1PILA

Structure of the escherichia coli signal transducing protein pii
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
112
structure length
112
Chain Sequence
MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFGRQKGHTELYRGAEYMVDFLPKVKIEIVVPDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRIRTGEEDDAAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Escherichia coli signal transducing protein PII.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Nitrogen regulatory protein
molecule keywords SIGNAL TRANSDUCING PROTEIN P2
total genus 22
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 1994-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1pilA00
1VHFA 1QY7A 2Z0GA 3AHPA 4CO4A 3N5BA 2J9DA 1J2VA 1O51A 5D4PA 3MHYA 2PIIA 4CNZA 1O5JA 1NAQA 1VFJA 1V3RA 2VD3A 3LF0A 3AA9A 3TA2A 5D4NA 4D3GA 2J9DE 2GNKA 2XG8A 4RWXA 1H3DA 1GNKA 4USIA 1KR4A 4NYPA 2ZOMA 3AA8A 2O67A 4CNYA 4C3KA 3GSDA 1UL3A 3O5TB 1UFLA 4D3HA 1HWUA 2O66A 2XULA 3AH6A 3O8WA 3HLUA 1V9OA 1OSCA 2NUHA 3X3UA 3M05A 2V5HG 1UKUA 4C3LA 1V3SA 1P1LA 1PILA 4CO2A 4RX6A 1V6HA 4AFFA 4RWWA 2RD5C 3BZQA 4Y6IA 5DRKA 4YB5A 2J9CA 4Y65A 2NS1B 5DS7A 4OZNA 3TA1A 4USHA 4WK3A 2JJ4D 4RLEA 4NYOA 4YB7A 3NCQA 4OZLA 5L9NA 4E98A 1NZAA 1NH8A 2GX8A 2EG1A 4CO0A 4ZK7M 3TA0A 4OZJA 2XZWA 3NCPA 3NCRA 4R25A 2GW8A 2EG2A 2J9EA 3OPKA 4IYQA 4CO5A 1Q1KA 5D4OA 4CO1A 4USJC 2ZFHA 3T9ZA 4CO3A 1NH7A 2NUUG 2DCLA 3CE8A 2CZ4A 5D4LA 4YB6A 3DFEA 2XBPA 4C3MA 1XK8A 1UMJA 3L7PA 2E66A 4WK1A
chains in the Genus database with same CATH superfamily
2DHAA 2UXBF 2BJ9A 3KNGA 3RBZA 2FLLA 1SC1B 2MQ8A 2XHCA 5HQMA 3KUGA 1JLFA 3AOBA 3S1TA 1FWPA 4P71A 3C2PA 1H72C 3UI3A 2E1CA 2C2KB 2ZD1A 2PEHA 4LRFA 4NZ0A 2DB1A 1HQEB 1RT1A 2LA4A 3IP0A 2UVVA 1JJ2R 1YLXA 4OYIA 5KFEA 4JI4J 4LF1A 4DS5A 4U96A 3TAQA 5FDLB 1JLGA 3JB9k 1R8BA 1TQLA 4K4ZA 2N7YA 2DCUB 4BC9A 1IKXB 1WTFA 2LLZA 1PAEX 3OTBA 4C9DA 3K2YA 1W2IA 4ANCA 2XMAA 3T1HJ 3H25A 2I2YA 1GXUA 4WU2A 3THTA 1TAUA 1UEVA 5IT9U 5A8WA 2OP5A 3LWMA 2VUGA 4AYBD 5ETNA 1Q0NA 2B3TB 2K8GA 4KB7A 4DOZA 2YQ0A 1M5HA 3Q2SC 2XCAA 2GJIA 4IUFA 4DR7F 4NASA 4Q8EA 3OT9A 2DXDA 2W2NP 3MM7A 5GMDA 2KFNA 1DTQA 2AHOB 2XSFA 4FYYB 1LWFA 5ETOA 5I3PA 1U45A 2COLA 3MEEB 3I55S 1CULB 1Y5NB 2MKJA 3BGLA 2RF2A 3BQ0A 2J8AA 2HKEA 5D3GB 3GLJA 1T9WA 1UZHA 1RTJB 2FDNA 1DTQB 1SC3B 4DL5A 3CO9A 3MM6B 4WFYA 2AYGA 1G4CA 5B08A 2OTLS 2ILZA 3J7A1 4IOAQ 1HWJA 1I5OB 3D0IE 3POTA 4WTOB 3TZXA 5KFJA 5L1LA 2AYBA 4PWDB 1WNEA 2KI2A 2XMWA 2GMLA 5HBMA 3HFKA 4C11A 1Q16B 2EVZA 2HHHF 1T9YA 1WF1A 2NUHA 5HO4A 4DUZF 4ECWA 2OPSA 2GQ2A 5A0YA 1IKXA 3HK2A 3DHXA 1V3SA 5DJBA 4ALZA 3W9IA 7AT1B 2DPIA 2B9YA 1BD6A 2KRBA 1FEHA 4IKAA 3UDLA 2R4FA 5KOXA 2RKIA 5DS7A 3Q8UA 5KFYA 1YJNS 1M1HA 6FD1A 1XNRJ 5IT0A 4G1QA 1JLFB 1LOUA 1ZAVA 3TA1A 2B7CB 2G1DA 3ETOA 1YJRA 4LBHA 3PX0A 1VC6A 4LR7A 3DLGA 1QAYA 5MAOA 1RT7B 2WVDA 2CDQA 2XO7A 2ZHBA 4WKRA 3C14A 2R8IA 2HZAA 5LMNJ 4YB1P 3KLHA 2MQNA 1RWPB 4DL6A 3MTKA 4OI3A 2VFRA 4WP9A 3T1YF 2G0CA 4ZK7M 5DLGA 3OD2A 3MUTP 4EU0A 3N0VA 5EWGA 1IUJA 2QLFB 3Q8RB 2UVRA 4YR0A 4EGLA 1TK5A 1QVGR 3GJRB 1ZZFA 1FD2A 2OPQA 4G6VB 4FYVB 2JEGA 2DHSA 4OV6A 3V4MA 2WSFC 5HVGA 3FC9A 5CCMA 3OTOJ 2HGMA 4WE1A 1S76D 4CH1A 1VIXA 2EWHA 1IKWB 2HNDA 3FDSA 4EBDA 5ETVA 1KP6A 4YUDA 4IOBA 1EJ7L 2L48A 4QR0A 2IM2A 1VK3A 3PJ9A 4OZ5A 2OSQA 4ED5A 3TVKA 1VRUB 4R8UA 2ZWPA 1A0OB 4YN3B 3UCZP 1RT7A 4WZQA 2VFVA 4IQXA 5ETTA 2BM0A 1X5SA 3CDEA 1N54B 2C3MA 2WAQD 2GHWA 3JQJA 5A8KB 2QFJA 3PM9A 2XYGB 4BLGA 1NUEA 4KKOB 3DGPA 4NLXA 4C8YA 2NPFA 5I42A 1G6BA 1WEZA 3HT3A 4ECQA 3QO9B 4U6PA 1FRXA 3UVJB 3TRGA 4C7QA 2ZBCA 4A8OA 5LOQA 2AV5A 1HBMB 2I5JA 4F04B 3BR8A 2KT5A 5HROA 1NPRA 1VOMA 3BO4A 3CTRA 2CJKA 2J6TA 2BV3A 2MZJA 3BYPA 3H2LA 4C0HA 2QA4G 3R2DJ 3W62A 1U6BA 2R3VA 4QPTA 2FJWA 3MD1A 1TKXB 3WX8A 2K7JA 5KG4A 5KFKA 3H90A 3FMWA 1VQYA 3M1VB 3P8BB 1SKWA 3KJVA 4ETZA 4ZPVR 4J9OA 2FVPA 2OFHX 4DV0J 5BJRA 2XTJP 3DLEA 1WKJA 2YQ3A 4P72A 1YQHA 3R6LB 2VFTA 4NX9A 4TVAB 4JI2F 5DETA 1FE4A 4JI0F 4N5SA 2R7UA 3UN3A 3H2VE 4Y2CA 1KR4A 1J5EJ 1Q8IA 5J2QA 2BJEA 1SL2A 2BA9A 5F8MA 5D0EA 4P73A 1AA1B 1MNEA 4BS2A 2XLKA 3VGTA 2BJ7A 2O5DA 3EPGA 3D4JA 2AJ0A 1C1BB 3H8YA 2A6MA 4OMFG 2AGOA 4QIVA 1O8BA 3QO9A 4KH0B 2VQEJ 5ETRA 1V5VA 4OX6A 1T02A 3WIUA 4I2PB 2DGUA 1VQ6S 1AYEA 5KT5A 2BE2B 2CG8A 4D3HA 2Z30B 4UY85 3CC4S 2P5VA 3H4BA 3TQ1A 1RAGB 3RB3A 3FEYB 2MLZA 3JSMA 1SJ4P 3O8WA 2LXUA 3NGUA 4P7TA 4A8WA 5C24B 4ECSA 3ZTPA 4N41A 2HVZA 2QSWA 2HQDA 3Q83A 3SCLE 1Y11A 1C1CB 1TKXA 3UO0A 2FHJA 2XI2A 3FJ2A 2FJAB 5F0WA 4OX7A 4DN9A 3PV8A 1VQOS 1FJGF 3VF0B 4Y65A 1N5SA 3NEKA 3NGRA 4ZCLA 3LGNA 5A8KA 3IRXA 3R2CJ 1RBOB 4O3RA 1GMWA 4ED2A 2HRTA 4FN5A 3RB0A 3PW2A 4KKOA 4DSLA 4X64F 5K5MA 1MWZA 3CJ8A 2V50A 4ITSA 3D5MA 1OPIA 2V9KA 4ANDA 2ZNZA 4OZLA 4HLBA 2W9BB 3M4XA 5EHHA 1MWQA 3F41A 4OZ2A 2LXFA 1WOPA 5JVGQ 3EZOA 4J5OA 2E5LF 2HNDB 2BMBA 4C6AA 2EFQA 3B4MA 5J2NB 2ZZTA 2J9EA 2JLGA 1BXNA 3AB2B 2CNNB 1UA0A 3WC2A 4I4BA 4OL8A 4NLRA 2VG6B 4USJC 5CYQB 4KPYA 2V0NA 2RU9A 2J0QD 1K0VA 1QSYA 1S7IA 4C4WA 4JI1J 2OTJS 4DEZA 3HVWA 1S0VA 2NSBA 3PEJA 5G0RA 3R5GA 2VASA 3CWJA 4OV1A 3CJTA 1U1OA 2FPHX 2RIJA 2UUBJ 3QRRA 