1BQXA

Artificial fe8s8 ferredoxin: the d13c variant of bacillus schlegelii fe7s8 ferredoxin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
77
structure length
77
Chain Sequence
AYVITEPCIGTKCASCVEVCPVDCIHEGEDQYYIDPDVCIDCGACEAVCPVSAIYHEDFVPEEWKSYIQKNRDFFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of an artificial Fe8S8 ferredoxin: the D13C variant of Bacillus schlegelii Fe7S8 ferredoxin.
pubmed doi rcsb
source organism Bacillus schlegelii
molecule tags Electron transport
molecule keywords PROTEIN (FERREDOXIN)
total genus 17
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1998-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqxA00
1FDDA 1H0HB 2WSFC 5L8RC 1DURA 5CHCB 3MM7B 5FD1A 3MMAA 3MM9A 3MMBB 2WSEC 1FTCA 1FRXA 3MMCB 1SJ1A 3IR7B 1JNZB 2VPWB 1F5BA 2PMZD 3MM5A 1D3WA 1DAXA 4XDDA 1GAOA 2V2KA 1JNRB 1FRHA 1Q16B 1WTFA 1IQZA 1BD6A 4DHVA 1FERA 3EXYA 3MMBA 1FEHA 3MMAB 2FJAB 2VPZB 5E7OB 4Y28C 1SIZA 4XK8C 3HKZD 3MM8B 1FRMA 4OMFG 2FGOA 1JB0C 1GTHA 3IR6B 4L6V3 2IVFB 2XSJB 2FDNA 2FJBB 1C4CA 1Y4ZB 1B0PA 1AXQA 2Y0SD 1BLUA 1FRJA 1K0TA 3EUNA 1FRKA 3PNIA 1R27B 2ZVSA 4ID8A 1Y5IB 2FJDB 2GMHA 1H7XA 1FDNA 1F2GA 3GYXB 2PA8D 4XDCA 1FDAA 4AYBD 1PC5A 1GT8A 2Z8QA 7FDRA 1FRLA 2FJEB 4RKUC 2WAQD 2XSJA 3OR2A 1FXRA 1FD2A 2V4JA 3OR2B 3MM9B 1G6BA 2FD2A 3MM7A 3MM8A 6FD1A 1FXDA 1H98A 3OR1A 1GTEA 1B0VA 1B0TA 1G3OA 1HFEL 3LW5C 2C3UA 3IR5B 1C4AA 1Y5LB 2V4JB 3MM6A 3EGWB 1VJWA 5CH7B 1F5CA 1Y5NB 1BQXA 1FF2A 6FDRA 3MMCA 5BYRA 1KQFB 5BYSA 4CI0B 2WB1D 2C3OA 1BWEA 4KT0C 2C42A 2WSCC 1FDBA 1SIWB 1ROFA 7FD1A 1A6LA 1XERA 1PC4A 2O01C 1IR0A 2VPYB 2PDAA 3C8YA 4YDDB 1CLFA 1H7WA 2C3PA 3MM6B 2VKRA 2GMJA 2C3MA 1KEKA 1FCAA 3MM5B 1DFDA 4OV1A 1FRIA 2C3YA 2VPXB 3OR1B 1RGVA 1BC6A 5BYQA 1KQGB 2UZAA
chains in the Genus database with same CATH superfamily
1UFWA 4F3OA 1YBUA 2JHEA 4PPZA 3CIZA 4NEZA 4A8QA 3O3LA 4BC7A 3KJVA 5KFIA 1HNXJ 4MK7A 1N48A 2E5IA 1S57A 4K4YA 3H8YA 4F2RA 3MM7B 4O0NA 1VR6A 1S1WA 2EK1A 2LMIA 3MM9A 3ONQA 2OD6A 4OHWA 4TY9A 2B4OA 5F0UA 4O3NA 5I3UB 2YWKA 2R7WA 1S10A 2I2YA 1XQIA 2BJEA 2XMJA 3IR7B 2ATCB 4NA1A 1S99A 3BKTA 4TNOA 3ZZTA 4CO2A 1LWCA 2GAGC 4L3KA 2IM2A 4DCOB 5LT5A 4ZKAA 2CQBA 2RE1A 4KH0B 4DCPB 1MWYA 3L7OA 2ZOMA 3BGOP 5JJBA 3T3FA 3Q83A 1KFSA 4JV2A 3M2UB 1B7YB 3CJKB 1WJ9A 4ILLA 1JNRB 2IYIA 2UXBF 4WWSA 1Q7YT 5A8RB 4IO9Q 2HGNA 2DO0A 3FGVA 5KTQA 1HBMB 1TFYA 2KM8C 4LFBF 4DL5A 3B8HA 2CAJA 1TL7A 1S1WB 2VBZA 4Y00A 1WORA 2CPDA 3LA0A 2R7QA 4IG0A 5I42A 2Y8WA 1HLWA 1FT8A 1RAOA 1SIZA 1W2IA 2DXDA 2HHVA 2Y1JA 4PQUA 1J5OB 1E6VB 1RA6A 2ZNYA 2XYHB 1UFLA 3NGTA 3POTA 3IM9A 3T9NA 2CNLB 4OHZA 5J2NB 4E8UA 1HHQA 3AFGA 2KVQE 4HT7A 3UQSA 5DETA 4BWMA 5F8MA 3KLHA 3F44A 2FJWA 1HQEB 1KHVA 2LYVA 3WC0A 4F04B 2FDNA 2V9WA 3HFKA 3I6PA 4LSNB 1F6TA 5A8RA 1D0EA 1BY9A 4QYRA 2BQRA 1I51B 2JEGA 2BMBA 4WXOA 3RRKA 2YWFA 4X4VA 3QIPB 1ZTTA 1FRKA 3VAGA 3TEHB 3ZNUA 2PMWA 2B5JA 4CT8A 1KS2A 1YJRA 2EKNA 3QLHA 3FSXA 5I4MA 2M52A 3JS9A 5HBMA 1SCJB 3H7HB 3KNAA 2ZJRQ 1JLCA 3JQJA 3GYXB 2FJXA 4AYBD 1PAEX 1NZ8A 4Y34A 3D6FB 2FIUA 4LF1A 1J5EJ 1FRLA 1RU2A 2E1PA 5G0RB 2VJUA 4N76A 2BANB 3GIKA 1YZ6A 1F3VA 2IVMA 5E33A 2HLTA 5B0CA 4HL9A 3K8WA 1R0BG 5KT6A 3J7Z5 4Q2LA 3HT3A 1GNKA 2CPEA 4H54A 4NA2A 5J2QA 4ATNA 1SKSA 3R5JB 1FD2A 2V6AA 1VK3A 1EAYC 1G6BA 1DTQB 1C2PA 1UAWA 1WC3A 1NXIA 3I9ZA 1RT6A 4QJVA 2KDOA 1BE4A 2V63A 1A0OB 1B0VA 1EARA 1GK8A 4DG1A 5L39A 1TKDA 1IR1A 5CYMA 2ROPA 3M8WA 2GQQA 4G1QB 1F3FA 2C2DA 1ZYQA 4C3LA 3W2WB 5F3TA 4DV6F 3QO9B 2GO8A 1FFSB 5A0YA 2XS7A 1IKXA 3UI3A 2J9DE 2B3TB 3KLIB 3O6QA 3A1YG 4KPYA 2M8DB 1P1TA 4PG6A 4L73A 4UTGA 4DJBA 4KHPJ 1CPZA 2AHOB 3H0PA 3JTPA 3N0VA 4FKXA 2XM3A 2WB1D 3ILJA 3MEDA 3DRPB 4LUBA 3UFCX 2WSCC 3Q22A 1NDCA 2HZVA 4ED5A 3TOQA 5LMNF 2YWHA 3GJTB 1KLMA 2G0IA 2GO9A 2M2BA 5I3QA 3DLLQ 2DNQA 1P9QC 3GFYA 3R8YA 3BO3A 2DR9A 3T6JA 3MEKA 5HSPA 3PR4A 4KAIA 4NLOA 2A1BA 2BABA 2ZITA 3H98A 4USKA 4YDDB 5JVGQ 2EBEA 2C3PA 3MM6B 2VKRA 4RW7B 3PY8A 2ZZMA 1P1LA 2OMOA 3IS9B 2KFNA 1DFDA 4ELTA 1UJ6A 2FZGB 3CB4A 3SV4A 1BHNA 5KFKA 1N34J 4W92B 4OHYA 5F9LA 2J76E 1MG7A 2DH9A 3SDEB 1LW0A 1KTQA 2C22A 4WIQA 1QE1B 1U0SA 2FC9A 4OX9J 1V5VA 3CW2C 4CO4A 2OTLS 1S9EB 3EGZA 1ZAXA 5H1SV 4NZ0A 4RBTA 2LEBA 4JV1A 3HFVA 2XI3A 3TJAA 3M4XA 2B8QA 2F40A 3QSIA 4JI5J 3E51A 2XEXA 4JOUA 1OYDA 2WRMA 3I4PA 4QPTA 4YFUA 3PW7A 3I5CA 2X51A 1H2UX 4DBQA 4NXMJ 2DGOA 3EZOA 1Q5YA 4OZLA 1BD6A 1P8GA 1S1VB 3T41A 2D3OR 3CDWA 4X66J 3KJNB 3HPOA 2CPYA 3SDEA 2B4UA 1RA7A 2XGPA 2B9YA 3EXYA 1UJ5A 1IKWA 2E1MC 5LM7E 5LMUJ 2AZ3A 3MECA 2KT2A 2KT5A 4OYPA 4YS2A 4DL4A 2MKCA 4KV8B 1RYSA 2AQ4A 3C6UB 2BKOA 4QR2A 3W65A 4DS5A 2KHDA 2F8EX 3IRXA 1BMQB 1N5TA 1ZOTA 2C2ZB 3TQEA 2ZKTA 2V4QA 4DV0J 3NL0A 3QFHA 5H9FJ 2NS1B 2BE2A 1F0XA 5E3CA 4DSIA 2EEYA 4ZCKA 5D4NA 2M8HA 3RJMB 4ETZA 4RW7A 4Y0FA 1C4CA 1JLAA 1V3SA 5C2GA 3JYTB 2D1CA 1JWWA 2AYMA 2FUG9 1BLUA 4XAKA 3O2IA 3THVA 4C8KA 3UCZP 3EVMA 2XNQA 1SKRA 4FF1A 4PWDA 2VH7A 1GMUA 4L76A 2ERRA 1HNVB 2VG7A 4HEA9 1TL5A 1WDTA 5HLFA 1UTAA 4Q5VA 1RZMA 2E7WA 2VFSA 4HR2A 3CC4S 4PG4A 4XPCA 2BQ3A 1AT1B 2ILYA 3ENWA 2CKWA 1YKWA 2DITA 3B6BA 1YJUA 5ETLA 4RKUC 4X64F 2AKWB 