4L6V3

Crystal structure of a virus like photosystem i from the cyanobacterium synechocystis pcc 6803
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
80
structure length
80
Chain Sequence
b'SHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAAQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
molecule tags Electron transport
source organism Synechocystis sp. pcc 6803
publication title Crystal structures of virus-like photosystem I complexes from the mesophilic cyanobacterium Synechocystis PCC 6803.
pubmed doi rcsb
total genus 13
structure length 80
sequence length 80
chains with identical sequence C, c
ec nomenclature ec 1.97.1.12: Photosystem I.
pdb deposition date 2013-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF12838 Fer4_7 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4l6v300
1G6BA 5E7OB 1FRKA 3PNIA 2WB1D 2VKRA 1K0TA 5BYRA 1GTEA 1FRXA 3MM7B 1BC6A 1AXQA 1D3WA 1BQXA 3EGWB 2XSJB 2C3MA 1FEHA 1BD6A 2FDNA 1R27B 3GYXB 5CH7B 2PDAA 1WTFA 2V4JA 1B0VA 3EUNA 1GT8A 3MM9A 1DAXA 3MMAA 1KEKA 4OMFG 2FGOA 1H7XA 2Y0SD 1FCAA 2C3OA 3IR5B 2GMJA 4CI0B 5L8RC 7FDRA 3MM8A 2PMZD 2V4JB 1FRMA 2XSJA 1PC5A 3IR6B 5FD1A 1SJ1A 2GMHA 2UZAA 1FDDA 1RGVA 1G3OA 3MM6B 4XDDA 3MMCA 2VPWB 1FRJA 5BYQA 3MMAB 4DHVA 3OR1A 3MM9B 2FJEB 6FD1A 2IVFB 1ROFA 1IQZA 1Y5LB 1F2GA 1H7WA 2VPXB 1BLUA 2ZVSA 4RKUC 1H0HB 2FJAB 3MM5A 4YDDB 1Y4ZB 1F5BA 1IR0A 1Y5IB 1FDNA 3LW5C 4AYBD 3MMBA 2C3UA 1B0PA 1XERA 1FD2A 3HKZD 3OR1B 2WSEC 2FJDB 4KT0C 3IR7B 1C4AA 1DFDA 1F5CA 1FTCA 6FDRA 4L6V3 2WAQD 3MM5B 2WSCC 1VJWA 1A6LA 1FXRA 1H98A 1FXDA 4XDCA 1B0TA 1JNRB 3MM8B 7FD1A 2C42A 4ID8A 1PC4A 1FRLA 1FERA 1SIWB 2Z8QA 1FDAA 1FRIA 4XK8C 1C4CA 3C8YA 1JB0C 1HFEL 2C3YA 1GAOA 1GTHA 1BWEA 1JNZB 1SIZA 1FRHA 5CHCB 2VPZB 1KQFB 2C3PA 3EXYA 1Q16B 2VPYB 2WSFC 2V2KA 2FD2A 2O01C 4OV1A 1FDBA 2PA8D 1KQGB 3MMBB 2FJBB 3OR2A 1CLFA 3MM7A 4Y28C 5BYSA 3MMCB 1DURA 3MM6A 1FF2A 3OR2B 1Y5NB
chains in the Genus database with same CATH superfamily
1X9WA 4BWMA 2WVFA 1IVZA 3PNIA 5HMYA 3CPWR 2K1RB 4ATNA 2FVSA 5EWFA 4C97A 3CD0A 1Q8KA 4NZ7A 2MLYA 3W63A 4QCLA 3J81j 5CABA 2G4BA 1Q1KA 3DLHA 2DGVA 4NYPA 3ILIA 3HMJG 2XMAA 2CAJA 2N82B 5J1EB 2JNJA 4F50A 1HQUA 4ZN3A 1VQ7S 2KKHA 1XR6A 2U1AA 1LWCB 1R27B 1S6PA 2JFKA 2PN6A 3HZGA 3MUTP 4DUZF 4WIQA 1FKOB 2EVZA 4O3NA 3KLFB 1GT8A 1LWXA 3M2RB 5EGYA 5IS2A 4J9QA 3MR5A 2J6SA 2AW0A 2QSWA 5D6GA 4C8OA 2F8EX 1ZS6A 4IFVB 4ZP9A 4NX9A 5DZ6A 1IN0A 5EDWA 1EAYC 4OHWA 5KOXA 5LSOA 3C6UB 3TVKA 3KHHA 2PE8A 3BH7B 3CDBA 2VG7B 5CYMB 2C3OA 2LYVA 4UOFA 3TA0A 2J7KA 3CE8A 1RWUA 2RRAA 4KQZA 4CQ1A 2HHHF 2QFIA 2Z2LA 2QO3A 4KGMA 2OO4A 3CDEA 4I4BA 5ETPA 3ZZPA 3MFIA 1G3OA 1OQ3A 1VC6A 4DXLA 2EPIA 1S0VA 3LGMA 2HIQA 4YUDA 3PW2A 4DL6A 3MXHP 3N6NA 2LDYA 4HT7A 1CJTA 2J6TA 2VODA 2NQPA 1UFLA 1H7WA 2E5HA 4ZK7M 1F2GA 4JI1J 1T7PA 1H0HB 2DO4A 2EG1A 3GIRA 5LMUJ 1R0CB 5GMEA 2NSCA 2DNQA 2Q3PA 2RQKA 2YNFA 4U95A 2KH9A 1RU2A 3K5NA 2POKA 4NCGA 4QPTA 2E5GA 1CJKB 1FDNA 1WF0A 3OVBA 2D69A 4LVNP 1IJFB 1U1PA 2KL8A 1AFJA 2VASA 3A3NB 4M8LA 4LUBA 2L08A 1T05B 2BKPA 2K7JA 2V67A 1V9OA 2BVZA 2M0GB 2VONA 2DH7A 3RBXA 3UD5A 4EFAC 1H38A 2YNHB 1TMJA 1H98A 3HVTA 4OHXA 4Q7AA 4WTYA 4XDCA 4F26A 1U1KA 5KFQA 4YOEA 3A13A 5BR8F 2LEAA 1BE4A 5JJBA 1DTTB 4J9NA 1SI9A 4ERDA 1RT7B 2G13A 3NAHA 3SMZA 2OFGX 1XJWB 2F63A 5LM7E 3JYTA 2QV6A 4LF8F 3TI0A 3MR7A 4RO0A 1RT3A 3S01A 5KFTA 1CQNA 1S7HA 1YGYA 3BBCA 3JQJA 1C0UA 2KRRA 1ZM2A 3R5BA 4FKXA 3E3XA 3FGVA 1WF1A 3FFIA 3L4BC 2D74B 3DRRA 3DDIA 3KG4A 2XS2A 4BS2A 1O5JA 1SC1B 2HVEA 3GB0A 3NMAA 4OZNA 1UEKA 4M5GA 3CCLS 4ID5A 4EK2A 2OEKA 3HVRA 4DPXA 5K9FA 2XS7A 4QR0A 4EBDA 2C1EB 1Q5YA 1NK8A 4N47A 1Q16B 2KFYA 5AE1A 1HD1A 1XWLA 2EC2A 4XPCA 3FSYA 2VC0A 1EB0A 3PR4A 3PYDA 1YVFA 2I2YA 1VQLS 3I32A 2EK6A 4M5DA 2UVVA 4O4GA 2CYYA 1RAAB 2CPJA 3AJDA 2C2DA 2FTRA 3HFVA 3KDNA 3MM7A 4ZP6A 3TA1A 1VDHA 1SJFA 1VGYA 5EWEA 4OL8A 3CDUA 4LF6F 4QIEA 3HK2A 2CWXA 3KLGA 4LSZB 1SL1A 4JI4J 2FPHX 4LFBJ 5J1PA 4NRUA 1WHVA 4YY3F 1UPPA 1HHTP 1N4LA 1ZPVA 2BE2A 1J27A 2VKRA 4DCPB 3CC4S 1RWMB 3IRWP 2VF3A 2HFNA 2QL5B 2LQBA 3KUEA 1IUJA 4M5KA 2QT7A 4UW2A 2XEXA 3T19A 3RB4A 3PHEA 1NSPA 4IUFA 3A3OB 1ZH5A 4OHZA 1RTDB 5L1JA 3HHLC 5ETNA 2IMWP 4OZ5A 2IY5B 3M6WA 2IAJA 3GFYA 1H74A 1FJGF 4DCOB 2BJEA 3TRGA 1X4DA 3KG0A 5C42B 1TL4A 3MM9A 2BM1A 3JXOA 2AJ4A 4U6PA 3CD5A 5HROA 3D4JA 3Q89A 1TTHB 2HBRB 2NZCA 3LOUA 5HBMA 1AROP 3Q2SC 2F65A 1NXIA 2KRBA 1S49A 1KLMA 1FT8A 1N5YA 4AL5A 1D8ZA 3CCWA 1YJWS 4IR9A 1RE1B 1TVRB 1WC0A 2DO0A 2I38A 1JMTA 2MZSA 3DYAA 7FDRA 2CPHA 4BDPA 5CZVA 3ZTOA 4EGLA 3B8HA 2XSFA 3C15B 2RRNA 4DV6J 1V3SA 2CRLA 1IKWA 4QYRA 1LWEA 1RAGB 3M30A 4USHA 4O3RA 1Z2LA 4H4MB 3T9NA 1U0SA 1UTAA 1QE1A 1UETA 2G9OA 1FESA 2DNNA 1GMUA 1R7IA 1HBUA 5LJ3Y 2I6WA 2VZ9A 3MM9B 4QWEA 3E01B 2YKPA 2ZJPQ 3D67A 1EX8A 3GSIA 2VKZG 2NUUG 4YB7A 2GO9A 4CDIA 5HMWA 1IBMF 3QT7A 4ZJQA 3UR0A 4BC7A 3PEJA 1S6OA 3EMTA 5IFMA 2R8JA 1F5BA 5BXIA 1IR0A 1SV5A 1X0FA 1WKLA 2DGXA 3CD6S 3K0JA 3UDLA 4WFXA 3W65A 3H42A 1SUQB 2MTLA 1CG2A 4PAAA 2DISA 1NH8A 5E5NA 1OY9A 1U24A 3WC0A 4ZMMA 2HS3A 2F4FA 1UJ6A 3OR1B 3OV7A 2NXCA 4TY9A 2RS8A 4ZPWR 4ZVUB 3C6TA 3NEKA 4G6VB 