4L6V3

Crystal structure of a virus like photosystem i from the cyanobacterium synechocystis pcc 6803
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
80
structure length
80
Chain Sequence
SHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAAQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of virus-like photosystem I complexes from the mesophilic cyanobacterium Synechocystis PCC 6803.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Electron transport
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
total genus 13
structure length 80
sequence length 80
chains with identical sequence C, c
ec nomenclature ec 1.97.1.12: Photosystem I.
pdb deposition date 2013-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF12838 Fer4_7 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4l6v300
1SIZA 2FJBB 2V4JA 1FEHA 1FDDA 3OR2A 3IR5B 5CHCB 1Y5IB 3MM8A 1Q16B 1K0TA 1Y4ZB 3OR1A 2VPYB 3IR7B 1B0TA 1FF2A 3HKZD 1H0HB 2FJEB 4XDDA 4DHVA 3OR2B 2VPXB 4ID8A 3MMAB 5FD1A 5BYRA 2WB1D 5L8RC 1BD6A 4RKUC 6FD1A 1H98A 1SJ1A 3IR6B 1FDBA 1KEKA 3MM6B 2FJDB 1HFEL 1WTFA 3MM9A 2C3MA 1FRJA 1B0PA 3GYXB 2C3PA 2C3UA 2ZVSA 3PNIA 4XDCA 2Y0SD 1AXQA 3MMCA 1C4AA 2C42A 1D3WA 2WAQD 2WSFC 5BYQA 2VPZB 2O01C 3MM5B 1FTCA 1SIWB 2FDNA 3MM8B 1C4CA 2UZAA 3MM6A 3MM7A 1FRIA 1Y5LB 1DFDA 1H7XA 4KT0C 2FJAB 1FRKA 3LW5C 3MMCB 2FD2A 1RGVA 1PC4A 4OV1A 7FDRA 5E7OB 1F5BA 1FDAA 2PDAA 3MMBA 7FD1A 1FRHA 1FRMA 1KQGB 4OMFG 1JNZB 4XK8C 4YDDB 1BWEA 1F5CA 1R27B 1GTHA 1ROFA 3MM5A 2V4JB 4CI0B 1JB0C 1Y5NB 1BLUA 1BQXA 1GAOA 2GMHA 6FDRA 1FERA 1B0VA 1FRXA 5BYSA 1FXDA 2C3YA 2Z8QA 3MM9B 2IVFB 1DURA 2VPWB 1FDNA 1F2GA 3MM7B 2PMZD 4L6V3 1FCAA 1XERA 2XSJA 1JNRB 2WSEC 1H7WA 3EGWB 1FXRA 1BC6A 2FGOA 1FD2A 1A6LA 3MMAA 1G6BA 2WSCC 3C8YA 4AYBD 2XSJB 4Y28C 2GMJA 1GT8A 1G3OA 3OR1B 2V2KA 1CLFA 1FRLA 1IR0A 3EXYA 1PC5A 3MMBB 5CH7B 1DAXA 1KQFB 1GTEA 2C3OA 1VJWA 2VKRA 2PA8D 3EUNA 1IQZA
chains in the Genus database with same CATH superfamily
1FWPA 1SVDA 1W7WA 3CXCR 4WK3A 2QLJB 2Z2YB 5HK4A 2R8HA 5EN1A 2UUAF 4ECVA 4RR5A 3A3NB 2W2NP 3QLHA 5HP1A 1TK5A 1MMDA 2OSQA 1TL4A 4Q0BA 3H98A 4RW9B 3OR2B 1LWXA 4Z37A 2MSSA 3GR1A 2MKKA 3MR6A 4C4WA 3SEOA 4ZLNA 2EFNA 5BYRA 4HKQA 2LCWA 2LDYA 2R42A 1VQ4S 4P74A 1Q95G 4BCAA 1FDBA 1S4FA 1S1WA 3EDRB 1YTYA 3HSGA 5HROA 3MM6B 2FJDB 1ZTWA 1U48A 3W3SA 3QIPB 5HVGA 1K1QA 4QQBA 2IAJA 4UOGA 4XDCA 1V3SA 1S1VA 3NWRA 4PR6A 1TAQA 2UXDJ 3FQKA 5CABA 1RBAA 5HJXA 1LEOA 2BJ8A 3R9LA 2MZJA 4DI6A 3CCJS 2B4OA 4LJMA 1RAHB 5GVQA 3GU0A 5H9FJ 4DBQA 1FFWB 1CS4B 4K2XA 2ZBRA 3I6PA 2BE2B 2HVDA 1CJVB 2K7KA 4MYTA 5IFMA 3MAQA 5DDQC 3RB0A 4NXMF 2E9RX 3MM5B 4AL6A 3LANA 3OW2R 1M1GA 4F0HA 2A10A 3M7VA 3GSDA 1YKWA 4E98A 3V4IA 4C0OC 4WU3A 4NEYA 4CM0A 3L3CA 1S1TA 4FKYA 1LQ9A 1VK3A 5ETPA 1RT7A 2CKWA 4WZQA 2AJ2A 3DOMB 5HMYA 3OTOJ 2K8GA 4X65F 3J7Z5 2J6SA 2ZITA 3IWXA 3BSCA 3Q86A 2L3MA 1XJWB 3UVJA 4TU8A 3I5CA 3BGRA 3MFHA 2EKNA 3BQ1A 2IYIA 3CCMS 3MCNA 5GMKa 2CVEA 3UVJB 1FRMA 2HRYA 3GB0A 5C24B 2RS2A 4QIGA 2QA4S 1J5EF 1QJHA 5F3TA 3KDNA 5RUBA 3AXKA 3LALA 2E1PA 3N5FA 4ECQA 2JEGA 1HNWJ 5J2NB 4DFKA 2CA9A 1N34J 4WIQA 1CSJA 1DQ9A 1FX2A 1ZM2A 2BE7D 4LRCA 3NGKA 1TAUA 3G9CA 4DUZF 1EQ0A 2DR9A 1FKPB 2QIFA 2RILA 4A8XA 3K5PA 2BE2A 4PAAA 1GAOA 2XNRA 3MI7X 3CULA 6FDRA 4WZMA 1XR5A 4L3NA 3U1MA 4KQZA 4CO1A 3B4DA 1AROP 1O8BA 2IJFA 1RWOB 1U8WA 2ABYA 2GO8A 4P75A 4F04B 1N5YB 3IS9B 3Q8UA 1R0BG 4GC6A 1XR6A 1S9EB 2ZNZA 3LGMA 4RPFA 1LW0B 4J9SA 1L3KA 3MUTP 4CDIA 3SV4A 4IOAQ 2HVEA 1T0TV 2CPIA 3BYPA 4Y2KA 4N56A 4F4YA 5F0WA 1T8EA 2R7TA 2XSFA 2IM0A 2FGOA 4LSLA 4J9MA 2IMWP 3UDEA 2D41A 1ZAVA 1X9WA 2H48B 4NYOA 1N48A 3PEJA 1YZ7A 5KTQA 4JI0F 3CCRS 3OT9A 4PUOA 5D3GB 4QW9A 3QLHB 1O5JA 4DOZA 2DEJA 5HP1B 4JV1A 1YRUA 3JAMY 5L1KA 4M95A 2WBMA 1SPBP 2V94A 3GTYX 3PX0A 3OTOF 3B54A 1S9FA 1A0OB 1S7HA 3SCIE 3ENVA 4O44A 1ZOTA 5AE3A 1VJWA 2ZWPA 3D1QA 3IRXA 4R8UB 2GV1A 4X4VA 3TUZC 2FJVA 1N52B 3CD5A 2ZZTA 3S01A 1GMWD 2LYVA 1D9DA 3MM8A 4DV5F 2XHCA 1C0TB 1A9NB 2QA4G 2RDDA 1NSKL 2DXFA 2MY8A 2LXFA 3KOAA 2ZOGA 2Y8WA 3ELHA 3HJVA 3HKZD 3C19A 3QAEA 4CO2A 3OFFA 5E3AA 5KG6A 2AV5A 4RUBA 1RT3B 2OELA 4ECTA 1UTAA 1GMVA 3LPEA 1WKJA 4ECSA 3H4DA 4NCGA 1UVMA 2DH8A 3I4PA 1FFGB 3PG9A 4EO8A 2NCKL 4WXWA 4WF9Q 2PGCA 1P9YA 2PIIA 2CDQA 4HVZA 5I3UA 1NHVA 2PA3A 1WI8A 1QVGR 3QPIA 1HQEA 1IWGA 1UJ6A 4G1QB 5E3CA 4C11A 3M9MB 3MR7A 1FNOA 2RF2B 2ZEJA 4EO6A 1C4AA 5IT9U 1WG5A 2BVZA 1HPZB 5CD4H 2PC6A 4O0NA 4DV3F 2IIHA 2LVWA 4LFAJ 5HQMA 1VR6A 3PRBA 1M90T 1TL3B 4O3OA 2CQ1A 4EGLA 1U1NA 2WONB 4NLTA 3AJ2A 4OYZA 5FDLB 4N77A 2ROEA 4F3QA 4OZ0A 4YR0A 3T5KA 3BO3A 4P2FA 1NDLA 1D09B 1RT4A 3DOKB 3MM6A 4JUZA 2OPRA 2ZBIA 3HHKA 3P4UB 4IG3B 4OV6A 4F0MA 3ISNC 5KFCA 3P5BP 2LECA 3BDEA 3BBFA 3V6KA 3K5MA 4NI2B 2UU9F 3PFEA 3P8BB 2PFFB 4K0KF 3G86A 1XR7A 3PFOA 3R8YA 1ZYQA 2C28A 2KZZA 5E7OB 1F5BA 1OY8A 3IS9A 4NL5A 2ZUAA 4HT5A 3ILOA 3V6DB 3LP1B 4QR2A 2HWHA 3W2WB 4G1PA 1T03A 2ZZNA 3MECA 1HQUA 1LWEA 4ERDA 2V63A 3CCES 2OGUA 3OD2A 5KG3A 5GAEU 3BH6B 3MM5A 3LUYA 1RISA 3OL6A 4DR4J 1ZZFA 2ZDOA 3EVOA 3SSSA 3CCUS 2R7VA 4WFNQ 3TX0A 3GZ7A 4QR1A 4JI1F 3GP9A 1UPPA 4BBYA 3HJFA 3S7RA 2G1DA 1E6YB 