1PILA

Structure of the escherichia coli signal transducing protein pii
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
112
structure length
112
Chain Sequence
MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFGRQKGHTELYRGAEYMVDFLPKVKIEIVVPDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRIRTGEEDDAAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIGNAL TRANSDUCING PROTEIN P2
publication title Structure of the Escherichia coli signal transducing protein PII.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Nitrogen regulatory protein
total genus 22
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 1994-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1pilA00
1VFJA 4RX6A 3BZQA 1KR4A 5D4PA 1OSCA 3O8WA 1V3RA 5D4LA 2RD5C 2ZFHA 2XULA 3TA1A 1VHFA 2Z0GA 5L9NA 3NCQA 1UL3A 3CE8A 3TA2A 3N5BA 2EG1A 2XBPA 4AFFA 4E98A 3AHPA 4CO5A 1NH7A 4R25A 5DRKA 4IYQA 4CO2A 1Q1KA 1NZAA 4USIA 2J9EA 4YB5A 4WK1A 4RWWA 3NCRA 4USHA 4YB6A 5DS7A 4NYOA 3O5TB 3GSDA 1V9OA 4CO3A 3DFEA 2NUHA 4RLEA 4C3LA 2XG8A 3L7PA 3MHYA 3HLUA 3LF0A 4CO0A 2O67A 1J2VA 1HWUA 1NH8A 1O5JA 3OPKA 2E66A 2PIIA 2V5HG 3AA9A 4RWXA 3M05A 4D3HA 2GX8A 2XZWA 1P1LA 2DCLA 2J9DE 4YB7A 1UMJA 2GNKA 3NCPA 4CO4A 2NS1B 3AA8A 2J9DA 1UFLA 1V3SA 4NYPA 4Y6IA 4C3MA 4OZLA 3X3UA 4CNYA 3TA0A 4CO1A 4CNZA 4WK3A 1UKUA 4ZK7M 1XK8A 1O51A 1NAQA 1V6HA 4Y65A 5D4OA 1QY7A 1PILA 2NUUG 4C3KA 4USJC 2VD3A 3T9ZA 2O66A 3AH6A 2ZOMA 4OZJA 2JJ4D 4OZNA 2J9CA 1GNKA 2CZ4A 2GW8A 1H3DA 4D3GA 5D4NA 2EG2A
chains in the Genus database with same CATH superfamily
3MD1A 2QO3A 2HVHA 2LQBA 3GIIA 3P8BB 3F0NA 2ZOFA 4EWTA 4U7UK 3BQ2A 3IBWA 1VQ8S 2G2OA 2CNOB 3G96A 3MM7A 2NCKL 2Y1IA 4AXJA 5L9XA 2AV5A 4RWWA 1K73T 2NPIA 4X4OA 4B08A 1YBAA 2VDHA 3N9UC 2KM8C 1K9MT 1FD2A 1HBNA 3PCOB 2HVZA 3PW7A 4DV5F 2RQMA 2PI5A 3ENQA 3JQJA 1S1XA 5F8JA 1UVIA 5KFYA 1FK9B 1UCNA 1FHTA 2CPEA 4CO1A 4EZ6A 1U09A 3MM6B 3IMQJ 2NUUG 2NXEA 1YZ6A 3RW7A 2JJ4D 2WONB 2P6SA 2V6AA 4X2BA 2AZ3A 1X7VA 2OFGX 5LJ5Y 2GGPA 3R1LA 4JI7F 2V67A 5LMUJ 4EBCA 3H90A 1PBUA 4CYUB 3UFCX 3K0JA 2FGCA 4B9LA 4USVA 5A8KA 5HI7A 4IR9A 1UWBB 1B70B 2G2YA 5I3QA 1E6VB 3DC2A 2PMWA 1DURA 1HARA 1S1UA 5IZHA 4CP5A 4DEZA 2AMCB 3RAQA 4YN3B 1S9GA 4DV2J 2YKNA 1HQUA 1UFWA 1WEZA 4ZN3A 1KQFB 2M2BA 3HHKA 2YNHA 1R8CA 1FA0A 1JIHA 4CLKA 1RTZA 4WXWA 1JLAA 1QM9A 4DU7A 4M5HA 3MR7A 4CLSA 1N5QA 3RUBL 1CSJA 4PWDA 2CNNB 2Y1LB 3M9MB 4YP3A 1IBLJ 2CZ4A 1GEHA 3MGJA 1MMDA 3KHLA 4KC5A 2YPZA 2QMWA 4NOHA 1U6ZA 5CYMA 3CCSS 3R7SB 3AOBA 3DGPB 2BM1A 2BRKA 1KLMB 3DLGA 2AEJA 3VHQA 1MWZA 4USMA 3MMAB 4JYAF 4WF9Q 5IC6B 2FY8A 1NDKA 1TKZA 4PYAA 1N8RT 1NXIA 4KGVB 4Y2KA 4F8RA 3AA9A 3W9JA 2NQPA 2FD2A 2VBWA 3LP0B 1FXLA 4TN2A 2V4JB 3SSSA 2XCPA 2KL8A 4G1PA 4DCOB 4R8UB 1BE4A 3W60A 1FFGB 1S49A 2XYHB 4U9RA 4ZS6A 4CNZA 3TYTA 2E1CA 5HROA 4I2PA 4B9UA 4ZPTR 3H5UA 3CCLS 4C48A 1UPMB 3HJFA 3THVA 4FDFA 4PEOA 1TQLA 2YWHA 2ZE2A 2WCXA 1N32J 4ECWA 1SC4B 1XIQA 3M2UA 2A6OA 1VK3A 2J0QD 4K4ZA 5IT9Y 2D9PA 3N6MA 2P2CB 4CT8A 1VRUA 1PKUA 4MH8A 1VHFA 3SFGA 1TUWA 3MUVP 1U4BA 1H72C 4YHHF 3H2VE 3DLEA 2UUBJ 3CVKA 2JVRA 3OLAA 4BLGA 4XPCA 2QLXA 3R5AA 4JI4F 4Y2MA 4J9MA 5J2MA 2JLFA 1MU2A 4HR2A 4CLYA 1LW0B 1U7LA 2OHDA 1TMMA 2GVZB 5KOWA 2BANB 2ZC4A 4PPZA 1NDPA 5L8RC 1JNRB 4J9RA 2HNZB 3ISZA 3HZGA 4X65F 2LLZA 4AQYJ 1VQKS 1CLFA 5D77A 3VZIA 3J7YU 1WHYA 3CJ3A 4BWMA 2Q43A 1V6HA 4YUDA 3SSRA 4KPCA 4FPIA 1R0BG 2OFHX 3NP5A 1TZ0A 3BGUA 3KK1B 3ZZPA 2VPWB 4Q8EA 1URNA 4QWEA 5HMWA 2FLOA 3HX9A 1UL3A 2FHKA 1IKWB 3HSJA 4LMZA 2E5GA 1FDDA 2RT3A 4NLWA 3JSRA 4PZVA 3I0RB 1VRTB 3D6HB 3N6NA 4H4KA 1G4CA 4ZPCA 2LU2A 1TU0B 1R8AA 3K17A 5CH7B 2ABYA 2OD6A 2G9OA 1X4DA 1SBRA 1LEOA 3OPKA 3ZZYA 2CPYA 3GG1A 2GX8A 4KGZB 2DNLA 2PC6A 2GQQA 4RZRA 2V2KA 4N47A 4LRFA 1TK0A 5IS2A 2K7JA 3OXLA 4ECXA 4LF1A 4Y0FA 2VPXB 3L09A 2ZM6F 6FD1A 2FPHX 1QDUB 2B9WA 1T3OA 1XWLA 2VG6A 2IPOB 3I87A 3HHEA 3OXGA 2OD4A 3O8WA 3V6KA 4DFKA 2XY5A 4J9QA 2VV5A 3TR5A 1A6LA 3WHIA 3EICA 1RAJA 2FTRA 4HACB 5IM0A 1P6TA 2WW8A 2Q1LA 3BSOA 4LQ3A 3CCQS 4F36A 2D3ZA 1S6QB 3O3LA 3K57A 3C14B 3R2DJ 3MM5B 1YGYA 2XS7A 2Z2MA 3E01A 2BQ3A 3KLHA 2JOQA 4YEAA 1TL3A 1JLGA 3MD3A 4YDDB 4PABA 1IBMF 2Y0BB 2XWXA 3HSDA 3BGRB 1L5UA 1M5HA 1SB6A 3D1QA 2HNYB 1HBMA 1LQ9A 3CDEA 2BYCA 1PG5B 4NLVA 1LOUA 4KQZA 5A0YA 4A46A 2W8KA 2FJDB 4OZ2A 2KH9A 3KK3A 3ET6B 2J76E 3ZXWA 1JLGB 2XLKA 1F9EB 3R6LB 2B43A 3GMGA 1JX4A 2Z0GA 1HNWJ 2VODA 2XWYA 4PAAA 1M5OC 1U0HB 4ZVSB 1C1CA 5FJ4A 3NLCA 1IR2A 4LSNA 2BJEA 2RU9A 4RU9A 1EIYB 3KUHA 3PM9A 2XG8A 3KJQB 5CZXA 2DGWA 1CQNA 4ZJQA 3FSIA 4YOEA 3T5KA 2W2MP 3CIMA 1MSWD 2KM8B 1H2VZ 3AA8A 2E44A 3HSZA 1XQIA 1I3OB 4P2XA 3ONQA 1RT5B 3CJ5A 1U1LA 2PMZD 3HM9A 1B3TA 3MAAA 1N0VC 3M9OB 1FJEB 1EHWA 4C3KA 5LSOA 1BQNA 2MZTA 2KT2A 2QL7B 3LANA 1V3ZA 3Q86A 1DZ5A 1VLOA 1CS4A 3TUPA 4AL7A 3UI3A 4XDDA 3DYAA 2QMUB 2VC0A 3NWGA 1UPPA 2R4FA 1RT2A 2G0IA 3D3BJ 2B7CB 3I0SB 2QJ3A 4IG3A 4YR2A 3I6PA 4CLFA 3MPWA 3SZ2A 3IFEA 1M5VC 4QOTA 3PX4A 1TKDA 4KB7A 2HHVA 3IA0A 2AYBA 1WG1A 3DM2B 4MJKA 3I9V9 1NLKL 4KV8B 2IYIA 1UMJA 4PG6A 1V5IB 4FXVA 4C8YA 4ED1A 3MM8A 1UJ5A 4RU2A 4O44B 2HHWA 2CWXA 3QRRA 3OFFA 1TUGB 1KQKA 1U24A 