1VQMS

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
b'SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vqmS00
5JVGQ 1URNA 1WHYA 3B4DA 2CQHA 3ZZYA 2DH7A 2YH0A 1VQ4S 3UD3P 1WF2A 4OZ0A 1X4DA 1WEZA 1UP1A 2DNYA 2HGNA 3CCMS 2YH1A 4F02A 2ADCA 2ZJQQ 1ZH5A 2M8HA 5ITHA 2HZCA 3CPWR 2MQLA 3SDEB 1ZZNA 5GADU 2LEBA 2RT3A 3SDEA 3R1HA 4ERDA 3TP2A 3CULA 3CCRS 3UE2A 2DGTA 2FC9A 3BO4A 3K0JA 3S01A 2FY1A 2MKJA 1WWHA 2DNQA 1WHVA 2CQBA 1OWXA 4QU7A 3SXLA 5GAGU 2ZJRQ 3IWNC 3P5TL 1WF0A 1X0FA 2DO0A 5FJ4A 2PEHA 3VALA 5LJ5Y 2MQQA 2DNZA 2E5IA 4F26A 1YITS 3CMAS 2VONA 5LXRA 3UCGA 1VQOS 4Y0FA 3Q2SC 2U1AA 2CPEA 1DRZA 5DM7Q 2YWKA 1FO1A 3EX7B 1RK8A 4WKRA 1HA1A 2KHCA 1D8ZA 3MD3A 1NO8A 2MY7A 5DETA 2CPZA 2KM8B 2OTJS 2DNGA 1X5OA 1OO0B 2MZJA 3CCUS 1M1KT 1X5SA 1U1PA 3ULHA 4TU9A 1P1TA 2E5HA 2JRSA 2OSRA 3HI9A 3G9CA 2HYIB 1KOHA 2DNRA 3G96A 5GAHU 1UAWA 4EGLA 2KRRA 5DDOC 1M5OC 3OW2R 2LA6A 4WFBQ 4C0OC 1VQ9S 2JVRA 2CPDA 2J8AA 2M8DB 5D78A 3EGNA 1SXLA 1X4HA 5GVQA 2N3LA 1FHTA 1VQ8S 2KT5A 2VOPA 3P49B 2CQIA 2XS7A 3LQVA 2RS2A 1VQPS 3MXHP 3NMRA 2DGOA 3NNCA 2DO4A 1KQSR 5HL7Q 3P3DA 1HD1A 2KG0A 1VQNS 5CYJA 2D9PA 2KH9A 1X4BA 1VQMS 2JX2A 1N8RT 1VQKS 5IQQA 1WTBA 4QQBA 2MZ1A 1WI6A 2WBRA 3D2WA 1U1QA 1PO6A 2E5GA 4WIIA 4IUFA 2M52A 4IOAQ 3MUMP 2MYFA 3MD1A 3CCJS 2CPIA 1VC0A 1VBXA 2DNKA 3N9UC 1Q82T 3RW6A 4WF9Q 4RU2A 3BEGB 4UY8T 2M7SA 2RUGA 1ZZFA 4PRFA 2KFYA 2BZ2A 2CQ4A 3CXCR 4TLQA 2NZ4A 5H1SV 3P6YC 4W90B 2XSFA 1H2UX 3SMZA 1BY9A 5LXYA 2MZQA 1FNXH 5DDPC 1N88A 2LXIA 2RNEA 1YWXA 2U2FA 4C7QA 4CH1A 1VQ6S 1X5PA 1K73T 1U6BA 5LSLA 2ERRA 1H2TZ 2AYMA 4WFAQ 1M5PC 2MZTA 2EK6A 2MHNA 2MQMA 2MQPA 1YJWS 2JWNA 2RVJA 3HHNB 2DHAA 1M90T 2MGZB 2NLWA 4QU6A 1FJ7A 2CQ1A 2CQ2A 2MGZA 1NJIT 2D3OR 2BOPA 1G2EA 2KI2A 5DDQC 1SJ4P 1X4FA 3U1MA 1SJ3P 2J0QD 1KC8T 2CPYA 1VQ5S 3B4MA 2KVIA 4ZKAA 1B7FA 4V19X 5IM0B 1Q86T 2LMIA 2K3KA 4YOEA 3J7ZT 2UP1A 3G8TA 4J5OA 5GMKa 1O0PA 2DGXA 5LSOA 3G8SA 1AUDA 3I56S 3NS6A 4A8XA 3VAKA 1X4EA 3BO3A 2G0CA 2HGMA 3ZZZA 2KXNB 2RQ4A 3VAIA 2Q79A 2DITA 1YJNS 1U1OA 2LECA 2HVZA 3J7YU 2RU3A 2X1FA 3THTA 1WELA 2CQPA 2D9OA 3MI7X 4YUDA 3EGZA 3BS9A 2MY8A 1X4CA 3VF0B 1A7GE 3CC2S 4TU8A 2RQCA 2F3JA 2MKSA 2VODA 1H2VZ 2KXFA 3R1LA 2CQ3A 2EVZA 2GHPA 3I55S 3NS5A 5D77A 4CQ1A 2DHGA 2G1DA 2L41A 3VAJA 1F9FA 2RRBA 3MDFA 1FT8A 1N54B 2QFJA 1DBDA 2FC8A 2DNMA 3H2VE 1HD0A 3L3CA 3CCSS 4CIOA 1JMTA 1R8PA 1WI8A 1X4GA 2DNPA 3G71S 3CCQS 2MSTA 3IRWP 1W2BR 4QPTA 1VQLS 3TO8A 3CTRA 4P6QA 2CPHA 5BJRA 2XNQA 3G6ES 2MKCA 3S7RA 3DLLQ 2M9KA 2MKIA 2DGWA 3PIOQ 4IOCQ 2I2YA 4FXWA 3S8SA 2MZSA 1YJ9S 2OTLS 3CD6S 1SJQA 1H6KX 2LCWA 4PR6A 3PIPQ 2N82B 5DDRC 2XB2D 3BO2A 2LEAA 1PGZA 2DHXA 2DISA 2CQDA 2DHSA 2M70A 4U67Q 2J0SD 2ZJPQ 2AYEA 2CQGA 2KU7A 2MSSA 2DGVA 1JJ4A 2MKKA 1U1NA 2LQ5A 3H2UB 2FHOB 1YHQS 1P27B 1S72S 1RKJA 3MOJB 2M0GB 3NNAA 2AD9A 1WG4A 1DHMA 1M5VC 1CVJA 2CPFA 1JJHA 2DGQA 2DIUA 2MZRA 4LJMA 2G4BA 4C4WA 2X1GA 1L3KA 1WHWA 1U1LA 1OPIA 3UWTA 2M88A 1YI2S 3CC7S 4W92B 3JB9k 3S6EA 3VAGA 2QA4S 2YTCA 5IFMA 5IM0A 2YKAA 1VQ7S 1U2FA 2OSQA 2XS2A 2PE8A 4PKDB 1YTYA 5HO4A 2DH9A 1QVGR 2KM8C 2RS8A 3NNHA 2J76E 3CF5Q 2KXHA 2DK2A 2MJUA 3UD4P 1U1KA 1SJFA 2DNOA 1A9NB 2L08A 1KOOA 2DNNA 4ED5A 1QM9A 1NU4A 2DB1A 2OIHA 4Z2XA 3MUVP 1KD1T 3CCVS 3CCES 1UFWA 2MJNA 1S79A 2LXUA 1VBZA 3RW7A 1X4AA 3V4MA 2RRAA 1XN9A 1QVFR 1VBYA 2CPJA 4WFNQ 2MPUA 2X1AA 1VC5A 2M2BA 5GAEU 3CUNA 2X1BA 1SJRA 2LA4A 3TYTA 1Q81T 3Q2TC 2QEXS 1OIAA 3FEYB 3VAFA 1K9MT 2GO9A 4UQTA 5CXTA 1D9AA 2SXLA 1U6FA 4TU7A 2MB0B 2AYGA 4IO9Q 5DM6Q 1WF1A 2DGSA 4LMZA 4Y00A 3MUTP 3CMES 4BS2A 1R8HA 3VAMA 1WEYA 1UW4A 3LPYA 2LYVA 4LIRA 2B0GA 3MURP 1VC6A 1WEXA 4CH0S 2N3OA 3G4SS 1M5KC 2KRBA 2JVOA 2I38A 5EN1A 2DGUA 1U1MA 4F25A 2DIVA 3CC4S 1X5TA 5MLCV 1Q7YT 2XNRA 2V94A 2E5JA 2CQCA 2ADBA 2CQ0A 1FXLA 1YIJS 2A3JA 3DXBA 1K8AT 2O3DA 2XS5A 1DZ5A 2VOOA 2DNLA 2M4MA 2MQNA 2MMYA 2F9DA 2HGLA 1FJEB 2FPHX 4OZ1A 1FJCA 2EK1A 2MXYA 5CA5A 3CCLS 2KN4A 2E44A 2CPXA 1WG5A 2CJKA 5LJ3Y 1WG1A 3UCUP 2DH8A 5JVHQ 3VAHA 2AYBA 3U1LA 2F9JA 2LKZA 3R27A 4YB1P 2L9WA 2KYXA 2MKHA 1WHXA 4WCEQ 1N52B 1U1RA 2KG1A 2N7CA 4M5DB 2OJ3A 1IQTA 4FXVA 3FEXB 3THPA 3UCZP 3US5A 2DNHA 1JJ2R 2K8GA 2MQOA 1HL6A
chains in the Genus database with same CATH superfamily
2VJVA 3T1YJ 4ZVUB 4ZS6A 2HLUA 3D0HE 2HGNA 2J9EA 3JSMA 2ZHOA 4OYWA 3GTYX 1RXOB 5D6GA 3PJXA 4FNHA 2OFHX 3CULA 2JFKA 3BO4A 3K0JA 2FY1A 2MKJA 4DX6A 3OL8A 1K0TA 4O4RA 2ZH7A 3NGKA 1CJTB 1F5BA 1EP4B 3P5TL 5T7LA 4F2SA 2ZKTA 4NLRA 5KFTA 2QE5A 1FEHA 4NCGB 5J2MB 1FRJA 2DT9A 1KLMB 4Y0FA 3H98A 3UDCA 3HHLC 2UXDF 4B3SJ 4DX8H 2UUCJ 5B0BA 1SIZA 3PYFA 3Q83A 4ZPBA 3UNGC 3O3LA 4PXEA 4JI4F 3ZO7A 1NK6A 1HBMB 3V6DB 2KT5A 5K20B 1REVA 2XS7A 4M5LA 4A8MP 1G3OA 5BXIA 2F65A 2A1BA 4KHRA 2GHVC 1WTBA 3HT0A 3BGRA 3LP2B 4HHUA 4PUOA 4JI8J 1S1UA 4WXWA 1N33F 3CE8A 1W26A 4HTIA 1VRQC 2XQCA 5KFUA 3AJDA 4UY8T 4OI1A 3PHEA 1EKSA 3ZC4A 5KFCA 2BZ2A 2FUG9 5F8GA 1QSLA 1EZZB 3CJ8A 5HBMA 4GKKJ 1S6PA 4NYPA 1IJFB 2MHNA 2MQPA 3LWMA 3F41A 5DRKA 3HD1A 5DDQC 1Y7PA 5KOXA 1RT5B 1N34J 2P9CA 1FCAA 4X64F 2B4UA 2B4VA 4DU7A 3I0SA 3MCSA 4ICLA 