2RQMA

Nmr solution structure of mesoderm development (mesd) - open conformation
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
141
structure length
141
Chain Sequence
GDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPIDFSKLDPGKPESILKMTKKGKTLMMFVTVSGNPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVSQDRCAEVTLEGQMYPGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of MESD45-184 Brings Light into the Mechanism of LDLR Family Folding
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
molecule keywords Mesoderm development candidate 2
total genus 31
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rqmA02
1SC6A 1O8BA 4NMLA 3ENVA 1M0SA 3KWMA 3K5PA 3LOUA 1LKZA 3CEDA 2QSWA 2J0WA 4PWUA 2J0XA 2JOQA 1LK7A 2CDQA 5IT4A 2P9GA 2MDAA 1KS2A 2ZHOA 3UW1A 3TUJC 3OFEA 5T41A 4GO5X 2RE1A 3OFHA 2QMXA 2PC6A 3OFFA 3OBIA 3HHEA 3DC2A 1ZPVA 5FIIA 3DHXA 5JJBA 2F8MA 2H9ZA 2P9CA 2RQMA 3P96A 3W7BA 2F1FA 5IS2A 2LVWA 3S1TA 3LUYA 3MTJA 1UJ6A 1YGYA 4GO7X 1Y7PA 3O1LA 1PSDA 3ENQA 3IXQA 1RWUA 3MAHA 1U8SA 3N0VA 2LQJA 3ENWA 1LK5A 3TUIC 2FGCA 3L7OA 1UJ4A 2DTJA 2KO1A 3TUZC 4M8LA 1XTZA 2QMWA 3IBWA 4LUBA 3AB4B 4GMKA 2PA3A 2RQKA 4X84A 2QRRA 3AB2B 3DHWC 2NYIA 3MWBA 1UJ5A 1YBAA 3AAWB 2P9EA 3NRBA 3OFGA 5IT0A 2DT9A 2I9SA 2JHEA 4IO1A 3U7JA 3DDNA
chains in the Genus database with same CATH superfamily
3DM2A 2LCWA 2DH9A 3Q0AA 4DX8H 3A8IA 4NYZA 4GKJJ 2MKIA 5BR8F 4X62J 1RT7B 2C3YA 2HQIA 4J5OA 4TKTA 4C8LA 4F2SA 2VQEJ 3NY0A 3BJYA 2JEGA 3KWMA 3N28A 2D3OR 5HMYA 4HVZA 3LOUA 4OI1A 3V4MA 2EI5A 2PEBA 3NBPB 2ZEJA 4FZVA 2AEJA 5L1IA 2J0QD 3VAIA 4TQRA 2G9OA 1E6VA 2AF6A 4I6AA 4ED0A 3PW2A 4DX6A 4IFYA 3W64A 5FLXY 4Q8FA 2IYGA 2OIHA 3AXKA 5LJ3Y 1TUVA 3E01B 3HD1A 4QQBA 2CJKA 2GW8A 1IBMF 4F67A 2YH1A 4K4XA 2ZHOA 1JB0C 3HT0A 1FJGF 1HA1A 2OFGX 2VBXA 1KNZA 1HNVA 4LJMA 1EIYB 4DR7J 4Q0BA 4LFCJ 3HJFA 2ILZA 1LFWA 2VG6B 1IQTA 3TO8A 3QJPA 2FJWA 1NH7A 3JTPA 1FJGJ 1WHYA 1Y3KA 3R5GA 1LWEA 4CM0A 3V81B 5CZXA 1REVB 2QN6B 1S0OA 2BKPA 4A8QA 1JLEB 2MHEA 3FSXA 1H2UX 1VLOA 1NK7A 4CLFA 3I56S 1SVDA 3FSYA 3IRWP 4H4OB 3M2VA 5F0UA 2MQPA 1B70B 1JLBA 5CYQB 2PD1A 1X9SA 3MR3A 2O01C 5E41A 2NREA 3G82B 2ZBQA 2KDOA 3FZBA 2CJXB 4FS1A 3W9JA 1D8ZA 2VV5A 2WSFC 3AY0A 3M2VB 3NS7B 3ZFVA 3PV8A 2UV8G 4DSFA 2V50A 3BH6B 2E7VA 1TFWA 2IM0A 1ZM3A 5AXNA 5C2CA 1RTJA 5IQ6A 4LF9J 2DNYA 2E7XA 1RAAB 4ZPDA 4GKJF 1SIZA 3EZ5A 2LQ8A 2VC0A 1UPMB 1U1LA 5C42B 2C2OB 2OO4A 2XG8A 2QLJB 2LA6A 3R5BA 4USUA 1J5EJ 4OX9F 2XMMA 2CPYA 3DGPA 1FVQA 1N5SA 4F7VA 5B0BA 3M9MB 1EETB 2VA3A 3CB4A 4XIUA 5K14A 4JI3J 1YJRA 2K7JA 2KG0A 4K0KF 3IGVA 5KFMA 2C3OA 3MGJA 3PRDA 2HFOA 2NUUG 4LSNA 3VGUA 4F26A 2PN6A 2K7KA 4EYIB 2KHDA 3D1HA 4IQXA 1GMWD 4L73A 2JEIA 4Q5VA 4ZLJA 2ZC3A 1E6VB 3L95X 4OZ5A 2DR6A 2CNLB 4TLRA 4QIGA 5B0AA 3C46A 2W7AA 1RTIA 2HAIA 2V8HA 3E3XA 3FCHA 2XMTA 3LTOA 2FHOB 1Q8KA 4MKBA 5KFCA 3OHAA 3CMAS 2KT2A 2KXNB 2MKKA 3BSOA 1VI7A 4UW2A 3TVKA 4L74A 1N33J 3RUBL 4U7UD 4ZCIA 2ZFHA 2DNOA 2C42A 4Q2LA 4RBVA 4CT8A 2CVIA 3KFWX 1SH2A 1Z2LA 2V9WA 2A0FB 1FERA 1M5KC 3CC2S 2R7QA 4OHZA 3ENAA 4NRUA 1BGXT 2G1HA 3W63A 4E0DA 5KT7A 2GO9A 1UZHA 1FFGB 1HQEA 1S9EA 5KOXA 3DYAB 1DTTB 4X4QA 3AT1B 4NPOA 2YKMB 4JV1A 2X1FA 3CCMS 1D0EA 4J9PA 2QL9B 1IBLJ 4ZVQB 2OPPA 3LAKA 3MECA 4UT4A 2JLFA 5KFUA 4DF4A 3RB4A 3SQGB 3ZZTA 1VQPS 1DQ9A 1PBUA 1TL7A 1YX2A 2BX6A 2IPOB 3CVKA 1F5BA 3N01A 4TYBA 1S9GB 1LOUA 3T19A 5AE1A 5DQIA 2IM3A 2WOMB 4DV6F 3JXOA 2UXDJ 3T1YJ 2GMHA 3KLIA 2IVFB 1P8GA 3WBZA 3CD5A 3PW0A 2HMIA 2HHHJ 2WVFA 5I3QA 2YNIA 4UZBA 3MM5A 2XS2A 3T1HF 1HIYA 3SV3A 4CO2A 5EWGA 3V5RA 1LEOA 1YJ9S 3R7NB 1XNRJ 4FYDA 4X4NA 2QSFA 1CEZA 1ZETA 1HPZB 1S4EA 4MH8A 2H48B 1JKHA 4J91A 4QZVB 4ECXA 1TL3A 2J6TA 4FF2A 2KH9A 3BQ2A 1IKWB 3BB5A 1TR0A 1X4EA 4IG0A 2DBBA 4FYXB 4QR2A 2ACYA 4WFNQ 2OTLS 2ASJA 2XBPA 1IR2A 2KL8A 3V4IA 2CQBA 1N6QA 2ZDPA 4DU7A 1RWXB 3T41A 2HHPA 5L9XA 2ILYA 1UFKA 3QRRA 4BLGA 2DH7A 3OSNA 3W8GA 4F4ZA 2Z56B 4FXWA 4RBTA 2RILA 2V5HG 2ZJQQ 1N34J 4DUYF 5L1KA 4MFBA 1CULB 1WC0A 3CPWR 1NSKL 4Y34A 1TUGB 3SFGA 3FQLA 3MM5B 4GO5X 1YJ7A 1J5OB 2NLWA 3TA0A 2XSJB 3PJXA 4J9NA 4OV6A 2YQ0A 1LXJA 2MQLA 2M7SA 4C0HA 5KT5A 1R0AB 4WFZA 1N32J 3F0NA 1RJJA 2FHMA 4OJGA 4DX5A 4Q44A 1NB7A 2KM8C 3WQPA 1UEVA 4DQPA 5IM0A 5IXUA 3MM6A 2BE2A 3A1YG 4EO8A 1C1CA 3HVTB 3V6DB 1BMQB 2RRAA 5F8JA 3SYZA 3VWSA 1PBAA 3TANA 4DF8A 4ZVSB 1X9MA 3FGVA 1BE4A 4N47A 1PO6A 2KFYA 1L3UA 5THWA 3W7BA 3D0GE 1TTHB 1B4SA 1FNOA 2HS3A 4RNHA 4QBUA 1UP1A 2ZBRA 3E51A 4FP9A 2RKIA 1SC1B 3KUGA 4ZVGA 4NXNJ 2E5IA 2VASA 1FDDA 3E8OA 3NP5A 1SC4B 4Y65A 4BS2A 2HW3A 1S7IA 1MROB 4LR7A 4YB1P 4LF7F 2XB2D 2W2OP 2KFNA 2AW0A 1JLAA 1WUUA 3C14A 1LXNA 1ZAWA 3BN7A 1SKWA 1DJ0A 4LF1A 4FF3A 2HG4A 4KGMA 4NCGB 1IQZA 4AXIA 1R8HA 2XULA 3LP1B 4NLOA 2QLXA 2W8KA 3KDNA 1WWHA 2B4PA 5A8KB 1RWUA 4A46A 2UUCF 4MTPA 4KV8A 4NYPA 3T5HA 4P71A 2ZZTA 1S76D 2W4DA 3FBCA 2EKYA 3L7OA 3OR2B 3P45B 3TX0A 5C25B 5LOQA 1XEZA 1NK4A 4N76A 1MMLA 2EPIA 3EXCX 3L3CA 4WIQA 4F25A 4IRDA 1X5PA 3CCES 1RWPB 3BGOP 4J9SA 1RT3A 1HQUB 1DQAA 4K2JA 3AXMA 4EBEA 1R0CB 1VHIA 4C8ZA 4QCLA 5HLFB 3DOKB 3RW6A 1B0VA 1OQ3A 4URGA 3KJNB 5D0EA 1QE1A 4LFAF 1HR0J 