3QT8A 4DU7A 1U4BA 5BXIA 2J7UA 1HNVA 2OO4A 2VG7B 2YXLA 3DRRA 1U0HB 5DZ6A 1LQ9A 1J2VA 2RRNA 2ZDPA 1SH0A 3M8ZA 4HHJA 4LF9F 2DGTA 2HAIA 4PRFA 4EBEA 3PIOQ 2KVIA 2FD2A 2IPOB 2JX2A 4FKYA 2NLWA 3MI7X 4WJBA 3PIPQ 2RSQA 4R5PB 4AT1B 1B0TA 3HP6A 4W90B 2BKNA 3FEYB 3H42A 1C4AA 2X1GA 2RF2A 4OI2A 4Z2XA 5DO2A 4ED3A 5LXRA 3ZZOA 4DL2A 1K9MT 3P96A 5FLXU 2C2EA 5U47A 1IKWB 3FCWA 1EZZB 5DDPC 2F8MA 3AXKA 3M32A 4ZIWA 3GG1A 1NK0A 1TVRB 4DFKA 3PXGa 3KWMA 1KQFB 1QLNA 2VZ9A 4NRTA 2J6UA 2C42A 5KFYA 1ROFA 2V8GA 4OHVA 2V34A 4Q2MA 7FD1A 2IMWP 5M2RA 5K8OA 5F8HA 3MD1A 3PKMA 1HYSB 3TA2A 4JI0F 4R8UB 2KXNB 3UD3P 1LXNA 3BR8A 1BXNA 2EG2A 3C8YA 4DX5A 1X4AA 3JQKA 1JXEA 2KFZA 1X4CA 2Z0GA 3K7RA 5CZVA 5J2PA 2C2OB 3TX8A 3HHNB 3BF4A 4URQU 2DNLA 2C3MA 3HSDA 4DQRA 4EBDA 1VRQC 5KFSA 4O0IA 3P5TL 1YITS 1RWWB 4ECYA 4TY8B 3HSJA 2FVSA 2UUTA 2UZAA 3IMQJ 4P2XA 3ETOA 3TW0A 4B17A 3KMQA 4IDKA 2EG1A 1HNIB 1TKTA 1S4FA 3TA0A 5L8RC 2RQCA 2HYIB 1O6XA 3ZZPA 3G4SS 4Y2CA 2BRLA 2IJRA 2LFVA 1RHMB 4KGVB 4NRUA 3SFUA 4ANDA 3MMCB 1HBNA 1RBOB 5F9NA 3S6EA 4TU8A 2XGQA 1NBEB 1S97A 4KPCA 4YUDA 1MWQA 1LWFB 2GVDB 3N01A 4LR7A 5KFFA 2DEJA 3IN5A 1NJYA 5F8IA 3CJ8A 1JLFB 3LH2S 3MGJA 2D74B 3QAEA 1VQPS 1RWOB 1YDLA 1C0UA 1WC1A 1FD8A 2DIVA 4OYWA 4DHVA 1RWVB 3CDAA 3LANA 4WFYA 1HQUA 3I0RB 3S1TA 3T9ZA 2CQ1A 4ID5B 3G8TA 4LFCJ 3MR3A 4J9UE 4CTAB 3OVSA 3KLGA 5L1JA 3P5BP 2RQ4A 4DR5F 5FDLA 1TK5A 2OFGX 2LDYA 3AJDA 3UN3A 1KLNA 2ROEA 1NSQA 1EKRA 2VASA 2YNHA 4I0WA 5D0HA 1QAXA 3GSDA 4XPEA 2D3O1 2HBZB 3RB3A 3W3SA 1REVB 1VIOA 1YGYA 3NS5A 1S9FA 4MFBA 2YX7A 3PG9A 1NPRA 1O8BA 3IR6B 1FWLA 2OAUA 1U6BA 4P2MA 3ZTQA 5DM7Q 2AJFE 1G7CB 2R3VA 2YY3A 3M30A 2V69A 5AXLA 3Q8RB 3VALA 4CM2A 2A2CA 2OIHA 1RTIA 2BEFA 2OI2A 2B51A 2IJNA 3UPFA 3LOUA 5SZTA 4ENOA 3PNIA 3TZWA 3VZIA 4PAAA 4C98A 2QG9B 1K8AT 1UVIA 1U09A 2K2PA 1T05B 2CPXA 1LK7A 2ZBQA 1U1RA 1S0VA 4K2XA 2VONA 2ZUGA 4HTIA 1X31C 2R8KA 2ADCA 1VLOA 1LWFA 3JB9k 3CCVS 3NXZA 1I5OB 3MF5A 1M5OC 2UVRA 2MJUA 3EX7B 1W2BR 5A8KA 3UE2A 1KN6A 5EX0A 1RT3B 3DI6B 2D41A 2FQQB 3JQMA 1QAIA 4DR1F 3ZC4A 4ICLA 3GB0A 5GAHU 9RUBA 4DLGA 1KQSR 4CLPA 2F7VA 4M63A 1FNXH 4U67Q 1GTEA 1HFEL 2LLZA 1GXLA 2VG5A 4M5DA 5D8HB 4IDKB 4YEAA 2YNGB 4ZN1A 4X65J 1SQFA 3BPSP 4WE1B 2YNIB 4HTJA 3PEJA 1S6PB 4N41A 5G4DA 5CH7B 1NCLA 2W8LA 5FLXY 4MK8A 2DBBA 1UETA 2IVYA 2M70A 1N0VC 1U7LA 3KHHA 5BYSA 3BKFA 2JLFA 2OPSA 3VV2B 1EX8A 3GWCA 3SQOP 5KFPA 1VQ7S 2LA4A 3TJ9A 2GGPA 3GJQB 3Q8YA 1GXTA 2XMTA 3BGFA 5DG9A 1TTHB 2VPYB 5CXTA 5K14B 3CTRA 5GVQA 1UWAA 2DRDA 1MLAA 3BEGB 4KBIA 5IOLA 3L3CA 4KTQA 1EHWA 2EFOA 5E41A 4KO0A 2DGQA 4DEZA 1HWUA 1RT5B 3GSIA 3PRDA 4PG7A 4B08A 4CLZA 4CWBA 5DZ7A 2RU3A 5J2MA 4JI2J 4NLQA 1GX5A 2WK4A 3D67A 4ZN3A 5HP1B 2HPUA 1HW9A 3V6KA 1K73T 1KOHA 1FESA 2CDRB 2EPIA 4J91A 1X9SA 2OP5A 4C8LA 3Q89A 3SSSA 2F9DA 2GGPB 4J90A 1H72C 2CYYA 1WD6A 2E5HA 4USVA 2UUCJ 3VQTA 4ECTA 1RUSA 1MMLA 4O44A 3CCWA 3M8PB 5T7LA 4CP5A 2W4DA 4DN9A 4DSEA 4BDPA 1PYTA 2CJAA 2FHMA 3GJRB 2H54B 2BJ9A 4B3SJ 3TEGA 4OYMA 3I5AA 4OYOA 4Y2MA 1D3WA 1DAXA 2JRSA 2KG1A 2YKPA 2QE5A 4H4OA 2GHVC 3PO5A 1U1LA 2FB0A 4DFPA 1O5JA 2FZKB 4BHQA 1HD0A 5T14A 1FRHA 3ET6A 1RAIB 1NMEB 5HLFB 1XNQF 1GQEA 4FPIA 3EZ5A 2UUBJ 4DUZJ 3CWJA 3LGHA 4MYTA 4NPOA 3SSRA 3MWBA 1UEKA 2HWIA 2MZJA 3I87A 1QSLA 2WCXA 2ZJPQ 1NKCA 1SI9A 2GS8A 2W2NP 3MMAB 4DPTA 1TUWA 2AV5A 2CNNB 2JOQA 1HWIA 2DKOB 3L9ZA 4USMA 2MGZA 3G6VA 3MEEA 4Y28C 2X1FA 4LFAF 1YQHA 4JI0J 1WUUA 2A18A 1RT1A 3VGTA 1D09B 3GYNA 4USJC 3WBZA 1V5IB 3BSOA 4F4KA 2V4RA 3OV7A 3KHRA 1QTMA 3P6YC 3C6UA 4AL5A 3H4BA 3VAHA 3OQ2A 3Q8SB 2VJVA 1WDDA 5LJ5Y 1OQ6A 3HF5A 4U96A 4USIA 3HZGA 2QL7B 2CPIA 3RAXA 1QAYA 3IFEA 3JTOA 1XK8A 5DG8A 4QWAA 1UWBB 4B3OB 2KTQA 2GMHA 2KG0A 4AE5A 1Z1ZA 1SPBP 3CXCR 4Y2AA 4EYHB 6AT1B 3BGUA 3MCMA 3OTEA 3VGUA 2BZ2A 2OSQA 2G13A 1AFJA 3RAQA 5K8MA 3PCOB 1YRXA 4DPWA 2V9KA 1S5ZA 2KB2A 4LVOP 5B0AA 1XMQJ 3OR2B 4X64J 4GC6A 4LF8F 2VV5A 2ZM6F 5D0EA 6FD1A 1X5SA 3DLKB 4NZ6A 3BDEA 1IKYB 3CCJS 4U8YA 1RTZA 2WVBA 2QRRA 3D0HE 3SCJE 4CLFA 2JVOA 4ZPVR 2CRLA 3M8QB 1VMBA 1F5AA 1K0VA 1SQEA 2O3DA 2Q6BA 1VJWA 4X4TA 2CQHA 2EFQA 3HHEA 3I32A 1QUPA 4NLRA 4XTTA 4PXEA 3R9LA 2QA2A 4BBYA 4JV0A 2GV1A 1L3SA 1HBNB 5HK4A 2BUNA 2HNZA 1EETB 5KG6A 4LSLA 2L9WA 4MIBA 4IR9A 3EYZA 1BWEA 3EJMA 2XY5A 4AXIA 2UU9J 4NLWA 2XMVA 2WBMA 2ZHOA 3JSYA 3M6WA 2EFNA 3QQCD 4IQMA 5ETRA 4B3MF 4PUOA 4DDFA 2V2QA 2N4CA 4WTOB 2IHR1 2J8SA 1WHWA 2Z57B 1SV5A 3R6LB 2XTJP 3D9BA 3ZTRA 3G71S 4LF4F 3CD5A 3M9NB 3N28A 1J5OA 2C1EB 1KEKA 3AQOA 3LP2B 2YVSA 1KD1T 1RAHB 2VU5A 4TXSA 1NHKL 3H5XA 3EXCX 2R7TA 1NPPA 5B0DA 3FKBA 3NGSA 1IJFB 2J7KA 4KHRA 3TZXA 2ZKUA 3TX0A 3FEZA 2BM1A 4DV7J 2K1RA 5DLFA 4QIFA 2MKSA 2RDDA 2ZE2A 3HJFA 2ZD1A 1KP6A 4FNIA 4X4NA 2KI2A 3MCOA 3QT6A 3OVAA 2W7OA 1FTCA 2UVVA 2FPHX 3FK4A 4J9QA 1CJVB 4I1TA 1OSCA 4RUBA 1CG2A 2KO1A 1F5BA 4O3QA 4Y2KA 4JYAF 2PMZD 4DUZF 4F0KA 4MT1A 4OHXA 2QZ8A 5K20B 4DV2F 4NLXA 2Q6CA 2NCKL 3HULA 2VBXA 3CJ5A 3M05A 3R7SB 4K7QA 4OI1A 5DM6Q 1T9VA 3HSZA 2HNYB 3G2XA 4KGZB 4ELVA 3UR0A 3GP9A 2G1DA 1SJ4P 2JNJA 2GQCA 4WFXA 2VFVA 4B3RJ 4DSLA 2E9ZA 4IUFA 2LQBA 5HMZA 4KH1B 2DHAA 1YSJA 5IFMA 2QGFB 4ALZA 1CQNA 2CG4A 5E5NA 3LTOA 2K3IA 