4P7TA

Structural insights into higher-order assembly and function of the bacterial microcompartment protein pdua
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
85
structure length
85
Chain Sequence
b'QEALGMVETKGLTAAIEAADAMVDSANVMLVGYEKIGSGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDVEKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyhedral bodies
publication title Structural Insights into Higher Order Assembly and Function of the Bacterial Microcompartment Protein PduA.
pubmed doi rcsb
source organism Citrobacter freundii
molecule tags Structural protein, electron transport
total genus 21
structure length 85
sequence length 85
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4p7tA00
4AXJA 4QIGA 4OX6A 3DNCA 4AXIA 3BN4A 4PPDA 3CGIA 4DDFA 3N79A 4P2SA 4OLOA 4OX7A 4P7VA 3NGKA 2G13A 2A18A 4OX8A 5DJBA 2A1BA 2A10A 4RBUA 4QIVA 3SSRA 4QIFA 4QIEA 3SSSA 5L38A 3I96A 3H8YA 3CIMA 3IA0A 3NWGA 3SSQA 3VCDA 4RBVA 3I6PA 4OLPA 2EWHA 3DN9A 4P7TA 4LIWA 4RBTA 3MPYA 3MPWA 3PACA
chains in the Genus database with same CATH superfamily
4OX9F 4LQ3A 1ZM2A 4X4SA 4PQUA 5ETVA 1S6QB 2BKOA 1FJGJ 1AW0A 3ENAA 1GTHA 3CC7S 2ZZMA 2XMWA 4U8YA 4N8OA 3FEXB 1U1RA 3MM9A 4DQQA 1RAIB 2FHKA 1R6VA 1T9WA 3IO1A 4RW4B 2O66A 5F9NA 1VQKS 2KTQA 2VH7A 3I4PA 4CLFA 4WFAQ 2ZH5A 3ULHA 2LLZA 1NU4A 4R0JA 1O5JA 4ZCMA 1Q5YA 2Z2MA 4RJVA 2J6UA 2PDAA 2ZH9A 3OTEA 1UW4A 2OEKA 2JNJA 5FDLB 1K73T 3G87A 4YOEA 1I6JA 1RTHA 2V9KA 4RNNA 1P27B 2DY9A 3IG1A 3WX8A 3N0VA 1Q1KA 3TUJC 1K47A 2UZAA 4LSLB 2VPWB 1UPMB 2QLFB 4FNIA 4C4WA 3NGRA 3MM6A 3DRRA 2V4RA 3FCVA 5D4LA 1NK6A 5DO2A 2DNMA 3HVWA 1RKIA 4C8YA 2EG1A 4LR8A 1FCAA 3MUVP 1ZH5A 1NSQA 3A8KA 4GO7X 1KD1T 1O51A 3O5TB 4DSEA 4DUYJ 2W4CA 4DX8H 2EFOA 1X7VA 1SI9A 3QIPA 2KDOA 1C1BB 4USTA 3ZZTA 1TU0B 1N5TA 3DLGA 4LREA 2DRBA 3BSAA 2XLKA 3GV8B 1TUVA 4R25A 1JJ4A 4OHVA 2HHVA 2QGFB 3GV7B 4CQ1A 1ZM4A 3ZTPA 1HBOA 2DCLA 1R6YA 2MHEA 4J9KA 3IP0A 4ZJQA 1WD6A 2HVDA 3A8EA 2ZBQA 4WXOA 4G1PA 3DCAA 5DZ7A 4HACA 3F73A 2OFHX 4NZ0A 3R1HA 3QPIA 3DLHA 1QAYA 3HPOA 4LRDA 3D6TB 4JYAJ 1HLWA 3CD5A 3RAXA 1UETA 4FYWB 2FC8A 2C3YA 2PC6A 3D68A 3OVSA 1S1XB 1U6BA 3EMTA 4ECUA 3KG1A 2FY1A 3U02A 4DG1B 4IQXA 2RMLA 4WFZA 2UP1A 2QSFA 1N33F 4JV5F 3CJKB 3DOKA 4WYWA 1J5EJ 4X66J 4D3HA 2RDIA 5AE2A 3ILIA 3UN3A 2IJFA 4X4RA 1CS4B 3AD9C 1YLXA 4P9SA 3PDNA 3TA0A 1HHTP 2MQLA 1BQNA 2WVEA 3R9LA 2HQGA 4Q44A 1GXLA 2FHOB 1MWYA 2QC3A 5IWAJ 4DLEA 2R8GA 1BXNA 2VKRA 1BWEA 2VD3A 1IQZA 2OUGA 3HVTA 5AXNA 1GMWA 3QJPA 3SQGB 5M2PA 2CDRB 4AUKA 3QGIA 2MZ1A 4WTOB 3DRYA 1X5OA 1UP1A 1GAOA 3I6PA 1LK5A 2FY8A 1FRXA 3VAGA 4MKVA 2XS2A 2DH9A 4EK2A 4QIVA 1NH7A 3TQEA 2H1YA 4U9RA 4C8NA 1ZPWX 1NSPA 3QAUA 4NLTA 4B9NA 2XSJB 1IR2A 2CNOB 1ZYQA 4ICLA 1TAQA 3DLKA 1N6QB 3DRSB 4C8MA 5F8IA 3OUYA 4J9MA 2DGUA 2QE5A 1GK8A 5J2MB 2NPFA 1CBKA 2J5AA 2YNIA 2DXFA 4KHPF 1WJ9A 1U1KA 3CMQA 2RRBA 3RBDA 1N0UA 2EWHA 3NOGA 4DV4J 3TARA 3PEJA 3JAMY 2GV1A 1FHTA 2L48A 2B3TB 4ETZA 4WIIA 1SQFA 1HQEB 2FIUA 1S12A 2K1RA 4OJ3A 3CE8A 2KH9A 1RGVA 1LWCB 3I0SA 1WF2A 3HMJG 3HKZD 3Q8VA 1FVQA 4KV8A 5LM7E 5CZVA 2IMWP 4DX5A 2DH8A 1QSYA 2DNKA 3GFHA 2AMCB 4URQU 3KLGB 2A1BA 2HEKA 4QYZJ 1VBXA 1NDCA 4LF8F 1TFWA 3BDEA 3H0PA 2B8PA 4N77A 3G9CA 1WTBA 1X4GA 2Y9HA 2RS8A 5KFRA 3CUNA 1PAEX 2EPIA 2WSFC 5HO4A 3UD4P 1Y4ZB 1I94J 2HZVA 1NAQA 3KK3A 2BRLA 1S99A 2M52A 1R0CB 3J7A1 4B3SF 1UTAA 4IFVB 2YNHA 5D4NA 1KVJA 1EZZB 3RBEA 3PO4A 2NYIA 3QAEA 1IVZA 3VCDA 3JSBA 2NPIA 3W62A 3SYZA 1P8GA 5B7WA 1U8SA 1NB7A 3W9HA 5L1KA 4B3MJ 2VFTA 4ZDNA 3KLHB 4JI3J 3HD1A 5DGBA 4ED5A 1R8PA 2K7KA 3SEOA 3CO0P 2UUAF 4LIRA 3JSMA 4DEZA 2BANB 3CD0A 1ZA2B 5IZHA 1Q8IA 2LP4A 3W5ZA 2E1CA 3CC2S 5HROA 3AD7C 5JXSA 2UXDJ 4ZCIA 4DDFA 1L3TA 3TI0A 2IVFB 1WI6A 3CDWA 2HS4A 5F8HA 5KFLA 2EFNA 4H4KC 1YK9A 2LQJA 2UVRA 4DU8A 1C0UB 3POTA 