1VQMS

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vqmS00
2B0GA 1WWHA 2DNHA 3CCUS 2HZCA 3CCLS 4EGLA 1N52B 4TU8A 4OZ1A 2OJ3A 4BS2A 2RS2A 1Q82T 2YH0A 3VAFA 1M5VC 3CTRA 1H2VZ 1S72S 3RW7A 4P6QA 2CPHA 3ZZZA 2JWNA 1VQ6S 1N8RT 2HGMA 2DO0A 2KRRA 3SMZA 2CPFA 2F9JA 2M9KA 5JVHQ 3UCUP 2OIHA 3MUMP 2CPDA 2RVJA 4WF9Q 1OO0B 3CF5Q 1HA1A 5GMKa 1H2UX 2FC9A 1VBYA 1FO1A 2RU3A 2KXFA 1X5OA 2DGUA 2MMYA 2VONA 1WG4A 2NZ4A 2CPEA 3VAKA 2KYXA 2QEXS 2HGLA 1RKJA 1U1OA 2LA4A 2DGWA 2MZTA 4OZ0A 3CCJS 1K8AT 3TYTA 1FXLA 4W92B 2MZJA 3H2UB 2YKAA 2U2FA 2KM8B 1SJ3P 1P27B 1UFWA 3G6ES 4WCEQ 2MKHA 3B4MA 2RQCA 1VQLS 2CJKA 1QVFR 3RW6A 2CQCA 1AUDA 2MKSA 3B4DA 2LYVA 2DHGA 3MD1A 4TU7A 1WEXA 1X5SA 3D2WA 3THTA 1X0FA 4WKRA 3J7YU 1FJEB 2DK2A 1PO6A 3VF0B 2CQ4A 2OSRA 2E5IA 2DGQA 2DGXA 1SXLA 2DHSA 1HD0A 1JJ2R 3BS9A 1YHQS 3CC2S 5FJ4A 1VBXA 5IM0B 1BY9A 1WHYA 1X4FA 2OSQA 2DH7A 2CQ3A 1X5TA 5DM7Q 1IQTA 4PR6A 2I2YA 3CD6S 1U1MA 3I55S 2G1DA 3UD3P 2M2BA 5D78A 1Q86T 3UWTA 3JB9k 1M5PC 2MQPA 2VODA 2EVZA 4PKDB 5DDQC 4Z2XA 4WFNQ 1KOOA 3ZZYA 5GAHU 3CCQS 2X1BA 5IM0A 3CULA 2Q79A 2DGOA 1X4CA 4A8XA 5LSLA 1P1TA 2SXLA 2F9DA 1K9MT 3LPYA 2J8AA 4PRFA 2J0SD 1R8HA 2LMIA 2DNNA 1KOHA 2RT3A 3CMAS 4YUDA 3VAGA 1HD1A 2RRAA 1HL6A 2XS5A 2CPJA 1X4EA 1VQMS 2RQ4A 4Y0FA 3VAMA 3CCES 3P49B 1YJNS 2HVZA 2ADCA 5LSOA 2DGTA 1H2TZ 4WFBQ 1VBZA 3L3CA 2V94A 3IWNC 1WF0A 2DNLA 4FXWA 4F26A 2E44A 5LJ3Y 5DDPC 3FEXB 2VOOA 2LEBA 2KU7A 3CMES 1JJHA 3EGNA 4C7QA 2QA4S 2XS2A 1WHXA 2KG0A 1NU4A 3THPA 2OTJS 2L41A 4F25A 4FXVA 1WG5A 5GVQA 3Q2TC 1X4GA 3P3DA 2QFJA 2YWKA 4QQBA 2LQ5A 3U1LA 2DO4A 4TU9A 3MOJB 2DNZA 3S8SA 3P6YC 3NS5A 3VALA 1U6BA 2DHXA 1L3KA 2DNKA 2E5HA 2L9WA 4CH1A 1FNXH 2MHNA 5CXTA 5D77A 3CC4S 3HI9A 1QM9A 4C0OC 1D9AA 1SJRA 2KXHA 2KH9A 1H6KX 4QU7A 2MSSA 1U1RA 2G4BA 2CQPA 1DZ5A 1WHWA 3NNCA 2DB1A 3NNAA 2YTCA 1U1PA 2D9PA 2M88A 3MDFA 1VQPS 3UCZP 1A9NB 1WHVA 1KC8T 3J7ZT 1N54B 3S6EA 3CC7S 3VAJA 2MZRA 3US5A 1U1LA 4WFAQ 3BO3A 1U1KA 2I38A 2LCWA 1YWXA 3U1MA 5LXRA 2CQGA 2CQIA 1WG1A 2MB0B 2YH1A 3K0JA 2KFYA 2MKKA 1VQ5S 2N3LA 3PIOQ 1FJ7A 2MYFA 5H1SV 2RUGA 5GADU 2MSTA 1VQ8S 1KQSR 2KVIA 2MXYA 5DM6Q 1ZZFA 2MPUA 3MD3A 4YOEA 5JVGQ 2DISA 2F3JA 2KRBA 2FY1A 3MUTP 2MQLA 2AYGA 1RK8A 2FHOB 2KN4A 1F9FA 2CPYA 2BOPA 2D9OA 1DBDA 1CVJA 1UW4A 2MKIA 3V4MA 4IO9Q 3Q2SC 2XNQA 1WEZA 2U1AA 4CH0S 2DNPA 4CQ1A 2J76E 1U1QA 2LEAA 2AYBA 2DITA 2M8HA 2DNGA 1KD1T 5DDRC 2NLWA 2KT5A 1NJIT 1M5OC 2ZJPQ 2ADBA 1ZZNA 1NO8A 2EK1A 2CQ2A 1WELA 2L08A 1U2FA 3LQVA 2M70A 4ERDA 1G2EA 3TP2A 5MLCV 2HYIB 1M1KT 2GO9A 2MJNA 1WI8A 1URNA 1FJCA 5DETA 3CCSS 4U67Q 2RRBA 1VC6A 4ZKAA 1SJQA 2MZQA 1OIAA 1VQOS 3BEGB 4QPTA 1X5PA 1OPIA 1UAWA 5LXYA 1S79A 3R27A 5IFMA 2ERRA 1Q81T 3MI7X 2M4MA 2UP1A 2XB2D 2N82B 2MZ1A 4Y00A 1FHTA 2AYMA 2KHCA 4LIRA 3CCMS 3DLLQ 2DNMA 4ED5A 3R1HA 3CCRS 1YTYA 1K73T 2K8GA 2RNEA 2CQ1A 1SJFA 1U1NA 4C4WA 2XNRA 5EN1A 3G71S 3R1LA 2X1GA 5BJRA 2MJUA 3NS6A 4V19X 1O0PA 2MZSA 3CPWR 1U6FA 3S7RA 1WF2A 3EX7B 1VQ4S 1SJ4P 4UQTA 2DGSA 2PEHA 2CQDA 3SDEB 1JMTA 2N3OA 2JVOA 2MQMA 3G8SA 3CXCR 1YIJS 4WIIA 2DH8A 2DIUA 5HO4A 3MXHP 1VQKS 2N7CA 3UCGA 1VQNS 3PIPQ 3TO8A 2BZ2A 4QU6A 5CYJA 2MY7A 5HL7Q 2FPHX 1JJ4A 1X4BA 2CPZA 3SDEA 3G9CA 2M7SA 3H2VE 1WI6A 1A7GE 1X4AA 2AYEA 2MKCA 3S01A 3DXBA 3MUVP 3NMRA 1VC5A 4IUFA 5DDOC 1UP1A 2FC8A 1DRZA 3VAHA 2CPIA 2GHPA 1Q7YT 2RS8A 2CQBA 2JRSA 1YITS 4F02A 3VAIA 2DNOA 3BO2A 1XN9A 3UE2A 2XSFA 3MURP 2M8DB 3HHNB 2VOPA 3I56S 2DNQA 2M52A 4TLQA 5CA5A 4IOAQ 2X1AA 1PGZA 2XS7A 2KM8C 3BO4A 1X4DA 1DHMA 2K3KA 5ITHA 1YJWS 4RU2A 5GAEU 2E5JA 1WF1A 4YB1P 3N9UC 1B7FA 2MQNA 3G96A 1M5KC 2LA6A 5IQQA 1WTBA 1VC0A 2MY8A 3G4SS 2M0GB 3P5TL 2PE8A 1WEYA 2E5GA 1QVGR 2DHAA 2KI2A 4IOCQ 3SXLA 1VQ7S 1M90T 1YJ9S 2EK6A 2HGNA 3CCVS 3FEYB 2CQHA 2LKZA 1ZH5A 2LECA 3EGZA 2J0QD 5GAGU 2D3OR 1OWXA 2O3DA 4W90B 2LXIA 3ULHA 4LJMA 4LMZA 2JVRA 2DH9A 4J5OA 4M5DB 2A3JA 3G8TA 2DNRA 2CQ0A 1YI2S 2DIVA 2DNYA 2ZJQQ 3OW2R 1D8ZA 2WBRA 1VQ9S 2KG1A 2DGVA 2LXUA 2MGZB 2KXNB 1W2BR 2AD9A 3UD4P 2MQQA 2CPXA 2X1FA 1X4HA 4UY8T 1N88A 2G0CA 1FT8A 3CUNA 2JX2A 3IRWP 2MQOA 4CIOA 2ZJRQ 2OTLS 5LJ5Y 1R8PA 3NNHA 2MKJA 2MGZA
chains in the Genus database with same CATH superfamily
1PSDA 2JEIA 4TU8A 5G4DA 2Y8WA 3C16B 2MQ8A 3QT5A 1KQKA 2ZH5A 2DO0A 5DGAA 3IR5B 4WF9Q 5L46A 2B8QA 2MDAA 3CF5Q 4CZCA 3CSKA 3W62A 2BMBA 4F67A 4MIAA 3DDIA 4W92B 5C7PA 1XR5A 3P8BB 2W7OA 1TVRA 1VQLS 3HKZD 2ZE2B 1BQNA 1X60A 1YBTA 2J7KA 3GP9A 2DR6A 3OVBA 3V6DA 2DK2A 3U27A 1RT4A 1CJUA 3D3CJ 1J27A 3RB4A 4B3MJ 3BV8A 4HL9A 4CTAA 5DM7Q 2HFSA 3I55S 3SZ2A 3TJ9A 2EG2A 4R8UB 3PNIA 3OTOF 1R31A 2XMAA 2ZHBA 2J6UA 4LF8J 3LPYA 1RSCA 1DQ8A 3DOLB 2GAGC 2EXUA 4PCQA 1B4SA 1UPPA 1XR7A 4YUDA 2WSCC 4WWSA 3UR0A 3NCPA 1UJ5A 2VA2A 2UXDJ 3FGVA 2FD2A 3Q8RB 1KQGB 2VOOA 1H3DA 2G0IA 3HSDA 2F65A 2QLWA 2XLIA 4IYQA 3T6JA 1YQHA 3J80Y 1WACA 4RR5A 5LM7E 3DM2A 2XULA 3UI3A 2DO4A 3PJ9A 2DNZA 3L4BC 4X4RA 1FXRA 2Q43A 3D7SB 3VQSA 1L3KA 3LF0A 5D15A 3K5MA 2RKIB 2UUAJ 4WJBA 4TY8B 3I5CA 3BR9A 2WW8A 2VUGA 2VPZB 1IR1A 3MTKA 5HP1B 2K1RB 3ZNUA 5AT1B 3WX4A 1IN0A 2HNYA 5KG7A 3GLJA 1U2RA 