2RQMA

Nmr solution structure of mesoderm development (mesd) - open conformation
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
141
structure length
141
Chain Sequence
GDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPIDFSKLDPGKPESILKMTKKGKTLMMFVTVSGNPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVSQDRCAEVTLEGQMYPGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mesoderm development candidate 2
publication title The Structure of MESD45-184 Brings Light into the Mechanism of LDLR Family Folding
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
total genus 31
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rqmA02
3ENVA 3HHEA 3S1TA 3DHWC 2MDAA 3N0VA 1XTZA 1SC6A 4X84A 2RE1A 3TUZC 3AB2B 3MWBA 1ZPVA 2KO1A 3LUYA 3MTJA 3AB4B 1PSDA 4LUBA 2F8MA 3KWMA 2QMXA 5T41A 3AAWB 5IT0A 2QMWA 2J0XA 2I9SA 2FGCA 2RQKA 4M8LA 3U7JA 1U8SA 2H9ZA 3O1LA 2PC6A 2P9GA 2DT9A 3K5PA 2JOQA 1RWUA 3TUIC 3P96A 4GMKA 2P9EA 2PA3A 2QRRA 1UJ6A 1UJ4A 3OFGA 2QSWA 2RQMA 3ENWA 2LVWA 1O8BA 1LK5A 1LK7A 3MAHA 4PWUA 3OFFA 4GO7X 3TUJC 2JHEA 1M0SA 3DC2A 5IS2A 1KS2A 5IT4A 2CDQA 3DHXA 2J0WA 3NRBA 3DDNA 3OFEA 3IBWA 2ZHOA 4NMLA 3W7BA 2F1FA 3IXQA 3UW1A 3OBIA 3CEDA 4IO1A 2DTJA 1YBAA 3ENQA 5FIIA 2NYIA 1YGYA 1Y7PA 1UJ5A 3OFHA 5JJBA 2P9CA 4GO5X 1LKZA 3L7OA 3LOUA 2LQJA
chains in the Genus database with same CATH superfamily
4Y0FA 1RLCL 1HNZF 2RVJA 5GVQA 2UUCJ 2OSRA 2KTQA 2EG2A 1VQSA 3D1HA 3E01B 3K2YA 1X9WA 1HBNA 1TKXA 1K44A 1RAFB 2JVRA 3TUPA 3AB4B 2V67A 1FDDA 5IT0A 2AYGA 3X1LB 2BUNA 2CQ4A 4YDDB 1HBNB 5K8PA 4RNMA 4CH7A 1V3ZA 1F6TA 4TKTA 3CD6S 1T9TA 5LJ3Y 2R2TA 1ZA1B 3WIVA 3UVJA 2MKIA 2WTFA 4HT5A 1TELA 2VICA 2GNKA 4USMA 3Q23A 1T94A 3IN5A 5G0RB 3HHDA 4KFBA 3D6MB 4CLWA 1P1TA 1CVJA 2IHR1 3DHXA 4QQBA 2KHCA 4M63A 1GEHA 4BC7A 3MZIA 4WBFA 4ZJOA 1FK9B 3DOMA 2GMJA 3THPA 2R8HA 3ETOA 5SUHA 3CC2S 1KR4A 3MI7X 6FD1A 2P9CA 2W7OA 1PYOB 2VG5B 2X1FA 3U27A 5CABA 1CEZA 2JL9A 1HBMB 4WFXA 4QCLA 5G4DA 1SC3B 1XBWA 2E7VA 2F9JA 3I87A 3PR5B 2V69A 4DR6F 3M30A 1JLQA 1VISA 1TL1A 3OTCA 2F40A 3ITHB 1NAQA 2J0SD 2W2PP 3M30B 1T9YA 3L7PA 3HI9A 3VV2B 2VFTA 2A2DA 1AB8A 1YLXA 3Q2TC 4PZVA 3FCWA 4F4ZA 3UDLA 3LTOA 5BR8J 2EFQA 1B0VA 2IY5B 5F0WA 1S4FA 1XK8A 3VZHA 1JJHA 2C2NA 1S7HA 3RB0A 4OZ1A 3J80Y 2EPIA 1JKHB 1VRTB 3U1MA 4DXLA 2V8GA 5A8RA 5B0EA 4QR1A 1REGX 4WIIA 2KRRA 3OFHA 2QA4S 2N4DA 1MWZA 3CSKA 2C2KB 2FYXA 1I5OB 3DRXA 4WFBQ 3H98A 1GXUA 4PG4A 3R5BA 1OSCA 3GYXB 3SSRA 4I2PA 3NNCA 4OI0A 3TUZC 2GIRA 3IBFB 1RGVA 4ID5A 2QJ3A 2Q6CA 1MW7A 4JI5J 4I2PB 1YJWS 3MMJA 1BXNA 4ID5B 2ZBQA 2LFVA 2NLWA 1T3NA 1YX2A 1BQMA 1ZPWX 2AJQA 4DR1J 4C3LA 2FY1A 5K20B 1BQMB 1SB6A 5B0FA 2LXFA 3ENAA 1RTDB 1FEHA 3MD1A 2CJBA 3CT9A 3OTEA 1T05B 1RA6A 3R5GA 4BCAA 4BDPA 4NA3A 5J2QA 3RRHA 4LMZA 4C8ZA 3M2UB 3ZTOA 1VQPS 2FC8A 2DK2A 2E5HA 2F65A 2F4FA 4OHVA 1LW2A 1FTCA 3HD1A 3P3DA 5GADU 4R5PA 2V63A 1DZ5A 2YWKA 3OXFA 4IRDA 3M8QA 1J27A 4OX8A 5I42A 3Q89A 3MAQA 1DAXA 3SYZA 1CBKA 1KTQA 1GX6A 3B8HA 2VA2A 1DY3A 4R5PB 2LYVA 3PEHA 4RO0A 2VUGA 2K2PA 2QMXA 4LBIA 5M2PA 3TWZA 4FF3A 3NS6A 2HIQA 3I55S 3EGVA 1FDNA 2IM1A 1RABB 4P2XA 4OI3A 4RBVA 5HJYA 1K73T 3L3CA 1NDPA 4LRBA 2MKJA 2GO8A 3BYPA 4WTOB 1H7WA 3QQCD 2FQQB 2BE9B 3CJ8A 3CO0P 1T9WA 1CJTA 1VBKA 3DGPA 5J2MA 5KG6A 3AD7C 1KS2A 1PC4A 2E5LJ 1CJTB 1R3NA 3DGPB 5EWFA 3F0NA 2YNGA 1HBUB 3IBCB 4DSKA 4ZVTB 3GSDA 3NGSA 1S1TA 2B4UA 2OPRA 3NGRA 3E2EA 4RNOA 2ZUGA 3VZIA 1UZDA 1S1TB 1LFPA 3S1TA 1OY8A 4CH0S 4FYXB 3Q22A 1N6QB 2E1CA 3OL6A 4P52A 4XDDA 1T02A 1SC6A 1KQSR 3D1QA 1YJTA 1NHUA 4DUZF 4ZOSA 4CI0B 1FE0A 4F25A 2XLJA 4KGMA 1WI8A 2EFNA 3RAQA 5KG4A 3TOQA 1HWKA 1IKXA 2RU3A 1DHMA 3N5FA 2BE2A 1I94J 5A8KB 1PYSB 2BANA 4ZN3A 3LAKA 1N5VA 2KFYA 5L1IA 2GAGC 4CO2A 4ICLB 3QAEA 1WDTA 1WF1A 2ZBIA 2BANB 3EMTA 3VCDA 1Y5NB 1MMLA 2KHDA 3GG0A 4AL6A 4V1Ak 2FVQA 3DI6B 2BEFA 3N5BA 2IBKA 4FKYA 1RT1A 3DLGA 5BXIA 1PO6A 3KUGA 2ABYA 3SXLA 2IJRA 1ZH5A 1ZTWA 3MM8A 4ZVGA 3EWGA 2DTJA 4RNHA 4R8UB 2QV6A 5D6GA 4ZCKA 4HI2A 3T1YF 2W7PA 2IVMA 4A8OA 2B8QA 1PGZA 3HULA 3RR7A 2L9NA 1D09B 2CDRB 5K8NA 5J1PA 3JTOA 3D5MA 4B3OB 1NK5A 8AT1B 4TU9A 3VVUA 5BYRA 3I4HX 1RKIA 3D0HE 2XNRA 2QYGA 2B4OA 2ZOFA 3GB0A 3HFZB 1A0OB 1R8HA 2QLWA 3I0SA 4OHXA 2FGCA 4YFUA 1U1RA 1JQGA 1O0PA 3QGHA 4MK7A 1R8PA 1SKUB 4G6VB 3E8OA 3UI3A 3MPDA 2MHEA 4Y34A 1RJJA 1BWEA 2P9EA 1RAEB 5DQGA 2KZMA 2ZKTA 1N88A 4OYMA 4XPEA 3H2UB 3O44A 1UL3A 1U7LA 1IBLJ 3W8GA 2I6WA 1HW9A 4YP3A 1UVKA 3H5XA 2ZHOA 1PBUA 1JLGB 3J81j 3Q0AA 2BABA 1M5KC 2V2QA 3BB5A 4NLSA 1ZTTA 1CJKA 4IG3A 5LOQA 2WSFC 4R0EA 1OPZA 2F9DA 1IBKJ 2PMHA 3MR7A 1QAXA 1HPZB 2BBEA 2ZDOA 3M8PA 4I0WA 1U45A 2ZUAA 2CJAA 3R5CA 1VJQA 2CG4A 2RB7A 3FBFA 2CZ9A 1YJ9S 1FDBA 1EZZB 3MM5A 3OTOF 1KVKA 1U1QA 5JXSA 5KG0A 2YKNA 1AXQA 5IT9Y 3KDOA 4HEA9 4J9LA 1FRJA 3KK3A 3OR1B 3N6MA 3L09A 4F0KA 3EXYA 2M88A 3U1LA 4FBTA 2HQIA 3IG1A 4LIWA 1IR2A 3TUIC 4M95A 1R7IA 3CPWR 2J6SA 3HHLC 2IJNA 3HVTA 5MLCV 4NLUA 4N8NA 3DRYA 2DO0A 2HQFA 3IG1B 3AHPA 5DS7A 2R2SA 3M4XA 1RAHB 5H1SV 1MWQA 4F04B 2FLNA 3G8SA 4C48A 1KDNA 3HKWA 1B64A 2EC2A 2RF2A 5HBMB 3CEDA 2CYYA 4OFZA 5L1LA 3QBCA 2YBVA 2DBBA 1YQHA 2PEBA 3GWCA 4YHHJ 4RWWA 