2XLJA 2A6OA 1SQGA 4KR0B 4LFCF 2GIQA 2R7VA 1RWOB 3FSXA 3KNAA 1HNIA 2NREA 1RAEB 1C1BB 4GVLA 3BS9A 2HS3A 2HBRB 3BBCA 4O44B 5E41A 3GIMA 1CC7A 3OPKA 1N36F 1M5SA 2GHPA 5HMWA 2YXLA 4PWDA 2K7KA 3GWCA 2X51A 4Y2AA 3MDFA 3QRPA 1HQEA 1DBDA 3W3SA 2FC8A 2DNPA 5D4PA 2MSTA 3MOZA 2W2PP 1I94F 3BN4A 3ISNC 2DXFA 3BREA 5KFBA 1JLBB 5HATA 2CRLA 3UVJA 1IBKF 4ZLLA 1EB0A 1NK8A 3PIPQ 2LEAA 4Q0BB 1OMSA 1XNRF 2QA2A 3PJWA 3POTA 4I69A 2DGVA 3RBDA 1KEKA 1P27B 3EWGA 1UVJA 1RAAB 4E8UA 3FRYA 5DG8A 5RUBA 5KFGA 1ZTTA 3FMWA 1E6YA 2JDJA 1Z2ZA 4K7QA 2NSCA 4ATNA 4C9DA 5IM0A 4P2SA 5D3GA 3U1NA 2PD1A 2AHOB 3O2IA 3BGOP 3D28A 3MMCA 4K4XA 2ZH8A 3UD4P 2DYAA 2C1EB 1TAQA 1WD6A 1JX4A 2N4CA 2DNNA 3D0IE 3AOCA 4NXNJ 3PKMA 4B3TF 2OPRB 3UO0A 4LT6A 1Q8LA 3MM8A 2HS4A 2IA0A 5D8HB 1YKWA 3JXOA 4GO7X 4DV5F 3VAFA 5AJ3J 2HHWA 2D3O1 2OGUA 2Y1LB 3PRDA 1UW4A 1KQGB 3OVAA 4RO0A 3IS9B 2R8IA 2VF3A 4HH0A 2FY8A 3CWJA 1JB0C 2O3DA 2M4MA 4TY8B 2DHHA 2XSJA 5IOLA 2A10A 3U1LA 1U6ZA 3K5PA 4KH0B 4PQUA 3I5BA 2HHVA 3FEXB 3TA1A 1RJJA 3MHYA 1KLNA 1VLOA 2DEIA 3UD3P 3GIKA 1JXVA 2B6AB 4Q8FA 3CGIA 2HZCA 3MFHA 2C3UA 2CXEA 1ZAWA 4X4OA 1UEUA 2FC9A 1WWHA 1CJTA 1Q79A 3MAHA 1PILA 3ELHA 1Y0HA 3BSOA 4NCGA 3DLKA 4P73A 1HNZJ 5M2PA 4WKRA 4DCJB 3OR2B 4ECXA 4USKA 1NJXA 2BJ1A 1FNOA 2RB7A 2GO8A 4ZITA 5C24B 3F44A 3OBIA 1N5YB 4ZCLA 2YKQA 3EGNA 1X4HA 4A47A 4LVOP 1HBMA 1N32F 2DGOA 4DV4J 3NLCA 3T9ZA 2FYXA 2BJ9A 2XMUA 2HFZA 3T5KA 1NH8A 5L1IA 1N8RT 4KT0C 3MEEB 3LP2A 4OMFG 4DPWA 4YQWA 2OPSA 3PACA 4ITSA 4KGKA 2WW8A 5CH7B 2J0WA 4YB6A 3QZ8A 4U7UK 3DU5A 5DDPC 1N88A 1C0UB 3JYTB 4TQRA 3QZ7A 1PCAA 3PRBA 4JV5F 3I31A 4HYKA 2MZTA 2DHAA 3KKFA 1FVSA 1LQ9A 4KGXB 1U48A 3BQ1A 1UTAA 1RT5A 1GMWA 1XEZA 1KTVA 2X3GA 5E33A 1LK7A 1VLYA 4FN5A 2HRUA 3DDNA 3HSGA 1AYEA 2KXNB 5ETLA 5KFEA 3LTOA 5EHHA 1WELA 2UVVA 1C1BA 1A7GE 2FJBB 1IKYA 4USUA 4Y28C 1JXLA 2EW9A 1AZSB 4B08A 5IXUA 4JI1F 1NHKL 2XZDB 4MAKA 1FE0A 1U4BA 4LF6F 3FJ2A 3H2VE 4KGVB 2GVZB 5C5JA 1SL1A 2BXJA 1YZ6A 5IWAJ 2AQ4A 2V50A 4LRBA 1LK5A 3Q8VA 4CH7A 5CCLA 2VQEJ 2QZ8A 3U27A 4I6AA 4DEZA 4ED1A 1S5ZA 3ZZTA 3RBXA 2N82B 5DDRC 2BR0A 1HNXF 2MKKA 1XIQA 2LQ5A 2WOMA 2C2RA 3H42A 1NEEA 2WK4A 3SSSA 3AB4B 4OHWA 5CYQB 1M5VC 2W2NP 1NPKA 2QT7A 4LFBF 2XYGB 2ZUAA 1LW0B 5AXNA 1DJ0A 3IAM9 3NXZA 1ZTWA 2QL9B 2GMJA 5IS2A 2BKOA 1S7HA 4UF4A 3ILOA 4YHHJ 1ZYQA 1FRXA 2GVDB 1X9SA 1KD1T 1VISA 4WFXA 2OPRA 2JJ4D 2ZH3A 2W7OA 4LF4F 2UVRA 1RWUA 2C2ZB 2F7VA 4WBFA 3MMBB 2APOA 2JLFA 1PJ6A 5KFVA 4OHXA 5ETSA 5ETVA 2B0GA 2VASA 2GHWA 3KLIB 1WEXA 3ZTOA 2GGPB 2HVEA 4OZ3A 2HNDB 4MH8A 4NI2B 4K4UA 1SL2A 4RLEA 5FDLB 2H5EA 3CC4S 5A8RA 3GCXP 2R7OA 1U45A 1YIJS 3IBCB 2WSEC 2O01C 2YKNB 1SVDA 1LEOA 1S0NA 1Q4RA 4NX9A 3QT6A 4CLWA 2EK1A 4NLPA 2P8IA 1I51B 2OPQB 3I9ZA 4JYAJ 2CIMA 4QIFA 5BYSA 1Q53A 2N7CA 4M5DB 4FXVA 1NZAA 3RYLA 4K4WA 2BM0A 2V4QA 4HT7A 2PN6A 4QWBA 2BJ8A 2B6AA 3JAMU 4NLWA 3GJSB 2MQLA 3SDEB 2E1CA 4ZVPB 5GADU 4I7FA 1K1QA 4EMDA 3QATA 3CCRS 4KH1B 4ZVSB 4Z7CA 4K8RA 2W25A 1KBRA 2XY6A 3PX0A 4OJGA 4DFKA 4X4TA 5FJ4A 1F60B 4E98A 1HHTP 3VALA 4B9NA 3QSYB 1GEHA 1RT4B 3SFUA 2PDAA 3TVKA 1T05A 2O66A 3EX7B 1Q0NA 4PYDA 3IGNA 5C25B 1NSKL 1DTQA 3W2VA 2J7UA 2AGQA 1SH2A 1IKVA 3G96A 4MK7A 4B3RF 3MR2A 3JAMY 4YDXA 3R97A 5C24A 2BJEA 2J8AA 4NLSA 1SXLA 2CYYA 4K4SA 2C2DA 2OD4A 2YVSA 1VR6A 2R8KA 2OMLA 1ULRA 2DO4A 4FYVB 4K5RA 2VFRA 2KH9A 3AB2B 4A46A 2HVDA 1Y5LB 5F8NA 2CFXA 2CG8A 4X4NA 1TQLA 2JLEA 3NOGA 1RWPB 4DG1A 2HQ3A 2EBGA 4PRFA 2L9NA 4NWBA 1QD1A 1HNWJ 4DV6F 3D9BA 5GMEA 4C7QA 3GFXA 3NAIA 2ERRA 2IA6A 3FBBA 3QMQA 2DRAA 3MM6B 1RU1A 5A8WB 4O3SA 4DR4J 2PFDA 3FBEA 1Y11A 2ZOFA 4WYLA 4OJ1A 2PA3A 3N6MA 3HDSA 1TFYA 5DZ6A 4L74A 2UP1A 3I82A 1C4CA 4J5OA 3HFKA 4NXMF 1LW2A 1OS5A 3NS6A 1R8BA 4OX7A 1JLGA 3WIVA 5DQGA 3DC2A 1YDLA 3R5JB 4M63A 2C28A 4M5MA 3KXDA 3SSRA 2XWYA 2V63A 4NZ7A 2RHSB 3IM9A 4WU3A 4UUWA 4DBQA 4TU8A 2FHJA 4M94A 1AZSA 3PG9A 3FC9A 2FJDB 2ZH2A 3R1LA 2E1MC 2B4PA 2JEGA 4ZLPA 2B5JB 3OHBA 1KVKA 5CAAA 3T6BA 3EPGA 1FT8A 4DV3J 1N0VC 3DHXA 5KFYA 3L3CA 4DUZJ 4FYDA 1JMTA 4S0MA 4WFYA 2PO4A 2GVZA 4EUVA 3TO8A 4EWTA 1R89A 1NCLA 4I4BA 3ZTSA 3F56A 5KG0A 2ASDA 3V4IB 4JI7J 2M9KA 3D54A 1LWFB 3EM1A 2PI4A 1F3VA 4WZMA 3W61A 3QRRA 2WAQD 3C66A 1TKTA 1HW8A 2WCXA 2R7WA 3SQOP 3MPWA 2F1FA 2MSSA 5C2GA 1ZPVA 3R3TA 1JJ4A 4ZJQA 1FK9B 1U1NA 2HHHJ 4XIUA 3KJNB 1YHQS 3W8GA 3UQSA 4I68A 5E3RA 3QGGA 1T7PA 3W9IA 1BQMB 5CYQA 2RDIA 3CC7S 4K4YA 5F9LA 3J80U 4ANCA 1U1KA 2QRRA 3K59A 3HVAA 2G9OA 1CJUB 3IP0A 3TJ9A 1T9TA 4DPUA 2V67A 1FF2A 4WFNQ 3KG1A 7FD1A 2YWEA 2X1BA 3E8OA 5HAOA 4TXSA 3WQPA 1MW7A 1FERA 3JQMA 2VFVA 1K9MT 3MMBA 1KQKA 2GAHC 4YR2A 4ALZA 1EJ7L 4IO9Q 4LMZA 2FQQB 2I5JA 1J5EJ 2LQ8A 3VV2B 4ED2A 2D69A 3J80Y 2WSCC 4ID5A 4RNNA 3M8RA 3UN3A 3W63A 3GIRA 2AJQA 5EN1A 4DCPB 3JTPA 3AODA 5FDLA 1X5TA 1VK3A 1S99A 1F2HA 2EFQA 2UUBF 4GVBB 2HEKA 3H0PA 2H3EB 2KJVA 2MQNA 5BR8J 2QLJB 4KFBA 4FKYA 3BGFA 2WVFA 3C3LA 3W64A 1OJ4A 3W65A 1RTDB 3UCZP 1JJ2R 1YBUA 3BV8A 4DSFA 2VBXA 2OEKA 2LVWA 3KNGA 4NE9C 3Q23A 2Y8YA 1UMJA 1QAXA 5HJXA 2NXUA 4F02A 4O3PA 2ZZNA 2J7KA 5LSRA 1WKLA 3SDEA 3R1HA 3TP2A 3BF4A 1ACMB 3QLHB 