2HHTA 1NLKL 4KGMA 1VRTA 3MM9B 3VGTA 3CCWA 2RJZA 2VC1A 1WC6A 3M8YA 4AQYJ 5LXYA 4M5GA 3D6TB 4ZLJA 1NSPA 2JFDA 2KT2A 2VPWB 3AQOA 2KVIA 3BS9A 1TU0B 2UUWA 3GFHA 4UZBA 3D0GE 1ITPA 2N4CA 3MEKA 1JLAB 3AOAA 4X64F 3RBEA 1FJGJ 2F4VF 2CQCA 1EQMA 1S6PA 3EM1A 3PTWA 1KTQA 4ELTA 5HBMB 3MEDB 4DR6J 4JI2J 3VALA 1CJKB 2DNOA 2V6AA 3QATA 2NPFA 3PRDA 3R6GB 2ALZA 1QUPA 2YNIB 4U67Q 4M5IA 2Y1IA 3NXZA 4IQMA 2CJKA 3UNGC 2BMBA 2YWGA 3CCZA 3BPDA 1LWEB 3THPA 3V2UC 3BBCA 2HYIB 1RACB 1FXLA 3C66A 1YJWS 2HVHA 1IR0A 3BEGB 4HR2A 4A8KA 3G2XA 1RTZA 4H4MB 2KJWA 4K5RA 1EETB 1OO0B 1U1OA 2NSCA 1XMQJ 1BQMB 1QY7A 3OTBA 2XULA 4YY3J 1HNZJ 5D4OA 3EE3A 3CC4S 1KNZA 3NOGA 3DOLB 4P2MA 2K3KA 1FEEA 4CM2A 1X9MA 4C48A 3M30A 2QYCA 4AE5A 2UV8A 1HBOB 5LMUJ 1TV6B 4RW6A 5J1EA 2EI5A 1WF0A 3A3OB 1S49A 1T05B 1HBNA 5EHHA 2I38A 1GX6A 2GHWA 2M4MA 3OHBA 1S0NA 4B3OA 5D0EA 3IGNA 3R97A 4OYOA 3HULA 3TP2A 1FO1A 4A48A 3VAFA 3KK1B 5J2MA 1IKWA 3RR8A 4B9SA 1JLQB 2W4CA 2P6TA 2VODA 3CJ4A 2DHAA 3K5OA 4FXVA 4USHA 1JLEB 1HWJA 5I3PA 4R8UA 2A18A 3A8EA 3HVTA 2NXNA 4NEZA 4Q2MA 5DG8A 4DR1J 3LP2B 5DJBA 4ZK7M 1U1PA 3KUHA 2ADCA 5KT2A 4B9MA 2AX1A 5E2QA 2E7XA 4I2PB 2XMUA 3GCXP 3H59A 3PIOQ 1U1LA 2R8IA 3C6UB 1TL5A 3IG1A 2LU2A 4OZ2A 1SKRA 4B9VA 2ATCB 4K7QA 4ZHRA 2GCFA 1IKYB 1Q1KA 3JYTA 3TAQA 1IWAA 4EEYA 1V5VA 1YHQS 2R4FA 4ZVGA 4ZVSB 4AFFA 3FRZA 5KFSA 4YHHJ 2WW8A 1FX4A 4NMXA 2NR0A 2X51A 2RE1A 4K4ZA 3G96A 1SI9A 2OPQA 4DSJA 2DT9A 1XTZA 3P96A 4JI6J 2DGVA 4QPXA 2HFOA 3MM8B 4ZJLA 3H0PA 1TKDA 2RU9A 3VAJA 1Q8IA 3O2IA 2HW3A 5LSOA 4B02A 3GFYA 2CPDA 2HFUA 1VQPS 2IBKA 2FHMA 2OFGX 2FJAB 4FDFA 4F26A 1HKAA 4G1QA 3Q24A 4QJVA 3QFWA 1NRKA 1SKWA 3CUNA 3M2VA 3I31A 2QLWA 4AT1B 3M2RA 1T9XA 5B0DA 1O51A 2JEFA 4RW7A 2IVMA 5F8NA 4C97A 2HEKA 1LK7A 2HNZB 3HT0A 3OSPA 2IDLA 3QSIA 3ADAC 4LF1A 4PXBA 4CI0B 4Z7CA 2YKAA 3PW5A 2UVUA 1DTTB 1RAJA 4DX6A 3H2VE 2ERRA 1P27B 2EFPA 2UUCJ 4RU9A 1BQXA 3DNCA 2Z2MA 3AY0A 1LNQA 2K2PA 2KYZA 3N0VA 3L9ZA 3QT7A 2XM3A 3EX7B 1B4SA 4JI8J 2QC3A 4I56A 1WKKA 5HVHA 4NWBA 3FEXB 1UW9A 2WHOA 3EXCX 1LOUA 1N0VC 2Z8QA 2R8JA 2HK3A 1R3NA 3BM7A 1JK9B 3BDPA 3HHLD 4K4YA 2YNFA 4ANCA 4PKDB 4X4OA 2YNGB 3EWGA 3M8SA 4ID5A 4R25A 3HSDA 3MM7B 2A6OA 2NQPA 1S0VA 3T5JA 4MKBA 4QBUA 1S97A 3S1TA 3SCKE 4U95A 2XWXA 3DRXA 1NJIT 3KHRA 2YX1A 1HYSA 4CH1A 5BXIA 5KFIA 1WJ9A 4KPCA 1F5AA 3GIJA 1NKEA 1EJ7L 1JLGA 1NKCA 3MAHA 2PE8A 4M63A 4DU7A 4MIAA 2CWXA 2XEXA 4A8MP 2KG1A 4RLEA 2B8QA 5KFDA 4OX9J 1V3ZA 3BKFA 4DDFA 3T41A 4KYZA 4OLOA 2GJFA 5CH7B 5A8RB 2R7QA 1X0FA 2VKZG 3A1YG 4LREA 1GTEA 1HNVA 1NHUA 2G1HA 2HBYB 2JL9A 3DLJA 4FPIA 4G65A 4M1KA 4QW8A 3W62A 3ZC4A 1RT4B 2W2MP 4C6AA 2KB2A 5LMNJ 2M52A 4FPRA 2ATLA 2XLJA 2H9ZA 1JXVA 1AW0A 2J9DE 2VBXA 1RI7A 2JLFA 2J9EA 2W2QP 3I5AA 2AT1B 2RQMA 1VQKS 3ET6A 4Y2CA 3U1NA 5CYJA 1RAIB 3VV2B 2IC3A 1YRTA 2BBEA 2QJ3A 2V0NA 2B43A 4Y65A 4OLPA 5FLXU 3T1YF 2F4FA 4JI7J 3PO5A 3BKUA 1SC4B 3M6UA 3SI8A 4XTTA 4DJBA 2M7SA 2MKSA 2YH0A 5EX0A 1HYSB 4DSIA 3FCVA 3ZZOA 5J2PB 3M4XA 4MK8A 2BUNA 3UNYA 3VGSA 3W5XA 2CG4A 3BQ2A 1DLOA 1Q5VA 1R6VA 5B0EA 6FD1A 5KOWA 3MR5A 3CNQP 1S9GB 3KLFB 4OJHA 4ED8A 1RHJB 2HZCA 2GQQA 1T7PA 1YJVA 2CZ9A 3G82B 4RZRA 2ASLA 1Q81T 1XWLA 4V19X 1U49A 1SQGA 3D0HE 1S1WB 3MTKA 4UT4A 3OJSA 4OZNA 5KT6A 4WFZA 3KXDA 4DR7F 2OPQB 1FE0A 2KT5A 5GAGI 2XC9A 3JQJA 4DQRA 1LW2A 1Y7PA 4C8ZA 2ZOFA 1TL7B 2C42A 1D3WA 3KLIB 1KFDA 1MG7A 2FVCA 2GO9A 1YRXA 3QAUA 5E3RA 2CJ9A 3OL8A 1HI0P 5H9FK 1YJ7A 2XMTA 3H42A 4L73A 2BJ1A 4ILRA 2GW8A 3EPIA 2HS3A 3K17A 4ZVHA 5FLXY 2CAJA 3DN9A 2XI3A 3L7PA 1NDKA 2FZKB 2NUUG 3H25A 1N5SA 3IRXB 5ETKA 1I5OB 1AFJA 1UFLA 3FMWA 2R7XA 3UDCA 2Y1JA 3U27A 4C0HA 2RRAA 1S6QA 3CIZA 3QT6A 1SKSA 2HVIA 1ZAWA 4ZPWR 5KFRA 1HW9A 3LW5C 3KK1A 3UDVA 1RGVA 2BQRA 3DGVA 4X64J 1VDHA 4FNHA 2RSQA 1WEXA 1FDAA 1OIAA 3IBWA 1X31C 3PYGA 4FXWA 1T05A 2NLWA 3CJSA 4YMEA 4K50A 1URNA 4CLWA 3I0SA 1RA7A 3M6VA 4LF6J 3NL0A 4JI1J 1S1UA 5GADU 3AD7C 3I0SB 4ZPBA 1QAIA 2QG9B 2MEWA 2BV3A 1S6OA 4JI8F 3AA8A 1PSDA 4OYXA 2DNNA 2WB4A 5F8HA 1YZ6A 3ZTRA 1WHYA 3O8WA 1T02A 1OSDA 3FDSA 4ZVEA 2J8SA 4KC5A 1MROB 2FPHX 1LKZA 3H5UA 3LAKA 2RF2A 4M5MA 3H90A 1RWNB 1RLDA 4PYAA 1S0OA 2QA1A 3BJYA 1WHWA 4Q5VA 4YDXA 1RBLA 4FS2A 1M0SA 1S5ZA 3GYGA 3KUEA 4R0JA 3N6LA 3QNWB 4DX5A 2AD9A 2EG2A 4CLTA 5KFHA 5T7LB 2DO4A 1FK9B 4UTGA 4RUHA 4P7VA 2C2DA 4TQRA 3MMAA 4KSEB 2EVZA 1ZH5A 1KWMA 1H38A 3Q83A 2OTJS 1TKTB 3OXFA 3RBDA 1JLAA 2JJ4D 2OPSA 4NLUA 1TL7A 3FJ2A 3W2WA 1HBOA 3I0RA 2VOOA 2H54B 2Z2ZA 4GO7X 4BDPA 2OPSB 3GIRA 3J7YU 1VJQA 3PCOB 4GVBA 4L3KA 3KJFB 1M5KC 4K4TA 3ULHA 2V4QA 1KLMB 4Y2AA 4I1TA 4DQSA 2DR8A 3DKDA 2DCLA 2CADA 2HHHJ 2UV8G 1TK0A 5DLFA 1IBMF 1SJ4P 1RZMA 4QIVA 2J6TA 4LR7A 1IVZA 1R0CB 1IQZA 2LQBA 3WX8A 1CJUA 2DCUB 2YKPA 3N5BA 4YN3B 1L3UA 4LBIA 4PYDA 4ZPVR 3G8TA 2NUHA 2IHR1 5KT4A 1YJRA 1CJVA 2LQ8A 2ZH3A 2AJQA 5F8JA 1RHQB 1Q8KA 1VLOA 1OY9A 3GJQB 2X1GA 3P45B 3Q89A 4KPYA 2M88A 1PYSB 4OZLA 1B0TA 4FYYB 1V6HA 2XMVA 3KK3B 1WC5A 3UD3P 4WYLA 5F8LA 1CJKA 4F25A 3HCXA 2WVFA 2XMAA 4LIRA 4ZVFA 2W9CA 1AUDA 4LSLB 5CCMA 1S12A 2EK1A 4LSZB 1D9FA 1BD6A 2MGZB 4F4WA 2V9WA 2IY5B 3OHAA 4AD6A 3JAMU 1T94A 1NDCA 2L08A 1WACA 4FN5A 5KFBA 3HHEA 4DPUA 4DQQA 1XK8A 3TZYA 3PVXA 1KVJA 