3FFIB 3K0JA 1JLAB 4B9MA 3QAEA 4J9RA 3GJTB 2KDOA 1VQ8S 1RT6B 3KHRA 3R2DJ 2F3JA 3LP2A 3LPEA 2XI2A 1D1UA 1RYSA 4MIBA 2AYBA 1KD1T 4F3QA 3B82A 4Z7CA 2ADBA 1TFYA 1VK8A 2LFVA 4LF7J 5B09A 4H4OA 5DETA 3JYTB 4ZKAA 1SJQA 1VQOS 1I3OB 2V0NA 1EZZB 3LWMA 1UAWA 3MI7X 3GR0A 4Y00A 4HI1A 2VBXA 1S59A 1YZ6A 1LWFB 1RT5A 7FD1A 4OX7A 2CJ9A 2PMZD 3LGHA 5KFXA 3PR4A 1U6FA 3S7RA 4EWTA 2IM1A 3MEGA 2OI2A 2HAFA 1EHWA 3TO8A 3KLHA 2VFSA 1F60B 4DG1A 5CYJA 4ELUA 1UEUA 3PACA 1CC7A 3G9CA 1M5HA 2VD3A 1X4AA 2DVIA 1HBNB 5CQGA 4Y65A 2BE2A 3VAIA 1IKVA 3FQLA 3RTVA 2ZOMA 1W25A 2J9CA 4J90A 3GR1A 4OZLA 1DHMA 3D9BA 3KFWX 4CLLA 2CA9A 1RTZA 4FYWB 2LA6A 2DKOB 2FB0A 1BUXA 2GMJA 3QJJA 4OYIA 2OELA 1BQMB 2BW7A 1M90T 2GQQA 1ZA1B 5KFFA 7AT1B 5GAGU 3H7HB 4K5RA 4Y34A 3A4TA 3JAMY 1V3ZA 2GO8A 4U7CA 3W9JA 1XNRF 3ZZUA 4A8WA 4ER8A 1N88A 2O66A 3QPIA 3O8WA 4CIOA 5I4MA 1CBKA 3MM5A 5LJ5Y 2A2CA 4I2QB 3CCUS 5KFHA 2IFXA 4DF4A 5KFAA 2C2ZB 3HHEA 5FIIA 1D0EA 2RUSA 2B4VA 4ZVGA 3CTRA 4HTIA 2M3DA 2JWNA 3MEDA 4FPIA 2KRRA 2CPFA 3R5DA 2ZNZA 4JP8A 3PFOA 1QLNA 3FCHA 4IO1A 5IV3A 5BYQA 2KYXA 2HGLA 3POTA 5F0UA 4M8LA 4FYDA 3M8PA 2OPSA 1HQEA 3NG8A 3H2UB 1Z4UA 2BKNA 1IKYB 5GAGI 4P7TA 1JIHA 1S99A 2UVRA 4K4VA 2HFVA 2RB7A 2UUBF 4QJVA 3CJKA 1C0UB 4IG3B 5IM0B 3AAWB 1BY9A 1S0MA 2CG4A 1X5TA 1IQTA 1RCXB 3FKBA 3CDEA 5DJBA 1MN9A 3PX0A 1Y3JA 4RW8B 4GKJF 1RBLA 3VGVA 2V4JB 4Q8FA 4CLFA 2GC8A 2SXLA 2F9DA 2ROGA 1UPMB 4CCHA 2J8AA 4J9QA 5HJXA 4ZPBA 3VAGA 4C6AA 3G2XA 2IDLA 5KAKA 3MGJA 1HIYA 4B9TA 4MKBA 3H4BA 3GFXA 3CW2C 4YS2A 1YVFA 2OPQA 2E44A 2OO4A 2ZD1B 4DR7F 4G1PA 4LSNB 4JBCA 2RF2B 4F4KA 4ELTA 3CB4A 1JXVA 1AUSL 3NBPA 3C16A 2P9GA 4RL1A 3H5XA 2L9WA 4X4NA 4B3TF 2QJ3A 2N4CA 4DR1J 3V4IB 2K7KA 2ZUAA 1YJRA 2APOA 1KWMA 3JXOA 4EO6A 1U1PA 1C1BB 2Z2YB 4UUXA 1RAEB 5H9FK 4O3OA 1TL1B 1HLWA 1AT1B 4ED8A 4ZHRB 1LFWA 2IRUA 5KFEA 3GYGA 2RH3A 4DFKA 5C24A 3GIKA 2F1FA 3AFGA 1LV5A 2ZFHA 2XMMA 3OR1B 3TA2A 1B64A 4B3RJ 2JDJA 2XMJA 4AD6A 4DPUA 5LOQA 4R8UA 4J9LA 5KFYA 3SV3A 2NSCA 1T05B 1RZMA 2M70A 2H54B 3OJUA 1XWLA 2B9YA 3N01A 3QWPA 4QPTA 3DOLA 3M6UA 2WBMA 2VQFF 4O0NA 1LWCB 1L3TA 2VV5A 4B9VA 4OHZA 4RNHA 3LGMA 4MK9A 2IHR1 5AJ3F 3KNGA 4UQTA 2W7AA 2N3OA 2Q6BA 3B78A 4JI8F 4KB7A 4O3QA 5T41A 2FGOA 2FHKA 2FVCA 2J5AA 3NY0A 2R7QA 4N8NA 3BSAA 3D54A 3MUVP 4IUFA 2CFXA 1UP1A 3I6PA 2RS8A 2YKNB 2FVQA 2HHPA 3NGSA 1GMWD 1XN9A 2VOPA 3VVTA 5HP1A 2K1RA 4IH6A 2JLGA 1PBAA 1OY8A 2BOAA 5HSPA 3R3TA 1BGXT 1FDDA 1FKPB 2XHWA 2R7UA 2X51A 4RO0A 3FFIA 2XTJP 3G96A 1VC0A 1MROA 4K0KF 4ECVA 2VQEF 3QRPA 4NLOA 4LSLB 5KFUA 2FHMA 3TVKA 3W5ZA 2BQ3A 1RT6A 3CO9A 4TVAB 3B54A 4FVCA 1IBLJ 2HGNA 2RMLA 2C1EB 3TW0A 2XG8A 1EP4B 1LW2A 5CZXA 4AUKA 3GZ7A 4F36A 3UVJA 2ROPA 4UOGA 2COLA 2MTLA 3TARA 3BSOA 4NYOA 2CQ0A 3D67A 2DIVA 3MR3A 1D8ZA 4LVOP 4B08A 4B3OB 1EAYC 2UXBJ 2Q3PA 2HHXA 4JB8B 4I56A 2FJBB 1VIXA 4RKUC 3V5RA 3BZQA 1S6PB 4ENOA 1E6YB 1UEKA 4NCGB 2K2PA 3BM7A 1KTQA 1N8RT 2HGMA 3RBZA 1NB2A 3G6VA 3CJ8A 2M9KA 3UCUP 2F7VA 4OQJA 4XTTA 1HA1A 2FC9A 1LQ9A 2Y9HA 1FO1A 2LDYA 1NSPA 4LUBA 3SCJE 2Q66A 2CPEA 1VI7A 2VG5B 5K14B 2RQMA 3GQCA 4LRFA 2KL8A 4NYPA 1AUDA 2QL5B 3MF5A 2BQUA 1XMQF 3H59A 2CQ4A 1AXQA 2J9DE 3LGNA 4J9PA 2HBRB 1X4FA 2CQ3A 3BBCA 4F04B 2EKYA 3UD3P 1V3SA 4WFNQ 4LRCA 1ZOTA 4PYAA 1HNZF 1GTHA 3NWRA 2B8PA 2HNDB 3KG0A 1X4CA 1IR2A 1Y4ZB 4WXWA 1EIYB 3FVYA 5C25A 1S7IA 4M5GA 3GWCA 3PEHA 1GEHA 3CMAS 2YKMB 3QT7A 1X4EA 1GFWB 1Y00A 2ZVIA 2BR0A 1YJNS 1SIZA 2PMWA 1QE1A 3SSRA 3T6BA 2VDHA 1UVJA 3QQCD 3UDVA 2VG7B 4RUCA 2NXCA 2W4CA 1REGX 3PX6A 1T9WA 4FF2A 4EZ9A 4EEYA 1MMDA 2H65B 1OSCA 4C8YA 3HI9A 1O6XA 4RW4B 1RHMB 4PWDA 5KT5A 2G4BA 5A2QU 2CQPA 4ZVEA 3NNAA 3OFEA 3OTOJ 3OL7A 4QWAA 1A9NB 2FJEB 4QIEA 3MFIA 4YDXA 3U1MA 2QE5A 4Q45A 3P4UB 2W4DA 1RXOB 1WG1A 1IKYA 2EC0A 3DRXA 1JK9B 4LF5F 4RW9A 4YEAA 4ALZA 1G4CA 1TV6B 3G87A 1C0UA 4IG3A 4CH7A 3QLHB 3QT8A 1IKXB 3HM9A 4ID5A 2D9OA 1R8CA 1BHNA 3EVOA 4RW8A 2V50A 3TUJC 1FDBA 4HH1A 2V4JA 2AGOA 3E01B 2BJ1A 1KFDA 1RISA 1CS4B 4M94A 1L3UA 1HQ2A 5IT4A 2WONB 3H5UA 1RABB 4HHUA 1SKUB 3KK1B 3KDOA 4X66F 5ETTA 1UKUA 2XYPB 4ZIWA 2J6TA 4C8ZA 1YBUA 3P5BP 1P1LA 2MQMA 3G8SA 1EQ0A 3MXHP 1VQKS 1HWLA 5J2NB 2BZ2A 3BN4A 4MIWA 4HI2A 4UOFA 1SC4B 1V6HA 2M7SA 1T0TV 1FF2A 3GSDA 4JI7F 4DEZA 2IVFB 2GVZB 2FC8A 1DRZA 3VAHA 2CPIA 2WTFA 2GIRA 2HS0A 4I69A 1IM4A 2HRTA 3QT6A 4KSEB 4HDHA 2YNHB 1RWWB 3ILLA 3J7AN 4FPRA 2CNNB 3DMJB 2AZ3A 2BABA 4OZ5A 5AXKA 4YB1P 2BRKA 4QWBA 4ATNA 1TL1A 1PIEA 1D09B 1M5KC 4A4JA 3C14A 1WEYA 2VFTA 1YJ9S 2ZEJA 3I32A 1ROFA 4MT1A 3OR1A 1D9FA 1BXNA 3W9HA 1F0XA 4DR3F 1TK0A 3NMAA 4EBDA 4ANDA 2B4OA 2AX1A 1U2CA 4JUZA 2PFFB 3BGUA 4CO4A 1WOPA 1S5ZA 2KXNB 2W9BA 2VIHA 3UD4P 1T05A 2CPXA 2X1FA 3DI6B 4YHHF 3M2VA 4FYXB 5K9FA 2ZJRQ 3T19A 2W2PP 2RD5C 2B4PA 1LWCA 4O4GB 3GMGA 4EBCA 3OLBA 3BBFA 1FTRA 3M30B 5LMUF 3GJRB 3TZZA 1N0UA 1M5VC 4LBPA 3PW5A 3BGOP 3MMAB 3M8SA 4BCAA 3SQGB 4NLTA 2MLXA 4CI0B 3BPSP 1XIQA 1FVQA 2MMYA 2VONA 3CDUA 4NA3A 3VAKA 3ILIA 4KE5A 2J7WA 3PDNA 4IOBA 5U47A 4KHRA 4IG0A 1QVFR 4B3SF 3IP0A 1J2VA 2BXJA 1B70B 4LRAA 3TAPA 3MCMA 1G6BA 5DQIA 1XNRJ 2W7PA 3NOCA 2AT1B 