3BR9A 2VFUA 2W9BA 2YWHA 4QR2A 3O8WA 2QLFB 5HLFB 4UOGA 2KZMA 1JJCB 2K3IA 3N6LA 2IBOA 3TRGA 4P9SA 1KR4A 3K5LA 3HCXA 3IGVA 5LXRA 1RT1A 1RT4A 2ZKUA 5DM7Q 4DR3J 1YBAA 3B78A 4J9OA 2ZM6J 4WP9A 3MMAA 4WXOA 2QC3A 1XNQF 4NL5A 4DSEA 4OZJA 2K2PA 5E7OB 3D3CJ 2D3UA 3QQCD 4L6V3 3CJRA 5ETNA 2C42A 4Q2LA 1NUEA 1L3VA 1FHTA 2PMHA 8AT1B 1XWLA 2QL7B 4IG3A 3CO0P 4LQ3A 2CJ9A 3DMJA 2ASYA 1FRIA 1VQKS 1YBTA 1SKWA 2WBRA 2E5GA 4X4PA 5ETRA 3MUMP 2V8PA 4UOHA 1VC0A 2LLZA 4V19J 2DNKA 4OZ5A 3KLEA 5KFLA 3CT9A 4G1IA 2ZNZA 2HMIB 1S1TA 2XO6A 2E1RA 1UWAA 1RTJB 1VQYA 4RJVA 1HYSA 5IV3A 2ZBCA 2LDYA 3FGVA 4QW9A 2JWNA 3MM6A 4YS2A 1U49A 4DR6F 4ZVHA 3BR8A 4RW8B 1FNMA 2LMIA 4KSEB 5D0HA 3K5NA 1CJVB 3H5SA 5L39A 4K2JA 1WOOA 3HHLD 1JLCB 4F0HA 2VG6B 3M6WA 1N4LA 1O5JA 1RQ0A 1BC6A 2WVDA 4H4MB 5H9EJ 4DR5J 2H48B 4DV0F 3EGWB 3IR5B 4P71A 2E7VA 3RJMB 2GNKA 4IKAA 3G71S 1WACA 1CS4B 1V3SA 1VRTA 1RTIA 1S1WB 4BC9A 2XNQA 2E7WA 3M30B 3C15B 3V4IA 1FX2A 1ZBTA 4C11A 3PRVA 2BACA 4HHJA 2XWXA 1PYTA 2CDQA 1PAUB 2LCWA 5IV4A 4A8WA 4YR3A 4TYAA 4EFAC 3W8PA 3EMTA 2G1HA 2J0SD 2V4JA 3BGUA 3KLFA 3CCZA 5HN0A 1SKSA 4ILLA 1R27B 4MT1A 5ETQA 4R0EA 2CUYA 2ASJA 2HWTA 5HQLA 4EZ6A 2VPZB 2ABYA 3KHLA 2YWGA 2MZRA 4LJMA 2HKEA 1FKPA 2CJXB 2AEFA 1BQMA 2VBZA 4G1QA 3PX6A 2O5DA 2EG1A 3T9NA 4DMZA 1H7WA 3MEGB 4J9QA 3NNHA 1BGXT 5CCMA 1SJFA 3H5UA 4CZCA 4HI2A 5B0AA 4K4VA 3G8QA 4IOBA 3KJVA 2IRUA 2AZ3A 1TTHB 2CPJA 3ZXWA 2LU1A 1JKHB 1OIAA 2H4WB 1UW9A 1UVMA 1IM6A 5CZVA 3CDAA 4WZQA 4NLVA 2XCAA 4LRDA 2EEYA 2FLPA 2LYVA 4HTJA 1NKEA 3ISND 3KUHA 4ZJLA 1IBLJ 4KKOB 1XC9A 1KWMA 2ILYA 1FFGB 1B3TA 1RE1B 1FA0A 1VK8A 2C2OB 2VDIA 2ZUGA 1HBUA 2QYGA 3CW2C 2F9DA 4OV1A 6FDRA 1IBMJ 1OSCA 2HBQB 2QMXA 2VG5A 2GAGC 1WG5A 4Q7AA 3PZPA 4L3NA 1IXKA 5B0DA 4KO0B 1S0VA 3B8HA 1U1RA 2IY5B 3C14B 2JL9A 3CIZA 3PDNA 1XMQJ 4R0JA 1URNA 5MAOA 2R8HA 1FI4A 1T03A 3OXFA 1Y5NB 4M1KA 1ZH5A 1S6QA 4URGA 3PR4A 2JSXA 1EQ0A 1TKZA 5I3QA 3KWMA 3ITHB 4KGMA 4FS1A 3QLHA 2IPOB 4G3IA 3PR5B 4QR0A 5HLFA 4AL5A 3DRXA 4DJBA 1MU2B 1NJZA 2MQQA 1D9FA 5G4DA 2N4DA 1TV6B 2HSEB 3Q2SC 1RADB 4U96A 4LSNB 4ECYA 1DRZA 5D4NA 1HA1A 5C7PA 3A8JA 4B3MJ 1TR0A 1JK9B 5M2UA 2BRLA 3OR1A 4M5JA 1Q16B 2D41A 5GVQA 1VQ8S 3QGPA 1FKAF 5L9NA 2W2OP 3EICA 4FPIA 1VQPS 3R7BB 1V9OA 1JQGA 2VG7B 4WU2A 3M32A 1R6YA 2W9CB 5A6WA 4Q8EA 5B09A 3ZZRA 5KG5A 1S97A 3C16B 3GP9A 2Z0GA 4ELTA 1M1HA 2IC3B 2MYFA 3EGVA 3N9UC 3SCLE 1HFEL 4RU2A 3BEGB 1TL1B 3TAMA 1ZZFA 3QRQA 1XK8A 4ELUA 4RW4B 3SMZA 1AROP 3RR8A 2MZQA 1GFWB 4USWA 4ZVTB 4BCAA 2QSFA 2YNGB 4J7CA 5LSLA 3ENWA 2NPIA 4H54A 3LF0A 1L3UA 2FLNA 1TP7A 2HFVA 1M90T 5KG2A 4QU6A 2XZWA 4Y2IA 3VZHA 1SJ3P 2VQFJ 1G6BA 2CPYA 3B4MA 1WUUA 1FX4A 3R7NB 4RW8A 4N47A 5LOQA 5AXLA 1C4AA 1TL3A 2QLWA 1O0PA 5A8KB 2UUAF 3JTNA 3VGVA 2G0CA 4ES1A 1JLCA 1ZM3A 1NZ8A 2LECA 2YQ1A 5KT7A 2Z57B 3BH6B 4H4OB 1HHQA 1B0VA 4H4MA 1U0SA 3GV8B 2MKSA 4OI2A 2G2YA 3EZ5A 4CTAA 1K47A 3NL0A 3L9ZA 4RKUC 2ASLA 4LF7J 1OPZA 5A2QU 1YJTA 4A48A 4I2PA 2PGCA 3CTRA 3IG1A 3RU0A 2BQRA 4X2BA 4ZVQB 1UL3A 3DLLQ 2ZBPA 4WE1A 3VQTA 3TZXA 1R8AA 3GYGA 3CD6S 1N5VA 2O1PA 2HK2A 3KK3A 2CQDA 2AYEA 2Y1JA 1RAOA 4LRCA 1GAOA 3FBCA 5CHCB 4KPCA 3JQJA 5E0OA 2H54B 3LAMA 4PABA 3MR7A 3CDWA 5A2QY 2OKQA 3NNAA 1VFJA 2P6TA 3LOUA 4W92B 4MYTA 2VFSA 4OYXA 3SBMA 5HO4A 2CG4A 1NB7A 2MJUA 3BQ0A 4X66J 3PEJA 1C1CB 1KOOA 5HMZA 2KKHA 3A12A 1IR1A 3HK2A 2IVYA 1F5AA 2FZCB 1RCOB 2UU9J 2CZVC 4WKYA 3PJ9A 1WNEA 2QMUB 1HNVB 2MPUA 2CDRB 2UZAA 2LP4A 3EVMA 2W8KA 4B3SF 4ILRA 3CUNA 4J9NA 1QDUB 2UUCF 3ET6B 2FJEB 4MJKA 3L95X 1JKHA 2G2OA 1NRKA 3NKYA 2GO9A 3W60A 3GJTB 1WKJA 2DGSA 3OLAA 4QIEA 1EETB 2QV6A 3EDRB 1VC6A 4CH0S 3A1YG 4Q43A 5KFRA 4OLPA 1HI0P 4N8NA 3WBZA 3OTCA 2XNRA 2H9ZA 3KLVA 5I4MA 3DXBA 2QA4G 4JI8F 5J2NB 4DFPA 2KZZA 2AF6A 1RAIB 1TUGB 4UW2A 1RGVA 4ZHRA 2AYBA 2NUHA 3PHTA 2Y8WA 5KFDA 1KQFB 2BW7A 2L9WA 1N52B 2YKMA 2QGFB 4ED4A 1X8DA 4LQ9A 4GKKF 1PAEX 3H4BA 4TVAB 2R7TA 1TK8A 1UZDA 1ZAXA 1VQ4S 5IQ6A 3BYRA 2R2SA 4DPTA 4AXIA 1TU0B 4W98A 4F0KA 3M6VA 5KFKA 4WYWA 1N34F 1IKXB 5IT9U 1W2IA 3Q8YA 1RKIA 2CQBA 2C2NA 3WIUA 4NCBA 1C0TA 1GT8A 4KJIA 2NS1B 1IN0A 3QJJA 3W9HA 1TV6A 4XTTA 1RT7A 1D8ZA 2XZTB 1PG5B 2VPWB 2ALZA 3W2WA 2DNGA 1KONA 2E5HA 2MEWA 2DRDA 1UEKA 4UTGA 2KRRA 5GADI 4NA1A 2M8DB 5KFNA 5LL6d 2C2KB 4M8LA 5EWFA 5IT9Y 4IH5A 3U7JA 1HWKA 2ROEA 3DLEB 2EKNA 2OMOA 1XR7A 2HVHA 1NB2A 1HD1A 1KNZA 2BUNA 2YQ3A 5L38A 1VQMS 4PPZA 4BWJA 2D1CA 4FXDA 3C16A 2ZWPA 1CBKA 4C0BA 3CCJS 2HFOA 2IC3A 3N79A 2R7SA 3G87A 1TL1A 5L8RC 3AT1B 3OV7A 4OLOA 3CXCR 4ZCMA 3PYEA 4F4KA 1BY9A 3I6PA 3FQKA 3C6TA 4I6YA 2E7XA 4NEYA 1VQ6S 3RRHA 8RUCA 2YNGA 4ZLJA 3FQLA 2J9DE 1YJWS 2UXBJ 1R6VA 2BKNA 1FJ7A 2XTJP 2DY9A 2BOPA 1R0AB 4CM2A 2JHEA 1X4FA 2J0QD 2AJ0A 2IDLA 4O4GB 2WB4A 4C6AA 4M5HA 1BXNA 1Q86T 4P74A 2VKRA 4JB8B 2AZ1A 4NXNF 2HFUA 1UJ6A 3DN9A 5A8KA 4A8XA 3R5CA 1X4EA 3PM9A 2G13A 1J27A 2HFSA 2JOQA 4I67A 2RRNA 4MIAA 4IFYB 3BB5A 1LFWA 2B4OA 2W2QP 2YNFA 3R6GB 5E3AA 2LEPA 5AJ3F 2GJ2A 1NKCA 5J2PA 2F3JA 4OQJA 1RP5A 3PFEA 1RBAA 3M9OB 3AJ1A 3EXCX 3QT7A 2ZD1A 1RAGB 1F9FA 1LOUA 2GC8A 1DQAA 2J7WA 4P7TA 2CKWA 3KK1B 4Y6IA 3K5MA 