1M5SA 5C24A 1D09B 3D28A 1ZPVA 4IG3B 4OI2A 1WKKA 2LA4A 1OIAA 1QAIA 4ZKAA 2FDNA 4O44B 2IRUA 2DGWA 2HK2A 4CNYA 2KN4A 3MR3A 2ATLA 3E8OA 2UU9F 1HNVA 4EYIB 1FFSB 5L38A 3I96A 3BKUA 3VV2B 5JVHQ 2FVCA 3SQOP 2UUBF 4QIGA 1SPBP 2E5HA 1NSKL 3G4SS 3OXLA 2H48B 4I2QB 1MLAA 2QLXA 2W9CB 3DI6B 2XLJA 2QT7A 4I4BA 4O3SA 1UCNA 3P3DA 2CKWA 3V6HA 4AT1B 2M70A 1C1CA 1AROP 2FJEB 3MTKA 3PHEA 5KG6A 3DXBA 3FNNA 4W4MA 2HBRB 4PYDA 2CQ0A 1M5HA 1PBAA 2IBOA 4Y2AA 2AP6A 1K0VA 4M5NA 1GMVA 2CPJA 5GAGU 2GIRA 4CP5A 4M5JA 1A9NB 2RILA 2NR0A 3UR0A 2XZWA 2NXCA 1T3OA 3HHKA 4M5GA 5LSOA 3GPAA 3GJRB 4OYWA 3CF5Q 3BGUA 1FF2A 4OHYA 3QT5A 1HFEL 3V6DA 2MSSA 5I4MA 2V8DA 5J2NB 3GILA 2JVRA 2Z8QA 1XK8A 2E29A 4ANDA 2OLWA 2C3PA 4GMKA 5E41A 1FRJA 2HPUA 3TYTA 1XMOF 4H4OA 3R3TA 4NLYA 2JLGA 4F8RA 5EHHA 1MWZA 4G1QB 2YPYA 2KKHA 4OLPA 1Y5NB 1FJCA 1FO1A 1CVJA 5HVFA 2BXJA 2LMIA 2HNZA 2VFRA 2ZDOA 2AGQA 4DL3A 4RNOA 2XNQA 3HM9A 1K8AT 3MAQA 1XNQJ 3TZWA 4CI0B 1DQAA 2OEJA 5GMKa 3Q2SC 4GC6A 1IKYA 4QR1A 2OMOA 4KBIA 3KMSA 3MEEB 4C0OC 3E3XA 3RU0A 1X4HA 2R9LA 4V1Ak 2VPYB 3TJAA 4NXNJ 4GKKJ 5KFHA 2PSZA 4F4ZA 2F8MA 4M5DB 2W2PP 2G0CA 3T1YJ 2L41A 3O8WA 3QIDA 4DFPA 3PJWA 5KFBA 2ALYB 2H65B 2E5JA 4L76A 1H38A 5IQQA 3LGNA 1JMTA 2AT1B 4U6PA 1SJ1A 5CYQB 3ZTQA 2VHGA 5GAGI 3NMRA 3NWGA 3ZZYA 2AJ1A 1IKWB 3M2UA 2CIMA 5HI7A 3CB4A 3H90A 3MEGA 2VZ9A 1Q82T 4DX6A 5F3TA 4OMFG 3HHLB 2XY6A 2PFDA 1TZ0A 4DR3F 4ES3A 1R8AA 1KLMB 4EEYA 2C2EA 1J5OA 3T9ZA 1Q8LA 1RBLA 2ZC4A 1SV5B 3H2UB 2JEIA 1VGYA 3K17A 2B4PA 1I3OB 3DM2B 7FD1A 1IBMF 3KXDA 3T9NA 1LKZA 4LF5F 1HQ2A 1OSCA 3RAQA 1QY7A 4ED6A 2NLWA 1REVA 3QYYA 4DFMA 4OX7A 3E2EA 3CCTA 3HHLC 1KC8T 2BACA 3I31A 5J2QA 1YIJS 3ZZPA 2P9CA 1X0FA 4U8VA 1UFKA 1OSDA 4W92B 2CPEA 3NGTA 3H5XA 2X3DA 2AYGA 4DQRA 2JZ5A 3B4DA 1SVDA 3Q83A 3CJTA 2U2FA 3QQCD 3MR6A 2DH7A 5IM0B 1VC0A 1SC4B 1URRA 3S8SA 5SZTA 2IAJB 3J7ZT 1VJWA 3Q86A 1VQNS 2J0QD 4DR2J 3LP1B 2YKNB 5KFNA 3GP9A 1ZTTA 5A8RB 1BC6A 2FHJA 4FF3A 1ELOA 3M05A 3MM8A 1RE1B 3L7UA 3OTOF 2PN6A 1LW2A 5A8WB 1U48A 4TY9A 4CLKA 3AQOA 2BZ2A 4EYHB 5KFAA 1VQPS 1VC5A 4DQIA 3OTCA 3QFWA 4L73A 3LOUA 4UOCA 4IDKB 2CPFA 2BE7D 1Q81T 4NLSA 2VONA 3HULA 3H2LA 4OYZA 3MHYA 3W2WA 2NZ4A 2X1FA 2V4JA 2OPQA 3QNWB 5LL6d 3GFZA 1UWBA 3D6MB 2GFFA 1M1GA 1RYRA 1F2HA 4DX7A 3MMCB 1BHNA 3IBFB 1WELA 4OI0A 4RU9A 3TAPA 1T11A 2M4MA 4A8OA 1NJIT 3GJQB 2XS5A 3BSOA 1UJ5A 1GX6A 2J0SD 3EZ5A 2G4BA 1EAYC 2RT3A 2J76E 4NLGA 1EB0A 2HHWA 3TUPA 2WCXA 4FF2A 2NXEA 3QSYB 3FDSA 2DPIA 4DPWA 5T7LB 1Q7YT 3L3CA 3KLFB 5HMXA 1TKZB 3G8QA 3OSNA 3OSPA 5C42A 4WU2A 4PXEA 2MKCA 3SSSA 2MDAA 1VLOA 4ID5A 1X4DA 3R6GB 4IR9A 1RT7A 2D9OA 1LEOA 5F8MA 4A8KA 4IH6A 1DTQB 1T94A 1FX4A 2PFFB 2BE2A 4UT4A 2XWXA 2ADCA 1ITPA 3BSCA 2OELA 3A8JA 2ILYA 1TUGB 4NA1A 4OX6A 5EUHA 3RB4A 1WDTA 1SH2A 2MKKA 4F4WA 1X60A 2B0GA 3RZAA 2WB1D 1Y0HA 1N5YA 2HHHF 3AA9A 4F36A 4CIOA 4F25A 2VJVA 2DGQA 3UCZP 4OJHA 1UWAA 2QFIA 3QWUA 1FEHA 1A0OB 1KHVA 1HWJA 1BQMA 1MMNA 1X9MA 2DR8A 2V6AA 3W7BA 3MURP 4EU0A 4WWSA 4FBUA 1QVFR 1IKXA 2OGUA 3NGUA 1NPPA 4JI5F 1N56A 1OY6A 4JB8B 4CWBA 4M5MA 4WFXA 3C66A 3PZPA 3OL7A 2NCKL 1HWLA 3AFGA 5B0FA 1NK0A 1FJ7A 1RU2A 3M30B 4N47A 2YPZA 5DG9A 1U2CA 4QOTA 1IJFB 3AD8C 1ULRA 3V81A 1T7PA 2GMHA 3UDLA 1QM9A 4Z2XA 1YGYA 3EJMA 4OHWA 3TA2A 4NA3A 4FPRA 2IRYA 1MU2B 1URNA 3QRQA 5AJ3F 1FEEA 4J7CA 5E3AA 2NZCA 3T6BA 3QWPA 2HNDB 2E9ZA 3JTNA 2HQIA 1CJKB 4M95A 2F1FA 1SJQA 2LFVA 4NZ6A 1WWHA 5U47A 3OR2B 3DRXA 1C0TA 3BEGB 3UCUP 2B9EA 5K8OA 1NPRA 2BVZA 2YNGB 2HQCA 2CQBA 5K9FA 1UVKA 4ZS6A 3RR7A 4FXVA 3UVJA 2F4VF 2HVZA 3M1VA 3T5KA 4KHMA 2GHVC 1HYSA 4TQSA 4FS1A 3IN5A 5L46A 3TP2A 1VYAA 2Q43A 3W8GA 2MY8A 3M8PB 1XIQA 4H4MB 3OJUA 1FJGF 2QEXS 2N7YA 2GAGC 4RBUA 1U1OA 3H25A 2ZKTA 4X4TA 1RT6A 4EBCA 2LQBA 4PG7A 2V4QA 4RW6A 5K8MA 3DDIA 3ZZOA 4PABA 4MIBA 3LTOA 5J1NA 3GFYA 3AOBA 3DLEA 4LR7A 4ED7A 