1R6YA 2R3VA 2UUTA 3BKUA 3R5JB 5LT5A 2ZH3A 2VL1A 4B02A 4FBTA 2R2TA 1JLQA 4DUZF 1JNZB 3OTOF 1B0TA 1R8CA 4BCAA 2U1AA 1S1XA 5IWAF 1IKWA 4LBHA 2V6AA 3HVWA 4IQMA 4XDDA 2CNKB 1IR0A 1FE0A 3M8SA 5KFPA 3TZXA 3BR8A 1AW0A 5D0HA 5EX3A 1RT6A 2GHVC 5KG5A 5KFJA 3CD6S 2YNIB 3TEGA 4WF9Q 5B7WA 1U47A 4DL0C 4OYAA 5E5NA 2DGUA 1Q95G 4IRKA 1FTCA 1LWEB 2FZCB 3MEEB 1RT5A 2ZDOA 4L3KA 5G0RA 4DCPB 4U8VA 3RTVA 1KQSR 3FFIA 4L6V3 1HFEL 1PIEA 2BBEA 2F63A 3ENVA 3MM8B 3MMBA 4I6WA 4X64F 3CCJS 1UVLA 1AROP 2DISA 2QL7B 1M0SA 5FDLA 3U1LA 1OS5A 5T7LA 1KP6A 1OQ6A 4MIWA 1LKZA 4PG6A 4B9MA 2OUGA 2QG9B 3PKYA 4DV4F 3LAMA 5JVHQ 2HBQB 4I68A 2V9KA 2I5JA 2VF3A 1TK5A 3O6QA 4DOZA 3UNGC 4ED1A 3ADAC 1VJQA 1R7IA 2CG8A 2JX2A 3D0IE 3NLCA 3ISNC 2UV8A 4OZ0A 1VBXA 1VQ5S 1HHSA 3D66A 4JOUA 4LRFA 4R5PB 3ZZ0A 4RLEA 1P9YA 1WORA 4DQRA 3MPYA 3GV8B 4V19J 1N36J 4I67A 2CJYB 2FZKB 4Z7YA 3VZIA 4DPXA 3C16B 4WYWA 2W8LA 5IQQA 1FWPA 1MN7A 1FFSB 2VG7A 2HNDA 3I82A 3P6YC 2W9AA 1RWOB 4B3RF 4JV5J 2Z2LA 8ATCB 4M5KA 3PR4A 5D6GA 2JZ5A 2QMXA 2IDEA 4K4VA 2MHNA 5KG3A 4OX6A 1W26A 3GJQB 3IAS9 3P5BP 4WXOA 2ZM6F 4OJHA 4JI1F 2DEIA 4LSNB 1HL6A 4USWA 1HNIA 3DLKA 5F8IA 4USHA 3OR1B 2Q43A 2ZH6A 2DNLA 4LRAA 3GFZA 3AOAA 1RGVA 3Q8YA 3B82A 3I6PA 2DGXA 2Z30B 5JUMA 1U1MA 1VC0A 1AFJA 2EK6A 3ONQA 2F1FA 3O44A 4M95A 1NB2A 3KK3B 1PG5B 4DSKA 2PMZD 1PYOB 3MM8A 4JV5F 1VCTA 4ICLA 2OD6A 2WVCA 4OYOA 2Z0GA 3ICLA 1DTQA 4URQU 1YWXA 1NK9A 1F3FA 1U0HB 1HNZJ 3WX8A 2NQPA 2DXDA 4H4KC 3CCSS 4NI2A 2RDIA 3MOJB 1XK8A 3GV7B 3J81j 4B3MJ 4C3MA 3DRPA 2AJ0A 2K3KA 3H25A 2FJXA 3SSRA 3I55S 4CO3A 3UD5A 1TUWA 2A18A 2RS8A 2UXBJ 1ZM4A 1HBUB 1QAJA 3C6TA 4EMDA 2MQQA 1FWLA 3I0RB 2HFUA 4CLYA 1A6LA 1QTNB 1VLYA 2BW2A 2IRUA 2XZDB 4G6VB 4OHWA 4FXDA 5KG2A 1IBKF 5KFOA 3GSDA 3UI3A 2FUG9 1RAGB 3EMTA 3MMAA 3DLEA 4NEZA 1I94J 2HBZB 3NOCA 2XY5A 1FKAF 4CYUB 2QV6A 3DOKA 1IBCB 2D3ZA 3AOBA 4WTYA 3G71S 1TKZA 1F9EB 4NLRA 2V69A 4GMKA 3MFHA 2R7XA 1BLUA 3A3PB 5IV3A 3BV8A 4YY3J 3HZGA 1LNQA 5E2QA 4X65F 2U2FA 4UUXA 4O23A 4C3KA 3DXSX 3HULA 4ED5A 2NZ4A 2AYMA 2GZOA 4M5LA 5J2QA 5BJRA 2FQQB 4GKKJ 4ES2A 3DDKA 2ZH9A 3M8ZA 1EP4B 3BREA 5J1NA 1KHWA 1BQNA 1C0TA 2G1DA 2CWXA 1NHKL 2XO6A 3OJUA 3IR5B 3LWLA 1ZTTA 2P9EA 1GT8A 3A4TA 3EGZA 1KKHA 3LGNA 4BDPA 3DU6A 3MR7A 4OI2A 1IUJA 1L5UA 3TAMB 3I4HX 2FVSA 3H2VE 5AXLA 1T03A 2M70A 2HVHA 3W65A 2LU2A 2FLPA 1WC5A 3NKYA 2YWHA 5DGBA 4LFAJ 1MROA 4H4KA 3TZZA 2N82B 4ED7A 2C3PA 1SC6A 3DM2B 2RRBA 1YG0A 1HYSA 5D78A 1MMDA 3PRVA 1VQ4S 2RIJA 3ILIA 4ECQA 3I5BA 3MTKA 3MCNA 2GVZB 2HNYA 3K5PA 2L9WA 3RAMA 2X3GA 2CQ0A 4PWUA 3UCUP 4B9TA 5HO4A 5FJ4A 3OW2R 4DL3A 3V6DA 2WBMA 1NSAA 1Y9OA 5C25A 4RX6A 5IM0B 1SUQA 2HGNA 3K57A 4OYBA 2HQDA 3KUHA 1RUSA 5JXSA 2VFUA 4KV8B 2YWEA 4AQYF 3B8HA 1SJ1A 3ITHA 3K2YA 4OYXA 2AGOA 1P6TA 1WKLA 2XSJA 1SPBP 5A6WA 3EX7B 1WACA 2PE8A 2WSEC 1V3SA 3UW1A 3QT8A 2I6WA 4BHQA 2YNHB 3OT9A 2XLJA 2HURA 1CSJA 5HAOA 2DR8A 2PA8D 1CULA 4DBQA 1RYRA 1AB8A 1NBEB 3J7Z5 2MKHA 4LR9A 3EUNA 1RKIA 1Y4ZB 2F3JA 2VUGA 2R7OA 3DCAA 3GJTB 2V67A 4KE5A 4M5GA 3TZYA 5DQGA 2OPSA 2LYVA 2QJ3A 2GV1A 4FN5A 3CCRS 1QAIA 5B0CA 1X5OA 1OO0B 1TL5A 3R6GB 1BXNA 1NMEB 1NU4A 2COLA 2HK3A 3M6VA 4P2SA 4ED3A 1JKHB 4I69A 2W24A 2QZ8A 3MAQA 4LRDA 3X1LB 5GADU 3VGSA 3MM6B 1PAUB 2B5JA 2LVWA 3R1LA 1VDHA 1QTMA 2LA4A 3JAMU 2BOPA 3N9UC 3DOLA 2XYGB 2XLKA 4ILLA 2ZBIA 4DR6F 4ID5A 1Y10A 1K1QA 3ET6A 2YKQA 4C0BA 5CCMA 1HBNA 2WOMA 3I87A 3WIVA 4ZMMA 3QSYB 5ETQA 2DHHA 3KXDA 2B7CB 3TWZA 2Z58B 2HWTA 2KI2A 2HHWA 2BANB 4DL7A 3ENQA 3MECB 2ROPA 4DU8A 4FYWB 2XQCA 2D9PA 1VQ9S 3CCLS 3IRXA 2I8EA 3MMAB 2ZKTA 3FNNA 4Y2IA 2B6AA 4K4WA 3V6HA 2V4JA 1NPKA 2XY7A 3D1QA 3DYAA 4DQIA 3T6JA 4JI4J 4F02A 1Q8LA 4LVNP 2AQ4A 3BKFA 4MKAA 3ISZA 5KFSA 2DEJA 5DZ6A 3WZ0A 1YLXA 2AU0A 2BJ8A 2BYCA 5CYMA 3QBCA 1PJ7A 4ZVFA 1SJ4P 2DH8A 1NZ8A 3WDOA 1RAJA 3D0HE 4DZ6A 2V8PA 1UFLA 1MWZA 2Q66A 3DN9A 3T1YF 1RTIB 5D4LA 1W7WA 4RNOA 2NYIA 2GCFA 2DGWA 1P1TA 1RACB 4KIAA 3KLVA 1IJEB 1PYTA 4NLQA 4DR2J 2RF2B 2JFDA 6FD1A 3QNWB 2EC0A 5LMUF 2IY5B 3C2PA 1YBUA 3CULA 4K4ZA 2MXYA 1TL7B 4LF5J 4F04B 1O5JA 1RHRB 1TZ0A 5K14B 2ZD1A 1RT1B 1WHXA 4LF5F 4L72B 2BVZA 2YKOA 3HSJA 4ZJLA 2UUWA 4MIBA 1YJUA 3W5ZA 4NLUA 5HJYA 4DL2A 2DRBA 4DR2F 1Q81T 2ZJPQ 2HK2A 4F50A 1VRTA 2OPRA 3KJFB 3QFHA 3CT9A 3POTB 1HNXJ 2CG4A 2W2NP 3H40A 4C11B 3R7SB 1HWIA 3QMQA 1FDAA 4MK7A 1N33F 1GXTA 1BY9A 2W4CA 4X66J 3CD7A 1TVRA 4HH0A 3ILJA 1H7XA 4GRSA 1V9OA 4NOHA 1CJUB 4P7VA 4HDHA 2C2KB 4P75A 5HATA 5L46A 1Y5IB 1WC3A 2G4BA 3P5TL 4TY8B 4X4TA 3A3OB 4FVMA 1MLAA 4H4OA 4P2XA 2RAQA 2KVQE 3NCQA 1N4LA 3BYRA 2BE9B 1RWKB 1T0TV 3K8WA 5IC4B 3VZHA 3KLEB 5K20B 4HLBA 3MUMP 4CCHA 3QT5A 4K0KJ 4O0NA 3CUNA 1TK0A 4ATNA 1URRA 4WU2A 4ZVHA 3H0PA 1YZ6A 2VA2A 2H4WB 5E3AA 3ZZOA 2BQRA 2FJBB 5E7OB 1X9WA 3JS9A 2WTFA 1AFIA 4DR6J 2AZ3A 2EG2A 3MEEA 4LRBA 1RE1B 1YBTA 2KT3A 2QE5A 2IAJA 3OQ2A 4LSZB 3OFHA 3KG0A 4KKOA 4KHRA 4NXMJ 1MU2A 3WIUA 4DV7J 4OZ2A 1YDLA 3VCDA 5CH7B 4QIVA 2W9CB 5HVFA 3TAPA 1HBUA 1CC8A 1C4AA 2WBRA 1K47A 3AQOA 1ZPVA 1T9UA 2J7WA 2WVBA 2E5GA 1S6PB 2YBVA 4IKAA 4DG1B 1HWKA 5KT3A 2VICA 2X1AA 3BO4A 4C6AA 4ZITA 1KR4A 1QUVA 5CYQA 2E9TA 3KNAA 2W9CA 4YR0A 2OMOA 2MKSA 3JQJA 4J37A 1UA0A 