4RW7B 4QYZJ 4ED8A 3G6ES 1H74A 2UVUA 2R9LA 4DU8A 3I4PA 4ZIVA 1H6KX 3DU6A 4YY3J 2HHTA 1UA0A 3TARA 2J6SA 4B9TA 2Y1RI 3MM7B 2CQGA 1BLUA 3SCJE 4K4TA 3MFIA 4ZCKA 2BE9B 4NLGA 3RB0A 1Y00A 4C4WA 1OPIA 3JSMB 3BSAA 3L4BC 3VAGA 3N5BA 1DAXA 2HHSA 3SIPB 4KV8A 4PZVA 5KT5A 2ILZA 2KXHA 4QWCA 2K06A 4U7CA 4LR7A 4DV2F 4G1PA 1WDDA 5T7LB 4C2MA 4EO8A 4TY9A 4CNYA 4LR8A 5LMUJ 1HNZF 3RR7A 3HPOA 2XY7A 1KP6A 1YJUA 4AT1B 4OJ3A 4KPYA 3T5LA 3ICLA 3ET6A 1QE1B 4UQTA 2Q6BA 3GZ7A 1S48A 1GX6A 1MROA 4P75A 3VVTA 1EETA 4O3QA 4ZOSA 1M5KC 3EPIA 4Q45A 4DV4F 1REVB 2BV3A 5KFHA 2V94A 5LT5A 3G6VA 1RT3A 2NXCA 4H4KC 2RJZA 3BGRB 3R7SB 1VI7A 3CDBA 3D68A 1NBEB 2RDDA 3ADAC 3CJQA 1TL7A 3HF5A 1EKRA 2CJAA 3THPA 2K8GA 1S0OA 1XERA 1B0TA 5HBMB 4LBPA 1ZS6A 3HLUA 1RT2A 4A8SA 1IKWB 1S6PB 1O8BA 1SBRA 2YQ0A 3CD7A 2BANB 2LEBA 4CI0B 3OSPA 1ELOA 2DNQA 2LFVA 3SXLA 1IR0A 3D1OA 1X0FA 3CCTA 4DOZA 4ICLB 2DR6A 1PIEA 4I0WA 4FNIA 1RK8A 3DOKB 2F8EX 3RZAA 1U0HA 5F0WA 1M1KT 3ULHA 2JLGA 4NLYA 4N77A 2WVBA 1MMNA 1SQEA 4C0OC 1VQ9S 3P4UB 4QWDA 1UZHA 2P5VA 1DY3A 4PWDB 3I5CA 2GS8A 1HQEB 2CQIA 4U7UD 3MXHP 5IWAF 1KQSR 2KG0A 1KS2A 2IMWP 1YLXA 1T3OA 4ECVA 3FFIA 4NYOA 3ZTRA 3NG8A 3SQGA 3AH6A 3D2WA 1MWQA 2VQEF 1R0BG 3H40A 2B43A 2IBKA 2CPIA 4BDPA 2M3DA 4LRAA 2HFNA 2BE2B 3UVJB 4CO5A 2BW2A 2VA3A 3BKFA 1GXTA 4R8UA 5B0CA 5L9XA 4DX5A 3NWGA 3POTB 1LV5A 2FJXA 1R43A 2FVRA 2XI3A 3LH2S 1SC1B 2LXIA 3MEDA 3HD2A 1X5PA 3PW2A 3MEKA 2J0XA 3W62A 3DRSA 4H4KA 3LP1A 2QYCA 2GQQA 4ED3A 1E6YB 2EBEA 5IM0B 1FEEA 1ICEB 3DLBA 4B9VA 5D3GB 1NXIA 3G8TA 1KKHA 3UD5A 4YHHF 2ZOGA 3NGSA 2D7SA 3VAKA 2HGMA 2HVIA 2RQ4A 4O0NA 4MKBA 2HRTA 5HVGA 4YUDA 3FVYA 4IFYA 4ED6A 4FBUA 2QG9B 2DRBA 5DO2A 4RX6A 1N56A 3T5HA 1R3NA 4NZ6A 4HH1A 1SPBP 3SSQA 3DRPB 1LXNA 2RMLA 4FP9A 2V2ZA 5ETTA 1R8PA 4U8VA 3KK1A 1P1LA 4RW7A 3DM2B 4CLTA 3AXKA 2OPPA 1V6HA 3PYGA 5KG7A 4IOCQ 4P2MA 3RG6A 3D6FB 4J9KA 1XJWB 5CD4A 1YK9A 5FLXY 3GYXB 4D3HA 3MPDA 4ZPVR 4JYAF 3MPYA 2XSJB 4BC7A 5LMNJ 2ATCB 1RWXB 4PQUB 1S59A 4IRDA 3KJFB 4NOHA 1TFWA 1DHMA 1XMBA 2DGQA 2XMVA 5CABA 4C3KA 2X1GA 1WC0A 3PO4A 1H73A 2HHPA 3OD2A 2J76E 1X31C 4RUHA 3J7A1 3N28A 3R6LB 3PVXA 1X9WA 1A9NB 3RB6A 3T1AA 4UZCA 3BSNA 3MUVP 3VHQA 5ETMA 2HW3A 3NY0A 3DLKB 3TQEA 2DD8S 3HHKA 2O67A 3OQ2A 1SJRA 3ISZA 1F0XA 1TAUA 1QE1A 2C3OA 3DGVA 2VZ9A 4YB7A 2XLIA 3MUTP 1Y3KA 3MURP 1DTTA 2KL8A 4CLFA 4KHMA 3DGPA 3N0VA 2HQGA 2I9SA 4ELVA 4QIVA 4C3MA 4F25A 4FBTA 4F50A 1HI1A 3OFFA 4NCAA 3MAAB 2Z2YB 3KMQA 1UVKA 4AE5A 1GMVA 4JI2J 1HBOA 3K17A 3CCLS 2GMHA 2IRXA 2OPSB 1HNWF 2KYXA 4WCEQ 1HKAA 1UVNA 4ECWA 1WORA 2CWKA 4C8OA 2CZ9A 2KT2A 4RZRA 4OZ0A 3CB4A 3OTDA 1IKWA 2F8MA 4DR4F 2ZJQQ 2YX7A 2B8PA 2PMZD 2IM2A 2BANA 1VIOA 3D6HB 4EZ9A 3J7Z5 3KDOA 2R7RA 3G82A 4QU7A 2OLWA 4ZVFA 2ROGA 4L76A 2PFFB 2E5IA 1ZM9A 5IC4B 3CEDA 2VIHA 4KB7A 3V81A 4EBCA 2W4CA 1H38A 2MY7A 2CPZA 2D74B 3DOKA 2ZZMA 2OTJS 4JI6J 3GPAA 1IKYB 5J2QA 3FCHA 4IRCA 1VYAA 3PNIA 2ZEJA 2WHOA 3MR3A 2HK3A 1XBWA 1NM2A 1M5OC 4QIWD 3IXQA 2NXEA 2HPUA 2CPDA 4DV3F 1SV5B 3OTOJ 2AV5A 2N3LA 4DUZF 4RNMA 1JLQA 4A4JA 3NCQA 3KLHA 3NNCA 3PYDA 4CO1A 1U2CA 5CYJA 5HMYA 3JSBA 1TMJA 2BOAA 2YWWA 1BUXA 2HBZB 1WC3A 2HWHA 1GTEA 1G7CB 3W5XA 1Q82T 2BE2A 2J9DA 1WSVA 2WZ1A 4ZCIA 3OSNA 3GIIA 5IT0A 2HHHF 3TA2A 4YP3A 3LW5C 4HACB 4EBEA 2WOMB 3G2XA 1K73T 3QIPB 2QO3A 2BEFA 3TX0A 2WVEA 3QPIA 5K8PA 3B54A 2CQ2A 1WOSA 1RA7A 4OX8A 4RBVA 1IUJA 4DL7A 3CJ0A 1JLFB 2WB1D 2V8GA 3THVA 4L72B 3TA0A 1LWEB 2Q1LA 1S4FA 1U1OA 3I0RA 3GG0A 4XO0A 3CCWA 2ZDOA 5AE3A 2AGOA 1R0CB 5IZHA 2ZBRA 3NAHA 3MGJA 4I56A 3EGZA 3LALA 2HQFA 3I96A 1B0PA 1SJ1A 5KFMA 4FVCA 1H2VZ 4USVA 1J5EF 2CA9A 1T02A 3D1HA 2RRBA 2JFDA 3DRPA 4JOUA 2QFJA 4C3LA 1FWLA 5DLFA 3EVWA 1D0EA 3HFVA 4Y2KA 5D4OA 4CO2A 3MR5A 1OYDA 3DM2A 1L3SA 4Q2MA 3R8YA 5A8RB 3IRXA 3VCDA 2I2YA 4DQPA 2VD3A 1SH0A 5BR8F 2BJ3A 1S4EA 2F40A 4U6PA 2W24A 2NPFA 2G2ZA 2RH3A 3C6UA 4IR1A 3J81Y 4ER8A 1YSJA 1QAYA 1MLAA 3K2YA 3LP0B 3GE9A 1FRHA 4FYXB 2IIHA 5EX3A 4RW9B 1T3NA 1RAFB 4PAAA 5EWEA 1HPZA 3UDVA 1RSCA 4DXLA 3AD7C 1R8CA 4HDGA 3PEHA 1UWBB 4I7FB 2EFNA 2RS8A 1RWMB 1NK9A 3D6MB 4PCQA 2AGPA 1RWKB 2XYPB 3M1VA 2FHKA 1QSYA 3HKZD 2EG2A 4JI0J 2LDIA 3QBCA 4XK8C 1X4AA 3CJ2A 1T05B 3IR7B 2ZM6F 1V3RA 5EGYA 1ZETA 1DTQB 3W2VB 1JIHA 1UFLA 1IKVB 4IYQA 3J7AN 1X60A 2GW8A 2ZITA 1F9HA 4DZ6A 1NHUA 2E66A 4GKJJ 3M2RA 3K57A 1KDNA 3JSYA 2HS0A 2Z8QA 5KG4A 4F67A 2VPXB 5AXMA 1T9UA 3MAAA 1K8AT 3AHPA 3IBWA 4DSLA 2HGLA 1FJCA 5KFSA 1PYOB 2MXYA 2HURA 1TVRB 2KN4A 1WG1A 2DH8A 4ZPAA 4DG1B 3DFEA 1TKXA 2CJBA 3D3BJ 3HVWA 4LF5J 1UJ5A 3HO1A 3LAKA 2MQOA 4TYBA 1HL6A 1M0SA 1ZM2A 4L75A 3GV7B 5JMNA 1CQMA 4ED0A 1QAIA 1S12A 1UA1A 3BN7A 4DZDA 4M5GA 1XR6A 3PO5A 4ID8A 1CLFA 3FDSA 2POKA 5GAGU 3IWNC 3LWLA 4LF9J 1LW2B 3TUJC 4DUYJ 1JLGB 3HVRA 4F7VA 3TJ8A 4RNFA 1EIYB 2RE1A 2KM8B 3I9V9 3CCUS 1TZ0A 4DR5F 3HI9A 3LGNA 2HYIB 1NKBA 2DNRA 5GAHU 1UAWA 2IYIA 1CJKB 3M2UB 2BM1A 4DV7J 5D78A 4G65A 1SV5A 4TN2A 4OIXA 4WTYA 3ZNUA 2JEFA 2VOPA 3P49B 2RS2A 2W7PA 3NMRA 2WRMA 5KFWA 3ZZ0A 2CWXA 1WC1A 3DRYA 1VQNS 2GQ2A 4N5SA 4DR2J 3OJSA 4QQBA 1Q95G 3DRRA 1QTNB 2ZDPA 4AD6A 2KFYA 1TKTB 