1VQMS

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 21
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vqmS00
2D9PA 2CQ0A 1VQNS 4CQ1A 3UD3P 2NLWA 2MKSA 2V94A 3CCJS 3CCES 2DH8A 1YI2S 2NZ4A 2Q79A 1SJRA 3CCRS 4ED5A 4F26A 3B4DA 3CD6S 2M4MA 1KD1T 3S7RA 1UFWA 3P49B 1SJ3P 5IQQA 1VC6A 3CC7S 3DLLQ 3K0JA 3US5A 2MZRA 4F25A 3TP2A 3VF0B 2EVZA 3R1HA 5HL7Q 4BS2A 1Q86T 2K8GA 3G4SS 3MD3A 3D2WA 5HO4A 3I56S 3MUMP 1NO8A 4FXVA 1K8AT 2E5JA 2MSTA 1WHXA 1NU4A 3UE2A 1DRZA 4IOAQ 1U1QA 5LSOA 1YWXA 2DGUA 2DIVA 3Q2SC 2KRRA 2F9DA 4IUFA 1VBXA 2CPHA 1RKJA 1L3KA 1FJCA 2KH9A 1VQ5S 5D77A 2LMIA 2LA4A 1WHVA 3NNHA 2MPUA 2KVIA 2MY7A 2M70A 2JVRA 1A9NB 1URNA 1VC0A 1ZH5A 2A3JA 4OZ1A 4W90B 1YJWS 3CCVS 4F02A 2VODA 1U1KA 1X4CA 1VQ7S 5GADU 5GAEU 4RU2A 1Q7YT 3UWTA 2X1AA 2HYIB 2HVZA 1OIAA 2LXUA 3CC4S 2RVJA 3VAKA 2RS2A 1N54B 2CPJA 5LSLA 5DM7Q 2WBRA 2ZJQQ 1ZZNA 2DB1A 4WCEQ 2ZJRQ 3G96A 2DGSA 3VAHA 2RRAA 2RRBA 1YIJS 1DBDA 2F3JA 4V19X 2N82B 5DM6Q 3P3DA 4IOCQ 1A7GE 2MKIA 2KM8B 3NS6A 2DGVA 1WG1A 3CULA 5JVGQ 2E5HA 2QFJA 5CXTA 2G1DA 2MB0B 5FJ4A 3R27A 1FNXH 2KM8C 1HD0A 1R8PA 1M5KC 3UCGA 4A8XA 1HL6A 2CPDA 2DNOA 3G9CA 2D9OA 2XNQA 3N9UC 2MKKA 4UQTA 3SMZA 3I55S 1WF1A 2CQ3A 1FT8A 2KXHA 2FY1A 2OSQA 1X4HA 4OZ0A 4WFNQ 1JMTA 2JWNA 2DGQA 2FC9A 2YKAA 4QU7A 5CA5A 2LEAA 1VQLS 2VOPA 2CQPA 5GAGU 3VAGA 1X5PA 2DNPA 2AD9A 3G71S 2EK1A 3UD4P 2DO0A 1VQ8S 2DNRA 1P1TA 2DGWA 1M5VC 3RW6A 1X5SA 1X0FA 1KOHA 1WEZA 2DGTA 3MURP 2B0GA 3MUVP 1X4AA 1U2FA 3CTRA 2L9WA 3THPA 3VAIA 2D3OR 1X5OA 1N52B 1WI6A 1U1NA 3SDEB 1WEYA 2DNYA 2ERRA 2RT3A 1JJ4A 2LQ5A 2X1FA 2MZJA 3THTA 2CPXA 2HGLA 2MGZB 4Y00A 1S72S 3MOJB 2MMYA 3S6EA 1FXLA 4J5OA 5BJRA 4C0OC 2PE8A 4TU7A 2XSFA 3IWNC 1VBYA 2CQ1A 4M5DB 5DDRC 1FJEB 2ADBA 1M5OC 4PKDB 4WFBQ 1VQ9S 3EX7B 1VQPS 1Q81T 1HD1A 2OJ3A 1KOOA 4QU6A 2MJNA 3LQVA 4QPTA 2OTJS 5LJ3Y 3PIPQ 3CC2S 4U67Q 1H2UX 2CQ2A 2KU7A 2LKZA 1KQSR 2RU3A 1FJ7A 1H2TZ 3FEYB 2XS2A 3HHNB 4PRFA 2CQ4A 2MKHA 5H1SV 1WHWA 3DXBA 1XN9A 2E5GA 3BO2A 2L08A 2RQ4A 4Y0FA 2PEHA 2VOOA 2E5IA 2YH0A 1D8ZA 2XS5A 5EN1A 2X1GA 1WTBA 2OSRA 4YUDA 2M9KA 4TU8A 2CPEA 4TU9A 1X4GA 5GAHU 2CQIA 1YJNS 2E44A 4ERDA 3TO8A 2MQMA 2QA4S 1N8RT 2JRSA 1JJHA 2LEBA 2CJKA 1WF0A 5IFMA 4WKRA 1O0PA 3G8TA 3ZZZA 3CCMS 2KG0A 2MQQA 4C4WA 2OTLS 2O3DA 4Z2XA 2I2YA 1VQOS 4CH0S 2EK6A 2M0GB 2DNKA 2FHOB 2CPFA 3CCSS 4UY8T 1SJQA 2MKCA 5GVQA 3P6YC 2DK2A 2KFYA 5D78A 3G8SA 2RUGA 1JJ2R 1WEXA 2FPHX 2MZSA 2DHXA 3OW2R 3HI9A 2CQDA 5MLCV 2N7CA 1BY9A 1W2BR 4W92B 1M5PC 2HGMA 1UW4A 1WI8A 2L41A 2SXLA 2YTCA 5CYJA 2DITA 1UP1A 1X4BA 2MYFA 1SXLA 5DETA 2DHSA 1H2VZ 3CCLS 1VQMS 2KXNB 1WG4A 3RW7A 1D9AA 1R8HA 4P6QA 2XB2D 2M8HA 2DNQA 3MDFA 4EGLA 2RS8A 5IM0B 2YWKA 2CPIA 1FHTA 3BO4A 3CUNA 3SXLA 2DISA 2LYVA 2CQBA 5JVHQ 1N88A 1DZ5A 2YH1A 3J7YU 2N3LA 2JX2A 5DDQC 3UCUP 1QM9A 5LJ5Y 3B4MA 3SDEA 2M2BA 1QVGR 2LECA 2DNLA 4LIRA 1SJFA 4QQBA 4LMZA 2XNRA 2FC8A 2MY8A 3S8SA 3NNAA 1U1RA 3S01A 2MZTA 1FO1A 2MGZA 2MZ1A 1QVFR 2I38A 2KG1A 3MXHP 2ADCA 1VQ4S 1UAWA 2DNMA 2DNHA 2MHNA 3V4MA 3VAJA 2DGOA 1VQKS 2U2FA 2DHGA 4PR6A 2M8DB 2DH9A 1YTYA 1S79A 1CVJA 3CCQS 2LA6A 5LXYA 3U1MA 1PGZA 2BOPA 2QEXS 1U1MA 3R1LA 1KC8T 4LJMA 1AUDA 3CF5Q 2KT5A 2KRBA 2MJUA 3Q2TC 2M88A 3JB9k 2MQPA 3L3CA 4FXWA 1P27B 3IRWP 2MXYA 2LXIA 3H2VE 3MI7X 2K3KA 2GO9A 2CQHA 2MQOA 2CPZA 2DIUA 4WF9Q 4YOEA 1WG5A 3BO3A 3EGZA 1WHYA 1WF2A 1NJIT 2MQLA 2J8AA 3BEGB 3MUTP 4ZKAA 5DDOC 3H2UB 3NS5A 2CQGA 3TYTA 3UCZP 2HGNA 1IQTA 2DNNA 2X1BA 3VALA 1X5TA 1X4EA 5LXRA 4WIIA 4WFAQ 1OO0B 1G2EA 1K9MT 1X4FA 1WELA 5ITHA 1VBZA 2J0SD 4CH1A 3J7ZT 1U1PA 1Q82T 3ZZYA 3EGNA 1OPIA 3LPYA 3ULHA 1X4DA 3G6ES 1OWXA 3CPWR 1PO6A 2M52A 1U6FA 2CQCA 2DHAA 2DO4A 5DDPC 1U1OA 2U1AA 2BZ2A 2JVOA 2G0CA 3PIOQ 3CXCR 1VC5A 2MSSA 1SJ4P 2ZJPQ 2MZQA 2MKJA 2DH7A 1YITS 2KXFA 4TLQA 4C7QA 2RQCA 3CCUS 2G4BA 2AYBA 1HA1A 2KN4A 3MD1A 4YB1P 3CMAS 2LCWA 3NMRA 1M1KT 3VAMA 3CMES 2XS7A 2KI2A 2J76E 5IM0A 1WWHA 2DNGA 2M7SA 3U1LA 3P5TL 3FEXB 2MQNA 1K73T 3VAFA 1DHMA 2VONA 1F9FA 1YJ9S 1M90T 1VQ6S 2AYMA 2CPYA 5GMKa 2J0QD 1U6BA 2DGXA 2GHPA 3BS9A 2OIHA 2F9JA 3NNCA 1YHQS 2DNZA 4CIOA 2AYEA 2HZCA 1H6KX 1B7FA 4IO9Q 1RK8A 2AYGA 1U1LA 2KHCA 2KYXA 2RNEA 2N3OA 2UP1A 1ZZFA
chains in the Genus database with same CATH superfamily
4DR7F 3JSYA 4L75A 4ZJQA 1YI2S 2WVEA 2XMUA 4DUYJ 2QG9B 3B4DA 2FVPA 1ZTWA 2O01C 3GILA 4OYMA 3VF0B 5B0CA 3HHEA 4BS2A 2F5GA 3MD3A 3WIVA 1D9FA 1NU4A 2OH2A 2DIVA 2J7KA 2ATCB 1TKZB 3BB5A 3H42A 1RKJA 4F4XA 4KHRA 4PWDB 4O23A 3MPUB 2VKZG 3M8PA 3I9ZA 2KYZA 2IVMA 2BJ7A 3TOQA 1YQHA 4C8OA 2GGPA 4FBUA 1YJWS 3CCVS 1RCXB 4FYWB 2I6WA 1RGVA 2H5IB 1TKTA 1S77D 4WCEQ 2ZOGA 2F3JA 2MKIA 4N76A 1WG1A 3CULA 1HBUB 3DLEA 4DV4J 1Q1KA 3M9OB 3K5LA 2M3DA 1MG7A 1R8PA 2GW8A 5I42A 3M32B 2XY5A 1G1XA 2VV5A 2A1BA 3N9UC 2KHDA 3SMZA 5J2PA 4HHHA 3IRXB 1HYSB 2J0XA 2DHHA 5E0OA 1KEKA 3MMBB 1NDPA 5B09A 4ZVGA 3KLFA 3T3FA 3HHDA 5C24A 2CJXB 3WZ0A 2DRDA 5JXSA 4CLWA 2FGCA 1M5VC 4M5GA 3RR8A 3R97A 4YDDB 4IR1A 5D6GA 2HFVA 1HI8A 3VQTA 4R0EA 4DV7F 1RT7B 2WONB 1PIEA 1FX2A 2CPXA 2XYGB 4HTIA 4I6YA 2LQ8A 3Q24A 3CO9A 3E01A 4C0OC 5HVHA 3Q23A 