1PILA

Structure of the escherichia coli signal transducing protein pii
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
112
structure length
112
Chain Sequence
b'MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFGRQKGHTELYRGAEYMVDFLPKVKIEIVVPDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRIRTGEEDDAAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIGNAL TRANSDUCING PROTEIN P2
publication title Structure of the Escherichia coli signal transducing protein PII.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Nitrogen regulatory protein
total genus 22
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 1994-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1pilA00
5D4NA 2XZWA 3MHYA 3O5TB 4R25A 3AH6A 3TA0A 2E66A 3M05A 3NCPA 2GNKA 2XBPA 1UKUA 2NUHA 3TA1A 4C3LA 2O67A 1NAQA 2EG1A 1V6HA 2O66A 4NYPA 2DCLA 5DRKA 2Z0GA 1OSCA 4ZK7M 3DFEA 3LF0A 1VFJA 5D4OA 4IYQA 4C3MA 2EG2A 4Y65A 2NS1B 1UMJA 2XULA 4C3KA 4CO2A 3O8WA 3NCRA 2GX8A 1J2VA 2VD3A 3AHPA 4OZNA 4USIA 4CO1A 4RWWA 4USJC 3TA2A 1VHFA 1V3SA 4WK3A 1QY7A 1O51A 3X3UA 3GSDA 2ZOMA 1NZAA 4D3HA 1Q1KA 3CE8A 3AA9A 2V5HG 3N5BA 2GW8A 4CO0A 5L9NA 4CO5A 1V9OA 4RX6A 4OZJA 1O5JA 4RLEA 1NH8A 4NYOA 1GNKA 4CO4A 4OZLA 2RD5C 2J9EA 1UFLA 2NUUG 4D3GA 4Y6IA 4YB7A 3AA8A 1P1LA 2XG8A 2J9DA 1KR4A 1HWUA 2J9CA 3HLUA 3NCQA 4YB6A 2J9DE 4WK1A 1XK8A 1PILA 2PIIA 2CZ4A 1NH7A 4AFFA 3OPKA 1H3DA 2JJ4D 5DS7A 1UL3A 2ZFHA 4CNZA 3L7PA 4CNYA 5D4PA 1V3RA 4USHA 3T9ZA 4RWXA 4YB5A 4CO3A 3BZQA 5D4LA 4E98A
chains in the Genus database with same CATH superfamily
2MXYA 3NG8A 1H2TZ 2CADA 4N8OA 3SQOP 3CUNA 1RTDA 3CW2C 3CEDA 1VFJA 2MZRA 1S97A 3MEEB 1VIOA 4DSJA 4AL6A 4IRCA 1UMJA 2W7AA 1V5IB 3V6KA 2KHCA 5K8NA 3B8HA 3X3UA 3TWZA 3DRXA 3DRPA 4RW9B 4FVMA 2R42A 4OHVA 2LYVA 1HQEB 3M32A 1VQ5S 3AOBA 3OJUA 4RW4B 1TV6B 1WG5A 2FHJA 3KK2A 3M8WA 3IFEA 1QTMA 3ENVA 3THTA 1BMQB 2GGPB 4BC7A 1C4CA 1KQFB 4ID5B 1SH3A 3JSMA 2CQ4A 2D3UA 3G87A 2CNLB 4Q8FA 1PILA 3HULA 4HHHA 2EBGA 4NOHA 1I94F 2YKAA 4DR7F 2F4VF 2J8AA 3WIUA 2JFKA 5EGYA 2HQ3A 2BABA 2D7SA 2ZOGA 4OYBA 3LP0A 4HL9A 1UCNA 2QJ3A 3FEXB 1R8HA 4ECXA 4RUBA 3DFEA 3OV7A 1ZOTA 1KTVA 2VODA 2VOOA 4FBUA 4B9TA 3E3XA 1CLFA 4CLWA 1UW9A 4Q2LA 1LWFB 4RUAA 4AL5A 2CJAA 1BHNA 4K4SA 4UY85 3FDSA 1YJUA 2N3LA 1FCAA 2HGLA 2Y8WA 1JX4A 1SJRA 4WYWA 2KVIA 3GE9A 1BQMB 1YRXA 4ANCA 2FLPA 4MIWA 1AFIA 1O5JA 2E44A 4BCAA 4H4MA 4TN2A 2W4PA 5J1EB 2AMCB 3PJ9A 3RW6A 1YQHA 2MJNA 2DNQA 2DISA 2E7WA 4YUDA 1D3WA 1UFKA 1G4CA 1NZ8A 3I0RA 2DJWA 2DGSA 2GO8A 1S72S 9RUBA 1TKTA 3HM9A 2VKZG 2OSQA 4GVBA 3ET6A 2L9WA 4TQSA 3LAMA 2K1RA 5A76A 2HMIB 3OTEA 3QPIA 2EFVA 2JEGA 1DURA 3PW2A 4C3LA 1M1KT 1NJWA 4A4JA 1R27B 1FA0A 1CVJA 2W2NP 3KMQA 2HWIA 4PKDB 4NYZA 3EPIA 4KH1B 1UWBB 1EQ0A 1WC6A 4RW6A 3ZZOA 2BKPA 3DM2A 2IHR1 4DOZA 5KFIA 5LMNF 3LALA 3MUVP 1JLAB 3JB9k 2PDAA 1QDUB 3KDNA 1L3KA 1R3NA 2QA2A 5LJ5Y 3H59A 2F1FA 4TNOA 4TLRA 1WHVA 2C3YA 2O01C 2AYBA 1GQEA 4PR6A 4WKYA 3PV8A 3X1LB 3T6JA 3NNCA 2VOPA 2EEYA 4KC5A 4UUXA 4N56A 4NWBA 2ZKUA 1AB8A 4DV1F 3I0RB 2XYGB 4DL7A 1SKSA 2HNDA 1XERA 1PC5A 4WFBQ 4LF5J 4A8WA 2K1RB 4B3TF 1C0TB 2DNKA 4I4BA 1JLQB 3RRKA 4DSLA 1B70B 3T5JA 4NLQA 2C28A 1R8PA 1T02A 2DB1A 2QFIA 5D0EA 1AT1B 3GIIA 2HBQB 5DLGA 1Q79A 2GV1A 4FYWB 2XMWA 1HNZF 3OR1A 5HP1A 1S6PA 5K14B 1RLCL 2FC9A 4FXDA 3DKDA 2GJIA 4FPIA 4ECTA 1HHSA 3O6QA 4XPEA 2XWXA 4WCEQ 5FLXY 4AUKA 2F65A 1VQNS 1Y3KA 2I38A 3PX6A 2MQNA 3A8EA 5K5MA 2R8IA 1RAEB 3TUZC 3BV8A 3DLLQ 3ZTQA 3PDNA 2KTQA 4NA1A 2HVZA 3ENAA 1YJ7A 5F9LA 3KUHA 3M8YA 4DL2A 2CVIA 2FD2A 4E98A 1X7VA 1LK5A 2RUSA 5J1PA 2UVRA 3CCJS 4JI4J 1HMVA 4OI6A 3UW1A 3D28A 2XLKA 1LOUA 2MQ8A 5AJ3J 3VR1A 4DDFA 4CDIA 4ZHRA 2J6SA 1RT1A 1NHUA 4KKOA 1X5TA 2D41A 3H42A 1N36J 2CVEA 4WFAQ 2UXBF 1U7LA 2YKOA 3UNGC 3TEHB 4CLZA 1N5QA 5EX3A 4L73A 3ZZPA 1R0BG 4OZ2A 5DO2A 1VCTA 2GIFA 3VVUA 3BKTA 1Q5YA 2KT2A 1S76D 2BUNA 1NHKL 3RG6A 3QLHA 3OQ2A 2W9BA 2GMHA 5K9FA 4DZ6A 4YP3A 3OR1B 1S6OA 1S6PB 3D6TB 3QFHA 3J7YI 3DLBA 4LF2A 1T0TV 1YDLA 4G1PA 3HVWA 3RBZA 1N33F 2YWHA 2HVIA 1XEZA 1TR0A 5KG7A 3RRHA 1CG2A 5HQLA 5IC4B 3NKYA 1B4SA 3DI6A 3EZ5A 3I56S 5KG4A 3UQSA 1X4DA 3QSIA 1IKYA 2HFZA 1NPKA 3HSGA 1MSWD 4KPYA 3NMRA 4O0IA 4DQQA 4LFBF 3LAKA 3GJRB 3PHTA 7FD1A 3ILLA 1UAWA 5C24A 1NHVA 1P1TA 4DR5F 4ZN3A 4PG4A 1N6QB 1NU4A 4XO0A 4ZHRB 3RYLA 1AZSB 1HI1A 3KDOA 3R97A 2V5HG 1Y9OA 2KG0A 3RB4A 1KLMA 3QWUA 5L1IA 2Y8YA 5HI7A 2ZC4A 2RDIA 4OZJA 2V68A 2G0CA 1RQ0A 2GQ2A 1DTQA 3TJAA 3EGNA 1NH8A 4DEZA 1S6QA 1N5VA 1FNOA 4U7CA 2XG8A 2GHWA 4LSLA 3FBFA 3FGVA 1G1XA 2AGQA 4N41A 2MMYA 4HH1A 1RDRA 4DG1B 3K8VA 5KFHA 4DX5A 2XI2A 1H38A 4KO0B 2V2VA 3TA0A 4KYZA 2JLFA 1ICEB 1N0UA 4F36A 5L1KA 1VK8A 2HG4A 2XMUA 2Z0GA 5IS2A 1RT6B 1QE1A 4C0BA 2ZH6A 2WHOA 3J7ZT 3U1MA 3FBCA 5D78A 3ILJA 5BR8F 4WZMA 3GV5B 4ZMMA 2RAQA 3KHHA 3N01A 3AA9A 2DH8A 3R5GA 1ZTWA 4Z7YA 3LUYA 3VGVA 4DMZA 5KFWA 5LT5A 1RAJA 2MKIA 1F6TA 4OYAA 4Q8EA 3P5BP 4HEA9 4LVOP 4WBFA 5J2MA 1DRZA 3KHRA 3TJ8A 4ILLA 1S6QB 4YHHJ 4OQJA 3KUGA 4NCBA 1VBYA 2MLXA 5AT1B 4F3QA 2BEFA 4CTAB 1JJ4A 4YOEA 2XZTB 1RWXB 4A8KA 3CF5Q 2Z2LA 3BKFA 4MT1A 4DPYA 1J27A 1RACB 2HEKA 4KTQA 5LOQA 4ZLLA 2H5EA 