2IA0A 3M05A 1J5OB 2IM2A 3UDLA 2J0XA 3AA8A 1T7PA 3RYLA 2G1DA 5D4PA 2M2BA 5KFBA 5EX0A 1X0PA 4NX9A 1UFKA 4LSLA 2OUGA 1JLCA 4RUBA 2H48B 2HQCA 3C6TB 3LUYA 3MMBA 1RHJB 3W1YC 3PO5A 3PZPA 4ED2A 4PRFA 1RAOA 1FEEA 2CWKA 3HJFA 1TR0A 1FTCA 3FMWA 3E51A 3WIVA 1R43A 4Y0FA 1P8GA 8RUCA 4DUZF 1H2TZ 4B3OA 1CC8A 3IXQA 3ZZTA 2DNLA 5LJ3Y 3RB3A 2KU7A 5K8MA 1C0TB 3L09A 3KK3B 1HR0F 4ILMA 3ITHB 1KLNA 1FE4A 2CNLB 1S6PA 3PTWA 3U1LA 3W5XA 4DQPA 3P6YC 4DSKA 3EUNA 2B5JB 4OYZA 4NXNF 2E5HA 1YDLA 2UUBJ 1V9OA 1Y0HA 3D1HA 2C2EA 1NMEB 2JFKA 1N5YB 3UDEA 1SJRA 3VGTA 2QLBB 4NLSA 3TUZC 1H0HB 3PX4A 3DFEA 4ECWA 4GKJJ 5HAOA 2POKA 5HBMB 5KFVA 1TMJA 3MDFA 4K2XA 3KNAA 3RRGA 1NBEB 4FZVA 2VG5A 1N54B 3CC7S 3VVUA 2Z0GA 3O1LA 1FJ7A 1N48A 1S12A 4LF4F 2FVSA 1BWEA 2XC9A 2KRBA 4X2BA 3MEEB 1RK8A 1RTJA 4KRWA 2NR0A 3JTPA 4QR2A 1UW4A 2MKIA 4DR7J 4H4MB 2K7JA 4CQ1A 3QGHA 2J7UA 2WVCA 1AW0A 2BKOA 1DARA 5I3UA 1ICEB 4KIAA 3ZO7A 4ZVRB 3M8RA 3DHWC 2KFZA 4O3SA 4LT6A 3LP0B 1M1GA 3PW4A 5HK4A 2V2VA 1UWAA 1SV5A 4B3TJ 2UP1A 1Q81T 2MZ1A 2AJFE 2YKMA 4KHMA 2ZH2A 4U7UK 3CCMS 4ED5A 1R27B 3CDBA 1TKZB 1Q8IA 2KJVA 2K8GA 1IWGA 1F9HA 4O4RA 1U1NA 2V2ZA 2OEKA 2YWHA 4MJKA 3KMQA 2XY5A 2VG7A 1Y3KA 1SJ4P 5F8NA 5H9EK 1DURA 1QAJA 3OUYA 1S48A 2GA7A 1NKEA 2C28A 4O44B 2AJ1A 1AZSA 1QDUB 2D3ZA 2ATLA 4F2RA 4LF9F 1NJWA 1HI8A 2MKCA 1B7YB 3NMRA 2IAJA 3AD7C 3CJ5A 5D6GA 1YITS 3QZ8A 2DCUB 4LRBA 1IXKA 3KG1A 4NEYA 1KBRA 2WVFA 2XO6A 3IG1B 1N5QA 5KFSA 4JV0A 2VQFJ 4OYMA 3O44A 1CJVB 2D7SA 3DLGA 2C2KB 3Q8VA 2LDIA 1IWAA 4PXDA 5L9XA 1NJXA 2R2UA 1TV6A 1NUEA 1X9MA 1R3NA 1ZETA 3QLHA 4YB6A 4X62J 1CULB 1U8SA 4QWCA 1NEEA 3HHLB 3G8TA 4KKOA 4ES1A 1YI2S 4JI8J 3AJ2A 2B56A 1W2BR 3BQ0A 1D3WA 3E01A 3T3FA 1DTQB 1Y10A 1UZHA 2C3OA 1FT8A 4O3NA 4QCLA 2E7VA 3CJSA 4DS5A 1R8PA 1RA6A 5F8MA 3I0RB 4OZ2A 2Y1LB 4WIQA 2BJ7A 4UTGA 3FJ2A 4NCAA 4WTOB 3MECB 1WSRA 2YH0A 1FFWB 4URQU 4DL5A 5J2QA 4NRTA 1R6VA 3AHPA 4USKA 3RW7A 4DU7A 2BBEA 5D4NA 3SMZA 3MUMP 3FRZA 3BYRA 4K0KJ 4I67A 2VQEJ 5J2NA 3D5MA 1H74A 3EYZA 2DGWA 5H9FJ 5KG1A 1XEZA 3EVWA 1NK6A 1P27B 2XYGB 2IMOA 3G6ES 5L1IA 1VRTB 4DV0F 4I7FA 2QSFA 4R5PB 2FJVA 3B4DA 2LYVA 2QLFB 5E0OA 1VRQC 1KHVA 1TL3B 1FJEB 1EB0A 2KKHA 1SQEA 3GTYX 3DMJA 3HVTB 2BM1A 2XBPA 1Q86T 3OL6A 4ZJLA 1Q0NA 2GX8A 5ETQA 1JLQB 1X7VA 2WB1D 2EFNA 2B6AA 3K58A 3DGVA 1OQ6A 3D68A 3GPAA 4J9MA 4J37A 1UWBB 4BBYA 2BQRA 3W2VB 1WDDA 4N47A 3CCES 1QSSA 1BE4A 2G2ZA 3L3CA 4HVZA 3DLHA 3PHEA 2B9WA 3I31A 2OMLA 4JI0F 2Y1JA 4D3HA 5AE3A 5HN0A 1SCJB 5C2GA 1FKOA 3MPYA 4K4YA 2V67A 3M30A 2JEJA 2UV8G 4NLXA 2W2OP 1XMQJ 4NLDA 3MM7B 3VGSA 4ZVFA 5HVFA 5IT0A 3NS5A 2AGPA 3E8OA 2QL9B 2Y1RI 2CVIA 2UUTA 4XDCA 2KT3A 3A13A 1WC4A 3JQKA 2EI5A 5ETMA 5IXUA 2KH9A 1H6KX 2QV6A 2BANB 3CCTA 3CD0A 4QU7A 4UOCA 1SC1B 2GQCA 4LVNP 1HNZJ 3F56A 3PW0A 1SI9A 2R7OA 3UCZP 1N4LA 3T1HF 3EE3A 5HMWA 3K2YA 3BO3A 2BACA 3K59A 5KFNA 3DRPA 1YJUA 4GMKA 4ED1A 1XC9A 4UUWA 1RGVA 1S6QB 4MKAA 1AFIA 1J5OA 1TFWA 5HVGA 1F9FA 3KUGA 1DBDA 1CVJA 1FWKA 5DGBA 3CJTA 1KVKA 2XNQA 4I6YA 2C22A 3FBCA 1EJ7L 5I42A 1FFGB 4C48A 1BC6A 4OV6A 3C6TA 2EC2A 5MLCV 2IIHA 1RAHB 3BEGB 1RWVB 2HQIA 2FJXA 5AXNA 2UVVA 2HBQB 1VQYA 2ZBCA 3GV8B 3VR1A 3OL8A 4OI3A 4ECYA 4Y28C 4DV7F 2QFIA 2Z56B 3DLEB 2V4QA 1YLXA 2YBVA 3VZHA 5IC6B 4F4YA 2MZSA 1VQ4S 2ZC3A 3KK3A 2B7BB 4HEA9 1XTZA 3QO9A 4J9KA 3NGDA 4LF5J 3KMSA 2CPZA 4I0WA 1S1UB 2A1BA 2FTRA 3RBEA 1YBAA 3TVYA 4FKXA 1NK9A 5DDOC 4F3OA 2EFVA 3F41A 4F02A 4IDKB 3BKFA 4Y2AA 2E1RA 2NPIA 5EUHA 4HDGA 5HBMA 2V8GA 4NLUA 3QJPA 3HJVA 1YRUA 2ALYB 2X1AA 2QLXA 3ICLA 2B4UA 2VU5A 4QOTA 1RWNB 3IO1A 2BX6A 5GAEU 1IUJA 5G0RB 3N9UC 1G1XA 2M0GB 3BKUA 5M2PA 2E5GA 1RADB 2YWGA 2D74B 2Z30B 2EK6A 4X66J 3PRDA 2UUAF 2DY1A 2HMIA 2CQHA 3W8PA 2LECA 3MEEA 4W90B 4MK7A 4CRJA 2PT0A 2E66A 1J5EF 2DNRA 1GAOA 2DNYA 1VGYA 2WBRA 2GVDB 2E29A 2H5JB 3H98A 2G0CA 2QRRA 4CO5A 4I4BA 4JI7J 3GB0A 3EXCX 2B0GA 3OBIA 3J7Z5 2DXFA 4GRSA 1VS3A 5I3PA 4I6WA 3HCXA 1TKZA 4OI1A 3VAFA 3KJNB 5KFRA 3JSYA 3TANA 3KLFB 1NSKL 3R2CJ 2QX0A 1G3OA 2GAHC 4P6QA 3SYZA 1SIWB 4EFAC 4M5LA 4ZP7A 5GAEI 3K89A 1HNIA 3CJ4A 3Q23A 1UZDA 1OY9A 2P6SA 1KNZA 1K8AT 1NPPA 3M8ZA 2DCLA 2OFHX 2JH3A 3HSGA 1SJ3P 2P8IA 4DR3J 3HMJG 3SFGA 2MKSA 3UR3C 2ZH4A 4TU7A 1ZAWA 3J81U 3LOUA 3FSXA 4CNYA 2W2MP 4NLQA 4YHHJ 3IG1A 2F4FA 2I2YA 2CDQA 3TUIC 4OLOA 2VODA 1MG7A 4WP3A 5LMUJ 2AQ4A 3OFGA 3MM8B 1U47A 5KFTA 3TEHB 2FDNA 4ED7A 3SEOA 1XJWB 1CULA 4OZNA 5DG8A 2WB4A 3HHLA 4DZ6A 2RHQB 2G13A 2RQ4A 4YB7A 4PWWA 1MMLA 3DGPA 3AH6A 4EYHB 1S0NA 2NQPA 1DTQA 3K5NA 1LW0A 5HMYA 4K4SA 1F2GA 3WHIA 2OTJS 2HQGA 4YB5A 2AWZA 4B3SJ 4DSEA 2J8SA 2CUYA 3S8SA 5ETSA 5A8WB 1SKRA 5E3RA 4OZJA 4P2FA 1JKHB 4C0OC 2QC3A 2HFOA 4Y3CA 2AJ0A 3OTEA 1HHQA 2R3VA 4NLGA 2V4RA 3UPFA 1NK5A 1RTIB 2DPJA 4ETZA 1RT1B 3I0SB 4R5PA 3NWGA 2KT2A 1EKSA 4KR0B 1TL3A 3GCWP 1TL7A 2MPUA 4DUZJ 1HPZA 3W8GA 2VKZG 2O1PA 5EWEA 2V9KA 1O8BA 2KN4A 2C2MB 3HVTA 4G3IA 1HR0J 2YQ0A 4PAAA 4EYIB 4A8MP 1N5VA 3G8QA 2AIRB 2P6TA 1P9QC 2KT5A 2WW4A 1JLQA 2CQ2A 4DPOA 1M1KT 2GO9A 1WI8A 4NXNJ 1S1VB 1EQMA 1JXLA 3TJ8A 3R27A 2ERRA 1N5TA 4NL5A 2IJFA 1UWBA 1FHTA 1I5OB 2AYMA 