3QT7A 2GMJA 2UVRA 2V8GA 4FBTA 5A6WA 4LREA 3TA0A 2W4DA 1D09B 2CAJA 2V4RA 1OYDA 4RR5A 4M94A 4FYDA 2ACMA 3ZZZA 4DOZA 1T95A 2I2YA 3FVYA 1NHVA 4MIWA 5CYMA 3QLHA 1IWAA 3W2WB 3EWGA 1IR0A 5EWFA 1C0TB 2MLZA 5KG0A 3ILOA 2FPHX 2MZSA 3RRHA 2V2VA 1YZ7A 1W2BR 1F3VA 2YNIA 2W7OA 1X60A 1UW4A 2HGMA 1U45A 2O1PA 5F0WA 3FEZA 4YP3A 1UA0A 1Y7PA 3CJ8A 1TL3A 2UVWA 1UKUA 4NCGB 1HBMA 2GNKA 3BO4A 3H4DA 2CQBA 2W9BB 5HVFA 2HLUA 5DLFA 4U6PA 4DUZF 2F4FA 3TQEA 2LU2A 1JNZB 3ZTSA 1CJUB 3R5BA 2XNRA 2MZTA 3MEEB 5B0FA 3CGIA 5IT9U 2DNMA 1MNEA 1NSAA 2DCLA 2IA6A 1VQKS 2DHGA 3H0PA 3DRYA 1U8SA 4DFKA 3L3CA 2IIHA 2MXYA 4X4QA 2V67A 5HLFA 1WHYA 4OZJA 2KDOA 4OYOA 2A6OA 1TL7B 4MH8A 3E51A 1NSKL 2X1BA 2GQQA 1ACMB 1DLOA 1K9MT 1X4FA 5ITHA 4ETZA 1IXKA 2POKA 4K4UA 3LPYA 1C0UA 1OY8A 2QLBB 3OQ2A 3H2LA 4B3OA 2X7IA 2R2TA 1R7IA 2IMWP 2BZ2A 3CCTA 1NK4A 2MSSA 2OLWA 4ES1A 3CJQA 3PNIA 1BC6A 2W01A 4C7QA 4EU0A 4U8YA 4IFYB 3DRRB 1RT1A 3AAWB 2XMKA 1AW0A 2KI2A 2DNGA 3U1LA 4LF7F 1RACB 4RW4A 2E1RA 1YJ9S 3MGJA 3NGRA 2J0QD 4IFVA 3EYZA 2GFFA 2YQ1A 1H6KX 3M2VA 2KHCA 2KYXA 3P8BB 1KONA 3D5MA 5HJYA 5C25A 2H1YA 1E6VB 2CQ0A 2R7QA 2NLWA 4M5MA 1TTHB 3CCRS 1RTZA 4AL6A 2ZH1A 2DPIA 4B3MJ 5IQQA 2XGQA 5J1NA 3MR2A 2NXUA 5T14A 2L48A 3BBFA 4KGKA 2K8GA 3OR2B 4C8LA 3D2WA 3I56S 1WC1A 2XULA 2AHOB 2HHHF 3Q0AA 2BJ1A 1LFPA 4LF9J 3QFHA 1WC5A 4IUFA 4LBHA 4EFAC 1VBXA 4RW6A 1JLQA 1VDHA 2QT7A 4ZPAA 2QIFA 1GX6A 4ZHRA 2CG8A 1EQ0A 3C6TB 2Z58B 3V4IB 5F41A 2XHCA 2UVUA 1VLYA 3PYDA 3ITHA 2XMTA 4NRUA 3VWSA 2GA7A 1N6QA 4U8VA 2DR7A 4TY8A 2FVCA 3KXDA 3VAHA 2RRBA 1DBDA 2EBEA 4BLGA 2H51B 2Y9HA 2QLFB 4WBFA 6FD1A 4KB7A 4DMZA 1ELOA 1SBRA 4QWBA 4X65F 4NLPA 5B0AA 2FZGB 2IC3A 1L3VA 2UZAA 1WACA 1FTRA 4FKYA 1WF1A 5G0RA 1Q5VA 1CG2A 3R6GB 2VC0A 1X7VA 4LR9A 3J7Z5 2DGQA 2YKAA 4JI3F 3HSJA 4P7VA 2AJQA 2GHWA 3KK1A 2E7XA 4DSFA 2CWKA 1MMLA 1S0NA 3RW6A 4MMOA 3R2CJ 2B5JB 1B0VA 4LF6J 3MURP 2B4VA 3RAMA 4K4WA 3DN9A 3W60A 2C2RA 1RUSA 1N52B 1GH8A 3SDEB 1JJ4A 2LQ5A 4YR0A 1X9WA 4EUVA 4R8UB 1S72S 2BE7D 3I4HX 2MMYA 2P9EA 1LOUA 1QDUB 2HVHA 1Y5LB 1KVKA 2LQJA 1XMBA 2NS1B 4QR1A 3MM8A 1KOOA 2XMVA 3CCWA 1MMDA 5K8OA 4HDHA 2XS2A 4PRFA 2BBEA 4X4NA 3KOAA 2AJ1A 5D3GB 2BXJA 2XS5A 3OLAA 2JFKA 2CQIA 4TYAA 2BUNA 1M1HA 5ETVA 2LEBA 4CNZA 4PQUA 1UW9A 1RE1B 2E29A 2ZZMA 3CCMS 1YLXA 3KJNB 2VG5A 1IJFB 2EK6A 2HQIA 1SCJB 3VZHA 4W4MA 3SIPB 2CPFA 2YX1A 2HHUA 3Q89A 4JI7F 1JQGA 2CNKB 2COLA 3DCAA 2G0JA 5KTQA 3DGPA 3QT8A 2GX8A 4USKA 3KLGB 1H2VZ 3HVWA 1K44A 1GEHA 1Y0HA 1NZAA 2V4QA 2HQCA 2H65B 2CA9A 3D67A 3W9IA 2ASYA 3M8YA 3T1YF 6FDRA 2DNLA 1LXNA 4IOBA 5A2QU 1LWCA 1SL0A 2PIIA 3DLGB 3JSBA 1C1CA 4NYOA 1TMMA 2Y8YA 2BOPA 1N4LA 1RHQB 3ONQA 5E3QA 3R1LA 2KRBA 1DARA 5HQ8A 4RUBA 4PWWA 3NGTA 1QAXA 2XLJA 2CYYA 1XNRJ 2CNLB 2QL5B 4TQSA 3TNVA 3M8QB 3DDNA 3GV5B 2J5AA 3JXOA 4NLXA 4ZKAA 5DJBA 4FS1A 2VA2A 4WFAQ 1VHFA 1HNIB 1WELA 2UUBF 5LOQA 3MCOA 3QIDA 1OPIA 1VBKA 1XK8A 4USVA 1HI1A 4IH6A 3N5BA 3CXCR 2E7VA 2QL7B 1L3TA 4X66J 1JB0C 3A4TA 1ITPA 2WZ1A 2JDJA 2J76E 1BQXA 2OEKA 3KDOA 4EO6A 2HWHA 1F9FA 4OI4A 3IR5B 1RT5B 2IJRA 2KT2A 3G82A 2VDIA 1CQMA 1YG0A 3RAXA 4K4VA 1F0XA 4NWBA 4KBIA 2N3OA 1VISA 3I6PA 4OYWA 1ZZFA 3A13A 3AODA 2PDAA 2DH8A 3FMWA 3MTKA 3CJKA 3ILJA 3P49B 1RAJA 1SJ3P 2R8JA 3FKBA 4CLLA 1DTTA 5HL7Q 3H4BA 1WHXA 2IDLA 2GC8A 4I2PB 4K4YA 3NCPA 3W1YC 4C8KA 3AD9C 1VHIA 3UR3C 3G6YA 3LP1B 3DOLB 4G6VB 4X4SA 2OPRB 2AZ1A 4KC5A 2MY7A 4Y28C 2HNZB 1KFSA 1NHUA 3CDWA 3TW0A 4ZS6A 1VQ7S 5ETTA 1Q7YT 3OR1A 1FCAA 3PCOB 4F2SA 1YRTA 4HACA 1SQEA 3QAEA 1FFWB 2ZH6A 3N6LA 1S6UA 3PFEA 2BANB 4NLTA 5FJ4A 3TRGA 3BGUA 4DG1B 5T7LA 3KG1A 1LW0A 3HCXA 3OJUA 2OMOA 1MSWD 2C22A 1I5OB 3RU0A 2MEWA 2RDIA 1T03A 4ZVHA 4DSKA 4EK2A 3SV4A 1TVRA 1T3NA 3HFZB 2DTJA 2H48B 1SQGA 1Q5YA 3MAHA 1S9GA 4O4RA 4I4BA 1JMTA 4H4KC 3VV2B 2LEAA 4C2MA 1DY3A 4ZVOB 1TUVA 3G71S 3BH7B 3IO1A 2R8IA 2UVVA 4MJKA 1SC3B 4DR4J 4U7UK 1D3WA 4B3MF 2B0GA 4XTTA 3PZPA 4FVMA 2F65A 1RT7A 1J5OA 5A76A 3H5UA 3C16A 4ECWA 4Q8FA 4DL6A 1WOOA 2UU9F 2C2ZB 3KJVA 1WTFA 3S6EA 1PYTA 1D0EA 1VBYA 3MM9A 2ADBA 2RHSB 2A10A 2XSJB 3EX7B 1HD1A 5DS7A 2DYAA 4KHPF 1CSJA 4J91A 4Q0BB 2ZM6F 4OLPA 3DOMB 2EXUA 3KUEA 1FJ7A 1LWEB 2NXEA 2E7WA 3M9MB 2O5DA 1RHKB 1NK6A 3EUNA 1CULA 2HVIA 4QJVA 2V2QA 3KLIB 2OKQA 4ES3A 1WF0A 3IC1A 3KLEB 4DN9A 4B9SA 1TR0A 3V81A 3O5TB 4N7TA 5KFCA 2DNKA 2FZCB 2R7SA 1T9XA 1REVB 5GVQA 2ZH3A 4KFBB 3C8YA 3NGUA 3IBWA 4DR2F 2Q6CA 4YY3J 4WWSA 3DRXA 2HK2A 2MKYA 5EHHA 2DVIA 3BYPA 2ILYA 3QJLA 2XM3A 2DBBA 1WDDA 4FYVB 2PGCA 2Z2ZA 2W25A 5J2QB 3TZYA 2YWKA 3NEKA 3MEDB 3ZTQA 3D0HE 1MN9A 1DZ5A 4DQPA 2G0IA 5HJXA 1JXVA 1GMUA 3MMAA 3BGRB 1RCOB 2NYHA 4XAKA 2RU9A 2JLFA 2BJ8A 1QD1A 3AA8A 3C66A 1N5YB 2QEXS 2KT5A 2GIRA 4M5IA 1P27B 1TL1A 3IGVA 3HFVA 2Z2MA 3J81U 1B99A 1OJ4A 5EWGA 3JS9A 1VRQC 2LVWA 1FJGF 3H2UB 5AXLA 4LQ3A 3ETMA 3QPIA 4F04B 3GJSB 1QAYA 1U6FA 2ZBRA 1M0SA 4OYZA 1XJWB 1WDTA 4C8NA 4G1IA 5DDPC 3LGNA 2CZ9A 3SFGA 4IQMA 4EMDA 3BGLA 3X3UA 5L46A 1CS4A 3KYLA 1R0CB 1EQMA 2LP4A 4DL3A 4LSNA 1FK9B 4DL2A 1IBLF 5SZTA 1XMQJ 3PW7A 3MWBA 4ANCA 3TAQA 2ZE2A 4FKXA 3OVBA 4R5PA 4CTAA 1JLGB 2QLXA 4ZLJA 