2EFGA 3HFVA 3HVAA 3BPDA 1PJ7A 1NK5A 3PRVA 3K2YA 1T95A 1RXOB 2W24A 5K20B 1TK8A 2Q6BA 2C3MA 1EX8A 4FF4A 2ATCB 1YJWS 4UW2A 3H20A 2E5IA 1FWPA 2R8JA 2P6TA 2CNNB 5LJ3Y 1UZHA 4TY8A 4BWJA 5DDQC 4AL6A 1U7LA 2MZSA 1ZZFA 2XZDB 3MZIA 4WZQA 2IBKA 3OJSA 4NLRA 3OFGA 4LSNA 1G7CB 2KB2A 3PIPQ 1TVRB 3OFHA 4I7FA 2ZNYA 4EMDA 2C2RA 2IYIA 3NY0A 3LQVA 3MEDB 4ECSA 4PQAA 3CMAS 5DQGA 4DUYF 1H7XA 5E5NA 3ZO7A 3UI3A 1TL3A 2B4VA 2C42A 1D9FA 1QLNA 3HD2A 2B8QA 3OLAA 1CSJA 3G86A 3VAKA 3BYRA 4J9VA 1HMVA 1WG1A 4DV0F 3C3LA 2VPZB 4CM0A 3P8BB 6FDRA 3IRXA 2QFJA 3C2PA 2B5JA 3LA0A 4ES1A 1ZAVA 4X4PA 2KVIA 4RKUC 2BQ3A 4MKAA 3HXMA 2CQ2A 1GEHA 3SI8A 4JOUA 2LDIA 2JVOA 1QJHA 3KUHA 4DR4J 2BA9A 1DTTA 1F3VA 1KOHA 2XM3A 3OL8A 4N7TA 2H9ZA 3LALA 2DXDA 3GLJA 1JNRB 4FXWA 3IBCB 2XWYA 2YWWA 1J5EF 4X66F 2H54B 3BO3A 1KP6A 2R7QA 2HRYA 4JI0J 1UVMA 3N6MA 1N36J 5H1SV 4QPTA 4YR2A 1J2VA 1NH8A 2P9EA 4MFBB 2R42A 3F0NA 3BGRA 2QA4S 5KT6A 5IWAF 1AFJA 4KGMA 1KN6A 2RU9A 4WU3A 1IKVB 2BJDA 3HHLD 1ZBTA 3PYEA 4TQRA 3ILJA 2GVDA 3D0GE 2J9DA 4RX6A 4YUDA 3Q8QB 1RT3B 2XLIA 4EI2A 4XTTA 4HL9A 1S9GB 2KYZA 4KT0C 1U6ZA 3SIPB 3FEZA 4DL4A 4LIWA 2W2NP 1R3NA 1FESA 2BOAA 5F8NA 1HPZA 5HQLA 3MCMA 1K0TA 2FLOA 2ZHBA 4O0NA 3D54A 1U1LA 5H9FJ 4WPAA 3DMJA 2VBXA 5L1JA 3MFIA 3X1LB 5JMNA 4NCBA 1XQIA 2WVBA 4F4AA 4AFFA 1NDKA 4ZN1A 2VASA 1CJTA 1XR7A 1HNWJ 3B6BA 1CULA 3Q22A 1BUXA 2C22A 2FJXA 3P5BP 2OPRB 4E8UA 3MUMP 2A2CA 3UQSA 4DF8A 3K58A 2ACYA 3FBBA 4DFKA 2CJYB 1SUQB 3W1YC 3DDKA 4DV4F 3GIRA 3MM5A 3T5HA 1GX5A 1Z4UA 3TO8A 2HRTA 3RAMA 2JSXA 5KFWA 3FEYB 2GJIA 1OYEA 3ITHA 2NQPA 1RUSA 2KM8B 3SDEB 1RWXB 4E2FB 2W8LA 1T0TV 2R7WA 2XNRA 5I3UA 3HK2A 5EWFA 4ZPWR 4DS4A 4WK1A 1D3WA 3W66A 3J7YU 4LF9J 5GMEA 2MKSA 1P1TA 4E98A 1NMEB 3D6FB 4CH0S 3SCJE 3ILLA 2N4DA 4CLPA 1E6VB 2DGTA 5GAEI 1S6QA 3W64A 2E5GA 2GO8A 2QN6B 2DHGA 3EZOA 4KHPJ 4OZ2A 2KM8C 2CG8A 1G6BA 5KG3A 3I9ZA 4CLLA 3W5XA 2JH3A 1HD0A 4NLVA 4ED2A 1P9QC 2CQGA 5KT5A 4RW4A 4X4VA 3C15B 3K89A 1H0HB 5CXTA 1K1QA 4BBYA 1I94F 2E9RX 3IGVA 5RUBA 1RWNB 4ZVUB 4O23A 2RNEA 1VR6A 2J7WA 3MCSA 5C2CA 2YNFB 1G2EA 1NJXA 4JI7J 1LV5A 4NL5A 5FDLA 3KHRA 3B54A 1FTRA 3D5MA 4USHA 2B56A 4P2XA 4B3MF 4JI3F 2LEAA 1YZ7A 5DLGA 3BQ2A 3HSDA 4LSLA 1X5TA 1EKSA 4P2FA 4JV0A 3KOAA 1QD1A 4PWWA 4KH0B 2ZOGA 3VZIA 2B51A 3CWJA 2UXDF 3FCHA 2V34A 1S7IA 4ECZA 4B17A 2VFVA 4JI8F 4LT6A 1UZDA 4ZLNA 3NNAA 3DOLB 2BBEA 3OT9A 4P10A 4WE1B 2PMWA 1C1BA 1AZSB 3RB3A 2VU5A 2GW8A 3BDPA 1WOPA 1FT8A 2E44A 1X4CA 4IG0B 2R7OA 5EDWA 1Y3KA 5CA5A 3AH6A 5I3QA 1QSLA 1B4SA 2V69A 4NEZA 2DNOA 1TK5A 5DRKA 3FQKA 3EDQB 2J9DE 4J9PA 1KDNA 2XTJP 3OFEA 4KGKA 2DGXA 1KHWA 1T9XA 1FDAA 3QZ8A 3M8RA 5AT1B 1FDNA 1S1XA 3BYPA 2R7RA 2QLWA 1VBZA 4DG1A 4X84A 4A4JA 3WBZA 3CJKA 1OQ6A 1VRUB 1LW0B 1WTFA 3UCGA 2KZZA 5A6PA 1CS4A 2BW2A 2FJDB 3MAHA 3EM1A 3K0JA 2DHHA 1Q8KA 1HBUB 4K7QA 5IV4A 2GGPB 4IQMA 1U1NA 1IBKJ 4C7QA 4UQTA 4IOAQ 3QFHA 2FVRA 1UL3A 4J5OA 2M8DB 5J1EB 3I0RB 1S6UA 4MK7A 4O3NA 2XG8A 3ZZUA 3SQGA 1N5QA 3MUTP 2Y0SD 4C0HA 3MPDA 3PM9A 5KFTA 4ZPCA 4ZVSB 2W1BA 3VAHA 3CCMS 3OXGA 1S72S 3GIJA 2RUGA 3THPA 2D74B 2B9WA 1I5OB 2AEFA 2HLUA 1P1LA 2CPDA 4I1TA 2XCPA 4GO5X 1VQ5S 2OTLS 4NASA 4ZPTR 3KYLA 1XNQF 5KG0A 4FYDA 4ETXA 1S1WB 1LOUA 1K44A 2XSJA 1YVFA 1AUSL 4U96A 3FQLA 1SKRA 1WNEA 2ZEJA 3T1HJ 4IOBA 2W4DA 2D3O1 3KHGA 1EHWA 2OSQA 1FVSA 3DDNA 1N6QA 4ECTA 3DRSA 3GB0A 4CLUA 3CO9A 1YJVA 1RADB 3M6WA 1HA1A 2IYGA 3LWMA 5MAOA 3QGGA 5KFGA 1RBAA 4CO0A 3VF0B 3VAMA 4NXNF 4GKKF 3I82A 3L7PA 1KNZA 4DV3F 5EWGA 2EFQA 3GWCA 4DSFA 3FZ2A 1YBTA 1PYTA 3J7Z5 3PXGa 4RO0A 1SL1A 4M5IA 2Y1RI 2ZH1A 1HQEA 2G2OA 1T05B 2VUGA 2WVCA 2W4PA 4WJBA 4Q0BB 3QRPA 2AEMA 2AHOB 1LWCA 1CQNA 3NS7B 1RWWB 3I87A 2NYHA 2JEGA 4PG6A 2BUNA 3KDOA 2ZM6J 3CJ8A 3KUGA 3KLVA 1JKHB 4ZMMA 4F7VA 3EWGA 4OZNA 4NE9C 1IM4A 3R8YA 5ETLA 3D1OA 1N34J 3CMES 1TV6B 4CLTA 3KLGA 