1VQMS

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 21
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vqmS00
3CF5Q 1M1KT 1DHMA 1VQLS 2MQMA 4CIOA 2RS2A 2CQGA 1Q81T 3J7YU 2DGSA 4WFNQ 1DRZA 1OO0B 1H2VZ 2ZJRQ 4WFBQ 1U1PA 1U1LA 3PIOQ 2LYVA 1WHWA 5IM0A 2XS5A 2MMYA 2XS7A 2GHPA 2LXIA 3CC2S 1AUDA 4Z2XA 3NNAA 2L9WA 2LXUA 1XN9A 2D9OA 3IRWP 3P49B 2FHOB 1X4DA 3CD6S 1U1OA 2FC9A 1IQTA 1WEYA 2KXFA 2WBRA 1VQKS 1CVJA 4ZKAA 1BY9A 2I2YA 2KFYA 4C0OC 2VOPA 2KXNB 1K9MT 2ERRA 1JJ2R 2AYEA 4QU7A 5FJ4A 4CH1A 2G1DA 3S7RA 5GVQA 1VQ9S 2VOOA 3UCGA 3G4SS 2M4MA 3SDEB 2RRAA 2GO9A 3VAJA 1S72S 1SJQA 2MZTA 1QM9A 2FPHX 4IUFA 2MKJA 1O0PA 1VQ4S 5DDRC 1X0FA 3SMZA 3CCLS 1VQOS 2EK1A 4PR6A 2X1AA 2CQIA 2KRBA 2E5GA 3VALA 1WG4A 2N82B 4WFAQ 2XNQA 5LJ3Y 5MLCV 1D9AA 1VQMS 1X5PA 1F9FA 1N54B 1NU4A 1VC6A 3MDFA 2K3KA 3BO2A 2ZJQQ 3NS6A 2ADCA 2ADBA 3MD3A 1U1MA 5D77A 2XS2A 1VC0A 1PGZA 1WHYA 1HL6A 3CTRA 2KVIA 4QQBA 1YJNS 2YH1A 1FHTA 2RNEA 2KXHA 2PE8A 3MUTP 3VAFA 1JJHA 2UP1A 3RW6A 2NZ4A 2DHGA 4C7QA 2MHNA 2PEHA 3VAIA 3P3DA 2M70A 2CQHA 5LXYA 1WG5A 2KYXA 1FXLA 5ITHA 1M90T 1NO8A 3R27A 5IFMA 4YB1P 1U1QA 2M7SA 4WCEQ 2CPXA 1HD1A 2DNZA 2MSSA 2LKZA 5DM7Q 2M8DB 2MPUA 3EGNA 1FO1A 3BO3A 1SJ4P 2MZ1A 3DLLQ 3HHNB 3CCES 2LECA 1WTBA 4LMZA 3FEYB 2CPFA 1VQ5S 1YTYA 3PIPQ 2JVRA 2YWKA 2MJNA 2BOPA 2MKHA 2FY1A 2HVZA 3CC7S 1DZ5A 2DNRA 5GAGU 4A8XA 2MGZB 2L08A 2RUGA 4CH0S 3RW7A 2AYBA 2CPHA 2E5IA 4TU7A 3NS5A 5LJ5Y 2HGMA 2J76E 1FJCA 1HA1A 2VODA 2I38A 5D78A 2MQOA 1VC5A 1OWXA 2U1AA 1WHVA 3IWNC 1SJRA 2DB1A 2X1BA 4IOAQ 2DGWA 1X4AA 2XB2D 2JVOA 3US5A 1P27B 3CXCR 3EX7B 2CPEA 4WKRA 2DO4A 3CCVS 1YHQS 3FEXB 4RU2A 2DNOA 3G71S 1H2UX 5LXRA 3D2WA 1X5TA 3Q2SC 2QEXS 1FNXH 2N3LA 1R8PA 2KU7A 2KH9A 3R1HA 1UP1A 2CQPA 2MQPA 5JVHQ 2RVJA 1WG1A 2MGZA 2DGTA 3U1MA 2DGVA 1U1RA 3THPA 3UWTA 1U1NA 2K8GA 1OIAA 2DHSA 1W2BR 2HGLA 2MQQA 2VONA 1X5SA 2M52A 4WF9Q 1HD0A 2RRBA 3CC4S 2O3DA 2AYGA 2J8AA 3N9UC 3CCUS 2FC8A 1M5PC 2F9DA 1FJ7A 1SJFA 1WWHA 3VAHA 5IQQA 1U1KA 4F02A 2MB0B 2DITA 4CQ1A 2MQLA 5CA5A 2DNQA 3TYTA 1VBYA 3CUNA 2MZJA 2KM8B 1UW4A 2OIHA 3HI9A 3CMAS 3MXHP 4ERDA 4FXVA 3BO4A 2KG1A 2SXLA 2MKSA 3J7ZT 2AD9A 1JMTA 2MQNA 3G8SA 1YI2S 4QU6A 2JRSA 2DH8A 1VBZA 1QVGR 1VQPS 2LMIA 2MY7A 2CQ4A 1G2EA 4WIIA 3UD3P 4W92B 2DGUA 2KN4A 4YUDA 2DIVA 2DNNA 2JWNA 1B7FA 3S6EA 1X4GA 1NJIT 5HL7Q 3UCUP 2U2FA 1ZH5A 2YH0A 3EGZA 2LA6A 1KQSR 5CXTA 1WEZA 3NMRA 2OJ3A 2F9JA 5IM0B 3SDEA 1P1TA 3UE2A 2OSRA 1KOHA 1YITS 2MZSA 2KM8C 2LEBA 2OTLS 3Q2TC 3I56S 1M5VC 4QPTA 4TU8A 2DNGA 2M9KA 2CQ2A 2E5JA 2LA4A 4FXWA 3L3CA 1X4CA 1N52B 3K0JA 1K8AT 3LPYA 2N3OA 2B0GA 2DNPA 2M2BA 2KG0A 3THTA 2DNKA 2DNYA 1RKJA 2DH7A 1Q86T 2KRRA 2DHXA 2G4BA 5HO4A 5JVGQ 3NNHA 2CQ1A 3B4DA 1UAWA 5CYJA 4IO9Q 2DGQA 2RU3A 5DDPC 1N88A 2EK6A 2OSQA 1WI6A 3MD1A 2F3JA 2MZRA 3S8SA 2E5HA 3H2VE 2CQBA 2CPYA 3B4MA 2N7CA 2A3JA 2EVZA 5LSLA 2LQ5A 1ZZNA 1YWXA 3R1LA 5LSOA 2CPZA 1M5KC 2DISA 2MSTA 2CPDA 2MKIA 2OTJS 1WHXA 2RT3A 1VQ8S 3MI7X 2MYFA 1N8RT 1H2TZ 4F25A 2MKKA 1H6KX 3MUMP 2MJUA 4LIRA 5GMKa 2KI2A 4V19X 1X4BA 2V94A 1DBDA 4PRFA 1VBXA 3CCSS 5DETA 1VQ6S 2X1FA 1WEXA 3ULHA 1A9NB 3TP2A 2KT5A 5GAHU 2M88A 4OZ1A 1M5OC 3CCQS 3ZZYA 2LEAA 3V4MA 1YIJS 1JJ4A 3MUVP 2AYMA 4ED5A 4P6QA 1WF1A 1Q7YT 5H1SV 2DGOA 4Y00A 1A7GE 1FT8A 2DNMA 3ZZZA 2DHAA 1L3KA 1WF2A 1FJEB 1SXLA 1KOOA 1X5OA 1K73T 3JB9k 3BEGB 1U6BA 1KC8T 2DNLA 4TU9A 1KD1T 4YOEA 3G96A 4W90B 4C4WA 3G6ES 2ZJPQ 1QVFR 2CJKA 2CQ3A 2YKAA 3CCMS 3VAMA 5DDQC 3S01A 2YTCA 3OW2R 1D8ZA 4PKDB 2D9PA 3CULA 5EN1A 2L41A 1U2FA 2MKCA 1PO6A 4J5OA 2MZQA 1OPIA 4TLQA 1RK8A 3TO8A 3LQVA 2CQCA 2DIUA 1WF0A 1U6FA 1YJ9S 2X1GA 2RS8A 2XSFA 2BZ2A 4F26A 3BS9A 2XNRA 3P5TL 2CQDA 3UCZP 4U67Q 1WELA 2JX2A 3MURP 3CCJS 2NLWA 5GADU 5GAEU 1URNA 4EGLA 2J0SD 2RQCA 1X4HA 2DK2A 4LJMA 1VQNS 2KHCA 2J0QD 3NNCA 2MY8A 3CCRS 1SJ3P 4OZ0A 3CPWR 2MXYA 3G9CA 3UD4P 4BS2A 3DXBA 4UQTA 1R8HA 3CMES 3MOJB 1ZZFA 1X4FA 2E44A 1Q82T 5DM6Q 2QFJA 2CQ0A 2G0CA 2QA4S 2M8HA 3I55S 2DNHA 2LCWA 3G8TA 2CPIA 2Q79A 3U1LA 5BJRA 1X4EA 1YJWS 2HGNA 2M0GB 5DDOC 3H2UB 4Y0FA 2CPJA 3VF0B 1UFWA 2HYIB 1S79A 2D3OR 2DO0A 2RQ4A 2HZCA 3P6YC 1VQ7S 4M5DB 3SXLA 3VAKA 3VAGA 2DH9A 2DGXA 4IOCQ 4UY8T 1WI8A
chains in the Genus database with same CATH superfamily
2HBZB 1M1KT 2XZTB 2CZVC 2V8GA 4RW8A 5D0RA 4ZVSB 2Z2YB 2BUNA 1ACMB 5MAOA 2CQGA 1NK4A 4USVA 5D0GA 5C2CA 3J7YU 1DRZA 3D66A 1S1UA 3W2WA 3MMCB 4C0BA 5HMZA 5CAAA 2ZJRQ 1BC6A 2D41A 2PMZD 1U1LA 4LF5J 5E3PA 1JLQA 1X9WA 3KNGA 2E9RX 5IM0A 2O5DA 2CJYB 2MMYA 3BBCA 3CNQP 3MPYA 1F3VA 4TQSA 2XS7A 2EFQA 2NS1B 3FVYA 2EXUA 3NOGA 3CC2S 2QA4G 2I8EA 4G1QA 4Y65A 2L9WA 2LXUA 4USWA 2HRUA 1XN9A 4EU0A 4UY85 1WC1A 1WKKA 3FEZA 5L1JA 4FF3A 2BQRA 2JC0A 3P49B 3AA8A 3M8PB 4PYDA 4HYKA 2OFHX 3CJTA 1ICEB 4J9NA 3HT0A 4HDHA 2UZAA 4DUYF 2AGPA 4FF1A 4IQMA 4OYOA 2GZOA 3SSQA 4JI0J 3BDEA 2KXFA 3TZYA 2ZH5A 4DL5A 3ETMA 1IBKJ 1CVJA 2K7KA 4CDIA 4DFPA 1XMQF 3LALA 2RDJA 4DI6A 2YX4A 5C42A 2I2YA 3ADAC 8AT1B 2B56A 1C4CA 3CW2C 4B3SF 1HBNA 4N41A 3KMQA 4R5PB 3PACA 1ZPVA 2PA8D 3M6UA 3PYFA 2DEIA 1WACA 4RUBA 3A12A 3L7OA 4R8UB 3HD1A 1RQ0A 