4AUKA 5HANA 3UD3P 1HQ2A 4CLFA 4V19J 1ZBTA 4DBQA 4M1KA 2UXDJ 4OLOA 4DPOA 1UWBB 3FZBA 3WHIA 1FD2A 2BA9A 2FJAB 2MSTA 4USUA 1XNQF 3R5AA 5E3CA 1IKVB 3OUYB 2HW3A 1T7PA 4Q5VA 4DR3F 2WVDA 1T05B 4YN3B 2J7UA 1EIYB 5H9FJ 1S1UB 2HHQA 4ITSA 4ZVEA 2MPUA 1KVJA 2V6AA 3VR1A 1Q8KA 4NLVA 1URNA 1AB8A 2B8QA 4LRBA 5SUHA 1X8DA 2XY6A 1OIAA 2RS2A 4X84A 4OI2A 1SC1B 5AJ3F 2AU0A 3OXGA 1X9SA 2QFJA 2G1DA 3BDEA 2AMCB 2QE5A 4LSZB 4ZP9A 4IG0A 2OEJA 1UJ6A 5KFJA 1RTJA 3TJ9A 4N56A 3MPWA 2HFSA 4OZ0A 1UL3A 2ZD1B 1U09A 1NPKA 3EGVA 4EBDA 1VQLS 3HVTA 1D8YA 1B4SA 4DR5J 2EK1A 3VGSA 4UY85 4O3RA 3RUBL 1P1TA 3MM6B 3LWMA 2PI5A 3MUVP 4F4AA 4WE1A 3CTRA 3D1OA 3OL8A 3CJTA 2FJDB 3CE8A 4PEOA 2HFNA 3FBFA 4ZCKA 4NLUA 5M2RA 1RT6A 2GV1A 1Q8LA 3I5CA 2VQFF 1JLFB 4B3RF 1TK0A 2HRTA 2UUAF 4QU6A 4ZPVR 4A47A 2DKOB 4PXCA 2H4YB 2BM1A 5E3AA 3LP0B 4M5JA 2IRUA 1ICEB 1KNZA 3SCKE 3A8IA 2YH0A 2M9KA 1JXLA 2QA4S 5IXUA 4NE9C 2JRSA 1JJHA 1QE1B 3DU6A 2YPZA 3D0IE 3G8TA 4F4ZA 1OPZA 4FF2A 1K1QA 4RKUC 1I6JA 4IRCA 1SJ1A 1NKCA 1VIXA 5KFIA 3OW2R 5ETLA 1MMNA 3KUHA 4KO0A 3HPOA 2AX1A 4UTGA 4ECVA 1X4BA 5DETA 3JSMB 2AZ3A 2XWXA 3W65A 2DNQA 2RE1A 5KT6A 3BF4A 1RABB 5D4NA 3VGUA 3FQLA 4UOCA 2ZDOA 2J8SA 2VDHA 1VQSA 3DYAB 2Y8WA 5HQLA 4ELUA 4QQBA 1I94J 1MW7A 1EJ7L 3S8SA 1HNWJ 1XEZA 3MXHP 3DLKB 1LNQA 4JYAF 2MHNA 3PW0A 3PEJA 1BMQB 3P96A 3I0SB 2DH9A 3GCXP 2ZNZA 1Y11A 4CO4A 3MR5A 1RJJA 1UCNA 1RP5A 4K59A 4X4TA 2M88A 1Q53A 4ID5B 4L76A 3IRWP 1MN7A 2I9SA 2QLWA 1FRKA 4LRAA 4WK3A 2K3KA 4USTA 4RW9A 3HMJG 5LM7E 4P2SA 3M7VA 2KFZA 1FE0A 4C97A 2A2CA 2GVZA 5K5MA 3VALA 5IT0A 4WIIA 2W9CB 4LBIA 2BKNA 1G2EA 3I32A 1CJVB 3H25A 2BJ3A 1B70B 2W4CA 2ZHBA 5FIIA 5DG9A 3WBZA 2DR8A 5ETMA 2CQCA 3BN4A 4ZCIA 2R8KA 3NAIA 4UOHA 5A2QY 2VG7A 3BSCA 5FDLB 3SCIE 4A48A 4J37A 3L7UA 2HNYA 1VRTA 3MFHA 3K5MA 5D0RA 1RTHB 4NA3A 1U25A 3M9NB 2GHPA 2P6TA 4QZVB 1J5EJ 1N0VC 3JAMY 1B7FA 5CHCB 4ZITA 4MFBA 1RHRB 2AWZA 2Q79A 2ALYB 1E6YA 4LFCJ 2G2OA 1HHSA 3DC2A 4Y2CA 5E2QA 4WXOA 1RTIB 3US5A 4JI8J 3JQMA 2EVZA 3VQSA 4RW8A 3KNGA 1C2PA 5CYQA 1SB6A 4OJGA 1RWPB 2HRYA 3CIMA 3BV8A 1RBAA 4FYYB 1FWPA 2QYCA 4C8MA 3ENWA 5EUHA 1M5HA 3C15B 4C6AA 2PA8D 1RHMB 4UOFA 4H4MA 4PG6A 1VQ5S 2C42A 5L8RC 3C14B 2YWEA 4ID8A 4ZK7M 3CJ5A 4IQXA 2JEIA 4W90B 4F02A 4N77A 2BQRA 4RUCA 2FJWA 5ETNA 1K0TA 2QA1A 1REGX 5DM7Q 2NXNA 1KS2A 2N4DA 2NSBA 4HL9A 4X64J 3DRPA 5JVGQ 5F9NA 3GIRA 1RLCL 1FEHA 3CEDA 4GVBA 2XO7A 5KFRA 3U1NA 3BKTA 1N34J 3QAUA 4G1QA 3R2DJ 3SCJE 2DR6A 4YS2A 4F7VA 4I1TA 2KZMA 4DV5J 4CO2A 2DNPA 4OJHA 1RT2B 3D0GE 4EI2A 4Y2KA 1JKHB 1EHWA 4GC6A 4OX7A 1HQUB 5KFWA 2GAGC 2LDYA 3W2VA 3SV3A 3THPA 1U1NA 2ERRA 2ZH8A 3OXFA 2YNGA 3ISZA 3LTOA 3F73A 1FXLA 2FJEB 1TUGB 4OX9F 2XSJA 2B6AA 4IG3A 1VRUB 3C6UB 3KLHA 1Q81T 1RYSA 4NA2A 4DPXA 3CDEA 1QAJA 4FF3A 1IVZA 2V2KA 5I3QA 2CG4A 2LKZA 4ECSA 2C3UA 1PKUA 4JV5J 5KOWA 3QO9A 2JLEA 4P2MA 4MIBA 5H1SV 2KT3A 3MEGA 1SV5B 2NPIA 3N79A 2V8PA 4AT1B 1AZSA 4TU9A 3KG0A 3AHPA 2E44A 1YJNS 1AFJA 4QW9A 2HK3A 1F5AA 1O0PA 4PQAA 1JLAA 2JHEA 4JBCA 1YGYA 1B3TA 4OFZA 1RAHB 3IFEA 1VQOS 2NQPA 2DXFA 4IO1A 5EX3A 3ET6B 4ANEA 1RU2A 5DO2A 2C3YA 3OL9A 4X62F 1JJ2R 3SSSA 1FE4A 4W92B 4LUBA 4P10A 1IQZA 2R7VA 2YWFA 1PBUA 1RAFB 1S59A 1D9AA 4CI0B 3W9HA 4NI2A 4EGLA 5IM0B 2MLYA 2WVCA 5C7PA 1RXOB 3JQKA 1XR6A 1GXLA 3CUNA 4DR5F 1KLMB 2LYVA 3IA0A 2OD4A 1NM2A 2YH1A 2W2NP 3W5YA 1YBTA 2R2UA 4Y3CA 3QGIA 2OUGA 4DR6F 1P6TA 1NK5A 3GV7B 1F6TA 5K8PA 2MGZA 3PJWA 2I38A 2HPUA 1U2RA 4J9QA 3BPSP 2EEYA 4OYXA 2DEIA 4KT0C 1YTYA 1S79A 1Q78A 2X51A 5J2MA 2NR0A 3CF5Q 5D0EA 3I96A 3CJ2A 4MAKA 1TELA 4ZVTB 4M8LA 3PRBA 4OJ1A 2Q66A 1SIWB 2R4FA 4A8OA 4OHWA 1UEUA 2FY8A 1X4EA 3M8PB 3K17A 1QJHA 3OFFA 4ZDNA 2J0SD 1Q82T 3LUYA 2GGPB 3UI3A 1G6BA 1TV6A 4BDPA 3PRDA 3D1QA 1FVQA 3A12A 2WBMA 4ZP8A 4RWXA 2HAFA 1TKTB 3K5PA 4ECQA 3KNAA 2HIYA 1JLEA 1UVKA 3CCUS 2ZEJA 5DRKA 2VFUA 2FVQA 1FXDA 4YB1P 3CMES 5A8KA 3DLEB 3QATA 3EJMA 3EICA 2CRLA 1ULRA 1PG5B 1N5SA 4KJIA 5I42B 3BSNA 4DSEA 3GR1A 4YB5A 4ED2A 3BS9A 2OIHA 4KPCA 2F63A 3J81Y 1IKWA 4HI2A 5J2PB 4FYXB 4HVZA 1V3SA 2CJAA 4MT1A 1HI0P 2V94A 4LIWA 3KLFB 2BRLA 2V5HG 3MMCA 5C24B 1N32J 3IG1A 4HI1A 2ACYA 1U1QA 4FF1A 4GKJF 2MLXA 3TR5A 3EVWA 1LW2A 4DS5A 2CPHA 1FDNA 2ZC3A 4ENOA 4O3OA 3E01B 1FRJA 5DQGA 2OFGX 2KB2A 4YFUA 5KT3A 3PX0A 2VODA 3C46A 3R5JB 2FLOA 2Y1IA 4LRDA 2RDDA 3VAKA 1FF2A 3F41A 4QIEA 4V19X 2C2DA 2EC0A 1IBCB 2FD2A 3DLBA 2E5HA 1Q16B 3R27A 3IMQJ 4DF4A 1FRHA 2WB4A 3OD2A 4BCAA 4UF4A 2BJDA 4I56A 1HL6A 3QLHB 5CYMB 2V0NA 2MKKA 4PG8A 5B7WA 2GJFA 4P52A 4OIXA 5E5NA 1QUPA 2ASJA 2HQ3A 2YNIB 4C3MA 1J5EF 3U7JA 1S1TB 5ETKA 1HBNA 1IWGA 8ATCB 1XMOJ 1TL3B 3OVSA 2R2RA 1HBMB 4LFCF 1WEZA 2JC1A 1L5UA 2F8MA 1KTQA 4IYQA 4RBVA 1DAXA 3H8YA 3VTIA 1NH7A 3AT1B 3I87A 2UV8A 4USMA 2HMIA 3GMGA 3THTA 1FKAF 2R7UA 1Z2LA 4USJC 4URSA 2ZNYA 4A8QA 3O2IA 4ZCMA 4HYKA 3PYFA 3ZXWA 3IBFB 1UETA 2OJ3A 4DV6J 3DNCA 5IV3A 3DOKA 5LJ3Y 3H20A 5FLXU 2KU7A 4JI0J 1R43A 1Y4ZB 1TKDA 5HLFB 3TUPA 1T11A 2E5GA 3DDIA 5DG7A 1HW8A 5EN1A 1RISA 3QQCD 4M95A 4ES2A 1FESA 3QGHA 3LF0A 5K8NA 4ED8A 4AL5A 1DLOB 2MQQA 3NMAA 1XC9A 2O3DA 2M0GB 3JTNA 3GZ7A 