1EKRA 4QWDA 1EIYB 1IBCB 2QFIA 3AD9C 3NLCA 3FC9A 3KFWX 3OTCA 3TYTA 5K8MA 2BR0A 4ZPDA 4ED3A 4JI5J 2XS5A 3AXMA 4J5OA 4OYWA 5KT3A 4Q0BB 3MMCA 1FJGF 5DRKA 3A4TA 5FIIA 2UXCF 4LBPA 4Y3CA 1S48A 4B3SF 3FFIB 4IYQA 4I68A 4DV7F 2CQGA 2D3ZA 4O4RA 3D5MA 4HTIA 2KRBA 2K7JA 1FTCA 4UQTA 3NAHA 4ZCKA 4I69A 2R7WA 2XLKA 5DO2A 2A2CA 2VUGA 2NXUA 2QMXA 1UAWA 2EWHA 1WSRA 2XY5A 1KP6A 1I94F 2IA6A 1TKZA 1G2EA 1XMOJ 1QUVA 4ZCLA 5KG1A 2KHDA 3LGHA 4RNMA 1SV5B 3IWNC 4GVLA 4X62F 3OLAA 1B7FA 1DHMA 1OMSA 3HVWA 3KG4A 5KFZA 2G0IA 5AE1A 1ZA1B 2BABA 4TYBA 3OPKA 4IG3A 2YWKA 2YXLA 3AB2B 3T9ZA 4OI0A 2W7OA 2B9YA 1TK8A 5CYQB 1S10A 1HWKA 4RW4B 4W92B 2DISA 1XNRF 1HD0A 1GTHA 1Q5YA 1XIQA 1ZS6A 1R8AA 2B0GA 2P6SA 4MAKA 3J81j 2EFVA 4B3SJ 1MU2A 2LU1A 2VASA 1V5IB 3A8JA 2VZ9A 4QIEA 2CJBA 1U24A 2OEJA 1VQSA 4JOUA 3BREA 4RW7B 2HFZA 5I3QA 5LT5A 1RYSA 2UP1A 4C0BA 3FFIA 4GKKJ 1Y00A 3IGVA 2GIFA 4PWDB 4K4UA 3B78A 3DGPA 3OL9A 1RTHB 4OI1A 2L9WA 2HQFA 1SC3B 1SH2A 2HBZB 3FCHA 2IVFB 1FJ7A 2QSWA 3KNGA 1W26A 1FDNA 2DY9A 5ETTA 3F44A 1SJFA 1W2IA 2G0JA 3VGUA 4GRSA 3UPFA 2NZ4A 2PMZD 4EUVA 4QYZK 1G4CA 1K44A 2AEJA 3VHQA 1HNVB 1U1RA 2VHGA 1FXRA 4IR9A 3IMQJ 2BQ3A 3DMJB 4PG7A 1VIXA 1HMVB 1HARA 1T3NA 4NXMJ 2GZOA 1KONA 2L9DA 4LMZA 2HHUA 4U9RA 3O44A 3DRSB 5KFWA 2VJVA 1EZZB 2HFSA 4R5PA 4KR0B 1UVIA 4QZVB 4A8YA 1VQ8S 3M2VB 1UZDA 2XMWA 3HHLB 4J9NA 1DAXA 3R1HA 5MAOA 5K5MA 4QU7A 1KQFB 4I6AA 2HIYA 4HLBA 4ED6A 4V19J 1ZPVA 4FF3A 2DXEA 2HHWA 1ZA2B 4OHZA 3Q2SC 4TNOA 5GADI 1S0MA 2F7VA 4LRDA 1UVJA 3N9UC 4LFCF 2XG8A 2PI5A 2UUAJ 4TYAA 2V2VA 3RRGA 4HEA9 5CHCB 2E5GA 4F4ZA 3R7BB 1X4DA 1I6JA 2B4VA 2FHKA 3JSBA 4I67A 2POKA 2HURA 2X1FA 3OR1A 4CYUA 4OI6A 4F4KA 1XMBA 4WIIA 3M30B 7AT1B 2BKOA 3DMJA 2Y8YA 3QRPA 2KXFA 2PMHA 4G3IA 4ID8A 4TN2A 3RW7A 2CPYA 1RP5A 3MMAB 2DNRA 1VC6A 1NK9A 3NKYA 2GVDA 3ZO7A 5L8RC 2DGUA 4QU6A 3QJJA 2RRNA 2DJWA 1S7IA 2WCXA 2DHHA 4TVAB 2CVIA 3IR6B 4ATNA 4HDHA 1YJUA 4DL2A 3AOBA 4B3MJ 4ELUA 4NRUA 3CDWA 2MXYA 3K5NA 3BSAA 2HWTA 3CWJA 1KD1T 1N33J 4AYBD 1K47A 4CWBA 3MPYA 4ZP8A 3GIIA 4USJC 3SQGA 4WK1A 4IKAA 2OAUA 5KG0A 3B8HA 3KLVA 5ETOA 1ZZNA 3D68A 1CS4A 3GG1A 3DI6A 2HBRB 3LP0A 2MQ8A 4LF9F 2ASJA 3LOUA 1S1XA 3M8RA 3M05A 4B3RF 5HMWA 2CXEA 2VPZB 4KAIA 3KJQB 1ICEB 1AUSL 4F4AA 3MEDA 5GMEA 3I55S 3V81A 1FKOB 2LEAA 1S6PB 2NXEA 2OKQA 2DBBA 4X62J 1R43A 4DV6J 3DLHA 3U02A 3AJ1A 2VONA 3MF5A 3MAAB 2NXCA 2I0XA 2BYCA 3D54A 2HGMA 3V4MA 4NLPA 5I42A 3GJSB 2I5JB 4PEOA 3T9NA 4DPWA 1FRKA 3SYZA 2PT0A 2W9CB 2E9TA 2R2UA 4NX9A 3W8GA 2VG5B 2CQ0A 2OD4A 3HDSA 3HHNB 6AT1B 2ZVIA 1I1GA 2C2KB 3BYRA 3M2UB 3PEHA 3QGGA 4ANDA 1HNWF 4XK8C 4YDDB 1CEZA 1HL6A 1Y3JA 3UCGA 3J7AN 4X2BA 1LV5A 4CCHA 4O3RA 2K1RB 1TUVA 2J7KA 2XZDB 4PCQA 2E5JA 3T1HF 2QMWA 3CDBA 3PHEA 5HVFA 2UXCJ 1TMMA 3PW7A 2K1RA 2ZH2A 3Q22A 3IM9A 3D3BJ 3FVYA 4ZVOB 3G71S 1B99A 1RTDA 1IR2A 1WHXA 2KJVA 4ZJOA 3SIPB 4HL9A 3OTEA 1S79A 2V8VA 3Q8YA 2JC0A 2R2RA 1ZETA 3KG1A 4DLGA 2ZKTA 1S1VB 2DNPA 2YTCA 5C24A 2ILZA 1FHTA 2CPXA 2QO3A 3W2VB 4JI4F 2M8HA 1YBTA 3UW1A 2ZH9A 3IRWP 3WC2A 1QAYA 1RT1B 2M2BA 3KJNB 4NA1A 2MLXA 2CNKB 1KOHA 3U7JA 3ZZPA 3BQ0A 4DR3F 2JEJA 2W7PA 1VIOA 3DRYA 3HFKA 3ISZA 2P5VA 3T1YJ 3V4IB 4DWIA 4QCLA 3HT3A 2B5JA 1AA1B 2DIVA 2QV6A 2VC0A 3HD1A 5CZVA 3KHHA 2FLLA 1NKBA 1JLBA 5KFNA 2E5LF 3EVWA 3HSZA 3R1LA 1HPZA 1G3OA 4LVNP 1RWVB 4DUTA 1L3SA 3PDNA 1IKVA 3PKMA 1LWFA 1PJ5A 3AOCA 2AX0A 4DV0J 3A12A 1RTIB 2KI2A 5DM7Q 1WOSA 1VQMS 2V5HG 4OYIA 1VCTA 2DNZA 5K14A 2KH9A 3CJ5A 1KQSR 3I82A 2BXJA 2V8PA 4Q45A 1WELA 5C2CA 2F65A 2OPRB 5JVHQ 3MAAA 3GQCA 3RW6A 1X4BA 1MWYA 4UQGA 2V4JA 3I56S 4EK2A 5DDOC 4DPYA 1DTQB 1KKHA 1P9QC 1ELOA 4RBTA 5ETMA 4C8MA 4DV7J 3V81B 2X7IA 1XC9A 2HHQA 4C8LA 3TZWA 1UP1A 3QWUA 3MOZA 3Q8RB 3D28A 1RHKB 2CNLB 3D66A 2XMKA 2FZGB 4OX6A 4KY3A 3TEGA 4BC9A 2X1BA 1FNXH 2M70A 2GGPB 1LK5A 3J7ZT 2WB1D 2ACYA 2E1CA 2HQIA 2MTLA 2FHJD 1S6UA 4M5HA 5A0YA 2OJ3A 3ITHB 4B17A 2UUBF 2E44A 2AP6A 4IRCA 1PBUA 4J9UE 4DV2J 1YJNS 2W24A 1TL1B 2C3MA 1P6TA 5JXSA 5HL7Q 2ZVSA 5F8IA 3CCSS 1J5EJ 3VF0B 3D9BA 3CO0P 4MYUA 2FHOB 1FT8A 3K8VA 2D9PA 3HM9A 3NGTA 1PGZA 2W9BA 4RX6A 4NI2A 4OJ1A 3QGHA 1F6TA 1FJEB 4B3TF 3J81U 1OPIA 4K4WA 4DXLA 1LW2B 4F2SA 1F60B 3LAMA 2XNQA 2DGOA 5IWAF 1TR0A 4EMDA 5KFGA 1F9FA 3CJ0A 1C1BB 4H4KC 3NEKA 3VAKA 4IO1A 2V67A 4FXDA 4E2FB 3LWLA 3H4BA 1WWHA 1Z2ZA 2ZOMA 3DYAB 4OHVA 4DZ6A 1U6ZA 2EFOA 1S77D 5L1IA 2AJ4A 3GCWP 2CQIA 2MSTA 2WOMA 2BANB 3GJRB 3DLKB 3ILJA 4NLWA 2E5HA 1H7XA 2OFHX 3TVZA 3M9OB 1W2BR 3HHDA 3NNAA 1RTIA 4MKAA 1SKUB 5KG5A 5GAGU 5ETLA 2V2ZA 2QL7B 2MHEA 1NZAA 4FKXA 7FD1A 4DSFA 1RTJB 2GAHC 2YNHA 4UOHA 3HO1A 2M5YA 1F5CA 1S59A 4JYAF 1JLBB 4CNZA 1EB0A 2J9CA 1T9TA 5F3ZA 3DCAA 4YHHF 2D3UA 4IRKA 1H2UX 1C0UA 1HQ2A 1WF2A 4P2SA 5J2NA 2H4WB 1PG5B 2HS4A 1S1UB 4RW4A 1VI7A 3RG6A 1VQ7S 2R2TA 2IDEA 1YIJS 2CZVC 4NXNF 3ZTQA 3G6ES 1ZM3A 3FSYA 4CYUB 1VYAA 1H73A 1XBWA 2Q3PA 4QYRA 5IV4A 5KG7A 2ZH6A 3SV3A 4ECUA 3DRPB 3P5TL 1PAUB 2BOAA 2C3YA 3A13A 3DLGA 4HTJA 4MFBA 1HBUA 4D3GA 4KH0B 4N5SA 2VDIA 3M32A 1P1LA 1NK8A 3D6FB 1TKZB 1N5VA 2E1MC 2FIUA 1RTHA 4FVCA 1UFKA 3H2UB 1S1TB 3BH7B 4H4KA 3TJ8A 3TO8A 2ZJPQ 1N56A 1Q86T 1MNEA 2GIRA 3H20A 5E3PA 4WE1B 1VFJA 3HVTB 3ITHA 4MKVA 