4L6V3

Crystal structure of a virus like photosystem i from the cyanobacterium synechocystis pcc 6803
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
80
structure length
80
Chain Sequence
SHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAAQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Crystal structures of virus-like photosystem I complexes from the mesophilic cyanobacterium Synechocystis PCC 6803.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Electron transport
total genus 13
structure length 80
sequence length 80
chains with identical sequence C, c
ec nomenclature ec 1.97.1.12: Photosystem I.
pdb deposition date 2013-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF12838 Fer4_7 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4l6v300
1HFEL 2VPYB 1FEHA 1H0HB 1KQGB 1PC4A 4XDCA 1G3OA 1FRJA 4KT0C 3EGWB 1DURA 3MM9A 1GTEA 4AYBD 3MM5A 3IR6B 1FRXA 3EXYA 1FF2A 1FRKA 3MMBA 1Y5NB 1G6BA 4OMFG 2WSCC 3MMCB 3MMAA 3LW5C 1C4CA 1KEKA 2C3OA 4Y28C 3C8YA 3MM7A 1BC6A 2C3UA 2PMZD 3EUNA 4L6V3 1DFDA 4XDDA 3MMCA 2V4JA 1FDAA 2GMHA 5E7OB 1IQZA 1PC5A 1FRMA 2XSJA 2O01C 1FCAA 1FTCA 1JNZB 1H98A 1Y5LB 1A6LA 1BLUA 7FD1A 1K0TA 1KQFB 1R27B 2WSFC 4OV1A 1F2GA 1JNRB 2C3PA 1GTHA 3OR2B 3IR7B 5BYSA 1FDDA 3MM6B 5FD1A 1H7WA 1F5BA 1FRIA 1FRLA 1Q16B 1GT8A 1IR0A 2FJDB 2FJAB 4RKUC 3MM8B 1RGVA 3OR1B 1JB0C 1GAOA 2V2KA 3IR5B 1BQXA 4CI0B 1FD2A 1FERA 2C42A 4DHVA 2FDNA 1WTFA 3PNIA 2Z8QA 3MM8A 2WAQD 1DAXA 2GMJA 2FJBB 3HKZD 2PA8D 1B0TA 1B0VA 1SJ1A 5BYRA 2VPZB 2FGOA 2FD2A 1XERA 1Y5IB 4XK8C 3MM9B 1FXRA 1F5CA 4YDDB 1C4AA 3MM5B 2VKRA 1H7XA 2ZVSA 3MMBB 1Y4ZB 3OR2A 2C3YA 1ROFA 3MM6A 1BD6A 2Y0SD 3MMAB 2IVFB 2UZAA 5CHCB 6FD1A 7FDRA 1CLFA 2WSEC 3MM7B 1VJWA 3GYXB 2FJEB 5CH7B 1FDNA 3OR1A 2WB1D 5BYQA 1FRHA 1AXQA 1SIWB 4ID8A 2V4JB 1B0PA 2VPXB 2VPWB 1SIZA 2PDAA 5L8RC 1FXDA 1BWEA 2C3MA 2XSJB 1FDBA 1D3WA 6FDRA
chains in the Genus database with same CATH superfamily
1SQEA 1RHUB 1S5ZA 4KHPJ 3M2VB 4IFVA 2KZZA 2GJ2A 5A6WA 1FJGJ 3O8WA 3NMRA 3TA0A 2HFUA 4NCGA 1FRXA 1MN7A 1EETB 4IQMA 2MZ1A 4F4WA 3N6LA 4ZCMA 1GMVA 1O6XA 1U02A 1N33J 2U1AA 1WG5A 2C3UA 4B9NA 4PKDB 2CG8A 4DF8A 5HBMA 5L9XA 4JI6F 5HMXA 3CCRS 2OPSB 4TU9A 2BXJA 5A8KB 2G2OA 2I8EA 4PXDA 1SH2A 4ZA1A 3S7RA 2EW9A 3DRRB 1DZ5A 2C2RA 2ASLA 3OT9A 5HI7A 3OSPA 2MQ8A 3FRZA 3MAHA 1FESA 3HHNB 3H59A 3P96A 3QAUA 3KOAA 4JOUA 1VBZA 1QD1A 1HBUB 4PUOB 4RNMA 3DYAA 1S7IA 2O67A 5C2GA 3ZTRA 4JI7F 1RT3A 2QO3A 2HRTA 3DRSB 2P9EA 4USMA 1TUWA 1OY9A 4L72B 2MTLA 3HCXA 4K8RA 4P2XA 2EWHA 4KRWA 2HHTA 3KHGA 1T9WA 3F0NA 1UWAA 4EYHB 2NQPA 3HSGA 4OZNA 1JMTA 3PCOB 4LR7A 3VAIA 1YRTA 3UR3C 1BQNB 2ZM6F 5LJ3Y 1RBOB 4DX5A 3CCMS 3C14B 1B7YB 2OHDA 1VK8A 5FD1A 2RKIA 1IM6A 3OV7A 1A7GE 1JX4A 3PJXA 1NM2A 1ZM9A 2HAIA 2R7UA 1TL1A 3CCUS 3DMJB 3FEYB 3AA9A 5F8LA 2ZUAA 3GIKA 3CJSA 1JLAB 2ZHAA 2IYGA 5K14A 4C3KA 1Y5IB 1S1UA 4Y6IA 2ZHOA 3O3LA 4LF4F 5ETMA 5KOWA 1Y3KA 3DM2A 3P45B 1L3KA 4DLGA 3TJAA 3UCUP 2FHJA 5FLXU 3BR9A 4L74A 1NK9A 4LFAF 1F9HA 2ZD1B 3IRXB 3SXLA 4AXJA 3D1HA 2DR7A 2MZSA 3DLGA 2M4MA 5HMZA 3NGKA 1FEEA 3MUVP 5DQIA 4EMDA 3D1OA 2KFZA 1SJQA 3GZ7A 4IKAA 3U1NA 1Q7LB 2MLZA 2RD5C 4O3PA 3CC2S 4IRKA 4XTTA 2VG6A 3MD3A 1MU2A 1TKZB 4KQZA 4ZN1A 1TK5A 3OR1B 1TK0A 3OSNA 2PSZA 3IG1B 2GC8A 3CIZA 1HQ2A 2U2FA 1ZZNA 1UWBA 2ZWPA 2Q79A 5DG7A 3JQJA 4L3NA 1S12A 2DNGA 3H2VE 3NWGA 1HNXF 3VR1A 3G6YA 5I3QA 1DQ9A 2R7OA 3VV2B 2DNQA 1SIWB 1M5KC 4WZQA 1EKRA 4YMEA 2J0QD 3QBCA 1FXDA 5KG6A 2B4VA 5K5MA 3M9MB 3FMBA 3A3NB 2VF3A 1KVIA 4QWCA 1YJVA 4TY8B 2VQEF 3GV8B 1FKOB 2WSCC 1XN9A 3NCPA 4NYZA 5KFSA 1HHSA 3M9OB 2BKPA 1T03B 4UUWA 4DFKA 3HT3A 1Z2ZA 4K50A 4I2PB 2QLJB 4WYLA 2IAJA 4B3SJ 4M5GA 5BYSA 3MUMP 2B8PA 3KLEA 3T9ZA 5H9FK 4OX7A 4M5NA 2WK4A 4JV2A 2JLFA 4N7TA 2JZ5A 5IM0B 3BKUA 2DKOB 3BO4A 2YNGB 1TVRB 4QIWD 5D0GA 3W60A 5B0FA 4I67A 2XMKA 3MFIA 1N5YA 1NRKA 1N36F 2K7JA 2IM1A 4MJKA 2MKYA 4NA3A 4U6PA 4TLQA 3TQ1A 4OX9J 1RHRB 2XY5A 2A2CA 4OI0A 3K5NA 3ZXWA 1HNWF 5F3ZA 3G8TA 5IS2A 2ZZTA 2LFVA 4MK9A 3CJ5A 4HHJA 1E6YA 1FFWB 3ICLA 3J80U 5DLFA 1NDPA 1TL4A 1K1SA 3I56S 2RUSA 2BYCA 4C8KA 1C0TB 5A0YB 4RX6A 5DGBA 2VA3A 4H4MA 1CJKA 5KFLA 3QLHA 3TO8A 3N9UC 5B0BA 3D7SB 3HD1A 3MPWA 4LFBJ 1RT7B 2QLWA 2F4FA 4KYZA 1RT6A 2ROGA 3ZZTA 2JWNA 4USUA 2ZOGA 1NCLA 1LWEA 3H5UA 3BM7A 4H4OA 1MG7A 2HFNA 1HD0A 3CEDA 5HAOA 1D1UA 1U6BA 3QATA 4KJIA 5D15A 8RUCA 1U0HB 3RAQA 4ED6A 2BOPA 2APOA 1TL7A 3CCVS 2R8GA 2AZ1A 5DDQC 1LWCB 2R8KA 2WW4A 3QAEA 3US5A 3SQGB 2JRSA 4W92B 5E3PA 3M32B 4DV0F 5CH7B 3CJ2A 2FY1A 2H9ZA 1P9YA 1MROB 2N4DA 4DG1B 4A8XA 3UNYA 4UUXA 3PZPA 4Y2MA 1HFEL 5I4MA 1SVDA 4KT0C 2RE1A 2M7SA 3UVJA 5MAOA 4NLRA 3NNHA 2WW8A 3NOCA 4L73A 3RZAA 2DGQA 3KJQB 4B17A 4JI4F 1Y7PA 4KR0B 2RU3A 1N52B 1RAOA 3NGSA 2CJAA 3BN7A 3CCTA 3I4PA 4JV5F 4GVBB 3EZUA 3HJVA 1DTQB 4MKYA 2R8HA 4B3MF 1NH7A 4EI2A 5FJ4A 3KK1A 3TUPA 4V1Ak 2KL8A 1RLCL 2GA7A 1OSDA 3KJNB 4JUZA 2GJIA 3EGZA 3W62A 1KDNA 2RU9A 5KAKA 2GMJA 1RAFB 1HW9A 2PGCA 4CO5A 4DEZA 1TL5A 1S99A 2E9RX 5LSRA 4DQIA 3QYYA 2NYHA 2V9WA 5D4NA 1BWEA 3NBPB 5HVHA 2ZNYA 4WIQA 4IH5A 1YJ9S 1N5QA 3MEGB 1APSA 2ALYB 4HVZA 3BV8A 3OHBA 1EKSA 4KO0A 3MF5A 1QY7A 