2RQMA

Nmr solution structure of mesoderm development (mesd) - open conformation
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
141
structure length
141
Chain Sequence
GDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPIDFSKLDPGKPESILKMTKKGKTLMMFVTVSGNPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVSQDRCAEVTLEGQMYPGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of MESD45-184 Brings Light into the Mechanism of LDLR Family Folding
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
molecule keywords Mesoderm development candidate 2
total genus 31
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rqmA02
5IT4A 3DHXA 4LUBA 1SC6A 3CEDA 2QRRA 2JOQA 3MAHA 1LK5A 3OFEA 2F1FA 3DHWC 3IBWA 2KO1A 3OFHA 4X84A 3MTJA 3OBIA 1XTZA 2H9ZA 3LOUA 2CDQA 4NMLA 2RQKA 2JHEA 5IT0A 2FGCA 1O8BA 3TUZC 3MWBA 3DC2A 3OFGA 5FIIA 3W7BA 3K5PA 1UJ6A 2LQJA 3P96A 2P9GA 2ZHOA 1KS2A 3HHEA 3S1TA 2NYIA 1UJ5A 2RE1A 3UW1A 1ZPVA 4PWUA 4M8LA 5T41A 1RWUA 3O1LA 4GO7X 5JJBA 1YGYA 3ENVA 3DDNA 3AB2B 3NRBA 3IXQA 2QMXA 1YBAA 3U7JA 1U8SA 3N0VA 1UJ4A 3OFFA 2QSWA 4GO5X 3ENWA 1LKZA 3AB4B 2I9SA 3ENQA 2DT9A 5IS2A 2J0XA 1LK7A 3L7OA 2LVWA 2DTJA 4GMKA 3TUJC 1PSDA 2PC6A 1M0SA 2RQMA 4IO1A 3AAWB 2F8MA 2J0WA 1Y7PA 2QMWA 3TUIC 3KWMA 3LUYA 2PA3A 2P9CA 2MDAA 2P9EA
chains in the Genus database with same CATH superfamily
5IT4A 5J1EB 3QJPA 3C14B 1Y9OA 3IGNA 3DDIA 2WVBA 3VCDA 1UETA 1U1RA 3Q89A 2LEAA 2JOQA 1X4GA 3T1HJ 4J37A 2YNFB 2IHR1 4KO0B 2HMIA 5DDQC 1VQ6S 1IKVB 5E0OA 1JLQA 2MSSA 4RLEA 3G6YA 2D3O1 2J6TA 1LEOA 4PXCA 4MIAA 2ATCB 1T3OA 4J90A 3ET6B 1I5OB 3I9ZA 2YKNB 1FRXA 2CADA 2R8KA 2X7IA 1SPBP 2DXDA 3BGUA 4ZLPA 1PGZA 1HHTP 4WJBA 2CG8A 6FD1A 2C1EB 4BHQA 4LR9A 2BRLA 1RTZA 1K8AT 5F8GA 3UD5A 3F73A 3I9V9 3GFHA 2MQNA 4AQYJ 1NPRA 4HTJA 3M8PA 3PXGa 1QAXA 2RQKA 2MZRA 2PSZA 2W7OA 1H2UX 2DD8S 3NG8A 4EWTA 4ZCKA 4I67A 2J9CA 2GGPB 1EP4A 3E01A 2MMYA 2M88A 4BWJA 3NGSA 5GMEA 2NLWA 4P2MA 4J91A 5C25B 3GCXP 1PAEX 3C15B 4IOCQ 2YX4A 2ZH3A 1HQUA 3ZZYA 2W2NP 5D6GA 1B4SA 1DJ0A 1NK5A 4K8RA 4EUVA 1SQFA 3UR3C 3L7PA 4QOTA 1RHRB 5A6PA 4CDIA 1NHVA 3CIMA 2CQDA 2YH0A 3QGIA 3ZXWA 2RHSB 2HHHF 2Q3PA 3PM9A 4JP8A 1SVDA 4W92B 1KN6A 4DX5A 1VQSA 1XMOJ 1H2TZ 4LSZB 4IRKA 1KOOA 2C3OA 1VLOA 2HFNA 2YY3A 3DLHA 3VAMA 2HVHA 4X4UA 1OS5A 3EICA 2CJQA 3DOLA 3EVWA 2IY5B 3WIUA 1RT1B 2QV6A 2XQCA 1I3OB 1ZM3A 3D54A 1KBRA 4DJBA 4F0KA 1IBMF 2J0QD 3JSYA 4DQPA 1IBMJ 5BYRA 5KOWA 4KKOA 4HLBA 1HARA 2YPYA 3G6VA 1CS4A 4CLSA 1FJEB 2LDIA 3C6UA 1NH7A 1WI6A 4B3MF 3KLEA 2ILYA 1RE1B 4FYVB 2QMXA 2QFJA 1UPMB 4W4MA 2G0CA 2D9OA 2GW8A 1O5JA 3CJ2A 2EKYA 3MF5A 5E5NA 1HR0J 1N32J 2ILZA 2E9TA 4K4UA 4YB6A 3JYTA 1KD1T 1B0VA 2BE2B 4NI2A 4RBTA 1OSDA 3I5CA 3R5AA 4USIA 1AZSA 1X5PA 2GQCA 3K59A 2DY1A 3DI6B 5FLXY 4NLTA 3D0HE 3OTBA 4LFAJ 2AYGA 2DNGA 1FNMA 3R97A 4M5DA 4H4KA 2D7SA 1ZOTA 3G82B 3IMQJ 3C46A 3BSNA 2XMMA 3JAMY 3MD3A 3UNGC 2R7TA 5ETPA 2W9CB 4OJ1A 2UVUA 3FMBA 1ACMB 3BH7B 1KC8T 2W9BA 1LFPA 2FC9A 5G0RA 3SSSA 3BKFA 5LMUJ 3PJXA 2BA9A 5L1KA 4NASA 2MB0B 5A76A 2OFGX 1IKYA 2ZBIA 5HQMA 4JI1F 1Q8IA 5L1LA 2COLA 4S0MA 1KVIA 4MK7A 3ADAC 3W65A 1F60B 1YJTA 3U1MA 4QWAA 2XSJB 3IAM9 3SQGA 1HBNB 3OTOF 2DGSA 2M0GB 4NLRA 4F26A 1NU4A 1HYSB 3NXZA 3B54A 4HT5A 2F5GA 1NZAA 2HNZA 2MJUA 4OMFG 1Y7PA 4A46A 5HN0A 2IA6A 1D1UA 2VICA 4PKDB 5IWAF 2VD3A 2VOPA 3JTPA 3UE2A 1VRUB 3HHLA 2A18A 2N4DA 1U1OA 1BUXA 3TA2A 5E41A 1HNVA 3CW2C 2HHTA 2H4WB 3CCVS 1VOMA 3DHXA 3RB4A 3NCPA 1WTBA 5CCLA 2OSRA 3MM7A 2ZH7A 1NJYA 1Q4RA 2O67A 1BLUA 5F3TA 5KFSA 2RDJA 4ZVOB 3PHEA 2VFTA 1ULRA 2PD1A 2Y9HA 4DL5A 2BANA 2PEBA 1SH3A 4MAKA 2G0IA 4HYKA 3THTA 2G9OA 2LP4A 1S57A 2A2CA 4NCAA 4RWXA 4G65A 4X84A 4L76A 1JLGA 3AFGA 4XIUA 2OUGA 4IG3B 3BQ2A 5LOQA 2D3ZA 4OI2A 3QGPA 4L74A 1X9WA 2HAFA 1FEHA 2XO7A 1GTEA 3V5RA 3J7A1 4X4VA 1TKXA 1V5IB 5FD1A 2XULA 2MKJA 1N5SA 1PO6A 1G4CA 1YJVA 1VJQA 2QFIA 2CNOB 2JLFA 3DOKB 2KT5A 2R3VA 2XMAA 1VQLS 2DY9A 4JI7F 1U09A 3RBZA 1Q7LB 4QIEA 5IT0A 4YY3F 4DR7J 1R0AA 1MWYA 1S1VB 4CT8A 5KFEA 5C2GA 1RAHB 5LMUF 4USMA 1IJFB 3LANA 4LF9F 4KC5A 4NEZA 4IH7A 1UKUA 1FT8A 4FS2A 4YOEA 4USVA 4DX8H 2HQ3A 4OJ3A 4DN0A 1A9NB 1HNIB 1RTIB 2OD6A 3LP0B 2NSCA 2AMCB 4X2BA 2HGMA 2WSFC 2ROPA 3K8VA 4H54A 2AYEA 1WKLA 1YQHA 4AFFA 2P9GA 1RDRA 1HBUB 1Q8KA 3JTNA 3N6MA 4P2FA 2R2RA 2VC0A 1FJCA 4RKUC 1UAWA 1H74A 4DV4J 3VAIA 1NK6A 1HWLA 4ZS6A 3OJSA 5KOXA 2H51B 3HXMA 4IKAA 1VLYA 3D1QA 5KFXA 1ZPVA 3BQ0A 3RR8A 4PG8A 4OZ5A 5DZ6A 4KPCA 3NCRA 1WI8A 2VKZG 4M8LA 2KL8A 3W62A 2HVIA 4F0MA 2KKHA 3DOKA 5I3QA 2BEFA 2IC3B 2R8IA 2UVRA 1RSCA 1QTNB 4B3MJ 2J7WA 4DLEA 4USWA 1SJ1A 2DNOA 1JNRB 4ECVA 3UVJA 4ZVSB 3WIVA 2WOMA 3EZ5A 3MPDA 1VISA 1J27A 2OEKA 2VFUA 3H2UB 3UN3A 1RT6A 1CQMA 2VL1A 3CJ0A 1BY9A 4J9KA 1HNVB 1A0OB 2X3GA 3CO0P 4NZ0A 4YS2A 5J2QA 3CO9A 4DSFA 5KFKA 1UTAA 3MZIA 3HLUA 3LA0A 4DPWA 3I5BA 5DDOC 1MMLA 2KU7A 1SL2A 1RT2A 1F9HA 1UFKA 2V9WA 1R0CB 2I9SA 4ZLNA 3O5TB 1S5ZA 2V34A 4YUDA 3OW2R 1YRUA 2OPPA 2XLKA 2LVWA 3HVWA 5DQIA 4YR0A 3OL8A 1U6FA 3UFCX 2VZ9A 2XCPA 5LT5A 4B9TA 2CPXA 1X4FA 4C11A 5LM7E 3K2YA 5KT3A 3QLHB 4XPCA 4RNNA 3MPYA 2CVEA 4ZA1A 5KFCA 2WSCC 4M94A 2HHWA 2A10A 3KUEA 