1UPMB 1R27B 3VR1A 2AYEA 4MT1A 5FJ4A 4YY3F 1DURA 1KLMA 2JH3A 4IFYA 2ZFHA 3QO9B 4UW2A 4ZVOB 4YMEA 1NJXA 1XMOF 1OS5A 2VJVA 2GJFA 2G1DA 1NK7A 3S7RA 2ASLA 3TARA 3G4SS 3H25A 1ZYQA 1XNRJ 2B6AB 4F2SA 4B02A 2HS4A 3ISND 1QM9A 3D1QA 3WIVA 2B9EA 3KHRA 2F4VJ 1O0PA 3E51A 1NDPA 3D5MA 1X0FA 2DD8S 5FIIA 1RAIB 2EK1A 1MG7A 4HTIA 2YKNA 5J1PA 1NNDA 2HHSA 1TL7B 3IMQJ 1JNRB 5CYMA 3A3NB 3J7YI 2E5GA 1N5VA 1Z2ZA 3VALA 1I5OB 4R25A 2N82B 3HD2A 1HBUA 1NK0A 3MCOA 3H5SA 3H2LA 3UN5A 4ELTA 2K7JA 3GR1A 4DF4A 2QO3A 5I42A 4NI2B 5F8HA 4DV3J 1PBAA 1VK3A 4ZVTB 3VCDA 4X4VA 3GJRB 3MR2A 4ECVA 3M2VA 2B7BB 4MFBA 3QT7A 1VS3A 4ES1A 4DQIA 3MM6A 4ZK7M 4YR2A 3DOMB 2UVUA 1IBMJ 2OMOA 3AB4B 4GKKF 4ZIWA 3IM8A 2NXUA 1Q8KA 3LH2S 5GMDA 1U09A 1VC0A 1PGZA 3CTRA 1YJNS 3RBDA 2QSFA 3IS9A 4DFJA 2F65A 1REVA 2GFFA 1ZBTA 2C42A 3CJ8A 4I2QB 4ZVUB 1FJGF 1F3FA 2GC8A 3MUTP 4DFKA 2PDAA 4TXSA 4B3MF 2R7WA 1RAHB 4FYXB 4YR3A 3RW6A 4DSKA 2HRYA 1U02A 1F60B 3OSNA 4K4WA 4DV6J 2PEHA 2GQQA 1UJ4A 2QL9B 2ASJA 3P3DA 3GIRA 3Q8RB 1HYSA 1KP6A 3PRBA 4HI2A 5FLXU 1TV6B 3CJSA 2NPFA 3VV2B 3FDSA 1WG5A 2OEJA 4LR8A 1WORA 5AE1A 2GIFA 4WXWA 4DUTA 1Q5VA 4JI7F 3AXKA 1VGYA 2AEFA 2EEYA 3NWRA 4KHRA 3RB3A 3O2IA 4UOFA 2M7SA 1U1QA 4PEOA 2DNZA 1I3OB 2MSSA 3EGVA 1KVJA 1VLOA 3UN2A 1SH0A 3C16A 1PYTA 1RUSA 3W5XA 1S9FA 3M1VA 3FFIB 2B9XA 1HNXJ 4AL5A 2OD6A 3HLUA 5JUMA 3PEHA 1NZAA 5B0GA 2HQDA 3M2RB 1TVRB 1B99A 2VQFJ 3CCES 1WTBA 1B64A 1VQ5S 2BACA 4FYVB 1TU0B 1YTYA 3W66A 3EZ5A 3SV3A 1IBLF 2KKHA 2MJNA 1HMVA 4GC6A 4DSFA 2CYYA 3OFEA 4U8VA 2JLFA 3GIMA 5DQGA 4K4UA 3PG9A 1FK9B 1L3SA 4RBTA 1OYDA 3V5RA 4U6PA 1G3OA 2J7KA 3DRRB 4CYUA 2FY1A 1DZ5A 2XWXA 3HVAA 3UI3A 2FVQA 2MGZB 1MROB 1SUQA 1WKJA 2FHKA 3CIMA 3KLHA 4J90A 5KFWA 3NS5A 4P2MA 4DCJB 1F9EB 2JEGA 2HGMA 2RD5C 3JS9A 4M5JA 5F8JA 2CNNB 4TNOA 3WZ0A 1ZM9A 2VODA 1IKVA 2I38A 4WE1A 1LEOA 1OWXA 2OHDA 3EVWA 4L72B 1KLNA 5BYRA 2U1AA 2R2SA 4JI8J 3GYGA 3SCIE 3ZZTA 2E9TA 5G0RA 1YG0A 2L48A 3TAMB 5KFNA 3IWNC 1SJRA 3M8SA 4BC7A 1KRPA 1WDDA 4ZMMA 2GVDB 4NEZA 1TAQA 4IH7A 2O66A 1X4AA 3US5A 4NA3A 4ECXA 1M1GA 3HZEA 4BBYA 3J80U 4JV1A 4WFYA 4DBQA 4ED0A 3MFIA 3BGOP 3QRPA 2DNOA 3G71S 1H2UX 2BJDA 4TKTA 1N5YA 4KY3A 2FVRA 2IJNA 1ZA2B 1X5TA 3Q2SC 1GMUA 1GTHA 2KHDA 3DRYA 3KK2B 3Q24A 3CB4A 2XCPA 2R7QA 3DC2A 1HWLA 2Z0GA 1MW7A 4QWDA 1R8PA 4ED1A 1D8YA 1KFSA 3HO1A 3TEHB 2KU7A 2KH9A 2NYIA 2FLNA 2M5YA 1UP1A 3NXZA 4EI2A 2MQPA 3KHHA 2BYCA 2H9ZA 1RAAB 5E33A 5JVHQ 3IRXA 4Q7AA 2R7VA 2LU1A 4OZ2A 4EK2A 1UTAA 1WG1A 2L3MA 6AT1B 2MGZA 4IG0B 4KH1B 4LR7A 2DGTA 2HSEB 4M5IA 4Z7YA 4H4OB 3PKYA 4K4VA 1AXQA 1PYSB 1VRUA 2MLXA 2E1AA 3A8EA 1HBOB 2G0JA 3DLEA 3NS7B 2P9EA 5KFGA 3THPA 2EKNA 5IOLA 2E1CA 1MU2A 2NUHA 3H0PA 1HMVB 4K0KF 4RW4A 2V2VA 3IWLA 5E7OB 1APSA 2GQ2A 3I87A 2J7WA 1TUWA 1X5SA 2XMVA 3FBFA 1NHUA 2OAUA 4I6YA 2K06A 4I6AA 4KGVB 3D3CJ 1MWZA 2RRBA 2C28A 4WF9Q 3KFWX 1AT1B 2F4FA 3SEOA 4WU2A 1C1BB 2VG5B 2ZH2A 4N76A 5KFAA 5KG1A 1WC3A 2KZZA 1FJ7A 2FB0A 1OMSA 4QIVA 2XHWA 2R2RA 3P96A 4USJC 4ED6A 2D3O1 4JV5J 2DITA 1U0HB 2DNQA 2R9LA 3CUNA 5BR8J 4QWBA 3UO0A 1JLGA 2KM8B 4DR3J 5A2QU 2QN6B 1R7IA 3ZC4A 1J5OB 4ERDA 4B3OA 2RKIA 4ZJQA 2AQ4A 4UUWA 1G4CA 2KG1A 1CSJA 1RP5A 2MKSA 4B17A 3I5BA 1PJ5A 1S1WA 2F8HA 1JMTA 2ZOGA 4O3QA 3K5NA 3M4XA 4NLQA 2MLYA 1WTFA 2YKQA 4C3LA 2QMWA 5CD4H 3VVTA 1FRIA 4QU6A 7FDRA 2WOMA 2OPQA 3UNGC 2JFKA 2LVWA 2VF3A 2HG4A 4X4TA 1Q5YA 2OLWA 4KC5A 4M5KA 1SKRA 3KLFA 1FRKA 3KK3A 3HULA 2C3OA 4DL2A 1N34F 4YS2A 2VBYA 1FI4A 5KT3A 4ECTA 2OFGX 2JWNA 3CSKA 2PD1A 1JKHA 3JQJA 4ES3A 2WOMB 5HL7Q 1HKAA 3JTPA 3R6GB 2DR9A 3MM8A 2YH0A 5LMNJ 1R6YA 3IC1A 2I5JB 2AJ4A 3BH7B 2QJ3A 3ZZPA 2LA6A 3KLEB 1KQSR 2CZ4A 4TN2A 1WEZA 4X66F 1K0VA 1HPZB 3K2YA 3V2UC 2QYGA 3RGIA 5KT5A 1YITS 4B3TJ 3R8YA 2KDOA 2OTLS 2PN6A 2DXFA 2V5HG 3ELHA 1H73A 4RUCA 4QPTA 2QL5B 1S1XB 4C8LA 4USMA 5KFVA 5EX0A 1TELA 1TK5A 1EB0A 3LPEA 3IR5B 2DPJA 4FXDA 3OTEA 3FJ2A 1QLNA 4K5SA 1S77D 4Y2IA 3JSMB 1NRKA 2CXEA 2D3UA 5KFSA 4A46A 1HNVB 4H54A 4OLPA 5A8KA 3C2PA 2ZH3A 3DLKB 5DO2A 3D67A 1K8AT 1Y4ZB 4ELVA 1MN7A 1RDRA 2LQJA 3HHLA 2ZNYA 4TY8B 2PC6A 1FEEA 1MSWD 3RU0A 3GSIA 2VQEF 3AQOA 3QJJA 2H51B 2RQMA 3THTA 2DNYA 4KO0B 3GV8B 3CD0A 1LW0A 4AL7A 3PEJA 3JSBA 3OTOF 4CLWA 4BC9A 1S57A 1WUUA 3GIIA 1EKSA 4NXMJ 1RB0A 1X8DA 1HBMA 2UV8G 3KHGA 5JVGQ 3D0IE 2CQ1A 3SQGB 3B4DA 3NKYA 3T9NA 4AYBD 1TKZA 1UAWA 5IXUA 3HKWA 4CO5A 3KOAA 4IFYB 3TX8A 3TRGA 2IVYA 3CCWA 4JI7J 4F04B 3SSSA 4CI0B 1WI6A 3MHYA 3CVKA 4DQSA 1BE4A 2FJWA 2RDDA 2LXFA 3KTQA 3D6FB 2E1RA 2I9SA 4KKOA 1FA0A 1JLEA 3RZAA 2B9YA 2E5LJ 2VBXA 2DEJA 4KFBA 2EBEA 5J2PB 3S8SA 1S12A 1HNXF 3BH6B 2CQBA 3CJ4A 3B4MA 2Y1LB 5I3UB 1NB7A 1Y5IB 5CZVA 2UXDJ 3MEDB 2QSWA 4C3MA 2VQFF 5G0RB 2N7CA 1M0SA 5ETKA 5LSLA 2LQ5A 1HQUB 4NLRA 3MR6A 2BJ8A 4WE1B 1FVSA 3E01B 2B4PA 1CJKA 2JOQA 2MSTA 1K1QA 3NGRA 4JB8B 3MXHP 2OGUA 2GAGC 3H5XA 3O44A 2RT3A 3J7AN 1QSSA 1S6OA 4ZP8A 5IT0A 3ISZA 1GT8A 1NAQA 1VR6A 2FIUA 3GE9A 2OI2A 2X51A 4ID5B 3TUJC 1DQAA 1PBUA 2UVVA 3KJNB 1T9VA 2IY5B 1SVDA 2XHCA 5KT6A 1H6KX 5LM7E 1HIYA 5IT4A 4ECYA 3MEEB 1JLGB 2FHMA 4I2PA 4JP8A 2XY5A 3TJ8A 3AD8C 1S1VB 1S1UB 