1XMOJ 1MU2B 2QFJA 1S72S 2CQPA 4YB6A 1XIQA 2C1EB 4CTAB 1Q5YA 2AYEA 1QE1B 1Y7PA 9RUBA 4LR8A 1XERA 5GMKa 4ICLB 2LEPA 4DR7F 3IFEA 4M5NA 3UR0A 1Q0NA 3CJKB 5HP1A 1OY9A 2BABA 3KK3A 3EZOA 1I3OB 4Y6IA 2M5YA 4ZPWR 4CO0A 1BQMB 3EWGA 2EK1A 1U49A 4RW9A 1IBMJ 4CH0S 2LEAA 2VPWB 2QEXS 2IC3B 2AJ4A 4M5JA 2PI5A 3MD1A 3UWTA 1WNEA 4W90B 2XWYA 3BBBA 2CIMA 2G0CA 2H1YA 2Q1LA 2DCUB 4GVLA 4RUBA 3J80U 1NKCA 1QM9A 3WC0A 2W1BA 2FGCA 4KGZB 2WSCC 5LJ5Y 3UVJB 4TN2A 3IN5A 2IRYA 3M6UA 3IC1A 1OYEA 4C8NA 1OIAA 3T9ZA 4USVA 2KO1A 3ZTPA 4RUAA 5I42A 3NNHA 3F56A 1X4GA 2QO3A 1F5CA 3C8YA 4OZJA 8RUCA 4AL5A 3N79A 4OYWA 2VBYA 3B6BA 2VQEF 2Y1LB 1X4HA 1NHVA 2V8DA 2XS5A 2J9DE 1RKJA 3UR3C 2IRXA 1H38A 2RQKA 4A8WA 4R5PA 3MEDA 3ZTSA 2MJUA 2RQ4A 1MMNA 1RT4B 2J9EA 4KAIA 3S6EA 1LW0B 3ZTRA 4LF4J 5ETLA 4O4RA 2ASLA 4ZPVR 1UTAA 2ZHBA 2MLZA 5CXTA 2RKIB 2JVOA 3BN4A 3FQKA 1HMVA 4DV2J 2B6AB 3U1NA 4J9KA 2HHSA 3R9LA 5IZHA 4B3OB 1ZA1B 2G2ZA 4KR0B 1URNA 1TKTA 1YQHA 2ASYA 2B9WA 4ZN1A 3NWGA 1HLWA 2EG1A 3VAKA 1YJWS 4AFFA 2BW7A 1ZBTA 3GCWP 2YKNA 3G9CA 1T94A 1VISA 1JLGB 3K5OA 3QJLA 5J2PB 2OLWA 4GKKF 2W7PA 3RAQA 1TL1B 5D4OA 2JVRA 1YIJS 3I31A 4U6PA 4KHMA 4ZPCA 2HLUA 3QGIA 2AZ1A 1YTYA 3QJJA 3KUEA 3W60A 4FKXA 1J5OA 4R0JA 4OI6A 2GJIA 2UU9F 4QWEA 3OUYB 2FLLA 1SL2A 2LXUA 3DXBA 2J0WA 1X5SA 5CYMB 4IH6A 3NMRA 2DK2A 4BWMA 2POKA 2RJZA 1LQ9A 2WAQD 4PPDA 5KFBA 1D9AA 3I32A 1S1VB 3KHGA 1U1NA 4PAAA 1RHQB 2M8HA 1G2EA 1ZAXA 1LK7A 3V4IB 2XHCA 2DGVA 3PYDA 1PYSB 1UW9A 4I1TA 4DCOB 3KHLA 3OLBA 2VH7A 1FO1A 4X4RA 3L7PA 5A8RB 3KNGA 4DV5J 1SKSA 1KS2A 2BACA 3QLHA 2JEFA 3NS5A 2EXUA 5ETTA 4ANEA 1HNZF 3U1MA 4RW4B 4EO6A 3KMSA 4DR3J 2HHQA 4NLDA 3BPSP 1HARA 1H72C 1Q16B 4QIEA 1HBNB 2RE1A 2FJEB 2UVVA 4M94A 4MJKA 3MUVP 3V6JA 3ZNUA 2ADCA 4EFAC 3OD2A 4EK2A 1S9GA 3OBIA 4QWCA 4F2RA 3GFYA 4JI7F 3SQGA 2DNGA 2Z8QA 3HSGA 4I6YA 3RGIA 5KFFA 2JNJA 2YNGA 4NLSA 1D09B 5K8NA 4B3TF 2H9ZA 3N4WA 1U48A 1Q7YT 4DPTA 2XNRA 2JC0A 4G1PA 2G2YA 1W2BR 3W2WA 2OFHX 3TR5A 2L08A 3BDEA 4B3RJ 1HHTP 2CJAA 3QWPA 3D67A 3M9NB 4F0MA 1YVFA 2E5LF 3HHDA 2CQ4A 4NYOA 1RISA 1RP5A 5D77A 2R7WA 2E1PA 1KDNA 3C15A 3DNCA 4M5IA 4PZVA 3VVTA 2F40A 2NYHA 2CQHA 4OYIA 4S0MA 1ZH5A 5ETRA 3T9NA 4YB7A 3DLJA 4C48A 3MDFA 3MCOA 4RJVA 4UOCA 4Y2AA 5I42B 3JYTA 2GIQA 5GAHI 2V4QA 4JBCA 2WW8A 4OI4A 2CZVC 4IH7A 3ZZRA 4CLUA 3GIJA 2AYGA 1KFDA 3FMWA 2IVYA 4U7CA 3K58A 1XMQF 5AT1B 1MWYA 3R2CJ 4CLKA 1C4CA 2O1PA 2ALYB 4XO0A 1K0TA 4RNFA 3EXYA 1OSCA 3M8PA 4ILMA 3DGPB 4NZ6A 3LQVA 4WJBA 5C2GA 3R1HA 1FESA 1LWFB 2R8HA 2P2CB 3QLHB 4CLPA 4ES3A 3QAUA 1C0UB 4CWBA 4TU7A 4YUDA 1GQEA 3BBCA 4ZDNA 3M8YA 4PXDA 4F8RA 3ISND 2FB0A 1RTDA 4FNIA 1UJ5A 1H98A 2DPIA 2YX1A 1BD6A 2NXCA 2OAUA 3BYPA 3GJSB 3QGHA 3J81U 3I0RA 1VC5A 1HNWF 2AMCB 4I56A 4IG0B 4Y00A 1U25A 3JSMA 3HFKA 1T7PA 1GTHA 3CCWA 3Q8VA 3SV4A 4G3IA 4DV0J 2JHEA 3IBFB 1G7CB 2HMIB 3M4XA 1N54B 4KO0A 3S01A 1EHWA 1FKPA 3THTA 3GCXP 2GAGC 3SZ2A 1GXLA 4MKYA 3MM7B 3H20A 2N3LA 5KG6A 5B0FA 5J2PA 2ERRA 2OGUA 4QJVA 2DHXA 4MAKA 2HQFA 2D74B 4JI6J 4KRWA 4FS2A 5H9FJ 4XK8C 1HNVB 2KXHA 3RRKA 3NGSA 2CFXA 4WK3A 2UXCF 5IFMA 1S6QA 1PJ6A 3KG1A 3MFIA 4R8UB 2CWKA 2QSWA 3FJ2A 2YY3A 3OR1A 2M0GB 4ZPTR 3CIMA 4JI8J 1KWMA 5B0EA 5E0OA 5J1PA 2PIIA 3EDRB 2UUCJ 4G65A 5KFTA 2HHXA 4J9RA 3CJSA 4IR9A 3C6TB 4NLYA 4JYAJ 3M05A 1JQGA 1RT4A 4TY8A 3TZWA 1EQMA 4EZ6A 2VG7B 2J6UA 1RQ0A 2Z2YB 3MPWA 4QIFA 1VIOA 4FPIA 5M2UA 2HWIA 3H98A 4LF7J 2V8GA 3DRPB 3K5MA 3RB3A 3L9ZA 1QVFR 3UFCX 1KONA 3AH6A 2EFQA 2BDPA 4ID8A 2FLNA 1S1WA 5EWFA 1D8YA 4LF6F 1DQ8A 4Q8EA 4WFBQ 2B9EA 4ZVTB 4F4AA 2BRKA 2VFRA 4QWAA 2F8EX 4O44B 3US5A 3GQCA 3IA0A 2I5JB 2HPUA 4AUKA 1NSQA 4EYHB 2PI4A 2QMUB 7FDRA 3I0SA 1TAQA 4ECRA 2KZMA 4MK8A 3DLGB 5HN0A 5FIIA 1N88A 2IC3A 2C2NA 2CAJA 2LXFA 3TRGA 4NLVA 3EYZA 3QIPB 1EETA 1S6QB 3H4BA 2IBKA 1KQFB 5JJBA 3RR8A 4LQ3A 1S0VA 1NO8A 2F8MA 4DFKA 3CGIA 3I9V9 3CDEA 3DKDA 3I0SB 3R3TA 2CJBA 4DN9A 4ED2A 4AL6A 3CJQA 1CJVA 4B9NA 4JV2A 4PWWA 1N32F 1UKUA 4DN0A 2BA9A 2CPEA 1R3NA 1AXQA 4Q7AA 4WFAQ 2CQIA 3JQKA 1CJKB 4KO0B 4ZP7A 4TVAB 1VK3A 1XJWB 4DUYJ 1GK8A 1NNDA 5HSPA 1H73A 1JMTA 3SEOA 2MZTA 2P6SA 3NGTA 2ZJRQ 2FJDB 3M30A 2CJ9A 3MEGB 3HM9A 3Q23A 4Q45A 3DOMA 1WHWA 3N6LA 2VFSA 1FRXA 3W9IA 1RSCA 3GONA 2YH0A 1EKRA 1VIXA 4DI6A 5J1EB 5KFHA 3QQCD 2YKPA 3V2UC 1T05B 3MAAB 2HFZA 4IDKB 4RW6B 1XTZA 2K8GA 2VG6A 3BR9A 3NGRA 5U47A 1S6UA 2CQDA 2HHHF 2QL5B 3PM9A 5FDLB 4ELTA 1OJ4A 1HQUA 4HACA 1R27B 3S8SA 4V1Ak 5AXMA 3CMES 3C6UB 4U9RA 3QO9B 5A0YA 2KJVA 3ILLA 4LIRA 1RI7A 5KG7A 3MPUB 1BHNA 3PZPA 2HQ3A 3ETOA 3CSKA 3UQSA 2FGOA 4IFYB 2PT0A 2B5JB 2E5JA 1X4DA 2C3MA 2LP4A 3D28A 3GFXA 3PYGA 4QPXA 2MKCA 2O67A 5D8HB 1B0PA 4IYQA 3GIMA 4KPYA 4O3RA 3LP1A 5KFXA 5E3RA 1CJUA 5KFGA 5KFIA 3TX8A 3SIPB 3JB9k 4HT7A 1KD1T 3N5FA 2OTJS 2F7VA 3QGGA 2GMJA 2LQ9A 2I9SA 3U7JA 2KN4A 3JSYA 1R8PA 3A8JA 5D4NA 2NUHA 4IOCQ 2APOA 3G6ES 1PAEX 3LH2S 1UEUA 3NAIA 3OTEA 2NPIA 4HTIA 1RHKB 1VRTB 3HKZD 2WRMA 3F41A 3I4PA 1T9TA 1SJ3P 4YR2A 1VK8A 2EFVA 5AJ3F 4UY8T 2ROEA 2F9DA 2XMVA 3FRZA 4KGXB 3MZIA 4P73A 4F36A 1SL0A 4DSLA 2IDLA 2LEBA 2J0XA 3F73A 4WPAA 3TW0A 4ZHRA 1KFSA 1FNMA 3MM9A 4OI3A 2UVUA 1OY8A 2H4YB 2LU1A 3A3NB 4HKQA 4RWWA 3W5XA 