1RWUA 4DU7A 1TZ0A 1C0UB 1RDRA 3PRVA 4B17A 2OI2A 1IBKJ 4B3OB 4URQU 4H4KA 3MM7A 3LANA 2CQDA 4J9LA 1M5PC 4OZ3A 4WFZA 1T9WA 1RT1B 4JI2J 3RW7A 4OI0A 2XB2D 2WB1D 2M8HA 4E2FB 3GR0A 3GU0A 4DV5F 4RW4B 3PM9A 2DISA 3IXQA 2FGOA 3WDOA 5LSRA 1AA1B 4IFVB 3J7YU 3B4MA 3M2VB 2KZZA 3ZZTA 4GKKJ 4M5NA 5KG7A 5C25B 4WK1A 4UZCA 2DNHA 3VAJA 4LF8F 4PR6A 4USWA 2JJ4D 4WTOB 1KC8T 1DTQA 4GC7A 4DHVA 3PHTA 1EP4A 4RJVA 2GO9A 5J1EA 3AJDA 5ADZA 2ZOMA 1V6HA 3MCSA 3GIJA 1HNXF 1IN0A 1WOPA 4RW6B 1JLQB 4OHXA 2MDAA 1IBMJ 4ZHRB 2JEGA 4JP8A 2AGQA 4K4TA 4LF4J 2VFVA 4CH1A 2RKIA 3ZZYA 3EGNA 2C28A 4Q43A 3A3PB 3ITHB 5J1PA 3Q8UA 4YHHJ 5KFVA 1RWKB 4UUXA 1VYAA 1N6QB 2BOAA 4Q8EA 4TY8B 3EXYA 2AEJA 2I5JA 2GJIA 5JUMA 1UVNA 1LV5A 2LCWA 4FDFA 3VAMA 5CABA 4OJ3A 3RRGA 4UOGA 2H5JB 4K7QA 3G87A 3K7RA 4YB6A 4DV2J 2IC3B 2HHVA 1BXNA 5K8MA 4CIOA 5G0RB 1RU1A 2AV5A 2JLGA 4WZQA 3M4XA 4ED5A 2CVEA 1KD1T 3WC2A 3KK1B 3D9BA 4NPOA 2DXDA 3A8JA 3W8PA 2PC6A 4B9MA 3TP2A 5L1KA 1KTVA 3G6XA 2VBXA 1HNZF 1NPPA 5KFQA 4PPDA 2XC9A 1CC8A 2OMLA 1YJUA 1N36F 4Z37A 1G4CA 1ZM2A 2QN6B 4RZRA 2F9DA 1Q4RA 4WYLA 2RQKA 1TMJA 4RBTA 1Z4UA 3HM9A 5KFLA 3T1HF 1LK5A 5D77A 4QWAA 1RSCA 5B0DA 1N56A 4K0KJ 4JUZA 1UMJA 4GO5X 3EM1A 2CWXA 3QJJA 1A9NB 5KFUA 3D66A 2YKNA 3MM8B 3ZTRA 4K2XA 3IS9A 3T41A 3O8WA 3P4UB 4ZJOA 4KGXB 4WFXA 2WBRA 2ZJQQ 4OV1A 4XPEA 2DGSA 3TZXA 1TKXA 4B9NA 2KM8B 2VZ9A 2FHMA 2HEKA 4PQUB 1T3OA 1WSVA 3MFIA 1ZM9A 2VG5B 3RR7A 4IKAA 4ZVPB 4H4OA 2OD6A 1HWJA 3G9CA 1MROA 4PG7A 3L7PA 2YWGA 4RNNA 2V8DA 5K20B 1X4HA 4J9NA 4PZVA 2RH3A 2JWNA 4C11A 4QU7A 4DSLA 5CA5A 3FC9A 1RAIB 3DGPB 2ZHAA 1X5PA 4NOHA 2AD9A 1RT3A 4C98A 1SKUB 2XCAA 1FDAA 2AJ2A 3PX6A 5C42A 4KE5A 2CDQA 2L9WA 3SQOP 3AOBA 3BM7A 1RA6A 2DJWA 1WEYA 1SL2A 2HBYB 4USIA 1LWCB 2MZJA 3MOJB 1SH3A 3K5OA 2EFGA 1JLCA 1R0AA 1U02A 2BX6A 4ELVA 5LT5A 3MAAA 1C1CB 3LGHA 3AA9A 2Q1LA 2CJBA 1NLKL 5DG8A 2IM1A 1KP6A 2XHWA 2XY7A 2OTJS 2IDEA 2QL9B 5K14A 1D8ZA 2YX7A 2OSRA 2CPEA 2D3UA 3UDCA 2XGPA 4ERDA 1GMWD 4O0NA 3TO8A 1JK9B 4ZVRB 1IR2A 3RGIA 3GQCA 3J7YI 1L3SA 2RB7A 1FX4A 1C1BA 1YRUA 1RT4A 4UY8T 3G8SA 2DHXA 3AXKA 3HI9A 5MLCV 2N7CA 3EZ5A 3TX8A 2HVDA 1AYEA 2W1BA 5F8NA 1R8HA 4G65A 3MDFA 4ATNA 2UXCF 2CPIA 4P74A 4P75A 1UZHA 1QSYA 5DLGA 3D3CJ 1XMOF 3DMJA 2GZOA 3G82B 4LVNP 1QVGR 2HS3A 1FNOA 2MZ1A 4I68A 2EFNA 3RBDA 4ILLA 1FKOA 3CJKB 1F2HA 1MLAA 4NXNF 1DTTB 3FZ2A 1EX8A 3W61A 3CIZA 4A8SA 1F2GA 2D7SA 1FEEA 3KJFB 3NGKA 1B0TA 1VMBA 4O3PA 3AJ2A 2XZTB 4NA1A 4NLDA 4J9KA 2J9EA 5F0UA 3MUTP 2RQMA 5C2GA 4B9VA 1HMVA 2C3OA 1R6VA 2VHGA 1JIHA 3OTEA 1R0BG 3P45B 4YEAA 4V1Ak 1CQNA 3PKYA 2ASLA 3ULHA 1X4DA 3DXSX 3RTVA 2M52A 2WSCC 2DEJA 1T02A 5B0BA 3OR1B 2B4PA 1KBRA 4CRJA 4EBCA 3OT9A 1GQEA 1ROFA 3D1HA 5EWEA 1NJWA 2DH7A 4HACB 3PVXA 4RUHA 2OPPA 2KN4A 3NMRA 2XS7A 2PT0A 3H5SA 1XERA 2GAHC 5T7LB 4F3OA 1LW0B 4DV0F 2QFIA 2J6SA 4K2JA 3LPEA 1NK7A 3J80U 5H9FK 3OTBA 4ZN1A 1T03B 4OV6A 5DGBA 2UXBJ 3NNCA 1TVRB 4ZP7A 4DCPB 4YR2A 1YJVA 2VG6A 3NXZA 2C3PA 1AT1B 1S9GB 1ZTTA 4JI5F 3N0VA 3PJXA 4C3LA 2YPYA 2BKOA 4QWEA 3R1HA 2VJUA 4B9TA 3DM2A 3R8YA 3HLUA 4URGA 3UVJA 2DGUA 4DV3J 1J5OB 5KFAA 1F9EB 5L1JA 3NWGA 3KMSA 3BZQA 3C16B 4HT5A 1W7WA 1FDBA 5CCLA 3KJVB 3SSRA 2ZC4A 2P8IA 3D6HB 3MM9B 1NZ8A 4AXJA 3OTDA 1V9OA 2ZITA 2M70A 2GIQA 3LGMA 4DL7A 1GXTA 4HLBA 4LF4F 2EG2A 1EB0A 4JI1J 4OHYA 2K1RA 1CULB 1ZZNA 1JJCB 2IM3A 5CD4A 3W5ZA 4IOCQ 4N47A 2RSQA 2DGVA 1HNVA 2B9XA 1U47A 5CXTA 4KV8A 2C2OB 4QIWD 3V81B 3M6UA 2OO4A 2DNOA 7AT1B 3V6HA 4UQTA 2HLTA 3EZOA 4I6AA 1S1TA 4DV2F 2V9WA 4WFNQ 3W63A 4U7UD 2D3O1 1EAYC 3NY0A 1BE4A 4B08A 2VOPA 3QIPA 5GMEA 3VAGA 2B3TB 1PJ7A 1MU2A 1F9HA 4Q44A 5KFKA 2W9AA 3EXCX 1VQ8S 1CJTA 1YK9A 1FWLA 5GAEI 4OI3A 1WJ9A 2RIJA 1X4AA 2HS0A 2XO6A 2D3OR 1KHWA 1FI4A 1GFWB 4RWWA 3MMAB 2HGLA 2C2MB 4KGMA 4TN2A 3AXMA 2XSFA 1PC5A 1CEZA 1ZA1B 5IWAJ 2MTLA 3D6TB 1S6QA 2R7XA 3HVRA 1VOMA 1Y3JA 1H2UX 2VKRA 4CNYA 4B3SJ 1TL1B 1NSPA 2JSXA 5I4MA 2RQ4A 4MK9A 4Y0FA 3T6JA 3HZEA 4XDDA 4LF5F 2MQMA 4DZ6A 4IRKA 3QT6A 2L9NA 4QYZJ 3G8QA 3QGPA 3ISND 3MM5A 3M6WA 2FHKA 1WNEA 1YDLA 3EDRB 1F5BA 4LFAF 1SKSA 4JI6J 5A0YA 2FB0A 1PC4A 4F0MA 1HPZA 4WXWA 1WI8A 2SXLA 2Y1RI 1S6PA 1CS4B 2CJQA 1D1UA 2DHSA 2W2QP 3HKZD 1VGYA 4LFBF 3D3BJ 1YBUA 5B08A 4LSNB 3THVA 4WP3A 3R6LB 2EFVA 5AT1B 3TA2A 4PXDA 5BR8F 5FLXY 3QZ7A 4TY9A 2ZE2B 1U49A 4QR2A 3R5CA 3X1LB 5GAHI 5J2NA 4R5PB 2LECA 3ETOA 4LIRA 2WTFA 1SJFA 2ZWPA 4CTAB 2MY8A 2VQEF 2JEFA 2V8HA 3D6FB 3GIIA 3OFGA 1HLWA 1VR6A 1UAWA 1SI9A 4B3TF 3B54A 2F40A 1NCLA 4CLUA 3KMQA 4M5DA 4DPUA 3U1MA 1WUUA 4ZPCA 3BSAA 3Q8VA 2IVYA 2LXIA 5L9XA 4G3IA 4YOEA 1WG5A 2LLZA 2YQ0A 3PV8A 4JV0A 3BEGB 3NS5A 4P2FA 3TYTA 3UDVA 2CNOB 2CVIA 2XTJP 3CJ4A 8RUCA 5ETRA 3NBPA 4DX6A 2OHDA 2CKWA 3D54A 4NCBA 4CM2A 2M5YA 2KKHA 2RQCA 2QMWA 3GG0A 2Z2YB 1WWHA 3P5TL 2EC2A 4I64A 2MQNA 2CZVC 3IP0A 2PEBA 4I7FA 2AYMA 5GMKa 4GVLA 4IG0B 2VF3A 1RTJB 4KYZA 1RAGB 1OYEA 4DR7J 2UP1A 1NUEA 1X31C 5CCMA 3CCJS 1WC6A 2BVZA 4F0KA 2V2ZA 3HVTB 4F26A 3TAMA 3SZ2A 3S7RA 1QAIA 4DUYF 3CC7S 3DLLQ 2QA4G 3T5JA 2OFHX 4WE1B 2YKOA 1OS5A 5L38A 4ICLA 3AB4B 3ZFVA 5E3PA 4C9DA 3K89A 3TEHB 1AUSL 3AH6A 