1PILA

Structure of the escherichia coli signal transducing protein pii
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
112
structure length
112
Chain Sequence
MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFGRQKGHTELYRGAEYMVDFLPKVKIEIVVPDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRIRTGEEDDAAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nitrogen regulatory protein
molecule keywords SIGNAL TRANSDUCING PROTEIN P2
publication title Structure of the Escherichia coli signal transducing protein PII.
pubmed doi rcsb
source organism Escherichia coli
total genus 22
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 1994-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1pilA00
1UKUA 2EG2A 2EG1A 2ZOMA 2GX8A 1HWUA 4USJC 1VHFA 2ZFHA 4ZK7M 4WK3A 3TA2A 3L7PA 3O8WA 3N5BA 1NH7A 2CZ4A 1J2VA 1NH8A 2J9EA 2J9DA 2V5HG 2XZWA 1O51A 4Y6IA 3NCQA 4IYQA 1PILA 4NYOA 2GW8A 4OZLA 1VFJA 3AA8A 3GSDA 1Q1KA 5D4PA 4NYPA 3M05A 4CO0A 2PIIA 4YB6A 4CO4A 4YB5A 1NAQA 5DRKA 4D3HA 3AA9A 3NCPA 3AHPA 3T9ZA 4R25A 2E66A 4RWXA 3O5TB 4CO5A 1QY7A 1XK8A 3DFEA 3MHYA 1GNKA 4CNZA 4Y65A 3TA1A 2XBPA 3NCRA 5DS7A 4E98A 4OZJA 1P1LA 1UFLA 1V6HA 4CNYA 4CO3A 2JJ4D 1V9OA 4AFFA 2DCLA 3OPKA 3LF0A 3AH6A 4CO1A 2J9CA 3TA0A 5D4OA 4YB7A 1V3SA 2NUHA 2GNKA 4RWWA 1UL3A 4USHA 4WK1A 2VD3A 2RD5C 4C3MA 2O67A 5D4NA 2NS1B 2XG8A 4C3KA 2NUUG 2J9DE 4USIA 1OSCA 1V3RA 1O5JA 4RX6A 3BZQA 1NZAA 1UMJA 5L9NA 4D3GA 3CE8A 2O66A 5D4LA 4C3LA 3HLUA 2Z0GA 4RLEA 3X3UA 4CO2A 1KR4A 1H3DA 4OZNA 2XULA
chains in the Genus database with same CATH superfamily
4OZ1A 1GH8A 4UUWA 4CLUA 3T1YJ 5I3UB 1XNQF 2C3YA 2HK2A 5GAEI 2BE2B 3M6WA 4ED2A 4P2XA 5KFQA 2IBKA 3TWZA 2KG0A 1D3WA 3V2UC 1N8RT 1U1LA 3QJPA 4WKRA 2E29A 4TLQA 1FEEA 1LWEB 2COLA 2KN4A 2J7KA 3GR1A 1NDLA 1KFSA 3EYZA 5HBMA 2FB0A 2UP1A 2E9RX 2IRXA 3LGNA 4ZIWA 4I0WA 2PC6A 3TZZA 3F73A 2QMWA 5SUHA 5KTQA 3UCZP 3DRYA 2NUHA 2C2OB 4CT9A 2FY8A 3LP0B 1K1QA 3SCIE 5DG9A 3BPDA 2X7IA 2HLTA 2HMIB 2JEFA 1S1UA 2BRLA 2DGQA 2JVOA 4IR1A 2DR5A 1ULRA 3OTBA 3NBPA 3P3DA 4F04B 4ETZA 2BW7A 3T5LA 5E3QA 4IR9A 4ANDA 5CYMB 4UOFA 3UCGA 1N6QB 2DH8A 1B64A 2RUGA 4GMKA 5EUHA 2FJAB 3N5BA 3LGHA 1WOOA 2W2NP 4ZHRB 1FE4A 4ZVPB 1R3NA 2ZH5A 2XMTA 3CULA 4IRCA 4MIBA 2ALZA 4IRDA 4N7TA 2XHWA 1S9EA 4M5NA 2D74B 5K5MA 1P8GA 1FCAA 4FF2A 4LMZA 3QT5A 3AOAA 1H73A 3QGGA 1TK8A 1V9OA 1M5HA 4Q8FA 3TQ1A 3A8KA 4RNOA 1FXRA 1Q81T 2ZKTA 1QUVA 1KVKA 4DI6A 1EP4B 1OYDA 4IFVA 3O1LA 2OFHX 2BR0A 5B0BA 2Y3YA 1JLEB 1HNVA 1NB7A 1ZS6A 2UUTA 3T41A 3IWLA 3W2VA 1NKCA 4DQSA 2ZOFA 2Z0GA 3TJ9A 3L9ZA 4CO2A 3KWMA 1TKZB 5KFSA 2L9WA 3M8ZA 2R7QA 1WOSA 1S49A 5EHHA 3C15A 4IO9Q 3DOMA 2QZ8A 1X4AA 2M2BA 3P5TL 3E51A 1N32F 1CEZA 2WCXA 1EHWA 4JB8B 1MSWD 2XY6A 4WFYA 1FRIA 2QA4S 1YGYA 2J0QD 1IQZA 1FD8A 3S7RA 1G1XA 2YKMB 3GG1A 4NLQA 3MMBA 2I8EA 4OL8A 4L6V3 1VRTA 2DNPA 2CG4A 3NS6A 1LV5A 4ZVRB 3JTPA 4DR5F 3MECA 3D3CJ 3EGNA 4GKKJ 4JI1J 4UY8T 4QIEA 1QAYA 1MWZA 1UL3A 2GQQA 1U0HA 4JI7F 3J7YU 1CC8A 2E1AA 3HVTB 3H5XA 3C8YA 2P6TA 2EWHA 4OYZA 2NR0A 2M88A 3MD3A 1AROP 4J7CA 2VFRA 2MZTA 5LMNF 4PWUA 3BN4A 2EFVA 3VCDA 3LP1A 4FDFA 2L08A 4J9MA 4Q43A 2DEJA 4ANCA 1F9FA 3ITHA 1TR0A 2ZDPA 2ZH7A 1Y4ZB 5GAHI 3IRWP 4CP5A 4C4WA 2YWFA 3BR9A 1EX8A 3HVRA 2FJBB 3M2UA 1XBWA 1AT1B 4C8YA 1S97A 2HSEB 4DV7J 5CYQA 3BSOA 3NMRA 5KFEA 3WHIA 2VC1A 1BXNA 3M8QB 3D0HE 4DUZF 3W61A 3V81B 2HFVA 4RO0A 4ER8A 2MLZA 3DGVA 3HFKA 2UUCJ 2PEHA 2XS7A 3H25A 4DV0F 2EC2A 1FRMA 2C2MB 1NHVA 4KH0B 1L3UA 2DIVA 4NOHA 4NLGA 1S1TB 2NXCA 2RDDA 4DV5J 1JLBB 3JQMA 3KNGA 3V6KA 4I67A 1Y5NB 3I55S 2AIRB 2CZ9A 3ZNJ1 1KLMB 1IN0A 4A8FA 2FGCA 4B9LA 4QIGA 3UE2A 2FYXA 1S0NA 2B4PA 3JSRA 1UVJA 4OZNA 3MUTP 3CJSA 3PW2A 3AQOA 4EGLA 3FCWA 1FKAF 2AZ3A 4HR2A 4F4AA 3UDLA 1RU1A 4OIXA 4JI2F 2FHMA 1T11A 2HKEA 1NJIT 4BC7A 3CCMS 4F67A 2B6AB 3HHLC 3OSPA 4HH0A 4PG4A 4LBPA 5DRKA 1YJWS 1OIAA 4JV0A 1MU2A 5KFTA 4WFBQ 2JEIA 3R2CJ 1YHQS 3R6LB 2IHR1 4FYWB 1RWXB 1JLQA 3GG0A 3QWUA 3CB4A 2I0XA 3KDNA 3TYTA 4C11A 3BGRB 3PO5A 5CH7B 2UVRA 4P7TA 2CQ3A 1V3SA 1XIQA 4WFZA 1VK3A 4DR1F 1VCTA 4X62F 3MM7A 5D4NA 1T02A 4EMDA 3A3PB 2GMLA 1V3RA 5KG2A 1TL4A 2UXBJ 2Y8YA 3SCJE 2QSFA 1CJTB 4KHPJ 3W7BA 4HH1A 2OFGX 2PGCA 3JXOA 4Q8EA 4S0MA 3EM1A 4LVOP 4PR6A 4RLEA 1FI4A 5HP1B 3SBMA 4NMLA 4TY8A 3TA2A 2OO4A 1RT4A 4ZVGA 3MDFA 2W25A 1BQNB 1SCJB 2O01C 3J7Z5 1NUEA 3MM9A 2KVIA 5C2GA 3CC2S 3T5JA 2DR8A 2DNKA 2B3TB 3CJKA 2XNRA 3FGVA 3M7VA 2Q6CA 1X0FA 1JNRB 1PYOB 2GA7A 4X4NA 1U47A 3X1LB 1NRKA 1QTNB 2AGPA 3HX9A 1R0AB 3JTNA 5THWA 2VG6B 4B3OB 1LK7A 3JYTB 1GQEA 5F8MA 2VONA 1HHQA 2FJWA 4J9SA 2B7CB 5DM6Q 1RGVA 3MAAA 2BJ7A 2DIUA 2MQQA 1UFKA 2HHSA 5BR8F 2ZH3A 1HQEA 3PJ9A 2XI2A 1WC1A 1F60B 5GADU 4B3MF 3MM8A 4UZCA 1F5CA 1TVRA 3ISNC 3ZTRA 3IMQJ 3DGPB 5B0FA 1UVMA 4OZ5A 4OJ3A 2E5JA 2WVBA 2YH0A 2MXYA 2VBYA 1NK7A 4NCGB 4KGXB 1DZ5A 2CQ2A 1U1RA 4J9VA 1APSA 2C42A 1CJKB 4ZVSB 5F8JA 1YTYA 2CQHA 3LPYA 4HACA 1Q8BA 1TKXB 4D3HA 2EFGA 2IA6A 2ZWOA 2IRYA 3MAQA 4P74A 5ETSA 1BWEA 4NXMJ 4CYUA 5HLFA 3US5A 3MGJA 4EBCA 3AFGA 2F7VA 3DLEA 4ZLNA 2Y1IA 3HDSA 1CLFA 1WACA 3GFXA 2EC0A 1UVLA 4KB7A 4UW2A 1NBEB 4MK9A 4YB1P 2VICA 3TARA 4C8OA 2HHQA 