1DQ8A 2XYHB 4O0IA 2HRYA 1FXRA 1Q5VA 3UCGA 3UN5A 2H5EA 2AEMA 1DBDA 3US5A 1VLYA 3S7RA 3RB6A 2M8HA 3MURP 1G7CB 3BGFA 3NOGA 5A8RA 2HNYA 3I5CA 2D74B 2MZRA 1EX8A 3CJKB 1LWCA 4A8YA 2QEXS 1WSVA 2ZKUA 3MM8A 3TOQA 1RKJA 3KLFA 3G9CA 4NEZA 3SSSA 1WI6A 1RTIB 3TJ9A 5IM0A 5DGBA 5DG8A 2I6WA 2B4PA 4O44B 4WBFA 3M6WA 4F67A 4I67A 1Y0HA 1HMVA 2F1FA 2B9WA 5A2QY 2E5GA 2KVQE 3PVXA 3ICLA 3MTJA 5A0YB 5D4PA 1LQ9A 2FQQB 3M2VB 5JMNA 2ERRA 4LF4J 1WSRA 3RAQA 3ISNC 4FZVA 3T6JA 2DK2A 2BJ1A 2DNHA 1L3SA 4YS2A 3R5AA 2N82B 1JLAB 3IS9A 1Q86T 2BJ8A 3NMRA 1DJ0A 1LWEB 3MMBA 5ETKA 3TA2A 2HMIA 2J9DE 2J6UA 1BMQB 3DRYA 3M6UA 2HPUA 3C14B 4YHHF 1RT2A 3GCXP 4CLKA 2V9WA 3DLGB 3BQ2A 4YEAA 3KMQA 1ZYQA 1FRHA 3G6XA 4FF3A 1F9HA 1PAUB 2XMVA 3CDUA 1TL3B 3CDBA 3HZEA 4WP3A 1D0EA 1ZTTA 2KM8B 4DR6J 4X4UA 2Z2LA 4PWWA 3CF5Q 1HNZF 4JBCA 2L9WA 4EBCA 4B02A 4N8NA 1J5OB 4IRCA 2ZBPA 4HHJA 1YWXA 4KH1B 4I2QA 3M8SA 2FVSA 2MHEA 1VLOA 4WPAA 2CZ9A 3OLBA 2DNYA 2H9ZA 4C3KA 1W2BR 1S6PB 1S9GA 2M5YA 4XIUA 1U4BA 1N34J 1UL3A 2Y8YA 3M8ZA 2KH9A 1TKTB 3C6TA 2EBGA 4J37A 3A8JA 4RW4B 1YI2S 3M8PB 4KBIA 3HVRA 1L5UA 4JI7F 1SIWB 2EW9A 5AE3A 3BN4A 1ZZNA 1VCTA 2K1RA 3UR3C 1QJHA 1UFKA 2MYFA 3JSYA 4NYZA 3QGGA 1RCXB 1LK7A 3M32B 2KRRA 8AT1B 3J7Z5 5L1KA 4QWAA 1NJWA 2DH7A 1OSCA 2JVOA 1U2FA 1P9YA 3MM6A 4B9UA 2NZ4A 1S79A 2ASLA 1MROA 3HHLB 2GZOA 3HF5A 2VOOA 4WIIA 4XDCA 4KGVB 2MQLA 4MFBA 1U6ZA 2CQBA 1P1LA 4GRSA 1SKUB 2C1EB 4LBPA 8ATCB 2LQ5A 4LF8F 2YVSA 4IO9Q 2XMTA 2XNRA 4Y6IA 2D69A 4TY8A 2D3UA 2MSSA 3FEXB 2GMHA 4P2MA 1M5OC 2GS8A 1U25A 2DR5A 2UXCF 2FJEB 1HW8A 2Y1JA 1B70B 3MM8B 2KHCA 4KGZB 3W1YC 3DLJA 2UVWA 1S77D 2IYIA 1LWCB 2ROEA 3UVJA 3J7YU 4ELTA 3A13A 1QVFR 1UVNA 2Z56B 4RW7A 4QWEA 1SKSA 4A46A 1UVIA 2N3OA 2YKNB 2WVBA 2XWXA 2PMWA 3CCVS 4TY9A 4DX5A 4O3SA 1S59A 3R97A 3HHKA 4FPIA 5CABA 4B3SJ 2OUGA 1X4DA 3G87A 3MUVP 4NL5A 1T03A 3IGNA 4K4VA 3OPKA 3ET6A 1SBRA 3NP5A 1UW9A 3FVYA 2I0XA 4USVA 4RW9B 2AKWB 4R0EA 4C48A 3CCRS 2Z57B 4C98A 3MMCA 5L9XA 3OJSA 1KSPA 5C5JA 4F0MA 2VODA 2GIRA 3DDKA 1GTHA 1Y5IB 4R5PA 3KK2A 3KLGB 4DLEA 3BKUA 2D1CA 3GR0A 2FC8A 4GO5X 2RILA 3A8KA 4JP8A 4K4WA 3DFEA 5AXNA 1X4CA 3GIJA 3VAHA 2BQ3A 2UV8A 1E6YA 4G1PA 3KUEA 2XMMA 1NJZA 2POKA 3BBCA 2R2RA 2X1FA 4X4NA 1JK9B 1HWKA 5K14B 3HHLC 4C8NA 1I3OB 5K8MA 3Q0AA 3MAAA 3WBZA 1K1SA 2YKNA 5HJXA 1SJFA 1VQ7S 1F2GA 3M8PA 4FDFA 1DHMA 1U02A 3L09A 4DV6F 5B0CA 2FLOA 1PKUA 2CG4A 2W9AA 4LREA 1FRIA 4K4SA 5JVHQ 3I82A 4Y2IA 3QAEA 3N01A 3RZAA 2A2CA 3HVTB 3BPDA 3IM8A 1NXIA 2YPYA 3FZ2A 2FLPA 2A2DA 3CW2C 2MTLA 2YWGA 3E3XA 3JS9A 5EX3A 1XNQJ 5CZXA 1RADB 4X66F 4LUBA 4MFBB 3EZUA 5H9FK 3VCDA 3NAHA 4MH8A 3HJVA 1TVRA 2HBYB 4C97A 4AQYF 4FBTA 4X4PA 1QM9A 1R0CB 2NXNA 4JUZA 2CQ2A 3D0GE 4NE9C 4C11B 5HMWA 3M30B 2FY1A 2M4MA 5F8GA 3M8WA 5E5NA 2YXLA 5KG5A 3LGMA 2BRLA 3DLLQ 3OV7A 2BQRA 2XQCA 4RW6A 4DQQA 3MFIA 4LT6A 4UZCA 1FWKA 1GX5A 1M5VC 4DCPB 3VHQA 4OI1A 5LJ5Y 4Z37A 4QWBA 4K4XA 3RG6A 1C4CA 3D68A 4YMEA 3MEEA 2E5JA 1D1UA 2GC8A 2GHPA 2CDRB 1T94A 2PSZA 3KFWX 1RTHA 2KDOA 3HFVA 2KB2A 1IR2A 3MM7B 4ZVPB 2HRUA 4DUYJ 4DFKA 3Q8VA 1KLNA 3PDNA 3SMZA 3T19A 3GTYX 1NZ8A 2A6OA 3D1OA 3EVOA 2OIHA 4B3OA 2VZ9A 4YDXA 2ZH8A 3DGVA 1MN9A 4M5MA 4MMOA 3W61A 3KK3B 3WX4A 1I94J 1FWLA 3K5MA 2D3OR 3OXGA 3H4DA 1S6QA 4B3SF 1NJIT 1V9OA 1XR5A 3EMTA 2BACA 1UKUA 2MMYA 4OZ0A 2PD1A 4NLWA 2V8GA 3DOLA 1E6VA 2HVIA 4LF6J 3GV7B 2HQCA 4X4OA 2GJ2A 4UTGA 4A48A 4Q5VA 3B82A 4LF6F 1Q7YT 2HVEA 3MCOA 4GKJF 1ROFA 3KLFB 3ZZZA 2DNNA 4GC7A 3SV4A 2IM0A 2DGVA 1NK4A 2CNOB 5HANA 3BR9A 1QLNA 3QIPA 4ES1A 1IKYA 5IWAJ 3HP6A 3NS6A 1CJUA 3B54A 4PUOA 3KDOA 2WSCC 4I7FB 3TVZA 1TR0A 4NLTA 4OHXA 4ED4A 5KFCA 1UPPA 2HFVA 4C8LA 1JLAA 3SQGB 1NK8A 4JV0A 5BYSA 3CMAS 2D3O1 2FJXA 2ZUAA 3IMQJ 5M2RA 2BKNA 1WELA 3IO1A 1TTHB 1U8SA 5BXIA 1SV5B 2LKZA 2WW4A 4N56A 3OW2R 3E2EA 1NSAA 2MGZB 1Y7PA 3R6GB 2ZWOA 4F50A 3RR8A 1S6UA 4NWBA 4ZJLA 3SIPB 4GKJJ 3PIPQ 2ZVSA 4ED0A 3OL9A 4AL7A 4HEA9 4FP9A 4M63A 4URGA 1HBUA 1GQEA 1HI8A 5AXLA 3GJSB 1ZTWA 1VHIA 4DJBA 3MECB 4X65J 1RSCA 1B4SA 2P2CB 3U7JA 3DRSA 2CZ4A 5DGAA 2X1AA 4ZPAA 4ENOA 4HVZA 3NY0A 3BB5A 5ETMA 3ZZUA 3QBCA 2UVUA 1HFEL 1TL7A 3JTOA 1BWEA 4XPCA 5C42A 5KFIA 4J9UE 4WK1A 3JSMB 2XCPA 1VHFA 5E3QA 2DNZA 5EWEA 3DDIA 4M1KA 2YKQA 1NDKA 1VMBA 1FJCA 3H7HB 1LEOA 1SUQB 2HAFA 3DN9A 4KFBB 1IBCB 4YY3J 4ED8A 2C2MB 1L3UA 2BOPA 4K2JA 4M5IA 3QFWA 2BX6A 2HBRB 5T14A 1G2EA 5DQGA 5J2MA 2M88A 2M2BA 3JAMY 2MPUA 5JXSA 2BR0A 3KLIB 3D6TB 4DX8H 3RB4A 4AT1B 3MCNA 3ET6B 2J9DA 4RNNA 2FHJD 3HXMA 4U67Q 2CJ9A 2EFPA 5J2QB 2P6SA 4CNZA 4LF4F 2EC2A 1O5JA 3OJUA 2PA3A 4PG8A 2DNKA 2E1RA 5T7LB 3OFFA 1HYSA 4OYBA 3V6KA 1TP7A 4MIAA 3FFIB 1U1KA 4U7CA 1KKHA 1IM6A 1H73A 1EKRA 1Y3KA 2EKNA 2YWHA 4V1Ak 3BPSP 1X8DA 5A76A 4RW8B 4B9NA 3TANA 4RNFA 1VYAA 2JDJA 2WHOA 2ZHAA 4DV1J 5H9EJ 5J1EA 3J81Y 1WHWA 3L3CA 4RW4A 4MKVA 3SYZA 1S1UA 2X1GA 3DM2B 4TLRA 1R0AA 2E7WA 1UFWA 1HNVA 4K50A 1LWFB 2MLXA 3IGVA 2VIHA 5EN1A 3W60A 4DL0C 2KXHA 3BDEA 2V2VA 3ENQA 2IMOA 1FNMA 1T3NA 3GV5B 3DXSX 3UDVA 4DV4J 3RYLA 3NAIA 1RTDA 2F65A 2AYMA 2RSQA 3K5OA 3KLIA 1JLQA 4OLOA 2F8EX 1ZS6A 5J1NA 5J2MB 5CHCB 2DEIA 3K5NA 3O5TB 1PSDA 5K8NA 4ED6A 2WB4A 1QAXA 2OPRA 3G86A 1XMQF 