1WHYA 1QSSA 4HR2A 3M9MB 1KRPA 3MOZA 5KFCA 4LUBA 1KFSA 3M8YA 4DPUA 1XTZA 2DRDA 5K14B 1RACB 4R0EA 2FGCA 3SCIE 4LJMA 1NJYA 1S48A 5FIIA 3GFXA 4I2PB 1FNMA 4LF2A 1S4EA 4MK9A 3GV5B 1YTYA 1NNDA 5B0CA 1G1XA 4IFVA 3R5GA 2KT3A 1EKRA 4RU2A 2WAQD 2QV6A 3C8YA 1N0VC 1GMUA 1JLAB 2CJAA 4RBVA 4H4KA 1WHWA 1VQ8S 4QBUA 3KLHA 3HT3A 3QJLA 2I1RA 4OX8A 4PXDA 2E1MC 2RUSA 4ILLA 2F7VA 4USWA 2BANA 2MQNA 2LXUA 4LF1A 5DQIA 1WEZA 1WUUA 5LSRA 5KG1A 4X62J 2X51A 1RCOB 4ZP9A 4G6VB 1TKTB 3M8QB 3SCKE 1SL2A 4OYOA 2AZ1A 2CNKB 3RRGA 2EXUA 4DR2F 1RT1B 2FZKB 2BV3A 3GYXB 4ANCA 4ZP7A 1C0UA 4DSJA 3ISNC 5KFSA 3X3UA 1XMQJ 2JDJA 1CEZA 2ZUGA 2DNPA 3KWMA 4USMA 3R27A 4YDDB 3UN2A 5CABA 2XHCA 1ZM9A 3CCJS 2R8KA 1MROB 2ZUAA 1Y5LB 4O44A 1OYDA 2BX6A 4W90B 4MKBA 1UAWA 1EQMA 1H6KX 4P7VA 4QW9A 4NLOA 1BGXT 1I51B 1IR0A 2XGPA 4DR5J 4YB5A 2QLBB 4DV1J 4RW7B 2CXEA 2YWGA 3M9OB 3M7VA 2WHOA 3LGHA 4I2QA 4PPZA 3F41A 4FYVB 4IYQA 1HHQA 4FPIA 3CC4S 1KR4A 4DWIA 2W9CA 2DNHA 3DI6A 4RPFA 2IM2A 2XI3A 3V4IB 4C48A 1L3VA 5D15A 3OTOJ 2YNIB 5KFYA 8AT1B 4QU7A 3SZ2A 1X8DA 5LT5A 1U2RA 1FA0A 2KL8A 2XS7A 1N48A 1FKOB 3TAMB 2ILZA 3Q2TC 1S1UB 4UUXA 3MMJA 5GMDA 1NDPA 1EJ7L 2J0XA 1JX4A 2OPPB 1YJ7A 1RWMB 2SXLA 1D9AA 2RHSB 4ZCLA 1RT5B 1S9FA 2K2PA 3OBIA 4WZMA 2IC3B 2WBMA 4XK8C 5J2NA 2F40A 4IUFA 4HDGA 1FRHA 4KGVB 4K5SA 3T3FA 2W2OP 4OJGA 3K8WA 1WF0A 2UXCJ 2CZ4A 1JQGA 3H42A 2HKEA 4G1QA 2P8IA 1FKPB 2BJEA 4O3RA 1S5ZA 3MR2A 1V3SA 4DR6J 2F8EX 2CFXA 1CPZA 2E1AA 2VDIA 5T41A 1ZZNA 3HP6A 3MR5A 1SJFA 4MJKA 1B99A 2WBRA 2RSQA 4DV5J 3ELHA 1CG2A 3BPSP 2J9CA 4NLWA 1NM2A 4O4GB 2YX1A 4DCJB 3FK4A 3CEDA 4ECWA 1PILA 3MEEA 1X9SA 1RHJB 1S10A 5BYQA 4K4VA 3VQTA 2MQQA 1VDHA 4R8UB 4KH1B 1GXTA 2DNQA 4FP9A 4L6V3 2VOPA 5G0RB 5IT0A 2I5JB 2ROGA 2MLYA 4ED0A 1RWPB 2IPOB 2ABYA 4M5DA 3B82A 1NJWA 2KXHA 1U1MA 3ZZ0A 1ZOTA 3QRRA 4ZN3A 4B3TF 4OI3A 3ET6B 5DDPC 2OD4A 2RS2A 4B08A 3HCXA 4DI6A 2UUCJ 5DLFA 4ZK7M 3BS9A 4DUZJ 5CYQA 4C3MA 3BSNA 4HHHA 9RUBA 1TL5A 4LF7J 5BYRA 4FS2A 1IKWA 1MN9A 4A8QA 3HF5A 4UY8T 4NPOA 2K8GA 2XMTA 3DOMB 5KFZA 4A8YA 2VQEJ 2UVUA 3M32B 5L1IA 2HIYA 3HHLA 3OW2R 1XNRJ 2HW3A 2CQ4A 3GIKA 2G2YA 1KLMA 2ZJRQ 1HBNB 1OO0B 2LCWA 2HHUA 1LXJA 1ZAWA 3NS5A 2IA6A 3TANA 3NXZA 4DN0A 2AKWB 2E66A 1T9TA 1XWLA 1SV5A 4YEAA 3AJ2A 3DM2A 1W26A 5AJ3J 1QUVA 2BJ8A 1H2VZ 1TFYA 3BB5A 4HH0A 2BJ7A 2JWNA 2CQHA 3OHAA 1LQ9A 3G6YA 2XYGB 2AF6A 2C28A 1YRXA 4QJVA 2W9BB 2ZJQQ 3AB2B 1F9HA 5C5JA 3C14B 4DBQA 1SB6A 4LFBJ 2V8HA 4RWWA 2V5HG 4ZCKA 2R7TA 3CCQS 4J90A 3P5TL 1UEVA 1W25A 2WK4A 2O01C 3L7OA 1B64A 4TLRA 5A76A 2GQ2A 1IBLJ 1Q95G 2AV5A 4ZPBA 2HZAA 2YVSA 5IM0A 3MAAB 4B3RF 1OQ3A 4DV6J 4I56A 2IAJA 4DJBA 2BQRA 4NCAA 1REGX 1JLQB 3MR7A 2YKOA 1SQGA 3LP1A 2MHNA 2YKNA 4CDIA 1MN7A 3D66A 5A8RA 1S4FA 4MYUA 1N32J 2MTLA 3UO0A 1WHXA 3JS9A 2DIVA 3DRPB 3CULA 4K4YA 1G4CA 3TRGA 5A8WA 3Q8YA 1KVKA 3G96A 2AWZA 2E7XA 1KSPA 2IM1A 4PEOA 5ETOA 4FVMA 2VDHA 2GZOA 3VVUA 2VV5A 4F0MA 2RJZA 4IDKA 4Q43A 2ZBRA 1UVIA 1WOOA 3TR5A 1SQEA 4K8RA 4B9SA 2OD6A 4J9RA 4C98A 1L3SA 2AYEA 3U27A 2HBZB 1KOOA 1D8YA 1RAFB 1KBRA 1Y9OA 2EFVA 2EW9A 1NJZA 4LF6J 3WC0A 2HVHA 4KC5A 3NGDA 4C8OA 3MMCA 2UUWA 2XB2D 3R5JB 1LWXA 1JLGB 1UVLA 4DPOA 2HVIA 1PJ6A 1HNIB 1NLKL 5IC4B 4DR4F 3NNHA 1DLOB 4XAKA 4MKYA 5T7LA 3F44A 4DSLA 3RW7A 1EIYB 4Z7CA 1Q0NA 1TKZA 5L1LA 4I68A 5AE1A 3FFIB 4JI6J 3CW2C 2HBYB 2FVSA 3OR1B 4F4XA 2OEMA 4DV0J 1PAUB 2GJ2A 4BWMA 1P6TA 1DTQA 1HQUB 4JI0F 5KFKA 4IFYB 1N36F 1VRTB 4RL1A 4X64J 3EVWA 3C6TB 1T8EA 2GIFA 2HHSA 2C3UA 3ICLA 2MZQA 3QSIA 5KTQA 3MDFA 1Y3JA 4K5RA 3JSYA 1FX2A 3WQPA 1RLCL 2VB6A 4OZ1A 1NRKA 5CD4A 4EO6A 1NSAA 4Y65A 2CNLB 2H5JB 3HJVA 2MLXA 1FWKA 3C19A 1UEKA 4YQWA 1P9YA 4RW8B 2X3GA 4K4UA 1JXEA 1RHKB 2JL9A 2JLFA 3W8PA 2XMKA 1K1SA 3C6UB 5KOWA 1DJ0A 2U1AA 1RTIB 5ETQA 4C6AA 2QMXA 3G8TA 5THWA 1S6PB 5B08A 5JVGQ 3TZZA 3BR9A 1RT2B 2V2VA 