2RQMA

Nmr solution structure of mesoderm development (mesd) - open conformation
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
141
structure length
141
Chain Sequence
GDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPIDFSKLDPGKPESILKMTKKGKTLMMFVTVSGNPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVSQDRCAEVTLEGQMYPGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Mesoderm development candidate 2
publication title The Structure of MESD45-184 Brings Light into the Mechanism of LDLR Family Folding
pubmed doi rcsb
source organism Mus musculus
total genus 31
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rqmA02
3U7JA 1XTZA 1LKZA 2FGCA 5FIIA 2MDAA 3OBIA 3OFFA 1LK5A 4LUBA 1KS2A 3UW1A 3CEDA 3TUZC 2I9SA 3OFHA 5JJBA 2JHEA 1LK7A 2LVWA 1UJ5A 2J0WA 1YGYA 2CDQA 1RWUA 3MAHA 1PSDA 3AB4B 3DHXA 4NMLA 2P9EA 3HHEA 1YBAA 2DT9A 3MTJA 2ZHOA 5IT4A 2QSWA 3W7BA 2KO1A 1UJ4A 1Y7PA 2QMWA 3LUYA 3IBWA 3MWBA 4PWUA 3TUIC 2H9ZA 3LOUA 3ENWA 3KWMA 4M8LA 1O8BA 2PA3A 2QMXA 1U8SA 2RQKA 3O1LA 4IO1A 1M0SA 5IS2A 2NYIA 4GO7X 2RQMA 2F8MA 3OFGA 2F1FA 2P9CA 3P96A 4GMKA 3DHWC 2QRRA 3S1TA 3AAWB 4X84A 2JOQA 3DDNA 3K5PA 3TUJC 3L7OA 3ENQA 3NRBA 1UJ6A 1SC6A 1ZPVA 2P9GA 3ENVA 3N0VA 2RE1A 2J0XA 2PC6A 3DC2A 5T41A 3IXQA 5IT0A 2LQJA 3OFEA 3AB2B 4GO5X 2DTJA
chains in the Genus database with same CATH superfamily
1RTIB 4QYRA 3VZIA 2IJRA 1RAOA 3RBZA 1NSAA 2XMTA 4ZCIA 2EKNA 2RQ4A 3V6DB 5CA5A 1HWLA 1N0UA 2CPEA 4ZOSA 1U48A 2VQEJ 4EBEA 3EDRB 2J0SD 1ZM4A 2AW0A 4K4ZA 5D15A 3OPKA 4O3QA 2KFNA 2KHDA 3D28A 1AZSB 3THTA 3R8YA 3EICA 2XSJA 4RNNA 4ZHRB 1P27B 2EW9A 2KXHA 5ETVA 3C19A 2XWYA 2W2OP 4ZJOA 1N4LA 3BYPA 1RAEB 2QLFB 3R5DA 4ZVSB 4NI2B 3QATA 4DPYA 5GADI 2VPXB 3P96A 3R97A 2HRYA 4DFPA 3JQMA 2DVIA 1P1LA 1Q5VA 2LEBA 1E6YB 5DO2A 2PE8A 2W4PA 2X1GA 3CULA 4NEYA 1DJ0A 3HFZB 4C8KA 1PBAA 1VIOA 4WJBA 1YQHA 3BO4A 3DXSX 4CLWA 2G2ZA 2HIQA 1NKBA 1SC4B 4DL0C 1RACB 3W60A 5LMUJ 3LW5C 1SL0A 3HHLD 4TN2A 4UQTA 1LW0B 1NPRA 2W9BB 1HNWF 3GG0A 2QL9B 1DTQB 4G1QA 4DOZA 2YNHB 2DK2A 2EBGA 3PHTA 2F4VF 1U47A 4RW4A 3G6VA 5D4OA 1UJ4A 3J80U 2LECA 3UDVA 4F4ZA 4OZ3A 1SUQB 5AE2A 2KJVA 4J9NA 1N5SA 5I3QA 3FCWA 1PYTA 4IH5A 1TL4A 3CCVS 1XQIA 4OLPA 3KMSA 1X0FA 3M6WA 2ZOMA 1IUJA 1RJJA 4ICLA 2M5YA 2YKNB 3BEGB 5KG6A 3ZZOA 4C11A 4KKOB 3Q2SC 4USKA 1RQ0A 3N79A 5C25B 1NSKL 5THWA 1U25A 4UT4A 1HYSA 1EETA 4I2QB 2IDEA 5HL7Q 4WPAA 3ZZUA 4K4UA 3IO1A 3T9NA 3MM5A 2NPIA 1T11A 4WIIA 2ZH2A 4IH7A 1KVKA 4IQMA 3AA8A 3SCLE 2PGCA 1DBDA 1A0OB 2W7AA 4O3PA 5LMNJ 2BACA 4JI0J 2E7WA 3I4HX 3QJPA 2HZAA 3MEEA 2DR6A 2KTQA 3TJ8A 4J7CA 3N4WA 1S57A 1PBUA 2X1FA 1H73A 2KJWA 3AJ2A 3MM7B 3SBMA 2CJXB 2ZD1B 3MEGA 2W24A 1GMUA 3DOLA 2DGQA 5IXUA 1JLBA 4OL8A 2H9ZA 4ED3A 3W1YC 5KFSA 2ZH6A 4ZMMA 2PA3A 5EWGA 4J9UE 4DQSA 1D1UA 4HTJA 2XS5A 2W9CA 2DISA 2FJXA 4NZ0A 1S0OA 2W25A 4YR3A 3Q8UA 3HO1A 2PEHA 2XLIA 2VOPA 1B4SA 1OWXA 1D9DA 2W8KA 3ENQA 1CJKB 4OX6A 4JI6F 4Q7AA 2HHPA 4I6AA 2GAGC 4DR4F 3BREA 2CQ2A 3CCRS 4CCHA 2LU1A 1X9MA 4USTA 3G86A 5GAHU 2OJ3A 3I56S 2SXLA 2I1RA 3GFHA 4O4GA 3TVYA 3RW6A 5ETNA 1CVJA 2E5JA 3HZGA 2K1RB 4LF8F 3T6JA 1UVLA 4DL5A 4IDKA 2YWHA 5ETLA 1Y0HA 4X4TA 1IKXB 4KV8A 2ZDPA 3QT8A 3NEKA 1I5OB 1MWZA 4RL1A 1NJIT 2P6TA 2ZH9A 2UUCJ 4RZRA 3A4TA 2Z30B 4LSZB 2BJ1A 5IT9U 1UPPA 2NUHA 2D41A 4LF5F 4DV7J 1PC5A 1NHKL 4K4VA 1Y9OA 2PIIA 4X4NA 2QFJA 2IA0A 3C16B 1YJNS 2AD9A 2KT2A 1BD6A 2HHSA 1RBLA 2IYIA 2BOPA 1S6PA 2Y1LB 4HR2A 1WKLA 2W2MP 2DXEA 3TAQA 4IOCQ 3ZTRA 1D8YA 4HT5A 2DNOA 4ZLLA 2LFVA 2BJ8A 1LW2B 1WG4A 3K0JA 3VR1A 2QLJB 5KFRA 1HI0P 1EZZB 1RTHA 4N8NA 2QC3A 3RBDA 4ECRA 3QRRA 2DHAA 4G1PA 5FJ4A 2IMWP 2HHXA 4ZVUB 5AXKA 1S49A 4KTQA 1HHTP 1AFIA 2RS2A 5ETKA 1Z2LA 3GJQB 1FEEA 4ZPWR 2RNEA 2ZWOA 2OFGX 4C8OA 2DGSA 1X4FA 4ZCMA 4C0OC 4RNOA 2AU0A 3UCGA 4PQUB 4IO9Q 3DI6B 1Q7YT 1UPMB 4ES1A 3OV7A 1U26A 2ZNYA 1S1TB 4ZN3A 3LP2B 5CD4H 1NEEA 3W2WB 3QWPA 3OHBA 2QLWA 4A8YA 2G13A 1S5ZA 4FBUA 4Q2LA 4DPOA 2F5GA 5DM6Q 3QGGA 4BWJA 1TELA 3N6MA 8ATCB 3H59A 2FUG9 3OTOJ 4OZJA 4D3HA 3U27A 3BF4A 3UVJB 3KLEA 1K44A 4DSKA 3LPYA 1XK8A 3GMGA 3DDKA 3I0SA 5L8RC 5FDLB 2BQUA 1QAIA 3BBBA 1N54B 3NCRA 1N5VA 1J5EJ 2BKPA 4ZVHA 1OY6A 2RUSA 3Q23A 3CCQS 1WEXA 2MQ8A 2BANB 2P5VA 4I69A 3I5BA 1VRQC 1Y7PA 2ZBIA 1EQ0A 5KFMA 4CTAA 4ILRA 3KJVB 4JI5J 2GQCA 5DGAA 2ZJRQ 1VRUA 3KLIB 4RW9B 1RP5A 2C2OB 3QGPA 3V81A 2B56A 4FXDA 5BYQA 2VKRA 4LVOP 1HPZB 2MQMA 1VQNS 4ZVEA 4QIWD 3TNVA 2UVRA 3TQEA 2CZVC 3B8HA 3V4MA 4CLPA 2ADCA 3ENVA 4UZCA 1RABB 1UVJA 2ZH7A 3VV2B 1YSJA 2E5HA 3UPFA 3JAMY 3MF5A 3GSIA 2JRSA 2XWXA 3HVWA 3D6HB 2LVWA 2CKWA 3PG9A 2LXUA 4LRDA 3KG4A 1S79A 2RU3A 2UU9F 1SKUB 3DLJA 4TYBA 2XI3A 4YDXA 2RKIA 1YI2S 1OSCA 2E9ZA 4Q44A 1HBNB 2NR0A 2DXFA 1D9FA 5DQIA 4TKTA 5H1SV 3BSOA 3NCPA 4M8LA 4PG5A 2IBKA 3UCZP 4JBCA 4N76A 1N5QA 1KLMA 3CD6S 4DF4A 5IV3A 4NWBA 4CM2A 3LO3A 4AL7A 4UY85 3OR2B 2DPIA 4DSLA 1REVB 4V19J 2O3DA 3AJDA 8RUCA 4RUBA 1SH0A 3NMRA 1VQ7S 2EKYA 4WFBQ 1UJ6A 2FPHX 4JI1F 1Q16B 4DR1J 4K4WA 5B0AA 1YJRA 4P2XA 3NGKA 1XNQJ 1NNDA 2QN6B 1QTMA 5HP1A 2BW7A 2MKHA 1OSDA 4K5SA 2MSTA 4UZBA 2HQGA 1PSDA 4JP8A 2O01C 2H65B 5GVQA 1YIJS 1H3DA 2BJ7A 4B3TF 2NPFA 3KNAA 