1YBUA 4L3NA 3K5LA 2QGFB 1RSCA 1TFYA 2KJVA 1QE1B 1VDHA 1WHWA 1HHTP 4HTJA 4F4YA 2KRRA 5F0UA 3NS6A 2OP5A 2LXUA 1AROP 3DGVA 3D3CJ 1RT4B 4ENOA 4L74A 2V8GA 4RNOA 3MPVA 2DGOA 4U7UK 1S1TB 5AXMA 1S10A 2HQDA 2QV6A 2BE9B 3POTB 4U7UD 1VJWA 2GMJA 4P2MA 2VIHA 4IKAA 6FD1A 1JLFA 1RP5A 2MKHA 3FBBA 2ZFHA 1Z2ZA 2F4FA 2R9LA 2DHXA 3MURP 3DNCA 4KHPF 5L1LA 1JK9B 4U96A 4ZPWR 1NJYA 4X66F 4JI2J 2AWZA 1MMDA 3LA0A 2GVDA 3HMJG 3D6FB 4OHZA 2DGWA 1LW0B 2PA8D 2KDOA 2C2MB 3FMBA 2GVZB 1R31A 4CLYA 4M5NA 3BH6B 4JP8A 4DPOA 2YPYA 1BLUA 2FZCB 4JI1F 4WF9Q 1M0SA 2HHTA 2AYMA 1KOOA 2M4MA 3J7AN 2LQ8A 5IZHA 5D77A 1KC8T 1E6YA 2ZBQA 1Q7LB 3M6UA 1S0VA 4R0JA 4KH0B 2J9DA 3K58A 5IXUA 2AIRB 1NXIA 3W8GA 1NDCA 3TZXA 3F41A 2ALZA 3P3DA 3L7UA 5M2UA 4OMFG 3OXLA 1XWLA 4ETXA 3B78A 3PACA 1SL0A 4ZKAA 5CYQA 3CJQA 1JLFB 1GH8A 1WC5A 3UFCX 3MUMP 4NXMJ 5KFAA 2R2RA 4QQBA 2Z2MA 5DG9A 1HNXJ 2ZD1A 1HNWJ 2HS0A 8RUCA 2LP4A 2ZJQQ 1X0PA 2FB0A 2XY6A 4DQIA 3NGRA 1HBOA 2PMHA 5EUHA 4OV6A 4C3KA 2W2PP 2CQHA 2ZDPA 2GVDB 2F8HA 2AW0A 5ETVA 1FJCA 5HLFA 3JSRA 1LFWA 4EFAC 2XCAA 4N47A 1YX2A 2PN6A 3PW4A 1T03B 2O1PA 1Q82T 2FQQB 3P6YC 2GW8A 2OUGA 3MXHP 2A3JA 2P6SA 3M6VA 1L5UA 3H5SA 2BACA 2W2MP 2KXNB 3TX0A 1Y00A 3W2VA 1FVQA 3T1AA 1RHJB 1UVIA 1U6ZA 2HFOA 3G8SA 1CJTB 3HHLA 2VFVA 3R1HA 3ZFVA 1E6YB 2MZSA 2XLIA 3OFGA 2H51B 3R5CA 1IBMF 5KFYA 1VRUB 1BD6A 2H48B 2BJ7A 4BLGA 2DNYA 3AB4B 4DHVA 3KJVB 4J9PA 5D0HA 2IM2A 3HHLC 3KUEA 1NMEB 3S8SA 4DCJB 4LBHA 2V4JA 4XK8C 3CSKA 2CPIA 2JWNA 2E9TA 4NYPA 1F1BB 2N4CA 1U1RA 2KXHA 1RYSA 2X1AA 3I5CA 5HROA 4Q45A 4C3MA 3PR5B 1NJZA 4C6AA 4OZ5A 4CH0S 2WVEA 1YVFA 2ZJRQ 3CIZA 5F8HA 1O8BA 3LP1B 4MIAA 3V4MA 4USKA 1Y0HA 3LP2B 3LPYA 3D67A 1VQOS 4CT8A 5CA5A 1NLKL 4ZITA 2C3OA 3PKMA 2VG5B 2CYYA 2VA2A 4EBCA 4DR7J 4G65A 3VALA 3Q8PB 2WTFA 4HDHA 3EGVA 4EO8A 2HRTA 5L38A 1EJ7L 4YS2A 1G2EA 2OPQB 2HSEB 3SCLE 1CS4B 2B9WA 4M5KA 1EETB 3MR7A 1IM4A 2E1AA 4MK9A 3KJQB 1NUEA 2QA4G 3CMES 2ZC3A 1FTCA 1TUWA 1N32F 2WRMA 3CJ5A 1XC9A 3W2VB 4A8MP 4PWWA 2LVWA 2XEXA 2E5GA 3BB5A 2ZZMA 3J81j 3UDEA 2UU9F 2NYHA 2DK2A 2MQMA 1HNVB 1FHTA 3CJ4A 3VQTA 2AF6A 4ECSA 1Q5VA 1RWWB 4QIGA 5IWAJ 4ZVSB 3PYFA 4NA2A 1YJ9S 3R2DJ 3B4MA 3EXCX 4I2QA 2BE7D 2GHPA 1D8ZA 1W25A 1UEVA 3MD1A 2YQ3A 1HD0A 1REVA 4OX9F 1Z2LA 3GG0A 5KFJA 3N5BA 1GK8A 1CJVA 4DV5F 3CCZA 1WUUA 2ATLA 1Y11A 3DLJA 1CQMA 1RBLA 3R3TA 4DBQA 3ETMA 2L9DA 4WPAA 3N5FA 3AA8A 4JI7J 1U49A 3LTOA 3Q8UA 3K59A 2V8VA 4JI5F 2Z30B 2DY9A 3GYXB 2CPZA 1EKRA 3C19A 4NMLA 5B0EA 1ZAWA 5JJBA 4IDKA 4J9LA 1SCJB 2E5LJ 5J2PA 2J6TA 3TUIC 5KFGA 1IBKF 2JLGA 3BQ0A 1X9SA 4FF4A 2K7JA 1JLEA 1D9FA 3AJDA 4UW2A 2VFTA 2QSFA 2HIQA 2Y0SD 1SXLA 1RWMB 5B08A 1NBEB 1MU2A 2NXCA 2E5IA 4RWWA 2QSWA 4I2QB 3I87A 2VZ9A 5IM0B 3ZTSA 1X4FA 1WC0A 2MSTA 4USUA 1FF2A 3DMJB 4P2FA 4ZVGA 1DAXA 4LSZB 3US5A 5CD4H 3DGPA 1IM6A 2KZMA 4TY8A 4DV1J 1MWYA 4DUZF 1YG0A 3MPDA 3H2LA 3UD3P 1P6TA 2R7SA 4FPRA 1ACMB 4K4WA 2K7KA 1E6VB 2C2ZB 4FDFA 2IM3A 2IA0A 3M9OB 2D3OR 1RAAB 5F8GA 3DLGA 1HW8A 3DRYA 4KIAA 1X9WA 1EP4A 3GWCA 2BRLA 4IDKB 3VCDA 1QLNA 4WJBA 5I3UA 1PAUB 5D4OA 1B0VA 4ZVTB 2BJ9A 3W9JA 4DV0J 5K8PA 2ZBIA 4QR0A 1ZPWX 2R8JA 3W2WA 1BQNA 1T9VA 2QIFA 2CPJA 4OYIA 2BZ2A 1LV5A 1MW7A 1MU2B 1OJ4A 3FCVA 3TUPA 5KFKA 4FNHA 3FCWA 2DPIA 4OL8A 3M7VA 1F9FA 2HLTA 2F3JA 3FQKA 1CC7A 1RBOB 2FVRA 1WKJA 2HZCA 3MM9A 3O1LA 2NXUA 4Y2MA 1TL1A 3M2RB 3CWJA 5LSRA 4P7TA 2QLJB 3OPKA 1PYSB 4TY8B 2BM1A 1PBUA 4DR3F 3KK1B 2AGOA 1Y5IB 2Y1JA 3TAMA 2R4FA 3KLIB 4PABA 4DV6F 5CYMA 1R0CB 3F44A 4K5SA 4N76A 3FC9A 5AE3A 3C6TA 3UVJB 3OHAA 4LQ9A 4B08A 2J0QD 3MAHA 1KHWA 4JUZA 3DLGB 2XO6A 3HCXA 4Y2KA 2WBRA 2GIRA 2RDDA 2ZITA 3FNNA 3NNAA 4FNIA 2DNLA 1RWKB 2HRYA 4B3RF 1NDPA 4L76A 1P9QC 1SKRA 5GAHU 1DFDA 3EPGA 4CO5A 1FEHA 1RA7A 3FJ2A 5HVGA 3OR2A 5D3GA 3N79A 3WIVA 1IUJA 3QQCD 1TTHB 3MI7X 3H5YA 8ATCB 3JTNA 2PGCA 4K4VA 4QWEA 1B0PA 2MZ1A 4LFBJ 4LF8F 3I32A 3K17A 1T95A 2XNRA 3MM9B 4IH7A 1FRMA 3TO8A 3T5LA 4DR5J 2YNHB 2N7YA 3UO0A 4F0MA 4ANDA 5ETKA 3QGHA 2ILYA 2C2OB 4LRFA 2YX1A 4ZPDA 2UXCJ 2AEJA 4NL5A 3C6TB 4P74A 4C97A 4IG0B 2DYAA 2GJ2A 1JWWA 2EW9A 4LBPA 4XAKA 3GG1A 1FJGJ 2GJFA 3GFYA 1Q1KA 4CH7A 4WE1A 1LWCA 1SV5A 4KGKA 2PFFB 5LXYA 4X4SA 4B9SA 2GHVC 2XTJP 3D6MB 1FFWB 2C2DA 4H54A 3C15A 2ZBRA 3B4DA 4KFBA 4JV5J 4LVNP 2ACMA 2MJUA 4O0NA 1MWQA 4X64F 4NLDA 4MKYA 4GVLA 3MEGA 1ULRA 4OX7A 1BGXT 1ZAXA 2KYZA 1R8AA 2NR0A 3H4BA 1RYRA 2NZ4A 2Q3PA 4Q7AA 2AJ4A 1HNIB 5KG0A 2YWWA 2GA7A 4KPCA 1PSDA 1CBKA 1NCLA 4MFBB 1WF0A 2RHQB 3OL6A 3F0NA 2JFDA 3BYRA 2IAJA 1PKUA 3VVTA 3MFHA 3ZTPA 1RT7A 3V81A 5LMUF 3Q2TC 4RKUC 3FZBA 1HWLA 2VJVA 4CH1A 2VFRA 3T1HF 2B5JA 3MCOA 1NPRA 1VQLS 4M94A 4FYDA 2LQ9A 1VC5A 3V6DA 1Q95G 2AV5A 1IJEB 2DRBA 4NI2B 1YKWA 2YWEA 4LSNA 2MKJA 1IBLF 3DLKA 4F4WA 5B0GA 2PIIA 2QYGA 3DYAB 2PFDA 4ECQA 3JAMU 5DS7A 3JQKA 4WTYA 4NRTA 1WOPA 3FKBA 2QL7B 3K8WA 3M2UA 1G6BA 4DV2J 3A8JA 5J2QB 1VYAA 1R0AA 1MG7A 2D69A 2O3DA 2ZH8A 3EUNA 1WG4A 5IT0A 4BS2A 2MDAA 2RS2A 3MZIA 3LO3A 4DWIA 1SUQA 2LFVA 2POKA 3D1HA 2X3DA 1OSDA 4RBVA 1KP6A 1SIZA 3MPWA 3Q0AA 1IR0A 3HXMA 3HPOA 2IAJB 3CJRA 2GCFA 4A46A 2FUG9 4PCQA 1YSJA 1RT2A 1SL2A 5GAEU 3MD3A 3MUTP 3NBPA 4TY9A 2DT9A 3KOAA 1X4CA 1MLAA 4OX8A 