1VMBA 4ED1A 4LIWA 2Z58B 1S6OA 3CCWA 3ENAA 2QSWA 2XSFA 5K20B 3CNQP 2RS2A 2KXFA 5J2QB 5DZ7A 5CQGA 4QYZJ 3OT9A 3NCQA 1OO0B 4LRCA 4CH0S 4X66F 3OR1A 5MAOA 1Y00A 3CT9A 1LK5A 5F0WA 4HYKA 2ZZMA 2D3ZA 3FNNA 4ELTA 3CEDA 1HHSA 2PD1A 4LF8F 2XC9A 4C2MA 4F2RA 1WHXA 4CO5A 3DFEA 4CTAA 1FJGF 4Y65A 1HBNA 1JLAA 4EZ9A 1N36J 3QZ8A 3LPEA 2IMWP 2QYGA 3MTKA 2BX6A 3D54A 2MJUA 4NRUA 4Z7CA 4O44A 1Q8LA 2FLNA 3OTCA 1N33J 1SUQB 1VIOA 2IYGA 2GGPB 1K47A 1UVNA 4QPTA 2CWXA 4NXNF 5G4DA 1QE1B 4F4WA 3BGFA 2MGZB 1TKTA 4NE9C 2ATCB 2CG8A 2QLFB 2V8DA 4NZ6A 1YVFA 4OZLA 2OTJS 5JJBA 3QQCD 2CADA 2RQCA 1TK0A 2E44A 2POKA 4RBTA 1VQLS 3PRDA 4NMXA 1S72S 2VPZB 3AHPA 3CXCR 1RWKB 1OPZA 1M90T 1CSJA 1HFEL 4NZ0A 3S6EA 2I5JB 4ZS6A 4OZJA 2F9DA 4F0HA 1XWLA 5KFLA 4P75A 1JLGA 3GWCA 3KHRA 3UR0A 3CCLS 2M7SA 2VG7B 3KK3B 4GC7A 4ATNA 3IXQA 3Q0AA 3P49B 4ECYA 3ZZZA 4DR4J 1C0TB 3G8QA 4I64A 3M8YA 3Q8SB 3MUMP 4LVNP 1FNOA 1UPPA 1O6XA 4IDKA 3C16B 4M8LA 3HSZA 1VR6A 4EBEA 2L9NA 3NEKA 3CDBA 1RE1B 2J76E 4QJVA 1G2EA 2OLWA 5F8NA 3KLVA 4NEZA 2V4JA 4IOAQ 1W2IA 2DO0A 2BKOA 1UPMB 5HL7Q 3NLCA 2N82B 4ED7A 1TP7A 1Q53A 4U8YA 3G6XA 2DITA 1RP5A 4WE1B 3O2IA 1WKLA 1IKWA 5E3RA 3OFFA 2D9OA 3WBZA 2I2YA 4J9PA 4NLOA 4A8KA 4K2JA 4J9NA 2UUWA 2HRTA 1FK9B 2R4FA 3ET6A 2RH3A 3HKWA 1AFIA 1DQ8A 1SH3A 4LF4F 1WC6A 3C6UB 3I0SB 5KG6A 5DO2A 2JVRA 4USWA 1SBRA 3FJ2A 1SL0A 2XCAA 4DPOA 1JWWA 4R5PA 2JWNA 4K4UA 2AEFA 1X5OA 1GXUA 1X31C 1E6YA 1X9SA 2YPYA 3X3UA 1H2TZ 4KPCA 1SJFA 3PFOA 4NEYA 3DRRB 2BQRA 5K8PA 4UY85 2OPRB 4TNOA 3GU0A 1NEEA 4XTTA 3QLHB 1FDDA 1S5ZA 4ECUA 3M8PB 4WKYA 3AQPA 4K4ZA 2GW8A 2J6TA 1FNMA 3JQJA 1JJHA 3EXCX 2N7CA 2YX7A 4CIOA 3VAFA 3MPVA 4Y00A 3SQGB 4ALZA 2AYGA 1EARA 1HKAA 9RUBA 1Y3JA 4RWXA 5IC4B 5KFYA 4MFBB 4CNYA 2IYIA 2NREA 1JLFB 1VRUB 1S1XA 3VAJA 5HSPA 4K59A 1S1VB 3HXMA 3JB9k 4O0IA 3NGDA 4KE5A 2A3JA 3D4JA 3G6VA 1NO8A 2QFIA 4OX8A 1RABB 3OUYA 4Z37A 4RUHA 3MMCA 4WPAA 1AZSB 1T7PA 4MAKA 2HGNA 5L1KA 2G0CA 2R9LA 1EAYC 1U0SA 3N28A 1VQYA 2H51B 3BJYA 2MDAA 4GO7X 5G0RB 4F25A 2G2ZA 3PYFA 5DQGA 3KXDA 2XSJB 1X4BA 4NLUA 4Y6IA 4DOZA 4IG0B 1S0MA 2IAJA 3QRRA 4G1IA 3C66A 1IKVA 2QL7B 2G4BA 2FUG9 4J9UE 4NL5A 1AB8A 2IDEA 4DS5A 2MTLA 5D0GA 5LMUF 3EZOA 1NK0A 2CUYA 1NJYA 2CJYB 2ZH8A 5E3PA 2MZ1A 1DBDA 4I56A 5DDQC 3H8YA 3M32A 2VASA 5J1EB 5IV3A 4IFYB 4C3MA 4DQQA 1NK8A 1F2HA 4DHVA 2WBRA 2J9DE 1NK4A 1HR0F 3KLGB 2F8MA 4KPYA 3MEKA 5AE1A 1NDCA 4DX6A 3CE8A 1QSLA 2HHXA 2K2PA 4ZP8A 5FJ4A 5B0CA 4X64J 1OQ6A 3MCSA 3QSIA 4BDPA 4NLPA 4I2PB 3O8WA 1RHKB 1UWBB 3OFEA 3OFHA 4QWCA 1WWHA 4YR3A 4LFAF 4ID5A 2B4UA 4DV4J 5A6WA 4OZ0A 4C0HA 1KHVA 5CZVA 4MIAA 1IR2A 3T6JA 2LP4A 3D6FB 5HROA 2RT3A 1NXIA 1T9TA 2E66A 3DN9A 3MPDA 4OZ2A 5C42B 1D8YA 1KTVA 4NWBA 4TU7A 3IS9A 3OTOJ 1FJ7A 3DM2A 4U7CA 5GMKa 3BM7A 2AGQA 2RILA 2VG5A 1M5OC 1XN9A 3NNAA 5KFHA 4F4YA 1VBZA 3WDOA 3OXLA 1LW0A 2DGTA 4JI8F 1QAIA 1QAJA 1VOMA 5ETTA 2B5JB 4AD6A 3ZTSA 1Q78A 3HHLA 1G6BA 5CA5A 4K4TA 3BDEA 3SMZA 2BM1A 1LWFB 3W9JA 4DL7A 3M6UA 2LQJA 1ZAXA 2OPSA 4F8RA 2KM8C 4CLTA 1VS3A 2KHCA 2P5VA 5E41A 1S99A 3FZBA 2Q66A 3PTWA 3M8RA 2R42A 3RBZA 5I42B 4Y3CA 2ZM6F 3VHQA 2Y0SD 2V9WA 3Q8RB 3RZAA 1KONA 1KP6A 3T5HA 4MKAA 3OL6A 1MG7A 3U1NA 1RISA 2VFTA 4NI2B 5DDPC 1RWOB 2U1AA 3V6DB 2AQ4A 3CJRA 4NA1A 2CVIA 5ETVA 4OMFG 2X1FA 2HIYA 4YFUA 1FKPB 3POTB 3R5AA 5E7OB 1FTCA 5D15A 4ICLA 1XNQJ 1W7WA 1A6LA 3TUIC 1D9DA 3HVWA 3SDEB 2CAJA 1OQ3A 1RSCA 3KK2B 2R7UA 3RW7A 2GMJA 4BHQA 1KEKA 4DR6J 2ADCA 3HHDA 2VFUA 3AOBA 1JXLA 1UJ5A 2E7WA 3BO3A 3AXKA 2GJIA 4RNFA 3UFCX 2AT1B 1SXLA 3IGVA 1ZAVA 3RTVA 1AFJA 3EUNA 4ZPWR 1KC8T 3I5BA 4I2QA 2HURA 5J2NB 2D3OR 4F7VA 1R0BG 1RWPB 2CZVC 3DLGB 1DTQA 5D4OA 4KGKA 3ILLA 2DNRA 3ILIA 5L9XA 1IWAA 1X5TA 3K5NA 3CCRS 2YKQA 3PJXA 4KR0B 4F02A 3MR3A 4RR5A 4C3KA 2QMXA 1VQOS 1XTZA 2ZH4A 1WKKA 1YJ7A 5SZTA 1DTTB 5M2PA 2XTJP 5FD1A 3NG8A 3MOJB 4QW9A 3RBDA 5F0UA 1VQ6S 5D4LA 3TX8A 2MQPA 4O0NA 3WZ0A 2GJ2A 2V9KA 1U1OA 3AAWB 1QSSA 2ZHAA 1R31A 2ROEA 2HWHA 1C4AA 3QJLA 4TVAB 4FZVA 1EQ0A 1SJRA 1NK9A 2FTRA 2DBBA 4K0KF 2RHSB 3W5YA 2CJKA 3E01A 3VV2B 3ZTOA 2RQ4A 4DSIA 4N8OA 5KAKA 3EDQB 2VOPA 5HBMB 4N76A 2AJQA 2WOMA 5K9FA 4AT1B 4GKJF 3ENQA 3FRZA 2KH9A 2PEBA 3B4MA 3SCKE 2WTFA 1BD6A 3FMWA 2I6WA 1U6FA 3PM9A 4P73A 2VIHA 1RAOA 3K8WA 1HPZA 2NXEA 2R8HA 1R8PA 1HNWJ 3SFUA 1S1UB 2MZSA 1LWCB 1N88A 4WWSA 3HT3A 4DV6F 1VHIA 3BYPA 2V69A 2H3EB 2HBYB 3NBPB 4N47A 1J5EF 3H42A 3OL7A 2K8GA 4WIQA 1WC4A 3NGSA 5DDRC 1KHWA 2GV1A 1N32J 5LM7E 2FJVA 4ZP9A 4WP3A 1QVFR 2DHSA 1HBMA 2CQDA 5KT7A 2CFXA 5DLFA 3KDOA 1J5OA 2E1MC 4YY3F 3QATA 3TUPA 1U7LA 4DR5J 1S9EB 4P52A 1XC9A 4TKTA 3TOQA 3TZXA 5J1PA 1ZZNA 1XR7A 1FTRA 4JI7J 5HJYA 1P27B 4F2SA 2UVVA 4DX7A 4OI3A 5KFMA 3KUHA 5ETLA 2DH9A 5CABA 4ERDA 2MMYA 2LCWA 4AFFA 3QAEA 1HNIA 4HLBA 2J9CA 1Y7PA 2AWZA 4L74A 3N6MA 3ZZYA 2ZHOA 1Q4RA 2VUGA 4IFVB 1RAGB 1RCXB 3SCLE 2O67A 3GQCA 3UCUP 4FYXB 4DL5A 2HFUA 1B0TA 3GPAA 2DNZA 3T19A 3OHAA 3I4HX 1HNVB 2AW0A 4YR0A 2HNDA 3A3OB 1EETA 4DPTA 3W2VB 1XJWB 4OYBA 2IPOB 4PWDA 4K8RA 5CD4A 4UOCA 5B7WA 3N6LA 4LRDA 1PYTA 1HQ2A 2HK3A 5LXRA 3C15B 3DOMB 3KG4A 4X4SA 3HSJA 1KQSR 1VLYA 4WYLA 1M1HA 2V8HA 4NA2A 1T94A 4NRTA 1S4FA 2CRLA 3EDRB 4DUZJ 1Q16B 2KT5A 