4TA 1KFDA 2QIFA 5K8MA 2R3VA 1UCNA 3GZ7A 3CNQP 2Y1JA 4X4UA 5H9FK 3ZZYA 5F8GA 1U24A 5AXMA 5C7PA 2V6AA 2IDEA 1L5UA 4RNHA 1PO6A 3PIOQ 1VK3A 3C66A 3N5FA 2WOMB 1UFLA 5F0WA 1AZSB 3H59A 2MSTA 1RT5B 5L1KA 2ZH3A 2ZBQA 1OYDA 3GWCA 3UN5A 5LL6d 1U1LA 2J5AA 4XDCA 1WJ9A 2V4JB 3ISZA 1GXLA 4O3RA 2FHMA 3PW5A 4ZOSA 3LPYA 2Q79A 3O6QA 4CO0A 4LF6F 4U7CA 2HFUA 3EM1A 3OSPA 3TJAA 4LRDA 3T5JA 1E6YB 4QR2A 4USTA 4E2FB 3VGVA 1HQ2A 3UNGC 3BPSP 5KT6A 4K59A 2JRSA 2A18A 3MMCB 4DV2J 2G2YA 4BC9A 1S1XB 1C1BB 1Q8LA 3Q83A 3CCWA 4NLXA 4YQWA 1RKJA 3ZZOA 2XY6A 4ZPAA 3T6BA 1T9XA 4WCEQ 1PYOB 1Y4ZB 3BKTA 3SDEA 4ZCIA 4DR7F 3CW2C 1RHKB 1YWXA 4NYZA 3SSRA 5L8RC 3KLFB 2KN4A 3RB0A 3D3BJ 3QRRA 4GKJF 3HT0A 2XLIA 4O3NA 3QFHA 1W2BR 2KT2A 2QA1A 1KSPA 4XO0A 3DFEA 3RBEA 3CDEA 2QLBB 2MSSA 2HURA 2UU9F 4I67A 4PYAA 4PG5A 3SQOP 2HVEA 2QN6B 2F8MA 3O2IA 1ZTTA 2W24A 1WOPA 4TN2A 3CCQS 3TAQA 4RNMA 4DU7A 4N5SA 2B4OA 3HJVA 1DTTB 4IQMA 1I1GA 3R1LA 3NGTA 3SXLA 2QV6A 2ZBIA 1IR1A 2D41A 2W4CA 1JJ4A 5DG9A 2YNHB 4NRTA 5ETOA 4KY3A 2VOPA 2E1MC 4CQ1A 2NQPA 4ZLNA 3GR0A 2RD5C 1PYSB 4QWBA 2FVQA 3WIUA 3C16A 3VAFA 1SV5A 4Q8EA 4RKUC 1GT8A 1H74A 5ETNA 4QIWD 4I0WA 2H5JB 3Q2TC 2JLEA 5LMUF 4CLKA 5A6PA 3DRSB 1NPPA 3CIZA 2ZDOA 3BN4A 2V69A 2KI2A 2WK4A 3EPGA 1EIYB 4ZLPA 2OMOA 2CWKA 4HR2A 2DNQA 3TVZA 1F60B 2HW3A 3T1YF 4C8LA 1KTVA 1F9HA 4OJ1A 2K7KA 2Q6CA 2F9DA 2BJ3A 2OI2A 2BW2A 1U1QA 3LWMA 2ZJRQ 3MEEB 1KVJA 1OQ3A 2ROGA 3CE8A 4NMXA 1K1QA 2W8KA 4F4XA 4ECZA 4NLVA 4M5DB 2MGZA 2JEGA 1N48A 2UP1A 2BVZA 2E7WA 4Z2XA 2B9YA 3M2UA 5FDLA 3ISND 1KTQA 5D78A 8RUCA 3S8SA 5I42A 1S6QB 1HNXF 3T5LA 5DM6Q 2UUAF 1EX8A 2W7AA 2RB7A 2WB1D 1NHUA 1S1WB 3HJFA 1KLMA 4CIOA 1NK4A 5KFHA 1VJWA 3W62A 1RWVB 1D9AA 2OH2A 4YUDA 1UPPA 5HMZA 4PKDB 1MU2B 2CPZA 4UY8T 2VFVA 2VJVA 1VLYA 