2YH0A 4KE5A 2FIUA 1EHWA 1U26A 2AJ0A 1CJUA 2XO7A 3PKYA 3M6XA 2RDJA 4ED2A 2C2RA 2LXIA 4DU8A 2VF3A 2BKOA 1AW0A 4K59A 2XSFA 1T05B 3MM8A 4P6QA 2BMBA 3D1OA 1XK8A 2A18A 3O3LA 2G2YA 1UPMB 2I6WA 3M2VB 3D54A 4UTGA 3AOAA 3PEHA 1UL3A 1RB0A 3UCUP 1EARA 2MQLA 2HQGA 3NS5A 1P9YA 5E3PA 4A8SA 4OJGA 2BYCA 4IR1A 5C2CA 1KHVA 2PD1A 3DRRB 2R2UA 4G1QB 4DS4A 4XDCA 1ZA2B 4CYUA 2MLZA 2DR6A 2CQBA 2KFYA 5K8OA 4I68A 1VQKS 2W2OP 1TP7A 2P6TA 3DC2A 4YDDB 2AX1A 3KHGA 4DUYJ 1SUQB 1U1OA 1CJKB 4ILRA 1VLOA 1Q81T 1K9MT 4MTPA 1NK0A 3TW0A 5I4MA 1QTNB 4LT6A 4OIXA 7AT1B 4RUCA 3SYZA 5FIIA 4LQ3A 1P1LA 2VG7A 5GADU 3CCSS 4ZCKA 3C6UA 1KBRA 3MECA 3G4SS 4U95A 2OI2A 2M8HA 1KSPA 3W8PA 2EFNA 4O23A 3GJQB 2HK2A 1ITPA 1YJVA 1ZM4A 2C1EB 5DQIA 2CNNB 1DARA 4WFZA 2XBPA 4DLGA 2H9ZA 4QIEA 2DD8S 5KFFA 2NXJA 5J1NA 1L3TA 3W5ZA 3M1VB 4LIWA 2F63A 2RNEA 3FRZA 2AJQA 3RBXA 1UP1A 2PEBA 3I6PA 1JNZB 3ILIA 5ETLA 1N5YA 1Y4ZB 4WXWA 2RKIB 2HRUA 1AXQA 1LQ9A 4HT5A 2ASDA 2JVOA 3BBCA 2NSBA 3OHBA 3I31A 4C7QA 1XMQJ 2IDLA 2VPWB 4TVAB 4IFYB 2ZHAA 2V0NA 3C66A 2IY5B 4C4WA 4ELTA 2E7XA 1W26A 5AE1A 2CIMA 1VS3A 1SC1B 3C6UB 3N0VA 2AYEA 3GTYX 4PQUA 5D4NA 5A6PA 3OTOJ 3UDLA 2F7VA 3H7HB 2NUHA 3RGIA 3N28A 5F9NA 5KFPA 1NSQA 2XSJB 4LF5F 2ABYA 3DOKB 1U1KA 4M5JA 1RTHB 2AP6A 5A0YA 3G6XA 1FK9B 2BE2A 3BSAA 2ZVSA 3IM8A 4IRDA 1QY7A 4PWUA 2E1RA 2OD6A 1HPZB 2HPUA 4R8UA 4W90B 3GYGA 5KFTA 3I9ZA 1N32J 2RQCA 4HYKA 3I0SA 4KJIA 2HS4A 4NLOA 3DN9A 3HJFA 1UEUA 3AD8C 4LR9A 2RF2A 1EZZB 1TL7B 3KK3B 1IR1A 1IKWB 3CPWR 3U27A 3VAKA 3CCWA 2Q66A 1MROB 1CSJA 2MHEA 3HKZD 3GIMA 2YNIB 1RHQB 1L3VA 3HT0A 2E5HA 2HKEA 1QSLA 3V6HA 2E9ZA 1M5VC 4OZ3A 2ZH5A 4ELVA 2BANB 2B8PA 2WB1D 1JLCA 1TUVA 3M8PB 1TL3B 4JI4F 3ZZ0A 2OAUA 3BDEA 3G6ES 4L72B 3K5MA 1XMBA 4DV5J 1Q86T 3IGVA 2XHWA 2CWXA 5AJ3F 1UVNA 3NNHA 1GMWA 3OLAA 5ITHA 4L75A 2DGUA 2MB0B 1NZAA 3BQ1A 4JI5J 4DFKA 2V67A 2D9OA 1VQ9S 1CULB 2CJYB 1RWUA 4MJKA 3C14B 2G0IA 5KT3A 5G0RA 4DV7F 4AQYJ 4O44B 4N5SA 1SBRA 2HZAA 5HATA 1WOSA 3QIPA 3PX4A 3MMBB 1KS2A 2DIUA 5DM6Q 1PO6A 1N88A 4DQRA 3RAMA 2JEJA 3DLEA 2FJAB 1WACA 3R6LB 2V8PA 5EWFA 3MEDB 5A8RA 2UVUA 2AJFE 4B3MJ 1HBMA 3VZIA 4ZA1A 5DZ7A 2R3VA 2BV3A 1Y5NB 1IN0A 3BGUA 3VGTA 2VFSA 4OYZA 1Q8LA 4ED8A 3L09A 4TU8A 3AHPA 1H73A 4F2SA 4USIA 4N7TA 1FKAF 1U6FA 2OLWA 4X4RA 1S9EA 1AFJA 2QMUB 2ASLA 2XWYA 2B4VA 4HH0A 2ZHBA 4ES2A 4QBUA 4ZVFA 3AB2B 2CPXA 4J7CA 2MSSA 4LRAA 4WXOA 3TAQA 4JV0A 1TVRA 3W65A 5CZVA 5G0RB 2RHSB 4OI1A 4K8RA 2PI4A 2KVQE 1QD1A 3TQEA 4UQTA 1IWGA 2V2QA 1PG5B 3UCZP 3U02A 1FDDA 3OVSA 1SJ4P 1RTJB 1RAHB 2WBMA 3C46A 2CDQA 4QWAA 1JKHA 3TA1A 3SV3A 1S6UA 5C25B 4PZVA 1SJFA 1BY9A 2J76E 4LR8A 4QU6A 3DOMA 4B3OB 3VAMA 5SZTA 1HBMB 2HQCA 3MTKA 5E33A 1BQXA 1X8DA 2KI2A 4ZCMA 2VD3A 2JZ5A 1H7XA 4JI6J 2HHUA 3CJ8A 1VQ4S 5HMWA 1YTYA 4F4AA 2I0XA 1EIYB 3E01A 1M1GA 4EO6A 3T9NA 3RR8A 1S59A 1BWEA 3QMQA 4K2JA 2BJEA 2M7SA 1KVIA 1PAEX 1C0UA 1WHXA 3FVYA 3SSSA 4QYZJ 3FEYB 1L3SA 1SC6A 4I7FB 3EDRB 3BBBA 1K73T 2DNGA 4P72A 3QSYB 2EKYA 5IC6B 5B0AA 2DKOB 2R7WA 3CMQA 3TI0A 3VTIA 4RBTA 3E2EA 4NPOA 2D3ZA 4YHHF 2AJ2A 2Z56B 4JBCA 4ED0A 2G9OA 1VRTA 2NSCA 3EICA 2UUAF 2B8QA 2Y0BB 4ZPCA 2DNRA 1NKBA 3K5OA 2G2OA 4NZ7A 1SC3B 4PUOA 2OPRA 1S1VB 1WC4A 1YJWS 2M5YA 4C8YA 1GX6A 2VBWA 4Y65A 4F26A 4ZPVR 5GMKa 2V34A 3EWGA 2CDRB 2KJWA 3TA2A 1WJ9A 3PM9A 2KU7A 5L46A 3SDEB 2DNHA 2W01A 4DZDA 2DHGA 2A0FB 3H2UB 3NP5A 1HWJA 2E1CA 4LF8J 2YNGB 2M52A 2WONA 3PFEA 1M5SA 1GT8A 4F7VA 4ES1A 3GPAA 1VQ8S 4J9MA 1UW4A 1TKXA 3QWPA 3U7JA 2FVQA 1FJEB 2J9CA 3GV8B 3DRSA 5CABA 4Z2XA 5DG7A 2ZH1A 5ETSA 1SL1A 2GQQA 2OHDA 1A7GE 4ZIWA 4TLQA 4DSEA 1HL6A 4NASA 5DZ6A 5A2QU 4WU3A 1UFWA 3MEKA 1UVMA 3T3FA 3MMAB 1TMJA 2KM8C 1S4EA 4YB1P 4G3IA 1RABB 1NAQA 4JI2F 4ZK7M 4DSFA 5CHCB 2AGPA 2G4BA 2V4QA 4PUOB 2I8EA 1WEYA 1J2VA 3VAGA 1AUDA 2JDJA 3EGWB 2CJXB 3OL7A 2CJBA 3BQ2A 2FZGB 4X62F 4QYRA 1FX4A 2YKPA 3PJXA 4X4PA 1S7IA 1OIAA 4A8FA 4NXNJ 3QO9A 3WDOA 4Q0BA 2Y1IA 2D9PA 4Y6IA 1U4BA 4CQ1A 4ZS6A 2WONB 2FVSA 3KHLA 3MM5B 3JAMY 3NGDA 4KHRA 2P2CB 2PMZD 1NB2A 2YWFA 5F8NA 4NLUA 5LMUJ 2W9CB 2H4WB 5JXSA 1AA1B 5KT7A 4ZVQB 4RU2A 2VV5A 2PEHA 4N77A 2N4DA 3BREA 3B54A 4NXMF 1NKEA 2EG1A 3PIOQ 2BJ3A 1HNXF 2HBYB 1HNWF 5GAGU 1S7HA 1ZS6A 5KFMA 1LKZA 2IM0A 3CJTA 2MGZB 1UPPA 3GONA 2RRNA 1YGYA 4IO9Q 3ZTRA 1RADB 2DHHA 1X4BA 2JSXA 1IBLJ 1B99A 3PEJA 3NLCA 4HTIA 2KZZA 2XZDB 2IVFB 1UJ4A 1U0SA 1OWXA 4QW8A 2HFNA 3BS9A 4F4XA 2FLOA 4YR3A 2VQFJ 3QO9B 3CB4A 3Q8RB 3THVA 4ICLB 2XS5A 1RAFB 4YR2A 1U1QA 1U25A 2XGQA 3CC4S 3PW7A 5ETQA 3G6VA 4K4YA 2EVZA 4QR1A 3T6BA 2VICA 3EXYA 5HAOA 2PMWA 2NXEA 5EX0A 3OL8A 1F9EB 4FKYA 4CLKA 3DHWC 2HWHA 1S1UB 4Z37A 4R25A 2LU2A 1KDNA 3CD6S 2XHCA 3L3CA 1BWVA 2M3DA 1U8SA 3JYTA 4NCAA 4RW7A 2DCLA 4K4TA 1QVGR 4DR4F 1X60A 1M5OC 1C1BA 1QM9A 3KLEA 1PC4A 5C42B 4TU7A 1BC6A 4XTTA 2HURA 3IS9B 5HJXA 1RTIA 5A8KA 4UZBA 2ERRA 2CFXA 1O6XA 2I2YA 1CEZA 4ERDA 4PPDA 2ROEA 5GAHI 2ZM6J 4NLSA 1F60B 3BBFA 5ADZA 1RGVA 3DDNA 3CO9A 4DR2J 4NYOA 1JJ2R 1S1WA 4JOUA 3GYNA 4OHWA 4DPWA 2B0GA 3OVBA 2WVBA 1FKOA 2GAHC 4KR0B 1GEHA 3SSRA 4RW8A 1HQUB 1H98A 4Y2CA 2RRBA 1HFEL 4AFFA 4IFVA 4ED7A 4IOAQ 3HFKA 2WCXA 1QUVA 4E8UA 3MAAA 4LF6F 1LXNA 2FHKA 1FNXH 3P5TL 4A8XA 