1OPIA 1TUVA 3GLJA 2ILZA 5LT5A 3QZ7A 5K8NA 4CLZA 1N6QA 2EC0A 3E2EA 1WG1A 2IM2A 3G82A 4FN5A 4JI0J 3LA0A 1VQNS 1Q0NA 3BGOP 2E66A 3VALA 2E29A 5L1LA 2HVIA 3QFWA 5I42A 2ADBA 1IKYB 2J9CA 3O5TB 2V9WA 2OPRA 4KIAA 1Q5VA 5B08A 1S0OA 3NNCA 3AFGA 4RWXA 4RWWA 2L3MA 3CIMA 2QTWA 2ZD1B 3I5BA 3NGDA 1GXUA 2DYAA 3M8QB 5EUHA 5FLXU 3V81B 2X1FA 3CJ3A 2KTQA 2NS1B 5JMNA 5F41A 2KM8B 4NMLA 2E7VA 3MOJB 5HMXA 4I6WA 4PQUA 1KDNA 4CO5A 2HHVA 5KG7A 2RB7A 1IKXB 3SQOP 3T1YJ 2B7CB 3V5RA 1EQMA 5DS7A 2E5JA 2UV8A 2ZH8A 4FPIA 1NLKL 1RCXB 2BABA 5H1SV 4KGKA 2PO4A 3KTQA 4F2SA 1U2FA 5U47A 4FBTA 1RAOA 2C2ZB 2GVDB 2KT5A 4WP9A 4UZBA 2ACMA 4OV1A 2HNYB 4OIXA 1FDBA 3OTCA 4ECZA 2V69A 4A8YA 4TN2A 4Y2CA 3OFHA 3TUZC 5HAOA 3BEGB 3JSMA 3K59A 2FVCA 4WU2A 3H40A 2CZ9A 2DGOA 1NNDA 2DT9A 3FBEA 2HK3A 2EFVA 2A3JA 3FC9A 3C2PA 3MEDA 3P4UB 5B0DA 2VOOA 3ENAA 2PEHA 4LRAA 3M9MB 1JLBA 2KG1A 3MEEB 4HH0A 2N3OA 4ZIWA 1KC8T 3KHRA 3H2UB 3H25A 3HJFA 4ZITA 5DLFA 4KC5A 2CQIA 4PYDA 4TY8A 3MR2A 3H4BA 1KOOA 2DR8A 2ZE2B 4IH6A 3ZZUA 2M88A 2V68A 4WIIA 4OJ1A 4QWBA 3FZ2A 1GXTA 5KT7A 3WX8A 1WI6A 1ZM4A 3AB4B 2V63A 3H2LA 4ZPVR 2DR9A 2UVRA 2XSJB 2ZVIA 1SC6A 3IS9A 2C3MA 1NRKA 3D3BJ 3TZWA 5C24B 2GV1A 2A6OA 4C0OC 4OHYA 2QMUB 4A8QA 2UXBJ 1WTFA 3DRXA 1RU1A 4Y34A 2UV8G 3MECB 2AP6A 3HSJA 3W9IA 2HHXA 1DAXA 4X4SA 4CP5A 3UCZP 4N41A 1M0SA 2ZH4A 5E2QA 3GP9A 3JTNA 5KT5A 1FTRA 5H9EK 3CDWA 2CZ4A 2Y0SD 1HR0J 1FCAA 5KAKA 5GAEU 1XC9A 1K0VA 2NUHA 2WHOA 1EARA 1DARA 4ED6A 3CF5Q 4I0WA 2DR7A 1S9GB 1LW0A 1QM9A 5H9FJ 4L76A 3IXQA 1TK5A 4A46A 4AL7A 2Y9HA 3IWXA 4B3TF 1SKRA 2AWZA 1F9FA 2XWYA 1JXLA 1FI4A 1CJVA 5BYQA 2LEBA 3GU0A 4RW9A 1Q53A 2HRYA 4NLDA 1XMQJ 3MCNA 2OPSA 3ZFVA 4Y2KA 1JK9B 4RKUC 3OHAA 2AEMA 1PJ5A 4PG7A 3EE3A 4YDDB 3RRGA 3OSPA 2QLJB 1X60A 1PJ7A 2N4CA 4UY8T 1CPZA 2DJWA 3BGLA 3T9ZA 1ICEB 4F0HA 3BGUA 1APSA 2VB6A 2YWFA 5C2GA 4YR3A 3JSBA 4CO1A 2ZHBA 4GC7A 4DI6A 2OUGA 3DLKA 3P5TL 1FA0A 3RW6A 4DV2J 1VHFA 1YJVA 2ILYA 4K4TA 4HTIA 4NLGA 3CXCR 2MLZA 4J5OA 1UVKA 2HVDA 4UQTA 1FTCA 3SV4A 3EM1A 4L6V3 4TQRA 2FVRA 4B3SJ 3B54A 4P71A 3ZZZA 2HW3A 1YK9A 1KSPA 2BKOA 4HH1A 5CD4A 1UVLA 4ICLA 4YFUA 1CJUB 7FD1A 1FO1A 3CJQA 4ID8A 5A8WB 2AJQA 4K2JA 2MKCA 4ECTA 3VGSA 3GQCA 1SIWB 3OBIA 2R8IA 4HACB 4NCAA 4F8RA 3GFXA 2UUCJ 1RB0A 3L7UA 1LWEB 5E3AA 1E6YA 3R7BB 4C2MA 3JS9A 1GK8A 1KP6A 1S1WB 1LWFA 1P9YA 2QZ8A 4J9PA 1IXKA 3UQSA 1PYSB 3OSNA 4NYOA 3TX0A 3IC1A 3R1LA 2OH2A 4OX9J 2LDIA 3L7OA 4DUYJ 1RWVB 2R4FA 2RS2A 2XULA 1KLMB 1XIQA 1UFWA 3F56A 3PACA 2R2SA 1EJ7L 2BV3A 1TELA 3AJ1A 3D6FB 3EGNA 2IVMA 3FK4A 3CWJA 3NOGA 3OT9A 4UOCA 3R8YA 3WHIA 2MHNA 4CLFA 5LMNF 1NUEA 2A2CA 2FYXA 4OX7A 2MZJA 1KVKA 3Q22A 1R3NA 1D1UA 2LEPA 5HN0A 2CPYA 4ZLJA 1U25A 3TJ9A 2W4DA 4JI5J 1TKXA 1N48A 3DRPB 3BSCA 2HWHA 2KFZA 1JLFB 1SH2A 2FHOB 2QC3A 2CQCA 2JOQA 2L9DA 2HURA 3DKDA 2CNKB 5KTQA 4KPCA 2M7SA 3QIPA 2LXFA 4DOZA 2B8PA 4A8SA 4EEYA 1TAUA 4OX9F 3CTRA 1AW0A 3ULHA 3EDQB 2EKYA 1TAQA 2J0WA 2FB0A 3GYNA 4IOBA 4RBTA 5LSRA 2FLNA 4CTAB 2WB1D 4RLEA 2UUBJ 4PYAA 3IAM9 1Y3JA 5KFBA 3CC2S 2LCWA 3BKFA 1WKKA 4DZ6A 4E8UA 3BM7A 3FCWA 3I5CA 3BQ2A 1MU2B 2OELA 5HQLA 2UXBF 1LW0B 2WW8A 3NS5A 5KFEA 2ZUGA 3GILA 2ZM6J 1FJ7A 1GMWA 2QLFB 2VQEF 3PFEA 4OYIA 2NXUA 3I56S 4JI6J 1RWOB 3QO9B 4LT6A 2YBVA 2ZNYA 3KJFB 4M5MA 2O5DA 5AXMA 3CCTA 4DSIA 4DR4F 1KEKA 4OMFG 4XIUA 4ZHRA 2YPYA 3W2VA 4QPXA 1S1XA 1VHIA 3CJTA 3GFZA 2HGLA 4IG3A 1F2HA 2YQ0A 4DX8H 1IKVA 2HFSA 4RU2A 2IYIA 4GRSA 1SH0A 2HS0A 1B70B 1U0HB 2V4JB 1YG0A 2FUG9 4CNYA 2FZCB 1S1VB 3TZXA 1ZETA 4WE1A 2V8GA 1L3TA 2E1MC 1TMMA 4JI3F 1RT4A 4B3RF 4WFZA 3K8WA 4N56A 1EIYB 1NJXA 3FKBA 4RUAA 4AQYJ 5ETLA 4H54A 3HPOA 1Z1ZA 3QSIA 2YKMB 1YIJS 4F4YA 3CMAS 5KG0A 2U2FA 1IR2A 3M1VA 1Y5LB 4IYQA 2ZH9A 1U1LA 1TV6A 1A7GE 1UJ5A 5F8JA 4ZS6A 2HQIA 2R8HA 2ZOGA 5B09A 2M9KA 1TU0B 2AX1A 3FRYA 2UXDF 4KYZA 4IOCQ 3DRSA 2CADA 2EI5A 3UDCA 4ZN1A 2ZITA 5SUHA 3ZTQA 5T41A 4DV2F 1XMOJ 2DEJA 4LJMA 4PG5A 1RKJA 2ZZNA 1REGX 4A8OA 2CPXA 3HO1A 3G8QA 4WFYA 5C25A 3CJKA 5HQMA 5KG5A 5AXNA 1HI8A 2RH3A 2ZFHA 2IBOA 1X9MA 2XMWA 1HNVA 1RBLA 2R9LA 4DSLA 4DSFA 1A6LA 2XZTB 3EDRB 2W1BA 1D9FA 2ACYA 1M5HA 1U0HA 4YQWA 2W7OA 1U1RA 2NSBA 2GC8A 1R8CA 3PM9A 5B0BA 3G8SA 3J80U 4HYKA 1FK9A 2ZOMA 3PYFA 1B7YB 2CQHA 3W60A 1RAHB 1NBEB 1U49A 1IJEB 1LK7A 1PBUA 2BACA 2DGQA 5DM7Q 2UUCF 4BWJA 3Q8QB 4CLPA 4NLPA 3BF4A 3KUHA 4ZP8A 3GJRB 1JB0C 1RT6A 1AZSA 4G3IA 2LLZA 4NXNF 2XG8A 4CRJA 4J9VA 4A8KA 2R7TA 1NSQA 3POTB 3DFEA 4FNHA 4F0KA 2KI2A 1TL1B 4OYZA 1X7VA 4O44A 4JI6F 3R2CJ 4DUTA 3PJWA 2NYIA 1IWGA 5THWA 4U7UK 1RWKB 1UEVA 4O3QA 3TOQA 5HROB 1DJ0A 1N5QA 2OTJS 2C2MB 1N0UA 1H3DA 3KLIA 4A8WA 4DQIA 2PI4A 2R7VA 1G4CA 2GIRA 2V8DA 3IG1B 2RD5C 3J7Z5 1WC1A 1VQ5S 3TAMA 4MIAA 4FZVA 4OJ3A 9RUBA 3C14A 5KFOA 5EX3A 1VCTA 2FJVA 1WOSA 4Y28C 1DQ9A 2LU1A 1CJVB 4DDFA 4ZIVA 4EBEA 4ZVSB 3W9HA 3MD1A 4O3PA 8AT1B 4OZLA 4UOHA 1GMWD 1RUSA 5HLFB 2CQ4A 4UF4A 1N32J 1VI7A 3KOAA 2PC6A 3Q83A 4O0NA 1Y11A 2K2PA 1NMEB 3OVSA 4F7VA 3BV8A 1N34J 3MTKA 4OI4A 1SQGA 3H98A 2ZNZA 2FVPA 4DX5A 3VVTA 4P72A 1PYOB 3CNQP 3C15A 4RUBA 2E5LJ 2G2YA 2J9EA 2DHXA 3LWMA 4LFCJ 3JSYA 1P6TA 1LWFB 3CCRS 2FQQB 2NCKL 3LANA 3CMES 2ZC4A 4CLLA 5CCMA 1WWHA 1XK8A 3AD9C 5CA5A 2IDLA 