4M63A 3HJFA 1SI9A 4OJ1A 2MHNA 3FDSA 4DZ6A 1HWIA 4DV0J 3FSIA 4DU7A 3JQKA 2C28A 3CD6S 2LEAA 5JVGQ 2Y8WA 4DPUA 3PYEA 1AA1B 2VDIA 3MMBB 3RYLA 3W1YC 1SQEA 3IG1A 4USKA 1N5SA 4Y28C 2QLWA 1VISA 4FF4A 1U2FA 3PRVA 1QVGR 3MECB 2V2KA 4KHRA 2AX0A 4FKYA 2A2DA 1U0HB 3Q2TC 5BJRA 2ZHBA 2F1FA 2EXUA 2HRYA 2E5HA 4MTPA 3VTIA 2IM3A 1SIZA 1X9WA 2FVCA 4KJIA 3DLBA 1ACMB 4RW7A 3QIDA 4H4KC 3LWMA 1T8EA 4FS2A 1F5BA 3D5MA 3THTA 1N34J 2L3MA 1FX4A 2Z30B 3QYYA 3LP1B 4G3IA 2F8EX 4XIUA 4NCBA 1SVDA 1T9XA 4LT6A 3ITHB 3G9CA 4USJC 4ID8A 1NK6A 4OI4A 2Y9HA 2FJXA 2BABA 1S7IA 2BEFA 2OMOA 3M2UB 4JI3F 1ZZFA 2AU0A 2JH3A 3DC2A 4CO0A 5CYQB 4C48A 2H48B 3R7NB 3A12A 1TV6A 1Q8IA 3T9ZA 4OI6A 1TMJA 1RHQB 3N5FA 2J8SA 3HCXA 3TVKA 1K8AT 3VVTA 3IAM9 2D41A 3H59A 2V8PA 2DRDA 1C1CA 2LEBA 4ZIVA 6FD1A 2IC3A 2ACYA 1UTAA 4CH7A 4PCQA 3FBFA 5KG5A 3GJRB 3ULHA 4P7VA 2B7BB 3QT7A 3QIPA 1L3TA 2Z2ZA 4L72B 4W98A 4WTYA 2YX1A 3M1VA 4DUTA 5K8NA 3GB0A 2L41A 4OYMA 2ZNZA 1UMJA 2JZ5A 1XQIA 5T14A 2EI5A 4V19J 2LU1A 2RDIA 1GTEA 1RBOB 1HBOA 4R0EA 1RT6A 4P2MA 2QC3A 3CTRA 3MD1A 4PG5A 4UF4A 2UXCF 4Q7AA 2FLOA 5B0DA 4Y2CA 4FYDA 3UDVA 4BCAA 4C0OC 5KG1A 5F8IA 4RW9A 1MU2B 2ASYA 1PGZA 1EB0A 4MIWA 1NK5A 1WHVA 2KDOA 2QIFA 1X4FA 1F3VA 1JLQB 5JMNA 4ES1A 1U26A 4C11B 3LW5C 4UQGA 2D69A 3BO2A 3LO3A 7FD1A 3M2RA 3RU0A 2YBVA 1ZETA 3LANA 4Q0BA 3OTEA 5BR8J 3OLAA 1YRUA 3MM7B 3R97A 2ZD1A 1GMVA 3BBCA 4B3MJ 2DGUA 2BYCA 4GRSA 1VQ4S 1P9YA 2IMOA 3FKBA 2VA2A 3IWXA 4IUFA 4ZJOA 2DD8S 2IRUA 2GIQA 3RB4A 3U1LA 1LKZA 4TY8B 4ZJQA 4BC9A 1TFWA 3I0RA 5BYQA 1RT4B 2AD9A 1XNRF 1FD2A 1SC4B 2NPIA 4QQBA 4J9LA 3MCMA 3MM9B 3OSNA 2W4CA 2HQFA 2H65B 3A4TA 3G6YA 2KXNB 3HPOA 4FYVB 3CJKB 1UA0A 3FBEA 1SPBP 7FDRA 3BQ2A 1N0VC 1RUSA 1I94F 3RRKA 1G3OA 2QRRA 1B0VA 5LXYA 1V3ZA 5E3CA 3IN5A 4AYBD 3EWGA 1P1LA 2GO9A 1HWKA 1WI8A 3CMES 3W9HA 4IO1A 5CAAA 2QA2A 2DYAA 2QTWA 3F44A 5I3PA 2V50A 1MN7A 1T9UA 2XM3A 1KFDA 1PJ6A 2VODA 2VJVA 2DRBA 4WTOB 1N33F 3MAAB 4OLOA 2FVRA 4EYIB 2F5GA 1JXVA 4UT4A 1HQEB 1GT8A 3MM8B 4B9TA 4P2FA 2NXJA 1R8BA 3MEEA 3RBEA 3D0IE 2EFPA 5KFOA 2OSRA 4LF8J 1RWUA 4I7FA 2IY5B 3PYGA 1FJGJ 2EEYA 1VQ7S 1DARA 2YY3A 4ECQA 2KT3A 4A8SA 4HACB 1VYAA 3KJFB 3GLJA 4J9QA 2XGPA 4B9UA 3CD5A 3MMAA 1XK8A 2CDRB 1GNKA 4BWMA 3DHWC 4CYUB 5HLFB 4DU8A 4G1QA 4DQIA 4FBTA 4C6AA 3CJ0A 1CG2A 4OV6A 5C24A 3B6BA 3DLEB 2GFFA 5FDLA 3PY8A 3D1OA 2QA4G 2G0JA 4NXNJ 1PO6A 4FS1A 4QWDA 1R8HA 4FP9A 4FVCA 4J5OA 2WSEC 4KBIA 1N54B 5LL6d 4KGZB 1KBRA 2WONA 3CDEA 3I56S 4QZVB 4HHUA 2DNLA 3D6TB 5KT4A 5GAGU 4C3LA 1IM4A 2ZH6A 2DR6A 3BKTA 2EPIA 3T9NA 1IUJA 1FXLA 3ILOA 4PABA 2KZZA 3OR1B 3KJNB 3MI7X 3VAHA 1GXLA 4MKVA 2PIIA 2HG4A 3DI6A 1PG5B 2R3VA 2OKQA 2YVSA 4CTAB 1VBKA 1HBNB 1S6PA 1JLAB 3GFZA 1BC6A 5LJ3Y 3NGTA 4DX5A 4EU0A 2BE2A 1WTFA 2GHPA 4W4MA 1WSVA 2FQQB 3Q8QB 2CQPA 3PX4A 4O44B 5HI7A 1KSPA 3EICA 4WIIA 4HI1A 1X60A 2CQGA 1X4EA 1OMSA 2P9EA 2OTLS 2VJUA 2JLEA 2GVDA 4IH5A 2LA4A 4FBUA 4R8UA 3H2VE 3DLJA 4URQU 3E8OA 2MQMA 5KFJA 2RNEA 2DHXA 2XULA 1Q79A 4HHJA 2RHQB 4B9VA 1TELA 3AD7C 1S6UA 3PRBA 3HJVA 2JRSA 2J9EA 3C14A 1Q95G 3D6MB 5D4PA 3RUBL 3R1HA 2YQ0A 3OJUA 4KKOA 1R6VA 5CCMA 2K1RA 1RTDA 1TU0B 4JV2A 1GXTA 4AL6A 4LF4J 5A8RA 2ZJPQ 1NNDA 1TFYA 1F9HA 2DXFA 1JLGB 3N6NA 4Q44A 3P6YC 1B99A 5A6PA 1C1BA 2E7VA 2W2MP 4OYAA 1NPRA 1ZM4A 2AHOB 4ECWA 2IM1A 4A46A 5KT5A 1RA7A 1F6TA 3QWPA 4ZKAA 3JSYA 2FHKA 2CJBA 1IM6A 3MFHA 4A8WA 1M5VC 2OH2A 3VWSA 2VOOA 2RU9A 1NJXA 2BANA 4IDKB 2WSFC 1NHUA 2P6SA 1Q0NA 3CCVS 4RKUC 4TXSA 4CZCA 4TYAA 5B09A 2KB2A 2QG9B 1WI6A 1EP4A 2FHOB 3CO9A 1WG1A 4ILRA 2VQFF 3PX6A 4YOEA 2H1YA 3H5UA 2CZ4A 2J9DA 4DL6A 4USVA 5IT9Y 1FRXA 3OTDA 4X4TA 3H40A 2DNQA 3K89A 1TKDA 2SXLA 5K8OA 1JXEA 2CIMA 1IKWB 2MQ8A 1XR6A 3J7ZT 1AUDA 2DK2A 1J27A 3ZNUA 1P9QC 2WSCC 2UU9J 1H38A 4ED6A 3SIPB 4Q2MA 2P2CB 3R9LA 2LLZA 1H7WA 4U7UD 4LREA 2APOA 4DG1A 2A1BA 4CLYA 4R5PB 2VFSA 1OSCA 1FERA 4ZJLA 1ZTTA 1E6YB 3RRGA 4LSZB 2NLWA 1HA1A 3EVMA 3H4BA 5H9EK 2UV8G 3I6PA 1ZPWX 3R5BA 2PN6A 4OX7A 1ZPVA 4X65J 5L8RC 4X64F 4X4QA 2ADBA 3KYLA 5LMUJ 1RCOB 3MR2A 1ZAWA 2CWKA 3H2UB 2B4VA 2Z4PA 4M5JA 4DV4F 1BHNA 4ITSA 3Q8VA 2AMCB 1EKRA 4M95A 3AA9A 2ZVSA 2E5IA 3K8VA 3NWRA 4R25A 3PVXA 2MZJA 4ED0A 4OHXA 1BQMA 3W5ZA 1U1KA 1K9MT 2VHGA 1HR0J 1ZBTA 5C5JA 2HZVA 1S1XB 1SIWB 2EW9A 3BGLA 4N56A 3C19A 5D77A 2V2ZA 2MJNA 4E8UA 3OR2A 2MLXA 1TL5A 4MJKA 2OEJA 5DM7Q 1T03A 3OUYB 4LJMA 3M8QA 3MMCB 2ZITA 1CULA 2DNHA 1F3FA 5KFNA 1IKYA 1VBYA 3FVYA 2FVSA 1RTIA 2XZTB 3CO0P 3CCUS 5AE3A 3HLUA 3FEXB 3UD5A 2MPUA 3QFHA 1K1SA 4ELVA 2YX4A 4CLFA 3UN5A 3PV8A 5HMWA 3VGVA 3DLKA 1NJWA 2YWEA 2CPYA 1VQKS 3PHTA 1YSJA 2D9PA 1SJ4P 4ZDNA 2IAJB 2AYEA 1IKVB 2J7UA 2CPFA 3HFZB 2P9CA 4A8YA 1OY8A 2HLUA 1PCAA 1MWQA 4H4KA 1Y5LB 4RW8A 3WC2A 2BRKA 1ITPA 3TJ8A 1PJ7A 3MHYA 3ZZUA 1UEVA 4JI8J 1RAAB 4Q45A 4OJGA 8ATCB 5HQLA 1HW8A 3M32B 4ECSA 2NSBA 2MKCA 2BZ2A 3T5KA 1LOUA 2KT2A 3OBIA 2ZJQQ 3BF4A 1CJUA 5J2PA 1EIYB 5HMYA 1RAJA 2GJFA 3ZZ0A 1FWLA 3PHEA 3CJ5A 2VH7A 5L1IA 4NLVA 4C8ZA 2IA0A 4OYWA 2CNLB 2HW3A 2ZM6J 4BWJA 1T0TV 2PSZA 2HNYA 3OLBA 2DHGA 4OV1A 4DMZA 2RAQA 1U45A 3HT0A 3ENVA 2UUAJ 3R1LA 3KUEA 4DR6F 1M5SA 1R89A 4ID5B 2XYHB 2KYZA 3R6GB 2AP6A 1S0VA 5KT3A 3QAUA 