3K5NA 2XMTA 4ECWA 1JNRB 2HBRB 1RTDB 1UJ6A 1N5TA 4Y3CA 1DQ9A 3EVMA 1R43A 4PYAA 4GKKJ 5IWAF 4I69A 1HI0P 3MCSA 4RUHA 1CPZA 3DRPB 5F41A 4FXWA 4URQU 4USJC 3ENWA 1EX8A 4X65J 2FJWA 1EQMA 3M32B 3KLEB 2HHSA 2APOA 3KJFB 4C98A 2B4PA 4H4OA 2Z57B 2Z8QA 4O3RA 3KK2B 1J5OA 2W4CA 1WF2A 5LSLA 1RTIB 5GMEA 5A8KB 2Y1RI 3MR5A 1KKHA 3SMZA 4RLEA 3R1LA 3JSMB 5F8MA 3JS9A 2FJXA 3CDAA 5KFRA 1QAJA 4HACA 2RB7A 3AD9C 2ZZTA 4OLPA 4JI7F 5L1JA 2UP1A 1C2PA 1X5OA 4DF8A 5I3PA 4G1IA 4YMEA 4PRFA 4JYAJ 3CO0P 2B9EA 1B0TA 3J7YU 3LP0B 2NLWA 4PXEA 4ES3A 2Y1LB 5JMNA 4NCGA 3Q23A 1Z4UA 4LUBA 2E5LF 2JEFA 3H4DA 1VQSA 2X1BA 2ZWPA 3H5UA 3M30A 2OH2A 3LGMA 4U9RA 4ZJLA 1OQ6A 2DRAA 2OFGX 2BDPA 3VHQA 3GSDA 1VGYA 1TMMA 4WYLA 1HA1A 5IT9Y 3UN2A 4H4MB 4ED4A 4A48A 4LR7A 2M0GB 2JLEA 3UI3A 2B6AA 1RCXB 1OY6A 1HBUA 4DCOB 2GO9A 4JI3J 1TKTB 1KEKA 4GVBB 1LWEA 2HGMA 3ET6B 1VBZA 4KSEB 1FXDA 3QT7A 3C8YA 3KLVA 5FDLA 3FUYA 2YVSA 3PO4A 3BKUA 2LCWA 5CYJA 2MZTA 2FPHX 1X4AA 3HHKA 1T9UA 2NQPA 3IMQJ 2OTLS 4Q44A 1W2IA 1FFGB 2XC9A 2PT0A 1F5CA 2VDHA 4HHUA 2ACYA 1FWLA 2EFOA 4CWBA 4ED5A 2FGCA 4DV0F 1S99A 3M30B 1O51A 3HK2A 3DXSX 4RW6B 2HHHJ 4F4KA 2BKNA 1REGX 2VBYA 3DM2B 2UUCF 5GAEI 1U0HA 1A9NB 4K5RA 1HD1A 3W7BA 2OO4A 4KV8A 5D0RA 2X1GA 3GSIA 4HI1A 4RPFA 1QSYA 1S49A 1MNEA 4AXJA 3R5DA 9ATCB 2CQDA 1Y3JA 2J0WA 4ZVRB 4GKJJ 4ZCLA 1KTQA 5T7LA 5CXTA 2VQEJ 4ZLNA 4KBIA 4WFXA 5F8IA 1X31C 1SKUB 1GTHA 4PYDA 1WEZA 1HBUB 2EWHA 5SUHA 4CNZA 2UV8A 4AYBD 4B9MA 3KG1A 1H0HB 2MKCA 5EN1A 2HNDB 3J7Z5 3A1YG 2B4OA 1EAYC 1O0PA 3OUYA 4C9DA 1T9YA 2XY7A 2LXFA 3VQSA 2QE5A 4NEYA 2EI5A 2V8HA 5FDLB 2R2SA 2O66A 1NPPA 1VQPS 4IQXA 2CKWA 1IKVA 2DGTA 1WF1A 2JC1A 2PC6A 1KQSR 3ILOA 3O2IA 1RI7A 4DV7J 1B64A 3Q2SC 2BOAA 1S9GA 1I5OB 2LQBA 2HAIA 5B7WA 3CCQS 1IKXA 1NB7A 2ADBA 4DUTA 3QT5A 5HP1B 1DLOA 1TKZA 1XTZA 4Y28C 3HFVA 1URRA 4DFMA 1MN9A 2AZ3A 3ISZA 1SJ1A 4YY3J 1W7WA 3N6NA 3GCWP 1UTAA 5BXIA 4ZLPA 2RD5C 1U0HB 1JB0C 4UQGA 2KB2A 1SJQA 5KTQA 3PYGA 3SCJE 1D9AA 3M8QA 3SV4A 2RMLA 1JLBA 3N4WA 5B0DA 5KG5A 3VGUA 1HWKA 3IRXA 4M5IA 2VUGA 1HMVB 1VQMS 5FLXU 1A6LA 2CG4A 3MOJB 1HHQA 4KGMA 2AQ4A 1HBNA 2IRYA 4OJHA 4FF1A 3IG1A 3NWRA 1D1UA 3A12A 1RT1B 3MR2A 4KKOB 3WC2A 4DL6A 3K57A 3OUYB 2VA3A 1S1XA 2RE1A 3EJMA 3O8WA 4C48A 4F02A 2UXCF 2R2TA 4CIOA 4IQMA 3G82A 3LOUA 5HBMA 5A8WA 1P8GA 4OX6A 1FWKA 2A2DA 1RT3A 3ITHA 2J7KA 1FJGF 3IR5B 3QLHB 1X4HA 3MM7A 2OFHX 2V9WA 1IKXB 5AXKA 2W9BB 1QJHA 4J9RA 2WSEC 3UD5A 2AEFA 5KFCA 5IFMA 2IYIA 4JV5F 3SQGA 1JXEA 1FXRA 2YNFA 1UETA 1H74A 5ETMA 1T94A 4USTA 2XM3A 1BUXA 4ZPAA 1U2FA 2JOQA 3QFWA 4DI6A 4MKAA 3DI6B 1X4GA 5KFNA 2DH7A 1T9WA 3T9ZA 1FVSA 4EU0A 1IKYB 2JHEA 3KLFA 4J9VA 3FMWA 3M8QB 3NY0A 5U47A 3M05A 1JLBB 2XYPB 5H9EJ 4CM2A 4CCHA 1U2CA 3ISND 1YZ6A 2F40A 2FLLA 4NA3A 3QNWB 4P73A 4UUWA 4B9LA 2PSZA 5C24B 3KFWX 4I0WA 2H1YA 3GFXA 4Z7CA 2XULA 3I5BA 1NK4A 3OTDA 1KLMB 2HW3A 5L9XA 2RH3A 4DU7A 4Y34A 2WZ1A 3S7RA 2UV8G 1DTQB 1Q8IA 3G82B 1TK8A 4RU9A 2ROPA 2AX0A 3T5KA 4IUFA 2ZUAA 1RHKB 3I9V9 4CRJA 2I5JA 4LSLB 2AD9A 2YKQA 2UUAJ 2LKZA 1J5EJ 5KT6A 1L3UA 4EUVA 1YZ7A 3D68A 2MQPA 3C3LA 5KFDA 1VRQC 1NEEA 1FWPA 3FZ2A 4W92B 2ILZA 1XQIA 4YB5A 3UNYA 4DL5A 5KFUA 2HS3A 3NCPA 4DV2F 4DXLA 4OHYA 4WFNQ 4C8ZA 1X4EA 2D1CA 3KLGA 1U09A 2M70A 3PCOB 4BDPA 2L9NA 3HHNB 4H4KA 5IV3A 3SIPB 3I5AA 4X2BA 4J9OA 4ED3A 5KFSA 3CJKA 1R8CA 2OTJS 3CMAS 2Q6BA 1UVKA 2M9KA 3IWXA 2R7VA 3W5XA 4UOGA 2EFPA 4H4KC 3HKWA 2H5JB 4C2MA 5KT5A 3H5XA 4R0EA 5J2MB 3T41A 3LANA 1DHMA 1XMOF 3W63A 1NKCA 2J9DE 1FKPA 2HQFA 3CCLS 3ZXWA 2I5JB 1K1SA 2P9EA 4LBIA 1PJ5A 4U6PA 4P7VA 1ZH5A 4OI4A 3PIPQ 2WVDA 1WELA 3HHDA 3WX8A 1HW9A 4USVA 2H4YB 3M4XA 4FF3A 1UVJA 1B7YB 3CT9A 3KKFA 4LF4J 2HVEA 3OLBA 2IC3A 4X62J 2B56A 3FK4A 2XMJA 2CPDA 1N4LA 2HLUA 4J9NA 4FVCA 1TFWA 5KFLA 2V4RA 4PQAA 1S12A 1Q0NA 3GB0A 3V4IA 2IDEA 4CO1A 1OO0B 2Q79A 4DUYF 2W1BA 3CDUA 5DLFA 4OLOA 5DQHA 1X5SA 3EE3A 2FYXA 2HNYA 4ANEA 4DJBA 3MWBA 1WG1A 4BBYA 1X0FA 2F5GA 4MYTA 4FYXB 1WEXA 2HFSA 1R89A 4YB7A 1OQ3A 1RJJA 2C42A 2IVMA 4RBUA 3CDWA 5HMZA 5KG3A 3KLHA 2MQQA 4JI0F 1FRXA 3DLHA 4F0KA 4LFCF 1VR6A 1NO8A 2OPSA 4C8MA 1DQ8A 2XZWA 4PWDA 3NOGA 4R5PA 1IQTA 4C11A 3R7BB 2GNKA 1RWPB 4M5DA 4DPUA 1TUGB 4DPXA 2QTWA 2V8DA 2EBEA 1F2HA 4DX6A 1LXJA 3ZC4A 3D66A 2AEMA 1K47A 4PG5A 3QGPA 3UE2A 2RU3A 3MEEA 2N3OA 2YPZA 1HR0J 2MZQA 2AZ1A 2LQJA 4HHJA 4D3HA 3ADAC 4DX7A 4RW9A 2D3O1 3T1YF 5L39A 4I6AA 3M8SA 1GXUA 4DN9A 2NYIA 4KHMA 4ER8A 1HQEA 4LFAJ 4RW4A 1TV6A 1UZDA 3CCVS 4QR2A 2GGPA 1XMQF 2FJEB 4HLBA 4ID5A 2HVHA 4F2RA 2IBOA 3IR7B 3MOZA 1TZ0A 4RR5A 2HFUA 1PCAA 4DR6J 5CYQB 4DR4J 1IVZA 3H25A 2BXJA 1RAIB 1I3OB 2ZD1B 3BGLA 1X5PA 4W4MA 2LLZA 5HANA 5EHHA 1U6BA 2FHOB 1HBOB 1UKUA 3PTWA 1N52B 4WP8A 3GCXP 3OTOF 4USMA 2X3GA 5HLFB 5DDPC 2QLBB 1QVFR 5BYQA 4F04B 2R8GA 1VHFA 2J0XA 3D0GE 1LWFA 2ZOMA 4M1KA 3BSNA 1U45A 3UR3C 2B43A 2XS2A 4E2FB 4QZVB 2MYFA 3JQMA 1N56A 2EFGA 1RWOB 2DGVA 4LF7J 3M9MB 1BQMA 3AODA 4LF6J 3HFZB 3FSXA 2P5VA 4D3GA 1VC6A 5E41A 3CULA 3HHLB 1YHQS 3U1NA 2W8LA 2UUBJ 4LRBA 3RAXA 1D09B 5J1EA 1VHIA 3ICLA 2VPZB 1SB6A 3A3NB 4USHA 5HL7Q 2V4JB 5KFBA 4ZOSA 3UD4P 5D4LA 1AUSL 2HK3A 3FFIA 1SQEA 3ZZUA 5HROB 2FVCA 2HMIA 2KFNA 3RRGA 5JUMA 