1GK8A 1FERA 2GFFA 2A6OA 2JLFA 3OTCA 5DQIA 2JC1A 3WC0A 2QZ8A 1LWFA 5T7LA 1OYEA 2ADCA 3VGUA 2Z2LA 3K2YA 2DR7A 4AXJA 2ZDPA 3HK2A 2AW0A 5CCMA 1OY9A 2DGTA 1Q5YA 3KLHA 2IIHA 2R42A 3DRPA 4OZ0A 1S6PB 1SJ3P 1BQMA 4JI8F 3EGWB 3EPIA 1H3DA 4DS5A 5HVHA 1GMUA 2CIMA 2Z2YB 4GMKA 3GIKA 5FLXY 2B0GA 3K8WA 3RG6A 4F7VA 4LJMA 2H5EA 4Q0BB 1K44A 2EC2A 4ED6A 1CS4B 4ZJQA 5F9NA 4FYYB 4AQYJ 2EC0A 3KK2B 1U8SA 3ITHA 4LF4F 2EI5A 5DGAA 2IVYA 1TV6A 2LYVA 5F8JA 1QVGR 1QVFR 3J80U 3PW0A 3PO5A 2NXNA 2E5JA 7FDRA 3HSDA 3K8VA 3M6UA 1I5OB 1VBYA 3I9V9 2JVRA 3TZXA 2XY5A 3WQPA 4K4WA 2EFQA 2CNLB 4DV1J 3NS6A 3BM7A 3M05A 5FIIA 1ACMB 5ETMA 2M52A 3BGOP 2ZH7A 2GGPB 1TKXA 4Y2AA 5KFTA 2J8SA 3ETOA 3DLEA 5C5JA 4EZ9A 3PHEA 2F4VJ 4ZHRB 2JZ5A 4HDHA 1YLXA 3DI6A 2L9WA 1N0VC 1DQAA 3N4WA 4ZLLA 3OV7A 4J9PA 3G4SS 2YQ1A 4JOUA 3LWLA 4ELTA 3MWBA 3LQVA 2QEXS 5KFYA 3ZZPA 3NKYA 3Q8YA 2XI2A 2KHCA 4DL0C 5LJ5Y 1VBZA 1CJTB 5D4NA 2EFGA 2V0NA 4FKXA 4IQXA 4IG3A 1EP4A 3T5HA 4CLSA 2ZHBA 1N52B 1UPMB 2K1RA 1VGYA 3NCQA 2KRRA 4KFBA 2WSEC 1N5YA 1FX2A 3BBCA 5GMDA 3TZYA 3KLEA 4DX6A 1YVFA 1PKUA 1DRZA 1K1SA 3POTA 4DR3J 4ZVOB 4CNYA 3IAS9 4KB7A 4K2JA 1SH0A 4G6VB 2BANB 4R0EA 2JEFA 3DKDA 2HHQA 5MAOA 3AT1B 4NXNJ 1Q0NA 5HN0A 1T8EA 1DQ9A 3NGUA 2WBRA 4OYAA 3OFFA 1B7YB 2VBXA 2E66A 1BMQB 2XGQA 4NA3A 1TP7A 3RRHA 1REVA 2LVWA 1OPIA 2U2FA 1R8HA 2H4YB 2DKOB 3N0VA 2J7UA 2YKOA 1O0PA 2DHGA 3H7HB 4HT5A 1FD8A 2HBZB 2N4CA 4R8UB 4NYPA 1IBKJ 1GFWB 1GXUA 1K0VA 3W65A 5J2PA 2PMZD 1Y10A 1C0TB 3L7PA 3F56A 1H7WA 2KFZA 3TWZA 5KFSA 1DAXA 2WONB 5C42A 4PQUA 5AE1A 4L6V3 4X4QA 3I5CA 2RAQA 4Z7YA 2XMKA 3K5MA 2COLA 3CVKA 2DYAA 3R5GA 1VC5A 3I56S 2FC9A 3F41A 3O8WA 1J5OB 2H9ZA 2KL8A 3K5PA 2V4QA 3CMQA 1L3SA 2C2ZB 4ANDA 3JAMU 3PW7A 4WYLA 3NBPA 3P3DA 5E33A 1D3WA 2PA8D 1DLOA 