1L3UA 2KXNB 4L74A 2I38A 2J5AA 5KT3A 3IWXA 3QIDA 1LXNA 4OX9F 4LF4J 1UAWA 3NS7B 5DG7A 2N3OA 2W01A 4PR6A 3KWMA 1UVIA 2YKOA 5L39A 5J2PA 1VOMA 3W65A 2KT3A 2M8HA 4HHHA 4KGKA 1EETA 5HVGA 3AOCA 2FUG9 3MCOA 2X7IA 1EARA 5FDLB 1EETB 1R8AA 2DR9A 4GRSA 1FKOA 3CJ3A 4PXBA 1YRXA 2R8JA 4Y65A 2BDPA 4NZ7A 1FKOB 1OQ3A 4N47A 4XO0A 4WE1B 4F7VA 3SZ2A 1FI4A 2HBRB 3KJNB 2AHOB 1RT4B 4H4MB 2M7SA 4Z7CA 4DV3J 2YWEA 4FF2A 2D9PA 2W9CA 1TK8A 3QMQA 4IR9A 3FVYA 3HD2A 1J5OA 3HFVA 5M2UA 2WBMA 1E6VA 3NWGA 2W9CB 1QLNA 2ZBPA 3QATA 1RDRA 4K4WA 4WFAQ 2H5JB 2KVIA 3V81B 2DRBA 1MMDA 2GMLA 1XR7A 3D67A 4M5IA 2MKSA 3HSZA 2HHHF 3PJWA 2Z57B 4B08A 2IBOA 4LRFA 1FDAA 2Q79A 4WWSA 1UJ4A 2YKAA 4JI8F 4PG7A 4DV4J 3KMSA 3HMJG 3OHBA 4LRAA 1V3RA 1WEXA 4OI4A 4JI6F 3G9CA 1NU4A 2K3IA 4AE5A 4CRJA 2YNHA 1X4GA 1R6VA 4RW8B 4ES3A 2MEWA 1LNQA 1RK8A 4K4ZA 4FZVA 4ECXA 5D0EA 3QRQA 1RWVB 4O3PA 3BBCA 4ED1A 4WP9A 1X4HA 3KLGA 3R5DA 3CJKB 1CULB 3LUYA 1JLBB 2GQQA 3PYFA 5HP1B 3MMAA 2E1PA 3W2WB 4RBUA 1WHVA 1NCLA 3GJSB 4MMOA 4DOZA 3TZXA 1FKPB 3J7ZT 3W1YC 4O3QA 3GIKA 1XMOJ 1FNMA 2Q43A 2BJ8A 4C11A 1LW0A 1RAIB 2CQPA 2E5IA 4Z37A 3KDNA 2VD3A 1I1GA 2GO9A 4OI2A 1GXLA 2XWYA 1JLEA 3W63A 1HQUB 1NXIA 5CCMA 2KFNA 3MEDA 3PM9A 3TNVA 4PG8A 4QW9A 2LCWA 1WKKA 2LEAA 4TU7A 4D3HA 2COLA 5LMUJ 4HH1A 1IKWA 4NXMJ 3MXHP 3QRRA 3L7OA 2B7BB 4QWAA 4ECRA 2HFUA 2HS3A 2ZNYA 2CJQA 4RPFA 3Q8SB 4LSZB 5IV3A 3LWLA 1R43A 3ZTPA 1ZBTA 1DTTB 1RUSA 3LP1B 1FHTA 5GADI 4FPIA 3HT0A 1NSQA 4C8KA 2FZKB 3VAIA 4C8OA 4MT1A 5KFZA 4ECUA 3HHNB 4I64A 3P8BB 1W26A 1SJRA 1JXLA 1Y4ZB 4HH0A 3BO4A 3UNGC 3LALA 3M6VA 4DX6A 3FSIA 1RT2A 4JI0F 2RDIA 2XZTB 2C3PA 1SBRA 1H2TZ 3K8WA 1M5SA 4PXEA 1RT2B 2HAIA 1S76D 4GO7X 3T5KA 2AYMA 2QA2A 4WP3A 3Q8RB 4ZS6A 1H72C 1WDDA 3BPSP 5EX0A 1SKRA 3A3NB 2GQ2A 1URRA 3IXQA 1RQ0A 4S0MA 4LFCJ 4EEYA 2VG7A 1NHKL 2HLUA 1P9QC 1KKHA 3BV8A 1FTRA 3VQSA 3TVYA 5B0BA 2HHWA 1K47A 1F60B 4WZQA 1S99A 4J9KA 2R7TA 4XAKA 3HT3A 1WOSA 3HHLA 1PAEX 1P27B 3M6UA 2JEJA 1X4EA 1WSVA 4AXJA 3BSCA 4O4RA 3G86A 2WB4A 1NSKL 2VG6A 1LWEA 4C8NA 1WC6A 3ZZPA 3T1HF 2BA9A 2KYZA 2MPUA 4HTIA 2QMWA 3SV3A 2OPSA 4YMEA 3C8YA 1RWOB 1LWEB 4G1PA 1LFWA 2UXBF 1TKTA 3VWSA 2ADBA 3AD9C 4OZJA 3CD0A 4P7TA 3RBZA 4LR9A 2MHNA 3ZO7A 2PGCA 3LGHA 4DI6A 1I3OB 2U2FA 1TKTB 4WU3A 3PFEA 4F4AA 4EBCA 2NCKL 4DJBA 3QIPB 1VHFA 2BZ2A 3HVWA 4KJIA 2KJVA 4XK8C 4M5DB 1VQLS 2E44A 5HL7Q 4F4XA 5EN1A 4WP8A 2ADCA 5KG1A 3JXOA 2DIUA 5CYMA 3HHEA 1X0FA 2M8DB 4WXOA 4PRFA 4R25A 3CDUA 1S6UA 4HHJA 1Q7LB 1G4CA 4DPTA 2PA8D 2DKOB 3QT6A 4YN3B 1G3OA 4ZVOB 5DDPC 2J7KA 1EKSA 3MTJA 2XGQA 1SXLA 3TP2A 1FXLA 1QM9A 2HIYA 4Q43A 1FX4A 4KSEB 2ACYA 2BACA 3MF5A 3O5TB 3Q8YA 3MOZA 4DPWA 2B4PA 1QVGR 3EDRB 2CQHA 1ZZFA 4N7TA 3K7RA 3N28A 3IR5B 3QYYA 4DL6A 2RRBA 4FXWA 1FESA 1X5TA 1G1XA 3CJQA 1YK9A 4G1IA 2W25A 4TY8A 3I5AA 2GVZB 5MAOA 2HPUA 1SV5A 4IRCA 2ZHAA 4OHZA 1Q8LA 1X60A 4ZVUB 2K1RB 4C6AA 1E6YA 1YI2S 3NNHA 1CSJA 3EPIA 3HZEA 1XNRJ 3UN3A 2NZCA 2U1AA 2FJVA 2ILYA 1E6YB 1S77D 2KKHA 4F0MA 3NLCA 2AZ1A 4EBDA 3GG1A 3BN4A 3PG9A 4LF9J 3TZYA 2P6SA 1VIOA 4FYVB 2XQCA 4EZ9A 1OYEA 5HATA 3DYAA 1RT3B 5DO2A 4DFKA 1GAOA 4NI2B 3C16B 4Q5VA 1LQ9A 3DLLQ 4IRKA 2LP4A 2YWGA 3JQJA 4NCGB 2OELA 1Y3JA 2BRLA 4OYZA 4U67Q 1N0VC 1DLOB 3M32B 2NUHA 2YPYA 1L3KA 4AQYJ 4DBQA 2B43A 1RBAA 3KHHA 1KC8T 2IRUA 2G13A 1U2RA 2QLFB 4NYPA 4CLUA 3QO9B 1RBLA 2AD9A 5D8HB 3RB4A 2GHWA 3CE8A 2Y3YA 1HHTP 2XYGB 4J9MA 1FF2A 1F0XA 2XC9A 4B9TA 1TP7A 1SC1B 1OJ4A 2B3TB 3WX8A 2KZZA 1BHNA 3P5BP 1TKDA 4EZ6A 2MQPA 3OL8A 2A6MA 4ZPWR 3DMJA 2DISA 1WKLA 4PWWA 1FJCA 3BM7A 5HANA 1FVSA 4KT0C 3GPAA 4C3KA 3G8TA 4GKJJ 3DRPB 4LR8A 3SDEB 2H48B 4J9PA 4UOHA 2DNNA 2V4JA 2R7SA 2VPZB 4ED6A 2GCFA 3Q8QB 5KAKA 3NCRA 3AJ1A 2V2KA 3VVTA 4X64J 2OHDA 2V2VA 3B6BA 4USTA 5ETKA 1R6YA 4K59A 1H3DA 3MAHA 4DV7J 3ZFVA 2V94A 5HROB 4KO0B 2YQ3A 4MFBA 4EGLA 2FJXA 4DZDA 4C0OC 1TR0A 3BH7B 2ZC4A 1X4FA 4OX6A 2VF3A 3OR2B 4NEZA 2JFKA 4MFBB 2OPQB 4L72B 4LBHA 3R97A 5EDWA 2GJ2A 2GW8A 1BGXT 2DNYA 2D7SA 3FBEA 4NEYA 2E1AA 4C97A 2AGQA 1SL1A 4X4QA 1MU2A 2HQ3A 4Q7AA 2DGXA 4LF7J 3CO9A 2VU5A 2C22A 3O6QA 2QT7A 4Q0BA 2RU9A 2GV1A 1WG4A 4YY3F 1K0VA 4OYIA 2LQ9A 2HHPA 3HJFA 4F50A 7FDRA 4N76A 1M1KT 4QU7A 3RYLA 5HQLA 2XHCA 4P9SA 4UOCA 3DRRB 3NS5A 4ZCIA 2HRTA 2XO6A 2ZOMA 4RW6A 1VC5A 2XS2A 1TAUA 5IT4A 4KV8A 4E2FB 3D6TB 5DZ6A 2NXCA 2BR0A 1LXJA 5KFQA 4NXNF 2QG9B 4KV8B 4JI4F 1Y7PA 5B7WA 4GO5X 4DU7A 1T7PA 3ZZOA 2AYEA 1NPPA 3VTIA 2CPDA 3FJ2A 2PIIA 1JMTA 4X4TA 4DCPB 4C98A 3LO3A 4MK9A 4CCHA 3NL0A 3A8EA 5LL6d 5CD4A 3FK4A 3QFWA 2DJWA 4Y28C 4ZJQA 1HNXJ 3WC0A 4DQRA 1UVJA 1DURA 5BJRA 4MJKA 3U02A 1K0TA 2BW7A 1S6QA 1JLCA 2CQGA 3BF4A 2LA6A 2CPEA 1X9MA 5I3QA 4OV1A 3RR8A 5AE3A 4OI6A 2YQ0A 2NPIA 4CH1A 2G1HA 1T03A 1S6QB 3C19A 4RX6A 3BGRA 5KFGA 2YXLA 1PKUA 4NL5A 3CD5A 2ZE2B 5A8WA 1FFGB 1W2IA 2M9KA 2OEKA 3BGRB 5GMEA 1R0AA 4KHPF 5A6PA 3M9OB 5EGYA 2FLOA 1V3SA 3W9IA 2FHOB 3IRWP 2Q66A 2VFSA 3C6TB 2A6OA 2FC9A 4LF6J 2DHHA 1BQNA 3FCVA 2QN6B 4ILRA 4ZLPA 2HWIA 1GX5A 4LSLA 1V6HA 4UT4A 1NMEB 5H9EK 1RTJA 2G1DA 1TVRA 1AUDA 3BREA 5DGAA 4O0NA 4DG1A 1HNWF 3MD3A 1FD8A 3VR1A 1HWLA 3OHAA 2VODA 4F36A 2CNOB 4X65F 4DG1B 3RZAA 3M9MB 4ZHRA 2F4VF 4ZVEA 