1Q8KA 4GKKF 2CPYA 1Q5VA 2NR0A 1RA6A 3P4UB 2BM0A 2F65A 3B4MA 4N8NA 1UAWA 2GIQA 4ICLA 2XTJP 2RAQA 3M6XA 3WZ0A 1KVJA 3CJQA 4FXDA 4IRCA 4OZJA 4K0KJ 3ILOA 3U02A 2MLYA 4K4UA 4X4NA 1VMBA 4DV6F 1TFYA 1NSPA 4MFBB 3F73A 4LRBA 4TQSA 3IC1A 4QJVA 3T41A 2QZ8A 3AQPA 3FQKA 4FF4A 5M2PA 1T9XA 1T05B 3G9CA 2V4JB 3UO0A 3ZNJ1 1RE1B 2J9EA 2NCKL 2DB1A 2HHVA 5CZVA 4KE5A 3Q22A 2N4CA 4CT8A 3K8WA 4ZPCA 1OPZA 2KHCA 1VQ9S 3Q8QB 4NX9A 1ACMB 2UXCF 3QGIA 1NPKA 4E8UA 3BKTA 2W7OA 1L5UA 4C4WA 1JNZB 4CO3A 5DM6Q 3T5KA 2XMUA 4R8UA 4NLUA 4DR7J 1Q16B 4WFBQ 1KQKA 4O44A 4YB6A 1EHWA 1QE1A 4ELUA 4RNFA 4U7UD 3RRKA 3GFHA 1TUGB 3BREA 2OPPA 1Z4UA 2AEMA 5A8WA 2V8HA 1EARA 3DCAA 1YSJA 3SV3A 4PWDB 1UJ6A 3I31A 1VLYA 1RT2A 3BSAA 3D28A 1YGYA 3NS7B 4NZ7A 1T11A 2P6SA 4WF9Q 2KVIA 4P75A 4K4WA 4UT4A 5J2PB 4QCLA 1NHUA 3RR8A 3LAKA 3EGVA 3R7NB 3IAM9 1QSSA 4FZVA 4PG6A 1T9VA 4WFNQ 1CPZA 1WORA 3NY0A 4C11B 1ZTWA 3VTIA 1PBUA 3IO1A 2C3OA 4U8YA 4ER8A 1U1LA 4ZPDA 5IT4A 3NGDA 5LMNJ 3MMCA 1S1TA 1HBOB 1QAXA 4OHYA 3KLVA 1IQZA 1FTRA 2XSJA 2IA0A 2HNDB 3DFEA 5F0WA 3LPYA 1XTZA 2DNOA 4TN2A 5L39A 5CQGA 5DDPC 4USHA 2DCLA 3VGTA 3OTBA 3PNIA 1WDTA 3NGUA 4OJ1A 3CDUA 3CJTA 2DRAA 2W7AA 2ZC3A 3M2RB 4NRUA 1BWVA 2KO1A 4UZCA 1PAUB 3THPA 2DITA 3MUTP 5DG8A 3CD6S 4F3OA 3OTDA 2HLUA 3BQ0A 1T8EA 1S9EB 2XLKA 2W8KA 3CIMA 1JLFA 2C3MA 4RW7B 2KT5A 2K1RA 4X4VA 2RVJA 2H54B 4RW6B 1SXLA 1UEUA 2QG9B 1VHIA 1DURA 4AYBD 2DH7A 1PYTA 2XI3A 3A13A 2QC3A 4DV2F 2W01A 4EBDA 4O4GB 1ELOA 3EUNA 1RISA 1U2CA 2CPIA 4LF6F 4C48A 4DOZA 2QSFA 4USKA 2CWXA 4UOCA 2F40A 3M8YA 1EZZB 4DX6A 3TR5A 3MR6A 2QV6A 3R5GA 1FE4A 5ADZA 5J2QB 3UN3A 1HMVB 2KYZA 2GV1A 3EE3A 1OIAA 2BE2A 1GXLA 2LEPA 2RQCA 4FPRA 1Q4RA 3G6XA 3BPDA 1U1OA 4CZCA 3LP2A 2X7IA 3GE9A 2J0SD 2R2UA 2Z30B 2VV5A 2W7PA 2GVDA 2WSEC 2DPJA 1UVKA 1SUQA 3FDSA 2YQ1A 2XMVA 1WC0A 4JI5F 4J5OA 2HHSA 3K5PA 3DI6A 2FLOA 2PMHA 3H0PA 1TKDA 2IFXA 1IKWB 3OFFA 1EP4A 4JI0F 2UVWA 2DGUA 3Q24A 1UVNA 3AAWB 3KFWX 2OPQB 3UD4P 4QPTA 2LEBA 4CLWA 2IRUA 1JXVA 1OY8A 3QRRA 2NXEA 4NI2B 2ZH2A 1VC6A 2AJ4A 1UEVA 1FKPB 1VOMA 3CVKA 4USWA 2YX7A 2HHUA 1QSYA 3E01B 1VQPS 4ILLA 2WVCA 2E5HA 3T1YF 4OYOA 2YNHA 1I94J 3E3XA 5IV3A 3G96A 2CADA 4KHPF 2IM0A 4CT9A 2FJWA 2BW7A 5D4OA 4H54A 3SFGA 3ZO7A 2V94A 4DR5F 1TP7A 3NRBA 5B7WA 5HQLA 3FBFA 2FJXA 1N33F 2WHOA 2VOOA 1EB0A 4B3TJ 4HL9A 4ZOSA 2UZAA 1XMBA 1VJWA 1SJ3P 2QMWA 2W2QP 3BGRB 2CPJA 1VQ7S 2HIYA 2B4OA 4I0WA 2ZJRQ 1N88A 4JI2J 2NXUA 1V5VA 4NL5A 4QWEA 1V5IB 1GTEA 1QSLA 3BDPA 2NUUG 3Q8PB 1JJHA 3ZNUA 2ZH1A 4IQXA 2Y0BB 2KN4A 2RSQA 2C2DA 1RHMB 4RW9B 2DJWA 3W9IA 1UFWA 3PW0A 1Y5LB 3D0IE 2RHSB 3UDVA 2LKZA 1TQLA 4K4SA 3AXKA 1U6ZA 4PG4A 4K4ZA 3H98A 3VVUA 3J81U 1P1LA 4OX8A 3HULA 3UN2A 2JEJA 4CH1A 4RU2A 4EBCA 4ETXA 4QIEA 3DGPB 1M5SA 5BR8J 4HR2A 4KFBA 4H4KC 1LFWA 5J1NA 3S01A 2OAUA 1HI8A 3NGTA 5J2NB 2IM3A 4DL0C 5KG7A 3DDNA 3MAQA 4OZLA 2B9EA 3DOMB 4FNHA 5LM7E 1TKTB 1N32J 1XR7A 5FDLA 3B4DA 4KGVB 2IPOB 2FVRA 2R7SA 2JEFA 5L1JA 3UDEA 4OI1A 2VJVA 3RB0A 1BY9A 3G87A 4CLZA 4PYAA 3V4IA 1KLNA 4A46A 3ELHA 4USJC 5E7OB 4J37A 2XZDB 1RBLA 4WP8A 1QLNA 3IXQA 4NLQA 5HP1B 2AJ1A 3UDLA 3UI3A 7AT1B 1B70B 2R2SA 2HQIA 4FXWA 3VAMA 2O1PA 5GADU 2FC8A 4K5RA 2KFYA 1U25A 1WJ9A 2LA6A 3VF0B 3POTB 3LP1A 2PA8D 2M9KA 1VQOS 1U1RA 2QMXA 1S0MA 3G82A 5AE1A 2D3OR 4K2XA 1R0BG 1F5CA 1S9GA 2KG0A 3H20A 3NAIA 5DM7Q 4QIVA 1B4SA 1RU1A 2ZDOA 1R8HA 4NMLA 4RW4A 1C0UA 5FLXY 1U1MA 3GYXB 5G4DA 1G2EA 1YWXA 2BJ9A 1V3ZA 3JYTB 4KKOA 1DTTB 2GVZB 2LXUA 3PYDA 2OP5A 1U24A 5M2UA 2ZEJA 4CWBA 5B0DA 4ES2A 2DHGA 3AJDA 3B78A 3KK3B 4QYZK 1U7LA 4DPOA 4KGKA 2LDIA 2LXFA 4NASA 3FZBA 4WTYA 1LW2B 1X4CA 3HX9A 2UVUA 4N47A 3H40A 3OVSA 4OYBA 1A0OB 1HWIA 3KDOA 4FS2A 3AJ2A 3W2VB 4OI6A 3W65A 2Y8WA 1SC3B 2Z56B 2DNPA 3MPVA 1NDKA 1FRIA 5BXIA 1CJTA 3K17A 5IFMA 2V2KA 1N6QA 1I51B 2OEMA 1X60A 1F2HA 2V2ZA 4DHVA 4DR4F 2ZBQA 2EPIA 1X5SA 5D0HA 3FJ2A 4NLSA 2E7XA 4X65J 3MGJA 4WU3A 2QX0A 1PCAA 1U1PA 4UW2A 1RHQB 3MMBB 4USTA 3K7RA 1S1XA 2JL9A 2DNRA 1OWXA 3SEOA 2MY7A 2VG5B 1FDNA 4QR1A 3FEXB 4B3SF 1GNKA 3RBEA 1NK6A 3R6LB 4IO1A 3R7SB 1YBTA 3QO9B 2ZE2A 2WVDA 1ZETA 2DNNA 5F8NA 2MJUA 4DR3J 1FX2A 4Q5VA 1FRJA 3KDNA 3EVWA 2XYGB 1KS2A 2ZH4A 4IFYB 3D6FB 1Q8BA 3PY8A 1PSDA 1H2VZ 3BEGB 2AGPA 2HBYB 1QJHA 2CNNB 4UY8T 4OX9F 4O3OA 2MPUA 1XC9A 1RTDA 2P6TA 2CXEA 4LIWA 4RBTA 3M2UB 4RNNA 2OKQA 3MCOA 3FGVA 1WSVA 2XI2A 2KJWA 3H5SA 4ZHRA 4Y2KA 4PCQA 2ILZA 2CG4A 1PAEX 2YWEA 3UNGC 2OFGX 4DUZJ 4F02A 1FK9A 5I3UB 4LFBF 5T7LB 2JEGA 1RT4A 2ZITA 2RJZA 3B54A 1BD6A 3KNGA 1HQUA 4CO4A 3C6TB 4OYZA 4MKBA 2BE9B 5GAGI 4HI2A 3A8JA 3I0SA 2UP1A 3P5BP 3BSCA 3J80Y 4M5DB 4MTPA 1YJTA 1FFSB 3GV7B 4I69A 4IH6A 9RUBA 3TARA 4U7CA 2PEBA 3FSXA 4TVAB 1GH8A 4EEYA 4Y28C 3SCJE 3N6MA 4Q44A 4XDDA 2OUGA 1VISA 4TY9A 1VCTA 4NRTA 4ZP9A 4K4VA 4OZ2A 3D4JA 2W9BA 1EJ7L 2YKQA 1FNMA 4LREA 2KFNA 4HLBA 4ETZA 3N5BA 3BQ1A 4ECRA 2Q3PA 2ZH7A 1FERA 2GZOA 3VALA 3DNCA 5LJ5Y 1RTZA 2QL7B 4ECQA 1IM4A 5KT4A 2XNRA 1HWLA 2FB0A 2BANA 1BQMB 2IMWP 4OHXA 1U26A 2JLGA 2FJEB 4Q2MA 4B9SA 4ID8A 3MPYA 3KHLA 4NCGB 1HNZJ 3HXMA 2E5LJ 2J8AA 3O5TB 2I6WA 5AE2A 2PT0A 4F7VA 3RB4A 2KT3A 3HHEA 3WQPA 2M70A 3GPAA 2LEAA 1S76D 2O01C 1FFGB 4ZP8A 4ID5B 2CPZA 1MSWD 