4L6V3

Crystal structure of a virus like photosystem i from the cyanobacterium synechocystis pcc 6803
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
80
structure length
80
Chain Sequence
SHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAAQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Crystal structures of virus-like photosystem I complexes from the mesophilic cyanobacterium Synechocystis PCC 6803.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
total genus 13
structure length 80
sequence length 80
chains with identical sequence C, c
ec nomenclature ec 1.97.1.12: Photosystem I.
pdb deposition date 2013-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF12838 Fer4_7 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4l6v300
1KEKA 1BLUA 2ZVSA 4AYBD 5CHCB 1JNZB 1H7XA 6FD1A 1Y5NB 1BQXA 2Y0SD 1FCAA 5L8RC 2PMZD 2WSFC 1CLFA 3MM6A 5BYRA 3GYXB 3MMBA 3LW5C 1G3OA 1DFDA 2IVFB 1GAOA 1FERA 1Q16B 4CI0B 1FEHA 1FXDA 2Z8QA 1FDDA 2VKRA 5E7OB 2FJBB 3OR2A 1K0TA 1C4AA 1PC4A 1JB0C 4ID8A 1A6LA 1H0HB 2GMHA 3IR6B 5BYQA 3OR2B 2VPYB 1DAXA 3MM8A 2PA8D 3MM9B 1BC6A 1IQZA 3EXYA 3MMCB 2FJAB 1KQFB 1FF2A 1GTEA 2O01C 3MM8B 1B0TA 1FRMA 1GT8A 1D3WA 3MM6B 1WTFA 1FDBA 2C3UA 2GMJA 1GTHA 2WB1D 2VPWB 1H98A 1IR0A 2VPXB 3EGWB 3MMBB 6FDRA 3OR1A 2WSEC 1Y5LB 1R27B 3PNIA 1FD2A 2C3PA 1SJ1A 1F2GA 1PC5A 5FD1A 3OR1B 1ROFA 1F5CA 1FXRA 5BYSA 2FGOA 1HFEL 4Y28C 2FJEB 1FRHA 1VJWA 4DHVA 1Y4ZB 7FD1A 1FRLA 1XERA 1C4CA 1FRXA 4RKUC 1FDNA 2PDAA 1F5BA 2V4JA 1Y5IB 1SIWB 2V2KA 1AXQA 2C3YA 1B0VA 2C3MA 4KT0C 4XDCA 2V4JB 3MM7A 3EUNA 1DURA 2VPZB 2FDNA 4L6V3 3MMAA 3MM7B 3IR5B 1FTCA 1KQGB 3C8YA 4OMFG 2WAQD 3HKZD 1FRIA 4XDDA 1B0PA 2UZAA 3IR7B 3MMAB 7FDRA 2C3OA 3MM5A 2XSJA 5CH7B 1G6BA 2WSCC 4YDDB 4XK8C 1H7WA 1JNRB 4OV1A 1FDAA 3MM9A 1BD6A 1FRJA 2C42A 3MMCA 3MM5B 1SIZA 2XSJB 1RGVA 2FJDB 1BWEA 1FRKA 2FD2A
chains in the Genus database with same CATH superfamily
4JI7J 4AYBD 4DR5J 3JSRA 3RGIA 2ZNZA 3NAIA 2H51B 2E5LF 1LKZA 3R3TA 4RWXA 1UVMA 1LWCA 3CJ8A 2QGFB 1YJNS 1NKEA 1RTDB 1REGX 4NZ6A 2EW9A 2HURA 1R3NA 1VBZA 4J9VA 1RWVB 1HQEA 3FKBA 1I94F 2ZEJA 3FRYA 4WP3A 5IT4A 3Q8SB 2J5AA 3OUYA 4DX6A 1VQ8S 3GMGA 2DNZA 2A0FB 3JQMA 2ZJPQ 3SYZA 3EGVA 5LXRA 1RU2A 5KT7A 2EKNA 2HFUA 2FGOA 4FF4A 4B9TA 5KFZA 3PG9A 4ZJQA 1YRTA 4DPUA 2VG6A 1OY6A 4YQWA 2FZCB 2M52A 5HBMA 2R7VA 5A8WA 3MTJA 4MK8A 3ILJA 3DRXA 3LQVA 3L7OA 1UAWA 1NB7A 4LF8J 2MQMA 3BGLA 3MCNA 1UFLA 3H20A 5D15A 4CH7A 1Q95G 3HJFA 5D4OA 4HEA9 1FRKA 1ZTTA 1B99A 2AEMA 4MMOA 4DLGA 1TL1A 2XHWA 3MAAB 3HMJG 3SMZA 1XIQA 2CXEA 4NE9C 4LMZA 3R97A 1WF1A 4KGMA 5F3TA 1AYEA 1N5VA 3LP2A 5IFMA 3AB2B 1DTTA 4TLQA 2W9BA 1NKBA 4IG0B 1RYRA 4LF5F 2QT7A 4C11B 1PBUA 4EK2A 4OJ1A 2V34A 3B82A 2NPFA 4KGKA 4DV5J 4QYZK 3FJ2A 3ZZTA 3PIOQ 5A2QY 4MIBA 1HBOB 4HR2A 5KTQA 1QAYA 2A6MA 3UDCA 1SJQA 1SJRA 3HVTB 2DIUA 3TRGA 2BR0A 3HD1A 1BQMA 3PJ9A 4J9RA 4RKUC 4OQJA 4B3MJ 4MFBB 2V4QA 1WF2A 3SV3A 2I5JB 1YGYA 2FB0A 1B3TA 2WBRA 2C2OB 3SCLE 1YBTA 1T11A 1RTZA 1SH3A 3LP0B 4GKJF 4JI5F 1HNVB 3FMBA 5J2NA 1CS4A 3PDNA 2HQFA 4ELVA 5T41A 4OZ2A 3D5MA 3F73A 4DG1B 2AIRB 4BLGA 4K4YA 4OZ1A 3GG0A 3MR3A 5J1PA 4JYAJ 1IKYA 1N5QA 3MUTP 1U0SA 4KPCA 4A46A 2UXBJ 1XMQJ 1NM2A 4E98A 2FVPA 1TAQA 1WEYA 4ED6A 2IM3A 1JLFA 4TY8A 2M9KA 2CRLA 2WHOA 3QNWB 4IG3B 2Q3PA 3UCGA 1YBAA 4OX8A 2DHSA 1REVB 1HWUA 2IC3A 1T03A 1U48A 2FHKA 2BMBA 5ITHA 5B0BA 4ZITA 3H98A 3MMJA 4DR5F 2IAJB 4I7FB 2C1EB 4LVOP 2ROEA 1O51A 2V4JB 3ICLA 2W2PP 1RT7A 2EG1A 2CZVC 4L6V3 4OL8A 2P5VA 1Q8IA 2ZFHA 1NDKA 3I32A 3T6BA 4DF4A 3I31A 3PRBA 1B0PA 1S57A 4CYUB 1JLCB 4OHVA 2M88A 1VQPS 1R31A 1EB0A 2G2OA 3M2RA 3QT5A 2YPZA 1TV6B 3GYNA 2MGZB 2XO7A 3FBFA 3E8OA 1K44A 4KE5A 3Q8VA 4H4KC 5LSLA 4X64J 2B4PA 4ER8A 4DUYF 2Z30B 1ZAWA 4E0DA 4QCLA 1VISA 4ED7A 5BXIA 4J9QA 1YLXA 2CQPA 3SSRA 1XMBA 2DGWA 5LM7E 1WF0A 3OJSA 5KFKA 2A6OA 1NK5A 3TUZC 3QSIA 2MLXA 1G2EA 3CVKA 1UJ4A 1FO1A 4NWBA 1RTHA 2EI5A 4NCGB 1UJ6A 3WZ0A 3AT1B 1JXEA 2C28A 1N32J 2KVIA 4DR4F 2GO8A 2VASA 3UR0A 2BABA 3LGMA 3C66A 1VQYA 5KFHA 1M1HA 5DDRC 2E1PA 4K4XA 2UVVA 2H3EB 4CM0A 5ETRA 1C1CA 3CC2S 4K4ZA 3D67A 2RAQA 1VQ6S 4USVA 3MGJA 3FK4A 4F50A 4KV8A 3X1LB 1XMOJ 2XMTA 1MNEA 1BLUA 1UVNA 3SDEB 1JJCB 1S9EA 3HVRA 2C2MB 1KFDA 2PMWA 2HZCA 1S48A 3P49B 4PWUA 5KFPA 5A0YA 2DR6A 1F9FA 3MM9B 3CC4S 3UDLA 1U6FA 5D78A 2DEIA 2Y9HA 2XULA 1JJ4A 1HR0J 3L9ZA 4F4ZA 4DR1J 2L48A 3FC9A 2N7CA 2JX2A 1F6TA 4OZJA 2ZOFA 4F0KA 3CDBA 4LF6F 2KT5A 4NX9A 2FGCA 4B3TJ 1KHVA 2N3LA 4ZP9A 5KFMA 3PV8A 1S1VA 3J7YU 3QRQA 1N8RT 4FF2A 2DR5A 4LF7J 2HS0A 3WX8A 4M5GA 5HVGA 4ECTA 4DF8A 1UTAA 4ZCIA 1HNIB 3F0NA 3TUIC 5J1EB 1RHRB 5DZ6A 3AD7C 1N33J 2DNQA 3T41A 4CWBA 3OXLA 1Z2LA 2ZOMA 2AJ4A 4DL2A 4CH1A 2CIMA 5IS2A 5C42A 4YS2A 5B0GA 4JI6F 4WJBA 3KHGA 1RAOA 4OI1A 2ZOGA 2RHQB 1RWXB 3HO1A 4U8YA 2X51A 3HLUA 4F36A 4NLRA 2UVWA 2YX1A 3E01A 2UUBF 4ZVHA 3J80Y 2OMLA 4LQ3A 2P6SA 2FHJD 1HQUA 1F2GA 3HKWA 3CDAA 2OEKA 3QO9B 5KOXA 4ZN3A 3C14A 2W4DA 3D3CJ 1U7LA 1RAHB 2AW0A 3FSYA 3VV2B 1YITS 4JI0J 1Y00A 4DS5A 2NS1B 3K89A 4CDIA 4ETXA 3H90A 3KDNA 1SCJB 3Q89A 4AE5A 1BD6A 2CYYA 2FLOA 4ZS6A 3Q24A 3ADAC 1LFWA 1XNQF 4F8RA 2QE5A 5FIIA 