1X4BA 2V94A 3TA0A 4EYIB 2Y9HA 4PRFA 1IKXB 2FGOA 2QLFB 3N01A 4OJ1A 5KFBA 4A8MP 2IM2A 3CJKB 3UDEA 1VQ6S 2BM0A 2X1FA 4NA2A 3D0HE 1JLBA 4QJVA 1QUPA 4XPCA 3OV7A 1C1BA 2RJZA 1M5OC 2VDHA 5C25B 3CCQS 2PFFB 4ITSA 4WP8A 3H7HB 1PAUB 1UZDA 3IG1B 4HHHA 5E3QA 3MUVP 2K3IA 1TK8A 1ZAVA 3M1VB 3PDNA 2BE2B 3ZO7A 1T9WA 2RIJA 1Q7YT 3IGVA 1TKDA 2AJ2A 4DG1B 2DGOA 3AY0A 4OYWA 1OJ4A 2QFIA 2DNMA 2WCXA 3A3PB 4U7UD 1LOUA 3W8GA 3NL0A 1HQEA 4EBCA 2F63A 1UFKA 2PFDA 2KZMA 3JB9k 2A0FB 3BEGB 2CNKB 2AIRB 5ETMA 3VZIA 2IFXA 5KTQA 3JYTA 4RWXA 3E2EA 2NYHA 2NSBA 3KUHA 1KONA 3OJSA 1CLFA 2PSZA 1V6HA 2RE1A 5IQ6A 4DV1F 2X7IA 1UJ5A 5ADZA 4MKYA 3C66A 1D09B 1RT1A 4DHVA 3G96A 2C3PA 4W90B 5F8NA 4I7FA 1EETA 1Y5LB 1HLWA 1RI7A 1T9UA 3DDNA 1YZ6A 1LFPA 2VG6A 5K5MA 2K2PA 2CQ3A 2YKAA 2AJ1A 3C6TB 3V4IA 4PQUA 4X62F 3BBFA 3C6TA 3V4IB 4OIXA 5KOWA 5EN1A 3O5TB 1LWEA 2EKYA 3M32A 3B6BA 2V9KA 4RBUA 3MR5A 1S76D 4K50A 1D1UA 5LMUJ 4UOGA 1K44A 3M2VB 3M8WA 3EPIA 1OPIA 1RK8A 3PTWA 3GG1A 3JQMA 2DIUA 2MLZA 3W9JA 4PABA 1SUQB 4B3TF 4UF4A 3VGUA 2XSFA 3P5BP 1PG5B 5JXSA 4GKJJ 1F1BB 1SC1B 2G2ZA 5F41A 1WELA 2JLGA 3LAKA 1FK9A 1FJGJ 2H5JB 2XMJA 2W9AA 4OX9J 1WOPA 3M05A 3LAMA 2YNGA 5D0EA 5GAEU 4DG1A 4EGLA 2UXCF 4ECSA 3TUPA 1G7CB 3GV7B 3N6LA 3IAS9 2RQCA 2ZZMA 2ALYB 2XMWA 3OD2A 5I4MA 1RHRB 3CO0P 1AZSB 2DJWA 4I4BA 3ILOA 3T6JA 2AWZA 4RZRA 1X60A 2ZH7A 1D9FA 3TX0A 2FLLA 2WW4A 3J7A1 1DTTA 4CLPA 1LW2B 1XR6A 5HJXA 3UW1A 1IKXA 4OZ0A 3PXGa 4LQ9A 3KDNA 2DBBA 1XBWA 2HRTA 3X3UA 1UA1A 1PCAA 1FDDA 1FDBA 1R8HA 3CMES 2RF2B 2HBQB 2MDAA 3T5JA 2PT0A 2WTFA 1S7HA 4NYZA 5C25A 1TUVA 3NBPA 4XTTA 4E98A 4C8MA 6FDRA 4N8NA 1UVMA 4I0WA 5KG5A 1VDHA 3DGPB 4N8OA 1XC9A 2CQ0A 2G0CA 5CCLA 2XCAA 2QA4S 2DR5A 2V4QA 1IUJA 4YY3J 1RSCA 3I55S 4C8ZA 2ASDA 3G8TA 1TL3B 5JMNA 4HACB 4NXNF 2AF6A 5J1EA 5K8NA 4DV5J 2V63A 3DRSA 5GADI 4LFBF 4DXLA 1NSKL 1YJVA 2M0GB 2WB4A 3MECA 4A4JA 1R0AB 2YKMA 3AH6A 2XC9A 1Q16B 1SB6A 2B9WA 2HYIB 3HK2A 5HMXA 1HW8A 2P9GA 1GTEA 1FERA 1RHJB 2HZCA 2J9EA 2PMWA 1S9GB 3W5ZA 1CJKB 3OTBA 1HI1A 3VAGA 4P2SA 2EFGA 3DM2A 3LA0A 4IFVA 7FD1A 5IV4A 1NMEB 3V6HA 1SH2A 2Q43A 2VFVA 4DWIA 2D1CA 1CC8A 4NLGA 4DPXA 2JLEA 5F0UA 4J37A 5F8LA 1U8WA 1VQLS 1D3WA 2QC3A 2HLTA 4KIAA 2FZGB 4MFBB 4OHWA 2ZNZA 3GB0A 4WIQA 4RNNA 4K4XA 4AQYJ 3PV8A 1Y11A 5I3UA 4ZVRB 3OSPA 1YLXA 1RISA 5KFDA 4C97A 4O0NA 2HVIA 1AFJA 2BXJA 3M6VA 1QY7A 5ETPA 3W2WB 5AJ3F 4O23A 2HURA 1QSYA 1H3DA 1SQEA 5IT9U 3PIOQ 4KHMA 2LYVA 3L09A 3MPVA 1WHWA 1RHQB 3OFFA 1CJUB 3BKTA 2F40A 3KJQB 4A8FA 4WTOB 2HIYA 2AGOA 1VISA 2IBKA 1AUDA 1FFWB 4Z2XA 3DXSX 2V8PA 2R3VA 3D28A 1Q7LB 5KFEA 1HNWJ 4HI1A 3NWGA 1Q4RA 3BF4A 3H5UA 3IM9A 4B3SJ 4I64A 4DR6J 4X4UA 2D9OA 2B5JA 3F0NA 4AXJA 1BQNB 3ZZ0A 3I32A 1DAXA 2J6SA 2XMAA 2BJ3A 3CCZA 3FCVA 1U1OA 4RW6B 1HW9A 2FC9A 3K5LA 2VH7A 3KNAA 4X4SA 1WEYA 2WBRA 3H90A 3HMJG 3WX8A 1VQKS 3W2VB 4QR1A 1NPPA 4MKVA 2OMLA 1SKSA 1PJ6A 1OQ6A 3NAIA 4IR1A 1JLAB 1S1TB 2HIQA 4YHHJ 4ED2A 5A8KB 1N32F 1B4SA 2XG8A 3N5FA 2VOPA 1RT3A 1K9MT 1GMVA 1S9EB 4W4MA 1NK8A 5E5NA 3Q8SB 3H59A 2VKZG 1DTQB 2JL9A 2WVBA 1YRTA 3DDIA 3Q89A 1VQ9S 3IO1A 2VOOA 4CP5A 4ELUA 1U4BA 5T7LB 2CDQA 2M4MA 2RRAA 2OPSB 1NSPA 4IKAA 3J81j 1IR0A 3TNVA 3TVZA 5D4LA 3M30B 4CO3A 2YKOA 4X62J 4EBEA 5E0OA 3KK3B 3ENAA 3V81A 5B0CA 2V9WA 5DDRC 1RBAA 4PWDA 3QSIA 2RILA 3AJ2A 4PWDB 4LFCJ 1FXDA 1JKHB 1IBLJ 1IWAA 1SL1A 2X1AA 1YSJA 3PW4A 3QATA 1I51B 1JXEA 2FVCA 3AA9A 3J7Z5 1UMJA 4TLRA 2GCFA 4ZIVA 2OPSA 4OHVA 4B3OB 4NLPA 1HQ2A 1IKWA 2B4OA 5MLCV 3G6YA 4JI2J 5J1EB 3BGRB 4LBHA 4CLYA 1D9AA 4QOTA 4LF8J 3OL8A 1RT6A 2EC0A 1X5PA 1F9FA 2CAJA 2KT3A 4FBUA 1R31A 2GAHC 1NU4A 3PKMA 3PYEA 4S0MA 3MGJA 4HEA9 4LSNA 1X31C 1RCOB 1IJFB 1S9EA 2ZWOA 1OSDA 4PPZA 2AP6A 4PCQA 1VC6A 4OJ3A 1J5EF 4DR4J 2GIQA 2VDIA 3POTA 1XQIA 4FS2A 5BYSA 2ZJQQ 1UVNA 2WVFA 5DLFA 2ADCA 2ZBIA 2LP4A 2VKRA 4OJGA 5A6WA 2IVMA 1U1MA 2HHTA 4ECRA 1VOMA 2V8HA 1WHYA 1DTTB 1HL6A 2BV3A 2N4CA 2XMKA 4HL9A 5I3PA 4MIBA 4ZCLA 4DL4A 1CPZA 2B4UA 1FHTA 4C6AA 2DR7A 2KXHA 2PE8A 4MK9A 1FWPA 1JWWA 4RNMA 2I1RA 4IQXA 2WBMA 2WRMA 4HH0A 2DHGA 2ZD1B 2HHHF 4DSJA 5KFPA 2C2OB 2CFXA 4RW7B 3EPGA 4FBTA 2M70A 1TTHB 2CQHA 4OI1A 4RUHA 4YFUA 1LV5A 2R8KA 2DRDA 2KYXA 2FTRA 4NRUA 3FQKA 1FXLA 3BQ0A 1PAEX 2DKOB 1F5BA 8RUCA 4L6V3 2HNYA 3MM5B 3PW0A 3AAWB 1N5YB 1M90T 2Z2MA 4ZP7A 4Q43A 4URGA 2HKEA 4KGXB 1HD1A 2A2CA 2BKPA 4B9VA 4RNFA 1NDKA 2BKNA 2O01C 4DQRA 1LQ9A 3I9ZA 3UFCX 3MF5A 4L3NA 3ENVA 4F0KA 5DM7Q 2M8DB 3EGNA 3PW7A 2JFDA 3DHWC 1RTHA 1SJ4P 2H4WB 1BXNA 1RTHB 2Y1RI 3OXLA 4LMZA 3FNNA 3FEYB 3G82A 3OFHA 1F5AA 3Q8UA 4NLTA 4CO2A 4K4SA 4K4ZA 2E7XA 4Z37A 2BOPA 3DN9A 1KEKA 1U24A 4OYXA 3KLGB 4JI8F 3NMAA 2HVZA 3CC7S 2DNRA 5CZXA 5J1NA 2UXBJ 2X3GA 4MMOA 4C11A 3RW7A 2CPHA 1YRUA 2E5IA 4HACA 4TU7A 1RLCL 4TQRA 2BR0A 1NH7A 4RW7A 3QLHB 2J76E 3HVTB 4KB7A 1HA1A 3OHAA 4LRDA 5J2NB 3HHLD 3PFOA 4ILMA 1RA7A 1HHQA 3RRKA 1WC6A 1W25A 1WHVA 3S1TA 4EBDA 2HPUA 1WC4A 3K8VA 4MYUA 4Y2MA 4ECZA 1NBEB 3DOKA 3OT9A 3D6MB 1N36J 2VA3A 2DGWA 1KS2A 1T9YA 1R8CA 2JVOA 3FBCA 5IC6B 1P27B 3CXCR 1LW2A 3QT8A 4J9KA 2OEMA 1MMLA 3EX7B 2NSCA 1YHQS 4Q8EA 4RU2A 5I3QA 