1FJCA 1VI7A 1U8WA 2YX4A 3FSIA 1RT6B 2Y1LB 2J6TA 3RYLA 3OTOJ 2BEFA 4ED7A 3A1YG 2B43A 3UNGC 2Z4PA 1ZH5A 3OPKA 3PW2A 3I9V9 1S9EA 4Q2MA 2B4OA 2HVZA 4K4ZA 2LXUA 3CC4S 1NDKA 1N54B 4EBEA 1NJYA 2WCXA 3LP2A 4CLZA 4JV1A 2F4VJ 3B8HA 3V6DA 1UFKA 3VZIA 1UWAA 5HQMA 3RB0A 4NEZA 4DFJA 2DD8S 2XWYA 3K8WA 2BW2A 4DV4F 2MQ8A 5U47A 4CP5A 4DR1J 1R89A 4PYDA 3N6NA 5KFEA 1W25A 2ZUGA 2P2CB 3V6JA 1RWVB 4ZVQB 4PABA 1T8EA 2W24A 4FNHA 5IQ6A 2UXBF 2KVQE 3CO0P 4KO0B 2HFOA 2HURA 1JX4A 2YWHA 5HAOA 2CXEA 1VJQA 4WIQA 2PA3A 4WPAA 3RBZA 1U0HA 1U26A 5DZ6A 1O8BA 3HSGA 3FBBA 2DXEA 4C48A 3KLVA 4Y2MA 5KFXA 2FJXA 3RRKA 3W62A 5A8WA 4ZPTR 2C2NA 4DV7J 3FBCA 1FRLA 1MWYA 2W2OP 1TU0B 1RB0A 1RKIA 2FHJD 4Y00A 3FBEA 5HBMA 2XQCA 1NB2A 5KG2A 4TU7A 3IWNC 3PR5B 5DDRC 2FTRA 2HHTA 2FVSA 4WFBQ 3LH2S 3RB6A 3GSIA 2FLLA 5RUBA 2RU3A 1H2TZ 3FEYB 5KFYA 3JAMU 1VQYA 3AQPA 2EFQA 2BKPA 4LSLA 4RW9B 7FDRA 3CJ3A 1KQGB 2JL9A 3DRSA 3BREA 1BD6A 2GVZB 4RW7A 2WHOA 1S1XA 2XI2A 4DEZA 5F8JA 5CZXA 3Q8RB 3MMJA 3CCSS 9RUBA 2MKCA 1B7YB 4Q7AA 1UVJA 3PW4A 1BY9A 2HG4A 2VG7B 2Q43A 2L41A 1WOSA 2L9DA 2PN6A 3QGGA 1UP1A 4CZCA 4RNFA 1VQMS 3FCWA 4X4OA 3HHLA 2BQUA 2C2KB 2HNYB 4PYAA 1VRTB 3GV8B 1FHTA 2P9CA 3OFEA 3A3OB 4DUZJ 3J7AN 3BR8A 4NMXA 5M2PA 2GVDA 4DSJA 3A8EA 3AB2B 3MTJA 2VA3A 2HFZA 3HO1A 3P5BP 4MFBB 5C5JA 3FNNA 3HX9A 4ZIWA 4IR9A 3QWPA 2E1CA 2QMUB 1E6YB 1CVJA 4NRTA 1HQEA 4F2RA 3FSYA 3HSDA 3M05A 3Q2TC 4ED3A 1PAUB 4RW8B 2AF6A 5CYQB 5IZHA 2V4JA 1S12A 4U96A 4LF1A 2X3DA 1P1LA 2DIUA 3BO3A 1SQFA 2XI3A 4B3SF 3I0RA 2MQLA 4H4MB 4CO3A 3T1AA 1EARA 2YWWA 1TQLA 1CJKA 2BE2A 4CYUA 1OO0B 2I8EA 4B02A 2K7KA 4AE5A 3GYXB 4DQQA 2BYCA 1PO6A 1CC7A 3EPIA 2J9CA 4NZ7A 4JI6F 2VU5A 1H74A 1S1WA 3DRPB 3KG4A 4OZ5A 1RI7A 4R25A 4DQIA 1Q8BA 2GS8A 4GVBB 4CWBA 3RG6A 2XZWA 3TVYA 3G2XA 2F9JA 4IDKA 5HP1A 4G1QB 1RWXB 3WX8A 1XQIA 2EI5A 1VIOA 1SJRA 3CD6S 4Y6IA 3GLJA 4USHA 4CDIA 4ED6A 5A8RA 1JNRB 3B82A 2ZVSA 4JOUA 2HHHJ 2IJNA 1K8AT 1S4FA 4F36A 2XLKA 1DRZA 3W2VB 3O3LA 3UO0A 2QZ8A 2KRRA 4LF9F 1KWMA 1ZETA 2QLJB 3NG8A 2YNGB 4ZJLA 1UJ4A 1QY7A 3KK2A 2B6AB 4IG3B 1Q8IA 3CD5A 1DFDA 2HNDA 2R8HA 1T94A 3KLHB 3TVKA 1T9TA 2VPYB 3J80Y 2KFNA 5CAAA 2OPQA 1N5VA 5C2CA 3QO9B 4NMLA 2CPJA 3MEGB 5LSLA 1A0OB 2FJVA 1Z1ZA 3FGVA 1AZSB 1H73A 1NJXA 2RRAA 2BW7A 4RL1A 3CSKA 1BQNA 3HVAA 3PR4A 1SH2A 1JLAB 2NZCA 4HH1A 1EKRA 3EVOA 4X65J 1MWZA 4UQGA 4KAIA 3N5FA 3IAM9 2B8PA 2XCPA 1ZPVA 2IYIA 4JI3J 4NLRA 3CT9A 2CQPA 2K3IA 3ZZRA 5GAGU 3K58A 2V50A 1AFIA 2WOMA 2DO0A 2GQ2A 4NI2B 1X5SA 1X0FA 3QZ8A 4U9RA 1KRPA 2AJ4A 1O5JA 3GYGA 4LF6F 1YKWA 1BHNA 4NLQA 4ECZA 1GMVA 2JC0A 2VFRA 1L3UA 2DNYA 1UVIA 3MECA 5HROA 4N41A 2MGZB 2D1CA 1NB7A 2CQ1A 1S48A 3PJ9A 1VQ9S 1VQPS 2A0FB 3M2RA 5J2MB 4ED0A 1PJ5A 5KFSA 2MJNA 4MTPA 2QSFA 4BHQA 3OTOF 3DLHA 5HATA 3TX0A 3L7OA 3K8VA 1LEOA 3SBMA 5E41A 3MCNA 4HHJA 3Q8QB 2YNHA 5KT7A 3DLJA 1LWXA 3AQOA 5BYRA 1JLBA 3A3NB 1ZAXA 1S1VA 5DQIA 2YKMA 2NCKL 2F4VF 1HR0J 2QMXA 2WVBA 3IAS9 1TV6B 4JI7J 2V69A 2DK2A 3ZTOA 2KFYA 3HHLD 2XYPB 2EFPA 1IKXA 2ZFHA 4DR1F 5EGYA 1FNMA 4N8NA 4L3NA 1JLEB 4C8ZA 3CCLS 2ZBCA 3CD0A 4E8UA 5A8KB 4DFMA 4L74A 2UUTA 1KQFB 4MK8A 1TAQA 5IC6B 4DFPA 2R3VA 1NKEA 4GMKA 4ZMMA 5F8GA 3T1YJ 1HBOA 5HK4A 1IKWB 2QO3A 2C2EA 1D9DA 1SUQA 2ADCA 2E1AA 4F0HA 2DGOA 4L6V3 2VJVA 3MMCB 1SL1A 4LJMA 3IG1B 3MPYA 8AT1B 1Y5IB 2ZBQA 2VBZA 4YQWA 3U27A 4O4GA 3HP6A 3POTA 3LO3A 2HIQA 3D7SB 2CPZA 1XNRF 2R42A 4WF9Q 3KHLA 3EGZA 4C0BA 3V6KA 4ZVFA 1LW2B 1TAUA 3ELHA 3PO5A 4FS2A 4NLYA 4ECXA 2UUBJ 3OV7A 2AW0A 4E98A 3OHBA 1DURA 2IY5B 3TAPA 4OYPA 4F67A 1A6LA 1HARA 5B0GA 2YKPA 1H38A 3L09A 3Q8SB 4AL7A 2DO4A 3KK3A 4BWMA 3TANA 2JVOA 4PUOA 5THWA 1UZDA 2UUCJ 1S76D 4X66F 2CDRB 1NDLA 2VB6A 2AYBA 2RF2A 4MK7A 1RWOB 2YNFA 3NRBA 2M7SA 2XLIA 1IM6A 1F5CA 2Y1JA 5KG6A 2E66A 5LMNJ 1RWMB 3TWZA 4KRWA 1RK8A 4CLYA 5E7OB 1DQAA 3ISNC 5IT4A 4UT4A 1EETA 1UFLA 2M4MA 1HBNB 4QW8A 5CQGA 1VC6A 1U0SA 2ROGA 4J9RA 2Z2LA 4ZCLA 1FDDA 5HO4A 3MUMP 4FXVA 3K5NA 4DWIA 2PFDA 3R5GA 4RNMA 3PEHA 3KHGA 3MZIA 3EDQB 3Q2SC 5KT4A 1TFYA 3TJ8A 4TXSA 2HMIB 4ECUA 1APSA 3VCDA 3WIUA 1WHVA 2D41A 2AQ4A 1YZ6A 1N33J 2Z8QA 2NXCA 3DOKB 2GO8A 1BQMA 2PSZA 4NXMJ 3FCVA 4O44A 5GAGI 2AJ0A 3H5YA 2WW4A 5KFBA 5F3TA 2HQDA 4DL5A 1YIJS 1A7GE 4KKOB 4KQZA 2R2SA 3D68A 4G1PA 1R8AA 3ZC4A 4DDFA 3RBXA 3HJFA 3PYEA 3TQ1A 3EGWB 5T41A 4BC9A 3MM7B 1NDCA 1RTDA 3C2PA 2O67A 2OSQA 1RBOB 5D8HB 2PMZD 2KJWA 3SQGA 3JTOA 5L9NA 1SIZA 2FIUA 4D3HA 3CWJA 4K5SA 4ECYA 5L39A 4DLGA 4DR4F 1NNDA 3MR6A 1S4EA 4I2QA 3VAIA 1WI6A 2IAJA 2UU9J 2RT3A 2ALZA 4LBPA 2DY9A 4FNIA 5H9EJ 3DU5A 1V3ZA 1NK9A 2PE8A 1IR1A 3IR7B 2F8EX 3NWRA 4OZNA 3HJVA 2AIRB 4KHPJ 2EKYA 2OGUA 3V2UC 4DL0C 2ZM6J 1DTQB 1H98A 3LQVA 4XK8C 3CC2S 2XG8A 4DQSA 3NLCA 1EP4B 1KFDA 4PG5A 2P5VA 2CQ4A 5J1EB 1WHWA 3DXBA 1KHVA 2PEHA 2E5IA 3HDSA 3M2UA 1WTBA 5AXKA 4DX8H 1HIYA 1N8RT 2CJKA 1T9UA 1NK0A 1QSSA 1R3NA 3V5RA 2RKIB 1PBAA 3CMQA 1J27A 3R7NB 5JMNA 1DJ0A 3DI6A 2I0XA 4DR2J 3QSIA 3E3XA 2XEXA 3I4PA 3OSNA 2J9DE 1WORA 3BBCA 4YY3F 2I5JB 3CB4A 2DITA 2XZDB 4DSIA 2CZ4A 2MHEA 3O1LA 3ZNJ1 3FFIA 1I51B 4CM0A 3TEGA 1XBWA 3M30A 3UD5A 2KXNB 3ENAA 