2HQDA 3UD5A 2NZ4A 2QZ8A 3C16A 3LGNA 4G1QA 2MKJA 5FLXU 2LQJA 2ADCA 1U2RA 2KXHA 2DNRA 2K7KA 2MKHA 2DR9A 4NEZA 4YB6A 2J9DA 2O66A 3F41A 2O67A 1Y5LB 1A9NB 1MU2B 3US5A 2L9NA 1S9GA 1CEZA 1I51B 3V4IA 4LSNA 5FDLB 3BM7A 1KP6A 4DR2J 4IOAQ 1QDUB 3QWPA 1RQ0A 4IDKB 2W2MP 2RNEA 3DLKA 4KAIA 1NPPA 4NZ0A 4PG8A 4RUHA 4NOHA 2Z2ZA 3QT8A 4LR7A 4JI4F 1RHMB 3GLJA 4F4WA 1E6YB 1UEUA 1I5OB 2RS8A 1HNXJ 1FDAA 5BR8J 4KRWA 3RUBL 1JXLA 4RW4A 3M9MB 4P71A 5HQ8A 1EKRA 4CNYA 2W01A 3MMBA 2CJBA 4CI0B 1FERA 2H54B 4ED2A 2WW4A 3CDEA 4B3TF 1HI0P 3R7SB 2COLA 3DU5A 2I2YA 3H5SA 2ZDPA 4CO2A 1CULB 4Y65A 1UETA 4RNOA 1QTNB 1HL6A 5F8NA 1YDLA 4X4QA 1HYSA 2ZNYA 2LA4A 2RMLA 3LTOA 1YZ6A 4ZPWR 2LVWA 4PXCA 3H59A 3VWSA 3ZO7A 5C2GA 4ZVTB 1DJ0A 3H5UA 4ZCMA 4FYYB 3LO3A 2HWIA 3D6FB 4TY9A 5HL7Q 4ZVRB 3QMQA 5KFNA 5AXLA 3C8YA 4NASA 2CNNB 3AD9C 4I67A 3PJWA 1FVQA 4OHYA 2YKOA 4PWWA 4CRJA 2PC6A 3DRSB 4K4VA 2AYBA 2IVYA 2OTJS 1N36F 3NOCA 3R5BA 3ETOA 2HVDA 4Y6IA 4GC6A 4B9VA 4YB5A 3DMJB 2DNOA 3M6XA 2VG5A 4YHHF 2XCAA 4J9LA 4H54A 2JEJA 2JSXA 1ZTWA 3BJYA 4O44B 3BO4A 4X4SA 2AYGA 1SKRA 3WBZA 3R2CJ 5L1KA 4ECSA 1VQNS 1RI7A 4B9LA 5SUHA 2AF6A 2DHAA 5KFXA 1QAIA 3LP2B 2L3MA 2E5IA 1NDPA 2QL5B 2JC1A 2OJ3A 5SZTA 2OHDA 1KNZA 5AXKA 4I6WA 4KKOA 3NGRA 1HPZA 2ZWOA 5IWAJ 2V2QA 2XMVA 4DFMA 2HS3A 1WTBA 1KN6A 5HANA 3B6BA 2RRBA 2RSQA 4HKQA 1SJ3P 3FFIB 4W90B 3DKDA 2C2NA 4A48A 2CPEA 5GMDA 5H9FK 5IZHA 1KOHA 2Y0SD 2QC3A 1P1TA 1TU0B 2Y1LB 2FVRA 4F2SA 3UNGC 1RHKB 4Z7YA 2ZH7A 1U24A 3E51A 2KXFA 2ACMA 2B8PA 4UY85 4I56A 3NWGA 4RW7A 2PMHA 3MF5A 3A8JA 4EU0A 1QVFR 1QTMA 3PO4A 2WB1D 4WFXA 1U8SA 3W5ZA 4FYXB 4WTOB 1IKYB 2A3JA 1NHUA 1HBUA 5BYSA 2JLFA 2GHVC 5A8RA 4XAKA 1NJIT 3T9ZA 3IG1A 1T95A 2CQDA 3C15A 1JLFB 1BMQB 5G0RA 1KC8T 4DV0F 4EEYA 2ASDA 4PCQA 4OX9F 2ZJRQ 4P75A 1WWHA 3G9CA 1YK9A 3HM9A 3NKYA 1FRJA 2M0GB 2AP6A 4JP8A 3UCZP 4RW8A 1S6OA 1W2IA 1M5SA 1CLFA 3V81B 4HHJA 3J7A1 2IMWP 3F56A 5EX3A 2W4CA 4URGA 2J8SA 4USJC 4YDXA 3OFGA 3L7UA 4ID5B 1H0HB 2ZH8A 5D6GA 2MYFA 4N8NA 4ANEA 2A2DA 1C0UB 2BE2A 3NL0A 2IJNA 1B0TA 2DNHA 3A3PB 4P6QA 3H2VE 3QBCA 5DETA 2XNQA 1NRKA 2R7OA 1V3ZA 3B54A 3WIVA 1RAGB 5A76A 5IM0A 3MXHP 2DGTA 2HG4A 3LAKA 1QM9A 2CG8A 2Y1RI 2RRNA 3M2UB 2AU0A 3CXCR 3BR8A 1N4LA 2XS7A 4ZVOB 1FKOA 2V5HG 2I6WA 4F26A 4JI2J 3P45B 2D3UA 2JDJA 5KFEA 1ZS6A 3T5LA 4L3NA 4P74A 1FRIA 1K47A 3KLEA 5E33A 4WCEQ 3GWCA 4ES3A 3CJKA 4C3KA 3IMQJ 1RDRA 5GAEI 1S6PB 3IO1A 4Q5VA 3CCJS 2XGPA 1S4FA 3PKYA 3IM8A 1N34J 1VFJA 1TKTB 1UMJA 2MZQA 1HWLA 3QT6A 1PC4A 2BANB 5ETTA 2VC0A 2UUAF 3D6HB 3Q8UA 2KB2A 1X4AA 3EGNA 3N6NA 3RBEA 3KTQA 1FX4A 2F8EX 5KG6A 3OD2A 2OSQA 4K0KJ 2V9WA 3NEKA 3QATA 2X1GA 3GIKA 1S1UB 2VFUA 4DCJB 1JLEB 2RHSB 3VAFA 4M63A 1HWIA 4EBEA 2E1RA 5E3PA 2JEGA 5F0WA 1JX4A 2YKNB 3D1QA 4PXDA 2ZD1B 4WU2A 2EFGA 4IYQA 5I3QA 3R27A 4F25A 1PIEA 2F4VJ 4WKYA 1PAUB 5LMNJ 4R0JA 1N48A 1JK9B 4ZHRB 3EICA 2CJXB 1SUQB 2XZTB 4DUZJ 2D9OA 4MKVA 2ZVSA 3MR6A 4OZ3A 3W1YC 4X65J 3TNVA 5CABA 1JLGA 2ZH1A 1WDTA 1WG4A 2VQFJ 3N6LA 1AZSB 1Q5VA 1EQ0A 2WVCA 2UP1A 5LSOA 3MM8A 3NCQA 2PA8D 4JUZA 2OTLS 3FSIA 2XC9A 1HBMB 3BGOP 1Q1KA 4OYPA 3FQLA 4PRFA 4ZLNA 1GT8A 1HWJA 2C3UA 1CQMA 2Z2YB 3BZQA 3PO5A 4FPRA 3TP2A 2AYMA 3BQ2A 1TZ0A 2HKEA 2VJVA 2P8IA 1RHQB 2ZHAA 3GQCA 1SV5B 1DQ9A 4X4RA 5C24A 4UY8T 2DO0A 4IOBA 2WOMB 2HBZB 3M6VA 1UZDA 2F8HA 3AH6A 2ASYA 2P6TA 4XDCA 2BJ3A 3IFEA 4WF9Q 5F9LA 4USMA 4WZQA 1M5KC 2WB4A 2E9ZA 4I2QA 4OYBA 5KT3A 1ELOA 1X4BA 2MY7A 4DSLA 3DM2A 4DPXA 4ZPCA 3PW0A 4TNOA 1NSPA 2DT9A 4URSA 1SIZA 2RKIA 2YNHB 3NCPA 3DDNA 1GTEA 3W66A 2KG1A 3KG1A 2QSFA 2CAJA 3HHDA 1Y5NB 3N9UC 2ZH6A 4ECVA 1HHTP 4NMLA 5DO2A 2WRMA 1Z2ZA 3THPA 4L72B 1N6QA 3OR2B 3ULHA 3OJUA 2BJ9A 1BXNA 3N6MA 2H5JB 4TU9A 3TI0A 2I38A 2BE7D 2OO4A 3OR1A 3TX8A 2Q66A 2BKNA 4CLLA 3OTBA 3CF5Q 4QU7A 2OI2A 4I2PA 3C16B 5KFYA 4FBTA 4Y2KA 3I56S 1S0MA 3FMWA 3O1LA 2K7JA 5B7WA 5E5NA 3CCTA 3MEGA 4OMFG 4LIRA 3RAXA 2K1RA 1KLNA 4OV1A 3MMCA 4MK9A 1ZBTA 3Q8YA 4CLTA 4LRDA 3M8RA 2B0GA 3QAUA 4A8KA 1J2VA 5D4PA 2KKHA 3M32B 3UD3P 2GMHA 2CADA 2IYGA 2M8HA 2YNGA 3EZOA 3SCJE 2HGMA 1VBYA 2W1BA 2GJFA 3DOMB 4K2JA 3OL6A 2R2SA 3MMBB 4ITSA 1RT6B 3IBFB 1OYEA 2IRXA 3MFHA 1EARA 1VJQA 4M5NA 3L95X 2YWFA 1KTVA 3KLFA 1BUXA 3M1VA 2CZ4A 2A1BA 4C9DA 2RDDA 3KXDA 2B3TB 5DG8A 4N7TA 3ZZYA 2LECA 2IDEA 1RLDA 4GMKA 2LQBA 3ZZUA 3OSNA 2IY5B 1WHXA 4CO4A 2N7YA 1RWWB 3CCSS 2AT1B 1RTIA 2DNKA 2LP4A 5C2CA 1N5YB 5DGAA 4RUCA 4KHPF 4DLEA 2G4BA 4F3QA 3KLHA 2W8KA 2W7AA 3CCLS 4C6AA 1UW4A 4OX6A 2XSFA 3HHLB 2FLNA 1S59A 4FKYA 2R7UA 1ZZFA 2GJ2A 3W65A 5I3PA 3W5YA 2UUTA 4GVLA 1AT1B 1WTFA 3A3NB 3F44A 4LSZB 2CZ9A 4BC9A 4QIVA 3TJ8A 2PEBA 4ELUA 1IKWB 1AUSL 3GFHA 3T6JA 2C2ZB 4CLKA 3SCIE 2IHR1 3QIDA 2CQ1A 4H4KA 1LW0B 4FNHA 2B5JA 2FQQB 2OD4A 3GR0A 5D8HB 5GAHI 5DDQC 3N0VA 5FLXY 2VZ9A 4EFAC 5HMXA 2V4RA 5GADU 3S7RA 1S1XB 1S6QA 4DDFA 2GFFA 3VZIA 2E44A 3A8EA 4U7CA 3TVKA 4EO8A 2WTFA 1C4AA 2AJ0A 3AFGA 5KFSA 4UT4A 3HT3A 4ZVEA 5LMUJ 4Y3CA 1DAXA 4DL7A 3WC0A 2JLEA 3CCRS 2DGVA 1QY7A 3G8QA 2CUYA 5KFTA 1C0TA 4P2XA 2XWXA 4F4YA 3TWZA 2UUCJ 2JEIA 2ASJA 2KFZA 3CO0P 4QQBA 2KM8C 3SFUA 2QIFA 3O2IA 4JV5J 3UW1A 1L3UA 1RE1B 1VBKA 3CTRA 2WZ1A 3EDRB 3NGUA 3W3SA 4Q0BA 5DM6Q 