4F4KA 2DIVA 3G82A 1XR5A 1B7FA 1S1TA 1SIWB 3DLJA 3L09A 1OPIA 2F8MA 1HA1A 2J9EA 3FQLA 3HSDA 3PNIA 4PR6A 3ZNUA 4ZVFA 5HMYA 3DYAA 1I1GA 5E33A 5KFFA 1YLXA 2EFOA 1SBRA 3N6LA 1CC7A 1WUUA 2EG2A 4FYWB 4IO9Q 1H7XA 3QYYA 2KG0A 5L39A 5H9EK 1NK7A 4OYIA 3P4UB 2DNRA 5G0RB 4P2XA 1M1GA 2RMLA 5KFOA 2FJVA 5CD4A 4WWSA 5J2NB 1IWGA 1C2PA 1N88A 3BSAA 5HQLA 2FD2A 2M8HA 2DO0A 4LFCJ 2FDNA 1VR6A 2W2QP 5D4OA 4YN3B 2BJ9A 2HG4A 2YPZA 4DUTA 3V6HA 2DPJA 1WSRA 3FEZA 4YMEA 3M30B 1CBKA 3NGDA 3K57A 2VJVA 4ZCLA 4Q43A 5KG6A 1C1BA 3CWJA 4ZPAA 1XERA 5F0WA 3IBWA 2DR7A 4DI6A 5L9XA 3OXLA 4GVBB 1Y0HA 3PR4A 1GK8A 1T9XA 1FKPA 4FKXA 3NMAA 2YNGA 3KLEB 1KQSR 1WTFA 1TKZB 2MZQA 1ZTWA 3M2RB 3OPKA 3LWMA 5DS7A 2EVZA 4ES2A 2B43A 4NLYA 2RNEA 1TL1A 2R8JA 3CCSS 3GSIA 2CDQA 1RAEB 4QPXA 5J2MB 1EARA 1RT7A 4C6AA 8ATCB 2WSEC 1KEKA 2ZJPQ 3BSOA 1WOOA 4K5SA 1JK9B 2XHWA 2FHMA 2OGUA 3A3NB 1RT1A 1XJWB 1YBUA 3DCAA 3RU0A 1JJ4A 3MD1A 1DURA 3W9HA 4I7FA 1W2IA 3CIZA 4F4XA 4WXWA 1S1XA 2C28A 1RKJA 1N52B 1TELA 1K1SA 3CDWA 3PHTA 4ENOA 4ELVA 4ZVHA 4C0BA 1AT1B 3BBFA 4CO4A 5LSRA 3CNQP 3TQEA 1DBDA 2R7SA 1MWQA 1P8GA 3PACA 1YTYA 2G2ZA 2WONB 3KKFA 2U1AA 3UDVA 2VFSA 1RTDA 3JSMA 4L3KA 1NPPA 3QGHA 1QSLA 4OHYA 4ZDNA 4F36A 2UUBJ 3KK3A 4DFPA 4YDDB 4FZVA 1QLNA 2ASJA 1TR0A 3DU5A 2IA0A 4P6QA 3DOMB 3GIRA 2MPUA 4X4TA 3LP1A 2L9NA 3GYNA 1YWXA 1LXNA 3IS9A 3UDEA 3KLGB 4HACB 2MGZB 4ECQA 1A7GE 1RBAA 2A6MA 4I4BA 4Y0FA 4Y34A 2YNFA 5B0EA 5HVGA 1LWFA 1FRKA 2E9ZA 3D9BA 2CUYA 1HQEA 2GV1A 1NSQA 2VG5A 4C8LA 3T1HF 1UFWA 1ZAWA 3TQ1A 4U7UD 2BJ1A 2FY8A 5A2QY 2CPHA 1D09B 4U96A 4Y65A 3J80Y 1UEKA 4O3NA 3GIMA 2FVCA 3H5UA 2WAQD 1YBAA 3VR1A 5F8MA 1YKWA 4URGA 1UJ4A 3OFFA 3T9ZA 3EUNA 3L95X 2OJ3A 5K14A 1RQ0A 1GX5A 3MM9A 3PRVA 1WORA 5CH7B 4ZMMA 2HMIB 3BJYA 3QAEA 3DLKB 2XB2D 4P7TA 4ED2A 2AP6A 3IR7B 2DB1A 1RTHB 2DT9A 2H4YB 3TA1A 3ELHA 1NSKL 3I0RB 4OYAA 2KXHA 3VVTA 1U48A 1S97A 3ONQA 2CQ2A 2OPQA 2HKEA 4RW9B 3GV7B 4DV1J 3NS5A 3FBEA 4DV0J 1S72S 1YJWS 1KQGB 2KT3A 4FPRA 1X60A 1C0TA 1B0PA 2HQDA 1M0SA 1WF1A 3SSQA 2B4VA 3D1HA 4CH7A 4I6WA 4DV2J 3QT6A 2LU2A 2XY7A 2HBQB 4PQUB 2G13A 3Q8RB 2JH3A 1TV6B 3RGIA 4CH0S 3MECB 2F65A 4DCOB 2YWHA 1F5CA 3SSRA 1IBLJ 3EVMA 4P73A 5C2CA 2M8DB 4RUCA 3H40A 1B70B 2C2NA 5ETOA 5JMNA 2CPDA 2WVCA 4U67Q 3IRXB 5ETMA 4DSJA 4DQIA 2FVRA 1VJWA 2K8GA 3BN4A 3I0RA 5J2MA 2QLXA 3IBFB 3UD4P 4KV8B 1ZTTA 5GAHI 5IM0B 1AROP 3A8JA 5T7LA 1ZM9A 1SL0A 1RYRA 2R8GA 1QAIA 3IFEA 2CRLA 4IG0A 2OHDA 5KFTA 3DRRA 4DOZA 5KFVA 2LEPA 2HHXA 4Y2MA 3K58A 3EMTA 2EFGA 3E2EA 1EB0A 3M8QB 1RAJA 3EE3A 3QSIA 5LXRA 4A8YA 2GHWA 2KYXA 3PFOA 4PRFA 2LQ5A 4LF8J 3BV8A 4DV6F 4OHWA 2VA2A 2J8SA 4IFYA 2DNYA 4P9SA 3HK2A 4G1QB 4K4TA 5H9FJ 3T1YF 2H5JB 1PC4A 1MNEA 2FPHX 2H3EB 2E5HA 2ZE2B 3BSCA 2OO4A 3C66A 4NMLA 3O44A 1DHMA 3EWGA 1CSJA 1HD0A 2RQ4A 1X0FA 4F4WA 2FGCA 5ETTA 5K5MA 5DZ7A 3MM8B 2QZ8A 3IWXA 3QIPB 4OI4A 5DG9A 3W5XA 1FF2A 5CXTA 1CJVB 2YKAA 2ZZNA 1RWNB 1M5HA 2E1PA 4NWBA 4OYOA 2FJWA 4GKJF 4IDKA 5HK4A 4XPEA 2B9EA 3DRSA 2V5HG 2R8HA 3PIOQ 4ZK7M 4U7UK 2OH2A 3AJ2A 4B02A 4X62J 3SCLE 4AL6A 4QR2A 1WC3A 4O23A 1F0XA 4DX6A 4MIBA 2OMLA 2BRKA 3UWTA 5M2RA 1WC4A 3KLFA 2R7WA 4JI1J 4GKKF 2UUCJ 3JS9A 2WBRA 1OY6A 4I64A 1SV5B 4LRBA 3HT3A 3GTYX 3ISNC 2CPFA 3VF0B 1XMQJ 1N36J 2QEXS 1VC0A 1RT4A 4A8MP 2UUAJ 4OFZA 4DUYJ 2F4VJ 4EGLA 4PWUA 2E7VA 1TV6A 1RT2B 3D67A 1V3SA 4RBVA 1SJ3P 1RT5A 3P45B 1F3VA 4WFNQ 3W3SA 2DR5A 4FF3A 1WG4A 3B4DA 4CLZA 2CA9A 2HZVA 4ITSA 3J81Y 1H38A 2RU9A 4KE5A 4L72B 4AYBD 5LJ5Y 3V6JA 5LSLA 1C0TB 2ALYB 1H7WA 1N5QA 3BBBA 3CE8A 2KJWA 1JNZB 4QIFA 1Y00A 1ROFA 5HAOA 5DO2A 1U6BA 4JI0F 3GFYA 1H0HB 1DQ9A 2LMIA 2AEJA 1LV5A 3CJ8A 3ZZPA 4JI0J 2QT7A 1IM4A 5IT9Y 1NEEA 2BUNA 5C24B 3ISND 4WYWA 3KXDA 2HVZA 3H20A 3ZTQA 2HWHA 4B9SA 2C3PA 1Z2LA 1VRQC 4CLTA 5IQ6A 1YJ7A 2IAJA 3H4BA 4PWDA 1XC9A 2W24A 2X1AA 1M90T 3H98A 4XAKA 2NYHA 3TZZA 1NMEB 4AXJA 3M7VA 3NBPB 2AGQA 3D5MA 4PZVA 2FJDB 3IO1A 2HPUA 3I6PA 3MM5A 5KFPA 4OZ0A 2VG5B 4RPFA 4DZ6A 3R9LA 1N34J 1PSDA 1WF0A 2PC6A 4NMXA 3T19A 3ZZRA 2DEJA 1QE1B 1E6YA 1ZS6A 4TNOA 4FPIA 1SC3B 3OTCA 4RR5A 1S9FA 1VQYA 3KLVA 2VKRA 3OXGA 4HACA 5T14A 4L73A 1H3DA 1JLBB 2E5JA 3CB4A 2C2RA 1NK4A 3C3LA 3LPYA 4OX9F 3CJKA 2V8PA 3BGLA 3CJSA 3VQTA 1TP7A 4X62F 2OTJS 2KHDA 2XZDB 3KHGA 2RDDA 3BGFA 3VZIA 5IV3A 4EBDA 3TUIC 1TVRB 1UMJA 1YIJS 3KG4A 2AGPA 4RW8B 5AJ3F 3CF5Q 2YKMA 3LP2A 3POTB 2MDAA 1UZDA 2I38A 3TAMB 3DGPA 3IR5B 3NCQA 4DV7F 3M1VB 2B4OA 1HHQA 3FKBA 3ILJA 4I56A 4NLDA 4UOFA 3MAQA 4EBEA 2WONA 5D0GA 2DHAA 3PYFA 2XS7A 1C4CA 3OL7A 3CCJS 1R89A 3Q8VA 4JB8B 5HBMB 4RO0A 2E66A 4NYZA 5HI7A 1KVJA 2KO1A 3HHLD 3PRBA 4WFBQ 4IOAQ 2BANB 3A4TA 3H90A 4UT4A 4OZ3A 4B9MA 1FEEA 1RT3B 2FJXA 3PX6A 1EHWA 4FYDA 2IVMA 3LH2S 4TLQA 3VGSA 4EI2A 1KKHA 3LOUA 2C2KB 3AQOA 2XZTB 3O3LA 1VGYA 3NOGA 4EYHB 1T8EA 3SV3A 3DGPB 3NLCA 2O01C 4UOHA 1N54B 4EMDA 4C2MA 4H4MB 1U4BA 1LW2B 3F41A 3ILOA 4NLVA 3HULA 3AD8C 3CMQA 2XI3A 3T5LA 3IGVA 3UCZP 2VQFF 1RTJB 3HVTB 2DPIA 1QVFR 3KFWX 3R5DA 1L3UA 1Q79A 5L1IA 2NXCA 4V19J 3TUZC 2NR0A 1VC5A 2N3OA 2XNRA 5FIIA 2FZCB 2VPYB 4RNHA 4DR1F 3SFUA 2HK2A 4HEA9 5DLFA 2RD5C 4YFUA 1XMQF 1R8CA 1TL7A 3P96A 2ZUAA 3DGVA 1HPZA 4FS1A 2CZVC 2CVIA 