3A8JA 4U96A 2XZDB 3EVOA 2VFVA 3M8WA 3O44A 4A47A 5HROB 1S12A 5KFFA 2HFSA 1VC0A 3GV7B 1DY3A 2IVFB 1FT8A 1FKOB 4NLWA 3CDAA 1BQNA 4DV3F 4FF1A 3IS9B 3DM2B 5B0EA 2DT9A 3LF0A 3RRHA 2R2TA 2VG5B 3D67A 1T05A 2HBQB 4KRWA 4NCAA 3FEYB 2ERRA 1VQMS 1LW0B 2A6OA 4A8XA 3EE3A 3HHLB 2W7PA 2AYBA 5KFZA 2VBWA 2LYVA 2RB7A 1WOPA 2UZAA 2DEIA 3TZYA 2O66A 2OPSB 3C2PA 1U8SA 4J9KA 4KC5A 1JJ2R 4WF9Q 2EFQA 4PUOA 1TAUA 4WFXA 1SQGA 2AJ1A 3VALA 3ZTQA 1I6JA 2WB4A 3RB3A 3NXZA 2V63A 3FCVA 5KG3A 2Q43A 4Y2IA 2UXDF 4QWBA 1S7HA 1NAQA 4N77A 1MLAA 4OHVA 4Q2LA 3JSMA 2Q6BA 4A8QA 1KQFB 3CJ2A 4A8OA 3SV4A 1QY7A 3QRPA 2OI2A 2BJEA 4KFBA 1SC3B 2JDJA 4RUBA 5J2MA 1B0PA 1NMEB 2AF6A 1SC6A 5KFKA 5HATA 1HNWF 2ZJRQ 4ICLB 3GV8B 3BH7B 1FNXH 3Q8PB 1RHMB 1VGYA 3BZQA 1MMNA 3KUGA 1N5QA 3IBCB 1CS4B 4K0KJ 3K5LA 3GTYX 4ZLJA 2HVDA 4PQUA 4LUBA 1IBCB 4O3RA 3C3LA 1N5YA 2KO1A 4EEYA 3OHBA 4QIFA 2BACA 4XK8C 3H90A 5BYSA 5EWEA 3VZHA 4GKJJ 3PACA 2OD6A 2BJ1A 3EGZA 5B08A 4LR7A 3CJ3A 4ZA1A 3B82A 2FD2A 4I2QB 5K8MA 2YQ3A 4O3NA 4DV6J 2XQCA 4AL5A 3PR5B 4QR1A 1SH0A 1H7XA 1DTQB 1RT3A 3IRXA 2ASJA 3T1AA 1J5EJ 1N4LA 3TANA 2FIUA 1AUSL 1RT7A 4IG3A 4LQ9A 1U8WA 4DFKA 3IAS9 3TUZC 2FLLA 2E1CA 4ZPAA 3S8SA 2Q1LA 4RX6A 1KVJA 2HHHF 1RACB 4LF5F 2W2OP 3MM5A 4NA3A 4EYHB 4AL7A 3ZC4A 4ZPTR 1FA0A 4YY3J 2KJVA 4ED4A 4PKDB 2KJWA 4DR7F 2J6UA 4LFBF 3ZTPA 2VQEF 1YBAA 3GSIA 1UWAA 2W01A 2QO3A 3HZGA 3SZ2A 2NZ4A 4DSKA 3BPSP 2LMIA 3AT1B 2QLJB 2WOMB 5D8HB 3AODA 1M5KC 4OI2A 1TL3A 2Y0BB 2C2NA 2MY7A 1XMBA 1ICEB 2DNOA 2OP5A 1IBMJ 2OPQA 1GEHA 3EMTA 3PKMA 4QPXA 1HPZB 4PG8A 4MT1A 3CGIA 4DFJA 2WBMA 3BKUA 2A18A 1P6TA 4CQ1A 2YKNA 3HHKA 4F0KA 1D09B 2PA8D 2MYFA 1U24A 2FVQA 5EWGA 3SI8A 1N34F 3D28A 2BJ9A 1B70B 2MEWA 3I82A 2RUSA 1DHMA 2XB2D 5F8LA 3FBCA 1HBMB 3L7PA 4RNHA 1Z1ZA 2G9OA 2CQ4A 1J5OB 2Q3PA 2GZOA 5KFRA 2RS8A 1N56A 2EKYA 2QX0A 2FC9A 5H9FK 3W63A 3N4WA 4O4RA 1RZMA 2BDPA 1K0TA 4YHHJ 1RKJA 1YJRA 1RBLA 2NZCA 4I4BA 5H1SV 4C8MA 3J81Y 1R43A 1HNIB 3MM6A 4YMEA 1ELOA 2IJNA 4ZOSA 3OXGA 5FLXU 2Y1RI 4L3KA 3TP2A 3SSSA 1VBXA 5HK4A 3EXYA 3K17A 4DDFA 2R8KA 2HNDB 1EETB 1N5VA 5GAEU 4PWDB 4IOCQ 3PW0A 1U6ZA 4IRKA 4RUCA 2V4QA 3EX7B 5ITHA 1Q82T 4JI3J 3CDWA 5HMZA 1H72C 1GK8A 2BKPA 1HNZJ 2DGOA 4F3QA 3LAKA 2M8DB 3VVUA 3GIKA 3EJMA 3R5CA 2UVWA 1IXKA 1FRLA 3LQVA 2DVIA 4B3TF 4OYOA 5K14A 2QA1A 1M0SA 2CJAA 5KFPA 1YZ7A 2QT7A 4H4MA 5C25A 5HANA 2HS3A 4NYZA 2XS2A 3D0GE 2CDQA 3D6HB 1VRQC 3BEGB 3IG1B 4X84A 5IM0A 4QU7A 2FVPA 1UFLA 1NZ8A 1WNEA 1R27B 3L95X 1EJ7L 2QFJA 2W8LA 4HDGA 4PPZA 4YB7A 2F9JA 3K5MA 3IBWA 5D6GA 3C46A 4RW7B 1S79A 1D9FA 4DEZA 2NUUG 1VC5A 5ETKA 4N8NA 3HP6A 1JX4A 2ZZNA 2W2PP 5MLCV 2UXCJ 4WBFA 3CMAS 2IFXA 2R7WA 1JIHA 1VQPS 3BH6B 2PA3A 4ZPDA 1FRJA 3CMQA 2H9ZA 1L3VA 2AJ4A 3RJMB 4NYOA 2Z2YB 2B9EA 3VAKA 4JI0J 3I9V9 2HGLA 1FFSB 1TV6B 4YB5A 3OL8A 2BW2A 5EDWA 2DXEA 2FHJA 1RLCL 3ELHA 2KKHA 2R8JA 3MF5A 2UUBJ 1TL1A 2RKIA 4TU9A 1X5PA 4KTQA 1ZA1B 1C1CB 1RT2A 4ES3A 1RU2A 2IC3B 2RIJA 1RHUB 5RUBA 4P72A 4PXEA 1CC7A 2JFDA 2G1DA 3PW4A 4UZBA 4LR8A 4NPOA 2WZ1A 3DDIA 2KG1A 3QIPB 2V4RA 4QU6A 2OEKA 3M1VB 2HPUA 2NS1B 3OVSA 5AXLA 2GIRA 1XNRJ 5FLXY 1FDBA 4XDDA 4JI4F 3J80Y 1NSAA 2LDIA 1RADB 1MN9A 1U25A 5LT5A 1SV5A 4K4SA 1SQFA 3CW2C 3UWTA 1HBOB 1VC6A 1KR4A 4UQTA 1RT6B 2WHOA 3GZ7A 4WK3A 3IP0A 1L3KA 2MB0B 1I94J 3KLEA 2ZUGA 4K4VA 3SXLA 4RW9B 5DG7A 2BA9A 3W65A 4DPWA 3H5SA 2DGWA 5KOXA 5HMXA 4ZCMA 3FCHA 2K7KA 1PKUA 1REGX 1YQHA 1URRA 3G87A 1M1GA 4OX9J 3IA0A 2AJFE 1LNQA 4MKBA 4K4XA 4OYIA 3N79A 3KKFA 2BMBA 4EO8A 3ZZTA 2W7OA 3M2RB 2ASLA 1U1MA 3MEGA 4Q0BB 1Z2ZA 2FPHX 2ZD1B 3M2VA 2W2QP 2GNKA 4WP9A 1X9MA 3MWBA 4ZN3A 2ZBIA 2KYXA 1N0UA 3DRPA 3KLIA 1NZAA 4ZCIA 3EZUA 4PXDA 4PZVA 3CJ8A 3I0RB 2X51A 2LVWA 2LA6A 3J7YI 3BYRA 3AD8C 1KOOA 4PAAA 4YR2A 2A0FB 2RF2A 4TU8A 2EVZA 4XO0A 3VR1A 2BVZA 2OJ3A 4N41A 2EKNA 2YNIA 3DRSA 1R8AA 4Z2XA 3RGIA 3GSDA 2XMWA 4UTGA 1UP1A 4F4KA 2ZH2A 1HW9A 1S1WA 5EX3A 2FZGB 3N01A 5KG0A 5A8WA 1HWJA 3QGPA 4BBYA 2J8AA 3I9ZA 2Y1JA 2XHCA 2RRAA 2ZZTA 1RB0A 2ROPA 3FEZA 5DGBA 1YIJS 4HEA9 4QYRA 1D0EA 3I87A 3W62A 3KG1A 2RSQA 2NYHA 4LQ3A 4WU2A 4H4OA 4DX8H 1I5OB 1N52B 2LQ8A 3FSXA 4PG7A 3MEEB 1WC3A 2XNQA 2KL8A 3D1HA 2ZBQA 2DXDA 2XI3A 4U67Q 5HQMA 4I7FB 4ZVFA 3BB5A 1U1PA 2BV3A 4RPFA 4PXCA 1YRTA 4IH6A 3I5CA 1YBTA 1RWWB 4MK7A 1LFPA 3PG9A 2ZEJA 3S01A 5ETPA 1Z4UA 4DCPB 3BQ1A 3O5TB 4G1QB 4ZP6A 3FQLA 5C24B 2KM8B 4BS2A 5FDLB 1S6QA 1SL2A 4ZVUB 4DL3A 2DY1A 4LRBA 5HO4A 1FHTA 1VQSA 4R0JA 2VPYB 5E3AA 2RMLA 2J0SD 4OFZA 4MKYA 2WONB 2EBGA 3BSCA 2GAHC 3R27A 2CJXB 4P9SA 2WVCA 2B8PA 5A0YA 1E6VA 3M9NB 4G6VB 2YNHA 4ZPCA 2YQ1A 4B9SA 1H0HB 4RW6A 1LW2A 2CJ9A 2V68A 3J81j 1NDKA 1B3TA 2HBRB 4YUDA 3QRQA 3HD2A 3GILA 1MROA 4ELUA 3T1HJ 4CI0B 1YI2S 2GX8A 2W4DA 4HKQA 3IC1A 4DR2F 1N5TA 3U27A 1NH7A 5KFAA 4J9RA 1DTTA 3S1TA 3TNVA 3RB0A 1NH8A 2LKZA 2V5HG 3PXGa 4Q5VA 4FKXA 4LF7J 3QT6A 2DR9A 1KS2A 2WRMA 1Q1KA 2A6MA 2FDNA 3DI6B 1YITS 4NYPA 2VBXA 3TVZA 3G6ES 3SV3A 1S6PB 1NM2A 1WC0A 3W2WA 5CXTA 3ZZPA 4FF3A 3H20A 3BQ0A 1DJ0A 1X8DA 1SKSA 4K5SA 4M5HA 4BLGA 2UU9F 4G65A 4J91A 1KKHA 7AT1B 1FXDA 3H4DA 1H6KX 2VKRA 3VF0B 1P1TA 4CLSA 5ETRA 4DR3F 3M30A 2C3OA 4K4WA 1RAEB 3MOZA 4IH7A 1DRZA 3ZZOA 3CDUA 