5K8OA 1VR6A 3ADAC 3B78A 1FVQA 2FHMA 4NOHA 2YVSA 3MM9B 3C15A 1N5YA 2ZH1A 2MYFA 1JWWA 1YRTA 3LH2S 1NKCA 3A8KA 3UW1A 1HWJA 3GFYA 1N5YB 1VQ7S 3N9UC 3CCSS 2NYIA 3BSOA 2NZ4A 1UJ5A 1NDLA 3TZZA 4YR0A 1SIZA 3BR9A 3CCVS 2VBXA 4X4NA 2I5JB 3RRKA 4CO1A 3OVSA 2VPYB 5E7OB 4RUCA 3CUNA 4ANCA 4PWDA 1T0TV 1S9GB 2DNQA 4OJ1A 2F3JA 1YRUA 2HBQB 5CYQA 4WCEQ 1XMQJ 5HK4A 4OYPA 2XMJA 1C1CB 4HYKA 1D9FA 3I5BA 3SCKE 2IRXA 1EX8A 4I68A 2AWZA 3ILOA 2K3KA 4NZ6A 4DR4F 4M5JA 1XNQJ 2JX2A 2O3DA 3UDEA 2RSQA 3ILJA 1DQ8A 2PI4A 1S1WB 1VC6A 5KFFA 1A7GE 2EXUA 4H54A 5C42B 3HLUA 3IGVA 4UQTA 5GAGU 2A1BA 4C0HA 5DLFA 3KK1A 1KFDA 1FO1A 2ZFHA 1KWMA 2DGUA 3WDOA 2MSTA 3WBZA 4HT7A 3KK1B 4CNZA 3MM6A 2MQMA 5RUBA 3DLJA 2XG8A 3I5CA 3GIRA 3MURP 2VJVA 5ITHA 1QSYA 1T9XA 1QVFR 5JMNA 1NBEB 2XSFA 1ZA2B 3GFZA 2EFVA 4L76A 5DDOC 2EG1A 3CC4S 3IRXA 1OY6A 2NR0A 3K5NA 2D3UA 2H65B 1HNVA 3KUEA 2HK2A 3NGKA 1DFDA 4IH7A 3EM1A 2DD8S 5GMDA 1F3VA 2M52A 5F3ZA 3NBPA 3FCHA 2MY8A 4RW7B 1IJEB 3NEKA 2FHJD 1Y5LB 5IT9U 1N33F 4NYZA 3ILLA 3GR1A 2L9DA 5HQ8A 1TV6A 2BM1A 1ROFA 4ZVSB 4M5HA 2ASJA 4OJHA 4ZVRB 3EVOA 1TL7A 3QSYB 1CC8A 2DH7A 2G2YA 1TV6B 5DM7Q 1BUXA 3R7SB 8ATCB 2KDOA 3KLEA 3GFXA 2OAUA 3BJYA 4UZCA 2NUUG 1NZAA 1TL7B 2CWKA 2DRDA 3FRZA 1EP4B 2VQEJ 2ZWOA 4DFJA 5DGBA 2P2CB 3MMBB 1GQEA 3C3LA 3DRSA 2XZDB 2NXJA 2V8PA 5A2QU 2FJAB 4B3SF 2E1MC 3IAM9 3HKZD 3HZGA 2E29A 4KKOA 1ZM4A 2LQJA 3TJ8A 3H40A 1Q8IA 1WELA 1WC0A 2L3MA 1Z4UA 4EUVA 1KN6A 4LVNP 3MAAA 3ULHA 2MLYA 4KKOB 2L48A 2HG4A 1AT1B 1N5SA 4DQIA 4M94A 3MUMP 1QSLA 4LF5F 4P71A 1LV5A 5KFPA 2VPXB 2ZVSA 3Q8VA 3GJTB 1B0TA 1O51A 4M8LA 4ZITA 1U6FA 3JSMB 1NJIT 4OYXA 1EQ0A 1KRPA 4DSIA 5DG8A 2QFIA 3TJAA 3DM2A 1JXEA 4MYTA 3FKBA 3QT8A 4DV0J 2R42A 3MCNA 2FVSA 2MGZA 5B0AA 1XMBA 3MEEA 3C66A 4USIA 4LF2A 3TAMA 2AGPA 3MOJB 5F8MA 2ZC3A 2MGZB 2PMWA 1B7YB 3PCOB 4NMLA 1ZETA 3MEEB 1S72S 4L6V3 5KFRA 5D15A 3PIOQ 1P1LA 1SQFA 3PJXA 3ZZZA 2PMZD 4ZJLA 1RA7A 1VRUA 4DF8A 5I4MA 3M8SA 4RUHA 2FVCA 5KFKA 1CJVA 5L38A 2Z2MA 4CLFA 1RU1A 2AX1A 4KTQA 1MMNA 1VRUB 1S1VB 4X84A 1HWIA 4DR2J 2PD1A 1TU0B 4TQSA 1CJVB 3KLHA 4ZIWA 1KONA 3BGUA 3GE9A 2Y1RI 1KP6A 3TI0A 2ACMA 3T5LA 2JLFA 1HYSA 8RUCA 5B0DA 2H3EB 3EXCX 1S0OA 1MROB 2P9GA 1Y0HA 2QMUB 4Y6IA 3UDVA 4UOGA 4OYAA 1RLDA 3KHGA 1VLOA 1U1LA 3SSQA 3TQ1A 1FERA 3W8PA 3AOAA 4B9VA 4ELUA 1WTFA 5KFXA 2CVIA 2RMLA 2HMIA 4JI1F 5T7LA 4J5OA 5DZ7A 4BWJA 1S9EB 4GKKF 3HJVA 4CIOA 4KB7A 3MEGB 1IQZA 1Y11A 3HX9A 3PACA 1NKBA 1C2PA 1ITPA 3F73A 4ECYA 4N56A 2KL8A 2DNHA 3KTQA 5CAAA 1UWAA 1M1HA 4OZLA 3G6YA 5J1EB 2XGPA 1Y00A 4P75A 1QJHA 3OXGA 3T6BA 4AXIA 4PXDA 3LPYA 4DR3F 1A9NB 3QJJA 4LVOP 3N79A 3ELHA 3M1VA 4DUYF 1N56A 1JLFA 4QWDA 4W90B 2V4RA 3BKUA 3JYTA 1YJVA 5KFVA 4LFAF 3LP2A 3IFEA 1JLFB 3G6VA 4F4KA 4ZCLA 4PUOA 2DR5A 5CH7B 2LECA 3BEGB 4FP9A 3FZ2A 3LP2B 5AJ3J 3ICLA 1GXTA 2UUCF 1LWFA 2QX0A 1C0UA 1X0PA 3W66A 5FIIA 3PV8A 3ZZTA 4UUXA 1HMVA 2AX0A 1LWFB 3MCSA 4K0KJ 4DQSA 2GHPA 3FEZA 2DH8A 2DGQA 3CDWA 3MECA 3VAHA 1K1SA 1KVIA 1FEEA 1NHVA 4CDIA 1X8DA 2E1RA 2BYCA 2APOA 4RNFA 4OZ3A 3AXKA 3OVBA 2N82B 1C1BB 4K4SA 3CF5Q 2W2QP 4EYHB 2DT9A 1X4BA 1XC9A 1JLAA 3G82A 2OMOA 2VV5A 4QYZK 4OL8A 3V6KA 3FEXB 3SCLE 2D69A 1RTIB 2QO3A 1QUVA 1XERA 3OFEA 3J7A1 2HK3A 2EEYA 5H9EJ 3QRPA 3KLIA 4F4WA 1YDLA 2XHWA 1RISA 4RUBA 4MKAA 4ZA1A 4A8XA 1KBRA 3KLIB 5DETA 5C24B 3PW4A 2RS8A 4PQUB 3AQPA 4DPYA 4F3OA 2EBGA 2X1GA 3NP5A 1MWYA 4MKYA 2EC0A 3N01A 1OPIA 2OGUA 1FJEB 1OQ6A 2J9DE 1QSSA 2RD5C 4P2SA 4OZNA 2V0NA 2OPPA 5B0GA 1H6KX 3DLEA 4NLXA 2HQCA 5ETRA 1HNIA 1QY7A 5BR8F 4WFNQ 1X4CA 3MTKA 2DNPA 5F8IA 2WOMA 3OD2A 4DN0A 1RWUA 2J6TA 1C4AA 2HVIA 4CM0A 1SKSA 2PA3A 1OS5A 2CQDA 3R1HA 2PT0A 3A3OB 1S1UB 2AT1B 4QPTA 3BQ0A 4ILLA 1R31A 4C8LA 2HNYA 5HMYA 3FSXA 5B09A 2K8GA 1U0HB 2HNYB 2CPFA 4ERDA 2HLTA 3PFOA 3KFWX 4A8YA 1NK9A 2BJ9A 4DV5J 3AFGA 5ETVA 2F8EX 4YS2A 1F5CA 1UKUA 1F5AA 3CJ5A 4ZN1A 2XB2D 4ILMA 2MKHA 2HHQA 5HSPA 5L9XA 4YOEA 2UXDJ 3SQOP 2E5GA 3PHEA 2AEJA 1NM2A 2GIFA 4CZCA 1S49A 2DCLA 2V5HG 1U8SA 4IFVA 4QIWD 2WBRA 2PC6A 3MR6A 5F8GA 3SQGB 2CPYA 1WHXA 4IFVB 1QUPA 2FY8A 2LA4A 4DPXA 3BKFA 4Q2MA 2MZSA 2LMIA 4OYWA 2GX8A 2MY7A 3M2RA 2HHVA 3PTWA 2GJIA 2RKIA 3Q86A 4O4GA 1WEZA 4CWBA 4WFYA 3DDKA 3M2RB 3M7VA 4O3NA 3BR8A 4NZ0A 1CS4B 1HQEB 5HVFA 4O4GB 5ETMA 1TKZB 2DHAA 3GFHA 5IOLA 4H4OB 4TXSA 5SZTA 2RQ4A 1FRXA 5KFSA 4UQGA 5EX3A 4G1QB 4AL5A 2FLLA 1W25A 2D41A 2G0CA 4EO8A 4HHUA 3RW6A 2FPHX 3HDSA 1KD1T 5KFWA 2XCPA 4AUKA 2H5EA 1EJ7L 4Q8EA 2CRLA 4PPZA 1KHWA 4YB6A 3CCES 1UZHA 3K5LA 2I1RA 1RI7A 1M1GA 3JQKA 2BKPA 4ZP7A 3MM7B 3SCJE 2E5LF 4B9LA 4CO3A 3C46A 5E3CA 3HHKA 1S6PB 2GJFA 4YUDA 3EGNA 1K8AT 2Y8WA 3PNIA 5E2QA 2WVEA 2Z2YB 3E01A 3GR0A 4MAKA 3ISNC 4JOUA 1RT5B 1DRZA 1NNDA 1N32J 1NK6A 1FRIA 3SBMA 3D54A 2RS2A 2HVHA 3CJ2A 5ADZA 3C2PA 4NA2A 2HZAA 2CNKB 2G0JA 4JI7J 5HLFB 1NSPA 1AUSL 3DXBA 4NMXA 4ECZA 2B5JB 1GK8A 1WACA 2VONA 1I94F 3CIMA 3US5A 3AB2B 3RB3A 5KT2A 4CTAB 4K2JA 2K06A 5G0RA 4J9SA 3TAQA 3MPWA 2CPXA 1YJNS 2BOAA 2YKPA 1FK9A 4F67A 3PW2A 4FYYB 1RWPB 3EVWA 4DS4A 4UZBA 2VG5A 1CQMA 2H54B 2ZJPQ 2V4QA 3Q8UA 4RLEA 3B4MA 4JV0A 2MMYA 3PDNA 4J7CA 1HBMA 4I69A 1RWXB 2PN6A 1T3OA 4U8VA 2P8IA 1ULRA 3WIUA 3JSRA 4HDGA 