4J90A 3PKMA 4MJKA 2GZOA 2HMIB 1F9EB 3N4WA 2F3JA 3TAMA 3UO0A 1V3RA 3D9BA 3K5LA 4ERDA 3FZBA 3IWXA 5HROA 4R8UB 3DDKA 3W5XA 3NGKA 3EVOA 2CDRB 3UWTA 2WVEA 4AUKA 1PCAA 5G0RB 2FY8A 4FDFA 3HSDA 1JB0C 4L73A 4LR9A 1V6HA 3JSBA 4LF9J 1X4HA 5C5JA 2WBMA 3VVUA 3CSKA 3LP1A 2FZGB 4LR8A 1LXNA 4C8MA 3PEHA 1XR5A 5DDPC 1F3VA 2GQQA 1APSA 3BN7A 4R0EA 2J8AA 3UVJA 3TEHB 4Q45A 5CCMA 1U47A 2FUG9 4DSEA 3HZEA 2QTWA 5GAGI 1RWNB 2NXJA 1K9MT 1WC5A 2GVDA 5HLFB 1U1RA 4PEOA 1Q7YT 3HULA 4A8WA 1NK7A 1YIJS 2FTRA 3MTKA 1FJ7A 4DBQA 4DFPA 1BWEA 3R1LA 4B17A 1CJVB 3N5FA 2DXEA 3V6JA 4LFCF 1ZPVA 4DJBA 2P2CB 2NSCA 5E3QA 3PW2A 2CJAA 3D0GE 5L46A 2YTCA 1Y10A 2W24A 2H65B 3KLEB 1U0HB 4GKKF 3I5BA 3S1TA 3QT7A 3AA8A 1T8EA 5E0OA 3DI6A 2UU9F 2VIHA 1RT5A 3GV5B 4M5IA 3QLHB 2PD1A 3W9IA 4WTYA 1WI6A 1S0OA 5CYMA 1SJ1A 2V2ZA 3NLCA 4DV6F 5H9EK 2IYIA 2BDPA 1CQNA 3IBCB 3RAQA 1T05A 4Q8EA 2OMOA 2XHCA 2EXUA 5IOLA 1FFGB 4RBTA 5AJ3J 3T1YF 4YY3F 2HK3A 2MDAA 2XY5A 1CJKB 4X4PA 3QSYB 4HTJA 2F63A 3DU6A 1FX2A 4MYTA 4FNIA 4TYAA 5HVHA 3BB5A 3RTVA 1ZAXA 4TYBA 2XLIA 2BV3A 5T14A 4CQ1A 1FXLA 3CCQS 3KNAA 3T1AA 3JAMY 2EFNA 3KJFB 4IFYA 3RRHA 1WSVA 5DRKA 1M5VC 1X31C 1FJGJ 1KDNA 1N0VC 3Q83A 1KSPA 3EXYA 1NK6A 1U45A 1VLOA 4FXWA 4DR6J 3RRGA 2MKCA 3V6HA 3OL8A 5RUBA 2CJYB 1QSLA 2XYPB 5FD1A 4XPCA 4MTPA 1A7GE 3JQKA 4OZ5A 1XBWA 2IA6A 3NBPA 1VS3A 1NZAA 4CH0S 3MM7A 4MH8A 1U1NA 4NLXA 1RT2A 3BGRB 3BQ1A 2J6UA 2HWHA 3DLGA 3AJDA 2VODA 2B51A 1RT4B 5H1SV 1PJ7A 4NRUA 4UF4A 2HLTA 3MM5A 2ZBQA 2ZE2B 5C24B 4URQU 2D69A 1IKVB 1RU1A 1DZ5A 2DB1A 3FBBA 4OZ0A 2DRDA 2PFFB 1NUEA 2GNKA 1S12A 5FJ4A 1S97A 4KSEB 4F7VA 1RT1A 1IBMF 2XMWA 3DRPA 2VJUA 2OGUA 1KBRA 2OELA 4DWIA 1FEHA 3Q8PB 2G0CA 3FCWA 3RW6A 1NSAA 2FC8A 1LOUA 3UD4P 5B0AA 2RKIB 2C2RA 2IM1A 3JTPA 4ZCKA 5KT4A 1LWEB 3ZFVA 4HH1A 2RE1A 4ZJLA 4OV6A 2W9CB 1ZM9A 1EIYB 3MWBA 1UJ5A 3KOAA 4YB7A 3R5DA 3T5KA 4I1TA 2YNIB 4K4UA 5KG2A 2DITA 3QJPA 3PX0A 3LWLA 2QFJA 1X9SA 4TQSA 4ENOA 2AGQA 4DV7J 5EWFA 4JI1J 3FEXB 3G8SA 2GIQA 2JWNA 4G65A 5T7LA 1FD8A 3R5CA 1NSKL 3NGTA 3VAGA 4K2XA 4WK3A 3Q86A 3TQ1A 3I0RB 3U1LA 1D9DA 2YQ0A 2X1BA 4AQYF 3JSYA 3DRRB 4K5RA 1FXDA 3CJ3A 5E7OB 4IR1A 3VCDA 2V8DA 4ICLA 3RG6A 4ED1A 3MMCB 1WKKA 1LQ9A 3IRXA 3D3BJ 1KKHA 4JI8J 2XGQA 3JTNA 1S0VA 4FVMA 1GMWA 3BYPA 3PNIA 1QLNA 1MWZA 4X4TA 1IBLJ 4RU2A 4OJHA 2QA4G 1RT3B 1B7FA 1RWOB 2YNGB 2ZITA 2DY1A 1QAJA 5A8KB 2Y8WA 1TVRA 3CIMA 1WI8A 2MXYA 3H7HB 2W8LA 2EEYA 3GJQB 4FN5A 3GTYX 1FJGF 3RYLA 3RRKA 3M8YA 1FKPA 2CPJA 3VAJA 3CEDA 4K4WA 1NKCA 4DR3J 4X66F 5MLCV 7FD1A 1TFWA 4C0OC 5B0EA 1FCAA 4BCAA 2ZH4A 1LWFA 1RAFB 4ETZA 1QAXA 3OTOF 2MZTA 2MHEA 4C3MA 1K0TA 3W2WB 4RW9B 2VA3A 4DV3F 3KK3B 3RBZA 4DMZA 3PR5B 2B4UA 2FVQA 4F4KA 2DNLA 3GIJA 4YR3A 1L5UA 1P6TA 2R8HA 3CC7S 3K5MA 1Y3KA 3J80U 3CMAS 1NK9A 4QIWD 4CLPA 3JTOA 2RQCA 1B4SA 1TL3B 2PFDA 2EC2A 4A8OA 1W2BR 3UN3A 3CCVS 2VFVA 3M8PA 1MMNA 3QJJA 2VUGA 1HHQA 2DVIA 2QRRA 4USIA 4QR0A 4NL5A 4O3RA 5U47A 2AJ1A 2YH0A 4RBVA 4IO1A 4X62F 1HI1A 2J7UA 2R42A 3DLBA 2RUGA 1VQSA 4OYAA 3G82A 2RH3A 3NNHA 3PX6A 2PMZD 1UA1A 1OWXA 4RNNA 2LQ8A 2OPRA 3ZTOA 3M4XA 5J2PA 2B5JB 1EJ7L 2NXUA 1YJ9S 1IN0A 2HSEB 2ZZTA 3MAQA 1YJWS 1RK8A 2DGUA 2E5HA 1DQ8A 5HMYA 3NGDA 1KLMA 2E9TA 5KFRA 3W9JA 3S8SA 2IM2A 5ETQA 1RCXB 3OL7A 1VGYA 4QR2A 1R0AA 4J9PA 1RBLA 4O4GA 1GH8A 4O4RA 4LF4J 3BO3A 2Z58B 1YRXA 4C8ZA 3JSMA 1X8DA 1TTHB 5ETMA 4DU8A 3PW5A 3MEEA 3WDOA 1LW2B 1MROB 2JLGA 5KG7A 2M7SA 3IAS9 2AEFA 1VQMS 3I4HX 2DKOB 1NO8A 1CJUA 5HP1B 3X3UA 3GYXB 1MN7A 5K14A 3LW5C 1G3OA 3TAMB 3FUYA 4P52A 3B78A 1UWAA 3LF0A 1TKXB 4C0HA 1TL4A 1PILA 1R8CA 1C1BA 1CJTA 3POTB 1UZHA 3MECB 2H9ZA 2H1YA 2HEKA 2HLUA 2KVQE 3AXKA 2CDQA 2Z4PA 5K20B 2GGPA 2XTJP 1R27B 5K5MA 5CZXA 2R2TA 4HT5A 4FXVA 1CBKA 5CYJA 1KD1T 4JV2A 2IA0A 4PG6A 3MFIA 3GG1A 3GIIA 2XS5A 1NJXA 1B0VA 2OEJA 4AL5A 4TU8A 3Q23A 1U09A 2WK4A 1RBOB 2BRLA 3CJ2A 4ILRA 3UQSA 3BSCA 1UW9A 1VDHA 1GX6A 1IQTA 1HMVA 3PEJA 4ZVSB 4ZLLA 4N76A 1O5JA 5DG9A 2BACA 3DLEA 1BQXA 3M6WA 4ED4A 1RHJB 2B43A 1RACB 2OPPB 3DOKB 2HNDB 2WVFA 3EGZA 1Q16B 2UXCF 4J9KA 2KI2A 5JXSA 2KZMA 2ZH2A 5B09A 3W2VA 3U1NA 1XTZA 4P73A 3ENQA 4IRKA 1X0PA 4OI3A 4QU6A 4NYZA 1WEXA 4QIGA 3L09A 2M2BA 1AW0A 1KTQA 1S79A 3D6MB 1OY9A 4KFBA 2Y1IA 1FA0A 3VGSA 4Y28C 1A0OB 2K3KA 2RVJA 4U96A 2DY9A 3PX4A 1OIAA 1NPRA 2HHHJ 1OY8A 5LJ3Y 3JS9A 2V67A 1KR4A 4ECZA 1ZOTA 1MG7A 9RUBA 1I1GA 3DHWC 2LFVA 2OPSA 3QRPA 3T3FA 4DXLA 2ZM6J 3IAM9 3EJMA 1VHIA 1OS5A 2J7WA 3IGNA 4IFVB 3CJQA 4G3IA 2HYIB 2VG7A 1UFWA 2N3OA 2XY7A 3ISNC 4OYWA 4NI2A 2RF2A 2QX0A 4V19X 3G4SS 3CD5A 1KVJA 5BYRA 5J2MB 2IPOB 4A47A 1QUPA 3EPGA 5KFFA 2G0JA 1VHFA 1IVZA 4F4AA 3THVA 2RQMA 1JJHA 3DNCA 3G2XA 3LPYA 4ZPTR 5A6PA 3LOUA 2LEBA 3W61A 2PGCA 2FLPA 2GW8A 1RSCA 4U7UK 4RWWA 4EBCA 4HTIA 3R1HA 2LQ5A 5C25B 4OI4A 1F9HA 5CYQB 3VAMA 2FYXA 1ULRA 1XERA 2KDOA 1ZYQA 2PDAA 3GE9A 4N41A 1WHYA 3DRYA 4B3RJ 1WC3A 1UWBA 1RWMB 4PQUB 3UR3C 1Y9OA 2Q1LA 2HBRB 2B9YA 2R7XA 4KB7A 4C4WA 2XSJB 3NBPB 4RW6A 1CSJA 4OYXA 3ITHB 3IA0A 4NLQA 2WCXA 3DLGB 4ECQA 1IKXA 1YJVA 2VKRA 2FJBB 3T5HA 2GHWA 4LSLA 3MEDA 2AV5A 4KJIA 3OTCA 4K5SA 3K8WA 1BWVA 2KHDA 1TKDA 2HVEA 3M30A 1HBNA 5I42A 4WFAQ 3E2EA 2CQ2A 3P3DA 4LRAA 1KQKA 