4DJBA 2GVDB 2GHVC 4B9NA 1X4CA 2OPPA 3LTOA 1YX2A 1NSKL 4OI1A 4R8UB 2VQFJ 2FLPA 5IT0A 5T7LA 3KLFA 2HZCA 2QN6B 4LFCJ 4JI5J 5L9NA 1RDRA 3FC9A 4P6QA 4DPYA 2HVZA 1FFWB 2V67A 4X65F 1YJVA 2ZOMA 2C2DA 1LWCA 2G2YA 5DJBA 3C14B 2E1PA 2NSCA 2N3OA 4RJVA 3V6HA 1U2RA 5GMEA 3R8YA 1T9YA 5CHCB 5GADI 4KKOB 5DLGA 2K1RB 1RTDB 2MKYA 5A8RB 4E2FB 5DG8A 1DURA 2F4FA 3FBBA 5KG7A 4LF9J 1S0OA 1M5PC 5L38A 1C1BB 1X0PA 3GIJA 1BE4A 3TR5A 2IJRA 2AEJA 1JMTA 1PC4A 2WK4A 1T9WA 1FVSA 4J37A 2QL9B 3VAMA 4QWEA 2BANB 2CA9A 1REVA 2BKNA 1H74A 1FDAA 3P4UB 3D68A 4HI2A 4ECVA 2E5GA 4E0DA 1KNZA 1UJ4A 3GFHA 2M3DA 2HFOA 5A8KA 2CNKB 4DS4A 1SKRA 3LOUA 5IQ6A 3CCZA 3CWJA 2HHUA 4M5IA 4X4OA 5D3GA 3W66A 3W5XA 4F3OA 4J90A 2QYCA 3LP2A 5ETNA 3HO1A 2B9YA 4O3SA 1V5IB 3UVJA 2QEXS 4LF6J 5IQQA 2H4YB 1C0UA 3C6TA 3SSRA 3KMSA 2C22A 1TL7A 3DU5A 4F0MA 4OYXA 3WX8A 3BN7A 3NY0A 4DG1B 4XPEA 4KV8A 1YK9A 4FNHA 2LFVA 3MPWA 4QCLA 2K7JA 4O4GA 5EN1A 2MKKA 1OPIA 1KDNA 2PO4A 2W9BA 4ILMA 4FNIA 2XWYA 2BJDA 3RAXA 4Y2AA 4P10A 2E9TA 1F2GA 4DLGA 5CYJA 2MQOA 2QJ3A 4CM2A 4F50A 2H4WB 2UUAF 4L75A 1W2BR 4MYTA 2R7SA 2O1PA 2MSTA 3RB6A 1FWPA 3THVA 1UA1A 8AT1B 4M94A 4YB6A 3TJAA 3PR4A 1TZ0A 2AV5A 4GO5X 1IKXA 2J5AA 1TUGB 1BQMB 8RUCA 2VL1A 2R7OA 1B7FA 1Q7LB 2GC8A 3U7JA 3MUVP 3P45B 4DUYF 2HZAA 4U8VA 3OR2B 3Q22A 3OFGA 2AEMA 3UNGC 5KFUA 1T03B 1FWKA 1WJ9A 3HM9A 1CULB 4AXIA 4NLSA 2JC1A 1NSQA 2E5LF 1JJCB 1IKYB 3FMBA 1G7CB 3Q89A 2RRBA 4G1PA 1RTIB 1O5JA 5AE2A 1S57A 2GO8A 2C3PA 5BXIA 1JJ4A 3DYAA 1QD1A 1D1UA 5E2QA 5FIIA 1JKHA 2CPXA 3DLKB 3ONQA 4RNNA 1VDHA 2ZE2A 4I1TA 1CPZA 2P8IA 2G2OA 2ZWPA 1X7VA 5HVGA 3R5GA 1HWLA 4DV3J 3PW5A 1UCNA 1R6YA 3NNCA 3WX4A 4RW8B 2M52A 2PE8A 3UD3P 2VV5A 2G0IA 2ILZA 2ZKUA 1RI7A 2BE9B 2VBZA 4CLWA 2LQ5A 3TAMA 1S10A 5DS7A 2LDYA 1KTQA 1CQMA 2C1EB 2BM0A 1NHKL 4DBQA 2DR7A 1IVZA 5HVHA 3PEHA 3V5RA 5HQ8A 5J2PB 1CJUB 4WU3A 2QL5B 2FZKB 2QV6A 1GX5A 3OJSA 2CQCA 2RQMA 5LSOA 4TN2A 4KO0A 1U02A 3K58A 1NCLA 2F40A 2DHAA 3Q83A 4MK8A 3VQSA 2KFZA 4JP8A 3H0PA 1HI0P 2M4MA 3EZ5A 4D3GA 4ECXA 2HNYB 1HARA 2AJ0A 2UXDJ 3MMJA 3LAMA 1GTHA 4LSLA 4NLDA 2GQCA 2F3JA 5L1JA 2EBEA 1RTHA 2I38A 2W9CA 5L39A 2CQBA 1WKJA 2HVEA 4IOBA 3MZIA 4JOUA 3DOLA 4GVBA 3ETMA 3MPUB 4QYZK 1QLNA 5KT2A 3TUJC 1MMLA 2HHPA 1S77D 2IM2A 1UEUA 2HFNA 2ZNYA 5CZXA 1T05B 2BOAA 4PG6A 2X3GA 4EZ6A 2FC8A 1YJTA 3B78A 2ROGA 3BSAA 4KY3A 4USMA 2C2KB 3D2WA 3JSBA 2CPEA 1RTJA 1S9GA 4FXVA 5DQHA 2H5IB 2BOPA 1T3NA 4XPCA 3L3CA 3ILJA 3KJQB 4U9RA 2MZQA 1UAWA 4DV1F 4PUOB 2V8VA 4QW8A 1DQ9A 3KLHA 2VB6A 1PSDA 5A2QU 4C8KA 2ATLA 5KFDA 4OLPA 1YJNS 4I69A 4C97A 2YNGA 3L09A 3MXHP 3JSMB 4ILLA 2LEPA 1ZYQA 1VIXA 2JX2A 3L4BC 3KJVA 4ZCKA 1WG4A 3NCRA 1K44A 4W90B 4KFBB 3IFEA 4CO3A 3QMQA 3P8BB 3DOKA 1IBMF 4DFPA 5J2MB 2HHHJ 2R2SA 4LF5J 4M5DA 3AY0A 2XS5A 4C0BA 4ENOA 4ZLPA 4X4RA 3UI3A 4C9DA 4DR7J 4LFBJ 2YWHA 4QR2A 2MQLA 1Y5IB 5KFXA 2XGQA 2VQEJ 2Z8QA 3I96A 3FFIA 5C7PA 4PQUB 4OZ3A 2ILYA 2AJ2A 1N5YB 1VHFA 2PMZD 2CVEA 2KRBA 2HBZB 1XMOJ 3SEOA 4USTA 3V4IA 1VRTB 5C2CA 2C2EA 3R5DA 3FQKA 5BYRA 2QLBB 2QMUB 2HYIB 2FZCB 4YHHF 2RJZA 2X1BA 4O3PA 1DAXA 3D1QA 4ZPBA 4ZVEA 1HHTP 4HDHA 1RT3B 3IRXB 5CCLA 3OPKA 2DNMA 3KTQA 1RT7B 3U1MA 1KRPA 4IG3B 3GCXP 4GC6A 3IR5B 5IC6B 3CSKA 2KVQE 1YDLA 2HS0A 1Q5VA 2NXUA 4DF8A 1RT5A 3CC4S 2K3IA 1X4HA 3MM5B 1Q7YT 2Q79A 4IKAA 3QGHA 1KQKA 3KK1A 4DXLA 4ANEA 1TTHB 1LEOA 1HNZF 3K0JA 3F56A 1BUXA 4DL4A 2VPWB 2PT0A 1MWYA 2KRRA 3AXMA 3V6JA 4LF2A 3OVAA 3E2EA 2HRUA 3AOCA 3DXSX 1Y11A 1G4CA 2X1GA 5F9LA 2AX1A 3K5PA 5A2QY 1YBUA 1PBUA 3LH2S 5DDOC 2WB1D 2HNZA 5A76A 1X4DA 1TL3B 1VK8A 2FHJD 1NKEA 3TI0A 3BSNA 4XAKA 2QLXA 2CNOB 4WXOA 3TA1A 3NKYA 4KIAA 1QTMA 1YJ9S 1SKWA 2OPQB 4PWWA 2P9GA 1B7YB 2X3DA 2WVFA 3NS7B 3G82A 3Q2SC 1QJHA 3LUYA 2YKNB 3PW7A 1WELA 4HVZA 4C98A 4KQZA 2E9ZA 4NLTA 2A10A 1WEXA 4ED3A 2DO4A 4RUAA 4B3TJ 3EPIA 3VGSA 3OL9A 5M2RA 2NYIA 4DCOB 4TQRA 5IWAF 1KQGB 4RNMA 4JI6F 3H2LA 1IBLF 3TRGA 4ETXA 1VQ5S 2OIHA 3GJTB 4LBIA 2KTQA 2DPIA 2KI2A 3HZEA 1HI8A 5E0OA 3WIVA 1DLOA 5JVHQ 4AQYJ 4JI0F 4I68A 4PXBA 5M2UA 2KHDA 3L7UA 1L5UA 2F8HA 1D9AA 3HD1A 3QT8A 4KAIA 3DMJA 3OD2A 2UUBF 3MM6B 2DGSA 4ZN1A 1HLWA 2MKJA 2XCPA 2DNYA 4N5SA 1RWMB 1XMQF 2GVZA 1HQUA 4Y2MA 3CCQS 3R7BB 2B51A 3UPFA 2RDJA 3FK4A 2JLFA 4RW4A 3RW6A 1IJEB 1GMWA 1RHJB 1FEHA 3NP5A 4Z7YA 4LSNA 2F65A 2UV8A 3HKZD 4LRFA 2YPZA 1R0CB 2ABYA 1UKUA 4B17A 5ETQA 5HN0A 3R7SB 5K14B 4DFMA 4OI0A 4CWBA 2XLKA 4B3RF 3R5JB 3W8PA 3PNIA 3G4SS 1UW9A 5KFCA 4DV2F 3TO8A 2CNNB 4H4MB 4ZP7A 4B3SF 1H2UX 4O3OA 5C25B 4WZMA 4PRFA 2F63A 3TAQA 2DRAA 3HI9A 3OXFA 1U4BA 4RU9A 3RG6A 3OW2R 5IM0B 2YNFA 2VKZG 2HS4A 4A8MP 4OX9F 1UW4A 3B54A 2I1RA 2ACMA 1HYSA 2WVEA 2ZVIA 3G71S 4JI4J 1JLCA 3MURP 3LGMA 3W9IA 1TVRB 4DCJB 3D3BJ 2MSSA 1SB6A 2MKIA 2F4VF 3IR6B 2HVHA 2IVYA 3M9OB 2XYPB 3PIOQ 2N3LA 1Y9OA 3MEDA 3T3FA 1N48A 2EG2A 4WFNQ 3NMAA 2V2VA 2ZFHA 2CPIA 1HNXJ 2RE1A 3TQEA 2DPJA 3D9BA 5IZHA 4X4PA 3H5YA 2B0GA 4O23A 3QO9A 1LXJA 5ETMA 2ZBCA 4LR9A 1SH2A 3KHGA 3MTJA 4TY9A 3VGUA 3CJQA 1IBKF 1TL1B 2RKIB 2V94A 1C4CA 1RAIB 4LRAA 3PDNA 2IM0A 2Z2LA 4NASA 2XMMA 2OEMA 1RT2B 1RT1A 1HMVA 1LXNA 2R8IA 4K50A 2PFFB 4JV5J 3HHNB 3NS5A 1OYEA 2FGOA 3MFIA 1NPPA 2XMVA 1QAXA 4YN3B 