1SC3B 1PJ6A 5A0YA 3BSCA 4URGA 5KG3A 3EMTA 1S1TB 4C4WA 3IM8A 1RWOB 3KLEA 2UXCF 3I9V9 5AXMA 3ILOA 2YY3A 2GMLA 1Q1KA 4DPTA 5KFCA 5E33A 2OPPA 1RT2A 5ETPA 4TLRA 2FJAB 3ET6B 3SDEA 4LF4J 1I94F 3KG4A 1S77D 4DV1F 2V8PA 3EZUA 2RRNA 5A76A 2F8MA 4W4MA 2VB6A 5HLFB 3DCAA 5E3PA 4J9SA 4MKYA 2M8DB 2HWTA 3RAMA 1N33F 2K3KA 2R7XA 1APSA 4RU2A 1NH7A 5HROB 5J2PA 4U6PA 2MQNA 1FD2A 3FDSA 2E5LF 1T94A 5D3GA 3P5TL 5A8RB 3PVXA 2YWWA 1K1QA 1JJCB 1NSAA 3EZOA 1FRKA 1NLKL 2GJ2A 2R8HA 5F9LA 2C3PA 2ZZMA 2BYCA 4NZ7A 3R8YA 3FEYB 4F50A 2R8IA 4XAKA 2D3OR 1TKDA 3UN5A 2HEKA 2LXIA 4DR5F 4TYBA 4J5OA 2HHSA 2R7SA 1S1WA 1F5CA 3N5FA 4G1QB 4X65F 2DGVA 2VA3A 2XYHB 5HQ8A 2PA3A 1YGYA 5DZ7A 2ILZA 4GKKF 1RUSA 4M5DA 4DN0A 4PG8A 1IKWB 1RWMB 2I8EA 4Q44A 1UCNA 4ZPCA 2DXEA 3HVWA 3CCLS 1V5IB 3DLEA 1S76D 2HIYA 1Q82T 1QUPA 1YJ7A 2V68A 3EDRB 2YNIB 3GIRA 5CCMA 3L9ZA 2RDDA 2DJWA 1TQLA 4YR3A 4M1KA 4LF6F 1T8EA 3BR8A 4DSJA 3SSQA 1TAQA 2RU3A 3BGLA 3TJAA 3ELHA 3BGRB 1FRJA 3N4WA 1FRHA 3DDKA 3T9ZA 4DDFA 3SI8A 2WSFC 4G65A 4QBUA 3BB5A 3G82B 6AT1B 4WCEQ 3B4MA 4A47A 3VCDA 4HHJA 1N56A 3ZNJ1 2DHGA 4BDPA 4WKRA 4F7VA 1ZAXA 3Q8QB 1YHQS 1Q8KA 4ZLNA 1LNQA 5G0RA 2B51A 3DXSX 2QTWA 3I96A 4DXLA 4V1Ak 3QSYB 3UWTA 1Q16B 3JB9k 4DLEA 2G2OA 3Q89A 2X1BA 4O3RA 2DGOA 1H73A 3GSIA 4USVA 1FXDA 2BV3A 4D3GA 2KHDA 1FD8A 3RB6A 5BXIA 4LRDA 3QIDA 1VIOA 2EWHA 5EWGA 5HMXA 5CD4H 4KJIA 1JLGB 2YQ1A 4FXDA 3NGKA 4DX8H 1TUVA 4DUTA 2NZCA 2HVZA 4L74A 4ZN1A 3NAHA 4NLPA 1XMOF 3M9OB 2QYGA 4GO7X 5BYRA 6FD1A 1WHXA 4DN9A 1R0AA 3IR6B 4PEOA 4FXVA 2HK2A 3Q2TC 3HT3A 3W2WB 3QGPA 4DV0J 4DR4F 4QIFA 3KK2B 3MOJB 1LFPA 3M8QB 4YR2A 2GS8A 2YX1A 4CH1A 5L1JA 2OLWA 3KJQB 3R7NB 1RTDB 4LREA 1QM9A 3HO1A 1XERA 3RJMB 4GC6A 3CCWA 4ZN3A 3ZXWA 1U26A 1RTHB 1PJ7A 2CKWA 4UZCA 4DV2F 2JHEA 2N3LA 5H1SV 4DCJB 2XQCA 2F5GA 4M5MA 2Z2MA 4ZPAA 3PW7A 2DISA 3OHBA 3MUTP 3ZZPA 1N0VC 4IH7A 2XMKA 4JI0J 2E1CA 1WD6A 4KC5A 4XPCA 4KV8B 2YNFA 1T02A 1DY3A 3A3PB 1LXJA 3I9ZA 4PXCA 4ZP8A 1X5PA 4QZVB 4KGMA 3HHLC 1UVMA 2BA9A 2L9NA 1HBOA 2XB2D 3U1NA 2ZITA 3ISNC 3EM1A 2I5JA 4NCBA 1RAIB 4JOUA 5HVHA 4TQRA 2VG6A 2LVWA 4RJVA 1N6QB 3T1HJ 4KPYA 1WF2A 4LFCF 4PXBA 5KOWA 3DKDA 4ZVQB 2LQ9A 3DOKB 5HO4A 1HW9A 4QU6A 2IYGA 2GJFA 5FDLA 4BC7A 3OSPA 4K7QA 1TKTA 4EZ6A 1JKHA 5KG2A 1EX8A 4BLGA 3SCKE 4DOZA 4C8LA 1HKAA 1RE1B 3UE2A 3CJQA 4TXSA 2GHWA 2D3O1 1F9EB 5J1EB 3AD9C 5CHCB 1RTIA 4JI6F 3Q8PB 2HHQA 4ZP6A 1FKAF 1C1CA 2RQKA 1RT1A 2HVDA 2JC1A 1E6VB 5D4LA 1QSLA 2HQDA 2MY8A 1T9UA 4Q43A 3GONA 4PABA 1QVGR 2PI5A 4HHHA 4DV7J 4S0MA 5E5NA 2VBYA 3NXZA 4ANEA 2CIMA 2R4FA 3CCZA 3ULHA 2N7YA 2VPXB 2W1BA 2A3JA 3DC2A 3KWMA 4NLWA 4X4VA 1CJKA 1FWLA 2LEPA 1WJ9A 3Q8YA 1HNVA 4X84A 1DLOA 3PRBA 1FDAA 4YN3B 3NCQA 1QAIA 4RNFA 2MGZA 4DX6A 3I5AA 2FLNA 1S4EA 2GNKA 3FSIA 1NPKA 1AB8A 2UVWA 1A6LA 3A8EA 3KHGA 3EPGA 1P9YA 1S1TA 2V6AA 1SL2A 1MNEA 4WFYA 3MR2A 3M8YA 3T5KA 1LEOA 3CWJA 2E9RX 4XK8C 2RVJA 1OO0B 1H2UX 3QYYA 4MH8A 2NZ4A 4ZDNA 1WG4A 2AGQA 4E98A 3FBBA 4OX9F 3ET6A 4KY3A 3GCXP 4F8RA 4KHPF 4FF1A 1QY7A 1LWEB 1ACMB 1RU1A 2CJKA 4LR7A 1NDCA 1J5EJ 4DMZA 1BMQB 1U0HB 4G6VB 1PO6A 2XO7A 1FDNA 4KQZA 4J9VA 2CJBA 3CC2S 4C97A 2OPRA 4ZPVR 1KSPA 3LTOA 4GVBB 5HROA 3H5SA 1U1MA 1HYSB 4QIGA 1RT3A 4Z2XA 5A8RA 4OHYA 3A8IA 4CT9A 2DPIA 4OYXA 2ASJA 3JSRA 3MCNA 1K9MT 5ETNA 1F3FA 5D0EA 2ZKUA 2AJQA 4CYUA 2ZH8A 4L75A 2VBWA 3JS9A 2AU0A 2JL9A 4K4UA 2ZOFA 2AP6A 1VOMA 4DR2F 3IWNC 4FXWA 3FEXB 4IH5A 4HT5A 4IRCA 1IKWA 2KG0A 4L72B 4DQRA 5KFIA 4EMDA 1GH8A 1KEKA 5GVQA 2YWKA 4QQBA 1BD6A 3ENAA 4QYRA 1XBWA 2Y1IA 4ICLA 1WSVA 4OI2A 1FNXH 2YNIA 5CXTA 3HSZA 1S97A 5F8LA 3TA1A 1D9AA 1VYAA 1KTVA 2MSSA 1GXUA 1RT7B 4DPXA 4WZQA 2IM0A 2ZBRA 2VJUA 4OJGA 2IRXA 5KFJA 4NA2A 1NK0A 1MN7A 2ALZA 2I38A 3M4XA 1RP5A 1MMNA 1W26A 3KKFA 2YH1A 1KVJA 4DSIA 3OTBA 2MXYA 4O3PA 4GVLA 3I4HX 4DV3F 2FZCB 4E0DA 3A8KA 3MMCA 3GFYA 1HBUB 2G2YA 3AOBA 1N5SA 3H25A 1KP6A 3VHQA 2J76E 1U1QA 4ZVOB 3H2LA 1XK8A 5DLFA 5DDRC 3PRVA 4P2MA 1RAFB 2L08A 3TI0A 5J2MB 1PBUA 2E1AA 2ZDOA 2RAQA 3C15B 5KFKA 1JLGA 4TQSA 1FK9B 5KFLA 2BW2A 1VHIA 3HDSA 3CCRS 4MK8A 3DOMB 3ONQA 5D0RA 2KZMA 5BJRA 1Q53A 3GILA 3N0VA 2OKQA 2ILYA 2CG8A 3AOCA 4PXEA 2MHEA 3EX7B 1OYEA 1HFEL 1TL5A 4KO0B 1JMTA 3C2PA 1ZBTA 3BF4A 3CEDA 2N7CA 3W2WA 3BPDA 1MSWD 3KK2A 2H1YA 1HQUA 5IZHA 4ETXA 1W7WA 1JWWA 1RTDA 5HI7A 1ZA2B 2XMTA 3FCWA 3MAHA 2RJZA 4IFYB 2IRYA 2WOMB 3EWGA 4CO0A 2HIQA 3DYAB 3MURP 2AV5A 4YDDB 1PGZA 1RTHA 1FEHA 1X4DA 3HD2A 4Q8EA 5JUMA 2HHWA 1B7FA 2F40A 1H38A 5C42B 5DQGA 2C3UA 4HKQA 4XO0A 4ITSA 3GIJA 4QYZK 2FHJA 2UXCJ 4DV6F 4AXIA 1S0OA 3P96A 2QSWA 4BC9A 1K0VA 2JVRA 1DFDA 3TZXA 2CJAA 2Z4PA 2DEJA 5B0EA 2F63A 2AD9A 3N28A 2C3YA 3BQ2A 1I94J 4UT4A 3MHYA 1MW7A 4X4PA 3M32B 4DV1J 4HH0A 3NNHA 2QN6B 4DFPA 4DPWA 3OSNA 1OY6A 5KFWA 2HLTA 2QLJB 3A3NB 3PJXA 1TTHB 3H42A 1S72S 1N33J 1N6QA 4QWDA 1B0PA 3U02A 3D0HE 1HWUA 4DS4A 3MCSA 3IA0A 4DR6F 2E5LJ 2VH7A 2DGUA 1Q8LA 2KFNA 4FS2A 1BWVA 4NLRA 3PM9A 1AYEA 4NE9C 4CDIA 3LWLA 9RUBA 3V6DB 1T3NA 1RYRA 2KM8B 3QWUA 3BYPA 4DR5J 3MR7A 2OHDA 2ZWOA 3R6GB 1R7IA 1PG5B 2BM0A 4NI2B 4X65J 5J1EA 1D8YA 4GKKJ 2ZE2A 3RR7A 