2C3OA 3OSNA 3V6HA 2DEIA 3W62A 5KFOA 5AT1B 1Q82T 2CIMA 3CVKA 2W8LA 3ITHA 4O44A 2UP1A 5E5NA 4DHVA 5D0GA 4TN2A 4A8SA 4EU0A 3DHWC 4PG5A 4EFAC 2UXCJ 2Y0BB 4KH0B 5H9FK 4O44B 3U1NA 2R7XA 4C9DA 2NPFA 2D1CA 2VASA 5JVGQ 2UUBF 3HM9A 5F8JA 4KHMA 1Y5IB 1JKHA 1VRTA 1VQOS 4KHRA 5ETNA 4AYBD 4I7FB 2XY5A 1YG0A 3FMWA 4DF4A 1EB0A 5D3GB 4OYOA 1IBLF 3KJQB 1OIAA 1ZM2A 4QBUA 1RAJA 2MKCA 3CDBA 4QYRA 1NK0A 4G3IA 5F3TA 3K8VA 2IIHA 4JBCA 3B4DA 3ET6B 2WB1D 2EBEA 3RRGA 3V2UC 4KGVB 2R7QA 3T19A 1IBKF 4BWMA 2C2MB 3FBBA 2N7YA 4X4RA 3LA0A 3B82A 1HARA 4PQAA 3CCZA 4DQPA 2MKYA 3T9ZA 2KVQE 3IAS9 2VOPA 4X4UA 3DLBA 1BQXA 4WYWA 4TVAB 3NNAA 3LP0B 4X62F 1MG7A 1HD0A 3I56S 2GVDB 3JTNA 1Q95G 5F8LA 1FXDA 3V5RA 4NYOA 5C25B 1NB2A 4XPCA 5IQ6A 2OO4A 1K9MT 1LEOA 4W4MA 5D4PA 1RTDA 2EK6A 1RAOA 1WSRA 2DXEA 2WVDA 1T05A 1B70B 4UTGA 4FYWB 3M2UA 4DV1J 3CJSA 1VLYA 1U2CA 3H4BA 4I6WA 5KFYA 3S01A 2RUSA 4K8RA 3ENWA 3PX6A 3R1LA 3VGUA 4YR2A 2ZDPA 1TZ0A 4KAIA 2E9ZA 4YHHF 3JQMA 4M5LA 1L5UA 4DSJA 3FSYA 2W9AA 2JC0A 2HBYB 1Y3KA 2ZZNA 5DJBA 1FRHA 3R2CJ 2ZEJA 1RADB 4LF4F 2BXJA 1UETA 2IAJA 4JV2A 2XMVA 2Z56B 5E3RA 2EWHA 3KHLA 4DR7J 3K5OA 3UO0A 4XTTA 3VAGA 1RU2A 2D3ZA 2IAJB 1SUQB 4QYZJ 2VJUA 1Z2LA 3G6XA 3C6UB 2CPHA 1QTNB 2OP5A 5A6WA 1HBUA 3D0IE 3KXDA 4CLYA 1R89A 3H90A 3ZTRA 3OUYB 1VS3A 2AJFE 4K2XA 2ASLA 3G4SS 2A3JA 4RR5A 2OFHX 2DRAA 1NUEA 2RH3A 3RBEA 1VBYA 3BO2A 1VQ5S 5IWAJ 2QGFB 2XLIA 4FNHA 5B0CA 2XM3A 2XTJP 4LQ3A 2HNDB 1N6QA 2BJ1A 3H7HB 2CPIA 4U7UK 3TA1A 4DV3F 3QPIA 2ERRA 2HNZB 2ZH5A 5C2CA 5KFCA 2YH1A 4WF9Q 2BKNA 2VB6A 3ZTQA 1Q8KA 2AU0A 2GIQA 4J9UE 3H2LA 1BE4A 5KT4A 5A8KA 1TFYA 4USVA 4ICLA 3H2VE 5IV4A 2IRYA 3W2VB 3NGDA 5HMXA 1DTQB 4E8UA 3D6HB 2V68A 1WNEA 3BQ2A 4HKQA 3AD8C 1ZZNA 2JH3A 2VFUA 3DI6A 1U1OA 3KYLA 1T9VA 5T41A 4NCBA 1WD6A 1U49A 1U09A 2ALYB 1OO0B 4DV4F 2W7AA 4R8UA 3R2DJ 2DGTA 3ZNUA 4DR5J 4ES1A 3F41A 3TR5A 4DDFA 2O66A 2CA9A 4B3OA 3UD4P 2DNMA 1R27B 2N3LA 4WXWA 3GU0A 5F8HA 4CM2A 1B3TA 2XYHB 1DQAA 5ETQA 1IR1A 4OLPA 3IGNA 1JK9B 3H5SA 2DGVA 2GGPB 2XSJB 1VJWA 2SXLA 2Y0SD 3JAMY 2J76E 5DG9A 3BN7A 1XMOF 4K4YA 2NYHA 3SMZA 1N36J 4URGA 1YBUA 1M5PC 4QOTA 2F5GA 4GVLA 1JLGA 1ELOA 3J7AN 3PX4A 2ASYA 3KJVB 2Z2LA 4Q2LA 2CZ4A 3DOKB 4RW4B 4P74A 1U1KA 2C1EB 1FWLA 4YDXA 2H4WB 5LMUF 1CG2A 1KTVA 1S48A 4MKVA 2UUAJ 1HPZA 1SKWA 1G7CB 3RAMA 4NXMF 2UVVA 5B08A 2R8IA 3M05A 4OHWA 1WORA 1KOOA 4DPUA 1XR6A 3TEHB 1TUVA 2R7UA 2M70A 1RT6A 3DGVA 4I56A 2CJKA 1PAUB 3SFGA 2PO4A 1FXRA 1N34J 1F2GA 3OR1A 3VHQA 4ZVHA 4DV2F 1RT6B 3H5YA 2I2YA 4DL7A 1YBTA 2UZAA 3IM8A 1IJFB 1WC3A 3E51A 4BLGA 3I0RB 3DCAA 4CO5A 3KLFB 3KMQA 3V4IA 4JI3J 1N54B 2WW4A 1HR0J 5HBMA 2ZBCA 2JJ4D 3O1LA 1HHQA 2H1YA 3V4IB 3GIIA 4ATNA 2XNQA 1SCJB 1ZM9A 3T3FA 1U1NA 2X1BA 1VK3A 1S1XB 3ISZA 4LFCF 5DQIA 3RTVA 2DR6A 1PBAA 4ZPTR 3CCUS 4WKYA 2KT2A 3HFKA 3FUYA 1Q8BA 4ETZA 2UVRA 4TU8A 1N33J 3NOGA 2E66A 4ZDNA 2ZKUA 2ZH7A 3FFIB 4HACA 3LOUA 1T95A 2GQCA 1HBOA 4HVZA 1OSDA 1TL5A 5FDLA 2UVUA 3FRYA 2LQ5A 1XN9A 3H8YA 1FRLA 3EPGA 4HACB 1MN7A 1HBOB 4UUWA 2ZVIA 4FNIA 3WQPA 3J7YU 1UWBB 3DXSX 1VQNS 2Q3PA 5KG3A 2JNJA 2HGMA 1X31C 3QWUA 4I2QB 3OTDA 2JEFA 1L3VA 5FLXY 1VC0A 2XS7A 4WZMA 4WE1A 4Y3CA 3DLKA 4WYLA 2VC0A 4V19J 2AEMA 1RT4A 2XI2A 4H4MA 4B3MJ 1IR0A 3P96A 4NX9A 3RB6A 1TL4A 1LWCB 2QZ8A 2ASDA 2Z4PA 3DLKB 1GMWA 3NKYA 3B54A 5LXRA 2HZVA 4LF8J 2ZH4A 4FS2A 5H9FJ 5LSLA 1RHKB 3EX7B 3OBIA 3V81A 1KNZA 5CA5A 4JB8B 1U47A 3IP0A 5D4LA 3R6LB 3MR2A 1SJ1A 2XMAA 1NB7A 1JNRB 3RG6A 2XY7A 2XBPA 3DFEA 4JV5J 5IXUA 4PXCA 1UFWA 5K5MA 2DNOA 1BWVA 4GVBB 4RKUC 1VQ6S 4Y2IA 1T8EA 2DR7A 5L9NA 2LDYA 3W3SA 5K14B 3CC7S 4B3TJ 3FMBA 3QZ8A 3K17A 2HVZA 1IXKA 5ETPA 3CCMS 2DITA 4RW8A 3R6GB 4M1KA 4I6YA 2OEJA 3GZ7A 4AFFA 3K89A 3OPKA 2Y1JA 2VQFF 1H73A 4NLOA 4ZPAA 2LVWA 4DZ6A 3I6PA 3OFFA 3L9ZA 2M3DA 1WI6A 2AIRB 3VALA 3MPUB 2AQ4A 3I31A 4DU8A 4IH5A 2UV8A 1XNRF 3CJKA 1CULA 4FDFA 2F1FA 3HF5A 1MN9A 4KPCA 1B99A 1JLBA 2QTWA 5HP1A 2HFOA 3W2WA 4IOCQ 3VAKA 2LU2A 3GV5B 1FKPA 1RT7B 2BVZA 5J1NA 2B9WA 4Y2AA 2W1BA 4EK2A 4LF9F 2HFZA 4ECTA 1RYRA 4FYDA 2ZITA 4X4OA 1MNEA 3MMCA 5D78A 4JUZA 1R0CB 4WK1A 1IUJA 2AW0A 6FDRA 1KFSA 1GT8A 3W9JA 1HQUA 4K4TA 4OLOA 3MMCB 2DPJA 4B9MA 4JI1J 3D7SB 2DNZA 4JYAJ 2LQBA 2XMKA 3EZ5A 2OTLS 2V2ZA 4A48A 4JI2J 3POTB 4KRWA 4AQYF 5LXYA 1CLFA 1HI1A 4M5MA 2DR8A 3QWPA 2CQCA 2J8SA 4IDKA 1TQLA 1KLNA 2DH9A 4PWUA 2MQNA 4B3RJ 1DTTA 1HL6A 3LP1A 2DGOA 4IDKB 3PXGa 3DOLB 2OFGX 1PCAA 4DR3J 2QA1A 1SL2A 1R0BG 1IKVA 4DS5A 1URNA 4PEOA 4DUYJ 3PHTA 1LKZA 2J8AA 2W2OP 3ENVA 2DHXA 5M2RA 4WFZA 3S7RA 3T9NA 1IKVB 3JS9A 4GKJF 4LQ9A 4FF4A 2UVWA 1WWHA 1NEEA 2POKA 2B9YA 3SIPB 3D66A 4JV1A 5F41A 3DDIA 3KK2B 2PDAA 3EYZA 4X64F 3QJLA 3M8RA 4IG0A 2G4BA 4DL2A 2OSQA 2YWFA 4MK8A 1DQ9A 1TL3B 4DV7F 4IG0B 4ZIVA 3PX0A 1TMJA 4CQ1A 4EO6A 1S9FA 2EFPA 2PE8A 4UY8T 2KXFA 2OJ3A 1LK5A 1TKXB 4KH1B 5KOWA 3K59A 2ROPA 2H4YB 4FXVA 3OLBA 2DNLA 2FJWA 1RCOB 2CNNB 2CKWA 3AA9A 2ZJRQ 2VFVA 1YJRA 2RILA 3M9NB 4LF7F 3UVJB 3R5AA 4MIAA 5L1JA 1Q4RA 4CO4A 3MR3A 4HLBA 2RT3A 4P6QA 4KFBB 3BSNA 1PJ7A 3DN9A 2YX4A 2BMBA 3MR5A 4OYBA 2JSXA 3QSIA 3EICA 5KG2A 5DDQC 4A8MP 3DOMB 1H2UX 3BYRA 1SIWB 3KUHA 2P5VA 1XQIA 4F4YA 4M5GA 4TLQA 2R9LA 