4X2BA 3N79A 2XSJB 5D8HB 2IM1A 3NLCA 5KFJA 1U2CA 3M8YA 1FNXH 2N3LA 3CD7A 4NLXA 3TQEA 2F1FA 3DCAA 2W2OP 2HFZA 3I6PA 3WQPA 4K0KJ 1KVIA 3GV5B 4NMXA 4F4YA 1I1GA 2OD4A 4DX8H 4P9SA 3WHIA 3MEEA 2QGFB 2N4DA 1BQMB 3FZ2A 3PNIA 1Y3JA 4OZ5A 4WYLA 4LRFA 2D3ZA 2FDNA 1QE1B 1ZTTA 1CBKA 1IN0A 5DQHA 2K8GA 4OZJA 3JTOA 1VRTB 2Z2LA 4DN9A 5J2MB 4RNHA 1B7YB 2HGLA 3K5OA 3EVMA 4ECUA 2MQQA 3E01A 2YNIB 2AGQA 1RT7A 2YXLA 1TZ0A 4NWBA 5F9NA 1HD0A 2YBVA 3W60A 1S5ZA 3L7UA 2AYGA 3EUNA 1TMJA 1QDUB 2J8AA 3N9UC 4L73A 1JX4A 2J6UA 4LF9F 5A0YB 4ICLB 1C2PA 4PAAA 2XGQA 2DT9A 3MMBA 1FFSB 5THWA 1WWHA 3VAHA 4IO1A 4N5SA 4F02A 1EIYB 1XR7A 2MB0B 3F44A 1YX2A 3KG4A 5CA5A 3KXDA 4KFBB 2WONA 2YY3A 3TYTA 5LOQA 1VBYA 1N32J 2HWIA 4I67A 2Z8QA 3HX9A 5T14A 2OIHA 3CE8A 2HFVA 3JTNA 3MM5A 4G6VB 1XWLA 4C8KA 4WU3A 1JLCB 5DRKA 2DRAA 3PW5A 4LF8F 3HFVA 1OY8A 2IPOB 2SXLA 1RKIA 2B51A 2BJEA 3N4WA 4NI2A 4ES2A 2MQNA 2IJFA 1LK5A 1S4EA 1C0TB 3EE3A 4XO0A 4DUZJ 3BJYA 1NK9A 2IRYA 3CDUA 3NGSA 2CQ4A 1RYSA 4WP9A 2R2UA 2J0XA 4O3SA 1G2EA 2H5IB 2PI5A 4QYZJ 1FFGB 4USKA 3PR4A 4Q2MA 2GJIA 2AJFE 2APOA 2OEKA 5E41A 2CRLA 4ZPWR 2B6AA 2DNNA 5AXMA 2BJ7A 2W2PP 1OQ3A 4JI3J 1Z1ZA 1K47A 3GONA 2FJBB 1X4GA 4KV8A 3S6EA 4F3MA 4ER8A 2YNFB 4AT1B 1C0TA 1KHWA 2UXCJ 3M9OB 6FD1A 1ZH5A 2LEPA 2W1BA 4OLOA 5A8RB 2BANB 2HQGA 2PI4A 4ZN1A 3TUZC 3H4BA 5CXTA 3NMRA 1C1CB 4A8YA 4CLFA 2QLXA 3PY8A 4LF5F 2XEXA 1PYOB 2ROPA 1P8GA 4ZPCA 1KNZA 1M1HA 3DKDA 2Y1IA 2ZITA 1RWKB 3HKZD 1WSRA 2RQKA 3OR2A 4IDKA 5HQLA 2QG9B 3I56S 4P73A 3NOCA 1M5VC 4F4KA 4ZPVR 2BW2A 2P2CB 2YVSA 3M8QB 3W8PA 2M9KA 2AV5A 2M3DA 5B0FA 4TU8A 3Q0AA 1RWVB 2BX6A 2DY1A 3GR0A 3TANA 4WFXA 1KTQA 2E5JA 4FYYB 4GO5X 1IKYA 4CO0A 3HVWA 2W7AA 4RR5A 3L3CA 2ZH1A 5ETRA 3K5PA 3K0JA 3KK1B 4C8NA 4ZVFA 4IRDA 2DXEA 3NRBA 4PWWA 1MN9A 1SH3A 1U48A 2V2QA 4JI0F 2IRUA 3D9BA 1W7WA 2M2BA 4G1QB 1IKYB 5DS7A 2KG0A 3BBBA 1R3NA 4KGZB 3J81Y 4HT7A 3I5CA 2VJUA 3KLFB 2ZEJA 3VGTA 1Q86T 1REGX 3CJRA 2DHXA 2GO8A 4X65F 2W7PA 2RHSB 5AE2A 2VPWB 1KBRA 2XBPA 1L3VA 2G4BA 1TKTB 5HO4A 5IWAF 3QIPB 4CRJA 3NNHA 4PWUA 5KG4A 3D1HA 3GYNA 2PIIA 3MPWA 4HLBA 4B9NA 3FGVA 2RAQA 4RX6A 4IO9Q 2UUAF 2XYGB 2C2ZB 5KFMA 3LF0A 1SIZA 4OZNA 4RU9A 1C1CA 3HT3A 1RTZA 1NDLA 3NBPB 3MD1A 5F8GA 1FE4A 1GK8A 4MKBA 5F0WA 1UWBB 3LOUA 3FSYA 3MTJA 2MZRA 4QWAA 4B3RJ 1CQMA 1VBKA 1LKZA 1YJUA 1KQFB 3LWLA 2RSQA 3H2VE 3EM1A 3ZTOA 5KOXA 1UL3A 1UFLA 3OUYA 1P9YA 1RT5A 2VG5A 1UW9A 5KFZA 2YKPA 2ATCB 2QL7B 1AZSA 3VWSA 1WOOA 3RBEA 1RTJB 2PMHA 3CJ5A 2Q3PA 2OO4A 2CPZA 4RL1A 2XLIA 5LMUF 1M5KC 5SUHA 2DISA 2MKIA 3FBBA 3OTCA 3KJVA 2OTJS 2YNGB 3EWGA 3NGKA 4Q5VA 2GX8A 2W4DA 4WWSA 5ETLA 1N8RT 1JXVA 3ZTRA 1U49A 4K59A 5L8RC 2VICA 3T5HA 4F25A 4HR2A 1CJUA 2G1HA 2LQ8A 4NLOA 4KT0C 4GKJF 5LT5A 3FC9A 3IRXB 3OLBA 4LIRA 3NCRA 2V69A 4ED4A 1VBXA 4U95A 5GAGI 1J2VA 2A2DA 1UVKA 3GFXA 4Y2KA 5DETA 2LQBA 3ULHA 1ZOTA 5FDLB 2KT5A 2HS3A 3TP2A 4CLSA 3Q8QB 1CULB 2CKWA 1NZ8A 3GTYX 4USUA 5CYQB 4X4PA 2XGPA 4F3OA 1N36F 3FQLA 4A8WA 1JJ4A 2JHEA 2KT2A 1IBCB 2GMHA 3ITHA 4OX8A 4A8SA 4EEYA 1YZ7A 3BB5A 5GAEI 1Y10A 4HT5A 4ZPTR 1FE0A 4LF6F 4LF6J 4F0HA 5LL6d 4DV1J 4JOUA 3DLBA 1LWFB 1V5IB 1A7GE 2GQCA 1Q8LA 3C6UA 3RJMB 2IIHA 4R0JA 1KTVA 2Z30B 2DHAA 1L3KA 2QRRA 3GG0A 1PIEA 2HAFA 4CO1A 3EXYA 2VZ9A 4OV1A 1BQMA 1UVIA 1U6BA 4ZP9A 2I6WA 1BUXA 3A3OB 1TQLA 5F3ZA 2DVIA 3OVAA 1FTRA 1KD1T 2PO4A 2XY6A 5HVFA 3DDKA 1KDNA 4DR6F 1E6YA 1GAOA 2C3UA 2Y0SD 3E3XA 2V8VA 4ZDNA 3GIJA 3H42A 4LF4J 4DR2J 2CJKA 1RACB 2P6SA 1N4LA 3QFHA 1O6XA 4AUKA 3HDSA 2W4PA 3A4TA 4W98A 3BDPA 2BABA 2W4CA 3DU5A 3D1OA 1V9OA 3CDWA 5DDQC 4K8RA 3VAMA 2OELA 1OPZA 5H9EJ 3PHEA 2ILYA 3DOKB 4N56A 2D9PA 4JI3F 2A10A 5K14A 5F3TA 3IG1A 4A48A 3M9MB 1U2FA 2MKCA 3LW5C 1Q78A 3W5YA 3T1HJ 1DLOA 4LSNB 2GGPA 4ECWA 1J5EJ 3QGIA 2QMUB 1N5QA 1GNKA 1QD1A 2Z58B 4J9QA 2HWHA 2C2KB 2CZ9A 2HFOA 3I0RA 3DFEA 2IC3A 1S1VA 2B7CB 2ZWPA 3LQVA 4MIWA 1IQTA 1B0TA 3D6HB 4G1IA 2YWWA 3FMWA 1WC5A 4KPYA 1J27A 3I0SB 2PGCA 2WVDA 4ZCMA 3DI6B 5L46A 1URRA 3BS9A 3OXFA 2J0QD 3BGFA 5K8PA 1T8EA 4IG0A 2K1RA 2EG2A 3MTKA 1TV6A 5GADU 1JNZB 2NCKL 3TEGA 2J0WA 3ISNC 4QYRA 4P2XA 4NOHA 2YX7A 1VQNS 4J9PA 2QIFA 3FMBA 4USIA 3M30A 5KAKA 1JK9B 3V6JA 2FUG9 2XMTA 2ABYA 4RO0A 4YR0A 3J81U 4FYWB 2MY8A 4WBFA 5HP1B 2J9CA 3NNCA 4DR7J 1SJ3P 4DSEA 4B9LA 2YWGA 1N5TA 3M6WA 4GO7X 5DGAA 4KRWA 4NXNJ 4F0MA 4F7VA 4DSLA 3IR7B 2XZWA 3PM9A 1X4FA 1CULA 5CYQA 3SCLE 3TJ9A 2ZH6A 1CC7A 1YBUA 4CT9A 2FJAB 3VTIA 3W62A 4NLUA 2AX0A 1G1XA 4ZLLA 2O1PA 1TKZB 2PA3A 2A6OA 4IG3B 2ASYA 3GJQB 2DPIA 1RWUA 2EFOA 1LXNA 2Q79A 3RG6A 3TOQA 4DPOA 3AFGA 5BJRA 1BLUA 2DHHA 4ETXA 1T95A 3KLHB 2AEMA 1LW0B 1SJ1A 2AW0A 1SPBP 5DDOC 1F6TA 5DGBA 2C2RA 4RW6A 5CD4A 4AQYF 4EZ6A 1S79A 3QFWA 3VGSA 2D3OR 1TFYA 4NE9C 3C14A 2HK2A 1ITPA 2CJXB 5B7WA 3VAKA 3O3LA 5KT7A 4U7UK 4JI4F 4DV7F 3DLKA 3UN3A 4WK1A 4IOCQ 2R7OA 4M63A 3ZNJ1 3DHXA 1NKEA 4UY8T 1EAYC 2NR0A 1KHVA 2G2OA 2HQFA 3W9HA 1DHMA 3CF5Q 2MQMA 2MTLA 3PRVA 5HLFA 3RR7A 1IBMF 1Q81T 2DGSA 1U7LA 4GKKJ 4DU8A 2BMBA 1G6BA 1H2VZ 1N0UA 2YNHA 3AJ1A 3B54A 3R5CA 4ZVEA 5HATA 5KFXA 5KG2A 4CCHA 4WFBQ 2HMIB 1U1PA 3D0GE 3LUYA 