2JC1A 3V6KA 2G0IA 1QE1B 4KB7A 1MMLA 1M5KC 1FXRA 1VI7A 3ZTRA 5F8JA 3J80U 3W63A 1N88A 3R5AA 1VC6A 4J9QA 4ZHRB 3ISND 1WC4A 2CUYA 3M30A 1OPZA 1KQSR 1FERA 2ROEA 3K5NA 2PMHA 1TKXB 4MIAA 4K4XA 1FNOA 3D0IE 1HNWF 3PRBA 4CLWA 3AB4B 1U26A 2VL1A 5CCMA 2V0NA 5EN1A 2IFXA 2XULA 3TWZA 5BR8J 3M8SA 1MU2A 5E2QA 1WC5A 1WC6A 4EFAC 2AJFE 2XMUA 2YWHA 1DHMA 1OJ4A 2HNDA 2DR5A 4WKYA 4G3IA 2B9YA 1CJKA 4FNHA 4DU7A 2V68A 1PBUA 2EFPA 3M9NB 1JLEB 1IQTA 5HAOA 1V3RA 3BM7A 5CYJA 2CAJA 3OR2A 2ADBA 2GIQA 4OZ5A 1JLCB 4Y0FA 4DPTA 4OZ3A 2YNGA 4KAIA 4IOCQ 4WP3A 2PMZD 1HW9A 4LF9F 1Q86T 2W25A 2IHR1 1S1TB 1S79A 1WC1A 1CJUB 3G82B 3Q23A 1HI8A 4Y2KA 3CCRS 4H4MA 2FJVA 4ZA1A 2UXBJ 2YX7A 3D0HE 4LSZB 1T9VA 4L75A 5ETKA 3HZEA 3N01A 4CYUB 3V4MA 2X1AA 1KQFB 4NXMJ 3JXOA 2F3JA 3P96A 4CNZA 2R2UA 2YY3A 3VHQA 5C2GA 5H9EJ 3EPIA 3ENQA 4F2SA 4CLYA 1YITS 5KT4A 4UOGA 4JI7F 2A18A 2FVQA 2EC0A 2EVZA 4IR1A 2XYPB 3L95X 1JJCB 3LP0B 1FDBA 1TAUA 2MYFA 4NYPA 1XBWA 4CO2A 3O2IA 1SIZA 4Y2CA 4C11B 4EGLA 4DR7J 2BABA 4QYZK 1RU1A 3KJVB 2RQMA 4C97A 1TVRA 4GVBB 3UPFA 4Y2MA 1F0XA 3MEDA 1VQ4S 1YJRA 4TXSA 5D0HA 4ATNA 2DNLA 4F4KA 2PD1A 5HL7Q 2FGOA 1N8RT 3BREA 3J81U 2J0WA 4ER8A 1RAJA 4YDXA 1T03A 1YWXA 1SXLA 3JSRA 1KQKA 5A0YB 1HI1A 4X4QA 2KFYA 2GO9A 2D1CA 3CJ2A 1SC1B 1TKDA 2MGZB 4ZLLA 3UD5A 3NCRA 3BH6B 2DTJA 1NHVA 4WP9A 2RQ4A 5KFPA 2XMJA 2QA4G 3W65A 4P71A 2DNNA 1JNZB 4OI6A 2D3ZA 2ASYA 2NSCA 1NPKA 1S9EB 4D3GA 4JI8J 4ZIWA 3LGMA 2ZFHA 3HLUA 4OYBA 4DN9A 4LBIA 1UVNA 3DU5A 2OSRA 3NGKA 5HANA 3PX4A 3KDNA 1NHKL 4WXWA 2DR7A 4LR9A 4K59A 2BJ3A 2YQ0A 1QUPA 4ZITA 1ZS6A 2G1HA 4RZRA 1TQLA 5IT9U 1S97A 2DHXA 3NOCA 4MFBA 1C4AA 1SH3A 2V67A 4DR1J 1S0OA 1IBKF 5B0BA 4GC7A 4Q8EA 2YXLA 2Z2YB 4R5PB 1NCLA 4HT5A 2R2RA 4C3LA 1HYSB 3OXFA 1IKVA 5ETSA 4ECVA 4EZ6A 2JJ4D 2IDEA 3W2VB 1J27A 4C8ZA 3GE9A 5A8KB 4C0BA 1RT3A 3M6UA 1S9GA 5FD1A 2I2YA 3VAFA 5HVGA 4KO0B 3Q8PB 1UJ4A 3U7JA 2B7BB 2RH3A 5J1PA 4O0IA 2PI5A 4PAAA 3W3SA 4OZJA 2ZH2A 2DIUA 2YQ1A 4A8SA 3TEGA 2C2MB 5LMUJ 1YRTA 5A2QU 4LF4F 1ZM3A 2Z2LA 3T1HF 1QDUB 1F5BA 2F5GA 1YZ6A 1U6FA 1L5UA 4OYMA 5HBMB 3GIIA 4DFJA 2JLEA 2KO1A 4YR0A 5ADZA 2OPRA 5BJRA 3NP5A 3FBEA 3PW2A 5LMNJ 2H5IB 3ZZRA 1H72C 1VIXA 3NRBA 4USIA 3QBCA 1SUQA 2BDPA 3R2DJ 4IH7A 2POKA 1F1BB 3D6HB 1B70B 3KK2B 1F5CA 1X9WA 2Y1IA 2QL7B 1BLUA 2IMOA 1FFGB 3A8IA 1YX2A 2KZMA 4CCHA 4YS2A 2HWTA 1U0HB 3JQKA 1GNKA 3MCNA 4K50A 2ZM6F 3H5YA 1NK4A 1NDLA 2Z30B 3IBWA 4ZVOB 4QR2A 3FUYA 3CCES 2BEFA 1N34F 3KG4A 1E6VA 5K8NA 3KLEB 3N9UC 1WEYA 1L3KA 2D41A 1RT4B 4YB6A 3FSIA 3MTJA 1N4LA 3D4JA 2DEIA 3CJ4A 1R31A 3WZ0A 4DV3J 4B9UA 1Y7PA 1TL1B 4ZPDA 1WEXA 1S0NA 3BQ0A 3C15A 4KYZA 4CTAB 2PGCA 4J9NA 3W61A 3O1LA 2RRNA 5D77A 1PG5B 3D67A 4QIWD 1HKAA 4J9OA 4HT7A 4IRDA 1MWQA 3KK1B 4NI2B 2YNFA 3FSXA 3LPEA 3CNQP 4L74A 2D7SA 2DKOB 2ZKUA 1NK9A 4LFAJ 4ZPAA 1D8ZA 3AAWB 4GRSA 1YI2S 4RUCA 1CQMA 1SL0A 3OFFA 1X4BA 3IWLA 2R8IA 2E7WA 2Q3PA 3TVYA 1Z2ZA 3P6YC 3CJRA 1VS3A 3KFWX 1XN9A 3NMAA 1HR0J 1B0TA 4X62F 3AQPA 4K4ZA 2QSWA 1XJWB 4DF4A 2XC9A 3LH2S 5L39A 4M5LA 1Q53A 1FI4A 4Y34A 3IWXA 3DOLA 2DGSA 2YKPA 4JUZA 4ZVQB 1VHIA 4WE1A 3MF5A 3L9ZA 1XMQF 4USJC 4URSA 4IO9Q 3QJJA 3KJFB 4OJ1A 3CVKA 1AZSA 1IUJA 2KHCA 3R2CJ 2UUTA 1LWFB 1TUWA 5CH7B 4U95A 1R27B 4IG0A 4RBTA 3TNVA 1S57A 5D4OA 4LBHA 4KKOB 5ETTA 4OLOA 5KFXA 3JTOA 1FKAF 1NUEA 4P74A 2XO6A 4DR5F 2WRMA 4QWDA 2IY5B 2FHMA 3M6VA 1GTEA 4DV1F 3RB6A 5FLXU 2RDJA 3ZXWA 2K3KA 4OQJA 2RDDA 3E01B 2V2ZA 3CCSS 3KMQA 1FRKA 3HJFA 5ITHA 3H4BA 4LRBA 5ETRA 4X4OA 3PRDA 2AJ4A 4OIXA 4QU6A 1W2IA 2IIHA 4B3OB 3N6NA 2QMUB 1VBKA 4ECYA 4KE5A 3SSQA 4X65J 3T1AA 3TA1A 2OAUA 2ZNZA 1FRIA 2GX8A 4WFYA 4ED8A 1VRUA 1LW0A 4ED4A 1KWMA 3DNCA 2J7KA 1WG5A 1M5VC 2A10A 4N76A 1TMJA 1HBUA 3MPYA 4OHZA 2GHWA 4U7CA 2GGPA 3K5MA 4O4RA 1Y10A 4PG8A 3TOQA 4FBTA 1UMJA 5HP1B 3IMQJ 2LKZA 3BO2A 5J1EA 1R8HA 3I0RA 4ALZA 