1VR6A 2ZC4A 1YBUA 3TP2A 1IKVB 2ZH6A 1C1CA 1UVIA 2UXBJ 3KYLA 4DCOB 1JWWA 3CJ8A 3QSYB 4O3SA 1JXEA 4JI6J 3A3OB 1S6PB 4O3NA 1EAYC 1OQ6A 2YNIB 5KG3A 2C22A 1LWXA 2VH7A 4LMZA 1YITS 2HQFA 2KHDA 3V4MA 3TUIC 5D3GA 6FDRA 3KHRA 1D9DA 4IDKA 3KKFA 2B6AA 1V3RA 2M2BA 2E1CA 3W8GA 4JI7J 4K0KF 4YHHF 3T5LA 2WONB 4WPAA 4YEAA 4Q0BB 2QYGA 4Y2CA 2B9XA 4URSA 1LKZA 4F26A 2E7WA 3NGRA 2D41A 2RKIB 1JJCB 1N8RT 2F7VA 5CXTA 3CUNA 4C97A 4F67A 4ZVPB 3RRHA 4RPFA 2LU2A 3DU6A 1I6JA 3QZ7A 4M1KA 4X4UA 8AT1B 1AUDA 4LQ9A 4ZDNA 2DGTA 2KYXA 3VGSA 1YHQS 2HMIB 2ADBA 3KUHA 4ED2A 2CQ3A 4U67Q 5K8MA 1CULA 1N56A 2HFVA 3T19A 1IBLF 1EX8A 3ILJA 3IN5A 4M5IA 1CVJA 5DDOC 4KGXB 3SDEA 1ITPA 4IG3A 1LWFB 1UPMB 3LP0B 4DR7F 4EK2A 3V6DA 1WHYA 1MNEA 3S1TA 2BDPA 2RMLA 5JUMA 1QTMA 1LXNA 5EGYA 1JJ4A 3CMAS 1FF2A 4LFAJ 3LGMA 1Q7YT 3VGVA 3HT0A 4S0MA 5GMKa 3GFZA 2ZBRA 1P1TA 1RWUA 4KH0B 3KJFB 4OJ3A 3TZZA 2CPEA 3TOQA 2NZ4A 2YBVA 2WTFA 3ITHA 4LF5J 4AL5A 5HSPA 5ETSA 2J0WA 1GAOA 2ZBPA 3FSIA 3C6UA 1RT1B 1TKXB 4KHRA 2FD2A 3DOKA 1NHVA 2RRAA 1HKAA 2OFHX 2BX6A 3BSNA 4J9SA 2D3O1 3KJVB 5CZXA 5LMNF 1U49A 3CWJA 4RLEA 4YN3B 1YG0A 3V6JA 2DH8A 4UTGA 4QIFA 1M1GA 5D4PA 2ZHBA 4FF2A 4QR0A 4D3HA 1X5TA 4DFJA 1PJ6A 3ENAA 1JXLA 4O0IA 4URGA 3M1VA 5L1IA 3T1AA 2XY6A 3MM7A 5A76A 2UXDJ 3KG0A 4DPXA 1IKXB 3L7OA 1NH8A 2B8QA 3CGIA 3PR5B 2DGOA 3O44A 1F9FA 2XMAA 3SYZA 3GYGA 2ZH3A 4FKYA 1E6VB 1F6TA 1HYSB 1ZS6A 2JOQA 2HG4A 3KLHB 4ZCKA 3PW7A 4NCAA 4BS2A 3K2YA 3BS9A 1AA1B 2COLA 2XCAA 2R8IA 1DAXA 3IM8A 1B0TA 4EUVA 1FWKA 1JLGB 3WIUA 1JQGA 5BJRA 3I96A 1RXOB 1BXNA 2Y0SD 3M8QB 3THTA 3KNAA 4MK7A 1R8AA 3DC2A 2DO0A 1FT8A 2JNJA 3FVYA 4P52A 3BGFA 1TELA 2HW3A 4P7VA 2OTLS 4C6AA 4DCPB 5C42A 1W2IA 1HQEB 1VRTB 4DPTA 3QJJA 2MKKA 1IJFB 2HGLA 3CF5Q 1JLQA 2AJQA 3C16A 4P6QA 2MQQA 1H3DA 1NEEA 3FQLA 2MDAA 1WF0A 5A8RA 3HZEA 1YJRA 1OYDA 2RDIA 1PYOB 4X4RA 1ZM2A 4R5PA 3GU0A 2VQFJ 4V19X 3NLCA 2LQJA 4MIWA 4P71A 1TL3B 3NNAA 2IM2A 1S1VA 2B5JB 5AXKA 4F3QA 1B99A 2CQ0A 3RAXA 1CC7A 2IDLA 4WIIA 3LWMA 5DZ6A 3M6UA 3PEJA 2W9CB 4K59A 2OO4A 1N48A 2R9LA 4KPYA 2W1BA 2NREA 2XMWA 3OL9A 1KD1T 3PW4A 1B0PA 3Q8UA 3LWLA 1EQMA 2ASJA 4HH0A 4IG0A 3NXZA 2NLWA 1YBAA 5E2QA 3GJRB 2CPXA 2OPRB 4CH0S 2YWWA 4Q45A 2XWXA 3TI0A 2EG2A 2ZVIA 3UW1A 4LSLB 2BOAA 1MW7A 1KRPA 3EVMA 3HVTA 3Q8YA 4DL6A 3AOCA 1YVFA 3D2WA 3CDAA 1LV5A 4M5KA 1WUUA 1YRUA 3HK2A 3M2VA 1REVB 3CDWA 3QPIA 1OY6A 2B4PA 4IYQA 3QT5A 1EETA 2B3TB 2Z57B 3KMSA 2DNMA 3VAHA 2K8GA 3D3CJ 3ZZRA 4FYYB 3BO3A 3DOLB 3TA1A 1HHTP 2OPSA 2FZCB 5A8KA 2HZAA 3K5OA 4QZVB 3DRRA 2G2ZA 2N3LA 3PYEA 2VHGA 1K73T 1WHXA 2OLWA 3CCWA 1D3WA 3U7JA 2JSXA 2X1AA 1TR0A 3UE2A 4OL8A 5KT5A 4KO0B 4C3MA 1HBUA 2SXLA 4PUOA 5E5NA 4ZKAA 3EYZA 4DV4F 5BR8F 2AQ4A 2FVCA 2VG7B 3QT8A 2G13A 3FMWA 4ITSA 1KHVA 2QEXS 5L1LA 4RUHA 1S48A 3DRSA 1SV5B 1RI7A 3VAGA 3JSRA 5THWA 1GTHA 4IR9A 1H7WA 3L09A 1MWYA 4GKKJ 3SMZA 3J81Y 3MPDA 3PO5A 2YX4A 2HK3A 2FJAB 4TU7A 2FDNA 1N32F 5DLGA 2YNFB 1VQMS 2GGPA 4ZP6A 2DTJA 5BYRA 3Q8SB 1UFLA 1BQNA 4ED7A 3GTYX 2UU9J 2MKSA 2BKNA 2DK2A 4OX6A 3C14A 2V8PA 4UQGA 2Y9HA 4LVOP 2I0XA 2QLBB 1S0NA 2VJUA 2DPIA 3OFEA 1U1NA 3E51A 3BO2A 4DUTA 1XBWA 2ASYA 5GVQA 1JLAA 1KQGB 4ED4A 4LJMA 2CDQA 1BUXA 1WF2A 5KFBA 3IS9B 5HQ8A 2RILA 2KRRA 3Q89A 4ECXA 3OVBA 1SKSA 1RCXB 2HWHA 1X8DA 3UFCX 2CJYB 4NLYA 1NUEA 2EBEA 3EJMA 1FTCA 1NKCA 4A48A 3RB6A 1WG4A 2ZD1A 3TZXA 2EKYA 2CZ4A 2A18A 3K58A 4JI1J 1LK5A 1X7VA 1VI7A 3HFVA 2OPPB 5A8WB 5DZ7A 4F25A 2HYIB 3H5XA 3AY0A 5KFRA 1Q8LA 2UUBJ 2HRUA 3PW5A 2IJNA 3SIPB 3G6VA 3OR1A 1WKLA 1REGX 3WX4A 3IG1A 3EPIA 2QT7A 4O23A 4WE1B 4QW9A 3GR0A 4PPZA 1RADB 2F8HA 1VBXA 2IVYA 4C2MA 3TX8A 3MMCB 4CM0A 4X65F 2BJ3A 1T95A 3D0HE 2GFFA 4R0EA 3VAJA 1YTYA 1S10A 1OJ4A 1NU4A 4GKJF 3PV8A 1A6LA 3UPFA 1JLCB 2A0FB 2AKWB 5HVGA 2DEJA 1G7CB 4J9PA 3BYRA 2BA9A 1WELA 1S4EA 1FKOA 4DR3F 4RZRA 3L95X 3NS6A 1VQNS 5D0EA 2HS3A 1T03A 2FJBB 4QWAA 2BR0A 4DQQA 4ZPAA 4CTAA 4DR2J 4E0DA 2CJ9A 5F0UA 2ZH9A 4PRFA 3HFKA 2V8VA 5KT3A 3HVAA 1Y4ZB 5IC4B 3MCNA 2IBKA 1IQTA 3Q23A 3OLAA 1JLFB 4DBQA 3FUYA 1U8WA 5IM0A 1SL1A 4B08A 3R5CA 2FLPA 1IR2A 2NSBA 2YNGA 1TVRA 3QIPB 5CYMB 1FDBA 1C4AA 2JLEA 1IUJA 1X5OA 3E8OA 1L3UA 2AP6A 3M8RA 4J9UE 2QLXA 1XNQJ 2JX2A 4WKRA 4CO0A 2VFUA 3QGHA 2ZKTA 1WC3A 4DUZF 2FLLA 3JTNA 3MWBA 3HVWA 1WKJA 2MZJA 3Q86A 1FX4A 2PMWA 3H7HB 4UF4A 1XK8A 5F41A 2JFKA 2ZJPQ 4NLXA 2OI2A 1RQ0A 2VOPA 1NKBA 4NOHA 4LUBA 1C0TA 5A0YA 2DBBA 2BRKA 1Z2LA 2HK2A 1N0VC 2DR8A 2WZ1A 3BJYA 4HTJA 3QNWB 2UUAF 2PC6A 4PQAA 1X4AA 2XMMA 2MZRA 3R97A 2FUG9 1VC5A 1RT7A 5LXRA 3NCQA 2FLNA 2DNZA 3RGIA 2CFXA 2I38A 2WVEA 2H51B 3MM9B 2MGZA 3QMQA 1S97A 4NEYA 3DXSX 5EX3A 1QVFR 4OJHA 1RTIB 1KP6A 3D9BA 1RWNB 4Y00A 1YK9A 4OV6A 1I1GA 1EP4B 4P2FA 4G65A 3PVXA 1CG2A 3TEHB 4FF3A 2IDEA 1U0HA 4DPWA 2DD8S 3H4DA 2DR5A 1SQGA 4MYTA 3R2CJ 2HNYA 3M05A 2HQGA 1P6TA 1LWCA 2WVBA 2AF6A 2I9SA 4PR6A 2C2ZB 3SQGA 1KQSR 5JXSA 3M32A 3R1LA 1P9QC 2G0CA 1Q82T 5IWAJ 3RJMB 1MROA 2YNHB 4DG1A 1Q81T 4F0MA 4ED5A 3L3CA 3R6GB 5F3TA 4F0KA 3MR5A 3LALA 3MM6B 4MKAA 5HQMA 3NG8A 2XQCA 1HNZF 1MN9A 3IR5B 2E5LF 4NZ0A 2EBGA 2MB0B 4LF8F 3V6KA 3FFIB 3VHQA 5KFDA 1WEXA 2H4WB 3CPWR 1RHJB 1SC4B 1FA0A 2D1CA 4YDDB 2QRRA 2BMBA 5LOQA 1DTQA 