2ZD1A 4HH1A 4DV2F 3MMBB 5CAAA 1UL3A 4FNHA 4WK3A 2IYGA 2WHOA 3NGUA 4KFBA 4ILLA 1PILA 2Z2MA 4LF1A 5B08A 4PCQA 3H8YA 4OZNA 4K4SA 3SIPB 1OYEA 3LWLA 2GJIA 5H9EJ 3EXCX 5BYSA 2Y1JA 4NI2B 2RUSA 2JVRA 1FRHA 4P74A 2ZM6J 1J5EF 2G2OA 1VRTA 2CJYB 3BYPA 1TKXB 4ZJLA 2XS5A 2ASYA 2GHPA 4ID5B 2E5LF 2JC0A 2EFPA 2JFDA 4KGMA 4C11B 3AB2B 3NRBA 4DDFA 3EXYA 2VH7A 1Z4UA 4MFBA 3L3CA 3FNNA 4DL3A 2J6SA 3HDSA 4OZ1A 1KTVA 1S79A 2YNHA 2J7KA 2IM1A 1U2RA 3VV2B 5EWEA 4TVAB 4TKTA 1ZZNA 5FDLB 1YRXA 4ZVEA 1LWEB 3NNHA 3L9ZA 2EFVA 2KI2A 4ZN1A 3TVKA 3S7RA 1M5KC 5KFMA 2UUTA 2KB2A 2QL7B 3MM7B 2XO6A 1FRIA 5LMNF 4MKAA 2C22A 1VQ5S 4MFBB 1XEZA 4GMKA 1REVB 4OI3A 4OJGA 2HW3A 3T5HA 2HGNA 4J9MA 3MEGB 2NZ4A 4ANCA 4AL5A 1B0TA 1UVKA 2RHQB 2KG1A 2RQMA 5A0YB 1QSSA 1LWCA 1C0UA 1BQMA 3UN5A 5A8WB 1T95A 1WKKA 2ZBRA 5KFYA 3HM9A 2UUBF 2UUCF 3IR6B 4U8YA 2CPJA 3D28A 1C4AA 4NZ7A 2LQ9A 2C2OB 3UDLA 1WNEA 3AT1B 2QL5B 2DGTA 4KFBB 5GMKa 2KN4A 2B4UA 2QA4S 1IBLF 3MCNA 1BQXA 3I96A 4C4WA 3JXOA 3VALA 7FD1A 3QWUA 4Q44A 1SL1A 2MKIA 4B3TF 2HVDA 4OX9J 3NMRA 2P9EA 4KBIA 1PBAA 1LNQA 3M32A 3NS6A 3OT9A 1HWJA 3GJQB 4KH0B 4ZHRA 3DI6A 1K1QA 3FJ2A 1JLFB 2QRRA 2QC3A 4ED4A 5F8IA 3H5XA 3RG6A 1KHVA 3UDCA 1S1VA 5K8PA 2DBBA 5HP1A 1N48A 4C7QA 3QRPA 2UXBJ 3N79A 2V4RA 1P1LA 1NKCA 3HHNB 1IUJA 4ELUA 4LFBJ 3T5KA 4RWWA 4M5HA 2JVOA 5KG1A 3R2DJ 5T7LB 4LF8F 1KWMA 1UFLA 4OI6A 1ZM4A 1WG1A 2HWIA 1FA0A 2XMUA 4DF4A 4EO6A 2X1FA 2Y8WA 4IRCA 3KDNA 2EXUA 1HBOB 4ZP8A 9RUBA 2VJUA 3HCXA 4O0IA 3N6NA 3CXCR 2OIHA 2N82B 1DTTB 1PAUB 2R7QA 5KFRA 2MZ1A 3H42A 3J7YI 4LF4F 4KHPJ 1GMWD 5GAEI 2CAJA 2Y0BB 3M2UB 3DOLB 4OYWA 1SUQA 3PDNA 4KGZB 3GIIA 5D3GA 3IWNC 1F2HA 1Q8LA 2VQEJ 4ECXA 1EIYB 5KT2A 1TL5A 2XMWA 3DDKA 3KLIA 1JB0C 2ZZTA 3MECA 3HSJA 4X4SA 1T3NA 2M7SA 1TMMA 2W25A 2V94A 5ETLA 3U27A 4CLWA 1L3SA 3R2CJ 3GMGA 2CZ9A 4JI6F 3H59A 2J5AA 1VQKS 2W1BA 1GMVA 3HHDA 2HBYB 2CPIA 2HRUA 1JLCB 1UJ6A 3PW7A 2E1CA 1FXRA 3VVUA 1NZ8A 1RADB 2C3UA 3OXFA 4OHVA 3QJLA 2JL9A 4C0HA 4P71A 3HHEA 2W7PA 4NYPA 1BHNA 1RHJB 3SMZA 4DSEA 3F0NA 1R31A 4PABA 3NNAA 4OL8A 3BGOP 3BO4A 2K06A 3M6XA 1D9AA 1U1PA 8AT1B 1G3OA 2GCFA 2LXIA 4F02A 1S6PA 3H0PA 2CWKA 4WTYA 3MI7X 1DRZA 4ILMA 3TAMA 2JLGA 1AFJA 4NXNF 1RWUA 3MOZA 1FFSB 3CDEA 1U24A 1YBTA 1X9MA 2JEIA 1VQ7S 1HBMB 1KNZA 4CT9A 4NOHA 2PGCA 2UXCF 4WP3A 3SQOP 4Y00A 4X66J 2Y1LB 3GIKA 2ZHAA 1FRMA 1LWXA 3QT7A 4CM2A 1DQ8A 2LFVA 3AH6A 4E8UA 1HQEB 2FZGB 2ZKUA 1VMBA 4NE9C 1MU2A 2YWGA 5L46A 4IFYB 5D15A 4X4QA 1SQEA 1HW9A 3R5BA 1ZA1B 1VS3A 3A3PB 3UR0A 3MR6A 3AA8A 2MZSA 4BCAA 4ZJQA 5C7PA 2AKWB 3FFIA 3TZXA 1FDNA 3C16A 1XK8A 1LKZA 2DGWA 3AB4B 4CM0A 5AXNA 2ZVSA 2PEHA 1DLOA 3KLGA 4WF9Q 4DV6J 3RBDA 5CZVA 1IM6A 4BWMA 1PG5B 4PPDA 2OMOA 3E8OA 2ZWPA 1KOHA 2VV5A 2ZKTA 2QSFA 3RZAA 4FNIA 2R2TA 1BXNA 1WEZA 4U9RA 5C42A 1GXUA 2X3DA 2CNKB 1RWOB 5SZTA 3UO0A 1O51A 1F9EB 5LL6d 2N4CA 1S59A 5JVHQ 2IRUA 4HI2A 3EM1A 2EBEA 3VGUA 1RCXB 3EZOA 2E29A 3KK2A 2RKIA 1RT4B 1C1CA 3AOBA 5F8HA 3KLHA 2QLFB 3H2VE 4HVZA 4UOGA 1PJ6A 1EKSA 1WHWA 1C1CB 3BB5A 3HZEA 3AD9C 3FBBA 3PYEA 3RJMB 2KM8C 5G4DA 2ASLA 2IJNA 4GVLA 4CLKA 3AOAA 3OTOJ 3J7AN 2QMUB 5IFMA 2FTRA 1GTHA 4KR0B 5EUHA 2HQGA 3ITHA 1FFGB 1YG0A 1I94J 1KLNA 5ETQA 1U25A 3EGWB 3TVYA 5ITHA 1GH8A 2RU3A 5DG8A 4QW8A 4ETXA 3GZ7A 4NXMF 2DRAA 2C42A 2K3KA 4CO0A 1KLMB 3CDUA 2MLYA 4YDXA 3DHWC 4WIQA 3CCLS 2V2KA 4KT0C 3R27A 2V2ZA 1I51B 1LOUA 3ZZUA 1MROB 2DHSA 4JV0A 4YR3A 1HI0P 2JNJA 2DNNA 5J2PB 3ULHA 2V4QA 3KMQA 1FFWB 4B3RJ 3ETMA 2DVIA 2ZE2A 4ZVUB 1Q8BA 3R6GB 4F67A 2BQ3A 3X1LB 1VIXA 3IG1A 2DCUB 2YKQA 3V6DB 2V4JB 2LDYA 5E3RA 3OJUA 1UZHA 4WK1A 4QYRA 3AOCA 5GAGU 3G2XA 1HR0F 1HNXJ 5B0FA 7AT1B 4B9LA 1CULA 2F4FA 1A6LA 3NAHA 2ADCA 1KRPA 4D3HA 1FRJA 1N33J 3MEKA 4I6AA 4CH1A 4ANDA 1GAOA 4C8NA 5EGYA 5CQGA 2AEFA 3DRRB 4DV5J 4DR3F 2OELA 5DM7Q 5EHHA 1R8PA 4QYZJ 1VBXA 1RHKB 1V5VA 2V4JA 3G71S 3I0SB 3OFGA 5KG4A 2FUG9 4A8SA 3EVOA 3A13A 3RYLA 3SI8A 3PIPQ 4ED5A 3T6BA 3C8YA 4LF7J 2CZ4A 3CT9A 3TZYA 1QVGR 1S0VA 3UI3A 2QLBB 2AJ0A 2YQ0A 3GFXA 2BV3A 5B0GA 3QLHA 2CPZA 4ZIWA 4EBCA 2LEBA 1BWEA 5AXKA 4DL2A 2G1HA 4V1Ak 5I3PA 2BQRA 1CJKB 2WTFA 1RACB 1H6KX 1WOSA 3R7SB 3M05A 4PUOA 4QJVA 2YNIA 1SIZA 1RHUB 2CJXB 2B7CB 2VDHA 1XN9A 5KG5A 3JB9k 5DG7A 4ETZA 1KHWA 3W8GA 1WHYA 4ZPVR 4DR2F 3SBMA 2N7YA 1IKXB 3IRXA 4X4OA 1RA7A 2I1RA 4JI2F 3K5MA 3IM9A 4DR6F 4DSLA 2ZH1A 4I1TA 4AT1B 1SKUB 3M2VB 2CQHA 3OQ2A 1NB7A 4JV2A 4WE1A 1TK8A 3CJ4A 3T6JA 3CCRS 4OI1A 2AJ4A 3BKUA 1ZETA 4R25A 2VA3A 4IFVA 4O4RA 1RT7B 1KQKA 4Q45A 2WVFA 5JXSA 3UPFA 2XZWA 4U7CA 1YSJA 4KHRA 3U7JA 2BOAA 4K59A 2AHOB 2IDLA 1IR1A 1WJ9A 2WW4A 4CYUB 3M8SA 1TTHB 2DGUA 4G1PA 3ZTOA 4CLUA 1VQNS 3VAJA 4PYDA 4KHPF 2Q6CA 4DCJB 1QAYA 4DZDA 5LXYA 2J0XA 1SJ4P 3P8BB 2J9DA 3SZ2A 1XNQJ 4KAIA 4LRDA 3OHAA 4RUBA 2E9RX 2VODA 3PR5B 3QSYB 1HBUA 3MAAA 4C98A 4O3SA 2C2MB 1PBUA 1U02A 2K3IA 5B0CA 1FKOB 1LWFB 2AF6A 1FDDA 2EFNA 4RJVA 1ZYQA 4UY85 1HNWF 4R8UA 2HIQA 4CRJA 1ZH5A 4AD6A 2XLIA 5I42A 5CYMA 1MU2B 3OSNA 1ZPWX 3PKYA 1G2EA 1DARA 3HFVA 4K2XA 1S99A 2J0WA 4KH1B 3IN5A 4P75A 2LXUA 4J9LA 2OI2A 2JC1A 3GR1A 1HBMA 2IM0A 1TL3A 2DGVA 3KWMA 5GVQA 2HLTA 3DXBA 2JEJA 4FXVA 3I55S 2F63A 3FGVA 3M32B 1BQMB 4F04B 