2UV8A 4DX8H 4P9SA 1S1TB 3NNAA 2VBZA 1FRLA 1UVLA 4AL7A 4LBIA 2HNYA 1CPZA 1IBKF 1TL7A 3LGHA 5HATA 1X5SA 5KAKA 4ZKAA 1RB0A 1IR1A 1GMWD 1FK9A 4DX5A 3I9ZA 3MMAB 2G0IA 3K2YA 3MD1A 3TZYA 4DL4A 3KJNB 4RL1A 2J0SD 2MZ1A 4WK1A 2C42A 2FJDB 2H48B 1SJ4P 3KDOA 4HVZA 5CD4H 2J9CA 2V9KA 2CQGA 4LFAF 2B6AB 2YQ3A 4RU9A 3M8ZA 2W9AA 1WC4A 3VQTA 4PWDA 2MZSA 1JKHB 4DL3A 1BE4A 4LFBJ 1KS2A 3QZ8A 3DYAB 2CPDA 2PEHA 4FPIA 4DV4J 1EZZB 3KJVB 3ZTSA 3DOLA 1KOOA 1L3SA 2ZWPA 4OX7A 4CTAA 1NBEB 5JUMA 3SQGA 3K17A 1PC5A 5D0EA 2OPQA 1FESA 2MLZA 2Y1JA 5D77A 2BQ3A 1T9XA 1YWXA 2ATCB 3EDQB 4WE1B 4C0BA 1D1UA 4OZLA 4ECWA 2APOA 2XMMA 3TZXA 4B08A 4Q43A 3BBBA 3M2VA 1KQGB 2VQEJ 1LEOA 1H3DA 1IWAA 3C6TB 3Q0AA 3ONQA 3M8QB 4ECRA 2BJEA 4NXNJ 2KJVA 3NCRA 1XWLA 3NRBA 5B0FA 3WC2A 3C6UB 2GV1A 3IXQA 4EYHB 2G1DA 3B4MA 4JI3J 2KH9A 1GAOA 1Y11A 4IH7A 1TKZB 4YEAA 2AHOB 4UQGA 2X7IA 2YVSA 3KK1A 4KGVB 2F9DA 5F8MA 4JI7F 1FF2A 3CB4A 5JVHQ 5EX0A 5L9NA 2UXDJ 3VZHA 3O6QA 5D0GA 2HBYB 4HH0A 4ZJOA 1XJWB 1S7HA 1JXVA 4NLYA 3TQEA 4PPDA 4DL6A 2D41A 4C8LA 2BYCA 3JB9k 4OHZA 2OAUA 1VRUB 1M1GA 3VAIA 4OJGA 3MOZA 2R7SA 1T0TV 3W7BA 1FTCA 4Q2MA 4DV1J 1JLQA 4B02A 3H40A 1U8WA 4RUBA 4ALZA 4OI6A 2OP5A 1VQ5S 2W25A 8AT1B 1TK0A 2M8DB 1U1KA 2CPYA 1RTDA 3M9NB 2E5GA 4BWJA 3D0IE 3WIUA 2GAGC 4GRSA 3NMRA 4LF8F 1XNRJ 3ZTPA 3IR6B 3H5YA 5BJRA 4F3MA 4LT6A 1DARA 1E6VB 5AXNA 3TO8A 1T02A 5KG5A 2DYAA 3I0SB 2B9EA 4K50A 1DY3A 3MR2A 3BR9A 2H4WB 4ZVGA 2GX8A 2AZ1A 4I0WA 2C3PA 2YPYA 1SH0A 2N4DA 3D6TB 2XCPA 1DLOB 2QLXA 1C4CA 3G6XA 2PI4A 2IVMA 2L08A 2BE9B 3IN5A 5F8JA 3MDFA 2EG2A 2HNZB 4CNZA 3I55S 4DV5F 3G71S 2HK2A 2M3DA 4G6VB 3U1MA 2PT0A 4HACB 4J91A 5HSPA 4ECUA 3JQJA 3NNCA 1G6BA 1OPZA 3A12A 3TARA 3C46A 1NPKA 4ZN1A 3MAAA 4B3MF 4TVAB 4RBUA 3OFHA 4XTTA 2AZ3A 2IM0A 3PW7A 2NXCA 2Z56B 2KFYA 2B4VA 2NXNA 2YQ1A 4IG0A 2L41A 4C11A 4P72A 1QVGR 4WYWA 5LJ5Y 1T7PA 3D54A 4ES1A 3CJ5A 2MB0B 1HBOA 1WOOA 3ET6A 5EHHA 2CPXA 2DHXA 2FZKB 4LRBA 4C48A 5C7PA 4EO6A 4C97A 4JYAF 5ADZA 3HVTA 1O6XA 4J9UE 2RRAA 2ATLA 2UXBF 3RJMB 2XMUA 1XMQF 1FRHA 3GU0A 4MFBA 3OVSA 1X9MA 3G96A 3NS6A 1DRZA 2I5JA 3PRDA 1NHVA 4F67A 2IRYA 2KO1A 2W2OP 2RT3A 1QSYA 3LP0A 1U1LA 1HNVA 2QLJB 2UZAA 3FZ2A 2VONA 2VFSA 2X3DA 3PYFA 2BOAA 4UZBA 4FVCA 2GJIA 4M1KA 3KUGA 1R8BA 2QL7B 1RTJB 4DG1A 1XN9A 2GA7A 1S1WB 3V6DB 4B3OA 5HAOA 4ZCLA 1R8AA 1NH7A 4QW8A 1HMVB 1EP4B 4OLPA 1WC1A 3GSDA 3KLIB 3DLHA 4IG3A 1REVA 3ISZA 1SKUB 3MUVP 3KKFA 4X64F 2X1FA 3GZ7A 1OMSA 2IAJA 3LUYA 5J2QB 2YWHA 4F0MA 4I7FA 2I1RA 3KUEA 2V4JA 3SIPB 4H4MB 3N28A 1WDDA 2M4MA 3CT9A 5KG3A 1XNRF 4N56A 3JYTB 4NLDA 4CYUA 1JLCA 1AFIA 4GO5X 2J0WA 2VV5A 4FYDA 1N32F 5D3GB 1UPMB 3GJSB 2HFVA 5IV4A 2VC1A 1SQFA 4B3SJ 4CLYA 1D09B 3AQOA 3G86A 4J37A 3OLAA 5IT9U 5JJBA 1GK8A 3IS9B 3DDIA 3R5GA 4TXSA 2MKIA 1OJ4A 5K8MA 2ZKUA 1XMOF 1KVKA 2VG7B 1I3OB 1RZMA 4NI2B 2BM1A 2QA2A 4NCGA 3GFYA 4DFJA 1Q8LA 3AXMA 4KYZA 4DPOA 1H98A 1T9WA 4KO0A 5EDWA 3FBEA 2MMYA 1F0XA 4G1IA 4GVBB 2HFSA 1QE1B 3TR5A 4Y2CA 4FS1A 3BGUA 4X4VA 2NYHA 4KBIA 2FLLA 4PKDB 1JWWA 4WFZA 2GHPA 3KG0A 1HR0F 4DR1F 1RYSA 2IBOA 4NYOA 4WXWA 3AOCA 2V63A 1WG1A 2O5DA 4DQSA 3UNYA 1VQ4S 3KLGA 4X4UA 4Q7AA 4BBYA 2VBXA 3ETMA 3SDEA 3I4PA 2GS8A 4OYMA 3BKTA 2N82B 3PR4A 1S10A 2HAIA 2PE8A 3BGFA 1HI8A 4OFZA 2DBBA 5I4MA 1UWBB 4LF7F 2B7CB 2HQCA 4J9MA 7AT1B 3CD0A 3FGVA 1LWCB 2E7XA 1NH8A 1VMBA 1MWYA 1ZA2B 1HQEB 1X4FA 1N33F 2V8VA 2H5IB 3S6EA 3OUYB 3CD6S 3NWRA 5L1IA 4ZPDA 3PY8A 3CWJA 3AJ1A 2NPIA 3M7VA 2Y0BB 4QZVB 4G1PA 1P9YA 2E7VA 1Z1ZA 1B64A 4WBFA 4DR7J 4MYUA 2V2KA 2EBEA 4GC7A 5KFGA 3CPWR 4KT0C 2OIHA 2VG6B 1HD0A 3H2UB 4ANCA 3VGVA 2E5LJ 2QMUB 1MN9A 5HBMB 3TA1A 5E2QA 3DGVA 5A8WB 3P8BB 4WIQA 3MR7A 4OI2A 3CDUA 2VBYA 4USHA 5J1EA 3UCUP 4DQRA 3HK2A 1I94J 4QIEA 4IH6A 3DLJA 2UV8G 3UPFA 4QYZJ 5B0CA 1VRQC 3P96A 4WXOA 4USTA 4JI0F 1K73T 2BKPA 1TL1B 5DLFA 3HXMA 4F02A 1ZPWX 1QSSA 4YR0A 3NS7B 4HLBA 2LXIA 1GQEA 4H4OA 4KR0B 5IV3A 4ANDA 4ZLJA 3D66A 1R0BG 1JIHA 3TVZA 2CWXA 4EZ6A 2IBKA 1RUSA 1DTTB 2W9BB 4DQIA 4OLOA 4GO7X 3QQCD 1XC9A 4P10A 3QO9A 3OXGA 3HZGA 4IUFA 1Q81T 4EYIB 4YOEA 3T5JA 1F5BA 2KZZA 3J7AN 1RAEB 2XO6A 4X2BA 1BQMB 4ED3A 4I69A 2L9WA 1VQ7S 3R6GB 1DURA 1M1KT 4Y0FA 4M5HA 3SQGB 4CO1A 2NUUG 4NMXA 4DR2F 3BH7B 1RWKB 2DO4A 3HHNB 1CC7A 4LF5J 5J2NB 1ICEB 4O3PA 1CS4B 4P7TA 4J9NA 2A2CA 4CO0A 1YTYA 4ZIVA 2C2EA 4FYWB 3JAMU 2XMJA 2BOPA 4Z37A 2A18A 4ZVQB 2OD6A 2OFHX 1NK0A 2HBQB 3FNNA 4A8MP 1HNXF 5BR8F 2RDIA 2KJWA 5LL6d 3ZTRA 1GEHA 2O01C 2QLBB 3HHKA 3W8GA 3MCMA 1BHNA 1L3TA 3ILOA 2MZRA 1MU2A 2F65A 4RJVA 6FDRA 1H74A 4TY8B 5FDLA 2BW7A 4AXJA 2IC3B 1T03B 4IDKA 4GKJJ 4JI5J 2ZBPA 1YKWA 2DH9A 4TQRA 2VB6A 3Q8QB 4UW2A 3HJVA 3OHAA 3LPEA 1AROP 1UVJA 1MWQA 2MQ8A 1E6YA 1JQGA 5D0HA 4YUDA 1RT7B 4PG5A 3SCKE 5MAOA 2U2FA 3HP6A 2VHGA 2DGXA 2G2ZA 3KNGA 2XZWA 3HFVA 1KEKA 1NK8A 6FD1A 1FWLA 3GCXP 1BQNA 5J1NA 3M2RB 2XNRA 4ZPVR 4EGLA 2KT3A 1NZ8A 1VQ9S 3H4DA 1JLQB 1CG2A 2AMCB 4PR6A 5F8IA 4NLPA 1S49A 1CULA 4DR7F 1PSDA 4A4JA 3D7SB 4WP9A 2HFZA 2HHTA 5IXUA 4BS2A 2LEPA 2E5JA 5KT6A 5KG0A 3GILA 4DSJA 4UUXA 4DN0A 3D1HA 2VPXB 1SL2A 3SZ2A 4NLUA 4RUAA 4PABA 1FWKA 1RTHB 5KFJA 1YVFA 4EZ9A 2XLJA 2DR8A 3BEGB 3E3XA 2DNGA 4C8OA 3EVWA 1OSDA 1PKUA 