2B56A 2IVFB 3MMAB 2J9CA 4OYWA 3R3TA 4DR5J 1WC4A 2Y1JA 3G4SS 2IC3A 2W2NP 2L9WA 1FJCA 1IXKA 4ECWA 3BBFA 4NYPA 2VB6A 2PIIA 4DSKA 1DQ8A 2UXBF 1WC6A 3IBWA 2F8MA 2NS1B 3P3DA 3PM9A 1U1QA 1MWZA 3AHPA 4L6V3 4ZN3A 2I1RA 3EPGA 1RCOB 4WBFA 3EMTA 5CD4H 2RT3A 3UWTA 3NBPA 2J9DA 1RJJA 1RHKB 1Y00A 3TYTA 5KFQA 4Z7YA 1FVQA 1RAAB 2GW8A 3MEGA 2ERRA 1YLXA 1KC8T 1WC5A 2V69A 1M5OC 3PKYA 2F8EX 3LGHA 2GMLA 2VICA 1WI8A 1S49A 1GX5A 5KFMA 1XEZA 4LRCA 1LNQA 3LO3A 2VKRA 2HZVA 4CO1A 1RWPB 2AZ3A 1KOOA 4NEZA 4F2RA 4KC5A 1S7HA 1SBRA 3RU0A 2BV3A 3EZOA 1L3SA 4CLFA 2J0XA 5C2CA 2XZWA 4P74A 1U09A 5KG4A 2LA4A 1AB8A 2NPFA 1RACB 1M5HA 3MHYA 3HSDA 5B0GA 4DSEA 2VFRA 3C8YA 1U6FA 1S59A 3W7BA 3MTJA 1T05A 2V4JA 1DLOA 3H5YA 2X3DA 4QBUA 3IWLA 2IVMA 2YH1A 3VVTA 2H5IB 1M1HA 3LGNA 4F4YA 3EGNA 3LF0A 1TV6B 3BKFA 2B7CB 1RKJA 4P2MA 3TAMA 3DKDA 3OTEA 1YRXA 1J5OA 1F9EB 4K7QA 5CYQA 3C3LA 4K4TA 4J9OA 4DX7A 4W90B 4Z2XA 4HDGA 1UJ4A 2QA2A 3D6TB 4LF5F 4LR8A 2VBZA 4DSLA 2B0GA 3FSYA 3CCQS 4B3RF 2VC0A 4PWDA 3R5BA 3GONA 2CQ2A 2GHPA 4OYMA 4WYWA 4JV0A 1QM9A 1HI0P 2DIVA 2W4CA 4NMXA 3QRPA 3RBDA 2HGNA 5J2PA 2VKZG 3FCHA 7FD1A 1HI1A 1KQFB 5I42B 2YKPA 1NB7A 2RB7A 3AB4B 4G1PA 1NJXA 2K3IA 4ATNA 4Y2AA 2ZBCA 3KLGB 4Y2IA 3MD1A 3NKYA 3JTOA 4L3KA 4C11A 3BN4A 2B9YA 4KV8B 1H6KX 4LF2A 4FBTA 3D6HB 3BF4A 3UCGA 4C8LA 4BWJA 2CQHA 1HBOA 4KY3A 4ZP7A 1YJUA 5IV4A 1CSJA 3P5TL 1F0XA 2HNDA 3NCRA 3WHIA 2NSCA 2DGSA 2UXDF 4YR2A 2J9DE 4F04B 4DR4J 4P2SA 2AEJA 2MYFA 5I3PA 2IYIA 2WB1D 5ETRA 4F8RA 1ZPVA 2CQCA 2VFTA 2YH0A 4YY3J 3M2RA 3SZ2A 1G3OA 1NJYA 3IGVA 1UMJA 1LOUA 4NWBA 5IZHA 4DI6A 1D8ZA 1JJ2R 4ELTA 4MAKA 1WOPA 3LW5C 3FC9A 2AJ2A 2CNKB 1S9EA 1BGXT 2KXFA 5KT2A 4OYIA 1RA7A 3IM9A 4AL6A 2NZCA 3HJFA 1RABB 2AJFE 4DQRA 2E1MC 3FBCA 2XS5A 4RW6A 3CDEA 3R2DJ 1VC0A 2R7QA 3LPEA 2OELA 4JI8J 4DV5J 4H4KA 4RBVA 2AD9A 2QE5A 1ICEB 4O4GA 1ZOTA 1LFPA 2WOMA 3PKMA 1HBNA 4NCBA 4MH8A 4FDFA 5DDRC 1UVLA 2EC2A 4ED3A 1HNVB 2F5GA 2DHAA 1W7WA 2EFGA 3K59A 3VAFA 2HNZB 3BH7B 5J2QA 2IJFA 1HMVA 2VQFF 2QYCA 1Q86T 2V50A 1SKUB 1AXQA 3V81B 1FNOA 2PDAA 1NK7A 4LT6A 2YKNB 1O0PA 2LQ8A 3DLKA 2DVIA 1CQNA 2QL5B 3D6MB 1X4GA 4DV3J 4HHUA 1AZSB 4DPYA 2CRLA 3Q2TC 1XMQJ 3BYPA 5K8PA 4DR6J 2J76E 4WXOA 3HHLB 4WWSA 2HHPA 3TZYA 3QRQA 1IKWA 2HIQA 4F4ZA 3ETMA 2NYIA 3OR2B 2GO8A 2D7SA 1X4FA 5H9EJ 2CQPA 2OPQA 1WEYA 2QTWA 4QR2A 3A1YG 2I2YA 4NI2A 3HHLD 2GIRA 1FKPA 2A6OA 2FY8A 2HBQB 2M3DA 3QT6A 1WOOA 2AYEA 1X0FA 1FVSA 3TWZA 1NNDA 2R2TA 1KONA 5KFPA 3W61A 2NPIA 3HSJA 2NUHA 5C25B 2BVZA 4QWDA 2G0JA 5L9NA 2MLXA 1L3VA 2BBEA 2Y3YA 2PFDA 3I5AA 5IOLA 1MMDA 3T5JA 3L7PA 2CIMA 4FYXB 2EXUA 3IBFB 3LAMA 1S0VA 4WK1A 4N5SA 5DO2A 3CJKB 3AOBA 3GJTB 3V2UC 3BGRA 1R8BA 5ETVA 2PD1A 3AXMA 3DDKA 2VL1A 4AL7A 2FZGB 4OIXA 2OSRA 1SC6A 4DL2A 3MPUB 3BBBA 3AT1B 3K5LA 1T7PA 3C46A 4DDFA 3GILA 4MYUA 3DLBA 1HARA 1HHQA 2Y1RI 3A4TA 4WCEQ 3HVRA 3JSBA 4ZVTB 1WTFA 1W26A 3QFHA 4N56A 3DHXA 1V3SA 2XYPB 4RW9A 3PRBA 2GQCA 4LRFA 2E1PA 4DL5A 2BRLA 5T41A 3L7UA 4CCHA 2HGMA 4FYWB 3PYGA 3M8PB 1YKWA 4LFCJ 4IDKB 2FVSA 3HMJG 1FWLA 3DGPA 3EDQB 2M52A 2PN6A 4JB8B 1QVGR 2AYBA 1DJ0A 5GAHU 2DR6A 3G86A 2EKNA 3H42A 2UU9F 5J2NA 2KDOA 1DFDA 3OHAA 3L9ZA 2D3UA 3DOMA 4YHHJ 5JVHQ 5IT9U 4ZVSB 1TKTA 1ZAXA 2NXNA 1UKUA 4B9VA 3ENVA 1A9NB 2GO9A 5HROB 3MM8A 2C28A 1Q79A 4EZ9A 1SCJB 4P7TA 5ITHA 4NYOA 4ZVHA 3VZIA 1JLEA 1UVJA 5AXMA 3HZGA 5HP1A 2EEYA 5EX0A 5IQQA 1NLKL 4RW8B 3HHLC 1HLWA 1NSAA 1K44A 3BDEA 3KK2B 1K8AT 4UZBA 2MQPA 1IWAA 3ET6A 1KKHA 3POTA 2R8JA 1YX2A 3JXOA 1I3OB 4R25A 1IBLJ 4JI1F 4LBIA 2ZBIA 3RW6A 3HFZB 4F3MA 4OI2A 1Y5NB 5CYJA 1TU0B 4HHHA 4YB5A 3CCSS 1KFDA 1N5VA 2UUBF 1CJVB 1BC6A 3OUYB 2CJQA 3C2PA 3JYTA 4TKTA 1DTTA 1UETA 3UDCA 3DN9A 1FI4A 1HW8A 4XPCA 2G0IA 1U2FA 3KK3A 2DISA 2V6AA 3E2EA 3NMAA 1WI6A 2HFOA 5J1EB 4DMZA 4NXMJ 5F8HA 1HPZB 1LW2A 3FK4A 1UA1A 1UL3A 1RKIA 3DRYA 5A6PA 2FHOB 4AD6A 2B9WA 4U8VA 3W2VA 3DLEB 4I68A 3D5MA 3T6BA 2AX0A 4BLGA 3H25A 3OL7A 3T3FA 2C3YA 3HHDA 2XSFA 2BM1A 5EWFA 4IOBA 4CLPA 5EN1A 3KXDA 1G4CA 4UQTA 5KFHA 3DRPB 3OXLA 5HMYA 4FVCA 2J7UA 1XIQA 5LMUF 2ZOMA 1ZPWX 3SCIE 4ZVOB 3SQOP 4ENOA 3MMBA 5KG5A 4ALZA 4DR2F 4GO7X 1PGZA 1RTHB 4JBCA 4ZJLA 4YDXA 1HL6A 2RH3A 3R5JB 2UV8G 2KH9A 1OMSA 2GQ2A 5KFKA 4QU7A 3QWPA 4I2QB 5HO4A 3MR3A 1RP5A 2Y8YA 1S77D 2DRDA 4A8MP 4NXNJ 2ZH8A 1HR0J 2FHKA 4IFYA 5CCLA 2V4QA 1JIHA 1O51A 1XNQF 4WFZA 3J7YU 2WRMA 1SB6A 1RAIB 4PYDA 1Z1ZA 1KFSA 3MM5B 3CC4S 2XULA 2KT2A 4DL4A 1W25A 4JI3J 1HNIB 3HKWA 1SJ4P 5D6GA 1ROFA 1LXJA 3M2UA 2JC1A 1S0OA 7FDRA 4DQSA 4K4YA 2YPYA 3M9NB 3I0RB 1QTNB 2AEFA 3MDFA 1IBMJ 2DHHA 4KTQA 1RTJB 1WTBA 1UW4A 1N4LA 3PXGa 5I3UA 2EI5A 5T7LA 4A8YA 2EG1A 5A8RB 2C1EB 4I7FB 1D9AA 5KFGA 3V5RA 1ZBTA 1TUVA 3C6TA 9ATCB 2OMOA 1J5EJ 5KFEA 1VBKA 4M5DA 4NLPA 1H98A 2Z58B 1S1VB 2Y1IA 2VODA 3CDBA 5AT1B 1PYSB 3SSQA 4P72A 3QJLA 5H1SV 2BEFA 4Q2LA 2FJDB 4HACB 3BGLA 2ROEA 1HBMB 3UR0A 1T02A 4A8QA 1U8SA 1SH3A 2FGOA 3DGVA 2YPZA 1X9SA 4IUFA 4O3RA 2W4DA 1Q95G 2EFVA 2RF2B 5IWAF 4HT7A 1S57A 2FZKB 2FVQA 4CDIA 3P49B 4GO5X 5IT0A 4RJVA 2VFSA 5KOXA 1RT5B 1KR4A 3JS9A 2BJ1A 1FD8A 3C19A 1CJUB 3EXYA 1OQ3A 1CEZA 2YTCA 4HT5A 3ZZPA 2OEKA 2XS7A 3PX6A 2H3EB 3CMQA 3EXCX 2H1YA 4ZJQA 4OZ3A 