2BKOA 2ZHBA 3ZZOA 3HD2A 2AJQA 3I4PA 5E3QA 2KXFA 4AUKA 2MQLA 2RB7A 4ZLJA 3MCMA 4F7VA 3JSMB 3ISZA 4KTQA 2BR0A 2KVIA 5HJXA 1K73T 4QR1A 4GC7A 2B8PA 3GU0A 4YB1P 2CQIA 1REVA 3UN2A 2E1RA 4A48A 5RUBA 2DK2A 3R3TA 5HMZA 4EZ9A 1SJFA 1RLDA 2C3MA 3GQCA 3PTWA 2J0SD 1D9FA 1VQOS 5JVGQ 1LWCB 5B09A 3FQKA 3ZTPA 4DSKA 5FDLA 1FWPA 5F9LA 3DFEA 4ES1A 2P6SA 2AW0A 1T9YA 2F7VA 4WFZA 4ECTA 3OTEA 3NY0A 3F56A 3PJ9A 4LREA 1YZ7A 2XTJP 2Y3YA 1TKZA 2IYIA 5HL7Q 2PMZD 1FKPB 5D3GB 3DKDA 3K89A 3KK2B 3W1YC 1Q1KA 4OHZA 5ETVA 1XNQF 1WF2A 3T5JA 1H73A 1HNXF 4OYZA 2GAGC 1C1BB 3H5SA 2IC3A 3OR2B 3FCWA 4WYLA 2CQ4A 3KG1A 2LCWA 4HTIA 2KH9A 2B51A 3FVYA 5L38A 2UXDF 4W90B 3Q8PB 4K50A 2DH8A 5IXUA 2VUGA 5IWAJ 2JX2A 3GYGA 1F9FA 4DV3F 4ID5A 1TQLA 4LBHA 2EKNA 4DPOA 2W9CA 2V0NA 5F8JA 2ZHOA 2M2BA 1NAQA 1M1KT 4TY9A 1MN9A 4YP3A 1DZ5A 5A8KB 4DPYA 2HHHJ 3DLGB 1FX4A 1WD6A 4GKKJ 1NRKA 3OVSA 2AZ3A 2RE1A 4DV7J 1JLFA 4JI2J 3CC4S 4Q2LA 2WK4A 3NWGA 1S6QA 2AYBA 3ZZTA 2BZ2A 3NS7B 2CIMA 4Z2XA 1Y10A 2CQGA 3AXKA 2OTLS 1GQEA 3PW4A 2FVQA 5GAEU 3TARA 3SCJE 1PYOB 2L9WA 4GO7X 3B6BA 3CCZA 1UEUA 3ILIA 3J7ZT 4DR2J 3DDNA 1NDCA 5DLGA 2G0JA 2LKZA 5H9FK 2GO8A 2YQ3A 3MMCB 3CC2S 5EWGA 5GMDA 4ZVTB 4QWEA 5HVFA 2CQBA 2LXFA 3MEEB 5CABA 4HHHA 1N32F 4QWBA 5A8WA 4DS4A 3EX7B 1EJ7L 3Q2SC 3KYLA 4DV1F 2FHJD 1SJRA 2HWTA 2QO3A 1R0AB 1PYSB 3MEGA 2AGOA 4LSNB 4J9SA 3GONA 2V6AA 2GNKA 2VQEF 3MUTP 3WBZA 2OPRB 5D8HB 3TUJC 3KTQA 2R2UA 2OP5A 1N33F 3H7HB 2XMVA 4MH8A 1PC5A 3EYZA 2YX7A 3R5GA 3RB3A 4LF4J 1RB0A 3CC7S 2K7KA 4TYAA 2V63A 2Z56B 3C19A 1B99A 2IJFA 3TJ9A 2YKMB 3LP2B 3POTA 3TWZA 4G6VB 2MZJA 3VAKA 1MLAA 2AX0A 2PA8D 2YNHB 3AY0A 2XYGB 3C15A 2MXYA 2R7VA 1SXLA 2GQQA 2DYAA 1X5OA 4RW7A 3C6TB 2ZH8A 4L3NA 3CVKA 4M5IA 2QLJB 2BKPA 4I2PA 3HZGA 2J9DE 5EX0A 2ZBQA 2Z57B 2DNQA 2ZDPA 5GAHU 2ZH9A 4DV4F 4AE5A 3OVBA 2HQCA 4NLWA 2ZH6A 1HFEL 3EJMA 4PXDA 3HO1A 1L3TA 2C2DA 4LUBA 2HBRB 2ZOMA 3ZZ0A 3CPWR 1N5VA 2CJ9A 4LIRA 4WFYA 4A8QA 2QJ3A 3NBPA 5U47A 2VC1A 4UUXA 4QWCA 1QUVA 3SV4A 2W2OP 4UQGA 4ZJOA 2KFZA 2PFDA 1IBKJ 3BREA 2BJ3A 3TX0A 3RBXA 3MMBA 4UTGA 1F3FA 4USHA 2UVWA 1HPZB 2FVSA 2R7XA 4RL1A 1TL7B 3U1LA 2MQPA 2GVZB 1VYAA 5K20B 2W4PA 2PN6A 4FF2A 3EGNA 3GV5B 4R0JA 1UVIA 2EEYA 1F5BA 4TN2A 3ZTRA 3VQSA 2KFNA 1Y3KA 2AEMA 4NL5A 4ZVPB 1LFWA 4CCHA 2EI5A 1JKHA 2W9AA 4LF5F 4HDHA 2P5VA 1SH0A 2FC8A 2HNYB 3W64A 1NXIA 5BXIA 2UVVA 3RR7A 2PFFB 4NEYA 2BM1A 4OX6A 1PIEA 2PT0A 2DKOB 3UCUP 3EGZA 1CC8A 2KDOA 3NGTA 3AD7C 3GV8B 4DR5F 2H1YA 4IRDA 3KJFB 4B3OA 4N47A 3UQSA 3VGTA 1NBEB 3PV8A 1TMJA 2MKHA 4NCGA 4ZVRB 3CCES 4IFVB 2ZH5A 4MYTA 4NA3A 3QRRA 2B56A 2EK6A 1JJHA 3D7SB 4Y2IA 1L3VA 4DUZJ 2OPRA 1VI7A 1OPZA 2MQQA 3B78A 2QYGA 2GAHC 1LW0A 4UF4A 2L08A 2VF3A 1FI4A 4OQJA 4OLOA 3HMJG 5KFQA 2HHVA 4XDCA 2QX0A 3LGNA 4DUYF 1XMOF 4FYXB 1U2FA 3CJ3A 4QR0A 4YR2A 5BYQA 1HQUB 1JXLA 1I94F 3M6VA 4JOUA 1G6BA 3HJFA 1YJUA 2HRTA 3RAMA 4CQ1A 2UXCJ 1SV5A 1IKYB 2EPIA 3NOCA 1FESA 3TEGA 2HHUA 5KFNA 5DGAA 2CQ1A 1TUVA 4O3PA 2XHCA 4LRFA 4NXNJ 1X4DA 2L9DA 2RQCA 4MIWA 4A8WA 4UQTA 2QA1A 3N5FA 4BLGA 2QYCA 3LALA 1F6TA 3GE9A 3WC0A 4B9VA 4FBUA 1AUDA 5E3PA 1HBNA 3K7RA 1N4LA 1T02A 3MUVP 3W61A 2HS0A 4CNYA 4JI5J 3CDAA 2AZ1A 1H98A 3US5A 2A2DA 1AZSB 4ZPCA 7FDRA 3J7Z5 3MMAB 5FJ4A 1IVZA 1FD8A 2JDJA 2VU5A 2BMBA 2F9JA 1WC1A 1KQFB 2DJWA 3L7OA 2DXFA 2FB0A 1YJ9S 1QTMA 1KP6A 2CQ3A 3CULA 5F8LA 4M5DB 1IWAA 3Q0AA 1HNZF 3S6EA 3H25A 4LF5J 2XMTA 1CS4B 1MWZA 2XM3A 3SFGA 3DU6A 2NPFA 1U0HA 3MAAB 1RP5A 4HHJA 1EETA 3RW6A 4BDPA 2DNLA 2YTCA 2GX8A 4MMOA 1URNA 3M8QA 5BJRA 5JUMA 5KAKA 2MEWA 2QE5A 3D2WA 4CO2A 4DR4F 3LTOA 1JXEA 2VIHA 4URSA 2ZOFA 1SKWA 1OJ4A 2L3MA 4M5GA 4FDFA 3QWPA 4M95A 1V6HA 4K4YA 3D66A 2RILA 5HANA 1XIQA 4Y6IA 2FLPA 3EDQB 1MMDA 1JWWA 3LUYA 2NCKL 1L5UA 3HX9A 1Y5LB 2KFYA 3WDOA 3KHHA 1Y5NB 3VGVA 2CQ0A 2MZTA 4WE1B 2QN6B 1OSCA 3MEDB 2AD9A 5F9NA 1Q0NA 2PIIA 3HVRA 4ZKAA 3QBCA 2NS1B 1Q5VA 2X1GA 3OFEA 4RW9A 5GADI 4K4WA 2OEJA 2RKIB 4F3QA 1M5PC 4JI7J 4DFMA 2AWZA 2VFRA 4FBTA 3E01B 1FXDA 2FLOA 2DO4A 3NGRA 2OPSB 3DLKA 3KG0A 4RW6A 1X4AA 3MM9B 4USJC 5AT1B 3MPUB 4HR2A 2P6TA 4LRAA 3DNCA 2H9ZA 4OHXA 5I3UB 2L41A 1NDLA 3ENAA 3F44A 5DDRC 4CLLA 3M9NB 2EW9A 2EK1A 4L75A 4Q8EA 3CD6S 1FHTA 4MYUA 2Z0GA 3HPOA 5L1JA 2HVEA 1DLOB 1RAOA 2IDEA 3MR3A 3PY8A 2B8QA 4M5MA 2XCAA 3I0SA 3T1YJ 1S76D 1QM9A 1SI9A 2OEMA 3FFIB 3GYXB 1U8WA 4ZN3A 3Q8SB 4OZJA 1SH2A 5I42B 2D69A 3IP0A 5E2QA 2XMKA 3MFHA 1IKVA 5LMNJ 4DQQA 1O8BA 3M9OB 1V3RA 2ABYA 1UVNA 4N8OA 2W01A 1RK8A 4O3QA 4F50A 4LJMA 3M9MB 1TK5A 1Z1ZA 1NDPA 2HNDA 3CDBA 2DNKA 4ECWA 1DTQA 3TOQA 2YKNA 2I6WA 1F5AA 5L8RC 1DTQB 2GMLA 5D0HA 3QIDA 3OLBA 3OD2A 1EQ0A 1VHIA 3R1HA 4PWDB 3IG1B 4QIWD 3LF0A 2K1RA 4TLRA 1Y3JA 3QPIA 1WC5A 4M1KA 4C3KA 4NLGA 3Q2TC 4LF6J 3P6YC 2PI4A 2DEIA 1TUWA 4LR8A 2DXEA 4P7VA 4DPUA 3VAHA 1TU0B 1MROA 4JI4J 1WELA 4C3MA 1U1KA 4A8FA 3MOJB 5ETSA 5IT9U 4DPTA 3CCTA 4F2SA 1UP1A 2HHSA 1VK8A 4ZOSA 3DOMA 4DX7A 2XMJA 4DLGA 3GILA 3V81A 4F8RA 2MHNA 4J7CA 3TVZA 5AJ3J 1G1XA 1XWLA 1Y4ZB 3R5CA 1IBKF 3WC2A 5JJBA 4GC6A 3D3CJ 4UW2A 3GR0A 4FN5A 3A12A 2MHEA 1R6YA 1U0SA 3KHRA 3Q24A 1RT5B 2XYHB 4LQ9A 4JUZA 1OQ3A 2YH1A 1VQPS 1FE0A 2IJRA 2V8GA 3N0VA 4BC9A 2FLLA 2IMWP 