3ENAA 4M94A 2CZVC 5SZTA 4L6V3 4F26A 1R6VA 5ETOA 3U02A 3GYNA 4J91A 2X1FA 3BZQA 5KFEA 4DR6F 4TQSA 1KC8T 4DR1J 1NUEA 2HS4A 2OEJA 3IRWP 1T7PA 4L3KA 3HVTB 5C42A 1I1GA 4KHPF 1REGX 2F63A 2DHGA 1VMBA 3OTOF 2D1CA 1SV5B 3AD8C 3TI0A 4Y00A 4OX9F 2ZVSA 3O44A 4I69A 3MR2A 3H2LA 2QYCA 4C0OC 4B3SF 1VQMS 3LP1A 4PXBA 3PVXA 2GZOA 2CPZA 4LRBA 4J9PA 2HFZA 2DYAA 2VF3A 2HPUA 4AE5A 1ZA1B 1M1HA 1WOPA 2ZWOA 5HATA 3D68A 3GWCA 4NXMF 2NZ4A 3NOGA 1VQ7S 3W66A 5KG5A 4HI2A 3CJ0A 2WZ1A 1H7WA 1O0PA 3OL6A 2VB6A 5A2QY 2AX1A 1FWLA 2G4BA 2VH7A 1NSAA 2CJQA 4TU9A 2BACA 2NXUA 4ES2A 1SPBP 1J5EF 4WCEQ 5HLFA 3C6TB 3W5XA 4B9NA 4IFVA 3TA1A 4DV6J 3FQLA 2DEIA 3CGIA 3TA2A 1S9FA 2L08A 1YZ7A 1XMQF 1T9VA 2ZD1A 4IH6A 4DG1A 2FJVA 3DRRA 5CD4H 2ZH7A 3WX8A 1SCJB 2DNHA 1BY9A 4NE9C 3DMJB 3KUGA 2P9EA 1YBTA 2HNDB 2DNMA 3QBCA 5DM6Q 3T3FA 3E3XA 1VCTA 2EFPA 3SCKE 4FP9A 1S6PB 1MWYA 4LRAA 2GJIA 4HH0A 3UDVA 3P96A 3M2RA 1YRTA 4CM2A 3CDWA 2DGVA 2KZZA 2GV1A 2MGZB 4PYDA 5THWA 2E7VA 1XERA 1K8AT 3CCTA 5ETLA 4O3NA 2FC9A 3DHWC 1AT1B 2HIYA 4NCGB 3CCES 5KFTA 4WPAA 2I0XA 2ROGA 4M1KA 4DMZA 4YY3J 1D9FA 4QR1A 3Q8PB 3LOUA 3W2VA 4ETXA 1P9YA 3UR0A 3TZZA 2DO4A 1IJFB 4Q43A 1BWVA 1NNDA 2C2RA 4ALZA 1LWEA 5GAHI 1CULB 3VAKA 2LXIA 5T41A 3D54A 2LU1A 4LFAJ 3BJYA 2AW0A 3GONA 4KY3A 2B8PA 2MPUA 2GJ2A 3FSXA 3UD3P 3KLIB 4IFYA 2VKRA 5DGBA 3G8SA 1ROFA 2IBKA 3M8PB 1X0FA 2ILZA 3R5DA 2IIHA 4ED4A 5BYRA 5BYQA 3TJ9A 5EGYA 1Q82T 4GVBA 1DBDA 3PKMA 1T9XA 1GNKA 2HRYA 5HAOA 3K5NA 5DDOC 3CD6S 3AD7C 2HHXA 2QSFA 1RKJA 2RJZA 2F3JA 4NA1A 1LKZA 2H4YB 1K44A 1RT4B 3ZNUA 4UZCA 2HMIB 4PG8A 2B6AA 2CWKA 3ZTQA 3CC4S 2FJBB 1JLEA 1Y7PA 4I0WA 4GVBB 3C15A 1NRKA 2N4DA 5AXKA 3OT9A 3R7NB 4WU2A 1ICEB 5A8WA 4JV2A 2O01C 3G8TA 1Y3KA 3R5JB 1WORA 5C24A 4K4TA 3SQOP 1H73A 4LF6F 4JYAJ 1A0OB 2MY7A 5KFKA 2B6AB 2KVIA 4OYWA 3PHEA 1OQ6A 2I38A 3IRXA 1JJ4A 3GIJA 3PYGA 3RAMA 1H98A 2HWIA 3OL8A 2VG5A 3KHRA 2R9LA 3SDEA 2CQPA 1F1BB 2CRLA 2VFVA 4KKOA 3K59A 2DIUA 4J90A 3R2CJ 3NAIA 3W8GA 3HO1A 1U47A 3OTEA 3RRGA 1Q78A 2N7CA 3EJMA 2GJFA 1R89A 4RBVA 2R7OA 2HW3A 3RRKA 3V6HA 1JLCA 2C2OB 2JRSA 3SCLE 1VC0A 5E33A 3DRPB 3K8VA 1PYOB 3CJQA 2LQ5A 1UVMA 4ZJOA 2M9KA 4LBPA 2KHDA 1OQ3A 3E2EA 3HVWA 4YHHJ 4F04B 2ZEJA 4X4TA 1NKCA 1RTIA 1V9OA 2DIVA 1HI8A 4JI4J 1S57A 4ZPVR 2GHPA 3CDBA 4N5SA 1TAUA 1FD8A 4NZ6A 2AJ2A 5KT6A 2XZWA 4ZJLA 2ADCA 1TKTB 3A3PB 1YJUA 2YKMA 3NY0A 1IM6A 1R3NA 2RF2A 3S7RA 2K1RB 2KDOA 4OV1A 4NYPA 3M8QA 1ZBTA 3HMJG 4CLLA 4X65J 4Q44A 1P1TA 2CPHA 1I5OB 4B3MJ 1RWMB 3V4MA 4N8NA 3FQKA 3CT9A 4CTAB 5A6PA 1PCAA 4B3OB 3AT1B 2Q79A 4E0DA 2XLIA 2BOAA 3GYXB 4OX6A 3U1LA 2D74B 2ATLA 1UP1A 4IRDA 5F0UA 3DGVA 2AWZA 2Q6CA 1N5TA 1VC5A 1HWKA 1O6XA 4DV7F 3FCWA 3QLHB 1WSVA 4PQAA 2BE2B 1FRLA 1PC5A 4BS2A 4ZN1A 2OPSB 4ZMMA 4Z37A 4MT1A 1UWAA 4J9NA 4LREA 3AAWB 1RAAB 3N5FA 4LIWA 5K20B 1JLFB 1H7XA 2UVVA 1OS5A 1Y9OA 2QLFB 2L48A 3KUEA 5I3PA 3EZ5A 4GO7X 3TVKA 4KE5A 4NEZA 2HS0A 5F3ZA 1FJCA 1N56A 1VQNS 3AJDA 2YNGA 1QAIA 2NSCA 2M8DB 1BQMA 3B78A 5C25A 5KFBA 3KK2A 4WKYA 4K4VA 3OVBA 1FCAA 2YNFA 1U6FA 3KLVA 3IBCB 3OBIA 4OJ3A 5B0EA 4DSLA 2ZM6J 2HBYB 2HZAA 1YIJS 3DXSX 2L9DA 2E9ZA 2XB2D 2FZGB 4NX9A 5E3QA 1RT7A 3N28A 2WHOA 4M95A 3G6ES 5HP1B 2RRNA 3MCOA 3GJTB 2BOPA 2GIQA 2HFSA 3UCZP 4RO0A 1Q7YT 1QE1A 2V9KA 3I56S 1BQMB 4ANDA 2HEKA 5GAGI 1RP5A 1TL1A 1C4AA 4OIXA 2J6SA 4OX7A 1XNRJ 4DS5A 4A48A 3KLGB 2ZVIA 4WYLA 2BDPA 4M5DB 2CQ3A 4O0NA 2QL5B 1RT7B 5DZ7A 1LW2B 4ED5A 5I42B 2B56A 3I96A 1ZZFA 4NWBA 3Q2SC 1X4HA 1RBAA 4I56A 3GJSB 2MKHA 3CCVS 5KFCA 1MROA 1SUQA 2J9DA 3MECA 2FJXA 4C98A 4O3PA 4F7VA 1WHVA 1IBMJ 5FIIA 2ASJA 1DRZA 2BW7A 2PN6A 3PRBA 2IJRA 1FJ7A 5GAEI 5DDPC 2RDIA 1HMVB 2W7AA 3EUNA 3HD1A 1WG5A 1YWXA 5BJRA 1HBOA 5F9NA 2KFYA 1HPZA 2VOPA 1Q8IA 4Q7AA 2DTJA 1RAIB 2RRBA 5A6WA 3B8HA 2RH3A 4V1Ak 2QYGA 4P73A 3JTPA 1NB7A 1FJGF 1FDBA 2J8AA 1FDNA 4CI0B 4IDKB 4ZHRB 4I64A 3QGIA 3D66A 2QA1A 4RKUC 2QA4S 1U1RA 2C3MA 4NEYA 4DL2A 3JSMA 2CQ2A 2RQ4A 3Q8RB 2EBGA 5KT5A 1Y5LB 3NGRA 1CJUB 4N7TA 3PRVA 4OMFG 3BREA 2JWNA 3CF5Q 4OX8A 2J7KA 4PG5A 4A8FA 4WKRA 4FKYA 1R8PA 3SBMA 4Q5VA 3HVRA 2N3LA 3HKZD 3OW2R 2Z4PA 3RR7A 3B82A 4UTGA 1PYSB 2G13A 4Y6IA 3FJ2A 3MTKA 1QLNA 1YSJA 3MUMP 4CLTA 1ZYQA 4J9UE 2RMLA 2B4UA 3KJFB 3UDEA 3VF0B 2WK4A 1NK4A 3CJ8A 3EZOA 4LR7A 2AD9A 3W1YC 3E51A 2J6TA 4A8MP 2DR9A 2IM2A 4D3GA 1B64A 3BR9A 1GK8A 1Q53A 4RX6A 5L1JA 3TAQA 2YWKA 2AU0A 1DAXA 3OR2A 1M5SA 3KMSA 2IVFB 3EZUA 4OHXA 3KG4A 2AEMA 5C7PA 1HIYA 3RBZA 1DTQA 2F8HA 3BF4A 2XMMA 1NK6A 3BB5A 2ZHOA 2IDEA 4I6AA 2VQFJ 1SQFA 3M8ZA 1QUVA 2OSQA 5DDQC 1VBYA 4CLZA 4O4GA 1SIZA 2RILA 1Z1ZA 3W65A 3PX6A 1VYAA 3EE3A 3OQ2A 4X4QA 3FCHA 1UVNA 2XSJA 2KT3A 1DTTB 3M9NB 3PYFA 1S0MA 1FKPA 1UEUA 1S0VA 3OTCA 5LM7E 3UVJB 2QLWA 4ECUA 1ZM9A 5CABA 1OY9A 5D4LA 4YQWA 4I2QB 1DHMA 4WTOB 4URGA 2CKWA 1T0TV 3H0PA 4TLQA 4R25A 3A1YG 1VJWA 1EKSA 2JL9A 4C97A 4QBUA 1WC1A 4DN0A 1M5KC 3MEGB 4IR1A 4KH1B 1VQYA 3TVYA 5B0CA 1SJ3P 4H4OA 3TARA 4NL5A 4KHPJ 4UY8T 3Q8SB 3MMBA 2VBZA 2J0XA 4DSJA 3ZTSA 2FVRA 4OX9J 5KFXA 3DLKB 4PWWA 4FYWB 5F8IA 3M05A 1JLBA 3HK2A 2YQ0A 1Q4RA 2JH3A 5J1NA 5JXSA 3EPGA 3IM8A 2R7TA 3LAMA 1W25A 3IS9A 4ECQA 2A10A 3AOCA 3KLEA 1YJNS 4OV6A 1GMWD 3IWLA 3ZFVA 