3F44A 2C2MB 3IAM9 4WFXA 2HRYA 5GAGI 2VPYB 5KFLA 1C1BB 1J27A 1CQNA 2MZSA 3DMJA 3VAHA 1U1KA 1HWUA 3GE9A 4FXVA 2RSQA 3AOCA 3GG1A 1AZSB 4DXLA 3PY8A 2CPHA 3LPEA 2K2PA 4USKA 2BJ1A 2HBYB 3GU0A 3GIIA 2UUBF 3BQ0A 4H4MA 2ZH1A 2B43A 1XQIA 1U1OA 2MQNA 3G2XA 1X5TA 3B4MA 4LF9F 5DDQC 3VAJA 4J7CA 1FK9A 1UVNA 1NKBA 3PYFA 4DX7A 5L1LA 2FYXA 3MMCA 4ZIVA 2DNKA 2HLTA 5RUBA 3OV7A 2F4FA 2LMIA 3HSZA 2PC6A 4OI0A 2EBEA 1M1KT 2W25A 5LSOA 2BUNA 2XMJA 1W25A 1I6JA 4URSA 3G8SA 5K8MA 3HVRA 2VKZG 2RH3A 5IC6B 1U24A 4TLQA 3IR7B 3MF5A 2BANA 3QGPA 3DRXA 2Y3YA 1ZZNA 1N8RT 1JNRB 1NJIT 3CDWA 2WK4A 3D2WA 1CLFA 4FVCA 4ITSA 2OPQB 3UCGA 1WTBA 2X51A 3GZ7A 3IG1A 1TP7A 3H5YA 4F0HA 5HMXA 3CDAA 2M8DB 1RDRA 1L3TA 4LFCF 2FLOA 3QPIA 3T5LA 2J76E 2BJ7A 3T1AA 2HYIB 1S77D 1X4AA 2CQ2A 2OPQA 1KQGB 3D6MB 1C2PA 2EKNA 3P49B 4DV0F 4M63A 2VBZA 2L9DA 4GVBB 2IYIA 4DR5J 2DRAA 2LECA 1WDDA 4ZVUB 2N3OA 1S1TA 2FZGB 1U8SA 3ZZYA 3CJ4A 3NGKA 2X7IA 4ECUA 2RNEA 1R31A 3QATA 1WELA 4RNMA 3OL9A 2NSCA 2IMWP 3BO2A 2MSSA 3OVAA 3TQEA 4LBIA 5DRKA 3IM8A 2DNQA 5GAEI 1WOPA 1HPZA 3HKWA 1F9HA 2ZH2A 3HCXA 1FEEA 1NZAA 2EVZA 5BR8J 1H74A 3DLLQ 2AGQA 3GFHA 5BYRA 1Q8IA 4TYAA 2QT7A 1EZZB 1PKUA 2M52A 1DTQB 1RTZA 5DGAA 4K2XA 4CZCA 1SQGA 2R7UA 1KEKA 3W5YA 3RJMB 4ALZA 4OIXA 3DI6A 1WI6A 4HYKA 1PCAA 5GAEU 3GP9A 5HJXA 3BSNA 2OPPB 4USTA 5KFVA 4QPTA 1BQMA 4JI5J 2W9BA 2DT9A 1Q53A 5EUHA 4DLEA 4IR1A 1VYAA 4L3NA 2V94A 1JJ4A 4IRCA 2Y8YA 1APSA 1UFWA 1LWCA 2DGOA 2LKZA 2VB6A 4D3GA 2IMOA 3BGFA 6FDRA 5D3GB 2BJDA 2E5LJ 1I1GA 1JWWA 3Q8UA 2JEJA 2ZUGA 3OXLA 3LALA 3TA2A 4MYUA 1DLOB 2K1RA 3K5NA 4IOAQ 4RU2A 1NPPA 2FD2A 2J7UA 4OYPA 3B4DA 4F3QA 3TAMA 2MZQA 2IM2A 1GMVA 1S6PA 3DU5A 4AXJA 5F3ZA 1M5VC 2DNNA 4J90A 4KHPJ 1H2VZ 3I5AA 3QYYA 1YK9A 2HVDA 4RNNA 2HQGA 3RBXA 3RBEA 4K5SA 4I7FB 3S7RA 4RKUC 3NCPA 2HWHA 3KHHA 5E33A 3VTIA 2R9LA 4KKOB 2IM1A 2HVEA 1Q1KA 5KG1A 5HVGA 3CF5Q 4ECWA 1QD1A 3M32B 1NSPA 3MI7X 3ZZPA 3IWLA 1S48A 2YX7A 3PACA 4RW9B 1RZMA 2CYYA 4ED4A 2JLGA 2UVRA 3DRRB 4B9LA 1WEXA 5HI7A 4LF8F 3BSCA 3R6LB 1Y5LB 3VGVA 4CYUA 2C2ZB 2DKOB 3JSBA 3L7UA 3H2LA 5G4DA 2RUSA 4NCAA 1SH0A 5G0RB 1FKPB 2XYHB 3O5TB 3PFEA 5KFWA 4RW8A 3PIPQ 5DG8A 2DIUA 3PX4A 3PO5A 4QU6A 1E6YA 1NDKA 5H9EK 4P74A 1VQ7S 2VKRA 4ECTA 2W2PP 2EFPA 3HHEA 2YKAA 3K7RA 4WXWA 4UOGA 5DM6Q 2OH2A 4KJIA 5LL6d 1EAYC 4N56A 3M8WA 1GX6A 2LFVA 5J2MB 3AD9C 1V6HA 2FIUA 2P9CA 2RQMA 3I96A 5IS2A 1TVRB 1U6ZA 1P27B 5GADI 1CJKA 1JLQB 2UU9J 1JLFA 1REVA 2BE7D 1TQLA 5CD4H 4OYMA 2LDIA 1YITS 2LQ5A 2GAHC 1FX2A 4F4KA 4ZP8A 3LO3A 1GFWB 2KFZA 1O0PA 1S57A 1VQ6S 1LWFA 2X3DA 1UZDA 3R97A 2W9BB 3THVA 4ZCKA 2DB1A 1FRLA 1DBDA 3KLHB 1RT3B 3MD3A 4FYYB 3VV2B 1RT1A 3GR1A 2WB4A 4WP9A 4DMZA 3M32A 1HNIB 3DLKB 3ZC4A 1N52B 1TMJA 2CPDA 3EM1A 1WEZA 4X62F 4PQUA 2C2EA 2AT1B 2YWWA 2DCLA 4NWBA 3AJDA 3N6NA 4O3QA 3EVMA 4JI0J 2HNDB 1NKEA 2RUGA 3Q2TC 1Y0HA 2GGPB 4MK9A 3GPAA 2XTJP 3AB4B 4BBYA 2R2RA 2ZNYA 4C8KA 4FYVB 4F4WA 2B51A 2IA0A 3M2RA 4PG5A 4PWDB 5F9LA 3R7BB 4DR1F 2QRRA 2ACMA 2QYGA 1U1QA 3PO4A 1P9QC 5C24B 1H7WA 4DSIA 2I0XA 1LWCB 5C7PA 2XYPB 3DGVA 4DQQA 2QTWA 4DJBA 5LMNF 1N5TA 2MLXA 3THPA 2AHOB 2VQFJ 4ZJOA 2V4JB 1KVIA 4P6QA 3BBFA 1S6OA 1FT8A 2J5AA 4NCBA 3K0JA 4KQZA 4PPZA 1GXUA 1KVKA 2R2UA 5T7LB 5ETVA 4RU9A 2ATLA 1TK8A 1L3SA 3DI6B 3KK2A 3JTNA 3G6YA 2N7YA 3AA9A 3LF0A 3QSIA 4IO1A 1SV5A 3MMBB 1N5VA 5A76A 3TUPA 3L4BC 2KTQA 2R7TA 4IG3B 2H5IB 2O3DA 5HBMA 1KQKA 2AEMA 1YHQS 1UW4A 2XHWA 3HXMA 2HGMA 5LSRA 2HZVA 2WB1D 1RU2A 2CQCA 3IG1B 3BSAA 4ETXA 1FKOA 3ZTQA 1NDLA 2BJ3A 2CA9A 1NK8A 3MCSA 2FC9A 4MFBB 4ECSA 1QSSA 3N6MA 1FA0A 1FD8A 2ZC4A 3R27A 5LXYA 1S59A 4I2PB 2B3TB 2MGZB 4CH1A 4GC7A 4DL6A 2BR0A 1JJHA 4WBFA 2NPFA 5L1JA 2MZJA 4YMEA 3JAMY 4P72A 4JV0A 1QLNA 1DHMA 5DO2A 1T9WA 2P9GA 1QSLA 1TFYA 2HVIA 4JP8A 4JI1J 4DV7F 3AHPA 2X1BA 3OXFA 3CJ8A 1B99A 4DDFA 4DWIA 2GVDB 1LFPA 4NXMF 2RMLA 1WOOA 1CS4A 1TV6A 3A8EA 3CJ5A 3Q2SC 2KRRA 5J2NB 1GEHA 3W62A 4ZVPB 1KC8T 4P10A 3NWRA 1W2IA 1XNQF 1M1HA 3KK1A 2W2QP 4NE9C 2G0JA 5FLXU 2OEKA 2F8HA 1IN0A 4DS5A 1VBYA 3HX9A 5HQLA 1TL4A 2P6TA 4FF1A 3H42A 2V4RA 4DR4F 4ZIWA 3MOZA 4JUZA 3SBMA 5IV4A 4DQSA 3KDOA 4DLGA 5GMEA 4RL1A 4R25A 3VQSA 1SL1A 4OMFG 4MMOA 2H65B 3J7ZT 2FVQA 3KK2B 4PEOA 1U2CA 3D54A 2CNNB 3JYTB 1CJTA 1T95A 4W92B 4B3SF 2QA1A 4NCGA 5CCLA 4A8XA 5KFDA 1FTRA 4B3OA 1QUPA 5H9FK 4B9UA 3HP6A 3IBCB 2GS8A 2GNKA 4HL9A 4OV1A 1YSJA 4F4XA 3CIZA 3UE2A 4K4UA 1F0XA 2DITA 2HIYA 4WP3A 4Y28C 2OPSB 5HQMA 4X66F 2Y0BB 1X0PA 4HI2A 1LW0A 1FK9B 5KFEA 1F2GA 3PW7A 2JC1A 4A47A 1HNXF 1U6BA 4HDGA 3IMQJ 2VOPA 1YRTA 2GQQA 2QYCA 3O1LA 2CPXA 4H4MB 4DHVA 2E9RX 2NSBA 3QAEA 2BMBA 1JIHA 2VDIA 3TVZA 4DL5A 3BGUA 4L75A 1HWJA 1ROFA 5I3PA 4XPCA 3GYNA 3PVXA 3GLJA 3LPYA 2E44A 4CH7A 4ED8A 2C3UA 1HHQA 1VQNS 2GX8A 4I4BA 1ITPA 2HNZB 3KJVA 2LQJA 4DFPA 1Y00A 1HI8A 3ENWA 3UVJA 3NG8A 2B4UA 1SC3B 2W4PA 4ZVOB 3OL6A 2KG1A 1NCLA 2Y0SD 1SXLA 5LMUJ 1DAXA 4CDIA 1HW8A 4ZN3A 3RB0A 1HD1A 2ZH5A 1FD2A 2NCKL 4J9UE 3C6UA 1EX8A 1H6KX 1RAFB 1U0SA 2ZOFA 2CXEA 2GIRA 3AA8A 4ILRA 4RW4A 4LBPA 4ED6A 1VFJA 3IBWA 4LREA 4B08A 2XMWA 1Q86T 3CC7S 2GVZA 2HNYB 2L3MA 2VFTA 2XMKA 2ZUAA 3FBBA 3JTOA 3R5CA 3W9HA 1AYEA 1CS4B 1TV6B 5HP1B 1KLNA 