5I3UA 1KVIA 2ZBCA 1GX5A 2PO4A 2YNFA 5ETLA 3TJ9A 3QAEA 4DUYJ 1C1CB 2HFNA 3QZ7A 2KHCA 3DRSA 4QWAA 2YH1A 1Y0HA 1BGXT 3THTA 3OLBA 5CHCB 4KV8B 1WUUA 2Q43A 3KYLA 2XLKA 5IWAF 1D9AA 1MLAA 1T9UA 3DMJA 3ZZRA 2HHXA 4DOZA 4IOCQ 3IM9A 1S9EB 5A6WA 1FDDA 3IC1A 1DTQA 4O44A 3I82A 3N01A 5KFOA 4DR4J 4Y00A 1JLAA 4LF2A 1UKUA 2JVRA 3NP5A 3TAPA 2F40A 5HVFA 5A0YB 5F3ZA 1H72C 3OQ2A 3TW0A 1VR6A 3CD7A 4OYOA 2MJNA 1C2PA 3N5BA 5CAAA 5LSRA 3K0JA 1W26A 4F2RA 4ILMA 3PCOB 1N56A 4IR9A 1VQLS 3LWMA 1CC8A 3A4TA 4NLWA 1WKJA 1UEKA 1HIYA 1URRA 4ZDNA 1DQAA 1YX2A 2LYVA 2BA9A 1RCOB 2MKSA 2LCWA 3CCES 1PYSB 3ET6B 1R0CB 1S1VB 3TX0A 3Q2SC 3FFIA 3GIMA 1NAQA 3QFWA 2ZBIA 2CQHA 4XK8C 4QBUA 2I0XA 3UDVA 4F0HA 2QEXS 2CJ9A 3FCVA 3OBIA 4ZMMA 3MM6A 3MEKA 1G1XA 2V2VA 4A8QA 3HI9A 3CCMS 1VLYA 1HNWJ 5C42B 3BDEA 4LF6J 2DRAA 3IP0A 1VC6A 4OYIA 2HPUA 2DK2A 1FRMA 5M2RA 2DHGA 2FJXA 2PA3A 1KRPA 2CQ0A 3E01B 1HD1A 4B3OB 2VL1A 1M5PC 1U1MA 2BJDA 2XYGB 1JJ2R 3ENWA 1HQUB 1NLKL 4RZRA 4FXDA 1KHWA 3R2DJ 3C14B 1O0PA 3D28A 3HCXA 2JZ5A 5K8OA 3HHEA 3BSNA 3NS5A 5GAHU 4HYKA 3HSJA 1YQHA 4W4MA 2EPIA 3BREA 5E3AA 4KTQA 1LWXA 2FHMA 4FBUA 4JI6J 1OQ6A 3BQ0A 1TFYA 3T1HJ 5LOQA 1Y7PA 1PJ6A 2EFPA 2M70A 1SL0A 3V81A 2F8MA 3FDSA 2GAHC 3FEZA 1JMTA 4JI2F 5G4DA 2RUSA 2VF3A 2LEAA 3DXBA 2UUBJ 2ZJQQ 1SKSA 1RHUB 1AA1B 4ID5A 2LMIA 2D3OR 2CNKB 2IMOA 4ID8A 3M05A 1C0UA 3MPYA 4I6YA 1HW8A 3HVAA 4G1QB 5AXMA 2OLWA 2F7VA 2R7TA 1SQGA 2CPZA 8ATCB 3AD8C 1S99A 2MZJA 1N34F 3TA0A 2VU5A 1U4BA 3PTWA 4N47A 3M2UA 2P9GA 5ETPA 1IUJA 2FJWA 1Y4ZB 1S9GB 1VQKS 3V4IB 4LSNB 1ZM3A 4K0KF 1TMJA 3KUHA 4IQXA 3A13A 1EQMA 3MI7X 2GIFA 4BWMA 3SQOP 1XNQJ 2KU7A 3DLKB 1SI9A 3EZ5A 4KO0B 4AFFA 2CPIA 1U1QA 2ZHBA 2JL9A 1R7IA 1Z4UA 2Y3YA 3CE8A 2L9DA 3SFGA 3RBDA 1S6PA 2DPJA 2ROPA 1EHWA 2AKWB 4QR1A 4WZMA 4KGZB 3CMES 1TKTA 2JJ4D 2F4VF 4RW4B 2BANA 1U02A 2IVFB 5LMNF 3HVWA 4I4BA 4KC5A 1DBDA 3CCZA 5F8LA 4V19J 1V5VA 2Z2LA 3KLGB 1A6LA 4DUZF 5F9NA 2QYGA 1S1UA 1OO0B 4X65F 1JLEA 3RB3A 1R8PA 2MSSA 2VQFF 3PFEA 3QIPA 2XWYA 3CUNA 4RPFA 3W64A 4JI4J 4O0IA 5GAGU 1HYSB 3HSZA 4DPTA 2YKNA 3NG8A 2ZD1A 3EX7B 2CG4A 1QD1A 2MQOA 2C3MA 1HLWA 4MKBA 1WHWA 3PYDA 1HNWF 3SSSA 4ZHRA 4NLTA 3H4BA 1SUQA 4OZNA 4YDDB 5L38A 2RS2A 5DQGA 3LAMA 5GMKa 3TEGA 5KFCA 2MY8A 2HQIA 1U26A 1AZSA 4DQQA 2EC0A 4N8OA 1ZH5A 3QGPA 1HARA 3MAHA 1HBMA 2R4FA 1EKSA 3I87A 1PYOB 4UOFA 5IT0A 5AE1A 2YX4A 2I9SA 2VG5B 4ZP7A 2OUGA 1KQFB 5HN0A 1XK8A 2FHOB 4Y2IA 3A3OB 3V6KA 5L9XA 2ZC3A 4PQAA 5D4LA 3T1HF 1J5OA 3QPIA 2LXUA 1FD2A 1PGZA 1SV5A 1YJTA 1NDLA 5H9FJ 4QOTA 2WOMA 4DL5A 1VJWA 4H4OB 3HD2A 2DNYA 2ZHOA 2ZC4A 2CVEA 2C3YA 1N36J 3FVYA 1HNZJ 4WFNQ 2FPHX 1RXOB 4KKOB 1L3KA 5IT9Y 1HPZB 4ZLPA 2VOOA 4DV2J 1S0NA 2YNHA 4YHHJ 2GVZA 3Q22A 1ZA1B 3UI3A 3MCOA 2HRTA 1S76D 2IJFA 2NXEA 3D0HE 1Q8BA 4XO0A 1P9QC 3KHHA 5D4NA 3IBWA 5K8NA 2R7WA 2J0QD 3OR2A 3TAQA 2BM0A 2YBVA 2V94A 2ZDOA 1Q78A 4NA2A 1FFSB 4RW7B 3GFXA 2FIUA 1VQOS 3FEYB 1SPBP 3K5OA 4NZ7A 5HQMA 3DLLQ 1HBUB 3KLVA 2CNLB 1KONA 3CJ4A 5A8RB 2XYHB 3MURP 1U49A 3K59A 1YJ7A 3PHEA 3BPDA 3IG1B 1SC6A 4O3NA 4TKTA 3C15B 3HDSA 5D0RA 4ZVFA 2HHUA 4AL6A 3RBXA 1UVKA 3VF0B 2LQ9A 2A10A 1NDCA 3MPDA 4RW8B 2R2UA 3M32A 4YB1P 2F9JA 5ETNA 1GXLA 1FKAF 2DJWA 2CQIA 1URNA 2R8GA 3O5TB 4NCAA 3DOMA 1SL1A 3KFWX 3P6YC 1BQNB 2BE2B 3C2PA 4FF1A 2W2NP 1RT6A 4OJ3A 5CXTA 4K8RA 4M5JA 4DV0J 4OX9J 5KFVA 2K3IA 4M8LA 5IM0B 4LQ9A 2OEMA 4C98A 3EXCX 2CWKA 3H0PA 2R8IA 2ZH5A 1WORA 2BBEA 1FKOB 1UEVA 1PYTA 2K2PA 2WW8A 1RABB 2J9DE 2Y8YA 3J7YI 3DC2A 3QGHA 3P5BP 2J76E 1N5YA 3ISND 4O23A 4CLFA 1RP5A 4OYZA 3CJKB 3A1YG 4B9MA 5I3UB 3VTIA 3OV7A 3DHXA 3PJXA 4QIFA 2ADBA 2YNFB 3HFZB 1DFDA 4QPTA 3HHLA 2UUWA 1RADB 3BYRA 4P7VA 2LXFA 1Q4RA 2VDHA 1RAIB 2HHQA 9ATCB 1T3OA 4IRDA 1SC3B 1HNZF 4WWSA 1T9VA 3J81Y 4DV2F 1IKWA 1TP7A 2YWWA 1TMMA 2AJFE 1DTQB 2J6TA 1YJRA 5LMUF 4DSKA 3H2LA 3VQSA 1JLAB 1VYAA 3IWLA 4ZIWA 1LW0A 2DGQA 2HRYA 2NUHA 1F2HA 2UUCF 2VD3A 2RQ4A 4E8UA 3MUMP 4XDDA 4NLSA 2KRRA 1U1PA 2UUAJ 2JFDA 5HO4A 4JV0A 4JV5F 3R5AA 1S1XA 4K7QA 1X5OA 4IH5A 4QW9A 3NGSA 1TAUA 3FSXA 2BVZA 2AEJA 1WACA 3IWNC 1UPPA 4RNHA 4Y2AA 3SI8A 3MD3A 4DX7A 4Z2XA 1JLGB 3I6PA 1HW9A 1Q86T 2B4OA 3BPSP 5DG7A 2SXLA 4CP5A 3J81j 3MM8B 1H73A 4W98A 2HIQA 2LU2A 3M6UA 3MM6B 4XIUA 2HZAA 3UFCX 2BW2A 5ETSA 2LDIA 1R43A 1M90T 1QJHA 2YWGA 1F5CA 2BJ7A 4HDGA 1NHKL 1R89A 3U02A 3SSQA 4PXEA 4LF9F 2CJQA 2F1FA 2HMIA 1YI2S 1FTRA 4EUVA 1FT8A 3AOBA 2YY3A 4WPAA 5IC6B 1X60A 1X0FA 3B4DA 3HT0A 2HVZA 4I2QB 2DNPA 1YRUA 2QN6B 3ENVA 1LXJA 2JC0A 2J7KA 2YX7A 3DM2B 1RAAB 2MKYA 2W7PA 1TR0A 3EM1A 2H5EA 3D68A 2BJ8A 5DGBA 4R8UA 3K8VA 1WJ9A 2KTQA 2AGOA 4ZVUB 1K1QA 4DSIA 4EBDA 2BQRA 1TL5A 5B0DA 4HI2A 4U6PA 2JFKA 3BSOA 4F04B 2VPYB 5L1LA 3NXZA 4R5PA 2ERRA 1BC6A 1WHVA 2Z0GA 5K8PA 1Q7LB 1S72S 4DQPA 1N6QB 2CKWA 2QYCA 1EX8A 1PG5B 3RU0A 2VPWB 6AT1B 4HHHA 3OR1B 2ZUGA 3GIRA 1V3SA 2FJEB 3P5TL 2WONA 2BEFA 2MQNA 4I2PB 2KYXA 5HLFA 2ASLA 2R8KA 2QMWA 3V2UC 2NCKL 4CLUA 2EVZA 4C8KA 2IJRA 4F3OA 1G7CB 3MEGB 2NR0A 1L3VA 4UOGA 1H7WA 5AJ3F 2K1RB 1IWGA 3RR8A 1CJVA 1K0VA 2YWEA 3BDPA 4UUWA 2DXDA 2XY6A 3GFZA 1OPIA 3VAKA 3DCAA 3CCWA 1W25A 1U0HA 4NYPA 2LDYA 1VC5A 1IBCB 2DCUB 4AD6A 1IQZA 2HS4A 3GR1A 1NXIA 