3W2WA 2HFSA 2OELA 1VQLS 3FZ2A 1RAGB 4XK8C 1NO8A 3A8JA 3FJ2A 5KFLA 4LR9A 1O0PA 4G6VB 4MFBB 4ZJLA 2PO4A 3CDBA 4RNFA 3BBCA 3B4MA 4BC9A 2G2OA 1T8EA 4C3KA 2IVFB 2OFHX 3DN9A 1YJVA 2XMKA 3KJQB 3GV8B 2CWXA 2R7RA 1L3UA 4ZPWR 4F4YA 1P6TA 4EO6A 3PHEA 3IAM9 2B56A 4TQSA 3DLEB 2F5GA 4UOHA 1N33J 2IAJB 2G2YA 2MQOA 1IKVA 1R27B 1VQOS 4F4ZA 3D4JA 4ID8A 2LXFA 1IXKA 4P52A 3EPGA 3V4MA 1Y5IB 3I4HX 1WEZA 3HHDA 2VBYA 2WOMB 3CMAS 4LF7F 4LSZB 4LF8J 1JLFA 4K0KF 1FHTA 4W4MA 4RNNA 3UD4P 1SH3A 2DB1A 2PA8D 3H59A 2L9NA 3U1MA 2BW2A 3IRXB 4JB8B 2W9CB 3WIUA 4IKAA 4LF2A 1ZPWX 2I1RA 5K14A 1WOOA 4PG8A 1T9TA 2RRAA 3K57A 1LWCB 4ZVFA 3DNCA 3M1VB 1JLGB 4KYZA 2XHWA 3R27A 4C4WA 2E29A 2V4JA 3FUYA 4X84A 1FE0A 2HQCA 3W5XA 2IAJA 3W9HA 1V3RA 1FJGF 1RWXB 4FYWB 3BDPA 3CJRA 5LL6d 4A8FA 1A7GE 3RB6A 3IBFB 4C0OC 1H98A 1CS4B 4J9SA 2LQ8A 4X4RA 3LW5C 4DFMA 4LRDA 1HD1A 2RB7A 2V94A 1VISA 2VQEF 2V50A 4DR3J 2E66A 2CQ3A 1RDRA 2NXEA 4OQJA 4R0JA 5J1PA 5KT5A 5EDWA 3C15B 2DIUA 3CDUA 1Y5NB 4ED8A 3IAS9 3LP1B 1KONA 2EK6A 2EFPA 2FHOB 1RABB 2W2QP 5CD4A 1JLQA 1PJ7A 2CWKA 3FRZA 4ITSA 2R2TA 4GKJJ 3DKDA 3W64A 4KFBB 4DOZA 1XERA 2GQ2A 2HFVA 1QE1A 2P5VA 4WYLA 4R8UA 5JMNA 1H74A 1HI8A 2RUSA 3CCLS 1X5PA 3BYRA 4IH5A 2IM3A 2JDJA 2F63A 2ZVIA 1YJNS 2G4BA 1HBUA 2KH9A 3NMAA 1CJKB 2GAHC 2B6AA 3OBIA 4PPDA 5HANA 4Q43A 4Y2IA 4UY85 5KFRA 3QJLA 1U1PA 4RUAA 1X4EA 1FK9B 4J9NA 1FCAA 3UNYA 4I56A 2VA2A 3SFGA 4LFBJ 3H2VE 2XCAA 1FWPA 2ZH4A 2MZSA 5EWGA 1B64A 1PCAA 3D1OA 5IT4A 3RR7A 1RCOB 2PE8A 3LO3A 1H0HB 2HRTA 3I31A 5D78A 3DOKB 2HK3A 2AEFA 1NM2A 1J27A 2ZE2B 1NB2A 4RNMA 1HWKA 3MHYA 1NU4A 4L75A 4LF5F 1S7IA 4RX6A 2MZQA 4PEOA 3G87A 3BH6B 3GONA 5KFCA 2KFYA 1FJEB 3X1LB 3HM9A 3CCRS 3O5TB 3UN5A 2D3ZA 3MUVP 2HHPA 4CQ1A 3QRQA 1R7IA 3CCTA 4DX6A 1JMTA 4P7TA 3ELHA 5KOWA 5KFHA 4FF2A 2DHSA 4IOAQ 2MYFA 3H2UB 3QT7A 1TAUA 2DNGA 2VG5B 2QFIA 3HHLB 1HQUB 1OQ3A 1V3ZA 2NZCA 3I0RA 3JYTA 3UCUP 2UXDF 4GKKJ 3DC2A 4LQ9A 4JI7F 3K5LA 3A8KA 4GVBA 5HVGA 3MMBA 2RDJA 4PYDA 1IBMJ 3NNHA 4CO0A 4G3IA 2EWHA 2QL9B 3DYAB 4A8XA 3G6YA 1M1GA 2VDIA 4NYOA 4DL6A 2E7VA 3SI8A 2R7UA 2H5IB 3RB4A 4ZIVA 2BACA 5LJ3Y 3GFHA 4J9MA 2MQNA 2I8EA 3ENVA 4DFJA 5F8JA 3B78A 3KMSA 4B9TA 3HK2A 4PWWA 3N4WA 4C48A 1C1BA 5SUHA 2YH0A 2YKMB 1T05A 2R7VA 1VBKA 2CZVC 3Q8VA 5ETTA 1FK9A 2ZBCA 4RNOA 3QZ7A 3TARA 2OD4A 1U47A 1RTDA 1RU1A 2Y0SD 2QT7A 4N8OA 3D3CJ 3AJ2A 4RO0A 4Y65A 2GHPA 5L1IA 1IBMF 4FF4A 4K0KJ 1S7HA 2B8PA 2YKNB 1MROB 1SH2A 3SSQA 1X5OA 2MLXA 2LDIA 3A8IA 5L9NA 4K4TA 4HHHA 3QRRA 3W62A 2LKZA 1U2RA 2RKIB 4TLRA 4Z7YA 3FQKA 4C8YA 2VHGA 2HFZA 2IFXA 1RXOB 4DX8H 3OHAA 4JI4J 5CQGA 4KHMA 3SCLE 4KIAA 3PW4A 4QU7A 2J9EA 1Q82T 2DNYA 1PC5A 1KRPA 2JLEA 2UUAF 4LIWA 2J9CA 2WAQD 4ZPDA 4DR2F 2DYAA 5I42B 2AEMA 4C6AA 4WE1A 2OKQA 1AW0A 2OPRA 3JSRA 4XIUA 1BQMA 1R31A 2GC8A 2DISA 3I0SB 3OD2A 4KRWA 5E3RA 5IQQA 2V2VA 4OX6A 1Q5VA 1HIYA 1N54B 2FGCA 1O51A 1RI7A 4WU3A 3S7RA 2LU1A 1Q1KA 3D5MA 3GG0A 2XULA 4DN0A 1Y3JA 3H90A 2DHGA 1T95A 4OX9F 2XNRA 4NZ7A 4BS2A 1BQXA 4NMLA 2VFUA 1CQMA 1TFWA 2CZ4A 2HIYA 2AJ0A 3CMQA 2MLYA 2Q1LA 1RWNB 4ILRA 4QIEA 5BYRA 4WFNQ 2MGZB 2AZ1A 1ZA1B 2KZMA 2BA9A 2KJVA 1FDBA 3MEDB 3L7PA 3LGNA 2HVZA 4DF4A 5KT7A 2J6TA 1RJJA 2N3LA 1WEXA 2XMUA 3CEDA 4MTPA 4PXCA 4R25A 4DV3J 5HROA 1IJEB 1ZA2B 3GMGA 5IM0A 2CQCA 3M8RA 1Q78A 2O01C 4I6AA 5B0FA 3RRHA 3J7AN 2LQJA 3KG1A 5CYJA 1S0NA 4F8RA 2OJ3A 2YNIA 2YTCA 2M4MA 1H7WA 4OLOA 1EKSA 3HVTB 2DGUA 5HATA 3I5BA 4EBCA 8RUCA 1V9OA 2NUUG 1QSSA 3G9CA 2J9DA 3V81A 1Y10A 2HKEA 3HD2A 1RGVA 4F02A 3JTNA 2HWHA 2M88A 1LFWA 1RWUA 2IM1A 1BQNB 4DPUA 1N32F 3V5RA 2JEIA 4ZVHA 4ECUA 3FBBA 2IM0A 1L5UA 1R8BA 1HBOB 4ZLNA 3J7ZT 1N0UA 4EYIB 1RT6B 5KFUA 1M1KT 5CHCB 3CVKA 4TLQA 1R89A 2IYGA 4LRBA 5DLGA 1DQ8A 3KLGB 5DS7A 1N4LA 2B4VA 9ATCB 3J81j 2BE2B 1ZETA 1ELOA 2V5HG 3UW1A 2XMMA 2MKIA 3TI0A 1YRTA 4M94A 3CO9A 3LP0B 1VQ8S 3N6LA 1DLOB 3HCXA 1U1OA 1FFWB 1T3NA 2V2KA 3AB2B 4FS1A 2A10A 1NJIT 1C1CA 4DL7A 1NB7A 3R1LA 2VICA 3KYLA 3KLVA 3AH6A 2HWTA 1HBOA 5ETSA 1ITPA 3KHGA 2HK2A 2LQ9A 3R3TA 1TKZA 4M1KA 2U2FA 4X4SA 5KFJA 3U02A 1JLQB 4AQYF 2FJAB 3BR9A 3DRRB 3CUNA 1LK5A 1Q8BA 3ZTSA 4QW8A 4F25A 4PQUB 5EGYA 2BKPA 2BV3A 3HVTA 3B82A 2RQKA 2O5DA 2Z4PA 2NXJA 2QL5B 1N6QB 1TL7B 2W4PA 3POTB 4ECZA 4CTAA 2G0CA 4K4UA 1S9EA 2A0FB 1F1BB 1QM9A 2RT3A 4P74A 4ZPBA 2W01A 1D9AA 4DSKA 3OUYA 4MYUA 1YI2S 2Z56B 4IG3B 3GPAA 5AE2A 1WACA 1UZDA 4ICLB 5IV4A 1VJQA 4PXBA 5KFTA 1JK9B 4YHHF 2J0XA 1RAJA 1TKZB 3EM1A 3BO4A 4WP3A 2XHCA 3MDFA 5D0RA 3C46A 4KJIA 2ZBPA 2HQ3A 1QVGR 2FJDB 1NAQA 3TO8A 4OYZA 4ZP7A 1OMSA 2PC6A 4ZVPB 2HHUA 2ZJQQ 1F2GA 1Y7PA 3W9JA 1LKZA 3MZIA 1IBKJ 2Z8QA 3FFIA 3M32B 2R4FA 5KAKA 1ZM2A 2WOMA 1SJQA 2NXNA 2RMLA 3JAMU 4YHHJ 3OR2A 1AZSB 1TQLA 5KG2A 3FBFA 1YJWS 3IO1A 3R6GB 4FDFA 4ZCIA 3OFEA 1U45A 3MM9B 4FF3A 3R5DA 5CYQB 2YPYA 4W98A 1VQ5S 3NCQA 1VRUB 1NK5A 4U8VA 3PYFA 4DV7F 3GJSB 4HH0A 5THWA 3KLIA 4CLWA 5KT2A 3TQ1A 2DVIA 2FLLA 2HHWA 2DGSA 3T1YJ 5A0YB 3K5OA 3EGWB 4FYDA 3NCRA 3HVRA 2L9DA 4DV1F 1FF2A 2VFRA 3UCGA 2JVRA 1KDNA 4IRKA 4C8ZA 3GCXP 3QPIA 3AHPA 5HI7A 1UP1A 1VQ4S 1KBRA 1SIWB 3PX6A 2CPJA 1A6LA 5AXMA 3ZFVA 4QQBA 3THTA 3EVOA 2ZDOA 2PN6A 1U48A 3H5YA 4NASA 4WCEQ 4LVNP 