2ZKTA 1NPKA 1UJ4A 2V4RA 3LH2S 1U48A 4LF4F 3PKMA 4ID5B 4ED2A 1FJCA 1HBOB 2XMVA 1RP5A 4I2PB 4FF2A 2XC9A 1U1MA 1TKTA 1T9UA 2XMUA 4GVBA 4BCAA 2G1HA 4QR1A 4CM0A 1FJEB 2GMJA 1U09A 2CPEA 4QW9A 3BSNA 4NA2A 2HNZB 4X4NA 1U1OA 4IRKA 2F7VA 3N5FA 2Y1RI 4DV3J 3CDAA 1QVFR 2HQFA 2GMHA 2UZAA 1UVNA 2ZH3A 1NDCA 2VJVA 2X3DA 1JLCB 4KO0A 4OZ3A 1FHTA 2ROGA 2YQ1A 4ES1A 4A4JA 3KJNB 2F8HA 2J0XA 1RAIB 1YJUA 2FY8A 3PCOB 4HL9A 4RX6A 1VQ4S 3QRQA 4CT8A 3UD4P 5IM0B 1RADB 2WB4A 2CQDA 4C8MA 1G2EA 5IWAF 2W9CA 4X4TA 4L75A 1NHKL 4M5IA 4X4QA 1L3UA 4F67A 4TKTA 3QIDA 2LQ8A 1HIYA 4X62J 2OTLS 2OPPB 1WNEA 3TUPA 2HNDB 4LQ3A 2HMIB 1RSCA 1FNOA 2HWTA 3AAWB 1WOOA 1WEYA 1CJKA 5CAAA 2DY9A 1PGZA 2ATCB 2LA6A 3D5MA 3L09A 1H6KX 1ZAXA 1TKXB 2YX4A 3E8OA 3M8QA 2HHPA 3L9ZA 2WAQD 1S97A 1W7WA 1VQKS 3T1YF 3HXMA 4ZJOA 1N54B 2CJYB 2X1BA 2PIIA 3HD1A 4G1QB 3LP0A 3Q23A 1R31A 4M94A 3A8IA 3KMQA 4J9LA 1ZBTA 4I69A 1RT3B 3SXLA 3US5A 4LRDA 2C2NA 1Q8LA 5KT2A 4KO0B 1EETB 2DNOA 2VIHA 2RVJA 1IKWB 3OL8A 4DFJA 4TQSA 5A8KB 2ASLA 2CQ1A 1RHUB 3TJAA 3U1NA 5F8GA 1RAJA 1RT1B 2BJ8A 2QA2A 2FHJD 3T5JA 4ZVQB 2JWNA 5D3GB 3CJ0A 3HDSA 1BWEA 4Y2MA 5EWGA 4LIRA 2DNKA 1X0PA 2CQ2A 4P74A 2R7SA 1FRHA 1H2VZ 3ELHA 1U7LA 4K2XA 2BE9B 1SV5B 1S59A 3G2XA 2GZOA 3CVKA 4KH1B 2L9WA 3NNAA 3DLEA 2BQUA 2V2KA 4RW8B 3QRPA 1NJWA 5J2QB 1M1HA 3HHKA 4K7QA 2MJUA 2HAIA 2F40A 4KY3A 4Q44A 2DK2A 4JI0F 1JLEB 3T5KA 1T03B 4QU7A 3MMCB 2RQ4A 4H4OB 4NEZA 4Y00A 1ELOA 1QLNA 4IFYB 3TVYA 2FZGB 4DR1J 2DH9A 2VDHA 3B82A 5GAEI 2APOA 3S6EA 5DQGA 2H4YB 5K8PA 3Q8UA 4OYOA 1PCAA 5CYQA 4LVOP 5KFIA 4A47A 1S6QB 4NLSA 4C0HA 3THVA 1VBZA 3M8YA 5KFJA 3UFCX 3QJLA 5IV3A 3K8VA 3C3LA 1UVIA 4LF8J 1YX2A 2Y1LB 1KQKA 1C0TA 5CD4H 4FXWA 3MEGB 3T1HJ 1QSLA 1RQ0A 4I2QB 5KFHA 2J9DA 2YWHA 3PRDA 4M5NA 1OSDA 4NYZA 5IOLA 1YRTA 4MK8A 1FVQA 1FVSA 2XY5A 1X4EA 2NLWA 3KYLA 3HHDA 5J2NB 4IO1A 2WTFA 1S72S 4CWBA 1GX6A 2X51A 1IBCB 2XY6A 3W1YC 4KGVB 1HQUB 2JZ5A 2IMOA 1N5YB 3CO9A 4YEAA 5FD1A 4DJBA 4DL3A 2ZBPA 4C8LA 4RW7B 3MMCA 2XYGB 4WYLA 1NDKA 5F3TA 3MECA 1T03A 3MMAB 4I2QA 1T3OA 2ZDPA 1ULRA 3FSXA 3N01A 3OR1A 2M8HA 4NL5A 4NLXA 4WJBA 2IVFB 4F4AA 2CG8A 3N28A 4ZPCA 3TQEA 1YBUA 4PUOB 4FYDA 2JLFA 4LF7F 4NE9C 4YY3J 1VISA 2F8MA 5DG8A 1G1XA 1HMVA 1RT5A 2YKNB 3M4XA 2C22A 2RKIB 1YI2S 4KAIA 1RWPB 1Q81T 1BGXT 1UW9A 2W24A 2AF6A 1T3NA 2MLXA 3DHXA 3GMGA 4B3MF 3AQPA 1HWUA 2W2QP 3O44A 4CNZA 2W8KA 3ICLA 1MWYA 2HHHJ 4P2FA 3ZZYA 4O3SA 1LFPA 1NSAA 3WIVA 2ZZMA 2WSEC 2YNGB 1N0VC 2WOMB 4DV7F 4MJKA 2B4OA 3D66A 5AXLA 2LFVA 4O0IA 4I6YA 4DV4J 4EYHB 3RG6A 1L3SA 2HSEB 4QWCA 1FXRA 3NS6A 1CC7A 3CCZA 3UWTA 1TK0A 2D3UA 4EWTA 5A6PA 3MM8B 3UW1A 4NPOA 5LOQA 3J7A1 4C9DA 4PWDB 1W25A 5KFMA 1VMBA 1DZ5A 4CIOA 1JXVA 1RTJA 2ZWPA 4K5SA 3ETMA 2Z58B 3M05A 3PIOQ 3O3LA 1Q7LB 4IO9Q 3J7AN 4DR2J 1WDDA 3PW0A 2FC9A 1C4CA 1DTQB 3BKTA 4NEYA 2ZZTA 1WSRA 3N0VA 3UN3A 2EEYA 2OPQB 4R8UB 3A8JA 3CCUS 4DSEA 1AA1B 2WONA 3QWPA 2AD9A 3I9V9 2HZVA 2KN4A 1M5SA 3NGUA 4ECQA 4GKJF 2YQ3A 2JRSA 1AB8A 2ZD1A 2Y0BB 2XO7A 2ERRA 1EP4A 4URSA 1HBOA 5HQ8A 2LU2A 2X1GA 3DXSX 1DHMA 3G87A 1HPZB 4WP3A 3KWMA 3NGTA 4ZA1A 3TA2A 5KFNA 4DLGA 2NXNA 4WK1A 5G0RB 3T41A 5CYJA 1RTJB 3B4DA 4C8YA 1DQ8A 2VPYB 3FRZA 3O8WA 2DH8A 2WSFC 1GH8A 2B43A 4DCJB 2P5VA 2B6AB 2O01C 3ETOA 4EUVA 4HR2A 1K73T 1KLNA 1YBAA 1RT6B 3D68A 1UL3A 4LQ9A 1MU2A 1MMLA 4RBVA 3NAIA 5F0UA 4B3TJ 3IM9A 1CLFA 4WTOB 3NGRA 4YR0A 3WC2A 2F4VF 4FKYA 2VU5A 2RNEA 3CCJS 2KFNA 4OYMA 4FXDA 1FF2A 4CTAA 4IOAQ 4IRDA 4RNMA 3ADAC 3OXGA 3THPA 2ROPA 2DY1A 2G0IA 1UW4A 2CJBA 3JTPA 2QL7B 3TUIC 8RUCA 1ZM9A 1SJ3P 4DWIA 1SQEA 2HAFA 1KRPA 2YX1A 1KWMA 2LMIA 1SJQA 3UNGC 4DV7J 2XHCA 4DL7A 2KDOA 3M6UA 1WI8A 2BW7A 1BQXA 4A8MP 4OI2A 3BBFA 3GR0A 2I9SA 1TL7A 3I4HX 1JLAA 4LR7A 4RBUA 3WX4A 3IWNC 1RI7A 2BUNA 4GKKJ 4NOHA 4ZVRB 1TL1A 5MAOA 5ETRA 4Y0FA 1JLQA 1OSCA 2W2PP 2O67A 3ET6B 3WBZA 4ECUA 2EFGA 3GJTB 3CJ8A 5E3PA 3DCAA 3KHGA 5J2NA 3S7RA 4PKDB 3OFGA 1XR5A 3UE2A 5GAHI 3V4MA 2CVEA 1SPBP 5AE2A 1FFSB 2BANA 3ISNC 5M2PA 4RU9A 3R97A 5KFYA 3KDOA 5KFUA 1MLAA 4GVLA 3DNCA 3DLEB 4LF5F 3O2IA 1I94F 2PMZD 1QAXA 1R8PA 1RDRA 2MQNA 3MEGA 4C8NA 4EMDA 2ZH2A 5DG7A 1HWJA 1XMOF 1O6XA 4E98A 5K5MA 4M63A 1U6FA 3EGVA 2R7XA 3PG9A 1FWLA 2WCXA 2A1BA 3F0NA 1S6UA 1FRJA 1T05A 3ISZA 3G86A 3HJVA 3NMRA 4TLQA 2CPZA 2RF2B 2YNIB 4MH8A 3LQVA 1Q8IA 1BLUA 2MYFA 3G8TA 3ENVA 3EPIA 3M2UB 2BJ3A 4QYZK 2B9YA 2Z2YB 2HBZB 2D9OA 2EFPA 2GMLA 2V2VA 4ZCLA 4QW8A 2Y1JA 2FC8A 1S6QA 1UP1A 2N7YA 4I7FA 4KHMA 2CJXB 4RW7A 4ZPBA 5T7LA 5C25B 3M30B 4C8KA 3SCIE 1S48A 2FGCA 4N8OA 1N52B 2BBEA 2GX8A 2HEKA 2C3UA 3C19A 3DMJB 3W7BA 4DQRA 2ZKUA 4FF3A 4M1KA 2V0NA 4H4OA 4L3NA 3G96A 3MI7X 2ASDA 3QSYB 1AZSB 2VBYA 4PABA 4PXBA 1Q79A 4KRWA 3GIIA 1RCOB 2NXJA 1VJWA 2WSCC 3KMSA 1YKWA 3KKFA 4BHQA 2MZRA 2QJ3A 2MGZB 1FWPA 1FXDA 1EP4B 1VRQC 4JOUA 2IBKA 2QE5A 4DV0J 2DNMA 2LXIA 3HHNB 1WACA 2OJ3A 2KJWA 1T9WA 3PEHA 2DNZA 3MPYA 5H9EJ 2PI5A 3CCMS 2B5JB 2P6TA 5KOWA 2I5JA 4CLWA 3OUYA 4Z2XA 2CG4A 3GV7B 1F6TA 3I0RB 5DDQC 2XM3A 3KK2B 2FJXA 2JEGA 2DIVA 4PG8A 2QN6B 2WK4A 5F8NA 3D6TB 2I1RA 4DX6A 3F73A 4PXEA 2ZBCA 4JV0A 3VV2B 3TR5A 3OL6A 2JJ4D 2A0FB 3M6XA 1SL0A 1J5EF 1S9EB 3Q0AA 1WEZA 4G1QA 3K58A 3ENWA 4ED3A 