4RNOA 2DEIA 1WEYA 4KB7A 1NB7A 2F1FA 2DRAA 1YQHA 4LRAA 2EC0A 2A6MA 5KFVA 1A6LA 3KJVB 1J5OB 5AXMA 1XNRJ 1HIYA 5D0GA 4WE1A 4ENOA 1UL3A 2FLOA 2IJNA 2JSXA 2GMJA 2KN4A 2O67A 2ZC3A 3GMGA 1RWMB 1OPZA 4DPOA 5CYMA 3RRHA 1SL0A 3WQPA 3FQLA 5K8OA 2RH3A 2CJQA 1UA1A 5LSLA 3UCZP 2IAJB 3P3DA 2RMLA 2JHEA 1JIHA 4DEZA 1T9VA 2O66A 3AQPA 2B6AB 5D4NA 3SSQA 1XMOF 2VD3A 4MMOA 2DNYA 1KVIA 2FC8A 2AJ1A 2H4YB 4FP9A 2B9EA 3UR0A 1WC1A 3EUNA 2YPYA 5K8NA 4YS2A 3L95X 1IN0A 3LA0A 3W5YA 4ILLA 3OR2A 3IR5B 3MEEB 4LRFA 1RAEB 4OYMA 4ZVUB 2NYHA 2V34A 1JJCB 2J0WA 2N3LA 4NLOA 1IBLF 1GX5A 4UUWA 4ECXA 4USVA 2HFNA 4RBVA 1M5HA 1Y0HA 1H0HB 1F9HA 2VPXB 3QBCA 3T5HA 4URGA 5AE2A 2HK2A 2B5JB 5IT0A 3KMQA 1NNDA 2IBOA 3QSYB 4RKUC 4RWWA 2E29A 1H98A 5G0RA 4DR2F 4P10A 1S72S 3Q0AA 2BW2A 4IOCQ 1KLMA 2CFXA 3GYXB 3FBCA 1N33F 2XMJA 4KBIA 1NSQA 2DIUA 4HHJA 4UF4A 2OPPA 1X5OA 2VIHA 5EUHA 2V4RA 1YLXA 2FZCB 2O5DA 2YPZA 4JV2A 3KKFA 4CH0S 3NWGA 1FWLA 4OQJA 4OFZA 5L1JA 3PIPQ 3OSNA 4Y2IA 1RLCL 4KV8B 1YITS 1L3VA 1M1KT 4PWWA 4NZ0A 2FVPA 2XY7A 3FSIA 4IDKB 1Q0NA 2MDAA 2ZZMA 3C46A 3BBBA 1NSAA 4ZPAA 2PN6A 9ATCB 4M8LA 2ZM6J 2CWKA 5D15A 4GKJJ 3VZIA 3HK2A 4YQWA 2OEKA 4LFBF 2GGPA 2XWYA 2L48A 5HMXA 3GLJA 5JJBA 1SL2A 2FJXA 4DPXA 2F63A 2APOA 5LJ5Y 1Q79A 1KS2A 1JNZB 1YG0A 4LSNB 1RT6A 2QRRA 3I32A 1RAFB 4FZVA 1APSA 2DH9A 4C8YA 1QDUB 1IM4A 2CJXB 2COLA 3I0RB 3IAS9 5D6GA 5BR8J 3MOJB 5A8WA 3JXOA 3WBZA 5DQIA 2KXHA 1PYOB 4IO9Q 3BSOA 3EGZA 3QO9A 3US5A 5IT4A 2RAQA 4RUCA 4ED0A 2MZSA 2AEFA 3KK3A 1BWVA 3W5ZA 4OJ3A 2Q79A 1SL1A 4LFBJ 2LDIA 2HHVA 3IG1B 4DR1F 1NO8A 1RU2A 3DXSX 5BJRA 3BR8A 1UVLA 4ELVA 3BGLA 2KO1A 1HQEB 4C11B 4DCOB 4LQ9A 4EBEA 5LSRA 2DYAA 1Y9OA 2NXJA 3UE2A 4FF1A 2HBQB 1SB6A 2QL5B 4U7UD 2OI2A 2MMYA 4L6V3 1FCAA 5DM6Q 4QOTA 2HQDA 1JNRB 1H74A 1HI8A 3GIMA 4JI3F 1Q78A 1YWXA 5LOQA 1XN9A 4KFBA 5EWEA 3CCQS 2WSCC 1RT3A 2XSJB 3OL7A 3MFIA 4DL5A 3R5JB 2DNKA 3IC1A 4QWBA 2FVRA 2P9CA 3TUJC 2KVQE 3CD7A 3E51A 1DTQA 3B6BA 3CSKA 4NRTA 5ADZA 4XPEA 2V2KA 4EU0A 1AYEA 1KR4A 3MR2A 2PEHA 3CB4A 1UCNA 2RKIB 2HQGA 1CULB 1QD1A 2CQDA 2HNDA 2IVYA 2V8HA 3F41A 4RW8B 4UUXA 2AU0A 5C25B 1X4GA 2KXNB 4DSKA 4OL8A 3AB4B 3EJMA 4ICLB 1BXNA 3PJ9A 2AQ4A 1HNXJ 1RT7B 1CVJA 2CPHA 4Y00A 1HNZF 1HR0F 2UXBJ 5HQ8A 4RNHA 4ECWA 3GV8B 1DLOB 1S6QB 1H72C 4YR3A 1U47A 1JLEA 1RWUA 3BZQA 3M6WA 2JVRA 1F3VA 2QTWA 4XPCA 3OJUA 3IFEA 4OYPA 5JUMA 1O0PA 4C3MA 2AJFE 2WVBA 2J5AA 4C2MA 3KLEB 1U0SA 2LP4A 2MZQA 1Y4ZB 1T95A 2YY3A 1TUGB 1NK6A 2GVZB 2OTLS 4PUOB 2GQCA 4JI2F 4KO0A 4LT6A 4CLUA 5KG2A 5M2RA 4DV6F 2JFKA 1RQ0A 5KFAA 1HNIA 3PYFA 5DDPC 4ZP6A 2OMLA 2ZBCA 5A8WB 1X4FA 3TJAA 4HI2A 5FJ4A 5D77A 3FK4A 2K06A 4FYXB 3IBCB 3SCJE 1KEKA 5KFPA 4RWXA 2E1RA 4M5DB 2Q1LA 1HFEL 5CD4A 2HLTA 1MWQA 4X4RA 2C2MB 2ZH1A 3M1VA 1S9GA 1FRJA 2I1RA 4N7TA 2C3UA 2WVEA 3KLFA 3H40A 2FQQB 3VR1A 3DRRA 1VQOS 4JI3J 2FC9A 1BHNA 2L9NA 3LH2S 2W01A 3R5GA 4CO0A 3M6XA 5HANA 4CNYA 2WAQD 4OI4A 4J9OA 3B4MA 1DBDA 2D1CA 2M3DA 4AL7A 1EAYC 2IPOB 2MJNA 2WRMA 3DU5A 3D1OA 4NA2A 4TLRA 3ZNUA 3SQOP 3K89A 5B0FA 1MMLA 3QZ8A 4LFAF 2PI4A 2J0SD 4NLGA 5ETQA 5IM0B 4YUDA 5KFKA 4OHXA 2DNQA 2ZNYA 3LTOA 4ECYA 3I96A 5C7PA 1D1UA 3DXBA 3DM2A 4ID5B 3CDEA 2CG8A 1T03B 1RKJA 3MPUB 3SXLA 1NJWA 4U8VA 4G6VB 4L72B 1PKUA 2JNJA 2E66A 3TJ9A 3A3PB 2CQ3A 3GFXA 1VK8A 1UWBA 2RKIA 1RCXB 3ZZRA 1DQAA 3JTNA 1IJEB 2XYGB 1VOMA 1PAEX 4OV1A 3THTA 2B7CB 4DF4A 1UWBB 3H5YA 3MEGB 2R8GA 1TP7A 1ZM4A 3NOCA 2BZ2A 4P71A 4F7VA 4ECZA 1YBAA 4NLVA 4YP3A 3G8SA 1K1SA 4JI7F 4OX9F 2Y0BB 1U0HA 2HGNA 5CCLA 4WJBA 4Q8EA 1JWWA 5IC6B 2QYGA 2YWFA 4KH1B 4EBCA 4BWMA 1WOPA 2YWWA 1FESA 4J9RA 4HDGA 1ZAXA 1B0VA 1HWLA 4MT1A 3C16B 3KHLA 3IAM9 4ZVTB 5L39A 1KOOA 4YB7A 2UU9J 4O0IA 4GKJF 3GG0A 3VAIA 2MZRA 3DRPA 1JLCB 2UVVA 4CLYA 2VICA 4XAKA 2G2OA 4ZPTR 5I42B 1OWXA 4DSEA 2YKQA 3EDQB 4ZP9A 4NASA 5IOLA 5F9LA 2DR6A 2HS0A 2Z56B 4CLLA 4WPAA 2XZWA 5CA5A 4MJKA 3HVRA 1N36J 1GEHA 3C8YA 3E3XA 1VLYA 2VQFF 3ZZ0A 2HG4A 1QE1A 4Y28C 2VQEF 1GT8A 2W8KA 3I5BA 4J9KA 5HI7A 4PG6A 2A3JA 1RB0A 3P6YC 3HI9A 4PQAA 2OIHA 2MPUA 2OD6A 3MCOA 2RUSA 3OQ2A 4KTQA 1GMWA 3K8WA 2Q6BA 4CO3A 4AUKA 2C2RA 4URQU 1XEZA 4CH7A 2GAGC 1WG4A 3R5DA 4KHPF 3SQGB 3OVAA 4I6WA 5I4MA 1IXKA 5JMNA 2AKWB 3OVBA 1NU4A 2C2NA 2HSEB 1S4EA 3CCTA 2V50A 2KKHA 1B70B 2P2CB 3QQCD 5IZHA 1D0EA 4B3TJ 1NK5A 1CC7A 1SJQA 4KGVB 4NCGB 3ZZYA 3NS7B 1E6VA 2LXUA 2AZ3A 1EP4B 3KHGA 1FEHA 4KRWA 5AJ3J 1UWAA 5D3GA 1TKXA 4A46A 1X5PA 4GVBB 3R5BA 2H5IB 2G0CA 2MQPA 2MQLA 4TU7A 2F9DA 2B51A 2RT3A 3BGOP 3SSRA 3W61A 2DHSA 2FJEB 2MKIA 4NCAA 3N79A 2HHXA 2NS1B 5DG9A 1SCJB 5HQLA 2ALYB 2K3IA 3TNVA 2HFVA 5FD1A 1R8HA 3NY0A 4BHQA 1X60A 4DMZA 4QPTA 1UW4A 1WEZA 2V2QA 3NGUA 3C6UA 3TZZA 1F2HA 5GAHU 4NOHA 3SCLE 4K4VA 2ZFHA 2N7YA 1YI2S 2W1BA 3HHLC 4LIWA 4CO5A 2YNHB 3BV8A 4TKTA 5B0CA 2OMOA 3C16A 3L7OA 5AXKA 3DDNA 3DGPB 3DLEA 4PWUA 2E5IA 3CVKA 4YY3F 5MLCV 4DF8A 1HBMB 3DLBA 3H2LA 1U02A 3MPDA 2CQPA 2YKMA 1N34F 4PQUB 3DRSA 2Z2LA 3T1HJ 4IFVB 1F9EB 3AT1B 4YB1P 1Q8LA 5ITHA 2EKYA 1VRQC 2AEMA 3MEEA 4TLQA 1OS5A 4JV0A 4P72A 2EFGA 2CIMA 5EX3A 4IFYA 4DN9A 1HMVA 1N0UA 1RWPB 3D67A 1HHSA 2F8MA 2IM2A 3UFCX 2GJIA 3EZ5A 4LR9A 1HW8A 3CD0A 4DFPA 1KN6A 4X65J 2LFVA 3G6VA 3RB4A 4XIUA 