2QSWA 4G3IA 2J5AA 3VQTA 5HLFB 1VLOA 3PW2A 5LSOA 1H2TZ 1JKHB 1VRUB 4CYUB 1FRLA 4DZ6A 5GAHI 2IIHA 3OXFA 1YIJS 1SPBP 2ZWOA 2CQDA 5G0RB 3R7BB 4A8KA 2FHMA 4HI1A 4ID5A 2ZVSA 1RZMA 2VC1A 1R89A 2DYAA 2AYMA 5FIIA 4ANDA 1VQYA 1IKVA 3BSOA 3FNNA 1IJEB 3B6BA 4OYAA 3TRGA 3M30B 3NWRA 4OLOA 2WBRA 4DR1F 2O3DA 4X4SA 5E3AA 5DRKA 1S6PA 2BJEA 3HM9A 2YNIA 4LVNP 5DJBA 3CCZA 3KLIB 4IOCQ 4B9LA 4M63A 3LH2S 3OFGA 1IBKJ 3GB0A 4QW8A 3T6JA 1UVMA 4I6YA 1R0AB 4FN5A 1JNRB 2HKEA 4DV4J 5KT6A 1JLBA 1TK8A 1H73A 2H4YB 1HWUA 4NA1A 4BC7A 2GGPB 4LSNB 4CLTA 2WONA 2HURA 4Q0BA 4PG7A 2V34A 3FRYA 2EVZA 4EGLA 2XBPA 2V0NA 1MWQA 2J6TA 2KG1A 5F8GA 3N01A 3PHEA 4Q8FA 3OTOJ 5H9EK 4J90A 2XGQA 1TTHB 3I5BA 4OZ0A 6FD1A 3QT7A 1H72C 4I6WA 4LF9J 3ULHA 4C98A 1LW0B 1FHTA 2HMIA 2VD3A 4LF7J 2DEIA 1C1BB 3O1LA 4IR1A 4IOAQ 3ZZOA 2IRYA 2RHQB 3TVZA 1WKKA 4X4OA 2R4FA 1YJ7A 1VQ6S 2W9AA 3OJUA 2KXNB 4C0HA 1N5TA 3OXGA 3RTVA 1YZ7A 1LWFA 3PFOA 4IH7A 1SI9A 3LP0A 4GMKA 2BACA 1F2GA 2Z2MA 2GCFA 1WNEA 3PRDA 5AXLA 4YS2A 2V67A 3MZIA 3TUJC 3K0JA 1M1KT 2MQOA 4X4QA 2MXYA 5D0RA 2DRBA 2J7WA 2WAQD 3PO4A 2HWIA 2ILYA 3KLFB 1Y11A 5KFVA 4DPUA 5B0AA 3AD7C 3HPOA 4P73A 1X31C 1NSQA 4B3OB 2ZDPA 2H65B 3CD5A 4WP3A 3J7A1 4W4MA 4FNIA 5CHCB 2FYXA 1O5JA 3MEDB 5KFYA 5BYQA 4Y3CA 5F8MA 3J7YI 3OD2A 1X4BA 1RT1A 1TKXA 2LQ9A 4UY85 2RUGA 3GWCA 1SKWA 4TLRA 4F4XA 1MMLA 2YKMB 5J2MB 3I55S 3KJVA 2C2OB 4DL3A 2D9OA 3HDSA 5ETPA 4OHVA 1TAUA 3JSYA 2JFDA 1ZZFA 2KI2A 1RB0A 2MZTA 4QOTA 2KZMA 4WZMA 4ZPBA 2IJRA 1QAJA 1K0TA 4DN9A 1RYRA 5ETQA 4X62J 3L4BC 3M6WA 4WFYA 4A8FA 2HQ3A 5KT7A 4YY3F 4CTAB 3ZTOA 1GX6A 4GKJJ 2KU7A 3CXCR 2Z8QA 2OEJA 2XLJA 1ZM4A 1IKXA 3CJ4A 1XWLA 3GSIA 4BDPA 4PABA 3OTCA 4KGMA 3C15B 1E6VA 2V8DA 4PXBA 4F50A 3R5AA 1HYSA 1CS4B 3BBCA 5GMEA 3KLHA 4G1QB 6AT1B 4XO0A 1NK8A 5HMWA 2AGOA 1TMMA 4JI8F 4DV5F 3N4WA 2C2EA 4MKVA 4URQU 1JLGA 4XDCA 2KTQA 5AJ3J 4DX8H 1QAIA 3KG1A 4OMFG 1YQHA 1FNXH 3M8QA 2YVSA 4MIAA 2Q66A 5HJXA 1R0CB 4J9LA 4UOHA 2UUWA 3MECB 4KGZB 3MEEB 2N3OA 2GMHA 5AE3A 3CMES 4ZK7M 1HQEA 4RBUA 1VRTA 3ZZUA 3UD3P 4KSEB 1KN6A 5C24A 3MAAB 4C3LA 2ADCA 4PQUB 1BQXA 4PG8A 2MKCA 2QGFB 3D66A 2I5JB 4A4JA 2J6SA 3S6EA 2MGZB 3HKZD 5F8IA 4DV3F 2F63A 4A8OA 1XMQF 3CO9A 2E5JA 3TJ8A 2DT9A 3GCWP 1KLMB 1IR1A 2UUAJ 2OTJS 1QUPA 1TL3A 4DR6F 4OI4A 2QMUB 3W66A 3TAQA 2B5JA 2HHWA 2P9GA 4U96A 4BWMA 3K5MA 2VPXB 3OJSA 2EFNA 3W5YA 2HNYB 3CB4A 4RL1A 2W9CA 2CZVC 5HATA 3IR6B 2ASDA 2CUYA 4WXWA 2YY3A 4NLOA 2D69A 2AYGA 1U4BA 3WIVA 2JH3A 4Q7AA 1GMWA 1S1WB 1RK8A 4J7CA 3NS5A 3NP5A 5U47A 2UVVA 1FRMA 2MJNA 4UOGA 4GVLA 4ZJOA 3IGNA 4CLUA 5LSLA 1RWWB 3OPKA 2OPRA 4DSIA 4J9KA 3KTQA 3M8WA 4LSLA 2DXEA 3GFYA 3UQSA 4IFVB 4OJGA 2FGCA 2LVWA 1REVA 2BZ2A 3TJ9A 2V2QA 2IC3B 5F9LA 3NAHA 2CPHA 1I5OB 2GAHC 2WCXA 4LF8J 3X1LB 2R7RA 1NSKL 3B82A 1YJNS 4C0OC 4LIRA 4QYZJ 4RNOA 3K57A 5HBMB 4C8MA 2UUCJ 3PFEA 5DQHA 1PBAA 1PKUA 3WDOA 3IRWP 3AOAA 1WG1A 4Y34A 2V8GA 3DOLA 1G6BA 2HEKA 1K1QA 4HDHA 3MI7X 3GIIA 1UZDA 2OMLA 3R27A 4EYIB 4OZ5A 2VIHA 4FYDA 1FCAA 1S6QA 2MEWA 4A47A 4LFCF 3RYLA 2BUNA 3DYAB 4C9DA 2ZKUA 4DV1F 3QZ8A 4ED0A 3CJ3A 1U1KA 4AE5A 1YI2S 1RT3B 2VG7A 2V4RA 3VAKA 5E33A 3VGUA 5GADI 2WBMA 3GMGA 1SV5A 2W24A 3M8ZA 2HVEA 2OGUA 3W2WA 4X66J 2IY5B 2RDDA 2IMOA 1HWJA 4PXEA 5EWGA 3DLHA 1PILA 2L41A 4F0HA 3PJ9A 2ALZA 2HS0A 2YNFA 1S6UA 4RNHA 3VCDA 1TL1B 2DHXA 1DLOB 4ZVGA 1OSCA 1IN0A 5K14B 4DV7F 5IT9Y 3EX7B 1S1UB 3GFXA 4KB7A 5KFUA 1XNRF 3ZFVA 3IR7B 2DXFA 3DM2B 5DGAA 1RWVB 4JP8A 3MTKA 4PZVA 1U0SA 3IS9A 4OHWA 3TAMB 1G1XA 1T9TA 1NJWA 1F1BB 2C42A 1Q53A 3RR7A 2MSTA 2ROPA 1H2UX 2D3ZA 1J5OB 3G71S 5CYQB 2Q43A 3N6NA 2DIUA 3JAMU 3Q2SC 3DLLQ 5GMDA 3PG9A 1QAYA 2XYHB 2A1BA 1SL0A 3ONQA 3DLGB 4A8WA 2FHJD 1N5SA 3JQMA 1XMOF 2L08A 1XR6A 2W2PP 2RIJA 4AQYJ 2UVRA 2QIFA 1GFWB 1SKRA 1VDHA 4LRAA 4NXMF 2ZFHA 3D0GE 2VG6B 4USIA 1MU2B 4ZITA 4PPDA 2W2OP 4WFAQ 3PEHA 3FEZA 5DG9A 2F4VJ 3T5HA 4CLYA 1UWBB 5K8OA 2VUGA 4P10A 2AX1A 4B3RJ 2LQBA 2YQ0A 2YKAA 4Y0FA 4EZ6A 4WE1A 2W2MP 2LQ5A 1R6YA 1F5BA 5ETKA 1BE4A 4F36A 2YWHA 4CI0B 2AWZA 5HL7Q 2VDIA 3EWGA 2PA3A 4EO8A 1N34F 1YJWS 2Z4PA 3PJWA 1JLCA 2QN6B 4QIGA 3WC2A 1R8PA 2HS4A 5EDWA 4C8YA 5RUBA 2N7YA 4KHMA 2OD4A 3G8SA 1FWPA 2LYVA 3LTOA 1M90T 2VZ9A 2VASA 2IAJB 3TAPA 3D68A 4NXNF 2GAGC 1HR0F 3KLEB 3PTWA 3ILLA 3FCWA 5E41A 1KTVA 2IHR1 4PG5A 2HPUA 2M5YA 4B9TA 1NB2A 1FXLA 2VBYA 4OYXA 1WD6A 2XHWA 3AFGA 4A8SA 1N5YB 1JK9B 2ATCB 4JI3F 3LA0A 5KFAA 1LK7A 3RG6A 1IKYA 3QIPA 5CYMA 3QQCD 3GYNA 1PG5B 2YX1A 4ANEA 1DBDA 3TA2A 4O0NA 1IBMF 2AU0A 2WOMB 1XQIA 1HBNB 2ATLA 1E6YB 3W8PA 3PHTA 3LQVA 3J81j 3A3PB 4ES3A 3CCES 1M5PC 2Q1LA 2VFVA 3JSMA 1SQFA 3DRXA 1N54B 1Y3JA 4H4MB 1CJKB 3QLHB 4FKXA 1J5EF 2YWGA 4WK3A 2ZNZA 3LOUA 1FO1A 4DCJB 2DNHA 1WHWA 1KWMA 1RT6B 2HZCA 3DLKB 2L9NA 4WU2A 3RUBL 5IQ6A 2NXJA 1CQMA 2ZZNA 5C5JA 2RS2A 1LWEB 1URRA 3ETOA 5J1PA 1H38A 3MM9A 3AD9C 3THVA 4H4OB 2ZZMA 1Q8IA 1RAJA 1RTIA 3RB3A 3N79A 3MCSA 4L76A 4YUDA 4F4KA 4J9VA 4NPOA 3KMQA 3M7VA 1GK8A 2CPDA 1TL7B 4CQ1A 3D3BJ 2AW0A 2E1RA 3RBZA 4AUKA 2BJ7A 4DU8A 1D8YA 2MKJA 1RBAA 3F44A 2DCUB 2RQMA 2HHHJ 4KPCA 4O4RA 4ZLPA 3DDIA 5DS7A 3FCVA 4E98A 3UVJB 3GJQB 3MM6A 2MKIA 2XLIA 5GAGU 1FJGF 1VK3A 1CLFA 4J9RA 3AJ1A 4J9MA 