4YB1P 2D9OA 2CQ1A 4WK3A 4AE5A 4B3RF 2V4JA 4C2MA 4ECUA 3KWMA 3GQCA 4DZDA 1T02A 4IFYA 3ZZPA 1JLGA 3JAMU 1U09A 1M5SA 2MKJA 4HH1A 3S8SA 4URSA 2LP4A 3JB9k 1QE1B 2O1PA 1TL3B 4MKVA 1V3ZA 2R7RA 1RT4B 3BSCA 1R0CB 4ED7A 1FJEB 1N34F 4NCBA 5KG2A 1KN6A 1VQMS 1S59A 2ZEJA 3SSSA 1U6BA 1H38A 3CF5Q 3H7HB 3LTOA 1VIXA 2HURA 3GYGA 3IG1B 4DPXA 1IBKJ 4TQRA 1RBOB 3T19A 4R25A 3SQGB 2QA4S 4ID8A 2JHEA 5A0YB 1R6VA 2PSZA 8AT1B 4F0KA 3PVXA 2GQ2A 1FA0A 1WKKA 2YY3A 1D9AA 1AA1B 2E9TA 3POTA 2AWZA 1X9SA 4J9VA 1Y11A 2GIQA 1RTJA 3D0IE 1C1CB 1T3NA 4GVLA 4Y34A 3LOUA 1SL1A 1H2VZ 1BQMA 1SJRA 4X4RA 4FXWA 2Y1RI 3QFWA 4NLYA 9RUBA 5J1NA 3I31A 2VQFJ 3HPOA 4X84A 4LR8A 2UUBF 1U02A 2V50A 5EWFA 3BR9A 3BKUA 2XQCA 1YJVA 2V5HG 1NSPA 1FVQA 2KXNB 4X66F 4ECWA 4HHJA 1FE0A 3FK4A 2O67A 3ILLA 3EX7B 3LQVA 2ZH1A 4BC7A 4IRDA 3I0RB 3H90A 2ASDA 1AB8A 3A3OB 1MN7A 4LRAA 1IKYA 3D9BA 4FYXB 3SCKE 1NDLA 1OJ4A 2KB2A 1LWFA 3M2RA 5EX0A 1NK7A 2RU9A 3MCOA 3TUIC 4NYOA 1F2HA 2PO4A 2K7JA 4M5DB 1AROP 2HWIA 3OTEA 1KDNA 4NLPA 4Y3CA 1T05A 4GMKA 4ZJQA 3MMBA 1K9MT 3OVSA 1CJTB 1S99A 3RB3A 2OIHA 1R3NA 4KIAA 3H4BA 4YEAA 3UD3P 4DBQA 1XNRF 1IVZA 2YWGA 1AUSL 4ED1A 2B51A 1HMVA 3DLHA 2FYXA 4MFBA 5KFUA 2DRBA 3J7YI 2Z2LA 4G1IA 1ULRA 3JSYA 3MCMA 5HO4A 3IMQJ 1WHVA 4YHHJ 4F4XA 1IR1A 2QEXS 5JMNA 5K8MA 2ROEA 3J81j 3M4XA 4U67Q 2ASJA 4OJHA 3UD5A 4KJIA 1RHQB 1OO0B 3IR7B 2RD5C 4ZVGA 2DH7A 2ZOFA 3KLVA 2AYBA 3A12A 1Q79A 4ID5B 5HVHA 5A2QY 1A9NB 2M2BA 2BZ2A 1CULB 1VQ5S 1NHVA 4YR2A 4JI4F 4CNZA 3K5MA 2IC3A 2VBWA 2QRRA 5KFZA 3EMTA 4NXMJ 2CNOB 2PT0A 2FLNA 4DSFA 3GV7B 4DUTA 2DR5A 1Q0NA 4MK8A 3PY8A 2XS2A 2MSSA 2Y1JA 5K8OA 3H20A 1GMVA 2Y3YA 4O44B 4C8NA 1UVMA 3M1VA 1Q8LA 3JYTB 5H9FJ 2QL5B 1PIEA 1VHIA 5LT5A 1R43A 3QGHA 2ZNZA 4UOCA 1VQ6S 3H5XA 4CH7A 1NK9A 4OX9F 1BGXT 3H40A 4CRJA 1LWCB 3QRQA 3K5OA 1HNXF 1NKEA 3CJSA 3QZ8A 2BE2A 3D3CJ 1RWMB 2EFNA 4ECXA 2NXEA 3TJ9A 3UDCA 4WFAQ 5A6PA 3FRYA 4IYQA 2N4CA 2QMXA 3MM6A 2GHPA 2XSJB 4WTYA 3HVRA 3B6BA 6FDRA 4KT0C 2A3JA 2FJEB 2OEKA 3GFYA 3DLBA 2CQPA 4DV5F 3RRHA 2GVDA 1TUVA 2CUYA 4E8UA 4E2FB 4F36A 4HEA9 2V4RA 2XO7A 1RUSA 1CEZA 5DDQC 1I1GA 3PX0A 2EFQA 2HMIA 5DZ7A 5HN0A 1RCXB 1U6ZA 1F60B 4OHWA 1X4BA 3P3DA 1VQKS 1Y5NB 1JB0C 2WTFA 5LL6d 3I9V9 4N56A 2RQCA 3L09A 3VQTA 5A2QU 3HHNB 4ZPDA 5KFCA 4LF9J 4G6VB 3RB6A 1DTTA 2DXDA 1UFKA 3IAS9 1LNQA 2APOA 2FJAB 3BN7A 4F3QA 2LA6A 1KNZA 1D8ZA 5JVHQ 1VC6A 2CZ4A 3G6YA 2CWKA 2VDHA 2FJBB 1ZS6A 2B4UA 2JX2A 2GFFA 4NCAA 3I32A 2VJUA 4ZVOB 1NM2A 2VKZG 2B9EA 2WSCC 2XBPA 5D4NA 2NYIA 1WG5A 2IJFA 2YTCA 5KFFA 1W2BR 1QAYA 4CIOA 1HD0A 1WELA 4CO0A 3CXCR 3CMAS 4DL2A 1FKOB 4H4KC 2XMKA 1M5OC 3CJ4A 3KK1B 2V8VA 2BQRA 3ZTOA 2G0CA 4PXBA 4QWBA 4A4JA 2R7TA 2PC6A 1N36F 1RT3B 2Q1LA 2MXYA 2QMUB 1K1SA 3D6FB 4OYMA 3KFWX 2NXUA 1Z1ZA 2GIFA 4Z2XA 1EX8A 3MM5B 3GJRB 2EC2A 2DPJA 1N56A 1U8WA 1UL3A 5CCMA 2VFSA 4QR0A 4LRFA 4AL6A 4DR5J 3ULHA 3SSQA 3UR0A 1FFWB 4AXJA 3I96A 1PO6A 2E44A 4Q5VA 3Q2TC 2WVBA 2RSQA 2EK1A 1EARA 2HVEA 1ZOTA 4LIRA 4ELVA 3PYGA 5H9FK 4G65A 1MWQA 1JJ4A 5J1EB 5GAEI 1MU2A 3AA9A 2UXDF 4P71A 4L72B 3UCUP 1NJYA 2AYGA 4ZPBA 4OYIA 2V0NA 4TYAA 5ETOA 1WUUA 2QGFB 3L7UA 1PILA 4NLRA 2E29A 3D0GE 5KFJA 3MGJA 4DF8A 1WD6A 2IRYA 1RI7A 3BR8A 1FWKA 2UUAF 1NO8A 3VF0B 3BKFA 1JXEA 2HKEA 5ITHA 3JS9A 5ADZA 1UKUA 1FVSA 1RU2A 1BQNA 4QWAA 5F8NA 3M8PA 1KQGB 2V4QA 2DIUA 4CO5A 4KAIA 1VBYA 1KTVA 1N48A 3IWXA 2DNPA 1FRHA 4IFVB 4KV8B 3EM1A 2CPFA 3QO9B 2GJIA 2C3MA 4QYZJ 1LOUA 2XGPA 3CMQA 3BM7A 4QWDA 1T9YA 1RTDB 4URQU 4NLQA 4C0HA 2XO6A 2L9NA 2DGVA 2PEBA 4DV2F 2HVHA 4OYXA 3NGRA 4H4KA 1HWUA 3Q8YA 3MAAB 3EGVA 3H5UA 1JNZB 4DCPB 2PFDA 1XBWA 1FXRA 4K4XA 5GAGI 1KLNA 4N41A 3DRPB 2FLLA 1B0PA 5KFXA 5AJ3F 4PPDA 2V34A 5A8KA 2V69A 3SI8A 2VC1A 2O5DA 1BXNA 1IKVA 4C97A 3CNQP 1YRXA 2WCXA 2QL7B 1HIYA 4ECZA 2M88A 5KFWA 4LF4F 3M9OB 3C46A 2ZJQQ 5B0BA 2IVMA 3C3LA 3GJSB 2YPYA 2BXJA 4U7UK 3HULA 1XR7A 5CABA 3CW2C 4UF4A 1NK6A 4WKRA 2NREA 4ZCKA 3W3SA 1RWNB 3UDEA 3T3FA 4B02A 3PO5A 1IM4A 2PDAA 4C48A 5D6GA 4UOGA 1Q81T 4DL3A 3WC2A 1WF2A 4NEZA 4B9VA 3I5AA 3R5BA 4Y00A 2HRUA 1R8BA 1XMOF 1Q5YA 2JL9A 3CDUA 3T5KA 2R8HA 2FY8A 1T03A 3F41A 4EBDA 1SKSA 1N5YB 4IG3B 1KVIA 2G0IA 1KOHA 2MQLA 2YWWA 2IM2A 4RLEA 3GZ7A 4LF7F 1RKIA 4PG7A 2LQJA 2F4FA 2J76E 4ZP6A 4ZVPB 2R8IA 2XM3A 2ZITA 1RAAB 3VTIA 4H54A 2HS0A 3QIPA 4QR1A 3BBFA 3LALA 4NYPA 2NXNA 3SYZA 2ZH3A 2WOMA 4CLZA 1CBKA 5DDRC 1PJ7A 1FNOA 3HFVA 3TARA 4JOUA 4F02A 5HANA 2WBRA 4TY9A 5F8MA 4OX7A 2R2RA 4CTAB 5KT5A 2DNQA 5M2RA 3LWLA 1VYAA 1RWOB 3BDPA 2RQMA 3MEDA 3RRGA 1DHMA 1WDDA 3A3PB 2MGZA 2RRAA 1KTQA 4OV6A 1B64A 2G9OA 3G82A 2PI5A 5E0OA 2A6OA 2IVFB 1QSYA 2PI4A 1FE4A 2XMUA 4F3MA 5C42A 3PHEA 3IR5B 1UWBB 2YXLA 3MMCA 5HQMA 5KG1A 2WONA 1T8EA 4DR3F 3PIOQ 3DOMB 1OYEA 4JI3J 2KG0A 3H4DA 2FGCA 2YKMA 5J2MB 2MDAA 2A2CA 5HMZA 2I5JA 1S0MA 2DNMA 3W66A 1FJ7A 5D8HB 2J9DA 3VWSA 4Y2AA 4IOBA 1SPBP 5KT2A 5GADU 5F3TA 2LMIA 1T0TV 4J9SA 1VRTA 2MQQA 2ACYA 2PFFB 4PXDA 2CRLA 4PPZA 4PWUA 1UW4A 5A8RB 4K2JA 1WI8A 4X4SA 3G4SS 4CH1A 3K5LA 3R2CJ 1MLAA 1Q1KA 3DYAB 3BDEA 2GCFA 5IOLA 1CQMA 2KM8B 1ZBTA 4NA2A 2JH3A 3L7PA 1KLMB 3KJQB 2XNRA 4AQYJ 2DCLA 2KYXA 1S0VA 3RJMB 4CO1A 1FD2A 3KK2A 3MPUB 5A6WA 