5AJ3J 4YDXA 1W26A 1L3SA 5KOWA 1WF1A 4LF1A 3BBBA 3WC0A 2BBEA 3DKDA 4DSJA 2HQ3A 1HBUA 2H5EA 5IT9U 2D7SA 5I3QA 3ETOA 1SV5B 1CJVA 1T3OA 3T6BA 1RHRB 3P96A 5IOLA 4QWAA 1WC5A 2M8HA 3RR7A 1IR1A 3JAMU 2R7RA 3VZIA 3KLEB 2KXHA 2J0WA 3GE9A 1IJFB 5LSLA 1WEYA 4DF4A 5I3UA 1K73T 4TLRA 1F1BB 4ZCLA 2GHWA 3NAIA 3G96A 3M05A 1QUPA 4ZVQB 2C2RA 2PFDA 2RVJA 2HHVA 1LWEA 1YRXA 4YP3A 2DJWA 2I9SA 2M5YA 3TX0A 3PCOB 2HAIA 3MEGB 2XLIA 4UOHA 2IBOA 1U1QA 3GMGA 1WDDA 2H5JB 4ZITA 3AB4B 4JYAF 2K3KA 3M2VB 4WFAQ 3R2DJ 3ZXWA 3NGRA 2JEGA 4QIVA 1TKTB 1PC5A 3LP0A 3W3SA 5DQIA 3IWNC 2AYMA 3CJ4A 2XY5A 1FKOA 2HMIA 3KLIB 3DRPB 3HF5A 2YKOA 1XERA 2CXEA 2VA3A 4ZVOB 2FJDB 1WSRA 2IVMA 2EK6A 4YS2A 4FVMA 1YWXA 4Y34A 3RAMA 3HULA 1YG0A 3N9UC 3T1HF 4PPDA 1LFWA 4O3QA 5CYMA 1ROFA 2RF2B 1N6QA 4I6AA 1H98A 3NAHA 3UR3C 2YNIB 2L48A 3DRSB 3Q23A 3VAIA 4LF7F 5L1LA 1MW7A 4MMOA 3KHHA 3BS9A 4P71A 4ZHRA 3DDKA 1S1WB 4CO4A 3CUNA 5A8WB 2NCKL 3T1YF 4RBVA 1FJEB 3I32A 5IT4A 1FDNA 1W25A 2LXFA 2JOQA 2U2FA 1HD0A 4FN5A 3AB2B 4DQRA 3PO4A 1DQAA 2EK1A 4MYUA 1SL1A 1FVQA 5DZ6A 3CCSS 1RYRA 1RJJA 3HFVA 4RWWA 3Q8UA 2DNGA 4HTJA 2DY9A 2VD3A 3KMQA 1VQNS 3Q86A 5HAOA 3G8SA 2MKSA 3TVYA 4DR2J 4H4OB 3GCWP 3IGNA 5JUMA 3LWLA 2FJEB 1VJQA 4LFCF 4JI5F 5LJ5Y 1JLEA 2V4JB 4K2XA 2M70A 1U1NA 5KG4A 1ZM3A 5IS2A 4OJHA 1U48A 1RK8A 1A9NB 2Z56B 3PYDA 5D78A 1TKZA 1LWXA 1C2PA 3B4DA 2CPHA 3JAMY 2VZ9A 2ZOGA 4KSEB 5F8GA 1CS4A 2HQDA 1OY9A 2HEKA 1NSPA 5IV4A 1AXQA 2PDAA 4EI2A 3KOAA 1KLNA 3ET6B 4DR3J 2D3UA 2XWXA 1UZHA 2HVIA 1S6QB 4LF9F 4B08A 2LU2A 3BV8A 2YKMA 3AD9C 4CLPA 4H54A 3CCTA 3HHLD 4KGVB 4URGA 1XR5A 3QZ7A 1FO1A 3SFGA 1JB0C 5KFBA 1I1GA 2OAUA 5A0YB 1E6VB 3HVTA 3LALA 3DNCA 2YNHB 2YWGA 2YH1A 3HVAA 2YXLA 4RW6B 1LW2B 2YTCA 4F3MA 1FX2A 5AXKA 1MROB 2BXJA 2HHWA 4AXJA 1A7GE 3FZ2A 1U49A 1WTBA 4FPRA 5U47A 1BMQB 3IBFB 4WZQA 1KOHA 2EFOA 3H98A 3W2WB 4PYDA 1HI1A 4LF6F 1MMDA 1QSYA 3SYZA 2A2CA 4HT7A 2W24A 3NGKA 5B0AA 3MPYA 2OD4A 3V81A 1NB2A 1RWNB 3O6QA 3M30B 1BY9A 1VJWA 2C3MA 3BDPA 3HHEA 1D8ZA 2PMHA 2G1HA 4USHA 2DB1A 4F4XA 2OPPB 3M6XA 1S1TA 2WAQD 4CLKA 1JLBA 1DFDA 4ED5A 4NLYA 5T7LB 3KLFB 4USUA 3OV7A 4GKKF 4JI1F 4AUKA 2XMKA 2QE5A 1KLMA 1B4SA 4V19X 1UETA 2D1CA 4C8LA 2HIQA 4X4UA 1H3DA 2B43A 3W64A 1WG5A 2DNNA 2B8QA 4M1KA 2CKWA 2IIHA 2YWWA 4URSA 4FPIA 4IQXA 4Y0FA 3MAHA 2ZDOA 2CYYA 4IYQA 3IM8A 3UN2A 5AXMA 1ZTWA 5F3TA 5GVQA 3GV5B 3GFYA 3ISND 3HK2A 1HIYA 4JV1A 2B6AA 1XEZA 2RRNA 4OX6A 4F26A 2K06A 1I51B 2XO7A 4ECZA 4RZRA 3DDNA 1FRKA 5H9EJ 3PX0A 5E33A 3BGRA 4DV7F 3N0VA 4XDCA 2CPJA 5ETOA 1R7IA 1FESA 1GX6A 3CF5Q 2VPXB 2XMUA 1I3OB 2UUCF 5LMNJ 1UJ6A 3UN3A 1YKWA 2ZH1A 3CJTA 1REVB 1BLUA 4EBDA 3KNAA 1T9VA 1CJTA 3GONA 4HT5A 3D7SB 1PAEX 1TQLA 4U95A 2NXNA 4DV5F 2B4OA 2J0XA 1O8BA 4PQAA 1X5SA 4ZK7M 5A8KB 3CCJS 5HP1A 3TZWA 3A8EA 4DN9A 5JXSA 1RYSA 1O51A 2RU3A 3CD0A 4B02A 1FRHA 5D3GB 2G13A 1JK9B 3LP2B 3PIPQ 3TEGA 2RQKA 5GAGI 2C3UA 4KHMA 4DUYJ 4WCEQ 3UVJB 3JS9A 2BQ3A 1Q86T 1VQ8S 4KH1B 1C0UB 4CCHA 1H2VZ 3C6TB 5KT6A 2OMLA 3DRXA 1TL7B 2E5LJ 1V6HA 3LA0A 1LQ9A 3DLLQ 4KV8B 1R0AA 4YEAA 3OQ2A 1YZ6A 3SQOP 3H7HB 3J7A1 2JHEA 2VG6A 4O4GB 4B3OA 3JYTA 2AZ1A 4X4VA 2ZC4A 3J7AN 3QPIA 1Z2LA 3NL0A 4USIA 2W9BB 2UVUA 1JNZB 1S59A 3GIRA 2N4CA 1M1KT 1U09A 3BREA 1WUUA 3U02A 3O3LA 1OS5A 2BQUA 1OWXA 2AGOA 2UXBF 3VQTA 3DGPA 2D3O1 3TEHB 4KHPF 1SJQA 1J2VA 3V4MA 2OELA 4A4JA 2R2RA 4JI2J 4M5GA 3CPWR 5GMDA 5L46A 1UVIA 4F4ZA 2XMAA 4NCGA 1NJZA 2LXUA 1IKXB 2GQ2A 1CJKA 1FF2A 2NQPA 3UNYA 1TKXA 3CC7S 3EVWA 3UD4P 5F3ZA 4NX9A 2CQ0A 1YLXA 2V34A 2BJ3A 2XBPA 2FY1A 1IQTA 3QGIA 3UW1A 3AJDA 4DL0C 4CO1A 1F9EB 4DLEA 2KFNA 2XMJA 1FFGB 4DR1J 2DGVA 4X62J 5LOQA 4PYAA 3TW0A 4EWTA 3CIZA 3DYAB 1AYEA 3GR0A 4DZDA 1JKHB 4A48A 3B8HA 4TYBA 2ZE2B 2Y1LB 2GAGC 3I4PA 3J81U 1ZOTA 1RWVB 1JQGA 1MNEA 2IJFA 2R7TA 4ES2A 2XZWA 3GYXB 1URNA 5J2QA 1PILA 3BBFA 3FUYA 4KGMA 2VU5A 1UZDA 5D0RA 3GYNA 4HL9A 3KHLA 3TAMB 1WORA 2R7VA 3BR8A 4JUZA 4UUXA 1TMMA 2LQ9A 4U7UK 5T41A 2N7YA 1U2CA 1WD6A 2C2ZB 3L7OA 4EO6A 3EPGA 4KO0B 4WK1A 2HWTA 2Z2MA 4DN0A 2HGMA 4DV1J 1CQNA 4NXMF 1SUQA 2GGPA 2O3DA 1A0OB 1TK5A 1PIEA 2N4DA 3W8GA 3E01B 2CPZA 1RBAA 3UQSA 1ZM9A 3HMJG 1QDUB 4CLZA 1SJ3P 1QE1A 1NPKA 2WVDA 4WYWA 2MGZA 4LSLB 2BJ8A 4NZ7A 3G8TA 4QIWD 1PJ5A 3GP9A 4EFAC 1EZZB 1OY6A 1XMOF 2DKOB 1OJ4A 1RTHB 5KFIA 1FJCA 1EQMA 1X4GA 2M9KA 2W9CB 1NLKL 2QGFB 4OHWA 4RBUA 3GIMA 1Q5YA 2KZMA 4I6YA 1QM9A 3DOLB 4GVBB 1GFWB 1KD1T 4C7QA 1HL6A 4DWIA 1VI7A 3UDEA 4E98A 3GYGA 2I5JA 1OSDA 6AT1B 3AH6A 5CD4H 1IR0A 3EGVA 2HQCA 2R7XA 1S9FA 2VG7A 3KK3A 1UFWA 1N36F 1RTJB 1S9GB 2B9XA 2W7AA 2DGXA 5HVFA 3A3NB 1C0TA 1NU4A 1HWUA 3QNWB 3KLHB 4ED8A 4ECRA 3C16A 2E1RA 3Q8YA 2L9DA 2R2UA 2V0NA 3NNHA 5F41A 3BKFA 4ZVHA 2YNGB 4MH8A 4X66J 1VFJA 2XEXA 3JTOA 4FXDA 1KVIA 2V8GA 3KJVB 2XO6A 1SKUB 2BE7D 3PJWA 4TQSA 2LECA 4Y2KA 1S48A 3ZZRA 4CLLA 3ZO7A 3J80U 2CQIA 1T95A 9ATCB 4EUVA 4LBHA 1Y10A 3DOKB 4WE1A 3MR6A 1CVJA 3CD7A 3GJQB 2DTJA 3RR8A 2ASDA 4M5DB 4FYYB 1SJ1A 3FSYA 1FK9A 4DL2A 1HD1A 1GMWD 2HQIA 3C6UA 3FFIB 3I0SA 3A8IA 3KFWX 4V1Ak 5LSRA 3DCAA 2X1AA 1S4EA 2LQBA 4HHHA 2V6AA 3I5AA 4KT0C 5F9NA 2EG1A 5EX0A 3DRRA 3AJ1A 4ZLLA 4DR4F 2W8KA 4HTIA 3V4IB 4DSEA 2OPRA 2MHEA 2KFYA 