1ZTTA 2CQGA 4C0BA 4N8OA 1GMWD 1M0SA 4FS1A 2B43A 5KFTA 5L8RC 3M4XA 3T1HJ 3FFIA 3X3UA 2Z2YB 1URNA 4ZMMA 2XY7A 2FC9A 5MLCV 3KK1B 1VIOA 4FXVA 3I9V9 4QU6A 4EWTA 3M6VA 2DY9A 3MMAA 3QSIA 4RWXA 1BHNA 4ZPWR 5SZTA 1FDAA 3W9HA 1PC5A 2MQLA 3PIPQ 4BHQA 4M5JA 5HANA 3UCZP 3OLBA 1NKEA 1TAQA 2OJ3A 2FIUA 4ECUA 3KUGA 2BW2A 5IXUA 3GIMA 1NBEB 2CVEA 3K89A 1ZH5A 1UP1A 4ZPVR 3U1MA 3CW2C 1VGYA 5HN0A 2HVHA 2RNEA 2XB2D 2HFSA 1IBKF 5C7PA 1FE0A 4AT1B 5A2QU 1X4DA 3ZTPA 4JYAJ 3G8QA 1FJEB 1WHVA 1RSCA 5K20B 3NEKA 2OSQA 2EK1A 4ICLB 8ATCB 4YB1P 3HF5A 1BMQB 4Q8EA 2C2KB 1HA1A 2O5DA 4YOEA 4X4PA 3WBZA 3OTOF 3OL6A 1M5VC 2V63A 5EWEA 2XO7A 4ZVEA 2JDJA 3GP9A 4LF9F 2FVPA 1IR0A 3MM8B 2HBZB 2L3MA 4LF7F 5EHHA 4X64J 2A6MA 2EC0A 5D78A 1B0VA 2BQRA 3DMJA 5KFXA 1JLEB 2BJDA 4DL7A 3GV5B 4KBIA 1XJWB 2F1FA 1IVZA 1WWHA 1OYEA 3DLJA 3SBMA 2AMCB 2CZ9A 3I6PA 3ET6B 2CQIA 4IRDA 1OPIA 4DXLA 1TV6A 3FKBA 1CBKA 2KKHA 4E2FB 4C8NA 4YB7A 1QUVA 4YP3A 3HSZA 1EIYB 2CJKA 2CYYA 4RR5A 4R8UB 1Q0NA 1NO8A 4O44B 1ZAVA 3BB5A 3IRXA 1P8GA 1QE1B 5KG0A 2H5EA 2C2NA 3RAMA 4GC7A 1K47A 4FP9A 1X0PA 2G9OA 2B7BB 1RT2B 3AQOA 4OHZA 2C3PA 1AW0A 3PX0A 3J7AN 1DHMA 3WC0A 1PIEA 2E44A 1FD2A 1TKZA 2R7TA 2LDYA 2VDHA 2BABA 1QDUB 3IBCB 1S4FA 2QJ3A 4XK8C 4DU7A 1UCNA 2CNOB 5L1KA 5I42A 4ELVA 2G4BA 2DH9A 1NK5A 4HKQA 3R1HA 4XIUA 2JHEA 3KLGA 1T3NA 3BZQA 4M8LA 3QGPA 1T0TV 1WC1A 2B51A 1S1TB 2GS8A 1DQAA 4KV8A 3RBXA 4X62F 3IWNC 2XSJB 4C8OA 2PEHA 2HRYA 4ZLNA 4O3QA 3SV4A 5KFNA 3CNQP 4DFPA 3TUZC 5CD4A 4TY8A 4CRJA 1D0EA 2VA2A 3P6YC 5LMUJ 3QJPA 5L38A 4DUYJ 1RWKB 4WKYA 4ZLLA 1NZAA 4I2PA 2O66A 3H90A 4DZDA 4DJBA 3I82A 2GHVC 4X84A 2AGQA 1SC1B 5AJ3F 3R9LA 3CTRA 2K1RB 3HD2A 1RU2A 2HQCA 3H2LA 2PO4A 5D4LA 4RO0A 5D8HB 4ERDA 1MMNA 2E9TA 2IA6A 3CJ0A 4ZS6A 1NHKL 3CSKA 2JJ4D 3P8BB 3VQSA 2ZH5A 5KFWA 1T94A 2VPYB 2YWKA 4QWBA 5JMNA 2W8LA 1WF1A 5L46A 4PEOA 4K2JA 4CLLA 1HNVA 1R6VA 2JVRA 1UEKA 4LRDA 1VQ4S 4B02A 2HNZA 1VIXA 3PACA 3T9NA 2BE2B 2VU5A 1Y9OA 1K0VA 1UPPA 3V81A 1ULRA 1U2RA 2R42A 4RUBA 3OVAA 3LP2B 4FYVB 2YKNA 3BGOP 2MHEA 2DNKA 4DLEA 3D1QA 2HAFA 4DS4A 1VFJA 5ETNA 1GT8A 2GVDB 4FF1A 1SUQB 3N0VA 5KG2A 3DXBA 3R8YA 1AZSA 1RWOB 4K5SA 3RRGA 5HVFA 3DI6B 2XWYA 4NLWA 4CP5A 1T3OA 1AYEA 2HBRB 2RRBA 3HHLA 2OIHA 3EDRB 1WEZA 3WX8A 3ADAC 3OR2A 2DNYA 1GQEA 2VBXA 2CKWA 2QLFB 2VPWB 3KHHA 3G2XA 4GC6A 2HFZA 2RDJA 1UJ5A 4TQRA 3ISND 2OD6A 2MSSA 2Z0GA 5CAAA 2L9DA 5EUHA 3IAS9 3NOGA 1IWGA 4I56A 5C25A 3ZC4A 2HWTA 2Q6BA 4U95A 1FKAF 1V9OA 4DSFA 4MMOA 3PYFA 4RUAA 2CPFA 4GVBA 3ZZ0A 2J6UA 4LBPA 3MEKA 2M0GB 2UUCF 2ZOFA 4M5MA 5HJYA 3CJKA 1WACA 2AIRB 4OFZA 3LUYA 2CQ4A 4QPXA 5B0CA 1H7XA 4WP9A 4DS5A 4W98A 5KG1A 3W5ZA 3VZHA 3GJSB 3W3SA 1FRHA 2AHOB 2W25A 2LLZA 2UUTA 2K2PA 2XHCA 2J8SA 2JC0A 1S72S 3A12A 1NPRA 1PJ7A 4M95A 3EVOA 2VBWA 5GAEU 4PAAA 4DR1J 4X66F 3M8PA 4L75A 2KVQE 1JLBB 4KFBB 1AUSL 3PR4A 2IBOA 5JJBA 2LXIA 2LCWA 2P2CB 2HVZA 5B08A 3BR8A 2ZUGA 2KM8B 1IBCB 3I5CA 4P9SA 3MOZA 3MMJA 3QWUA 2AV5A 1W2BR 4LSZB 5FDLB 3A8KA 2FQQB 3I32A 5LT5A 2K06A 2Q6CA 2ZM6J 2E29A 4RU9A 4MFBA 4ZCIA 2DR9A 2WB4A 1D9FA 3V4IB 4ZLJA 4ES1A 2JEIA 5HROA 1UFKA 1RAGB 3IA0A 2RRNA 4I6AA 1NAQA 1KHWA 4J9NA 1NZ8A 1PO6A 3MOJB 1SL2A 3MR2A 4RW8A 3LP1B 3GIJA 4LF4J 1Q5YA 2XG8A 3GG0A 4MIBA 5E3RA 3KK2A 3G82B 4CM2A 1S9GB 1UTAA 3Q0AA 3A8EA 2CNLB 1OS5A 2V9KA 3ISNC 4AQYF 2J7KA 1GXTA 3AH6A 4RW4B 2N7CA 1C0UB 4U9RA 2ZJQQ 1JB0C 4KKOB 4FPIA 1NMEB 1TZ0A 3V6HA 1CJVA 2V5HG 3OUYA 2XZTB 4I64A 3AD8C 3SI8A 3JAMY 1WOSA 2F4VF 4AXIA 5KFOA 1KOHA 2DXDA 3Q8RB 1X5PA 1VS3A 2GHWA 4ZVFA 3TX0A 5J1EA 2HLTA 3GCXP 1HPZA 1NK0A 3ZZZA 4OLPA 3I4HX 1HIYA 3F41A 3CO0P 3R5DA 3PRVA 2E5GA 2RS8A 2QA4S 1WSRA 4DN0A 3DLEA 4PWWA 3EGWB 4YR3A 2P5VA 1F3FA 1CJTB 4EO6A 2F9JA 1N6QB 1R3NA 1B3TA 4TNOA 2POKA 4ECSA 1HNXJ 3DRPA 2CJBA 1Q78A 2WSFC 3GR1A 4YFUA 2E9ZA 4Z37A 1S1XB 4WFXA 3Q83A 1DRZA 3HLUA 3KG4A 3W64A 3FBBA 2ZE2B 3U27A 4D3GA 1RTHA 2VQEJ 1P27B 2DGXA 2QL9B 3MCMA 2HHQA 1SH0A 2H48B 1UA0A 3EZ5A 2CJXB 2CVIA 4FBUA 2NXCA 5LL6d 4I2QA 2CDRB 4N76A 3TW0A 2OH2A 3DU5A 3ENQA 2ABYA 1RWMB 4ED8A 1NDCA 1RTDB 2X1GA 3TEGA 1FEHA 1HWKA 3RW7A 2X51A 4K4XA 1J27A 2KM8C 4XAKA 4RW7A 2IRXA 3MM5A 2FPHX 2XMTA 4CNYA 1HNIA 4CLKA 4F4AA 1N36J 2XEXA 2DHSA 1KBRA 4ZHRB 2H5JB 2A2DA 3QFWA 3I0RA 2CWKA 4OZ1A 2PI4A 1CC8A 1DARA 1FK9B 1H74A 2GX8A 1ZA2B 1RTJA 2KB2A 5E0OA 5C24B 1HNWJ 1R27B 4OV1A 2MQMA 1RT4B 3TZWA 1AROP 1DY3A 1HQUB 4HH1A 1EQ0A 2GNKA 2XNQA 3GLJA 2N82B 4DSJA 2FTRA 3I0SB 4I7FA 2X3GA 4CNZA 4B9MA 2V68A 4ECZA 4OYPA 4CLSA 4RWWA 5DQGA 4J9QA 4HEA9 3W63A 4F2SA 4M94A 2MY8A 4I4BA 4TYAA 5LXYA 3SCKE 2XCPA 4KIAA 4GRSA 4HACA 4OI3A 2QA4G 1HBMA 3CULA 2W9BB 5KFJA 1H0HB 3I87A 3OQ2A 1VQSA 2HHHF 2HQDA 4KH1B 3SCLE 2RF2A 3BQ2A 1KEKA 2HHXA 1I94F 2B4UA 2MHNA 5CA5A 3SFUA 4ZIVA 4WTOB 3GSDA 4RUCA 3MR7A 1R43A 2KJVA 2BKOA 1RT5A 4DV0J 1V6HA 3O2IA 4OQJA 2BANB 2KXHA 4BBYA 3TVYA 4ZIWA 4NZ6A 1FDDA 3E01A 1CJUA 5ETOA 1GXUA 1KSPA 1U45A 2X1BA 1VQ5S 1RDRA 3T1HF 2R3VA 1O8BA 4IO9Q 2DGVA 5GAEI 4B3TF 3GQCA 3A8IA 3IWXA 4ECTA 4KAIA 2G1DA 3D67A 4NA2A 2CQ1A 4JI4J 4HTIA 1HD1A 1U48A 3CC7S 5HK4A 4HYKA 5K8NA 5JVGQ 5HLFA 4JI2F 3ILIA 2DO4A 1JKHA 1T9UA 1VRUA 4CYUA 2YKOA 4EBEA 4JV5J 1VYAA 2A10A 4DQPA 