2B9WA 2I8EA 1M5OC 3QLHA 3V5RA 4U95A 2E29A 3MPWA 4MT1A 4X4NA 4ECYA 1LV5A 2POKA 3K5NA 1CJKA 4PG7A 1TK8A 3W63A 4DR6F 1QUVA 1W7WA 1XR6A 2QLFB 1RWUA 4NXMJ 3KLFB 3M1VB 2CJKA 3BF4A 3QIPB 2LKZA 1R6YA 3PVXA 4ED5A 4M5DA 1WSRA 1Q82T 4QYRA 1FEEA 1H7XA 1O8BA 1UP1A 1RTIB 2B56A 4TU7A 2AX1A 2J9EA 3HX9A 3W9HA 2BJ1A 3KLHB 4XPEA 2X1AA 3VGTA 4TLRA 4A8SA 3A8IA 3CCUS 5E41A 1ZM4A 5EWGA 1LFPA 1SB6A 4O3QA 2OKQA 4OHWA 1GXUA 3W62A 3MCSA 1X7VA 4N77A 3PM9A 1J27A 2MHNA 4PYDA 1S77D 4M5MA 1SIWB 2HAFA 5HJXA 1NU4A 2IFXA 5HJYA 3BGRA 2XM3A 4KHPJ 1RT4A 2HHWA 1J5OB 3IR5B 2C2DA 3PYEA 2DRBA 2ZE2A 3OW2R 1IKVA 1NB2A 2JRSA 1Y3JA 1JNRB 2QFIA 3R7NB 1R8HA 3BH6B 2WSFC 4A8YA 2AWZA 4M94A 1AUDA 1S6QB 4DEZA 4PZVA 2G13A 1SQEA 4YP3A 4DV7F 5HMWA 3ZZOA 4ELTA 4JI1F 2EK6A 3TANA 4Y2MA 3QGIA 4MIAA 2GVZB 3MOJB 4PAAA 1LWEA 4MK7A 4NRTA 2H4YB 1NJYA 2R7RA 2VICA 4B9NA 2ZZNA 3C3LA 3H25A 3TUPA 3M9OB 4CCHA 4WYLA 2W9CA 1BY9A 2MSTA 5E3CA 4C7QA 3EGWB 1IR0A 3BV8A 1C0TB 1XEZA 3A8KA 4KH1B 1TQLA 2VFRA 2YNIA 3I96A 4D3GA 2JHEA 3VR1A 2PN6A 1NK4A 5KFLA 3OFEA 1FRXA 1FDNA 2AQ4A 2XEXA 3CJ0A 4CO5A 4KGXB 1T3NA 1JLBA 2NYIA 3K7RA 4JI8F 4KIAA 5F41A 4Q0BB 2VOPA 4WU3A 3AJ2A 3LANA 1AB8A 2IIHA 4C3LA 2CNOB 5CA5A 1IBLF 2F5GA 3AHPA 2D74B 3W60A 1F3FA 3I0RA 3GONA 2P9CA 2D9PA 2PSZA 3CW2C 1KFSA 2UVRA 3LALA 1OYDA 3BBFA 3DRRA 3NMAA 3BO2A 3L7PA 5HROB 1X4EA 2XI3A 1TELA 2Q6BA 5EN1A 1NEEA 3H5XA 4DCPB 1UVIA 1T9YA 1UCNA 2CA9A 3RAMA 4Z7CA 2GQCA 5K9FA 3C19A 4DR3F 1YG0A 3SBMA 2GIRA 2DIVA 3KHRA 3HF5A 1V5IB 4ED0A 4NXMF 1LK7A 3CO9A 3ZNJ1 4BDPA 1EAYC 4HL9A 3LP1B 3HHLD 4DL0C 4AT1B 1MMDA 1RT3A 4LUBA 5ETKA 2ABYA 3R6LB 3AODA 2LA6A 5A8KA 1N5SA 3TZZA 1Q79A 4CO3A 3UVJB 2FC9A 4DPWA 4IO9Q 1RKJA 1VK8A 2GVDB 3ILIA 3PW4A 2HHSA 1D8ZA 3KG4A 3ZC4A 2EWHA 5LXYA 1KWMA 1K8AT 3IR7B 2HWTA 4Q44A 4U9RA 2IRUA 1VRTA 4DSFA 3ZTQA 4E2FB 2Q6CA 1RGVA 3ENAA 3PZPA 2W7OA 3RB6A 3KMSA 4CT9A 1U6ZA 5H9EJ 2BRKA 3W2WA 2HW3A 4RW9A 1VIOA 3HPOA 5KOWA 2RQKA 2RJZA 3KK3A 1NJWA 1VIXA 3VHQA 4FP9A 2QO3A 4ZA1A 5KFBA 4WKRA 1RA6A 1OSCA 2BX6A 3Q8RB 1S4EA 1MMLA 2B7BB 1LNQA 3I5CA 4ZPBA 3DI6B 1RT5B 1TL3A 4L76A 4RNFA 1SC1B 2B9XA 4KHMA 4LREA 2O3DA 3KMQA 1FHTA 2ILZA 2KRBA 8RUCA 2DEJA 5CYMB 3UN2A 5HQLA 1CVJA 4LBPA 3JXOA 1T05B 3AB4B 1GMVA 2DPIA 1FI4A 2MJUA 3EUNA 1SBRA 4ZPAA 4LFCJ 4BHQA 1PO6A 4WFYA 1UFKA 4NLOA 2J0XA 2C2KB 2QJ3A 4HDHA 2FJVA 2OFGX 2YKQA 2YKMA 2DH8A 2E1MC 1G4CA 3EMTA 2WSCC 2D3ZA 4GKKJ 5AE3A 2PI5A 2JEFA 3UN5A 2MEWA 2FD2A 1GFWB 3CMQA 2WVBA 4KQZA 5L8RC 3K58A 4PPZA 4LF4F 2UU9J 5EGYA 5KFQA 3D4JA 3GJTB 3ZZZA 3TZWA 2OSRA 4B9SA 1X4CA 4FKXA 4DV6J 2Z57B 1MSWD 3ILLA 4IFYB 1PAEX 1AFJA 2RU9A 3R7BB 1PBAA 3PRVA 5CCLA 3T1YJ 4I68A 2HGNA 1RBAA 2RIJA 4YY3J 4RLEA 3PYGA 2M5YA 1GXTA 3H8YA 2GCFA 3V4MA 1F5AA 2QLWA 3GP9A 2XBPA 2DNNA 3EWGA 2CPHA 2FVCA 1M5HA 1IJFB 2DTJA 2DNMA 3AAWB 3MM7B 4YFUA 3KK2A 3CNQP 5DLGA 4USKA 1RT2B 4UOCA 1LW2A 4LBHA 1MROA 1GNKA 4RNMA 1K1SA 5L1JA 4YR2A 3UE2A 3AQPA 3G87A 3MM5B 5HP1A 3H42A 2E1AA 1RA7A 4PUOA 5DQHA 5JMNA 2ZBRA 1P1LA 1RT1B 1TKXA 3CIZA 1XQIA 3DRPB 2QG9B 1RAJA 3O8WA 1MW7A 1J5EJ 3POTA 3MECA 3EZUA 2MQLA 5DDOC 3AY0A 3M8WA 4ZP8A 4M5KA 2EBGA 4K4SA 2V6AA 4F4XA 1U25A 3QJLA 3OXFA 3R5JB 2V0NA 3OVAA 5IC4B 4R5PB 3DN9A 3G6VA 4IKAA 3DGPA 3PIPQ 1AXQA 4KPYA 3G6ES 1IBMJ 2MQQA 2W2QP 4R25A 1WG5A 3MPVA 3EVMA 4L74A 1Q53A 1IM4A 2WONB 4ZP6A 5T7LB 3ZXWA 4JB8B 4C8YA 1H6KX 2OPPA 3DOKA 2HNDA 3D2WA 2ZUAA 3P4UB 4QJVA 2HHHF 4KHRA 2KL8A 3CDWA 1X5TA 1H2TZ 2EKYA 3QGGA 4LIWA 2ZM6F 4P2SA 1NMEB 1EETA 3OL9A 3GCWP 1N52B 3PACA 5DZ7A 3MR5A 4ICLB 3GSIA 3QYYA 5L39A 4PG4A 3IRXB 1GMUA 2R9LA 4U8VA 2CQBA 4UOHA 4BC7A 2HVIA 3R9LA 4OI0A 4DN9A 2MTLA 3NAHA 2VH7A 2RB7A 5B08A 2OH2A 1LK5A 5ETVA 1TVRB 1S9FA 4RO0A 5A2QU 4AQYJ 2JOQA 2EFVA 2JVOA 4IFVA 1IJEB 4MKYA 2DXFA 3U27A 1U1OA 1FKPB 4A8XA 1V9OA 5KT5A 4U7UD 1JNZB 5J2MA 4B3RF 1IXKA 4O3OA 5EUHA 5HK4A 4NEYA 1D8YA 2R2RA 1HA1A 2HFOA 2V69A 3BKFA 1VCTA 5GADI 1LWFB 4QWEA 5F8GA 3PFOA 1F1BB 4M5DB 1B7YB 1Q0NA 3GV8B 5BYQA 3QRRA 1WC6A 2Q79A 2QV6A 1WD6A 1YZ7A 1X4DA 4J7CA 4RX6A 2D3O1 2XMAA 3OSPA 5C25A 2WSEC 2NSBA 5CYQA 4NA1A 3ZZ0A 4JBCA 3QFHA 3PHTA 2AGPA 3CJRA 3D1OA 2VDIA 4X66J 2HHPA 3G6YA 1SKWA 2HVHA 2EK1A 2FY1A 4X84A 3M8PB 4PQUA 4YN3B 2VKZG 1NNDA 3OTOJ 5DJBA 2QSWA 2R8JA 3I5AA 1J5EF 7FDRA 2UVUA 4DV3J 2XSJA 4EI2A 3ITHA 2FVSA 3T9NA 2YXLA 3G82B 1WOSA 2R3VA 2KXNB 2OPRB 3KHLA 2BKOA 5IQ6A 2XS2A 1P8GA 5J2PB 4EMDA 3OVBA 2XMKA 1Q5YA 3QWUA 3BBCA 1VBXA 3M8SA 2O1PA 3OPKA 1SXLA 1KLMB 5KFDA 2KFNA 1S1TA 3OHBA 3ZZPA 4HT7A 3VAHA 3CJTA 4X62J 4DU7A 1IR2A 1H2UX 5CZVA 2N4CA 2XQCA 2E66A 4ZK7M 1ACMB 4LFBF 1R0AB 1YJUA 2KYZA 4O4GB 1ZETA 4DV4F 1N54B 2RDJA 4L75A 3MMAA 2X3GA 4PXBA 1WC0A 2NQPA 4DUTA 4CLZA 3RB0A 3JSMB 5CH7B 2V8GA 4WIIA 1WNEA 2B6AA 3MEEB 3U7JA 3HFKA 1JLBB 4PYAA 5AT1B 3TA2A 2GO9A 3L4BC 1I6JA 2KG0A 5THWA 1CJUB 2VQEF 5K14B 1JKHA 3HSGA 5M2PA 3VGUA 4NXNF 3DYAA 5F0UA 3WQPA 5AE2A 3KJVA 3GJRB 1HWKA 1TUVA 5GVQA 4Y34A 2QL9B 5GMEA 1F60B 4USUA 4JI3F 3N79A 1C1BB 1CJTB 1X5PA 3PXGa 4UZCA 4C2MA 5HI7A 5DQIA 1NJZA 2HHVA 3OTEA 1S5ZA 2GGPB 1SC4B 2BXJA 2HGLA 4WE1A 2CVIA 4W92B 4YMEA 3LA0A 3RZAA 1R6VA 4FYVB 1HKAA 3MPUB 4DZ6A 2CQCA 5KFUA 2UXDF 1P27B 2MPUA 3C6TA 