3MAAA 4IDKA 2B4VA 2DY9A 4UF4A 1HBOB 1JJ2R 3T5JA 1KLMB 3BZQA 4M5MA 5EN1A 4TXSA 1S1UA 2HAFA 3EE3A 3TVYA 2C28A 3QRQA 3Q8RB 1AT1B 5SZTA 2PO4A 5ETOA 5CQGA 2QLWA 1FDNA 5B0DA 5KFQA 1FXLA 3J7YI 1VOMA 4JI4F 1UWAA 3OFGA 1FXDA 3PDNA 3NXZA 5IT0A 4KB7A 3PX6A 2DRDA 3CJ2A 3UDCA 3VVUA 2A6OA 2CQGA 5ETMA 1FKOB 1NXIA 1AUDA 2HVZA 4OHYA 4NI2B 1U8WA 1JLEA 5HROA 4LMZA 3BGLA 4WWSA 4NA3A 1U0HA 2F4VJ 2IAJB 3FMBA 1HI1A 4C3LA 3LWMA 1U1PA 2R7VA 4A4JA 1KN6A 3QT7A 4HR2A 4USJC 4FF4A 1N48A 1J2VA 2HS0A 2KM8B 2EFOA 2G13A 2QLFB 2KB2A 2KRBA 4HACB 4ZS6A 5I3UA 1TKZB 4K4TA 3BQ1A 2JLEA 1QAYA 1UVJA 2RHQB 4RW6A 5C5JA 5GAHU 1S97A 2MQOA 2DD8S 4Y2CA 1SH3A 2XMAA 1N0UA 3ILOA 2JOQA 2RD5C 4K4SA 2Z2ZA 2OKQA 4OFZA 2OJ3A 1SJRA 1NPRA 2UZAA 4U67Q 3J7A1 3SSQA 1F6TA 3DOMB 2VG5B 2V2VA 4CNYA 1VHFA 4ZK7M 1I51B 4WP8A 1Z2ZA 2O5DA 1MW7A 3HF5A 3QFWA 4A8KA 3T3FA 4X4OA 3BGRA 4PWDA 1PC5A 2EFNA 3OFEA 2GGPA 2HFVA 4O4GB 2BOAA 4DV1J 4B3SJ 1A0OB 3AODA 2HIQA 4MIAA 5D0RA 5F8LA 4TU8A 1DURA 5D4PA 4ZP9A 1WKKA 3KJQB 3RBZA 4W98A 4PXBA 3MEKA 5DLGA 2VU5A 4CLZA 3VAGA 2QA2A 3AJ2A 1T9YA 2HKEA 3HSDA 4I2QB 1RXOB 1NRKA 3B78A 1FRJA 1WDTA 2Y9HA 3DHXA 3QIPA 1X31C 1F9FA 2FHJA 4JI8F 3KOAA 4WZQA 3D6FB 4J9MA 1JLCB 2KHCA 2K3IA 2RU9A 1L3VA 4I2QA 4NLPA 8AT1B 4AE5A 2UXCJ 4DS4A 3KKFA 3CJKA 2FVCA 2XEXA 3VAFA 2D69A 2D41A 3MTJA 2KU7A 3MM7A 2YTCA 1FFWB 2WVDA 4J9VA 2H54B 4NEYA 2VONA 1YGYA 1QJHA 1S1WB 1WEYA 3AJ1A 3QIDA 4OZNA 2HQCA 1JLFB 2PDAA 2WW4A 5HROB 1WF1A 1XR7A 4OHVA 3OSPA 2XGPA 2ALZA 3OVSA 3EPGA 3PFOA 2CZ9A 2HBRB 2IFXA 3BGRB 4KFBB 4CNZA 2IJNA 2GQCA 2YPYA 3OTDA 4X4VA 3G82A 4ZLLA 3JSMB 4BWJA 3Q8SB 2FJAB 4OX8A 4M5HA 2ZOMA 5EHHA 4OX7A 2PFFB 5KFZA 3RAXA 4OHXA 2RB7A 1T3NA 4WYLA 3SQOP 1F2HA 2DJWA 1X4BA 3NGUA 2XCAA 4M1KA 3CE8A 4Z37A 1UL3A 2XSFA 3GV5B 2XS7A 4KTQA 4NLGA 1BWEA 4RWXA 4CQ1A 4KC5A 3KLGA 4RR5A 4LUBA 5HQ8A 1GTEA 1EARA 1R8BA 2A2CA 5T14A 5AE3A 2NXEA 4YY3F 1YRUA 4X65J 3OL8A 2OSQA 3AD8C 3ETMA 2VZ9A 4HHHA 4NASA 4E8UA 3KYLA 3R2DJ 2HZAA 2XLIA 4UUWA 2DY1A 2Q79A 1T9VA 4PKDB 4ID5B 2OHDA 4N8NA 2G0IA 3Q89A 4CT9A 1F5AA 2CPZA 3MXHP 2V68A 4EU0A 1FRKA 1IBKJ 3FEYB 2WONA 9ATCB 2HNZA 1U09A 2KYXA 3KJVB 2BQUA 1CVJA 2PMHA 2AKWB 2VJUA 4DPYA 4C7QA 4E98A 3ZTOA 2DNMA 2MY7A 4ZKAA 4ECVA 2UXBF 3CWJA 1RWMB 1B7FA 2EC2A 2G2OA 1VR6A 5KG0A 4W4MA 4HHJA 4YHHJ 1UVMA 4ZLPA 2XM3A 4PCQA 2ZH8A 1RADB 1G4CA 2BKOA 1JXVA 2DHAA 2D3UA 3UN3A 5EWEA 1Q82T 3IO1A 4B9VA 5MLCV 3C19A 3HPOA 2BKNA 2CKWA 1RAIB 3W2WB 4CIOA 3IR6B 1C0UA 2JL9A 3HD2A 1VMBA 2BRLA 1R6VA 3QZ8A 3EPIA 1LW2A 1HD0A 2Z2MA 4QU7A 3CCUS 4OJ1A 2V8VA 1PC4A 1R89A 1HBMB 2VDHA 1GH8A 3CEDA 1QY7A 2J8SA 4ANCA 4UOFA 3WX4A 4C9DA 1CBKA 2FVRA 1C1BA 4CLTA 4YP3A 3PW5A 2NS1B 3LW5C 5JVGQ 3BS9A 4JI7J 4DV3F 1NK6A 1RWVB 2CUYA 2KVIA 1SUQB 2RF2A 2ZVSA 2ZM6J 3J7AN 3TQ1A 1BQXA 2DO0A 1S4FA 3QT6A 1FJ7A 2P5VA 4YR3A 1X7VA 2VJVA 4NLXA 3MURP 4ZVEA 4EBDA 2H5EA 1HBMA 3EVOA 2NXUA 4RZRA 1SKUB 1QVGR 1YZ7A 5KTQA 1HI0P 1IWAA 1WKJA 1Z1ZA 1IXKA 3C15B 4WE1A 3SI8A 4FNHA 2OEMA 2GVDA 1ACMB 1FNXH 1PGZA 1FE4A 3HHLB 1KBRA 2IVMA 2YWGA 4DV5F 3TAQA 1M90T 5ETKA 4IFVA 1FEHA 2AIRB 1HW9A 4RBUA 1RCOB 3G87A 3W66A 1BC6A 3MCMA 3TP2A 3HHLC 4WCEQ 3OXGA 4PYAA 5F3TA 3PYEA 4EBCA 3MR6A 1A7GE 1TL3B 3N5BA 4IUFA 1CG2A 3LGHA 1FVSA 1M5SA 2A2DA 1ZM9A 3G6XA 4Z7CA 1RHJB 1XBWA 3OUYA 1P1LA 3G8TA 4DV4J 3TI0A 3H4DA 2BE2B 3P96A 2CZ4A 1IKYA 1Q4RA 1YJTA 2E66A 3DFEA 2L41A 4A8OA 3S1TA 5GMDA 3M8RA 4H54A 1RB0A 1X4FA 2M2BA 1AA1B 3EVWA 4X64J 5A8WB 3GIRA 5HBMB 5MAOA 1B7YB 2FC8A 1XNQJ 1REGX 1WC4A 3L09A 3HT3A 1WF0A 3SCJE 4CO1A 3H90A 4NLTA 2EBGA 2EW9A 1RBLA 4U96A 3HLUA 7FD1A 4UZCA 3VHQA 2V2ZA 3CO9A 4ELVA 4OLPA 3R8YA 4EGLA 1TKTB 1XWLA 2A6MA 3TJ9A 2MZ1A 1NUEA 4N41A 3OL7A 2VPZB 1OSDA 3N0VA 3KMQA 2XY6A 2V2KA 1N56A 3MUTP 4KGVB 2MQMA 2EEYA 1WF2A 1MWQA 4IFVB 1U45A 4EZ9A 1UJ4A 2VPXB 1IR1A 2MKJA 3HHLA 4I64A 2DTJA 3OTOJ 1QDUB 4K4YA 2HHTA 2MKYA 4QOTA 3MEDB 1U26A 4QW8A 4C98A 1S10A 4B9SA 2N4DA 3PEJA 1HR0F 2QMWA 4LF4F 4KT0C 5K5MA 2E5HA 4K50A 4U7UK 2UUAJ 3FRYA 1RBAA 1G6BA 2DNZA 2AJFE 2JRSA 2XZTB 5M2PA 1WG5A 4Y2MA 1FRHA 3ITHB 3W2VB 2GFFA 1NDPA 4A48A 1NK5A 2HS4A 3HK2A 3NNCA 2YQ3A 2ZHAA 1TL1A 3H59A 2BM1A 5I4MA 4P2MA 2R8KA 2MSTA 3AAWB 4ZCMA 1JX4A 2W01A 4WKRA 2HGLA 2DIVA 1T11A 2I1RA 1N5YB 1R8AA 2BXJA 2NXNA 1JXLA 4DR5F 2PGCA 4LIWA 3UD4P 4RUCA 2HHUA 2B4OA 2VD3A 4DFJA 2F9JA 3I9ZA 4K8RA 1B3TA 2H5JB 1BWVA 3AD7C 5F9NA 3VALA 1AUSL 5GAGU 2MJNA 3NAHA 2HEKA 2M88A 2D9OA 4C8OA 3C3LA 3PIOQ 2E1AA 2CPJA 3P3DA 3OVBA 2UUAF 2V63A 2R8IA 1GMUA 1MNEA 2OEJA 2AD9A 2KZZA 1ZM2A 1IKXB 2W7OA 3P8BB 5K9FA 4PUOB 1F3VA 1XMOF 3AQPA 1FDBA 4C8YA 4JI0F 1RBOB 3EGNA 5J2MA 4NX9A 2GMLA 1HWLA 3CDUA 3FUYA 2VG5A 3CW2C 3BEGB 2Y1RI 2NZCA 4LQ9A 4OZ3A 3RZAA 4C2MA 2RDJA 3D4JA 1BQNB 1C0TB 1RABB 2MLYA 3FKBA 2GHPA 3ZZUA 2GJFA 2BZ2A 5IT4A 1U6FA 1R0BG 4YB5A 2DNHA 5DETA 3GWCA 3PHTA 4LT6A 4R0EA 4NZ7A 2AP6A 3UN5A 3DRRA 3OTCA 3NMAA 5T41A 5C42A 4ZPAA 3Q8PB 3KLGB 4OLOA 4NA1A 5DJBA 5ETSA 1OY6A 2MEWA 3DLEB 1RWWB 2AWZA 2HSEB 3V6KA 5H9EJ 1N34F 3SCIE 3GR0A 3CCQS 3KLEA 3HO1A 3CDBA 1KVJA 2W2MP 2VIHA 3FCVA 4PR6A 2A3JA 3K17A 4OQJA 1RAHB 2R42A 4PG7A 2ABYA 3G6VA 2DPJA 4UY85 1FX4A 1PILA 2ZE2B 5IT9Y 4F0KA 2AJ2A 