2PI5A 4X2BA 1R31A 4LBHA 4B3MJ 4MK8A 2GQQA 5ETLA 5CCMA 5G0RA 3CCLS 3FBEA 3K8VA 1PC4A 2BJ8A 2W4PA 3QIDA 1VRQC 1KNZA 1F3VA 1Y0HA 4ZVRB 2RQKA 1C1CB 1FRKA 3BGUA 4NLGA 2ACYA 3M8SA 2GIFA 1C4CA 4M5LA 4DWIA 1S6QB 3MURP 4Y65A 1R8CA 4YR0A 2EFPA 4ZCLA 3M30A 5M2RA 4JYAF 3J7Z5 4UOFA 3VWSA 2E66A 1SJRA 5KTQA 3DHWC 5D77A 3QGGA 1S9FA 4BC9A 5K9FA 2MKHA 2Z2ZA 2D74B 1AT1B 5KFCA 3KLIA 4PWUA 4Z7CA 5D3GB 1MLAA 4ILRA 3W2WB 1SJ1A 2B6AB 1LQ9A 1RLDA 4DV1J 1NPPA 1R0AA 2P8IA 2XO6A 1VQLS 2LMIA 5A2QY 4M5HA 3I9ZA 4C8ZA 5B0EA 2ACMA 3U1LA 3SSRA 3Q8VA 4LSNA 3UN5A 3H8YA 2JVOA 2HSEB 1TFWA 2K3KA 1NXIA 5DETA 2Z2LA 4X64F 4V19J 2DNLA 5H9FJ 1S6OA 4G6VB 2XC9A 3W9JA 2K7KA 4PXCA 1AFJA 4X4TA 4DV6J 2MZQA 2XMJA 2LP4A 3KWMA 2RQ4A 4FVMA 4CIOA 4N77A 2PE8A 3J7ZT 1LW0A 1VBYA 1CULB 4ECYA 2CA9A 2FJVA 1C1BA 3TANA 4TU8A 3BH6B 3N28A 4AFFA 4Q43A 1K9MT 3TVKA 4NLTA 1TMJA 1RWXB 3SDEB 4USVA 2C2MB 4IG3B 4DV7J 2E5IA 3ISZA 3GIRA 3KUEA 3S8SA 3V6DB 1L3TA 1C2PA 1XNRJ 3W1YC 2UXCJ 3OL8A 2M8DB 5F9NA 3JB9k 3LANA 3CD0A 3OFHA 1RUSA 1ZAWA 4DFMA 4B9UA 2EFOA 3PX4A 1SIZA 2DY1A 1VQKS 3BPSP 3KLFA 2QA1A 2GVZA 3CT9A 3ITHB 2P9CA 4NE9C 3AB2B 3ZTQA 1YZ6A 4LF1A 4ZVQB 1XMOJ 4B3OA 1XR5A 1UW9A 3C6UB 2PMZD 3MEDA 2V2VA 4QYRA 2BE7D 4LQ3A 3DOKB 1PJ5A 1GEHA 4DF4A 1N0UA 1UZHA 4CO2A 4ED1A 2YKMA 3PDNA 5J2MA 1S79A 5KFIA 1KTQA 2DGWA 2PFFB 4WJBA 1NDLA 1NJIT 1Q1KA 2G1HA 3AA8A 3HHKA 3GG1A 2CQBA 2E1AA 2R7XA 4G1IA 1FXRA 2MMYA 4XPEA 3M1VB 3CE8A 4DUYF 1X4EA 3MM7B 1N34J 3ENWA 3H2UB 4TXSA 2G2YA 4TYBA 2VG5A 2HVIA 5CABA 5ETTA 2A3JA 1D09B 5SUHA 1LEOA 3MXHP 3QO9A 2E7VA 3OW2R 2HVDA 3W5XA 1Y10A 3AODA 2YXLA 4ZPTR 1F5AA 1VQ8S 3C15A 1IKYB 5E3CA 2LU1A 3C66A 1CS4A 4G1QA 2R7VA 1SJFA 2YWFA 3O6QA 4U7UK 2MQNA 1WDDA 1BLUA 3PIOQ 1NK4A 3F56A 4EFAC 2L48A 2M88A 3CCJS 3IMQJ 3OBIA 1R7IA 4RKUC 2UV8A 1RGVA 1NJZA 2WVFA 4I1TA 2KRBA 1X4HA 3ZTSA 3JSMB 5C42B 3IFEA 3MECA 2F3JA 1X9WA 3MEEA 3NNCA 4DV2J 1YDLA 5KFFA 1B7FA 1XERA 2Y1LB 2AT1B 2AJ0A 3HO1A 1JLQB 1B64A 4LF6J 3C16B 1FJ7A 3G6ES 3SSSA 3MAAA 5F8JA 3MFHA 4LR9A 4PQUA 4CH7A 4NLDA 2I5JA 3B8HA 4R5PB 1ZA1B 2F9DA 4ECVA 4EU0A 3HI9A 4BCAA 2YQ3A 3EM1A 4R0JA 3ZZYA 3NL0A 1KLMA 5T14A 1ZM3A 3IP0A 2R2RA 4YQWA 4NLVA 3D54A 2XGPA 3N5FA 3EICA 2VONA 5KFZA 3FZ2A 1GMUA 2CAJA 4J91A 4JV1A 1J2VA 4ZVUB 1RAHB 1X9MA 5IC6B 5B09A 3HP6A 2QFJA 4JI5J 2BQUA 4MT1A 1U47A 3TQEA 2EK6A 1F60B 4JI0J 2BQ3A 3JQKA 2QFIA 1ZYQA 4ILMA 1RAEB 1VJQA 2X1FA 4ANCA 4IG0B 2XS2A 2VPZB 1S1WA 3H4BA 2M8HA 1RYSA 1OO0B 2LECA 2R7WA 2GJFA 1AFIA 2D9PA 4C7QA 3TNVA 1KVKA 1VHFA 5AXNA 3UD5A 1BQMA 1T9YA 3CJRA 3T1YJ 5E3QA 4N41A 2EFQA 3HVTB 2XM3A 3JTPA 3CD7A 4QQBA
chains in the Genus database with same CATH topology
4NCGB 1SQEA 3HXMA 3FFIA 3X3UA 5L9NA 3M2VB 1L3VA 4IFVA 1URNA 2KZZA 2BBEA 2GJ2A 4ZMMA 2XY7A 5A6WA 2FC9A 3O8WA 3NMRA 3TA0A 3I5AA 5MLCV 3KK1B 2J8AA 3O5TB 4NCGA 1MMDA 1VIOA 1FRXA 4FXVA 3I9V9 3T5JA 4QU6A 3L7PA 1EETB 4IQMA 3M6VA 4EWTA 2MZ1A 4F4WA 5AE2A 3N6LA 2CIMA 4ZCMA 2PT0A 3RB4A 3MMAA 2KT3A 3HHEA 4RWXA 2M70A 3LAMA 2U1AA 1S0VA 4WK1A 1WG5A 2C3UA 2LEAA 4B9NA 4N5SA 5DO2A 3CJKB 3V2UC 1S76D 4ZPWR 3BGRA 5SZTA 1R8BA 4PKDB 2PD1A 1FDAA 3DDKA 2VL1A 1PC5A 4AL7A 2O01C 4OIXA 2OSRA 4ZP8A 1SC6A 2MQLA 4ID5B 4DF8A 2CPZA 4DL2A 5HBMA 1MSWD 3PIPQ 4BHQA 3UCZP 3OLBA 2ZC4A 1TAQA 1NKEA 2FIUA 5L9XA 4ECUA 2OJ3A 4JI6F 5HMXA 3CCRS 2OPSB 4TU9A 2BXJA 5A8KB 3K5LA 2I8EA 3TP2A 1T7PA 2BW2A 4PXDA 1SH2A 4ZA1A 3S7RA 1IKVB 5IXUA 1C1CA 2ZH6A 2EW9A 3DRRB 4DDFA 1DZ5A 3GIMA 3C46A 2CVEA 2C2RA 3GILA 1UVIA 4MYUA 3DLBA 1HARA 3HVRA 2Y1RI 4WCEQ 3KYLA 2ASLA 1JWWA 1ZH5A 3JSBA 1WTFA 5HI7A 3OSPA 3MAHA 3FRZA 4N56A 1FESA 3DHXA 1UP1A 4O3SA 4ZPVR 3HHNB 3U1MA 3H59A 1V3SA 1JXEA 3P96A 4RW9A 3QAUA 3PRBA 2GQCA 3KOAA 1VGYA 5HN0A 4JOUA 2HVHA 2RNEA 1S6PB 1VBZA 4O3NA 2XB2D 1HBUB 4PUOB 1IBKF 1OQ6A 4DL5A 2YNIB 2BRLA 5KG3A 3DYAA 5T41A 4RNMA 2C22A 1FE0A 4CCHA 1X4DA 2VH7A 2O67A 4LMZA 2HGMA 1YITS 3M8PB 3G8QA 4JI7F 4IDKB 1FJEB 2KHDA 2FVSA 3HMJG 1RT3A 2QO3A 3V4MA 3TUIC 3DRSB 2P9EA 1WHVA 5D3GA 3DGPA 6FDRA 3KHRA 1D9DA 4IDKA 2OSQA 3KKFA 2B6AA 4L72B 2EK1A 4ICLB 1V3RA 2M2BA 4YB1P 3HF5A 2EWHA 4KRWA 2E1CA 2M52A 2HHTA 3KHGA 4Q8EA 2PN6A 1QVGR 4K0KF 4YHHF 2AYBA 1DJ0A 5GAHU 1HA1A 3T5LA 2O5DA 2WONB 4EYHB 4YEAA 4YOEA 3G86A 4Q0BB 2NQPA 4OZNA 4Y2CA 4X4PA 2B9XA 4URSA 2UU9F 1LKZA 3WBZA 5J2NA 2KDOA 1JMTA 1DFDA 4F26A 3VAIA 3OTOF 3OHAA 1YRTA 2E7WA 3UR3C 1BQNB 3OL6A 2D41A 2RKIB 2ZM6F 2D3UA 3DOMA 1N8RT 1M5VC 5JVHQ 2F7VA 5LJ3Y 5EWEA 2XO7A 5CXTA 4ZVEA 3CUNA 4C97A 4F67A 2JDJA 3RRHA 3CCMS 4LF9F 1TKTA 2LU2A 1VK8A 3DU6A 5FD1A 1I6JA 2FVPA 1ZAXA 2RKIA 1UKUA 3QZ7A 3OV7A 4M1KA 4X4UA 1A7GE 1IR0A 1JX4A 4B9VA 3ENVA 3PJXA 3MM8B 1ZM9A 2HAIA 1AUDA 2L3MA 2R7UA 4LF7F 1TL1A 5EHHA 3CCUS 3DMJB 3FEYB 1A9NB 2GO9A 4LQ9A 4ZDNA 2EC0A 3AA9A 2DGTA 5HROB 2KYXA 5F8LA 3MM8A 2C28A 3GIKA 5D78A 1B0VA 1Q79A 1YHQS 2BQRA 2HMIB 4EZ9A 2ADBA 3DMJA 4P7TA 1JLEB 1JLAB 5KFXA 5ITHA 2IYGA 2ZHAA 2BJDA 2CQ3A 5K14A 4U67Q 4C3KA 4ED2A 3GV5B 4DL7A 1Y5IB 4KBIA 5K8MA 4NYOA 4ZVHA 1N56A 1S1UA 4Y6IA 2F1FA 2ZHOA 3O3LA 3T19A 3VZIA 4LF4F 1WWHA 1IBLF 1JLEA 5KOWA 1Y3KA 3DLJA 1UVJA 3DM2A 5AXMA 3HZGA 3IN5A 5HP1A 5EX0A 5IQQA 1L3KA 3I6PA 4RW8B 1CVJA 2CQIA 3HHLC 4DLGA 