3E3XA 2KDOA 1NKCA 1NMEB 4KJIA 3GCXP 2CA9A 4QR1A 4RW7A 3R97A 4ECRA 2UVWA 4DX7A 1FVSA 3V6DA 4BWJA 1CULB 3D6TB 4DPTA 2Y9HA 1ZM3A 4LFBF 4DL6A 3BDEA 4YY3F 4WU3A 3VQSA 2CPFA 2OTLS 1R3NA 1KOOA 3EZ5A 1WC0A 2ZH9A 4YHHF 3BR8A 3DOKA 5FD1A 1M5VC 2PGCA 4K2XA 2VPYB 1NK9A 2IHR1 4PWDA 4OI2A 4HL9A 4Y2KA 3SI8A 3KK1B 1AT1B 1CC7A 4LF1A 4HLBA 4F8RA 1WD6A 3QWUA 4IH6A 4U67Q 1ZM4A 5AT1B 3EXCX 2Z56B 1FJCA 2V2KA 4TKTA 4FZVA 2EWHA 1UETA 1RSCA 1M5HA 1NDKA 4B9TA 1OIAA 4ED4A 1TL7A 3GYXB 3MF5A 3MPUB 1H2VZ 1H72C 1ZZFA 3NGRA 2GVZB 1DTQA 2XNQA 3HKWA 1HBMA 3OTDA 1AA1B 3MM7B 5AE3A 4ENOA 1RAEB 2NYIA 2B9EA 4HTIA 2JLGA 5MLCV 2YWHA 1WOOA 4QCLA 5KG0A 1Y5IB 1LEOA 1NU4A 2YNFA 3VV2B 2OAUA 1B7FA 2Y8YA 2OO4A 5HBMB 3G96A 2ASDA 4ZVUB 1X0FA 2IJNA 1GX6A 1QE1B 1U0HB 2WHOA 1PYTA 4AXIA 2C2DA 2E9RX 4YR3A 5IV3A 4DX5A 2CNNB 3RU0A 3HI9A 1G4CA 1TQLA 4P6QA 4IRCA 2HNDA 2NXUA 2DNNA 2MEWA 2W9CA 3BKFA 1ZH5A 2EFVA 2CYYA 4M5JA 4U7UD 1JIHA 3FSIA 4MKBA 3KLIA 2YPZA 3FRYA 2CZ9A 2RHSB 3QT7A 4WFZA 3OJSA 2AZ3A 4EMDA 3W60A 5DM7Q 3AFGA 4NI2A 5J2MA 4NL5A 1TFWA 1QDUB 4CNZA 4OIXA 4USWA 3M9OB 2JC0A 2RRAA 5H9FJ 1NK8A 2R2TA 1MWQA 3AQPA 2HBYB 2BJEA 4RR5A 3DOLB 3M8PA 2C22A
chains in the Genus database with same CATH topology
1JLBB 2V94A 1D9DA 1NK5A 5K8OA 2VBWA 4PXBA 4X66F 3CC7S 1ULRA 4O3QA 2HS3A 4H4MB 3M32B 3MMBB 2BA9A 2BQUA 3CTRA 1S0OA 2OTJS 5B0AA 1JX4A 1H2TZ 4QWDA 2W4DA 2V8GA 3KJVA 3U02A 1HD1A 1FVQA 1P1TA 2IAJB 5J1EB 2ZH2A 4DL4A 1HQUA 2IBOA 2KH9A 4LF8F 5EX0A 3FSYA 3CUNA 2PI4A 3FFIA 4DHVA 1FT8A 2MKJA 1RT4A 4FVCA 3W2VB 3GFZA 3U7JA 4G1IA 4DQPA 3V2UC 2GV1A 3ZZRA 3RB3A 3PEHA 1MWYA 3FQLA 4FS2A 2FC8A 2OP5A 1IKWB 5A0YB 5E41A 3WDOA 5E2QA 1NH7A 3BO4A 4F4WA 1SL2A 3DLGB 1N5QA 3NMAA 4GKKF 4Q2MA 5C42B 1X5OA 5EUHA 4PQUB 2C2RA 1M5OC 2I8EA 2DB1A 