2YX4A 5EGYA 2JWNA 1UAWA 3PX0A 3CNQP 3H2UB 4DG1A 1WC6A 2BM0A 2XWXA 2Y8WA 3BH7B 4CLLA 1F1BB 1NEEA 1IKXA 5F41A 1WC1A 3RW7A 4DEZA 3FBFA 3MMJA 4KYZA 2ZNZA 4ZOSA 3LUYA 4ZJQA 3M7VA 2JFKA 1K0VA 5IT9U 1RTDB 1OPIA 3FCWA 4PXCA 3EGVA 3BO3A 4LF8J 1RA6A 3HZEA 2OPRB 2E7WA 1CJVB 5HLFA 2C22A 3IS9A 4IOBA 2MMYA 3A12A 3DLHA 4O3OA 1YI2S 5CABA 3UD3P 4Q0BB 1TAUA 3T6BA 3TEHB 4KH1B 3M9OB 1WG4A 5CZVA 1VQLS 3SXLA 1RAEB 1NJWA 4YDXA 3W3SA 4QIWD 4AT1B 1K1SA 5L39A 3SMZA 4NL5A 2LXIA 3CJTA 3E01A 4DV3J 4X2BA 1RA7A 1ZTWA 4O3NA 3OR2A 3HHLD 2ZOGA 3TUIC 4KHPF 4QYZJ 1ZA2B 2ZWPA 2YWFA 3G86A 3D5MA 2EFGA 4ZPBA 3H7HB 3PRBA 5HK4A 3HFZB 2BEFA 4M5DA 5HANA 1HQ2A 3NBPA 3D6TB 4WKYA 3NGDA 1S0NA 3C16A 3MHYA 2BQ3A 5DDPC 3M8QB 2QA4S 2ZZMA 1HKAA 1G1XA 4ECZA 4QR0A 2R7SA 1DZ5A 5EX0A 2DXFA 4FPRA 2R7RA 4PUOA 1ZS6A 4DSJA 3LP2B 4LRCA 4WTOB 2J7KA 4C97A 1D9DA 2GIFA 2AJQA 4C11A 3D68A 4YHHF 4P7TA 1UCNA 2M4MA 3POTA 4TY9A 3Q8QB 4IO9Q 4JI5F 6AT1B 4TU9A 4F3OA 2C2RA 2OP5A 2UVWA 3M1VB 3BKTA 2HHVA 1KRPA 2RS2A 2YNGB 3NRBA 2PFDA 2HZCA 3MR5A 2DXEA 2ZD1B 1TELA 3D3BJ 5L8RC 5LSLA 1LWXA 2E1CA 4TNOA 3OTBA 3AFGA 2VOOA 2YWKA 4UQTA 1J5EF 3FFIB 3FEZA 5CHCB 2EWHA 1RT5B 1O8BA 5LM7E 1JK9B 2VC1A 5K8OA 3GYXB 1YJNS 5AE2A 2GHWA 1ULRA 3K8VA 3TA1A 3EICA 2CRLA 4P2FA 5IOLA 1GNKA 4K5RA 5KG4A 4ANDA 3KLFB 1X0FA 4OL8A 5J2NA 1RLDA 2Q6BA 3VR1A 3K59A 1WI8A 1ICEB 2J8AA 5A8RA 1TKXA 1S1XB 4DPWA 2DGSA 1U02A 3RB6A 3NOGA 2VBWA 3FK4A 1DARA 1D3WA 3A8KA 4QYRA 3KHRA 1NLKL 3RBDA 1HBOA 1S1TB 3OPKA 1TKXB 2IHR1 4NZ0A 5ETPA 2DGQA 4ETZA 3IRXB 1RT2B 5KAKA 5KFYA 1K8AT 1EQ0A 1IWGA 1FWKA 3O2IA 4XPEA 5CYJA 1T02A 2D1CA 5HMZA 2ZH7A 2JJ4D 3TUJC 2AEFA 3QWUA 4DUTA 2DGTA 3O8WA 3SCLE 1RTHB 3D3CJ 4A8YA 3PKMA 3OHBA 3NL0A 1Y11A 3M8PB 2L48A 1D9FA 4C4WA 1XC9A 4CM2A 3M2UB 1AZSA 4C8MA 1JJCB 1I5OB 5A8WA 5A2QU 4QYZK 1ZAVA 1MSWD 4PQAA 2RHSB 1NJYA 4AQYJ 4HI1A 1SV5B 1K9MT 3MM9B 4RW7B 1WJ9A 2DO4A 2JDJA 2FDNA 2HFNA 4DPOA 4OZLA 5A8KA 1SBRA 1UPPA 1Q78A 3LP0A 3CO0P 4NA2A 2JH3A 4F3MA 4TQSA 2XGQA 2XC9A 2VFVA 2BJ9A 1KTVA 2CADA 3PHEA 2FY8A 5DLFA 3E2EA 3EZUA 3HMJG 2ZVIA 4YFUA 3H5XA 2IIHA 2SXLA 4X4UA 1FRIA 4E2FB 2ZZNA 3LANA 4PYDA 4KY3A 2ADBA 1HYSB 1RHMB 2QFIA 3HFVA 4I0WA 5C24A 2KXFA 4DV1F 1VGYA 1VRUA 4GO7X 5DG9A 2M9KA 2IA6A 2QIFA 1Q8BA 3PTWA 2E9ZA 1X4CA 2ZITA 2UUBJ 3LP2A 5KFNA 3NNAA 1K44A 4A8MP 4WIIA 4X4SA 2YNHA 3PJ9A 1GAOA 1WTFA 1QSYA 1O6XA 1RAOA 2DR9A 1ZZFA 1B64A 1IKVA 1CJTB 2GQ2A 4CP5A 2FTRA 3Q86A 4M5DB 2F65A 7AT1B 5EDWA 3DMJB 4UQGA 1XMBA 1ZPWX 1XR5A 1X60A 4PQUB 4NMXA 1BUXA 4PXEA 4WK1A 3UNYA 4UOHA 5KT4A 1FJEB 5F8NA 1EP4A 3B54A 3IGNA 1VS3A 1N5QA 4ZHRB 1RYSA 1H2TZ 2FJVA 1FF2A 5DQHA 3TUZC 3QO9A 1VBZA 5AJ3J 3UDLA 2AV5A 3M2UA 2FPHX 4O3SA 2YVSA 2AX0A 4HEA9 4O0IA 3KK1B 3KLHA 3D9BA 2GO8A 4NRTA 1M1GA 1A9NB 2PA3A 1S99A 3HI9A 2O66A 2RU3A 1LW2B 3C66A 2Y1IA 5D15A 2IBOA 3FEXB 2LLZA 5DG7A 1T9XA 2AYBA 5AXKA 2Q3PA 2M3DA 3PJWA 4QW9A 3FVYA 4CTAA 1KOHA 1SB6A 1KTQA 3UPFA 1RTJB 4Y2KA 5DDOC 1G3OA 4Y0FA 1I94F 1SQEA 4DL4A 1YBAA 3EGWB 2R8JA 4KBIA 4N7TA 5B08A 2BJEA 2H51B 4G1IA 4Q2MA 2PEHA 2R4FA 1H0HB 4I2PA 2MGZA 3TJ8A 1NJXA 3M30B 3MEGA 2LQBA 3PNIA 3A13A 3U27A 4L76A 3QZ7A 2J6SA 3R5DA 2FHJD 3Q22A 2ZE2A 2MTLA 4A8FA 1XR6A 1FI4A 2OMLA 2WONB 3PG9A 1Q7LB 1V3RA 3NCRA 5DZ7A 3CD0A 4CI0B 2XCPA 2ASDA 5M2RA 3D6HB 2YNFA 3RYLA 1UVIA 1SJFA 2QC3A 3DDNA 4MYTA 4B3MF 1U1RA 4CLWA 3DLBA 3V81A 4USIA 4EWTA 2XMUA 5A0YB 1VBKA 2CDRB 1U2RA 4IG3A 4OJ3A 4DCJB 4X4PA 4DSEA 1JLGA 4MKVA 4WZMA 1FHTA 1UEKA 2ZBCA 4BC7A 1D1UA 2F4VF 1TMMA 2HFSA 4EUVA 5KFKA 2QA4G 4AL7A 4LVOP 5CD4A 1T05A 4N5SA 5J1EA 4KSEB 1M5PC 4ELUA 3BPDA 4RUHA 3CMQA 2DNRA 1WG1A 1HMVB 1MN9A 2B0GA 2E1MC 3IP0A 4KPCA 2CDQA 4HH1A 4AD6A 5H1SV 3OJSA 1NHUA 1Q5VA 3NEKA 2RQCA 2MDAA 2MPUA 4MT1A 3PXGa 3UDVA 3WC2A 4HHUA 4P52A 3TNVA 4OZ1A 3HHNB 2B8QA 3LGMA 1Y3JA 2RRNA 1EB0A 1WD6A 2MY8A 4O4GA 3M2RB 2CQ3A 4KFBA 4Z2XA 4BC9A 3CC4S 3FSIA 3TYTA 2AGPA 3RU0A 3P4UB 1DLOA 1S7HA 2K1RB 1WSVA 2KKHA 2KT5A 2GC8A 3M8QA 5KOWA 1N36F 2B7BB 1SKRA 1RK8A 1SIWB 2RDDA 3UDEA 5JMNA 3Q24A 5D3GA 1RCXB 1SJQA 1IJFB 2A1BA 2WCXA 5DS7A 2KJWA 1V3ZA 5F8GA 3OFFA 1VQ8S 1L3KA 3HVAA 1U2FA 4PABA 5B0GA 4ER8A 2IJFA 3BDPA 2J0SD 2HRUA 1U7LA 2B9XA 3HDSA 3D1OA 3CCTA 4KH0B 5A2QY 2D7SA 4R8UA 3K89A 3FBEA 2Y1JA 4LFBJ 2ROGA 2N4CA 3HJVA 1N5YA 4ZVRB 3PW4A 3HHKA 2Z57B 3PCOB 4Y3CA 4AYBD 1S0MA 4YEAA 5FD1A 2X1GA 3SDEB 3J7YU 4DR4J 5KFRA 4EEYA 4LF6J 3GYGA 4J9OA 4FDFA 4F4YA 2C2DA 4P9SA 5GVQA 1N0VC 2KYZA 2B56A 2OI2A 5BXIA 5L38A 3W2VA 3QRPA 2R8GA 1DFDA 2YNFB 2B8PA 2OELA 2YPZA 1LV5A 2MZRA 5DM7Q 3TJAA 2CPFA 2LDYA 5ADZA 1PSDA 1V5IB 4ZLNA 2VODA 4JYAF 2MQ8A 4IH5A 5E3QA 4O3PA 3UO0A 4J9LA 2OD4A 3MPVA 3W8PA 1JLBB 3MAHA 4FKYA 1UMJA 1CQMA 4DZDA 3I5CA 5A6PA 1FJCA 4JI2F 1E6YB 5IWAJ 3ZNJ1 1EJ7L 1S1UB 3IWXA 4RW8B 5E3CA 1NAQA 4YS2A 4DUZJ 1OWXA 3G4SS 1WSRA 1YRXA 2K06A 2F5GA 2V2QA 4HTJA 3W1YC 4CO5A 4PG8A 1UA1A 4M8LA 4ZA1A 3GMGA 1U4BA 4FBUA 4JI6F 4XAKA 5HVHA 1VQYA 1FRMA 5I3UB 3MR2A 3GTYX 1XN9A 1GX5A 3CTRA 1Z4UA 2GA7A 4X84A 2NR0A 1FCAA 2NXJA 3CJRA 1QAXA 2Q6CA 3ET6B 3JSRA 3ULHA 2ZWOA 4U95A 2J9DA 2QLBB 2DHGA 1RHUB 4I7FA 1IKYB 3EDQB 4PG4A 1RT6B 1Y5NB 1ZOTA 4ES1A 3UCZP 2CJQA 5F0WA 5E3PA 2ZH4A 