2HGNA 1NKCA 3LP0A 2DRBA 2UUAJ 4ZN3A 3U27A 3W2WA 4I2PA 2KFYA 1OS5A 1OWXA 1N33F 4TQRA 2DIVA 3KDNA 3DLKA 3LOUA 3I56S 4A8XA 4DL4A 4A8FA 2JLEA 3IG1A 3MEGB 1FDNA 1RA6A 2FZCB 2M0GB 3CNQP 1N56A 3NMAA 4X4QA 1HBMA 2Z2YB 1DY3A 5CYMA 1VDHA 1HNXF 4LSLA 1UVKA 2A1BA 3EM1A 3M2VA 4ID5B 3AT1B 4ECUA 1S1UB 3DM2A 4JI5J 5KTQA 3WQPA 1HMVB 3PRVA 2AJ2A 2R8JA 1SUQA 1VJQA 2LYVA 1VQLS 3TEHB 1JJHA 2OFGX 1RWWB 1NNDA 4MYTA 5KT4A 4DV0F 1NJXA 4WFBQ 2VA3A 3HO1A 3UPFA 3KJVB 3LA0A 4DR5J 3UD4P 3ENAA 5ADZA 2DHXA 1VRTA 4KHRA 3TR5A 1YG0A 5HMYA 4PRFA 3TX0A 4LSNA 1MW7A 2JX2A 3N6LA 1W26A 3TA0A 1H7XA 4PYDA 2AGPA 3DMJA 1Q82T 3JSRA 3GJQB 1RA7A 5GADU 4LMZA 4TU8A 3RBDA 3OVAA 2QO3A 4RUAA 4ZVFA 1FHTA 2HYIB 1RT5B 1X5PA 1KDNA 2OMLA 2OPQB 2DHGA 2EI5A 2ZEJA 4ZCMA 1VBYA 3B78A 2UU9F 4IR1A 2G2YA 2WONB 2QJ3A 2H54B 3D3BJ 4UY8T 5CYQA 4LSLB 4MYUA 1NB2A 3R5CA 2BJDA 4PWUA 2OH2A 4RUBA 4QIGA 2NZCA 2V68A 3DI6A 4DPOA 3ILJA 5LL6d 5KG1A 4QWCA 2XBPA 3NGSA 3WHIA 1IBLF 5BYRA 4FF2A 2R7TA 1TL4A 3OR2A 1IBLJ 2HHUA 3X1LB 4NCGB 4J9VA 1FFWB 4DR6F 4PUOB 1SH3A 5AE2A 3G8TA 1ZPWX 2ZITA 4ZVHA 4QQBA 5B0BA 3TZWA 2HWIA 3I5BA 5K8PA 4RNOA 2JEFA 4B3TF 3AD9C 1FK9A 1VRTB 2GMJA 4OX8A 4CT8A 4XK8C 2RNEA 1ELOA 3W63A 2MXYA 1VBZA 4M5JA 4B9SA 3QT7A 1LXJA 3Q8PB 5KFZA 3LUYA 3EPIA 3NG8A 1HARA 1FERA 3MI7X 3W9HA 2CQHA 3V6JA 2IVYA 4IO1A 1KVIA 4K4UA 3UD5A 4DQPA 3ZTQA 2NPIA 2VB6A 2ZKTA 5KFGA 4FBUA 4ZVGA 3G6ES 4DS4A 4LR8A 2I1RA 4KSEB 2CQGA 2HFSA 1RWXB 2QMWA 1ZAWA 2RQCA 1NAQA 1VS3A 4G1IA 5DZ7A 2YY3A 2ZNYA 1LNQA 4B3MF 1AFIA 4CLUA 1VQ5S 5FJ4A 2CJAA 3O2IA 3BO3A 1JLCB 2DKOB 2PA8D 2QT7A 5KG0A 4CLYA 4ZIVA 4QW8A 1WOOA 3CUNA 3FBEA 2XG8A 4IFYA 3NNCA 4WP8A 3QIPB 2HQIA 3JQMA 1HD1A 3KUHA 4DV5J 2JWNA 1DAXA 4DV2F 1H2TZ 1CULA 1P9QC 5IV3A 1LW2A 3K8VA 3PHEA 1IQZA 3S8SA 4DUYF 3GCWP 4Q2MA 4NXNJ 3VV2B 5GADI 3PKYA 4NA2A 2XLIA 3TQEA 3CEDA 1RAEB 1D3WA 1WC5A 1GXLA 1CSJA 1KLMA 2J7KA 5IQQA 4CDIA 2V2ZA 4NEYA 5L1IA 4LF5J 3QGIA 2J0WA 1JLEA 4OI6A 1AUSL 3PW4A 3HJFA 2C42A 1FI4A 3DOMB 4PXDA 5HBMB 1P8GA 3AB4B 2ZH9A 1T9VA 1X4BA 1IKVA 4WFZA 3ULHA 2R7QA 3E01A 3AH6A 2CQPA 1JXEA 2V6AA 3PYGA 1R43A 1X4AA 3KLEA 4Q8FA 2ZE2A 2X1BA 3D2WA 1SVDA 2FB0A 4DV5F 2HK3A 1EB0A 1Z2LA 5HN0A 4DV4F 2IBOA 3EVMA 5KAKA 1RTDB 2Y8WA 1T0TV 1TMMA 2VFUA 3I0RB 4AFFA 1KTQA 1FKPB 2VFSA 3DDNA 4YR2A 4N7TA 4F2RA 2CPZA 4DSIA 2NXCA 2BEFA 2NS1B 2RQKA 1VIOA 3TAMA 1VK8A 1S1VA 1WORA 3O1LA 1N36F 1U7LA 1EP4A 2MHNA 4H4KC 4MAKA 4RW9A 4JV5J 3OQ2A 4XTTA 4OYWA 4UF4A 4USHA 1C2PA 1XERA 2DEJA 3S6EA 5HP1A 1XWLA 4M94A 1RT4B 3MCSA 3NKYA 3IAS9 2YNHB 2YNIA 3HVAA 3T41A 2ZH1A 1PGZA 3QJPA 2BRKA 5L9NA 3KHGA 4KRWA 1HYSB 4F25A 4DUZJ 1H2UX 1NSKL 4QIEA 2DO0A 1T05A 2EXUA 5GAGI 2DNOA 1RDRA 3N9UC 2ILYA 4DV7J 1WACA 3NBPA 3BQ1A 2FYXA 4R25A 3U1LA 3HT0A 2QZ8A 3CJ5A 2L9DA 4UOFA 1KONA 2GJFA 3I0SA 1GMVA 3WC0A 3QZ7A 3V4IB 2M9KA 4ZS6A 3MZIA 4WKYA 2LXIA 2NUUG 2W4DA 2PDAA 3BN7A 2PFDA 3MPDA 2PMZD 1VQSA 3MOJB 4JYAJ 1QE1B 4Q2LA 2X51A 4H4OA 5H1SV 2MGZA 1URNA 1SJ3P 1F60B 2RVJA 2PO4A 3I32A 2IC3B 2N4DA 1VQ4S 4M5DB 4IDKB 4R8UB 2RB7A 1IWGA 2Y1LB 3EUNA 3OL7A 3FSIA 4PQUB 4PZVA 2WVEA 1XR7A 4OYZA 3C15B 4I1TA 3RRKA 2LA6A 5DDRC 4FS1A 2VKZG 4CTAA 3F56A 4HTIA 1Y3JA 1OO0B 4ZHRA 2B9XA 2IDLA 2DNGA 3DOMA 5CYJA 1IR0A 5C25A 5KT6A 4HHHA 3AD8C 4WE1B 2MEWA 3TJAA 4CO4A 5C2CA 3PFOA 4CLPA 2MB0B 1EQ0A 1W7WA 2GFFA 2WBRA 3K7RA 1KEKA 3A3NB 3IM9A 1S48A 1HLWA 4URQU 2N7CA 1EHWA 1S5ZA 2HZCA 3PX6A 2FLNA 3CJ0A 4P7VA 3GQCA 1D09B 1UJ5A 2K7KA 4DSFA 4LFAF 2VQFF 2ZC3A 1AZSA 2K1RB 5KFRA 1QTMA 3QPIA 3EICA 2HWHA 4KYZA 3UWTA 4ES2A 3DHWC 7FD1A 1S0NA 1PYOB 1X9SA 4J7CA 1N4LA 2H48B 1GXTA 1PO6A 1RT2B 4RU2A 3EGZA 1ZAXA 4OHWA 4F0KA 4N77A 2AGQA 2GVDB 2DY9A 1RAFB 3CSKA 3BSNA 2DGQA 2EFGA 1NO8A 1N34F 1RLDA 3LGHA 2YPZA 4DR4J 1KWMA 2ZOMA 3PW0A 1RBAA 1HIYA 2DH8A 1FTRA 3VALA 2M70A 2HEKA 2J0XA 1OIAA 3PXGa 2BXJA 2BZ2A 1U2RA 4ZVEA 4QIFA 3H2UB 1RI7A 4KO0A 3THPA 1FJ7A 2CQDA 5IZHA 1SH2A 3SXLA 3EZ5A 3C6UB 1FE0A 3FQKA 3M8YA 3ZNJ1 4CLLA 4MKYA 2AX0A 2G0IA 2GA7A 5CZVA 4L76A 5LMNF 3GONA 1CC8A 1NU4A 3IS9B 4MIBA 1R6VA 3SSRA 5KFAA 3VAGA 4TN2A 5L38A 2W9CA 3FBFA 5E3CA 3AJDA 2RJZA 5HATA 1GEHA 2CQCA 3LPYA 4HDHA 4IDKA 1HPZB 4Z7YA 2CJYB 2VG5B 3V2UC 5IS2A 3H42A 1ZOTA 3VTIA 3PIOQ 3CCQS 2KN4A 2IRXA 3MOZA 4RWWA 1KQSR 1WC4A 1J5OA 1HQUA 2NYIA 4PKDB 1HQEA 1M1GA 1RT1B 1OMSA 1HNXJ 2E7XA 3Q2TC 3GG0A 1Q78A 2O01C 2BJ3A 2VBXA 2NXEA 2VBZA 1JMTA 1HKAA 5U47A 3GYGA 4DDFA 4CRJA 1S1TA 4DR3J 2C2EA 2ALYB 2KO1A 1S0OA 2MQMA 2M3DA 4CYUA 4DR1J 2V94A 1TUWA 3I5AA 2DPJA 4ID8A 3BGRA 3Q24A 3IR6B 4YB7A 3NCQA 1K8AT 3J7YI 2EC0A 1JIHA 4E98A 3MGJA 2UXDF 2IVFB 3IR7B 2EG1A 5IOLA 1SL1A 1NHVA 4ZLJA 5F3ZA 3VZIA 1MN7A 3J81U 2KHDA 2ASDA 1FO1A 3GG1A 2IC3A 3W64A 3HVTA 4KGKA 1S57A 3D1HA 3D6HB 3NOCA 4IYQA 4RR5A 4TNOA 4CM0A 2AT1B 5HP1B 1QE1A 3CJ2A 3QQCD 3FGVA 1SL0A 2AIRB 2QX0A 3IRXB 1JNZB 1WEXA 5GMKa 3G4SS 3G71S 3N6NA 1FVSA 2XNQA 1CEZA 4I69A 5DQIA 5ETPA 1FRKA 1RWNB 5HLFB 3I9ZA 2NSCA 2W1BA 4EFAC 5HVFA 2V4QA 1B7YB 4RUCA 2CWKA 2OO4A 1S1XA 1TKDA 2NLWA 4DI6A 3LANA 5A8RB 4LF5F 3UNYA 3NBPB 3VAKA 4ZVRB 2FGOA 4DL2A 2ZZMA 2WRMA 3MEKA 3OFEA 4QJVA 2E66A 5C24A 2CZVC 2DXEA 2HNZB 4QYRA 4CLWA 1RUSA 3W2WB 1TK0A 3K89A 