4DR1F 3I0SB 2CQBA 1EETA 3T6JA 1KQFB 3IFEA 2VJUA 3V6DA 1JJ4A 3BDPA 1HNIB 1NM2A 2CNLB 2W8LA 4JBCA 1BXNA 4C0BA 4JI5F 1YHQS 3N6LA 5JVGQ 3ZNJ1 4ECXA 3DDNA 1E6YB 2OD6A 4JI3J 1GFWB 1VLYA 4KPYA 2FHMA 4NLOA 4Q5VA 1YJ9S 4XO0A 2DRAA 5HLFA 1VBYA 2GVZB 5KFXA 4DV5J 3SQGA 2VG6B 1PJ6A 4AXIA 5BYSA 3EZ5A 4UTGA 5DLGA 3OR2B 3A8KA 2A10A 1HMVB 1RT5B 2E5IA 2GIQA 1S5ZA 2XYHB 2YKNA 1VOMA 2ZHOA 4USVA 1T9VA 5IM0A 1LFWA 2Q43A 1QD1A 3H4DA 1KD1T 4GKJJ 1IQTA 4NCGB 4OV6A 3VVUA 1VRTA 1F0XA 5DETA 1SJRA 4WFBQ 2YNFB 2FVQA 1OPZA 3K5MA 3HT0A 2C2KB 4DV0F 1RZMA 1SVDA 3A1YG 3JSMB 2HQCA 2HZAA 2NPIA 3NBPA 3JYTB 2LP4A 2XYPB 4DMZA 2FHJA 1FEHA 2IA0A 3PDNA 4YB6A 4DX7A 2HQ3A 4X65F 3M8RA 3OW2R 2HQDA 2HHQA 1RHKB 3E51A 2ZHAA 2XMMA 3PYGA 2OEMA 2GFFA 5B0CA 4JI7J 3UD3P 2IJFA 5D0HA 3LWLA 4IQXA 2WW4A 1IM6A 3MHYA 1TKDA 4DFPA 4F25A 4OZ2A 4MT1A 2XBPA 2Q66A 5KFDA 2F4VJ 3IR5B 1QSSA 1ZTTA 4ED1A 1M5VC 3D1OA 2UUTA 1RISA 2HRUA 3WDOA 3T1HF 5FDLB 1C0TB 4CO0A 2OSRA 5HATA 3IRXB 4ZKAA 2KHDA 5KFCA 1HKAA 3ZZRA 3R7NB 3IR6B 3CO0P 3SCJE 2VC1A 1SJ1A 3SCLE 4UT4A 1LEOA 4IRCA 2GHPA 3H59A 2B8QA 2XI2A 4TVAB 2WVEA 3KLFA 3R6GB 3TANA 1IBLF 2C2RA 3M2VA 3POTA 2MQMA 2GAGC 4DU7A 2VQFF 5D4NA 1PBAA 5D77A 1S7IA 5CYQB 1UVJA 3JSRA 3P6YC 2VPXB 4TYBA 1WC5A 2CA9A 2GJ2A 5IXUA 3HSGA 1RWXB 3VWSA 2HFZA 2XTJP 3LTOA 2Z4PA 4C11B 1NEEA 1ZM3A 4ZPDA 2MMYA 4DR3F 4DPWA 3TP2A 1S77D 3R7SB 4EZ9A 1Y5IB 2WBMA 3FCHA 5KG1A 3MMBA 1CS4B 3NL0A 1WTBA 4WFNQ 5C24A 3M6VA 1MN9A 3M1VB 4ES2A 4TU9A 3PV8A 4RW9B 3DHWC 1JLFA 2J5AA 4UUWA 4AUKA 2IJRA 3DRPA 2QRRA 3MCOA 1FX2A 4K50A 1JXEA 3Q24A 1N56A 3GCXP 5IT9Y 1WJ9A 1SCJB 5DDRC 3PO4A 1RWNB 4PZVA 4I6AA 1FKPB 3U1MA 2K8GA 3W5ZA 2HHWA 1RHMB 2O1PA 3HX9A 2F1FA 5ETMA 3D2WA 2BYCA 1N36J 4JI7F 1TFYA 1I5OB 1NPRA 3FUYA 4N8NA 4OX6A 3VZHA 1LKZA 1JIHA 1X31C 2CJQA 5D0RA 4DN0A 4LFCF 4G1PA 2AHOB 3MFHA 2PD1A 1HW8A 2YXLA 1R8BA 1GTHA 3ET6A 3N79A 1NHVA 3G6XA 4JV1A 3QJPA 2BX6A 4ZPTR 3J81Y 3G71S 1HARA 4RPFA 1NJIT 2HHTA 3SBMA 3VGUA 5KFWA 2P9EA 1SIZA 3SCKE 5CHCB 5HK4A 2AJ2A 2IM1A 2R7OA 3DLLQ 2RDIA 4DR5F 2DVIA 2GS8A 2MY8A 3FZBA 2QYGA 1A0OB 2A6MA 3RAMA 4K4WA 2DTJA 4IG3B 4J9MA 4ILMA 2MQQA 3HT3A 3FMWA 2FY1A 2HMIA 4KJIA 3UDEA 2DNLA 3OR2A 2K06A 4JI8F 2JHEA 5F8IA 1K9MT 1REVB 1GMVA 1M90T 4F3OA 3CJKB 2ALYB 1R0BG 5L1IA 1JJCB 1MMNA 2E44A 3DOMA 4N76A 4DU8A 4PWDA 4LSNB 3C16B 3TZYA 4CLUA 4MFBB 3G82B 3AOCA 2EW9A 3OTOJ 4A8FA 2R7WA 1N6QB 1G6BA 3GTYX 3H0PA 4B9VA 1RJJA 2QMXA 3NGKA 3M32B 4ED5A 2HHSA 4W90B 1K0TA 5KG4A 3U7JA 2DGUA 3BN7A 2FHKA 3MM7B 3KG1A 4I7FB 1PYTA 2CIMA 3EVWA 4W4MA 4O4GB 2XZWA 3SSRA 2JEFA 4X65J 2V94A 2VBXA 4NXNJ 2G0JA 1OY8A 3OFFA 3GYXB 4FVMA 5HANA 1SH3A 2IFXA 3EZOA 3W66A 1YQHA 5B0EA 4ED7A 3UVJA 3BR9A 5B7WA 4Q45A 1SXLA 2JLEA 2W9BB 4P7TA 3PFOA 4P75A 4C98A 1A9NB 2NR0A 4FDFA 1OYEA 2XMTA 4B9SA 1HNVB 2QLXA 2ZWOA 5ETKA 1Y0HA 3N6MA 2XB2D 2VHGA 2V2ZA 2YH0A 3MCMA 4ZLNA 1MW7A 2IDEA 1FRMA 1O0PA 3AJ2A 3UCUP 2Z0GA 5KFLA 4WXOA 4F02A 2UU9J 2HPUA 1HLWA 3MM6B 4XDDA 1RBAA 3QO9A 2OFHX 4LRCA 2NXEA 1WEXA 2AGQA 2DIUA 2LECA 3M9NB 3QGGA 3P45B 2FJEB 2DHGA 4ELVA 1QAIA 1IQZA 5C2CA 3RJMB 2YWWA 2G2OA 1P8GA 1X4BA 3AODA 1L3VA 3EGZA 1X4HA 3HP6A 1UAWA 4B02A 2DXDA 2IM3A 3J7YI 1RACB 2HFVA 3R5DA 3SFUA 1DRZA 4BLGA 2EFQA 3C6TB 3RBEA 3U27A 2GJFA 2ZE2A 4U9RA 2DHHA 4LF6J 2HQGA 3CJ2A 4AQYF 2R2RA 3PX0A 2IRYA 4NLYA 1UVMA 1DLOA 3THTA 2Y3YA 1RT4B 4HHUA 3TAMB 5GADI 2G2ZA 2HBYB 4L74A 2CDQA 1GNKA 2DKOB 2ADCA 1BUXA 2YNIA 3NGSA 3PRBA 3KLIB 1JX4A 4X4RA 2NZ4A 3H5XA 3QAEA 1UWBB 2ZBQA 2B51A 1R0AB 4PQAA 3ZTRA 3QFHA 4ZDNA 2QLBB 4OYAA 3UPFA 1NPPA 3W2VB 2ATLA 2DB1A 2VUGA 5I3PA 1FFGB 3KUGA 3SV3A 4DL4A 5HP1A 2Y8YA 3MPDA 3MUMP 2BM0A 3DI6A 3WZ0A 1X5OA 2YWGA 1SL2A 1RHQB 2DRDA 3CJRA 3BO3A 2C42A 2KU7A 2XLKA 2QMWA 1FRLA 2MDAA 4NLQA 4DEZA 3QYYA 1RABB 2XNQA 8ATCB 5KT6A 3I4PA 5EN1A 1RLCL 4JB8B 3M8SA 1S10A 5IQQA 2JLGA 1MNEA 2DRBA 2NPFA 5DQHA 3VGVA 1YWXA 2ASYA 2W2MP 4HDGA 2PT0A 2HIYA 1S1UB 4LIWA 1F1BB 2QL9B 1LW2B 4HLBA 4MK9A 1TZ0A 3VAGA 4F4WA 1K8AT 1YRXA 2FLPA 3A8EA 5T14A 1FKPA 1LQ9A 4USKA 4AXJA 4DL0C 1KR4A 2IAJB 1VIXA 1KBRA 1JJ2R 3NWGA 2V4QA 1NK0A 2P2CB 2ZOFA 3LP2A 4C8ZA 3AY0A 3VAFA 3VCDA 1NJYA 1KQGB 4K4UA 2MKHA 2XO6A 3MMBB 3TAPA 2MZTA 2Z57B 5A6WA 3B4MA 1QUVA 3I31A 3R9LA 3CUNA 2V2QA 2R8KA 4LMZA 4H4MA 4R5PA 2WOMA 4BC9A 1JLQB 3W2WA 1Y5NB 2OKQA 3SIPB 5A2QY 3BO4A 2ALZA 3ZTPA 5DDOC 2B4UA 2MHEA 1HNZJ 2RF2A 1HI0P 3W64A 1LXNA 2O3DA 2BJDA 2W4PA 1FNMA 3IA0A 4F3QA 3MAAB 2GGPB 3S1TA 2GVZA 3EGWB 1LOUA 1UA0A 2A18A 2V8PA 5B0GA 4WU3A 1GQEA 3SZ2A 3JQMA 2OPPA 3MEDB 2M3DA 2ZDOA 3V6JA 4B3SF 3UN2A 5ETTA 1VQ6S 3LPYA 1GXLA 1RKIA 3MMAA 4FPRA 4TU7A 1RBOB 4F3MA 1EKSA 3I87A 3VAKA 3V4IB 1U2CA 3SSQA 1PO6A 3LF0A 1KFSA 1RTHB 1YJNS 1VQ9S 2DGWA 2DD8S 2YH1A 2MB0B 4ANEA 2D1CA 4DQSA 1RA7A 5FLXY 1WUUA 4ZVFA 4RR5A 4NA3A 1BHNA 5D4OA 5M2RA 3UR3C 2K3KA 3J7YU 2ZM6F 1PAEX 1YZ6A 2R7QA 1JLAB 4DN9A 1ZA1B 3R6LB 2E5LF 1KVIA 2QG9B 1RGVA 4CLTA 2VPWB 3I0RA 3K5OA 3KK2A 1VBXA 1UZDA 6FD1A 2YKQA 3KLVA 3CC7S 1XR7A 1Y3KA 2OMLA 2KVQE 3BSAA 3OTEA 4XPEA 4GVBB 2HFOA 2Z2MA 3DOMB 3BYPA 4GO7X 2MEWA 4I1TA 4KGXB 1RHRB 1NHUA 5GVQA 3PXGa 4USMA 2MGZA 1FEEA 3AA9A 2B3TB 3BN4A 3FBBA 4PWUA 1U47A 2E1CA 4KFBB 4ZLLA 1WORA 