4F36A 3V6JA 5M2PA 1C0TB 2M5YA 5KFWA 3AD7C 2AGOA 3DU6A 1R3NA 4GO5X 4HI2A 4IH7A 5DJBA 3P4UB 4P6QA 3UR3C 4X66F 2MZTA 1JLBB 5E3AA 4K8RA 5IZHA 2NYIA 4LR8A 2C3YA 4I7FA 3QMQA 3OR1B 4Y3CA 1L3KA 1RT7A 3VVUA 5D3GB 1KQGB 2HHHJ 2K1RB 2U1AA 3HDSA 3PRBA 4P73A 1OPIA 4JI5F 3DMJA 4HKQA 1WF1A 2QLJB 5FD1A 1UPMB 3CJ3A 1XNRJ 4L72B 1YLXA 4FXVA 1X8DA 1Q79A 3CJSA 4WYWA 2MZ1A 1RB0A 2W2PP 3D3BJ 4C8MA 1L3VA 2IRXA 4C8OA 4Q7AA 4FN5A 4ERDA 2H48B 1SC3B 4ES2A 1VRTA 3T5LA 1YBAA 1H2VZ 2MQPA 2GIQA 4NMXA 2KHCA 4DU8A 1PGZA 2ACMA 4DR6J 3OFFA 2ZH9A 1HBMA 1R0AA 4JV5F 1Q95G 2MMYA 4DI6A 2X1AA 4DPXA 3T1HF 4RW4A 3MPVA 3VGVA 1CSJA 2C2KB 4URSA 1RSCA 1WOPA 2DHHA 4PQAA 3LALA 2ZUAA 3CJ2A 3MPUB 2X1BA 1RYRA 1HWJA 3NOGA 2VL1A 1RT5A 3P3DA 4DV3F 1B70B 3PM9A 4ZVUB 1BQMB 3K89A 2HHXA 1UEUA 2MSTA 1PBAA 4OI3A 3X3UA 2I5JA 3K5PA 1SC6A 3Q86A 3HHLD 5HBMB 1RWPB 1TL3A 3G82A 2YWGA 1UVLA 1IBKF 2OH2A 2BJ7A 4GVLA 2XZTB 2YWEA 4FZVA 3M8YA 4RW8A 3I55S 1X0PA 4LMZA 3FRYA 4RW6A 4TKTA 4X62J 1RTHB 1XMBA 3RB0A 4C7QA 1XR7A 5CA5A 1GH8A 2AYBA 1YJTA 4I4BA 4DUTA 4KSEB 1VGYA 3K0JA 3PYDA 1FDNA 2FC8A 2K8GA 2OPSB 1WEYA 4RW9A 2R7OA 1MROA 4MKYA 4IQXA 2H65B 4I6WA 2QTWA 5CD4H 3A3PB 2M7SA 3BJYA 3ISNC 1MN9A 1QTNB 3EDQB 1VQSA 1HMVB 2WVEA 3RBZA 3ZTPA 4UOGA 3Q23A 4M5GA 1LXJA 2BJ8A 3T5HA 1UW9A 3NGRA 2KJWA 4DR7F 3PVXA 1KVJA 1KNZA 4N47A 3WIVA 4DS4A 4HYKA 4PWUA 1N6QA 2LEAA 4DLEA 1TL1B 3BM7A 2DD8S 1KVIA 3JXOA 3US5A 3Q8PB 1MNEA 1J5EF 1S0MA 3GQCA 2CADA 4ZVTB 2RIJA 3H20A 4CYUB 3FMWA 2DEIA 2APOA 3CDEA 4I7FB 1S6QB 4I2PB 3HKWA 4DQIA 2OMLA 2PEHA 4F4WA 3BGLA 1FI4A 1S79A 2RUGA 2V67A 2PIIA 2CQ4A 2W24A 4DPOA 4M5IA 2QX0A 3QAUA 3RYLA 3TVZA 1TV6A 4UW2A 3GIMA 4JI4F 1VQNS 2ASDA 2ZHBA 3HZEA 3MEGA 4H4OB 1QAJA 4OI0A 3RBXA 2E7XA 3UNGC 4F3QA 4YB1P 2OEKA 4LT6A 2KXHA 2CVIA 3AA8A 5T7LB 3PW5A 3KOAA 1TUVA 3V81B 4O3OA 2QJ3A 4CO1A 1YZ7A 4DUYJ 1PSDA 4DR4J 4X4QA 4NEYA 2A3JA 4DV5J 1BC6A 3HX9A 2IRUA 5DDOC 1HHTP 2PT0A 3NWGA 2FTRA 1SJRA 1X7VA 2WONB 4NYPA 1AZSA 4J9OA 4LBHA 2YNHB 4OYXA 2WSFC 4NCBA 2Y9HA 3CCZA 1PBUA 2HGLA 3M2RB 5HP1A 4JUZA 5CYQA 1JLEB 1PJ5A 3MR2A 3E8OA 2XQCA 5J2MB 2W8KA 3QSYB 1YIJS 1NK4A 2WSEC 3PJWA 4OJHA 1OY8A 4ZJOA 4JI7J 3ILOA 3IWXA 4ANCA 1JNZB 3L7UA 3CT9A 3QNWB 4ZVEA 3BQ0A 2JEFA 3C66A 2UUWA 3CD0A 2OTJS 3G6XA 3HO1A 2J7WA 1VI7A 2LECA 3T1HJ 2DY9A 1RACB 2OPQB 3UDCA 5ETQA 5K8NA 1FXLA 3N5FA 1TELA 3E01A 1N8RT 1ZS6A 3H5UA 5HAOA 3VCDA 1VK8A 2GVZA 3UVJA 2ALYB 5F3ZA 2J0SD 4TN2A 3CC7S 2JEJA 1HNZF 1N5VA 4NI2B 1TAQA 2AW0A 4NWBA 3PHTA 1Q8KA 5H9EJ 1N56A 2ASLA 3MAAA 4WFBQ 3KLHB 2AT1B 3GFXA 5I3UA 1LV5A 1PJ6A 3HLUA 3CC2S 2YH1A 3ZNJ1 3QJJA 2XLJA 1FVQA 2ASYA 1F9FA 2N7YA 2CA9A 2I38A 3NEKA 3NS7B 3TNVA 3J80U 2PFFB 7AT1B 3TZZA 1KVKA 1X4DA 1XJWB 1L3TA 2VOOA 2E44A 4AQYJ 2AGQA 1XN9A 1P27B 5KT3A 3PR5B 3A13A 2YNFB 3DXBA 4EEYA 4GO7X 3HI9A 1H2TZ 1RTJB 2AX1A 3P45B 4TU9A 1XIQA 1JLGA 2HG4A 3M1VA 4NI2A 2X3DA 4WP8A 3RUBL 5GADI 4LF7J 1B7FA 1UA1A 3O1LA 1P9YA 3AT1B 3OPKA 5CABA 5F8GA 4TU7A 4Q8EA 2ZH2A 1MU2A 4O4GB 4FVCA 4OZ3A 3LAMA 1TVRA 3D7SB 4TYAA 5GAGU 5HJYA 3JSBA 1I94F 3W1YC 1TL3B 4ZLJA 4J9LA 4OL8A 3TWZA 3RW7A 3LP0A 3ZZ0A 1C1CB 1TV6B 3FDSA 4OZNA 2OHDA 2B4PA 3DXSX 4CH7A 1UFKA 1WC6A 5CCMA 2Z58B 2QIFA 1FJGJ 1ZBTA 1F60B 2PGCA 1DHMA 1S6QA 3EMTA 5KFZA 2ZOGA 4HACA 3T6BA 3M6UA 3PX4A 3W2VB 3BGRB 3OUYB 3J7YI 5ETMA 1RLCL 1IQTA 3DHXA 4K2JA 2GA7A 3PACA 2POKA 3GYGA 4USHA 3UD5A 3GIIA 4JI1F 1XR5A 3NLCA 1AB8A 1NDKA 4DV4F 1CBKA 3IR5B 2NYHA 3LGMA 5KFOA 3VWSA 3WC2A 3AJ1A 1OY9A 4CLKA 1UVKA 4WZMA 3H40A 1AUSL 3GCWP 1FKPA 3KLFB 2K7JA 1YHQS 1K1SA 4MKAA 4B9LA 3GILA 3HVAA 2ROGA 4GMKA 2UXDJ 2KXFA 1H38A 4WBFA 5IM0B 1VC5A 4WU2A 5EWFA 4IFVB 3QATA 2HBRB 4O4RA 3O8WA 3K58A 5GAHI 2MQMA 4N7TA 4K5SA 4UQTA 3BSCA 1B3TA 1IM4A 1WC4A 4FYYB 2Z2YB 4NCGB 4S0MA 3RTVA 1W25A 2HRYA 4YR3A 3QBCA 2RD5C 1N32J 2QN6B 2XZWA 2Q43A 5E3QA 1Q86T 4I2PA 1OPZA 2K3KA 5A8WB 1IBLJ 2HBQB 2EBGA 3BB5A 1RAFB 3IBCB 2HFUA 1WSVA 3MD3A 3TJ8A 1HI0P 2MY8A 1S48A 2F8HA 1EETA 2J5AA 4LBIA 4L3NA 2UVUA 2YQ1A 1UL3A 3CGIA 4P72A 1X9MA 2DRAA 2HZAA 4PG5A 2DK2A 3U1NA 1LNQA 1AYEA 4FS2A 2MHEA 5ETOA 3VAMA 2CJYB 1CJKA 3OXFA 3BKUA 4K4VA 4ER8A 1VDHA 1JJ2R 5I3PA 3K5MA 2AWZA 3PKYA 3E2EA 3W66A 4KFBA 2DR8A 2XYGB 2PI5A 5E0OA 3VHQA 4F4AA 3CPWR 2XYPB 4X4OA 3KFWX 4NXNJ 2Y1LB 1R6VA 2J0WA 4U7UK 2VB6A 3HXMA 4YB5A 1D9FA 2Q79A 1NNDA 1TMMA 2AP6A 5A76A 5ADZA 4CH1A 4ELUA 3MM5A 3GTYX 4ZVRB 1U1NA 5C25A 2H4YB 5DQHA 4DL3A 4PUOB 1GMVA 2N7CA 3S8SA 1YJ9S 2GIFA 1TU0B 1F2HA 1HW8A 4H4KC 3V2UC 3F56A 2NR0A 3OTDA 5HVFA 4C11A 4DV0F 1IVZA 4V1Ak 1SKWA 2DGXA 3OL9A 4ZCMA 4QOTA 4CIOA 4WFAQ 4EMDA 2W7PA 2VQEJ 3SBMA 4NYZA 1NHVA 5EUHA 1FEHA 4E2FB 3Q8QB 4PXDA 5K9FA 2E1RA 4CLSA 5MAOA 2B43A 3RBDA 5D6GA 4FNHA 5T41A 4JI3F 1X5TA 2R2RA 3TAPA 5D4PA 3OL8A 1HR0J 3CF5Q 3WQPA 3TANA 2CXEA 3OT9A 3VVTA 3ICLA 2XLIA 3ITHA 1PAUB 1T3OA 3MM8B 1IUJA 2RJZA 3WDOA 1RT1B 1LWXA 3J80Y 2CFXA 4IRDA 1REGX 1GTHA 2OGUA 4L6V3 5HQ8A 5KFNA 5JXSA 2DJWA 3KHLA 4IOCQ 2R2SA 2HQIA 3BS9A 3N5BA 2JZ5A 3VGSA 3ULHA 2P8IA 3JSMB 2HMIB 3PO4A 1FRJA 3AXMA 2DNMA 2W9BA 4A4JA 1UPPA 3GZ7A 1AROP 3QRPA 4F4XA 4DCJB 3V6DB 1U0HA 4G65A 4J9KA 1FX4A 2RS2A 4OYAA 1S0OA 3MR5A 2YKQA 2KRBA 3KLFA 3GIRA 