3PR5B 4JI2J 3SCKE 1EKSA 1IM6A 1SQFA 1NK0A 2FHKA 1ELOA 2DHSA 1HNWJ 4YOEA 2VQFF 3DRYA 3CCVS 5LMNJ 5CA5A 3ZZZA 2XZWA 5K8PA 1JLAB 2J9CA 3C14B 3VAMA 2CVEA 1RT7A 4G1QA 4DPUA 3RRHA 1KLMA 4CO4A 4DR1J 3MMCB 4ENOA 1MG7A 3CJ0A 1SCJB 4NMLA 2QGFB 4HT5A 1VRQC 1X8DA 2DVIA 1TKDA 1JXEA 4RO0A 4NXNF 1NDCA 2QX0A 3RG6A 1WOSA 5D0GA 5SUHA 5HMWA 1VQOS 4RPFA 2H3EB 3VGTA 2DNPA 5ITHA 3JQMA 4ZCLA 1RLCL 1XMQJ 3WHIA 3CCZA 4K7QA 4LFBF 1Q79A 5HL7Q 2XNQA 2E1RA 2OSRA 5B09A 3CJ3A 1GMWA 1YJVA 5KT2A 4N77A 2PSZA 1NM2A 1SI9A 2IJRA 1R0AA 1IKVB 2CQ1A 4CRJA 4UTGA 3M6WA 5CAAA 1PJ5A 5DDRC 2N7CA 1KOOA 1RWNB 3J80Y 3GG0A 2CNOB 2RT3A 4U8YA 2DR7A 2RVJA 3DRSB 4LSLA 1NJZA 1TU0B 1RT2A 1UWBB 1VQKS 1VRUB 2HRTA 2AX1A 1IM4A 3GIKA 1T8EA 1IVZA 2XI2A 2DYAA 3H5UA 1N6QB 4G1QB 2L9NA 4B3TJ 3IWNC 4Q43A 3GILA 4J9QA 3LA0A 4ECYA 2BV3A 3DC2A 1T03B 2Z4PA 2ATCB 5F8MA 3O3LA 3FC9A 4KGKA 3ZXWA 3RRGA 1KHVA 3GJRB 5F8HA 5KFAA 3KTQA 3LP0B 3PEHA 4GVBA 1VQSA 4YDDB 2DR5A 4JB8B 2FVPA 4LF2A 1C1CB 1H3DA 3HVTA 3KLFA 1KSPA 4RW7A 3M6XA 3TARA 1VC6A 2I38A 3R5AA 1XNRF 1S79A 1OYDA 3K5LA 2UP1A 2E29A 1M5HA 2A10A 1UJ6A 3BM7A 3T1HJ 4N8OA 2YQ1A 3MPDA 4QWDA 5J2QB 5KT6A 4WU3A 4DR3F 3T5KA 3DOLB 2UXDF 4WFYA 4DV6J 3TOQA 5LXRA 3G8QA 2V34A 1RTHA 4QWBA 4DFMA 3FZ2A 1OMSA 4K59A 4PRFA 3VF0B 1FXRA 4ZP6A 1DRZA 2WHOA 5L9NA 3BF4A 3IXQA 3DDIA 1M5OC 2MB0B 3ZO7A 2ZKUA 3U02A 4D3HA 3GB0A 2YKMA 2WVEA 3NS6A 4GC6A 1IBLF 1HQEB 1S9EB 1RU1A 1LK5A 1VJWA 2GJ2A 3X3UA 4A8SA 1K73T 2V0NA 1T3OA 2YXLA 1S1VA 4YQWA 2XO7A 1CPZA 1NH8A 4EI2A 4B17A 1R43A 1UWBA 2CPIA 3SFUA 4QR1A 5BYSA 3H8YA 3W61A 3DRSA 3ELHA 4LSLB 1ZYQA 1O51A 3D7SB 4WE1B 4V19X 1OPZA 1V5VA 1S9FA 4NLWA 3OLAA 3CXCR 1DY3A 3VQTA 2PMWA 5BYQA 3AB2B 3SSSA 2MYFA 3DHWC 2AJ1A 1UETA 3IM9A 3KLIB 3MWBA 1F60B 4USMA 2D3O1 1WHVA 1CC7A 1VQMS 2VHGA 3Q83A 4ERDA 3GSIA 3J81Y 2I2YA 4OYZA 4XDCA 3RR7A 3SDEA 2YKNB 3EJMA 4XTTA 2XI3A 3UN2A 3H5SA 1S5ZA 2R2SA 2WZ1A 1UVKA 1JLCA 2FY1A 2B9YA 3FDSA 1S12A 4C0OC 3KG4A 2ZBPA 3G96A 4DV2F 1YKWA 2JSXA 3DLGA 4YN3B 1S49A 4JI3F 3M1VA 1DTTA 3IS9B 4CLSA 4OX9J 5ETNA 4O44A 2P8IA
chains in the Genus database with same CATH topology
3DM2A 2LCWA 2DH9A 3Q0AA 4DX8H 4NYZA 2MKIA 5BR8F 1RT7B 2C3YA 2HQIA 4J5OA 4TKTA 4C8LA 4F2SA 3BJYA 2JEGA 3KWMA 3N28A 2D3OR 5HMYA 4HVZA 3LOUA 4OI1A 3V4MA 2EI5A 3NBPB 4FZVA 5L1IA 2J0QD 3VAIA 4TQRA 2G9OA 1E6VA 2AF6A 4I6AA 4ED0A 3PW2A 4IFYA 4Q8FA 5FLXY 2IYGA 2OIHA 5LJ3Y 1TUVA 3E01B 4QQBA 2CJKA 2GW8A 1IBMF 4F67A 2YH1A 4K4XA 2ZHOA 1JB0C 1FJGF 1HA1A 2OFGX 2VBXA 1KNZA 1HNVA 4LJMA 4Q0BA 3HJFA 2ILZA 1LFWA 2VG6B 1IQTA 3TO8A 3QJPA 2FJWA 1NH7A 3JTPA 1WHYA 1Y3KA 3V81B 1LWEA 5CZXA 1REVB 1S0OA 4A8QA 1JLEB 2MHEA 3FSXA 1H2UX 1NK7A 3I56S 3FSYA 3IRWP 4H4OB 3M2VA 5F0UA 2MQPA 5CYQB 1JLBA 2PD1A 1X9SA 3MR3A 2O01C 5E41A 2NREA 2KDOA 3FZBA 4FS1A 1D8ZA 2VV5A 2WSFC 3AY0A 3M2VB 3ZFVA 3PV8A 2UV8G 4DSFA 1TFWA 2IM0A 1ZM3A 5AXNA 1RTJA 5IQ6A 2DNYA 2E7XA 4ZPDA 4GKJF 1SIZA 3EZ5A 2VC0A 1U1LA 5C42B 2OO4A 2XG8A 3R5BA 2LA6A 4OX9F 2XMMA 2CPYA 3DGPA 1FVQA 1N5SA 3M9MB 5B0BA 2VA3A 1EETB 3CB4A 4XIUA 5K14A 4K0KF 1YJRA 2K7JA 2KG0A 3IGVA 5KFMA 2C3OA 3MGJA 3PRDA 2HFOA 2NUUG 4LSNA 4F26A 2PN6A 2K7KA 4EYIB 2KHDA 3D1HA 4IQXA 2JEIA 4Q5VA 2ZC3A 1E6VB 3L95X 4OZ5A 4TLRA 4QIGA 5B0AA 3C46A 2W7AA 1RTIA 2HAIA 2V8HA 3E3XA 3FCHA 2XMTA 4MKBA 2FHOB 4BWMA 5KFCA 3OHAA 3CMAS 2KT2A 2KXNB 2MKKA 3BSOA 1VI7A 4UW2A 3TVKA 4ZCIA 2ZFHA 2DNOA 2C42A 4Q2LA 4RBVA 4CT8A 2CVIA 3KFWX 1SH2A 1Z2LA 2V9WA 1M5KC 1FERA 3CC2S 2R7QA 4OHZA 4NRUA 4E0DA 1BGXT 5KT7A 2GO9A 1HQEA 1S9EA 5KOXA 3DYAB 1DTTB 4X4QA 4NPOA 4JV1A 2YKMB 2X1FA 3CCMS 1D0EA 4J9PA 2OPPA 3LAKA 3MECA 3RB4A 2JLFA 5KFUA 4DF4A 1VQPS 3SQGB 3ZZTA 1DQ9A 4TYBA 5H9EJ 3CVKA 3N01A 1F5BA 3T19A 1S9GB 1LOUA 5AE1A 5DQIA 2IM3A 2WOMB 4DV6F 2GMHA 3KLIA 2IVFB 1P8GA 3WBZA 3CD5A 3PW0A 2HMIA 2XS2A 5I3QA 2YNIA 3MM5A 3T1HF 3SV3A 4CO2A 5EWGA 3V5RA 4FYDA 1YJ9S 4X4NA 2QSFA 1CEZA 1ZETA 1HPZB 4MH8A 4QZVB 4ECXA 1JKHA 2J6TA 4FF2A 1TL3A 2KH9A 3BQ2A 1IKWB 3BB5A 1TR0A 1X4EA 4IG0A 2DBBA 4QR2A 2ACYA 4WFNQ 2OTLS 2ASJA 2XBPA 3V4IA 2CQBA 1N6QA 2ZDPA 2HHPA 5L9XA 2ILYA 2DH7A 3OSNA 4F4ZA 2ZJQQ 4FXWA 4RBTA 2RILA 2V5HG 4DUYF 5L1KA 4MFBA 3CPWR 4Y34A 3SFGA 3FQLA 3MM5B 4GO5X 1J5OB 2NLWA 3TA0A 2XSJB 3PJXA 4J9NA 5KT5A 4C0HA 1LXJA 2MQLA 2M7SA 1R0AB 4WFZA 1RJJA 2FHMA 4OJGA 4Q44A 1NB7A 2KM8C 1UEVA 4DQPA 5IM0A 5IXUA 3MM6A 2BE2A 3A1YG 4EO8A 1C1CA 3HVTB 3V6DB 2RRAA 5F8JA 3SYZA 3VWSA 3TANA 4DF8A 1X9MA 3FGVA 4N47A 1PO6A 2KFYA 1L3UA 5THWA 3W7BA 3D0GE 4QBUA 2HS3A 1FNOA 4RNHA 1UP1A 3E51A 4FP9A 2RKIA 4ZVGA 2E5IA 2VASA 1FDDA 3E8OA 3NP5A 4BS2A 4Y65A 2HW3A 1MROB 4YB1P 4LF7F 2XB2D 2KFNA 2AW0A 1JLAA 1LXNA 1ZAWA 3BN7A 1SKWA 1DJ0A 4FF3A 2HG4A 4KGMA 4NCGB 1IQZA 4AXIA 1R8HA 2XULA 3LP1B 4NLOA 2QLXA 2W8KA 1WWHA 2B4PA 5A8KB 1RWUA 4A46A 2UUCF 4MTPA 4KV8A 4NYPA 3T5HA 1S76D 2W4DA 3OR2B 2EKYA 3L7OA 5DLFA 5C25B 1NK4A 1XEZA 4N76A 1MMLA 2EPIA 3EXCX 3L3CA 4IRDA 4F25A 1X5PA 3CCES 4J9SA 1RT3A 1HQUB 1DQAA 4EBEA 4C8ZA 4QCLA 5HLFB 3DOKB 3RW6A 1B0VA 1OQ3A 4URGA 1QE1A 4LFAF 1R6YA 2UUTA 5LT5A 2ZH3A 2VL1A 4B02A 4FBTA 2R2TA 1JLQA 4DUZF 1JNZB 3OTOF 1B0TA 1R8CA 4BCAA 2U1AA 1S1XA 5IWAF 1IKWA 3HVWA 4IQMA 4XDDA 