3H2LA 1WG5A 4M5JA 4LIWA 4PXEA 3QNWB 2YNGB 4IH5A 2B5JB 3DMJB 3KLHB 3HKZD 2RJZA 4P2SA 3M2UA 5CCMA 4UY8T 3B4MA 4NLSA 4QU7A 1FWLA 3CGIA 4ZPBA 4RUAA 2FYXA 2WB1D 2R2SA 2DR9A 4TY8B 4DR3J 4PXBA 1X9SA 3CD0A 3DRSB 4CNZA 2M52A 1RHMB 4D3GA 5IV4A 2B7BB 1T03A 5KFGA 2VQFJ 3TX8A 1VCTA 5EN1A 2DNMA 2FJBB 3HFZB 2R42A 2RF2B 2UV8G 5HJYA 1WKJA 1ELOA 4Y2AA 2A0FB 1FNXH 4FF4A 3R7BB 2JRSA 2XEXA 1FE4A 4C8KA 2Y0SD 1FK9B 3KMSA 3MMAA 2FQQB 1HNZJ 4W98A 4JI3F 1EETB 1M5OC 4ECRA 3WX8A 2B3TB 2VG6A 2IVFB 1NM2A 3G4SS 4G1QA 1TK0A 3V4IA 2V2VA 1DFDA 4NLOA 1S1UA 1S6OA 2GVDA 2ZJQQ 2MQ8A 4TYBA 4NPOA 4Y3CA 4QWDA 4PG5A 1J5OA 1YDLA 1XBWA 1T9VA 4YEAA 2AJ1A 2BQUA 3M8ZA 3PZPA 4WKRA 4LBPA 1JXVA 1K0VA 4ZP6A 2HZCA 3I82A 3KJNB 3QO9A 4H4OA 2F1FA 3VHQA 1NK0A 4ZLLA 2ROGA 4LVNP 3SDEB 3I5AA 2EC0A 2BX6A 2ZDOA 3GWCA 1S1TB 4HDGA 5ADZA 3QFWA 4YQWA 2MKKA 3MR2A 1NJIT 2ZH4A 1K47A 3IWLA 4F4AA 1RTDB 4A8OA 2HIYA 3Q23A 1JJ2R 3IM8A 4EO8A 3HFKA 4RNFA 2C3YA 1UWBA 4P10A 3BPDA 4HL9A 4NRTA 3W2VB 2QLWA 4E98A 4DF8A 1IBCB 2DHXA 4J9QA 1RT6B 1VFJA 2OPPB 3BO2A 1NNDA 3O2IA 4DMZA 3D68A 2POKA 1BQNA 1JLAB 4TU9A 4DL7A 2HHPA 1JX4A 1GT8A 4N76A 4C8YA 2PMWA 3E3XA 2XYPB 5DQGA 2VOOA 3GJSB 2EWHA 3VZHA 2ERRA 2W2PP 1WC0A 1RI7A 3BS9A 2JLEA 4DR5J 1SUQB 2APOA 4B17A 1FX2A 3BKTA 4X4RA 2GIQA 2VBYA 4IQXA 4CLYA 1ZA2B 1KTQA 2HNYA 3D6FB 3M2RA 1L3KA 4DV5F 4OJHA 4DU7A 3IA0A 3PYGA 2WOMB 3R6LB 4M5LA 3TR5A 2WRMA 4FVCA 1KS2A 4GVBA 4YB7A 4MK8A 2ACMA 2Y8YA 5ETRA 3DRPB 1VQMS 3TA0A 3CTRA 3PEJA 3JTOA 4NLUA 1PYTA 2MY7A 2F40A 2NYIA 5K14B 1RTIA 3UW1A 3M30A 3I31A 5IZHA 4DFKA 1UA1A 1RYSA 1KDNA 1RAFB 4LSLB 4ZIVA 3IBCB 2LLZA 2WB4A 4PEOA 2RS2A 5HP1B 2VG7A 5T41A 4WPAA 4B3SJ 3MM6A 2BJEA 1J5EJ 2YBVA 1Y5IB 1QJHA 2MKSA 2CFXA 5MAOA 1RWVB 1UEVA 4ZHRB 1KFDA 2MQMA 4KY3A 3W2WB 2BW7A 4ECUA 4JI5F 3AODA 2HEKA 4WKYA 3GJRB 4M5NA 4NYOA 1BMQB 2GVZA 1AW0A 1QUPA 4WP8A 4ED1A 3SXLA 1T05B 1HMVA 1SCJB 3CCUS 1VIOA 3MFIA 1IKWA 1Y11A 4ZVGA 2RH3A 3I32A 1ITPA 4IQMA 1D0EA 1UCNA 4B3TJ 1VQ8S 4LSLA 4OZLA 3AQPA 3BGRA 4NXMJ 1D3WA 2HFSA 2VPZB 4C48A 5EWFA 1TKTB 3BDPA 1FCAA 2B4PA 2F8HA 4J9VA 2AV5A 2HQIA 1KFSA 1ICEB 4N41A 4Y2KA 3DRPA 3RRHA 2RRNA 1WEYA 2NXEA 4DQSA 1KSPA 3TAQA 5DRKA 2BXJA 3PX4A 4I2PB 2LU1A 5F41A 1NH8A 4IG3A 3M6WA 2QG9B 2MQOA 4N56A 3C6TA 2XI2A 1JLGB 1BWVA 3NAIA 3NKYA 2QIFA 1S9GA 2ZUGA 1I6JA 1S1XB 4BC7A 3HT0A 3D0IE 4I7FB 1AB8A 1Q78A 5KT6A 4JYAF 4ZVQB 3L7UA 3T41A 3A8IA 2GA7A 3W8PA 4TQSA 3TI0A 2YWKA 4X65J 2QMWA 4ELTA 4ATNA 2Q79A 1U6ZA 1YX2A 5MLCV 4F2RA 4X64J 2FHJA 4MT1A 1P9YA 3KOAA 1IR2A 3CJ5A 1NDKA 3I87A 3PW5A 2VBZA 2E1MC 2KRBA 3AJDA 2AIRB 2MKCA 1JLEA 3DM2B 2A3JA 2ZITA 3TUPA 4LRCA 5KG2A 1TKTA 4N77A 1TVRA 3HP6A 3CMES 1DQAA 2UUAF 2F4VF 1VRTB 2DH7A 2HNZB 1LK5A 1Z2ZA 2MJNA 1N5TA 5K8NA 1S7IA 2AYMA 1HIYA 3QT8A 4LMZA 5AXMA 4HKQA 1SQGA 3FSXA 1D9DA 1E6VA 2D3UA 3MMCA 5HMXA 3D3BJ 5LSOA 2DGOA 2GMHA 3TEHB 3DLGA 1B64A 2FJAB 4C97A 1UW4A 4ZP9A 5A8KA 2KVQE 3HD1A 2PDAA 1QD1A 3QZ8A 2C2EA 3MM5B 2ZD1B 1J5OB 3A8KA 5AE2A 2UU9J 2H54B 4O0NA 2KZZA 4BBYA 1S1UB 2GVDB 4UZBA 2C2ZB 1MW7A 2BYCA 4CP5A 2JEGA 4RZRA 4AQYF 1R3NA 4ZPTR 2JHEA 1NKBA 2XWYA 5KFZA 3DYAB 2Y1RI 2RT3A 1APSA 4OYPA 4RNMA 4RU9A 2RAQA 3OR2A 5KFHA 1FK9A 2VPXB 3BQ1A 1XR7A 3NGKA 1C0UB 2BE2A 2DGQA 4J5OA 3M8RA 1HNWJ 4TQRA 5HVHA 3FUYA 2ZH2A 2F3JA 2HAIA 4DL6A 1RKIA 3PO5A 1LW2A 3DXSX 2UXDJ 2RF2A 1MMNA 4RUHA 3W9JA 3MPWA 4CO5A 3FSIA 3VTIA 1FTRA 4QU6A 4PPZA 1R7IA 1S6UA 4LR7A 4LQ3A 1NJZA 1S9EA 3PKMA 1TKDA 3Q83A 2OKQA 4DG1A 1SKSA 2Y1IA 2XGQA 4ALZA 3B8HA 1K44A 4ED6A 4E0DA 4QYZK 4KIAA 4CTAB 1NB2A 5C25A 4Q2MA 1UVJA 1R43A 1U49A 1CJTB 1J2VA 4IUFA 1NHUA 1PCAA 1UWBB 3KLFB 4J9RA 2AU0A 2WVDA 1NKEA 1MSWD 2OAUA 3NEKA 1GFWB 4DR6J 2MYFA 2NUHA 5H1SV 4JV5F 1Q95G 3CCMS 2CNNB 4KGKA 3IXQA 1NK8A 4IDKB 1Q53A 1HI8A 1UPPA 4FXDA 2XNQA 1GXTA 1CJVA 4DCPB 2VBWA 4C8MA 2LYVA 5HATA 2DIUA 1TL4A 3S8SA 1MG7A 3BDEA 1RABB 2V9KA 1R6VA 3PJWA 1HKAA 3QGGA 5B0AA 3JAMU 1IKWB 4A8XA 4DV0F 4NLPA 1T05A 1O0PA 3ICLA 4OI0A 4WXOA 3FCVA 1ZM2A 2ZZMA 4DR7F 4OX7A 4OYXA 4KO0A 2K2PA 1FKOA 3FC9A 4IR1A 3LP0A 4WZQA 3GB0A 5DETA 1GXLA 4NLQA 3OLAA 1GMWA 2VG6B 5D0EA 1P27B 3GPAA 1K0TA 5HMWA 1JIHA 4NZ6A 4ZP7A 3ET6A 2KZMA 4EFAC 1RCOB 3M4XA 4TU8A 2IAJB 1D8ZA 5DQHA 2I0XA 3BEGB 1VBYA 4CO1A 3FDSA 4IR9A 4O44A 4R8UB 3CJQA 3FZ2A 4LBIA 4CWBA 2BVZA 3TANA 2J6UA 2H65B 2R7UA 4J9OA 3FMWA 5K9FA 4KRWA 4F4YA 1AXQA 4F4ZA 1T03B 4KV8A 1N8RT 4WZMA 4UOCA 2PA3A 3BZQA 2Z58B 2V50A 3FEYB 2ALZA 3H4DA 4RW4B 2BKNA 2EBGA 2I5JA 3MGJA 3MR7A 4CI0B 2RRBA 3FEXB 2ZWOA 1SC6A 2DHHA 3A1YG 1OYDA 5KG7A 4I0WA 4DL4A 1NK9A 3CEDA 2MLXA 5THWA 1VK3A 4K4VA 4M63A 4QIVA 1JQGA 2G4BA 3GJTB 4RW6B 1X4BA 1U1LA 2OPSA 1K9MT 1HI1A 4DXLA 1S77D 1NSAA 1YITS 1RBLA 4HT7A 2DRDA 5IC6B 5LJ3Y 2M3DA 1S0NA 1M5SA 3OBIA 3N4WA 3M1VA 6FDRA 5GAGI 3LW5C 1NO8A 5D4NA 4JV1A 3FRYA 3PFEA 4ZCMA 4XDDA 3W60A 4RW8A 1VRUA 3HHLB 3DRYA 1CVJA 4YB5A 1WHVA 3IC1A 2CXEA 2Z2YB 4PG7A 3LPEA 5CD4H 2V67A 3RAQA 3CJKB 2V8VA 4J9UE 5E3AA 1F1BB 1RTHA 1EP4B 2XSJA 3SQGB 1FO1A 3RUBL 1N34F 2XS2A 3TO8A 3FZBA 4PYAA 2R7OA 4K7QA 5KT5A 1CJKA 4DUZF 3G9CA 1RWMB 1X5TA 2N3LA 2DITA 5CHCB 2IM2A 5FLXU 2W9BB 3TZWA 3MUMP 1T9WA 4WP9A 4NA1A 1X4HA 3QAUA 4JYAJ 