2V2KA 3KHHA 4JV5J 3FEZA 1SBRA 2IJNA 3M30A 1RAFB 1FEHA 4X62J 4BWMA 2KU7A 2CQBA 2JLFA 2YWKA 2G0JA 1JLCB 4WYWA 2QZ8A 3MECB 3TEGA 4DUYF 3F73A 1S1UA 4DXLA 4ALZA 4DQRA 2X3GA 3B4DA 2LA4A 3FSYA 3MOZA 3HJVA 3MOJB 4FKYA 3VAFA 2UP1A 3PACA 3ZC4A 3G8SA 2U1AA 4EFAC 2J9EA 1U1RA 4WU2A 4ZS6A 1JLQA 5D3GA 1R6YA 4EI2A 4KGKA 5J2NA 5CYQA 4XIUA 1HR0J 2YNGA 4A46A 5JUMA 3EDQB 5B0FA 5IQ6A 3M8ZA 4LF6J 5K9FA 2RVJA 4CM0A 4KFBA 2JOQA 2V6AA 1LWEA 3FBCA 3C15B 5HMXA 2DHSA 2OSRA 2E7XA 1U1QA 1FERA 2XEXA 1K47A 2LQ8A 1YRUA 1IQTA 1XMQF 1FRIA 4J90A 1RT6A 2QLBB 4NXNJ 4H4OA 4CLTA 1PJ5A 1VFJA 4DL4A 2YKAA 4XK8C 1OQ3A 4TU7A 3LP0B 5KFAA 2H3EB 3BQ0A 2DH8A 5RUBA 1WACA 2RDIA 4J9KA 5CXTA 3BGRB 1E6VB 3GV5B 4WF9Q 2KZMA 1FK9B 1G7CB 2YKQA 1O6XA 4ZIVA 2R7QA 3M9MB 2WK4A 3AOAA 4RU2A 1XMBA 4GKKJ 2OEMA 4WCEQ 3CJQA 1IWAA 1WG1A 1BQMB 1ROFA 1F6TA 2FVSA 2VG5A 3H25A 3D6MB 1TKTA 3W63A 1T9TA 5B0CA 2DHGA 3RUBL 2HQCA 4HT7A 1FRJA 3TZYA 3CMES 3R5JB 2ZKTA 4A48A 4NLDA 3GYNA 5CYMB 1U2FA 3HKZD 4ER8A 1UZDA 3TRGA 4FP9A 2DGXA 5E2QA 2M4MA 4DDFA 2UXDJ 2FIUA 3A1YG 2XC9A 2QLXA 5C24A 2AGQA 1U2CA 1P1TA 3DU6A 4GKJJ 2VIHA 3TX8A 1RHUB 5F8GA 4QZVB 2E5LJ 4DV4J 1CS4A 1TMJA 3QLHB 5HVFA 3ISZA 3JSMB 4URGA 2CVIA 2BA9A 1SVDA 1ZA2B 2HK2A 3KLFB 3IM8A 4QPXA 4P7TA 2Q6BA 4F8RA 2EXUA 3ZTQA 2ZBQA 4F04B 5BR8J 1RT5B 1TL7B 4IUFA 2Q79A 4HLBA 2DNRA 3FBBA 4UUXA 1QSLA 2EK6A 2U2FA 3PW0A 5IM0A 3TVKA 4M95A 2H4YB 1EB0A 1RLDA 4USJC 4LFCF 3QRPA 3PR4A 4R8UA 4I0WA 3UW1A 2D3UA 1HBUB 2I9SA 1PAEX 3OL9A 2VG6A 1IQZA 1WNEA 4ECVA 3HD1A 3LAKA 3CCLS 4L3NA 3C6TB 3CIZA 4BLGA 2ALZA 4EZ9A 1IBMJ 3MUMP 3UNGC 4DUZJ 5AJ3J 4NCGB 3Q8PB 3IN5A 4M5LA 2AJ4A 3BSNA 1JKHA 4DV0J 2YX1A 3GILA 2BW2A 1VQLS 1VQ9S 2HHWA 4YB7A 3FGVA 3PRBA 1L3UA 1DLOB 4MK7A 1QSSA 5IZHA 4OX8A 5J2PB 1S9GA 1SKRA 1SH2A 1SB6A 3CD5A 2GA7A 2ZZNA 1I6JA 1BWVA 3GB0A 2ASYA 1RT2A 2KRBA 3FEXB 2K7KA 4DMZA 4B3OA 1TKDA 1FKPB 3MD3A 1TP7A 2C3UA 2GX8A 3W8GA 5G0RA 1EAYC 1HLWA 2MTLA 1DAXA 2DNKA 2W1BA 4XPCA 4LJMA 1FJGJ 3IRXB 3MM9B 3K2YA 4DLEA 1H74A 3GCWP 4PEOA 3N28A 2OPPA 1S1XB 1RSCA 3TAMB 4IQXA 1TQLA 3P8BB 2Q6CA 2Y0SD 3OBIA 1N32J 1PC4A 2GJ2A 3NY0A 2CDQA 3NNAA 2EG1A 3O2IA 2FHOB 3UNYA 4KYZA 3KK3B 2Z58B 3DLEB 3QAUA 2QV6A 4BCAA 5D4PA 3CDEA 3LGHA 3LWMA 2CQ4A 1IBLF 3NS7B 4XO0A 1TL1A 4L73A 2DEJA 1LXNA 4N47A 5LJ3Y 2UXBJ 5A8WB 2F9DA 2MB0B 1P9QC 4QJVA 1R0AA 4ZCLA 4WZMA 4Y65A 1MROA 2ZZMA 3W2VB 2G2YA 5DLFA 3MURP 2JVRA 3CJKA 2DJWA 3SFUA 1FNXH 4WE1B 3GONA 3EXCX 5K8NA 1PYSB 3DLGA 3D5MA 5ETTA 2PMHA 4EWTA 3DC2A 1YJ9S 3VCDA 2XMMA 3PV8A 5IWAJ 3CSKA 3ET6A 1EP4A 2WSFC 2X7IA 4DZ6A 1J27A 4I2PA 1DRZA 1TK8A 2B5JB 2JEFA 2VA2A 1JLFA 3GIKA 3PFOA 2D69A 2D9PA 4DPTA 2XZDB 1A7GE 1J2VA 1KHVA 2DCUB 4HYKA 3IC1A 1U49A 4O3SA 3N9UC 2HNZA 1VISA 4WFZA 4DV6F 2BKOA 2OPSB 4JI8J 2DGUA 4KO0A 4FF3A 3ENWA 2CAJA 1L3KA 3FKBA 1CLFA 1GX5A 5GAHI 5L46A 4DR7F 4USIA 2CJYB 4BDPA 4FYYB 2F1FA 5HQLA 1X31C 2HHHF 2CZ9A 3P5TL 1RT7A 4MH8A 3SEOA 5KFGA 4K59A 1PJ6A 4PYDA 2DHHA 4ZPCA 1RDRA 2P9GA 1EIYB 2CG4A 4J37A 4NLTA 4DQIA 3AB2B 3CGIA 3US5A 4JV1A 1XN9A 4USWA 3OFFA 1JLAA 2W7PA 1TV6A 5T7LA 2DR9A 2AGPA 2XG8A 1FRLA 2C2MB 3BH6B 4OI0A 3LP1A 1O0PA 4FZVA 3TYTA 1GAOA 2GW8A 4MMOA 3D1OA 3QT7A 2Z8QA 1IXKA 1G3OA 3HT3A 1LQ9A 2LKZA 1NK5A 1NJXA 3RG6A 1KQSR 4X64J 4YB5A 4XAKA 2HW3A 5B0EA 1UETA 4USUA 5HAOA 2M52A 3K58A 2HFVA 4IO1A 1RWWB 5I3PA 1S10A 1LXJA 2FJDB 2BVZA 1NAQA 3HSGA 1NUEA 3BKTA 2N7YA 3DGPB 1M5VC 4P73A 1NDPA 3HD2A 2YNIB 5D0RA 1PG5B 4EK2A 3DLKA 4WIQA 4J9MA 5LXYA 2KFZA 3NS6A 4PUOB 4RU9A 2FGOA 3R3TA 4NRTA 5D0EA 3HSDA 5EX3A 1U1LA 5LSOA 1OQ6A 2E5IA 5C7PA 4OZ2A 4WWSA 2CXEA 4ZLJA 3QJJA 1H72C 4GVBA 1WC3A 3RB0A 4RBUA 3IWNC 3T1YJ 2XLKA 3KLHB 4OI4A 4RUCA 2QA1A 4WFNQ 4WBFA 4LFAF 2HGMA 1FFSB 5F0UA 1U1MA 4ECYA 2HIYA 3OXGA 1O8BA 2K8GA 3MD1A 5J2QA 9ATCB 2D3ZA 3CIMA 2V2VA 4Y2MA 1RWKB 2B9YA 2K2PA 3A8JA 1OY8A 2MY8A 3PKMA 2CJAA 3WZ0A 5M2PA 4KH0B 4I7FA 1SC3B 3R1LA 1TK0A 2C3YA 3QAEA 3P45B 3OFEA 2GGPB 2BBEA 2KT5A 1TFYA 4B9MA 3A3NB 3Q8QB 2HK3A 1GNKA 3CCZA 1X0PA 3ILIA 4KRWA 5KFLA 5BJRA 1T94A 1HNVB 1W7WA 3MM8B 4HL9A 4C4WA 1XR5A 1FI4A 1ZAWA 3KJNB 2QX0A 1UJ5A 2DIVA 1RTIA 1R89A 4FNIA 3CC7S 4DR2J 4I6YA 3V6DA 1X60A 4K8RA 4ANDA 4B9SA 1VMBA 2HQFA 3D2WA 1RAHB 3HVTB 3OT9A 3PX4A 1WSVA 2C3PA 2IPOB 3GR0A 4GC6A 4PQAA 3UE2A 2XMVA 4ITSA 2ZDOA 2OELA 4NX9A 4KHPJ 1RAJA 1AZSA 3NOCA 4QWEA 2RQKA 2X1BA 4LT6A 4ZHRA 3NBPB 3BZQA 5KAKA 4ZITA 2D74B 5B0GA 2C22A 4DWIA 3KYLA 2DRDA 1M90T 2Z56B 1NK8A 4NI2A 1RKJA 2QE5A 1V5IB 2CFXA 4ES2A 1REGX 3J7YU 4OMFG 1CJUB 3K8WA 5HBMB 1E6YA 1BE4A 2VV5A 2HG4A 1I51B 2AX0A 3M32B 4JUZA 3OLBA 1S9FA 2DNNA 5HK4A 4BHQA 1R8HA 4CO3A 1IN0A 3CWJA 3CJ3A 4YY3F 3BYRA 3HHLB 2W9BA 4K4YA 3W61A 1S48A 1DTQA 4LFCJ 2YNHA 3VVUA 2CNKB 4P72A 2XTJP 3R5AA 3PRDA 4UQGA 4WKYA 2BR0A 2ZFHA 4O4RA 1SUQA 3RAQA 1WTFA 3HSZA 4X65F 4RBVA 2VL1A 3TP2A 2OPQB 4OZ0A 4P7VA 3MPVA 4YB6A 3BSAA 2Y8WA 2H5JB 4M1KA 2ATCB 3MEDB 3CD7A 4B3SJ 2X1AA 4C98A 4C8MA 2MGZB 2RH3A 4KKOA 3PTWA 4U7UD 3EYZA 3TZXA 1FXDA 2VF3A 2RE1A 1UVKA 4OI3A 3LH2S 3LANA 1GMWA 5JXSA 1SXLA 3QT5A 4KGZB 3NGUA 4QIGA 4I2QA 3MMCB 1U1PA 2FVRA 3UN2A 3R9LA 2KH9A 2RDDA 1EJ7L 5LXRA 3M8QA 2J6TA 1YKWA 1C1BB 4KPYA 2RDJA 1TVRB 