3QIPA 3NCPA 3D3CJ 1QDUB 1YIJS 2XYPB 4P7VA 4M5DA 3UN5A 4DCOB 4NWBA 1RHUB 5ETTA 3UR3C 2LXUA 5CYJA 4DL5A 1WEYA 4DUTA 2J7UA 1S59A 1V9OA 5GAEU 7FD1A 5A76A 3CXCR 4LFBJ 1JLQB 2KT5A 1TL1B 2C2DA 3QGIA 1EAYC 2VL1A 1T9UA 2GZOA 4Y2KA 4R0JA 1VQ4S 4USJC 2AMCB 3BKTA 2JWNA 5D0HA 3W5ZA 1RYSA 3SI8A 2DGSA 5KFHA 4IO9Q 1XIQA 1P6TA 4Q44A 2CJ9A 4A4JA 3IR6B 2HHUA 1HNXF 2NSBA 2GMHA 2R8KA 1BMQB 3SSSA 3DU6A 4TQRA 5A8RB 4YQWA 2YQ1A 5D4NA 1U26A 1X5SA 4QIVA 2UU9J 3BBFA 1NDCA 3OW2R 2DHGA 3HHLD 2HS0A 4C7QA 3UWTA 2ZH6A 1HHSA 1WHYA 2GVZA 1R8BA 4TY9A 2VIHA 2DY9A 4TYAA 3CCJS 2GC8A 2JRSA 3BQ1A 2K1RA 3QFHA 2X51A 1S79A 1L3SA 3QGGA 3GYNA 2Y8YA 2HZCA 3F56A 3X3UA 2ZM6J 4ITSA 3G8QA 5IM0A 2W4CA 2FIUA 5LMNJ 4LF6F 2C42A 1HQ2A 4P10A 2VZ9A 5IC4B 1IM6A 2VBWA 4IO1A 3CDEA 5IM0B 3CMES 3CJTA 1RT3A 1M5VC 2CWXA 1TK5A 2QSFA 1Q86T 1NKEA 1REVA 5I3PA 2VC1A 1NDKA 4NI2A 3C16A 5EUHA 1ZAWA 2MLZA 3KJFB 2B9XA 4PG6A 1REVB 3VAJA 4NCGA 1ZM3A 5J2QB 1DLOA 2HGLA 3M32A 4IH6A 2KG1A 4WIQA 2XMTA 2OIHA 3W9HA 1LW2B 4ECVA 3I9V9 2RQKA 1FJ7A 3W5XA 1FWPA 4FBUA 3QO9A 3NMRA 1SJQA 4FPRA 2MZQA 5CHCB 3M8QB 2IMWP 4ANDA 5I42B 3PW7A 4FXDA 3G71S 4TLRA 3OLAA 2QSWA 3OL7A 4QIFA 4FKXA 2OI2A 3RAXA 3IBWA 4DX5A 2BM0A 1J5EJ 4URSA 1N5QA 1Q81T 1FRMA 3DRPA 3E3XA 1OWXA 2OUGA 1VGYA 1IBMJ 3LGNA 3SDEA 2HQDA 1XMQF 3RBXA 4QWEA 4I4BA 1NJZA 1FJGJ 5JVHQ 2ZH3A 5LT5A 4P73A 5J2MB 2B4VA 1AW0A 4EI2A 4YB7A 1J2VA 2WONA 1XNQF 4AD6A 3NAHA 4PABA 2Y1IA 2YNGB 1HNZJ 2VBZA 5HROA 1ZS6A 4KO0A 1B4SA 2DHSA 2MZRA 4DX8H 1BD6A 3LWMA 2WONB 2OPRB 3QAUA 3OR2A 2OPQA 4N8OA 1JJ2R 3J7YI 3J80U 4Q8FA 1FFWB 1EQMA 3D28A 4LJMA 2R2RA 1H98A 1RBOB 2G2ZA 1XWLA 3QZ7A 4OMFG 2JHEA 1SJFA 4ED8A 1VQMS 5ETOA 3VGSA 1H0HB 2WSEC 1F9FA 2Z2ZA 4F8RA 1IKXB 1S12A 3DDNA 2BE2B 4NE9C 4NA1A 3ZZ0A 1FRKA 4B02A 1FE4A 1QAIA 3UR0A 2AJ2A 5KFUA 4K4VA 3BGOP 2E7WA 2WZ1A 3CCTA 4ZVQB 3O3LA 4F2SA 3HVRA 4DLEA 3HSJA 3TO8A 3LPEA 1RT1B 3DLGB 3DRRA 2DB1A 5HAOA 3KNGA 3PJ9A 1SC4B 1X4DA 3MM8B 1SH3A 1OYDA 1KQGB 3IS9A 4DN9A 5AXKA 2QL7B 4HDHA 4ED7A 3EJMA 3UN2A 1GMVA 2Q6BA 5I3UA 2RRAA 2FDNA 1Y10A 3JB9k 3IS9B 1V5VA 2VQEF 4DR6J 4WKRA 3BZQA 5I3UB 2MZTA 3A8IA 3P5TL 3R7BB 2WCXA 2J0WA 1KLMA 4DQQA 3I0SB 2UUBJ 2AEFA 3NRBA 3O8WA 5KFNA 2HS4A 4NLTA 2DXFA 4KC5A 4ZCMA 4RNNA 4DV6F 1RB0A 5EHHA 5DRKA 1Q7YT 1KLMB 1Z2ZA 1EKRA 1Q1KA 3SEOA 5KT7A 5JUMA 3KG4A 1HLWA 1VBXA 4OX7A 1G6BA 1IM4A 2V9KA 1OMSA 2YX1A 1FX2A 4WK3A 4L3NA 3CCRS 1U4BA 2J9CA 5DDRC 3H5UA 4PAAA 5KFIA 1SJ3P 2ZE2A 2CQBA 5KFMA 4USHA 2QEXS 3T41A 3IO1A 4LT6A 2NREA 4ECWA 3MFIA 1YJ7A 2G2OA 1X4AA 1CJKB 4IG3B 4DV0F 1Q79A 1Q53A 2J9EA 2MJNA 3NG8A 1GNKA 1UW9A 3FC9A 2L08A 3TA2A 4O3OA 1IN0A 4J37A 2XMWA 4X62J 3M8PB 1WF2A 4ENOA 3A3PB 3C6TA 2LKZA 4YEAA 1NPKA 3OQ2A 4HTJA 2F8HA 3D9BA 3MM5B 1UVMA 1X5OA 3SFUA 3A12A 3D6FB 2YKNB 3CD7A 3N6LA 3KK3B 3G96A 3J81Y 1TUGB 1WHWA 1WOOA 3P4UB 5EWGA 4DR2F 3M8ZA 5F0UA 4FVMA 4CLPA 2V8DA 3HVTB 1GH8A 4P2FA 4DFPA 4KE5A 4QWCA 1WTBA 2LU1A 2CNLB 2YKMA 6AT1B 3K0JA 1JNZB 1AROP 1KHVA 5KG5A 3BDPA 1UEVA 2B51A 2MXYA 3KG0A 3RJMB 3EUNA 5A2QY 4BS2A 4MIWA 2RF2B 2YKMB 2AP6A 2ZOGA 3IA0A 3R7NB 1M5OC 1FCAA 2QL5B 5J2NA 3MM9A 2B9EA 3MDFA 3P49B 5HJXA 4GC7A 5D4OA 2XZWA 5J2NB 2Z58B 2HKEA 2K7KA 3MCMA 4EWTA 3R8YA 2EI5A 2O67A 2KYXA 3I9ZA 4GMKA 4RU9A 5HQMA 1UJ6A 2I5JA 1XJWB 1S9GA 1RACB 5J2PB 1VMBA 3N6NA 3UQSA 1C1CA 2DVIA 2FVPA 2N7CA 1V5IB 5THWA 1FFSB 1RWMB 2VH7A 2MSSA 2FD2A 3QNWB 3RW7A 4C3MA 3EGZA 2Q1LA 3S6EA 1SH2A 1UFLA 1S1WA 1VYAA 3Q2SC 3H4DA 2UUTA 2VKRA 4B9NA 1AFIA 2BQ3A 3WZ0A 3JAMU 4CLKA 4U8YA 4UOFA 5C42A 3UCUP 3GSIA 4QW8A 4NLYA 1VBZA 2YX7A 3ILIA 3R3TA 3DLHA 3LF0A 3FQLA 1WKJA 4K5RA 5EWEA 3VQTA 4DUZJ 4J9NA 5ETLA 2YPZA 5L46A 3QJPA 3BDEA 3OJUA 1RHRB 1J5OB 2JVOA 3H25A 1E6VB 1PILA 4WU2A 4CLSA 5AJ3F 2HVDA 1N52B 2R4FA 4OV6A 2OD4A 3HVAA 2PSZA 3UPFA 2QA4G 2BE7D 4USKA 1U25A 3SCIE 4K0KF 2F63A 5GAEI 3CGIA 4RW7A 1B0PA 3NXZA 5CQGA 1LOUA 2XMUA 3JSYA 2DO4A 3MPVA 3NY0A 4IFYA 2AJ0A 3CJRA 2O1PA 3L7UA 1JJ4A 3VGVA 5KG7A 4IFYB 2MQLA 3T1YJ 2FHKA 2OD6A 4CNYA 2YNHB 3TJ9A 1HI8A 1EP4A 3VAFA 4NLQA 3G87A 2VHGA 2YTCA 4OZ5A 2Z30B 3MMBA 3U7JA 3TW0A 2IM3A 3H20A 1AFJA 3DNCA 4NLDA 2HSEB 1QAJA 2QRRA 2L9WA 3KLGB 3MMAB 3EVMA 3PEJA 3MHYA 2OMLA 1D3WA 3D3BJ 4C11B 4EBEA 3ENQA 1P9YA 1LW0B 3VAMA 4ZPBA 3K57A 1Q5VA 2QLJB 3RUBL 1VQKS 3JSMA 1JLEB 2DPIA 2EFGA 2VDHA 1SQGA 1AYEA 3PO5A 4LF1A 2YWWA 3IMQJ 1TTHB 3MEDB 2CQ2A 2EKYA 4U7UD 4L3KA 2ROGA 4FN5A 4QR0A 1G2EA 1IKWB 1RSCA 4RBTA 3CULA 5C7PA 4BC9A 4C4WA 3EZUA 1RE1B 5FLXU 3I32A 2CVEA 1WC5A 4CLTA 2A0FB 3K5PA 4DV2J 3OTOJ 1X7VA 1F3FA 2ATLA 1U2FA 4Z2XA 4A8WA 3PW0A 3GCWP 2ZHBA 2NXUA 1S1VA 4I67A 4OJGA 1SJ4P 4ZKAA 4A8QA 4DV5F 3HO1A 2ZZTA 2OKQA 3A13A 3LANA 3WHIA 1VCTA 4XDCA 3EE3A 3VF0B 3OXLA 4KPYA 3R9LA 1H74A 4KY3A 2KH9A 2UXDF 1MROA 1FNXH 1VIXA 4J9OA 1BY9A 3PYGA 2PFDA 4OZ0A 2ZD1A 2D3O1 4X66F 2YNIA 2MQ8A 4LUBA 1WG5A 2ZZMA 3AAWB 2FJEB 2NS1B 4ZPVR 3A4TA 4OX9J 2VG7B 4NLRA 3T6JA 2ZD1B 4ZVFA 1F9EB 2YNIB 2HQGA 1NJYA 1PYTA 2R8GA 5HO4A 4N77A 1S9EA 2JFDA 3V4MA 2N4CA 3HHLB 3K5MA 7AT1B 4Z7YA 4I1TA 3T1AA 5E3QA 4DCJB 3UD3P 3MEGA 1NLKL 1RWKB 2K7JA 4LR7A 1RKJA 2IPOB 4DSFA 4U9RA 4X2BA 2KG0A 1NH8A 2VG6B 2CJXB 2DNRA 2L41A 5IS2A 4QJVA 