2EC2A 1X0PA 3QQCD 4LF2A 1OY8A 2EFQA 1PKUA 2CWXA 2GFFA 2LA4A 3D6MB 3W5ZA 2O5DA 5B0BA 5HO4A 3KHLA 3MDFA 4USTA 4RX6A 2R7RA 3R1LA 2HFVA 3SCKE 1ZAXA 3ZNJ1 3LGHA 3R5JB 1NSPA 3THPA 1BD6A 1WDDA 2HFZA 2ZNYA 4OLPA 1VQ9S 2CJAA 4Q0BA 5J1NA 1UJ5A 1X8DA 3Q86A 2JZ5A 2MGZA 3K5LA 1D8YA 5C24A 2HK3A 5KG3A 3LP1B 2XG8A 4FXWA 1QSYA 2XSFA 5ETNA 4B9UA 2Q66A 1CULB 4HHUA 4X66F 1KLMA 3K17A 3P5BP 4FVMA 2JWNA 2XY5A 2ASDA 3AHPA 4I68A 3NL0A 2BABA 1X4CA 1YGYA 5IM0A 1F2GA 2PO4A 4TY8A 3DLEA 4ES3A 5J2PA 2RUGA 3ITHB 3RAXA 4G3IA 2ATLA 3CJRA 4MKYA 4B3OB 2KRRA 4G1IA 2RDIA 1P1TA 1FNOA 1HWKA 1S48A 2XBPA 3D0GE 3FSYA 1W26A 3M8WA 2LA6A 1TUGB 1X31C 4LVOP 5M2UA 3HI9A 3G6XA 4EZ6A 2M4MA 5CZXA 1IXKA 1EX8A 4GO5X 2ZBCA 4TXSA 1GEHA 1WDTA 5KFUA 3DLLQ 3PEHA 3T1AA 4DN9A 2OFHX 3OSPA 3ILLA 1LK7A 3KNGA 4ICLB 4WTOB 1Q82T 1N5YB 3TRGA 2CPEA 4ECZA 2YQ1A 4H4KC 1NCLA 5HSPA 3QZ7A 1IQZA 4JI6J 2CYYA 4LF9J 1TFWA 1TL1B 4B9NA 2YVSA 1CJUA 1T9UA 1KVKA 2MTLA 3QATA 3HJVA 4C9DA 3QIPA 2AJFE 2FJEB 2Q43A 4O4GA 3AAWB 3MM8A 2NXNA 2ROEA 4J9NA 1R8BA 5D4PA 3D6HB 4LF7F 4KGXB 3BM7A 2VPWB 3LGMA 3JQMA 4URQU 3AJ1A 5KFWA 1Q86T 1NJXA 4ZPDA 3LQVA 1REGX 2KJVA 2NUUG 3FBFA 1AYEA 4I6YA 3S01A 3VAFA 4Q0BB 3DLEB 1EKRA 3RTVA 2BJ7A 4MKBA 1CLFA 1U0HB 2JSXA 2DRBA 2EG1A 3ZZZA 5C42B 3GFZA 3MR5A 2D41A 2P9CA 4DSIA 2L48A 1JKHB 1JJCB 1MN7A 1VHFA 2VB6A 4XO0A 1QAJA 1TFYA 3G6ES 1B7YB 1XNRJ 1YJNS 1YHQS 3PO4A 1FWKA 4QCLA 5KFBA 2AJ2A 1YVFA 4DQRA 2RRAA 3MAHA 3KK1A 3V6KA 1YJRA 4EK2A 2B9XA 1WSVA 5IC4B 1S6PB 1RISA 3O8WA 3VAGA 5IOLA 2FIUA 3FRZA 4EYIB 3RB6A 2FLNA 4K4ZA 1QDUB 2B9WA 2Z2ZA 3IS9B 3WZ0A 3EGVA 3ZTSA 3RBEA 3TP2A 1VBZA 1OIAA 1TZ0A 3RRKA 3JSBA 3GIJA 5KFDA 5E3CA 2ZC4A 1U47A 3EPIA 2AX1A 3R8YA 4FP9A 1FJGF 2IVYA 3N5BA 3TJ8A 3KK3B 4NLXA 4DPXA 5A8RA 3BPSP 3MTKA 3OVAA 2XLJA 2Z30B 2YWEA 3OTDA 4JBCA 1QY7A 4CIOA 3V2UC 1NUEA 4U6PA 4DS5A 1FRLA 1IJEB 2Q6BA 2XC9A 3KUGA 5B7WA 3B82A 2ZJRQ 2I2YA 4PQUA 3KLIB 1FDAA 1ZBTA 1HW8A 2WZ1A 3N9UC 4RW7B 4F25A 4DR1J 2CKWA 4LFAF 5AXLA 3OL6A 4K2JA 3MWBA 1HWUA 3DC2A 3EPGA 1IN0A 1LW0B 3RRGA 5J2QB 2NXJA 3MEDA 4ER8A 1IQTA 3LAMA 3M8YA 2GHVC 2HFUA 1N6QA 4N8NA 1DTTA 2CJBA 2I5JB 2WCXA 2IPOB 2HYIB 2CDRB 5KFAA 4DR4J 5HROA 1WC6A 1NHKL 2FZKB 1RU1A 3QRQA 1RA6A 1OWXA 2QTWA 1BC6A 1R8HA 4EEYA 4WFAQ 2E5IA 2NXUA 1T9TA 4ED7A 2LQBA 1S0MA 2M70A 1XNRF 2IRYA 2R4FA 1Q5YA 3BGRB 3P5TL 4K4XA 1HL6A 3J80U 2YKOA 2HHQA 1AFIA 2GJ2A 5BR8J 5A2QU 5F0UA 3G86A 3I4HX 4EU0A 3UD3P 2DNHA 3NNCA 1HBOA 4CLFA 1R27B 2E5LJ 2CJKA 2JJ4D 4ECSA 4JV5J 1U26A 2MSTA 2E7XA 3G8QA 4FKYA 2ZM6F 4LFBF 3TW0A 3ENVA 4AL7A 2HS3A 4O3OA 1VBKA 1X4EA 5HLFA 4O44B 1FKAF 4KJIA 3CSKA 1HNIA 3UNYA 3W2WA 3BO3A 1RZMA 2O1PA 3C2PA 1V9OA 1NLKL 3T3FA 1EAYC 1RAAB 2VONA 2GC8A 2CQPA 4R5PB 5A6WA 1WACA 2E7WA 5D0RA 2V2QA 3JSRA 4CO3A 2G1DA 1GNKA 1CG2A 2HSEB 4N5SA 2H5EA 4HI1A 3OUYA 4KHMA 2RIJA 2V8HA 3JQKA 1UVMA 2BDPA 3QJJA 2IBKA 1RJJA 1S12A 4JI8J 2BACA 3PCOB 3PYDA 2KXNB 1YI2S 1T7PA 3D4JA 3PX0A 3TNVA 1VQ4S 4Y28C 5I4MA 2YXLA 1GMUA 2P8IA 2GJFA 1CJTA 4L6V3 1RGVA 3D6TB 2H48B 2CNLB 2W4CA 2UV8A 3IAS9 4KGVB 1SJQA 1DAXA 2K7JA 4JI3J 4IH6A 5A0YA 1LWEA 2G2YA 1RHQB 1WOPA 3G87A 5EX3A 1S9EB 4Q7AA 4DG1B 4RNOA 4X4PA 2XGPA 2IBOA 4X64F 2QA4G 1S1WB 5BR8F 4K0KJ 5J1PA 2GZOA 1BQNB 4LT6A 1FJ7A 1KONA 3O6QA 3K8WA 4Q5VA 3W63A 2J8AA 2DGXA 2CQCA 2SXLA 4CTAA 3CMAS 2Z8QA 2ZVIA 4LSNA 3P49B 2VFVA 2KTQA 4CLPA 3UVJB 2A6OA 4M5KA 4C8OA 5D77A 3HSZA 1WEXA 1WHXA 4QBUA 4X4NA 4USUA 3KNAA 4LFCF 4N7TA 2E1AA 3Q22A 3EZUA 4U95A 2B6AB 5CYQB 3GP9A 2MY8A 2WW8A 3HHLC 3LAKA 4TU7A 3CCQS 1S0OA 3T9NA 1SKRA 2UXBF 1HWIA 3M6UA 3A8EA 3G8SA 1FXLA 1XTZA 5K8MA 5K8OA 4OZ2A 2GIRA 2KT2A 1HMVB 2BOPA 5J2NA 2X1BA 3W9IA 3ZC4A 2DH9A 2KYZA 4CZCA 3QT5A 4A8KA 5B0DA 2IFXA 4ILRA 4PG6A 4USKA 5HLFB 1TAUA 5KFIA 3MCSA 2HGLA 2U2FA 1OO0B 3KDOA 1E6VB 4ID8A 3OR1A 1DY3A 2HZAA 2KHCA 1FVSA 2O3DA 1UWAA 2RSQA 3OR1B 2V68A 2B9YA 5DJBA 2E44A 2RVJA 2OD4A 3W5YA 1PJ7A 2VG7B 1RTJA 3HVTA 3HHKA 1JMTA 2GMJA 4OYBA 4MKVA 3WX4A 4I69A 1S4EA 2FY1A 5AE3A 1RAIB 2DISA 2M9KA 3MXHP 1JLEB 3DM2A 3PW0A 4U8VA 2ZC3A 2F8EX 4F3OA 3E51A 2WBMA 4KSEB 2UP1A 1U1MA 3J81j 2B6AA 3Q8UA 4KB7A 5CYQA 3X3UA 4A4JA 1HYSA 4C3LA 1EZZB 2GIFA 2PMHA 3AXMA 1XMBA 4QW9A 3KUHA 2GQ2A 4Q8FA 2JFKA 4Z7CA 3OHBA 2R9LA 1X7VA 3RW7A 1UW9A 4H4MA 2B5JA 4K0KF 3SCIE 3TJAA 1S10A 4ZPWR 1Q16B 3KJQB 3O1LA 2Q1LA 1N0UA 3JQJA 3MMJA 3NP5A 4R0EA 1JLAA 4XTTA 1S1WA 1P6TA 2V69A 3CCWA 2RS8A 4RBUA 2P2CB 4Z7YA 3TYTA 4O3RA 2BE9B 4ZITA 1RT3A 5AE1A 2YWWA 1N36F 4DWIA 1M1HA 1FDBA 3CUNA 2NSBA 1RWWB 1XR6A 3HF5A 4NX9A 1RWPB 1S9GB 2W4DA 2UZAA 1RWXB 2B0GA 2GO9A 1IKXA 5SUHA 4IOBA 2DR6A 3ZO7A 1EQMA 1N0VC 2FHOB 5HBMA 5HQ8A 2BJ8A 2ZOGA 5DM6Q 2DNPA 2QSWA 2X51A 4B08A 3P3DA 1WWHA 2IIHA 5L9NA 1JLBA 1PJ5A 5KFJA 3MEEA 5IS2A 3SDEA 3AA9A 1LQ9A 1V3ZA 2YNIB 3BBCA 2VASA 1FERA 2LECA 4PUOB 2J76E 3R7NB 5A8RB 1QE1A 2CPYA 2DTJA 3Q8YA 3KK1B 1R0BG 4YHHJ 3L4BC 4A47A 1N56A 4RU2A 2NQPA 3OUYB 4YY3J 2I8EA 2XWXA 2W7AA 4GRSA 2JEFA 4Y2CA 1U2CA 4IO1A 2HQFA 3MM6B 4R5PA 3BN7A 3U1NA 4OIXA 2ZNZA 1T94A 2ADBA 3GG1A 4LF6F 2NZCA 1S6QB 2HURA 3VWSA 4WCEQ 4MJKA 1T0TV 1JLQB 2BJDA 2IM3A 1E6YB 2MLZA 4DBQA 1P9QC 5KT4A 4WU2A 4WIIA 3JYTB 2ZEJA 1ZZFA 