1OQ3A 2PD1A 4PPDA 4WBFA 1E6VA 4MYTA 1Y5LB 2HNZB 4DHVA 3ZZYA 4QR1A 3PFEA 2HHUA 2WK4A 3B6BA 2QMXA 2Y3YA 4TKTA 3HLUA 1ITPA 3ZTOA 2DRBA 2XS5A 5ETLA 4LF6J 1U02A 4QWEA 3QMQA 2R7TA 1U45A 4FYVB 3R6LB 5LSOA 3W61A 4ILRA 1WC3A 3AY0A 2RILA 1C2PA 4PG4A 4F25A 2I1RA 2EPIA 1R0CB 3HXMA 1U7LA 5JMNA 2O67A 1IBMF 4X62F 3J80U 4DF8A 2CZVC 5D77A 2KXHA 2B43A 4KBIA 1ZM9A 5LSRA 5F0WA 2CYYA 4ECTA 4PUOB 3OVSA 2RKIA 4DX7A 3K17A 4ZITA 4TY8A 4LR8A 2HAIA 5CAAA 1O51A 2DRAA 1RAGB 3ISZA 4X64F 2OP5A 2VKRA 2OGUA 3MD3A 2WZ1A 1JLAA 1XMOJ 2JNJA 1T95A 2BOPA 4USHA 4H4OB 4CH0S 2DNPA 4M95A 5ADZA 3W3SA 5A6PA 2HFUA 2NLWA 3D6FB 4DR4J 5F8HA 4P75A 1ZZNA 3LQVA 4RBVA 3FSYA 2LU2A 5IFMA 3IBCB 1QJHA 3OJSA 3DLBA 3JYTA 3MEGB 5DLGA 1Q4RA 1KHWA 2ZDPA 4KGZB 2LP4A 2ACYA 4L6V3 3G71S 4U7UD 2Z2LA 3KDNA 1FWPA 3KLHB 3K8VA 4AT1B 4DG1B 2PEHA 1LWFA 1NDLA 1F1BB 2ATCB 4B9UA 3GE9A 2C2DA 2DH8A 2WVDA 4DV2J 1UVKA 3LP1B 4P52A 2BE2B 1IKVB 3IFEA 2C2RA 1A7GE 4JYAF 3J81j 4RNNA 4LFBF 4OL8A 2GHPA 2XMWA 4M5JA 2QMUB 3W65A 1CQNA 2YX7A 1HMVB 2FYXA 2HWHA 2Q6CA 2QYCA 5J1PA 1HBNA 2DNQA 3PYFA 4HYKA 4ZLPA 1S57A 1XQIA 5FLXU 2E5JA 3T9NA 3O6QA 5GMDA 3K7RA 3SFUA 3KLVA 2DHAA 4V19J 4C8OA 4WXOA 2LKZA 3C6UB 1HBUA 5B0FA 2J0QD 2QO3A 1VHFA 1BQMA 4LFCJ 1SQFA 5I3QA 4LFAF 4LSZB 3KLIB 2BJEA 4U8YA 4E2FB 2WAQD 5J1NA 1T03B 2AMCB 2VF3A 5C5JA 3M8WA 4PG6A 3JTNA 1RWXB 1HBMB 3HVRA 2HBYB 1Y9OA 3TWZA 2V2KA 2OTLS 2CRLA 3GIIA 3OXGA 2MKJA 4JI5F 1RDRA 1FK9A 4JI1F 2IM3A 3CJ2A 3MEDB 2XMUA 1RACB 1N52B 2EFGA 4EGLA 3IS9B 3LAKA 1FI4A 1R89A 3DOMA 2Y0SD 4I2QA 4C3LA 2HHTA 3KTQA 4JI6J 5KG4A 5IS2A 2ABYA 4DFJA 1I1GA 4B9LA 1JNZB 1UJ6A 3JQJA 2OPSB 3W5YA 4JV2A 4WU3A 4ECRA 5GMKa 1HQEB 1VBYA 1S9EB 1MWQA 3ZTRA 1NZ8A 4KH1B 5HATA 3JSBA 3KHLA 2UU9F 1SVDA 1WC0A 3MPVA 1VDHA 4AQYF 3RW6A 1LXNA 4K5SA 3O3LA 3BJYA 5K8NA 3UNGC 2A10A 2RDIA 3PG9A 5K8PA 4C0BA 2WVBA 1HARA 2DH7A 5B0DA 4EO8A 1S10A 3I87A 1QSYA 4RWWA 5KT6A 1M5PC 2FUG9 3H0PA 2HHHF 2EVZA 2CJQA 5DDQC 1T9XA 5C42A 5IM0A 5E41A 3CULA 2Q79A 4DV4J 2Y0BB 5L1LA 1TUWA 5F41A 1ZM4A 5KT7A 2VBZA 4P72A 4RX6A 3PO4A 4CLPA 2RT3A 2YWFA 1TK5A 3H8YA 3OR2B 3A3OB 4RNOA 5THWA 4OX9J 4RBTA 3HD1A 2XCPA 5AE1A 1WF0A 4KHPJ 2LEBA 3NBPB 3TR5A 3W64A 2GV1A 3M32A 1JXEA 4IFVB 2NXUA 1XR6A 2AJ2A 4KH0B 2A2DA 1F2HA 4DL2A 3DRYA 2ZD1A 3OFHA 4LSNA 2B9EA 1U6BA 2RF2A 3R97A 4FS1A 4K4WA 1OS5A 5IT9U 5MAOA 4UQGA 2BUNA 2CAJA 4M5HA 3TX0A 1WHWA 2P9EA 3MM6B 2XMVA 4QIVA 3S6EA 3V4IA 5C24B 3VAJA 3HX9A 1HI0P 3CJ3A 1FFSB 1U1LA 2LQ8A 1C1BA 2BVZA 2GQ2A 5M2UA 1NJZA 4OYBA 2GZOA 4NI2A 2Y8YA 2H5EA 3UN3A 4DR2J 1WKLA 4Q2MA 4ZHRA 2XWXA 4P73A 3ZZOA 3PYDA 5LMNF 2A0FB 1BQXA 2Z8QA 1UA1A 3NOGA 4HTJA 4P7VA 2JEFA 5BR8F 3EGVA 4UOHA 2DNGA 2HNZA 2NREA 2FLPA 1U2FA 1FJCA 4U67Q 3WZ0A 1SH3A 3KLGB 2FJDB 2OMOA 3DLLQ 2DNMA 4K4TA 2DYAA 3D4JA 2RNEA 4YFUA 5IV4A 4N8OA 3PJWA 4JV5F 3H20A 1TMMA 2MJUA 4WFXA 2DGSA 3OTDA 1XMBA 5CYQB 5B0GA 1VK3A 1GQEA 3VQTA 4CNZA 3PIPQ 3M7VA 2MY7A 5CZVA 1JJ4A 3H2VE 4DV3J 2VPWB 1AFJA 2ZH7A 3N6LA 2ZH3A 4ZIVA 3DXBA 5IC4B 1Q7YT 2R2RA 2V8DA 2H4YB 3OT9A 2HS3A 3A1YG 2AEJA 2YKPA 2YNGB 4IRDA 3L7UA 3JQMA 1MROB 4PUOA 5CA5A 1NM2A 2YKNA 1RB0A 4NPOA 1HHTP 4ANCA 3BO4A 2IY5B 2BE9B 1LW2B 3UVJB 2D1CA 3QJLA 3G4SS 3HSJA 3N79A 2PE8A 1OYDA 5EWFA 1FKPA 4FNHA 3ILJA 2W8LA 3D0GE 2QA1A 3V81B 2EFOA 2A18A 3RU0A 2E9ZA 2O3DA 2RE1A 2ZM6F 1LWXA 2NYHA 3D66A 1P6TA 1EP4A 4USMA 3CIZA 4CLWA 1H72C 4I2PB 3CO0P 4B9NA 4YMEA 2CNOB 5KOXA 1U8WA 1WWHA 2DNHA 1UMJA 4IQXA 1HWKA 2E1PA 3HFKA 2BKPA 4QR0A 5L9NA 2PMHA 1KS2A 3M2RB 2DXDA 2HK3A 1TK8A 4KYZA 3HKWA 3FMBA 1U48A 4DPYA 4KAIA 1E6YA 4NCGA 4I1TA 1MLAA 1X5OA 4CLKA 3LP1A 1WOOA 2VZ9A 4TN2A 3IRXB 5FLXY 3MOZA 1H7WA 1X9SA 3UD5A 1FNOA 4NEZA 4DV6J 5KFZA 3MMJA 2CQCA 5DS7A 7FDRA 1HMVA 1PJ5A 5K14A 4ZS6A 2QMWA 4X4QA 3HK2A 3I82A 3VF0B 1C4AA 1SXLA 2B7CB 4C3MA 2KTQA 2X3GA 4LBIA 1Y5NB 1CLFA 4F0KA 2OD4A 5C25B 1EARA 4M5IA 4PKDB 3A8JA 3M6WA 1WC5A 3QIPB 3JSMB 2AJ4A 3C6UA 2V8VA 3ZZ0A 4W98A 1QE1B 1R8HA 5CH7B 2HNDA 1VQSA 3RGIA 2XZWA 3KLIA 3W63A 5CD4A 4DR6J 2RDJA 1ZTWA 1T03A 3GJQB 1VBZA 1R8BA 1WDTA 1VMBA 4A8OA 1HBMA 3MTJA 2PGCA 2QIFA 4I68A 1NU4A 4NMXA 1S4FA 4Y2KA 4DI6A 4NXMF 5E3AA 4MYUA 1CG2A 1JX4A 1N34F 3IS9A 4PWDB 2G0JA 2FZGB 5A2QY 3TA0A 3TAMB 4FN5A 4Z37A 4U9RA 4K50A 3TAQA 1RAAB 3HZEA 1S9EA 1L3VA 1KVIA 1DQAA 4FDFA 5D0HA 4RW4A 4MAKA 1Q5YA 2VC1A 4RW9B 4B02A 2K06A 3N5BA 3PKMA 2ZOGA 2A6MA 1YWXA 2GJIA 1JNRB 3PIOQ 2MYFA 3PCOB 1FCAA 4ID5B 3OLAA 4QYZJ 4A46A 1D9DA 4LQ9A 3M6VA 4HT7A 4P71A 1CQMA 5ETVA 2AYGA 2C42A 1LKZA 1ZYQA 2NCKL 2R42A 4P9SA 4FF3A 1SKWA 3MM9B 4C8MA 2I0XA 1H7XA 2HZVA 2RU9A 2XY7A 2HS4A 1NJIT 5DG9A 1IKXA 1IBMJ 2OFGX 2KO1A 3TP2A 3J7A1 2VFVA 1VC6A 2H4WB 4P74A 2M4MA 3FEZA 3OR2A 4TNOA 1WKKA 1CS4A 1YTYA 1UVLA 3QAUA 3KJFB 5IT9Y 3IWLA 2WONA 3L7PA 4F3MA 3CGIA 2HBZB 3KK1A 3LO3A 1YIJS 1FX4A 2IJRA 4IFVA 2DIUA 5CCLA 4X64J 2QL7B 1SL1A 1HHSA 1FA0A 2NSBA 1YSJA 3Q83A 5KTQA 1WORA 3FQKA 3KXDA 1RHQB 1ZTTA 1MU2B 1UVNA 3H5YA 3MM6A 1TKXB 3NCRA 2HRUA 2GVZA 2HSEB 1REVB 1IBKF 3HHNB 4R25A 2XZTB 2GW8A 3CT9A 3C14B 2KM8C 2PIIA 1N36F 1SKSA 3C3LA 3D1OA 1YJWS 1OMSA 1QD1A 