2XGPA 4ZVEA 3UNYA 4F2SA 1S7HA 4MFBA 3DRSA 1IJEB 3MPUB 1KBRA 3IR6B 5J2PA 3DKDA 4O23A 3WC0A 4X66F 1NM2A 1FRJA 5KFGA 1LFPA 1RDRA 2IFXA 2EXUA 2ZKTA 4B3TJ 3KLEB 2PEBA 1G2EA 1J5EJ 3QWUA 3CCMS 1KQSR 3KDNA 4DX6A 5F8LA 5I4MA 5AXNA 1XMQJ 4ZPBA 2UU9F 1HW9A 1BUXA 3UDCA 3R3TA 2B9XA 2BXJA 3MEDB 3I5CA 1PJ5A 4QZVB 4LR8A 2KO1A 2MLZA 2AF6A 4BHQA 3CNQP 1QJHA 3QJPA 1F5AA 2NXCA 3GCWP 3JYTB 1KQGB 2HGNA 4RW7A 3K2YA 3DCAA 2R7VA 1SQEA 2DPIA 4ZP9A 5FDLB 1Y10A 3R5GA 4I4BA 4FYXB 2HWHA 2DNGA 4FBUA 3AH6A 4N8OA 2ASDA 4OYPA 4DCJB 1U1QA 4FS1A 1QTMA 1SJRA 2R7WA 2QG9B 3UD4P 2FLNA 4DV2F 2OO4A 4F0KA 5ETSA 3T5JA 5HJXA 3V5RA 1YJ9S 1D9AA 2OEMA 1JLQB 1VBKA 4NLDA 5J2QB 1AROP 2Q3PA 2UV8A 5AT1B 2W1BA 4DX8H 2J7WA 5GMDA 3PJ9A 3ZC4A 3M6UA 2GVDB 5E7OB 2IM0A 2MLYA 3IG1A 1OSDA 3GSDA 4RW9A 3M1VB 1E6YA 4YMEA 1QSSA 4DX5A 1IBLF 1GXLA 3QZ7A 1R8BA 2O1PA 4UQGA 1RAHB 4YB7A 1U1NA 1REVB 3AODA 1JWWA 2ZHAA 4ERDA 2C2KB 2IRYA 1UZHA 2ZH5A 3T19A 2OELA 1YLXA 1NKBA 5KFPA 3WDOA 2M0GB 1PJ6A 2R8IA 3CJ4A 1IQTA 3QT5A 3RJMB 2DXEA 3MXHP 1GMUA 2VQEJ 4NXNJ 2HQCA 3MAHA 1RHRB 5D0RA 1ZAWA 3SQGA 3KJVB 4UOGA 3M8WA 2CQ0A 4OFZA 4P75A 3WZ0A 1Q1KA 4QJVA 2J5AA 3W63A 1TL7A 2QC3A 2PA3A 4USWA 1IBKJ 3VTIA 1CJTA 3C46A 3V81A 2L3MA 1F9HA 3D28A 3PO4A 4Y34A 4RW6A 1SKWA 2ZBPA 1J2VA 1N32F 4HT7A 4DQPA 3TAMA 4EYIB 3DI6B 1ACMB 2FHJA 2VJUA 2J9DE 3IM9A 2VHGA 4OYXA 3H5SA 1UFLA 2DXFA 1DLOA 5BR8J 4H4MA 1EJ7L 1SKUB 3DLLQ 4GO5X 2AYMA 3IR5B 2UUBF 3JB9k 1S12A 3SYZA 1TMJA 1RCOB 3M4XA 5EX3A 3KMQA 3CJTA 3W2WB 4LRCA 3H5YA 3LP2B 5DQGA 1H2UX 5D4NA 2V68A 4EMDA 1KTQA 2XZDB 2WSFC 2Y8WA 3NWRA 4Q0BB 4GKKF 2UZAA 1RAEB 1JKHA 4ZP6A 1T03B 4F67A 4FZVA 3WBZA 4ATNA 1JK9B 3OR1B 4UUXA 3NGUA 4IYQA 3D6MB 1S6UA 1CJVB 3NL0A 1GT8A 3I32A 4MKVA 1ZH5A 4OYIA 1S6OA 1Q16B 2QEXS 2YH0A 4F02A 3HF5A 3EXYA 2F8EX 1Q8BA 2B51A 2ZZNA 1C1BB 2WTFA 3J81U 4IG0B 4ER8A 2FY1A 1CQMA 2DH8A 1HWUA 3QT6A 1RBLA 4J9KA 1VISA 2V2ZA 3FKBA 1ZAXA 4WE1B 3TP2A 3MM9B 1TAQA 4P6QA 1F3FA 5K8MA 2CYYA 4EEYA 1Y3JA 4K4WA 4BWJA 3FVYA 1P9QC 2LQJA 1XR5A 4S0MA 4WXOA 3DOLA 2DRBA 4DWIA 3TW0A 3CC2S 4Y2CA 4QU7A 1AFJA 1ZTWA 4UF4A 4P2SA 2OPRA 4HHHA 1X60A 2M8HA 3MR3A 2F40A 4DOZA 1I6JA 4TY8B 3BBCA 3MEEA 1D09B 1P27B 3NAHA 3OFGA 1SQGA 4RL1A 3BPDA 5KG4A 3IC1A 4WP8A 3VGSA 2G1HA 3CB4A 4KHMA 3M6WA 1RQ0A 6FDRA 4J9SA 4J9OA 3L3CA 4DV7J 1RA6A 4RNOA 4C0BA 2MKJA 3C16B 2FHMA 4I7FA 1UA1A 1HNIA 2NLWA 4QWBA 4JB8B 4A8WA 4ZVGA 2IRUA 5DLGA 2YH1A 1RT1B 3MMCA 2W4PA 2XI2A 5CYJA 4ED6A 4ZPWR 1K47A 4GKJJ 5CZVA 3QIDA 3NBPA 4MK9A 3TEHB 4KT0C 1LXJA 5EX0A 3PW0A 4DPWA 2GQCA 1SJFA 5BYSA 1RU2A 2DGOA 3SV3A 1U1KA 1AUSL 3JAMY 2RVJA 4DPOA 3FUYA 3VAGA 2HBZB 3MOJB 4CIOA 1S9EB 3PW5A 3BH6B 4K5RA 3FFIB 3HKWA 4R5PB 2XNQA 4OI2A 5F8NA 2LCWA 5CYQA 4WIIA 2D3OR 3MZIA 1OIAA 2K2PA 4HHUA 2IVMA 1PIEA 2HRUA 1P8GA 1LWCA 2CZ9A 4F3MA 1J27A 4NLTA 2D7SA 4XIUA 4DV3J 3NGKA 3QATA 3DLBA 3TZYA 2AP6A 2ZH3A 3T1YJ 5RUBA 1Q81T 3L7OA 4YB5A 1MN9A 4MK8A 3NNCA 3JTNA 1N52B 4EBEA 3L7PA 3OTDA 2C3PA 4CO0A 5KG2A 1YG0A 4LT6A 1FT8A 2B5JA 5DQIA 3N01A 4FBTA 3BKTA 5KFVA 1RTJB 3IGNA 1NPRA 4CZCA 5IOLA 2MHNA 1IVZA 1HNWF 2GMLA 3AD9C 5KT3A 4DUZJ 3GR1A 4DL6A 4NI2A 3V6DB 4YS2A 3LQVA 4ENOA 5IQ6A 1FKOB 4H54A 5HMZA 2MKCA 1XNQF 3HP6A 1OSCA 3Q83A 4ED7A 1F9FA 1FE4A 1YVFA 5G0RA 2CIMA 1R27B 2NXJA 2V8HA 1HNVB 2F4FA 2V50A 4FYDA 3IBFB 4ELUA 2W4CA 3HCXA 4G1QB 3MR5A 2W2NP 1HWIA 1FJGJ 1S1WA 2CJ9A 4ID5A 3TUIC 2ZNZA 1QAJA 1U1OA 2IC3B 2ZZTA 2QA4G 1RT3B 4U6PA 1U02A 3LGNA 3OUYB 3CCUS 3BO2A 3KJNB 4TNOA 3HHLD 5K14A 4DX7A 5A8RB 3I55S 2HQIA 3VQSA 1N5YA 3K7RA 3QIPB 2VONA 3MCMA 1JXEA 2DVIA 5T7LA 2XYGB 1B7YB 2ZZMA 5HK4A 4IO1A 4DFPA 1VQ5S 1VR6A 5DLFA 2KT5A 3B4MA 2MZRA 4Q8FA 2MEWA 4LF7F 3JQKA 2JEGA 3ZTPA 3VV2B 2OPQA 4U8VA 5HBMB 2XHWA 1RWUA 2RD5C 2VG7B 4NLPA 3I5AA 4UY85 1FRXA 1S72S 5KFSA 3M30B 3MPVA 5E3CA 3PEJA 4JI0F 4UT4A 3KG0A 4Y3CA 1S1TA 2GMHA 1SL0A 2EFVA 1APSA 2GS8A 5I3UA 2COLA 2IJNA 2UP1A 2J9EA 1NKEA 2PD1A 3DOKB 3GQCA 3CC7S 1SH0A 1FKAF 1IBCB 2ERRA 2FVQA 4ZVPB 3W62A 3R8YA 2VASA 4HT5A 2AJ1A 1TELA 2IHR1 2YQ1A 3HFZB 2R8JA 1KTVA 2IVYA 3GFXA 3RYLA 3NNHA 5ETPA 3DN9A 4DR1F 1RCXB 3QFWA 3PNIA 1RTDA 3RW6A 3TWZA 2XLJA 4PUOA 2NREA 3KNAA 4Y65A 3Q8QB 2AJ4A 2YWGA 2WOMB 2P8IA 1VQOS 5KFDA 4RPFA 4KFBB 3LGMA 2AX0A 1HBUA 3NGTA 2ROEA 3GIRA 5D4PA 4E2FB 3HHLC 3NRBA 3FK4A 3DDKA 4JP8A 2ZJRQ 5IT0A 2VZ9A 3AHPA 2D69A 3EGNA 2WVDA 1PC4A 2KFZA 2JHEA 1F2GA 1HYSA 1BXNA 1PGZA 1TKXA 1OY8A 3PIPQ 2KYZA 4PQUA 1RA7A 5L1IA 4EU0A 2XMKA 2LFVA 1VHIA 3RBEA 1EP4B 3WQPA 4RNHA 3T6JA 4AYBD 2PI4A 3AXKA 2ZJQQ 3M2VB 4V19J 4CCHA 4FXWA 1KWMA 2FYXA 3D0HE 2OLWA 4UOHA 4JI6F 4CWBA 2VU5A 1L3VA 1KVIA 3GTYX 3TO8A 3FRZA 3DDNA 2HQ3A 5AE1A 3ETMA 2KRBA 1YI2S 1HHTP 4ANEA 2JVOA 1U2RA 4BDPA 4DDFA 1IKXB 2EPIA 1RACB 2F9DA 3OXFA 4K0KF 4C11B 2IJFA 1S5ZA 4K2JA 1FK9A 2HK3A 2PEHA 2E5HA 2XULA 4DLGA 3C66A 3MM6A 4U8YA 4WBFA 1BC6A 3SCJE 1CC7A 2J0SD 3MI7X 4X66J 5ETQA 4DUTA 1A7GE 4JI1F 2WONA 4GC7A 3RRHA 4PG4A 2XMVA 2H51B 4XO0A 4DV0J 2CPDA 4EYHB 1K0VA 2WVCA 3SXLA 2L9NA 3VWSA 4CYUA 2B9YA 3G86A 1NB2A 4KR0B 2H65B 2B3TB 2UU9J 1FRMA 3D67A 3M32B 3ZZRA 1UWBA 4ZOSA 1E6VA 3PW4A 1Y5NB 2ACMA 4CDIA 2XM3A 3A8IA 3VVUA 3FEYB 2RSQA 4YY3F 2GMJA 