3D6MB 4ZLPA 2RQKA 3TOQA 3MCMA 2VFRA 2ZHAA 1SC1B 3KTQA 2XY6A 1MN7A 2R2SA 5CAAA 4ZHRB 2H3EB 5LMNF 3OXLA 3MMBA 2G9OA 1K73T 2DNMA 1NXIA 1N5YA 1VBKA 5IXUA 2AMCB 3HFVA 2B8PA 5KT5A 3JSMB 3PW0A 3LP2A 3RUBL 1RTDB 3QZ7A 2J7WA 4DV4F 2P9EA 3D3CJ 4S0MA 4N41A 1NZ8A 5E0OA 4P7TA 5A6PA 2BA9A 4X66F 1BGXT 1KTVA 3C14B 3DHXA 1HA1A 4DUZJ 3PO4A 4O3PA 2H65B 4LF7F 2EW9A 3MGJA 4MIWA 1BQNA 4EYIB 3BB5A 4ZDNA 2D3OR 1KHWA 4L76A 3GV5B 4JV5J 5GMDA 1HBNB 2CQ2A 5U47A 2YNGA 3HXMA 4CLPA 2VF3A 4CZCA 5ETNA 1RYRA 2HRTA 2KM8B 1W25A 2X3DA 1YGYA 2I6WA 2O1PA 4J9PA 2CPFA 1PILA 1J2VA 1X4CA 2HLUA 2B4UA 1WG1A 2CPZA 4PG8A 3KLHB 2GFFA 2R3VA 3CO9A 3DOMA 1TKTA 1BC6A 4URSA 1S57A 1SH0A 2ZUGA 3HFZB 3VZHA 1FKOA 5IT9Y 1RE1B 2D69A 4B9UA 2MHNA 3AH6A 3NCPA 3RZAA 1GXUA 4F02A 1WORA 1QM9A 3KLGA 5E3QA 3SDEA 3CCVS 2YKMB 3T6JA 1S99A 2QSFA 1F0XA 2LLZA 4WXOA 1FKAF 2MLZA 5LXRA 1H2TZ 1YDLA 2DPIA 5G4DA 3CMES 3EICA 3THVA 5I3UB 3AD8C 3SMZA 1JJ4A 4GKKF 3BR9A 1QSYA 4IR1A 1RHRB 3CW2C 1U1KA 1SJ3P 2PA8D 1TUWA 4M5DA 2DGXA 4CT9A 5C25A 1KLNA 1PYTA 4RW8A 1OSCA 3CJ2A 4PPZA 4ZN3A 5EWFA 3O1LA 2IJRA 4PABA 1VBXA 2FTRA 5FDLA 2F8HA 4NLRA 1Q82T 4EZ6A 4X4UA 2ZWOA 3G6YA 4J9VA 4NLXA 2ZE2A 4DL3A 1C0TA 4HHHA 4ECRA 2VBWA 1IKYA 2HZVA 2YKNB 4KFBB 3OUYA 2F40A 1VRUA 2XB2D 4I0WA 3NS6A 3KLEA 2JH3A 5B08A 1TMJA 2IM3A 4ED4A 2ZM6F 1X9SA 2B4PA 5K20B 1GH8A 2W9AA 2ZJQQ 1Q8BA 3DLEB 4IOBA 2ASDA 5KFLA 2VOPA 3FUYA 4J7CA 4A8FA 3C2PA 2V8DA 2RB7A 3JSMA 1R0AB 4USUA 5F9NA 2LEPA 4MK9A 3PNIA 3FBEA 4ILMA 3R5CA 4FVMA 4RNFA 2RDIA 2AYEA 3UQSA 1WI6A 1AXQA 4MFBB 2OUGA 2GIQA 3RU0A 4MTPA 5BR8F 3G8QA 3QGPA 3VAHA 3IO1A 3KDOA 2XS2A 2OPPB 2FVQA 1AFIA 3ENWA 5EWGA 3BN4A 2RVJA 5KAKA 2M8DB 1HHQA 4CLKA 1LXNA 3QT5A 1KSPA 2PSZA 3TQEA 3PV8A 3TA1A 4DZDA 3W1YC 3NS5A 1TL3A 1KVKA 5DQHA 3VCDA 4WFYA 3G82A 1S9EA 4NYZA 3TARA 1GFWB 5HATA 4YOEA 2DXDA 1TELA 4DLEA 4L75A 1RAGB 1WHVA 2DGQA 3DI6B 3LP0B 3M2RB 4N8NA 2MKYA 5J2PA 3ZZZA 1HBMA 3K57A 1RU1A 1NK0A 3ISND 5DETA 3M8PB 4U8YA 1FRHA 3T6BA 3CJ8A 1XNQJ 1F3FA 4G1IA 4JI5F 2CQBA 4F0KA 1REVB 5L9NA 4DL6A 4OZ5A 2AGPA 2FGCA 4WBFA 2VU5A 2VBYA 3IM8A 1NDPA 1X4AA 1ZPWX 2BE9B 1WDTA 1H2VZ 3F0NA 2HIQA 4NLSA 3FBFA 1AB8A 4ZITA 1Y5NB 2BJ3A 3HF5A 2D74B 5KFYA 3D2WA 3PY8A 5KOXA 1H6KX 1M5SA 4ALZA 1UEKA 5C42B 3WX4A 4JP8A 1K0VA 1FVSA 5DGBA 3W2VA 3V6HA 2XYHB 2E7VA 2EPIA 2VA3A 3W9IA 5HMZA 2C2ZB 3M8QA 2HNYA 1Q4RA 1RAAB 2B9WA 3E01A 3GIKA 5HN0A 1E6YA 2F8EX 1SJRA 1DURA 2KRRA 4J37A 1U09A 2QMUB 2RHSB 3N4WA 1FE4A 1U7LA 5J1PA 3RAXA 1GK8A 1U1QA 5E33A 2GX8A 1JLGB 3Q8PB 3JSRA 4U6PA 1YX2A 4XO0A 1N6QB 4MKYA 1X5TA 2VG6A 3EZUA 4QIWD 3NGDA 4E0DA 3WIUA 1M5PC 1WNEA 3PW2A 5F8GA 2D7SA 1AZSA 4CTAA 1HQUB 3Q2TC 1U2RA 1WTBA 1OY6A 4DU8A 4NCBA 1JLFA 2VFTA 3A8IA 1NJZA 1RHUB 1VS3A 1TV6A 1NM2A 2BRLA 2VG5A 4RW6B 4DPTA 2DNHA 3DLGB 2LQJA 4PG5A 3KYLA 1UFWA 3EXYA 4X4QA 3VAMA 2AIRB 5H9EK 2GMLA 1NH7A 2QGFB 3AJDA 5ETVA 4WU2A 1CQMA 1YVFA 2MZ1A 2C3OA 1D8ZA 3EYZA 4IQXA 2UXDF 5JVGQ 1HNXF 3TVKA 2Q43A 4PZVA 4QWEA 3CJKB 1L5UA 4FBUA 4ZLLA 3GYNA 9RUBA 4DCPB 4HACA 4JYAJ 1FDDA 2HHPA 2RS8A 1Y5IB 4NLYA 1DQ8A 3OXGA 4RUAA 2KFYA 3VVTA 3GILA 1LWFB 2XGQA 2D3O1 4N76A 3LWMA 3VTIA 2ZJRQ 2VJUA 3W8PA 4MIBA 2R7SA 1OQ3A 1U25A 3SFGA 4XDDA 4FS1A 2DGSA 1X4EA 2VG6B 4ES1A 1VISA 4ZIWA 3KLGB 2HMIA 1FI4A 1U2CA 4WKRA 3EZOA 4B3MF 1SJ1A 2QX0A 1EARA 4Y2MA 2BEFA 2F9JA 3NRBA 3SFUA 4A4JA 2NSBA 4DX8H 3E8OA 1UJ4A 4F50A 3DYAA 4X4PA 4KIAA 4F4XA 3M8QB 4Q8FA 2BJ7A 2QT7A 2ZH5A 3HD2A 3WIVA 2Q6CA 2J0QD 2BJ9A 1QTNB 3QT8A 2HPUA 4OX8A 1NPKA 2EK6A 3C15B 4A8OA 3QIDA 5IWAJ 1YJ9S 4ZMMA 3MWBA 1IBLJ 2IRXA 2MLYA 1PJ7A 2U2FA 3HLUA 5L9XA 3RTVA 4QR0A 4F36A 2J0XA 2F3JA 4F67A 1LFPA 4A8WA 2Z57B 4C8KA 4C3KA 3C6TA 3MURP 2MKHA 3IWLA 2BX6A 2GA7A 5DQGA 3NBPA 2KFNA 1DARA 3O3LA 4NE9C 3MR3A 3DHWC 1BY9A 3M8WA 4IG0B 3MMCB 2EG1A 4P6QA 5D0HA 4EFAC 4K4XA 2R8KA 2Q66A 2UUBJ 3V6JA 2HWIA 4WTYA 3BGUA 3DLKA 2V8GA 5KFOA 2FY1A 2KTQA 2PDAA 1CULA 3PZPA 2XQCA 4W90B 2ZE2B 4J90A 3TZXA 4UOFA 3K59A 3QO9B 4KJIA 3Q8VA 3G6XA 3LGNA 4DUYF 4I4BA 3MUVP 5J2QB 2EXUA 3DLLQ 3TWZA 1RWKB 3MUMP 1GNKA 1N5TA 1UEUA 2D9OA 2ZD1B 4E8UA 2HAFA 4DL4A 2DR7A 1JJHA 1UVNA 4DN0A 4W98A 4WP8A 5AT1B 1T3OA 3CC2S 1BUXA 2Y1RI 1WUUA 2I8EA 2GMHA 3WDOA 3ZNJ1 1N4LA 4AL5A 2IFXA 3D4JA 4PG4A 4JV5F 1FRXA 2KG0A 2OLWA 1I94J 4K2JA 4NZ6A 5B7WA 3B82A 5BYSA 1TL1A 3PHTA 5DG7A 1HR0J 3HZEA 3ONQA 5F8MA 2UXBF 2KT3A 1PJ6A 2GS8A 4DR7J 3C6TB 5AJ3F 3CMAS 2KDOA 2C22A 2ZBQA 1YJTA 3JQKA 3IN5A 4B9LA 1KQKA 2MB0B 4ANEA 3J80U 2WSEC 4TY9A 4BLGA 1QAXA 4DR3J 3FRYA 1N32F 4WP3A 1D9AA 2H5JB 3HP6A 2XLIA 3CJ3A 4M5LA 2ZDPA 1K9MT 3NAIA 4OHWA 4UOCA 5CYQA 3JTOA 3NGRA 2LA4A 4DV1F 1IM6A 1U2FA 2ROGA 2WVDA 3ETOA 1CQNA 2VFSA 5CQGA 3S8SA 1U8SA 4P2XA 5J1NA 4LF7J 3HZGA 3PX6A 4Q44A 4ZN1A 1DJ0A 1NB2A 3EPGA 1CLFA 2L41A 2XBPA 2PEBA 2FLNA 3UDLA 1JXEA 4QWCA 1RBOB 5D78A 1E6VB 4PXCA 4DV0F 4DS4A 1Q7LB 1VMBA 1IBKF 3DM2B 3O6QA 3NMRA 5CZXA 4LF4J 3NBPB 3OFHA 3JB9k 2GQ2A 2CDRB 1FD8A 3ENAA 3RBXA 3CIMA 4U7CA 4X4SA 5A0YB 4O44B 2QEXS 2CRLA 4AXJA 2Z4PA 4ZPCA 1JKHA 5M2PA 1OJ4A 1FA0A 3JSYA 3MTJA 3TVYA 5DDRC 3KMSA 1Q16B 2LEBA 1QTMA 4FF2A 4OYBA 3UI3A 4Y0FA 4PXDA 1N88A 5KT7A 3FKBA 2GJ2A 3BN7A 3FEZA 3LP1A 3HVAA 3AAWB 3OFGA 