1T9VA 2YXLA 1TP7A 1Q8BA 2YNHA 4ZCKA 5IQQA 3K8WA 4OLPA 3FBFA 4HLBA 1RWPB 4K2JA 4LF2A 4C2MA 2PSZA 1YJVA 4F0HA 3BH6B 1NKBA 3CCVS 3HHLD 4ZMMA 1ZH5A 3GJSB 3EGZA 5D4OA 2W9BB 2PA8D 1GK8A 1OWXA 2CZ9A 3ISND 2BE7D 3IC1A 1HNWF 2LU1A 3M2VB 4FF4A 4Y2MA 5IOLA 1KLMB 2N4DA 3K5LA 5KFPA 2UUWA 2JZ5A 1PILA 2JX2A 4JYAJ 1M5SA 1FE0A 3KLGA 5F9NA 4EBEA 3MFHA 3DRSB 2JSXA 3ETOA 4LFBJ 4A8YA 5E3QA 4ZVSB 4OJ1A 2V63A 3DI6A 4OV1A 4OZ1A 3V6HA 1GX6A 3BGFA 4CLYA 1R8AA 4NZ0A 2HZAA 3DN9A 1Q7LB 3FC9A 2D69A 4O4GA 3H90A 2A6OA 3GG0A 1VQ6S 4ECXA 2OIHA 5CYQA 2CJXB 5A6WA 1LOUA 5B0BA 3R7BB 3MMAA 4IG0B 4B17A 4USTA 1HNXF 1W2IA 5AE2A 1RKJA 3SQGA 2CXEA 2MZTA 3AODA 4P2XA 2CADA 2MZJA 3CNQP 3KOAA 2U2FA 4LFAJ 1QTMA 1HW8A 4CLSA 2IVYA 3EGWB 3MD1A 2YNGA 2KJWA 2HW3A 4DSFA 2Z58B 3BS9A 3FCVA 3CD7A 3NGTA 1VBXA 4M5KA 2P9CA 3LALA 1JLCB 3MMBB 3PKYA 2XGPA 2AEMA 4JI5J 1GNKA 2MQPA 4JI1J 1ZS6A 1T3OA 1HI1A 3D28A 3CCQS 2XLJA 4A8XA 2PI4A 2CNKB 2I6WA 3VV2B 5E7OB 5E3CA 3V81A 1GTEA 5K8OA 2XY6A 4DBQA 2M5YA 4AFFA 1Z1ZA 3AOAA 1V5VA 3SQOP 3NL0A 4F4AA 2GCFA 3ETMA 1X8DA 5KFOA 2LQJA 4I2PA 4OYWA 2UU9J 2L9DA 2IBKA 1JJHA 4C7QA 3THPA 2H5IB 3Q24A 4AQYJ 2NS1B 1RWKB 4TU9A 1AA1B 2GGPB 1C0TA 4KGXB 1S9FA 3EZ5A 3M2RA 3QRRA 3ITHA 4IR9A 3TZYA 4O23A 4P2SA 2WHOA 3HHDA 2V34A 1U25A 4ZLLA 3CD5A 3FUYA 2B5JA 3CDWA 2DB1A 2HHHJ 3TZWA 4OMFG 1YJTA 2GIQA 2ROEA 1N5YA 2V9WA 2P5VA 3IRXA 4JV1A 3L95X 2LCWA 3HFZB 5LXRA 3PY8A 3R7SB 2KFYA 1EKRA 1RTJB 4JI3F 5GADU 3UO0A 3QFWA 5DM6Q 3UN2A 5I3UB 1NXIA 5F8IA 1VBKA 3PV8A 4IO9Q 3DU5A 1WEZA 2W9CB 1SV5B 4NYZA 1M5OC 4R0EA 2Z2ZA 3QIPA 4K8RA 1WELA 2VFUA 3JSMA 2VASA 4ZJQA 2MJNA 4H4MA 4ED0A 2VC0A 3V6KA 5A8KB 5B0CA 4MKVA 3LP0A 4N77A 4DU8A 3R1HA 1K73T 4Y2IA 4U96A 3OUYB 5EN1A 2QT7A 1KR4A 1N32F 3GYNA 3K5PA 3PYGA 1AZSB 1ZM2A 2IC3B 5KG0A 3MR6A 5M2RA 2OH2A 1RBOB 3WX8A 2IAJB 1PCAA 1G7CB 4L3NA 1X4BA 1NK8A 1PAUB 4C8NA 2CZ4A 5GADI 1QTNB 4DUYF 2DY9A 2JOQA 4DSLA 1UFLA 3TAMA 1Z2LA 1VJQA 1VC5A 4C98A 1IR0A 3R5CA 4O44A 4WPAA 5LMNJ 2XLKA 4CP5A 4A8KA 3D6MB 2HQ3A 4ZOSA 1UEVA 1JQGA 4A48A 5BR8J 1Y5IB 2F4VF 3CDAA 2QGFB 3DLGB 1IQZA 3I56S 4ZPWR 4QW9A 4B9SA 5KT2A 3DHXA 1UW9A 4ZVHA 3SBMA 4BWMA 1NB7A 3TNVA 4KPCA 1EETB 3A12A 1WTBA 1CPZA 3HHKA 4KKOB 2I9SA 4JV5J 3DLKB 4CO1A 4ZCIA 1CJVA 3G86A 2YKQA 5DZ6A 3MAAB 4LMZA 2QA2A 1WC1A 2R2TA 1S1XB 3F73A 3MM9A 1FJGF 3K5OA 1QAYA 2HVHA 4MFBB 2NXEA 4EI2A 2ZNYA 2MQQA 1X4HA 4IQMA 4ZA1A 4HR2A 3MWBA 1JLFB 1Q5VA 3SCIE 3HT0A 4USWA 3BSNA 5RUBA 3O2IA 5J2QB 4DL3A 1NCLA 1Q79A 4KFBB 3QBCA 2RS2A 1FX2A 2HFZA 6FDRA 2DEIA 3NEKA 1H2VZ 3I0RA 1OPZA 5K5MA 3ZZZA 2G9OA 2L3MA 4L76A 3MECA 4OX6A 4LQ3A 4H54A 3DRRB 3G6XA 3W60A 2ASDA 4G1IA 4EK2A 1NHUA 4I7FB 2GHVC 3CCJS 2YQ3A 3EICA 3D0IE 3X1LB 3BREA 1SUQB 1TUGB 2HG4A 4ZLJA 2ZM6J 1MU2A 3RRHA 4FYYB 1WEXA 4AE5A 3D2WA 1YKWA 5DG7A 1TKXA 5EX3A 2LQBA 2ASLA 1REVA 4XIUA 1RHRB 2R9LA 1GMWA 1FESA 3VGUA 4F2SA 1VRTA 2NYIA 2OSQA 3IBFB 1UA0A 2B6AB 1X9WA 2HLUA 5IQ6A 2E1MC 2XHCA 1S49A 5GAHU 4GC7A 2RHSB 3R5JB 2DR7A 3AD8C 3DDNA 5DRKA 1UL3A 4Q0BB 2XSJB 3P45B 3D6TB 4CO2A 2CPJA 1WOSA 1K47A 1VRUB 3AQOA 3TQ1A 2ZBQA 1VQMS 2DBBA 1FKOB 3P49B 2ADCA 1KLMA 2FLLA 1TU0B 5F8GA 5KFDA 2CVEA 3MZIA 5DDPC 3W2VA 2DT9A 2QA4S 4L3KA 4WP9A 3DRSA 2EW9A 3LH2S 3GFZA 4WE1B 2YVSA 3FZ2A 1NKCA 1ZM3A 4WTYA 2R2SA 5F3TA 3ENQA 5T7LB 4PG5A 3MM7A 3KUEA 1CJTB 2YWEA 2M88A 3DRPB 5KT3A 2ZUGA 3BKTA 1VQPS 3MAQA 2BANA 5GAHI 4ED4A 1WHVA 4R0JA 3J7ZT 2AW0A 1CSJA 3UDCA 4DCPB 4M63A 3DNCA 4I6AA 2XM3A 4N56A 2QG9B 1ZZFA 3C19A 4YOEA 5I42B 2MQLA 1RWUA 4Q5VA 2JEGA 2FHOB 1S6QA 4QPXA 4FP9A 4RLEA 4NXMJ 5K20B 1KDNA 4QIWD 5CYMB 5L1KA 2GMHA 2W8KA 4X4UA 3KHHA 1N34J 1SPBP 1I6JA 1URNA 2GIFA 3D1QA 4YP3A 3HP6A 1OIAA 1JB0C 2HQFA 4ZK7M 3VTIA 5KFMA 2EG1A 2Q1LA 3K57A 4ZVUB 3RBXA 3MPWA 2J9EA 3D6HB 2DR8A 3QZ7A 3QO9B 2DTJA 2WCXA 3HFVA 5BYSA 3ZC4A 2PC6A 4RBUA 5JJBA 3CXCR 2HWIA 2OD6A 3CJ0A 2LXFA 1NNDA 2RSQA 2GGPA 2BJ3A 2FPHX 3R5AA 3VZIA 2X7IA 2AYEA 3S01A 4LF1A 5L39A 2JRSA 1YZ7A 1S1UA 1GXLA 4FVMA 3BO2A 3ZTSA 4ES3A 2MEWA 2V8HA 4ECUA 4OYPA 3AB2B 3NP5A 4IDKA 4DL7A 1PKUA 4MTPA 2HMIB 4F0MA 4DX5A 2W24A 3FRYA 2ZH9A 2HVEA 5D8HB 2FIUA 2FJWA 4PQAA 3CE8A 2W9CA 3EDQB 4F4XA 2ZJQQ 3OW2R 1VQ9S 4CO3A 1RA7A 1VLOA 1UETA 2E9TA 1U4BA 3IRWP 2KB2A 1RHUB 4CT8A 5A8KA 2GVDA 3R5BA 3H4DA 3IM9A 1S9GB 2HZCA 3NKYA 1DTTB 3NLCA 5H9EJ 1MWZA 4C3KA 4BS2A 1A0OB 4JI2F 4AL5A 1FVSA 1UJ4A 1IBKJ 4PQUB 1HNIB 1NHKL 1N36J 2IC3A 3EJMA 2AEFA 3KLFA 1NRKA 4AXJA 1I51B 1U1OA 4AYBD 2W2NP 3IAS9 2QZ8A 4H4KA 3J81Y 3T5HA 1UFWA 2RQCA 3DLJA 1HNWJ 2JLFA 1O5JA 4ID8A 5C2CA 4FKYA 3THTA 3GU0A 2DGXA 4JI4F 1JJ2R 1RU2A 1F6TA 1M0SA 2AKWB 1DJ0A 2VICA 4PR6A 3CD6S 5DO2A 5ETOA 5DQHA 4ILLA 1VISA 1JLEB 1EETA 5AJ3J 4KTQA 3NS7B 5LSLA 3ZZRA 3DLKA 4YQWA 3DGPB 5F3ZA 3MM8A 3MAAA 2RRAA 3ENVA 2ZBIA 1LW0B 1S1XA 3HVAA 1PYTA 3LANA 4YY3F 2DGTA 2KVQE 4MFBA 1HNXJ 4F4ZA 4WFBQ 2R8JA 1U49A 4J9OA 2WVEA 4OHWA 4F26A 1JLFA 3AQPA 2C3MA 3T1YF 1WG5A 4KFBA 2YKOA 3QGIA 3I5BA 2DRDA 1S6UA 4Q7AA 2ZH6A 1X4GA 3P3DA 3VALA 2DNKA 4KT0C 1GT8A 2W25A 2UUCF 1Q78A 3EVMA 2NPFA 2DR9A 3WQPA 3DRRA 5A8WA 1U1RA 2VFRA 3LA0A 2EFQA 2YTCA 