3QO9B 1XBWA 4P7TA 2KU7A 1FRHA 2DB1A 3NKYA 4QR2A 4WZQA 4I6YA 3Q2TC 1Q5VA 1RT6B 1C4CA 4TXSA 4EO6A 2KJVA 4LFAF 4E8UA 3W8PA 3H42A 4HI1A 2V8VA 1Q8KA 2MDAA 4LIRA 1ZTTA 2GCFA 2ZDPA 4DL7A 1HI1A 2PT0A 1Z2LA 4NLUA 4WZMA 3AXMA 4J9VA 2BW2A 4WK1A 5AE3A 3OL9A 4XAKA 2DHHA 2M88A 4N41A 2Y1RI 1RABB 1N34J 1WG4A 2RQCA 5KG3A 1Y11A 4Z2XA 3DGPA 1UAWA 6AT1B 1X4CA 3AJ1A 1KLMA 4HLBA 2CPXA 4DR4F 5L46A 2DKOB 1IM4A 3MMAA 1TVRB 2DY1A 2MTLA 1Y0HA 2YY3A 2HHPA 2OJ3A 3T9ZA 3JAMU 1Y00A 1IWGA 3LP0A 3IWNC 2N3OA 2IAJB 5HN0A 1L3SA 2V4JA 4XK8C 1KRPA 5DDRC 5IV4A 4R8UA 4FNHA 4ZVRB 1KR4A 2BRLA 9RUBA 1SKRA 1VQ4S 3HJVA 1ZOTA 3L4BC 2XBPA 4WYWA 1TR0A 4QWCA 2VICA 3TQEA 4CO2A 3EVWA 4ZP7A 1DQ9A 3MCNA 1JJCB 2E5LJ 1RWWB 4QIEA 3JSYA 2CJXB 3NS6A 1WSRA 2ZBCA 3O2IA 3BYPA 2K3IA 3I82A 1AFIA 2V2QA 1C0UB 5B0BA 2UXDJ 2A1BA 5LOQA 1YJVA 2FC8A 3P3DA 4IRCA 3OFEA 2VFSA 2DHXA 2GNKA 4CT9A 3J7A1 3QZ8A 2I5JB 3PEHA 3JSBA 4DR2F 4DR5F 3KKFA 1NSQA 4WIQA 1LW0A 1GTEA 1ZA2B 1AZSB 1GFWB 2GVZA 1QY7A 3CO0P 5KFFA 5J2NB 2BANA 3P49B 2O66A 2QZ8A 4ES3A 3THTA 2EFOA 2HNZA 5IQQA 2I8EA 1U48A 1HW8A 2OPPB 1YX2A 1R6YA 2ZOGA 2UUAJ 3BM7A 1RHUB 4FXDA 2KG0A 1I94J 3CE8A 1T05B 4HL9A 2FHOB 2QN6B 3QGPA 4ECVA 4GKKJ 3KK1A 5DM7Q 3K89A 4N77A 2HVDA 3UO0A 1KVKA 1YK9A 2E7XA 3CJ2A 1IKYB 1T9TA 4EUVA 3MPDA 4NLYA 1IKWA 4B3MF 2G0CA 4P9SA 1WWHA 1YJRA 4DLEA 4BC9A 4ZCMA 1NO8A 3I0RA 4OI1A 1D9DA 1VRTA 3NCPA 3EVMA 3C8YA 3AOAA 3NEKA 2RNEA 2DNKA 1CG2A 2BABA 2XI3A 3D7SB 5LMNJ 4ZVUB 3ZZZA 4WP3A 2A3JA 1Q79A 3LW5C 1CJKB 1UFKA 3AB2B 4CM0A 5D4OA 3JXOA 1NJYA 4ZVTB 3Q0AA 3BQ0A 3TUZC 2DO0A 1T95A 3WIVA 2VC1A 3WC2A 2DJWA 2Y8YA 2MHEA 4X4SA 1HA1A 5ETKA 2FB0A 3L9ZA 5E3AA 4A8SA 2YXLA 2CQ4A 4QQBA 2EKYA 5KG1A 2MQNA 5LL6d 4OYMA 2WSEC 2W7PA 3BR8A 1N5VA 3S01A 4DR7J 3PFOA 3ZNJ1 3UN2A 2OAUA 1KDNA 3KYLA 3MAQA 2VOOA 4X62F 1GXTA 4HACA 3HXMA 4OHVA 3TJAA 1MMLA 4DV1F 2FQQB 5KG7A 1S6QA 1N36F 1MG7A 3K8WA 3C14A 5KT4A 2LA4A 3BO4A 2ACYA 3MM5A 3HZEA 2RHQB 2H5IB 5HVFA 3W64A 2JX2A 3G71S 4CH0S 1F0XA 2EC0A 1U25A 3V4IB 2JC0A 2YNIB 4FVMA 4I68A 2R7XA 1XNRF 2WW4A 4OJGA 4QYZK 4NRTA 3B6BA 3BGRA 5D3GB 2FJAB 3P5TL 4JV0A 1VK8A 2HNYA 2MKSA 1KVJA 5LT5A 2W2QP 4JI3J 3GV8B 4RW8B 4B3RJ 5E3PA 3MUTP 3A4TA 1U26A 2DEJA 1XJWB 4O0IA 4TQRA 2HHHF 5A76A 2DGSA 4KBIA 3HHLB 2JDJA 3ET6A 2V63A 2F4VJ 1UJ6A 4USHA 4C8LA 3GP9A 1HWJA 3S8SA 3KHGA 3Q24A 1U0HA 2YKOA 3H4BA 1NK7A 3MEKA 2O67A 3CSKA 5K8PA 1O5JA 2E66A 4DZ6A 3EM1A 4IQXA 1MNEA 1DARA 1IKVB 3R9LA 2CJKA 3TA0A 4F50A 4USTA 1LWFB 2MQ8A 2VFTA 4ED2A 2MKIA 1BD6A 2ATCB 1LV5A 2DR7A 1KEKA 8AT1B 4NLXA 3N0VA 4B9MA 3C6UB 1RT5A 3BQ1A 2HRTA 4QWAA 4PXDA 1VBZA 1XNQJ 5IFMA 2UVRA 4E98A 3PIOQ 1N5SA 5HANA 5CAAA 1YJWS 3T41A 1HQEB 3SEOA 2E1AA 3T6BA 3GV5B 4LFCF 1X5TA 5K9FA 1J5OB 2HFVA 1WI8A 1WTBA 5H9FK 4KSEB 5CD4A 1QTNB 2I6WA 2BJ9A 3FZ2A 3I0SA 4QPXA 1TV6B 4HKQA 2CXEA 1H6KX 3I4PA 2C42A 5JJBA 3DOMB 2DRDA 2F9JA 4JV5F 1S1VB 5KFLA 5M2UA 3K5LA 2HVEA 4JV1A 3DM2A 1X5OA 2BA9A 2H5EA 5GADU 4JUZA 4KV8A 1FFWB 3IAS9 3PTWA 4TKTA 1NSPA 1FWPA 4O44A 2HG4A 3W3SA 4NZ0A 2G0JA 4B17A 4LF7J 2JLGA 1YRUA 1WEXA 2BE9B 3J7YI 1RZMA 3MFHA 2VQFF 3EVOA 4NCAA 3QNWB 3MMJA 1VQSA 3M6XA 3VVTA 4DV4J 4JI0J 1ZM4A 4K2XA 1NJXA 4OHYA 2EK1A 3GFHA 2N4CA 3VAMA 2UUWA 3GPAA 4K8RA 3C19A 3HVTA 3RBDA 2CVIA 4JI2F 4D3HA 2WBMA 3PYDA 1VDHA 2W9AA 5GMKa 1SV5A 2B9EA 3Q22A 2LYVA 3POTB 4FS2A 1RTHB 2FIUA 2YTCA 2W24A 2Z8QA 3DRXA 1Q7LB 4KRWA 2PE8A 5AXLA 3PZPA 1LFWA 4NPOA 4HHJA 3GIKA 4IUFA 1MWQA 2NPFA 1KONA 3TJ8A 1EETB 2MKYA 3MR6A 4C4WA 2YKAA 1HR0J 3GFYA 4O3SA 3MF5A 3AQOA 2QGFB 2ZJPQ 3QPIA 4DPXA 1WC6A 1D1UA 3VAIA 3C2PA 5D15A 4PCQA 1FTRA 5J1EB 2QFJA 1S10A 5D6GA 3UCGA 3TANA 1R0AB 4EK2A 4DPTA 3BV8A 2OH2A 5B7WA 4A8XA 4J37A 3C6TA 4CH1A 2BKOA 1NHUA 3KDOA 1Y4ZB 2B4VA 2ZH9A 1RGVA 1WNEA 2C2NA 1JB0C 4CLUA 5DO2A 1T02A 4LBIA 5F41A 1WHXA 2FDNA 3MURP 4YR3A 2MSTA 4O3OA 3H8YA 1U8SA 1Y5IB 4Q2LA 4B3TF 4B9SA 1RAFB 5KFRA 3W61A 4DZDA 2PFFB 2RB7A 2ZBQA 1U1PA 4H4KC 3VGTA 3DMJA 3ETOA 3NGSA 2W9CB 3VAFA 4DUYF 4JI6J 2HNDA 4TLRA 1IN0A 2MMYA 2RKIB 4NLRA 1S6PA 5B0FA 3MFIA 4ANCA 4O3RA 3GIMA 8RUCA 2UUCJ 3A8KA 5JVHQ 4K0KJ 3ZZ0A 4EFAC 2EK6A 2E9TA 1X4EA 3HD2A 1OPZA 4PWUA 2MGZA 8ATCB 4IQMA 2W9BA 2MQOA 2EFGA 5D0GA 4NYOA 1C0TB 4OI6A 4JI1J 3DFEA 4C3LA 5IC4B 1SC3B 1WKKA 1EZZB 1R7IA 4NCGA 3EGWB 4U7CA 3QT8A 2B8QA 3OV7A 4EZ9A 1TTHB 4DQQA 2BJ3A 2PIIA 4MAKA 1XN9A 5EN1A 2W9BB 2MYFA 4A8QA 2ZNYA 3UCUP 4OZLA 1T9YA 2ZUGA 4LBHA 4KHRA 3V6JA 1CULA 3HI9A 4IRKA 5IWAF 5AJ3F 3LA0A 4MIWA 5F0WA 2XO7A 4LSLB 3KLIA 3U1NA 1HKAA 2ROPA 3W5ZA 1VIXA 3M8PA 2JEFA 4NMXA 2XCAA 1VGYA 3ITHB 2HQGA 2DNYA 3BGLA 2DNPA 1RJJA 1JXVA 4ECZA 2CPIA 4NASA 4OYBA 4RW4B 2WB4A 4KTQA 2CADA 4TYBA 4K7QA 1RT4A 2VFRA 4IOBA 1FX2A 2U2FA 2VQEF 2HMIA 2D41A 4NXNF 2F8MA 5GADI 1KNZA 1BMQB 1GX5A 4L74A 1RBOB 1SI9A 1OYDA 4J7CA 4L72B 2H4WB 2LMIA 3NMAA 4DR4J 2ZH8A 2ZBRA 3MPYA 3FEXB 5U47A 4RNMA 2DR5A 1Z4UA 4MIBA 2ZH2A 3MM7B 1IBKF 2YX1A 2XYPB 2C22A 2BJ8A 4UQTA 4OJ1A 1H2TZ 1KFDA 3TNVA 4ZCIA 2J6UA 3GILA 3CXCR 3PACA 2IRXA 1Q95G 2DR6A 1HBNB 2OSRA 2EBEA 1F3VA 2UXCJ 1RAOA 2MQLA 2HGMA 2EI5A 3D0GE 1W2BR 2QX0A 1WOOA 2BR0A 3KXDA 1S1XB 1DQ8A 5BR8F 3FZBA 4WFNQ 4KPYA 4BC7A 4CRJA 2CQDA 4DL4A 2VFUA 