2WZ1A 4U7UK 3C15A 1SH3A 2CQHA 2IM1A 1MMNA 2OSRA 3K7RA 4Q2LA 4USTA 5DZ7A 5B0GA 1NK4A 3QRQA 2V68A 5A2QU 5K8PA 2J76E 3V5RA 1C2PA 2ZD1A 1U6BA 1SXLA 1UKUA 1M5OC 2J8AA 1ZM9A 2HRUA 4LF5F 2DPJA 2HHHF 2CYYA 4B08A 1RADB 2MGZA 3UO0A 4FF4A 1RA6A 4JI0J 1VRTB 1YSJA 3MM9A 1XNQF 1OQ6A 3RRKA 3UN2A 4IH5A 3HKWA 2R9LA 4K8RA 2YKOA 3RGIA 2M9KA 2HZAA 5CYMB 1JLFB 2GVZA 4DUYJ 4A47A 3ICLA 4LF6F 2WSFC 3FMBA 2OEMA 4TY8A 4IDKA 2VQFJ 3S6EA 1WD6A 2MYFA 1MN9A 2PD1A 2SXLA 1MW7A 3I9ZA 4CT8A 4ZIVA 2RQCA 3GV7B 3CPWR 1N6QA 2G13A 1D8YA 1R89A 1X8DA 3H5SA 2AYMA 4LF8J 4Q7AA 1IUJA 1CG2A 3KWMA 2RRBA 3MM7A 1HWIA 3ILLA 5D0RA 3F73A 2CPEA 4Y6IA 4IRDA 1Y5LB 1Z1ZA 2Z30B 3T3FA 2QE5A 5DZ6A 1NMEB 3D7SB 3NNHA 3X1LB 2HNDB 3QGIA 5HSPA 2FD2A 1Y11A 2RNEA 3R7NB 2N82B 2U1AA 1T9YA 4DR2J 2HVZA 2GNKA 3FNNA 5EDWA 1TVRA 1L3TA 5IQQA 3LPYA 5KFTA 3E2EA 4FBTA 1BWEA 4K59A 2XO7A 3R6LB 1ULRA 2CNOB 3H8YA 4JB8B 4KGXB 2XYPB 3T5LA 4LF9J 1T9WA 2W2PP 3UD5A 3VQTA 4LR8A 4KGZB 1M5VC 1WC0A 2YQ0A 1URRA 2CZ4A 2WVCA 5T7LA 1KFSA 1Q7YT 3JQMA 1IJFB 4OZJA 4TY8B 3OV7A 1MLAA 2DK2A 4FYDA 1HLWA 2V69A 2KM8C 2J9DA 4F3OA 4V1Ak 2ZH7A 4EI2A 2UUCF 1LWCB 5D8HB 1NPPA 4LRBA 4DR5J 3KUGA 1TTHB 1WOOA 3M2UA 4LF5J 1VQNS 1CJTB 3ET6B 4R5PB 3KG0A 1GXTA 1RCOB 1Z2LA 4ETZA 5L1LA 3H7HB 3UWTA 2AGOA 3R2DJ 1OYDA 1F1BB 2W2OP 2JZ5A 2XGPA 2VDHA 1QE1B 1RJJA 1O6XA 4H4OA 5EGYA 1G1XA 4I7FA 4WCEQ 1KBRA 1RKIA 4DV4J 2DD8S 1FD2A 2MZTA 3GR0A 2F4VJ 2LMIA 4KGKA 2PFDA 1G6BA 2FUG9 2WONA 2YWHA 1REGX 4FYVB 4H4OB 1BE4A 8ATCB 3BKTA 3N6MA 3T19A 3DU6A 2OO4A 3MPWA 1QSLA 1VBYA 4IFVA 2ACMA 4WP9A 3CC7S 2Y9HA 2DRDA 2MY7A 4ZP7A 4J9LA 2JDJA 8RUCA 1EKSA 1KC8T 3PYDA 2BQUA 4USWA 1T11A 3CJQA 4AXIA 3M8PA 1FRLA 4O3NA 4BC7A 2CNNB 4DG1A 4HI1A 2ADBA 4CLSA 1R0AA 1QAJA 1CBKA 3QMQA 3RAMA 4KKOA 5E5NA 3VAGA 2CQ4A 2P8IA 2XS7A 2CJYB 2LA6A 1T9UA 2VKRA 3PACA 2BANA 4ZVQB 3OLBA 3TA0A 1LXJA 4BWJA 2XO6A 3H5XA 1HD1A 2JLGA 2BW7A 2YNFB 1XMQF 2FJBB 3ETMA 2DVIA 2YKNA 2KYXA 3OUYB 1V9OA 2KU7A 3CE8A 1C1BA 4M94A 4QWAA 3QRRA 4B3RJ 1N32J 1TVRB 3GFZA 3AHPA 1P8GA 2YVSA 3LF0A 2KL8A 4HT7A 1HWUA 1J27A 4DHVA 2FLPA 2AGQA 1B7YB 2AZ1A 3F56A 3NCRA 4KHMA 4WKYA 1DTTA 5A6WA 1C0UB 3BGFA 3BPSP 5AXLA 3Q8QB 4O3QA 2B9XA 4ETXA 3PR5B 2VH7A 4I2PA 4ITSA 4ER8A 5KFQA 2VBZA 1TZ0A 2I2YA 2AYGA 2DKOB 3OTDA 2HGLA 1MSWD 4NA3A 4JI4J 3M9NB 4KKOB 2C3PA 3T1AA 3GE9A 1YK9A 4GMKA 1NH8A 4NYPA 5ETSA 2MKCA 1PBAA 4NLQA 4OX7A 4F3MA 2AYBA 3JTPA 4LQ3A 3TAPA 4OHYA 1N5QA 1I51B 2XI2A 5J2MB 2C2EA 4NZ7A 1FJCA 3ZTSA 4W4MA 1FKPA 1VHIA 4X84A 1Z4UA 4NMLA 1UEVA 3NMAA 3W64A 5CXTA 1IQTA 3OFEA 4CIOA 2YQ3A 2FDNA 2BKPA 4CLZA 1C4CA 1WKLA 3UN5A 4USKA 3TQ1A 3QIPA 3TX8A 2BM1A 1FRIA 3TAMB 2IYGA 4PXEA 5KFXA 3KLHA 3EGNA 2Y1LB 1RT5B 3UD4P 4LSNA 1TFYA 4KT0C 5H1SV 5A8RA 2BJEA 2A1BA 2JWNA 4M5JA 5SUHA 3PKYA 4DV2F 3MMJA 4C9DA 3CTRA 3WZ0A 2XHWA 7FDRA 4CO4A 1CJTA 3G4SS 1HHTP 3N01A 4IG0A 2NYIA 4KO0B 4F8RA 2HQCA 1UPMB 1SUQB 3EMTA 3PX4A 3NNCA 3CDUA 1N36F 1QLNA 3W9JA 3PR4A 1JKHB 5HLFA 2XZTB 1S76D 2F5GA 5DS7A 2UVRA 1RT2A 1X5SA 2ZC4A 1X4HA 1MU2B 2X3GA 3LO3A 4O23A 5HBMA 1LFWA 5A76A 2N7CA 2BDPA 4GC7A 3VWSA 1MWZA 2EFQA 1FERA 3OBIA 3L7UA 4ICLA 5J1EB 4HYKA 3EVMA 4U96A 2QFJA 3TI0A 3MEGA 5HO4A 2B56A 2J6UA 1IBMJ 3D0IE 3M1VB 3DOLA 3NCQA 2C2OB 1FTRA 3X3UA 2MQNA 3SZ2A 1NJXA 1F2GA 2RD5C 4M5KA 4DFMA 1SV5A 3FBBA 3KK2B 2CUYA 1OYEA 1UMJA 2DY1A 1R8BA 2XSJA 4ED2A 3K58A 1N8RT 1CPZA 2GC8A 5K14B 4C8NA 4IFYB 3TAMA 1Y10A 2BKNA 4CRJA 1GXLA 5IM0A 5D4PA 2VQEJ 1BQNB 4JBCA 4C3LA 1VQ5S 1REVA 3QJLA 1IKVB 1VQYA 1EHWA 3MHYA 5B0AA 2R7OA 3RR7A 4QIFA 1JXLA 2G2ZA 4PQUA 3QWPA 1FVQA 3QFHA 3N28A 2QLBB 1RWWB 2W8LA 2ASYA 4IUFA 2JOQA 3DDIA 3ZZTA 5KG4A 4ZCMA 3HMJG 4ED5A 1UJ5A 3V6DA 2JVOA 3MMBB 1PC5A 3CD6S 3FCWA 2HKEA 1M1HA 1ZBTA 1B64A 3ZTOA 2EC2A 2PMWA 4WWSA 2LKZA 5GAHI 3IBFB 2VA2A 3OVSA 4ED7A 1WC4A 4ZVPB 1ZTTA 3N6NA 3TA2A 5HROB 3UN3A 4QYZJ 1SIZA 2EBEA 2ZHOA 4HH0A 2BACA 2HMIB 4NPOA 4J9QA 1NK7A 2AF6A 1K8AT 3KNAA 2LQ9A 2PO4A 2DNLA 1NEEA 5C2GA 4OIXA 2YX7A 2AW0A 2GHVC 1RT6B 1RWXB 1KDNA 1PIEA 1X0PA 2A2DA 2H5EA 3IR7B 1FF2A 4C8OA 1TFWA 1TKXB 5IS2A 5D4LA 2G2YA 1AZSB 3W63A 4CTAB 5E41A 1SBRA 1RAOA 2HHSA 2QN6B 1RT2B 3WC0A 3KJVA 3RB3A 1J5OA 5KFFA 2RHQB 5IC4B 1CJUB 2UUTA 2NZCA 4USMA 3MECB 3MDFA 1NAQA 2CPJA 1RABB 2FHJA 2MQMA 3HHLA 1B0PA 3ENQA 2IA0A 1AT1B 1FFSB 4DQPA 3CT9A 3A8KA 1R6YA 4P73A 3MPVA 1Y3KA 2Y0SD 4O3SA 2JC1A 2HNYB 1VGYA 1EX8A 2XTJP 4C98A 5BYQA 1IKXA 2W4DA 3AA9A 1A7GE 3DOKA 3TR5A 1C1CA 5C42A 5SZTA 2X1AA 3CF5Q 5HAOA 4RU2A 1PCAA 5GAEI 1JJ2R 2DRBA 2IMOA 1SIWB 1QVFR 5KFUA 3W65A 2QL9B 1WF1A 3UCUP 1BQMA 3IP0A 5HJYA 2UZAA 4UW2A 3CCLS 2FVSA 1EETA 1JLCA 1KHVA 3R5AA 5L46A 4HHUA 4KHRA 1DFDA 1UA0A 4BS2A 2Y3YA 1WSVA 1BMQB 1HI1A 1RTJA 2EEYA 5KFJA 5T14A 4PRFA 4OI3A 4D3HA 1PC4A 2ILYA 3Q23A 4DG1B 2YQ1A 3G87A 3GWCA 1KQGB 3FGVA 1ACMB 2AJ0A 4OMFG 5LL6d 4ES2A 3CGIA 4DX7A 1NPRA 1X7VA 8AT1B 4DFJA 1U1MA 2VL1A 4X4NA 4B9TA 2YNIA 1R27B 3AFGA 3O5TB 4NLDA 4ZS6A 4KV8A 3W9HA 1TQLA 3GJTB 4HACB 1UVKA 1U6FA 5ETRA 1JB0C 2ZKUA 1R31A 1FNMA 4OYAA 3CJKA 3IA0A 4C7QA 1VC0A 4RO0A 1BLUA 2GHPA 1C1CB 4I7FB 4IH6A 2MJUA 3BF4A 2M0GB 3PJXA 4FYWB 4RBUA 5J2QA 1VQ6S 2C1EB 2W4PA 3R3TA 3I4HX 1LW0A 2N4DA 3TANA 3CMQA 