1U02A 1TL4A 2GMLA 2XYHB 2DNNA 3AXMA 3N6LA 8AT1B 1SVDA 4OZNA 3VZHA 3EVOA 1YWXA 2LDYA 5AE2A 4J9QA 2YWGA 5E3RA 2J7UA 2E5JA 1UWBA 2YY3A 2VFUA 2ADCA 2GC8A 1QUPA 3FRYA 2BR0A 3GILA 3EX7B 3GU0A 2YQ0A 2NXNA 1JLAA 5B0BA 2XMAA 2PI5A 3MFIA 2DTJA 4UT4A 4AQYF 3JSBA 3CD0A 4V19X 1KONA 4K4UA 2BBEA 4IO1A 3QAEA 4EBEA 3IGNA 3HVRA 4QIWD 3NRBA 3F73A 1UWAA 3LGHA 3IWLA 4B02A 3L9ZA 1U1LA 3HVTA 1EKSA 3BGFA 4B3MF 1H72C 4V1Ak 3RBDA 3FFIB 2FVPA 5GAGI 4OYWA 1REVB 2FJBB 1C0TA 4WKRA 2MY7A 4EK2A 1RKIA 1JLQA 3C16A 2B7CB 3DHXA 5E7OB 1CJVB 1N5SA 5CAAA 2HGNA 2QL5B 4DLEA 5HSPA 3THPA 4DV3J 3NAHA 4OI0A 4ECUA 4O3NA 1WKLA 3GR0A 5K14A 5DDQC 3UWTA 3MGJA 1ELOA 2XMMA 1OS5A 3TZWA 1XR7A 1N54B 3EZUA 5J2PB 3CJ3A 2KG1A 1V3ZA 2IVYA 3HSDA 3KG4A 2XGPA 3I4HX 2A1BA 4ZIVA 4JI8F 4RNHA 3NGSA 4QPTA 3A3OB 1JLEB 2C2NA 5IOLA 2UUCJ 2IA6A 3K2YA 5CCLA 3HVTB 1SC4B 2MTLA 3G9CA 4MKVA 3PY8A 4J90A 2UXDF 2MHNA 3C2PA 3K89A 4JI6F 2IIHA 1NNDA 2C3UA 3DGPB 3UDVA 4NLGA 4O4GA 3C16B 4IOCQ 2KRBA 3R5AA 4CO4A 3G71S 4UY8T 1FRLA 1RZMA 1X9MA 3K5PA 2QEXS 3IR6B 5ETPA 4FF2A 2ATCB 2HAFA 3P96A 2JJ4D 5C2GA 4OI2A 1OY9A 2FY8A 3Q24A 4FZVA 3AT1B 4RZRA 1V3RA 4DF4A 4ZP8A 3HSZA 1EP4B 3EM1A 4M5GA 2X1FA 1PIEA 3RBEA 2HQIA 4EI2A 5I3UB 3NEKA 1OSCA 3HO1A 1IJFB 2FHJD 3KG0A 2Y3YA 4A8OA 3W2WB 1BQNB 3ZO7A 1CC8A 4CO2A 1YJNS 1S0MA 2XQCA 3HZEA 4RNFA 4LF1A 3DU6A 1QAIA 3EZOA 2JRSA 2I1RA 3MPYA 1N6QA 3W62A 1SQFA 1AZSA 3ZNUA 2DITA 2H65B 4CM0A 1WC1A 3Q22A 1WSRA 3SSQA 4C8OA 3OVAA 1TL1B 2DGXA 4O4GB 4DSKA 1LK7A 3MCNA 4K4ZA 4JB8B 3PHEA 3BPDA 3TAMB 5HVFA 4ECZA 4LREA 1M5HA 5CYMB 3CCRS 4IOBA 4M63A 4MIBA 2HHXA 4LMZA 4DG1A 4NZ6A 4AD6A 2WVFA 3SEOA 4JV1A 2OKQA 4KO0A 1WHYA 3RB3A 4K0KJ 4K50A 3PNIA 3EGZA 3OXFA 3P45B 4P9SA 4MK7A 1RT6A 5H9FK 5T41A 1TL5A 4HVZA 1TK0A 1Q4RA 5CZXA 4LRDA 2DNZA 3P8BB 4UF4A 2B4UA 2K3KA 1TELA 1VK3A 2CJKA 3OR2B 2IM1A 5D3GB 2WW4A 2RIJA 3OFEA 2OMLA 2BOPA 4NXNF 4G6VB 3ZZTA 2CRLA 2CPYA 1SPBP 1JQGA 3CD5A 4C8NA 1SKWA 5M2RA 4NLXA 2RRAA 5LSOA 1GFWB 2C2EA 2N82B 5HN0A 3NGKA 2B3TB 4CLLA 2R7RA 1VLYA 2B7BB 2DEJA 1K0VA 4OHXA 3A4TA 3CVKA 4CTAA 2ZJPQ 1T7PA 2MKYA 2W9AA 1S57A 2GZOA 2CAJA 4KGXB 3TVYA 2R7TA 3D2WA 3QGGA 4O4RA 2B51A 2BQ3A 3SXLA 2DY1A 3W1YC 3E51A 2E29A 2WK4A 4WE1B 2HFVA 4TYBA 5KOXA 1LWCB 1SV5B 3GQCA 3C15B 4NEZA 4KFBB 1N8RT 3TX8A 3RTVA 3IBFB 5E2QA 1Q16B 1LW2A 5IT4A 3MEGB 4DL3A 1N34F 4WIIA 1GTEA 1RT4A 1MMLA 2DGQA 5FD1A 4Q5VA 4EEYA 1S1TA 2VQFF 4X4NA 3POTA 2J7WA 5BYSA 1ZZNA 4EZ9A 1VIXA 3LWLA 5E5NA 1M5KC 1SH0A 2LEBA 3P49B 2PO4A 2DH9A 4NX9A 2CQ3A 4DV4F 2IRUA 2RQ4A 3R6GB 2HWTA 2YX7A 3LPEA 2EKNA 1RT7B 3V81B 2KFZA 5LM7E 4UOHA 2M2BA 4GC7A 1FD8A 2B5JB 4DL4A 4BHQA 1LW0A 3WX4A 5HVHA 3V5RA 5HMXA 2GVZA 3CD7A 1FEEA 1V3SA 3V6DB 2A6OA 1XMOJ 3HD2A 3MPUB 4CZCA 2UVWA 2MKKA 4FS1A 2VH7A 5T14A 2ZM6F 1RE1B 3IRWP 2IMOA 2ZH7A 3BSOA 5F3TA 2WW8A 2OGUA 2LMIA 4LSNB 3DLKB 4P75A 4DR2F 2C3PA 4J91A 2YBVA 1KR4A 4ZPTR 4X4OA 2LU1A 4LF9J 1LW2B 1NH7A 3HF5A 2I9SA 4QPXA 4JV2A 2DR8A 1Q7YT 2CXEA 3M2UB 3RZAA 4LRCA 1R0AB 4AXIA 3ZZZA 4P71A 3BDPA 5KFOA 1TU0B 3CCMS 4I6WA 1NK6A 2ZH2A 1KRPA 1DY3A 3OT9A 4MKBA 3P4UB 1KFDA 5RUBA 1XNRF 2XMKA 1N48A 1YJTA 2HHPA 1FT8A 4PXCA 4GKKF 1NK8A 3DCAA 4CLTA 4QOTA 3J7A1 1RT2B 2DXEA 1FJ7A 3NBPB 3I96A 1KN6A 1XJWB 4HKQA 1NSPA 1ZZFA 2V50A 4X65F 5KFXA 4CO0A 2HBZB 3VWSA 4OFZA 1CJUB 2RS8A 3CCTA 1T03A 1H7WA 2BX6A 3BO3A 3OFFA 3G6YA 2DHAA 2G0JA 4JI0J 1XNQF 4LFCJ 4WZQA 3MM8B 3HX9A 1TKDA 3TVKA 3TANA 2UZAA 3TVZA 2NCKL 2MZJA 3HLUA 3RW7A 3CTRA 2ZH4A 3R5BA 2RU9A 4K4XA 4ECVA 2E1PA 1FFSB 2QLXA 3W61A 2CQGA 1CJTA 3D7SB 2MY8A 2JVRA 3PX0A 1BXNA 3D3BJ 2XLJA 2RSQA 2ZWOA 4JYAF 4Y2AA 2Z4PA 3PRBA 1KLNA 1VRUA 3QBCA 3CC2S 2YKNA 3KJVA 3PO5A 4DS5A 4CYUB 2QT7A 4O3OA 3VF0B 3UPFA 3T1YJ 3AJ1A 2C3MA 4DR1F 1DQAA 1IWAA 1HI8A 1WDDA 3Q8VA 4F0HA 2U1AA 5D6GA 4B9NA 3SI8A 5BJRA 1UA0A 1Y7PA 4NLPA 5KG2A 3CE8A 3LP1A 4ALZA 1RLDA 3VGSA 1T9XA 5B0FA 4QIVA 3LP2A 2ZH3A 2EPIA 2VG5A 3CDBA 3GP9A 4OI3A 3AY0A 2VG7B 3L4BC 1UFLA 2OPQA 3PG9A 1CS4A 3LH2S 3MECB 3OSNA 2FHMA 1UEKA 1S48A 3WHIA 1EETA 3J80U 4OZ0A 4JI3F 4FXVA 1SQGA 2YTCA 2RQMA 1JXLA 4FN5A 3LWMA 1M5PC 4EZ6A 4ZCIA 4F50A 2KT3A 3AQPA 5LXRA 4RNNA 1FDBA 1HNVA 4CLUA 2OPPA 1I1GA 1ZAVA 1Q53A 4C8LA 2YKNB 1CQNA 1NRKA 4FYYB 5K8MA 4ZVEA 1XBWA 1JLGA 5KT4A 3Q83A 2ALYB 3NL0A 1N5YB 1RAGB 1N0VC 3OSPA 2L48A 3DXBA 2IJNA 2FC8A 3A8KA 1YIJS 3RB0A 2UUTA 5J2NA 2MPUA 4DL0C 2HHHF 1GXTA 4C0OC 3DU5A 2ZNYA 4ETZA 2VJUA 4L6V3 5DDOC 4BWJA 2QO3A 5ETTA 1MMNA 2AU0A 3GIRA 1I94J 4NE9C 4NZ0A 2F4VJ 4QWCA 4GKJF 3MAQA 1Y10A 2VQEF 5D8HB 1VBKA 1H3DA 1NJXA 2VC1A 4OV1A 4OJ3A 4TQRA 4PQUB 4CNYA 3L95X 1G7CB 4EBDA 5B09A 2ZE2A 3VAJA 2HHWA 3BN4A 1GXLA 4KQZA 1NK9A 2DXDA 3A8IA 3SCKE 3A3PB 4XPCA 3IXQA 2OD4A 2WAQD 4Q43A 2CJQA 1JJCB 4QJVA 4PXBA 2QC3A 2DO4A 1SIWB 4MH8A 2HVDA 5A0YB 2BE2B 1B7FA 3TEGA 4QYZK 4C0HA 2OPPB 5E3QA 3JXOA 3TJ9A 4R8UB 1FO1A 2AT1B 1KVJA 1OPZA 1JLGB 4ZVPB 2YKMA 3PJWA 3ONQA 3QJLA 3I0SB 4O3QA 1RAOA 5IM0A 2YX4A 4AT1B 3DMJA 2RF2B 1R7IA 5J2NB 4YY3F 4EYHB 3N6MA 2RILA 3HD1A 3NAIA 3UCGA 1XIQA 4PAAA 3SZ2A 3JTOA 3Q8SB 3Q8QB 3E8OA 4UOCA 1KQKA 3CDEA 3OTCA 4ZVHA 5DGAA 3JQJA 1JLCB 2MQOA 1E6VA 2D74B 4EWTA 3H0PA 2E66A 2CQ2A 2P9GA 3W9IA 3GFZA 