3MWBA 1CQNA 1HPZA 3PJXA 1SBRA 4X4OA 1RT4B 4UTGA 3R7NB 2I5JA 2ZM6J 1FRLA 4YN3B 1TL5A 4JI5J 3DYAA 2VHGA 4H4KA 4YB6A 2IA6A 4DR5F 2IVFB 1HNZF 3R5JB 4O44B 4I1TA 3IRWP 4LSLB 4DV4J 2FHOB 3C19A 2CNOB 2RHQB 4ZVHA 5D4NA 3LWMA 4ED8A 4RPFA 5AE3A 1T05B 1OY6A 1VI7A 2IBOA 2ZDOA 1JXLA 2ZHAA 3M8QA 4LSLA 3Q83A 1RLDA 1BD6A 2VB6A 2FYXA 3VQSA 2KFYA 2DY9A 4H4MB 4ECQA 1CJTB 3VGVA 1JLEB 1AYEA 4LRAA 4C0OC 4KYZA 1S0VA 1IR2A 3QSYB 2NQPA 3LGNA 2KXNB 2ERRA 2UUWA 5E2QA 1JJ2R 3QZ7A 4QU7A 1UZHA 5D6GA 2IM3A 3FUYA 3OL6A 3KUGA 5A8RA 3NGDA 1S6PB 3SQGA 4EUVA 2YQ3A 4ENOA 3LP0A 1V3SA 2H3EB 2KYZA 2MKYA 2FZKB 3R7SB 4FF2A 3SDEB 1EP4A 2EPIA 2Z56B 3AOBA 2GO9A 4KO0A 4WKYA 3VAJA 5HLFB 5LSRA 3PJWA 3FRZA 1S72S 1SJQA 4JI1F 2MZTA 4QR0A 5M2UA 4X4NA 2VV5A 1XNQJ 4CH7A 1I6JA 3B8HA 2ZKUA 1U26A 1VQOS 3WIUA 4KV8B 2ZH4A 2C2NA 3OJUA 1TL1B 5J2QA 5AT1B 5KG7A 3BM7A 1HNVA 4USHA 2CQIA 3ZTSA 4F50A 2FVSA 2UP1A 1UPPA 2HNDB 4DR4F 1WG4A 4WFAQ 1WD6A 2XNQA 3T19A 3GIKA 1FF2A 1MMDA 5LJ3Y 5EWEA 2R8HA 1S49A 1FRXA 2CNLB 4BHQA 2GNKA 3UVJB 3QAUA 4NASA 2MHEA 3MAQA 1BWVA 4AFFA 4DX5A 1EQ0A 2E7VA 2AU0A 3LO3A 2HZAA 4CLZA 3K59A 1QAJA 3MDFA 3BSNA 4F4WA 1NSQA 3RAXA 1XMQJ 2K3KA 4PXBA 1HWUA 4YEAA 1SI9A 1RTDA 1HBNB 4KQZA 4H4MA 5DLGA 2ADBA 3DM2B 3MD3A 1NHVA 2HHHJ 2YNIA 5D77A 3L4BC 3C3LA 3PYGA 4QQBA 4OJHA 5EWGA 4E2FB 4KBIA 5KFCA 2AMCB 2RNEA 5DG8A 2J8SA 3L7PA 4DOZA 5ETTA 1JJHA 2ZOFA 3KWMA 1O8BA 5HJYA 4DL7A 3UNYA 2C3MA 4O44A 3SYZA 1RAGB 4O3NA 4A8OA 3QZ8A 1NK5A 4C7QA 3TVYA 1YBTA 3DRPB 4DS4A 2C2MB 2XI3A 1FKOB 1SIWB 2N7YA 4PPDA 1NO8A 3R27A 3V6KA 3OL9A 4OI6A 4QZVB 4WCEQ 4OI3A 2W9CA 2HMIA 4RUAA 4MYTA 3V6DA 4IR9A 4JV5F 1GMWA 1QAYA 2CDRB 1IM4A 2W01A 1W26A 4CLKA 3F73A 4OYBA 2EFVA 2LKZA 8ATCB 4DV0F 2MPUA 1AROP 4PG8A 1FO1A 3A1YG 4RW8B 1RADB 3IR6B 4EMDA 3TQ1A 2G0IA 1YBAA 2GJ2A 2MZ1A 5M2PA 4ZA1A 3HHNB 4DR7F 4DN0A 2LECA 3UDCA 4CO4A 3M2UB 3BYRA 1A0OB 3EJMA 1XMOJ 2V68A 2JVRA 3CO9A 5BXIA 2CJAA 2W25A 3FK4A 4D3GA 2C3YA 4JYAJ 1RWMB 1VHFA 1VJWA 3N6MA 3PX0A 2ZE2B 2MKHA 3G2XA 1HBOA 2MEWA 4KSEB 2W9BB 4ZPDA 2FJEB 3NGUA 1A6LA 5GAGU 5J2NA 3CJ2A 4A8XA 4WZQA 2COLA 3CEDA 3T5LA 1FKAF 3PX4A 2AYBA 3HVTA 3BKUA 3HZGA 4H4KC 5HANA 4TYBA 3T1YF 4FYDA 3R7BB 3AXMA 2W8KA 1CJVB 3O1LA 5D78A 2FQQB 3DLGB 1VK8A 4ZLPA 1GH8A 4QWCA 1Z2LA 3HVRA 4I2QA 2QLWA 3K7RA 3KLGA 4DR3F 3FBEA 2ZZNA 2BRLA 3C6UB 3G8QA 3MEDA 1HWIA 2VD3A 3QIDA 2H48B 3CDBA 4ALZA 1LWCA 1QJHA 1GQEA 2XB2D 2JJ4D 3ILLA 4ZPBA 3MAHA 1X9MA 5J2PA 1KQGB 2HFNA 2KVQE 3NEKA 4ZPAA 2DO4A 3VZHA 4P75A 2VG6B 3DOMA 4QPXA 3CCVS 5HP1A 4CNZA 5LXRA 4NCGB 1GEHA 3I96A 4GVLA 2BJ9A 1Q0NA 2QMXA 5FDLA 4JUZA 3QWPA 1SC4B 3GYXB 1VIXA 3RUBL 4ZITA 1FXRA 5I42B 5DG9A 3T3FA 2CQPA 4QW9A 1RA6A 3VHQA 2RVJA 3LP2A 3VQTA 1M5SA 3OFGA 3G6VA 1WC0A 3HSGA 3OL7A 2GVZA 4LRCA 4MH8A 5A76A 2W9BA 2DGVA 2ZM6F 1PJ7A 3ILJA 2ZH8A 3UWTA 1T9XA 2ZBRA 1OIAA 1UEUA 3N6NA 5A2QY 2DHSA 3QNWB 4DV6F 1W2BR 4JI1J 1R8BA 4FVCA 2EG1A 4GMKA 3Q8PB 3HSDA 2VONA 2H65B 1L3TA 1NM2A 2XULA 4OI2A 3CWJA 3CC4S 1TVRA 2O3DA 4PG6A 3CIZA 1UJ6A 1FVQA 3QGGA 4FPRA 4B3MJ 2ZDPA 3ZNUA 1JLBB 2Q6CA 2ZOMA 1Q8BA 5K14B 3OUYB 1SJFA 3IWXA 3LGHA 3CJKA 3RBXA 4DR2F 2D7SA 4GVBB 2VFRA 4PQAA 5AXKA 5EUHA 4CQ1A 5K8MA 1U1KA 1Y7PA 2QA2A 1S97A 4F4AA 3ET6B 2MZJA 1SL0A 3TAPA 4WYWA 3H4DA 3HI9A 1KLMB 2X3DA 1SC6A 4YP3A 4KJIA 4A47A 2AX1A 3BGLA 5E3AA 4FXVA 4LVNP 4UZBA 4F67A 4ID5A 1ELOA 4QIGA 2RU9A 3KLEA 4MK8A 3F41A 1RJJA 3J7ZT 2W8LA 3ZTQA 3QRQA 4DCOB 2ZBQA 1JLFA 4DPYA 2IDEA 3TA1A 1JJCB 1Y00A 1NPKA 2JRSA 1TKTA 3IA0A 5L9NA 1RTIA 3OTOJ 1YI2S 1CS4A 4L75A 4PG7A 4Y3CA 1AB8A 2LMIA 5KG3A 3W65A 3W1YC 3OW2R 4WIIA 1QVGR 3EICA 3V81B 4KGMA 4J9LA 2DGUA 4YQWA 2KN4A 1T9TA 1S6QB 1IXKA 5HSPA 2DIVA 3UDLA 1Q1KA 4K2XA 1CS4B 2LU2A 1NJIT 3JSRA 1WKLA 2W2MP 3E8OA 3MZIA 3TR5A 4LFBJ 1X0PA 4DEZA 4Q0BB 1R43A 4FN5A 4ZS6A 3T9ZA 3D6TB 3MFHA 1S0OA 1RTDB 2YX1A 2E5LF 3GU0A 2HK3A 3SI8A 2VC1A 1HWJA 3EGZA 2HAIA 4P71A 1KWMA 3D4JA 2UXDF 2H4YB 1GX5A 2OJ3A 5IM0B 5AXNA 1P1TA 3UE2A 1KOHA 2FD2A 3D3BJ 2KM8C 1FNMA 2LEBA 3AD7C 3R6LB 2Q6BA 3EGWB 4DZ6A 2ACYA 1HBMB 3WDOA 3OVBA 1RWWB 2B8QA 1NKCA 2QE5A 1S4FA 2CIMA 2UU9J 1FDAA 2HLUA 4M8LA 2CADA 2DCUB 2GW8A 1X7VA 2KL8A 2IMWP 3BR8A 3KG1A 1RABB 5CYMB 1WSVA 2VG7A 1X4CA 4L3KA 2HFSA 1TL7A 1JLAA 1S1TA 1N52B 4NLWA 1TL1A 4NLDA 4XK8C 5EDWA 5CQGA 3QT6A 4TY8A 1B0VA 2HZVA 3SCKE 2XQCA 2N3OA 3C14B 1NK6A 1DQ9A 2DNPA 3OTDA 5E3RA 3J80Y 2BRKA 2QT7A 4EZ9A 3MEGA 1EJ7L 3R5DA 3EDRB 3JSMA 5IZHA 1RT5B 3HHEA 3MPUB 1RAFB 2DYAA 2DNKA 4O4RA 3NY0A 2L9NA 2DH7A 3GFHA 2KRRA 3SCJE 3GFZA 1ZETA 1BQNA 3IBCB 2CWXA 4YDXA 4X4RA 2R7RA 1S1XA 1T02A 2OPRA 3K58A 3FKBA 4CT8A 2FJDB 2OP5A 3P45B 1RHUB 3BREA 1UEKA 5CYJA 1TFWA 4ZVQB 1P6TA 2RU3A 1N88A 5A8WA 2C2DA 3T1YJ 2GHVC 4RJVA 1I94J 1GXTA 2V2KA 1N56A 1MWQA 5KFRA 4G65A 2HHXA 2WONB 4Q0BA 2P6TA 4EFAC 3MAAA 4P10A 2Y8WA 4LQ3A 2CPYA 3EMTA 3FCWA 2EFNA 1NH8A 2BKOA 2QZ8A 2QTWA 4ICLA 5KT2A 3GMGA 2EVZA 5AXLA 3BPSP 5KG0A 4X64J 2KJVA 3DGVA 1RGVA 3C15B 1ZZNA 1YWXA 3M8PA 1VIOA 3DRSB 5LSOA 2OPQB 4DQPA 2HQ3A 3RB0A 1RTIB 4M5DA 4CZCA 2CPDA 3X1LB 5IT9Y 1TL3A 4JI5F 4M94A 3TI0A 1VQ8S 2MYFA 1S1WB 2AHOB 