3M8QA 2GQ2A 2DGSA 2F4FA 4D3HA 1FNMA 3TJAA 2DCLA 4DFKA 3C6UA 1OQ3A 3OT9A 2ZH3A 4X4OA 1FE0A 4JV1A 1S6UA 2V68A 3DLEB 1TKZA 4KH0B 4MAKA 4LF1A 4M95A 4ES2A 4DV1F 3OFFA 4UTGA 3NOGA 3HHLC 4JOUA 1X9WA 1VRTB 1N0UA 4LJMA 5LT5A 2K06A 3W2VB 2Z2MA 1FJCA 2U1AA 2DGOA 1D3WA 2QA4S 4HI1A 3OTDA 3G8TA 4KY3A 1VC0A 2E9RX 4FF3A 1M0SA 1NCLA 4IRCA 4C8NA 3WX4A 1D9FA 4L3KA 5JVGQ 1FXRA 4DHVA 4KFBB 3TUJC 2AD9A 2HZVA 1VRUA 4HHUA 2HQ3A 2J6SA 2ROGA 1YBUA 2NZCA 3FBCA 1TV6A 3MHYA 2MKKA 4EWTA 4QWCA 1TK5A 2MGZA 3GPAA 3CULA 3RB4A 4AXIA 4NCBA 2UXCJ 3WHIA 3HKZD 3DXSX 4Q2LA 2OPSB 5CQGA 3J7Z5 2ZVIA 1RISA 4ED8A 2HRUA 3FQKA 1U6BA 2D1CA 2LU1A 3MZIA 2BUNA 4J9OA 4NPOA 5KG4A 3CJSA 2XG8A 1H2VZ 4A8FA 5DM7Q 2RF2B 1T94A 4U67Q 1SVDA 4K4TA 4DZDA 4N5SA 1WELA 3T19A 2YKMB 2YKAA 5HMZA 2V8PA 4QPXA 1E6VA 1TUWA 3O3LA 3EE3A 3I0SA 1KQSR 3IGVA 2GMJA 1RLCL 1GTHA 3SEOA 2KN4A 2CQ3A 3EYZA 2DH7A 4CZCA 1HHSA 2JNJA 1DLOA 5KFAA 2E7WA 4DPYA 3TYTA 1D0EA 3BSAA 3BN4A 5CD4A 2IDLA 2HNZA 4Q8FA 2MQPA 1YSJA 4DCOB 4HACA 2CQ4A 4LRCA 2V50A 2AJ2A 2D7SA 3BS9A 2CFXA 2BQUA 1DHMA 5KFIA 4CLWA 1FNXH 2C3OA 4DI6A 5E3RA 1VI7A 3MM9A 1IM6A 2JH3A 4TN2A 2DHHA 1U2FA 4RW6B 3Q2TC 5EWEA 2ALYB 4QWDA 4I6AA 2VBWA 1ITPA 4V1Ak 2HQGA 1VOMA 3KK2B 4CLSA 3B8HA 1FFWB 3R8YA 3NY0A 5ETOA 2G1HA 1IKXB 1X4GA 4LSLB 2FJAB 3MEDB 4ILLA 3BKUA 2QA1A 3AA9A 2ZKTA 4PUOB 4UQTA 5DS7A 4ZVPB 3M30B 4LVNP 2C22A 1H38A 2ACYA 2DR7A 1HBNB 5I42B 1N88A 4QWBA 3IRWP 3FCHA 5F8HA 3TVYA 1FWPA 3GYGA 2ALZA 3RW7A 1HNIA 5GAEU 3GV7B 2BZ2A 1ZM2A 1Y5IB 1S7IA 4OHXA 2PIIA 2VFTA 3ZNUA 2HNYB 4ZOSA 4ATNA 2VPZB 1TL7B 4J9SA 1RKIA 2CPFA 2ZZMA 1FK9B 3W8PA 3O44A 1RTJA 1Q8KA 4NLVA 4I64A 3DGPB 2E1CA 3L3CA 4IQMA 1S1WA 3V6DA 4O3SA 3SXLA 2RU3A 1EP4A 4LRFA 2YKPA 2P9EA 2QMXA 3KLIA 4S0MA 4B3SF 2G9OA 1RWPB 1FJEB 4PWDB 4OIXA 4USWA 1UL3A 1ZAVA 2G2YA 4CIOA 1IBKJ 1FDBA 3KJQB 2NREA 1XR7A 4P2FA 4O0NA 3VALA 5IQQA 3S01A 1HQ2A 5J2QA 3DOLB 3J81U 2AX0A 4CM2A 1ROFA 4CTAB 1EETB 5M2UA 4H4MA 2OPQB 4B9UA 1ZZNA 3VVTA 3FRZA 3JYTA 4LFAJ 1NSQA 2GC8A 4FZVA 4ECXA 1FNOA 1N5TA 2FDNA 2AYEA 5D3GA 4DS4A 5KFWA 3M2VB 3KWMA 3EPIA 1T9TA 2YWKA 2LLZA 3I9V9 3UDEA 3DFEA 2VA2A 2KT2A 4WP8A 2XI2A 4P2MA 2K8GA 4K59A 1WEZA 3RR7A 2XZDB 2DD8S 3IS9A 5KT2A 4FS2A 2V8HA 2DISA 2EFOA 2Z8QA 2FHJA 1PJ5A 1FE4A 1TUGB 3AOAA 4RR5A 2GMLA 2KM8B 3J7ZT 1FVSA 3LH2S 4MIWA 1SH2A 4M5LA 3KK1B 1YHQS 1B70B 3ELHA 2EFQA 2B8QA 1WOPA 3SV4A 4GVBA 3K57A 2W4PA 1QE1A 2MLYA 1WKLA 4NLGA 1HFEL 1RJJA 2RD5C 4CT8A 3GB0A 3K5PA 5KG1A 2AJQA 2WVDA 2XB2D 2ZH9A 3CGIA 2NLWA 2HIYA 2ILYA 2RILA 3TOQA 2WAQD 1UA0A 2R7QA 1U2CA 1SJFA 4NA3A 4WFBQ 1VK3A 4J5OA 4MKAA
chains in the Genus database with same CATH topology
2YWEA 4AYBD 5GADU 4M1KA 3S7RA 1S1XB 1R8BA 1S6QA 3JSRA 3BDPA 4UUWA 1RTJB 4DG1A 2XY6A 1XN9A 2ZNZA 3NAIA 4DDFA 3GFZA 2GFFA 2GA7A 1OPIA 2E44A 3VZIA 3A8EA 3VAKA 2E5LF 1LKZA 3DCAA 3CCWA 3R3TA 4RWXA 1S1WB 4U7CA 1UVMA 1LWCA 3TVKA 3V6DB 4B3OA 4EO8A 1W25A 1YJNS 4ZCLA 2WTFA 1NKEA 1RTDB 1R8AA 1NH7A 1C4AA 4NZ6A 2AJ0A 2EW9A 4NYPA 2LDYA 4QW8A 1R3NA 5KFSA 1VBZA 1VC5A 2DCUB 1HMVB 3HT3A 4ZVEA 1HQEA 1EP4B 1DAXA 4Y3CA 4OLPA 1I94F 4DL7A 3FRYA 5IT4A 3WC0A 1IQZA 2HS4A 2JLEA 3GSDA 3CCRS 3GR1A 3Q8SB 2DGVA 2J5AA 1QY7A 3G8QA 5KFTA 2B9WA 2I8EA 3OUYA 3KLIB 1M5OC 1VQ8S 3DLHA 1C0TA 3QLHA 4IG3A 3V5RA 4F4YA 2XWXA 1REVA 2E29A 3GMGA 3MPWA 2DNZA 3ISZA 3MUVP 2JEIA 3KKFA 2ZJPQ 3SYZA 4X64F 2ASJA 2KFZA 5LXRA 5KT7A 2X1FA 3GZ7A 4QQBA 2IAJA 3LUYA 5J2QB 2KM8C 2YWHA 2FGOA 4FF4A 4X4NA 4I7FA 4ECYA 2I1RA 1LV5A 4B9TA 3SFUA 5KFZA 2QIFA 3O2IA 2POKA 3UW1A 1YRTA 3K5NA 1L3UA 3CTRA 4PG7A 2V4JA 1TK8A 4DR6F 2VG6A 1QUVA 3W3SA 4Q0BA 5DM6Q 4YQWA 4H4MB 3PKMA 1XR6A 3N28A 4MJKA 2M4MA 2M52A 1RWUA 5HBMA 2R7VA 2HMIB 5A8WA 3MTJA 4MK8A 3KLFB 3CT9A 3N4WA 3M1VB 5KG3A 3BF4A 2CJKA 2F3JA 3QIPB 1XNRF 4N56A 2LKZA 3TAMA 3JYTB 4NLDA 1R6YA 3DRXA 3PVXA 1JLCA 3LQVA 3L7OA 1UAWA 4ED5A 1NB7A 1AFIA 2MQMA 1V3RA 4GO5X 2J0WA 2VV5A 3BGLA 4M5DA 4FYDA 1N32F 5D3GB 1UFLA 3H20A 1Q82T 4QYRA 4CH7A 3K5LA 3HJFA 2VC1A 5D4OA 4HEA9 1FEEA 4ERDA 1FRKA 1ZTTA 1H7XA 4MMOA 3FZBA 4DLGA 3IWXA 5HROA 1TL1A 2XHWA 3HMJG 1O8BA 1UP1A 4R8UB 1RTIB 3AQOA 3G86A 3DDKA 3SMZA 2B56A 4J37A 4TU7A 3NGKA 2AX1A 2J9EA 3HX9A 3OLAA 5JJBA 3UWTA 4AUKA 4LMZA 5G0RB 3KLHB 3IS9B 1WF1A 4XPEA 4KGMA 5F3TA 1JB0C 1N5VA 2X1AA 4TXSA 2MKIA 4TLRA 3LP2A 5IFMA 4A8SA 5K8MA 3AB2B 2ZKUA 1XMOF 1DTTA 4TLQA 2W9BA 1NKBA 1V6HA 2VG7B 4IG0B 1RYRA 4LF5F 2QT7A 3JSBA 4C11B 3CCUS 5E41A 1X4HA 5C5JA 1ZM4A 5EWGA 2WBMA 4OJ1A 3B82A 2BM1A 1LFPA 3CSKA 2QA2A 3LP1A 1SB6A 4NCGA 4O3QA 3GFYA 4DFJA 2OKQA 1Q8LA 2NPFA 4OHWA 4KGKA 1LXNA 4DPOA 1GXUA 1H98A 3PEHA 4C8MA 1XR5A 4KO0A 5EDWA 3MCSA 3FJ2A 2MMYA 1F0XA 3ZZTA 4G1IA 5A2QY 3PIOQ 4MIBA 1HBOB 5KTQA 5DDPC 1X7VA 4N77A 2GQQA 1QAYA 1QE1B 3PM9A 3BN7A 1APSA 3UDCA 4R0EA 3TR5A 2J8AA 1SJQA 1SJRA 4Y2CA 4FS1A 3BGUA 3HVTB 2DIUA 4Q45A 5CCMA 4X4VA 3TRGA 2BR0A 2MHNA 1U47A 2FUG9 1BQMA 4KBIA 4DSEA 3HZEA 1S77D 4J9RA 4RKUC 5GAGI 1SIWB 4OQJA 1K9MT 2FLLA 1NU4A 4MFBB 4PKDB 2IFXA 1JWWA 4WFZA 2V4QA 5HLFB 1WF2A 2GHPA 3BGRA 3KG0A 1U1RA 3SV3A 1HR0F 2I5JB 1YGYA 4DR1F 1RYSA 2FB0A 2IBOA 4NYOA 4WXWA 1RT4A 2HHWA 2WBRA 1Q7YT 3SCLE 1WG1A 2O5DA 1J5OB 3IR5B 4DQSA 2C2DA 