2CDQA 4NRUA 2LLZA 2OPSB 2HBZB 5CZVA 4CT9A 3W5YA 1U6BA 5J1EA 1UP1A 2W4DA 1NZ8A 1BLUA 2V8VA 9RUBA 2FTRA 2CXEA 1ZAVA 3GCXP 4F0HA 3D1OA 1DJ0A 4CLLA 1IWGA 1RAGB 2RAQA 2MQOA 2KO1A 1JXVA 1UA1A 4YB1P 1M5HA 2VKZG 1VQ9S 2XS5A 4RUAA 5A0YA 3PKMA 5F8NA 3OV7A 1HI0P 1VDHA 4KBIA 5L1KA 1FNOA 2JZ5A 1WF0A 3G2XA 3ZTSA 5CYMB 4IOBA 5A0YB 3PRBA 4KR0B 3CCWA 5E3AA 1NK8A 2HHHJ 1RCXB 1N32F 5K8MA 3TUJC 2BRKA 1S6OA 1XR5A 1D1UA 3WC2A 1PC5A 3MUTP 2JEGA 4C8MA 1UW4A 2DEJA 4JI7F 2IC3A 4D3GA 4KGZB 3NOCA 4PCQA 4JI8J 2ZH8A 2BV3A 2NXNA 1FA0A 1SI9A 1YTYA 3RGIA 1UVNA 4QU6A 4ECQA 4FS1A 2IC3B 5AE1A 4JI6J 1I51B 1C1BA 4KIAA 2B6AA 4M5NA 3TYTA 2J9DA 2VQFJ 1FKAF 4I6AA 2QE5A 3AT1B 2MQQA 3PYEA 2RE1A 4PYDA 4TY8B 2B6AB 2FZCB 3TAPA 2LQ8A 3M6XA 3KNAA 1SV5B 1PSDA 1NSAA 4ELVA 3M6WA 1YITS 1VHIA 3GJQB 4J91A 1N8RT 2IMOA 4USUA 5E33A 1RTIA 2C3YA 2IA0A 1TUWA 4FF1A 3JTPA 3V6DA 2CQ1A 1JJCB 1VK8A 2M2BA 2JOQA 3QLHA 1WC4A 4ANEA 1H38A 1WC1A 1H7XA 3P45B 3LW5C 2RQMA 4A8KA 3V6DB 5C24A 3NGUA 4PQUA 2XCAA 4KGXB 2MKKA 3QLHB 2BJ7A 3OTBA 4DSLA 3W64A 2V50A 3W61A 2EW9A 2AZ3A 3DYAB 3H59A 3L95X 1EHWA 2KB2A 1GTHA 3DU5A 5ETSA 2BQRA 2DYAA 1S97A 5FJ4A 4RZRA 2VBYA 2UXCF 1S7IA 3EZOA 1UPPA 3Q24A 5BYSA 3I96A 5HVHA 2Y1LB 1YVFA 5AXLA 2OEMA 3HPOA 1IKYA 1U6ZA 3LGMA 2P6TA 3OSPA 3CDAA 3CB4A 1JB0C 2IDEA 4ZP8A 1WOPA 3AXMA 4DL3A 1S1UA 1IKYB 3GTYX 1FT8A 2I9SA 1U0HA 5IZHA 2V34A 1IVZA 1NJXA 4QZVB 4Q45A 3IR7B 1RWNB 2CQ3A 2VOOA 3MUVP 2XEXA 3DMJB 1WJ9A 3GIMA 2KN4A 5GAHU 2G9OA 2IVYA 4MIBA 4B9SA 4JI0J 4ETXA 2HHSA 5F9NA 4IKAA 2KRBA 2I8EA 4JI5F 2LXIA 4RWXA 2V4JB 2XMMA 4B9UA 4N5SA 4A46A 2QLBB 3Q8PB 1RAAB 4DR1F 3QGPA 1LK7A 1SPBP 2AGOA 1O5JA 5KFLA 1UEUA 4WPAA 3TZWA 2YKQA 2HURA 2J6UA 2VFRA 3SQGA 3CMAS 2DY1A 4DV1F 2RDJA 4IOAQ 2BKOA 2MJUA 4RW9A 1KVJA 1RHMB 3R27A 2I0XA 1TFWA 4X4VA 4ZP9A 2R3VA 4LBPA 1D9DA 3PIPQ 4RW9B 2W9BA 2CAJA 4NCAA 2XLKA 3T1HJ 3FDSA 2C2RA 1MU2B 1CS4A 1HQEA 2HWTA 1TKZA 4ZPCA 3OFGA 4H4OA 2W9BB 3CWJA 4PKDB 3ZXWA 2UXBJ 4Q0BB 3PRDA 4OI1A 5HMWA 1U1PA 4G1QA 2AKWB 2XY6A 2B8PA 3CIZA 4AT1B 4ZMMA 2DXDA 4XIUA 5KOXA 2RIJA 4LSNA 4DR7F 3J7Z5 4YB5A 2JEIA 1JX4A 4CT8A 2O01C 1IQTA 3GV8B 1KQKA 2W24A 2MLXA 1C4CA 3H42A 3ETMA 1CPZA 3AY0A 1DARA 4ZVPB 4RW6B 4LSNB 3MM7A 2FB0A 5CXTA 1APSA 2EK1A 3N0VA 3AQOA 4F3QA 1S6PA 4NLWA 2NQPA 4ES2A 1PIEA 2H51B 4BHQA 3CJ4A 1NK4A 2WW8A 4QIGA 3FZBA 1NH7A 2DCUB 5IWAF 4OQJA 3M2VA 5DQHA 3HCXA 4QWBA 1RT5A 4Y00A 3GILA 5DLGA 3ZC4A 1YZ6A 2V9WA 3M2VB 1Y9OA 1ZAXA 4LREA 1Q0NA 4L73A 5CCLA 1GMUA 5HLFA 3AJDA 5HI7A 2GFFA 2B5JA 4BBYA 2C3UA 4J90A 4DLGA 3UE2A 1S10A 5KFAA 1F5BA 1MLAA 2WAQD 4CTAA 3GYGA 1R8CA 5AE2A 2QFJA 4E98A 1JLCB 1YBAA 4ZPDA 2J7WA 3CCQS 2EVZA 4ED5A 1YKWA 1T03B 3NWRA 2MTLA 5F9LA 2JC1A 2FZGB 5A8WB 4Y2CA 4LIRA 4O3SA 1PJ5A 5HN0A 2BJEA 2VPWB 1SL0A 1R0AB 3KKFA 3ZZRA 1BC6A 1B7FA 2F7VA 4UY85 2J0XA 4DR5F 1S0VA 3BSAA 2BOPA 1BQNB 3TX0A 4DX7A 2RUGA 3A8JA 3GV7B 2KM8C 4LSLB 2RNEA 2LEBA 4H4KC 1UVLA 1RTJB 3AODA 1TVRB 3HSDA 4K4UA 3LQVA 1M0SA 1F9HA 2UV8G 3MGJA 4J9QA 2E9TA 2AYBA 3PVXA 2KU7A 1AZSA 3IWLA 2W8KA 2WHOA 1GTEA 1S4EA 4X4PA 4ZHRB 3KHRA 1U48A 1NPRA 1AZSB 2FGOA 2D9OA 4W92B 4I7FA 3TRGA 1KQFB 1N36F 2FHJA 5D3GA 3HXMA 4N41A 4U96A 4IYQA 1SVDA 3THVA 3C15B 2NSCA 1YSJA 3AJ2A 2W2MP 1ZOTA 3ET6A 1EIYB 2LDIA 3ZZYA 1ACMB 3D68A 3CNQP 2G0IA 4IR1A 2HHTA 2CPJA 3D4JA 3ZNJ1 5KFBA 2UUAF 1U1MA 1I6JA 4A8FA 4MH8A 4O3RA 4Y2MA 2FLPA 4O0IA 4DPOA 4ED2A 3TARA 4B17A 4PWDB 1AA1B 2WVFA 2FJDB 4CP5A 5CYQB 3LP0A 4C8YA 2GVDA 1QD1A 3RBDA 1HD1A 1PG5B 2FJBB 2X3GA 1N34F 2E9RX 4OHYA 3M8YA 5C25A 3V6JA 1D8ZA 1UCNA 4CYUA 1HKAA 2E7XA 2C28A 1M90T 2MB0B 1U24A 4CYUB 4JI3F 1HR0F 2FVRA 2DNGA 1X9SA 3MM6B 1T11A 5KFEA 2JLEA 1YWXA 2H9ZA 3M8WA 1U8WA 3IRXB 2RDDA 4YY3J 1HNVB 2IVFB 3UFCX 4ED3A 2GA7A 2EKNA 5CD4H 2AJ1A 4F26A 2HFVA 1O6XA 3NBPB 4F02A 4MKBA 4A47A 2M0GB 2ROEA 3TEGA 3PO4A 1CQNA 3W7BA 3W60A 2W2NP 5LSRA 3J81U 2QLXA 1SUQA 3F44A 1WUUA 3PR4A 2BQUA 2EFOA 1MSWD 2AJ4A 3C6UA 1U0SA 2BX6A 4J9VA 1VI7A 5KFJA 2VDIA 1YZ7A 3OUYA 4U7CA 5C2GA 3TX8A 4NXNJ 3KLEB 1F1BB 1HW8A 4ELTA 4IQXA 4JI4J 4LRDA 3OVAA 4ZP6A 2CZVC 2HNDA 4G65A 3DRSB 4B3MF 1XEZA 4NASA 2HW3A 4DV6J 2HNZA 2CJYB 2X3DA 1W2BR 4ZLJA 2IA6A 2IYIA 4DSEA 4ZK7M 3O2IA 3EGWB 4QIEA 4LF8F 2M4MA 1QTMA 3MAAB 2ZWPA 3GP9A 2YH0A 3FQKA 3GIJA 1YHQS 3DC2A 1NK7A 2VA3A 3W2VA 1DTQA 2QL9B 2IM2A 3FGVA 3THTA 4GC6A 4KYZA 4YR3A 4TNOA 4ID8A 3HP6A 4JV5F 3KG1A 3IWNC 2R2UA 3HSGA 1UFKA 1GFWB 3TA0A 3DM2B 2B0GA 1FWKA 4MTPA 4KHPJ 2HRUA 3PW5A 2OLWA 4B3TF 2HAFA 3TAMB 3AOBA 1ZPVA 2W4PA 3G6ES 2NXEA 3AA8A 1K1QA 5KTQA 2B56A 1HWUA 4K4XA 1S57A 2IDLA 9ATCB 3D2WA 5AXNA 2HYIB 4HI1A 5LJ5Y 4E0DA 1HNWJ 3MPYA 4EYIB 3BBBA 4ZLLA 1O8BA 4C2MA 3KLVA 3KLHB 2GGPA 4X65J 5K9FA 5D0RA 4HR2A 2F4VJ 2XSJA 2QC3A 4O23A 3UDCA 2CQ0A 1HYSB 1WG1A 2WK4A 4TYBA 5GAHI 1OY9A 3T5HA 2RHSB 1YGYA 1UTAA 4CO0A 5JJBA 2V6AA 3RU0A 3JSBA 2CPZA 3KJVA 1C0TA 3TANA 1N4LA 1U02A 4UF4A 1N5TA 1TK0A 3BGFA 3DOKA 4RW4A 1N48A 3TVZA 4H4KA 5LSOA 3MEKA 2E5JA 5E41A 4PPDA 2B7CB 3A1YG 4JYAF 1C0TB 4ED4A 3GQCA 2KM8B 2HMIB 5T7LB 2Y9HA 4JI2F 3MFHA 2IM0A 2IYGA 1KSPA 3R5JB 4NPOA 2WRMA 4P72A 1VFJA 2RRNA 4WTYA 3BS9A 4DEZA 2KFZA 4B3RF 3ISND 1NO8A 5U47A 2Z0GA 3PYDA 