3OLAA 1MROA 2LDIA 2E7WA 1L5UA 3PO4A 4B9UA 4CM2A 3MECB 3DGPA 2RKIB 4MAKA 3RB6A 2HQIA 2A18A 1QAIA 1KQKA 1JLQB 3MM7B 5KFIA 3QPIA 4RW9A 3BZQA 1DARA 3MR7A 3RRHA 5HQMA 3KKFA 3ET6A 2H5EA 1U0HA 2YNHB 4LF7F 1GMWD 2QLBB 1Z4UA 1RAOA 3CCSS 2FJXA 1NSAA 3AOAA 1A9NB 3ENQA 4A8KA 2CG4A 1YQHA 2M88A 5FD1A 2UUBJ 1RE1B 3HM9A 2ZVIA 1YVFA 3A8IA 3Q23A 3ZZYA 2LEAA 2ZVSA 3CJ0A 3BV8A 3FCHA 2AYMA 3C16B 4ED5A 2A1BA 1WF1A 1FCAA 4P6QA 1XIQA 2E66A 3CDAA 3U27A 4Y00A 3EYZA 4ZHRB 4DR1J 5B0BA 1FT8A 3ZZZA 2W24A 2VUGA 2E29A 3JYTB 5G4DA 1Q95G 1WF2A 1FJEB 1B0PA 1WNEA 5IC4B 4IRKA 1KOOA 3BN7A 3NAHA 1K73T 4OI0A 3QBCA 1RAJA 1KC8T 3KHLA 1M5HA 5HMYA 4TU9A 2QYCA 2UVWA 2JEFA 2JDJA 4YB7A 1IQZA 2VASA 4M5HA 3ZXWA 5JJBA 3JAMY 2CA9A 2ROGA 2BBEA 3IBWA 1AA1B 3BKFA 3KLIA 5C2GA 3GQCA 4NL5A 2GMJA 2LDYA 2VPZB 2WB1D 4C4WA 1KVKA 3TZZA 3FSXA 3G6ES 4DLEA 1QVFR 2GMLA 1TKXA 2BEFA 3UPFA 1TAUA 4WZMA 2FY8A 2DR6A 5HI7A 1GXUA 1FRHA 2V67A 5ETNA 4E8UA 5GAHI 5HAOA 2Y0BB 4PQUB 3S01A 2YTCA 4EO6A 2EC2A 2G9OA 4WK3A 1NJZA 4PKDB 3MMBB 4ZJOA 2LFVA 2YPYA 3G82B 2VA2A 2L41A 3SV4A 1IWGA 4I69A 4V19J 4JI4J 3CULA 1TKXB 3TA2A 3C46A 3CD5A 9ATCB 1PO6A 4DV5F 2VU5A 2ZKTA 4J5OA 3SSRA 4RBVA 2CJQA 3DLGA 1HNWF 1DQ8A 2A6MA 2F8MA 5CHCB 4O3RA 2XM3A 1Y9OA 2R7SA 5C24A 1GXLA 2CQCA 4P72A 5ETVA 1U6FA 3UVJA 3PHTA 2RDIA 1R8AA 5HBMB 3PRDA 3K5MA 1YJ9S 1S0MA 2RS8A 1EETB 4LBIA 4F3QA 1MNEA 3I4PA 2BZ2A 1KFDA 3MMAA 4I7FB 3VVUA 4F26A 2XNRA 3P5TL 4NZ0A 4ZCKA 4U67Q 4DU7A 3W3SA 3CCJS 2NLWA 3UR0A 4Q45A 2ALZA 1HI8A 3MCNA 1FX4A 1URNA 3N28A 3JSYA 1LK7A 1NJWA 2DCLA 5HROB 1L3UA 4OQJA 3RYLA 2NXCA 4B08A 4G3IA 2J0SD 1X4HA 3LANA 2DK2A 4Y2CA 2UV8A 3L9ZA 5K8OA 5H9FJ 3AOCA 1QTMA 3SFUA 4BWMA 3GJTB 3R2DJ 1EP4B 3FFIA 3HFKA 5K9FA 3CCRS 1WDTA 1DFDA 3GJSB 5C7PA 3T1AA 3CPWR 5KG6A 1O5JA 3G9CA 3UD4P 2V4RA 3R5AA 5FLXY 3GWCA 3DXBA 3V6DB 1S6PA 2D74B 3MOJB 1ZZFA 4AL6A 2E44A 3MM7A 1T3NA 3LP1A 1T03A 1OY9A 1U2RA 2GS8A 3H8YA 2BM1A 3AB2B 1NPRA 4IRCA 3AD9C 3T5KA 1T3OA 3U02A 2DNHA 2KB2A 2XYPB 4OYPA 1RT6B 3GFYA 3N5BA 3Q86A 2QX0A 4DV7J 2FGCA 3T41A 4MIAA 3U1LA 2RMLA 1X4EA 2VFTA 3C15A 4JYAF 3OQ2A 3HCXA 3D68A 1TR0A 3SFGA 4M95A 5F8IA 1T05A 1CEZA 3G86A 2CJ9A 3IS9B 1FKPA 5RUBA 4C9DA 2RQ4A 1N48A 3Q22A 3CJQA 4M5DB 5F9LA 1N34J 1XNQF 5U47A 2LLZA 3KK1A 2DH9A 1BMQB 2OKQA 2NREA 2P9CA 4DV2F 2HHUA 3LGMA 4FKYA 3EVOA 3CCTA 5D3GB 1N0VC 3O8WA 5DQIA 4CIOA 1D0EA 1XTZA 2ZUGA 1B70B 1V5VA 4NEYA 1UWAA 5ETQA 2RS2A 3JQKA 4WFNQ 1OO0B 5DZ7A 1S99A 2P5VA 2YPZA 4PXDA 2VFSA 3MMCA 1VMBA 5ETOA 4CLTA 5CCMA 3CGIA 4DV4F 1Y5NB 2RUSA 5E3CA 5EX3A 2BE9B 4RNOA 4F8RA 1NEEA 2IHR1 4HDGA 4NA1A 4CNYA 1I94F 1KKHA 4C3KA 2XS5A 4ANDA 1DY3A 4YB5A 2HNDA 4LUBA 2GHPA 2LXIA 1ROFA 2BANA 3NNAA 4ZOSA 1SV5B 3TUIC 2E1PA 4LSZB 4P7VA 1EARA 2KTQA 2YKNB 2ZD1A 2GIRA 1X4DA 1RTJA 5KFHA 1T94A 4I68A 3SIPB 4DPTA 2EFPA 4HHJA 3CD6S 4CWBA 1N6QB 2POKA 4GC7A 1ZA1B 1TP7A 4WP3A 3ONQA 3ILIA 2DR8A 4ZKAA 4OX9F 4BLGA 3R2CJ 3KYLA 1BY9A 4Y2AA 2BDPA 1VCTA 3OHBA 3TZWA 1RWPB 2CVEA 2YWHA 3BSCA 1UWBA 2VG7B 1X9SA 2MQ8A 3DOLA 4OYIA 3DLJA 2HVHA 2QA1A 4JI6J 2Y1JA 1C4AA 1B3TA 4KGKA 4MKAA 2F5GA 3M6XA 4CH1A 1EKRA 1U0SA 1UCNA 2RB7A 3MM8B 4LF7J 4R5PA 4M5GA 4B9SA 3WX4A 1VQYA 5GVQA 5C42B 1NXIA 3BGRA 5HK4A 3IFEA 3UCGA 3THVA 2BOAA 1C0UA 2JSXA 2WSEC 1HARA 3P4UB 3BYPA 4L74A 4DMZA 5EHHA 3TWZA 4B9TA 5D3GA 1T0TV 4DV0J 1RHMB 1TMMA 2ZBCA 3P8BB 4PG4A 4HKQA 2UXBF 2DTJA 2FPHX 4IUFA 2MKJA 2PEBA 1VQ4S 2Y3YA 3SMZA 1RU1A 3I31A 3CCLS 4PR6A 4WJBA 3TW0A 1JLFB 1JQGA 2EBGA 2KRBA 3EDQB 3OPKA 1TK0A 2B8PA 1EQMA 1FDNA 4A8QA 1H7XA 1RT4A 3H98A 4ZN3A 1IVZA 3SQOP 1ZAWA 2HHPA 1FRMA 4OZLA 1J5OA 2HHVA 2UUAJ 4CTAB 1RXOB 2F7VA 4Y6IA 2CUYA 3OVSA 3PO5A 1FD2A 2EW9A 1VQMS 2CJBA 4J91A 4FP9A 4GVBA 4EYHB 3KUEA 1N54B 3PZPA 4PUOA 3AJDA 3UQSA 4OMFG 3QGHA 4P2FA 1N33F 1DLOB 2XSJA 1Q8IA 1RYRA 2ZZTA 4EWTA 4K4TA 4Q8FA 1NB2A 2RF2A 3QWUA 4LF1A 3BO2A 4KAIA 1LWXA 2HQCA 3NS6A 2QV6A 4WXOA 4ETZA 3KJFB 1HHSA 2VPYB 1E6VA 5B0AA 1RBLA 3HHLC 1K0TA 1FEHA 4RW4B 5B09A 5KFLA 2XS2A 1AW0A 2VFUA 1XR5A 1YJRA 2KVIA 1IJEB 4J9UE 4Y34A 4DX7A 2V2ZA 1PC5A 4OYZA 2YH1A 2XLKA 3QYYA 3MCMA 4M5LA 3VAFA 4H4OA 1BWEA 2D69A 1NKBA 2R42A 2FJVA 1E6YB 2FHJD 2XWYA 3K17A 4DFMA 2DRBA 1FWKA 2EI5A 2OUGA 3L95X 2NUUG 5KFFA 2NZ4A 3IGNA 1UKUA 2J7UA 2KFNA 1HNIB 2MHNA 1YJTA 3A8KA 3FZBA 2EWHA 1VBZA 3VAIA 3DNCA 2OPPB 4K2JA 2B4VA 3MMJA 5LXYA 1QUVA 4R0EA 2J5AA 2ZBPA 4RWWA 2BQ3A 3B82A 4OHXA 4QIEA 1JLCA 3NGTA 4NCGA 3W63A 5ITHA 3IN5A 1QAXA 5IFMA 4YB1P 5HMWA 2NXEA 1TL4A 3IAM9 1YDLA 2XZDB 2CPXA 2AEJA 4HH1A 1FX2A 1LWFA 4JV0A 4ATNA 3K89A 3R5GA 3D54A 4IYQA 5HBMA 4CLLA 3M8RA 3H40A 3RTVA 2R8JA 2R7XA 4CLUA 4YHHF 3ZZOA 4OX6A 1PKUA 3UD5A 3ITHB 1RT2B 2OH2A 4OHZA 3FSIA 3KK2A 4FDFA 4P74A 3K57A 5A0YA 1GFWB 3AODA 3CMQA 4JI2F 1FESA 3BO3A 1HHTP 3DLLQ 3QRRA 3UR3C 1PSDA 1U8SA 2CPFA 2XMUA 1YGYA 4IFVB 2YQ1A 3PIPQ 1H38A 2YWKA 1LWCB 4JBCA 3R97A 3HPOA 3RAQA 2GVDA 2Z57B 1VRTA 5J2MA 1P9QC 4LF2A 2YWEA 4C0HA 4FNIA 5L39A 2HNYB 1QE1A 4N47A 1H72C 2FLPA 3I4HX 4CYUB 4DL3A 3I0SA 2AZ1A 3HSJA 2L08A 3PCOB 3KLIB 4UUXA 2RUGA 2BE7D 5D4PA 4CH0S 1VYAA 4J9VA 3HHKA 4DZDA 5KFQA 2XO7A 