2BM1A 2YKMB 3NG8A 1Z2ZA 4NMLA 2KZZA 4JI2F 2ZC3A 2NSCA 3KDOA 5LOQA 4QR2A 3NGDA 1S0NA 1TUGB 4PZVA 3OTDA 3Q24A 4XDDA 4LSNB 3ILOA 1VRTB 4C6AA 4QIFA 4R0EA 2B9WA 1KOOA 2KKHA 2IAJB 4U9RA 5DQGA 4DV1F 1NDCA 5IT9Y 2FDNA 2IBOA 4LFBJ 3F56A 4DFKA 3BH7B 1HNZF 3X3UA 1NH7A 3D0HE 1S9EB 3DNCA 1U0HB 3VZHA 4P2FA 3UDLA 1HNIB 2P8IA 1ZAXA 2R7OA 3KK2B 1CJKA 3TANA 2J7UA 4KE5A 3W8PA 3I4PA 4U6PA 4LSLB 4MIAA 4OYBA 3G2XA 1SV5B 4Z7CA 2K1RA 1RWPB 2D7SA 4HVZA 2J7WA 3PW2A 2V8DA 3TA1A 2A10A 1WC6A 1IKXA 2OLWA 2MZQA 2ILYA 3SDEB 4ZK7M 3M8SA 3M6XA 3T5LA 4J9QA 3NWGA 4EUVA 1U1OA 1NPPA 3LF0A 2COLA 2ZH4A 2OMOA 3FDSA 4GO7X 3T1HF 5CYQB 1SH3A 5AT1B 3Q22A 3MR2A 3D1QA 3C16A 2MLXA 3VALA 2VFUA 2FZGB 2O66A 4OJGA 4KFBB 4KGVB 2AF6A 2FHJD 1EKRA 2H1YA 3C14B 5KOWA 4NE9C 2WB1D 2HZCA 2VG7B 5DRKA 1KHWA 3GPAA 3IGNA 3TJAA 4MTPA 2IYGA 1NHUA 2W2PP 1LW2A 3M2UB 2VU5A 3M8YA 2MYFA 2RRBA 2MLYA 1KBRA 5HROB 1C4CA 4J5OA 1WF0A 2HGNA 2WVEA 4WK1A 3DGVA 1VS3A 2HFOA 3R6LB 2AQ4A 3JXOA 1VLOA 5GAEU 3BGOP 3PXGa 3OVAA 2KT3A 2HHQA 3BPSP 1CJVB 3FZ2A 4OHYA 5KFVA 4Q0BA 4DG1B 2VICA 2BUNA 4X4OA 4PQUA 2FC8A 2CADA 4HKQA 4QU6A 1L3VA 4MIBA 4F26A 4ZPAA 1S1TA 3LP2A 3ISNC 2IM3A 1SJQA 1X5SA 4OZLA 5KFQA 1YITS 4PG8A 3DDNA 1IWGA 4I6WA 2DBBA 4OYOA 2CYYA 2HVDA 4ZP9A 1SC6A 3AXMA 4CH0S 2AJQA 3CD0A 1I94J 4K0KF 4DEZA 1SJFA 2HS4A 2GO8A 2HQIA 2JLEA 2L08A 5KFTA 1C0UB 3UVJA 1GFWB 2RS8A 4O3RA 3KJFB 4TY8A 1F0XA 5H9EK 2VQEF 5FDLA 1NPKA 1JK9B 3CO9A 2IM0A 3FFIB 1YGYA 1S12A 1PGZA 1X4GA 3ICLA 3DMJA 3I6PA 2W4CA 3EVOA 1JXVA 1KD1T 4NLGA 2CJKA 4Z7YA 2LLZA 2ERRA 3OR1A 3HHDA 1VBKA 3RGIA 1J5OB 2BANA 1WSRA 4ZVRB 4O0IA 3HM9A 3KJVA 3Q8VA 5EWEA 1KVJA 4FVMA 4OZ1A 1JX4A 3OJSA 1ZTTA 3VGVA 3KLIA 4RW9A 1L3SA 5AXNA 3FMBA 3AAWB 3R5CA 2DNZA 1S1VA 2ALYB 2HFSA 5DQHA 1Y3KA 5C2CA 1HHSA 3EPIA 5LSLA 4DS5A 3UR3C 3K5NA 5G4DA 4DFMA 1S7HA 1YTYA 1HA1A 3HMJG 2DNGA 1Q95G 5I42B 1IKWB 2VBXA 5LMUF 3FBEA 3OUYA 5J1PA 3ITHB 3TO8A 4WXWA 1K0TA 3CE8A 3QBCA 1GXTA 4LRBA 4C8ZA 4CI0B 5JVGQ 3CCSS 3PCOB 3Q0AA 1RK8A 2VDIA 5BXIA 2AJFE 4ED5A 2OI2A 1ZETA 1RA6A 4LBPA 2LDIA 4LR7A 4D3GA 4C9DA 4A8MP 2R7UA 4B9NA 1N33J 1H2UX 1GH8A 2RF2B 1YJ7A 4TNOA 4DCOB 4MYUA 2QA4G 1JXLA 1HBNA 5KFBA 4DR6J 5IS2A 2YPZA 4DV3J 3OFGA 2MZTA 1M5KC 2F65A 4RWWA 4K50A 1HQUB 5AXLA 4BBYA 3QYYA 3OR2A 1OPIA 1REVA 4F4WA 1HWKA 2LQ9A 1UTAA 1T9XA 2Y0BB 3GE9A 1CC7A 5E3PA 2RILA 1GT8A 1SIZA 4LVNP 2W2QP 2ZBRA 3D67A 1GQEA 4JI0F 4JI7J 1ITPA 2OP5A 3NNHA 4IG0B 3T6BA 2N82B 2F9JA 2GMJA 4DN0A 1RADB 3CJ8A 1YBAA 3ZTSA 2AX1A 4N7TA 1VQOS 4B9TA 2P2CB 4W4MA 2HVZA 2QA2A 4MJKA 1ZAVA 2DB1A 2V9WA 1YRTA 1BQXA 1DQAA 3ZO7A 1JLEB 3M6UA 1FCAA 1RGVA 1F9FA 1TL1B 2GC8A 2GVZB 3JTPA 3RB4A 2NSBA 2ZVSA 5KFIA 1TL5A 1VK3A 2GIRA 5IFMA 2ACMA 2OTLS 1L5UA 1TL3A 2ZVIA 4OFZA 1RT4A 3DRRB 2FTRA 5T41A 4ED4A 2AT1B 1RT1B 5E3QA 3DLGB 2KDOA 3K59A 1PCAA 3G9CA 4N77A 1V5VA 1NDKA 3IG1A 4O3NA 4DSIA 4CLLA 3IR6B 1HL6A 4I2PB 1HNWJ 5HLFB 4EYHB 2UUCF 2EI5A 3VGUA 5A0YA 1V6HA 2X51A 1AW0A 2MKCA 2LQBA 4F2RA 2QMWA 4M5HA 3J7ZT 2F4VJ 1VC0A 1HBOB 2E1RA 1KQFB 4QU7A 1PYOB 4QWCA 4NOHA 1X4EA 1WHXA 2OGUA 1C1CA 4KC5A 1N6QB 2L48A 2BV3A 2OMLA 1KONA 4FS2A 2RMLA 3THVA 3L7OA 5C2GA 2B9XA 4X4QA 2MKIA 1BUXA 2JC1A 1F9HA 3HHKA 2JC0A 2OD4A 3GFXA 3MCNA 2NXJA 4QIVA 4ANCA 2FZKB 4FYVB 2V68A 4LUBA 3RU0A 1NJZA 4CO4A 4PWDB 1LK7A 4LREA 1NK4A 3AD7C 2F3JA 5T7LB 1HI8A 3DN9A 7AT1B 4NZ7A 3FZBA 5A76A 3KUEA 3AXKA 1YZ6A 1T9VA 2AZ1A 3TAPA 4FF1A 4M5DA 3RR8A 2LU2A 4C3KA 2AYEA 1JNRB 4KPCA 5I3UA 2IA6A 3DKDA 2OSQA 1M1KT 2DD8S 1WEZA 3QGIA 4RNFA 5KFNA 2AGOA 3OTOF 2JFKA 5IC4B 2GNKA 2A6MA 3ZNUA 2QO3A 1VBZA 2BJ3A 4A8XA 3FNNA 3NRBA 2CQ0A 1CJTA 4YS2A 4H4MA 1WJ9A 3CCWA 4JI6J 2RRNA 2PA8D 2DGTA 4DR4J 2E7VA 1HW9A 3U7JA 1J5EF 1FRXA 2F63A 1RXOB 4CYUB 4U96A 4LF8J 4DCJB 2WRMA 1DFDA 1HKAA 2B7CB 2BJEA 3P49B 3MFHA 2KVQE 2C2EA 4J9RA 2CQIA 4AYBD 1UEKA 2J0QD 2OKQA 2VPYB 4DS4A 3H2LA 3PIPQ 3BO2A 4JI5F 1ZTWA 3VQSA 1S6QB 1F9EB 1U24A 5D0GA 3NXZA 1LFPA 4F4KA 1F2GA 2KXFA 2OO4A 4WYLA 4DSJA 3FVYA 4KR0B 4LF5J 3BJYA 2NS1B 2A18A 1G4CA 3EGNA 4FYDA 4XTTA 1BWEA 3BBCA 3DHWC 4OZNA 2EBEA 1CULA 1HI1A 3DM2A 4DQPA 3ENAA 1YJTA 3S6EA 3HK2A 3D6TB 4RW6B 3F44A 4LIWA 1N52B 2WZ1A 3CDAA 4RW8B 1OIAA 3IP0A 4X4UA 2RIJA 2W9AA 1NK0A 2FHMA 2G4BA 4A47A 4ZVFA 4O44A 5GMDA 4IKAA 2JEJA 1BMQB 4IR1A 4FPRA 3HDSA 4UOHA 2K3KA 4B08A 3MMAB 4PABA 3JYTA 5DETA 1OYDA 3C66A 4CLSA 4PG6A 1TK5A 1LWCA 1S1WB 2XYHB 5EN1A 1TKZA 1QY7A 2GMHA 3NCQA 3ZZ0A 2R8GA 1HQEB 3B78A 5LSRA 2LDYA 2I2YA 3N6NA 1C0TB 2FQQB 4L75A 2GJFA 1UMJA 2CPYA 4QW9A 2XZWA 4DR1F 4RWXA 3V2UC 3HI9A 4NZ6A 2HPUA 4F4AA 2FZCB 1XNQF 1X5PA 3N0VA 4F67A 5AE3A 4NASA 4NA1A 2M8DB 2ROPA 2CPIA 4WFYA 2DHXA 3I55S 1IR0A 1U2RA 3VAHA 5B08A 3MPYA 3GIMA 5D78A 1GEHA 4M5IA 3RTVA 3PM9A 5K8PA 2HEKA 2HNDA 2X3DA 4LBIA 2Y1IA 2V2ZA 2A2DA 2M70A 3BQ2A 3MTJA 4K4SA 3FC9A 4ENOA 1RLCL 1Q86T 4YOEA 2IHR1 1TTHB 4Y2KA 3HXMA 2V2QA 1X9WA 1S77D 3P4UB 5DJBA 3IFEA 2OPRA 1BLUA 3VHQA 2KFYA 1KQKA 4Y6IA 2R42A 2DNLA 5IV4A 4CDIA 3ZZZA 1NKCA 1D0EA 1QVFR 2ASLA 3M9NB 4Y2IA 2DKOB 2MQOA 2VD3A 1FKOA 3O5TB 4HI1A 3KK1A 2J8AA 5CD4A 2AEFA 2NYHA 2W8LA 1IBKF 5L1IA 2DY9A 2H54B 4G1QB 1RT3A 3HX9A 3CDBA 2HHTA 3EGWB 1XR6A 1SQGA 4WP9A 