2O5DA 1D8ZA 3H8YA 3M1VB 1YG0A 2BJDA 1OO0B 4J37A 3BSCA 4OZNA 2X1BA 3DLKA 2VFSA 4PQAA 1UWBB 2ZHOA 3TX8A 3ZFVA 2M2BA 4QYRA 3PIPQ 3M4XA 5ADZA 4MJKA 3VAHA 4OX8A 3KK1A 1UVJA 1KLNA 1FESA 3CCVS 2N3LA 3M2RB 5D3GA 1VQPS 4J9SA 4WKRA 1XEZA 2OPPA 3WX4A 2XLKA 1N6QB 1Z2ZA 2DHAA 2V9KA 1LW2A 4BS2A 3HVWA 3QJJA 3NL0A 2CPYA 1RA7A 3MPWA 5E7OB 4HI1A 5C25A 5AXNA 4YB7A 4DQQA 3KFWX 1FRHA 2UUWA 3B78A 3QGPA 3KNAA 3PZPA 4XPCA 3KG1A 2MY7A 3NBPB 5DG8A 1VIOA 5E3AA 5EWEA 4TY9A 4C0BA 1FKPB 5GVQA 2MZRA 2LKZA 4OL8A 4ZP8A 2YKPA 4RNFA 1M0SA 3CEDA 3I4PA 4TQRA 1R31A 1BLUA 4RUHA 1JNZB 3AA8A 4M95A 1VMBA 2FB0A 2QRRA 3PR4A 5KFDA 1UA0A 1SIWB 4DS4A 1IQZA 1RT7A 5L1LA 2I5JB 4N8OA 3MEDB 4K5RA 1C0UA 1VQ4S 4K4UA 1WTFA 3VAGA 4ICLA 1O51A 1URRA 2LQJA 4OZLA 3HHLB 1IKVA 5IZHA 1H0HB 4RW7B 3O5TB 3Q8QB 1RWUA 2ABYA 2E1RA 3JSRA 1A7GE 4CT9A 3QGGA 4D3GA 3DDNA 3BO3A 1SJ4P 3SV3A 4C9DA 3C6UA 3Q23A 5FJ4A 4F25A 2G1DA 3V6DB 1R7IA 2MZJA 5KFJA 5KT3A 1VQKS 2CPDA 3MM8B 3MM7A 4DUYF 4TU7A 1VQ7S 3QPIA 1KOHA 5LT5A 1N56A 2VV5A 4TYBA 2KU7A 2EFPA 4G3IA 3HDSA 3T3FA 1N32F 1OPZA 2UUBF 4WYWA 1FRKA 1UA1A 4MKYA 4RW8A 4ZPWR 1WNEA 1ZAWA 2UVVA 1BQNB 2CQDA 3OVAA 1QJHA 3I55S 4FF3A 2DNGA 1NH8A 1QSYA 2CQ4A 2MZ1A 2E7XA 1S9GA 3M2VB 2UV8G 5DJBA 2CQPA 3JSBA 3UCGA 1XR7A 1X7VA 3ZZTA 1TKZA 1SL1A 2Q66A 1YI2S 2WCXA 2WSFC 4I69A 1SJRA 4RU9A 2L9NA 3DOKB 4IRKA 1VQ6S 2RDIA 4DL5A 5KOXA 4V19X 4NLGA 3BJYA 2QA4S 2HQIA 3SQGB 4Q43A 4PPDA 4WFYA 3LAKA 1HWJA 5AXLA 2W9BB 3IBWA 4DEZA 4RLEA 4F50A 3RRGA 1ZM2A 2N82B 1UVNA 1FO1A 3M9NB 3N28A 2KZZA 1IKXA 2V8VA 4HYKA 2K7JA 2HHWA 3VZIA 1OWXA 4RUAA 4ZMMA 1M1KT 3M6XA 3VCDA 2D74B 3N9UC 3JYTA 1HMVB 1QE1A 4OJGA 1D1UA 3QO9B 2M8DB 3M30A 4E8UA 4HH1A 3QIDA 3KK3A 2L9DA 3CF5Q 2CPEA 4CH7A 2QFJA 3G86A 3TUIC 3M8RA 1FE4A 2FPHX 4TXSA 