4DV3F 2AZ3A 1RZMA 2V8DA 1HNIA 4ILRA 1H7WA 5LJ5Y 3HXMA 2E9ZA 4P52A 3QJLA 1FJCA 2MQOA 1R6VA 4KE5A 2HVEA 1VC5A 2W2NP 2GGPB 1RWOB 2F8EX 4C48A 1SL2A 3LTOA 3OR1A 1ZPWX 3DRRA 3M2RA 3H5YA 2GHWA 4NLSA 4O4GB 5BYQA 1YJ7A 1H0HB 4DCPB 4FF4A 4FPIA 4ILLA 5F8MA 2DB1A 1T11A 2X1BA 4IOAQ 1S6UA 4NRTA 3PR5B 3CT9A 5HVGA 1ZM3A 3BGUA 1W2IA 2CPEA 2HEKA 1O51A 2V4JB 4ZLNA 2XLJA 4F4XA 3FEXB 4XDDA 5KFTA 4OHYA 3DU6A 3T6BA 4ZLJA 3SZ2A 1U47A 1F0XA 3OR1B 3D2WA 4KTQA 1FKOA 2CVIA 2IAJB 1RBOB 4IOBA 1LFWA 4FKXA 2QEXS 1ULRA 2FHJA 1R89A 1TUGB 3DRPA 1KR4A 1VQSA 3PJ9A 3QAEA 4TY9A 5IS2A 3QLHA 2NXJA 4QW8A 2ZC3A 4JI6F 4X65J 3R1HA 2UVRA 5HN0A 4J9MA 3QIPA 2HNZB 4WTYA 4I2PB 2YQ0A 3CJ3A 4OX7A 2VIHA 5ETSA 1OYEA 3O6QA 2HBYB 1MLAA 1N5SA 3U1MA 2C2EA 2ILZA 2HW3A 4Y28C 1U1RA 4UT4A 4ED7A 1U1NA 1ZS6A 4OYAA 1HYSB 4O3OA 4U7CA 2HHQA 4OFZA 3ZZUA 2FZCB 3KDOA 1S59A 4LT6A 2HVDA 4ZVGA 1HR0F 1Q53A 1F2HA 1PILA 2M52A 1SC3B 5HQ8A 4MTPA 2IRXA 1HFEL 3ENWA 5EWFA 3CCUS 1LNQA 1REVB 3MM6B 3BSOA 2FC8A 4DLGA 1M5PC 1LWEB 2WHOA 2F9DA 3A8JA 3N0VA 5KFKA 2Q66A 3CDEA 5DJBA 5IQQA 1JIHA 5T7LA 1NJYA 1BHNA 4IDKB 4LR9A 4DDFA 2MQLA 1XEZA 2ZHOA 2VPXB 2IA0A 3MM9A 4QIFA 4LREA 1UW4A 4HVZA 4NMLA 3NCQA 5M2RA 3ZTPA 4BCAA 3CMAS 4NZ6A 1HBUB 2AT1B 5AJ3J 4FS1A 3BO4A 1ZM4A 5A8WB 1RT1B 3NP5A 1UVLA 4N77A 1U6ZA 2AD9A 1WJ9A 3W9IA 2AJQA 2OPPA 4B9MA 4J9RA 1SKUB 3G8SA 3JAMU 2CWKA 3F56A 2OPRB 1S48A 3KJVB 2YNFA 2DH8A 2ZH9A 3MPDA 1DJ0A 2G2YA 2XI2A 3ICLA 4HTJA 3TVKA 3W2VA 2MY7A 5BR8F 4DPUA 1VQPS 4C8YA 1RU2A 2WZ1A 3UD3P 4W92B 3IXQA 1LXJA 2WVEA 1K1SA 4NYPA 3I82A 3MEGB 3I9V9 3UDVA 4ANCA 2NXNA 4IH6A 4YUDA 4ZHRA 3KLVA 3GILA 1R0CB 2WVCA 3G6XA 5KFYA 5J2QB 3SBMA 4X64F 1B7FA 2C22A 2B5JB 4M1KA 1T7PA 4XDCA 1ZTWA 3WC2A 2BE2A 3UCUP 3AQPA 2U2FA 4PXCA 4B3RF 2V6AA 1SV5A 2UU9F 2VBZA 1FWLA 1SQFA 3QO9A 5KT4A 1OSCA 3POTB 2GV1A 4P7TA 5B08A 2F9JA 3SDEA 2OSRA 1RAEB 4QYZK 2MZSA 3I5AA 3LP0B 4X4QA 5B0EA 1AFIA 3Q2TC 1CJTA 2R7UA 2G13A 2WK4A 1Q79A 3MOZA 1FRJA 3NCPA 4U8YA 4UQGA 4FVMA 3HSZA 5D0HA 4ID8A 1VRQC 4K4YA 4KHPJ 1IKWB 1N33J 5LMNF 4D3HA 2DNGA 3QQCD 2CQ2A 2UUCJ 4L76A 3KG0A 2JC1A 2AKWB 4X66J 4NYOA 2LA4A 3QT5A 4FXWA 2UUTA 2IMOA 1UEVA 3GP9A 4KR0B 4R8UA 5L1LA 1KN6A 1S0NA 3U1NA 4QBUA 3M9NB 1SQGA 4WPAA 1RT7B 4NPOA 1S10A 4F4ZA 4OL8A 9RUBA 3QGPA 3U7JA 2R2TA 3LPYA 4PG5A 3DYAB 1NLKL 2B0GA 3M8ZA 4DPWA 1NDCA 1ZAXA 3NG8A 3DLHA 3EZOA 3HP6A 5DZ6A 1AUSL 1V3RA 5T41A 3B78A 1RKJA 4M5NA 1C0UB 4DUZF 4Z7CA 4LFAF 3WC0A 4XIUA 3OR2B 5CH7B 2ZHBA 3ETOA 1MMNA 5D4OA 2WSFC 2R8GA 3QMQA 4XAKA 1DTQA 2P8IA 2DGQA 2Q1LA 1D9DA 4LFCF 4XPEA 3MCSA 5DDPC 2W2QP 2HS0A 3Q8YA 1ZM2A 3BR9A 2EK6A 2OSQA 4ZCIA 4G1PA 2C1EB 2XY7A 3HFZB 1GX6A 5SZTA 2Y8YA 3DOLB 2L9DA 2B43A 4NCAA 5DG7A 2ATLA 1F5CA 2V4JA 1SKWA 2F3JA 3ZZRA 2IJRA 4PYAA 2E5HA 3RRGA 2E1MC 4N7TA 2V50A 3DRXA 5KFUA 4NLYA 4MJKA 1PC4A 5L9XA 4O4GA 2A3JA 3HJVA 3A13A 2Z4PA 1VHIA 4U96A 2QLJB 3R1LA 3HHDA 3PW2A 4O3PA 7AT1B 4C2MA 4CM0A 3HHLB 3DMJA 2KFZA 2ACMA 1BGXT 1WHXA 2DXDA 1QTNB 3R3TA 5GMEA 3GCXP 1MU2B 3MI7X 3OBIA 4QR2A 4C11B 3RB4A 2UUBF 1H2TZ 2LQ9A 1VRUB 3DLEB 2JNJA 2BQUA 4I56A 3MR3A 2MKKA 3MMAB 3EXCX 2BVZA 4MK7A 4ZJLA 3MUMP 4OZ3A 2IYIA 3T1HF 2R7TA 3LP2B 2MJUA 3TAQA 1WOSA 3MM9B 4HHUA 1Y3KA 4UZCA 2KI2A 4RLEA 5GMKa 4V19X 4IG3A 1DBDA 1U25A 3OXGA 2W7OA 3QJPA 2HFUA 4DR1F 1FNOA 3RAMA 1WEXA 4URSA 2XO6A 5GAHU 2JEIA 1YK9A 1XMBA 4OZ1A 1XNRF 2IM0A 1HR0J 1JB0C 4GRSA 1H98A 2Z2ZA 3M32B 3V4MA 1YIJS 1SCJB 4UOCA 3GPAA 3WBZA 1YKWA 4AE5A 1HI0P 2F4VF 3C8YA 4DUYJ 1RCXB 5H1SV 4USTA 1S9GA 2VQEJ 1U45A 2VL1A 4O0IA 1IBKF 1FKPB 3HJFA 3TAMA 1S6QA 1NUEA 4J9OA 4OYMA 4DSIA 2K1RB 2YKMB 3AT1B 4LVOP 1EZZB 1SXLA 3KMSA 1R0AA 1EHWA 1X5OA 4QWEA 3JXOA 1IKVB 4UOHA 2NZCA 2DNLA 1XK8A 3IBFB 2HNZA 4LBPA 5L38A 2HWTA 2HBRB 2I0XA 2BA9A 2IC3B 5D15A 4NX9A 3I0RB 4C8OA 4YOEA 1XJWB 2IAJA 2J9DA 3DI6A 2WSCC 2FLOA 3LP1B 2ZJPQ 1T03B 1V3ZA 4BWJA 2ZE2A 5H9FK 2VC0A 2YWFA 2AJ0A 3MEKA 4AD6A 4QCLA 4K7QA 3CCMS 4DX6A 5IWAJ 2RRNA 5L1IA 4DL6A 4M5MA 2JZ5A 4LRBA 1R0BG 3GCWP 4FZVA 1E6VB 2KJWA 1D8ZA 4FNHA 4IH5A 4TYAA 4TVAB 5A6PA 2FVPA 4NCBA 1YRXA 2H1YA 4KPCA 4E0DA 3R5BA 3W64A 4NZ7A 3ZFVA 2MZQA 3PFEA 2B3TB 4PUOB 4TLQA 5EGYA 4PZVA 3TO8A 4DR5J 5HROA 2R8IA 1WF0A 1UA0A 4WKRA 4QIWD 2X1GA 2W9CB 4CTAA 4RW9B 1Y0HA 4F36A 3W61A 1RWNB 3GLJA 4V1Ak 1UETA 3FRYA 2CQDA 1MWYA 2WW8A 2GVZB 5B0DA 3UCZP 2JX2A 4J7CA 4LIWA 4C98A 3R9LA 3MURP 4J9SA 4U9RA 1IR1A 1S7IA 5CABA 1FD8A 2UUCF 1VLYA 1NCLA 5C24B 3PYDA 5H9EK 2XMMA 4Q2LA 5HVHA 3BQ2A 1QSLA 4I6WA 3M7VA 4ANEA 3IP0A 3BQ1A 4LJMA 3EZUA 1HQUA 4Q44A 2KHCA 3HF5A 3GZ7A 3BPDA 4K5RA 1KSPA 2GA7A 5IV3A 3D7SB 4PXEA 2BW7A 1BQXA 1RT2A 2H54B 3RR8A 1VFJA 3G87A 3MAAB 2R4FA 4LF9J 2MXYA 3BSAA 4AXIA 1UVJA 4DL0C 4BS2A 2XTJP 3BN4A 3Q8VA 4UQTA 2ZC4A 4KKOB 2XYHB 1FTCA 2O67A 1HNZJ 2RH3A 3PVXA 4LF4F 2BJ1A 4LFAJ 4ED3A 1Q82T 1RHKB 3W7BA 5K20B 2J6TA 4OI4A 2ROEA 4KH0B 3TZXA 5DM6Q 4ZVPB 5KFOA 2QFJA 4DF8A 3PX6A 1CJVA 2M8HA 1RT3B 3TJAA 1CG2A 2VBWA 2JEJA 1HWKA 2J9DE 2NPIA 4KHPF 4DS5A 2LCWA 2V0NA 2IYGA 2CPIA 4OV6A 5C5JA 4JV2A 2WAQD 4EO8A 4DQQA 4YDDB 3RBZA 1NHKL 3GSDA 5L1KA 4URQU 4DV2J 1YJWS 1RWXB 2CG8A 2HGNA 1HQEB 4BDPA 3H2UB 4F2RA 1F9HA 2CPJA 4Y0FA 3VF0B 2ZUAA 1N6QA 4NXMF 1IM6A 1UFWA 4DJBA 4X84A 2DO0A 1XERA 3H20A 4RKUC 1P1LA 3P6YC 1VJQA 1H74A 3DMJB 3SXLA 4WFZA 1VQ7S 2V34A 3AHPA 3K8WA 2HHWA 3M2UA 4ZP6A 4NLVA 1F2GA 2DGXA 2IDLA 2KO1A 1EX8A 1WI8A