4BS2A 3M8QB 4RW4B 4N5SA 2RHQB 3DFEA 1XJWB 2BE9B 1U6FA 5E3RA 2UU9J 4RBTA 3LUYA 3UQSA 1NU4A 5AXMA 5CCLA 4LR9A 2MKKA 2XZTB 1R8AA 1VR6A 3JSRA 3L4BC 4ZLPA 3KLGA 4ICLB 3ETMA 1ELOA 4C11B 3TZZA 3K17A 2VQFF 1GMWD 2HHUA 2FJWA 2R2UA 2G2OA 1HYSB 3A8KA 1EETB 1QLNA 5T14A 2KVIA 2DITA 1N5TA 2EPIA 3DXBA 1WHYA 3GIRA 5DZ6A 4NLSA 5EHHA 2H5IB 5ETRA 5J1EA 4O0NA 3LA0A 3EZ5A 3FQLA 4PKDB 4JI1J 1FTRA 1DZ5A 3IBCB 2CIMA 3MEEB 4B9LA 5HMYA 2XI2A 2UVUA 2F40A 2YNFA 2GAHC 1SCJB 3MEGB 1OS5A 2P9EA 3CDWA 3DOLB 1P9YA 1I3OB 1ZYQA 1SJ1A 2VASA 1JLBB 1QAXA 5GMKa 1W25A 5ETPA 3P5BP 4TLQA 3ZTPA 3CB4A 1VGYA 4B3TJ 4WTOB 4TU9A 1PKUA 2ZHAA 1SKWA 2W9CB 4AD6A 5U47A 2HBRB 1FD8A 2H5EA 4B3RJ 3QSIA 4IFVA 4GC7A 3V5RA 3QO9A 5B09A 2R8JA 4RNMA 3ZZYA 2YH0A 1RTDA 4DLGA 3HSJA 1SIWB 3T5JA 3KOAA 5E7OB 3IM9A 4U95A 4Q2MA 3KG1A 4ELTA 3CT9A 4F2SA 3MAAA 1N34J 4C3MA 4O4GB 1VC5A 2LEAA 4IDKB 4I4BA 3OSPA 3DRPA 5LJ5Y 2VBZA 4ZPTR 4M5JA 1Q53A 4YHHF 4BC9A 3ONQA 3DHXA 3SMZA 4CT9A 3TR5A 3DRYA 2ZM6F 3PYFA 1OPZA 5ETSA 2HQ3A 1EKSA 2XS7A 4MAKA 3FCVA 4FS1A 4ZP8A 3THPA 4ZKAA 4Q45A 1Q4RA 5ETQA 4ED0A 1YX2A 4MKAA 3V4IA 1X4AA 3IRWP 1IJEB 1KR4A 3CC2S 4P9SA 1WOPA 4Q0BB 1S6PB 4CLKA 2C2DA 4NXMF 3GWCA 2CJBA 2CPDA 2ZE2A 2DH9A 1UZHA 2UUBJ 2BRKA 4RNHA 2YWEA 2KM8C 4W92B 4DU8A 5KTQA 1RTHB 5MAOA 2WW4A 5IT0A 3I87A 1N5YA 4IG3A 4RW7A 4X66J 5E3CA 3JTOA 2AYMA 3M2VA 4RX6A 5DS7A 1FJCA 3I9ZA 5KG3A 1JQGA 4JV0A 1SJ3P 4P10A 1UEUA 4TY8B 3B54A 2J8SA 3FUYA 3GG1A 4PYAA 4CT8A 2MJNA 3RRKA 3CUNA 3DMJB 4Y28C 4DPWA 3PO4A 1SQFA 3VGSA 4DL7A 2R7WA 3E2EA 4U8VA 3OR1B 4FVCA 1GXUA 5KFOA 1YZ7A 3FQKA 1VQ8S 1FXLA 2XCAA 4U8YA 2CA9A 2P9CA 2ZJPQ 3H5YA 3GSDA 1CQNA 4USHA 4A8FA 3KLEB 4B9UA 2QYCA 3I0SB 1S1VB 3D4JA 1Z4UA 3R7BB 3TQ1A 1QAJA 3FEYB 2XLJA 1U45A 2XYGB 4CZCA 3G87A 2GQQA 3TA2A 1A6LA 2CVEA 1UWBA 1XNRJ 2BYCA 4QPTA 1T95A 3X1LB 4LF9F 2R2SA 2FB0A 3DOMA 4NLXA 4A8OA 3OUYB 4O3OA 5J2MA 2MJUA 3PX6A 3AJ1A 4Y0FA 2JJ4D 4B3MF 3TUPA 3IWLA 3W5XA 5IQQA 1RAGB 3QPIA 1VHFA 3MHYA 4A8WA 2OEJA 1VRUB 1ACMB 2FD2A 4E0DA 2IRUA 3V81B 2WAQD 2BQ3A 3OXLA 4AL5A 5A8RA 2QJ3A 2YQ1A 4KHRA 4JI4J 1BY9A 1X4CA 2ZH8A 2CNNB 3DYAA 1MMDA 1H0HB 3DLLQ 3R27A 3FSXA 2CJQA 4ZPVR 1B3TA 4P75A 4ZVTB 4YR0A 3T9ZA 5L38A 5HSPA 4NLVA 3P6YC 2AMCB 2XY6A 5CHCB 1XTZA 1LKZA 1GTEA 1K73T 1RAIB 1URNA 1WF1A 3MPWA 2RKIB 3QMQA 2KI2A 1JLCA 3MECA 4RUAA 2CG8A 2VFTA 1PAUB 1ZM2A 2PN6A 2QSFA 1GXLA 1KWMA 4AFFA 1EQMA 4DJBA 2I6WA 3ISND 4DR5F 1WI6A 2YWFA 2JSXA 1R27B 2QSWA 4RPFA 4OX9J 3PYEA 1YK9A 2OHDA 1HNXJ 4Q8EA 3N6LA 5E3AA 3GCXP 3QSYB 1F5CA 2C3OA 4QBUA 2C2RA 2HLUA 2GS8A 3OQ2A 2K06A 2FVPA 2VPWB 4UW2A 3R1HA 1KEKA 2OH2A 4DV5J 3J7AN 1AXQA 2N3LA 3TUJC 1Y5LB 4QCLA 2VFVA 3CPWR 3W65A 2XMJA 2KHCA 4M5KA 1B0VA 5HP1B 3C15A 2FHJA 1VQ4S 3CJ2A 4LMZA 1M5HA 3BO3A 3PYDA 3JQKA 3AOBA 4FDFA 4NL5A 2Z4PA 2QG9B 3CTRA 1VI7A 2DR7A 1IBCB 1RWUA 2NZ4A 2MZSA 5L9NA 4AXIA 2XCPA 3TWZA 3FJ2A 2V4JB 3LP0A 2NZCA 3JTNA 3BGRA 2Z57B 1E6VA 4LF1A 2BABA 3SV3A 4IFYB 1JLGB 1FK9A 3JSBA 1MWYA 2VBYA 2VFRA 5CQGA 2MY7A 4KSEB 5HQ8A 2JNJA 1SJ4P 2L3MA 2V63A 5KFEA 4EBCA 1CC8A 3CJ5A 2UUWA 1B70B 3PJWA 2D1CA 3TA0A 4HI2A 1SQEA 4MIWA 1ZPVA 2V94A 3PNIA 1MG7A 2AV5A 3AY0A 3AOCA 3H0PA 3ETOA 2R2TA 1N36J 3H8YA 3L9ZA 5ETMA 1S6UA 3ILJA 3TUZC 4I64A 1NBEB 4JB8B 3QQCD 5CYMA 3H2VE 4WU3A 2LEPA 2AIRB 4ECTA 3POTB 1Q8KA 4TXSA 2UUTA 3KUHA 4PWWA 2DT9A 1RTJB 2R3VA 2Z2YB 5IT4A 2QIFA 1EHWA 2AZ3A 4TVAB 2IY5B 1W2IA 3OHAA 2IMOA 3OSNA 4FXVA 4MYTA 4RR5A 4FKXA 3PJ9A 3QLHA 5D0HA 3JSMA 1NMEB 2CPHA 2XMWA 2HLTA 3SXLA 3KLFA 3O44A 1N8RT 3SFGA 5I3UB 4K5RA 3WX4A 3OTBA 2WW8A 3KTQA 4IRKA 3IA0A 2Z0GA 3NMAA 1OY9A 3AQOA 4TU8A 1T9WA 1RT5A 3DRSA 1TL7A 4UY8T 3RZAA 4OI6A 2FHKA 4I68A 1C4AA 4H4MB 3PKYA 4R5PA 2E1CA 4J91A 1TAQA 3H2UB 1RISA 1TUWA 4YDDB 4ECQA 1VQSA 1RHJB 2MZRA 1NB7A 1YBUA 2OD6A 2UUAJ 3WHIA 1IKYB 1LWFB 3M2RB 3VAMA 4CO2A 1HBUA 3FBFA 4QIEA 1QTNB 2GV1A 4RKUC 1TU0B 1FX4A 2KO1A 3C6TA 2ILZA 3KHLA 3C8YA 1XC9A 3CCJS 3D3BJ 3K89A 3WC0A 2V9KA 3WBZA 2VPZB 4NCGA 2C2ZB 2G1DA 1T05B 2KL8A 3UD4P 3MMBB 2NUUG 3VAIA 3MXHP 4IR9A 3TW0A 1RYRA 5DM7Q 1NB2A 1DARA 4JYAF 2ZM6J 1FDAA 1DQ9A 3AFGA 3PW4A 1KRPA 3MZIA 2HYIB 4HHHA 4K7QA 2AKWB 4DV2J 2ATLA 1DLOA 3S1TA 5KG5A 2MHEA 2FVCA 5J2PA 4LRCA 3GR1A 1S97A 2GHWA 2EFVA 2UXCF 3WIVA 4USVA 2GZOA 2DEIA 1GK8A 1HMVB 5LM7E 3TZWA 1IJFB 4EU0A 4MFBB 3DM2B 1FKPA 4JI3F 3N5BA 4OYZA 1NZ8A 3BQ1A 1TKXA 3RW7A 3IRXA 1F3FA 3MM9A 2YQ0A 5M2UA 2MPUA 2BMBA 1NSQA 4PXCA 2AP6A 4UUWA 1S1XA 3TAMA 3WX8A 2F7VA 2J0WA 1FTCA 5KFHA 1HBMA 4CLYA 3ZFVA 2ZZTA 3SCIE 2FC9A 4LF4J 3PDNA 2ROGA 2CJ9A 3IS9A 1T7PA 5EUHA 2ZBCA 1K0VA 1V3SA 4OQJA 1S4EA 4HACA 3GU0A 3KK3A 2HS3A 2IC3B 4YN3B 1U8SA 2AEJA 3DLEA 3OLAA 1Y4ZB 3T41A 3M7VA 1TKZB 4W90B 4AQYF 3DOKA 3MPDA 1UFLA 5A8WA 2MQPA 4JV5F 1XMOJ 1YWXA 3CCTA 3S01A 2YQ3A 3RAMA 3MR5A 1WKJA 3HJFA 4DFJA 4X62F 3W2VA 2HZVA 1ZA1B 1G2EA 3D1HA 3QIDA 4WE1A 3M1VB 1SI9A 2CQDA 4LF7J 7FDRA 3G96A 4X4PA 1KC8T 4A8KA 1S4FA 1S7IA 1O51A 3W9HA 1FWLA 3OL7A 2L9DA 3G8TA 4M5MA 2NXCA 1WORA 2IIHA 3GFZA 4TLRA 2BE2B 3QNWB 1K8AT 2B5JA 2F8HA 7FD1A 2HNDB 5K14A 3OTCA 1LV5A 1FKAF 1RCOB 3E01A 3MM6B 1U1NA 1HR0F 5DDOC 4ILMA 1X5OA 3OL6A 2VH7A 2JVOA 1UAWA 4C8YA 3B4MA 2ADBA 