4A8WA 1VQ4S 1NK7A 2DRBA 2ZE2A 3KLGA 1SH3A 3OW2R 3LP0B 1IKVA 1YIJS 2JRSA 4X4UA 4GKJF 2FTRA 4JI5F 1Y3JA 4Q7AA 1HNVB 3MTKA 3FMBA 5J2NA 1JNRB 1FJ7A 4BBYA 2VBXA 3PDNA 4MKAA 3SDEA 3I4PA 4DBQA 1R8HA 4DFPA 1BWEA 3R1LA 4B17A 2N82B 3PR4A 3N5FA 2WSFC 1S10A 2HAIA 2PE8A 3BGFA 4A8YA 2AWZA 4M94A 4ELVA 1HI8A 4OFZA 5T41A 3V6JA 1AUDA 1S6QB 1ZPVA 2DBBA 3D5MA 4DEZA 4DJBA 5I4MA 4LFCF 2G13A 1UWBB 2NSCA 4DG1B 5E3QA 3F73A 4LF7F 1SQEA 2B7CB 3PW2A 2CJAA 3D0GE 4YP3A 4DV7F 5HMWA 4OZ1A 3GG0A 2YTCA 3MR3A 3ZZOA 5J1PA 4K4YA 1IKYA 1N5QA 4J9MA 4ELTA 2W24A 4JI1F 3MUTP 3CD0A 2EK6A 4A46A 3TANA 3FGVA 1LWCB 4Y2MA 3QGIA 2E7XA 3KLEB 1NH8A 1VMBA 4MIAA 1MWYA 3MOJB 4GKKF 3I5BA 3S1TA 1LWEA 4E98A 4MK7A 4NRTA 2FVPA 1NJYA 3AA8A 2R7RA 1T8EA 1TAQA 1HQEB 1X4FA 4B9NA 2ZZNA 5E0OA 3C3LA 3H25A 1WEYA 2V8VA 4ED6A 3M9OB 4CCHA 2IM3A 4WYLA 1N33F 3DI6A 2W9CA 3S6EA 2UU9F 1RT5A 1JLFA 3GV5B 1BY9A 4TY8A 2M9KA 2MSTA 5E3CA 3OUYB 4C7QA 2CRLA 2WHOA 1IR0A 3EGWB 3CD6S 1C0TB 5L1IA 3QLHB 1XEZA 4IG3B 4ZPDA 3PY8A 2PD1A 2Q3PA 1YBAA 3CWJA 4OX8A 3UCGA 2DHSA 3AJ1A 1REVB 1WI6A 4WTYA 1HWUA 2IC3A 1S0OA 2NPIA 5CYMA 1T03A 1SJ1A 1U48A 2FHKA 3NLCA 4DV6F 1TQLA 2IYIA 5ITHA 2VFRA 2YNIA 2BDPA 5B0BA 1CQNA 3RAQA 1T05A 4Q8EA 3I96A 2OMOA 3H98A 3MMJA 4D3GA 4DR5F 2JHEA 4QZVB 4G1PA 4RBTA 3VR1A 2PN6A 2IAJB 1NK4A 3T1YF 5KFLA 3OFEA 1FRXA 4I7FB 1Z1ZA 1B64A 1FDNA 2AQ4A 2XEXA 3CJ0A 2V2KA 2EBEA 4LVOP 4MYUA 5KFGA 4CO5A 3CPWR 4YY3F 4GC7A 2ROEA 1O51A 2MDAA 1T3NA 4KT0C 2XY5A 1JLBA 2OIHA 2NYIA 3K7RA 2V4JB 4JI8F 4KIAA 3ICLA 5F41A 2VG6B 1HD0A 3H2UB 1RT7A 4Q0BB 2EG1A 2VOPA 4X4PA 4WU3A 2CZVC 4HTJA 3AJ2A 4L6V3 3DU6A 3LANA 5HBMB 3TA1A 5E2QA 4OL8A 2P5VA 1Q8IA 2ZFHA 4C3LA 5A8WB 3I32A 4MYTA 3T6BA 4DF4A 4FNIA 4OI2A 3CDUA 4TYAA 3I31A 2VBYA 3PRBA 4USHA 5CA5A 1B0PA 1IBLF 5J1EA 3UCUP 3BB5A 3AHPA 1JLCB 2D74B 4OHVA 4DQRA 3HK2A 3RTVA 1ZAXA 4TYBA 2M88A 1VQPS 2XLIA 4QIEA 2BV3A 5T14A 1R31A 3DLJA 3I0RA 4IH6A 4CQ1A 2P9CA 2UV8G 3M2RA 3UPFA 2D9PA 4QYZJ 2PSZA 1KFSA 2UVRA 3LALA 1FXLA 1TV6B 5B0CA 3GYNA 3CCQS 3KNAA 3P96A 3T1AA 3DRRA 4WXOA 3JAMY 2MGZB 4JI0F 2XO7A 1K73T 3NMAA 3BO2A 3L7PA 3E8OA 1TL1B 1X4EA 5HROB 2EFNA 2Q6BA 2XI3A 5DLFA 1NEEA 5EN1A 4KE5A 3HXMA 3H5XA 1UVIA 4F02A 4H4KC 4IFYA 1ZPWX 5LSLA 1QSSA 3RRHA 2B4PA 4YR0A 3RAMA 4DUYF 1ZAWA 4HLBA 5DRKA 2GQCA 1M5VC 4E0DA 5K9FA 4QCLA 4DR3F 2LXIA 1GQEA 4ED7A 4H4OA 4J9QA 1N0VC 1KSPA 4KR0B 2CQPA 1YG0A 3SSRA 1XMBA 3EXYA 2DGWA 2GIRA 2DIVA 3KHRA 3HF5A 1NK6A 1JIHA 3TVZA 1U45A 4ED0A 4EZ6A 1LK7A 3CO9A 1WF0A 4NXMF 4FXWA 2IBKA 1DTTB 3OJSA 2W9BB 5KFKA 3RRGA 2MKCA 4DQIA 1NK5A 3TUZC 4OLOA 4BDPA 4GO7X 4HL9A 1G2EA 3CVKA 1UJ4A 1FO1A 3V6HA 1XC9A 3LP1B 3HHLD 1RTHA 2EI5A 4NCGB 4NWBA 4DL0C 1UJ6A 3OL8A 3WZ0A 3QO9A 3OXGA 1QSLA 1MMDA 1RT3A 1JXEA 4LUBA 5FD1A 2ABYA 4XPCA 4MTPA 2C28A 2LA6A 5A8KA 1A7GE 3HZGA 2KVIA 4IUFA 4DR4F 1Q81T 4OZ5A 1N5SA 2GO8A 1XBWA 2VASA 2BABA 3UR0A 1Q79A 4EYIB 2IA6A 4CO3A 3NBPA 4YOEA 3T5JA 1F5BA 2KZZA 2FC9A 3LGMA 1VS3A 1NZAA 3C66A 1VQYA 5KFHA 4X2BA 1BQMB 4ED3A 4I69A 2L9WA 4CH0S 4IO9Q 3MM7A 4MH8A 1RKJA 1VQ7S 1VK8A 5DDRC 1U1NA 4K4XA 2UVVA 3PW4A 1DURA 4NLXA 2HHSA 1RT2A 3BGRB 3BQ1A 1M1KT 2J6UA 1D8ZA 2HWHA 3DLGA 3KG4A 1C1CA 3ZC4A 3CC2S 2VODA 4K4ZA 2B51A 2EWHA 4Y0FA 5LXYA 1RT4B 3SQGB 5H1SV 1K8AT 3IR7B 1VQ6S 4NRUA 4CO1A 2HWTA 2HLTA 2NUUG 3MM5A 4Q44A 4U9RA 3MGJA 2IRUA 2ZE2B 4F50A 1VRTA 4KV8A 4DR2F 3X1LB 5C24B 2XMTA 4URQU 1MNEA 4DSFA 1IKVB 2DO4A 3HHNB 2Q6CA 1DZ5A 1RGVA 2DB1A 1CC7A 1BLUA 5J2NB 3PZPA 1UVNA 4O3PA 2W7OA 4P7TA 4J9NA 4OZ0A 3RB6A 3SDEB 3KMSA 4CT9A 1U6ZA 2A2CA 4CO0A 1YTYA 2GNKA 5FJ4A 2PFFB 2C2EA 1S97A 4KSEB 1RT1A 1IBMF 5H9EJ 1S9EA 2XMWA 2BRKA 3HVRA 3W2WA 2HW3A 3DRPA 4RW9A 1VIOA 3HPOA 2XMJA 5KOWA 1KFDA 2BOPA 2HZCA 4DWIA 2RQKA 1S48A 2RJZA 1FEHA 4Z37A 3Q8PB 3KK3A 1NJWA 1VIXA 2A18A 2G0CA 2OD6A 3P49B 3RW6A 4FP9A 2QO3A 4ZA1A 4PWUA 2OFHX 1NK0A 3FNNA 5KFBA 5KFPA 4A8MP 2FC8A 4WKRA 1LOUA 3UD4P 5A0YA 1RA6A 1HNXF 1OSCA 5BR8F 5B0AA 1F9FA 3MM9B 3CC4S 2RDIA 3UDLA 3Q8RB 2KJWA 5LL6d 1U6FA 2RKIB 1MMLA 2IM1A 2O01C 3HHKA 3JTPA 5D78A 4ZCKA 5KT4A 2C2RA 2B7BB 3I5CA 1LWEB 2XULA 3ZFVA 1L3TA 4HH1A 2RE1A 1JJ4A 2MZRA 4ZPBA 4F4ZA 1MU2A 2L48A 3DI6B 2W9CB 1ZM9A 6FDRA 1RT5B 1TL3A 4TY8B 3MWBA 5FDLA 1UJ5A 4RNFA 3KOAA 2N7CA 2JX2A 4YB7A 2B9XA 4KHMA 4OZJA 2O3DA 2ZOFA 4AXJA 3KMQA 1FHTA 2ILZA 2KRBA 3CDBA 3R5DA 2IC3B 5CYMB 4LF6F 1T03B 4IDKA 1CVJA 3T5KA 4I1TA 2KT5A 4NX9A 2YNIB 2FGCA 1T05B 3AB4B 1KHVA 2DH9A 4TQRA 2VB6A 2N3LA 4K4UA 2DPIA 5KG2A 3Q8QB 4UW2A 4ZP9A 2DITA 5KFMA 3PV8A 3OHAA 1AROP 2MJUA 1S1VA 3QJPA 3J7YU 3PX0A 1UVJA 1N8RT 3LWLA 3EUNA 2QFJA 4FF2A 2DR5A 1SBRA 4ZPAA 1X9SA 4TQSA 4BHQA 1PO6A 4WFYA 4NLOA 2HS0A 1E6YA 2J0XA 4YUDA 2AGQA 1RT7B 4PG5A 5EWFA 3SCKE 5MAOA 2U2FA 3HP6A 3FEXB 3G8SA 4HDHA 2GIQA 2FJVA 2JWNA 5T7LA 2OFGX 2YKQA 1FD8A 2DH8A 2E1MC 2YKMA 2DGXA 3R5CA 4ECTA 4DF8A 2WSCC 3KNGA 2D3ZA 4ZCIA 1HNIB 3TUIC 5AE3A 2XZWA 5J1EB 2PI5A 3VAGA 2JEFA 4K2XA 4WK3A 2FD2A 1KEKA 3TQ1A 1NK8A 6FD1A 4KQZA 2DNQA 5L8RC 3K58A 1BQNA 4PPZA 3I0RB 5J1NA 3U1LA 3OXLA 4LF4F 1Z2LA 2ZOMA 3M2RB 2AJ4A 1D9DA 4DL2A 2XNRA 4ZPVR 4EGLA 4CH1A 5EGYA 2CIMA 2X1BA 5IS2A 5KFQA 4AQYF 3JSYA 2KT3A 3DRRB 3ZZZA 5C42A 4K5RA 1FXDA