3OUYB 4W90B 1N8RT 2HLTA 2DVIA 4ECZA 2BW7A 1S9EB 5HQLA 4RJVA 1N6QB 1FF2A 1KVJA 1AB8A 4XAKA 1XNQF 3QJLA 2HFNA 3C16A 2JVRA 2XGQA 1WJ9A 3SCKE 2YQ1A 3CIMA 3FUYA 1TV6B 3KG4A 3PYEA 3DYAB 4WU3A 3R7BB 3G6VA 3K57A 3EGVA 1IBKF 2MZ1A 3MHYA 3ZTRA 1S10A 2A18A 3BM7A 1MU2B 2EKYA 1FKPA 2LDYA 3TWZA 7FDRA 1NB7A 2IBKA 4ILRA 3UNGC 3CC7S 1V3RA 2IRUA 1R8HA 2VJVA 1TL3A 2GIQA 1MROB 3HHLA 2W7PA 3GFXA 2YNHA 4UUWA 4NXMJ 1T8EA 4OYOA 2RU3A 3KG0A 3PG9A 3THVA 1TMJA 2YH1A 4LVOP 4KJIA 1IKVB 3CMES 4PABA 3LAMA 4NI2A 1C1BA 1F1BB 5KT7A 2ACMA 2QYCA 1XJWB 3D54A 5LJ3Y 1CJKB 5THWA 3K5LA 2LDIA 1S9GB 1S6PA 4G65A 4ZVUB 1B0TA 2C3UA 3KWMA 1NSQA 4CLFA 5GAEU 1REVA 1M90T 3PO5A 3M7VA 4LFBJ 1PIEA 4WYWA 3A4TA 3G8QA 2BM1A 1WTBA 1D9DA 3IWNC 1N88A 1NCLA 3QAUA 3A8IA 3HHNB 3TJ8A 3W2VA 2GVZA 3DLEB 1LW2B 2E9RX 1UJ6A 2YKPA 3BH7B 1B7FA 1KOOA 2J8SA 2YX1A 1WDDA 2JZ5A 3TUJC 4DN0A 1UETA 3H5XA 2W7AA 3G6YA 4QR1A 4K0KF 3MUMP 1M5PC 2GO9A 3CC2S 3HX9A 1VI7A 1B3TA 3U02A 3DLBA 1FX2A 3ELHA 1C0UA 1YRTA 3RTVA 1XIQA 3UDCA 5K9FA 2X3GA 5B0DA 2UXDJ 5HROB 1YSJA 2MSTA 4DV6J 1KBRA 3Q8QB 2XZTB 2G13A 4I2QB 3OTDA 1R8CA 1DTTA 1Q8LA 4DUTA 1S72S 1UZDA 2C3OA 3Q8YA 4USUA 5I3UA 4FF1A 5D0RA 3T5JA 4X62J 5KFNA 2OLWA 3ISND 1KTVA 1Z1ZA 1YRUA 3E8OA 2CADA 4X66J 1QSSA 4DR5F 1KHWA 2R9LA 3UFCX 1DZ5A 3M1VA 2QC3A 1SH0A 1S12A 5ETSA 4S0MA 1WC3A 2B6AB 3M8QA 4NLOA 1PJ6A 3PYFA 3H40A 3P5TL 4AE5A 2U2FA 3T3FA 4NCGA 4JI0J 3PW5A 2R2TA 3OR2B 1LKZA 2IDEA 1Y9OA 2P9EA 2Y1RI 4IG0B 1U26A 1Q7LB 1ZA1B 3R1LA 3VGVA 2IAJA 3OTEA 3BF4A 2CPFA 2Q6CA 2PI5A 2YWWA 2FD2A 2VG7A 2CQIA 2F9DA 3ITHA 1RZMA 2PFFB 2DGOA 1H74A 4AXJA 2R8HA 2P6TA 4KHPJ 2CKWA 2FVCA 2QSFA 2W25A 2ZC4A 5GAEI 5F8LA 5KFBA 4I56A 1HQUB 5MLCV 1RT5A 1DQ9A 2PC6A 5KT2A 5LMUF 4F2SA 4Q0BB 3MF5A 1R8AA 4DCOB 3UCUP 2AEFA 2P9CA 3BKFA 2DGTA 3OLAA 1C1CA 3QT6A 3I4HX 2NR0A 1WWHA 1O6XA 1HNIB 2A10A 1HD0A 2EFNA 3DLKB 3E51A 3KJFB 4LIWA 3EXYA 4O23A 4PQAA 3CCWA 5D77A 2MKHA 5KFPA 3DI6B 3OL8A 4B3RF 2DNRA 4ILLA 1WC1A 3C6UA 1KRPA 1FNOA 1RYRA 1C0TB 2Z2ZA 2Z0GA 1CJVA 2OPPA 3FNNA 2XGPA 1RTHB 3M2RB 2FZGB 1P6TA 2HHPA 1RTJA 3N5FA 5K8OA 4GKKJ 1KNZA 1RHUB 1UJ4A 1HR0J 1HPZA 3OFGA 4WFXA 1D8YA 2HHXA 2PIIA 4ZDNA 2B0GA 1H7WA 2LQ8A 1DTTB 3DCAA 4WFNQ 1X4FA 1MG7A 1P1TA 2OEMA 2YBVA 1S6QB 1O0PA 3GWCA 3MD3A 1XNRF 4ERDA 2YNGB 2ZJQQ 4H4MB 2ZOFA 2W9BA 2VOPA 2HFZA 3N79A 5D4NA 4F4YA 4NLDA 1LK5A 2N4CA 3LTOA 3W66A 3F0NA 4IH7A 2F8MA 3M30A 5A2QU 1RHMB 2ZJRQ 1CJUB 2XY7A 2JEJA 3ILOA 4KO0B 1ZM4A 2CYYA 2DGSA 4Y00A 3K5PA 2GVZB 1WI8A 1BQXA 3N6MA 2E1AA 2BE2A 2V4RA 2B4VA 4CQ1A 1Y5LB 2HGLA 2A3JA 2RF2B 3OL6A 2DR8A 4DSJA 3NL0A 3ADAC 5FIIA 3U1MA 4FS2A 2R7SA 2X3DA 4ATNA 4E2FB 1JLBA 2MY7A 3EYZA 3H0PA 3AA8A 2P8IA 1QD1A 2XSJA 1RP5A 4OZ1A 3W5YA 2CJXB 5HL7Q 1FKOA 4I6AA 4L74A 1YTYA 3IBCB 1V3ZA 4P75A 3IXQA 3J7AN 3SDEB 2F7VA 2FJBB 4ANEA 4EMDA 2XHWA 1ICEB 1T9XA 1TAQA 2HFOA 1WDTA 4DL7A 1XN9A 4NI2B 1OY8A 2H1YA 2KJWA 3BJYA 2IM3A 3ZTSA 2CNKB 2APOA 3IWXA 5E0OA 3MR2A 4A8MP 1CQMA 1Q95G 1M5KC 4IFVB 1JLGB 1LXNA 4HL9A 3W8PA 4B08A 1NJYA 1TL7B 3KOAA 4RL1A 1TUVA 4HR2A 1FFSB 2EK6A 4USMA 2OI2A 4ZJOA 1DFDA 6AT1B 2HWTA 1N5VA 2HS3A 1RT3B 2LMIA 3BSCA 3O6QA 4NCBA 4ZVTB 4UQTA 4ED3A 1R7IA 1U1MA 3QFHA 4C3MA 2HBZB 1CC7A 1CJKA 1JKHA 3EE3A 2MQOA 1G1XA 1S9EA 1N6QA 1TV6A 3C46A 1N0VC 5L46A 4IRDA 4KQZA 3ETMA 1HNWF 1X4EA 2IJFA 3C16B 3FSXA 3HHDA 4HHUA 4L6V3 5B0FA 1FDBA 1ZA2B 2ZH6A 2CFXA 4F4ZA 4X2BA 3AJ2A 4NA1A 2M8DB 2NQPA 2Q3PA 1S97A 1S4FA 1QAIA 5CCLA 1CLFA 2LEPA 4H54A 2DO4A 2WBMA 2ZZNA 3R5JB 1BQNA 2HBQB 3HD1A 1NKEA 3UR0A 4IOCQ 1B99A 4F8RA 3IC1A 3B4DA 1AFJA 4RW7B 3HSDA 4I0WA 4Q0BA 1IKWA 5D4OA 2WCXA 2HS0A 4A8SA 1RU1A 3T9ZA 5I3QA 2O3DA 3KJQB 3VAMA 3NGTA 2D7SA 1VQPS 4WFAQ 6FDRA 3RJMB 3G2XA 3PX4A 3T5LA 5AXMA 4X64J 5D4LA 3ZNUA 4CIOA 3C3LA 4M5HA 3AXMA 1NK7A 2MJNA 2BANB 4OYMA 1BE4A 1RWUA 2G9OA 1N5QA 3G8SA 3SQGA 3HKZD 1GAOA 4DV2J 2B6AA 2LFVA 2ADBA 4NMXA 2R2SA 3PO4A 2GHVC 2HLUA 2ATCB 4EO8A 2HAIA 1QY7A 1HBUB 3MMCB 4UW2A 3RR7A 3CCUS 3DLHA 3HHLD 1H98A 2C3YA 2WVFA 2DGXA 1KLMB 5F0UA 2XI3A 3L7UA 2GQCA 2N3LA 3PJXA 1D9FA 2A0FB 4M5LA 4BCAA 5HQ8A 3Q22A 4DFJA 4X4VA 2HSEB 5B0GA 2WVCA 5LSOA 4HACA 2H65B 3MMAA 4A8KA 3T1YJ 1VFJA 4JI8J 2KFZA 2HHSA 1RAAB 5F8JA 4ECVA 1S6OA 1OY9A 3KLEB 3EGNA 2G2OA 2E44A 2NCKL 3AA9A 1IR1A 1SQEA 3JTPA 1NDPA 2GNKA 2FJVA 2QLJB 2RT3A 3PNIA 4AUKA 4XDDA 3A1YG 3W9JA 3UD3P 1YIJS 5HMXA 3R27A 3N4WA 4IFYB 2XY6A 2I38A 2L3MA 3BGUA 2R42A 2HMIB 1YJVA 1U6FA 1PBAA 2VC0A 4USIA 1FKOB 2K3IA 2LCWA 1NK9A 3LW5C 9ATCB 1S99A 4NYPA 2ALZA 1SCJB 3IBFB 4N8OA 2VPWB 4USKA 4USTA 4O3NA 3W3SA 3V6HA 2CWXA 3ENVA 2O67A 1JXVA 2VL1A 2OD4A 1YITS 2R7VA 3MPWA 1SJQA 1WOSA 2D9PA 1S0MA 9RUBA 2XB2D 2ZH5A 3H59A 2ASYA 2OMOA 2VH7A 1KQKA 4CTAB 2XC9A 2MKKA 2PE8A 1UA1A 3GSIA 2YNGA 1DLOB 2JC1A 4UOGA 3CCES 3QRPA 4DR4F 1R8PA 1Z2ZA 1LW0B 2UUWA 4PPDA 1TFWA 3QJJA 2QE5A 2WOMB 3UQSA 1AZSB 1YJ7A 1NHUA 2RRNA 2V5HG 4TYAA 4DR2F 1M5SA 3PHTA 3KJNB 4H4KA 1Q5YA 2ATLA 4B9LA 2G4BA 2AZ1A 1YRXA 4DR2J 1I1GA 4B3RJ 3JQKA 3PW7A 1KC8T 1NKBA 4X4RA 4R5PB 1YJWS 3GR1A 1QAJA 4ZLLA 3DRXA 1U09A 1C0TA 3SBMA 4RU9A 2ABYA 5JUMA 4DX7A 3C15A 4FPRA 3D28A 1URRA 4RLEA 4TXSA 3R7SB 4DWIA 3DMJB 1A9NB 3MAAB 2ZBIA 4ECXA 