2OPSA 2GVDB 4LF6F 5F9NA 4B3MJ 3MR3A 4OI1A 2G1HA 2OPRB 3QZ7A 3C2PA 1NXIA 2C42A 1ZH5A 4OZ5A 2HMIB 1M5PC 2PMZD 4DX5A 2W7OA 5KT4A 3KMQA 2ZKUA 5CH7B 3W5ZA 2NLWA 2J6UA 1IR2A 2B7BB 4NXNF 1XWLA 3IBFB 3VAJA 4ANEA 1KP6A 4UOFA 4DR3J 1R8CA 1DTTB 3PEHA 1RWVB 3OL8A 1LK5A 1D3WA 5FD1A 2RT3A 2H48B 4OV1A 4F0HA 4N8OA 5DDPC 3MR6A 2L9WA 3O3LA 4PRFA 4DQQA 1AUDA 1UP1A 3GV8B 1B0TA 2RHSB 2EFPA 2MKYA 2P6SA 4GKKF 2E1PA 2V8HA 3W9IA 1Q82T 1MNEA 1MMLA 1FFGB 3TVZA 3KLGB 2DNHA 3AD8C 5FLXY 5L1KA 1YHQS 2C1EB 4ZA1A 4RUHA 3DGPA 1NH8A 1FWPA 2YNIA 2EWHA 4DX7A 2MZJA 5SZTA 1FT8A 2M0GB 1F5AA 4GO5X 1WC0A 4ZIWA 4PUOA 2B6AA 5E41A 2HNYA 3AD9C 1R7IA 3IGVA 3BN4A 3BV8A 4A8QA 4DUYJ 1S6OA 3C6UA 1VJWA 4AT1B 2CQHA 4GKJF 3R6GB 3UI3A 3KHGA 2E66A 2LQ5A 3MTKA 2YNFB 3K7RA 1VK8A 2R7VA 2E5LF 1U0SA 4DV4F 1UA1A 1KFDA 2POKA 3E51A 1UVNA 5F9LA 3KLHA 1SC1B 1FDDA 3OJUA 3DU5A 3HKWA 3ZXWA 3FCHA 3HHLC 4OHZA 4OHXA 2C2NA 3MEKA 3EXYA 1U4BA 1U1KA 1MU2B 4XPEA 4FF4A 4L74A 1VLYA 5BR8F 5DG9A 3UO0A 3E8OA 1WEYA 5KT7A 1UVIA 3NL0A 4LQ9A 2JLGA 5L1LA 4ES3A 1XMQJ 2WB4A 4V1Ak 1G1XA 1NLKL 3MMJA 4MKYA 1BQNB 1HW8A 4OIXA 1Y3JA 3M8PB 2GGPA 3WQPA 1NRKA 1IBMF 1F5BA 2C2KB 1HNVA 4DUZF 3MM8A 3HHEA 2UVWA 3L3CA 5FLXU 3NGTA 2H4WB 3M8WA 2NQPA 4DV0F 3CCUS 3N01A 5KT6A 3NAHA 2XB2D 3PFEA 1C2PA 2JZ5A 3HVTA 3KDNA 2AJ2A 4IOAQ 1JJHA 5KFYA 3KKFA 3G8QA 3BPDA 3TOQA 4FYWB 3TEHB 4PCQA 3V4IB 2WVFA 2EFOA 3DCAA 3SV4A 5F3ZA 3BB5A 1T9UA 3NBPA 2XNQA 1FJGF 3V6KA 5A8KB 2BM0A 2ZE2B 3CO0P 4ED2A 4QOTA 1IKVB 5L1JA 2VODA 2VZ9A 1YJUA 1F1BB 1CJUA 5HBMA 3SQOP 1N32F 1WC5A 4DI6A 2Y9HA 3ZZTA 3UN5A 2LCWA 1X5TA 2AJ1A 4RW7B 1TR0A 2AJ0A 3HFKA 3M2VB 3M32A 3I5CA 2QTWA 2AEMA 3CCES 2BJDA 4NRUA 1CPZA 1DURA 3ELHA 3EGZA 2CDRB 3T5HA 1QUVA 3VVTA 3HHLA 3VAGA 2BDPA 5F0WA 4RJVA 2KN4A 2BX6A 1UFWA 4OYAA 2UXBF 2DNYA 1WHWA 3WIUA 3L95X 4K4TA 3N5FA 4EEYA 2EEYA 4EMDA 1NZAA 1RU1A 1T03B 3QT6A 4PG4A 4KGMA 1RA7A 2OPQA 2D3OR 3M8RA 2KRRA 5GMEA 2VC0A 4HH0A 4AUKA 5IWAF 4LQ3A 2FLPA 3BGUA 4C3LA 4JYAJ 3HCXA 1H98A 3E3XA 1G6BA 1LW0A 2EC0A 3QIPB 3HZEA 3G6XA 4USMA 1MMNA 3KXDA 4I1TA 2WOMB 4HTIA 2UXCJ 2QT7A 4LBHA 4QYZK 3EJMA 4YUDA 3U1NA 2QYGA 2VA3A 1C1BA 1UW9A 1FF2A 1TVRA 3K8VA 3LGNA 1QD1A 5F8LA 1VDHA 2BOAA 1ICEB 3Q8RB 4JI8F 3FSIA 1B7FA 5CAAA 1FDBA 4S0MA 1Q78A 2UV8A 3BGLA 1KSPA 2YKNA 1Y10A 3G82B 4LSNA 1FHTA 3QJLA 5C25A 3A8EA 2HAFA 5KOXA 2IAJA 3UFCX 1S76D 3MDFA 5C42B 4OLOA 1V3RA 1WOSA 1GX6A 2WONB 2VHGA 3BS9A 2ZC4A 1FRMA 1NJWA 4U7CA 2DRAA 2MLZA 4DSEA 1S9EA 3IXQA 3NP5A 1U0HA 2Z2MA 2I5JB 2E1MC 2RUGA 2PD1A 1NCLA 2W4DA 2D3O1 1VJQA 4P6QA 2HRTA 3DDIA 4LF2A 4F50A 1HNIA 4DX6A 3H42A 2MZ1A 3GIIA 4KGXB 4P74A 3NNCA 3MI7X 3OFHA 2ZOGA 2B0GA 3MM7A 2ZD1A 5CYJA 2JFDA 5BYSA 4LSLA 3PJXA 5HATA 2JEIA 2CPJA 3R2DJ 2VJVA 4V19X 1SV5A 2ZBPA 2ZHOA 4F0MA 2HBYB 5H9EJ 3AHPA 3JQJA 4P2SA 5F8HA 4X64F 3FMWA 6AT1B 2BJ9A 2XYPB 1M1HA 1QDUB 4X4VA 3SDEA 4Y2CA 4ZJLA 4HDHA 5HI7A 1KKHA 1IBLJ 3PW5A 3R7NB 2W2NP 1HD1A 2Y8YA 3NGSA 3U1MA 1Q8BA 1MW7A 3V6JA 3M30B 2FLOA 3DRXA 1B7YB 2J9DE 5HJXA 3UN3A 2CNLB 1S1UB 2I8EA 1UEVA 4P52A 3NKYA 2XGQA 3C14A 3RR7A 2I0XA 3PR5B 2VG7A 3CEDA 2VONA 3S7RA 4QW8A 1CSJA 5CZXA 3T1YF 4HDGA 2WVCA 3Q8SB 4CP5A 4DHVA 1JLQB 5D3GB 3AQPA 3M2UA 1X8DA 4DN9A 4X2BA 2VUGA 5F41A 5J2NB 5HROA 3SZ2A 2ABYA 1RHMB 3U1LA 2RAQA 1WDTA 2YNGB 2XHCA 3A13A 4MK9A 2J9CA 2YKPA 2IDLA 1UWAA 3CJ0A 3D7SB 1UA0A 4WXOA 2M3DA 4DV6J 1YDLA 4KBIA 1QUPA 3O1LA 1B99A 3PZPA 2IRXA 4Q43A 3BGFA 1CJVA 1LWEB 2F8MA 2HBQB 1JIHA 4DG1A 1Y5IB 4ZN1A 4DR7J 1Q7LB 1WOOA 1FRKA 3J7A1 1L3TA 1WWHA 2HHHJ 1MN9A 3PRVA 2FY1A 4DPUA 4ILLA 2RB7A 3MUVP 1RT6B 1VQYA 5F8IA 4H4OB 2MQNA 1HHQA 3WDOA 1URRA 1D09B 4K2XA 1GTHA 3A8IA 5BYRA 3H5SA 4OJ1A 5FIIA 5AE1A 1C0UA 4ZLNA 3GTYX 4DR2F 4EO6A 4EYIB 4F25A 4NLOA 5KFPA 4KHMA 5KT3A 5L9XA 5MLCV 4L3KA 3DI6A 3FFIA 3O8WA 1AT1B 4M5GA 4KHPF 3QFHA 2N4DA 2L41A 3W2WA 4I67A 2Q3PA 1U7LA 2HFNA 3M6VA 1QJHA 2CPZA 1J5OA 2B8QA 2VG5B 4FN5A 2M7SA 2HFUA 1TKTB 1WC4A 3V6HA 2PMWA 1W26A 2MEWA 2F8EX 2AHOB 2FVQA 2XY7A 1VBXA 2CQGA 4NLUA 3IAM9 3RYLA 2J6SA 3GLJA 2MHNA 1ZM3A 4FBTA 2HBZB 3DRSB 1TZ0A 4ELUA 4WP3A 5C24B 2KG1A 2GHVC 2ZUGA 5I42A 1IKWA 3HLUA 5JJBA 3J7Z5 1ZPWX 4CNYA 1ZZNA 5EDWA 4W98A 4R5PB 4NLWA 1R0BG 1M1GA 3ITHA 2ZHBA 3FRZA 1CS4B 5E5NA 5GAGU 1FESA 2E1AA 3W62A 2EG2A 3EUNA 2WBMA 1XIQA 3AT1B 3EVWA 1TFWA 2JWNA 2DGWA 4LFAJ 2BKNA 3CJRA 2OUGA 2HWTA 3R5GA 1RTZA 5B0DA 3MAQA 5KG0A 3OW2R 3R7SB 5DG7A 1H2TZ 5KFDA 2RF2A 1HPZA 1UCNA 4B17A 4B3SF 3Q83A 4G3IA 3T1AA 5K20B 5IM0B 3NOGA 2YX4A 2YBVA 1YG0A 3ADAC 5SUHA 3K57A 3GIJA 1HQUA 1RHRB 1S72S 3NWRA 4R8UB 1VOMA 1IM6A 2ZWPA 2R4FA 4E98A 2LXIA 2VG6B 3HVAA 4QQBA 3SIPB 5D4LA 4ERDA 3HT0A 4ETXA 1RZMA 5KFKA 3SSRA 1TKXB 2IFXA 4CLFA 4C7QA 2DR8A 3MUTP 1X4DA 2OAUA 4IG0A 2VB6A 2XSFA 1JKHB 5I4MA 3LAMA 3EPGA 1FNMA 1HBMB 4DL6A 4MKBA 3G6ES 3GYXB 2Q66A 5HMWA 1DQ8A 1R8PA 2JDJA 3IS9B 1S9GB 2DY1A 4PR6A 4HACB 2DGOA 4LFBF 2HSEB 1RT2B 3AH6A 6FD1A 3GJTB 4B3OB 4KB7A 3O6QA 3D68A 2B4VA 1OMSA 5G0RB 1JLEA 2A0FB 3LPEA 5LMNF 5C5JA 2B3TB 2KYZA 1SL2A 1HWIA 2ZUAA 3LGMA 3DOKB 1H7WA 2GVZA 4C8LA 2OPPB 4NYZA 4ECSA 2JEGA 1XEZA 3H98A 2B43A 2M8HA 5DG8A 1Y00A 2YKOA 3MFIA 2V8PA 1K1QA 2ZH5A 3DRRA 1O5JA 4Q8FA 