3SFUA 3R5DA 1UPMB 5IV4A 5M2UA 3SXLA 2GIFA 5JVHQ 2AT1B 4IH5A 1Q95G 4KH0B 5FD1A 3OHAA 1GX5A 4FXDA 1TL4A 4LMZA 5L1IA 1QVFR 4RU9A 1V5IB 2KG1A 3GIKA 1FERA 3V4MA 4NL5A 4JV2A 4RBUA 5CD4H 3CCQS 2LA6A 3ZZOA 1AUDA 2MJUA 5KFHA 5D15A 4WJBA 5KFDA 4M5HA 3B78A 1LWFA 2NUHA 1I1GA 1NKBA 5E33A 1WF2A 1FJGJ 1LFWA 3W64A 4CLTA 5DDOC 3UCZP 2HGNA 3NP5A 4CT8A 3AFGA 1SC4B 4KH1B 1VBZA 3GJRB 2NPFA 2B7CB 2YKNB 2HHXA 1S99A 2B9WA 2GHVC 1HR0F 2U1AA 4ZPDA 2G0CA 3PIOQ 3IS9B 1ZS6A 4HKQA 3JYTA 2BRKA 1FKPA 2AX0A 4ALZA 1YITS 2KXFA 2AJFE 1TKXB 3CJRA 5D0GA 4Y2AA 4RO0A 1M1KT 4YDXA 4WP9A 1IBLJ 3FEXB 1UVMA 1M90T 5CZVA 5AXNA 1XMQF 4H4OB 3OBIA 1MROB 2DNZA 5ETSA 4ED1A 1UTAA 1U24A 1PSDA 3ZNUA 2ATLA 3DKDA 4AXIA 3E2EA 4C11B 2MKSA 4KY3A 5KAKA 1RBLA 4LQ9A 4J9OA 1NJZA 1RT3B 1S5ZA 2UXDF 3BBBA 5C42B 2E9RX 1XNQJ 4IOAQ 2RMLA 1WC0A 2ZZNA 4M5LA 2BJ9A 4P2XA 2HAIA 3AD8C 5KFMA 2PO4A 4DR3J 3FQKA 1KLNA 4YR3A 1K47A 3KDNA 1G3OA 1L3KA 1JLCB 1R0AB 3RB4A 1VS3A 2LMIA 3MAAB 3NNHA 2D74B 5LL6d 3GYNA 1OQ6A 1VC0A 4OZ1A 3M1VA 3H98A 4I69A 4NCAA 2X1AA 1S0VA 4DPYA 5AJ3J 5KOXA 3M8WA 5K14B 1F1BB 5DM6Q 2UUCF 4PCQA 3GP9A 2OPSA 1O6XA 4DCOB 1NBEB 1IKYA 2ZOFA 1RWWB 1C1BB 2NUUG 2WW8A 2KTQA 1RT4B 3N4WA 2CPDA 5I3UA 2D9OA 2QC3A 2KXHA 2Z0GA 5LMNF 3VVTA 4F8RA 4HTJA 2DRAA 1UEVA 1GK8A 4A46A 4QR0A 2ASDA 2PD1A 4LRCA 1ZAWA 3DMJB 2FVRA 1U2FA 1HW9A 3N01A 2VASA 3S1TA 4QYZK 1X5OA 1LXJA 4LR7A 1TKZA 1YSJA 4A8YA 4C3KA 4FPIA 2QYGA 3BH6B 4PWDA 2ZH2A 4J5OA 2QV6A 1RWNB 4C8YA 2VQFJ 4B3RJ 4ETXA 1FKOB 1FJEB 2IBKA 1KVIA 2UUAJ 2K7JA 3IM8A 2QTWA 3PX4A 2ZZTA 2GQCA 3C19A 3HHNB 1N33F 2ZWOA 4OI1A 2L08A 3BGOP 4HDGA 2LXFA 2J7WA 4NXMF 1X4GA 4O0IA 1ZM4A 1HBUA 3ADAC 3HFKA 1HMVB 2H5EA 4C0HA 1RADB 4N8OA 3PFOA 1S0OA 3MR3A 4CO1A 3H7HB 3M32A 2GJ2A 2VBYA 1KSPA 1SJQA 1CBKA 1NEEA 2KJVA 1HWUA 1RA7A 2E9ZA 2A6MA 1TK5A 3IRXA 1HYSA 4PPZA 2IFXA 1G7CB 3MMBA 1T9VA 3N28A 2MYFA 2B4UA 2OPPB 3PYGA 4W98A 5HI7A 1GXUA 4MKBA 5AE2A 2VD3A 4DJBA 3TARA 1VLOA 1HWKA 1B0PA 3MOZA 4WZMA 3I82A 4X4VA 4QBUA 4XIUA 2V68A 2FLNA 2HHSA 3HXMA 3UCUP 3OTCA 3K2YA 3QYYA 2VG6B 2CIMA 2WONA 1U1RA 3S01A 2PFFB 3HULA 4JYAJ 1I94F 1HNWF 1SVDA 1UA1A 4KHMA 3KKFA 2U2FA 2M8DB 1NMEB 1ZPWX 4CT9A 1WKJA 2F8HA 1FFGB 4O3QA 3DM2B 2MQPA 3PY8A 2C1EB 3MI7X 4DX7A 3UVJB 2ROEA 1EKSA 1KKHA 4D3GA 3TVZA 4JI4J 1H0HB 1IQTA 1OY9A 2PMHA 4A8FA 1TUWA 3MPVA 3KHRA 1YJRA 5F3ZA 3PO4A 2I1RA 4MYTA 4P71A 3CPWR 3W2WA 2DHAA 1C0TA 3LWLA 2Z56B 1HKAA 2R7RA 3T9NA 1GTEA 2ZJPQ 4LT6A 3NL0A 2MZQA 2K1RB 3KHHA 4TLQA 4AFFA 3UR0A 1HNVB 3CDAA 4KV8B 4NCGA 4TKTA 1K73T 3OSPA 4XDCA 3KFWX 2W9BA 5KG5A 2XYHB 3RJMB 1CJUA 2AYEA 2V9KA 3W8GA 4IO9Q 4OHZA 4QIFA 3MEEA 4CQ1A 2BR0A 3UW1A 3QIPB 3OL7A 4XPCA 2RAQA 1MU2B 3HHLC 3GWCA 5KT2A 4QWCA 1CJTB 1YX2A 2BM0A 4JI8F 2AGPA 1HWIA 1NO8A 2EPIA 3SSQA 2R7OA 4OX8A 5LSOA 3PW5A 3VGVA 3TJAA 3EPGA 4KGVB 1TL7A 5D4PA 2R7TA 5F8IA 2J0WA 1LKZA 2JVRA 1S6QB 1VJWA 4WU3A 5KFNA 1U1KA 1N0UA 2YVSA 3DGVA 2DPJA 1T9YA 4DI6A 2EFOA 2HYIB 4Q45A 3QRPA 1NHKL 4WTYA 3W3SA 4KKOA 4I0WA 4IFYA 3DRRA 5HN0A 3ENVA 1M5SA 5IT9Y 3BSOA 4X64F 1ZYQA 5HMZA 1FNXH 1HD0A 4DF8A 3MM5B 1GMWA 3LA0A 1EZZB 3UCGA 2HWTA 4ANDA 3R7BB 4Z7CA 2VUGA 4EZ9A 4GO7X 3I55S 5A0YB 3GFYA 2JEJA 3W7BA 2J9DA 1HPZB 2HBZB 1N34F 1T0TV 4AYBD 3JTPA 2FY1A 3AD7C 2G13A 1E6VA 2HQGA 3ENQA 3KUGA 1RYRA 2HHWA 1VK3A 1S6PB 4EWTA 4OYAA 2B56A 5HVGA 3IGNA 4DCJB 2XMAA 3OR2A 1KOHA 3ICLA 2IRYA 2H9ZA 5J2NB 1FRXA 5F9LA 1Q0NA 4K4XA 4E0DA 4NYPA 4OYIA 2X1FA 3MPDA 1C4CA 4OX9J 3C6TA 3V4IA 3Q22A 4M5DB 7FD1A 5HMWA 1SKRA 1U6ZA 4L72B 4WYWA 2YKQA 3KJQB 4HR2A 5A6PA 3QNWB 4JV5F 2L3MA 2VOOA 3AOCA 3F44A 4OX6A 4R0JA 4QYRA 4J90A 2KG0A 4OYBA 2B7BB 2DT9A 4UZBA 4Z2XA 3NBPB 2FHOB 4DQRA 3QJPA 1F3FA 2JOQA 4X62J 2UV8G 4LRFA 3R9LA 3QMQA 3M8RA 2HSEB 3LALA 3OJSA 4DN0A 1S9FA 2G2YA 5MAOA 4HH0A 3HT3A 4RX6A 3M6XA 1H72C 2QSWA 1XR5A 4FPRA 1K0VA 3QRRA 2VBWA 4J9MA 1AXQA 4P6QA 4NZ0A 4ZPBA 3UDLA 2K2PA 1S10A 4JB8B 2B5JA 1S97A 2AEMA 4I7FB 4NLWA 5LMUJ 1N88A 4F50A 3FSXA 2N3LA 2JX2A 5DDQC 4DR6J 2E1PA 1B64A 1QM9A 4MKVA 3SDEA 2B9EA 2M2BA 4R8UA 2OAUA 3TAMB 4DUTA 1UJ5A 1TL5A 3ZZ0A 1RAEB 3ZO7A 5ETPA 3BQ1A 3H2VE 2CQHA 1Y5NB 2MQOA 3OFHA 5D3GA 3D6MB 2FJBB 4ICLB 1O51A 3PTWA 1X5TA 5LXRA 2ZKUA 4ECTA 4A8KA 1N5QA 3T19A 1HHTP 3LOUA 2H3EB 4CLKA 3HT0A 2BMBA 2N4CA 3G6ES 1URRA 1S9EB 4NEYA 2DY1A 1H7XA 4O3NA 3O6QA 3LP2B 2B51A 2HS4A 3DFEA 3IR6B 4FF4A 3KLGA 3V6DB 4ILMA 4EYIB 3UFCX 5HMYA 2XMJA 3GTYX 2IM2A 2CPYA 4NYZA 2XBPA 4KIAA 3BR9A 3BKFA 4A8WA 5BXIA 1YHQS 3PKMA 3Q8PB 2VPZB 1Z2ZA 1TFWA 2JZ5A 4H54A 3GFZA 3DLGA 3NOCA 1U0HB 4QIVA 3TUIC 3BGFA 1UVLA 4DU8A 1N32F 1TP7A 3G4SS 4A8MP 5DQHA 2WSFC 3M8ZA 5A8WB 2APOA 3MHYA 5D0HA 4GKJJ 1GAOA 1YWXA 3M8QA 4DZDA 3AJ1A 2NYIA 4ER8A 5HBMB 1HNIA 5JJBA 2LQBA 4ELTA 4FZVA 4JI4F 1SC6A 4Y34A 2A3JA 4ZLLA 1C4AA 2ZBPA 2FQQB 5GAEU 4RU2A 4DV1J 4RUAA 5L1LA 4TNOA 2RVJA 4LSLB 3H59A 4P9SA 3DHWC 1GTHA 1DQ8A 2DB1A 2QRRA 4TVAB 3NS7B 4NX9A 2V34A 3DRSB 4DPTA 4RW7B 3CDBA 4Y65A 1S1XB 4UUWA 3T6BA 1YVFA 3BN7A 4NZ6A 3ILIA 2FLPA 2EG1A 3UN5A 1RT5A 4A8XA 4KSEB 1XWLA 4K50A 5ETQA 1S0MA 3WQPA 4DXLA 4DX5A 1RQ0A 2RRNA 1OSCA 3GG1A 2O66A 