1Q1KA 3SSSA 2DITA 1KQFB 1J2VA 1Z4UA 2PI5A 1Q82T 3NNHA 1X4GA 2F1FA 3SYZA 1JLFA 3UR0A 2UZAA 3AY0A 5F9LA 3CD0A 4OV1A 5IT9Y 1QAIA 5CXTA 1X4DA 3MM6B 4B3TF 1HQEB 2ZFHA 4R5PA 1TAQA 3BGRB 3CC4S 2HNYA 4I6AA 3H40A 1UJ5A 4IG0B 4ZA1A 5EWGA 2M88A 3Q0AA 1RT6A 3OL7A 1XN9A 2AU0A 2YVSA 3TA1A 1ZPWX 2CJBA 5LSRA 5EGYA 1U49A 1JLAA 2WB4A 3DU6A 2LEBA 1VRUB 1FCAA 2R8KA 2XNRA 4ECUA 3DNCA 5B7WA 1XMQF 3L3CA 3UDLA 1DARA 5JJBA 1CQMA 5F8IA 4LUBA 2B4PA 1QUVA 2C3YA 2RQ4A 3LH2S 3VQTA 3D0GE 1JLEA 3NLCA 2XMTA 2MXYA 1X9SA 1LW0A 4LSLB 1PC5A 2WBMA 1HBMB 1TL5A 2VUGA 1FJEB 1F0XA 4TY8B 3Q8SB 4QQBA 2ILYA 4ED2A 2A10A 5D4OA 2CQGA 1APSA 1C1CA 3CGIA 3HVTA 4H4OA 2LXFA 4DX8H 3TUZC 2VFUA 1S6OA 3MR6A 4QWEA 2DNYA 4YMEA 1L3KA 4KV8A 1HFEL 3HHLD 4C8OA 1B0PA 1F9FA 3CCSS 3HLUA 4OZJA 1WHYA 2R7XA 2ZUGA 4ZPTR 5F0UA 4WFBQ 5GADU 3BF4A 4F2RA 2HZCA 1JMTA 2MPUA 2YY3A 3JTOA 3TANA 3QJPA 3LALA 1QUPA 3G8TA 4B3RF 4URSA 3PRDA 3ZZZA 4EFAC 5C24B 2LU1A 1VQNS 2DIVA 4D3HA 4KRWA 1KHWA 5KTQA 2R8IA 3CDAA 2EFOA 1SI9A 2FJEB 2IRUA 2GC8A 4MIBA 2UXBF 4B9SA 2F4VF 1PC4A 2E5HA 3CCTA 3I87A 4ZPVR 3MEKA 2B3TB 4BCAA 2IM1A 4YOEA 4CTAA 3DOLA 2FVCA 4DPOA 5F8HA 4B9NA 1JLBA 1F5CA 1FDNA 5IT0A 4QYZJ 1MW7A 3TA0A 1N33F 4OI1A 2VQFF 3CJ3A 2RE1A 2HWHA 4H4MA 3MMBA 4C3LA 4C11A 2ZC4A 5FLXY 1N34F 2ZKUA 3LP1B 2RS2A 2YNIB 3BGFA 4Q8FA 3KOAA 1P9QC 1S0NA 5J1EA 4XDDA 4FPRA 1LXJA 1S1TA 4Y2IA 2PFFB 2AGPA 2KT5A 2PD1A 2FVSA 2ZJQQ 2DNRA 2VONA 2FVRA 4DV0F 5DS7A 2PA3A 3W2VA 4N77A 2MKKA 2XHWA 2JOQA 4J9LA 4M8LA 1G1XA 3IRXB 1AUDA 2E5LF 3JSYA 4XIUA 2VPWB 1VBXA 2DGQA 5A0YA 1U6ZA 2B51A 1Z1ZA 4Y00A 4L3NA 4I7FA 3VAKA 3DLGA 3H5YA 3UD4P 3H4DA 3MR2A 2HNDB 1U47A 4ATNA 3E2EA 2W9CB 2IA6A 2VB6A 3NRBA 1GXTA 2FY1A 2ZM6F 2O3DA 3HKZD 1VQLS 2OPQA 4DQIA 1NNDA 3IR7B 4NCGA 4RNOA 3G6XA 5LSOA 