4DX8H 1RT1A 3Q89A 1CG2A 3RAXA 2XMAA 4NA3A 1YJWS 2R9LA 3CVKA 1V9OA 2FJVA 3G71S 1HQ2A 4IRCA 1JJ2R 2XHWA 2A1BA 4YY3J 2CQCA 2LXFA 4KH1B 3W7BA 3ZZRA 3PEJA 3CJTA 3MWBA 5HLFA 1BHNA 3HP6A 4P2MA 1RB0A 2CPXA 5K14B 3E01B 4ZVQB 5KG7A 5KG4A 1R0AB 1QE1A 1HBOA 1MROB 3U02A 4X65J 3CJKB 3SCJE 5EGYA 4PXEA 3KNGA 1FDNA 3CCMS 5B7WA 4OJ3A 2CQ3A 2MKSA 3VAKA 1N6QA 3TX0A 2RJZA 4L76A 5DGBA 3ET6B 3EZOA 2UVVA 4FPIA 1EP4B 4YP3A 2OTJS 4R0JA 4NPOA 5F8JA 2MMYA 3EZUA 3SQGA 1HWJA 3NAIA 1JLFB 1KS2A 2K3IA 1YLXA 2YX7A 2J5AA 5IC6B 1H7XA 2B4OA 1TMMA 1LWXA 5HVGA 4DV7F 1QVGR 2WHOA 3AB4B 1AFJA 2HNZB 4OYPA 4PWDA 2OFHX 2UV8G 5DLGA 4JI2J 5L39A 4KO0B 4ED8A 1Q8IA 2HWHA 2M9KA 1FX2A 5D77A 3J81Y 2HHVA 4M5NA 1N88A 1P6TA 1WTBA 3EE3A 1N0VC 1X4HA 4JV2A 1FO1A 1RT7B 1WC1A 3MCSA 1T3OA 4HHUA 3QWUA 2NCKL 3EWGA 4DV1J 2I38A 1HNZJ 2XULA 1JJCB 1LEOA 3KHRA 4J9LA 1I94F 1RE1B 2EFGA 3OD2A 4ZP7A 2N7CA 1VQPS 1XERA 4YFUA 4OHVA 2E9RX 4OI2A 1JLAB 4XDCA 1TV6B 1RHKB 2DTJA 3RBEA 1MSWD 2B4PA 2WVDA 3I0RA 1P8GA 1APSA 4F7VA 4RO0A 2DO0A 3M05A 3LP1B 2HQDA 3B82A 1QM9A 4J9PA 2B6AB 4NMXA 2EVZA 2GMLA 3MAHA 2HNYB 1VCTA 5HJYA 4CYUA 2C28A 3D54A 3GP9A 3C6UB 3TI0A 4WZQA 4GRSA 4EO8A 3IBWA 4F3OA 2R7SA 4ETZA 2QFIA 1DY3A 3MR7A 2J7KA 2V67A 4Z37A 1ZM9A 5K5MA 2CWXA 1TAUA 2YVSA 3CC4S 4L6V3 2YH1A 1S6QA 3Q86A 4ATNA 1JMTA 2HAIA 3DLKB 4CQ1A 1R31A 2GO9A 4WFXA 3T1HJ 4DU7A 2Z2ZA 4F4YA 1YVFA 4YQWA 2IVYA 4M94A 2E5GA 4IH6A 2BEFA 2W01A 4O23A 1HARA 1RYSA 4CWBA 1RWXB 1X7VA 3KUGA 3VGTA 3OXFA 4RW6A 4C0BA 2Q43A 3J81U 4GVBB 1LFWA 4WP8A 2BE7D 4RW8A 4A8SA 1H6KX 2N3OA 4CLUA 3NS5A 1JWWA 5CZVA 4EZ6A 3RBXA 4YMEA 1BC6A 2V8GA 3I82A 4EGLA 2XY5A 4ID5A 4KQZA 2B8PA 1N33F 2HGLA 2R7XA 3MMAA 3AODA 2DYAA 2WSEC 5J2QB 1RBAA 1AYEA 1KFSA 4OYWA 4ED6A 4M63A 4DR6F 4UTGA 3W9JA 1HFEL 3W64A 1M0SA 4DV3F 1YBTA 2DO4A 1S1WA 2LYVA 3F0NA 4I7FB 4J9OA 4ZDNA 2IM1A 2VOOA 4FF2A 1HQEA 4TQSA 3EVMA 4KY3A 2HVIA 4FNHA 4MT1A 2R8KA 3UWTA 3K5PA 3J80Y 3W5YA 1C0TA 1F3VA 5E33A 4I56A 2BRLA 3ZNJ1 1ZZFA 3HF5A 2UZAA 2J0XA 2HFZA 4PAAA 4JI7F 2H51B 3D66A 3PW7A 3NLCA 3KG0A 4K0KJ 3OVBA
chains in the Genus database with same CATH topology
2R8IA 3IRXA 3OUYA 1RTIB 5J1PA 2ZITA 4QYRA 3MM9A 3VZIA 5M2UA 2MPUA 2XMTA 4ZCIA 2RQ4A 3VTIA 3ITHB 3TO8A 4PXCA 5CA5A 3V6DB 1HWLA 4H54A 1N0UA 2AP6A 4UUWA 2HMIB 1S1XA 4WXWA 3TAMA 2HS0A 2F7VA 1K0TA 2CPEA 3CE8A 3QIPA 4ZOSA 1GXTA 4QR1A 2J0WA 1U48A 1FTCA 5KFHA 4C8ZA 1HBMA 4CI0B 4EBEA 2J0SD 3LALA 4NYPA 1ZM4A 2AW0A 3ZFVA 5JVGQ 3CCSS 3Q0AA 1RK8A 3SCIE 2FC9A 3SYZA 2ZH3A 2WOMA 3PDNA 4K4ZA 5DDRC 2AJFE 3OPKA 2ROGA 4O3QA 4ED5A 2KFNA 1FNOA 2CJ9A 3TARA 2KHDA 3D28A 3IS9A 1T7PA 5EUHA 4JOUA 3THTA 1ZETA 2ZBCA 1K0VA 4F02A 1RA6A 4C9DA 2LDIA 4D3GA 1V3SA 2WBRA 4A8MP 4TY9A 2R7UA 4B9NA 4OQJA 2XSJA 5F8MA 1H2UX 4OX7A 1GH8A 4RNNA 2R2RA 4ZHRB 1P27B 2EW9A 2KXHA 2RF2B 4TNOA 2XWYA 4CTAB 4MYUA 3KK3A 5KT5A 2QA4G 1JXLA 2DNQA 2HS3A 2IC3B 5M2RA 1HBNA 3LWLA 1U8SA 3DLEA 5KFBA 3OLAA 1N4LA 1Y4ZB 5IS2A 3R5DA 3BDPA 2RQMA 3MEDA 5GADI 3RRGA 1DHMA 2VPXB 3OFGA 2MGZA 1TKZB 3P96A 2MZTA 1M5KC 2RRAA 4W90B 4RWWA 1KTQA 4AQYF 3DOKA 4K50A 1B64A 2HRYA 4DFPA 2G9OA 2DVIA 1P1LA 2PI5A 2LEBA 5E0OA 1HQUB 1UFLA 1E6YB 5A8WA 5AXLA 2MQPA 2IVFB 4BBYA 4JV5F 1QSYA 5DO2A 2PE8A 2W4PA 2X1GA 3CULA 1YWXA 2PI4A 1FE4A 3CCTA 3QYYA 3S01A 2XMUA 4F3MA 3OR2A 2YQ3A 3RAMA 5C42A 1OPIA 3PHEA 1REVA 3IR5B 1UWBB 3MR5A 4F4WA 4DFJA 3HJFA 1DJ0A 1HWKA 4X62F 3MMCA 3W2VA 2LQ9A 4C8KA 5KG1A 2WONA 1VIOA 1G2EA 1T8EA 3D1HA 4DR3F 3GE9A 1CC7A 3QIDA 4WJBA 4WE1A 5E3PA 3PIOQ 1YQHA 3M1VB 3BO4A 3DXSX 2RILA 1GT8A 1SIZA 1SI9A 2CQDA 4LVNP 2HIQA 1NKBA 1GQEA 4JI0F 2KG0A 7FDRA 3G96A 3H4DA 2FGCA 2OP5A 4X4PA 2YKMA 4A8KA 1KC8T 5J2MB 3NNHA 1S4FA 4IG0B 2MDAA 2A2CA 4DL0C 5HMZA 3LW5C 1O51A 1SL0A 2I5JA 3T6BA 3HHLD 1S0MA 2DNMA 3OL7A 2L9DA 4TN2A 3G8TA 1FJ7A 4UQTA 1LW0B 2W9BB 5D8HB 2N82B 1HNWF 3GG0A 2J9DA 2F9JA 3VWSA 2PFFB 2GMJA 1DTQB 3GFZA 4DN0A 4G1QA 4Y2AA 4DOZA 4TLRA 2BE2B 2YNHB 2DK2A 4IOBA 5KT2A 1K8AT 2B5JA 2EBGA 5GADU 5F3TA 2F8HA 7FD1A 1YBAA 2HNDB 2LMIA 2F4VF 1U47A 2AX1A 4RW4A 3G6VA 4J9SA 1VRTA 5D4OA 2ACYA 1UJ4A 3OTCA 5K14A 4PXDA 2MQQA 2LECA 1VQOS 1LV5A 2CRLA 4B9TA 1FKAF 4F4ZA 3E01A 1SUQB 5AE2A 4PPZA 3MM6B 4PWUA 2KJVA 4J9NA 1UW4A 5A8RB 2HVZA 1N5SA 5I3QA 1U1NA 1HR0F 5DDOC 4ILMA 1WI8A 4X4SA 1X5OA 3G4SS 4CH1A 3OL6A 2QA2A 4IH5A 3K5LA 2VH7A 4MJKA 1TL4A 1ZAVA 2DB1A 3CCVS 2V9WA 2JVOA 1UAWA 1YRTA 1BQXA 4C8YA 3B4MA 1DQAA 2ADBA 1Q1KA 4OLPA 1JLEB 2OPSA 3M6UA 1FCAA 3KMSA 1RGVA 4LF6F 5F9NA 3MR3A 4OI1A 1X0FA 1F9FA 3M6WA 3DYAB 3BDEA 2GCFA 2OPRB 1TL1B 1CQMA 2ZOMA 1IUJA 1RJJA 3QZ7A 2GC8A 2KM8B 3C2PA 2C42A 4ICLA 1ZH5A 2M5YA 2YKNB 3BEGB 4OZ5A 5KG6A 3ZZOA 4C11A 1ZBTA 3JTPA 4NA2A 2JH3A 3L7PA 1KLMB 2NSBA 4KKOB 3Q2SC 2PMZD 2W7OA 3RB4A 2ZVSA 1M5PC 5KFIA 1RQ0A 3N79A 1TL5A 5C25B 5KT4A 2XNRA 1VK3A 2DCLA 2GIRA 3KMQA 2ZKUA 5IFMA 2KYXA 5CH7B 1S0VA 5THWA 4CO1A 1U25A 1FD2A 2NLWA 2OTLS 1L5UA 1TL3A 3KK2A 5A6WA 2V2KA 3KHHA 2J6UA 1HYSA 3FEZA 1EETA 2B7BB 1SBRA 4I2QB 1RT4A 4OFZA 4NXNF 1XWLA 3DRRB 5HL7Q 2IJNA 2FTRA 5T41A 3VAJA 3M30A 1FEHA 4BWMA 2KU7A 3ZZUA 2CQBA 2JLFA 4K4UA 1RT1B 3IO1A 2YWKA 3T9NA 5E3QA 3MM5A 2NPIA 3DLGB 2KDOA 3K59A 1JLCB 4WIIA 