4DR4J 3Q83A 3I82A 3FNNA 3UCZP 2C2OB 2PFFB 3IM9A 4NRTA 4HL9A 3UCGA 2ALZA 1LWXA 3I0RA 1RTHA 1VQ8S 2MZ1A 3KLFA 4K50A 2QIFA 3M1VB 2RJZA 3NAIA 5E3PA 1N0UA 1P8GA 4DL0C 2A2CA 1RTHB 3JYTB 5KFTA 2V8HA 2MDAA 3QT5A 4PUOB 4CLZA 2KI2A 1S1XA 3BO3A 1RWWB 3MWBA 5D77A 3WX4A 4U6PA 2GHVC 2A18A 1C0UB 2ATCB 3NCQA 2JDJA 1HMVB 1RTZA 2HRYA 4IUFA 5CZXA 3EDQB 2HWHA 3LAMA 4AL7A 3D0GE 3OL9A 4ER8A 1ZYQA 3MECB 3FFIA 2CFXA 2HEKA 1X5PA 3ONQA 4ED0A 5DM6Q 3I4PA 2YNFA 2CADA 5KFDA 1CJUA 4OJ3A 5IC6B 3CMQA 2YWHA 2BJDA 2HGNA 2YNFB 5KT6A 2ZH2A 3T5JA 1UWBA 2XWXA 1RP5A 1CJUB 4KQZA 2RQCA 1ICEB 1S5ZA 4DMZA 1RXOB 3GONA 5IFMA 4I2QA 4JP8A 4IQMA 3N4WA 4URQU 2ILZA 1JLAB 4X4SA 3ZZUA 3G82B 4EMDA 3CTRA 3UNYA 3PY8A 4B3SJ 1LWCA 2GS8A 2H5IB 3OJSA 3H0PA 1TMMA 1VRQC 2A10A 4LRCA 4RL1A 2DIVA 1W7WA 2M5YA 3CJ0A 1H2VZ 1SQEA 1L3TA 4WJBA 1YJUA 2OTJS 4LF5J 2XO7A 1VQYA 1S0NA 4LFBF 2MZJA 2C2EA 1HA1A 1Q5YA 3IC1A 2PEHA 1SH0A 4ECSA 3GJRB 2BW2A 4RU2A 3CCLS 2DGWA 2C2ZB 2OPPB 3KOAA 3DLEB 4DL4A 1KOHA 2YY3A 4J9RA 4C0BA 1HNIB 3PZPA 2IFXA 4GVBA 5KT5A 2CQIA 4ZLNA 5K14A 2OH2A 3NMAA 2WOMB 1Q78A 1S0MA 2UU9F 2WVCA 5GMKa 2AV5A 5AXMA 4QR2A 1KEKA 2WSCC 2D74B 1UEKA 4PYAA 3PRVA 4MYUA 2LEPA 3VGTA 2F8MA 1NJWA 1F2HA 4OIXA 4F2RA 1Q16B 1QE1A 3P6YC 2QYCA 3BPDA 3QT7A 2CG8A 2ZM6F 3OT9A 1UA0A 1PJ6A 2AF6A 1RZMA 3BH6B 1QE1B 5LMNF 5C5JA 3SV4A 2R7VA 1RT7A 2PI5A 4L75A 5IQQA 2R7RA 3FBCA 1Z1ZA 2Z8QA 2KJWA 4X66J 3AH6A 3PKYA 3FEYB 2HFSA 2RHQB 4K7QA 2HFNA 3NGTA 1FD2A 4OZ2A 5L8RC 1A6LA 3GMGA 1RHQB 1GMWD 1D0EA 2ZNZA 2R7WA 4DWIA 2WVBA 1D8YA 2J0QD 1CC7A 2DNKA 1RHJB 3GLJA 5E0OA 3DKDA 3HK2A 4U95A 2ZJQQ 3POTA 1NRKA 1QAYA 5GAGI 1XTZA 4GKKJ 1D9AA 1IBCB 2CUYA 4ALZA 2O5DA 5FD1A 2RKIB 4UW2A 2UUWA 2D3OR 2IJFA 3TQEA 2XI3A 1TAQA 4K5SA 2BJ3A 1UPMB 3TVKA 2XULA 3UD5A 5BYQA 3DOLA 4QPXA 1IWAA 3L4BC 1HIYA 4V19X 1UMJA 2C3MA 1DBDA 4FVCA 2HHXA 2JLGA 4W98A 4F3MA 5T14A 1J5EF 2GAHC 2R7OA 3CW2C 2X1AA 4NLGA 2KXHA 5HMZA 2ZH9A 1IBMF 3K58A 1HFEL 1FJGF 5LM7E 4DFMA 3C14A 3S8SA 4M5KA 4LFAJ 3KK2A 2ZBRA 3BGLA 1JIHA 4P2MA 4USWA 4NLPA 2HVEA 3C14B 1TL3A 4RJVA 4NLVA
chains in the Genus database with same CATH topology
4Y0FA 3ZZOA 1HNZF 2AYEA 2RVJA 3VTIA 1MROA 5GVQA 2UXDF 2CPDA 1FNXH 3H5SA 3FJ2A 2PIIA 1VIXA 2OSRA 4J9OA 1BY9A 1JMTA 4OZ0A 4X4TA 2DGVA 2GGPB 2KTQA 4C98A 3LO3A 2EG2A 4MK9A 1VQSA 2XSJB 3D1HA 3E01B 3K2YA 2ZD1A 1VJWA 1X9WA 2SXLA 2Y0SD 3JAMY 4CCHA 3NL0A 2J76E 3A8EA 5DG9A 5LL6d 4X66F 3BN7A 1XMOF 4K4YA 1HBNA 1TKXA 2YNIA 2JVRA 3SMZA 3AB4B 4LUBA 1WG5A 2ZZMA 1FDDA 2DJWA 3AAWB 2FJEB 2NS1B 4Y28C 5IT0A 4ZPVR 4URGA 2VG7B 4NLRA 2AYGA 3T6JA 3WC0A 2ZD1B 4DQRA 3X1LB 2BUNA 1UVJA 1DURA 5BJRA 2CQ4A 4MJKA 3U02A 1M5PC 1K0TA 4YDDB 4ZVFA 1HBNB 4QOTA 2YNIB 1JLGA 5K8PA 4RNMA 4CH7A 1ELOA 1V3ZA 1NJYA 1S6QA 2R8GA 3PX4A 1JLCA 2ASYA 4TKTA 5HO4A 4N77A 3KJVB 2CQGA 3CD6S 1S9EA 2JFDA 5LJ3Y 2Z2LA 4Q2LA 2CZ4A 3V4MA 2N4CA 3BF4A 2LA6A 2CPEA 3HHLB 3K5MA 1X9MA 3DOKB 4RW4B 5I3QA 2R2TA 4I1TA 4OV1A 3T1AA 3RR8A 5E3QA 5AE3A 1U1KA 4OI6A 2MKIA 2NPIA 4CH1A 3UD3P 3MEGA 2WTFA 1T03A 4HT5A 4YDXA 2K7JA 1S6QB 4RX6A 5LMUF 1RKJA 1CG2A 1KTVA 3BGRA 1S48A 4DSFA 5KFGA 1HPZA 2GNKA 1SKWA 4NL5A 4U9RA 4X2BA 3CD5A 2ZE2B 1G7CB 5A8WA 2KG0A 3RAMA 3Q23A 1NH8A 2VG6B 1T94A 3IN5A 5G0RB 4NXMF 2DNRA 2UVVA 3HHDA 4KFBA 1W2IA 5IS2A 2L41A 1P1TA 1CVJA 2M9KA 4QJVA 5B08A 2R8IA 3M05A 2CDQA 2IHR1 3DHXA 4NRUA 4OHWA 4QQBA 2LLZA 2KHCA 4M63A 3BGRB 1R0AA 4KHPF 5A6PA 2OPSB 1KOOA 5CZVA 3M9OB 4BC7A 3MZIA 1XR6A 4CT9A 1FK9B 3DOMA 5EGYA 1TUVA 2R7UA 2GMJA 1U6BA 2FLOA 2M70A 1RT6A 3THPA 2R8HA 5J1EA 4I56A 1V3SA 3ETOA 1UP1A 2FHOB 2W4DA 2CJKA 3SFGA 2PO4A 5SUHA 1FXRA 3IRWP 1KR4A 3MI7X 6FD1A 3CC2S 2Q66A 2P9CA 2VFSA 1F2GA 3OR1A 4ZVHA 1BLUA 3C6TB 2V8VA 2W7OA 2FC9A 4DV2F 2VG5B 2FTRA 1BQNA 2X1FA 1ZAVA 1RT6B 3U27A 3H5YA 1CEZA 3D1OA 2JL9A 1HBMB 2I2YA 1DJ0A 4WFXA 4ILRA 4DL7A 4QCLA 4ZLPA 2HWIA 1GX5A 5G4DA 4LSLA 1V6HA 2UZAA 1XBWA 1RTJA 1IJFB 2MQOA 2G1DA 2KO1A 3E51A 1UA1A 1TVRA 2F9JA 4YB1P 3I87A 3PR5B 1M5HA 3I0RB 2VKZG 1VQ9S 3DCAA 2XS5A 4CO5A 1AUDA 3KLFB 3KMQA 3BREA 4RUAA 5DGAA 4DG1A 4DR6F 3V4IA 3M30A 1JLQA 5A0YA 1N54B 1HNWF 1TL1A 3OTCA 3PKMA 3MD3A 1FD8A 5F8NA 3OV7A 1HI0P 3VR1A 1HWLA 2F40A 1NAQA 3ITHB 5HBMA 2ZBCA 4KBIA 2JJ4D 5L1KA 2J0SD 1FNOA 3OHAA 2VODA 2JZ5A 3O1LA 1WF0A 4X65F 4DG1B 5CYMB 3RZAA 3M9MB 3M30B 3L7PA 4ZHRA 4IOBA 3GIIA 5A0YB 3V4IB 2F4VF 3HI9A 2VFTA 3PRBA 4KR0B 2XNQA 4ZVEA 4ATNA 2A2DA 3Q2TC 1ZM9A 3T3FA 3CCWA 1U1NA 5K8OA 2X1BA 4F4ZA 5E3AA 1NK8A 1VK3A 3UDLA 1S1XB 3B78A 3ISZA 1FVQA 2FHMA 4LFCF 2EFQA 1B0VA 5F0WA 5DQIA 1N32F 1S4FA 5K8MA 3TUJC 2BRKA 1XK8A 1S6OA 4NOHA 3VZHA 3RTVA 1XR5A 2YVSA 1JJHA 3MM9B 1D1UA 3WC2A 1PC5A 1S7HA 3MUTP 4ZPTR 1N5YA 2ZH1A 2JEGA 4C8MA 2MYFA 3RB0A 1YRTA 4OZ1A 3J80Y 2EPIA 1JKHB 1VRTB 3U1MA 1JWWA 2V8GA 1UW4A 5A8RA 3CCUS 3LH2S 1NKCA 5B0EA 4WKYA 2KT2A 4JI7F 2IC3A 4D3GA 3UW1A 4PCQA 1HWJA 3HFKA 1Q8BA 4QR1A 2ZH8A 4ETZA 2UVRA 3GFYA 4TU8A 4WIIA 2BV3A 1FA0A 1N5YB 1VQ7S 1SI9A 3N9UC 3CCSS 2NYIA 2KRRA 2E66A 4ZDNA 1YTYA 3BSOA 2NZ4A 1UVNA 4QU6A 4ECQA 1UJ5A 2ZKUA 2ZH7A 3OFHA 4FS1A 2QA4S 4YR0A 2N4DA 3FFIB 1SIZA 2IC3B 3BR9A 3CCVS 2VBXA 1MWZA 3CSKA 1T95A 3LOUA 5AE1A 4X4NA 2I5JB 2GQCA 1HBOA 