5F0UA 2NZ4A 3R5DA 4RNOA 2RSQA 2XHCA 4A8YA 3TX8A 3TJAA 3FCVA 4HACA 1S10A 2E1PA 2M5YA 5HROB 4OI4A 3QIPA 3K7RA 3I4HX 2H5IB 3EZOA 4NRUA 1FKOB 1YRUA 1RHUB 4NLDA 4QOTA 4YMEA 1H7XA 6FD1A 3J7ZT 5L1KA 1JLFA 4OX9J 1N6QA 5GMKa 3UFCX 1HIYA 3OTEA 1U09A 4USMA 4KTQA 1YQHA 1E6VA 4K4ZA 5K14A 3TUIC 3I56S 1RDRA 2C2EA 4K5SA 1ZA1B 4DDFA 1LWEA 3VTIA 3ZZZA 3VAIA 2DITA 3R9LA 3J7YU 2DXDA 3M8QA 2L48A 1CQNA 1G4CA 1Z4UA 2C3MA 5I3UB 2MY8A 4DR1J 1T11A 1VHIA 2FGCA 2R7QA 2XCPA 4NLTA 4ES3A 5DQHA 2H5JB 2IAJA 2OEJA 4N7TA 2GA7A 2YWFA 3M6XA 3T5JA 1OQ6A 4NPOA 2L41A 2I5JB 3M2VB 4QR1A 3GSDA 2DNMA 3CCSS 2X7IA 3GCWP 3MPUB 1IBLF 3KG4A 1WI8A 1X4GA 1VRUA 3CCQS 2QSWA 3GYNA 4ID5B 2ACMA 1N5QA 1VQLS 4J37A 4Y2CA 1VIXA 5F3TA 1OY6A 5KFQA 4AL7A 2DGWA 2AEMA 4L3KA 3CJKA 4MMOA 2MZSA 3ONQA 3WC2A 1YJ9S 2FLOA 3CSKA 4OZNA 3CVKA 1IBMF 1KN6A 1SJQA 5KOWA 4FDFA 2F4VJ 1RLDA 4GC7A 4KFBB 2DISA 2CJQA 4U67Q 2RF2B 4PG8A 1DQ8A 3EXYA 4IFVA 1TL4A 3M8YA 1TUVA 2UUTA 2ZOMA 2OH2A 1XMQF 1S72S 1RKJA 3LP0A 1Q7LB 4RW9A 2OEMA 4R5PA 1WG4A 2VBYA 3FK4A 2F5GA 1PJ5A 2M88A 1YI2S 2GCFA 2YKAA 2OSQA 3G6XA 2KM8C 1HR0J 2B9EA 1UWBA 3CF5Q 3DLGA 4I6WA 4I2QA 2W9BB 2Z58B 4KY3A 3AD9C 1EARA 3B82A 4DUTA 2OIHA 5B0EA 2R7XA 2FHMA 2LXUA 1RT1B 1VBYA 1FDDA 3FZBA 4HKQA 1RTHB 3FZ2A 1VC5A 5C42B 3TYTA 4B3MF 2CNOB 4OI0A 4JI3J 1NPPA 3MMAB 1D9AA 3S1TA 4NMXA 3IWXA 5K8MA 2CVIA 3MM9B 3MR6A 2FIUA 1WF1A 4B9UA 4BS2A 1DLOA 5JUMA 4ANDA 5B0FA 4I1TA 1RHQB 4E0DA 1URRA 2GZOA 4HVZA 1X0PA 3GILA 4IG3B 4AUKA 1D3WA 2KVQE 4CNZA 2E5JA 3DMJB 2GJIA 4KRWA 3OXGA 3G86A 2GV1A 1XMOJ 5CYMB 5A76A 4XPEA 1QAJA 1UJ4A 2R8GA 2YY3A 3Q89A 4XPCA 2AJFE 2KHDA 3KLEB 1TVRA 1QSSA 1YRTA 3BBFA 5E5NA 2V0NA 1S1TB 4RW6A 2DNHA 2V9KA 5C2CA 4WK3A 2EKYA 4EO6A 5I42A 2IDEA 4ILMA 1HYSB 2DH7A 5DGAA 3CJTA 1UP1A 2B3TB 2JH3A 2VQFF 1WC5A 1WC6A 1SQFA 3UE2A 4DF8A 4LSLB 1TUWA 4PG4A 4IRKA 1J5OB 2PEHA 3P8BB 2V68A 2ZH1A 5L1JA 3NWRA 3L7PA 2R7UA 2EXUA 4BBYA 2LQ9A 4B9LA 4DWIA 3TANA 2V5HG 1LWXA 2JEJA 4OYPA 5KT2A 2R3VA 1CJKA 3M2UA 4LF7F 3DOMA 1KFSA 3EDQB 3QGHA 2DPIA 4HL9A 5HP1A 3SEOA 4DPXA 4EBDA 1ZOTA 1RBLA 4KBIA 3AQOA 3JS9A 1VRTB 1RTIB 5DG9A 4KHPJ 4DPOA 1XTZA 1PO6A 4C8LA 4IUFA 4C11B 4IOAQ 3MD1A 3OFEA 3TNVA 2EPIA 1JLAA 4ENOA 4NASA 2Y0BB 1NLKL 3NBPA 2YKPA 3EE3A 5H1SV 2RQMA 2V4JB 3KLFB 1H2UX 1DFDA 5LXYA 1RA6A 1FNXH 3QIDA 1YWXA 3OLBA 2A6MA 4NMLA 1S1VB 3NGTA 4ZA1A 4EU0A 4TKTA 5F8IA 4WFAQ 4XDCA 2EK6A 5HROA 3DHWC 2MGZB 2QX0A 3H2LA 4OL8A 2BA9A 3H4DA 1FKOA 1FKPB 3PX4A 2KVIA 1B7FA 4G1QB 2NSBA 3BM7A 4NZ0A 3FSYA 4X66F 1UETA 4PWUA 1J2VA 3RB4A 3NEKA 2H4YB 5E3CA 3W5ZA 5BYRA 2C22A 5K9FA 4ZP6A 2UU9F 1UEVA 2RIJA 3P45B 2DEJA 2NQPA 1D09B 1Z2LA 1VMBA 3KJVB 3TZYA 3X3UA 5I3UA 3CC2S 4LF8J 4JI5J 4UOFA 1GMUA 3MWBA 3D1QA 3ZZOA 2FB0A 3BBBA 4AFFA 4ZDNA 4OYZA 4DHVA 2XMWA 4X4SA 3KG0A 3M2VA 3MM5B 1FD8A 2V8DA 4DR7J 4WTOB 2MLYA 4AQYJ 2ZE2A 5BJRA 2XULA 5KFIA 1NJYA 2MKIA 3H20A 4FXWA 3S8SA 4F3OA 4DF4A 3RAXA 4MK8A 5DJBA 3QWUA 1HBUB 1NMEB 3FBFA 2RAQA 2XB2D 2WVCA 3H25A 2VG5B 4ED7A 2KU7A 2RF2A 4DQIA 1JXEA 4PG7A 1FWPA 3VWSA 5B08A 3C2PA 2IJRA 2V8VA 6AT1B 1SKUB 1T03B 3A3NB 3BYPA 4EK2A 2YPZA 5H9EK 1U1LA 5H9FJ 3P96A 2YNIB 2QLXA 1S6QB 3S6EA 3WDOA 2HQCA 4J9VA 2HQIA 1TKZB 3E3XA 4ZP9A 4ZVEA 2CNNB 4Q5VA 2FD2A 2PI5A 2VA2A 3M8PA 3H5YA 1FRLA 2OO4A 3OJUA 4YR0A 3CCES 3OXLA 1S79A 1SUQA 3RW7A 3FNNA 1XN9A 3R5BA 3Q22A 3GR0A 3O5TB 4IG0A 2LA4A 1RTHA 3QFWA 3HKWA 5ETKA 5C42A 3RRKA 3FEYB 4JV0A 5E2QA 1W25A 1JNRB 1RT6A 4TU7A 4KGZB 3MM9A 5JJBA 3T41A 3OR1B 1R8HA 3C19A 4CLSA 3LPYA 4LIRA 2JC1A 3GLJA 2E5LJ 2VKZG 3HHLA 1S9EA 2B7CB 2IVMA 1XQIA 5MLCV 3TVZA 3M32B 4C48A 2A3JA 1YX2A 1HBNB 1NH7A 3QT5A 5CYMA 1AFIA 4EI2A 1FJEB 1FE4A 2H51B 3AA8A 2CPXA 2CJKA 5LJ3Y 3KK2A 3TAMB 2B51A 3KJQB 1BE4A 2VC1A 3QT8A 4LBHA 3QJPA 4K0KJ 4U9RA 2UXBF 2IMOA 1WOPA 1D1UA 2J5AA 3DDKA 1Y10A 2YKOA 4LF2A 3Q24A 4LFAJ 1MMDA 2C3YA 4PWWA 3FSIA 4IR9A 2LU2A 4LSLA 1CPZA 1TL3B 3TR5A 4F8RA 2P9GA 5FIIA 4DL5A 2W01A 5DZ7A 2F8HA 1J5OA 2UXCJ 1YITS 2VONA 2Z2ZA 1VQOS 1LWCB 3VZIA 1T94A 4OHZA 4OYIA 1FO1A 1P8GA 3MD3A 3V2UC 4HHHA 2MZJA 2V2KA 1Q8KA 3VVUA 3PXGa 5K8NA 3CJSA 1FDAA 3K8WA 1RZMA 5DDOC 3B6BA 4GO5X 2N7YA 4CTAB 4WFBQ 5AXKA 5M2RA 3MAQA 2C3PA 4AL6A 5D0EA 4L73A 4QW8A 2LXFA 3WZ0A 2B9YA 4I2PB 4CLUA 2WONA 3IG1B 5E3QA 1X4BA 2JX2A 3QO9A 4IDKB 4WE1B 2GQCA 2M52A 5KAKA 3DI6A 4FVMA 5EWGA 2F63A 4YY3F 1F5CA 2EC2A 3KK3B 1VGYA 2Q6CA 4FPRA 3EYZA 3P6YC 2KB2A 4F3MA 2HRYA 2B56A 5T14A 4ECRA 1TMMA 4LR9A 2MKYA 1X9MA 3FMBA 4X62J 1ZM4A 3KHGA 1S1VA 3IM8A 2W4DA 5HVHA 2MGZA 1HI8A 1WDTA 1K0VA 3N01A 4PG6A 5KTQA 1N5SA 1HARA 1EP4A 2K3KA 4CLPA 4DV2J 3AXMA 4USIA 5J2MA 4EYIB 2ACYA 1KLMA 1VJWA 4KIAA 5LMUF 4E2FB 2G0IA 2VDHA 2CAJA 1VQSA 3UNYA 2ALYB 1F3FA 3IMQJ 3UDEA 3ENQA 2VODA 1YJ7A 3TQ1A 3BKTA 2UVWA 1IM4A 2WSFC 3OVSA 3BQ2A 1AA1B 2G1DA 1Y3JA 3V6DA 4A8QA 1GNKA 2BABA 3VGSA 4F4ZA 3MM5A 3UN2A 2OD6A 2QTWA 3IRWP 4ZVOB 2DCLA 2GJFA 2EFOA 4DQRA 4USJC 3Q8PB 3HP6A 2RHQB 2KDOA 4V1Ak 3MTKA 1V3ZA 3W5YA 3S7RA 3PIOQ 3ZZPA 4D3GA 4IO1A 2WW4A 4FF4A 2ZC4A 3PY8A 4PR6A 4DV1J 3N5FA 3BO2A 1PGZA 2DHXA 2DHSA 2ZHBA 4ZHRB 4KE5A 4F36A 1HMVB 1K44A 