3LP2B 1A7GE 3TI0A 5CH7B 1HHSA 3DU6A 1YX2A 1NK0A 1PCAA 1RGVA 1F9FA 4F0HA 5D0HA 3MMAB 1D9AA 4LR9A 1XMQJ 1E6YB 2XM3A 2PGCA 3D0HE 2X7IA 3NCRA 8RUCA 2HHVA 2LU1A 5AJ3F 1IVZA 2AEJA 2CPXA 3D6MB 5IT4A 2YTCA 1CJTB 4DBQA 3RRHA 4KTQA 3KNAA 1KFDA 3BREA 4L3KA 4Q45A 4TU9A 2BQUA 1J5EF 1HI0P 1U0SA 3H5SA 3HKWA 2XY5A 3CD6S 1NH7A 1Q79A 2DBBA 3QGHA 3AQOA 3V4IA 4JI3J 3HD2A 5KG7A 5FLXU 3RGIA 1N36J 5IQ6A 3OSPA 1IBMF 2FVQA 3CGIA 2AMCB 4HT7A 2QRRA 3EGWB 1UWBA 4DSKA 3KG1A 2Q66A 1WHYA 1RWVB 1NSPA 1YBAA 2HNYB 4LSNB 2B4OA 4PPZA 4DV1F 1S9FA 1UVMA 4I6YA 1UTAA 2JEIA 4K7QA 4OJ3A 2GCFA 2RQ4A 4M5DA 2IRYA 2B9EA 2J7WA 3CCTA 5K20B 2Y3YA 4BWMA 2HZVA 4MK8A 4W92B 3EX7B 1FRJA 1GMWD 4NA3A 4U8YA 3BGRB 4XPEA 3CXCR 1YBTA 2G0JA 1VC0A 3G82B 3AHPA 4X65F 1MMLA 3D3CJ 1MMNA 2UP1A 4NLUA 4ZJQA 3I0SB 4KHPF 4QYZJ 4AD6A 2MQPA 1TU0B 1NK5A 3U1NA 4C8OA 3GIMA 3I0RA 1ITPA 2CQ4A 2B5JB 2R7RA 4KY3A 1FNXH 2E9ZA 3RBXA 3WDOA 4FXDA 4N47A 4Y2KA 4DX6A 2KTQA 1HR0F 3D9BA 1K9MT 4OIXA 4DU7A 1B64A 1Y10A 2G1HA 2OAUA 1KOHA 4FF4A 4QYZK 2V67A 4M5KA 3GU0A 3TEGA 1C4AA 3CCJS 1R0BG 4JI7J 3TZZA 4FNIA 1CQNA 3AAWB 4CZCA 2NYHA 3K58A 2CPHA 2HQGA 3SDEA 1CVJA 3NGDA 4U8VA 3QLHA 4WXWA 2AJ4A 4H4MA 3O3LA 4DPTA 2V8VA 3DKDA 2FY8A 3FRYA 5T7LA 2ROPA 2DJWA 5KG6A 1RU2A 2KG1A 1GMUA 3KLVA 4KV8A 3W7BA 2E1MC 3W5ZA 1G3OA 3CJ4A 3MPVA 4FYXB 4PCQA 1BY9A 3C19A 4FNHA 3I96A 4NZ6A 4DF8A 1RAHB 1EAYC 3MEDB 3ISZA 4GVLA 3M9MB 2R7XA 4I6WA 3GSDA 3AOAA 2VONA 2ZE2B 1MWYA 2ZUGA 3HSGA 5HVHA 5LT5A 3OFHA 3NRBA 3SZ2A 3ENWA 2DISA 1WHVA 1N5TA 2MKYA 3L4BC 1RWOB 5E7OB 1WUUA 1H6KX 3C8YA 4YHHJ 1TKZB 2Z4PA 3IR5B 1FXLA 4LFAJ 2R8GA 2LP4A 1RHRB 1F3FA 2LVWA 4ZCKA 2R2UA 4FYWB 1S49A 3CCZA 3RBEA 4ER8A 1LV5A 2IA0A 4OI0A 3BEGB 4J9LA 3OHAA 1QUVA 5KT3A 4IQMA 4RX6A 4X4SA 2BKPA 1QDUB 4JB8B 2LQJA 3FQLA 1VRQC 5E2QA 5DRKA 1H0HB 5E33A 4KPCA 1KD1T 3DGPB 2OHDA 3G82A 2RS8A 1RLCL 2E29A 2KL8A 2QFIA 1WKKA 4B3MJ 1R31A 4LRDA 4P6QA 1RTIA 4L3NA 5IM0B 3QRQA 4JI6F 2HNZA 4WK3A 2BE9B 4Y34A 2Z2MA 3I87A 1IWAA 2K2PA 3CT9A 3T9NA 1HL6A 3GMGA 3ZZ0A 5J2PB 3F73A 1TFYA 2W24A 2FHOB 1NZAA 1NH8A 4CO0A 4F4AA 1HNIA 2KM8C 4YY3F 1FRLA 3ZC4A 3ZZPA 2BANA 4UUXA 5H9EK 1X7VA 2M52A 1RABB 1APSA 4ILMA 5DG9A 4F3OA 4MK9A 4DG1A 3W5XA 2CUYA 1ZETA 1HWLA 1ULRA 5AXKA 2VJUA 3M2RA 2EK1A 3S01A 3T5KA 1TELA 1F0XA 5I42B 3CMQA 2V34A 2AD9A 4FKYA 2JFDA 4GVBA 1NDLA 2CPIA 5L8RC 4ZCIA 1F2HA 3OTCA 1WF2A 2DYAA 3ILLA 4OI2A 1KQFB 4EUVA 3GIRA 3SCJE 3J7ZT 2Q1LA 3BSOA 3PY8A 2HQ3A 1TL1A 1XK8A 2QMXA 3MEGA 2KU7A 2DNMA 4Y2MA 4ECYA 4EK2A 3RW7A 3PTWA 3R1HA 3BGOP 2J7UA 2IA6A 5LXYA 3M2UB 3NS5A 3IRWP 4MTPA 2ZM6J 1WG1A 5DDOC 4F4XA 3AODA 3R3TA 4IRKA 5H9FJ 2QL5B 4QU6A 2WW8A 4PXBA 1NPPA 3W2VB 4F36A 2W7OA 3CJQA 3SEOA 4B9TA 1S1VB 4AL5A 4PWDA 1U49A 4NLQA 3PACA 4OI4A 1WG4A 1W25A 3BV8A 3FK4A 4KGXB 4ETXA 2QV6A 3R8YA 5EWFA 4Y3CA 3T6BA 3UN2A 1SKRA 1HNVB 3TNVA 2HFUA 3ZXWA 3TX8A 5IFMA 2MKIA 3B6BA 3FZBA 2VPZB 1XR6A 5ETLA 4EBEA 3MXHP 3JAMU 1OPZA 3QZ8A 2B43A 3QLHB 4D3GA 5F9NA 2L41A 5AT1B 2QL7B 4LRBA 1PBUA 1QTNB 1T9UA 4YOEA 2JC0A 1ZM9A 3IAM9 3LP0B 2E5LJ 2YKMA 2ACYA 3KHHA 3HPOA 4DPYA 2DR9A 4LSZB 4DQIA 4A4JA 4OHVA 4DLGA 2KKHA 1REVB 2QTWA 3VGSA 5F9LA 1EETB 1S1WA 4LF9J 3M9OB 1QSLA 2UUAF 2K3KA 3CDWA 3GB0A 4YFUA 2LEAA 1VQ9S 2JOQA 4HT5A 3P3DA 1F6TA 3C66A 4ZP9A 1OY6A 4PEOA 3ZZYA 2XS5A 3AY0A 3PJWA 5RUBA 1UFLA 4DR1F 3NNAA 2AX1A 1VJWA 2W8KA 5KG2A 1HQ2A 3EWGA 5IWAF 2RHQB 4J91A 2B7BB 2AYEA 2ZHOA 3DRPB 4ZKAA 3HDSA 2YNFB 3QNWB 4P9SA 4J9NA 4HYKA 1BGXT 1B0PA 1YJUA 4EYIB 2VBYA 3HLUA 2XS7A 5DQHA 3JSBA 1FDDA 3OXFA 3X3UA 4X62F 1JLQB 4LF2A 1GFWB 4YP3A 4UOCA 1VR6A 2CVIA 3KXDA 4A8QA 3LALA 2EFOA 4C3LA 1UVLA 4CO2A 3DRSB 3TVYA 1JX4A 5KFTA 4EWTA 5KFMA 3MECA 4FVMA 2DR7A 1VBKA 4YB5A 1PJ5A 2J9CA 4PG6A 4PXCA 3QGPA 2FHMA 2I5JB 2VKRA 2YKMB 4PG7A 2BBEA 1YZ7A 5F41A 1CJTA 4LF8J 3PRDA 3FCHA 3CJ3A 2D3ZA 4RW8A 3MDFA 1WKLA 4M8LA 5IC4B 4K5SA 4RUHA 2AWZA 3QT5A 1X60A 4NYOA 3SQOP 3CJSA 1T03B 3P49B 3SFGA 5HAOA 2J0SD 3QYYA 2QLWA 3TP2A 4Y28C 2DRAA 1JWWA 2FUG9 1XBWA 4IG3B 2F5GA 4E8UA 3SI8A 5LM7E 1IQTA 2NREA 4LFCF 1U24A 4IR9A 3ZZRA 5EUHA 2Y9HA 3WZ0A 2QL9B 5BR8F 4DL3A 2DTJA 3A3PB 1BQMA 4UQGA 4KT0C 1LWXA 4GC6A 2RAQA 3RU0A 5G4DA 2XEXA 2ROGA 3IBWA 1FVQA 2ZFHA 5ETQA 3R9LA 5DDQC 4CO3A 1SV5A 5KFFA 4ECTA 1K0TA 2Z58B 4BC7A 4TY8B 2E1PA 1TZ0A 2C2ZB 4OQJA 1RK8A 5D78A 5A6PA 4F4KA 1T05B 3HFZB 3UDEA 1PYTA 1RB0A 4DXLA 4Q43A 4P2SA 3VAFA 4DV3F 3PKMA 3OHBA 3BH6B 1VQMS 5CQGA 3L7PA 5DZ6A 3GPAA 4DPXA 3V6DB 2RQMA 2CQ3A 1NLKL 3R7NB 4OX9F 1U1PA 1BC6A 3HSZA 2QG9B 1DLOA 3CD5A 3HSJA 4RBVA 5LXRA 5KFHA 5KFOA 3DC2A 3DOKB 3MCMA 5SUHA 5J2PA 5B7WA 3V81A 3SCIE 2V2KA 3KYLA 5B0EA 3KHLA 3TAMB 4ECRA 1JKHB 3KKFA 4DMZA 2UUTA 3TAPA 1VBXA 1FJEB 2VC1A 4CT9A 4HH0A 1J2VA 3M8RA 1N48A 1SJRA 1RAIB 3T1HF 3Q8SB 3CDAA 3LH2S 4KE5A 3VWSA 1WF0A 2VDHA 3OVBA 4F3QA 4Q7AA 1TK8A 3DOLB 1HBNB 3GFZA 1N33J 1IXKA 1L3VA 4IH5A 2Q79A 3E01B 3LP2A 2GVDA 1VQ8S 2C22A 4QCLA 3CD0A 3BS9A 5FD1A 1U1QA 3QATA 1U8WA 4DU8A 2WZ1A 2QN6B 1JB0C 3BYRA 5DG7A 4ZPTR 4LF7J 1IKYB 1VISA 3HMJG 1PC5A 1SPBP 1RWMB 3J80Y 4OHYA 2QYGA 5DDPC 1TKZA 4JV1A 4C8ZA 3PEHA 2C2DA 3A3OB 4ZPWR 1ACMB 1GNKA 1Z4UA 3DNCA 2UXBJ 2BOAA 1JLBB 2ZVIA 1GK8A 