4HVZA 2QSWA 3KOAA 3DRPA 4OI0A 2AIRB 2FVCA 3CD7A 3CDAA 4YDXA 3LO3A 1F5CA 2HVIA 4WP9A 3SFUA 3SCIE 3PX0A 2R42A 2XMJA 1TFYA 4ES1A 1V3SA 2RUSA 1WUUA 1VC6A 1LK7A 2OKQA 2GGPB 3BPSP 3AFGA 2VKZG 1S97A 2BZ2A 5LXRA 1HHQA 4HDGA 3PDNA 2RQKA 2R8KA 4ZITA 2VD3A 4DR2J 5A8KB 4DR5J 2ZOMA 3H7HB 1TKTA 2CVEA 3CEDA 3B4DA 2DCUB 1VQ6S 5KT7A 1S1UB 2K1RA 3OHBA 4HTJA 4LFBF 1ELOA 1W7WA 4WWSA 1S9GB 3LAKA 3FSYA 2YKNB 1HQUB 2QIFA 4CO5A 2F5GA 2W8LA 1BGXT 4CTAA 4ELTA 3J81j 4B3OA 1S59A 2YNHB 4NLSA 2B4OA 2HS3A 4ILMA 3J80U 3US5A 3NNAA 1JLAB 3LALA 2XS2A 2MKKA 1NDLA 3QJJA 2ZBIA 1NJIT 1QSYA 3QLHA 4PWDB 2XMWA 1S48A 2BE2A 2EC2A 3FNNA 4AT1B 4CO4A 3DRYA 2O5DA 2OPSA 2KTQA 3MWBA 2B7BB 1RK8A 5CYMB 5K8OA 1JLFA 2CQIA 3DLGB 2J9CA 1WKJA 3FC9A 5HQLA 4PPDA 3BS9A 4ZLNA 3ILLA 3H20A 1YTYA 4NRUA 3W5YA 1TKZB 4AL5A 2OI2A 1MN7A 4GKJF 1N88A 3BKUA 1ZPWX 4ZKAA 2R7RA 5DRKA 1QAXA 3M8SA 3GE9A 4ICLA 4X4PA 2Z57B 4IO9Q 3BSAA 1WDDA 1IXKA 3JTOA 3Q89A 5HROB 1N4LA 1OWXA 4OI3A 2Z30B 4I2PB 5HP1A 3JS9A 4OZ1A 2VDIA 3KWMA 5KFWA 2LKZA 1X31C 2ZE2B 2V5HG 1EB0A 1S4FA 3D4JA 3M2UB 4ZIVA 4X62J 1OYEA 4ICLB 3RAXA 2PSZA 2D9OA 1VRUB 3O1LA 1S79A 3G6YA 4DV3F 4DV1J 3KLGA 2AYGA 4DR3F 1AB8A 4M5DA 2RDDA 1N36J 2GIFA 2DHSA 2RUGA 3T1YF 3DLEB 2JLEA 1LW2A 1UVKA 3G4SS 1X5PA 2QRRA 5I42A 3M8YA 5GMEA 4OZJA 1PAUB 3OVSA 4PG7A 3CJKA 1U2FA 4Q45A 1LK5A 3KHHA 1KP6A 5J2MB 1MU2B 3HVAA 2BV3A 1LNQA 1AYEA 3CPWR 2JSXA 7AT1B 2YWWA 1NH7A 5L39A 1HMVA 4DUZF 2ZITA 3UDLA 2HHUA 2HHHJ 3VGUA 1WF0A 3CJKB 4QWDA 1WACA 4RLEA 2KG1A 1FTCA 1FRKA 3UR3C 3DXBA 2LDYA 4M5LA 1U1MA 4EI2A 4IDKA 3RZAA 4ZHRA 2BJ1A 5KFIA 3UW1A 5FD1A 3PJXA 3Q23A 1VQPS 1YBUA 2IM1A 3HHDA 2JFDA 1SJ1A 2V8PA 3FRYA 4V19X 4LVNP 2ZHBA 1CJUA 3EYZA 3TOQA 4DQRA 4B02A 1TUVA 2ZUAA 4OJHA 1W26A 2GW8A 5JVGQ 2C3OA 3PR5B 4GC6A 3NG8A 3J81Y 3PR4A 2RE1A 4C0HA 2DHAA 4WTYA 2UVWA 5L9NA 5CCMA 1WEYA 4MKBA 4IOAQ 4N76A 2FZCB 1PSDA 3G6VA 2V34A 2XMTA 3BGFA 3NOCA 5ADZA 2R8HA 3G6XA 4F4XA 3MHYA 3BBFA 4FVCA 1UW9A 1PAEX 3H5XA 4LFCJ 3IR7B 5DZ6A 1T3NA 5KFZA 3A13A 2BX6A 3R1HA 3ULHA 2V0NA 3ZZUA 2VG6B 2XTJP 3EMTA 1WELA 4K5SA 1KOOA 3GU0A 3VAHA 3R6GB 5IM0B 5KFJA 2JZ5A 2XQCA 4JV5J 2IM3A 4TY9A 4PXCA 4DSEA 2KI2A 4NCBA 2Y9HA 2MLXA 1X9WA 1N33F 3CUNA 4LF9J 1RHMB 2DK2A 3VCDA 4WFBQ 5KFHA 4PR6A 1UTAA 2OGUA 2E9RX 3CDUA 2HHSA 3E01B 3N5BA 1DTTA 5IV3A 1KD1T 1SJQA 1RWVB 5KAKA 3KLHB 1VBXA 1TL3B 3S1TA 1GAOA 2JFKA 1O8BA 1NK9A 3UVJA 2UVUA 2H54B 4YFUA 3PW2A 1WKLA 1HBMB 4F4WA 2M5YA 2K8GA 4FKXA 2QFIA 2DD8S 4I2QA 5DG8A 2RS2A 5A0YB 3QSIA 4K4YA 4K4SA 3DU6A 3G2XA 1D3WA 4QPTA 4UZBA 3QSYB 2XNRA 3KK3B 2OTLS 1WHWA 2DCLA 2V9WA 3OVAA 4ZVFA 3MEGA 2ZDOA 1B0TA 3I5BA 1OO0B 4JI2J 2QT7A 2OMOA 4F3QA 1UKUA 2PA8D 4F4KA 1C1CB 3M7VA 2MQMA 3SMZA 1I51B 3DLKA 3R5BA 1UVJA 2DNZA 4L76A 2CG8A 4LSNB 1H3DA 2Y1JA 3QQCD 5GAHU 1D8ZA 3VQTA 4U96A 1UEVA 4LJMA 3DLHA 4LF4J 2XO6A 2GQ2A 4B9TA 3ENVA 1R0CB 1K1QA 1SXLA 4NMLA 2FVPA 4DL0C 2BQUA 4AL6A 3SIPB 5LSRA 2XZTB 1NJWA 5CA5A 1CVJA 3IO1A 2DXDA 3IGVA 3P6YC 2NYIA 1KKHA 2R2TA 2FLLA 5ETMA 1QAYA 3MAAB 2D3O1 4OHZA 1BQNB 4P72A 4ETZA 4FF4A 4DF4A 4U95A 1HFEL 4C8KA 3BKFA 3KNGA 1WC3A 2WRMA 1CS4B 2IYGA 2X3DA 3LWLA 2QA2A 1RHQB 1KFSA 3HHNB 3DYAB 1FVQA 3MEDA 3F73A 2P5VA 1RT2B 1NU4A 5JUMA 1XR6A 3B54A 1NMEB 4CQ1A 1FNXH 4IG3B 3T1HJ 2LDIA 4QW9A 4DV0F 3JYTA 4DUYJ 1VFJA 1U6BA 2J7UA 2APOA 2Z2LA 5M2PA 1FNOA 5FDLA 2CNKB 1FVSA 4AFFA 3AB4B 3D1HA 3SI8A 2MZQA 4MKYA 2ILYA 3M6VA 4MMOA 1JQGA 2KVQE 2UXBF 2GAHC 3MM8B 4QCLA 4ZLJA 2W2PP 5HQMA 1H38A 4NLQA 2HZVA 4M8LA 4C9DA 3L95X 3PKYA 1PO6A 4KO0A 1JLQA 2F7VA 5J2QA 4DSIA 3CJSA 2QLJB 4OLPA 1NPKA 5F8HA 1MW7A 2GVDA 2QMXA 4HTIA 5EHHA 3PHTA 1SC6A 1WF2A 1X4AA 4I1TA 1RXOB 2RRAA 2CJAA 3PJWA 3ZZOA 1O51A 3M1VA 3NGDA 2M70A 1PILA 3Q8YA 1TP7A 4R0JA 3GZ7A 4KO0B 5C42B 2DH7A 3DU5A 2HFNA 1N34F 4F4YA 2OEKA 2CQGA 1REVA 5IWAJ 4M5GA 5AJ3J 4LVOP 4PXEA 2YWEA 3ILIA 1H74A 3H2UB 1SH3A 1JXLA 3RB0A 2PMHA 2MQPA 1BQXA 1HLWA 2L9WA 4DQSA 1TFWA 2CPFA 3LP1B 1WI6A 1S76D 5DETA 1N6QA 5L1LA 4HH1A 3O5TB 1DJ0A 2JEJA 5IT9U 2NUHA 3PY8A 3KJVA 4C8OA 2EFNA 1M1KT 4FF3A 3QRQA 2XY7A 1F5BA 1B4SA 2R2SA 2ALYB 2CDQA 3P4UB 4XDCA 5HLFB 1VI7A 4HEA9 2LXUA 1N6QB 5KFQA 4J9LA 4IFVB 1SJ4P 3VZHA 1XK8A 1QUPA 2AGPA 1WDTA 3G87A 1BWEA 2E5LF 1FERA 2AJFE 2LA6A 3DI6A 1XC9A 2ZD1B 2GHVC 7FD1A 4OZNA 1NJZA 2E1RA 4DG1B 3DRRB 4DV5J 3IWXA 1UJ4A 2YWFA 3N79A 2NXNA 2UXDF 4ZPAA 1DFDA 2ZFHA 1GQEA 4ZIWA 4PRFA 2H48B 3K5MA 3T5LA 1ZS6A 1RLDA 3ADAC 1K1SA 2CJBA 1RWXB 3W2WA 3LP2A 3BYRA 4F0HA 3BN7A 2XC9A 3TZWA 3CTRA 1CBKA 4MYUA 1RAGB 4M5MA 4Q0BA 3M2RB 1YJ7A 3CIZA 3RGIA 1T03A 3SV4A 3I4HX 4OL8A 3OR1A 2GO8A 4AD6A 2IY5B 4JI7J 3V2UC 1RU1A 1KS2A 1CJVA 4MIAA 1FEEA 1PJ7A 3ISND 1V5VA 4WFXA 2UUAF 1SIWB 3EXCX 2NS1B 2X3GA 1I94F 3M8RA 4EGLA 1FNMA 3CWJA 3GFZA 2PGCA 1C1BA 2XEXA 1SH2A 5GAGU 2E1MC 1IQZA 4IG0A 5BXIA 3ENWA 1IWAA 4X4NA 2DY9A 4WE1A 3MM9A 3NS5A 3GSIA 1VQ9S 3W2VB 4DL3A 3UN3A 2KJWA 2HFOA 3OFHA 2EFQA 2H5JB 2LQ9A 4JI5F 4URQU 1HHSA 1LWEB 2WSCC 1KHVA 2WAQD 1M5PC 3A8JA 3D6FB 4TVAB 1RWOB 5KG0A 4LFBJ 2E1PA 4WFYA 1FXDA 5LMNF 2IMWP 4IFYB 2FJWA 4L3NA 3K58A 3R27A 3CCJS 2C28A 4TY8A 1EQ0A 5KTQA 5GAEU 3X1LB 1NEEA 2UV8G 2X7IA 2IBOA 4EBDA 2NZCA 2D3UA 4OLOA 3BSCA 