3M8PA 4QWDA 2GGPA 1UMJA 1IKYA 4LF7J 2QEXS 1NU4A 3OHBA 3K5LA 4JP8A 2W9CB 4GC6A 2J7UA 2PFFB 4USWA 2OEJA 4WYWA 2PGCA 4C3LA 2XNRA 2J0QD 4PUOA 3QAUA 5J1EA 3VAJA 3GPAA 2L48A 2HNYA 3JAMY 4LBIA 4P52A 2KZMA 3D28A 2J7WA 1HHQA 1MMDA 2HRTA 2RILA 4IFYA 6FDRA 2BR0A 1MN7A 1RA6A 4ZPAA 4CO4A 5I3QA 2BJ7A 3MR3A 1VQOS 2GQQA 3HHLB 1JLEA 3BS9A 1I3OB 3CW2C 4R0JA 2BEFA 1Q95G 4J91A 3M2UA 2DCUB 3UCGA 3GIMA 1JNRB 4K0KF 1FX4A 2MKYA 4LREA 2CPIA 3H2VE 3KNAA 1QAJA 1V3ZA 1W2BR 4Q8EA 4DPUA 3NNHA 1FDAA 2EXUA 4IDKB 3LP2B 4F36A 2BZ2A 1KFDA 5CCLA 2KZZA 1CULB 3LP1B 4Q8FA 2CJ9A 3HF5A 4USUA 3JTOA 3IG1A 4DF8A 2H1YA 2XZDB 1HFEL 4OI0A 2HBQB 2QFJA 3E01A 5AJ3F 5A8WA 4USIA 1VK3A 4FNIA 2IC3A 4ICLB 5E3RA 3PJ9A 3UO0A 2HKEA 3EXCX 4OQJA 3HZEA 1JNZB 1N5SA 3CIZA 3DGVA 1WD6A 5GMDA 1W2IA 2J8SA 3ZZOA 1RT2B 5EHHA 2ZH6A 1I51B 3AOBA 5KFRA 5I42B 3EYZA 2PFDA 3TUJC 1XMQF 3KNGA 2CPFA 1HWIA 2AJ1A 2BE2B 5L46A 5IT9U 1WDTA 2JDJA 4QIGA 1NK5A 4FF1A 2EKNA 1T0TV 4EZ6A 3DMJA 4NMXA 3MAQA 4HKQA 4R5PB 1J5OA 2CPDA 4DPYA 2KYXA 2M52A 4MYUA 3CULA 4QYZJ 4URGA 3D7SB 1B64A 4OYXA 4DFMA 1SB6A 4NI2A 1QAYA 1B99A 1SC4B 4ELUA 4JI2J 1IKXA 1T94A 1H2UX 3R5JB 4WPAA 2KHCA 1K47A 3MPUB 3RUBL 4HI1A 4FF4A 3RB3A 3LALA 4GKKF 4ZVHA 3PIPQ 3S8SA 2LKZA 1S0MA 2BW2A 2AYBA 1B4SA 2H5EA 2IRUA 1NKEA 1SKSA 1BC6A 3ILOA 4NLWA 4MMOA 4WCEQ 1RAEB 3IRXA 2XGPA 3D3CJ 2HFUA 2FDNA 3UNYA 3DLJA 2B56A 1HBNA 3DRRB 4PWWA 1LXJA 1S1UA 3QNWB 3J7ZT 3P96A 3P49B 4DR6F 1IBKJ 2OD4A 2ZBIA 3AXMA 1QUPA 3LAMA 3KK1A 1JLCA 3QATA 1RT2A 2D3O1 4K4ZA 1F9EB 1VRUB 3GV8B 3CCSS 1NKCA 1HPZA 3CJSA 1YLXA 2E7XA 5JVHQ 1CSJA 4JV5F 2CNNB 3QZ8A 4CI0B 4ENOA 4I64A 2XGQA 3QMQA 2AEFA 2M70A 5JXSA 1M1GA 3V6HA 1TK8A 5DGBA 5GAGI 3IM8A 1TP7A 1SKWA 2XSJA 5I3UB 2B7BB 3KLEB 2BJ1A 2OPQA 2YY3A 2M2BA 3LGNA 4FYVB 5IC4B 4R8UA 5HSPA 1YBTA 2W25A 5DG9A 2OHDA 1PSDA 3M2RA 1S1VA 3QGIA 4CM2A 2C28A 2AJ0A 1FKOA 1QJHA 1JLGB 2AKWB 3GJSB 3VR1A 5HVHA 1P1LA 3SDEB 4F4XA 5DDPC 4ALZA 1JLBB 2BXJA 2EBGA 4DR5J 2MSSA 4ZP7A 5F8LA 1KQSR 4QR2A 5L9XA 2FJAB 3MM5A 5HJYA 1RTIA 2KT3A 1LNQA 1MWZA 4IG0A 3FSIA 1QE1B 1YJTA 1C1CB 2B4PA 5B0AA 3W5XA 1F9HA 3ZNUA 1LV5A 2XS5A 2WRMA 1RYSA 3LP0B 2RDJA 2HZCA 1H72C 3M9OB 1B0PA 1HNXJ 3P3DA 3N4WA 1J2VA 4TYAA 3DLGB 1M5KC 2B6AA 2HLTA 4WFAQ 4ZVTB 3SI8A 4S0MA 4AFFA 3IR7B 1Y10A 4C6AA 3HFKA 4DR7F 4LRFA 4P2XA 3ISND 4D3GA 4DV6F 1NSKL 2RU9A 2VD3A 1NK7A 2IYGA 2NREA 4NLUA 2MPUA 2LQJA 4C4WA 1RTZA 3I96A 5HBMB 1NK9A 4LBPA 2W7AA 3DDKA 1NAQA 4NLTA 5LSLA 4LF1A 4EBCA 4B9MA 4FBUA 1PC4A 3OLBA 4CH1A 2DPJA 4K4XA 3PZPA 2XLJA 3N5BA 3RBZA 3V81A 4U8YA 1CBKA 2BMBA 4NA1A 5DO2A 3C8YA 4X4VA 3CJ5A 2B5JA 1TUGB 3I6PA 3OUYB 3KK3B 2MKKA 1X4GA 3SFGA 3KLHB 4ZVEA 4QOTA 2V8HA 2JSXA 1GAOA 2RUSA 2UUWA 4M5JA 4D3HA 3EPGA 1LWCA 1S6PB 3RRHA 4B9LA 5J2PB 3NXZA 3PY8A 4JV5J 4URQU 2RIJA 2WZ1A 2F9JA 3V4IA 4RW4A 1O51A 3FCVA 4QIFA 3JQKA 1MROB 1RT7A 4OLPA 3RB0A 1GEHA 2C3PA 1C2PA 3AOAA 3M32A 4DQPA 1AT1B 2HG4A 2JC0A 3VAHA 5CYMA 2BRLA 2DITA 3GG0A 1DBDA 2DR6A 3K57A 3H8YA 4IQMA 2HNDA 4PG6A 5IZHA 1M1KT 4CLSA 3OL9A 1NDPA 1TL3A 3EJMA 1U26A 1ZZNA 2L9NA 3OJUA 1XNQJ 2LXUA 4QJVA 1K1QA 4GO5X 3ONQA 3JB9k 3QGHA 3C14B 3FEXB 3W5YA 4NCBA 4DS4A 4ZCIA 1NO8A 2H9ZA 3L95X 3UI3A 4MK7A 1IR1A 5CZXA 1CJTB 3V2UC 4RNFA 2BE7D 2OLWA 3AHPA 3W2WB 2MQPA 4ECSA 5M2UA 3T5HA 3NRBA 3L7PA 3DRSB 2D9PA 3DOKB 5L1KA 2IIHA 3IN5A 1AXQA 3WIUA 3CMQA 2UU9F 2R3VA 2D3ZA 1BQMA 4ZOSA 3GIJA 5IWAJ 1HWKA 1VQ8S 3HSZA 4CT9A 2H3EB 4CH7A 5GMKa 5D8HB 2JVRA 2DXEA 3B6BA 1X4AA 2VG7A 4RW4B 1VJQA 3FJ2A 4J9RA 1ACMB 4I68A 1VR6A 3PRVA 2FGOA 2IM0A 4LF4J 4HEA9 3AH6A 3KFWX 2UVUA 1WG5A 1CEZA 5E3QA 2PMHA 1EZZB 2B9EA 1TL7B 3Q8PB 5KG6A 1HQEB 3FQKA 1BMQB 1S57A 2CWKA 1PC5A 3FEZA 5ETVA 1RTDA 1CULA 3LP1A 5D78A 1UFKA 2QA4G 4WZMA 1FDDA 4RW6B 2H54B 2AYGA 3OVAA 2HK2A 2MKJA 1HL6A 3GZ7A 2VL1A 4DR3J 4EYIB 2EK1A 2OSQA 2QX0A 2YWEA 4H4KC 4ZVGA 5B0FA 3V6KA 3PW5A 2PEBA 4C7QA 1KKHA 3H5YA 3DXBA 2VFUA 1K44A 1IBMJ 1EQ0A 4DF4A 3K17A 1TKZA 1Y4ZB 3D0GE 3DOKA 4MKBA 3AXKA 4Y6IA 3RW7A 4K4SA 4YS2A 2B9WA 1AFIA 4DR6J 4MYTA 1C1BA 3QLHA 1UWBA 1R0AA 4AYBD 3HLUA 1RXOB 3CCQS 4X4UA 2IA6A 5J2QA 2M5YA 4WK3A 2WBRA 2MXYA 1SJ4P 4WXWA 3Q8YA 2FLLA 2PSZA 3DOLA 4MKYA 4J9OA 3A12A 4DG1B 4DR2F 2AU0A 2GJIA 4KFBA 3C6UA 2GCFA 2AEJA 4IFVA 4PCQA 5FIIA 5K14A 1VK8A 3NCPA 1BY9A 4O44B 1N88A 3MEEA 3G6VA 4PG4A 5G4DA 5JUMA 1U1NA 4U7UD 4X2BA 1M5OC 3CB4A 1IKVB 1FERA 3MR6A 2VQEJ 2AGPA 2BQ3A 3CEDA 3EZUA 4QU6A 2Z8QA 3QBCA 1U8WA 3J81U 1FRIA 1HD0A 1OWXA 3TJ8A 2AT1B 5C7PA 4Y2IA 4IKAA 1F5AA 2F3JA 4ELTA 1R6YA 1D8YA 5F0WA 1U02A 1YJ7A 2QIFA 2CNOB 3UDVA 4Q2LA 1T9YA 1ZZFA 5D4LA 2XCPA 2AQ4A 2F9DA 2HHUA 4JI4F 3TWZA 4XAKA 4LFBF 3HCXA 1QSYA 2YNHA 3HVTB 3X3UA 1U4BA 3PHTA 3KK1B 1Q82T 3G9CA 4I2PA 3RB6A 2H5JB 4KV8A 1FFWB 3O6QA 2RMLA 5KG3A 3I55S 4FS1A 4WP8A 1Q7YT 4PQUB 2UXCF 2I5JB 4NLRA 2BRKA 5KFKA 2CQ3A 5ITHA 3OL7A 3GJQB 5KT4A 2LVWA 3W8PA 3GV5B 2KB2A 5DGAA 1RYRA 4Q0BB 2KJVA 2KG0A 2MQ8A 3EVMA 4OYPA 3VZIA 5J2MA 4DL2A 5CQGA 3ITHA 2CJKA 1JLGA 4DG1A 3NLCA 4ED8A 2OI2A 3I5AA 2CQGA 2JEJA 5A8RB 1N33F 1AYEA 5D15A 2MQLA 3RTVA 1JJHA 4DZDA 2MKIA 3FEYB 2NYHA 4N7TA 4P2MA 3TVZA 3NWRA 1VIOA 2GO8A 3D54A 3BJYA 3EICA 3CCVS 3T3FA 2E9RX 4WF9Q 4ETZA 4UZCA 