1C1BA 4HVZA 3RRKA 4KIAA 2B6AA 3DRXA 4CO1A 3TYTA 4WFBQ 3OVSA 2J9DA 2VPYB 5E7OB 1OSDA 4RUCA 3CUNA 1TL5A 3H98A 1GXUA 5FDLA 1FKAF 3FRYA 2LQ5A 4I6AA 2UVUA 1XN9A 4PG4A 4PWDA 2QE5A 1S9GB 2DNQA 3H8YA 1FRLA 4OJ1A 3R5BA 1OSCA 3GYXB 2MQQA 3SSRA 3EPGA 2RE1A 4I2PA 3NNCA 2F3JA 1YRUA 4OI0A 3TUZC 5CYQA 4TY8B 4WCEQ 1HBOB 4UUWA 2GIRA 1RGVA 4ID5A 2B6AB 3TAPA 2XMJA 4FNIA 1C1CB 3M6XA 4HYKA 3KNAA 1SV5B 2Q6CA 1PSDA 3J7YU 1D9FA 3I5BA 3SCKE 1UWBB 4ELVA 1MW7A 3DXSX 1VQNS 2Q3PA 3M6WA 4I2PB 1YJWS 5KG3A 1YITS 2IRXA 3MMJA 2HGMA 1N8RT 2IMOA 4I68A 2AWZA 5E33A 1RTIA 3QWUA 4I2QB 2K3KA 3OTDA 4NZ6A 4ID5B 2JEFA 1L3VA 2C3YA 2IA0A 5FLXY 2NLWA 1VC0A 1T3NA 2XS7A 4FF1A 1BQMA 4DR4F 3JTPA 4WZMA 4WE1A 2JX2A 2O3DA 4Y3CA 2RSQA 3DLKA 4WYLA 3V6DA 2VC0A 2CQ1A 1ZPWX 4V19J 1DQ8A 1VK8A 2AJQA 2PI4A 2M2BA 1S1WB 1RT4A 2JOQA 2XI2A 4H4MA 3QLHA 1IR0A 1VC6A 4C3LA 3P96A 2FY1A 4NX9A 5KFFA 3RB6A 1A7GE 1H38A 1TL4A 1LWCB 2QZ8A 1BQMB 4H54A 1H7XA 2ASDA 2Z4PA 3LW5C 5C42B 1SB6A 2RQMA 3DLKB 3HLUA 4A8KA 3V6DB 5C24A 5B0FA 3NKYA 3IGVA 2LXFA 4PQUA 4UQTA 5GAGU 2A1BA 4C0HA 2XCAA 5DLFA 3KK1A 2MKKA 3QLHB 1KFDA 5LXRA 3OTBA 4DSLA 1FO1A 2ZFHA 1RTDB 2EW9A 1FEHA 3MD1A 2CJBA 3CT9A 2DGUA 3DYAB 3H59A 3OTEA 2ZH4A 1T05B 1RA6A 3WDOA 3L95X 4BCAA 2MSTA 3WBZA 4BDPA 4FS2A 4NA3A 5H9FJ 5LSLA 5J2QA 2KB2A 3RRHA 3EX7B 1GTHA 3DU5A 4HT7A 3KK1B 2BQRA 3OBIA 4C8ZA 3M2UB 4LMZA 4CNZA 3V81A 1KNZA 1S97A 3MM6A 5FJ4A 4RZRA 5CA5A 1VQPS 1U47A 2MQMA 2FC8A 2VBYA 2UXCF 3DLJA 2XG8A 2DK2A 3I5CA 3MURP 2E5HA 5ITHA 1QSYA 4OHVA 5D4LA 1LW2A 1QVFR 3Q24A 1FTCA 3MR2A 1SJ1A 2XSFA 5BYSA 3P3DA 1NB7A 3I96A 5GADU 3GFZA 2EFVA 4R5PA 1JNRB 1DZ5A 2YWKA 3OXFA 5DDOC 4IRDA 2EG1A 2XY7A 3CC4S 1YVFA 3M8QA 4OX8A 5AXLA 3IRXA 5I42A 3HPOA 1IKYA 3K5NA 2XBPA 1DAXA 3DFEA 1U6ZA 3MAQA 3SYZA 2D3UA 2P6TA 3LGMA 3OSPA 1KTQA 3CDAA 1HNVA 1GX6A 5IXUA 4PXCA 3CB4A 1JB0C 1UFWA 3B8HA 3NGKA 1DFDA 2VA2A 4ZP8A 4R5PB 4IH7A 4DL3A 5K5MA 2DNOA 1S1UA 2DD8S 2LYVA 2M52A 3PEHA 2VUGA 4RKUC 3NBPA 2K2PA 5F3ZA 1VQ6S 4Y2IA 1T8EA 2DR7A 1IKYB 3FCHA 2QMXA 2MY8A 4RW7B 1IJEB 5L9NA 2LDYA 5M2PA 2FHJD 3W3SA 5K14B 3CC7S 4FF3A 1FT8A 1Y5LB 3NS6A 2HIQA 3FMBA 3I55S 2I9SA 1N33F 4NYZA 3QZ8A 5IZHA 3GR1A 2HVZA 2L9DA 1FDNA 2IM1A 5HQ8A 1TV6A 2BM1A 1IXKA 4OI3A 4RBVA 1K73T 3L3CA 1NJXA 4QZVB 4Q45A 1ROFA 3CCMS 2DITA 3IR7B 4RW8A 2ASJA 4M1KA 4I6YA 2MKJA 2GO8A 4OJHA 3GZ7A 2CQ3A 2VOOA 4AFFA 1CC8A 3OPKA 1H7WA 2DH7A 3MUVP 2XEXA 2Y1JA 1TV6B 2VQFF 5DM7Q 3DMJB 4NLOA 4ZPAA 2LVWA 3DGPA 3I6PA 3GIMA 2KN4A 3OFFA 5GAHU 2KDOA 3KLEA 5J2MA 3GFXA 2G9OA 5KG6A 2M3DA 2OAUA 1WI6A 2IVYA 3BJYA 3VALA 2NUUG 1NZAA 4MIBA 4B9SA 1KS2A 3FRZA 1PC4A 4ETXA 1EP4B 2HHSA 5F9NA 2AQ4A 3I31A 4IKAA 2KRBA 1R3NA 4IH5A 2UV8A 5EWFA 2I8EA 4DFJA 5DGBA 1XNRF 4JI5F 3CJKA 2F1FA 3HF5A 2LXIA 3MMBB 2YNGA 1JLBA 1GQEA 1HBUB 4DSKA 5HP1A 2HFOA 3C3LA 4RWXA 3DRSA 3W2WA 2V4JB 3GSDA 1S1TA 2XMMA 4B9UA 2FJAB 4IOCQ 4N5SA 4A46A 2B4UA 3VAKA 4B3SF 2E1MC 2LU2A 2OPRA 3IAM9 2NR0A 3HKZD 3HZGA 3GV5B 1FKPA 1RT7B 2E29A 2BVZA 3Q8PB 5J1NA 4KKOA 2B9WA 4Y2AA 4RNOA 4DR1F 2ZUGA 3QGPA 3VZIA 1ZM4A 3E2EA 2LQJA 1LK7A 2AGOA 4LF9F 1O5JA 5KFLA 1S1TB 1UEUA 3H40A 1LFPA 3S1TA 2YKQA 1Q8IA 2HFZA 2J6UA 1WELA 4ECTA 2VFRA 4CH0S 1RYRA 3Q22A 1N6QB 3SQGA 3OL6A 2E1CA 2L3MA 4XDDA 4FYDA 1Z4UA 1T02A 2ZITA 4EUVA 1KN6A 4LVNP 4X4OA 3CMAS 1MNEA 1SC6A 3MMCA 5D78A 4JUZA 3ULHA 1KQSR 3D1QA 4KKOB 4WK1A 1YJTA 2L48A 1IUJA 2HG4A 1NHUA 2AW0A 4DUZF 4DV1F 1N5SA 2RDJA 6FDRA 4ZOSA 1KFSA 1GT8A 4DQIA 4CI0B 4M94A 4IOAQ 1HQUA 1FE0A 4F25A 3MUMP 2MJUA 1QSLA 2XLJA 4LF5F 4K4TA 4KGMA 1WI8A 5KFPA 1LV5A 4RW9A 4OLOA 3MMCB 2DPJA 4B9MA 2EFNA 1KVJA 2VPXB 2ZVSA 3R27A 3RAQA 5KG4A 3TOQA 1HWKA 1IKXA 2RU3A 1B0TA 1DHMA 3N5FA 2BE2A 2DNZA 2I0XA 5A8KB 1TFWA 1O51A 4X4VA 2LQBA 2BANA 4M8LA 4ZP9A 3LAKA 1U6FA 1N5VA 3JSMB 1D9DA 2XMKA 4RW9B 3PIPQ 3EZ5A 2KFYA 2OTLS 5L1IA 2W9BA 4A48A 4NCAA 2XLKA 3POTB 4CO2A 4ICLB 1NJIT 3QAEA 4KRWA 4AQYF 1WF1A 3FDSA 2C2RA 2ZBIA 5LXYA 1CLFA 1MU2B 1KRPA 1HQEA 1HI1A 5DG8A 2DR8A 2BANB 3QWPA 4DSIA 2HWTA 3VCDA 3DM2A 1JXEA 1TKZA 4MYTA 1Y5NB 2CQCA 4ZPCA 3OFGA 1MMLA 2KHDA 4H4OA 4IDKA 2W9BB 1TQLA 3GG0A 1KLNA 2MGZA 2FVSA 3CWJA 2DH9A 4PKDB 4PWUA 2MQNA 5B0AA 4AL6A 1XMBA 2FVQA 3DI6B 3MEEA 3C66A 4USIA 4Q0BB 3PRDA 3N5BA 4OI1A 2IBKA 5HMWA 3TAMA 1RT1A 1DTTA 1HL6A 3DLGA 2AGPA 1U1PA 3LP1A 3MOJB 2DGOA 4G1QA 5F8MA 4IDKB 2ZC3A 1PO6A 2MGZB 2ABYA 4NMLA 3SXLA 2XY6A 1ZETA 3MEEB 1S72S 3PXGa 3CIZA 3DOLB 2OFGX 4L6V3 1ZH5A 1ZTWA 3MM8A 5KFRA 4ZVGA 4ZMMA 2DTJA 4RNHA 4R8UB 2QV6A 3PIOQ 4XIUA 1P1LA 2QA1A 3PJXA 3ZZZA 5KOXA 2RIJA 5D6GA 4ZCKA 4LSNA 4DR7F 3J7Z5 1SL2A 4YB5A 1IKVA 4HI2A 4DS5A 1JX4A 2JEIA 2PMZD 4CT8A 2O01C 2W7PA 3T1YF 1IQTA 3GV8B 1URNA 1KQKA 1RA7A 1VRUA 2IVMA 2W24A 4DF8A 4A8OA 1C4CA 1LKZA 1PGZA 5I4MA 2J8AA 3M8SA 1CPZA 3AY0A 4RUHA 3ENVA 2DHXA 5M2RA 2FVCA 5KFKA 1DARA 4WFZA 3RR7A 2L9NA 4RW6B 4LSNB 3S7RA 2Z2MA 5L38A 3T9NA 1IKVB 3MM7A 2AX1A 2FB0A 4LQ9A 4FF4A 5K8NA 5CXTA 2UVWA 2EK1A 1APSA 3N0VA 4KTQA 1WWHA 1NEEA 3AQOA 5J1PA 1MMNA 1VRUB 1S1VB 4X84A 3JTOA 1HWIA 3D5MA 4F3QA 2PD1A 1S6PA 2POKA 4NLWA 1NK5A 4B3OB 2NQPA 4ES2A 4TU9A 2B9YA 5BYRA 4TQSA 3I4HX 4BHQA 3CJ4A 3KLHA 1RKIA 4JV1A 3D0HE 5F41A 3KK2B