2Y0SD 1UA0A 2WVEA 2DBBA 4WJBA 4JI8F 3I31A 4I6WA 2FVSA 1NBEB 3C16A 1EKRA 1NHVA 5B0AA 1NAQA 3FBEA 2MSSA 3FBBA 4ZVHA 1RT1A 4OZ3A 1JLEB 4DR7F 1NPPA 3C15B 1X4FA 3ILOA 2FJEB 1RKIA 2SXLA 5GVQA 5A8WB 2CUYA 2BE7D 2O3DA 3E8OA 3OLBA 2N82B 1D8YA 3ISNC 2FLPA 5C24B 1F60B 1S9EA 1VQLS 3FFIA 3GLJA 4NLOA 4EO8A 4R5PA 2Q66A 1JJ2R 2C2MB 4UOCA 3ZTOA 4L75A 3D6TB 1WC0A 2BQRA 3GCXP 2YPYA 3U27A 4DF8A 3IRXB 1RYRA 1AXQA 2E29A 4YB6A 5J1PA 5FLXY 5EWFA 4IOCQ 1RE1B 2VG5B 4TYAA 3SDEB 4DJBA 1T9WA 4KKOB 4Z7CA 4JI3F 2RU3A 1G6BA 4B3RF 1HNXF 4C8MA 4DHVA 4CNYA 3FCVA 4Z7YA 1JLCB 4ZDNA 3BH7B 2ALZA 4X64F 5DG7A 1VJQA 3A12A 5KOXA 2F4VF 3BGOP 1RTJA 3D1OA 4RNNA 4DR3J 2CQHA 3K5PA 1AW0A 2HURA 1RTIB 4C6AA 1Q5YA 4JBCA 4OZ0A 3NCQA 2E7WA 5AE2A 1L3TA 3V6DA 3QJLA 1FKOA 4USIA 4DXLA 3BDPA 5CQGA 2YKMB 2BMBA 2RF2B 4QW8A 2JC1A 5DS7A 2X1BA 1YHQS 3M8QB 3IAM9 2LEBA 3Q8UA 3CD5A 4LF2A 1ZAVA 4IH7A 1HNVA 1VS3A 4LRDA 1F6TA 2KRRA 3VR1A 4G1QA 2FHJD 3D9BA 2CG4A 3LPEA 5KFOA 3CMAS 3C3LA 2IMOA 2CDRB 4C3MA 3TUJC 5EWEA 4K4XA 2IC3A 3THPA 4RNFA 2KB2A 1RT3A 2RIJA 2CNLB 2Z58B 3P5BP 4Y2IA 1CPZA 3OUYA 4LSZB 2C2DA 1YQHA 5ETTA 3PFEA 3UN5A 5A8RA 1URRA 2WB1D 4M63A 1RHJB 1G7CB 2K7KA 3QIPA 1SC1B 5T14A 4KAIA 5D0HA 4NLGA 3F41A 1L3UA 1VLYA 1EQMA 4GMKA 3BEGB 1D0EA 3J7ZT 1U2CA 2W25A 1YDLA 4LF5F 2FGOA 1FX4A 4O4RA 5LXYA 4KH0B 2QV6A 4DU8A 3I9ZA 4W4MA 5HBMA 2YNGB 2VG7A 4K4UA 5DQHA 1FXRA 3M30A 3A3OB 3UD5A 1RB0A 5C25B 3KK2B 1X9MA 3EGVA 4G65A 4LF8F 2YNFB 5ETNA 5KG6A 2ZWPA 1WC4A 1YITS 4DFJA 2AEFA 2B4PA 3FEZA 2EW9A 2LEAA 1KHWA 5E5NA 3G82A 4G1IA 3QYYA 3D2WA 3DHXA 3DOKA 5B09A 2DNOA 2IA0A 4WK3A 2VPZB 5H1SV 3HT0A 2QTWA 1GMWA 2HYIB 5HMXA 1QE1B 1ZM2A 4DV4F 3EDRB 1S99A 1IR0A 1TL1B 4F4AA 4ZCKA 2F1FA 1N0UA 2F65A 3G82B 1XEZA 5HL7Q 1TL4A 4MYTA 2AGOA 1XMOF 3CCZA 2Z2YB 1N33J 2WOMA 4ZLPA 1C2PA 4KFBA 2KHCA 5A2QU 4ED3A 1MROB 1SUQB 5M2RA 3MECB 1XR7A 1UVLA 5IT4A 5EUHA 2DGQA 2V2VA 3RG6A 3KFWX 1ZETA 1VRQC 3OSNA 5ETRA 1HR0F 1DQAA 1HBOB 1HPZB 4LUBA 3QRPA 2HQFA 1HNZF 3LGHA 1X4BA 7FDRA 4M5NA 2C2EA 5KFNA 1EP4A 1R31A 3F44A 3GB0A 3LUYA 3A3NB 4ZLLA 4ECYA 3GJQB 3DDIA 4RR5A 3M2VA 5DJBA 2E5JA 2X1GA 2GA7A 3JSMB 5G4DA 3JQMA 4P7VA 2LP4A 2P9CA 1KN6A 3VGVA 4OZ5A 3CO9A 1B0VA 1N54B 5E2QA 1NZAA 2IDLA 1IKXA 3DNCA 2BM0A 3FGVA 4LQ9A 2AGQA 4N56A 3TZXA 5ITHA 4YB1P 2KXHA 2V94A 4C11A 3R97A 2VA3A 3EDQB 1GH8A 3VAJA 9ATCB 2ASLA 2HIQA 4FNIA 4A8OA 2M7SA 2VA2A 4KGKA 3LF0A 1KOHA 1NH8A 1UETA 2G1DA 3W9HA 2CQBA 5K5MA 3NS7B 2UUCF 1RISA 2M52A 2A18A 4DL5A 2ZC3A 4RJVA 4CLPA 3GG0A 2M3DA 5EWGA 1M1GA 4X84A 3QFHA 3OR2B 4F4ZA 2ZH1A 5C2GA 4QIFA 3M32A 3CMES 2VL1A 1ZZNA 1R43A 3EWGA 3FMWA 1QVFR 4BCAA 4IH5A 4XPEA 3BSNA 2A2CA 2R2UA 5LJ3Y 1FESA 4WFZA 3QO9A 1DTQB 4FF1A 4A4JA 4F2RA 3MOZA 3D5MA 2HFUA 2Y3YA 4O4GB 2J8SA 3OHAA 2PDAA 3A8EA 4ZPDA 1UEKA 1RT6A 2E5IA 1RWNB 1VIOA 5HVHA 2EVZA 1VOMA 2XSJB 4KYZA 4OQJA 2UXBJ 4DR6J 1AUDA 2W7OA 2DGUA 4IKAA 1FKPB 1RHKB 4AUKA 4I67A 2KYXA 4RWXA 3H40A 3LTOA 4DPUA 2HBQB 1FI4A 4ECSA 2AQ4A 5C2CA 3OTOJ 3KTQA 4GRSA 1WJ9A 1BLUA 1RYSA 1UW4A 2LVWA 4KIAA 4UUWA 2HHQA 5HSPA 1ULRA 3H25A 4B3SJ 5MLCV 4DN9A 1HWLA 4RUAA 2AJQA 2BKNA 2POKA 2Q6BA 2VIHA 2K06A 4H4OB 2HKEA 3L7UA 1TVRA 2MZSA 1V3RA 5HQ8A 2AHOB 4GVLA 5CHCB 3ZZTA 3MMBB 1U45A 4NXMJ 4AXIA 3WIUA 2OTJS 1Q86T 2DPJA 1JLBB 1Q0NA 4B9VA 2IAJA 2I1RA 1PYTA 3RB4A 1SL2A 3CULA 2DGTA 3IS9B 2W2OP 3F56A 2JEIA 4NA2A 5D0EA 5FLXU 4ED0A 3UQSA 1UZDA 3HFKA 4MFBB 2C3UA 3ICLA 4MKAA 3DRSB 5J2PB 3OSPA 3N6LA 2XGQA 4DI6A 5CXTA 5HMYA 1A9NB 2U1AA 2UXCF 1C0UA 3TVZA 4UW2A 2KN4A 1NCLA 5DG9A 1QSLA 1Z2ZA 1CC8A 1M90T 2MQQA 1WD6A 4TU8A 1HQ2A 5LMUF 2H9ZA 3MDFA 2R7UA 2I5JA 3AY0A 5D8HB 3PXGa 4CH7A 1EAYC 4HDHA 3RR8A 2ADBA 2QLBB 3VALA 3DLJA 1AZSA 1B0PA 3N4WA 4MK7A 2MJUA 5J2NA 2DGXA 4C8ZA 2W4DA 2DH9A 4FPRA 2EKNA 2HK2A 2P9GA 2P6TA 1U49A 4P71A 1WF1A 2MZJA 2OPPA 2R2RA 4RBTA 1W2IA 2BKPA 2ZH6A 4RW7B 2OUGA 3UWTA 3EGZA 3QT7A 2Z2ZA 2BJDA 2YQ3A 5KT2A 1T05A 3TX0A 3ILJA 1LWXA 2OP5A 3J7AN 1ITPA 4YR0A 3GR0A 2A2DA 2FUG9 1CEZA 4USKA 1IKYA 5CCLA 3AQPA 4DBQA 2UUTA 1ZPVA 3LH2S 2IA6A 1NSKL 4ZCLA 2FZKB 2VPYB 1MMNA 2XY6A 2GC8A 2HBRB 1WOSA 4ID8A 2GIRA 4A8YA 2V4QA 2PFDA 3IG1B 2A0FB 1TK8A 2GAGC 1DY3A 2HZCA 3TAPA 4RW9B 4ECTA 2MY8A 4QIWD 1T8EA 1CJKA 1E6YB 1NZ8A 4Y28C 4FF2A 5F3TA 4JI5J 3QGGA 1SKSA 2H1YA 2DNQA 4OYAA 5HO4A 3HFVA 4ILRA 3K5OA 5L1KA 2GHWA 1PBAA 2QL9B 2V8GA 3KLFA 2WVBA 3EX7B 3UNGC 2L41A 4PKDB 2XMAA 2WBRA 3EPIA 1X4GA 4QU6A 1X8DA 1HI0P 3WX4A 4TU7A 2V8DA 3W9IA 4G6VB 3IN5A 1AA1B 4X4RA 4L73A 3KLFB 3QAEA 1T11A 1FDAA 3MCSA 3SQGB 2G2ZA 1IUJA 4USJC 4JI8J 4LF6J 4P52A 2HHTA 4DQIA 2R7SA 1TL7B 4OI4A 2JNJA 1OMSA 1U0SA 4X4VA 3P45B 1CJTB 3V81B 1NDCA 2Z56B 3MTJA 5KFMA 4RW6B 3FBFA 5C5JA 2XHCA 5MAOA 2CAJA 3TAMB 3V4IA 2YNIA 4F0MA 4XTTA 2M4MA 5KFUA 3HPOA 5D3GA 3GJRB 5SUHA 3H4DA 1DLOB 4H4MB 3PO5A 4RW8A 5B08A 4NZ7A 3RU0A 2OMLA 3KG1A 3HLUA 4J5OA 4AQYF 3LWMA 4KJIA 1F2HA 3HHLA 4URSA 1P1LA 2MXYA 4LR9A 3RB3A 3HDSA 4X4UA 1FO1A 1YKWA 1YRXA 2VJVA 3T9NA 4M5IA 2HGLA 1ZM3A 1JKHB 4M5KA 2J0WA 2X51A 1HNXJ 2KKHA 4C2MA 5KFAA 4F25A 3J7Z5 1M0SA 4RUBA 2LEPA 2MZ1A 4X64J 2CA9A 1IKVA 1B7FA 2AT1B 3U7JA 2HAFA 4U7UD 1RWKB 5H9EK 4K59A 4RUCA 1LWFA 1S4EA 3CCWA 