2KFZA 1NBEB 3SBMA 1FXDA 2RIJA 3GSIA 3PXGa 4ES3A 5A8KA 4EYHB 3CJRA 2W7AA 1G7CB 1N54B 1Q53A 1U26A 3DDKA 2VB6A 3VQSA 2FJWA 2DNGA 2DTJA 3UR3C 4I2QA 2DGTA 4H54A 3TRGA 1SC6A 3U1LA 2JX2A 2FY8A 1H7WA 5L38A 3J81Y 3P49B 2VG7A 1JMTA 1R8PA 3HPOA 3HX9A 5IQ6A 1IKWB 4RL1A 2QLXA 4A8SA 4X66J 2EBGA 1SQEA 1SUQA 4HH1A 4WTOB 1H3DA 2OH2A 2OP5A 1VQLS 3KLIA 1IR1A 3M32B 3ZXWA 1HBUB 3BO2A 2B3TB 3E01B 3EGVA 3TEHB 3J7A1 4CQ1A 4KHPJ 4Z7YA 1R8CA 1RUSA 2NPIA 2W25A 4LBHA 4O4GA 1I3OB 2DHGA 3BGRB 1UETA 4OJGA 3RJMB 2VFUA 3PM9A 2XCAA 1KRPA 2JEIA 4X4TA 2JLEA 4LFCJ 4Q43A 3K5LA 2AWZA 4CLFA 5B09A 2B6AA 4LUBA 3CEDA 1RDRA 5G0RB 4ZVRB 4ZA1A 4H4MA 1QSSA 4TU9A 2UVWA 4Y34A 3RB6A 1HNIB 3PYEA 1R7IA 2RDJA 5HLFB 3FZ2A 1DZ5A 5T41A 1K0TA 3I9V9 1CC8A 5C5JA 4N47A 1P1TA 2VPYB 2E7WA 4JI6F 2J7UA 5KFEA 1RHMB 3CDAA 3J7YI 4DV1J 2E5LJ 4YR2A 2VG7B 3DFEA 4M5NA 4UY85 2IC3B 3GPAA 1U4BA 2G4BA 1VBZA 2HQ3A 2RU3A 4F2RA 4DCJB 4RNNA 4ZJQA 3ILIA 2ZBPA 2RQ4A 1RT1A 2DH7A 1PO6A 1WTFA 2GVDB 5H9EJ 1JX4A 1DRZA 5A8KB 1RSCA 3C3LA 4ZCIA 3VVUA 4ED1A 4CP5A 2KZMA 4O4GB 4DV3J 2RUGA 3J80Y 2DHXA 4GO5X 4OZ3A 4Z2XA 4LF8F 3POTA 2BJDA 4OI2A 1RK8A 3QYYA 4RW9A 1XQIA 3ZZUA 3FZBA 3RAQA 2OHDA 3W66A 2W9BB 4DV5J 3JYTB 5M2UA 2B7BB 2O01C 3AODA 3PRVA 4TXSA 3R7SB 4DL7A 1FK9A 2DO0A 5K9FA 4A8QA 3ZFVA 1NHKL 2BM0A 3PW4A 2QA2A 2BOPA 5F41A 3TW0A 1VQ9S 4KE5A 2XCPA 3C14A 2DR5A 1V3RA 5IV3A 2FYXA 4I64A 3L4BC 3D6HB 3I87A 3NG8A 3RBZA 4YB6A 5A2QY 2ZH8A 3MD3A 2NREA 4USIA 2KHCA 2YBVA 4I2QB 1JLQA 4YB5A 3JS9A 3L09A 4DL0C 4YFUA 2AHOB 3D1HA 2E9ZA 1MROA 3DRRB 4RJVA 3CJTA 2DGWA 4L74A 4LF4F 2WTFA 2WW4A 2IRYA 2ZH4A 2I5JA 1RT5A 2E1AA 1NCLA 2P9GA 2JRSA 2WK4A 4LF2A 4N8OA 5F0UA 1NJYA 1VC5A 3GONA 3KK2A 3FSXA 3ZTPA 1ROFA 2Z58B 3K2YA 4DQIA 2V4JB 2YWEA 3NGSA 5DGAA 4TQSA 4NXNJ 2DITA 4OZ1A 3WHIA 4UY8T 2VV5A 3NP5A 3MZIA 4ZKAA 1YBUA 3FEYB 2HNZA 2Z0GA 3MXHP 2MQOA 1S1XB 2BRKA 4MH8A 3VGVA 4B9NA 2R7UA 3TUPA 4DR5F 2A0FB 2O3DA 4AQYF 2V9KA 4UZCA 4PPDA 1FWKA 2LXIA 3LQVA 2MQQA 1IBKJ 4YEAA 2H51B 1LWCA 2HAIA 4EWTA 4PWDA 2MKJA 3M8ZA 2DB1A 2H1YA 5DLGA 4R0EA 3MD1A 4ZOSA 4DS5A 1RXOB 3IXQA 4P9SA 4DR6F 1GMUA 1XERA 2WOMB 3SDEB 1WC3A 1U0HB 2QZ8A 1SQFA 5LMUF 4EBDA 2CJAA 3EGWB 2IRUA 3Q8SB 1U45A 3R2CJ 3DC2A 1VRUB 1GQEA 1VHFA 3W60A 3K0JA 4B3OB 2QLFB 4J91A 4P52A 4WFBQ 2R7RA 5LM7E 4FNIA 5B0BA 1DY3A 3POTB 2VFVA 2N3OA 3RYLA 4K4SA 4LVOP 4DR4F 1IKXB 2ZHBA 5KFMA 2XMMA 2FB0A 3HSJA 2I9SA 1B3TA 3OR1B 4IH7A 2YH1A 2YX4A 2ROPA 5AXNA 3PJWA 4MK7A 2WBRA 4EZ9A 4WFXA 4WFAQ 5THWA 1EP4A 1NUEA 1WDDA 4WYWA 5LJ3Y 3BSNA 1UZHA 1JQGA 3R27A 2LQ5A 4K5SA 4I6YA 3W7BA 4DSLA 4K0KJ 3BO4A 3TUIC 3QJPA 3MCSA
chains in the Genus database with same CATH topology
3CXCR 4WK3A 2R8HA 5EN1A 2UUAF 4ECVA 3QLHA 5HP1A 1TK5A 1MMDA 2OSQA 1TL4A 4Q0BA 3H98A 4RW9B 3OR2B 4Z37A 2MSSA 3GR1A 2MKKA 3MR6A 4C4WA 3SEOA 2EFNA 5BYRA 4HKQA 2LCWA 2LDYA 1VQ4S 4BCAA 1FDBA 1S4FA 1S1WA 1YTYA 5HROA 3MM6B 2FJDB 1ZTWA 1U48A 3W3SA 3QIPB 1K1QA 4QQBA 2IAJA 4XDCA 1V3SA 1S1VA 4PR6A 1TAQA 3FQKA 4IR1A 2MZJA 3CCJS 2B4OA 4LJMA 5GVQA 5H9FJ 4K2XA 4MYTA 5IFMA 3I6PA 2BE2B 4ECSA 3RB0A 2K7KA 3MAQA 4NXMF 5DDQC 2E9RX 3MM5B 4AL6A 3LANA 3OW2R 2A10A 3GSDA 4E98A 3V4IA 4C0OC 4WU3A 3L3CA 4WZQA 1S1TA 1LQ9A 1VK3A 1RT7A 2CKWA 5HMYA 2K8GA 4X65F 3J7Z5 2J6SA 2ZITA 3IWXA 3BSCA 4TU8A 2L3MA 3BQ1A 3CCMS 3CCVS 3I5CA 3BGRA 3MFHA 2IYIA 5GMKa 2CVEA 1FRMA 2HRYA 3GB0A 5C24B 2RS2A 4QIGA 1J5EF 1QJHA 5F3TA 3LALA 3N5FA 4ECQA 2JEGA 5J2NB 4DFKA 1CSJA 1DQ9A 1ZM2A 3NGKA 3G9CA 4DUZF 1FKPB 2QIFA 2RILA 4A8XA 3K5PA 2BE2A 1GAOA 2XNRA 3MI7X 3CULA 6FDRA 4WZMA 1XR5A 4L3NA 3U1MA 4KQZA 4CO1A 3B4DA 1AROP 1O8BA 2IJFA 2GO8A 2ABYA 1N5YB 2DPIA 3IS9B 4GC6A 1XR6A 1S9EB 2ZNZA 3LGMA 4J9SA 1LW0B 3SV4A 1L3KA 3MUTP 4IOAQ 4N56A 2CPIA 1T8EA 4Y2KA 4F4YA 5F0WA 2R7TA 2XSFA 2IM0A 2FGOA 4LSLA 4J9MA 2IMWP 2D41A 1ZAVA 1X9WA 4NYOA 1N48A 3PEJA 5KTQA 4JI0F 3CCRS 4PUOA 5D3GB 4QW9A 3QLHB 1O5JA 4DOZA 5HP1B 4JV1A 1YRUA 3JAMY 5L1KA 4M95A 2WBMA 2V94A 3PX0A 3OTOF 1S9FA 1S7HA 3SCIE 3ENVA 4O44A 1ZOTA 5AE3A 1VJWA 3D1QA 4R8UB 3IRXA 4X4VA 2GV1A 3TUZC 2FJVA 1N52B 3CD5A 3S01A 2LYVA 1D9DA 3MM8A 4DV5F 1C0TB 1A9NB 2QA4G 2MY8A 2LXFA 3KOAA 2ZOGA 3HKZD 3QAEA 4CO2A 3OFFA 5E3AA 5KG6A 2AV5A 1RT3B 4ECTA 3H4DA 4NCGA 1UVMA 2DH8A 3I4PA 4EO8A 4WXWA 4WF9Q 2PGCA 2PIIA 2CDQA 4HVZA 5I3UA 1NHVA 2PA3A 1WI8A 1QVGR 3QPIA 1HQEA 5E3CA 1UJ6A 4G1QB 4C11A 1FNOA 2RF2B 4EO6A 1C4AA 1WG5A 2BVZA 1HPZB 5CD4H 2PC6A 4DV3F 2LVWA 3PRBA 1M90T 1TL3B 4O3OA 2CQ1A 4EGLA 1U1NA 2WONB 4NLTA 3AJ2A 5FDLB 4F3QA 4N77A 2ROEA 4OZ0A 4YR0A 3T5KA 3BO3A 1RT4A 3DOKB 3MM6A 4JUZA 2OPRA 2ZBIA 3HHKA 4IG3B 5KFCA 2LECA 3ISNC 5I42A 3BDEA 3V6KA 3K5MA 2UU9F 2PFFB 3PFEA 4K0KF 3G86A 1XR7A 3PFOA 1ZYQA 2C28A 2KZZA 5E7OB 1F5BA 3IS9A 4NL5A 4HT5A 3V6DB 1T03A 3LP1B 4QR2A 2HWHA 3W2WB 4G1PA 2ZZNA 3MECA 1HQUA 1LWEA 4ERDA 3CCES 5KG3A 5GAEU 3MM5A 3LUYA 1RISA 3OL6A 1ZZFA 2ZDOA 3SSSA 3CCUS 2R7VA 4WFNQ 3GZ7A 4QR1A 4JI1F 4BBYA 3HJFA 3S7RA 2G1DA 1E6YB 2HHTA 4KGMA 1VRTA 3MM9B 3CCWA 2RJZA 2VC1A 5LXYA 2HMIA 2JFDA 3BS9A 2KT2A 2VPWB 3AQOA 2KVIA 2UUWA 3GFHA 3D0GE 2N4CA 3MEKA 1JLAB 4X64F 3RBEA 2F4VF 2CQCA 1S6PA 1KTQA 4ELTA 5HBMB 3MEDB 3VALA 2DNOA 2NPFA 3PRDA 2ALZA 1QUPA 2YNIB 