3AOCA 3GFYA 3L95X 3VR1A 5B0AA 5D3GA 3AD7C 3FCVA 2DNPA 2D41A 2F63A 2KVIA 1CS4B 4FXWA 2R8KA 4JYAF 3CVKA 4U95A 4DF4A 3BSAA 1LFWA 1MSWD 1F5AA 4EYHB 1HBOA 4ZHRB 1FT8A 4K4YA 2OGUA 1RYSA 5IV4A 5AJ3J 3CJKA 3POTB 2QA4S 4ZOSA 4DV7F 2PT0A 4ZA1A 4TQSA 2EEYA 3OXLA 4ZMMA 2W2MP 2Y0BB 1JJCB 3W65A 1SQFA 2FVRA 5BR8J 5KFUA 1RHJB 2EPIA 3KMSA 2Y1IA 2VF3A 1RHKB 2DT9A 1PG5B 2SXLA 5GAHI 2C28A 4B3TJ 3BZQA 2W01A 5DO2A 1CJVB 2IMWP 4OYPA 2IFXA 3SV3A 4MK7A 4X4TA 1FJGJ 1X31C 2I8EA 2ZH3A 3J80U 3H5UA 1FK9B 2OJ3A 1V5IB 2KT3A 2OSRA 5KFQA 5GAHU 1XMOF 1FRMA 3TZYA 2JJ4D 4Z2XA 4NLPA 4RBUA 4LQ9A 5GAGU 2RMLA 1MLAA 1F3VA 5T41A 2CPYA 1BQNB 3D6FB 4L73A 4LVNP 1WEYA 3BBFA 5KFXA 4ED7A 4NCAA 2CRLA 1U1RA 2KG0A 3KTQA 4OZJA 2VBWA 5D0GA 4P74A 3NCPA 1SC6A 3TO8A 2CJQA 3ZFVA 1AT1B 2EG2A 4QR2A 3GIKA 4OHZA 4J9SA 4JI6J 1R89A 2GGPA 2NXUA 2YKAA 4HI1A 4EI2A 4OLPA 4TYBA 3UE2A 4OJHA 1PYSB 2CVEA 2LQ9A 4DFPA 4DSEA 5F8IA 3CE8A 2ZH4A 2UXCJ 5EGYA 3V81B 2DD8S 2CNLB 2VA2A 2AJQA 2JHEA 3I6PA 3M9NB 2VQFJ 1L3KA 3ZTOA 2CPJA 4TLQA 4ED1A 4NXNF 5KG3A 1HNWJ 4QU7A 3AXKA 3FBBA 2ZH2A 2H51B 2V2QA 4I68A 4PYAA 2HVHA 2MKSA 5LSRA 1EARA 4NOHA 5C2GA 1JJ4A 1NDCA 2B51A 1UWBB 2AJFE 4Z7CA 1XC9A 2F4VF 2E7VA 2W2OP 3P4UB 2MKCA 4LRCA 4K5RA 1RT4A 2DIUA 3MM9A 2HW3A 1CPZA 3IA0A 2IY5B 1AROP 1FESA 1S1TB 2HIQA 5I3UB 2XZDB 3FBCA 2UU9J 1NPKA 2C2OB 1RT3A 2RE1A 2I9SA 4HH1A 1IN0A 5E3AA 1N32J 2RDIA 3EJMA 3HULA 3LO3A 1UVJA 1YKWA 3GYXB 3KK1A 4RPFA 1E6VB 4NZ7A 3GV8B 5I4MA 4DFMA 5C7PA 2BDPA 2XWYA 3ZZTA 4B9VA 4E0DA 2BKOA 5DM7Q 2OKQA 1KFSA 3NNHA 1UP1A 2KZMA 3GZ7A 1N0UA 3EDRB 4J9MA 3QT8A 2CA9A 4Y0FA 2W9CB 4K4TA 4CP5A 1T7PA 2UUBF 1U47A 1F5CA 1TKTA 3C6TB 4DZ6A 1FD8A 1U48A 1H3DA 3JTNA 3OSNA 3KK3A 3K59A 1YJ9S 3LAKA 1EP4B 1LWEA 3GFHA 2V8PA 1YDLA 2GIFA 3MMBB 1S7HA 1OJ4A 4RKUC 2ZH7A 1YHQS 1IBMJ 2H3EB 4K8RA 2XSJB 4CYUB 3MM5A 3MWBA 2CQ0A 2Q6BA 3PCOB 1UAWA 2RRBA 4GO7X 1UPMB 2ADCA 1FKAF 2OEKA 3CULA 3PYDA 2Q43A 1SIZA 2PMHA 5F3TA 2VPXB 2QGFB 1RQ0A 4ZP7A 3KHRA 3EVWA 4O0NA 4CNYA 2B8QA 2CAJA 2V63A 3GP9A 4DPUA 2DR6A 2C3PA 4IFVA 2CPDA 3R5DA 3SFUA 5DLFA 4FXVA 4JI8F 3LP1B 1X5TA 1HWUA 1FXDA 1RHQB 1RJJA 3H20A 1MMDA 4L72B 3GILA 3M2UA 4WYLA 3VQSA 3BO2A 2XULA 2LU2A 1RACB 3FRZA 4WJBA 2NXJA 2C2NA 3FCWA 1KS2A 1CG2A 2JNJA 3NWGA 1JLCA 4F7VA 1CS4A 1BHNA 3BKTA 2HG4A 4QZVB 1OQ3A 2RUSA 1I51B 2LQBA 3I4PA 4V19X 4U7UD 2IM1A 4V19J 1Q4RA 1BUXA 2RD5C 1HWIA 1KQGB 2HK2A 4ZVOB 4O3OA 3LWLA 4CI0B 1X4HA 4EZ9A 2OPPB 4M95A 2XMKA 5M2PA 2HHQA 4F26A 1VQKS 4QIWD 2MQQA 4KFBA 4OZNA 1UEUA 3F44A 4OFZA 4J9QA 1X9WA 4ICLA 5CD4H 4DR7J 4CM2A 1BQMB 4Y2AA 1SI9A 3I31A 4ZP8A 2JH3A 2DHHA 1ZM2A 4PXEA 1NHKL 3AQPA 2DY1A 2FGCA 3M6VA 4RBTA 2PI4A 1GH8A 5GVQA 2EFVA 1U0HB 4YDDB 3TYTA 1DURA 2MZSA 3PR5B 1D8ZA 2M7SA 1HBNA 3MR7A 4ZP6A 4O3QA 2ZJPQ 4HKQA 3GIIA 2XZWA 5KFLA 1U0HA 1VGYA 5CD4A 4TKTA 2V4JA 3Q86A 3RW6A 1Y4ZB 4DZDA 4DQSA 4JI4F 3RUBL 3HCXA 2H4YB 4C0OC 1UWAA 2VG6A 2YWFA 1Q1KA 4KAIA 2JL9A 3K17A 3L7OA 1OQ6A 3DU5A 4NLYA 5KOWA 2RDJA 4DG1B 2AF6A 5GMEA 4BBYA 4MIWA 2PEBA 3FSYA 4CLSA 3OR1B 2DCLA 3W8GA 4CWBA 4ID5A 3KK1B 5CXTA 3NGKA 2BABA 1SXLA 1YZ6A 2FZKB 4LQ3A 4OYAA 1BLUA 3R5BA 4L75A 3IWLA 2DGWA 4R0JA 4FKXA 4ZVQB 2RDDA 3MPUB 4O3PA 3P45B 4PAAA 3KLHB 4JI1F 4LRAA 1TL1B 4UT4A 5F8HA 1M1KT 3CIZA 4YQWA 1HI1A 4O4GB 2YNFA 1RTZA 3PFEA 2ZM6F 1SC4B 4RNMA 1GX6A 4Q44A 1Q8BA 2QLBB 1N5YA 2YNIB 2WONA 1RISA 2KJVA 3J81j 4KC5A 2W8LA 3CCSS 4AL6A 1NMEB 3RAXA 5IXUA 5KFVA 3OVSA 1Q8KA 2ZOGA 3N5BA 2VQEF 4CCHA 4EZ6A 4C2MA 5DM6Q 2EBEA 3NXZA 1YJTA 4OZ3A 2E5IA 4P52A 5CYMB 2Y0SD 5HJYA 5J2NA 1U2CA 4LFCJ 3MPYA 4UOHA 2V4JB 2YWEA 1EETA 1FEEA 3MMJA 4ZN1A 1K73T 2H5IB 2ZDOA 4PR6A 3GYNA 2IIHA 3ZZOA 5EDWA 4MJKA 2C2RA 2AJ1A 2MJUA 4QWDA 1FFGB 1R0AB 2F4VJ 4JV5F 2HVDA 3LF0A 1RWKB 1EQMA 3M8QB 4GMKA 2YX4A 3EXCX 3P96A 1RT6B 3V5RA 2CXEA 2GQQA 3VVTA 4I64A 4LBIA 2DNLA 3M32A 4ZPCA 4RWXA 4JI2J 2KYXA 4B3OB 1JXLA 2RHSB 3DRPA 2V8HA 3Q89A 3OTOF 2FTRA 1RT6A 2J76E 4ICLB 5HMZA 2CQ1A 1K1QA 3FFIA 2HHHJ 2OPRB 3BBBA 1JLEB 4DQRA 4CH7A 1IM4A 4M5NA 1PC4A 3PR4A 4WWSA 3HM9A 3TW0A 5A6WA 1XQIA 3P6YC 1JQGA 1WC6A 3K8WA 2R7OA 3CPWR 4RW6B 2RRAA 1S1WB 3T1AA 5J1EB 1IJFB 3I9V9 3IG1B 5AE1A 5D6GA 2ZBQA 1N32F 1OYEA 1OSDA 3VQTA 5ITHA 4CH0S 5HI7A 3MR6A 4O4RA 3A8EA 1N52B 1WC0A 1S4EA 4WF9Q 3VZHA 1T9TA 4A47A 3FMBA 4NLSA 5JJBA 2HHWA 1RAOA 1P27B 1RXOB 3JYTB 3JYTA 3H5YA 1I94F 4N76A 5HK4A 5C42B 4GKKF 2E5HA 1VRUA 1XMOJ 2BE7D 3SSQA 1NRKA 2HS4A 2YX7A 4DCJB 1YK9A 5HSPA 1GTEA 2FIUA 5BYQA 3CCLS 2ZD1B 1H38A 1VQNS 1GT8A 1KHVA 1V6HA 3ILIA 4QPXA 4LF7F 4LFBF 3VAIA 3QWPA 4RNHA 2JFKA 5E41A 5HLFA 2E9TA 1J27A 4WIQA 3MM5B 5IC6B 3H98A 4MKAA 2YKOA 3IFEA 2QIFA 4KHMA 2MZQA 4FVCA 5C25B 1KN6A 4EEYA 1UEKA 5F8NA 4O44A 4LIRA 5EX0A 4J9KA 1XMBA 3QMQA 3OUYA 3B8HA 3DRRA 4U9RA 2QA2A 2ZDPA 2DRDA 4NMLA 4RZRA 3T5HA 1T11A 1K47A 1IJEB 1UCNA 2BVZA 3PRBA 4FYDA 2HHTA 1ZPVA 2H5JB 1XTZA 2J6SA 2HIYA 4K2XA 2VHGA 2XS2A 1U1LA 1A6LA 2AZ3A 2GX8A 4C0BA 4AQYJ 2D9OA 2UZAA 4ELUA 1ZH5A 2F8HA 2MLYA 1VC5A 5KFSA 1FTCA 3CJRA 1REGX 2AW0A 2B5JA 2K06A 4F3MA 3D66A 3DYAA 4NPOA 4ES3A 3TUZC 4CO5A 2XO6A 1HHQA 1M0SA 2AP6A 3QWUA 5B09A 2W4CA 4G1QB 2WK4A 4MT1A 4AXIA 5G0RB 3D1QA 4GVBB 4JI3F 1DQAA 