4USUA 1HD1A 4W90B 4FYYB 2I2YA 2W01A 1RI7A 1Q8LA 3R7BB 3OD2A 4CO3A 3O6QA 3C6UA 5B0GA 2A6MA 4P2FA 2YVSA 3DOLB 1T9UA 4NYZA 5F9LA 3PYEA 2AKWB 1OPIA 2OPRB 1HQEA 4RUHA 2RHSB 2OIHA 2MJNA 3X3UA 3MEEB 1J5OA 4ELVA 1T94A 4UOFA 2HQDA 2HLUA 2YKQA 3RB6A 1H0HB 1G3OA 3IP0A 1XMBA 2YBVA 1TV6A 4MTPA 2X1AA 3J80Y 3DOMA 1GX6A 2LECA 4DSFA 4QYZJ 1S1VA 3TEGA 2YKPA 2HSEB 4ZP8A 4I7FB 1HNIB 4ZVQB 2ASYA 3MMCB 4K50A 1X5SA 3T1AA 4ZVOB 3NBPB 2HWTA 2NR0A 3NCRA 1R8HA 3HULA 3ZO7A 4LF5J 1GMVA 2DT9A 4HYKA 3UE2A 3GV7B 2H3EB 4A47A 1EX8A 1QVGR 3NMRA 5H9EJ 1KLNA 1RUSA 2XSFA 2ZKUA 2DRAA 4W98A 3OJUA 4LF9F 5CYQB 3AJ2A 3W7BA 5D78A 5E3RA 1NK5A 4O3QA 4LF8J 3BN4A 1XTZA 1LWCB 4ZK7M 3H59A 1QD1A 2RS8A 2QE5A 2BUNA 4C8NA 2AJ0A 2C1EB 2PO4A 5EDWA 2I9SA 2KXNB 3BO3A 2EG2A 1SL1A 5JMNA 1L3KA 2RDJA 3POTA 3CCRS 3QWPA 1RTHA 1S0OA 4C7QA 5HJYA 1MLAA 2EG1A 3D3CJ 3SSQA 1JMTA 2B5JB 5E41A 3PV8A 3HSGA 3PG9A 1XMOJ 3IXQA 3ELHA 2MB0B 4FYVB 4DFMA 3R5CA 4W92B 3QAUA 1LXNA 5F8GA 3NXZA 4ILLA 1EETA 5K8NA 2XMUA 1S77D 4NI2B 1NK0A 4QIGA 3ZTRA 2VUGA 1X9SA 3TRGA 1IR1A 4ED8A 3FMBA 1FRIA 2DNNA 4OYOA 5J1EA 5H9FJ 3G9CA 1R0AA 4P74A 1G1XA 3LPYA 2HLTA 4LF4F 5G0RB 2GFFA 4R0EA 4QR0A 1HNZJ 1RLCL 4KGXB 3TQ1A 2BJ7A 1TL5A 4QIVA 1JNZB 1NHKL 1S1WB 1JJHA 5IXUA 4ID5B 2GO9A 4A8KA 1RSCA 4M5JA 2C2ZB 2WVFA 1HD0A 2DR8A 4BBYA 3CMQA 2DITA 5B0DA 1SVDA 2W9CA 1WC5A 2XS5A 5F8MA 3H98A 3RTVA 5K14B 3T5HA 4JOUA 2RKIA 1WTFA 1N5YB 1S0NA 3GYGA 1S7IA 4CLWA 3D0IE 5T7LB 5LSLA 1GXUA 1OY6A 2BVZA 2BEFA 2CJYB 1B99A 3OL7A 2NSBA 1FEHA 3CJRA 1NK8A 1U8WA 2LQ8A 3BDEA 2BBEA 3T1HF 3Q8VA 1RADB 2C3YA 4KGMA 4ECRA 4F3OA 4QYRA 1OJ4A 2KFNA 3OTBA 4P10A 2EWHA 1C0TA 2OPQB 4G3IA 5E0OA 2DNRA 4WU3A 4OYZA 1S1TB 1N48A 2HAIA 1BHNA 1EARA 3FDSA 5I3UB 4DCPB 2EEYA 3RBXA 4Q2MA 4FN5A 2CFXA 2CQ1A 1YJTA 4U67Q 3OJSA 2VBXA 1KSPA 1FFSB 4DSKA 3CW2C 2CPJA 3TX8A 4NA3A 3HT3A 3CD0A 4LSLA 4DS4A 4DPYA 2AYEA 2NYHA 4P2MA 2DISA 2KXFA 4ZA1A 2R8GA 1RTDB 2VBYA 2RAQA 1TK5A 1K0TA 2LXFA 1FF2A 3ITHA 2ZH4A 4PUOB 2K3KA 2KZMA 3FBCA 2YX4A 3S6EA 3QMQA 2V4RA 1X0PA 2B0GA 2YX7A 1HBUB 4RW4A 4RBUA 1HL6A 2CQCA 2AZ1A 3UPFA 2N7YA 2R3VA 5DGAA 4ITSA 1RWPB 3BBBA 1FWKA 3QGHA 1GTHA 4Y2AA 1FE0A 3G8QA 2R7QA 5L38A 1HYSB 2V69A 5HVGA 4OHWA 4DV6F 5AXMA 4WFAQ 3PRDA 1TKXB 3U1MA 5ETVA 4PQUB
chains in the Genus database with same CATH topology
3MD1A 2QO3A 3OFHA 1Q53A 1VK8A 2EFQA 2HVHA 2HNYA 2LQ9A 2LQBA 2MKSA 4RX6A 1KVJA 3GIIA 5LT5A 5L1JA 3TAQA 3GV8B 4JI5F 4RW8B 4URQU 2YWKA 1HHSA 1LWEB 2ZOFA 5E3PA 2WSCC 3MUTP 1U26A 2AU0A 1KHVA 4O0IA 1DAXA 4EWTA 2WAQD 4U7UK 4TQRA 3BQ2A 1M5PC 2HHHF 3OR2A 3IBWA 1VQ8S 2DGSA 4KBIA 5KG0A 3G96A 3HHLB 3MM7A 2Y1IA 2JDJA 4AXJA 4WFYA 1FXDA 5LMNF 1M5SA 3KMSA 5L9XA 2IMWP 4IFYB 2AV5A 2FJWA 1UJ6A 4L3NA 4RWWA 1K73T 3K58A 4USHA 2NPIA 3R27A 4C8LA 3CCJS 2C28A 1HWJA 4TY8A 2IVFB 4B08A 3S8SA 4X4OA 1YBAA 5KTQA 3N9UC 3EZUA 4OHXA 3KG4A 3KHGA 5GAEU 2KM8C 1K9MT 3X1LB 3Q24A 2YKOA 3H4BA 1NEEA 1NK7A 3MEKA 1FD2A 1HBNA 1DTQA 2F8HA 2O67A 3BF4A 2HVZA 3CSKA 2UV8G 3PW7A 2XMMA 5K8PA 1O5JA 1NK6A 3BB5A 2IBOA 4DV5F 4EBDA 2RQMA 2E66A 2PI5A 3ENQA 2ZHOA 4I6AA 2D3UA 4OLOA 3BSCA 1S1XA 2Y0SD 4IQXA 1QUVA 1MNEA 2OSQA 5F8JA 1UA0A 5DDQC 1DARA 1VBYA 1UVIA 1IKVB 5KFYA 4O4GA 2CJKA 2DBBA 1FK9B 1SIZA 2RILA 4WJBA 1Z1ZA 3PX6A 1FHTA 3OQ2A 2CPEA 4JI8F 3TA0A 4CO1A 3I31A 4I6WA 4F50A 2FVSA 4X4QA 3FCHA 4EZ6A 1U09A 1NHVA 1UVNA 2XSJA 3MM6B 5B0AA 1NAQA 2KT3A 1DTTB 2MSSA 1LWFB 4ZVHA 3M9NB 2VFTA 2NUUG 4ED2A 1S0MA 1RT1A 1JWWA 2MKIA 1BD6A 1LV5A 1FKPA 1UEUA 3RW7A 2DR7A 1S0VA 1JLEB 3OTCA 4ERDA 4DR7F 1KEKA 2JJ4D 2WONB 2QLWA 2P6SA 4ECUA 1X4FA 2FJEB 4X2BA 1ZM9A 1RKIA 2SXLA 5GVQA 1X7VA 2OFGX 5LJ5Y 5A8WB 4NLXA 2O3DA 3E8OA 3N0VA 3OLBA 2GGPA 4B9MA 5D4LA 2N82B 3R1LA 1D8YA 3ISNC 2FLPA 3C6UB 1RT5A 3BQ1A 4JI7F 5C24B 4YQWA 4I2QB 1DHMA 1F60B 1S9EA 4URGA 2CKWA 4QWAA 4EBCA 4PXDA 1VBZA 5IFMA 1VQLS 2UVRA 3FFIA 4NLOA 3UFCX 4EO8A 3K0JA 4E98A 4R5PA 2FGCA 4B9LA 4TLQA 4R25A 3A1YG 2Q66A 5A8KA 3PIOQ 1VJWA 1N5SA 1JJ2R 4UOCA 2JL9A 5HI7A 4C97A 1YJWS 4IR9A 4QBUA 1HQEB 4DN0A 1UWBB 2BQRA 3SEOA 5I3QA 1M5KC 1E6VB 3MEGB 3DC2A 3IRXB 3U27A 4DF8A 1VQYA 2E1AA 3TVYA 1RYRA 4IR1A 3T6BA 1AXQA 1DURA 5B0CA 3GV5B 2E29A 1HARA 1S1UA 4YB6A 1SJ3P 4H4OA 5IZHA 5J1PA 3TARA 4LFCF 5FLXY 5EWFA 4IOCQ 1X5TA 4DEZA 4NL5A 5K9FA 3RAQA 1J5OB 4UY8T 2VG5B 1WI8A 4TYAA 1S9GA 1WTBA 3Q8SB 3MMBA 2VBZA 2J0XA 3SDEB 4DSJA 4KSEB 2FVRA 2YKNA 4DJBA 5KFXA 3DLKB 1HQUA 4KKOB 1UFWA 1WEZA 5F8IA 3M05A 1JLBA 3FZ2A 3HK2A 3I0SA 4QPXA 1TV6B 4HKQA 4JI3F 1Q4RA 2JH3A 1H6KX 5J1NA 3I4PA 2RU3A 1KQFB 1G6BA 5JXSA 3EPGA 3LAMA 4B3RF 1HNXF 2M2BA 3HHKA 4C8MA 2R7TA 2C42A 2YNHA 1R8CA 1FA0A 1JIHA 1W25A 3IS9A 5JJBA 4ECQA 2A10A 4DHVA 2F9JA 4CNYA 4WXWA 3KLEA 4JV5F 1JLCB 1S1VB 1YJNS 4ZDNA 1JLAA 5KFLA 1QM9A 5M2UA 3K5LA 2ALZA 4JV1A 4X64F 5DG7A 3IWLA 3ZFVA 2XGPA 3DM2A 1X5OA 4ZVEA 2BA9A 1N5QA 2H5EA 5GADU 4JUZA 5KOXA 4F2SA 4KV8A 2F4VF 1CSJA 4PWDA 1S7HA 1RTJA 4MFBA 3D1OA 3IAS9 4RNNA 2CQHA 3K5PA 3M9MB 4YP3A 2CZ4A 4TKTA 3DRSA 3MGJA 1AW0A 1IJEB 1MMDA 3KHLA 4KC5A 3IR6B 5J2PA 4O23A 3WC0A 4X66F 1RTIB 1FRJA 2QMWA 4NOHA 5KFGA 1LFPA 4JBCA 1RDRA 1U6ZA 4O44A 2HG4A 5CYMA 3CCSS 3W3SA 4NZ0A 2IFXA 4OZ0A 3NCQA 4B17A 