3LWMA 2DNHA 4JI6J 4I68A 8AT1B 1XMQF 2VG6A 4V19J 4M5DB 5BJRA 3T1YF 1U8SA 4A8KA 2FVQA 3D1HA 1FKAF 4A47A 2HVDA 4NLVA 5DDRC 2PA3A 1JJHA 2CPHA 2CDQA 4YR2A 1VLYA 3CNQP 2EXUA 2CZ9A 2MEWA 2BYCA 1Q53A 3N79A 2EFVA 4XO0A 2FY1A 2E9TA 3DGVA 5HQLA 1S6OA 3FSYA 1VBZA 1IM6A 1XNQJ 1DY3A 2WBRA 3HJVA 3G82B 4ECWA 4IRCA 2VODA 3MPWA 1S1XB 3PFOA 2C2MB 4QYZK 1FVSA 1NZAA 4F3MA 3ETMA 2V8DA 4B9UA 5J2QB 4ZLPA 2JWNA 5ETVA 1HQ2A 5HO4A 2ZH6A 4X62F 3NNCA 1SUQA 4DXLA 2B7BB 2EKYA 4KV8A 1S1TA 2XMAA 1NK9A 4CI0B 3ET6B 3KJFB 4Q44A 4B9SA 4HDGA 4KKOB 3E3XA 4LRFA 1NH8A 4LSNA 4ZP8A 3BBBA 5IS2A 1UJ4A 3W5ZA 4CLUA 1RKJA 1HARA 4O4GA 2MPUA 4WFZA 5IT9Y 3C15A 3IGVA 2VA3A 4ZPAA 2NPFA 4UQGA 4ED6A 1U25A 3N6MA 4URGA 1WOSA 2R42A 1CLFA 1WKKA 4LRAA 3J81Y 5L1LA 3MM5B 3LP2A 4M8LA 4OV1A 3BO2A 3F0NA 2AD9A 4ZLLA 3NMRA 1XR6A 3ZZYA 4B02A 2KZZA 2BQUA 2L48A 4BLGA 4KQZA 2UUCF 3A8EA 3WZ0A 2A6MA 1I3OB 2GX8A 2Z2ZA 3TUIC 3K8VA 1R0CB 4CZCA 1Y11A 5IC4B 3IS9A 3HFZB 1S4EA 3FFIB 2YKMA 3CULA 2DR6A 1NSPA 2VF3A 3LWLA 5KG3A 2R7SA 2HNZB 2RVJA 4JI2F 1T9XA 1RT3A 2VPWB 4DPYA 1FTRA 3OXLA 2BJDA 1VS3A 5LMUF 2JFKA 3IP0A 2E5JA 1WHXA 2W4CA 3T19A 2NPIA 2B9XA 3C6TB 2KKHA 2OEMA 3K17A 4QIVA 3UDLA 4A8SA 4F0MA 1N36J 2WW8A 3D68A 1FNMA 1RQ0A 3DRPA 4KE5A 4QIWD 4ZVQB 3OL7A 3TAQA 3AOBA 5DG7A 1WC0A 2HQFA 4M95A 2NQPA 4RR5A 4K4SA 4WPAA 3OVBA 4NLDA 3DM2B 1R8PA 1S9GB 1CJUA 2DRBA 4FBTA 1RHQB 2VPZB 1QVFR 5RUBA 5CYMB 2WVFA 4N56A 2W2OP 3R5BA 2E5LF 1FFGB 4M5HA 3SEOA 4WTYA 1K47A 1DTQA 1IKXB 1ICEB 4J9VA 3WX4A 4RBUA 1ULRA 2HEKA 4D3GA 2R9LA 3UDVA 4LF5J 2HVEA 4EI2A 5GADU 2XSJB 4PR6A 2NREA 2AX0A 4NOHA 3DI6A 5AXKA 5C2CA 4IR1A 4Y6IA 2IBKA 1IN0A 3TRGA 1SC1B 1RP5A 1WWHA 5C42B 4B3TJ 3VAIA 2FLNA 1RAAB 2DNNA 2MQQA 4O3RA 1SL0A 2XG8A 2VQFJ 4ZVGA 2HS0A 4OYBA 4AUKA 2ADBA 4QCLA 2R8IA 4J5OA 1HNWF 4DL0C 5KFEA 5HN0A 4F50A 4JBCA 3B54A 1GT8A 5HMYA 4C8NA 2HAFA 3MEEB 4KC5A 5IQ6A 4CLYA 3NG8A 2W9AA 4OJ3A 2IIHA 2R2UA 2XSJA 1RCXB 1M0SA 3FEXB 4H4MB 3L95X 3CCUS 1ZM4A 2XB2D 1SL1A 2MLZA 1CC7A 5J2NA 1I6JA 4IG3A 3VAKA 3D2WA 3RRGA 4GKJF 1FJ7A 4JI8F 1FXDA 2ZWOA 5D77A 3I0SA 4DSFA 4UY8T 5HMXA 1AA1B 3P49B 1URNA 2QLBB 2VFTA 3B4DA 2BX6A 3PYGA 2BJ3A 4RW9B 2I6WA 5L38A 3OTOJ 1RHRB 2GFFA 5BR8J 3CCES 1EP4A 4YB7A 1T03B 1VQ9S 1NEEA 2HBYB 2LU2A 4NA3A 2ZC3A 4R0EA 4B3MJ 2XY6A 3UVJB 3MXHP 1QY7A 2C3OA 2JFDA 4RU9A 1ZM3A 1KWMA 1JJ4A 2BXJA 2R8GA 3C6TA 2XBPA 3L4BC 2XY7A 1GFWB 3A12A 4AL7A 3NNAA 2YKNA 2HHTA 2JSXA 5FIIA 2I5JB 2K06A 4OJ1A 4P10A 2AYEA 2CUYA 5BR8F 5H9FK 5EWEA 3KUGA 4ZOSA 2QC3A 2XC9A 2XS5A 1CJTA 1HPZA 2DO4A 1HA1A 2L08A 4DWIA 4WP9A 1KHWA 3W61A 1JLEA 2Z2MA 5B0EA 2HRUA 1AUDA 1K44A 1M5SA 1KKHA 3DDKA 2DNKA 3MECB 5CAAA 4YY3J 2UV8G 1M90T 3MCSA 4OX8A 1GMWA 5JVHQ 3M8QA 2JC1A 3MPYA 4ED0A 3PV8A 2RF2B 1CEZA 1BGXT 2ZH5A 4OI4A 1JQGA 1OS5A 1R0AB 4EFAC 4DZDA 1TK8A 3ILIA 2A2DA 2ZEJA 1DURA 1KR4A 4ZDNA 2C2NA 2UVWA 3KK1A 3J81U 3KLEB 2IRYA 4X2BA 1VRTB 5HMWA 3T5JA 1M5VC 2P9CA 4PCQA 1Q81T 1WHYA 3NGDA 1EIYB 3CJ4A 4M5LA 2RNEA 4ILMA 3K2YA 3DRYA 4OLPA 3G96A 5HROB 2IBOA 4NLSA 4BWJA 2HSEB 1VBYA 3GV7B 4B3RF 1RWKB 1FEEA 2CG8A 4FP9A 1U26A 4ECVA 4P2FA 2ZZNA 1T9UA 3HT0A 1Q16B 2CNOB 2DNZA 1IQZA 2KN4A 3DRXA 5L46A 5F8NA 3H4DA 2NSCA 3AAWB 2F4VF 3DMJB 4DV2J 4MMOA 4OZ2A 2DXFA 2LEPA 3PDNA 1KSPA 3J7A1 1ZTWA 3DOMB 1U49A 3TUZC 3IWLA 2YBVA 2MZRA 3DLBA 2EI5A 2GIRA 2GVDA 5E7OB 4B9MA 2Y1IA 5CZXA 1NJWA 2XZDB 3VR1A 2ZH3A 3C19A 4KGKA 2VQFF 1S12A 2V8VA 2UXCJ 3ISND 1FRMA 2QLWA 4WIIA 5DRKA 4D3HA 5ITHA 2BDPA 1HI1A 2IJFA 3M6VA 4B9NA 1DQAA 2DNPA 3NBPA 4RZRA 4CDIA 4A48A 1JLBA 1YG0A 1AXQA 2D9PA 1JX4A 5B09A 4B3SF 1ZZFA 1HNIA 4HVZA 4QR1A 1KQKA 5MLCV 1NSAA 3DOMA 3FBEA 5KG1A 2I0XA 4MKVA 1NJXA 2BW7A 4ZHRA 3J7YU 2ZVSA 4WK3A 3EE3A 2UUAJ 3OXGA 4ES3A 4UZBA 1QUVA 3VF0B 4ED1A 4OYIA 3K5NA 1TK0A 3LPEA 1MMNA 4I67A 4EU0A 1MWZA 1A9NB 5GMKa 3CE8A 4NCAA 4XDCA 1WELA 1OYEA 2IA0A 4ZA1A 1WG1A 1RTHA 2NUHA 3JAMY 3VTIA 3Q0AA 2AYGA 7FDRA 3FVYA 1IBLF 2BE7D 3EZUA 2YX1A 4BCAA 2RKIA 2HS4A 2P9EA 3M8SA 2CQIA 2WVCA 4F2SA 2RU9A 5A2QU 2E9RX 4ID5A 4RJVA 3C14A 3DM2A 1N36F 3PX0A 3MM8A 4DR7J 2HW3A 4MIAA 3GV5B 4K59A 4NX9A 1FJCA 2C3UA 1PYOB 2L41A 4KGXB 1NJZA 1S1UB 2PEBA 3CMES 1TUGB 2ACYA 2CJXB 3D66A 4M5NA 4OFZA 4EK2A 3OJUA 1QJHA 5KFGA 1VFJA 1YBTA 6FDRA 2G2ZA 5HQMA 2DTJA 1EQMA 2FLPA 2R8JA 1GEHA 2F65A 1SVDA 2B5JB 3M2VA 3MMCA 4A8OA 4IOBA 2F4FA 4C11B 2ZM6J 4TQRA 3UO0A 1FO1A 4LJMA 5LOQA 3GLJA 5A8WA 3RAMA 3ADAC 3DFEA 1Q8LA 4PZVA 1RAEB 3VZHA 5DDQC 4RLEA 3V4IA 2YNFA 1H3DA 2DY1A 2IC3B 3QWPA 2LP4A 5IT0A 1XMOJ 2EC0A 1UVNA 3CD7A 3QFWA 2FY8A 4CNZA 4NL5A 2DNRA 2HLUA 1N5QA 2RDIA 3EPIA 2L3MA 1KC8T 4O23A 2DGWA 1U6ZA 1FRIA 3D0IE 4TYBA 2VPXB 1HNXF 4JI1J 3RU0A 4DQQA 4OZ5A 3Q24A 4U6PA 1PG5B 1T9YA 4EZ9A 3W5YA 1G1XA 5B08A 3NGKA 5E2QA 3NOCA 2O67A 3ZTOA 2YNGA 5B0BA 4G1QA 4MIWA 3WHIA 2D69A 3NAHA 4USTA 4ZP9A 3ZXWA 2WTFA 2IY5B 1U2FA 3JSMA 3A3NB 2HMIA 2H51B 4N77A 5D4OA 2KYZA 3AA9A 2W9CA 1YX2A 4K4ZA 2HQDA 4H4MA 2HURA 2H1YA 2DR5A 1SJ1A 1GMWD 1S59A 1W7WA 3W2VA 3RGIA 5DQIA 2KU7A 5GAEI 2VC0A 1X4FA 2Y0BB 3D1QA 2SXLA 2WVDA 3H2LA 2HGMA 3SMZA 4XDDA 1PIEA 4EGLA 3BSAA 3G8SA 2UP1A 2P6SA 4USWA 1Y00A 2H3EB 2ZFHA 2F1FA 3RBEA 2YKAA 2XS2A 2IDLA 2B6AB 