3M8SA 1IR0A 1FE0A 5KFPA 3BR8A 1AW0A 5EX3A 1RT6A 2GHVC 5KG5A 5KFJA 3CD6S 2YNIB 4WF9Q 5B7WA 1U47A 4DL0C 5E5NA 2DGUA 4IRKA 1FTCA 1LWEB 3MEEB 5G0RA 1RT5A 2ZDOA 3RTVA 1KQSR 3FFIA 4L6V3 1HFEL 2BBEA 3ENVA 3MM8B 4X64F 3MMBA 4I6WA 3CCJS 1UVLA 1AROP 2DISA 5FDLA 1M0SA 3U1LA 1OS5A 5T7LA 1OQ6A 4MIWA 1LKZA 4PG6A 4B9MA 3PKYA 4DV4F 3LAMA 5JVHQ 4I68A 2V9KA 2I5JA 1TK5A 3O6QA 4DOZA 3UNGC 4ED1A 2JX2A 1R7IA 1VQ5S 3D0IE 3NLCA 3ISNC 2UV8A 4OZ0A 1VBXA 1HHSA 4JOUA 4R5PB 3ZZ0A 4RLEA 3MPYA 3GV8B 4V19J 4I67A 1S72S 3VZIA 2W8LA 4WYWA 5IQQA 2VG7A 3I82A 3P6YC 2HNDA 4B3RF 2W9AA 2Z2LA 3PR4A 5D6GA 2JZ5A 2QMXA 4K4VA 2MHNA 5KG3A 4OX6A 3IAS9 4WXOA 2ZM6F 4OJHA 4JI1F 4LSNB 1HL6A 1HNIA 3DLKA 5F8IA 4USHA 3OR1B 2Q43A 2ZH6A 2DNLA 3GFZA 1RGVA 5JUMA 3B82A 3I6PA 2DGXA 1VC0A 1U1MA 1AFJA 2EK6A 3ONQA 2F1FA 3O44A 4M95A 3KK3B 4DSKA 2PMZD 3MM8A 4JV5F 4ICLA 2OD6A 2Z0GA 3ICLA 1DTQA 4URQU 1YWXA 1NK9A 2NQPA 4H4KC 3CCSS 2RDIA 1XK8A 3GV7B 4C3MA 3DRPA 2AJ0A 2K3KA 3H25A 2FJXA 3SSRA 3I55S 4CO3A 2A18A 2RS8A 1ZM4A 1HBUB 1QAJA 3C6TA 2MQQA 3I0RB 1A6LA 1VLYA 2BW2A 2IRUA 4G6VB 4OHWA 4FXDA 5KG2A 1IBKF 5KFOA 3GSDA 3UI3A 2FUG9 3MMAA 3DLEA 2XY5A 2QV6A 3DOKA 2D3ZA 4WTYA 3G71S 1TKZA 4NLRA 3MFHA 4GMKA 2R7XA 1BLUA 4X65F 3HZGA 5E2QA 2NZ4A 2U2FA 4UUXA 4O23A 4C3KA 3DXSX 4ED5A 2AYMA 5J2QA 5BJRA 4ES2A 3DDKA 2ZH9A 1EP4B 3BREA 5J1NA 1KHWA 1BQNA 1C0TA 2G1DA 3OJUA 3IR5B 3LWLA 1ZTTA 2P9EA 1GT8A 3EGZA 3LGNA 4BDPA 3DU6A 4OI2A 1L5UA 1IUJA 3TAMB 3I4HX 2FVSA 3H2VE 5AXLA 1T03A 2M70A 2HVHA 2LU2A 2FLPA 5DGBA 3NKYA 2YWHA 4ED7A 1MROA 4H4KA 2N82B 2C3PA 1SC6A 3DM2B 2RRBA 1YG0A 1HYSA 5D78A 1MMDA 1VQ4S 2RIJA 4ECQA 3I5BA 3MTKA 2HNYA 3K5PA 2L9WA 3RAMA 2X3GA 2CQ0A 4PWUA 3UCUP 4B9TA 5HO4A 5FJ4A 3OW2R 4DL3A 3V6DA 2WBMA 1Y9OA 5C25A 4RX6A 5IM0B 1SUQA 2HGNA 3K57A 5JXSA 2VFUA 4KV8B 2YWEA 4AQYF 3B8HA 1SJ1A 3ITHA 3K2YA 2AGOA 1P6TA 2XSJA 3EX7B 5A6WA 1WACA 2PE8A 2WSEC 1V3SA 3UW1A 4BHQA 2YNHB 2DR8A 2XLJA 1CSJA 2PA8D 4DBQA 1RYRA 3J7Z5 2MKHA 3EUNA 1RKIA 1Y4ZB 2F3JA 2VUGA 2R7OA 3DCAA 4KE5A 5DQGA 2OPSA 2LYVA 4FN5A 2GV1A 3CCRS 1QAIA 5B0CA 1X5OA 1OO0B 1TL5A 2COLA 1NU4A 3M6VA 4P2SA 4ED3A 1JKHB 4I69A 2W24A 2QZ8A 3MAQA 3X1LB 5GADU 3MM6B 1QTMA 2B5JA 2LVWA 3R1LA 2LA4A 2BOPA 3N9UC 3DOLA 2XLKA 4ILLA 2ZBIA 4DR6F 4ID5A 1K1QA 2YKQA 4C0BA 5CCMA 1HBNA 2WOMA 3I87A 4ZMMA 2B7CB 2HWTA 2KI2A 2HHWA 2BANB 4DL7A 3ENQA 3MECB 2ROPA 1VQ9S 2D9PA 3CCLS 3IRXA 2I8EA 3MMAB 2ZKTA 3FNNA 4Y2IA 2B6AA 4K4WA 3V6HA 2V4JA 4F02A 2XY7A 3D1QA 3DYAA 4DQIA 3T6JA 1Q8LA 4LVNP 2AQ4A 4MKAA 3ISZA 5KFSA 3WZ0A 2AU0A 2BYCA 5CYMA 4ZVFA 1SJ4P 2DH8A 3WDOA 1RAJA 3D0HE 1UFLA 1MWZA 2Q66A 3DN9A 3T1YF 1RTIB 5D4LA 4RNOA 2NYIA 2GCFA 2DGWA 1P1TA 4KIAA 3KLVA 1IJEB 4NLQA 2RF2B 2JFDA 6FD1A 2EC0A 5LMUF 3C2PA 3CULA 4K4ZA 2MXYA 1O5JA 1TZ0A 5K14B 2ZD1A 1RT1B 1WHXA 4LF5F 4L72B 2BVZA 2YKOA 2UUWA 4MIBA 1YJUA 4NLUA 2DRBA 4DL2A 4DR2F 1Q81T 2ZJPQ 4F50A 1VRTA 2OPRA 3CT9A 3POTB 2CG4A 3H40A 4C11B 1HWIA 3QMQA 1FDAA 4MK7A 1N33F 1GXTA 1BY9A 2W4CA 3CD7A 1TVRA 4HH0A 1H7XA 1V9OA 4NOHA 4P7VA 1Y5IB 2G4BA 3P5TL 4TY8B 4X4TA 4FVMA 4H4OA 3NCQA 1N4LA 3VZHA 3K8WA 3KLEB 4HLBA 3MUMP 4CCHA 3CUNA 1TK0A 4ATNA 1URRA 4WU2A 4ZVHA 2VA2A 5E3AA 3ZZOA 2BQRA 2FJBB 5E7OB 1X9WA 2WTFA 1AFIA 2EG2A 3MEEA 2QE5A 2KT3A 3OQ2A 2IAJA 3OFHA 3KG0A 4KKOA 4KHRA 1MU2A 3VCDA 5CH7B 4QIVA 2W9CB 3TAPA 1HBUA 1CC8A 1C4AA 2WBRA 4HDHA 3AQOA 1ZPVA 2J7WA 2E5GA 1S6PB 4IKAA 4DG1B 1HWKA 5KT3A 2X1AA 3BO4A 1KR4A 1QUVA 5CYQA 2E9TA 3KNAA 2W9CA 4YR0A 2OMOA 2MKSA 4J37A 1UA0A 1MU2B 2QFJA 2CQPA 4YB6A 4CTAB 2AYEA 1QE1B 1Y7PA 5GMKa 4K50A 1XERA 4ICLB 2LEPA 4DR7F 3IFEA 3UR0A 3CJKB 5HP1A 3KK3A 2BABA 4Y6IA 4ZPWR 2M5YA 4CO0A 1BQMB 2EK1A 1U49A 4RW9A 4CH0S 2LEAA 2VPWB 2QEXS 2IC3B 2AJ4A 2PI5A 1WNEA 3MD1A 3UWTA 4W90B 2XWYA 2CIMA 2G0CA 2Q1LA 2DCUB 1NKCA 1QM9A 3WC0A 2FGCA 5LJ5Y 2WSCC 4TN2A 3IN5A 2IRYA 3M6UA 3IC1A 4C8NA 3T9ZA 1OIAA 4RUAA 2KO1A 5I42A 3NNHA 3F56A 1X4GA 2QO3A 1F5CA 3C8YA 4OZJA 4AL5A 3N79A 2VBYA 2VQEF 1X4HA 1NHVA 2V8DA 2XS5A 2J9DE 1RKJA 3UR3C 2IRXA 1H38A 2RQKA 4A8WA 4R5PA 3MEDA 2MJUA 2RQ4A 1MMNA 1RT4B 2J9EA 4KAIA 3S6EA 1LW0B 4O4RA 2ASLA 4ZPVR 2ZHBA 5CXTA 2RKIB 2JVOA 3BN4A 3FQKA 1HMVA 2B6AB 3U1NA 4J9KA 2HHSA 5IZHA 4B3OB 4KR0B 1URNA 1TKTA 1YQHA 2ASYA 2B9WA 3NWGA 2EG1A 3VAKA 1YJWS 4AFFA 1ZBTA 2YKNA 3G9CA 1T94A 3K5OA 1JLGB 3QJLA 5J2PB 2OLWA 4GKKF 2W7PA 3RAQA 1TL1B 5D4OA 2JVRA 1YIJS 3I31A 4U6PA 4KHMA 4ZPCA 2HLUA 3QGIA 3QJJA 1YTYA 1J5OA 4R0JA 4OI6A 2GJIA 2UU9F 4QWEA 3OUYB 2FLLA 1SL2A 2LXUA 3DXBA 2J0WA 1X5SA 5CYMB 4IH6A 3NMRA 2DK2A 2POKA 2RJZA 1LQ9A 2WAQD 4PPDA 5KFBA 1D9AA 3I32A 1S1VB 3KHGA 1U1NA 2M8HA 1G2EA 1ZAXA 1LK7A 3V4IB 2DGVA 4I1TA 3KHLA 3OLBA 2VH7A 1FO1A 4X4RA 3L7PA 5A8RB 3KNGA 1SKSA 1KS2A 2BACA 3QLHA 2JEFA 3NS5A 1HNZF 3U1MA 4RW4B 4EO6A 3KMSA 2HHQA 4NLDA 1HARA 1Q16B 4QIEA 1HBNB 2RE1A 2FJEB 2UVVA 4M94A 4MJKA 3MUVP 3V6JA 2ADCA 4EFAC 1S9GA 3OBIA 4QWCA 4F2RA 3GFYA 4JI7F 3SQGA 2DNGA 2Z8QA 4I6YA 5KFFA 2YNGA 4NLSA 5K8NA 4B3TF 2H9ZA 3N4WA 1U48A 1Q7YT 2XNRA 2JC0A 4G1PA 1W2BR 3W2WA 2OFHX 3TR5A 2L08A 3BDEA 1HHTP 2CJAA 3QWPA 3M9NB 1YVFA 2E5LF 3HHDA 2CQ4A 4NYOA 1RISA 1RP5A 5D77A 2R7WA 3DNCA 2F40A 2CQHA 1ZH5A 3T9NA 4YB7A