2YKMB 3H2UB 2AJ2A 4A8FA 4O3NA 4GMKA 4C8NA 5A0YB 2XGQA 4M5IA 2CPFA 5HK4A 1T9VA 3RRGA 1SC3B 3NMAA 2I6WA 1L3KA 4CDIA 3JB9k 1U8WA 2QA4S 2YNIA 3AA9A 2EWHA 4C0HA 1QVGR 2DR8A 2AIRB 2L08A 1C0TB 3UDLA 3HMJG 2DB1A 4URQU 3UR3C 3NS7B 4ETZA 2CNKB 3ETOA 4X65J 2QFIA 4M5NA 3D67A 1RT7B 2HNZB 3D0GE 2EC0A 2QEXS 5ETPA 2ZC3A 3A8KA 3W2WB 4O44A 4NLXA 4YB5A 4B02A 4DPYA 1RLCL 5DM6Q 4PG5A 4F4AA 2KT3A 2KRBA 3MCOA 3WX8A 1S0MA 4DL4A 3P5BP 1Q7YT 2IFXA 3K5OA 2V69A 2VB6A 2IJNA 1JLBA 4MIBA 1HBNA 3MZIA 2L9DA 1YVFA 2FTRA 2XS5A 3GONA 3JSRA 4Q0BA 1GMWD 3WX4A 5CA5A 2I8EA 2E44A 2V4RA 1WKKA 5HSPA 3GIJA 4MFBB 1RYRA 2XM3A 4JUZA 2X3DA 3QNWB 3C6TB 5IC6B 5JVGQ 1WHYA 1FJGJ 3Q86A 3PTWA 1KVIA 4AXJA 1WEZA 2DNYA 5KFPA 5ITHA 1ZZNA 3T1HF 4OYAA 2RT3A 2XBPA 3KHHA 2VC0A 3W66A 4IQXA 4CLZA 3OL7A 2Y0SD 2ZJRQ 4TLRA 3EJMA 1ZPWX 5LJ5Y 3A3PB 3H7HB 4Y3CA 4B9MA 1FDBA 3E51A 2JEIA 2P9EA 1SI9A 1LWCA 2OELA 3AJ2A 4RL1A 1NO8A 2HG4A 2EI5A 1X5OA 2YNFB 3CJ5A 1X5SA 1P1TA 1RISA 5J2PB 1B70B 2ZBIA 1IQZA 2JZ5A 4N56A 4OZLA 4MTPA 3OHAA 2ZD1B 5U47A 1FWKA 3IS9A 3A3OB 4Z37A 5GAGI 3HVTB 3LQVA 4QWEA 2CVEA 2J6TA 2J9CA 3I87A 3V6HA 2AX1A 1ZAVA 2RKIB 4OYBA 5IQQA 1DQ9A 1U1QA 4IDKA 4TY8A 4X4VA 3RW6A 1G1XA 5LMNF 5GAHI 3UR0A 3HHEA 3K8VA 2ZH6A 1L3TA 2U2FA 5F9NA 3EUNA 1U6BA 2ZHAA 2VV5A 3ILIA 3D4JA 1UFKA 3LUYA 3T1YF 2RVJA 2FJWA 3GMGA 1VCTA 1AB8A 1G2EA 3U1MA 1M1GA 3ILLA 2LQJA 2YNHB 4KV8B 1VJQA 4LREA 4CO3A 2DY1A 1RI7A 2A2DA 4DLEA 2VJUA 4ZPDA 2MQ8A 2GMLA 3Q8RB 3GB0A 2CZ4A 3M8ZA 1TK5A 3OR2A 2YX4A 2W4PA 4ZN3A 3VF0B 2UXDJ 3A4TA 3E2EA 4HEA9 4QZVB 4LUBA 1N5YA 4JI4J 2YPYA 1MROB 4RWXA 1AW0A 4OV6A 4J9PA 3M6UA 2AP6A 2MHEA 1P9YA 2WBMA 2MDAA 3BPDA 2OI2A 3SCIE 2MKCA 3J7YI 1LNQA 3MEEA 1RT3B 4ZP8A 1N33J 4JI2F 3IFEA 2BE7D 1T0TV 4DSJA 3I5AA 1PBAA 3BKUA 3FEZA 1IR2A 3N6NA 3FCWA 4DN9A 2ZH4A 1TL7B 4R25A 4ECUA 1C0UA 1QJHA 3JYTA 1HMVA 4OX6A 2QJ3A 1T9WA 3MECB 4EYHB 1T9XA 2J6UA 2V6AA 3GV5B 3R2DJ 2M0GB 5KG1A 5A0YA 1RT2B 2DIUA 2G4BA 3BDPA 2V34A 2J8SA 4MYUA 2KTQA 2FVPA 4M95A 3LPEA 4B3OB 1Y4ZB 5KT6A 4X64J 4ZPTR 4IQMA 2IYGA 3X1LB 2UUWA 5D4LA 5J1EB 2ZH5A 4QYZK 1L5UA 2QLBB 3PFOA 4QWAA 4LFCJ 1VBZA 1QVFR 2UV8G 1UKUA 4K2XA 5GAEU 3CNQP 4YN3B 4ECZA 4JI6F 1S9FA 2HNZA 2Q43A 2XMJA 1U0HB 1GXLA 4DQSA 2VU5A 2RUSA 1EAYC 1N36J 1Q5VA 4YFUA 4JBCA 1WEYA 4X4RA 3OTOF 3IC1A 2HIQA 3G4SS 1RB0A 1XR5A 1GQEA 2FJAB 3L7UA 2W9AA 5AE1A 1I94J 3PKYA 1CC8A 3FFIB 4RBUA 3ENAA 3SQGB 3U02A 1F9EB 2MMYA 4LBIA 3PV8A 4OZ1A 3OL9A 1IBKJ 1I1GA 1SIWB 1NNDA 1GK8A 4TNOA 1XNRJ 4CT8A 4R8UB 1WHXA 1FRMA 1IQTA 2OJ3A 1YG0A 3N4WA 5F8JA 4C8KA 3VQSA 1A0OB 3ILJA 4MFBA 3BZQA 4RUCA 3B4DA 3MEDB 2HZAA 2XG8A 3ZZYA 2YH0A 3HJFA 4P52A 3IBFB 2FGOA 1WF2A 2IHR1 3HZEA 3DRSB 3HULA 1LW0A 4N41A 2M8HA 4LIWA 1OY8A 3LP1B 2FHJD 1VOMA 2DGTA 2B8QA 3BSCA 1V5IB 2VICA 4F4WA 4OHVA 1WF0A 2DO0A 2DR9A 4B3TJ 4X4UA 2GVDA 4Q44A 2DNZA 5K8OA 4F26A 3UCGA 2U1AA 2CPEA 3D6TB 3Q8UA 2BKPA 1I6JA 4DQQA 2VPYB 2FZKB 4DS4A 3TEHB 4DV5J 3G9CA 2JRSA 4LVNP 1KOHA 1M5HA 3W1YC 4CYUB 2IM0A 1EX8A 1I5OB 3OW2R 2PEBA 3I32A 2LQBA 3OTBA 3KLIA 5EUHA 2GGPA 3DNCA 2K1RB 1GXUA 1CULB 2HNDA 4NI2A 2BMBA 3HVTA 1YJRA 3FRZA 5KFFA 5HL7Q 3P3DA 2JNJA 3VGUA 1CG2A 2D9PA 5GMDA 3M9NB 4M5KA 2YKNA 2OPPB 2RKIA 3WC0A 1RCXB 4WIIA 1AT1B 5ADZA 3RTVA 1N5TA 4WF9Q 4UUXA 2OPQA 4JP8A 3Q0AA 4M5DA 2RDJA 1U47A 2VH7A 3NGRA 2ZNYA 1Z1ZA 3OT9A 1D9DA 2HBYB 2CQ1A 2P6SA 1OQ3A 1PYSB 2D3OR 3SV3A 2B7BB 1KC8T 3J81j 2A0FB 3QFHA 2YNHA 4P72A 5LSOA 3G8SA 4ZPCA 4J9MA 1IVZA 3D66A 3BO3A 5CQGA 1VHFA 4JI0F 2HVZA 2RU3A 1NDPA 2CQPA 2Y1IA 5C25A 3DXSX 2FVCA 3GSIA 1SC6A 1RACB 4CT9A 4P2FA 2HZVA 1UPMB 1F6TA 1GTHA 3NRBA 4O0IA 5D77A 3QGIA 1SC4B 4KQZA 2YX1A 3WHIA 1IWAA 5THWA 4GKJF 1HD0A 4ZLNA 1Q8BA 1DTTB 3M7VA 2R4FA 3DOLB 1N32J 3DGPB 1FD2A 4P6QA 1FDNA 1BWVA 3ETMA 3H8YA 2OTLS 3A13A 4LF1A 3L7OA 1HBOB 1QLNA 4LF5F 3SV4A 3HXMA 2OP5A 1FVQA 1HHSA 3O1LA 1RTZA 5KFOA 3O6QA 1U02A 1VBKA 3MECA 3MOJB 3LA0A 4JV5J 1LKZA 5A8WA 1WTFA 4RPFA 1VQ7S 2PE8A 2DH9A 1U8SA 2HNYB 2NYHA 5D15A 4NLUA 4B3OA 2DK2A 5KFJA 2DNOA 2V2VA 2E9ZA 3G82B 2R42A 4ZVGA 4LF9F 2C2MB 1KSPA 2BJ7A 2F4FA 5J1EA 1QM9A 1HLWA 4F4XA 4DUYF 3CCVS 1UFWA 4TQSA 2RRAA 3V81B 4UZBA 2R2UA 2XEXA 1HW9A 3Q2TC 3GJQB 2VHGA 2VFTA 4DSKA 4RR5A 5J2QB 2B5JA 1NK7A 4JI1J 4Y2MA 4USTA 4DV7F 1S77D 1PSDA 3QAUA 1EQMA 2DKOB 2Z4PA 2QL5B 4LF6J 1HWUA 1UPPA 3RAQA 5HQMA 2I38A 1JLQB 3KLHB 2Y9HA 1NSAA 4DR2F 1LWFA 2ZVSA 3DYAB 1FFSB 3QAEA 1B99A 2VOOA 2DNLA 4I64A 2R2TA 1S7IA 2FJVA 4P7VA 5KG3A 4OI6A 2V2QA 1MWZA 1FK9A 1SB6A 1HNXJ 3BJYA 3UI3A 2W8LA 4URSA 2CQHA 4DI6A 3CD0A 2AJ1A 1YGYA 4C8MA 1Q8IA 2HHUA 2RU9A 3CPWR 4LFBJ 2GIFA 4ERDA 3LGMA 3L09A 2KO1A 3MCMA 1QY7A 1WHVA 4OX9F 4ZMMA 1CJUA 3VGTA 3KTQA 1BQNB 5SZTA 4X4QA 4O23A 4QCLA 2FZGB 3I0RB 4FKXA 1PKUA 1HWLA 3CDEA 1Y5IB 2NUUG 4DR1F 2ATLA 2BRKA 2DCUB 4LF4J 4HT5A 3D7SB 4F4YA 5FLXU 2BX6A 3NGDA 2IM1A 4CYUA 4NEZA 3OFGA 2LA6A 5T41A 1RHJB 3GFHA 2K1RA 1MN7A 1CULA 3ZTQA 4CM0A 2AJ4A 2PA8D 1KVJA 3G6YA 1QTMA 5B0GA 1F2GA 1U24A 4GVBA 3HT3A 2DTJA 3LO3A 1WI6A 3IRXB 1NDLA 4CP5A 2NXNA 2F4VF 1VBXA 2HLTA 3M9MB 2H1YA 3QSIA 2M7SA 4HLBA 4TLQA 1RTDA 3C6UB 5LM7E 