2D9PA 4WYWA 2Z57B 4J9NA 5IWAF 3RAXA 3R5GA 5SUHA 1U1KA 3HF5A 1TL7B 1HPZB 1SUQA 2MB0B 5EGYA 3PW2A 1U6ZA 2G1HA 2FHJD 3M1VB 3RG6A 4DV5F 5KT4A 1TELA 4XPEA 3PYEA 1PYOB 1TAUA 2FY1A 2HRYA 2V2QA 2D41A 2NXJA 3I0SA 1F3VA 2W4PA 4RW6B 4DQSA 1SJ1A 2CPYA 2XWYA 2J6SA 3V4MA 2UZAA 4E8UA 3Q2SC 3W9IA 2U1AA 4USJC 4GO5X 2X3DA 3OD2A 1RLDA 4NMLA 3HULA 2W2QP 1YX2A 2EK1A 4USIA 1G2EA 4DFMA 1XNQF 1GXTA 5A0YB 2RRBA 3D3BJ 2MZQA 4Q0BA 4I64A 1RI7A 2XSJA 4ECQA 5L8RC 2N82B 3KLEB 1VRUA 2DD8S 2V69A 5HJYA 2ZKTA 1S1VA 2CQ1A 4WP8A 4OHVA 2OPPB 1RT2B 2IMWP 1O0PA 3CPWR 2FVPA 2CQDA 4M5NA 4ZPTR 4IR1A 3SDEB 4DV4F 3TUPA 4ES2A 1URRA 2IYIA 4WIIA 3BBBA 4OX8A 2J9DA 5KG5A 4WE1A 4JI3J 5HL7Q 4A8SA 3RAQA 2YX4A 1B99A 5T7LA 1NSQA 3SV4A 3CIMA 4OI0A 5SZTA 4N76A 2FY8A 1GMUA 5J2PB 3CVKA 1CJTA 3IMQJ 2FLOA 4FNIA 2IVMA 2H9ZA 2M52A 4IOAQ 1RAJA 5D3GB 2OEJA 2P2CB 5HLFA 1B0VA 2FZKB 2O5DA 2KI2A 4RZRA 1VQ7S 3HZGA 3X3UA 2EBGA 1S1WB 3AXKA 5KG6A 4P10A 1L5UA 5LT5A 3SSSA 1MWYA 3B8HA 5D0GA 2XEXA 1N32J 3Q86A 2EEYA 1UVIA 4A8FA 3IWXA 4RU9A 1VFJA 4M5DB 3AA9A 4DLGA 2ASYA 2XCAA 4OIXA 1KFSA 2PN6A 5CYMA 2AHOB 4AL7A 4YR0A 4B3MF 4CLUA 3CUNA 4DUYJ 5CABA 4G1QA 2ACMA 4J9UE 3KUHA 2OJ3A 4WK3A 3C46A 1HWIA 4C0HA 3TVZA 4OYOA 3UFCX 4ZPDA 4CLZA 4LF8F 2F4VJ 1Y11A 5KFQA 3R9LA 2D3UA 2PO4A 4DL4A 3RZAA 2BJ9A 2HHVA 1PAEX 2IPOB 5JXSA 1U09A 1K0TA 2UXDF 2ZWPA 4WK1A 3M2UB 2QEXS 2LA4A 2ZBPA 8AT1B 3M9MB 1NZAA 1U24A 1YK9A 3CJRA 3TRGA 3QNWB 2MKHA 3RBDA 3BGRA 4N7TA 1TL4A 1FJGJ 4X4SA 1X5SA 3GV7B 4DWIA 3ADAC 2DGQA 3E2EA 3G82A 2B3TB 2R7VA 5FJ4A 4NA1A 3QATA 9ATCB 2HURA 1WHYA 2CDRB 4OZ3A 2ZC4A 2FQQB 3OFFA 2JFDA 5D78A 2JLEA 4U8VA 1K1SA 5T14A 5EHHA 3H40A 2KZZA 4HACB 4OI4A 1SH2A 1ZPVA 2JJ4D 4USUA 2VPYB 2ZVSA 5F8JA 4ED3A 2IDEA 2DNNA 4IKAA 3GG1A 4A8QA 1SL0A 1WC6A 4RPFA 8ATCB 4ZVTB 4ELVA 3WDOA 1R0AB 2XGQA 2V94A 1KKHA 3TEGA 4NLVA 3WC2A 4OHXA 3EGNA 3C8YA 4EUVA 1WUUA 1NPRA 4PYDA 2VDIA 1S9GA 1DTTA 3QSIA 4WZMA 4LF7F 2IBOA 1F5AA 4ZP9A 2ZZTA 4PQUA 4OI6A 3M9NB 1JLBB 2MHNA 4PPZA 2XZDB 4L73A 2MKYA 1RJJA 2DR5A 4FBTA 3M8QA 1RCOB 2HKEA 4H4KC 1RBAA 2AX0A 4BHQA 3EPIA 1WNEA 4ECZA 4Z7YA 2E7WA 3OQ2A 2MZRA 2MLZA 4CM2A 4C11B 3OHAA 2ZZNA 3WC0A 1VQ5S 3ZTPA 3WIUA 3OPKA 1SC6A 3BDEA 1KQSR 2KVIA 3MCOA 5FD1A 2YNFB 5JVGQ 1LK7A 4WU2A 3GIMA 2FVRA 3OXFA 3U7JA 3OVAA 2HFNA 3ENWA 3F44A 3KJVB 2W01A 4URSA 1JLEA 2BDPA 2LEAA 4C9DA 2M8HA 3NGRA 1HBOB 3C66A 3T5LA 4NZ6A 2UV8A 1RQ0A 5ETKA 4ERDA 4RW7B 3RRKA 4NASA 3CCSS 4KV8A 2I5JB 4DQIA 2H51B 2PFDA 1OPIA 2R8GA 1KN6A 2OAUA 5LXYA 2VG6B 4LIRA 1WKJA 1ELOA 4PG7A 2ZH1A 4EU0A 2XNRA 2E7XA 2VHGA 2AZ1A 3MPUB 5B08A 2X1GA 3TQEA 1KQFB 2JVOA 4N41A 2KYZA 5FDLB 2FGCA 4C8KA 2LLZA 5L38A 2V5HG 1TKTB 3UCGA 1VQNS 2NUUG 2B9XA 1WI6A 4UF4A 3DOKA 3AT1B 5E2QA 4BWJA 4OYAA 4FBUA 4WYLA 2EBEA 1VR6A 1TVRB 4CWBA 1PC5A 3UQSA 1BQNB 1C1CB 2AF6A 1H98A 2XSFA 1RT4B 1CJUB 4TLQA 2RIJA 4NRUA 3UW1A 1B3TA 5EDWA 1ULRA 4CTAB 3CMQA 1WF1A 4ZJOA 2BJ8A 1QAXA 3UNYA 1UTAA 5ETRA 2YPYA 4ZVPB 4LR9A 3M1VA 1SBRA 2GFFA 1QUVA 2H3EB 4O0IA 3NGUA 1CJKB 1IM6A 1FRMA 1NK7A 1NDPA 1HNVB 2NXNA 4RW6A 1Z2ZA 2DH9A 1AROP 1YRTA 1DLOB 2F8EX 2L48A 1IBCB 2MGZB 2ZHOA 1FRLA 4IRKA 3WBZA 2IA6A 3F0NA 2MQOA 3FNNA 4F4WA 3JTOA 5B0AA 5KFGA 2CWXA 3KYLA 1TZ0A 3IGVA 4XDDA 1YRXA 3DM2B 4X4OA 1KRPA 3RUBL 4TYAA 5LL6d 1IJEB 1GX5A 2O01C 2CPHA 1Y7PA 2WSEC 3T5JA 3V6JA 2F9JA 5JVHQ 2CPDA 3NAIA 2R7WA 3BQ1A 2KXFA 4CLTA 3FZBA 2IJNA 4OZ0A 4DJBA 3QFHA 2HNYB 3AJDA 1L3SA 3TYTA 1FXLA 2YKAA 3GFHA 3PHTA 4UW2A 1KONA 2OPRB 1NAQA 1RHKB 1X0FA 3BN7A 1LWEA 3J7YU 3RR8A 2OSRA 2E5IA 2EFPA 2DHSA 1HD0A 3E3XA 1T11A 4UY85 1RT3B 2YPZA 3S1TA 3LP2B 1NHVA 2C2NA 3I4PA 4AL6A 4DR1F 1U0HA 4QW8A 1YG0A 3AJ1A 1RLCL 3N6NA 4NWBA 1KOOA 1S7HA 4WKYA 4CYUB 2JC0A 1DAXA 2PEBA 2PDAA 4JI2J 5AXLA 1P1TA 1FNMA 4GVBA 1PYSB 2BEFA 1HYSA 3THVA 1U0SA 4Y6IA 3LW5C 2J0SD 2LMIA 1KOHA 1OJ4A 1OSDA 4LBHA 3HPOA 4OJHA 1HD1A 1X31C 4LF9J 1HL6A 2NUHA 3T1AA 3L7OA 3TX8A 3VAMA 3W66A 1RT5B 3AB4B 2XI3A 4NOHA 4K59A 3T41A 3Q22A 4PZVA 3BDPA 4RUAA 4ECSA 3CMES 4B3RF 2XS2A 3ZFVA 4ICLB 2L41A 4OFZA 2DHHA 4K4XA 4X4TA 2QFJA 4DL6A 2LQ5A 3MPDA 4ED6A 2DHXA 4JI4J 3J7YI 3CC4S 3N6MA 1CEZA 1PC4A 3NRBA 3O5TB 2MLYA 3GV5B 4DZDA 3LAMA 4UZBA 5HQLA 3OL9A 5HANA 1DZ5A 1S0VA 3NNCA 3Q8SB 1T9YA 1R0BG 3M2UA 1VJWA 3Q8UA 4WFZA 1KC8T 1FRIA 4OJ3A 3US5A 1RT7A 4WFAQ 3W7BA 2F8HA 2CQIA 2CQGA 2VL1A 3OV7A 3PR5B 3AXMA 3MMCB 4LIWA 3VWSA 1SB6A 2MKKA 2VJVA 2RUGA 4N5SA 2CJYB 2MSTA 1NDKA 3QGGA 3SIPB 4YY3J 3V2UC 1IJFB 2R7RA 2EKNA 4DL0C 1WTFA 1NJYA 1LK5A 4KGKA 1RKIA 5B7WA 4U95A 3T1YJ 2DITA 4HACA 2ZJPQ 1T9TA 1NO8A 4KGVB 2HYIB 3TOQA 2UUCJ 2HPUA 3MM5B 1S79A 3JAMU 4RNMA 1M1HA 4K4ZA 2KHCA 3IGNA 3EXYA 5J2MA 3IAM9 1SQGA 1IBLF 1SJFA 3Q0AA 3C15A 1Q95G 3RB0A 3IBWA 3R1LA 3GYXB 3NS6A 3BH7B 4V19X 5IWAJ 4TY9A 1HQUB 1FERA 4RUHA 2UVUA 4RWXA 2R8KA 3ZTQA 2UXBF 4DV5J 3POTB 4KO0A 5HMZA 1NH8A 3IN5A 4MMOA 1ZAVA 1S6OA 3M8PB 1ZPWX 1GMVA 1JLBA 3OXLA 1K44A 4J7CA 2BJDA 2CQBA 2DNOA 3M6XA 1SH0A 2OEMA 4J91A 3DU6A 1VCTA 2K3IA 3PXGa 1XNQJ 2XS7A 3CJKB 4DCOB 5ITHA 3G6YA 4ZCMA 4IFYA 5HQMA 3SCLE 2WOMA 2BRLA 4C11A 4Y2CA 3DYAA 2W9AA 1C4CA 3MR5A 4NLYA 4IOCQ 2HVIA 3SXLA 3OTCA 1NK4A 3QRQA 1F5BA 2QA4G 3IR7B 4DQQA 1B0TA 1V3RA 3FBEA 1VLYA 1BLUA 5GMEA 1FRXA 3FK4A 4PWUA 1IVZA 3KJVA 4LJMA 2J0WA 2C2OB 1R6YA 2KG1A 2ZHAA 2WRMA 2LXUA 2OPQB 4UY8T 4RW7A 4ZCLA 1HWJA 4CM0A 1DQ9A 3PEJA 3MEKA 4Q2LA