3CJ2A 6AT1B 3DDIA 2ZE2B 3LF0A 1U2RA 1WI8A 3G86A 1WDTA 4HI2A 1Y5LB 3HP6A 3N9UC 1WWHA 4B3SF 5AXNA 2ZZNA 4Y2IA 5D0GA 2DNPA 1M90T 4FBTA 4ATNA 2IJRA 1NK5A 2VU5A 4DQSA 2IFXA 5LMNJ 3CCUS 3UN3A 5L8RC 3HZGA 2YKMB 2UVVA 3QIPB 2KL8A 2HIYA 4JI8J 4XDDA 1S0OA 3GV7B 1NK7A 4QWDA 3TARA 1MWZA 3DLEB 3OBIA 4HDGA 2W4DA 3PFOA 2CPHA 3BGRA 3M2RA 1YITS 5A8RB 2QMXA 5DETA 1FX2A 2HNZA 3KJNB 5LJ3Y 3KK1A 2KYXA 3PYEA 2UXDJ 3KLIA 2G13A 2DIVA 4I64A 5E0OA 2DR5A 4B3TJ 1DZ5A 2UUWA 3UVJA 4IYQA 3NMAA 2XCPA 3I4PA 1YLXA 4TXSA 3D0HE 3HSJA 2L41A 2VL1A 5EDWA 1S9EB 2V94A 3IWNC 1HNZJ 3HHLD 4YDXA 1EB0A 2W2QP 2BQUA 3G2XA 3IP0A 3DDKA 4WFYA 3ZZRA 1H6KX 2CQ1A 2E1MC 1V5VA 1TVRB 2NZCA 3TNVA 3PW0A 1ZM3A 5JVGQ 1VQ7S 2W7OA 1S0NA 4RNMA 1ROFA 3IM9A 1D0EA 2ASYA 1PYOB 3ZTOA 1WC3A 1J5EF 1NSKL 2IJFA 3OXGA 3L7PA 3D9BA 1JKHB 5B0CA 2XMVA 3I55S 1LWXA 3MM6A 2RQKA 1NDKA 3AOCA 3BGRB 1D9DA 3V2UC 1WI6A 2VONA 3DOMB 3BN7A 3CXCR 2KHDA 2YNHA 2HNZB 4DN0A 1RCOB 4C8KA 2QLWA 4X4VA 3CNQP 1PJ7A 2CJ9A 4KRWA 3W60A 2UXBJ 3JTPA 1VJQA 1WSVA 3E01B 1FI4A 3NCRA 2P9CA 1PBAA 4IG0A 2V2ZA 3TZZA 4X4UA 2EK1A 2H54B 3SFGA 2CWKA 5JVHQ 1F5BA 1MN7A 1C0UB 4DSIA 1UVLA 3UDCA 3PRDA 3KNGA 2ZOFA 2W7PA 2VPXB 1F9HA 3B82A 3GMGA 3GFHA 5DM7Q 2H3EB 4F4ZA 1T8EA 1FRJA 1HWUA 1KD1T 4WK1A 1N33J 2FJDB 2KO1A 4DPTA 2Q1LA 1NM2A 3FBEA 4W98A 1JMTA 1VRTB 3MMCA 4S0MA 4ZDNA 3PZPA 3BZQA 4MYUA 5CQGA 3CCES 4ITSA 2OPRB 3O5TB 4YQWA 1HNIA 2SXLA 4ZJQA 1GAOA 3BO2A 3D5MA 4X4TA 4MFBA 4YR0A 4LF4F 2FY1A 3MM6B 1I51B 3L7OA 1D8YA 1OYEA 3FSYA 3QAUA 5I42A 2DCUB 4TYAA 3M6WA 4DCPB 3ELHA 4I56A 3NOCA 3FQLA 4GC6A 1HYSA 2GAGC 3IAM9 1TKXB 2FTRA 4I67A 2MLYA 2C22A 2ZKTA 2RVJA 4KB7A 2EC0A 2DXFA 2M8DB 3DRSB 3EDQB 3RR7A 2B9XA 2KM8B 2G1HA 3J81U 5KG1A 3TOQA 4NI2A 4ZP7A 4NLTA 3R9LA 1OY8A 2KN4A 3H98A 4IR9A 1UA1A 3DYAA 4FKXA 2QA4S 3R5JB 1DBDA 3AJ2A 3CJSA 3DOLA 2CQ0A 3MHYA 2VDIA 2Z2ZA 5HQ8A 3MMCB 1FXLA 3O44A 3TR5A 4P52A 3HVAA 5J2QA 3T19A 4PXDA 3BM7A 3VAHA 3MCMA 1NJIT 4J37A 2EG2A 5BR8J 1FE0A 3QIDA 3W9HA 4NLVA 1XR6A 3ENQA 3VAIA 3VV2B 1N34J 2JH3A 1IBCB 2FDNA 5M2PA 5I42B 3GZ7A 1HR0F 3QT6A 3V6JA 4RO0A 5BYRA 5L9NA 2L3MA 4IH6A 4Q0BB 2AYGA 2LDIA 2KT5A 4WTOB 4AL7A 1RKJA 4V19J 1T11A 4QU7A 1HYSB 3W66A 4LFAF 4DV4J 1KWMA 3MF5A 3JSYA 5D15A 4N8NA 5A6WA 4GO7X 1T05A 5HK4A 4CP5A 2BW7A 2U2FA 4EGLA 4WP3A 1U24A 4M5LA 3M2VA 4DR6F 2EC2A 4GRSA 1TAQA 4QCLA 5I3QA 1JXVA 5IQQA 3H8YA 5LL6d 1R8BA 4I2PA 2CQCA 2JEIA 5KFQA 3DRRA 3DOLB 3OW2R 1YI2S 3IBWA 4RJVA 5KOWA 1F2GA 3WBZA 4G1QA 3TAPA 5F3ZA 1HLWA 4PG7A 1B3TA 1U1NA 2LA4A 2MKSA 3CIMA 4E0DA 3BSCA 1RHUB 2CG8A 2P8IA 4QIFA 4YFUA 1CJKA 2VPYB 1S9FA 2DBBA 4CLFA 3TZYA 5ETRA 2HZVA 1R6YA 4YEAA 3BJYA 1LFPA 5F0WA 2XNQA 2CUYA 4LF7F 3LW5C 4IH5A 4RL1A 2UUBF 4WWSA 1XNRJ 1TK5A 3KWMA 3ZNJ1 4KHPJ 4ZP9A 2OSRA 5F8JA 5H9FJ 4DX8H 3GIKA 1SI9A 4LIRA 4X66J 1RTZA 4NLWA 3HJVA 3BR8A 3JYTB 3QRRA 4RW7B 2ZDOA 3AH6A 2VB6A 1P27B 1ZYQA 4J9KA 4CLSA 3HHEA 5IQ6A 4M95A 1C1BB 4FS2A 1APSA 2HHQA 2NS1B 2HHVA 1XNQJ 3IBCB 4I2PB 4JI1J 2JC0A 3M1VA 4MAKA 1SJ3P 3NGTA 4IG3A 2JL9A 2ZH9A 2EXUA 5HMYA 4ZN1A 1S1WB 1K44A 2RKIA 1FKOB 3H2VE 5CCMA 5DG8A 1WORA 1JJHA 2ZUGA 4RW8B 1TQLA 1RBAA 4OZ1A 3CJ0A 2OJ3A 1U47A 4YB6A 4IFVB 2PE8A 3J80Y 3S1TA 1FRHA 2XB2D 1K1QA 4ZPBA 4B9UA 1RISA 3BGOP 4IFYA 3BH7B 3MAAB 4DR1J 1RUSA 1F0XA 3MTJA 1FRIA 1F3VA 5DDRC 1RK8A 3MDFA 2DR7A 1PJ6A 2RUGA 3LQVA 2DO0A 5E3AA 2GFFA 2XSJA 2W25A 2F9DA 2LECA 3DOKA 2K2PA 3WC0A 4H4OB 1RTHA 2QYCA 2IBKA 1J5OB 1FK9A 2Q43A 4KGZB 2OEMA 2R8KA 1V9OA 2QX0A 2CZVC 5F8LA 4HT7A 1HPZA 4IG3B 3AFGA 4HACB 4DV3F 1GNKA 4KAIA 4J9SA 1DJ0A 5G4DA 1FNMA 4O3PA 4A8QA 1IXKA 1AYEA 1KQGB 1G3OA 1YBAA 3QGIA 3ISNC 2BJ8A 3GLJA 1TL7A 3KK3A 1IKWA 4KT0C 3KNAA 2GQCA 1IBMJ 3FCHA 1IR2A 1VOMA 4LJMA 4PPZA 1MROA 2QRRA 4DFPA 2YNIA 4NCGB 3HT3A 4B17A 2O5DA 3H90A 3HI9A 1UJ5A 1NDLA 3NGUA 1T3OA 5K20B 2KXFA 2F8EX 2O67A 1SH2A 2BANA 2JX2A 1HKAA 5MLCV 1VI7A 4Y0FA 4U67Q 2W8KA 3M8PA 1TL3A 4GMKA 1FDNA 1GMVA 3IO1A 2GX8A 1U1MA 2DNOA 1FDAA 1HIYA 2Z58B 2MEWA 3NS7B 4KY3A 2V63A 4NMXA 4NLRA 4M5MA 3W64A 7FDRA 3R7NB 3G96A 4RX6A 1XR5A 3WQPA 2VBZA 5GMDA 2B6AB 2XS7A 3H40A 2YXLA 4WU2A 1CULA 2Q6CA 1T3NA 3C14A 1FESA 2QMWA 4BC9A 1LWEB 1PYTA 4O3SA 1ZPVA 3BEGB 4F25A 5H9EK 4Q2MA 3QYYA 1A0OB 1ZETA 2R7OA 5CH7B 4O44A 3CC7S 5ETNA 4DFJA 3AXKA 5IT9U 2ZHOA 3MMBA 2VKRA 3EVWA 2K3IA 2UU9J 4FYVB 3QJJA 5AXLA 5D4PA 2DEIA 4ZLJA 4F3MA 1YRTA 3D1QA 2J5AA 3TUJC 5C7PA 3F56A 2IRXA 2WSFC 2AHOB 3MEDA 3H20A 4CLPA 2OEJA 3R2CJ 2A10A 2LA6A 2F9JA 4GO5X 2W24A 3QRQA 2XY5A 3AQOA 1FTRA 3BR9A 4OX9J 3ULHA 1WNEA 4TU9A 1PGZA 3R7SB 4EMDA 3IC1A 2M88A 1OPIA 1KOHA 1UZHA 3VAFA 4PG8A 1GMUA 3RU0A 4J9UE 2ROGA 1C4AA 4KV8B 4X84A 3Q89A 5GADI 3QZ8A 4IRKA 2LEAA 2F8MA 2OELA 3PXGa 3BF4A 3OD2A 2X51A 1VC0A 5GVQA 3EMTA 4USWA 4OZLA 5T7LB 1LEOA 2BVZA 1N36F 1FD2A 4OYMA 2BQRA 3QATA 5ETOA 2QFJA 1NSAA 2WVCA 3Q8YA 1F3FA 6FDRA 3RUBL 5KAKA 3D4JA 4NLYA 3W3SA 2EFQA 3IAS9 1IBKJ 4FP9A 5KFZA 4M8LA 2R7QA 5CD4A 4B3SJ 1I6JA 5MAOA 2AKWB 3A13A 1IKVB 1ZM2A 1RTJA 1S77D 4OYOA 1URNA 1V6HA 4MK8A 3AD7C 3M8RA 2CA9A 2JNJA 2G1DA 5E3CA 5KFVA 2NREA 2ZNZA 5C25A 2CQIA 1S9GB 1RWVB 4K0KF 4B3OA 5HJYA 2CPFA 4P2XA 1VQYA 1DLOB 4AE5A 1ZTTA 1TKZB 3QZ7A 4CI0B 