2H4WB 3HZGA 3MM9B 5D8HB 1F9EB 1QUPA 2BW2A 2DH9A 3VVUA 3CCMS 5LSLA 1N5YB 1AXQA 2IYGA 2VG7B 2WSEC 3ITHB 3O44A 3QSIA 2L9NA 4KR0B 4YB6A 4O4GA 4BHQA 1AUDA 2V69A 2IAJB 1OYDA 2CIMA 2UUCJ 1UMJA 2OPSB 1T3OA 1SJ1A 2W2QP 3RAMA 3DXBA 3MR3A 4IH6A 2QLXA 3GJTB 2UV8G 2DXFA 1SQGA 1YVFA 2P9GA 4I7FA 3OR1A 2HQFA 2RKIB 4W98A 2ASJA 3TUPA 4LJMA 5CAAA 4J90A 3UW1A 1DARA 1LFPA 1RBLA 4JOUA 4MKBA 4JV2A 1O51A 2AQ4A 3N28A 1X9MA 4DPWA 2RH3A 1UW4A 4IG0A 5M2UA 2U1AA 2KXFA 4KIAA 2JRSA 4BWJA 3AJ1A 3BDPA 1BWVA 3A12A 3GE9A 4NRTA 1X5OA 2OEJA 2VG5A 1RAJA 2VD3A 4YR3A 1SB6A 2OD6A 2WTFA 4JI5F 4URSA 3QIDA 4ELVA 1HBOB 2FJDB 4NLVA 1HW9A 2IJRA 4DV3J 2GAGC 2L08A 2AU0A 1HHTP 3CO0P 3P5BP 2UUCF 4P2XA 3LP1A 2VPYB 2LECA 4EO6A 4HDGA 3OBIA 1L3TA 4B9MA 2XMUA 5KFWA 2G2ZA 5IT9Y 4HACB 4KGMA 3MEDA 4QBUA 1Q81T 1ZM3A 4F4WA 3D7SB 4ZLNA 3CB4A 1T95A 5CA5A 2RS2A 4BDPA 1RCOB 2IJNA 2KYZA 2V8DA 5SZTA 2XLJA 3HI9A 1C0UB 1NK6A 2F9JA 3NWRA 3MAHA 3HHEA 3CD7A 3EDQB 1TVRB 4NRUA 3DOKA 1IBKJ 2PN6A 3TARA 2MDAA 2O66A 4NLGA 2YWKA 1U1NA 4G3IA 5FLXY 2IPOB 5J1PA 1WD6A 2KXNB 4OX9J 4P2FA 1RKIA 4J9PA 2VICA 1B0VA 3M05A 3PZPA 4B17A 4OJ1A 4J9RA 2F3JA 4M5GA 2O1PA 1F5BA 1PILA 3Q23A 5LMUJ 1R6YA 3VAJA 5FDLA 2F40A 4KV8B 4W4MA 2GAHC 2IHR1 1R27B 3G96A 1PJ7A 1EZZB 1Q53A 2DNQA 2J5AA 1EIYB 5D15A 5KFDA 4HI2A 1XEZA 1YGYA 4CLZA 4WCEQ 3MFHA 2HURA 3FEZA 4ZPDA 1KVKA 1K44A 3M6XA 3NLCA 4TU7A 1FX4A 2VV5A 4OJGA 4U7UK 3IN5A 1TUGB 3ONQA 4K59A 1ZBTA 2VDIA 4C8MA 2RUGA 3WIVA 5A8WB 3MR5A 2WB1D 2CPEA 2XYPB 3NS7B 2GV1A 1CBKA 4DHVA 4C8KA 1TL5A 2BUNA 4ZITA 3V6DA 1DRZA 1X0FA 3ZO7A 4QW9A 4ZIWA 4IG3A 2FC9A 2JSXA 4OYXA 1FDAA 1X0PA 2FHKA 1NBEB 2KT2A 1H2VZ 2MZTA 2B8PA 2OELA 2IVMA 1RE1B 2XMJA 3AFGA 3D67A 4RO0A 4CLTA 4PQUA 1MU2A 1FA0A 4F02A 1Y00A 1NEEA 1FCAA 1S1XB 2GW8A 1WG5A 4WZMA 2B4UA 3DRRB 5L39A 1AW0A 4LF9F 2YH0A 3K0JA 2W2PP 4X84A 4ZVSB 4CO1A 3KLGA 2ZBRA 3KK2B 4USWA 3JXOA 2BYCA 1NM2A 2MY8A 4HTJA 1JNRB 1I6JA 2QMUB 2DITA 4PG4A 2F4FA 4UZBA 1R3NA 2GGPB 2GO8A 4P10A 1EKSA 1HA1A 4WXOA 2LEBA 4ZPBA 2QA1A 5K14A 2VU5A 4WTYA 3VGUA 4ZLPA 4DR3F 2KZZA 3LQVA 1YBUA 5E3RA 4NXMF 2WOMA 3TUIC 3QSYB 3FKBA 4XO0A 3LPEA 2B56A 1HNZJ 3MAQA 1LW0A 2R7WA 2W4PA 4PG5A 4QOTA 4K0KJ 1X4GA 3L9ZA 2CJBA 2JLFA 5L1JA 5E3PA 2Z8QA 1WHXA 4H4OB 3RRGA
chains in the Genus database with same CATH topology
2DHAA 2UXBF 3KNGA 2FLLA 1JLFA 3S1TA 3C2PA 3UI3A 2E1CA 2ZD1A 2PEHA 4NZ0A 2DB1A 1HQEB 1RT1A 2LA4A 2UVVA 1JJ2R 5KFEA 3TAQA 4DS5A 5FDLB 1JLGA 3JB9k 1R8BA 1TQLA 4K4ZA 2N7YA 2DCUB 4BC9A 1IKXB 1WTFA 2LLZA 4C9DA 3K2YA 1W2IA 2I2YA 3H25A 1GXUA 4WU2A 3THTA 1TAUA 1UEVA 5A8WA 2OP5A 3LWMA 2VUGA 4AYBD 2B3TB 2K8GA 4KB7A 4DOZA 2XCAA 1M5HA 3Q2SC 2GJIA 4DR7F 3MM7A 2KFNA 1DTQA 2XSFA 5I3PA 1LWFA 1U45A 2COLA 3MEEB 3I55S 2MKJA 1Y5NB 3BGLA 2RF2A 3BQ0A 2J8AA 5D3GB 2FDNA 1RTJB 1DTQB 4DL5A 3CO9A 3MM6B 4WFYA 2AYGA 5B08A 2OTLS 2ILZA 3J7A1 4IOAQ 1HWJA 3D0IE 3POTA 5KFJA 2AYBA 5L1LA 1WNEA 2KI2A 2XMWA 2GMLA 5HBMA 3HFKA 4C11A 1Q16B 2EVZA 2HHHF 1WF1A 2NUHA 5HO4A 4DUZF 4ECWA 2OPSA 2GQ2A 5A0YA 1IKXA 3HK2A 3DHXA 1V3SA 5DJBA 4ALZA 2B9YA 1BD6A 2KRBA 1FEHA 4IKAA 3UDLA 2R4FA 5KOXA 2RKIA 5DS7A 5KFYA 1YJNS 6FD1A 5IT0A 4G1QA 1JLFB 1LOUA 1ZAVA 3TA1A 2B7CB 2G1DA 3ETOA 1YJRA 3PX0A 1VC6A 1NK0A 5MAOA 3DLGA 1QAYA 2ZHBA 1RT7B 2CDQA 2XO7A 2R8IA 4YB1P 3KLHA 2MQNA 4DL6A 3MTKA 4OI3A 2VFRA 3T1YF 2G0CA 4ZK7M 5DLGA 2UVRA 3MUTP 4EU0A 3N0VA 5EWGA 1IUJA 3Q8RB 4YR0A 4EGLA 1TK5A 1ZZFA 1FD2A 2OPQA 4G6VB 2JEGA 2DHSA 3V4MA 2WSFC 5CCMA 2HGMA 4WE1A 1S76D 4CH1A 1VIXA 2EWHA 1IKWB 2HNDA 3FDSA 4EBDA 4YUDA 4IOBA 2L48A 4QR0A 2IM2A 1VK3A 4OZ5A 4ED5A 2OSQA 3TVKA 1VRUB 4R8UA 4WZQA 3UCZP 1RT7A 2VFVA 4IQXA 2BM0A 1X5SA 3CDEA 1N54B 2C3MA 2WAQD 2GHWA 5A8KB 2QFJA 3PM9A 4C8YA 4KKOB 3DGPA 4NLXA 2NPFA 5I42A 1G6BA 1WEZA 3HT3A 4ECQA 3QO9B 4U6PA 1FRXA 3TRGA 4C7QA 2ZBCA 4A8OA 2AV5A 1HBMB 2I5JA 3BR8A 2KT5A 2J6TA 3BO4A 1VOMA 2CJKA 3CTRA 2BV3A 2MZJA 3H2LA 4C0HA 2QA4G 1U6BA 4QPTA 2FJWA 3MD1A 1TKXB 2K7JA 5KG4A 5KFKA 3FMWA 1VQYA 3M1VB 1SKWA 3KJVA 4ETZA 4ZPVR 4J9OA 2FVPA 2OFHX 5BJRA 3DLEA 2YQ3A 4JI2F 1YQHA 2VFTA 4NX9A 5DETA 1FE4A 4JI0F 4N5SA 2R7UA 3H2VE 4Y2CA 1KR4A 1Q8IA 5J2QA 2BJEA 1SL2A 2BA9A 5F8MA 4BS2A 1MNEA 2XLKA 2O5DA 3EPGA 2AJ0A 1C1BB 3H8YA 4OMFG 2AGOA 4QIVA 1O8BA 3QO9A 4OX6A 1T02A 4I2PB 2DGUA 1VQ6S 5KT5A 2BE2B 4D3HA 4UY85 2P5VA 3H4BA 3TQ1A 3RB3A 1SJ4P 3FEYB 3JSMA 3O8WA 2LXUA 4P7TA 4A8WA 5C24B 4ECSA 4N41A 2HVZA 2QSWA 3SCLE 1C1CB 1TKXA 2FHJA 2XI2A 3FJ2A 2FJAB 5F0WA 4OX7A 4DN9A 3PV8A 1VQOS 1FJGF 3VF0B 4Y65A 1N5SA 4ZCLA 3LGNA 5A8KA 3IRXA 4ED2A 4FN5A 3RB0A 3PW2A 4KKOA 4DSLA 4X64F 5K5MA 1MWZA 4ITSA 3D5MA 1OPIA 2V9KA 2ZNZA 4OZLA 4HLBA 2W9BB 3M4XA 5EHHA 3F41A 2LXFA 5JVGQ 2E5LF 4J5OA 2HNDB 2EFQA 3B4MA 5J2NB 2J9EA 2JLGA 3AB2B 1UA0A 3WC2A 4I4BA 4OL8A 4NLRA 2VG6B 4USJC 5CYQB 4KPYA 2V0NA 2RU9A 2J0QD 1K0VA 1QSYA 4C4WA 2OTJS 4DEZA 3HVWA 1S0VA 2NSBA 3PEJA 5G0RA 2VASA 3CWJA 4OV1A 1U1OA 2FPHX 2RIJA 1DQ8A 4O0IA 2HRYA 1FXRA 3UCGA 2H5EA 1DBDA 3US5A 1VLYA 3S7RA 3RB6A 2M8HA 3MURP 1G7CB 3BGFA 5A8RA 2HNYA 3I5CA 2D74B 2MZRA 3CJKB 1LWCA 4A8YA 2QEXS 2ZKUA 3MM8A 3TOQA 1RKJA 3KLFA 3G9CA 3SSSA 1WI6A 1RTIB 5IM0A 5DGBA 5DG8A 2B4PA 4O44B 4F67A 