1BGXT 1T11A 3C14A 4FYYB 3FK4A 4K5RA 4X65F 3Q8QB 1FVQA 5J1EA 4ED3A 2DHGA 3EDRB 3GCWP 5D78A 2YWFA 4J9PA 3K5NA 5DGBA 3SYZA 2FHKA 3V6DA 4KYZA 2W2MP 1CJUB 1S49A 4NA2A 3BH6B 4QIGA 2MKYA 4XK8C 1S7HA 2NPIA 4NRUA 4QQBA 4ED8A 4NCBA 1HD1A 2ZFHA 1RUSA 3TAPA 5KTQA 3IRWP 1URRA 2BBEA 2WVEA 4CYUA 3BR9A 3K5OA 2W8LA 3UCGA 1Q81T 1SC1B 3HSGA 3OFHA 5KT7A 4C8ZA 1CEZA 2KM8B 3GLJA 4OYMA 3ZFVA 5HROB 4B3RF 3RB0A 4O4GB 3MTJA 3A3OB 4UZCA 2OSQA 2HRYA 1HHSA 2F9DA 5F8NA 4MK9A 2GS8A 3G8TA 1RLCL 3FBCA 4UUWA 2D9PA 4QPTA 1U1QA 1W7WA 3N28A 4ICLA 4PG4A 3WHIA 1N5YA 2IRXA 4BS2A 2QGFB 4ED0A 2DCLA 1H2VZ 4F0HA 3LO3A 2XY6A 2N7CA 3KJVB 1FJGJ 2Z4PA 2UU9F 2H5IB 2VHGA 2D74B 1G7CB 1FD2A 2FVPA 1XQIA 2J7UA 1OMSA 4H4OB 1B3TA 3I56S 3DLBA 4KPYA 2HFOA 2W8KA 3W2VA 2GGPA 4V19X 1U1NA 2ACYA 4ERDA 1GX6A 2DNZA 2HBZB 3W7BA 3K5PA 4PAAA 3MPVA 1VC6A 2LQJA 5EDWA 1S4FA 1AA1B 2K1RB 5ETKA 4JI4F 1TL3B 1Q7YT 3MURP 3OV7A 2E5GA 3V4MA 2VBXA 2OLWA 3PG9A 3QO9B 3S1TA 4FF1A 5F3ZA 4PQAA 3OL9A 4OV1A 2HNDB 2A1BA 2BE7D 3GG0A 4P52A 5GADU 1M5VC 3C16B 1RBOB 5CYMB 2AQ4A 3MHYA 3HVAA 3CD5A 3U02A 4HH0A 5DDPC 2AT1B 1YRTA 1H72C 1RAGB 3V4IB 1LXJA 3NWRA 3C6UB 5CYJA 1SC4B 5D4LA 2YKPA 4P72A 2PI5A 3J7YU 4DL0C 1HQ2A 4WU3A 3PW2A 1CPZA 4WBFA 3THVA 1O6XA 1IR0A 3D1OA 4KKOB 4MTPA 2D1CA 2QA2A 2ZBPA 4DHVA 3QMQA 1NPKA 3MCOA 3H5YA 3W66A 1R8AA 4OV6A 1YK9A 1YZ6A 5I3UA 1U8SA 2LQ8A 5E7OB 1ZAVA 4Z37A 2HS4A 4IG0B 5KG0A 3J81U 4GKJJ 1CQNA 3CJTA 1AUSL 1KR4A 1VDHA 3BR8A 3BF4A 3BYRA 3CD7A 3ENWA 4PWWA 1FTCA 2BW2A 4YHHF 3KJVA 1W2BR 3ENQA 2NREA 3DN9A 3QFHA 4I2QB 4KQZA 8RUCA 5M2PA 4JI8F 1BE4A 4C0OC 1HLWA 4DFJA 3N01A 2O66A 4F3MA 4WFXA 4ANEA 3G96A 3SEOA 1N6QB 4QZVB 2QL9B 4DU8A 6AT1B 2M5YA 3M2VA 2PE8A 1JLCA 5CA5A 3PVXA 1UVLA 2CG4A 3DMJA 2OPQB 5C5JA 1OY9A 1SB6A 5KFLA 4ZCIA 9ATCB 4DEZA 4NCGB 4DV3J 3ETOA 4I2QA 2FGOA 4IYQA 1X5SA 4OX8A 1UA0A 2UUWA 3HKWA 1NJWA 3DRXA 3WQPA 2IMOA 2YX1A 1RXOB 3M8PB 1U45A 2DR8A 3K0JA 1TAQA 2VDIA 1RU2A 3FCHA 4ECYA 2V8DA 2BM0A 2HLUA 5IQQA 4B3SF 3GSDA 1RWKB 2Z2LA 3PRDA 4E2FB 1OQ6A 1U7LA 4RW4A 1W25A 3V81B 2D3OR 4AXIA
chains in the Genus database with same CATH topology
5IT4A 5J1EB 3QJPA 1Y9OA 3IGNA 3VCDA 1U1RA 1UETA 2LEAA 2JOQA 1X4GA 2HMIA 4J37A 2YNFB 2IHR1 4KO0B 1VQ6S 5DDQC 1IKVB 5E0OA 1JLQA 2MSSA 4RLEA 3G6YA 2J6TA 4PXCA 4MIAA 1T3OA 3I9ZA 2YKNB 1FRXA 2R8KA 3BGUA 4ZLPA 1PGZA 1HHTP 4WJBA 6FD1A 4BHQA 2BRLA 1K8AT 5F8GA 3F73A 3I9V9 3GFHA 2MQNA 4HTJA 3M8PA 3PXGa 1QAXA 2RQKA 2MZRA 2PSZA 2W7OA 1H2UX 2DD8S 3NG8A 4EWTA 4ZCKA 4I67A 2J9CA 2GGPB 1EP4A 3E01A 2MMYA 2M88A 4BWJA 2NLWA 5C25B 4IOCQ 2YX4A 2ZH3A 1HQUA 3ZZYA 5D6GA 1DJ0A 1NK5A 4EUVA 3UR3C 3L7PA 4QOTA 5A6PA 1NHVA 3CIMA 2CQDA 2YH0A 3QGIA 2HHHF 2Q3PA 3PM9A 4W92B 1KN6A 1VQSA 1H2TZ 4IRKA 1KOOA 2C3OA 2HFNA 2YY3A 3DLHA 3VAMA 2HVHA 4X4UA 1OS5A 2CJQA 3DOLA 1RT1B 2QV6A 1ZM3A 3D54A 4DJBA 1IBMF 4B3OB 2J0QD 3JSYA 4DQPA 5BYRA 5KOWA 4KKOA 4HLBA 1HARA 3G6VA 1FJEB 2LDIA 3C6UA 1NH7A 1WI6A 4B3MF 3KLEA 2ILYA 2QMXA 2QFJA 2G0CA 2D9OA 2GW8A 1O5JA 3CJ2A 2EKYA 3MF5A 5E5NA 2E9TA 4K4UA 2ILZA 4YB6A 3JYTA 1KD1T 1B0VA 2BE2B 4RBTA 1OSDA 3I5CA 3R5AA 4USIA 1X5PA 2GQCA 3K59A 3DI6B 5FLXY 4NLTA 3D0HE 3OTBA 2AYGA 2DNGA 1FNMA 4M5DA 4H4KA 2D7SA 1ZOTA 3C46A 3BSNA 2XMMA 3JAMY 3MD3A 3UNGC 2R7TA 2W9CB 4OJ1A 2UVUA 3FMBA 1KC8T 2W9BA 1LFPA 2FC9A 5G0RA 3SSSA 2MB0B 3PJXA 2BA9A 5L1KA 2OFGX 1IKYA 2ZBIA 4JI1F 1Q8IA 5L1LA 2COLA 1KVIA 4MK7A 1F60B 1YJTA 3U1MA 4QWAA 2XSJB 3IAM9 3SQGA 1HBNB 3OTOF 2DGSA 2M0GB 4NLRA 4F26A 1NU4A 1HYSB 4HT5A 4OMFG 2HNZA 1NZAA 2MJUA 4A46A 2IA6A 1Y7PA 5HN0A 1D1UA 4PKDB 5IWAF 2VD3A 2VOPA 3JTPA 3UE2A 1VRUB 3HHLA 2A18A 2N4DA 1U1OA 3TA2A 5E41A 1HNVA 2HHTA 3CCVS 1VOMA 3DHXA 3RB4A 3NCPA 1WTBA 5CCLA 2OSRA 3MM7A 2ZH7A 1NJYA 1Q4RA 2O67A 1BLUA 5F3TA 5KFSA 2RDJA 3PHEA 2VFTA 1ULRA 2PD1A 4DL5A 2BANA 1SH3A 4MAKA 4HYKA 3THTA 2G9OA 2A2CA 4NCAA 4RWXA 4X84A 1JLGA 4XIUA 4IG3B 3BQ2A 1X9WA 2D3ZA 4OI2A 3QGPA 3J7A1 1FEHA 2XO7A 1GTEA 3V5RA 4X4VA 1TKXA 5FD1A 2XULA 2MKJA 1N5SA 1PO6A 1YJVA 2JLFA 3DOKB 2KT5A 4JI7F 1VQLS 1U09A 5IT0A 1Q7LB 4QIEA 4YY3F 1MWYA 1S1VB 4CT8A 5KFEA 5HP1B 5LMUF 1IJFB 3LANA 4LF9F 4KC5A 4IH7A 1UKUA 1FT8A 4FS2A 4YOEA 4DX8H 1A9NB 2HQ3A 4OJ3A 4DN0A 1HNIB 1RTIB 2OD6A 3LP0B 2NSCA 4X2BA 2HGMA 2WSFC 2ROPA 3K8VA 4H54A 2AYEA 1YQHA 4AFFA 2P9GA 1RDRA 1HBUB 3JTNA 3N6MA 2R2RA 2VC0A 1FJCA 4RKUC 1UAWA 1NK6A 3VAIA 1HWLA 4ZS6A 3OJSA 5KOXA 3HXMA 4IKAA 1VLYA 3D1QA 5KFXA 1ZPVA 3BQ0A 3RR8A 4PG8A 4OZ5A 3MR5A 2HVIA 3NCRA 1WI8A 2VKZG 4M8LA 2KKHA 3DOKA 5I3QA 2IC3B 2R8IA 2UVRA 2J7WA 4DLEA 1SJ1A 2DNOA 1JNRB 4ECVA 2WOMA 3EZ5A 3H2UB 2VFUA 2OTLS 1RT6A 1CQMA 2VL1A 3CJ0A 1BY9A 4J9KA 1HNVB 2X3GA 4NZ0A 5J2QA 3CO9A 4DSFA 5KFKA 3MZIA 3HLUA 5DDOC 3I5BA 1MMLA 2KU7A 1SL2A 1RT2A 2V9WA 2I9SA 3O5TB 4YUDA 3OW2R 1YRUA 2OPPA 2XLKA 2LVWA 3HVWA 5DQIA 4YR0A 3OL8A 1U6FA 3UFCX 2VZ9A 2XCPA 5LT5A 4B9TA 2CPXA 1X4FA 4C11A 3K2YA 5KT3A 3QLHB 4XPCA 4RNNA 3MPYA 2CVEA 4ZA1A 5KFCA 2WSCC 4M94A 2A10A 4F4KA 2DIVA 1XR5A 1B7FA 1S1TA 1SIWB 3DLJA 3L09A 1OPIA 2F8MA 1HA1A 2J9EA 3FQLA 3PNIA 5AE3A 4PR6A 5HMYA 4ZVFA 3DYAA 1I1GA 5E33A 5KFFA 3N6LA 2EFOA 1SBRA 1CC7A 2EG2A 4IO9Q 1H7XA 3QYYA 2KG0A 5L39A 1NK7A 2DNRA 