1VHFA 3AB4B 4DV6J 1C0TA 3LF0A 1SKUB 3IG1B 1WTFA 5HJXA 4CO5A 4RUHA 3AD9C 1CJVA 3IM8A 4JP8A 2YPZA 2B9WA 2LVWA 4OZ1A 1F9EB 2G9OA 4JI6F 1MU2B 3SIPB 1TR0A 2O66A 5KG5A 4K4WA 1REVA 2DH8A 3U27A 3MOJB 1RHKB 1ACMB 1LFPA 1TMJA 4MK9A 3LPYA 5E3PA 2ZHAA 5ETKA 5DGAA 1DARA 1H6KX 1EB0A 3FCHA 3M30B 3NAIA 2B9EA 4ED7A 1U1KA 1JJCB 1PILA 1R43A 3T1AA 2MXYA 2FVPA 4DX7A 3D6MB 4X4UA 5LMNJ 3C3LA 2QA4S 1NUEA 2A6OA 1JB0C 4C0HA 1Z4UA 3CO0P 2JLGA 2FJBB 3N6NA 1V6HA 2JH3A 3BGRA 3PTWA 2XSFA 1W26A 1PYSB 2EVZA 4IG0B 3RZAA 3SCIE 1HL6A 3DDIA 4ECRA 3KK3B 3W7BA 3M6XA 4OI6A 5DQGA 3BN4A 3DLHA 5M2UA 1LWEB 2MDAA 4OJGA 1U1MA 1SL2A 2XCPA 3C2PA 3I9V9 4AL6A 3GR1A 3IWNC 3R7BB 3KXDA 4DR2J 1LW2B 3FSIA 1G2EA 1RKIA 3ITHB 3LUYA 3WX8A 4KO0B 2FLOA 5KFDA 3W8GA 4YQWA 5IV3A 4O3SA 4QYZJ 4C97A 2BR0A 3IXQA 3OFHA 1WG5A 1I1GA 1YVFA 3MAQA 1NSKL 4U95A 3MCNA 1M5PC 5J1EB 1TKTB 2QSWA 3ZZUA 2HNDB 4EWTA 2E1CA 1KLMB 2MHNA 2MKYA 1BWVA 1JXVA 1WI6A 4PYAA 2HIQA 2QMUB 1T9WA 1FKOA 2OPPB 4UUWA 4F67A 5J1NA 2GCFA 4QW9A 3DLKA 3NRBA 4J9RA 2ZH7A 3TUJC 2AJ1A 4LF6F 4QR0A 1IWAA 2N3OA 4U9RA 1UMJA 1T03A 2WB4A 1HKAA 5C25B 4QWDA 2MKKA 3ZO7A 4LREA 4O3PA 5B7WA 3EGNA 5LSOA 2F4VJ 5DGBA 4KB7A 1Y3KA 3UDEA 4E0DA 1HR0F 3OLBA 1YK9A 4O44B 3HSGA 4YN3B 4DG1B 4CLLA 1VC6A 2AU0A 2FYXA 2GJIA 2QSFA 3G86A 5CCLA 4YR0A 3R1HA 2XWXA 1SJ3P 1DRZA 1D9DA 3HD1A 1SXLA 4RW8B 8ATCB 1HNWJ 1AFIA 1HYSA 2BOPA 2RILA 3CJ0A 3MEGB 5C24B 1S76D 2FZCB 3KG0A 5A8KB 1DTTA 2W7AA 5L1KA 3ENAA 4KR0B 1SJFA 1VYAA 4M5MA 4U7UD 3ILLA 3MTJA 2ZBRA 1LEOA 3CIMA 1IR2A 1WHVA 4QZVB 1H73A 4JV5J 1JLCB 4F26A 3MOZA 1VIXA 3BBFA 5KFQA 1CC8A 1C1BB 1NH7A 4R5PA 3KTQA 5F8LA 1N88A 1MN7A 3QWUA 3DOLA 3TAMA 5LSRA 4AD6A 2MB0B 4LF4J 2MJNA 5A6WA 2VOPA 4DQSA 1APSA 3D28A 2B7CB 1FDDA 4A46A 4NXNF 1T0TV 3W9IA 1N5SA 2QLFB 2ILZA 3W63A 2FHJA 2PMHA 2VBWA 2XWYA 3H5SA 3ISZA 3IBWA 4RNHA 4YDXA 5LSLA 3MMBB 4JYAJ 4QIGA 1RTJA 5D4LA 1VCTA 2V8HA 1EJ7L 2WZ1A 4HI1A 3IC1A 3IRWP 3R2CJ 3RW6A 1MSWD 4FPRA 2CJKA 4K5RA 4RUCA 1E6VA 1SB6A 2RRBA 1BUXA 1EP4B 2ZOFA 3DLGA 4KGMA 5F41A 2CJBA 4NLPA 3HHLC 4I2QB 2DNOA 2FHKA 2VG6B 2GJ2A 3U7JA 5AE1A 1ZAWA 4ZHRB 2FHJD 1N5YB 4K50A 2GZOA 1R6YA 1I94J 3NY0A 1D8ZA 4P7VA 1SV5B 4P75A 1WTBA 3DCAA 5HL7Q 1WG4A 3HMJG 3F73A 1UA0A 4CM0A 4I69A 4ECSA 2KL8A 1U2CA 3OSNA 3SQGA 1DZ5A 5D3GA 3HVWA 1S6UA 2ABYA 4HACB 1JLAB 2VIHA 2CPFA 1Q4RA 4YOEA 1U24A 3F41A 2CPZA 5HVHA 2Q3PA 2E1AA 1NK6A 5A6PA 2QYGA 2CJQA 1CULA 2YWWA 4ZMMA 2V0NA 1YRUA 3H25A 4MAKA 2HS3A 2OLWA 2WHOA 2NZ4A 1HBUB 2UUBF 2HHQA 3G8QA 3QT5A 1DTTB 5AXNA 2XO6A 4RU2A 2V2ZA 2MTLA 4LFAJ 4CT9A 1PO6A 1S1VA 1B0PA 5ETPA 2MKHA 3PYEA 2XO7A 1WSRA 2GW8A 1OSDA 3W60A 1QD1A 1NDPA 3KUEA 3KJVB 2HHHF 4Q45A 1RT4A 2Y1RI 4ZVSB 1HQEA 4TY8A 4C0BA 3FMBA 4CH0S 3ZZRA 1N33F 1SQGA 2G0JA 3W8PA 2M3DA 1ZH5A 3OW2R 1FDAA 4P2SA 3NCPA 3LP1A 4USUA 1UEVA 1T11A 4UF4A 1GX6A 1VBXA 1R8CA 1FA0A 2JC0A 1RTDB 4HDHA 3MAAB 2COLA 1FE4A 4KKOA 5ETNA 2ZH1A 4YB6A 3CCSS 2ASJA 1DBDA 4ZITA 2HHSA 1X4BA 4UZCA 3THPA 4LQ3A 2DHXA 1S1TB 2LCWA 2CQDA 3ENQA 1IWGA 2R8HA 4DV5F 1S72S 1XEZA 1XWLA 2QMWA 1NLKL 2Z30B 3NBPB 4NLUA 4G1PA 3MM6A 2V4JB 3DYAA 4NLTA 1PKUA 3QYYA 2HNDA 2QO3A 1JKHB 3C16A 4ZPCA 2RH3A 5F0WA 4CYUA 1OO0B 5LXYA 2QA4G 4ECXA 2R7XA 4GVBB 1M1HA 3AY0A 3D0GE 3BPDA 1TL1A 3P8BB 5GAEU 4Q8FA 5EN1A 4QPXA 4IH6A 2H4WB 2Z2LA 4K4XA 3DLEA 4QWCA 3RR8A 4DV4J 2QYCA 2BM0A 2QV6A 1N5YA 2DPJA 4IFVA 1LWEA 4DUYF 3NKYA 3DRSA 3NP5A 1IKVB 1PC4A 4DR4F 4I64A 1IR0A 4M5KA 5GMDA 4FYXB 2C2RA 4CCHA 3KK3A 1U1QA 4ED4A 2ZBIA 4GC7A 2VC1A 4CLTA 2EFGA 4E98A 2AGPA 3EICA 4M5JA 5KFAA 5BYQA 4J9PA 4WK1A 4UT4A 1NRKA 2DR7A 4FXWA 1UKUA 2J6SA 1Q7LB 3OLAA 2UXCF 2MY7A 3KK1B 3OHBA 5H9EK 5AT1B 3GIJA 2BANA 3PJ9A 4PKDB 2W25A 5J1EA 4WZQA 5D0GA 2LXUA 2RQMA 1S9GA 3M9MB 1FRXA 1SBRA 2PD1A 1KTVA 3BREA 1MMDA 2OUGA 1C0UB 2E5GA 3NGUA 5A2QY 1SC4B 2UU9F 3QGGA 4C9DA 1FWKA 4V19X 1XBWA 3FCVA 4B9VA 3CSKA 2MQLA 3KUHA 1M5KC 1S77D 1WC5A 2BBEA 1S1XA 2CJ9A 2DCUB 3QGIA 3R5AA 1FX2A 2QEXS 3CCQS 1RTIB 1QDUB 3KNGA 3Q2SC 1T7PA 2YX4A 3I56S 3BYPA 1WF2A 1RBAA 4FXDA 1FERA 1HHSA 4Z37A 3Q8UA 3O44A 2DCLA 4YP3A 3FNNA 4MJKA 5KFVA 5KG4A 3BSNA 2BVZA 1NK8A 5KFBA 2OEJA 1VQYA 5KG0A 1D8YA 4IFYB 4Q0BA 4GKKF 2VKZG 3VAJA 4EUVA 3TR5A 1NKEA 2DXEA 4P71A 5KT4A 4DR5J 3GFZA 2W2MP 1S6PA 2YQ0A 1FKOB 2OPPA 3MAHA 3TVYA 3VAFA 4F0HA 2HFOA 4OMFG 2KM8B 1CJUB 1T94A 3KG4A 4RWWA 2PFDA 2XMWA 3I96A 1JXLA 4MH8A 1DJ0A 3S01A 1RISA 3OJSA 1KFDA 4IFYA 1NKBA 4Q0BB 1MW7A 2RHSB 2M0GB 3GU0A 2K7KA 4KY3A 1LW0B 1S49A 2V8PA 4RW6B 3MUTP 4QWBA 1X0FA 2Y3YA 2W9BB 1UVJA 5KFMA 2IMOA 1VQ6S 4DZ6A 3M9OB 2KT3A 1WF0A 3M2UA 3CJKA 3G6ES 2ZH8A 3V4IB 2M9KA 1RT7B 4LIRA 1LW2A 2F9JA 4HH1A 3LAKA 2ZNZA 2D9OA 2GVZB 2VD3A 2YQ3A 4ZCLA 5C5JA 3BH7B 1G4CA 1JKHA 3C16B 3FC9A 1N52B 2OPQA 4UOFA 4FVMA 1UCNA 1R8AA 4DR1J 2ALZA 3CJQA 1Z2LA 1IKYA 3M7VA 2H5EA 1XMOF 2X7IA 1YJ7A 4KHPF 1FXRA 3MTKA 2CQGA 2OPRB 3OTBA 4ZVOB 3TVKA 1RK8A 1JIHA 1X4HA 5C42A 3MM7A 2UXBJ 2QFJA 1YTYA 2ATLA 1UZHA 1TKXA 4AFFA 2DGVA 4N8NA 3VQSA 3T5KA 1WKJA 1UW4A 2RS8A 2WONA 1Y5LB 3DGPB 1N34F 1BQNA 2DPIA 4RWXA 4DMZA 5J2PB 4C3MA 4YMEA 4U7CA 1FKPB 4ES1A 5KOXA 1XNRF 5IXUA 1F5CA 1ZPVA 3PFEA 4LBPA 3HHKA 4AXJA 4ZPTR 3AOCA 4LFCF 