3HD1A 3NGSA 1SPBP 3HHLB 3LW5C 3HKWA 2YY3A 2DNRA 2DGWA 2FUG9 3NAHA 3OLBA 3CNQP 5CH7B 2E1MC 2AKWB 4I2PA 3HHKA 4GRSA 2GVDB 2R9LA 3I31A 1FRIA 1S7IA 3MAQA 2XMWA 3LP1A 3EZUA 2HQFA 3DOLA 2WRMA 2OPRA 3JSRA 2BABA 1H7WA 2F1FA 2AEFA 4ED4A 1M5OC 2HBQB 2NSCA 1HQEB 4I6WA 2HNZA 2IA0A 3C3LA 1UPPA 4U67Q 4DV6F 2V4JB 3IBCB 4JI0F 5ETOA 2MKHA 4OMFG 2IMOA 4OZ2A 3BO2A 2EWHA 2QJ3A 1WD6A 4YUDA 4TU8A 5GAHU 3I0RB 2IJFA 3FDSA 3IWLA 4ZLNA 2ROPA 2BANA 2NXJA 2W2MP 4ZA1A 1CJKB 2BE2B 2QA2A 3FCHA 4CYUB 4DG1A 2VH7A 5KT5A 2DCUB 4Z7YA 4IH7A 4CH0S 3LAKA 4HEA9 4B9LA 4K8RA 4ZP6A 4ZOSA 5GMDA 1IBKF 2ZHOA 2V63A 4X4UA 1HWLA 3VHQA 3TUZC 2YTCA 5D4OA 1RAOA 2P9GA 3N6MA 1S1WB 5G4DA 4JI2F 3SYZA 4MIAA 4HT7A 2RS8A 4F3MA 5EX0A 4LR8A 1FA0A 3GJQB 4IDKB 3QWUA 5LJ5Y 2ZH5A 5HP1B 3CJSA 2VICA 2RHQB 4GKKF 1VQ4S 4LF8J 5EDWA 2YQ3A 4B9UA 4LF2A 4L73A 5F8LA 1PGZA 3PACA 1Y00A 5A8RB 3KWMA 1X0PA 4Q0BA 3DOMA 1QUVA 1LWEA 5KFGA 3TA1A 2ILZA 3Q83A 1HFEL 2Q3PA 4X4PA 1HNXJ 2ZH4A 4P73A 3EE3A 3J81j 3KLIA 4OQJA 2CQGA 5KFOA 2ZKTA 3KLEA 3KK2B 4Y2IA 1IBMF 4ZVUB 1KN6A 3J7ZT 2HNDB 2HZVA 1BUXA 1CPZA 3WC0A 1REVA 3GPAA 5IC4B 4YHHF 5AXMA 2OPQB 4KFBA 3FRYA 1VC5A 1FVSA 5D4LA 1W2IA 4MKYA 4OHVA 2X3GA 3CJ0A 1BQNB 1UEKA 1P8GA 3MD1A 3CMAS 5J2QA 1VK8A 4KTQA 3BQ0A 1V3RA 3NKYA 1ZA2B 3MEDA 3QT5A 2HBRB 2DGXA 2RDJA 2LU1A 2CNNB 5LMUF 2Y0SD 1BGXT 1U1LA 1RZMA 4QIGA 2RNEA 3BGRA 5B0EA 3QFWA 3TUJC 4CLSA 1VQNS 3M6VA 1CLFA 3CCES 2NZ4A 2WSEC 1YJ7A 3SEOA 2PI4A 5HMXA 1PYSB 1UFWA 2WOMB 1N5YA 3K0JA 3VGTA 3EVMA 2MZRA 4F25A 4ZIVA 3HD2A 1HNZJ 3T5HA 3D28A 4CCHA 1Q86T 4EZ6A 2DR9A 1N36J 3GIMA 2BACA 3I5AA 4AQYJ 2E5LJ 3RB3A 4WFYA 3MECB 5HROB 3T1HJ 3PXGa 1GNKA 1XIQA 2N7YA 2IBOA 1Y10A 2NREA 3CCZA 3FRZA 3K57A 4F3QA 2JFDA 3ILLA 3T5LA 3F56A 2KVIA 3ZZPA 4K0KF 3M2RB 2FHJA 3BYRA 1QSLA 2OELA 2YBVA 1R6YA 1X4CA 1IUJA 5GADU 1FTCA 3T9ZA 2VIHA 2Q6BA 1Q7LB 1OMSA 4TYBA 1ZM3A 2VPXB 2ZJRQ 2YNHB 2ZH9A 1JLBB 1S1VB 2IRXA 1RHUB 3FJ2A 4ZN3A 2YKMB 2KM8C 1FK9A 4BC7A 4YMEA 4N5SA 3F0NA 1M5KC 2ZDPA 5H9EK 4QWDA 1H3DA 3TI0A 1WC3A 2XNQA 1P9QC 2BV3A 1QTMA 1FT8A 1JLGA 4WKYA 1IKXB 1QLNA 2C3MA 3IWXA 1F60B 3D4JA 1P9YA 3CW2C 1PILA 1UWBA 3VVUA 3QBCA 3W5XA 2IHR1 4LVOP 1XTZA 1HBOB 1IKVA 3OUYA 2KO1A 3I5BA 4NASA 1SUQB 1T05A 1PAEX 5BJRA 3UPFA 2A2DA 1S1UA 5KG4A 2KL8A 4PKDB 2BJEA 1R27B 2PMWA 3EMTA 2WAQD 1BLUA 5HSPA 3HSZA 3PIPQ 5KFZA 2F7VA 1SH0A 4O4GB 3POTB 5KFTA 3GCWP 3BJYA 1W26A 4DV1F 2LFVA 2IPOB 4I67A 4J9SA 5IFMA 2BDPA 1OY6A 2OTLS 1V5VA 2OEMA 2QGFB 3HK2A 5D78A 5KFPA 4RNHA 1WEXA 1JXEA 3KK3B 4PUOB 4WP8A 3RBEA 2ZD1A 5CYJA 1SXLA 2RF2B 2YNFB 2W4PA 4J9PA 2UXCJ 2GMHA 2CFXA 3J7A1 1BWEA 2CUYA 3MM6A 2VL1A 2A18A 2LQ9A 2WVFA 3A8KA 1SKWA 1YJTA 2RJZA 2W8KA 3RZAA 4U7CA 2G1HA 2HHPA 2ZBIA 1FWKA 1NK8A 1FO1A 3L95X 3MF5A 5KG3A 2FDNA 2EW9A 3CDUA 1OQ3A 3GJTB 1EETB 5I3PA 3K59A 1JLFA 4NXNJ 4FP9A 3QSYB 1U1MA 2G9OA 1M1GA 4CH7A 4FXWA 4NLSA 2Y3YA 1NPRA 3RAQA 3LP0A 2HVEA 1NJIT 4KPYA 2JH3A 3AOAA 1S57A 5IS2A 3L9ZA 4X4RA 4OI6A 3E8OA 2DNNA 1QE1A 4EYHB 2D69A 1KDNA 4CLPA 3QRQA 1U1PA 2R7WA 3OL6A 4S0MA 1S49A 2VPWB 4PXBA 4EEYA 3IM9A 4J9VA 3W9JA 4ECRA 3G86A 1BQMB 3GFHA 4O44B 2AP6A 4P7TA 2IVFB 1FFSB 1SJ4P 4J7CA 2YXLA 2MKJA 2JNJA 4A4JA 3B6BA 1TK8A 3M8SA 1HA1A 3JSMA 1RHJB 4QPXA 4DV0J 1GT8A 2LEPA 1X9MA 1AROP 3VAFA 1DHMA 2VONA 1FXRA 2ZVIA 1HHQA 2B9YA 5DGAA 1U6BA 3DYAA 4DL4A 2HZCA 2HKEA 2AYGA 1NSQA 1MWQA 4UW2A 1RTDB 4L3KA 2VC1A 3DDKA 4JI5J 2D9PA 2D3ZA 3DLKA 3SQGB 1S7HA 3I0SA 4OL8A 5GADI 2GMLA 1I3OB 4O3SA 4ID5A 4M63A 2E5JA 5K9FA 3UE2A 4QCLA 4F4YA 3BPDA 4I2QB 3FMBA 2K06A 4NLOA 5F8HA 4DV3F 2IAJB 3R7SB 2Z57B 3Q8YA 2DRBA 2KH9A 4RNOA 4ZPWR 2W9CA 1CJVA 2LA4A 3SI8A 2HRUA 2VFTA 2EKNA 3T5KA 1WKKA 2FZKB 1U2CA 3UWTA 3GB0A 3NOGA 2FYXA 1Y3KA 1U7LA 4JI1F 3M2UB 3G96A 2N82B 4X2BA 2RILA 5FDLA 3P3DA 3FK4A 3NS6A 3KTQA 2MB0B 2HFUA 1PYOB 5AE3A 1WSRA 2VFSA 1Y9OA 1RTHA 2P6SA 4P72A 3DI6B 2HZAA 2E9TA 3MR7A 2CJ9A 2CQ3A 4WU2A 2CADA 2XMMA 4YB7A 4J9UE 2FC9A 5E3RA 2ZUAA 3L4BC 3UNYA 3FFIB 5BYQA 4ZLPA 3M30B 3UD4P 4RLEA 2EBGA 1RTIA 4DS4A 4DPWA 1FRMA 3HF5A 2WK4A 2DGTA 2IYGA 4PAAA 1PCAA 4HHUA 1XR7A 2H4WB 1ZOTA 3WX4A 3NCRA 1JWWA 1RAAB 3C15A 3O44A 4RPFA 4K5RA 4AQYF 2E5LF 2R8GA 3C14A 4NLGA 3GSDA 3NCQA 1PJ6A 5IWAF 5BYSA 3GONA 4QPTA 3GFXA 2CQ2A 1KQSR 3TZWA 3PHEA 1LWFB 2UUWA 1XN9A 4FN5A 4ILRA 3BKUA 3H90A 4LF5J 2X1GA 3FUYA 3TZZA 2Z30B 1BWVA 4QOTA 5DZ7A 3MEKA 1J2VA 2QX0A 3AY0A 3OVAA 4WKRA 4PXEA 3UDEA 3Q86A 4C4WA 1KR4A 4IRDA 2H54B 4LFAJ 4F4KA 3P6YC 5KG1A 2RUGA 2G2ZA 1NRKA 4EO8A 3JYTB 1QTNB 2LDIA 1FKPB 1NAQA 4LF7J 2BQ3A 4LFBJ 1K1SA 1R31A 4Q2LA 1WG4A 1RT2A 3HZGA 1N5TA 3DHXA 1JKHA 3ZTPA 2OP5A 5BR8J 3GE9A 1HQUA 4F4WA 3H5XA 4XO0A 5F8MA 3CD7A 2RD5C 2DR5A 1ZAVA 2VQEJ 2J6UA 2FC8A 4PG4A 2W7AA 4ZVSB 2CJYB 3NNAA 1VFJA 1R8BA 3UN3A 5KFFA 3LAMA 1DQ9A 3NGDA 4B3TJ 1U4BA 3BDPA 1FD8A 4KGZB 3PG9A 1NH8A 3PDNA 1VRUA 4OZLA 2RUSA 3C6UA 1WKLA 5LXYA 4KR0B 4CO5A 1KQKA 5AE1A 2Y0BB 3JB9k 2HWIA 3R3TA 6AT1B 1LK7A 4AD6A 1R8CA 2ZH7A 3BQ2A 4M5KA 1Q79A 1SV5A 3CVKA 4MYUA 2W7PA 2J8AA 1U48A 1S6OA 4TQRA 2ABYA 3UN2A 1N48A 3G6VA 3ET6A 3W66A 2BE9B 1IJEB 1OWXA 3H40A 3M1VB 4CO0A 2V8VA 1U1OA 2W8LA 3U02A 9ATCB 3OXLA 3ZZUA 2GCFA 4K4SA 2IM0A 2G4BA 3IN5A 3UQSA 4MKAA 5IOLA 3MCMA 2OPSB 5IM0A 2AGOA 1IKYB 1YBAA 1YRXA 4TLRA 1RLDA 1KLMA 1IM4A 1OSDA 4FVCA 1VQ6S 1WC4A 4DLEA 3SCLE 2W2PP 4BBYA 3JQJA 5I3UB 1VCTA 4U95A 4PWUA 1LQ9A 1NXIA 4BWJA