5G0RB 2RMLA 5KFOA 2FJVA 5J2NB 1C2PA 1N88A 3BSAA 2FD2A 2M8HA 2DO0A 2FDNA 5D4OA 3V6HA 2HG4A 2DPJA 3FEZA 4YMEA 3M30B 3NGDA 3K57A 4ZCLA 4Q43A 5KG6A 1C1BA 3CWJA 4ZPAA 1XERA 5F0WA 3IBWA 2DR7A 5L9XA 3OXLA 1Y0HA 3PR4A 1FKPA 3NMAA 2YNGA 3KLEB 1KQSR 1WTFA 1TKZB 2MZQA 1ZTWA 3M2RB 3OPKA 3LWMA 5DS7A 2EVZA 4ES2A 2B43A 4NLYA 2RNEA 1TL1A 2R8JA 3CCSS 2CDQA 4QPXA 5J2MB 2DR5A 1RT7A 2WSEC 1KEKA 2ZJPQ 3BSOA 4K5SA 1JK9B 2XHWA 2FHMA 1RT1A 5D8HB 3DCAA 3RU0A 1JJ4A 3MD1A 1DURA 4F4XA 4I7FA 1W2IA 3CIZA 2C28A 4WXWA 1S1XA 1RKJA 1N52B 1K1SA 3CDWA 4ELVA 4ZVHA 4C0BA 5LSRA 4CO4A 2R7SA 1DBDA 1P8GA 3PACA 1YTYA 2WONB 3KKFA 2U1AA 2VFSA 1RTDA 3JSMA 1QSLA 3QGHA 4OHYA 4ZDNA 3KK3A 4DFPA 4YDDB 4FZVA 1QLNA 2ASJA 1TR0A 3DU5A 2IA0A 4P6QA 2MPUA 4X4TA 3LP1A 2L9NA 3GYNA 1YWXA 1LXNA 3IS9A 3KLGB 2MGZB 4ECQA 1A7GE 4Y0FA 4I4BA 4Y34A 2YNFA 5B0EA 1LWFA 1FRKA 2E9ZA 1HQEA 2GV1A 2VG5A 4C8LA 3T1HF 1UFWA 1ZAWA 3TQ1A 5A2QY 2CPHA 4Y65A 3J80Y 4O3NA 3GIMA 2FVCA 3H5UA 2WAQD 1YBAA 3VR1A 5F8MA 4URGA 1UJ4A 3OFFA 3T9ZA 3EUNA 3L95X 2OJ3A 5K14A 1RQ0A 1GX5A 3MM9A 5CH7B 4ZMMA 2XB2D 2HMIB 3BJYA 3QAEA 3DLKB 4P7TA 4ED2A 2AP6A 3IR7B 2DB1A 1RTHB 2DT9A 3TA1A 1U48A 3I0RB 2KXHA 1S97A 3ONQA 2CQ2A 2OPQA 3GV7B 4RW9B 3NS5A 1S72S 1YJWS 1KQGB 2KT3A 4FPRA 1C0TA 1B0PA 1M0SA 1WF1A 3SSQA 2B4VA 3D1HA 4CH7A 4I6WA 2LU2A 2XY7A 4PQUB 2G13A 3Q8RB 2JH3A 1TV6B 4CH0S 3MECB 2YWHA 1F5CA 3SSRA 2M8DB 4RUCA 3H40A 2CPDA 4U67Q 3IRXB 4DSJA 4DQIA 2FVRA 1VJWA 2K8GA 3BN4A 3I0RA 5J2MA 2QLXA 3UD4P 4KV8B 1ZTTA 5GAHI 5IM0B 1AROP 5T7LA 1RYRA 1ZM9A 1SL0A 2R8GA 1QAIA 3IFEA 2CRLA 4IG0A 5KFTA 3DRRA 4DOZA 5KFVA 2LEPA 2HHXA 4Y2MA 3K58A 2EFGA 3E2EA 3M8QB 1RAJA 5LXRA 4A8YA 2GHWA 2KYXA 3PFOA 4PRFA 2LQ5A 4DV6F 4OHWA 2VA2A 4IFYA 2DNYA 3HK2A 4G1QB 3T1YF 5H9FJ 1PC4A 1MNEA 2FPHX 2ZE2B 2E5HA 3BSCA 2OO4A 3C66A 4NMLA 3O44A 1DHMA 1CSJA 1HD0A 2RQ4A 1X0FA 4F4WA 2FGCA 5K5MA 3MM8B 2QZ8A 3IWXA 3QIPB 4OI4A 5DG9A 5CXTA 1FF2A 2YKAA 2ZZNA 1M5HA 4NWBA 2FJWA 4IDKA 4XPEA 3DRSA 2V5HG 2R8HA 3PIOQ 4ZK7M 4U7UK 2OH2A 3AJ2A 4B02A 4AL6A 3SCLE 4QR2A 4O23A 1F0XA 4MIBA 2OMLA 2BRKA 3UWTA 5M2RA 3KLFA 2R7WA 4GKKF 3HT3A 2WBRA 4I64A 1SV5B 2QEXS 3VF0B 3ISNC 2CPFA 1VC0A 1RT4A 4A8MP 4OFZA 4EGLA 4PWUA 1TV6A 1RT2B 3W3SA 1V3SA 4RBVA 1SJ3P 1RT5A 4JV5F 4WFNQ 4FF3A 1WG4A 3B4DA 4ITSA 3J81Y 1H38A 2RU9A 4KE5A 4L72B 4AYBD 5LJ5Y 3V6JA 5LSLA 1C0TB 3CE8A 1H7WA 1N5QA 2KJWA 1JNZB 4QIFA 1Y00A 1ROFA 1U6BA 5DO2A 4JI0F 3GFYA 1H0HB 1DQ9A 2LMIA 1LV5A 3ZZPA 2QT7A 1IM4A 5IT9Y 1NEEA 2BUNA 5C24B 3ISND 4WYWA 2HVZA 3H20A 2HWHA 4B9SA 2C3PA 1Z2LA 5IQ6A 2IAJA 3H4BA 4PWDA 1XC9A 2W24A 2X1AA 1M90T 3H98A 4XAKA 4AXJA 3NBPB 2AGQA 3D5MA 4NXMF 2FJDB 3IO1A 2HPUA 3I6PA 3MM5A 5KFPA 4OZ0A 2VG5B 1PSDA 1WF0A 2PC6A 3T19A 3ZZRA 1QE1B 1E6YA 4TNOA 3OTCA 1S9FA 1VQYA 3KLVA 2VKRA 3OXGA 1NK4A 5T14A 1H3DA 1JLBB 2E5JA 3CB4A 2C2RA 3C3LA 3LPYA 4OX9F 3CJKA 3BGLA 3VQTA 4X62F 1TP7A 2OTJS 2KHDA 3KHGA 3BGFA 3VZIA 4EBDA 3TUIC 1TVRB 1UMJA 1YIJS 3KG4A 2AGPA 4RW8B 5AJ3F 3CF5Q 2YKMA 3LP2A 3POTB 2MDAA 3TAMB 2I38A 4DV7F 3DGPA 3IR5B 3NCQA 3M1VB 2B4OA 4I56A 4EBEA 3MAQA 4NLDA 2WONA 2XS7A 2DHAA 1C4CA 3OL7A 3CCJS 1R89A 5HBMB 2E66A 4NYZA 5HI7A 1KVJA 2KO1A 3HHLD 3PRBA 4WFBQ 4IOAQ 2BANB 4B9MA 1FEEA 1RT3B 3PX6A 4FYDA 2IVMA 3LH2S 4TLQA 3LOUA 3AQOA 3O3LA 1VGYA 4EYHB 1T8EA 3SV3A 3NLCA 2O01C 4C2MA 1N54B 4H4MB 1U4BA 1LW2B 3F41A 4NLVA 2XI3A 3T5LA 3IGVA 3UCZP 2VQFF 1RTJB 3HVTB 2DPIA 1QVFR 3KFWX 3R5DA 1L3UA 1Q79A 5L1IA 4V19J 3TUZC 2NR0A 1VC5A 2XNRA 5FIIA 2VPYB 4RNHA 4DR1F 3SFUA 4HEA9 5DLFA 2RD5C 4YFUA 1XMQF 1R8CA 3P96A 1HPZA 4FS1A 2CZVC 2CVIA 2ZD1A 4HH1A 4DV2F 3MMBB 1UL3A 4FNHA 4WK3A 2IYGA 2WHOA 4KFBA 4ILLA 1PILA 2Z2MA 5B08A 4PCQA 3H8YA 4OZNA 4K4SA 5H9EJ 3LWLA 2GJIA 3EXCX 5BYSA 2Y1JA 2JVRA 1FRHA 1J5EF 1VRTA 1TKXB 2XS5A 2ASYA 2GHPA 4ID5B 2E5LF 2JC0A 2EFPA 2JFDA 4KGMA 4C11B 3AB2B 3NRBA 4DDFA 3EXYA 2VH7A 1Z4UA 4MFBA 3L3CA 3FNNA 4DL3A 2J6SA 3HDSA 4OZ1A 1KTVA 1S79A 2YNHA 2J7KA 2IM1A 1U2RA 3PO5A 5EWEA 4TKTA 1ZZNA 5FDLB 1YRXA 4ZVEA 1LWEB 3NNHA 2EFVA 2KI2A 3TVKA 3S7RA 1M5KC 5KFMA 2UUTA 2KB2A 3MM7B 5LMNF 1VQ5S 1FRIA 2C22A 4MKAA 4MFBB 1XEZA 4GMKA 1REVB 4OI3A 4OJGA 2HW3A 3T5HA 2HGNA 4J9MA 3MEGB 2NZ4A 4AL5A 1B0TA 1UVKA 2KG1A 2RQMA 5A0YB 1QSSA 1LWCA 1C0UA 1BQMA 5A8WB 1T95A 5KFYA 3HM9A 2UUBF 2UUCF 3IR6B 2CPJA 3D28A 1C4AA 4NZ7A 2LQ9A 3UDLA 1WNEA 2DGTA 4KFBB 5GMKa 2KN4A 2B4UA 2QA4S 1IBLF 1BQXA 3I96A 4C4WA 3VALA 7FD1A 3QWUA 4Q44A 1SL1A 2MKIA 4B3TF 3NMRA 2P9EA 4KBIA 3M32A 3NS6A 1HWJA 4ZHRA 3DI6A 1K1QA 3FJ2A 1JLFB 2QRRA 5F8IA 3H5XA 1KHVA 3UDCA 1S1VA 5K8PA 2DBBA 5HP1A 1N48A 4C7QA 3N79A 2V4RA 1P1LA 1NKCA 3HHNB 1IUJA 4ELUA 3T5KA 4RWWA 5KG1A 2JVOA 5T7LB 4LF8F 1UFLA 4OI6A 1ZM4A 1WG1A 2HWIA 1FA0A 2XMUA 4DF4A 4EO6A 2X1FA 4IRCA 2OIHA 1HBOB 4ZP8A 4O0IA 3N6NA 3CXCR 2N82B 1DTTB 2R7QA 5KFRA 2MZ1A 3J7YI 4LF4F 5GAEI 3M2UB 3DOLB 3GIIA 1SUQA 3PDNA 3IWNC 5D3GA 1Q8LA 4ECXA 5KT2A 1TL5A 2XMWA 3DDKA 3KLIA 1JB0C 3MECA 4X4SA 1T3NA 4LF5F 2M7SA 2W25A 2V94A 3U27A 1L3SA 3GMGA 4JI6F 3H59A 2J5AA 1VQKS 3HHDA 2CPIA 2HRUA 1JLCB 1UJ6A 3PW7A 2E1CA 1FXRA 2C3UA 3OXFA 4OHVA 3QJLA 2JL9A 4C0HA 3HHEA 2W7PA 4NYPA 4DSEA 3SMZA 1R31A 3NNAA 4OL8A 3BO4A 3M6XA