1VRUA 4HLBA 2HNYA 4OZJA 2IDEA 3IG1A 1M5HA 2P9GA 1D1UA 2JL9A 1RE1B 4N5SA 5IWAJ 3MR6A 1NPKA 1RHUB 4WXWA 3V6DA 4FBUA 1DLOA 2FVRA 3MFIA 3AOAA 3FBCA 1SUQB 4TVAB 4RPFA 4F7VA 2BE9B 2PDAA 3MR7A 2HFNA 4NLYA 3IGNA 1URRA 4ZP6A 4DV1J 4B3TF 1E6YB 3D54A 4RL1A 2FJVA 3OFGA 4A8YA 1TZ0A 1XTZA 2EC2A 2C28A 2FVCA 1X60A 2XI2A 2PSZA 3K59A 4L74A 3BN7A 4ANEA 5AJ3F 4P9SA 5GAGI 3EGVA 2KRRA 3SQGB 2J0QD 4ZK7M 5B0GA 3CCMS 3SZ2A 4LF6J 1UVMA 3SCKE 3PEHA 2E5LJ 1FNOA 2ZD1B 1HWLA 3R5CA 3QIDA 3GR0A 3KDOA 1TL4A 3MMAA 3CD6S 4GRSA 1EQ0A 2D7SA 3OTCA 2RHQB 2BJ1A 3QJPA 4RBVA 2MQ8A 1ZZNA 2W1BA 1HMVA 2H9ZA 2IC3A 3MMJA 4I2QA 4PABA 2ZZTA 3FZBA 4CNYA 3SYZA 3PW0A 5IWAF 2MSSA 3DLGB 3DHWC 3D6TB 3EDRB 3KKFA 3MPDA 2CQ0A 3TZYA 4JI3J 1VQKS 1GAOA 3LQVA 4PWDB 4IO1A 4QU6A 4X4PA 3DGPA 4HT5A 4X65F 3A3OB 2GJFA 2AF6A 2AJ4A 2HQGA 2DH7A 2N4DA 1TKXB 3AODA 4UOCA 2XLKA 3A4TA 5IC6B 2ZWPA 2VDHA 3QGPA 3IA0A 2BOAA 3PW2A 4NE9C 5L9XA 4OZ0A 2J8AA 1GXUA 2IA6A 2QA1A 2LXIA 3CJTA 5D15A 3KLEA 3DOLB 3TAMB 1RLDA 2CQ2A 4LSLB 3PJXA 1S1UA 1VOMA 2CNKB 3M2VB 4EO8A 4A8MP 4J37A 2LA6A 1NHUA 1Q8IA 3Q2TC 2NXCA 3D6HB 4QWEA 1CJTB 1HPZB 1YWXA 5K8PA 3HKZD 1VHIA 1R8HA 3FQLA 1HNZJ 4ED2A 1OWXA 2FGOA 2DT9A 5KFXA 2JJ4D 4RW4B 1OIAA 2NXUA 2AJQA 3QLHB 5C24A 3TP2A 3OL6A 2AIRB 4A8WA 1Y4ZB 1Y0HA 1RWMB 5JUMA 1B4SA 1CVJA 2WW4A 3QIPA 3NWRA 2H5JB 1X9WA 4DSJA 1F9HA 1K0TA 3C14B 3EUNA 5FJ4A 1K1QA 2LQ5A 3RG6A 4ZJQA 4LF9J 1RHJB 4G1IA 4LRCA 2ZC4A 2F3JA 3DLJA 5KG7A 2KYXA 3HHLA 4MKBA 2HVHA 4DR6F 3TYTA 1H7XA 4YY3F 3SV3A 4NCGA 3PZPA 2VUGA 5IT9U 1Q0NA 3BV8A 1Y9OA 3R2DJ 2CVEA 4EZ6A 4WF9Q 4UUXA 2QMXA 1TP7A 2FJEB 3MURP 3DDNA 4DR3F 2G1HA 4ETXA 2QLXA 1CS4A 3DRSB 4ZS6A 1UWBA 2NSBA 5AE3A 1B99A 4CRJA 4DF8A 4B3OA 4ECQA 3KK2A 3N9UC 1QSYA 4OV6A 1RT2A 2CIMA 5EHHA 3MUMP 1LOUA 1ZAVA 1CULB 3TUPA 1WKLA 2CQPA 3BZQA 1RBLA 3OR1A 5EX3A 2GMLA 1G3OA 2BRKA 5K5MA 2HZCA 3E01B 2B0GA 3NS6A 3QZ8A 3L09A 4CO3A 2AJ2A 4NXMF 1E6YA 1U8WA 4QBUA 4OIXA 3EWGA 3R5GA 3BQ1A 2P6TA 3KDNA 3OSPA 2EW9A 3AD8C 2OSRA 2GNKA 2P2CB 5G0RA 2HVIA 1OY6A 1U02A 3ZZZA 1VQMS 3UN2A 1U6FA 2X3GA 4C2MA 1RADB 1T02A 2Y8YA 3PRVA 3UWTA 4OX7A 4Z7CA 1KOOA 4KT0C 2I9SA 4WKRA 1RT2B 3DU5A 4HHUA 4H4KA 3R97A 5C7PA 3KK2B 2Q66A 3M2RA 2AMCB 5GMEA 1X4GA 2MKJA 3EVWA 1DQ9A 4IYQA 1WI8A 1OJ4A 3I82A 3QGHA 3TA1A 1NDLA 3U1LA 2V68A 5AJ3J 3OTOF 3V6HA 1VC0A 3AQPA 1XC9A 3M8PA 2PI4A 1WNEA 3QO9A 1IBCB 4I6YA 3BQ2A 4FYVB 2GMJA 2GHWA 4J7CA 3R7NB 2D3UA 2YKOA 2N82B 1ZM9A 3MFHA 2UV8A 3DOKA 4JI8J 2AEJA 1NK7A 4DQPA 1Z2ZA 2RAQA 3GE9A 5FDLB 3SXLA 2O1PA 4WKYA 4NLGA 1RT4B
chains in the Genus database with same CATH topology
1UFWA 4F3OA 2JHEA 4PPZA 3CIZA 4A8QA 3O3LA 4BC7A 3KJVA 5KFIA 4MK7A 1N48A 2E5IA 4K4YA 4F2RA 3H8YA 3MM7B 4OHWA 2LMIA 1S1WA 2EK1A 3MM9A 4TY9A 3ONQA 2OD6A 4O3NA 5F0UA 2B4OA 5I3UB 2YWKA 2R7WA 1S10A 2BJEA 2XMJA 3IR7B 4NA1A 4TNOA 1S99A 3ZZTA 4CO2A 5J1EA 2I2YA 1LWCA 1KVJA 2IM2A 5LT5A 4ZKAA 2CQBA 2RE1A 1MWYA 3L7OA 2ZOMA 5JJBA 3T3FA 4JV2A 1KFSA 3M2UB 3CJKB 4ILLA 1JNRB 2IYIA 2UXBF 1Q7YT 5A8RB 4IO9Q 2HGNA 2DO0A 3FGVA 5KTQA 1HBMB 1TFYA 2KM8C 4LFBF 4DL5A 3B8HA 2VBZA 1S1WB 4Y00A 2CPDA 5I42A 4IG0A 2R7QA 1SIZA 1FT8A 1W2IA 2HHVA 2Y1JA 4PQUA 1J5OB 1RA6A 1E6VB 2ZNYA 3T9NA 1UFLA 3POTA 4OHZA 4E8UA 5J2NB 4HT7A 3UQSA 5DETA 5F8MA 4BWMA 3KLHA 2FJWA 3F44A 1HQEB 1KHVA 2LYVA 3WC0A 2FDNA 2V9WA 3HFKA 3I6PA 4LSNB 5A8RA 1D0EA 1BY9A 4QYRA 2JEGA 4WXOA 3RRKA 2YWFA 4X4VA 3QIPB 1ZTTA 1FRKA 3VAGA 4CT8A 2B5JA 1KS2A 1YJRA 3QLHA 3FSXA 5I4MA 2M52A 5HBMA 3KNAA 2ZJRQ 1JLCA 3GYXB 2FJXA 4AYBD 4Y34A 2FIUA 1FRLA 4N76A 5G0RB 2BANB 3GIKA 2IVMA 5E33A 5B0CA 2HLTA 4HL9A 3K8WA 5KT6A 3J7Z5 3HT3A 4Q2LA 5J2QA 1GNKA 2CPEA 4H54A 4NA2A 1SKSA 4ATNA 1FD2A 1VK3A 1G6BA 1DTQB 1C2PA 1UAWA 4QJVA 3I9ZA 1RT6A 4DG1A 2KDOA 1TKDA 1B0VA 5L39A 5CYMA 2ROPA 2C2DA 2GQQA 4G1QB 1ZYQA 4C3LA 3W2WB 5F3TA 4DV6F 3QO9B 2GO8A 5A0YA 2XS7A 1IKXA 3UI3A 2J9DE 2B3TB 3KLIB 3O6QA 3A1YG 4KPYA 2M8DB 1P1TA 4PG6A 4DJBA 1CPZA 3JTPA 3N0VA 2WB1D 3MEDA 4LUBA 3DRPB 3UFCX 3Q22A 2WSCC 4ED5A 3TOQA 5LMNF 2YWHA 1FJCA 1KLMA 2GO9A 2M2BA 5I3QA 3DLLQ 2DNQA 1P9QC 3GFYA 3BO3A 2DR9A 3T6JA 3MEKA 3PR4A 4KAIA 4NLOA 2A1BA 2BABA 2ZITA 3H98A 4YDDB 5JVGQ 2EBEA 2C3PA 3MM6B 2VKRA 4RW7B 3PY8A 2ZZMA 1P1LA 2OMOA 3IS9B 2KFNA 1DFDA 4ELTA 1UJ6A 3CB4A 3SV4A 5KFKA 4W92B 4OHYA 5F9LA 2J76E 2DH9A 3SDEB 1LW0A 1KTQA 2C22A 1QE1B 2FC9A 4CO4A 2OTLS 1S9EB 3EGZA 1ZAXA 5H1SV 4NZ0A 4RBTA 2LEBA 4JV1A 2XI3A 3M4XA 2F40A 3E51A 2XEXA 4JOUA 2WRMA 4QPTA 3I4PA 4YFUA 3PW7A 3I5CA 2X51A 1H2UX 4DBQA 2DGOA 4OZLA 1BD6A 1P8GA 1S1VB 2D3OR 3CDWA 3HPOA 2CPYA 3SDEA 2B4UA 1RA7A 2XGPA 2B9YA 3EXYA 1UJ5A 1IKWA 2E1MC 3MECA 2KT2A 2KT5A 4DL4A 2MKCA 4KV8B 1RYSA 2AQ4A 3C6UB 4QR2A 4DS5A 2KHDA 2F8EX 3IRXA 1N5TA 1ZOTA 2ZKTA 2V4QA 3NL0A 5H9FJ 2NS1B 2BE2A 1F0XA 5E3CA 4DSIA 4ZCKA 5D4NA 2M8HA 4ETZA 4RW7A 4Y0FA 1C4CA 1JLAA 1V3SA 3JYTB 2D1CA 1JWWA 2AYMA 2FUG9 1BLUA 4XAKA 3O2IA 3THVA 4C8KA 3UCZP 2XNQA 1SKRA 4PWDA 2VH7A 2ERRA 1HNVB 2VG7A 4HEA9 1TL5A 5HLFA 4Q5VA 2E7WA 2VFSA 3CC4S 4PG4A 4XPCA 2BQ3A 2ILYA 3ENWA 2CKWA 2DITA 1YJUA 4RKUC 4X64F 1U4BA 2J7UA 1HNVA 2OO4A 2VG7B 3DRRA 3ZZRA 2BR0A 1NK4A 1LQ9A 1J2VA 2RRNA 2ZDPA 1SH0A 4HHJA 2DGTA 