3GCWP 4DPTA 5F9LA 1QY7A 1VBKA 3OQ2A 4MIBA 2GVDA 4ECRA 3CGIA 1F60B 4B08A 1GTEA 2H65B 4DV5F 1PKUA 1R8AA 3MGJA 3NCRA 1J5OB 1X8DA 3GWCA 2RE1A 3RRKA 2VH7A 3TEGA 3I82A 1VQPS 2DEIA 2XMKA 3J80Y 4N5SA 5ETQA 2H48B 2PDAA 2V4JA 1I94J 4NLVA 1MG7A 2CQPA 2ROEA 2W2OP 3HVAA 4KH0B 4NWBA 3W62A 5LMNJ 4CYUB 1XNRJ 4RNOA 2G1DA 2HS4A 5L38A 4EO6A 1RK8A 1VC0A 2FLOA 2WVCA 4KKOA 4X4OA 4RJVA 1WC3A 1X4CA 1YRUA 1H7XA 4FYWB 5A0YB 3Q8SB 4Z37A 3RAQA 1XNQF 2XCAA 4FYXB 4RNNA 1O8BA 3OFEA 4HI2A 4MKVA 4A48A 4YB5A 2E9TA 3CT9A 2GQCA 4OLOA 5C5JA 1C1BB 2D7SA 2UUAF 4LFAJ 1EKRA 4NI2B 4DFKA 4P2SA 3OJSA 4QZVB 3RYLA 1BQNA 1ZTWA 2WVDA 3F44A 2W9AA 2DNPA 4DSKA 2Z2ZA 4E2FB 1PG5B 1TKZB 1JQGA 1S1WA 1P9QC 2ASJA 1I6JA 3DLBA 4YB1P 1ITPA 1HA1A 4X4PA 1N5TA 1SKUB 3N9UC 1H73A 3HHLA 3QGPA 5T7LB 4WKYA 1CC8A 3OLAA 4K4YA 2J6UA 4YN3B 1B7FA 3SSSA 1SC3B 4MTPA 3JAMU 3TARA 2HYIB 4AT1B 4FYYB 4MAKA 4RW6A 3TNVA 3G6YA 3VF0B 1UWAA 1OYDA 3R5GA 1V6HA 2DNRA 2Z56B 3LW5C 4I56A 3TEHB 4UOGA 4LRBA 1M5PC 1N8RT 2AYMA 1FD2A 1XERA 1VC5A 4UY85 5KFAA 1S0NA 1DLOB 2B0GA 2ZJRQ 2UUAJ 5D0GA 1WKJA 3BR8A 1DQAA 2Z30B 3D0IE 4B3RJ 3OD2A 4LSLB 4ZLPA 2E1PA 2JFDA 2MZQA 4PPZA 1Q86T 4ZJLA 4WBFA 4IDKA 4AD6A 1B0TA 2GHVC 3P5BP 1ZAVA 4J9KA 1S9GA 1MWQA 1HBMB 1XN9A 3GYGA 4OYBA 3GIKA 4OI1A 3DYAB 4B9TA 2QSFA 1Q4RA 3IMQJ 1TVRA 2V5HG 4EU0A 2Q79A 1UEUA 3NY0A 2SXLA 3PW4A 3BGRB 4IH7A 5F8MA 3IAS9 2V9KA 4AE5A 3DN9A 4Z7CA 2MQOA 4J37A 1WG4A 4DLEA 1NCLA 4O4RA 3TQ1A 4JV2A 2IC3B 4NXMJ 1N5VA 2UXDJ 2GQ2A 4NASA 1SQFA 3SEOA 1HBNB 5KG2A 5KT3A 3DGPB 3NCQA 3KJVB 1HQ2A 3VAMA 5HI7A 4B17A 2QA1A 1NJZA 4M95A 1P27B 3MTJA 1E6VA 3HHEA 3BGFA 1CJUA 2WONB 3HD2A 4U67Q 4FS2A 3QQCD 3A3PB 1S1XB 2LQ9A 3CD7A 4IR1A 2DHAA 3BDEA 3FBCA 5KFSA 4ZHRB 2KO1A 2W9BA 4J7CA 2R7UA 3M8PB 1G7CB 4ZCKA 2RQCA 3FNNA 2OPRB 1S1TB 4F04B 3K5PA 2EG2A 2A2DA 3PTWA 4LFAF 2FD2A 3ZXWA 2V6AA 3MMJA 1NB2A 1R8HA 4YMEA 3RAXA 2EBEA 3NS7B 2VA2A 1XQIA 2CXEA 3KLGB 3NBPB 1FD8A 1IWAA 2V34A 4HVZA 1L5UA 4EI2A 4B3MJ 3HVWA 1MROA 4HT5A 1VYAA 4RNHA 5HO4A 3OXLA 4Z7YA 4DPOA 2MKSA 4L72B 1HBMA 3GG1A 2RUGA 1TV6B 5E41A 2XLIA 2C2EA 5E7OB 4OI6A 2OGUA 2COLA 4JYAF 4HDHA 4B3OA 2VICA 3QIPB 4Q43A 1T8EA 2J0SD 2IRXA 1S1TA 4QIVA 5L9NA 4HHHA 2V50A 5SZTA 4DV4F 2BA9A 2DCLA 5HMZA 2CJAA 1NZ8A 3G4SS 1D3WA 2P9GA 2DGTA 5K8OA 4ITSA 4KHPF 1F3FA 3IGNA 2L41A 1D0EA 1E6VB 1WHXA 1ZYQA 2BDPA 1HI1A 4OFZA 4O3OA 4ECVA 4X84A 1TKTB 2VFTA 4V19X 1X9SA 1ZA2B 1UKUA 2DPIA 2JH3A 3QPIA 4UQGA 2W4CA 3V6DB 4R0EA 4TLRA 2JEIA 2RDDA 3OTOF 1KN6A 2KXHA 5D0EA 2CUYA 5L39A 5GAHU 2H5IB 4F0MA 5L8RC 3R5AA 3MM8A 1TFWA 1DTTA 5F8HA 3MWBA 2N3LA 2VV5A 3PW7A 1RTHA 4W92B 2VOPA 5IT0A 1MSWD 2AGOA 2KM8C 5IQ6A 1U6ZA 2M4MA 3Q8VA 4U96A 3W8GA 3DU5A 1FNXH 4MKAA 1BWVA 3W3SA 2YNGA 4DHVA 4DV1F 2E7WA 3BQ0A 2BOPA 2AMCB 3BO2A 1WC6A 3C16A 4O23A 1W26A 3C66A 3DM2B 3PR5B 4B9NA 2FJWA 1D09B 5DM6Q 2R2UA 3MUVP 3FBFA 4OJHA 3TO8A 5AE3A 2GA7A 4CLKA 3GSDA 4WWSA 4NZ0A 3DRYA 1CQMA 2HWIA 2MZ1A 1XNRF 4ILLA 2CKWA 4PRFA 3HFZB 5I3UA 4WKRA 4X64F 2QYCA 3ZO7A 5CXTA 4NZ6A 4LR8A 2YKAA 4RL1A 4KSEB 4KHRA 2FJDB 5IT4A 1LW2A 1U45A 1KOHA 1B3TA 4K0KJ 1V5VA 2OMOA 5IC6B 1NKBA 1RAFB 2KXFA 1JWWA 2ZUAA 4PEOA 1GX5A 4DS5A 4PXDA 1NDLA 3D1QA 4U7CA 2XWXA 2QGFB 1SUQA 2GAHC 1ZAWA 2XQCA 3RU0A 4P9SA 3AT1B 2CVIA 2DGSA 3LPEA 1IM4A 3DI6B 4N77A 2FIUA 1R89A 4XK8C 2Q1LA 3D6MB 3X1LB 4LSLA 5GAGU 4FVCA 2HGNA 2WVBA 2M8DB 5LJ5Y 2VG5A 1KTVA 4X64J 3Q8RB 5C42A 1S12A 1K1SA 4CYUA 1V3RA 2VFSA 2ZH5A 3BZQA 2HVHA 1X4FA 4LF2A 1HBUB 2RSQA 4RZRA 4H4KA 1YJRA 4KKOB 4OZ1A 1WF2A 4P6QA 2RQMA 3BGRA 2YTCA 3TAQA 1CVJA 1U8SA 2ZEJA 3FVYA 4JI1F 1KHWA 3AB2B 3ZTSA 1PILA 1KS2A 2K1RA 1YTYA 4CLYA 2IVYA 4B9UA 1URNA 5I4MA 1CS4A 1HHSA 3DLKB 3IWLA 1Q78A 1T11A 3HSDA 4DBQA 5LXYA 3R1HA 4PR6A 3BH6B 2OAUA 3IP0A 4P7VA 2KVIA 5DRKA 2XI3A 5ADZA 5HP1B 1BQNB 2UVWA 4RUHA 3PX4A 1WELA 2AJFE 1DURA 3QJJA 3MM6A 4J90A 3I9ZA 5GADU 1I1GA 2AZ1A 2HVZA 4TY8B 3ITHB 4KGZB 2LQ5A 4P10A 3VTIA 2MY7A 4RW8A 3W61A 1SBRA 1HW9A 2GIFA 1FRKA 2P9CA 2JL9A 2J9DE 3HKWA 5BYRA 3ZC4A 3MCSA 4KR0B 4W98A 4C3KA 4DQQA 4DR4J 4TNOA 3SQGB 5J2MB 3ENQA 4WE1B 5LXRA 1QTMA 3TZZA 3IBCB 2X3GA 1NZAA 3NKYA 4X66F 1HNXF 3D6HB 4OZ0A 5CH7B 4BBYA 5D3GA 2YX7A 2QLWA 1Y9OA 1DY3A 1Y00A 1RT1A 2VBZA 1U2RA 3FFIB 3MPWA 3PJXA 3EUNA 2AZ3A 4USJC 4Y3CA 3VQTA 3KJVA 1X5SA 5G0RA 3UN5A 4QQBA 1T95A 1T02A 5F3ZA 4ANCA 3T6BA 3H90A 4ZCMA 3SYZA 3O1LA 3TYTA 1J5EJ 4ETXA 2J76E 3CJ4A 5D4PA 1AUDA 4V19J 2RT3A 2DR5A 4OJGA 2YKOA 5A0YA 4ECWA 3T5LA 3EWGA 2P8IA 1P1TA 2J8AA 3ILJA 4K59A 4DV3F 3NG8A 1REVA 2OIHA 3K7RA 3LGHA 4ED4A 3Q2TC 4PXCA 5LMUF 3DGPA 1UCNA 2Y1IA 4LR9A 4XTTA 4Q2MA 1C0UB 3MAHA 3A4TA 4I67A 5K14B 5AXKA 2DNHA 4EO8A 1NK6A 5ETSA 5ETOA 1Y7PA 2IJNA 4CCHA 2ZBRA 3K2YA 4HTJA 4KTQA 3BREA 3M7VA 4B3OB 3RR7A 2IHR1 2W2NP 3FQLA 1R6VA 1UZHA 1ZOTA 1TUWA 4KBIA 4PPDA 2I0XA 4YDXA 1TR0A 1WHYA 3HKZD 3MF5A 3QT6A 1Z4UA 2W01A 4P73A 1TQLA 4X62F 3MURP 1DFDA 2P6SA 3H5SA 1C4AA 3DC2A 4KT0C 4C11A 2YVSA 3D9BA 1RTIB 4IG0B 1HYSA 3RZAA 3KJQB 3MM5B 2VFVA 4MIWA 3U1LA 5BR8J 2ZH7A 1S4FA 2V8VA 4F4ZA 1HR0F 3BBBA 3T1AA 2HNZA 4DV1J 3AD8C 3MD3A 4JI8J 4RUCA 2ZJQQ 4ECYA 3LAKA 4X66J 3K89A 2VG5B 5HL7Q 4AL6A 2BQRA 3QRRA 2Q6BA 3U02A 4CH0S 2MJNA 2QA4S 1VS3A 