4U67Q 2Y1IA 2CJKA 4IQMA 3UNGC 2YWGA 3CCZA 2HYIB 1LWEB 3THPA 3V2UC 1FXLA 3C66A 1YJWS 2HVHA 1IR0A 3BEGB 4A8KA 4H4MB 2KJWA 4K5RA 1EETB 1OO0B 1U1OA 2NSCA 1BQMB 1QY7A 3OTBA 2XULA 3CC4S 5D4OA 1KNZA 3DOLB 2K3KA 1FEEA 1X9MA 3M30A 2QYCA 4AE5A 2UV8A 1HBOB 1TV6B 4RW6A 5J1EA 1WF0A 2EI5A 1T05B 1S49A 1HBNA 5EHHA 2I38A 1GX6A 2GHWA 2M4MA 3OHBA 1S0NA 4B3OA 3IGNA 5J2MA 3TP2A 4A48A 1FO1A 3VAFA 3KK1B 1IKWA 3RR8A 4B9SA 1JLQB 2W4CA 2P6TA 2VODA 3CJ4A 2DHAA 3K5OA 4FXVA 4USHA 1JLEB 1HWJA 5I3PA 4R8UA 2A18A 3A8EA 3HVTA 4Q2MA 1U1PA 5DG8A 3LP2B 5DJBA 4ZK7M 4B9MA 2ADCA 5KT2A 2AX1A 5E2QA 2E7XA 4I2PB 2XMUA 3H59A 3PIOQ 1U1LA 2R8IA 3C6UB 1TL5A 3IG1A 2LU2A 1SKRA 4B9VA 4ZHRA 3JYTA 2GCFA 1IKYB 1Q1KA 3TAQA 4EEYA 1YHQS 2R4FA 4ZVGA 4AFFA 3FRZA 5KFSA 2WW8A 2NR0A 2X51A 2RE1A 4K4ZA 3G96A 1SI9A 2OPQA 4DSJA 2DT9A 1XTZA 3P96A 2DGVA 4QPXA 2HFOA 3MM8B 1TKDA 2RU9A 3VAJA 1Q8IA 3O2IA 2HW3A 5LSOA 4B02A 3GFYA 2CPDA 1VQPS 2IBKA 2FHMA 2OFGX 2FJAB 4F26A 4G1QA 3Q24A 4QJVA 1NRKA 1SKWA 3CUNA 3M2VA 3I31A 2QLWA 3M2RA 5B0DA 1O51A 2JEFA 4RW7A 2IVMA 5F8NA 4C97A 1LK7A 2HNZB 3OSPA 3PW5A 4PXBA 2UVUA 4CI0B 2YKAA 1DTTB 1RAJA 3H2VE 2ERRA 1P27B 2EFPA 4RU9A 1BQXA 3DNCA 2Z2MA 3AY0A 3KK2B 2K2PA 2KYZA 3N0VA 3EX7B 4I56A 4NWBA 3FEXB 2WHOA 3EXCX 1LOUA 1N0VC 2Z8QA 2R8JA 1R3NA 3BM7A 1JK9B 3BDPA 3HHLD 4K4YA 2YNFA 4X4OA 4PKDB 4A8FA 2YNGB 3M8SA 2NQPA 4ID5A 4R25A 3MM7B 1S0VA 3T5JA 4MKBA 4QBUA 1S97A 3S1TA 3SCKE 2XWXA 3DRXA 1NJIT 3KHRA 2YX1A 1HYSA 4CH1A 5KFIA 1F5AA 3GIJA 1NKEA 1JLGA 1NKCA 3MAHA 2PE8A 4M63A 4MIAA 2XEXA 4A8MP 2KG1A 4RLEA 5KFDA 1V3ZA 4DDFA 4OLOA 5A8RB 5CH7B 1X0FA 2R7QA 2VKZG 3A1YG 1GTEA 1HNVA 1NHUA 2JL9A 3DLJA 3ZC4A 4M1KA 4QW8A 1RT4B 2KB2A 2M52A 4FPRA 2ATLA 2XLJA 2H9ZA 1AW0A 2J9DE 2VBXA 1RI7A 2JLFA 2J9EA 3I5AA 1VQKS 2RQMA 4Y2CA 3U1NA 5CYJA 2IC3A 1YRTA 2BBEA 2V0NA 2B43A 4Y65A 4OLPA 3T1YF 3PO5A 3M6UA 3SI8A 4DJBA 2M7SA 2MKSA 2YH0A 5EX0A 1HYSB 4DSIA 3ZZOA 5J2PB 3M4XA 4MK8A 2BUNA 3BQ2A 2CG4A 1DLOA 5B0EA 6FD1A 3MR5A 5KOWA 1S9GB 3KLFB 4OJHA 4ED8A 1T7PA 2HZCA 2GQQA 1YJVA 2ASLA 4RZRA 1Q81T 1XWLA 4V19X 1U49A 3D0HE 3MTKA 1S1WB 3OJSA 4OZNA 5KT6A 4WFZA 4DR7F 2OPQB 1FE0A 2KT5A 5GAGI 2XC9A 4DQRA 1LW2A 1Y7PA 4C8ZA 2ZOFA 2C42A 1D3WA 3KLIB 1KFDA 2FVCA 2GO9A 3QAUA 1YRXA 5E3RA 2CJ9A 3OL8A 1HI0P 2XMTA 4ILRA 2GW8A 3EPIA 2HS3A 4ZVHA 5FLXY 3DN9A 2XI3A 3L7PA 2NUUG 3H25A 1N5SA 3IRXB 1AFJA 1UFLA 3FMWA 2R7XA 3UDCA 2Y1JA 3U27A 4C0HA 2RRAA 1S6QA 3CIZA 1SKSA 2HVIA 1ZAWA 4ZPWR 5KFRA 1HW9A 3LW5C 3KK1A 2BQRA 1RGVA 4FNHA 2RSQA 1WEXA 1FDAA 1OIAA 3IBWA 4FXWA 1T05A 2NLWA 4YMEA 4K50A 1URNA 3I0SA 1RA7A 3M6VA 3NL0A 1S1UA 5GADU 3I0SB 4ZPBA 1QAIA 2BV3A 1S6OA 4JI8F 3AA8A 1PSDA 5F8HA 2DNNA 2WB4A 1WHYA 3O8WA 1T02A 1OSDA 3FDSA 4ZVEA 4KC5A 1MROB 2FPHX 1LKZA 3H5UA 3LAKA 2RF2A 4N41A 1S0OA 2QA1A 3BJYA 1WHWA 4Q5VA 4YDXA 4FS2A 1M0SA 4R0JA 3N6LA 2AD9A 2EG2A 5KFHA 5T7LB 2DO4A 1FK9B 4RUHA 4P7VA 2C2DA 4TQRA 3MMAA 4KSEB 2EVZA 1ZH5A 1H38A 2OTJS 1TKTB 3OXFA 3RBDA 1JLAA 2JJ4D 2OPSA 4NLUA 3FJ2A 1HBOA 3I0RA 2VOOA 4GO7X 4BDPA 2OPSB 3J7YU 1M5KC 4K4TA 3ULHA 2V4QA 1KLMB 4Y2AA 4I1TA 4DQSA 2DR8A 2DCLA 2UV8G 1TK0A 5DLFA 1IBMF 1SJ4P 4QIVA 2J6TA 2LQBA 1IQZA 2DCUB 2YKPA 3N5BA 1L3UA 4ZPVR 3G8TA 2NUHA 2IHR1 5KT4A 1YJRA 2ZH3A 2AJQA 5F8JA 2X1GA 4KPYA 2M88A 4OZLA 1B0TA 3KK3B 1V6HA 2XMVA 3UD3P 4WYLA 5F8LA 4F25A 4LIRA 4ZVFA 2W9CA 1AUDA 4LSLB 5CCMA 2EK1A 1D9FA 1BD6A 2MGZB 4F4WA 2V9WA 3OHAA 1T94A 2L08A 1WACA 4FN5A 5KFBA 3HHEA 4DQQA 3PVXA 1XK8A 1KVJA 4QWDA 5K8MA 3NLCA 2BR0A 3OTCA 3KFWX 3TYTA 4ZPDA 4ED3A 2XS5A 4J5OA 5KT3A 4Q0BB 3MMCA 1FJGF 5DRKA 5FIIA 2UXCF 4Y3CA 1S48A 4B3SF 3FFIB 4IYQA 4I68A 4DV7F 2CQGA 2D3ZA 4O4RA 3D5MA 4HTIA 2KRBA 2K7JA 1FTCA 4UQTA 3NAHA 4ZCKA 4I69A 2R7WA 2XLKA 5DO2A 2A2CA 2VUGA 2NXUA 2QMXA 1UAWA 2EWHA 2XY5A 1I94F 2IA6A 1TKZA 1G2EA 1QUVA 4ZCLA 5KG1A 2KHDA 4RNMA 3IWNC 1SV5B 4X62F 3OLAA 1B7FA 1DHMA 3KG4A 3HVWA 5KFZA 5AE1A 2BABA 4TYBA 3OPKA 4IG3A 2YWKA 3AB2B 3T9ZA 4OI0A 2W7OA 2B9YA 1TK8A 5CYQB 1S10A 1HWKA 4RW4B 4W92B 2DISA 1XNRF 1HD0A 1GTHA 2B0GA 2P6SA 1R8AA 4MAKA 2EFVA 1MU2A 2LU1A 2VASA 2VZ9A 4QIEA 2CJBA 1U24A 4JOUA 1VQSA 3BREA 4RW7B 2HFZA 5I3QA 5LT5A 1RYSA 2UP1A 4C0BA 3FFIA 1Y00A 3IGVA 4PWDB 4K4UA 3B78A 3DGPA 3OL9A 1RTHB 4OI1A 2L9WA 3FCHA 1FJ7A 1SH2A 2IVFB 2QSWA 3KNGA 1SJFA 1FDNA 3F44A 1W2IA 3UPFA 2NZ4A 2PMZD 4EUVA 1HNVB 1U1RA 1FXRA 4IR9A 2BQ3A 3DMJB 4PG7A 1VIXA 1HMVB 1HARA 1T3NA 1KONA 2L9DA 4LMZA 2HHUA 4U9RA 3O44A 3DRSB 5KFWA 1UVIA 4R5PA 4KR0B 4QZVB 1VQ8S 3M2VB 3HHLB 2XMWA 3R1HA 4J9NA 1DAXA 4QU7A 5MAOA 5K5MA 1KQFB 4I6AA 4HLBA 4ED6A 4V19J 1ZPVA 4FF3A 2HHWA 4OHZA 3Q2SC 4TNOA 5GADI 1S0MA 2F7VA 1UVJA 3N9UC 4LFCF 2XG8A 2PI5A 3RRGA 4TYAA 4HEA9 5CHCB 2E5GA 4F4ZA 1X4DA 1I6JA 2B4VA 2FHKA 3JSBA 4I67A 2POKA 2X1FA 3OR1A 4OI6A 1XMBA 4WIIA 3M30B 3DMJA 2KXFA 2PMHA 4G3IA 4ID8A 4TN2A 3RW7A 2CPYA 1RP5A 3MMAB 2DNRA 1VC6A 1NK9A 3NKYA 1K9MT 4QU6A 5L8RC 2DGUA 3QJJA 2RRNA 2DJWA 2WCXA 4ATNA 2CVIA 3IR6B 4HDHA 1YJUA 4DL2A 4ELUA 4NRUA 3CDWA 2MXYA 3K5NA 3BSAA 2HWTA 3CWJA 1KD1T 4AYBD 3MPYA 4ZP8A 3GIIA 4USJC 3SQGA 4WK1A 4IKAA 2OAUA 5KG0A 3B8HA 3KLVA 1ZZNA 3GG1A 3DI6A 3LP0A 4LF9F 2ASJA 3LOUA 1S1XA 3M8RA 3M05A 4B3RF 5HMWA 2VPZB 4KA