chains in the Genus database with same CATH topology
1Q79A 4DFPA 1PSDA 2JEIA 4KFBB 3OSNA 4TU8A 3FJ2A 4NCAA 5KFWA 5G4DA 2RS2A 3MECB 2YH0A 2HFZA 6FDRA 4URQU 2HLTA 3PJXA 4DL5A 1H2VZ 5J2QA 4NRTA 3AHPA 3I0RA 3RW7A 1S72S 1OPZA 2BBEA 5D4NA 1N6QA 5K5MA 3ZZZA 2G9OA 4QWDA 1KQKA 2L3MA 1B0PA 2ZH5A 2DO0A 5DGAA 3SMZA 3U02A 3MECA 4OX6A 3IR5B 3MUMP 3D0HE 3FRZA 4LQ3A 4H54A 4WF9Q 3DRRB 2MDAA 1HWUA 3CF5Q 4DS4A 4CZCA 3G6XA 3MCSA 3IA0A 3CSKA 4DR6F 2VH7A 2ASDA 4I67A 4G1IA 2DGUA 5J2NA 1Q8LA 2KFNA 4FS2A 3D5MA 3EYZA 4NLRA 4F67A 1NHUA 2DGWA 4I7FB 2GHVC 3CCJS 5F8MA 3PM9A 4MIAA 5H9FJ 2YQ3A 5KG1A 1XEZA 3LWLA 1NK6A 4W92B 3V6DB 1XR5A 1T3NA 1RYRA 3D0IE 2KM8B 2W7OA 1P27B 2IMOA 3G6ES 3BREA 1SUQB 1TVRA 3X1LB 1VQLS 3QWUA 5L1IA 3HKZD 2HG4A 2ZE2B 1VRTB 1BQNA 1MU2A 4DV0F 3RRHA 4I7FA 2QSFA 4R5PB 2FJVA 3B4DA 2LYVA 1R7IA 2J7KA 1WEXA 4AE5A 2BM0A 5E0OA 3D2WA 5DG7A 1TKXA 1KHVA 5EX3A 1TL3B 2LQBA 2DK2A 3V6DA 3U27A 1RT4A 2ASLA 1FJEB 5J1EA 1REVA 4XIUA 1D8YA 3RB4A 2R9LA 2KKHA 2ZZMA 1FESA 4F2SA 2ZE2A 1VRTA 3RR7A 2NYIA 1SQEA 1OQ3A 2OSQA 4HL9A 4CTAA 5DM7Q 3DMJA 1UA0A 3HVTB 2B6AB 2PD1A 1X9WA 3I55S 2BM1A 3SZ2A 2HLUA 5IQ6A 4PPDA 1E6VA 2XBPA 1Q86T 2E1MC 2EG2A 4MYTA 3OL6A 4R8UB 3PNIA 1Y5LB 2HNZB 4DHVA 1S49A 3ZZYA 5GAHU 3OTOF 4QR1A 3PFEA 4GC7A 2HHUA 2GX8A 1R31A 2WK4A 1JLQB 1X7VA 2DR7A 3DDNA 2WB1D 2EFNA 5DRKA 2ZHBA 2B6AA 2J6UA 1UL3A 3K58A 2QMXA 3LPYA 4TKTA 1OQ6A 4Q0BB 1DQ8A 3DOLB 3HLUA 4PCQA 2XSJB 1XR7A 2DRBA 4YUDA 2WSCC 4CO2A 4J9MA 4J37A 2XS5A 2CPJA 3UR0A 1UWBB 3NCPA 1VRUB 3AQOA 3TQ1A 4BBYA 2BQRA 3W2VB 4QWEA 1VQMS 3QMQA 1UJ5A 4N47A 3CCES 2R7TA 2DBBA 1QSSA 2VA2A 1FKOB 3P49B 1U45A 2ADCA 3FGVA 1KLMA 5LSOA 2FLLA 5F8GA 2FD2A 3Q8RB 4ILRA 5KFDA 3L3CA 4HVZA 2CVEA 3AY0A 3DLHA 3PHEA 1KQGB 2B9WA 3MZIA 3I31A 5DDPC 2OMLA 2VOOA 1H3DA 4JI0F 2Y1JA 4D3HA 3W2VA 5AE3A 2DT9A 2QA4S 2RILA 1C2PA 2QLWA 5HN0A 2XLIA 4IYQA 1FKOA 3T6JA 1YQHA 3MPYA 3DRSA 4PG4A 4F25A 4K4YA 2I1RA 2EW9A 3J80Y 1WACA 2EPIA 3HXMA 3M30A 2JEJA 3DM2A 2XULA 3UI3A 1U7LA 2UV8G 2O67A 1IBMF 3LH2S 3GFZA 4NLXA 4WE1B 4X62F 4NLDA 2DO4A 2YVSA 2DNZA 3MM7B 4ZVFA 1FXRA 2Q43A 5IT0A 3FZ2A 4X4RA 1NKCA 3NS5A 2AGPA 3VQSA 3E8OA 1L3KA 2Y1RI 4DF8A 1ZM3A 3LF0A 2CVIA 2CZVC 2UUTA 4WTYA 4XDCA 2KT3A 5D77A 5F3TA 2R2SA 3ENQA 5T7LB 2EI5A 3K5MA 2KXHA 5IXUA 4PG5A 1H6KX 2QV6A 2KH9A 2BANB 2B43A 3CCTA 2RKIB 3MM7A 3CD0A 4KBIA 4QU7A 4WJBA 4UOCA 1ZM9A 4TY8B 3I5CA 2GQCA 4LVNP 5LSRA 3BR9A 5F0WA 2WW8A 2YWEA 2CYYA 2M88A 4ECTA 3DRPB 2VUGA 3F56A 5KT3A 2ZUGA 2VPZB 4PUOB 1VQPS 3MAQA 3MTKA 3OVSA 1SI9A 2R7OA 2BANA 3UCZP 5GAHI 2K1RB 3PW0A 1WHVA 5HP1B 2RKIA 4R0JA 3WX4A 1IN0A 5HMWA 3J7ZT 3T1HF 1N4LA 2HNYA 5KG7A 3K2YA 2AW0A 4TY8A 1U2RA 2HAIA 3BO3A 2BACA 1CSJA 3K59A 3UDCA 5KFNA 3FFIB 1O51A 2DRAA 3DRPA 3ISZA 1YJUA 3K0JA 1JLAB 4X64F 4GMKA 4ED1A 4B9MA 4M63A 3QAEA 4J9RA 3DNCA 1XC9A 4I6AA 4UUWA 1RGVA 2KDOA 4N56A 1VQ8S 1S6QB 2OP5A 2VKRA 1RT6B 4MKAA 1ZZFA 3KHRA 3MD3A 4YOEA 2F3JA 5I42B 1AFIA 1JLAA 2MQLA 1J5OA 1RWUA 4Q5VA 2JEGA 1TFWA 3LP2A 2FHOB 1F9FA 1T95A 2BOPA 1S6QA 1DBDA 2XI2A 4QPXA 1D1UA 1CVJA 4USHA 4H4OB 5DGBA 2XNQA 4FP9A 4CH0S 4I6YA 2DNPA 2C22A 4M95A 5ADZA 1RYSA 4MIBA 2AYBA 4RLEA 5I42A 3W3SA 5A6PA 1KD1T 2NLWA 4QIWD 5CYMB 4F3QA 5L1KA 3B82A 2GMHA 5F8HA 2W8KA 4X4UA 1BC6A 3KHHA 1ZZNA 2ADBA 1TFYA 1VK8A 3C6TA 3LQVA 1I6JA 5B09A 5MLCV 4H4OA 4RBVA 1URNA 5DETA 3JYTB 3D1QA 4ZKAA 1SJQA 4YP3A 3HP6A 1OIAA 3FSYA 1VQOS 3BEGB 2LU2A 1JB0C 2V0NA 2HQIA 2FJXA 3LWMA 1UAWA 5AXNA 2UVVA 5IFMA 3MI7X 3GR0A 1VQYA 2ZBCA 4ZK7M 3GV8B 4Y00A 3VR1A 3OL8A 3VTIA 4HI1A 4OI3A 1QJHA 5KFMA 2EG1A 4ECYA 2Q1LA 2VBXA 3OJSA 3DLBA 3K57A 4Y28C 3JYTA 1LWFB 3MEGB 4DV7F 3DLEB 5DLGA 2V4QA 1Q4RA 1KHWA 1RT5A 2ZDPA 7FD1A 3MPWA 4OX7A 2J9EA 2DR8A 2ACYA 2CJ9A 4L6V3 3G71S 3QZ7A 3QO9B 2PMZD 3VZHA 2Z2LA 3KLHB 2DTJA 2WCXA 5KFXA 2MZSA 3K8VA 1U6FA 3S7RA 4DG1B 4EWTA 3PR4A 4F4YA 2IM1A 1VQ4S 2PEHA 5BYSA 1LWFA 3MEGA 3ZC4A 2PC6A 2ZC3A 4RBUA 3KK3A 5JJBA 3CXCR 2B7BB 2HWIA 4HEA9 1XTZA 2OD6A 4B9UA 3GE9A 2C2DA 2DH8A 3CJ0A 2LXFA 3QO9A 4J9KA 3NGDA 3TO8A 1NNDA 1UVKA 3KLHA 2VFSA 3LP1B 1F60B 4DG1A 5CYJA 4ELUA 1UEUA 2RSQA 2GGPA 3KMSA 3PACA 2FPHX 1CC7A 2BE2B 2CPZA 3R5AA 4I0WA 3G9CA 1M5HA 1S1UB 3VZIA 1IKVB 3IFEA 2A1BA 2FTRA 1A7GE 2VD3A 3RBEA 2C2RA 1X4AA 4JYAF 2AYEA 3S01A 1YBAA 3TVYA 1NK9A 5DDOC 4RNNA 2DVIA 4F3OA 4LFBF 1HBNB 4OL8A 2GHPA 2XMWA 2EFVA 5CQGA 4Y65A 5L39A 2JRSA 2BE2A 3F41A 4F02A 1S1UA 3VAIA 1CQNA 1IKVA 2YX7A 4IDKB 1GXLA 1HMVB 3FQLA 4FVMA 4Y2AA 2E1RA 2NPIA 3BO2A 5EUHA 3RTVA 4HDGA 5HBMA 2ZOMA 2V8GA 1W25A 4ES3A 4NLUA 2J9CA 2V8HA 2HWHA 2Q6CA 2QYCA 5J1PA 4ECUA 1HBNA 2DNQA 3QJPA 1YRUA 3AB2B 3NP5A 3GR1A 2X1AA 4HYKA 4OZLA 2QLXA 4ZLPA 3ICLA 2B4UA 1N32F 4QOTA 1DHMA 4IDKA 3IO1A 4DL7A 5GAEU 1IUJA 3KFWX 2E5JA 5G0RB 3N9UC 4MTPA 3T9NA 2HMIB 3OVBA 3O6QA 1G1XA 2LA6A 2FB0A 3K7RA 3SFUA 2GMJA