1FERA 3B6BA 4OYPA 2IPOB 4HR2A 4CT9A 2V69A 4DQPA 1KNZA 2RJZA 5EWEA 3OJSA 4OYXA 4DUZJ 3RB6A 3QRPA 4ED6A 1RU1A 2VHGA 2OEKA 2R8HA 3D6HB 4I7FA 2R7UA 3PRVA 1ZM9A 3IRXB 4A47A 1RXOB 2FJVA 2QA1A 2DVIA 4I1TA 2X7IA 3NWGA 1HBNB 4RWXA 2E7VA 5HQMA 1RHRB 1KVKA 3IG1B 2LQ5A 1ZA1B 2VASA 2A2CA 1S1XB 4UOFA 2V6AA 2J0SD 2WSCC 5HO4A 1VMBA 3QJPA 3KXDA 3S6EA 1S1VA 2VBXA 5HBMB 4NRUA 4XIUA 3GIJA 5A8WB 4WP9A 2ZBPA 4WK3A 3ITHB 1RT3B 2Y9HA 2ZBCA 2IYGA 4F8RA 1RU2A 2FLNA 4P2SA 3MM7B 1S4FA 2ASJA 1IQZA 2WB4A 3SDEA 5EWGA 1VBXA 3RJMB 2LEPA 4TKTA 1TAUA 4ECRA 3SQGB 1WTFA 2YNFB 3UN5A 3HDSA 2YNGA 2N7CA 1QAYA 5A2QY 5DJBA 4J5OA 1WOOA 3Q86A 3R8YA 1HQ2A 2VC0A 4DR3J 1HARA 4OJ1A 3PYDA 1YJRA 2QLFB 1YK9A 2PA3A 2ZEJA 3LGNA 1RWNB 1F5AA 1W2BR 4DV6J 3KLFB 4K2XA 2A6MA 2E9RX 2CNOB 4MMOA 2QL9B 3GJSB 4ELUA 2G2ZA 1VQ6S 2CZ9A 2L08A 1VISA 2B9YA 1C1CA 5KG6A 2CPEA 4ECYA 3MMAA 1DTTA 1BE4A 5DQGA 2OMOA 3IA0A 3W5YA 2KH9A 3RAQA 1FE4A 2H5IB 2WOMA 2IMWP 2BA9A 4B3RJ 1H2UX 1WD6A 4L3KA 2BRKA 2OIHA 2HYIB 3G8TA 3EYZA 2R7XA 3TRGA 3PVXA 2VG6A 1WKKA 2QN6B 2QZ8A 2COLA 1JIHA 1HWIA 4BWMA 3K7RA 1FRKA 1Q8KA 4U8VA 4YN3B 2J6UA 2NUUG 3OFHA 1U1PA 3J81Y 2AJ1A 5H1SV 3BPSP 4WIQA 3BO4A 5FJ4A 1OYDA 2DHSA 4LF9F 2C2KB 3FEZA 3MM5A 5C5JA 1GMWD 1S5ZA 3CGIA 1QAXA 2BW2A 2W9CA 3I82A 2EK6A 4QWBA 3KLGB 2K8GA 2RT3A 3FSIA 2QG9B 4M5HA 4K7QA 3OTBA 3MR6A 1C1CB 3IN5A 1M1HA 3S01A 3TQ1A 1DTTB 3M8ZA 2DR9A 3CJKB 1LNQA 2MGZA 5DGBA 1GX5A 1RT5A 3KMSA 2NPIA 2WOMB 1S79A 4F3OA 3WZ0A 5IV4A 3KYLA 1YBTA 4URSA 4ID8A 2Z2YB 2CNKB 1Z1ZA 2VG6B 4UZCA 3SBMA 2DNMA 4X64J 1XN9A 4ZP6A 3SFUA 2BM0A 4ZVOB 1FKPB 3AAWB 2YH1A 3TP2A 2YWKA 2BJ1A 2GIQA 2FGOA 2K06A 3NCQA 2XI3A 1Q8BA 3NXZA 1KFSA 5THWA 3K0JA 2YQ1A 4PG6A 2NPFA 3G8QA 3TYTA 3T5HA 4ICLA 4ED1A 2FZKB 4ILMA 3MR3A 1K8AT 3R27A 3M9NB 4B9VA 1OMSA 3QT8A 2V2KA 2CQPA 2IC3B 5KT2A 1RHMB 4A8YA 1R6VA 3OL9A 3MMJA 4EYIB 1S1UA 3SCIE 5DRKA 3U1LA 1K0TA 3PR4A 2V9KA 3KTQA 4P10A 1U48A 3T1HJ 3V4IB 4F67A 3ZZYA 5C42A 1U8WA 1ZBTA 3IS9A 3GJTB 2KKHA 1RA6A 2ZVIA 1Q78A 4U8YA 4ZVUB 2HNYB 2DRDA 1T9TA 4ZJOA 4QW9A 1RT5B 4KGVB 2J8SA 1WTBA 4Y00A 2GS8A 4URGA 4X4QA 5KFEA 3ETOA 3BYPA 2J9EA 2BJDA 3UR0A 2DPJA 1QSSA 3PW5A 3KLHB 2CZ4A 1HQUA 1YRUA 3D0IE 2OPSB 3GR1A 4PEOA 1H2VZ 4PWDB 4R5PB 4C11B 4I6YA 4CO3A 4M5DB
chains in the Genus database with same CATH topology
2MXYA 2HHWA 3BN4A 4KGMA 1GXLA 3NG8A 1H2TZ 4KQZA 1HBNA 2AQ4A 1NK9A 4MFBB 1WF0A 3SCKE 2IRYA 4XPCA 4OJHA 3IXQA 2OD4A 2WAQD 4Q43A 4FF1A 2CJQA 4N8OA 3IG1A 4QJVA 3CUNA 4PXBA 1D1UA 3OL6A 2JFDA 1RTDA 1RT1B 2IAJA 3MR2A 4KKOB 3WC2A 4DL6A 3CEDA 2DO4A 1SIWB 3K57A 1VFJA 2MZRA 1S97A 3OUYB 3MFHA 4MH8A 3MEEB 2VA3A 5A0YB 1RT7A 1S1XA 5LMUF 3V81A 2BE2B 3FZBA 4RKUC 3Q2TC 2RE1A 1VIOA 1HWLA 4DSJA 1B7FA 4AL6A 4IRCA 1UMJA 4CH1A 2W7AA 3O8WA 4F02A 2VFRA 2UXCF 4C0HA 2R2TA 3V6KA 3T1HF 2B5JA 2OPPB 5E3QA 4CIOA 2KHCA 4IQMA 1VQLS 5K8NA 3LOUA 5HBMA 4M94A 4FYDA 3B8HA 3X3UA 5A8WA 4R8UB 1P8GA 4OX6A 3DRXA 3DRPA 1FO1A 2LQ9A 4RW9B 1KVJA 1OPZA 1JLGB 1VC5A 2YKMA 4FVMA 3PJWA 3V6DA 2A2DA 1RT3A 3ITHA 3ONQA 2J7KA 4OHVA 3QJLA 2LYVA 3I0SB 1FJGF 1HQEB 3IR5B 3M32A 4O3QA 3QLHB 5IM0A 1VQ5S 2YX4A 1X4HA 3MM7A 3OJUA 2OFHX 2AV5A 2V9WA 1IJEB 1IKXB 4RW4B 5AXKA 2W9BB 1TV6B 1QJHA 1WG5A 2FHJA 3DMJA 3KK2A 2RF2B 4J9RA 2WSEC 3IFEA 1QTMA 1R7IA 3ENVA 5J2NB 3THTA 2GGPB 4YY3F 5KFCA 4BC7A 1C4CA 5IFMA 4EYHB 2IYIA 3N6MA 4ID5B 1KQFB 4JV5F 3SQGA 2DRBA 1JXEA 2RILA 1FXRA 1SH3A 2YNFA 1UETA 3NAIA 3JSMA 2YWEA 2CQ4A 4LSNA 2MKJA 1IBLF 3UCGA 2D3UA 3DLKA 1T94A 3SZ2A 1PILA 5B0GA 4F4WA 4Q8FA 2PIIA 3JTOA 3Q8SB 3DYAB 2EBGA 4NOHA 1I94F 4ECQA 2YKAA 4DR7F 3Q8QB 2F4VF 3E8OA 4UOCA 2J8AA 4ZPAA 1U2FA 2JOQA 5DS7A 2JFKA 4WTYA 1KQKA 5EGYA 1M5OC 4MKAA 3DI6B 3CDEA 4NRTA 1X4GA 5KFNA 2DH7A 3T9ZA 1FVSA 3OTCA 4EU0A 3K8WA 2HQ3A 1IKYB 2BABA 2JHEA 2D7SA 3M2UA 4ZVHA 1G6BA 2ZOGA 5DGAA 3KLFA 1JLCB 2MQOA 1E6VA 2D74B 4EWTA 3LP0A 4HL9A 3FMWA 3M8QB 5J2QB 1R0AA 5U47A 2E66A 2CQ2A 3M05A 2O3DA 1JLBB 2ZH8A 5H9EJ 2P9GA 1WG4A 3EUNA 3FEXB 5IT0A 4CCHA 4BS2A 3GFZA 3ISND 2MDAA 2F40A 1R8HA 3CJ2A 4ECXA 3MZIA 2RS2A 3LO3A 2FLLA 4NA3A 4DWIA 3DFEA 2ZE2B 3LF0A 1SUQA 1U2RA 1WI8A 3G86A 3OV7A 4UUWA 4B9LA 1ZOTA 1KTVA 2PSZA 2POKA 5C24B 4HI2A 1Y5LB 4Q0BB 3D1HA 3KFWX 3HP6A 4I0WA 2VOOA 2VODA 1OSDA 4RBVA 4FBUA 3GFXA 1SIZA 3E3XA 4B9TA 3MPWA 2XULA 3I5BA 3N9UC 3Q0AA 1IR0A 1CLFA 1WWHA 4Q2LA 3HXMA 1LWFB 3HPOA 1NK4A 4B3SF 5AXNA 2IAJB 4RUAA 4AL5A 2CJAA 2GCFA 4A46A 2ZZNA 4K4SA 4UY85 2FUG9 4Y2IA 3FDSA 2DNPA 1M90T 4PCQA 1YJUA 3OTDA 1YSJA 1RT2A 1KLMB 1SL2A 4FBTA 2N3LA 5GAEU 1FCAA 2HGLA 4ATNA 3MD3A 3MUTP 2HW3A 1NK5A 5L9XA 2RH3A 3NBPA 4TY9A 2DT9A 4DQSA 1JX4A 3KOAA 4Y34A 3S7RA 1SJRA 1DTQB 1X4CA 2IFXA 1Q8IA 2UV8G 4OX8A 2YH0A 2KVIA 3GE9A 4KE5A 4WYWA 1BQMB 1YRXA 2FIUA 3CCUS 1TK8A 4MIWA 5L8RC 2FLPA 3HZGA 4RU9A 1AFIA 1U26A 2ROPA 2AJ0A 2AX0A 2XO7A 1O5JA 3PKYA 3M6XA 3T5KA 2RDJA 2E44A 4IUFA 2YKMB 2UVVA 4BCAA 3I9V9 4H4MA 4ED2A 2I5JA 3QIPB 2C2RA 2LXIA 4TN2A 2W4PA 4LSLB 5J1EB 1AW0A 2AD9A 2YKQA 4K59A 2XSFA 4XDDA 1T05B 1S0OA 2LKZA 3GV7B 3MM8A 3RW6A 1YQHA 2MJNA 4P6QA 2DNQA 1NK7A 5KT6A 2DISA 3D1OA 1XK8A 2A18A 2E7WA 4QWDA 1MWZA 3DLEB 3OBIA 3TARA 4YUDA 3O3LA 1L3UA 1D3WA 4HDGA 