4CO0A 5AT1B 2ZH9A 2ZVIA 2RNEA 4CH1A 2RD5C 4ECTA 2K7JA 3BPSP 2AYMA 3KMSA 4DS5A 4ETXA 2MQMA 2DBBA 3HHNB 3HSJA 4DL2A 1B64A 3PW0A 1R31A 1HPZB 1SJ4P 1H3DA 2NYIA 2XLKA 1VQ5S 4ZKAA 2ZBQA 3RBEA 1HR0F 4QBUA 2R2RA 3H90A 4YOEA 4J9LA 2DGXA 4DX7A 2B9WA 3KFWX 1AUDA 3M1VB 3ZTPA 4UOCA 2X1FA 3MCNA 3AQPA 2NCKL 2PMWA 1RWWB 4JI3F 1S6OA 1S6UA 5I3PA 4NLOA 1T8EA 3TEGA 5KG6A 3TOQA 4B3RJ 2EVZA 3NS5A 1RUSA 3SZ2A 3VAJA 1HWIA 1N54B 1SH3A 2HAFA 3PCOB 4QPTA 3M2RB 3OUYB 4PXBA 4WIQA 4DFJA 2CPHA 3DOLA 3MTJA 2QA1A 4RBTA 1XMOF 4PEOA 4QYRA 4QJVA 3TZWA 5F8MA 5KT3A 4LSZB 4KAIA 2XO7A 2HMIA 2M70A 4F3QA 1SL0A 5FD1A 2HAIA 4OZ2A 1TKXB 2Q3PA 4DV6J 1RTJA 2W7AA 1RHMB 4ECSA 2FLLA 1S1XB 4FF3A 4Y34A 2EFPA 4LRFA 5J1PA 4GRSA 3W9JA 2AD9A 2I1RA 1CVJA 4RUBA 1MNEA 3UWTA 1TK0A 2YTCA 1U2FA 2XS2A 1AXQA 1KTQA 3A8IA 4NYZA 4OYOA 2HNYA 1CJVA 3M8SA 4PPDA 4MIWA 1X7VA 3TZZA 3QYYA 4NXMJ 3AFGA 5F8HA 2OFGX 5DQIA 1U25A 1NU4A 2VG6A 3K89A 4K50A 1QUPA 2RQKA 1RWNB 5DG7A 5DS7A 3TI0A 4U95A 2IM3A 3RUBL 1NDCA 5KFXA 1APSA 3OL6A 2SXLA 1U6FA 2Y3YA 1RBOB 2AYGA 5K5MA 1UVIA 3CMES 3NCRA 4NA3A 7AT1B 4IH6A 1CS4A 2MLXA 1S1WA 2DGUA 3TW0A 1U1MA 3M30A 1PJ7A 1FXRA 2VBWA 2NXJA 3C15A 1NK4A 2ADBA 2CQ0A 4ANEA 4KHPF 1FXLA 4JI7F 3DYAA 2IRYA 3SYZA 3FUYA 3HHDA 1KHWA 3DRRB 5J1NA 3SI8A 2QMWA 4CWBA 4BHQA 1BMQB 2F9JA 4YB1P 2LKZA 3V5RA 3MF5A 1NPRA 1GX5A 5D0GA 3RAMA 5L1LA 2A18A 2XMMA 4WP8A 1LXJA 2B9XA 7FDRA 4DL3A 1X4DA 1BHNA 2ADCA 3ENVA 4DSIA 3GG1A 3EZUA 1N48A 1Q1KA 3MEGA 4JV2A 1S9GB 5G0RB 3GFZA 3S01A 1NHVA 1AFJA 1N6QB 1IBCB 3KLGB 1E6VB 2XYHB 1BQNA 5K14B 3PW7A 4IH7A 2Z56B 5IT4A 3T19A 3MMJA 3CMAS 3E01B 5L46A 2YWKA 4A8OA 2OAUA 3M8QB 2KHCA 4J9RA 3C8YA 4ZK7M 4C8YA 4LF8F 4JI5F 1S49A 1U1PA 4TU9A 1FTRA 2DR7A 3CMQA 4B9SA 2IAJB 4O3OA 3J81U 2JVRA 1GH8A 4UT4A 3VR1A 4DR7F 4AQYF 4OJHA 5SUHA 4KKOA 1VS3A 2R8JA 2AX0A 1KFDA 2KFNA 1VRUB 2Z30B 4XAKA 1JWWA 4HI1A 1TKDA 2MZ1A 2UUBJ 5CZXA 4WWSA 3CJKB 5KFAA 4KO0A 2RUGA 3TVYA 1NSPA 2CQ4A 1H72C 1HQ2A 3C14A 4W90B 2XSFA 3DDIA 4QPXA 4WJBA 1HQUB 4IFVB 2DXEA 5HI7A 4X84A 2HHQA 5F3ZA 3KOAA 1MSWD 1OY9A 4R5PB 2V9WA 1BQXA 4C97A 1S57A 4C98A 1V5VA 3ITHA 1B7YB 3HZGA 5BYQA 1TL5A 1RABB 5ETOA 1CSJA 1Q5YA 4OI3A 3DCAA 3DLGB 4I2QB 3C46A 3IO1A 1MU2A 4A8KA 4WK1A 3R2CJ 4ECQA 3HSDA 3OFHA 1REGX 4LSNA 4DFMA 1YJVA 3MI7X 3H5XA 3NP5A 2IVFB 1PC4A 1NAQA 4DR3F 1O51A 1FXDA 1XNQJ 3DLJA 4P10A 2KXFA 2CQ3A 3FKBA 3I55S 1P6TA 3CJ4A 1HWJA 2XY5A 1A6LA 3GQCA 2E5LF 1DLOB 4DN0A 4CIOA 4RNHA 2VG7A 5HQ8A 1W2BR 2V8HA 5HANA 3LGHA 4F0MA 3NCPA 3OUYA 2W9CA 1FFWB 3HSZA 4DLGA 1Y9OA 1N0UA 4J9SA 1RAHB 4ES2A 2BDPA 4MKAA 3T3FA 4UQGA 3RBZA 3F73A 4RW4A 4C8ZA 4RW6B 4DCOB 1DARA 1S1XA 1UCNA 4B17A 4K0KF 5I42B 1MMLA 3R5GA 1JJHA 2Z2MA 3K58A 1ITPA 2HHXA 3RB3A 3V6JA 4DR6J 4ZPWR 1JNZB 4MKYA 4LFAF 4N76A 2XMTA 3ZFVA 1U26A 5A6PA 2CADA 1UVLA 4MK9A 2BBEA 2P2CB 2PC6A 1T95A 3D5MA 4YDDB 1EHWA 2FVQA 4WFZA 2UXCF 2QN6B 3KUEA 2MJNA 2G0JA 1ROFA 4J90A 2X1AA 4H4OA 2VUGA 4YEAA 3IWLA 5EDWA 4FF2A 2DJWA 5CXTA 4FF1A 3AOBA 4BWMA 4DV0J 1NK0A 3ZZUA 4Y00A 3IAS9 3VAMA 2EFVA 3DOMB 3HX9A 1JLEB 2JVOA 1B4SA 2ZZTA 4FS2A 3PW5A 5HP1B 2PSZA 2Z2LA 4K59A 2CQCA 3HFZB 3UPFA 2XC9A 4P2XA 5EX0A 2FVSA 1NDKA 5KT4A 2AW0A 1DZ5A 5GAEI 2FPHX 4AYBD 4WPAA 4UY85 1YZ7A 4FYWB 4PYAA 5KFZA 3UCUP 4NLQA 1W7WA 5JVHQ 2BQUA 1JLAB 1MG7A 4RUAA 1SKRA 3R27A 2AT1B 1YRXA 1SCJB 2COLA 3NBPB 3US5A 4N8OA 1FTCA 1FRKA 3CJ3A 4X62F 4USHA 3PW4A 1QUVA 3KDNA 3TUPA 3CCMS 2YH1A 2GX8A 1WSRA 4WP3A 1TELA 2GIRA 2QIFA 1S9GA 3BH7B 5G0RA 1C1CA 3A8EA 1OWXA 1CEZA 3CIMA 4JV1A 4F2RA 2HIYA 1WJ9A 3KLGA 2Q66A 4PQAA 3KHRA 3TAPA 1HNVA 4HR2A 1ZA2B 3E01A 2KJWA 4Y65A 4MKVA 2E29A 5DETA 4ZVRB 4ZN1A 2BJDA 1FESA 1OO0B 4NA2A 2OSRA 1PBUA 4EGLA 4W4MA 1WC4A 3UW1A 3AOAA 2CNLB 3NOCA 1F1BB 4BLGA 2XMKA 2HQDA 2ZE2B 5DLGA 3BGLA 3TWZA 4OFZA 1RYSA 5J2NA 4PUOB 1S1UB 2HWIA 3M4XA 5E3PA 4ZIWA 3GFYA 4DV1F 9RUBA 2DVIA 8ATCB 1S76D 3SFGA 1BWEA 4KC5A 2W2MP 5HMXA 5HVFA 3GU0A 5CD4H 1HQUA 2MLZA 3M05A 5D0RA 1O6XA 3Q8SB 2XHWA 1OYEA 1H2TZ 1M5PC 4ZJOA 2AWZA 2NLWA 1NJIT 2KI2A 1IKXA 1AUSL 3QJLA 4U8YA 4V19X 1DURA 4FYYB 4CLKA 4DL6A 3R5AA 1D8YA 2IJFA 2XMAA 2PIIA 3HJVA 3JQKA 3I0SB 4PXDA 2L3MA 2E1AA 3W7BA 3M8PB 5F8LA 3Q8QB 2BYCA 2Q79A 1YJNS 4O3RA 3T6JA 4HDHA 1HNIB 1MN9A 1OSDA 4X65F 3THTA 1SUQB 2D9OA 2ZFHA 3OVBA 4KYZA 1X4CA 4GC6A 1MWYA 4IG0B 1C2PA 1KHVA 2RQCA 1RT6B 5AE2A 4CQ1A 1RHKB 1RWVB 1BD6A 2DHGA 3IN5A 2ROPA 5B7WA 3LANA 3BDEA 3M8WA 2XGPA 3DLEA 2BQ3A 2NR0A 2JC0A 3HHLB 1S9EB 3F0NA 2UV8A 3NGUA 1KRPA 1R7IA 2OHDA 1VDHA 1T9YA 1P9QC 2DR5A 5DGBA 1NJWA 3GR1A 1LFPA 4F04B 3GJRB 1K1SA 2EFGA 2FDNA 2ZJPQ 3KK2B 3EVOA 3TUZC 1RU2A 1RHRB 1NK5A 2VL1A 4G6VB 3AY0A 1RAJA 2FHOB 2MTLA 2KFZA 3H59A 2KYZA 4CLYA 4CCHA 1FJGF 2AEJA 3AD8C 3KYLA 1NSQA 2AMCB 4Z7YA 1R0AA 3T1HJ 4ZP7A 1WHWA 2I0XA 2DPJA 5HJYA 4NRTA 5IFMA 4O4GA 4PKDB 1YTYA 3MMCB 4QIGA 3UN5A 2E9TA 1U7LA 2D3ZA 3V6KA 2W1BA 2UUAJ 4ED5A 2PT0A 3CO9A 4Z2XA 4J91A 2OUGA 4RWWA 3MM8B 3V4MA 2RILA 1I3OB 2H65B 3O44A 4RU9A 2WTFA 3IA0A 2M2BA 4CLLA 2AU0A 3TAQA 1Q81T 1Q78A 1PC5A 3IR6B 3ZNJ1 5JXSA 4DL0C 2NZCA 3JTOA 3DLHA 2MB0B 3DKDA 1H0HB 2GFFA 1IWGA 3MPVA 2N3OA 3KUGA 3CDUA 4OYMA 2CJYB 4PXCA 1JLEA 3QWPA 2DIVA 3CD5A 2WONB 4XDDA 5H9FK 3RGIA 2ZWOA 2AKWB 3QO9B 3AAWB 3SCKE 5F41A 9ATCB 4OHYA 1IJEB 3DI6B 4FZVA 4J9UE 2YBVA 1U2RA 3VAHA 4CO4A 3HM9A 3MM7A 4CRJA 2BVZA 1H98A 2A2CA 2MKHA 2E9RX 2KG1A 2XI2A 4EEYA