4AQYF 1BWVA 1WDTA 3K7RA 3QLHA 5HJXA 3M8PA 2E7XA 2EFNA 3OVBA 3CIMA 5I4MA 3QJJA 3ISZA 2J7WA 3SQGA 2ALYB 2R8GA 3K57A 3F0NA 5EGYA 2MY8A 3VGTA 3WIUA 2JJ4D 3A1YG 4I6WA 4IQMA 4MFBA 4M5KA 3ENWA 2JL9A 4ZVTB 1KN6A 1JLFA 5IWAJ 1RA6A 1VRUA 2HHTA 4JI6J 1IBLJ 2XLJA 3ZFVA 1S1VA 4P2SA 1RKIA 1RT5B 2XG8A 4X2BA 3PZPA 4PEOA 5E5NA 3SSQA 2ZBRA 3E3XA 1RLDA 1NDPA 1O0PA 3QSYB 1AZSA 3GIIA 3KK1B 5EWFA 4DPXA 1RAHB 5H9FJ 1WEZA 2YKPA 2MQNA 4OQJA 2CPDA 5G0RA 5AXNA 2HWIA 5J1NA 1EKSA 2XSJA 3G86A 3NRBA 4IG0A 5KFGA 3IR7B 2HNZB 2DISA 3AJ2A 4KYZA 1Y0HA 4FXWA 1XMQJ 2ZC3A 3G2XA 3P5BP 1V5VA 5IXUA 4K7QA 1VQ9S 4CNZA 2HQGA 5DETA 4OHZA 1RAFB 5KFWA 3M6VA 3G82B 3DLHA 1NKBA 2DCLA 1PYSB 2JNJA 3TA0A 3THPA 2OUGA 2M0GB 3KG0A 3HSDA 5J1EA 1KWMA 4IFYA 3ADAC 3UDCA 4NLXA 4UOGA 2OHDA 4RU2A 3KLGA 2O5DA 2W1BA 4B3RJ 4QR0A 3QFWA 2VDHA 1PAUB 4DV2J 4B3SJ 2PMWA 3PFEA 2B56A 4JBCA 1R8CA 3NOGA 1WHWA 1HNXF 2PI5A 2JLGA 4I2PA 1DLOB 3DXBA 2ZH9A 1UWBA 3K2YA 1ZA2B 3GJSB 2JC0A 4OYPA 2YKAA 1WHYA 3F41A 4K5RA 3DMJB 3DHXA 4EK2A 1CBKA 3WQPA 4YDDB 1F5AA 5ADZA 3A13A 2JFKA 2F4VJ 4JV5F 1WF2A 3K5OA 5C42A 1RQ0A 5GAHU 4DQPA 2GVZB 1HQUB 3BO4A 4WJBA 1RXOB 3NOCA 2HFZA 1FE0A 1Y3KA 5AJ3F 2W9AA 4RW4B 4OHYA 2IDLA 3UO0A 4L73A 4CRJA 2PI4A 3FRYA 3CVKA 1TUVA 4LSNB 1UEKA 4ZPVR 1Q8KA 2B5JA 4WP8A 2XY7A 2CQ1A 2WW4A 4RL1A 5AT1B 1TAQA 1LWFA 1GAOA 2GIFA 2WW8A 3RAQA 2GMHA 3I31A 2NPFA 4QOTA 1ZH5A 3CCES 2JEJA 3Q24A 1AW0A 1IBKJ 4YQWA 3BGUA 3QBCA 2B9WA 2DH7A 3MCNA 2MLYA 3PEJA 5I42A 4GVLA 2YNFB 4M5LA 3NCPA 3D66A 3IM9A 3M4XA 4L3NA 4U6PA 1HYSB 4AE5A 2AKWB 5DGAA 4NI2A 1S76D 1JLCB 4ECTA 4W92B 2BUNA 5KFVA 3W60A 3V6DA 3MR7A 3RBXA 6FDRA 2H54B 1TUWA 3MCOA 2OGUA 3NWGA 2RD5C 4CDIA 4B9MA 2VC0A 3NGUA 2DCUB 4DSFA 1FKPA 2GCFA 3BGOP 3POTA 4C8NA 3OTOF 3TAPA 4WXWA 3DU6A 2VF3A 1RTZA 3MEDB 1YJUA 3HSGA 1VLOA 3SDEA 3MR5A 1GMUA 3KK2A 2CJQA 2XYGB 4L76A 3MMAB 4CT8A 3QO9B 4LFAJ 5D0EA 2JSXA 2Z57B 3AA8A 1WF0A 3M8SA 3PKYA 3M9MB 2KU7A 4JYAJ 4M5MA 1SC1B 1PBAA 3EGWB 4NLRA 2DHHA 4CM0A 1RT1B 4CH1A 3ICLA 1HMVB 3R3TA 3VAGA 1BGXT 4QBUA 3K59A 2HAFA 4J9OA 3IO1A 5J2NA 2YWKA 4DSLA 2OSQA 5D0HA 1U6BA 3DLGA 1K0VA 1HBUB 4F36A 5B0GA 2ZBPA 2MZRA 1ZM2A 2V2QA 2W4PA 1IWGA 2LXIA 1CJVB 2J6SA 2MKHA 2GS8A 1F0XA 4K4YA 1BQXA 1UVKA 2ZUAA 5F8HA 4LIRA 5IFMA 4ZMMA
chains in the Genus database with same CATH topology
2EG2A 4WFNQ 4OZ1A 1GH8A 3NMAA 2ZFHA 2FJVA 2CPIA 4ZP9A 3GIKA 3R5CA 1QVFR 2RE1A 2UVWA 2DHSA 4UUWA 1IXKA 1FRLA 1HBMA 3LQVA 2DPJA 5I3UB 2DVIA 2CQDA 4B3TF 5IZHA 1XNQF 2C3YA 5KT7A 4X4PA 2CFXA 5DLFA 5GAEI 2BE2B 5K14A 2B0GA 3M6WA 3H5YA 4ED2A 5KFQA 1J5OA 2IBKA 4O23A 3QO9A 2E1MC 2QA1A 2KG0A 1D3WA 1LXJA 1M0SA 4YY3F 1G1XA 2CJAA 2ZBCA 3V2UC 5KFPA 2QT7A 1U7LA 1U1LA 1N8RT 3QJPA 4WKRA 2E29A 4H4MA 1S9EB 1SH2A 1XC9A 4TLQA 1FEEA 3KHGA 4TKTA 3TOQA 1LWEB 5C25A 5J1PA 2HS3A 3MTJA 4TY9A 4NYZA 1ZZNA 2COLA 2KN4A 1XR7A 1IBKF 2J7KA 2XS2A 1TL1B 2RKIB 2CDQA 2V94A 3D0GE 1FTRA 3GR1A 1KFSA 1C4CA 3BEGB 3PDNA 3EYZA 2IM0A 2Z2LA 5HBMA 3IG1B 2FB0A 4X84A 1P27B 5IM0A 2XMMA 4F2SA 2UVVA 1RT2B 2UP1A 2FVPA 1RT1A 4OI3A 2E9RX 4QU7A 1HMVA 5KFMA 2IRXA 3LGNA 1LXNA 1UFLA 1WNEA 2R8IA 4I0WA 2DH9A 4K50A 2PFFB 1R27B 3HHNB 4ERDA 3NS5A 2MMYA 2PC6A 3L95X 2LCWA 4AFFA 2QFJA 3QAEA 1HNIA 4HLBA 2W8LA 2FGOA 4HDGA 3MFIA 3F73A 2QMWA 4PPZA 2J9CA 2XMVA 1Y7PA 5SUHA 1QAXA 2AWZA 5KTQA 3UCZP 3DRYA 2F9JA 4YB7A 3K5MA 2NUHA 4CT9A 3LP0B 1K1QA 3N6MA 3ZZYA 4YDXA 3IBWA 2ZHOA 5D6GA 3SCIE 1Q4RA 5KOWA 5DG9A 1L3SA 1WF1A 3C46A 2VUGA 4RW7B 4IFVB 2HLTA 2HMIB 1S79A 3WC0A 3SCLE 1D9FA 2BBEA 2O67A 3GQCA 4DSJA 3UCUP 2HQ3A 4DL5A 2JEFA 1B0TA 4DEZA 1S1UA 2NUUG 2DNZA 1VC5A 1HBUA 2H5EA 3T19A 2BRLA 3OHAA 2DGQA 3I4HX 1HNVB 2AW0A 2D7SA 2JVOA 5I3QA 4IR1A 4N8NA 3ETOA 4YR0A 3HP6A 1JX4A 2DR5A 5MLCV 1ULRA 2ZZNA 2HNDA 3OTBA 1EETA 3W2VB 3NBPA 1SV5B 4PWDA 1T3OA 3T6BA 3CMAS 3P3DA 4UOCA 5B7WA 3N6LA 4ETZA 3T5LA 5E3QA 3P96A 2IFXA 2R7WA 4IR9A 5CYMB 4QWAA 1JIHA 2M8HA 3RR7A 5LXRA 3UCGA 2R7RA 1VQPS 1N6QB 3VZIA 2DH8A 1B64A 3KLEB 2RUGA 2KXHA 4GMKA 5EUHA 2FJAB 2PA3A 3KG4A 4ZPDA 2J0WA 3GE9A 4X4SA 3N5BA 1KQSR 1IJFB 1FRJA 1VLYA 5LSLA 4WYLA 2V8HA 1WEYA 4DF4A 4NA2A 2H9ZA 5I3UA 1L3VA 1T94A 4NRTA 1K73T 1S4FA 2AJ4A 2CRLA 4NYOA 4ZHRB 1FE4A 1Q16B 4TLRA 1R3NA 3VAKA 2KT5A 2ZH5A 2XMTA 4M63A 3HJFA 1SI9A 4OJ1A 2MHNA 3CULA 3FDSA 3I9V9 4ZCLA 2GHWA 3NAIA 3G96A 3M05A 1QUPA 4IRCA 2HGLA 4MIBA 2ALZA 1HWIA 4IRDA 3FSIA 1TV6B 2C2RA 4YB5A 3OL8A 2BW2A 5EDWA 2C28A 2XHWA 2RVJA 3CD6S 2LEAA 2HHVA 5JVGQ 1S9EA 2FHJA 2D74B 1LWEA 1YRXA 5K5MA 1P8GA 2KKHA 4YP3A 3MF5A 2R8JA 1TL1A 2RKIA 3MMBB 2DJWA 3RYLA 1FCAA 2I9SA 4FF2A 4LMZA 4TU9A 2M5YA 1X5PA 4KTQA 1SQEA 3IG1A 4Y28C 1N5SA 2HAIA 2QLWA 4FF4A 3MEGB 1U2FA 1C1CB 2XLIA 3QGGA 1RT2A 2IBOA 2V2KA 3MECB 4KHRA 3GMGA 4ES3A 1U1QA 2IC3B 1TK8A 1V9OA 1M5HA 2RIJA 2AX0A 4Q8FA 3AB4B 3TQ1A 4JYAF 2K3KA 3M2VB 4RNOA 4PXEA 1FXRA 4WFAQ 1CC7A 1Q81T 2JFDA 2G1DA 3PW4A 2A2DA 3Q2TC 5BJRA 2ZHBA 4NPOA 2F1FA 2HRYA 2JEGA 2ZKTA 2KG1A 1QUVA 2E5HA 3QIPB 4QIVA 1TKTB 1PC5A 4MTPA 2V4RA 3VTIA 4QU6A 2IM3A 1SIZA 3LP0A 5DQIA 1X9WA 3IWNC 3W3SA 3M1VB 2HPUA 2FVCA 4KJIA 2AYMA 3DLBA 1EP4B 2NS1B 3CJ4A 4RW7A 4IFVA 3OVSA 2XY5A 3O1LA 2OFHX 1FKOA 3QIDA 3KLIB 3DRPB 