3GFHA 3HI9A 3MPVA 3VGTA 4OI3A 3MAAA 3LUYA 1S4EA 2KXNB 1QVGR 1N36F 3UVJB 2BKNA 3BYRA 3M8ZA 1VLOA 2BOAA 3IBFB 3IGVA 5MLCV 4ZVOB 4ED0A 2R42A 5H9FK 1PAUB 3MOZA 4R25A 1KVJA 2O66A 1VRUA 2R7RA 3RR8A 3AD7C 2RHSB 1WHWA 4USTA 2VQFJ 1RHJB 1N34F 2G0CA 3PYEA 3GE9A 4QWAA 5J2PA 5K8MA 4TXSA 1VFJA 3EXYA 2ZH1A 3GONA 1N32F 4DUZJ 3DU6A 1FWKA 2D3OR 3R27A 4MFBA 2PMWA 2DBBA 3IBWA 3HHLD 3BB5A 3H5UA 2JX2A 1S99A 9ATCB 2ABYA 2N7CA 5A2QU 4K4VA 2FJBB 2K3IA 4J9SA 1U6BA 2AV5A 4Y65A 3BQ1A 3DOLB 2UUBF 3B78A 2AX0A 4G1IA 3L3CA 3VQSA 2OPSB 5RUBA 3DM2A 1HNWJ 3QT5A 5KFFA 1FE4A 1FJGJ 2EWHA 2X7IA 2KT2A 4LBHA 1T9TA 2MSTA 1FRXA 1OS5A 4TU8A 2X1AA 3PX6A 1V5IB 4DL5A 4OYWA 4CO3A 3DLGA 2GHWA 6AT1B 2EFNA 3Q86A 1BD6A 2IPOB 4G65A 3MZIA 1HWLA 3RBDA 1TL5A 1B0VA 5AT1B 2BANB 4C3MA 1X5PA 2RAQA 2RJZA 1BQMB 4IH5A 2YKMA 3AA8A 3MDFA 1D9AA 3I0SA 3QWUA 2RRBA 4M5HA 4QIWD 3D0HE 3G6ES 1HNZF 1UPMB 2H4WB 2JC1A 2DHSA 2VDIA 2ZC3A 1HQEA 1OO0B 4DR7J 1HNWF 1FK9B 1XEZA 3KHLA 1KNZA 1VRTB 1OJ4A 4Q0BA 1F3VA 4ANDA 2DNYA 5DZ7A 4GMKA 1PIEA 3GR1A 3IS9B 4U8VA 3CSKA 3R3TA 4KE5A 3VHQA 4F2RA 2VFRA 1OIAA 1U1QA 3OXFA 3W9JA 1DTQA 2LA4A 3OTDA 5A8KA 4Y2AA 2VA3A 1D9DA 2YWKA 4E0DA 1FXLA 3LO3A 1FKAF 2KYZA 2VG6A 3IO1A 3M8WA 3H7HB 3EVOA 2E1AA 4LF9J 4OHVA 4YR2A 2XMJA 3QT8A 1ROFA 2E1RA 2HGMA 2F5GA 2Q6CA 1JKHB 3BPDA 3ILLA 2CDRB 1IBKF 3R2DJ 4K8RA 2YPZA 2ZVSA 3P8BB 4HHJA 2HLUA 4OX8A 3NOCA 4JI2F 1VQSA 4NRTA 3QLHB 3TX8A 5KFPA 1UA1A 2B4VA 3HULA 4ZVPB 1URRA 1NB7A 2E9ZA 2CQ0A 5KFZA 5HVGA 1YITS 1S9FA 4UUXA 1NH7A 4L73A 5E0OA 4WZQA 5DQIA 1X5TA 3D1HA 4M5DB 5E33A 3BKUA 1N33J 2EFOA 4NXMF 1YDLA 4LF5J 2BJ9A 3M2VB 3VAIA 3SDEA 4KB7A 5BJRA 3F41A 3KLHA 1F5CA 2C2OB 3R5CA 1RLDA 3TW0A 5J1NA 1YSJA 4J9UE 3BPSP 1TL3B 4F4KA 1LK5A 4V1Ak 2RKIA 2DNGA 2H51B 1H2TZ 5KFGA 1ZPWX 4K5RA 1WSVA 4JYAJ 1VQYA 5FDLA 2Y8WA 1T9XA 4C48A 1L3KA 2AIRB 5AJ3J 2VBWA 2R2TA 3RGIA 3ZZTA 4YHHF 1HNIA 2XHWA 3FDSA 3OTBA 4KHPJ 4L3KA 1NK4A 1EHWA 4OZJA 1AUSL 5HVFA 3KLEA 2CFXA 3NP5A 2PA3A 3C46A 1XMBA 2RU3A 1XBWA 2FZKB 1RWWB 1S9EA 3HM9A 4ES3A 1VQMS 2R8GA 1JKHA 3BSOA 1S76D 1YZ7A 3FMBA 2C3YA 3OPKA 2DXFA 4JUZA 5F9NA 3EX7B 3PKYA 1KHVA 2AYEA 4FP9A 1WC4A 2N4DA 2OP5A 5E3CA 3KK3A 3PO5A 2UXCJ 3ZZ0A 4LSNA 2RHQB 4M5LA 1KTQA 2XY7A 1OY6A 2VPZB 1C1CA 3AQOA 4CO2A 5A8RA 4A8XA 2UP1A 1S79A 1QDUB 2GNKA 4HACA 5A76A 4CZCA 1OMSA 5K20B 1IBLJ 3MEKA 2B9XA 4LF9F 2JVOA 2I8EA 2PA8D 5LL6d 5KFVA 4YHHJ 7AT1B 5DJBA 1KONA 4YP3A 2W7PA 3KXDA 1Z2ZA 4QBUA 5HJXA 3CCES 4FXVA 2D41A 4ER8A 5IV4A 5FJ4A 2GW8A 4DSJA 4ILRA 5EX0A 1Q8BA 2CZVC 4KV8B 2K7KA 3PVXA 1HYSB 1QTNB 1OQ6A 1R43A 1WOPA 3H20A 3WQPA 4DUYF 1XTZA 1FE0A
chains in the Genus database with same CATH topology
1X9WA 4BWMA 3PNIA 5HMYA 3CPWR 2K1RB 4ATNA 2FVSA 5EWFA 4C97A 3CD0A 4NZ7A 4QCLA 2G4BA 1Q1KA 3DLHA 2DGVA 4NYPA 3HMJG 4F50A 1KQSR 2N82B 1VQ7S 5J1EB 1HQUA 2KKHA 1XR6A 2U1AA 1LWCB 1R27B 1S6PA 2JFKA 2PN6A 3HZGA 3MUTP 4DUZF 1FKOB 2EVZA 4O3NA 3KLFB 1GT8A 5EGYA 3M2RB 5IS2A 4J9QA 3MR5A 2J6SA 2AW0A 2QSWA 5D6GA 4C8OA 2F8EX 4ZP9A 4IFVB 5EDWA 4NX9A 1IN0A 5KOXA 4OHWA 5LSOA 3C6UB 3TVKA 3KHHA 2PE8A 3CDBA 2VG7B 5CYMB 2C3OA 2LYVA 3TA0A 2J7KA 3CE8A 1RWUA 2RRAA 4KQZA 4CQ1A 2HHHF 2Z2LA 2QO3A 4KGMA 2OO4A 3CDEA 4I4BA 3ZZPA 3MFIA 1G3OA 1OQ3A 1VC6A 2EPIA 1S0VA 3LGMA 2HIQA 4YUDA 3PW2A 4DL6A 3MXHP 3N6NA 2LDYA 4HT7A 2J6TA 2VODA 2NQPA 1UFLA 1H7WA 2E5HA 4ZK7M 1F2GA 1T7PA 1H0HB 2DO4A 2EG1A 2NSCA 2DNQA 2Q3PA 2RQKA 2YNFA 2KH9A 3K5NA 2POKA 4NCGA 4QPTA 2E5GA 1FDNA 1WF0A 3OVBA 4LVNP 1IJFB 1U1PA 1AFJA 2VASA 4M8LA 4LUBA 2L08A 1T05B 2K7JA 1V9OA 2BVZA 2M0GB 2VONA 2DH7A 4EFAC 1H38A 2YNHB 3HVTA 1H98A 4Q7AA 4OHXA 4WTYA 4XDCA 4F26A 1U1KA 5KFQA 4YOEA 5BR8F 2LEAA 4J9NA 1DTTB 1SI9A 4ERDA 1RT7B 2G13A 3NAHA 3SMZA 2OFGX 3JYTA 2QV6A 4LF8F 3TI0A 1RT3A 3S01A 5KFTA 1CQNA 1S7HA 1YGYA 5JJBA 2KRRA 1C0UA 1ZM2A 3R5BA 3E3XA 3FGVA 1WF1A 3FFIA 2D74B 3DRRA 3KG4A 2XS2A 4BS2A 1O5JA 3GB0A 3NMAA 4OZNA 3CCLS 4ID5A 3HVRA 5K9FA 2XS7A 4QR0A 4EBDA 1NK8A 4N47A 1Q16B 2KFYA 5AE1A 1HD1A 1XWLA 4XPCA 3FSYA 2VC0A 3PR4A 1YVFA 2I2YA 1VQLS 3I32A 2EK6A 4M5DA 4O4GA 2CYYA 2CPJA 2C2DA 2FTRA 3MM7A 4ZP6A 3TA1A 1SJFA 1VGYA 5EWEA 4OL8A 3CDUA 4LF6F 4QIEA 3HK2A 3KLGA 1SL1A 2FPHX 5J1PA 4NRUA 1WHVA 4YY3F 1HHTP 1ZPVA 2BE2A 2VKRA 3CC4S 3IRWP 2HFNA 2LQBA 1IUJA 4UW2A 2QT7A 3T19A 2XEXA 3RB4A 4IUFA 3PHEA 1ZH5A 4OHZA 1RTDB 5L1JA 3HHLC 2IMWP 4OZ5A 3M6WA 2IAJA 3GFYA 1FJGF 2BJEA 3TRGA 1X4DA 3KG0A 5C42B 1TL4A 3MM9A 2BM1A 4U6PA 2AJ4A 3CD5A 5HROA 5HBMA 3LOUA 1AROP 3Q2SC 2KRBA 1S49A 1KLMA 1FT8A 1N5YA 4AL5A 1D8ZA 3CCWA 1YJWS 4IR9A 1TVRB 2MZSA 2DO0A 2I38A 1JMTA 3DYAA 7FDRA 2CPHA 4BDPA 5CZVA 4EGLA 3B8HA 2XSFA 2RRNA 1V3SA 2CRLA 1IKWA 4QYRA 1LWEA 3M30A 4USHA 4O3RA 1Z2LA 4H4MB 3T9NA 1QE1A 1UETA 2G9OA 1FESA 2DNNA 1R7IA 1HBUA 5LJ3Y 2ZJPQ 2VZ9A 3MM9B 4QWEA 3E01B 2YKPA 4FS2A 2VKZG 1NJZA 5HMWA 4YB7A 2NUUG 1IBMF 2GO9A 3UR0A 4BC7A 3PEJA 1S6OA 5IFMA 2R8JA 1F5BA 1IR0A 1SV5A 1X0FA 2DGXA 3K0JA 3CD6S 3UDLA 4WFXA 1SUQB 1CG2A 5E5NA 2DISA 1NH8A 3WC0A 1U24A 4ZMMA 2HS3A 3OR1B 1UJ6A 3OV7A 4TY9A 2RS8A 4ZPWR 3C6TA 4G6VB 1OPIA 1TUVA 2ILZA 5LT5A 3QZ7A 5K8NA 1N6QA 2EC0A 3E2EA 1WG1A 2IM2A 4FN5A 1VQNS 2E66A 3VALA 2E29A 5L1LA 2HVIA 2V9WA 