2ZH2A 3G9CA 4IH7A 4WYWA 2QZ8A 3MECB 4IQMA 3AA8A 3SCLE 1R8CA 1DTTB 2PGCA 4DUYF 1DBDA 3F73A 2W7AA 3PEHA 4O3PA 4N77A 1S1UA 1LK5A 1D3WA 2BACA 3OL8A 5FD1A 2RT3A 4ALZA 2E7WA 4OV1A 4DQRA 2X3GA 3I4HX 3B4DA 2LA4A 3FSYA 3MOZA 3MOJB 3QJPA 3MEEA 4N8OA 5DDPC 3IG1A 2KTQA 3VAFA 2UP1A 3PACA 3MR6A 2L9WA 3ZC4A 4O3NA 3G8SA 4DSIA 3N4WA 3O3LA 2U1AA 3IR6B 1HL6A 4I2PB 4EFAC 2X1FA 4PRFA 2J9EA 2KJWA 4EYHB 4DQQA 5HLFB 2EI5A 4WU2A 1U1RA 1UP1A 4ZS6A 3AJ2A 1AUDA 3MM7B 5A0YA 1V6HA 2X51A 2ZD1B 1AW0A 1JLQA 5D3GA 3MEGA 2UUCF 1R6YA 2MKCA 2LQBA 2W24A 4F2RA 2QMWA 3GV8B 4KGKA 1B0TA 3J7ZT 3DOLA 2DGQA 1VC0A 5SZTA 5J2NA 1HBOB 2EFPA 5IXUA 2P6SA 2E1RA 1KQFB 4GKKF 1JLBA 4OL8A 4QU7A 2H9ZA 5CYQA 4ED3A 4QWCA 4XIUA 2V8HA 5KFSA 2YNGA 4NOHA 4A46A 4ZMMA 1X4EA 2PA3A 5JUMA 5EWGA 2ZH6A 4DQSA 1WHXA 1D1UA 4HTJA 2XS5A 5B0FA 2W9CA 1Q82T 1MNEA 1MMLA 1C1CA 2DISA 5IQ6A 2FJXA 4KC5A 4NZ0A 3TVZA 1S0OA 2W25A 4YR3A 3KLGB 3HO1A 2DNHA 1N6QB 2PEHA 5K9FA 2RVJA 2L48A 2XLIA 2BV3A 5FLXY 5L1KA 4KFBA 1YHQS 2JOQA 2OMLA 1LWEA 2VOPA 1KONA 4FS2A 2RMLA 3THVA 1OWXA 3L7OA 4ZA1A 4RUHA 2B9XA 3DGPA 1D9DA 5HMXA 2W8KA 2DHSA 3ENQA 1NH8A 2OSRA 2E7XA 4OX6A 1U1QA 4JI6F 1FERA 2XEXA 4Q7AA 2YNIA 4X4QA 2HHPA 4I6AA 2MKIA 1YRUA 1IQTA 4DR4F 3BREA 2CQ2A 1XMQF 1FRIA 3CCRS 4CCHA 2LU1A 1RT6A 1X9MA 2JC1A 3G86A 5GAHU 2OJ3A 2EWHA 4H4OA 3I56S 2MZJA 2SXLA 2I1RA 3GFHA 2M0GB 1FT8A 1F5AA 2JC0A 3HHKA 4GO5X 1VFJA 4O4GA 3TVYA 2OD4A 3RW6A 1CVJA 3GFXA 2E5JA 4DL4A 2YKAA 4PUOA 4QIVA 4XK8C 2B6AA 5E41A 3HZGA 2K1RB 1OQ3A 4TU7A 4LF8F 2HNYA 3T6JA 4LUBA 1NJZA 1R7IA 3IGVA 3RU0A 4DL5A 1UVLA 3BN4A 4IDKA 2YWHA 4A8QA 4CO4A 4PWDB 1S6OA 1Y0HA 1LK7A 3LP0B 5KFAA 3C6UA 1VJWA 2CQHA 4GKJF 3UI3A 4X4TA 3BQ0A 3KHGA 1NK4A 2E66A 2DH8A 2LQ5A 1WACA 2RDIA 4J9KA 1IKXB 3MTKA 4KV8A 2ZDPA 2YNFB 5CXTA 2F3JA 3BGRB 5T7LB 1E6VB 3GV5B 1HI8A 4WF9Q 2KZMA 1MWZA 1VK8A 1FK9B 3DN9A 3K7RA 2E5LF 2R7VA 1G7CB 1NJIT 2P6TA 2ZH9A 4NZ7A 2YKQA 3FZBA 4DV4F 4RZRA 1UA1A 1KFDA 2POKA 2R7QA 3E51A 3M9MB 1UVNA 2WK4A 5F9LA 3KLHA 1FDDA 1XMBA 3OJUA 4RU2A 2NUHA 2D41A 3DU5A 3HKWA 4LF5F 1PC5A 3FCHA 3HHLC 4OHZA 4K4VA 4OHXA 1Y9OA 3TAPA 2PIIA 4FF1A 4WCEQ 4X4NA 3MEKA 3EXYA 4M5DA 2QFJA 3RR8A 1U4BA 2IA0A 1U1KA 2LU2A 1MU2B 4C3KA 2AYEA 4XPEA 1YJNS 1JNRB 4FF4A 1WG1A 1BQMB 1ROFA 5I3UA 2IA6A 2OSQA 2AD9A 1VLYA 2KT2A 1BD6A 5BR8F 1M1KT 2HHSA 2DD8S 1WEZA 2IYIA 3QGIA 4RNFA 5KFNA 2AGOA 2FVSA 3OTOF 5DG9A 2BOPA 2JFKA 2VG5A 3H25A 3E8OA 1S6PA 1WEYA 2GNKA 5KT7A 1TKTA 1UVIA 2QO3A 5B0CA 1VBZA 4A8XA 3NL0A 3FNNA 3NRBA 4LQ9A 2CQ0A 2JLGA 3TAQA 2DHGA 5L1LA 4IOCQ 1D8YA 4HT5A 2DNOA 4HT7A 4H4MA 1FRJA 3CMES 3CCWA 4ES3A 1LW2B 2RRNA 1WG4A 3K0JA 2PA8D 2ZKTA 3VR1A 2DGTA 4A48A 4NLDA 3GYNA 2WB4A 5CYMB 1G1XA 1U2FA 3HKZD 3MMJA 4MKYA 5KFRA 1HW9A 3U7JA 3TRGA 1BQNB 1HW8A 4FP9A 4OIXA 1J5EF 1HI0P 1Y3JA 1RTHA 4N8NA 3RBDA 1FRXA 3M8PB 2DGXA 2GGPA 2M4MA 5E2QA 4DDFA 4ECRA 2DHAA 2FIUA 4G1PA 5FJ4A 2IMWP 3A1YG 2HHXA 5AXKA 2WRMA 1S49A 1NRKA 2XC9A 1DFDA 1IBMF 2B7CB 2BJEA 2QLXA 1F5BA 1HHTP 2RS2A 4KTQA 3P49B 1AFIA 1HNVA 4DUZF 1Z2LA 5C24A 3MFHA 2AGQA 1FEEA 3MM8A 1P1TA 4ZPWR 2RNEA 3DU6A 2C2EA 2OFGX 4J9RA 2CQIA 3HHEA 2UVWA 4C8OA 3L3CA 4AYBD 2J0QD 2OKQA 2VPYB 3TX8A 4DS4A 2NQPA 2DGSA 3H2LA 3PIPQ 4DV0F 3CCUS 3BO2A 3N01A 1X4FA 4JI5F 4ZCMA 1ZTWA 5F8GA 4C0OC 4QZVB 5KT6A 3NAHA 4RNOA 2AU0A 2XB2D 3VQSA 3PFEA 3UCGA 4PQUB 4IO9Q 1C2PA 2JZ5A 3DI6B 1S6QB 3HVTA 1U24A 1Q7YT 3QLHB 3ISZA 4ES1A 3OV7A 4URGA 3JSMB 2CVIA 1U26A 1LFPA 2BA9A 4IOAQ 2ZNYA 1S1TB 4F4KA 1F2GA 3LP2B 2KXFA 2OO4A 1JJHA 5KFYA 4WYLA 5CD4H 3KKFA 1NEEA 4DSJA 3G8QA 3FVYA 4KR0B 3W2WB 3QWPA 3OHBA 3TOQA 3KLFB 3BJYA 2QLWA 2NS1B 4PCQA 2A18A 3V4IB 4A8YA 2G13A 4QPXA 3EGNA 4FYDA 4P7TA 4FBUA 4Q2LA 1BWEA 4DPOA 3DHWC 4OZNA 2EFOA 3DCAA 2Q6BA 5DM6Q 3SV4A 4F8RA 5F3ZA 2EBEA 3QGGA 3BB5A 3NBPA 4BWJA 3N6MA 2XNQA 1HI1A 1RT5B 3DM2A 3H59A 4DQPA 2FUG9 4OZJA 1YJTA 4D3HA 2Q79A 4IUFA 3S6EA 4HLBA 3U27A 3HK2A 1FJGF 3V6KA 2DNRA 3BF4A 4UUXA 5A8KB 1QSLA 2BM0A 2ZE2B 4RW6B 2EK6A 4ED2A 3KLEA 4QOTA 3F44A 4DSKA 2U2FA 4LIWA 1N52B 3PW0A 5IM0A 1IKVB 3TVKA 3LPYA 5L1JA 4M95A 1XK8A 3CDAA 2VODA 3GMGA 2VZ9A 3DDKA 3I0SA 5L8RC 1YJUA 4USJC 4RW8B 5HBMA 5FDLB 2BQUA 4LFCF 1N32F 1OIAA 1QAIA 4X4UA 3ZZTA 2LCWA 3PR4A 2RIJA 4R8UA 2W9AA 4I0WA 1NK0A 1N54B 1X5TA 2AJ1A 3NCRA 4RW7B 1N5VA 3UW1A 2D3UA 1TR0A 2FHMA 1HBUB 2I9SA 2AJ0A 2G4BA 2VG6A 3HFKA 4ZVHA 3OL9A 1IQZA 4A47A 1WNEA 3M2VB 4ZVFA 3Q23A 4O44A 3CCQS 4IKAA 3M32A 2JEJA 1WEXA 4ECVA 4IR1A 3I5CA 4FPRA 3HDSA 2K3KA 3LAKA 4B08A 3CCLS 4L3NA 3C6TB 3CIZA 3MMAB 3CCES 2ALZA 4EZ9A 2BJDA 3UNGC 3MUMP 2BANB 3JYTA 2P5VA 4NRUA 4NCGB 1CPZA 1DURA 3Q8PB 3IN5A 4I69A 3I5BA 5DETA 2AJ4A 3EGZA 3T5HA 1Y7PA 2ZBIA 5KFMA 1QUVA 4CTAA 3BSNA 1JKHA 3C66A 4ILRA 3HHLA 2YX1A 3GILA 3KJVB 3VAGA 2BW2A 1VQLS 4PG6A 1TK5A 1LWCA 2BDPA 5F0WA 1VQ9S 1S1WB 2KN4A 2GQCA 5DGAA 1UFWA 2UXBF 2HHWA 2DNYA 1TKZA 1WHWA 3FGVA 4YB7A 2ZJRQ 1QY7A 5EN1A 1VRUA 3L95X 4K4TA 3KLIB 2GMHA 1RP5A 4RW9B 3NCQA 3PRBA 3N5FA 3ZZ0A 4EEYA 1L3UA 1DLOB 1HQEB 2R8GA 4MK7A 1QSSA 5IZHA 4OX8A 5J2PB 1NZAA 1S9GA 1SKRA 1SH2A 3B78A 1SB6A 3CD5A 1T03B 2GA7A 5LSRA 2LDYA 2ZZNA 3QGPA 1I6JA 3V81A 4PG4A 2I2YA 3GB0A 3N6NA 2B56A 4FXDA 1C0TB