2BR0A 2HMIA 3HF5A 2YKOA 4H4KC 5AXLA 1XERA 2GIRA 3LWMA 1T8EA 5B0BA 5FLXY 1FDBA 4XDDA 4FS2A 4JI4F 1F5BA 2VA3A 3D5MA 3J80Y 2LDIA 2FJDB 1JLEB 1HNVA 1NB7A 3THTA 2UUTA 2L3MA 2IVMA 2EK6A 3QYYA 1U25A 3IWLA 3LP1B 3W2VA 5LT5A 4G3IA 1SV5A 2F8EX 1NKCA 4K4SA 4DQSA 4FVMA 4XIUA 4NCBA 2ZOFA 1YWXA 2Z0GA 4Y34A 3RAMA 3UWTA 1HBOB 1VC6A 4CO2A 1KR4A 4UQTA 1RT6B 1YG0A 3N9UC 3T1HF 4PPDA 3KWMA 4LT6A 3ITHB 1LFWA 4USJC 3G9CA 1TKZB 2WHOA 4O3QA 5KFSA 4ID8A 5CYMA 2L9WA 3GZ7A 4WK3A 1ROFA 1L3KA 1NK6A 2R7QA 2MB0B 4OI4A 2RF2B 1S49A 2FJXA 1N6QA 4I6AA 5EHHA 1H98A 2BABA 3KLEA 4IO9Q 3DOMA 3NAHA 3UR3C 2YNIB 2QZ8A 2ZUGA 2L48A 3DRSB 2OMOA 4K4VA 1X4AA 3SXLA 3Q23A 3VAIA 2M2BA 3P5TL 4LF7F 4RW9B 5L1LA 1MW7A 3M2UB 4MMOA 3KHHA 3BS9A 5DG7A 4JI3F 1ZZFA 3E51A 2BA9A 2AU0A 2JH3A 3DC2A 3H5SA 4ZHRA 2DGWA 3DDKA 1S1WB 5KOXA 4CO0A 5HMXA 4ZCMA 1N32F 1CEZA 5CYQB 4CO4A 3CUNA 5A8WB 3FCHA 2WCXA 2K7KA 1MSWD 1TV6A 3T1YF 2XY6A 4WFYA 1FRIA 1Q8IA 3T9ZA 2QA4S 1YGYA 1YQHA 4RBVA 4OI6A 2J0QD 1URRA 1IQZA 1FJEB 3I32A 5IT4A 1FD8A 3IA0A 1FDNA 1W25A 2AJFE 2YKMB 3N5FA 3S7RA 3GG1A 4NLQA 4MKBA 2LXFA 4K4XA 2JOQA 3MMBA 2U2FA 3TVKA 1K8AT 3N79A 3KKFA 1HD0A 2I8EA 4FN5A 3AB2B 3ZZTA 4EO8A 3M2RB 2W7OA 4DQRA 2ASLA 3PO4A 3IAM9 2D41A 4OL8A 3H59A 1VRTA 4L6V3 1U1MA 2DNPA 2CG4A 1DQAA 3NS6A 3MEGA 4Q0BB 1C1CA 2EK1A 1LV5A 3JTPA 4DR5F 2LEBA 3MECA 4MYUA 1SL1A 1FVQA 6FD1A 2IC3A 3EGNA 4UY8T 4QIEA 2ACYA 4CH7A 4PCQA 1Z2ZA 3CCSS 1RYRA 2FPHX 2ZD1B 3M2VA 5KG5A 1RJJA 1QAYA 2GNKA 1MWZA 4RWWA 1UL3A 3ULHA 2GQQA 2DNGA 4HTJA 4P7VA 4JI7F 2VD3A 1X9MA 3J7YU 2B7BB 1CC8A 2E1AA 3HVTB 3MWBA 3KMQA 3H5XA 3QIPA 3C8YA 1L3TA 1VQNS 2P6TA 4L72B 4WTYA 2EWHA 2YX1A 2NR0A 3M1VA 2M88A 3G8SA 2MKSA 3MD3A 3TVYA 1AROP 4H4OB 2ZBIA 2KYXA 2VFRA 2MZTA 5K8NA 5LMNF 4PWUA 1N0UA 3DRPA 3KLIA 3BN4A 3IGNA 1NZAA 3GB0A 5JUMA 2L41A 3LWLA 2EFVA 2FJEB 2ZNZA 4ZCIA 1UMJA 3EZUA 4LFCF 2JZ5A 5LJ5Y 1JLEA 4JI5F 3VCDA 2V4JB 5T14A 4PXDA 2EI5A 4K2XA 3I0RB 3LAKA 2M70A 2X51A 3LP1A 2L08A 2LVWA 1U1NA 4V19J 2M8DB 5KG4A 1ZM3A 2LU1A 2LA6A 2RDIA 5IS2A 3J7YI 4J9MA 1GTEA 4Q43A 1HBOA 4R0EA 4OJHA 1U48A 1RK8A 1A9NB 1RT6A 1KOOA 1F9FA 3CTRA 3ITHA 5D78A 1TKZA 3MD1A 4PG5A 1C2PA 3B4DA 1TR0A 2UXCF 4YR2A 2ZDPA 4Q7AA 2ZH7A 2CPHA 2RF2A 4TU8A 1Y4ZB 2EVZA 2FLOA 5B0DA 4Y2CA 3JAMY 4XO0A 3VR1A 2BVZA 5GAHI 4FYDA 2OJ3A 2VZ9A 4N41A 2ZOGA 2YNIA 4BCAA 4C0OC 3IRWP 4KSEB 4C4WA 5F8GA 3DRSA 1R8AA 2YWFA 3BR9A 5KG1A 4Z2XA 5F8IA 3GSDA 3HVRA 2FJBB 4RW9A 3M2UA 2XMWA 1XBWA 1UP1A 1MU2B 4F4KA 2ZH2A 1HW9A 2ASYA 1AXQA 1PGZA 1S1WA 4C8YA 2PDAA 4MIWA 5EX3A 1NK5A 1WHVA 1S97A 1KLNA 3KOAA 2KDOA 5CYQA 2QIFA 3N01A 5KG0A 1X4FA 5A8WA 3BSOA 3NMRA 1HWJA 5KFEA 1JLQB 2D3UA 2XWXA 3QGPA 2VC1A 4ES1A 3M8QB 3D0HE 3T3FA 4BBYA 4DUZF 3V81B 2HVIA 1S6QB 1U26A 4C11B 4B08A 2LU2A 4LF9F 2J8AA 3I9ZA 2Y1JA 3LW5C 2YKMA 4UQGA 3HFKA 2PEHA 3BO2A 3H25A 4H54A 2XS7A 3LO3A 7FD1A 2RRAA 4DV0F 3CCTA 3HHLD 3M2RA 4URGA 1FRMA 3RU0A 1NHVA 1ZETA 3LANA 4Q0BA 1XR5A 3QZ7A 3OTEA 2DIVA 1FO1A 4NOHA 3OLAA 1L3UA 1YRUA 2ROPA 3FEZA 5DGBA 4NLGA 3SFGA 1YIJS 1JB0C 1S1TB 3MM7B 2ZD1A 5KFBA 4HEA9 1I1GA 4QYRA 2OAUA 1JLBB 2DGUA 1D0EA 2BYCA 5A0YB 3I87A 1VQ4S 3KG1A 1E6VB 3HVTA 3KNGA 3LALA 3V6KA 2RSQA 2IMOA 4I67A 1Y5NB 3I55S 3DNCA 4LQ3A 2YNHB 2YWGA 4WU2A 2YH1A 2VA2A 3HVAA 3IWXA 1KLMB 4H4OA 1IN0A 4RW6B 4A8FA 1LW2B 4IUFA 2FGCA 4B9LA 4DX8H 2YTCA 4QIGA 1N52B 3UE2A 4F3MA 5AXKA 3FSXA 4PG7A 1S0NA 1MROB 2DD8S 2IRUA 2GIQA 3MEEB 2BXJA 3RB4A 2HHWA 4AXJA 2XNQA 3U1LA 2B4PA 3JSRA 3D1HA 1A7GE 1LKZA 4TY8B 1TFWA 4BC9A 2XI3A 4U67Q 4OZNA 3FZ2A 3I0RA 1UVJA 1U49A 1WTBA 5BYQA 4I7FB 1RT4B 4ZVFA 3MUTP 2AD9A 4FPRA 3BB5A 1U1PA 1XNRF 1FD2A 5U47A 3PW2A 2NPIA 3AQOA 2BV3A 4QQBA 4EGLA 4J9LA 1FKAF 4WZQA 4PXCA 1YRTA 3MM9B 4IH6A 3OSNA 1KOHA 2W4CA 3I5CA 3UDLA 2EFOA 4OIXA 4JI2F 2FHMA 3G6YA 3H98A 4MK7A 1LFPA 1NJIT 2KXNB 4BC7A 3HPOA 3CJKB 3CCMS 4F67A 3S01A 2B6AB 3HHLC 3OSPA 4HH0A 3W2WB 1UA0A 4PG4A 5DRKA 1YJWS 1OIAA 4JV0A 1MU2A 7FDRA 1Z4UA 5KFTA 4WFBQ 1N0VC 3BQ2A 2JEIA 1YHQS 1I94F 1HI1A 3RRKA 4LF6F 1MMDA 1G3OA 2QRRA 3BQ1A 3O5TB 2IHR1 1B0VA 4G1QB 5LXYA 1V3ZA 1QSYA 3SYZA 1JLQA 3GG0A 4ZP6A 3FQLA 5E3CA 3QWUA 3CB4A 4AYBD 3IN5A 2A2CA 4HT7A 1P1LA 2I0XA 2W24A 2GO9A 5C24B 3NGKA 5B0AA 3TYTA 2KM8B 4BS2A 3MPYA 2OD4A 3V81A 5FDLB 1S6QA 4C11A 1SL2A 1HWKA 1WI8A 3BGRB 3PO5A 4DL3A 3CMES 3O6QA 4IO1A 3M30B 5CH7B 5HO4A 1BY9A 1FHTA 2UVRA 1VJWA 2C3MA 3BDPA 3HHEA 2QA2A 4P7TA 1D8ZA 1VQSA 2PMHA 2CQ3A 1V3SA 3F44A 5I3PA 4USHA 2DB1A 4WFZA 4F4XA 4R0JA 1KFDA 2VPYB 5E3AA 1VK3A 2RMLA 4OFZA 4DR1F 2J0SD 2VODA 4MKYA 2OPPB 4X62F 3M6XA 1S1TA 3MM7A 5D4NA 2WONB 2DRBA 1N33F 2WAQD 2EBGA 3BSCA 4OLOA 1T02A 3R27A 2FVRA 1JLBA 1V3RA 2GMLA 5KG2A 4EYIB 1DFDA 5A0YA 1TL4A 5L1IA 4ED5A 1E6VA 4NLYA 5T7LB 3KLFB 3SCJE 2QSFA 3OV7A 3W7BA 4HH1A 3M9NB 2OFGX 2YNHA 4G6VB 4ZPCA 4AUKA 4JI1F 2XMKA 4GKKF 1HQEB 2QE5A 2PGCA 4B9SA 1KLMA 1H0HB 4RW6A 1LW2A 2CJ9A 1GT8A 3MM8B 4V19X 4Q8EA 1UETA 4YUDA 4LVOP 4PR6A 2D1CA 4RLEA 4C8LA 4B9TA 2HIQA 3GILA 1MROA 4X4UA 1R8BA 3MEEA 3RBEA 4ELUA 1H3DA 3D0IE 4CI0B 5HP1B 2B43A 1YI2S 2GX8A 2EFPA 2W4DA 4HKQA 3IC1A 1WG5A 4NMLA 4TY8A 5KFOA 4DR2F 3TA2A 2OSRA 1N5TA 2DNNA 2OO4A 1RWUA 4I7FA 3U27A 1RT4A 4ZVGA