5I42A 2ADBA 1IKYB 2J9CA 3O5TB 2OPRA 4KIAA 5B08A 1S0OA 3NNCA 4RWXA 4RWWA 2L3MA 3CIMA 2ZD1B 3I5BA 3NGDA 1GXUA 3M8QB 5EUHA 3V81B 2X1FA 2KTQA 3CJ3A 2NS1B 5F41A 2KM8B 4NMLA 3MOJB 5HMXA 4I6WA 4PQUA 4CO5A 2HHVA 5KG7A 2RB7A 1IKXB 2B7CB 3V5RA 5DS7A 2E5JA 2UV8A 2ZH8A 2BABA 5H1SV 4F2SA 4KGKA 2PO4A 3KTQA 1U2FA 5U47A 4FBTA 2KT5A 4OV1A 2HNYB 4OIXA 1FDBA 3OTCA 4ECZA 4A8YA 4TN2A 4Y2CA 3OFHA 3TUZC 3BEGB 3JSMA 3K59A 2FVCA 4WU2A 3H40A 2DGOA 1NNDA 2DT9A 2EFVA 2A3JA 3C2PA 3MEDA 5B0DA 2VOOA 2PEHA 3M9MB 1JLBA 2KG1A 3MEEB 4HH0A 1KC8T 3KHRA 3H2UB 3H25A 3HJFA 5DLFA 4KC5A 2CQIA 4TY8A 3MR2A 3H4BA 1KOOA 2DR8A 2ZE2B 4IH6A 3ZZUA 2M88A 4WIIA 4OJ1A 4QWBA 3FZ2A 1GXTA 5KT7A 2DR9A 1WI6A 1ZM4A 3AB4B 3H2LA 4ZPVR 3RR7A 2UVRA 2XSJB 3IS9A 1SC6A 1N4LA 2C3MA 1NRKA 5C24B 4MKYA 4OHYA 2GV1A 4C0OC 4A8QA 1WTFA 3DRXA 4Y34A 2UV8G 3MECB 2AP6A 2HHXA 1DAXA 4X4SA 3UCZP 4N41A 1M0SA 2ZH4A 5E2QA 5KT5A 3JTNA 1FTRA 3CDWA 2CZ4A 2Y0SD 1FCAA 5KAKA 5GAEU 1XC9A 1K0VA 2NUHA 2WHOA 1DARA 4ED6A 3CF5Q 4I0WA 2DR7A 1S9GB 1LW0A 1QM9A 5H9FJ 3IXQA 1TK5A 4A46A 4AL7A 3IWXA 4B3TF 1SKRA 2AWZA 1F9FA 2XWYA 1JXLA 5BYQA 2LEBA 4RW9A 1Q53A 2HRYA 4NLDA 2OPSA 3ZFVA 4Y2KA 1JK9B 4RKUC 3OHAA 4YDDB 4PG7A 3RRGA 3OSPA 2N4CA 4UY8T 1CPZA 2DJWA 3BGLA 3T9ZA 1APSA 2VB6A 2YWFA 4YR3A 3JSBA 4CO1A 2ZHBA 4GC7A 3P5TL 3DLKA 1FA0A 3RW6A 1VHFA 1YJVA 2ILYA 4K4TA 4HTIA 4NLGA 3CXCR 4J5OA 1UVKA 4UQTA 3SV4A 1FTCA 4L6V3 4TQRA 2FVRA 3ZZZA 2HW3A 1KSPA 1UVLA 4HH1A 4ICLA 4YFUA 7FD1A 1FO1A 5A8WB 4ID8A 2AJQA 2MKCA 4ECTA 3GQCA 1SIWB 3OBIA 2R8IA 4NCAA 4F8RA 3GFXA 1LWEB 5E3AA 1E6YA 4C2MA 1S1WB 1LWFA 2QZ8A 4J9PA 1IXKA 3UQSA 3OSNA 4NYOA 3R1LA 3IC1A 2OH2A 2LDIA 3L7OA 2R4FA 2RS2A 2XULA 1KLMB 1UFWA 3F56A 3PACA 2R2SA 2BV3A 3AJ1A 3EGNA 2DRBA 2IVMA 2NR0A 3CWJA 4UOCA 2MHNA 5LMNF 4OX7A 2A2CA 2MZJA 3Q22A 1R3NA 1D1UA 2LEPA 5HN0A 2CPYA 1U25A 2W4DA 1TKXA 1N48A 3DRPB 3BSCA 2HWHA 2KFZA 1JLFB 1SH2A 2FHOB 2CQCA 2JOQA 2L9DA 5KTQA 2M7SA 3QIPA 2LXFA 4DOZA 4A8SA 4EEYA 1TAUA 4OX9F 3CTRA 1AW0A 3ULHA 2EKYA 1TAQA 2J0WA 2FB0A 3GYNA 4IOBA 4RBTA 5LSRA 2FLNA 4CTAB 2WB1D 4RLEA 3IAM9 1Y3JA 5KFBA 3CC2S 2LCWA 4E8UA 3BM7A 3I5CA 3BQ2A 1MU2B 2UXBF 1LW0B 2WW8A 3NS5A 5KFEA 2ZUGA 3GILA 1FJ7A 2VQEF 3PFEA 2NXUA 3I56S 3QO9B 4LT6A 2ZNYA 2O5DA 5AXMA 3CCTA 4DSIA 4DR4F 1KEKA 4OMFG 4XIUA 4ZHRA 3W2VA 4QPXA 1S1XA 3GFZA 2HGLA 4IG3A 4DX8H 1IKVA 4RU2A 2IYIA 2UP1A 1SH0A 2HS0A 2V4JB 1YG0A 2FUG9 4CNYA 1ZETA 1S1VB 2UVVA 1L3TA 4WE1A 2V8GA 4JI3F 2E1MC 4B3RF 1RT4A 4WFZA 3K8WA 4N56A 1NJXA 4RUAA 4H54A 3HPOA 1Z1ZA 2YKMB 1YIJS 4F4YA 3CMAS 5KG0A 2U2FA 3M1VA 4IYQA 1Y5LB 1U1LA 2ZH9A 1TV6A 1A7GE 1UJ5A 5F8JA 4ZS6A 2HQIA 2R8HA 2ZOGA 5B09A 2M9KA 2AX1A 3FRYA 2UXDF 4IOCQ 3DRSA 2EI5A 3UDCA 2ZITA 5SUHA 5T41A 4DV2F 4LJMA 4PG5A 1RKJA 2ZZNA 4A8OA 2CPXA 3HO1A 3G8QA 4WFYA 5C25A 3CJKA 5KG5A 5AXNA 1HI8A 2RH3A 2ZFHA 2IBOA 1X9MA 2XMWA 1HNVA 2R9LA 4DSLA 4DSFA 1A6LA 1D9FA 2ACYA 1M5HA 4YQWA 2W7OA 1U1RA 2NSBA 2GC8A 1R8CA 3PM9A 5B0BA 3G8SA 4HYKA 1FK9A 2ZOMA 2CQHA 1U49A 1IJEB 1LK7A 2BACA 2DGQA 5DM7Q 2UUCF 4BWJA 3Q8QB 4NLPA 3BF4A 4ZP8A 1JB0C 1RT6A 4G3IA 2LLZA 4NXNF 2XG8A 4A8KA 2R7TA 3POTB 3DFEA 4FNHA 2KI2A 1TL1B 1X7VA 4O44A 4JI6F 3PJWA 2NYIA 5THWA 4U7UK 4O3QA 1UEVA 3TOQA 5HROB 1DJ0A 1N5QA 2OTJS 1N0UA 1H3DA 3KLIA 4A8WA 4DQIA 2PI4A 2R7VA 2GIRA 2V8DA 3IG1B 2RD5C 3J7Z5 1VQ5S 3TAMA 4MIAA 4FZVA 4OJ3A 5KFOA 2FJVA 5EX3A 4Y28C 1DQ9A 2LU1A 4DDFA 4EBEA 3MD1A 4O3PA 4OZLA 5HLFB 2CQ4A 1VI7A 3KOAA 2PC6A 2K2PA 3OVSA 3MTKA 4OI4A 3H98A 2ZNZA 2FVPA 2J9EA 2DHXA 3LWMA 3JSYA 1P6TA 1LWFB 3CCRS 3CMES 3LANA 2ZC4A 5CCMA 1WWHA 1XK8A 5CA5A 2ZKTA 1UJ4A 2V4RA 3LH2S 1U48A 4LF4F 3PKMA 4ID5B 4ED2A 1FJCA 1HBOB 2XMVA 1RP5A 4I2PB 4FF2A 2XC9A 1U1MA 1TKTA 4BCAA 2XMUA 4QR1A 1FJEB 2GMJA 1U09A 2CPEA 4QW9A 3BSNA 4NA2A 2HNZB 4X4NA 1U1OA 4IRKA 2F7VA 3N5FA 2Y1RI 1QVFR 3CDAA 2GMHA 2UZAA 1UVNA 2ZH3A 4KO0A 1JLCB 1FHTA 2ROGA 4ES1A 4A4JA 2F8HA 2J0XA 4HL9A 1YJUA 4RX6A 1VQ4S 4CT8A 3UD4P 5IM0B 2WB4A 2CQDA 4C8MA 5IWAF 2W9CA 4X4TA 4X4QA 1L3UA 4F67A 4TKTA 3QIDA 2OTLS 2OPPB 1WNEA 2HNDB 4LQ3A 2HMIB 1FNOA 2HWTA 3AAWB 1WEYA 1PGZA 2LA6A 3D5MA 3L09A 1H6KX 1ZAXA 1TKXB 2YX4A 3E8OA 3M8QA 2HHPA 2WAQD 1S97A 1VQKS 3T1YF 3HXMA 1N54B 2X1BA 2PIIA 4G1QB 3LP0A 3Q23A 1R31A 4M94A 3KMQA 4J9LA 1ZBTA 4I69A 1RT3B 3SXLA 3US5A 1Q8LA 5KT2A 4KO0B 1EETB 2DNOA 2RVJA 1IKWB 3OL8A 4DFJA 4TQSA 5A8KB 2ASLA 2CQ1A 3U1NA 5F8GA 1RAJA 1RT1B 2QA2A 3T5JA 2FHJD 2JWNA 5D3GB 3CJ0A 3HDSA 1BWEA 4Y2MA 5EWGA 4LIRA 2DNKA 1X0PA 2CQ2A 2R7SA 1FRHA 1H2VZ 4K2XA 1U7LA 1SV5B 3CVKA 2L9WA 3NNAA 3DLEA 2BQUA 2V2KA 4RW8B 1NJWA 5J2QB 3HHKA 2MJUA 2HAIA 2F40A 4Q44A 2DK2A 4JI0F 1JLEB 3T5KA 1T03B 4QU7A 3MMCB 2RQ4A 4H4OB 4Y00A 1ELOA 1QLNA 4IFYB 3TVYA 2DH9A 3B82A 5GAEI 2APOA 3S6EA 5DQGA 5K8PA 4A47A 5CYQA 4LVOP 5KFIA 1S6QB 4NLSA 4C0HA 3THVA 1VBZA 3QJLA 5KFJA 3UFCX 3K8VA 3C3LA 1UVIA 1KQKA 1C0TA 5CD4H 4FXWA 3MEGB 1QSLA 1RQ0A 4I2QB 5KFHA 2J9DA 2YWHA 3PRDA 1OSDA 4NYZA 1YRTA 4MK8A 1FVQA 1FVSA 2XY5A 1X4EA 2NLWA 3KYLA 3HHDA 5J2NB 4IO1A 2WTFA 1GX6A 2X51A 2XY6A 1HQUB 2JZ5A 2IMOA 1N5YB 3CO9A 4YEAA 5FD1A 4DJBA 4DL3A 4C8LA 4RW7B 3MMCA 4WYLA 5F3TA 1T03A 3MECA 3MMAB 4I2QA 1T3OA 2ZDPA 1ULRA 3FSXA 3N01A 3OR1A 2M8HA