3ETMA 3IS9B 1H7WA 1QTNB 2QA1A 4NYOA 2KJVA 4C2MA 2B4UA 3AOCA 3VQSA 4UY85 2UXCF 2ZH7A 4P52A 2FJBB 4O3QA 2B43A 5LSLA 2AW0A 4FZVA 1N5VA 1U4BA 4AD6A 5KT2A 1VISA 2Z4PA 4DR6F 4TNOA 5B0EA 1APSA 3RBZA 2CDQA 4EZ9A 2N3OA 4FF1A 5EWEA 5L8RC 1RAHB 3EXYA 2JEJA 3DGVA 1S1WA 1MMDA 2HFVA 2BMBA 4DV5F 4TKTA 2X7IA 2Y3YA 3T5JA 1YKWA 3IR7B 2OKQA 5GAHI 2AX0A 4RNHA 1UA0A 1FD2A 4NYZA 2DXEA 3CIZA 2VC0A 2CQCA 4A8MP 3H40A 2N4CA 3CD7A 1JLBB 1HNZJ 4ZJOA 1KS2A 4ZVTB 2BKPA 3R5BA 3JYTB 2EKNA 4CLSA 1SJ4P 3AA8A 5M2UA 3CDAA 2PE8A 4LMZA 1H3DA 4BC7A 4ZVFA 3L09A 1OWXA 3BJYA 3WDOA 1U09A 2XO7A 1T05A 2HYIB 2GCFA 3HDSA 1X4EA 4Q0BA 2VBYA 3US5A 5AE3A 2XGQA 4PUOB 2UUCF 4HVZA 3CT9A 2CWKA 4JP8A 2YKMB 1S7HA 1NK8A 4DUZF 4PG5A 2BYCA 2BRKA 1JKHA 2HHPA 4LF7F 2QYGA 1JB0C 2BM0A 3DFEA 2YKAA 1CJVB 3IM8A 2XY7A 3LF0A 3KJNB 3IC1A 1TV6A 3KTQA 2VQEF 1O8BA 3UE2A 2KI2A 1XNRF 4YY3J 3RJMB 5F0UA 4ZLPA 2RAQA 2GMJA 2CPZA 3MMAB 2HVEA 1RWVB 1K9MT 5K14A 3KLIB 2WTFA 3CGIA 3ENVA 2EC2A 2UVWA 3IWNC 3UD3P 5KFUA 4U7UD 1R8BA 3BGLA 4NLQA 4I2PA 4B3TJ 2M8HA 2B6AB 2NSBA 3CJSA 3PCOB 1DURA 2KRRA 2N3LA 1M1HA 2A3JA 2BKNA 4EBEA 2VA3A 2C1EB 2HGNA 1ZETA 2EG2A 4G65A 1JLAA 3MECB 1NXIA 2H3EB 2R2SA 3TVKA 1PYOB 3MWBA 4LFBF 2LXIA 1YJUA 1WACA 4JV2A 3MI7X 4QPXA 2C2NA 3VGSA 2RE1A 1IBLF 2VQFJ 3BBCA 3UW1A 1TKTA 2IJNA 3M8QA 3I32A 3PTWA 4DV6F 3M8ZA 1EETB 1E6YB 2VBWA 1RHMB 1RTDB 2J7UA 2NREA 4BC9A 4PXCA 1RT1A 3T41A 2R7SA 3EGVA 4KFBB 1WF1A 2WOMB 2MZJA 4ECXA 4UOFA 2E9TA 1N32F 1CC7A 2OPSA 1U1QA 6AT1B 4JBCA 3D9BA 2HNYB 2XHWA 2V2QA 3PY8A 1SIWB 5LOQA 4P6QA 1MROA 3THTA 3R97A 3A1YG 2ZBPA 5B0AA 1M5PC 2FLPA 5KAKA 1KQGB 3PYDA 2JFDA 3MMBB 3PJ9A 1RTZA 3QATA 1M0SA 1BD6A 3G71S 3EPGA 3BGFA 4JI2F 1FK9B 3HX9A 3NAIA 3PHTA 5F0WA 1RJJA 2QZ8A 4RW7A 2PA8D 4B3RJ 2HAFA 4B02A 4Q8FA 4LF6F 3B8HA 3BH7B 2W7OA 4AL5A 2I9SA 4PKDB 4M5HA 3CCVS 2CQ3A 3H4DA 1H98A 1U25A 3R6LB 3C16B 5IV3A 3UNGC 4J9UE 3AODA 3H98A 1YJTA 3V4IA 4OYIA 1FRLA 1YJ9S 2DO4A 5CZXA 2CA9A 2VG7B 2RQKA 4ELTA 3GYGA 3A3NB 4PWDB 3NCPA 3M2VB 3RW6A 3GJSB 3HHDA 1FKOA 3TAMA 4A48A 1S1UA 1FFWB 1HBMB 4B9TA 4NMLA 2LQ9A 4JI6F 4IRCA 2PA3A 2VIHA 3DHWC 5DS7A 3SV4A 5DM7Q 2R8HA 1WDDA 4MMOA 1LWEB 4K4TA 2OPPA 3RB0A 4F0HA 4CM2A 4L72B 1RT5A 3PW4A 2YH0A 3TUIC 4QR0A 4W98A 3EVMA 2IC3A 2XI2A 2WZ1A 3TZYA 2HAIA 4F2RA 2F63A 4QIFA 3PNIA 4X64F 1RAOA 3VGUA 1RHUB 1RWKB 3EZUA 4RW9B 1VQSA 1VQYA 2HHTA 2LA6A 1BE4A 2DCUB 3AT1B 4WYLA 1IN0A 5D3GB 1FKPA 2Z2ZA 4RUBA 3WIUA 3EX7B 2D3UA 3O3LA 3DGPB 2FUG9 4F04B 2VC1A 2YWKA 3CCUS 1RKJA 2M5YA 4FYYB 1WSVA 3RTVA 1VQMS 1NBEB 2VA2A 1JIHA 2JFKA 1RAGB 2C3OA 2JRSA 2RKIB 2QRRA 1IXKA 1Q7LB 3ZTOA 2FPHX 3MM7A 3UDEA 3SXLA 4DZ6A 3I5CA 4O4GA 2ZD1B 4C3KA 4HI2A 2PI4A 1JXVA 2OMLA 1SKSA 5GAEU 1BMQB 4G1IA 4R8UA 4HI1A 1RAAB 3LPYA 4RNFA 2GAHC 2N7CA 1JLFB 5G0RA 4U67Q 2DR9A 2I5JA 3KJQB 4KR0B 1O0PA 2P2CB 4DV2F 4HTIA 3IR5B 3PX0A 1WKLA 2XMAA 5ETNA 5BR8F 4UUWA 2VG6B 3QO9B 7AT1B 4OI4A 2ALZA 3FRZA 5DQHA 1XR6A 2DB1A 4Y00A 4E0DA 3ET6A 2GHPA 3HSGA 2ZHAA 3GMGA 4WCEQ 2IRXA 1OMSA 3AJ1A 1GXUA 2DPJA 5I42B 2ERRA 4P73A 2K3IA 2GQQA 5HQMA 2Z57B 4Q2LA 5C25B 5H9FK 1X0PA 4X4UA 3LUYA 3DOMA 3KUEA 1HI0P 2CZVC 3M32A 4M63A 2RF2B 1I1GA 4WP8A 5HLFB 4ZJLA 1HBNA 2GVZB 4PYAA 4KIAA 3JQJA 3BN4A 2UXBF 3Q89A 5KFEA 5E3CA 1FDDA 4QWEA 2M0GB 2KVQE 2NUHA 4N5SA 2OIHA 2LVWA 5CYMB 3GJTB 5DGAA 3ILOA 4NXMF 3AHPA 1YG0A 1JWWA 3IAM9 1Q4RA 4CZCA 2FZGB 4F67A 3QLHB 4YB1P 1OPIA 2GS8A 2W9BA 2RHQB 1VQLS 4TN2A 5L9XA 4TLQA 2N82B 2A0FB 3C14A 2F4FA 4NMXA 4LQ9A 3JAMU 3QT8A 1ROFA 1TR0A 2C2OB 4K4SA 3CD6S 3HHNB 5A6WA 1B7FA 1UFWA 1RK8A 1OY9A 4P7TA 3UR3C 1S1VB 3L4BC 2MKHA 1T9UA 1JK9B 1Q5VA 3MAAA 2WONB 2RB7A 2Q66A 1MG7A 1V3ZA 4KRWA 5HMWA 3DYAB 2Y0BB 4DR7F 4QCLA 1JLQA 3DU6A 2D3OR 2IM3A 1RHRB 4N41A 3R5DA 2EK1A 3NBPB 2CJ9A 3DRPA 2KXNB 3NG8A 1TL7B 2ZOFA 1U49A 4PXBA 5F8GA 1HWIA 4MT1A 2HMIB 2E5LJ 