3M6WA 4I67A 1Y0HA 1HMVA 2F1FA 2B9WA 5A2QY 2E5GA 3PVXA 3ICLA 3MTJA 5A0YB 5D4PA 1LQ9A 3M2VB 2ERRA 3RAQA 3ISNC 4FZVA 3T6JA 2DK2A 2DNHA 1L3SA 2N82B 3R5AA 1JLAB 3IS9A 1Q86T 3NMRA 1DJ0A 1LWEB 3MMBA 3TA2A 2HMIA 2J9DE 2J6UA 3DRYA 3M6UA 2HPUA 4YHHF 1RT2A 2V9WA 3DLGB 3BQ2A 4YEAA 3KMQA 1ZYQA 1FRHA 3G6XA 4FF3A 2XMVA 3CDUA 1TL3B 3CDBA 3HZEA 1D0EA 4X4UA 1ZTTA 2KM8B 2Z2LA 3CF5Q 1HNZF 4JBCA 2L9WA 4EBCA 4B02A 4N8NA 1J5OB 4IRCA 4HHJA 1YWXA 4I2QA 3M8SA 2FVSA 2MHEA 3OLBA 2DNYA 2H9ZA 4C3KA 1W2BR 1S6PB 1S9GA 2M5YA 4XIUA 1U4BA 1UL3A 2KH9A 1TKTB 3C6TA 2EBGA 4J37A 4RW4B 1YI2S 1L5UA 3M8PB 4KBIA 3HVRA 4JI7F 1SIWB 2EW9A 5AE3A 3BN4A 1ZZNA 2K1RA 3UR3C 1QJHA 2MYFA 3JSYA 4NYZA 3QGGA 1LK7A 3M32B 2KRRA 3J7Z5 5L1KA 1NJWA 4QWAA 2DH7A 1OSCA 2JVOA 1U2FA 3MM6A 4B9UA 2NZ4A 1S79A 2ASLA 1MROA 3HHLB 2VOOA 3HF5A 4WIIA 4XDCA 2MQLA 4MFBA 1U6ZA 2CQBA 1P1LA 4LF8F 2LQ5A 2YVSA 4IO9Q 2XMTA 4Y6IA 4JV2A 4TY8A 2D3UA 2MSSA 3FEXB 2GMHA 1M5OC 1U25A 2DR5A 2UXCF 2FJEB 1HW8A 2Y1JA 3MM8B 2KHCA 3DLJA 2UVWA 1S77D 2IYIA 1LWCB 2ROEA 1UVNA 3J7YU 4ELTA 1QVFR 4RW7A 4QWEA 1SKSA 4A46A 1UVIA 2N3OA 2YKNB 2XWXA 3CCVS 4O3SA 4TY9A 3HHKA 1X4DA 3MUVP 1T03A 4NL5A 3IGNA 4K4VA 3OPKA 1SBRA 3NP5A 3FVYA 2I0XA 4RW9B 4R0EA 3CCRS 4C98A 3MMCA 5L9XA 3OJSA 1KSPA 5C5JA 2VODA 2GIRA 3DDKA 1GTHA 1Y5IB 4R5PA 3KK2A 3KLGB 2D1CA 3GR0A 2FC8A 4GO5X 2RILA 4K4WA 2BQ3A 3DFEA 5AXNA 1X4CA 3GIJA 3VAHA 2UV8A 1E6YA 4G1PA 2XMMA 1NJZA 2POKA 2R2RA 2X1FA 4X4NA 1JK9B 1HWKA 5K14B 3HHLC 4C8NA 5K8MA 3Q0AA 3WBZA 1K1SA 2YKNA 1SJFA 1F2GA 1VQ7S 3M8PA 1DHMA 3L09A 4DV6F 5B0CA 2FLOA 2CG4A 2W9AA 4K4SA 1FRIA 5JVHQ 3I82A 4Y2IA 3QAEA 3N01A 3RZAA 2A2CA 3HVTB 2FLPA 3FZ2A 2A2DA 2YWGA 3E3XA 5EX3A 5CZXA 4X66F 4LUBA 4MFBB 3EZUA 3VCDA 3NAHA 4MH8A 1TVRA 4C97A 4AQYF 4FBTA 4X4PA 1QM9A 4JUZA 2CQ2A 3D0GE 4C11B 5HMWA 3M30B 2M4MA 5F8GA 5E5NA 5KG5A 3DLLQ 3LGMA 2BRLA 3OV7A 2BQRA 4RW6A 4DQQA 3MFIA 4LT6A 1GX5A 1M5VC 4OI1A 5LJ5Y 4Z37A 4QWBA 4K4XA 1C4CA 4YMEA 3MEEA 2E5JA 1D1UA 2GC8A 2GHPA 2PSZA 1T94A 3KFWX 1RTHA 2KDOA 1KLNA 2KB2A 3MM7B 2XNRA 2HRUA 4DFKA 4O3RA 3PDNA 3SMZA 3T19A 2OIHA 3D1OA 4B3OA 2VZ9A 4YDXA 2ZH8A 4MMOA 3KK3B 3WX4A 3K5MA 2D3OR 3OXGA 3H4DA 1S6QA 4B3SF 1NJIT 1V9OA 1XR5A 2BACA 1UKUA 2MMYA 4OZ0A 2PD1A 4NLWA 2V8GA 3DOLA 1E6VA 2HVIA 3GV7B 4X4OA 2GJ2A 4A48A 4Q5VA 3B82A 4LF6F 1Q7YT 4GKJF 1ROFA 3KLFB 3ZZZA 2DNNA 4GC7A 3SV4A 2IM0A 2DGVA 1NK4A 3BR9A 1QLNA 3QIPA 4ES1A 1IKYA 3HP6A 3NS6A 4PUOA 2WSCC 4I7FB 3TVZA 1TR0A 4NLTA 4OHXA 5KFCA 4C8LA 1JLAA 3SQGB 1NK8A 4JV0A 5BYSA 3CMAS 2FJXA 5M2RA 1WELA 3IO1A 1U8SA 4N56A 1SV5B 2LKZA 3OW2R 3E2EA 2MGZB 1Y7PA 3RR8A 4F50A 1S6UA 4NWBA 3PIPQ 2ZVSA 4ED0A 3OL9A 4AL7A 4HEA9 4FP9A 4M63A 4URGA 1HBUA 1GQEA 1HI8A 5AXLA 1ZTWA 4DJBA 3MECB 5DGAA 3U7JA 3DRSA 2CZ4A 2X1AA 4ZPAA 4HVZA 3BB5A 3ZZUA 2UVUA 1HFEL 3JTOA 1BWEA 4XPCA 5C42A 5KFIA 4WK1A 3JSMB 2XCPA 1VHFA 5E3QA 2DNZA 5EWEA 4M1KA 2YKQA 1VMBA 1FJCA 1SUQB 3DN9A 4KFBB 4ED8A 2BOPA 4IUFA 1L3UA 1G2EA 5DQGA 5J2MA 2M88A 2M2BA 3JAMY 2MPUA 5JXSA 2BR0A 3KLIB 3RB4A 4DX8H 2J9DA 4RNNA 2FHJD 3HXMA 4U67Q 2CJ9A 2EFPA 5J2QB 2P6SA 4CNZA 4LF4F 1O5JA 3OJUA 2PA3A 4PG8A 2DNKA 2E1RA 5T7LB 3OFFA 1HYSA 3V6KA 1TP7A 4MIAA 3FFIB 1U1KA 4U7CA 2YWHA 1Y3KA 1X8DA 4RW8B 4B9NA 3TANA 4RNFA 2JDJA 2WHOA 2ZHAA 5J1EA 3J81Y 1WHWA 3L3CA 4RW4A 3SYZA 1S1UA 2X1GA 3DM2B 4TLRA 1R0AA 2E7WA 1UFWA 1HNVA 4K50A 1LWFB 3IGVA 5EN1A 4DL0C 2KXHA 3BDEA 3ENQA 2IMOA 1FNMA 1T3NA 3GV5B 3DXSX 3RYLA 3NAIA 1RTDA 3K5OA 2AYMA 2RSQA 3KLIA 1JLQA 4OLOA 2F8EX 5J1NA 5J2MB 5CHCB 3K5NA 3O5TB 1PSDA 5K8NA 4ED6A 2WB4A 1QAXA 2OPRA 3G86A 1XMQF 2HGNA 1NKCA 3LP0A 2DRBA 3U27A 3W2WA 4I2PA 2KFYA 1OS5A 1OWXA 1N33F 4TQRA 2DIVA 3I56S 3DLKA 3LOUA 4DL4A 4A8XA 4A8FA 2JLEA 3IG1A 3MEGB 1FDNA 1RA6A 2M0GB 1N56A 3NMAA 4X4QA 1HBMA 5CYMA 1HNXF 4LSLA 1UVKA 2A1BA 3M2VA 4ID5B 4ECUA 1S1UB 3DM2A 5KTQA 1HMVB 2R8JA 1SUQA 2LYVA 1VQLS 1JJHA 2OFGX 4DV0F 1NNDA 4MYTA 5KT4A 1NJXA 4WFBQ 2VA3A 3HO1A 3UPFA 3KJVB 3UD4P 5ADZA 2DHXA 1VRTA 4KHRA 3TR5A 1YG0A 5HMYA 4PRFA 4LSNA 1MW7A 2JX2A 3N6LA 2AGPA 3TA0A 1H7XA 3DMJA 3JSRA 4LMZA 1RA7A 5GADU 4TU8A 3RBDA 3OVAA 2QO3A 4RUAA 4ZVFA 1FHTA 2HYIB 1RT5B 1X5PA 2OMLA 4IR1A 2OPQB 2DHGA 2EI5A 1VBYA 4ZCMA 3B78A 2UU9F 2WONB 4UY8T 5CYQA 4LSLB 4MYUA 3R5CA 4PWUA 2BJDA 2OH2A 4QIGA 4DPOA 3DI6A 4QWCA 5LL6d 5KG1A 2XBPA 1IBLF 5BYRA 4FF2A 2R7TA 1TL4A 3OR2A 2HHUA 3X1LB 4NCGB 4PUOB 1SH3A 5AE2A 3G8TA 1ZPWX 2ZITA 4ZVHA 4QQBA 5B0BA 4RNOA 2HWIA 3I5BA 5K8PA 2JEFA 4B3TF 4NCBA 1FK9A 1VRTB 2GMJA 4OX8A 4CT8A 4XK8C 2RNEA 1ELOA 2MXYA 1VBZA 4B9SA 3Q8PB 1LXJA 5KFZA 3LUYA 3EPIA 3NG8A 1HARA 1FERA 3MI7X 2CQHA 3V6JA 2IVYA 4IO1A 1KVIA 4K4UA 4DQPA 2NPIA 2VB6A 2ZKTA 5KFGA 4FBUA 4ZVGA 3G6ES 4DS4A 2I1RA 4KSEB 2CQGA 2QMWA 1ZAWA 2RQCA 1NAQA 1VS3A 4G1IA 1AFIA 2YY3A 2ZNYA 4B3MF 5FJ4A 1VQ5S 2CJAA 3O2IA 3BO3A 1JLCB 2PA8D 5KG0A 2QT7A 3CUNA 4QW8A 4IFYA 2XG8A 3NNCA 3QIPB 2HQIA 2JWNA 1DAXA 4DV2F 1H2TZ 1P9QC 1LW2A 3K8VA 3PHEA 1IQZA 3S8SA 4DUYF 4Q2MA 5GADI 3PKYA 4NA2A 2XLIA 3CEDA 1D3WA 1GXLA 1CSJA 1KLMA 2J7KA 5IQQA 5L1IA 3QGIA 2J0WA 1JLEA 4OI6A 3HJFA 3PW4A 2C42A 4PXDA 5HBMB 1P8GA 3AB4B 2ZH9A 4WFZA 1X4BA 1IKVA 3ULHA 2R7QA 3E01A 3AH6A 2CQPA 1JXEA <