chains in the Genus database with same CATH topology
4DR7F 4MFBA 4CQ1A 2BR0A 5CCMA 3JSYA 3CCJS 3UW1A 1YI2S 2AWZA 2Q79A 2BVZA 3HVTB 2XMUA 4F26A 3QIPB 3TAMA 3B4DA 1E6YA 3OL7A 4XPCA 3SZ2A 3S7RA 2FVPA 1QAIA 1HHSA 4DUYF 3DC2A 1ZTWA 1MU2B 2O01C 4Y2CA 3HHLC 5E2QA 3GWCA 3GILA 3CC7S 3DLLQ 4WXOA 1RTIB 3US5A 5KT2A 2QA4G 5B0CA 3VF0B 4QWCA 2EVZA 3VQSA 4RW8A 3HHEA 3T5JA 4BS2A 3KNGA 2BM0A 1C2PA 3MD3A 4JI8F 5CYQA 2AGPA 1HWIA 1SB6A 1NO8A 2OFHX 2EPIA 4OJGA 3SSQA 1D9FA 2R7OA 2HRYA 4OX8A 1NU4A 3CIMA 2OH2A 5LSOA 4WE1B 2YKOA 2DIVA 3PW5A 2QYCA 2J7KA 4C8MA 1OS5A 3ENWA 5EUHA 5L38A 1TKZB 4ICLA 3AB4B 3BB5A 3ZFVA 5E3PA 3EPGA 1M5HA 4C9DA 1RKJA 2PA8D 4F4XA 3AH6A 4KHRA 4H4MA 4PWDB 1FJCA 4PG6A 1VQ5S 4O23A 1VI7A 2C42A 2VKZG 3M8PA 5D4PA 5L8RC 2YX4A 3FSIA 2YWEA 1RT6B 3I9ZA 2KYZA 4ID8A 2IVMA 2R7TA 3TOQA 4ZK7M 1YQHA 3CJ5A 5F8IA 2J6TA 4C8OA 3RYLA 2J0WA 2GGPA 4IQXA 1LKZA 4ED7A 3A1YG 2B43A 3UNGC 2JVRA 2Z4PA 4FBUA 1S6QB 1VJWA 1ZH5A 3OPKA 2JEIA 4WU3A 3PW2A 1YJWS 4W90B 3CCVS 4F02A 5KFNA 3I9V9 1U1KA 1N0UA 2YVSA 4N77A 2BQRA 2DPJA 1S9EA 1RGVA 4RUCA 2FJWA 4Q2MA 2B4OA 2EFOA 1K0TA 2HYIB 2HVZA 4Q45A 4K4ZA 2LXUA 2QA1A 3CC4S 1N54B 1TKTA 5DM7Q 1S77D 4EBEA 1KS2A 1NJYA 2WCXA 3LP2A 4WTYA 4WCEQ 3W3SA 4KKOA 2N4DA 2ZOGA 2F3JA 4JV1A 2NSBA 4I0WA 4IFYA 4HL9A 3B8HA 3DRRA 5HN0A 2MKIA 4N76A 3V6DA 3ENVA 3VZIA 1M5SA 1WG1A 3CULA 1HBUB 5IT9Y 3DRPA 3BSOA 5JVGQ 3RB0A 3DLEA 1Q1KA 4X64F 1ZYQA 5HMZA 5F9NA 3M9OB 3K5LA 4DFJA 2DD8S 2XWYA 3K8WA 2BW2A 2M3DA 1FNXH 4DV4F 1HD0A 1FEHA 4DF8A 3CEDA 1R8PA 2XO7A 2GW8A 3MM5B 5I42A 5U47A 3M32B 2XY5A 1G1XA 3UCGA 2HWTA 2VV5A 2A1BA 5KFRA 3U1NA 1R89A 2VUGA 3N9UC 2KHDA 4GO7X 3SMZA 4EZ9A 3N6NA 3I55S 5A0YB 3GFYA 5KFEA 1W25A 2ZUGA 2JEJA 3W7BA 3V6JA 3QAUA 5J2PA 2J9DA 4G1QA 1HPZB 3SCJE 1N34F 1T8EA 2W24A 4FNHA 4AYBD 3JTPA 2FY1A 3IRXB 5IQ6A 1HYSB 2G13A 2J0XA 2UXBF 1E6VA 4I1TA 5E0OA 4KO0B 2HFOA 1KEKA 3ENQA 3MMBB 1RYRA 1JX4A 5B09A 4ZVGA 2HHWA 1VK3A 1S6PB 3KLFA 3T3FA 2KZMA 2YWHA 3HHDA 4EWTA 2PA3A 4CO2A 5C24A 2DNPA 4OJHA 3WZ0A 1RT2B 1U26A 1O8BA 2B56A 3D0GE 5JXSA 4Y2KA 3IGNA 2FGCA 1JKHB 3KLVA 4Y2MA 5KFXA 1M5VC 2FJXA 3RR8A 4YDDB 4GC6A 3OR2A 3RRKA 5D6GA 4OX7A 4IR1A 1KOHA 3ICLA 5A8WA 1HQUB 5KFWA 1HI8A 2IRYA 2LDYA 2H9ZA 3W2VA 4ZPTR 3SV3A 3THPA 3VQTA 4R0EA 5J2NB 1FRLA 1FRXA 1MWYA 1U1NA 4DV7F 5F9LA 2ERRA 1RT7B 2WONB 4K4XA 4E0DA 4NYPA 2ZH8A 3OXFA 2X1FA 1RKIA 2CPXA 2YNGA 4HTIA 4I6YA 2FHJD 4Y00A 1C4CA 3Q24A 3ISZA 5HBMA 3CO9A 3F73A 1FXLA 2FJEB 3E01A 5KG2A 4C0OC 3C6TA 4TU7A 3Q23A 4OX9F 3V4IA 3IWNC 2XSJA 2B6AA 4IG3A 3Q22A 4M5DB 3PR5B 5DDRC 2FTRA 1VRUB 2HHTA 2FVSA 4WFBQ 3C6UB 3KLHA 1Q81T 1RYSA 7FD1A 4NA2A 2GMJA 3CDEA 3LH2S 5HMWA 1SKRA 1U6ZA 3RB6A 1QAJA 2UVRA 4FF3A 2V2KA 2FLLA 2V8GA 4L72B 5I3QA 2CG4A 2LKZA 2RU3A 4WYWA 4ECSA 1H2TZ 2C3UA 3FEYB 5KFYA 2YKQA 1VQYA 5KOWA 3AQPA 4FBTA 5A6PA 2EFQA 2JLEA 3QO9A 4MIBA 5A6WA 4LSLA 5H1SV 2KT3A 3MEGA 4RW9B 1SV5B 7FDRA 3TA0A 4JV5F 3CJ3A 2NPIA 3N79A 2W4DA 1KQGB 2L3MA 2VOOA 2JL9A 4TU9A 3F44A 3DRSA 3KG0A 3BREA 1BD6A 3AHPA 2E44A 4OX6A 4RW7A 1YJNS 2V4RA 4R0JA 1AFJA 4QYRA 2WHOA 1S1XA 4QW9A 2XI2A 4M94A 4FYDA 1F5AA 1O0PA 4PQAA 4DEZA 1JLAA 2JHEA 3ZZZA 1T95A 4DOZA 2KG0A 4JBCA 1YGYA 2B7BB 2DT9A 4OFZA 2I2YA 4Z2XA 3IFEA 5F8JA 3NBPB 1VQOS 3FVYA 5CZXA 3Q8RB 2NQPA 2FHOB 4DQRA 3MMJA 1NHVA 4IO1A 5EX3A 3CCSS 4MIWA 5CYMA 3QLHA 3QJPA 2JOQA 2MKCA 3W2WB 1IR0A 4Q7AA 5DO2A 5EWFA 2C3YA 2UV8G 3OL9A 1C0TB 4X62F 1UVJA 3QMQA 3M8RA 1JJ2R 5KG0A 2FPHX 2MZSA 3RRHA 3PW4A 3SSSA 3LALA 3OJSA 1BY9A 1FE4A 4DN0A 1W2BR 1S9FA 4W92B 2YNIA 2W7OA 4LUBA 2HG4A 5MAOA 4HH0A 2VG7B 2HGMA 1UW4A 2Q43A 2L41A 1U45A 2O1PA 3HT3A 4RX6A 1IQZA 2L9DA 2PN6A 3M6XA 3QGGA 2QSWA 5F0WA 1UP1A 4CZCA 2R7VA 1XR5A 3FEZA 4FPRA 4RNFA 1VQMS 1K0VA 4YP3A 2VBWA 4J9MA 1UA0A 1Y7PA 2YWFA 4X4OA 3HHLA 1AXQA 1D9AA 4P6QA 2BQUA 1TL3A 2UVWA 4NZ0A 1UKUA 4ZPBA 3UDLA 2HNYB 4NCGB 4CI0B 4EGLA 1VRTB 5IM0B 2K2PA 3GV8B 1S10A 1FHTA 1HBMA 2GNKA 2P9CA 2B5JA 1XR6A 3BO4A 1GXLA 3OFEA 4I7FB 4NLWA 3H4DA 3CUNA 1KLMB 4DR5F 2LYVA 2CQBA 3IA0A 2W9BB 2OD4A 1N88A 4F50A 2HLUA 5DLFA 4U6PA 4DUZF 2YH1A 3BR8A 2LU2A 2N3LA 1JNZB 3FSXA 5M2PA 2JX2A 5DDQC 2R2UA 4DSJA 4Y3CA 1QM9A 1B64A 3R5BA 3QGIA 3A8EA 2M2BA 3SDEA 4DR6F 1P6TA 1NK5A 2XNRA 3AB2B 3MTJA 3GV7B 5K8PA 2MZTA 3MEEB 2VA3A 2HFZA 4R8UA 3PJWA 2MGZA 2I38A 2OAUA 2HPUA 1U2RA 3HO1A 5B0FA 3CGIA 4MFBB 5C5JA 4J9QA 3FNNA 3HX9A 2DNMA 1MNEA 4IR9A 3QWPA 2DCLA 2IA6A 1VQKS 2DHGA 2E1CA 4KT0C 3TAMB 1E6YB 1YTYA 1S79A 1Q78A 1CVJA 4NRTA 1HQEA 1UJ5A 2X51A 5J2MA 3DRYA 1TL5A 4F2RA 2NR0A 3FSYA 3CF5Q 1U8SA 3ZZ0A 3M05A 3Q2TC 4ED3A 4RW8B 4DFKA 3I96A 2AF6A 3CJ2A 4MAKA 5CYQB 5IZHA 3L3CA 2V4JA 2MXYA 3BQ1A 3H2VE 4M8LA 4X4QA 3PRBA 4OJ1A 2Q66A 2CQHA 5HLFA 1Y5NB 2MQOA 3OFHA 1P1LA 5D3GA 2DIUA 1SIWB 2R4FA 3BO3A 2XI3A 1WHYA 4OZJA 2FJBB 2KDOA 4ICLB 4A8OA 4OHWA 4B3SF 3I0RA