chains in the Genus database with same CATH topology
1M1KT 2CZVC 2V8GA 4RW8A 2BUNA 5MAOA 2CQGA 1NK4A 3J7YU 1DRZA 1S1UA 3W2WA 3MMCB 4C0BA 5HMZA 2ZJRQ 1BC6A 2D41A 2PMZD 1U1LA 5E3PA 1JLQA 1X9WA 3KNGA 2E9RX 5IM0A 2O5DA 2MMYA 3MPYA 2XS7A 4TQSA 2EFQA 2NS1B 3FVYA 3CC2S 2QA4G 2I8EA 4G1QA 4Y65A 2L9WA 2LXUA 2HRUA 1XN9A 4EU0A 4UY85 3FEZA 5L1JA 4FF3A 2BQRA 2JC0A 3P49B 3AA8A 3M8PB 4HYKA 2OFHX 4J9NA 4HDHA 2UZAA 4DUYF 2AGPA 4FF1A 4IQMA 3SSQA 1IQTA 3BDEA 2KXFA 2ZH5A 4DL5A 1CVJA 2K7KA 4DFPA 1XMQF 3LALA 2RDJA 2I2YA 2YX4A 5C42A 4B3SF 4DR6F 4N41A 2B56A 1C4CA 1HBNA 3KMQA 4R5PB 3PACA 1ZPVA 2PA8D 3M6UA 4R8UB 1WACA 3L7OA 1RQ0A 1R27B 3VR1A 2AYEA 5FJ4A 4YY3F 1DURA 1KLMA 2JH3A 4IFYA 2ZFHA 3QO9B 4UW2A 4YMEA 1NJXA 1XMOF 1OS5A 1NK7A 2G1DA 3S7RA 2ASLA 3TARA 3G4SS 3H25A 1ZYQA 2B6AB 4F2SA 4B02A 2HS4A 3ISND 1QM9A 3D1QA 3KHRA 1O0PA 3E51A 3D5MA 1X0FA 2DD8S 5FIIA 2EK1A 4HTIA 2YKNA 5J1PA 1NNDA 2HHSA 1JNRB 5CYMA 3J7YI 2E5GA 1N5VA 1Z2ZA 3VALA 4R25A 2N82B 1HBUA 1NK0A 3H5SA 3H2LA 4ELTA 2K7JA 3GR1A 4DF4A 2QO3A 5I42A 5F8HA 1VK3A 3VCDA 4X4VA 3MR2A 4ECVA 3M2VA 2B7BB 4MFBA 1VS3A 4ES1A 4DQIA 3MM6A 4ZK7M 4YR2A 2UVUA 2OMOA 3AB4B 4GKKF 2NXUA 3LH2S 1U09A 1VC0A 1PGZA 3CTRA 1YJNS 3RBDA 2QSFA 3IS9A 4DFJA 2C42A 1REVA 2GFFA 1ZBTA 4I2QB 1FJGF 3MUTP 2GC8A 4DFKA 2PDAA 4TXSA 4B3MF 2R7WA 4YR3A 3RW6A 4DSKA 2HRYA 3OSNA 1F60B 4K4WA 2PEHA 2GQQA 1UJ4A 2ASJA 1HYSA 3P3DA 3Q8RB 3PRBA 4HI2A 1TV6B 2NPFA 3FDSA 1WG5A 5AE1A 4WXWA 4JI7F 4FXDA 1VGYA 3RB3A 4KHRA 3O2IA 1U1QA 2M7SA 2DNZA 2MSSA 1KVJA 1SH0A 1S9FA 3M1VA 3FFIB 2B9XA 4AL5A 2OD6A 3HLUA 5JUMA 3PEHA 1NZAA 5B0GA 3M2RB 1TVRB 3CCES 1WTBA 1B64A 1VQ5S 2BACA 1YTYA 3SV3A 3EZ5A 1IBLF 2KKHA 2MJNA 1HMVA 4GC6A 4DSFA 2CYYA 3OFEA 2JLFA 3GIMA 5DQGA 4K4UA 1FK9B 1L3SA 4RBTA 3V5RA 4U6PA 1G3OA 2J7KA 3DRRB 2FY1A 1DZ5A 2XWXA 3HVAA 3UI3A 2FVQA 2MGZB 1MROB 1SUQA 2FHKA 3KLHA 3CIMA 5KFWA 3NS5A 2JEGA 2HGMA 2RD5C 5F8JA 4TNOA 3WZ0A 1ZM9A 2VODA 1IKVA 2I38A 4WE1A 1OWXA 4L72B 1KLNA 5BYRA 2U1AA 2R2SA 3SCIE 3ZZTA 2E9TA 5G0RA 1YG0A 2L48A 3TAMB 5KFNA 3IWNC 1SJRA 3M8SA 4BC7A 1KRPA 4ZMMA 1TAQA 4IH7A 2O66A 1X4AA 3US5A 4NA3A 4ECXA 3HZEA 4JV1A 4BBYA 4WFYA 4DBQA 4ED0A 3MFIA 2DNOA 3G71S 1H2UX 2BJDA 4TKTA 1N5YA 2FVRA 2IJNA 1X5TA 3Q2SC 3KK2B 1GTHA 2KHDA 3DRYA 3Q24A 3CB4A 2XCPA 3DC2A 2R7QA 2Z0GA 1HWLA 1MW7A 4QWDA 1R8PA 4ED1A 1D8YA 1KFSA 3HO1A 2KU7A 2KH9A 2NYIA 2FLNA 2M5YA 1UP1A 3KHHA 2MQPA 2BYCA 2H9ZA 5E33A 5JVHQ 3IRXA 4Q7AA 2R7VA 2LU1A 2FVPA 1S77D 1WG1A 2L3MA 4LFBF 2MGZA 4IG0B 2DGTA 4K4VA 4H4OB 3PKYA 1AXQA 1VRUA 3DLEA 5KFGA 2E1AA 3A8EA 1HBOB 2P9EA 3THPA 2E1CA 1MU2A 2NUHA 1HMVB 4K0KF 4RW4A 5E7OB 3IWLA 1APSA 2GQ2A 3I87A 2J7WA 1X5SA 2XMVA 5LT5A 4M95A 1NHUA 2OAUA 4I6YA 4I6AA 4WF9Q 1MWZA 2RRBA 2C28A 3KFWX 3SEOA 4WU2A 1C1BB 2VG5B 2ZH2A 4N76A 5KFAA 5KG1A 2KZZA 1FJ7A 2FB0A 4QIVA 2XHWA 2R2RA 3P96A 4USJC 4ED6A 2DITA 2DNQA 2R9LA 3CUNA 4QWBA 1JLGA 2KM8B 1R7IA 3ZC4A 1J5OB 4ERDA 4B3OA 2RKIA 2AQ4A 4UUWA 2KG1A 1CSJA 1RP5A 2MKSA 4B17A 3I5BA 1S1WA 2F8HA 4O3QA 1JMTA 2ZOGA 3K5NA 3M4XA 4NLQA 2YKQA 1WTFA 4C3LA 2QMWA 5CD4H 4QU6A 1FRIA 7FDRA 2WOMA 2OPQA 3UNGC 2JFKA 2LVWA 4X4TA 2HG4A 2OLWA 4KC5A 1SKRA 3KLFA 1FRKA 3KK3A 2C3OA 4DL2A 1N34F 2VBYA 5KT3A 4ECTA 2OFGX 2JWNA 3CSKA 2PD1A 1JKHA 4ES3A 2WOMB 5HL7Q 3JTPA 2DR9A 3MM8A 2YH0A 1R6YA 3IC1A 2I5JB 2AJ4A 3ZZPA 3KLEB 2LA6A 1KQSR 2CZ4A 4TN2A 1WEZA 4X66F 1K0VA 1HPZB 3K2YA 3V2UC 5KT5A 1YITS 2KDOA 2OTLS 2PN6A 2V5HG 4RUCA 4QPTA 1S1XB 4C8LA 5KFVA 5EX0A 1TK5A 3IR5B 2DPJA 3OTEA 3FJ2A 1QLNA 4K5SA 4Y2IA 3JSMB 1NRKA 2D3UA 4A46A 5KFSA 3C2PA 1HNVB 4H54A 4OLPA 5A8KA 2ZH3A 3DLKB 5DO2A 1K8AT 1Y4ZB 4ELVA 1RDRA 2LQJA 3HHLA 4TY8B 2ZNYA 2PC6A 1FEEA 1MSWD 3RU0A 2VQEF 3AQOA 3QJJA 2RQMA 3THTA 2DNYA 4KO0B 3GV8B 3CD0A 1LW0A 4AL7A 3PEJA 3JSBA 3OTOF 3GIIA 4BC9A 1X8DA 1HBMA 2UV8G 3KHGA 5JVGQ 3D0IE 2CQ1A 3SQGB 3B4DA 3NKYA 3T9NA 4AYBD 1TKZA 1UAWA 5IXUA 3HKWA 4CO5A 3KOAA 4IFYB 3TX8A 3TRGA 2IVYA 3CCWA 3SSSA 4CI0B 1WI6A 3MHYA 3CVKA 4DQSA 2FJWA 2LXFA 3KTQA 2E1RA 2I9SA 4KKOA 1FA0A 1JLEA 3RZAA 2B9YA 2VBXA 4KFBA 2EBEA 5J2PB 3S8SA 1HNXF 2CQBA 3CJ4A 3B4MA 5I3UB 1NB7A 1Y5IB 5CZVA 3MEDB 2QSWA 4C3MA 2VQFF 5G0RB 2N7CA 1M0SA 5LSLA 2LQ5A 1HQUB 4NLRA 3MR6A 4WE1B 1FVSA 3E01B 2B4PA 2JOQA 2MSTA 1K1QA 3MXHP 3O44A 2RT3A 1QSSA 1S6OA 4ZP8A 5IT0A 3ISZA 1GT8A 1NAQA 2FIUA 3GE9A 2UVVA 2X51A 4ID5B 3TUJC 1DQAA 5KT6A 1H6KX 5IT4A 4ECYA 3MEEB 1JLGB 2FHMA 4I2PA 2XY5A 3TA0A 1S1VB 1S1UB 1X4BA 2V94A 4EYIB 4PRFA 1IKXB 2FGOA 3N01A 4OJ1A 5KFBA 4A8MP 1VQ6S 2IM2A 3CJKB 2X1FA 3H5XA 2BM0A 4NA2A 3D0HE 1JLBA 4QJVA 1QUPA 4XPCA 3OV7A 1C1BA 2RJZA 1M5OC 5C25B 3CCQS 2PFFB 4ITSA 3IG1B 1TK8A 5E3QA 3MUVP 2K3IA 1ZAVA 3M1VB 3PDNA 2BE2B 1Q7YT 2RIJA 3IGVA 1TKDA 4DG1B 2DGOA 3AY0A 2DNMA 2WCXA 1LOUA 3NL0A 1HQEA 4EBCA 2KZMA 3JB9k 3BEGB 3JYTA 3E2EA 3VZIA 2IFXA 5KTQA 4RWXA