4O3PA 4I64A 3KNAA 2WSEC 4HLBA 2YWEA 4USUA 3LP2B 5E3QA 2FD2A 3H5SA 5HJXA 4GKJF 4Y3CA 2UVVA 2ZE2B 1F60B 3R7BB 3RYLA 5J2PB 4ERDA 4K0KF 4CO1A 3SV3A 4YP3A 2XEXA 1NZ8A 6FD1A 3QZ7A 5KG5A 5AXMA 3K7RA 1B7YB 2V50A 4KTQA 2JOQA 3D7SB 1JLGA 3AXMA 1VQ9S 3RBXA 1YBUA 3BV8A 4DPYA 1RTJB 1AA1B 2JHEA 1HNIA 4NCGB 2Y1JA 4YHHJ 4LBPA 1LK7A 2DJWA 1DLOA 2QMWA 1EP4B 4RLEA 1RB0A 3Q24A 5KT7A 1SJRA 2YH1A 1D1UA 1RA6A 1FRMA 2R4FA 1RQ0A 3FFIA 2DNRA 3PX6A 5FJ4A 4OYPA 5IOLA 3EUNA 2MKJA 3OR1A 2M7SA 3DXSX 4OYXA 2BQUA 2AGPA 5CD4H 1YDLA 4JI4F 2FJAB 1HQUA 3QT7A 2LEBA 5T14A 3HT0A 2G1DA 2HWIA 4IFYA 1VRTA 5D8HB 4RR5A 3S6EA 4AQYJ 3C6TA 3LAMA 4DR1F 3JQMA 3ENWA 2NUUG 3K5OA 4WIQA 3SMZA 2MQMA 1R0AB 2HLTA 2ZHOA 1KVIA 4AXJA 4Q7AA 1S49A 4ELVA 2A6OA 1DZ5A 1RZMA 1FXDA 2KG1A 3M2RB 4RW8A 3ONQA 2APOA 3ZZZA 4X2BA 4DLGA 1HARA 4FDFA 4IKAA 2AJ2A 2VG5B 3C6UA 5HATA 1KONA 3M4XA 1VRQC 2ZH4A 1RTIA 2EBEA 1DRZA 3Q8SB 4J9LA 2ZVIA 2WVDA 5AXKA 4U7UK 4KQZA 1S6PA 1JJ2R 3FSYA 1X5PA 1RT2A 3EDRB 3TW0A 3BKTA 1Z2LA 1QE1A 5LMUF 3I9V9 4DV7J 2FLLA 4TVAB 2AYBA 1TTHB 3THVA 4ZHRA 2NXUA 5I3PA 1ICEB 1TKXA 1GT8A 2IVYA 5D78A 3BGOP 4PQUB 1BWVA 5LMNF 3IM9A 3HO1A 2NXNA 5F3ZA 2MZTA 4GVLA 3FBFA 1RBOB 3MM9B 3NLCA 5MLCV 1JLEA 2PO4A 1V5VA 4A8WA 4LFCJ 4J91A 2BW7A 1RA7A 4XIUA 3KHLA 1NKEA 1JLCA 5M2RA 1AYEA 4B9VA 2HURA 3ZC4A 1RSCA 2KT2A 3MPUB 3OQ2A 8RUCA 3MOJB 4LF4J 1B0VA 2XMMA 2Z58B 4KSEB 3PG9A 2C2KB 2ZBCA 4DL5A 1S1TA 3BBBA 5LXYA 3N28A 1VQ7S 5IC6B 2MB0B 2HIQA 1RTHB 1CJUA 2QO3A 4EO8A 3G82A 1UEUA 4ID8A 1R7IA 3IG1B 4DL7A 3KNGA 5J2MA 4ZVEA 4FKXA 3PYFA 3TJ9A 3MD3A 3MM6B 3QMQA 3DRRB 4JI1J 1YHQS 1SKWA 2MPUA 4QYRA 4CYUA 3CCLS 1ZTWA 2BJ9A 3T5LA 4B9LA 1LFWA 2D69A 2YX4A 3PW7A 4NLXA 3A3OB 3NCQA 4BDPA 1F3FA 3UFCX 3FMWA 2L9WA 3EVOA 2EI5A 4YFUA 5GVQA 2VF3A 2QX0A 3NAHA 2F9DA 2IJRA 3QIPB 2VFSA 3R1LA 3IFEA 2HGLA 1D0EA 3DLGB 4LFAF 4F3OA 1FE4A 1A7GE 3LW5C 3LP0A 2XCAA 1DQ8A 2XY5A 2CPYA 2AX1A 1HNXJ 3KG0A 1KLNA 2LU1A 3E51A 4AXIA 3Q8RB 1RCXB 2Q1LA 2ZOMA 4C11A 4WKRA 2LDYA 4ENOA 3CCZA 2OO4A 5LJ5Y 2CJXB 1HBOB 2P5VA 1HR0F 4MAKA 3KJVA 4GVBA 4HACB 3VGVA 3VAJA 2WW8A 1NKCA 2A6MA 2M2BA 3MFHA 4F3QA 3FJ2A 3PVXA 4NA2A 3GR1A 3CJQA 3OL9A 2DRAA 5B0GA 4ZVRB 3NWRA 5GADU 3U1LA 5HN0A 4UTGA 1LNQA 2FTRA 1VFJA 2W8KA 5A0YA 3R5CA 3RRHA 2V63A 2MGZA 3S1TA 2O67A 3AY0A 1IBCB 3DOKB 1A6LA 5BXIA 3CJ0A 1QAJA 3WIVA 5KG2A 1RDRA 1F6TA 2GJFA 2DNGA 2QA2A 1U2FA 2OP5A 1XEZA 3FGVA 2CWXA 2GMLA 1BQNB 1T02A 2W7PA 3PR4A 2NS1B 2P6SA 1Q78A 3K59A 3MEKA 2V9WA 3J81j 4PPDA 2DBBA 2CADA 2AQ4A 3VTIA 4ELUA 4DQPA 1YQHA 4MH8A 2JEFA 1S9EA 3S01A 3N5BA 1JXLA 2IVMA 5DDOC 2FYXA 4TYAA 5HQ8A 1ACMB 3HVTB 5E3PA 2JX2A 5KFVA 2VOOA 2ZH8A 3K8VA 3PV8A 3D3CJ 2AJ0A 4PRFA 4IG3A 2IM0A 3OTBA 4X65F 2ZC3A 3PFEA 3PW5A 1WC3A 4XDDA 1T9YA 5HSPA 2C2DA 4Y28C 2CJQA 2ZH3A 1OY8A 2VICA 3BQ1A 1X4FA 3WC2A 4OV6A 2XMVA 3BKFA 3Q8UA 4URGA 2PIIA 1L3UA 3A4TA 2AU0A 4WFBQ 3ZNUA 3PJXA 5IXUA 4NLPA 1UA1A 4DL6A 4R5PA 1VIOA 1TL4A 3QT6A 2COLA 4ICLB 1KFDA 3DLKB 2KXFA 4L3NA 4YB7A 3DKDA 3CTRA 3W2VA 3OUYB 1GQEA 3PO5A 4TYBA 5A8KA 2B9XA 1RAEB 4KO0A 4LRFA 4ED1A 4ZP6A 1RHQB 1PJ5A 2FVPA 3LANA 1RP5A 4A8FA 3HSZA 1QTMA 2VPXB 3M8WA 4I67A 3MCOA 1H2TZ 4P2SA 4Q45A 3G6ES 4CO3A 3HI9A 2YQ3A 2CQIA 4CLZA 5GADI 3MPVA 2K1RB 3DN9A 5B0DA 3H5UA 1WOSA 3EGNA 1KTVA 3I0SB 4P75A 4M5KA 2QL5B 2DGVA 3A12A 5KG4A 1RABB 4KV8B 2MQOA 2XYHB 5HBMA 4P2MA 4QWCA 4Y2IA 4OX9J 8ATCB 1HNZF 3BN7A 4DUTA 2KFZA 2MJUA 1UW9A 3V5RA 4Q5VA 1UFLA 1XR5A 3FC9A 5HK4A 3H59A 2I38A 3IA0A 4M1KA 4CO5A 2V94A 2DEJA 2KRBA 3KK2A 4DZDA 2Q79A 1WG4A 1X31C 1QVGR 3CSKA 3CDUA 3ZTSA 1NZAA 1ZAXA 4IO1A 3KK3B 2HSEB 4NZ7A 1XC9A 1U0HA 2K7JA 2KJWA 2VKZG 4KPYA 2ROPA 2H4YB 4XPCA 2YNHB 1T03B 2M9KA 2DO0A 2GA7A 3VAIA 4NX9A 3GSDA 4IRKA 2O5DA 1N54B 2QJ3A 3SBMA 3KLEA 3P4UB 5EGYA 2H51B 1RT4A 1G3OA 1SH0A 2W2MP 3UDVA 3JSMB 4YY3F 5JJBA 3H8YA 3SCLE 