chains in the Genus database with same CATH topology
1M0SA 1ZM2A 4R0JA 1URNA 5MAOA 2R8HA 3B4DA 3MEDB 3GV7B 4ZS6A 2XG8A 3ZZYA 2YH0A 3HJFA 1T03A 1CQMA 2FGOA 2HLUA 4ED0A 1WF2A 2IHR1 3D0HE 3OXFA 1Y5NB 3HZEA 1QAIA 3DRSB 2HGNA 2J9EA 3JSMA 1UA1A 2ZHOA 3BN7A 1LW0A 4M1KA 4N41A 1ZH5A 1S6QA 2M8HA 4URGA 3PR4A 2JSXA 1XR6A 5D6GA 3PJXA 4LIWA 4FNHA 3LP1B 3PO5A 2OFHX 2FHJD 1TKZA 1VOMA 3CULA 5I3QA 3KWMA 3ITHB 2DGTA 4KGMA 2JFKA 3BO4A 3K0JA 4ID8A 4FS1A 2FY1A 2MKJA 3QLHA 3OL8A 1CLFA 1K0TA 3BSCA 3FDSA 4O4RA 4G3IA 2POKA 2ZH7A 3NGKA 1F5BA 3PR5B 1EP4B 5GAGU 4QR0A 3IWNC 3P5TL 5T7LA 4F4WA 4F2SA 5HLFA 4OHVA 2ZKTA 4NLRA 3LWLA 1WF0A 4AL5A 5KFTA 3DRXA 4DJBA 1LW2B 2DO0A 3TUJC 1MU2B 2DR9A 2QE5A 4X4UA 1NJZA 1FEHA 2MQQA 4Q44A 4NCGB 2DNZA 1D9FA 5G4DA 5J2MB 1FRJA 2N4DA 2DT9A 4F26A 5K8OA 1KLMB 1JLGB 1TV6B 3UCGA 3HVRA 4Y0FA 3Q2SC 2U1AA 3H98A 2CPEA 4LSNB 4ECYA 1DRZA 5D4NA 4RNFA 1HA1A 2RE1A 3UDCA 4DQQA 2VPYB 1I6JA 3HHLC 2KM8B 4DS4A 2UXDF 4DX8H 3I9V9 3CCUS 1TZ0A 5B0BA 4DR5F 1TR0A 2JRSA 1SIZA 3HI9A 3LGNA 4LVNP 2HYIB 1JK9B 1KOHA 1M5HA 5M2UA 1NKBA 2BRLA 2DNRA 4ZPBA 2IM0A 3UNGC 5GAHU 1UAWA 2IYIA 3O3LA 3OR1A 4PXEA 3OW2R 1Q16B 3I32A 4JI4F 3M2UB 2LQBA 2BM1A 3OTBA 3KLIA 5D78A 1NK6A 5EUHA 2GGPA 3DNCA 2D41A 1HBMB 5GVQA 2K1RB 1GXUA 3V6DB 1VQ8S 3QGPA 2HNDA 1SV5A 4TN2A 4OIXA 1FKAF 4WTYA 2KT5A 5L9NA 2JEFA 2VOPA 3P49B 1REVA 2XS7A 1VQPS 2RS2A 1V9OA 2W7PA 3NMRA 3HVTA 4A8MP 1YJRA 3FRZA 5KFFA 5HL7Q 2VG7B 2WRMA 5KFWA 4WU2A 3P3DA 3M32A 1R6YA 3ZZ0A 1CG2A 1G3OA 3DRYA 1VQNS 2GQ2A 2D9PA 5A6WA 2W9CB 4Q8EA 5B09A 3ZZRA 3M9NB 4N5SA 5KG5A 2A1BA 2YKNA 1S97A 2OPPB 4KHRA 3OJSA 2RKIA 2GHVC 4QQBA 3WC0A 1WTBA 3BGRA 3LP2B 2Z0GA 4ELTA 4PUOA 1S1UA 4WIIA 4WXWA 1N33F 3CE8A 3DRRA 2IC3B 2MYFA 5ADZA 3RTVA 2ZDPA 4HTIA 3N9UC 1N5TA 3SCLE 4WF9Q 4UUXA 5KFUA 1HFEL 4RU2A 2OPQA 3BEGB 1TL1B 3TAMA 4UY8T 4OI1A 3PHEA 3ZC4A 1ZZFA 2KFYA 1TKTB 5KFCA 5F0UA 3Q0AA 2BZ2A 4M5DA 2RDJA 2NZ4A 1XK8A 1U47A 3R5DA 4RNOA 2RSQA 4ELUA 4RW4B 2VH7A 4A8YA 3TX8A 3SMZA 1AROP 3RR8A 2ZNYA 2FUG9 2MZQA 5F8GA 1QSLA 4BCAA 2QSFA 1S10A 2YNGB 5HBMA 5LSLA 1Z1ZA 1S6PA 3ENWA 2NPIA 4H54A 3LF0A 2M5YA 4NYPA 5HROB 1IJFB 4OI4A 3QIPA 1L3UA 2FLNA 2MHNA 1TP7A 3K7RA 2MQPA 3I4HX 3LWMA 1D9DA 3F41A 4NRUA 5DRKA 1M90T 5KG2A 4QU6A 1FKOB 2CQ1A 2P6SA 2XZWA 1OQ3A 4Y2IA 2D3OR 1YRUA 5DDQC 1Y7PA 3VZHA 1SJ3P 3SV3A 1G6BA 2B7BB 5KOXA 1KC8T 2CPYA 3B4MA 1RT5B 4NLDA 4QOTA 2P9CA 4RW8A 4N47A 4YMEA 1FCAA 5AXLA 4X64F 1H7XA 6FD1A 2B4UA 2B4VA 1C4AA 3J7ZT 1TL3A 5L1KA 1JLFA 2YNHA 1N6QA 2QLWA 5GMKa 3UFCX 1O0PA 3OTEA 1U09A 4KTQA 5LSOA 5A8KB 1YQHA 4ZPCA 3G8SA 3I0SA 1E6VA 3MCSA 5K14A 3TUIC 3I56S 1RDRA 4ICLA 4J9MA 3JTNA 4K4ZA 2C2EA 4K5SA 2XLJA 3BO3A 4DDFA 2G0CA 5CQGA 1LWEA 3VTIA 3ZZZA 1VHFA 4ES1A 3VAIA 1JLCA 2DITA 1ZM3A 4JI0F 4KR0B 4LFCF 2GIQA 2R7VA 2LECA 2HVZA 3J7YU 2RU3A 3FSXA 3M8QA 2L48A 1CQNA 3KNAA 1HNIA 1Z4UA 5KT7A 2NREA 2CQPA 2C3MA 1C1BB 2Y1IA 5I3UB 3BS9A 2MY8A 5C25A 3DXSX 2FVCA 4H4OB 1SC6A 2HS3A 4CT9A 1B0VA 2FGCA 4H4MA 2R7QA 2XCPA 3GV8B 4NLTA 2MKSA 4OI2A 4ES3A 5DQHA 2IAJA 1GTHA 4O44B 5E41A 3EZ5A 4CTAA 3GIMA 1CC7A 2GA7A 2YWFA 3M6XA 3OPKA 3T5JA 3NRBA 1N36F 1M5SA 4O0IA 2GHPA 5HMWA 4PWDA 5D77A 3NL0A 2K7KA 3QGIA 1OQ6A 4KQZA 4RKUC 4NPOA 2L41A 3GWCA 2X51A 2YX1A 4Y2AA 5THWA 2I5JB 3M2VB 4QR1A 3MDFA 2ASLA 3GSDA 1HQEA 1DBDA 1OPZA 3W3SA 2FC8A 2DNMA 4GKJF 1HD0A 3CCSS 1Q8BA 1DTTB 1YJTA 1IBLF 3KG4A 2R4FA 1WI8A 1X4GA 2DNPA 4A48A 1VRUA 5D4PA 2MSTA 2QSWA 3GYNA 4ID5B 3CCQS 4I2PA 1N5QA 3DOLB 1VQLS 2PGCA 3CTRA 1FD2A 3MOZA 4P6QA 3IG1A 3RU0A 4J37A 2BQRA 4Y2CA 4X2BA 1VIXA 1FDNA 1I94F 5F3TA 3BN4A 5KFQA 1UL3A 4AL7A 3DLLQ 2DGWA 3ISNC 4WE1A 3VQTA 3CJKA 4MMOA 2MZSA 3ONQA 3WC2A 1R8AA 3BREA 3H8YA 1YJ9S 5KFBA 2OTLS 1JLBB 2FLOA 3CSKA 3CD6S 1N5VA 2CRLA 3CVKA 4OZNA 1IBKF 1IBMF 2O1PA 1KN6A 1SJQA 5KOWA 1NK8A 3PIPQ 3KK3A 3L7OA 4GC7A 2LEAA 4KFBB 4Q0BB 1HBOB 2DISA 2CQDA 2CJQA 4U67Q 1XNRF 1QLNA 2AYEA 2Y1JA 4LF5F 2QA2A 3SV4A 2RF2B 3PJWA 4PG8A 3HXMA 1DQ8A 3POTA 4I69A 2OP5A 3EXYA 1GAOA 1FVQA 2DGVA 1HHSA 4IFVA 5CHCB 1TL4A 3O1LA 1TUVA 5E0OA 3LAMA 2UUTA 2ZOMA 2OH2A 5KFOA 1XMQF 3O6QA 3RBDA 1KEKA 1P27B 3MECA 1S72S 1RKJA 3LP0A 3MOJB 1Q7LB 3CDWA 5A2QY 4RW9A 2OKQA 1LKZA 5A8WA 3NNAA 3G9CA 4R5PA 1UVJA 1WG4A 1VFJA 2VBYA 4E8UA 1WTFA 3FRYA 5DG8A 5KFGA 2P6TA 1ZTTA 3FMWA 3LOUA 2M88A 1YI2S 4W92B 1E6YA 2JDJA 1Z2ZA 4MYTA 2GCFA 2NSCA 4ATNA 4C9DA 5IM0A 2VFSA 2YKAA 1VQ7S 4P2SA 2OSQA 2PE8A 5D3GA 5HO4A 2DH9A 3U1NA 2PD1A 3G6XA 1U8SA 2HNYB 3O2IA 2KM8C 4NLUA 1UWBA 3D28A 2CG4A 3DLGA 3MMCA 3CF5Q 1NB7A 4K4XA 2DK2A 2MJUA 2ZH8A 3UD4P 4I6WA 4I2QA 3BQ0A 2W9BB 3PEJA 5KFJA 1TAQA 1WD6A 1C1CB 2DNOA 2E9ZA 1JX4A 2N4CA 1KOOA 2DNNA 3D0IE 4ZVGA 4LF9F 5HMZA 2KKHA 3PKMA 4B3TF 1KSPA 3HK2A 3B82A 5J1EA 1QM9A 2IVYA 1F5AA 4F4XA 2OIHA 4DUYF 5B0EA 2CZVC 2OPRB 4WKYA 3CCVS 1UFWA 2R7XA 4TQSA 1WNEA