2HAIA 4PRFA 4EBEA 3PIOQ 2KVIA 2FD2A 4WJBA 2JX2A 3PIPQ 2NLWA 3MI7X 2RSQA 4R5PB 1B0TA 3HP6A 4W90B 3FEYB 1C4AA 2X1GA 2RF2A 4OI2A 4Z2XA 5DO2A 4ED3A 5LXRA 3ZZOA 4DL2A 1K9MT 3P96A 2C2EA 5U47A 1IKWB 5DDPC 2F8MA 3M32A 3GG1A 1NK0A 1TVRB 4DFKA 3PXGa 3KWMA 1KQFB 1QLNA 2VZ9A 4NRTA 2J6UA 2C42A 5KFYA 1ROFA 2V8GA 4OHVA 4Q2MA 7FD1A 2IMWP 5M2RA 5K8OA 5F8HA 3MD1A 3PKMA 1HYSB 3TA2A 4JI0F 4R8UB 2KXNB 3UD3P 1LXNA 3BR8A 2EG2A 3C8YA 2KFZA 1X4AA 1JXEA 1X4CA 2Z0GA 3K7RA 5CZVA 5J2PA 3TX8A 3HHNB 3BF4A 4URQU 2DNLA 2C3MA 4DQRA 4EBDA 5KFSA 4O0IA 3P5TL 1YITS 4ECYA 4TY8B 2FVSA 2UUTA 2UZAA 3ETOA 3TW0A 4B17A 3KMQA 4IDKA 2EG1A 1HNIB 1TKTA 1S4FA 3TA0A 5L8RC 2RQCA 2HYIB 3ZZPA 3G4SS 4Y2CA 2BRLA 4NRUA 3SFUA 3MMCB 1HBNA 5F9NA 3S6EA 4TU8A 2XGQA 1S97A 4YUDA 1LWFB 3N01A 1NJYA 5KFFA 3IN5A 5F8IA 1JLFB 3LH2S 3MGJA 2D74B 3QAEA 1VQPS 1C0UA 1FD8A 2DIVA 4DHVA 3CDAA 3LANA 4WFYA 1HQUA 3I0RB 3S1TA 3T9ZA 2CQ1A 4ID5B 3G8TA 3MR3A 4CTAB 3KLGA 3OVSA 5L1JA 4DR5F 2RQ4A 5FDLA 1TK5A 2OFGX 2LDYA 2ROEA 2VASA 2YNHA 4I0WA 1QAXA 3GSDA 4XPEA 3RB3A 3W3SA 1REVB 1VIOA 1YGYA 3NS5A 1S9FA 4MFBA 2YX7A 1O8BA 3IR6B 2OAUA 1U6BA 5DM7Q 2AJFE 1G7CB 2YY3A 3M30A 5AXLA 3Q8RB 3VALA 2A2CA 2OIHA 1RTIA 2B51A 2IJNA 3UPFA 3LOUA 5SZTA 3PNIA 3VZIA 4C98A 1UVIA 1K8AT 1U09A 2K2PA 1T05B 2CPXA 1LK7A 1U1RA 1S0VA 4K2XA 2VONA 2ZUGA 4HTIA 2ADCA 1LWFA 3JB9k 3CCVS 3MF5A 1M5OC 2UVRA 2MJUA 3EX7B 1W2BR 5A8KA 3UE2A 1KN6A 5EX0A 1RT3B 3DI6B 2D41A 1QAIA 4DR1F 3ZC4A 4ICLA 3GB0A 5GAHU 4DLGA 1KQSR 2F7VA 4M63A 1FNXH 4U67Q 1GTEA 1HFEL 2LLZA 1GXLA 2VG5A 4M5DA 4IDKB 4YEAA 2YNGB 4WE1B 2YNIB 4HTJA 3PEJA 1S6PB 4N41A 5G4DA 5CH7B 2W8LA 5FLXY 4MK8A 2DBBA 1UETA 2IVYA 2M70A 1N0VC 1U7LA 3KHHA 5BYSA 2JLFA 2OPSA 5KFPA 3GWCA 1VQ7S 2LA4A 2GGPA 1GXTA 2XMTA 3BGFA 5DG9A 2VPYB 5CXTA 5K14B 3CTRA 5GVQA 4KTQA 3L3CA 3BEGB 4KBIA 2EFOA 5E41A 4KO0A 2DGQA 4DEZA 1HWUA 1RT5B 4PG7A 3PRDA 4B08A 2RU3A 5J2MA 4NLQA 1GX5A 2WK4A 5HP1B 2HPUA 1HW9A 3V6KA 1K73T 1KOHA 1FESA 2EPIA 1X9SA 2OP5A 4C8LA 3SSSA 2F9DA 2GGPB 2CYYA 1WD6A 2E5HA 3VQTA 4O44A 1MMLA 3CCWA 3M8PB 5T7LA 4DN9A 2W4DA 4DSEA 4BDPA 2CJAA 2FHMA 2Y1IA 3I5AA 4Y2MA 1D3WA 1DAXA 2JRSA 2KG1A 2YKPA 2QE5A 4H4OA 2GHVC 3PO5A 1U1LA 2FB0A 4DFPA 1O5JA 4BHQA 1HD0A 5T14A 1FRHA 5HLFB 1XNQF 1GQEA 3EZ5A 3CWJA 4MYTA 4NPOA 3SSRA 3MWBA 2MZJA 2HWIA 3I87A 1QSLA 2WCXA 2ZJPQ 1NKCA 1SI9A 1NJXA 3MMAB 2MGZA 2AV5A 3G6VA 2JOQA 1HWIA 3MEEA 4Y28C 2X1FA 4LFAF 1YQHA 2A18A 1RT1A 3GYNA 4USJC 3WBZA 3BSOA 4F4KA 2V4RA 3OV7A 3KHRA 1QTMA 3P6YC 3C6UA 4AL5A 3H4BA 3VAHA 3OQ2A 3Q8SB 5LJ5Y 1OQ6A 3HF5A 4USIA 3HZGA 2CPIA 3RAXA 1QAYA 3IFEA 3JTOA 1XK8A 5DG8A 4QWAA 1UWBB 4B3OB 2KTQA 2GMHA 2KG0A 4AE5A 1Z1ZA 3CXCR 4Y2AA 4EYHB 3BGUA 3OTEA 2BZ2A 2OSQA 2G13A 1AFJA 3RAQA 5K8MA 1YRXA 2V9KA 2KB2A 4LVOP 5B0AA 3OR2B 4GC6A 4LF8F 2VV5A 2ZM6F 6FD1A 1X5SA 3DLKB 4NZ6A 3BDEA 1IKYB 3CCJS 3D0HE 2QRRA 3SCJE 2JVOA 4ZPVR 2CRLA 3M8QB 1VMBA 1F5AA 1K0VA 1SQEA 2O3DA 2Q6BA 1VJWA 4X4TA 2CQHA 2EFQA 3HHEA 3I32A 1QUPA 4NLRA 4BBYA 4PXEA 1L3SA 2QA2A 1AUDA 4JV0A 2GV1A 1HBNB 5KG6A 2BUNA 2HNZA 1EETB 4IR9A 4LSLA 2L9WA 4MIBA 3EYZA 1BWEA 2XY5A 4AXIA 4NLWA 2XMVA 2WBMA 2ZHOA 3JSYA 3M6WA 2EFNA 4B3MF 4IQMA 4PUOA 4DDFA 2N4CA 2IHR1 3G71S 1WHWA 1SV5A 4LF4F 3CD5A 3M9NB 3N28A 1J5OA 1KEKA 3AQOA 3LP2B 2YVSA 1KD1T 4TXSA 3H5XA 3EXCX 2R7TA 3RW6A 5B0DA 4LF9F 1IJFB 2J7KA 4KHRA 2ZKUA 3FEZA 2BM1A 2K1RA 5DLFA 4QIFA 2MKSA 2ZE2A 3HJFA 2ZD1A 4FNIA 4X4NA 2KI2A 3OVAA 2W7OA 1FTCA 2UVVA 2FPHX 4J9QA 4I1TA 1OSCA 1CG2A 2KO1A 1F5BA 4O3QA 4Y2KA 4JYAF 2PMZD 4DUZF 4OHXA 2QZ8A 4DV2F 4NLXA 2Q6CA 2VBXA 3CJ5A 3M05A 5DM6Q 4OI1A 2HNYB 4ELVA 3UR0A 2G1DA 1SJ4P 2GQCA 4WFXA 2VFVA 4DSLA 2E9ZA 4IUFA 2LQBA 5HMZA 2DHAA 1YSJA 5IFMA 4ALZA 1CQNA 2CG4A 5E5NA 3W2WA 2K3IA 1VQLS 3FZ2A 4XK8C 1NO8A 5KFLA 3FJ2A 1O0PA 4G6VB 4MFBB 2PO4A 3CDBA 4RNFA 3B4MA 4BC9A 1T8EA 4C3KA 2IVFB 2OFHX 3DN9A 1YJVA 2XMKA 3GV8B 2R7RA 1L3UA 4ZPWR 4F4YA 1P6TA 4EO6A 3PHEA 3IAM9 2B56A 4TQSA 3DLEB 2IAJB 2MQOA 1IKVA 1R27B 1VQOS 4F4ZA 4ID8A 2LXFA 1IXKA 3EPGA 3CMAS 3V4MA 1Y5IB 3I4HX 1WEZA 3HHDA 2VBYA 2WOMB 4LF7F 4K0KF 1JLFA 1FHTA 4RNNA 3UD4P 1SH3A 2DB1A 2PA8D 3H59A 2L9NA 3U1MA 2BW2A 3IRXB 2W9CB 4IKAA 1ZPWX 2I1RA 5K14A 4PG8A 2RRAA 3K57A 1LWCB 4ZVFA 3DNCA 3M1VB 1JLGB 2XHWA 3R27A 4C4WA 2E29A 2V4JA 4X84A 2RDJA 1FE0A 1FJGF 2IAJA 1V3RA 3BDPA 5LL6d 4A8FA 1A7GE 3RB6A 4C0OC 4J9SA 1H98A 4X4RA 3LW5C 4DFMA 1HD1A 2RB7A 2V94A 2VQEF 2E66A 2CQ3A 1RDRA 4OQJA 4R0JA 5J1PA 5KT5A 5EDWA 2DIUA 3CDUA 1Y5NB 4ED8A 3IAS9 3LP1B 1KONA 2EK6A 2EFPA 2FHOB 2R2TA 1JLQA 3FRZA 4ITSA 4KFBB 4DOZA 1XERA 2GQ2A 2P5VA 1QE1A 4R8UA 4WYLA 3CCLS 3KOAA 1HI8A 1YIJS 2R7VA 1X5PA 4IH5A 1YJNS 2IM3A 2JDJA 2G4BA 1HBUA 2KH9A 3NMAA 2B6AA 3OBIA 4PPDA 4Q43A 4Y2IA 4UY85 5KFRA 3QJLA 1U1PA 4RUAA 1X4EA 1FK9B 4J9NA 1FCAA 2VA2A 4I56A 3SFGA 3H2VE 2XCAA 2ZH4A 2MZSA 5EWGA 1B64A 3D1OA 5IT4A 3RR7A 2PE8A 3LO3A 1H0HB 3I31A 5D78A 3DOKB 2ZE2B 4RNMA 1HWKA 3MHYA 1NU4A 4LF5F 4RX6A 2MZQA 5KFCA 2KFYA 1FJEB 3X1LB 3HM9A 3CCRS 3O5TB 3MUVP 2D3ZA 2HHPA 4CQ1A 1R7IA 3CCTA 1JMTA 4P7TA 5KOWA 5KFHA 4FF2A 2DHSA 4IOAQ 2MYFA 3H2UB 1TAUA 2DNGA 2VG5B 3HHLB 1HQUB 1OQ3A 1V3ZA 3I0RA 3JYTA 3UCUP 2UXDF 3DC2A 4LQ9A