5DDOC 3UCUP 3SDEA 2FHJA 4IRDA 1OPIA 3BR9A 4IG3A 3BDEA 1LWFB 1TV6A 1NK9A 3KK2B 1K8AT 4LFAF 2KKHA 4C8NA 2MQPA 4YB7A 1QUVA 3POTA 3LP0B 2R8JA 4YP3A 4DR7F 3V6DA 4R25A 1WHYA 1MNEA 4JI1F 3S1TA 2BDPA 2CJKA 2RMLA 2ZD1B 2ZBIA 2CYYA 4R8UB 3RW6A 3IRXB 5JUMA 1QTMA 1LXNA 1NO8A 5EGYA 3SXLA 4AXJA 3D1HA 2DR7A 2MZSA 4O44B 4F3MA 1FF2A 3CMAS 1JJ4A 4OI2A 1Y5NB 5CYJA 1ZAVA 3BB5A 3DLGA 2M4MA 3IRXA 5HMZA 1P8GA 1QE1B 5KG0A 3LGMA 4YB5A 1Q7YT 2H5EA 3CCSS 1KFDA 3NGKA 1FEEA 1N5VA 5GMKa 2UUBF 3GFZA 1BC6A 3OUYB 3MUVP 1P1TA 5DQIA 1RWUA 2CJQA 3D1OA 3C2PA 3RAMA 3JYTA 4OJ3A 2KFZA 4GC7A 2CPEA 4TKTA 1DTTA 1UETA 3UDCA 1SJQA 4FP9A 3TOQA 3DN9A 1X0PA 2G9OA 1HW8A 2B7BB 3GZ7A 4IKAA 3U1NA 1RT2B 1Q7LB 3AQOA 4OHZA 2C3PA 4XPCA 1AW0A 2NZ4A 1U2FA 2RD5C 3KK3A 4O3PA 2DISA 2WTFA 3ITHA 3CC2S 3PX0A 4IRKA 4AL5A 2VG6A 3MD3A 3E2EA 1MU2A 3NMAA 1TKZB 1WI6A 2HFOA 4KQZA 4DMZA 5J1EB 1DHMA 1TK5A 3WC0A 3OR1B 2E44A 5F8HA 1HPZB 1LW2A 2J0WA 1GAOA 1TK0A 3OSNA 1UA1A 1FD2A 1TKZA 1UL3A 2PSZA 3IG1B 3FSIA 2GC8A 2R7TA 2LDYA 3CIZA 1RKIA 3C6UA 2U2FA 1ZZNA 2BABA 1RT1B 1UWBA 3DRYA 5A6PA 2FHOB 1TKXB 2Q79A 5DG7A 1S4FA 2B9WA 4KHRA 2FD2A 3DOKA 3W2VA 3DLEB 4I68A 1NHVA 3D5MA 3T6BA 2RRAA 2AX0A 2OFHX 4XK8C 3BSNA 5L1KA 3H25A 4J9SA 3KJVB 5I42A 4L3NA 5CZXA 3OL7A 2DNGA 3H2VE 3NWGA 4ELVA 3T3FA 2C3YA 5LMNF 1HNXF 2DH9A 2G4BA 1U49A 1NK5A 3VR1A 3G6YA 4HKQA 3CWJA 3R1HA 4RLEA 3HHDA 4XIUA 1YG0A 2JHEA 2XSFA 3V6JA 3KLGA 5I3QA 1DQ9A 2DH8A 1T3NA 2R7OA 3BZQA 2BM1A 4M8LA 5EWFA 3QGPA 4IOBA 5EN1A 2DNQA 4QIFA 1SIWB 2B51A 1M5KC 1S1TB 4WZQA 1DQAA 5D4PA 4YMEA 2ZHBA 4KV8A 2J0QD 4UQTA 4X62F 5KFHA 3DRPB 1FXDA 4FF2A 3IWNC 5KG6A 2B4VA 2XSJB 5K5MA 4C8OA 2PEHA 2HRYA 3OXLA 5HMYA 4FVCA 2J7UA 3M9MB 3FMBA 4QR0A 4D3HA 1KVIA 4O3QA 4QWCA 1X5TA 5LMUF 2ZOMA 1ZPWX 3SV4A 3SCIE 4DFJA 5KFNA 1YJVA 4TY8B 2VQEF 1JXLA 3MMBA 4O0IA 5KG5A 4DFPA 3GV8B 1FKOB 4URGA 3M1VA 3TUZC 5L1IA 3T1AA 4ALZA 2WSCC 4DR2F 1XN9A 3NCPA 4GO7X 4NYZA 5KFSA 4TY8A 1HHSA 2XY6A 1PGZA 1RTHB 3MM7A 4JBCA 3M9OB 1D0EA 2VA2A 1T03B 4UUWA 3P6YC 4DFKA 3KG0A 3QJPA 4YDXA 1IKXB 1Z2ZA 3HT3A 4K50A 4I2PB 1HL6A 5L38A 3L7OA 1NH8A 2RH3A 4WYLA 2IAJA 2UV8G 2KH9A 4WKYA 2GQ2A 3CGIA 1NZAA 5KFKA 3PR5B 2DGOA 3O44A 4I2PA 1F9FA 3QWPA 4QU7A 5BYSA 4I2QB 5HO4A 3MUMP 3KLEA 3T9ZA 3SYZA 2O66A 3MR3A 1RP5A 2ZH3A 4OX7A 2WK4A 1E6VB 1S77D 4DJBA 4JV2A 2JLFA 3I82A 1HYSB 4A8MP 2JOQA 2GHVC 2HG4A 3KLHB 2JZ5A 4X84A 2ZH8A 4ZCKA 2FHKA 4IFYA 5CCLA 5IM0B 3PW7A 2V4QA 1JIHA 2AGQA 1O51A 4NCAA 4BS2A 3K2YA 3BS9A 2COLA 3BO4A 2YNGB 1TVRB 4QIWD 5AJ3F 2XCAA 2R8IA 1XNQF 5B0FA 1DAXA 4WFZA 2XMKA 3J7YU 2WRMA 3CTRA 3MFIA 1N5YA 4I67A 1B0TA 1SB6A 2K1RB 1NRKA 4EUVA 1N36F 2K7JA 2IM1A 4MJKA 1JLGB 3H2LA 1Z1ZA 2PO4A 4NA3A 5D4LA 1KFSA 5BJRA 3I96A 3MM5B 3CC4S 4U6PA 2XULA 4ERDA 5D8HB 4TLQA 2KT2A 4DL4A 1W25A 3TQ1A 1HNIB 3HKWA 1SJ4P 5D6GA 1ROFA 1MMNA 2E9TA 1LXJA 2Y0SD 2XY5A 3M8QB 2A2CA 3M2UA 3THTA 4OI0A 3KNAA 2IA6A 2JC1A 1R8AA 3CJ0A 4MK7A 7FDRA 3DC2A 3K5NA 1S0OA 2DO0A 4DQSA 1FT8A 4K4YA 3FVYA 1HNWF 5F3ZA 3G8TA 4ZS6A 5IS2A 3M9NB 3I0RB 3BGFA 3CSKA 4MK9A 3CJ5A 2HW3A 4HHJA 1E6YA 2JJ4D 3MDFA 4P7VA 2OTLS 5C42A 3VQSA 4KTQA 1W2IA 1RTJB 1WTBA 3ICLA 5DLFA 1TL4A 1K1SA 1HQEB 5KFWA 2ZH5A 1T94A 1VRTB 2VPYB 3I56S 2YWKA 2BYCA 1UW4A 4C8KA 4QWBA 2W8LA 1C0TB 5A0YB 1WF1A 3QJJA 2MKKA 3PXGa 1N4LA 5I3UA 4RX6A 2EI5A 1IJFB 5DGBA 1HNVA 2VA3A 4H4MA 2HGLA 2JVRA 3QLHA 5T7LA 5KFLA 3TO8A 1JLQA 2EG1A 3CF5Q 4A8YA 2AJQA 5A8RB 3N9UC 4P6QA 2MQQA 1H3DA 5B0BA 4I7FB 1D9AA 3MPWA 5KFGA 3V5RA 1VQ4S 4B02A 1ZBTA 2HNZA 1NEEA 1VIXA 3FQLA 1TUVA 3PACA 3T9NA 3C6TA 2BE2B 2MDAA 1WF0A 1RT7B 2QLWA 2OMOA 1Y9OA 5A8RA 1K0VA 3HZEA 1YJRA 1RT6A 2RDIA 3V81A 5KFEA 1ULRA 1U2RA 4X4RA 1ZM2A 4M5DA 3OVAA 2ROGA 4R5PA 4NLPA 3ZZTA 3LP2B 1H98A 2YKNA 2JWNA 1S1VB 2Y1IA 2VODA 2ZOGA 3CDBA 1LWEA 2MHEA 4V19X 3H5UA 3NLCA 2DNKA 2LQJA 4MIWA 1TL3B 4DLEA 3D1QA 3NNAA 3SSQA 3QJLA 5H1SV 2IM2A 1VFJA 4DS4A 3BM7A 1S1VA 1GT8A 2B5JB 4Q2LA 4H4OA 4FF1A 2FJDB 2HFNA 3CEDA 1HD0A 1SUQB 3N0VA 5KG2A 5AXKA 4F3QA 3DXBA 2CQ0A 4K5SA 3BGLA 2ROEA 1D1UA 1HBMB 3RAXA 1U6BA 3RRGA 4KJIA 1CC7A 3DI6B 3UR0A 2XWYA 4NLWA 4WIIA 1T02A 3LWMA 4A8QA 1T3OA 1U8SA 3M6UA 3PEJA 1SH3A 2W9CB 3RAQA 2RRBA 4ED6A 2FGOA 3HHLA 4K59A 2OO4A 1N48A 2R9LA 2BOPA 2OIHA 2APOA 4KPYA 3CCVS 1X9SA 2R8GA 1WEZA 4IUFA 4O3RA 5DDQC 1LWCB 2R8KA 2W4DA 2NREA 2EFVA 3OR2A 2RF2B 3QAEA 5IWAF 4HT7A 3US5A 2DNYA 3SQGB 2JRSA 2XMWA 4W92B 5E3PA 2FVQA 3M32B 1GQEA 2VBXA 4DV0F 2CKWA 5CH7B 3OL9A 3CJ2A 1KD1T 3PW4A 3P49B 4GO5X 5IT0A 2FY1A 1B0PA 2H9ZA 2VPWB 2VFSA 1MROB 3LWLA 2N4DA 5KOXA 4DG1B 2ASJA 4HH0A 4A8XA 1RT5B 3KHHA 4UUXA 1KR4A 3PZPA 4IG0A 4Y2MA 1HFEL 2NLWA 1YBAA 5I4MA 5E2QA 1FD8A 4KT0C 2CPXA 2OPRB 4CH0S 4GC6A 2RE1A 3EXYA 4Q45A 2HFZA 2M7SA 2XWXA 1OQ3A 2RDJA 3TI0A 5MAOA 1CEZA 1UJ5A 2EG2A 4NLRA 3NNHA 2WW8A 2YTCA 4HT5A 4TQRA 3UW1A 3ISND 3RZAA 2OD6A 3ZZPA 2MSSA 4LSLB 2DGQA 2Z0GA 4B17A 1MW7A 1KRPA 1Y7PA 2L9DA 4JI4F 5EUHA 3IAS9 4KR0B 2RU3A 1N52B 2XS7A 3HVTA 3PX6A 3EXCX 4DL6A 4I56A 2CJAA 5C25A 1YVFA 2QSWA 3BN7A 3CCTA 3D2WA 3I4PA 4G3IA 3CDAA 4JV5F 1LV5A 2J5AA 3ZC4A 1YRUA 3EZUA 3HK2A 1DTQB 2HWTA 2Q6BA 3M2VA 1REVB 3VQTA 2R8HA 5HLFB 1FKAF 4MKYA 3PW2A 1V9OA 4DSFA 4MMOA