2E7WA 5AE2A 2JLGA 1YRUA 2ZKTA 1L3TA 3KLEB 1WEXA 3J7YI 2BM1A 3V6DA 3MFHA 1G2EA 2VQFF 3QWUA 2BRKA 4NCAA 1KLMB 3QJLA 3DLGA 3CCMS 1FKOA 1KQSR 4USIA 5F8LA 3MMJA 1MWZA 5I4MA 3BDPA 1VQSA 3M6XA 3MMAB 5CQGA 2YKMB 4JYAF 4WF9Q 5AXNA 2RF2B 4QW8A 2JC1A 5DS7A 4ZPBA 2X1BA 1YHQS 2UU9F 1ZM4A 3M8QB 3IAM9 1HW9A 4K2XA 2LEBA 3UDCA 3R3TA 2B9XA 2BXJA 3CD5A 1TKZA 3MEDB 1ZAVA 1NJXA 4IH7A 3I5CA 2EK1A 4OHYA 3GFHA 2N4CA 1HNVA 1VS3A 4QZVB 3VAMA 1N8RT 2KRRA 2UUWA 3VR1A 2KO1A 4G1QA 3HVTA 3RBDA 2AF6A 4Y2KA 2FHJD 2CVIA 4JI2F 4BHQA 4F8RA 3AA9A 4D3HA 2NQPA 2CG4A 2FD2A 2VBWA 2WBMA 3LP0B 1FXLA 4TN2A 2W9AA 2V4JB 5KFOA 5GMKa 1QJHA 3CMAS 1SV5A 3QJPA 1F5AA 3SSSA 2IMOA 3C3LA 3JYTB 1KQGB 2HGNA 2XCPA 3Q22A 4G1PA 4R8UB 2LYVA 4RW7A 4C3MA 3TUJC 3K2YA 3POTB 3DCAA 5EWEA 2R7VA 1SQEA 2DPIA 4K4XA 4FS2A 2IC3A 4ZP9A 1S49A 5FDLB 1RTHB 2FIUA 4U9RA 4ZS6A 3THPA 3TYTA 4CNZA 4RNFA 2KB2A 4I4BA 4I2PA 4B9UA 1RT3A 2RIJA 4ZPTR 2YTCA 4Y2IA 3H5UA 2W24A 3CCLS 1CPZA 2Z8QA 2HWHA 3OUYA 3HJFA 3THVA 3DRXA 2DNGA 1YQHA 2C2DA 4FBUA 3AH6A 4N8OA 3PFEA 1TQLA 2YWHA 2ASDA 1Q7LB 2ZE2A 4KRWA 2WCXA 2PE8A 1U1QA 5AXLA 5A8RA 4FS1A 1URRA 1QTMA 2WB1D 4ECWA 1SJRA 3PZPA 1LFWA 4M63A 4NPOA 3M2UA 4HHJA 1G7CB 2K7KA 3QIPA 3GIKA 4IUFA 1VK3A 2J0QD 4K4ZA 2R7WA 5IT9Y 2D9PA 2NPFA 5T14A 3N6MA 3UD4P 2FLNA 4KAIA 4CT8A 1KONA 1VRUA 4NLGA 3MR6A 1EETB 4C4WA 2YKAA 4MH8A 4DV2F 2OO4A 3F41A 1VHFA 3SFGA 1L3UA 3T5JA 1VLYA 3GFYA 3V5RA 3MUVP 4O3SA 3MF5A 4GMKA 3BEGB 1U4BA 4YHHF 1YJ9S 1D9AA 3AQOA 3H2VE 1D0EA 1JLQB 4NLDA 5J2QB 1AROP 2Q3PA 2UV8A 3DLEA 3J7ZT 2ZJPQ 3QPIA 2W25A 4DX8H 1D1UA 3VAIA 2J7WA 3CVKA 2JVRA 3OLAA 3ZC4A 3C2PA 4LF5F 2FGOA 3M6UA 4PCQA 4O4RA 4XPCA 2QLXA 1FTRA 5E7OB 3R5AA 5J1EB 2QFJA 1S10A 4JI4F 2IM0A 4Y2MA 5D6GA 4J9MA 3UCGA 3TANA 5LXYA 1R0AB 5J2MA 3IG1A 2OH2A 2QV6A 2JLFA 3I9ZA 1MU2A 1OSDA 5B7WA 3GSDA 4A8XA 4J37A 5HBMA 3C6TA 4CH1A 1NHUA 2YNGB 2VG7A 4K4UA 1Y4ZB 1LW0B 1U7LA 2B4VA 4RW9A 5DQHA 3M1VB 1E6YA 2ZH9A 1RGVA 4YMEA 1QSSA 1FXRA 3M30A 5KOWA 1IBLF 5C25B 1WNEA 3KK2B 2BANB 1GXLA 1X9MA 3QZ7A 1R8BA 2ZC4A 4PPZA 4LF8F 1JB0C 2O1PA 2YNFB 5KG6A 5L8RC 5DO2A 1JNRB 4J9RA 2HNZB 3ISZA 1YITS 1T02A 5F41A 3HZGA 4UQGA 4YB7A 4DFJA 4X65F 2LLZA 2B4PA 3FEZA 1U1NA 1VQKS 1REVB 1WHXA 1CLFA 2EW9A 2FDNA 1KHWA 2LEAA 5D77A 5E5NA 2IRYA 4G1IA 2MSTA 4O3OA 3QYYA 4YR3A 3D2WA 3H8YA 3VZIA 3DHXA 2ZH5A 3J7YU 1U8SA 1Y5IB 3DOKA 4Q2LA 3T19A 4B3TF 1WHYA 4B9SA 3CJ3A 4BWMA 5KFRA 5B09A 2DNOA 2IA0A 1NKBA 2PFFB 2RB7A 5KFPA 4WK3A 2Q43A 3WDOA 1U1PA 2VPZB 5H1SV 4H4KC 2M0GB 1V6HA 4YUDA 3DMJA 3ETOA 3SSRA 2W9CB 2HYIB 3VAFA 4DUYF 5HMXA 2R8IA 3CJ4A 1IQTA 2E1CA 1QE1B 2HNDA 2OFHX 1TZ0A 3BGUA 3NP5A 3KK1B 4TLRA 3ZZPA 1ZM2A 2VPWB 4DV4F 3MXHP 1IN0A 1S99A 2MMYA 1IR0A 2RKIB 4NLRA 4Q8EA 1TL1B 1URNA 4QWEA 5HMWA 3MAHA 4ZCKA 1S6PA 2FLOA 2F1FA 5B0FA 3HX9A 1UL3A 1N0UA 3MFIA 2FHKA 4O3RA 1XEZA 1IKWB 5HL7Q 1TL4A 3GIMA 1ZAWA 3SQGA 3KJVB 4LMZA 4MYTA 2E5GA 2AGOA 1FDDA 1XMOF 5JVHQ 2RT3A 3CCZA 2CQ0A 3ZZ0A 4EFAC 4OFZA 2EK6A 4NLWA 2E9TA 1X4EA 2WOMA 1OPZA 3JSRA 3WZ0A 1Q1KA 4PWUA 4QJVA 4ZLPA 2MGZA 2J5AA 4IQMA 2W9BA 1C2PA 2MQOA 3I0RB 2EFGA 4KFBA 2KHCA 1VRTB 3N6NA 2PA3A 4H4KA 4ED3A 1MROB 1SUQB 4ZPCA 2LU2A 5M2RA 3VTIA 3MECB 4NYOA 1C0TB 3C46A 3V81A 1R8AA 4OI6A 2L3MA 3DFEA 4C3LA 3D28A 1XR7A 5CH7B 3PO4A 1UVLA 1R7IA 2ABYA 2OD6A 4Y34A 4NCGA 3EGWB 4RW6A 5IT4A 2G9OA 5EUHA 1X4DA 1SKWA 4U7CA 1J2VA 3OV7A 1SBRA 2DGQA 1N32F 4HT7A 4DQPA 3KFWX 3OPKA 3TAMA 1ZETA 4EZ9A 4EYIB 4DQQA 3ZZYA 2CPYA 3DI6B 2FHJA 2PIIA 4MAKA 3OSNA 3GG1A 2GX8A 1XN9A 2DNLA 2J9DE 2PC6A 5EN1A 1HR0F 1DQAA 1HBOB 2GQQA 2W9BB 2MYFA 1HPZB 4LUBA 4A8QA 4RZRA 2V2KA 1HNZF 4N47A 3H5SA 1X4BA 1UFLA 7FDRA 2ZNYA 3UCUP 4OZLA 1DLOA 4H4MA 5KFNA 2C2EA 1TK0A 1EP4A 2ZUGA 5IS2A 2K7JA 1R31A 3OXLA 4KHRA 4ECXA 3V6JA 3F44A 4GO5X 3DLLQ 2AYMA 3IR5B 3GB0A 4Y0FA 2UUBF 2VPXB 3L09A 3LUYA 3HI9A 3JB9k 4IRKA 2ZM6F 5IWAF 3SYZA 6FD1A 5AJ3F 2FPHX 3M4XA 4ECYA 2B9WA 4MIWA 5F0WA 2XO7A 4LSLB 3M2VA 5EX3A 3KMQA 3KLIA 1T3OA 3W2WB 3H5YA 3LP2B 5DQGA 5DJBA 2E5JA 1H2UX 1XWLA 5D4NA 2VG6A 3U1NA 2X1GA 3I87A 2ROPA 3HHEA 1KTQA 2WSFC 1VIXA 3M8PA 3OXGA 2JEFA 2OD4A 2GA7A 3JSMB 4Q0BB 3O8WA 4GKKF 3V6KA 2UZAA 4DFKA 2XY5A 5G4DA 1JKHA 4J9QA 2VV5A 4ZP6A 3TR5A 1A6LA 4P7VA 4F67A 2XCAA 1VGYA 3ITHB 4FZVA 1T03B 1RAJA 2P9CA 1KN6A 3WBZA 2DNYA 4ATNA 3BGLA 2FTRA 1JK9B 4OZ5A 2DNPA 3CO9A 1RJJA 3OR1B 5IM0A 1B0VA 1N54B 4UUXA 4ECZA 1P6TA 5E2QA 4IYQA 2WW8A 1NZAA 1S6UA 2CPIA 2Q1LA 3NL0A 1GT8A 3I32A 3BSOA 1IKXA 3DNCA 4LQ3A 3CCQS 1ZH5A 1S6OA 2BM0A 2D3ZA 3FGVA 1Q16B 1S6QB 4LQ9A 2AGQA 4N56A 3O3LA 2QEXS 5ITHA 3K57A 4YB1P 2YH0A 2KXHA 2V94A 4C11A 4F02A 4RW4B 3HF5A 2VA3A 2WB4A 3EXYA 3MM5B 4KTQA 3VAJA 1GH8A 2ASLA 2F8EX 4TYBA 1YGYA 1RT4A 2HIQA 2VFRA 1Q8BA 4FNIA 2B51A 4A8OA 1C1BB 2ZZNA 2WTFA 2XS7A 2M7SA 2VA2A 2Z2MA 4IOBA 4KGKA 3LF0A 2U2FA 4IG0B 1KOHA 3E01A 2FY1A 1CQMA 2VQEF 2DH8A 2HMIA 1HWUA 2D41A 1NH8A 3KLHA 2BQ3A 4NXNF 2JOQA 4YEAA 4J9KA 2F8MA 1TL3A 1ZAXA 4WE1B 3TP2A 3MM9B 1JLGA 1TAQA 1UETA 2G1DA 4P6QA 5GADI 1KNZA 3MD3A 4YDDB 1IBMF 2XWXA 5K8MA 2CQBA 5K5MA 3BGRB 1L5UA 2CYYA 1M5HA 1SB6A 4EEYA 1GX5A 1Y3JA 4K4WA 3D1QA 2HNYB 1HBMA 1LQ9A 1RISA 1SI9A 4L72B 4BWJA 2UUCF 3CDEA 2BY