2DGVA 4F3MA 2N7CA 5BYSA 5LXRA 2CJKA 4ECYA 3M2RA 1RT3B 3KLIB 1T94A 2MB0B 3AH6A 2KXHA 1KONA 4NLQA 2HS0A 1Q8IA 4IFYA 4ED0A 4DFKA 1VQSA 4MK9A 1SKSA 1UKUA 4YB1P 4ID5A 3B8HA 3DLLQ 2BM0A 1VQ8S 2W8LA 3CJKA 1FE0A 3N6LA 4KC5A 2LQ9A 3MUTP 1V3ZA 3CB4A 3L7OA 1FKPA 2DO0A 4IOBA 5J2MB 2HYIB 4X4VA 2OPRB 4A8QA 4HTJA 4YDDB 2HIQA 3TA2A 2JL9A 3TP2A 4O3SA 1V9OA 1FRMA 4DV4F 1S77D 4PG6A 3MMJA 5KT4A 4I68A 4DR6F 2I5JA 3MEDA 3GG0A 4A46A 5IXUA 3MM5A 4W90B 1UMJA 4WIIA 4RWWA 1RTDB 2XS7A 5IM0A 3W2WA 2PEHA 3JTPA 2CQ0A 4OHWA 3G8QA 3IO1A 4KO0A 4ETZA 5CYJA 1S0MA 1L3TA 2M70A 3SCIE 1JXLA 2ZKTA 4F4ZA 3TAPA 2M0GB 1VFJA 4DSIA 3LGNA 4UQGA 2CQ1A 2VFRA 4PCQA 4OFZA 4Q2LA 1P1LA 2IFXA 3UE2A 2XGPA 2HVZA 2XSJA 3IGVA 3MR5A 5GAEI 3SCKE 3OSNA 2KM8B 5D8HB 4MFBB 4RNNA 1Z2LA 2LQBA 2MQNA 4PXDA 1BQNA 4G1QA 3G8SA 4ZVEA 4RUCA 3Q24A 1RQ0A 2ZH1A 4OI4A 2QMWA 1HQUB 2D7SA 4RBVA 4WF9Q 4ES1A 3LOUA 2KO1A 2VPZB 2KHDA 4J9KA 4FBTA 1W2IA 4A8FA 3FFIB 4WFXA 1TKTB 4DLGA 1RT4B 2DR9A 2E29A 4ZVFA 4WK3A 1SC6A 3Q8RB 5KFZA 3IA0A 2XO7A 4JYAF 4YFUA 3QMQA 2I38A 2LXUA 1RTIA 3PV8A 5KFQA 1SJQA 4DV2F 1FTCA 2M7SA 3SCLE 2LEAA 3N79A 5M2RA 2GO9A 1SH3A 3KNGA 2JSXA 2R7RA 3C6TB 2IVFB 3CDBA 4K4ZA 2DNMA 5D77A 3RAMA 1IJEB 1AFIA 1P6TA 3CMES 2XS2A 3LO3A 2FLOA 2XMWA 1H6KX 4ZS6A 4DBQA 3OVSA 4Q44A 2RU3A 5CQGA 2B9WA 3TW0A 4NX9A 3QO9A 5F41A 3H98A 4DUZF 5D3GB 3AB4B 6FD1A 3LUYA 4RW4A 5KFOA 2I0XA 1VRTA 4FNIA 2DRAA 3IWXA 4IYQA 4JBCA 4AE5A 3RB6A 1YGYA 2DGOA 5C25B 1KRPA 3VAJA 2FHOB 5L9XA 3THTA 4DR1F 3CCUS 3DRRA 4MH8A 4ALZA 4X4RA 2BV3A 2J8AA 2OPSB 2F9JA 3AA9A 3PFEA 3MM6A 1HQEA 4QIFA 3I82A 1M90T 2C3UA 3GB0A 4A8OA 1R0AA 1U1MA 4ZDNA 5CYMB 1HD0A 2OFHX 2W7PA 1IBKF 3H4BA 4QJVA 3S1TA 1HPZA 3NG8A 1R8PA 2HHSA 1XK8A 3QZ8A 1VRUA 2DH8A 1OQ6A 2V4JA 4ICLB 4ZP9A 4ZK7M 