4EUVA 2W4DA 3I0RA 2DJWA 2DGSA 2GO8A 3M2VB 2MQPA 1S72S 1TKTA 3HM9A 3D54A 3C3LA 5KFDA 2VKZG 3PFOA 2CPHA 3BGRA 3M2RA 3PEHA 1NEEA 1UL3A 2OSQA 3UCUP 1YITS 2MQLA 3FZ2A 2L9WA 5A8RB 2QMXA 4W92B 5DETA 2ILZA 4TQSA 3NS5A 2HNZA 3LAMA 4YB5A 5E3PA 5LJ3Y 2K1RA 3KK1A 4A8SA 4OJGA 2KYXA 2BYCA 4IR1A 4DL5A 2HMIB 3OTEA 3QPIA 5KFUA 2EFVA 2JEGA 1DURA 3KLIA 1KHVA 2G13A 2DIVA 2HS3A 2PD1A 4I64A 3NCPA 3DRRB 5E0OA 4DV2F 3PW2A 4C3LA 2DR5A 4OHYA 2R2UA 4WFNQ 4G1QB 4DS4A 4C8ZA 1M1KT 1X4EA 1NJWA 4XDCA 4A4JA 1DZ5A 1R27B 2D1CA 1FA0A 3KLGA 2UUWA 1U09A 2M70A 1CVJA 4IYQA 3NMAA 2CQBA 2KFYA 3KMQA 2XCPA 5K8OA 2HWIA 3I4PA 4PKDB 4NYZA 4I68A 1VQKS 3EPIA 4BDPA 2L9NA 4TXSA 3D0HE 2L41A 3HHNB 1TP7A 2P6TA 4H4KA 2VL1A 3DC2A 4YDDB 2AX1A 5EDWA 3KHGA 1S9EB 3I5AA 4X2BA 2V94A 4J9OA 3IWNC 1SUQB 1U1OA 1UWBB 3HHLD 4ED3A 4YDXA 5KFSA 3CJKA 1R8CA 4ILRA 2OTJS 3CMAS 2Q6BA 1UVKA 2M9KA 3IWXA 4RW6A 2R7VA 2BQUA 3ZZOA 2EFPA 3DDKA 4H4KC 4WFYA 1Q81T 3ZZRA 3HKWA 4MTPA 1K9MT 3DM2A 1NK0A 1H6KX 3TW0A 2CQ1A 2IHR1 4DOZA 5I4MA 4LT6A 2E1MC 5KFIA 5LMNF 4OIXA 4C2MA 1TVRB 3LALA 5KT5A 3MUVP 3TNVA 3PW0A 4RUCA 1JLAB 1ZM3A 3SYZA 3H5XA 3JB9k 4R0EA 5JVGQ 2PDAA 5FIIA 5J2MB 1VQ7S 1L3KA 3LANA 1DHMA 4LQ3A 1P1LA 2W7OA 2VG7A 5GADU 1XMOF 1R3NA 3CCSS 2QA2A 1S0NA 1NKCA 2J9DE 5LJ5Y 1FKPA 4ZCKA 4RNMA 1ROFA 1D0EA 3H59A 2ASYA 3C6UA 2F1FA 4TNOA 4TLRA 1WHVA 3MECA 3G4SS 3CCLS 1J5EF 2I5JB 1K1SA 2C3YA 2M8HA 2O01C 2P9EA 1KSPA 4U6PA 4P7VA 1ZH5A 2EFNA 2AYBA 4O23A 4OI4A 1GQEA 4PR6A 2IJFA 3PIPQ 4WKYA 3PV8A 3X1LB 1WELA 3T6JA 3NNCA 3OXGA 2VOPA 3L7PA 3HHDA 1YJVA 1ZM4A 4KC5A 1HW9A 4UUXA 3M4XA 1JKHB 5B0CA 4N56A 4FF3A 2XMVA 4NWBA 2ZKUA 3I55S 5DQIA 4DV1F 3I0RB 1UVJA 3MM6A 2RQKA 3BGRB 3CT9A 1D9DA 1DARA 3KKFA 3V2UC 1WI6A 4DL7A 2VONA 1SKSA 2HNDA 4WFZA 2XBPA 1XERA 3OLBA 2H9ZA 2IC3A 4DLGA 3BN7A 3CXCR 1PC5A 2B56A 2HNZB 2KHDA 2YNHA 4DN0A 4WFBQ 4QIEA 4A8WA 2K1RB 2DD8S 4C8KA 2QLWA 4X4VA 5KFFA 2CJ9A 4KRWA 5J1NA 2XMJA 2CPDA 1L3TA 4B3TF 1C0TB 1N4LA 3M1VB 2DNKA 2HLUA 4J9NA 4I4BA 4LIWA 3JTPA 2RNEA 4FVCA 1JLQB 3RRKA 3FRZA 2AJQA 3E01B 4DSLA 1TFWA 3NCRA 3T5JA 5KFLA 1UP1A 2V4RA 3I6PA 4PQAA 2P9CA 4NLQA 2C28A 3GB0A 3V4IA 4CO1A 1R8PA 1T02A 2DB1A 1JNZB 1OO0B 4IG0A 3GIIA 2Q79A 1N5YA 5DLGA 4DUYF 1Y4ZB 1Q79A 2GV1A 4X4UA 4WXWA 2EK1A 2XMWA 1HNZF 3SFGA 2RKIB 3CDUA 5JVHQ 5DLFA 1F5BA 3OR1A 4OLOA 2HRUA 5HP1A 1S6PA 1C0UB 5K14B 4DSIA 1UVLA 3UDCA 2FC9A 3PRDA 4FXDA 1AXQA 1LQ9A 5DQHA 3KNGA 1X5SA 2ZOFA 2W7PA 2VPXB 4HT5A 2HNYA 2GJIA 3B82A 2ASDA 2JVOA 3GMGA 4ECTA 3GFHA 4DJBA 1HHSA 3O6QA 3MWBA 4XPEA 1WG1A 4BBYA 2NSBA 1X0FA 2XWXA 5DM7Q 3OHBA 3I31A 4MYTA 4F4ZA 1T8EA 4C7QA 1WEXA 4WCEQ 1R89A 4YB7A 1FRJA 2VPWB 5FLXY 4AUKA 1VQNS 1OQ3A 1Y3KA 1HWUA 2I38A 1RJJA 2C42A 2MQNA 2IVMA 3A8EA 4WK1A 2FJDB 5K5MA 1KD1T 2KO1A 4RBUA 2R8IA 3TUZC 4IFYB 2ZHAA 2V0NA 3C66A 3CDWA 3DLLQ 5HMZA 3PDNA 2KTQA 2Q1LA 4C4WA 4NA1A 4ELTA 2HVZA 5KG3A 2E7XA 3KLHA 1JMTA 1VRTB 3MMCA 5AE1A 2CIMA 1VS3A 2MQQA 4JI0F 1FRXA 3DLHA 5F9LA 4ZDNA 3C6UB 3N0VA 4LFCF 2AYEA 3PZPA 3BZQA 4MYUA 4DL2A 5CQGA 3CCES 2CVIA 4PQUA 2FD2A 2OPSA 1NO8A 4ITSA 4C8MA 4E98A 1DQ8A 5D4NA 2OPRB 2XZWA 5A6PA 1X7VA 3O5TB 4YQWA 4PWDA 1HNIA 1LK5A 2SXLA 3UDLA 5J1PA 4R5PA 4C11A 3CCJS 2UVRA 1IQTA 1HMVA 2GNKA 1GAOA 2F7VA 2NUHA 4OI6A 3BO2A 3N28A 3D5MA 4M5DA 3UW1A 5F9NA 5KFPA 4X4TA 3D28A 2V8DA 4MFBA 4YR0A 4LF4F 2EBEA 2FY1A 2XSJB 1LXJA 3ZC4A 1LOUA 3MM6B 2XLKA 3VR1A 3L7OA 4DDFA 4LF5F 1D8YA 4ZHRA 3FSYA 3QAUA 4PG5A 5I42A 2J6SA 2ABYA 2DCUB 3DOKB 1RT1A 1NHUA 4KKOA 4TYAA 3QGPA 1X5TA 1U1KA 3M6WA 2D41A 3UE2A 2RU3A 1RTHB 3MEEA 2AP6A 5A0YA 2N3OA 1FK9B 2CVEA 4WFAQ 1U7LA 3G6XA 2BE2A 2YKOA 2ZVSA 2MZQA 3BSAA 3UNGC 4IRDA 1QY7A 4PWUA 2LQJA 2E1RA 2OD6A 4HHJA 4D3HA 1K0VA 1N5QA 4I56A 5EX3A 3ZZPA 1HPZB 2HPUA 5DO2A 4R8UA 3FQLA 4W90B 5KFTA 4GC6A 4RW9A 1HYSA 3T1YF 3I9ZA 3IAM9 5L39A 4I6AA 3M8SA 1GXUA 4DN9A 2NYIA 2RQCA 2KT2A 1TKXB 2FTRA 3I0SA 4KHMA 4HYKA 1HQEA 2BUNA 2C22A 1S76D 4I67A 4KJIA 3QLHA 2ZKTA 2HS4A 2RVJA 4KB7A 2EC0A 2M8DB 4NLOA 3DN9A 4RW4A 3DRSB 3OQ2A 2W9BA 1TV6A 2GMHA 3HJFA 5K9FA 4YP3A 1UEUA 3OR1B 1S6OA 2RF2A 4QR2A 1S6PB 3CCVS 3KK3B 3CPWR 1IKWB 3RR7A 2B9XA 3U27A 3J7YI 2GGPA 3VAKA 3DLBA 2KM8B 1XMQF 5KG1A 2FJEB 3TOQA 4HLBA 4ID5A 2HVHA 4F2RA 3CCWA 4ZP7A 4G1PA 2IBOA 2Q66A 1MROB 3HVWA 3IR7B 1N33F 2YWHA 3MOZA 1CSJA 4NLTA 2MHEA 2HVIA 3HKZD 3GIMA 2KN4A 2YNIB 1TZ0A 1XEZA 3H98A 5CYQB 1L3VA 2E5HA 4IR9A 1TR0A 1UA1A 3DYAA 5KG7A 2QA4S 3H25A 1DBDA 3RRHA 1CG2A 2BXJA 3AJ2A 1QSLA 3NKYA 3V6HA 2E9ZA 2ZD1B 3BGLA 1X5PA 2LLZA 3DOLA 3DI6A 5EHHA 2CQ0A 3EZ5A 3I56S 5KG4A 3UQSA 2ZH5A 1M5VC 1X4DA 3MHYA 4ELVA 1U6BA 5HQ8A 3MMCB 2BANB 1IKYA 2FHOB 1HBOB 2WB1D 1UKUA 3O44A 2HFZA 3TR5A 1JLCA 1FXLA 1TUVA 3M8PB 1MSWD 1N52B 1TL3B 3HVAA 3OTOF 3T19A 5J2QA 4KPYA 4JI4F 3ZZ0A 4PXDA 2OAUA 3NMRA 3BDEA 3G6ES 4L72B 4O0IA 3K5MA 4DQQA 4LFBF 1XMBA 3LAKA 1Q86T 3BM7A 3IGVA 3VAHA 2XHWA 1NJIT 2X3GA 4J37A 2EG2A 5HLFB 1FE0A 3QIDA 5AJ3F 1UVNA 3NNHA 4NLVA 1XR6A 7FD1A 5DDPC 3ENQA 3VAIA 1UAWA 5C24A 1NHVA 1P1TA 3OLAA 5ITHA 4DR5F 1QVFR 4PG4A 2JH3A 2FDNA 5BYQA 1N6QB 1NU4A 2R8GA 1VHFA 2J0XA 5M2PA 2DGUA 4XO0A 4ZHRB 3D0GE 3RYLA 1LWFA 3GZ7A 5I42B 1HR0F 1HI1A 2ZOMA 3V6JA 1NZAA 2MB0B