4RU2A 1IKVB 2GQ2A 4QZVB 2LMIA 4QIEA 4ZCKA 1AFJA 2PDAA 2ZBCA 3F44A 4RZRA 4DL2A 4M94A 3C6UB 1IM4A 1P8GA 4LIRA 3X3UA 4EO8A 2C3PA 4JV1A 3PJWA 5KFKA 3BQ0A 1TZ0A 4ZKAA 5JVHQ 4NA1A 1WG4A 3FSXA 4OHVA 2YKNB 1ZM9A 1K8AT 1T7PA 4RW8B 4I56A 4X65F 2NSBA 2BUNA 2JJ4D 4ES2A 2W9AA 2CQBA 2DPJA 1HNVB 3M6WA 3PVXA 4JV2A 2BE2B 3F73A 3NP5A 4EYHB 2AQ4A 2CG4A 3O1LA 1SBRA 2CPIA 4IOAQ 1DJ0A 2YWEA 1N88A 5C24A 2DRBA 4WFAQ 3CJ5A 4UQTA 2DT9A 4QIGA 3FZBA 1MROB 2PT0A 4JV0A 5KFXA 3EGNA 1SJFA 2D3OR 1DBDA 3VAIA 5DO2A 1BD6A 4O4RA 4BWMA 1LK5A 1HBOA 3FRZA 3PACA 2ADBA 3CDUA 2ZE2A 2DCLA 2IBKA 5EN1A 3DRXA 2HHVA 4IR9A 1RJJA 1YJRA 5I3UB 1MMNA 5JXSA 3PEJA 1UJ6A 3QWPA 1C4CA 4WJBA 5CYQB 5KFNA 4EUVA 4ZPDA 2YNGB 1FDBA 2QYCA 3LP1A 4NLSA 2GO8A 2YNIA 4Q45A 2B9XA 4DSKA 1FDDA 4QW8A 1S49A 1NK7A 1UP1A 4MTPA 3KK3B 3NGKA 1S10A 3PW4A 4F3QA 4DMZA 3RW6A 2QSWA 1S79A 4QPTA 2XS5A 1Q4RA 5IQQA 4KKOB 4RW6A 3G9CA 5BYQA 1KQSR 3IRXA 1UVMA 4X64F 5E3QA 3KLVA 2G13A 3EX7B 3R5BA 3S7RA 2HNYB 1NKEA 2ZH5A 2PIIA 4Q7AA 3MUVP 4AL7A 2A2DA 1RT6B 3HF5A 3M8QA 4PWUA 4B17A 1U1RA 4ECXA 2DNLA 1SL0A 5AJ3F 2FJDB 1FEEA 3TR5A 1QAYA 1ZOTA 1HNIB 4H4KA 5CH7B 1MNEA 3PRBA 3HMJG 1JLEB 3D1HA 4ED8A 1SKWA 1G7CB 1L3UA 3TNVA 1YJWS 4EBCA 1NZAA 2OKQA 1N4LA 1RT3A 5BYRA 4F67A 3BDPA 4FBUA 1IKYA 2RS8A 2Z4PA 1T05A 1S9EA 4ES3A 1C1CB 2BM1A 4GO5X 1NKBA 4NCAA 4NZ7A 1FRJA 5M2PA 3KHGA 2IM0A 2VA2A 1LFWA 3L09A 1QY7A 4N8NA 2M5YA 2CJAA 4B9UA 4KV8B 2KJWA 2R7OA 2OSQA 4O44A 1FXRA 2MHNA 3UQSA 2ACYA 4WKYA 2JX2A 5KFRA 4QOTA 1WF0A 3KHLA 2DNPA 2J7WA 2DGUA 4MMOA 2HFOA 2X1AA 4F4YA 1RA6A 2APOA 4AUKA 4DG1A 1M5SA 5B09A 1HWUA 5KOWA 1RTDA 2GCFA 2GHWA 3GQCA 3QGIA 2QLXA 2VC0A 4C8KA 2MHEA 5KT2A 2ASLA 3R27A 4OZ1A 2LDYA 4CTAB 3HX9A 5GAHI 3G6YA 1V3SA 2R7QA 4NLTA 4DV5F 3V6JA 3SFUA 3GIJA 2FGOA