1LFPA 1PGZA 1TL1A 2MEWA 4A46A 4AYBD 5HROB 4UZCA 4F26A 4YMEA 4CTAA 2XSFA 3FZBA 4JYAF 3IRWP 5IS2A 5DZ6A 2MJNA 2V8GA 5IQ6A 1MW7A 3J7AN 5CCLA 2ZDPA 4OFZA 3POTB 3QGPA 3KK1A 4NI2A 1IJEB 5C24B 1N5SA 2KHDA 1SJ3P 2ZZTA 1FE0A 4WBFA 1MSWD 2IA0A 1H74A 4OI1A 2PT0A 4KJIA 4UF4A 4WFNQ 3A13A 5CAAA 2Y8YA 2L08A 1VCTA 1HNVB 5ETPA 3KHHA 3ETOA 2VQFF 1U45A 2ZBIA 1U0SA 1UPPA 2MKYA 2H4WB 1SC6A 3NEKA 1M90T 1H2UX 2WSCC 4ED3A 4KY3A 4ECQA 3NS6A 4CH7A 2OH2A 1C2PA 3H2VE 4XPEA 4UQGA 4DQSA 5E3RA 4C8KA 3PFOA 3GTYX 1LWFA 4ITSA 1C1CB 4NRUA 3SFGA 4K4WA 3O44A 4USVA 1N33J 3MGJA 3HFKA 3W5YA 4JV5J 3J80Y 1AFIA 1SCJB 2RD5C 4KKOA 1SKUB 1VJQA 2LECA 2O3DA 1VBYA 3T6JA 4Z7YA 4AE5A 1O6XA 1YRUA 4ZVGA 2I6WA 2RVJA 3GIMA 2MKIA 1PCAA 4ZVPB 1AUDA 4DL0C 3E01A 4QQBA 4NRTA 3V6DB 4J9SA 3VGTA 2FLNA 3ADAC 4ZIVA 4USKA 2DGOA 4MIWA 3GYNA 3W9JA 3DLBA 4F02A 1XERA 3PYGA 3VZHA 2E7VA 3R7NB 3RUBL 5KFJA 4H4OB 4HHJA 2B4OA 4B3OA 1YBAA 2L3MA 5D6GA 2BOPA 2GNKA 2L9NA 4HHUA 3TX0A 4ZLJA 4OYAA 3WX4A 3TEHB 4OZ0A 3AJDA 5K8PA 5KFDA 3G8SA 4IH5A 3KKFA 5KOXA 4HKQA 2BR0A 2HNZB 3AOAA 4CH1A 2VFUA 5D4PA 4JI2J 3OPKA 5SUHA 1HWKA 1FD8A 5KFMA 1S0MA 4RWXA 4HYKA 5HP1A 1IKYB 1PKUA 2VBZA 3IS9A 3FCWA 3LO3A 4ES2A 5IT4A 1BQXA 4ZOSA 5HMYA 1N52B 2R7VA 4OHXA 5DG8A 4V19J 2CPXA 2QYCA 4PZVA 4TU8A 2BE9B 3PKMA 2HQDA 2IDLA 3KLFA 2QL9B 4LRAA 2LU2A 2J6TA 1KEKA 4YR3A 3OVAA 4QWBA 3K5PA 3ZFVA 4AL7A 3D1QA 3TX8A 5HVHA 3BR8A 1Q16B 3EICA 4N8NA 4NLUA 2AEJA 3OLBA 3TVZA 3I56S 4EWTA 3MD1A 1V9OA 1VQ6S 4H54A 4ECRA 1JLBA 3M2UB 2HS3A 2DD8S 3UNYA 1CLFA 3MEGB 3JYTA 4HDHA 1DARA 3GONA 1R0BG 3C46A 3DLLQ 2HFNA 3OHBA 4LF8J 2OFGX 1KTQA 2AYMA 2XZTB 3BF4A 1J5OB 3T19A 1BY9A 3J81Y 2RRAA 4NEYA 1FTCA 1AT1B 3I55S 3CDBA 3HFZB 1DBDA 4FYXB 4I6AA 2ZVSA 3GCWP 3PW0A 3N6LA 4PUOA 1CC8A 2DNYA 1B3TA 4M8LA 1F2GA 3GU0A 1REVB 1U8WA 3IAS9 4B3SJ 2YKMA 3V2UC 3OL6A 1VQOS 4HTJA 3DC2A 5D0RA 5J2QB 2J6SA 5E0OA 2BM1A 2ZITA 1CJVA 5EX0A 2E1RA 3AXKA 1YJNS 3A3PB 3G6XA 2DVIA 3TUZC 1FXLA 2F8HA 2Q6CA 1W7WA 1WHVA 5KFQA 2UUAJ 1EARA 1PSDA 2DNZA 4HH1A 3I5BA 1S76D 3J7YI 3HSJA 3MMAA 4DV2J 4DMZA 2KYXA 3M6XA 2HFOA 4UZBA 1TELA 3KLIA 2JC0A 2MQPA 5DM6Q 2OHDA 3CXCR 2CJKA 1S59A 2HHXA 3GG0A 3LAKA 1VLYA 1IWAA 2R2TA 1Y11A 1WI8A 1YSJA 2FB0A 4NWBA 3PR5B 2B6AA 3HZGA 3BZQA 4DSIA 1GMWD 2QLJB 3N79A 2B7CB 5IT9Y 2UV8A 3MM8B 4QIEA 4DPXA 3NGSA 3MECA 1LW2B 3ZNJ1 1R8CA 4ANEA 4C9DA 4LVOP 3QGHA 1TK0A 2H5EA 2FQQB 1F9FA 2HFSA 4S0MA 4WF9Q 2LYVA 1FNXH 3RG6A 4RNMA 2UU9J 4RUHA 1AXQA 3H7HB 2M88A 3OVBA 1M1KT 2MLZA 3W2WB 2V4JB 2OPQB 3M8PA 3CDEA 3GG1A 2LXFA 2UUBJ 2F65A 5D0EA 1UWBB 3I4HX 3ISZA 1EETA 2CG4A 1E6YA 5BYSA 3EXCX 3PIOQ 1RTDA 4DSKA 3WHIA 2MSTA 4Y6IA 4LRCA 4KFBA 2WOMA 1GFWB 2O1PA 2Z56B 3GQCA 4EBDA 1S77D 3NL0A 2A2DA 4A8XA 5L9NA 1Q8BA 2HNYA 2RU3A 3DHXA 1LXNA 3EGZA 4I6WA 1UVJA 2WB4A 4WTYA 4JV1A 4DS5A 2Y8WA 5H9EK 2E5LF 5A2QY 5AXLA 3EYZA 1D9DA 3SFUA 2ZWOA 4QZVB 2CQ1A 2FJWA 3MMBA 5C42B 1TMMA 4XO0A 2PEHA 3JTPA 2J8SA 3FVYA 1FK9A 3CJ5A 4ID5B 1RT7B 4M94A 3VWSA 4XDCA 4MTPA 3LWLA 4O3OA 1HD1A 2BE2B 5KG7A 4Z37A 3C16A 1IM6A 2FZCB 1XMOJ 1RLDA 1VOMA 1RYSA 2W2QP 4WK3A 4YHHF 4MK8A 1N5YB 1H73A 7FDRA 2VG7A 5K5MA 3GZ7A 4OV1A 4PWDA 3M2VA 1PO6A 2RQCA 1X4AA 2HG4A 4BLGA 3NNCA 2DHSA 3T1YF 1BQMB 1HBMA 1HL6A 3BO4A 4YN3B 4DOZA 1LWEA 4GKJJ 2MXYA 3DLJA 2ZJPQ 1UKUA 3TAQA 2ZZNA 1IKXB 2Z0GA 2MY7A 5IFMA 4I0WA 4K0KJ 2GQCA 4ZP8A 2BJ1A 2AD9A 1KKHA 3W9IA 5HJYA 2HHQA 4F0KA 2HRUA 4C8LA 1RI7A 4AQYF 3G2XA 3TJ8A 4RW9A 3MPWA 4KGXB 3Q0AA 1NEEA 3D1HA 2V8VA 2W9AA 3B4MA 5D3GA 1U1PA 2R7UA 1PIEA 3DGPA 3EE3A 5E33A 4LVNP 3V81B 1VHFA 2CPHA 3P49B 1IWGA 2G2ZA 1WSRA 2RIJA 2EBGA 1Y00A 2RKIA 3D2WA 2M3DA 2G9OA 2LQ5A 4JI4J 2ZD1A 1T3NA 1V5IB 3JB9k 4OZLA 3W60A 1C0TB 4DV7F 3OTDA 4K2JA 4PG4A 2EEYA 2CZ9A 4MYTA 1NKBA 2Y1LB 2YKQA 3O6QA 3VALA 2CRLA 3UVJB 3M1VB 1JLFA 2CJBA 2VODA 2LEPA 3UWTA 4ILMA 1PC4A 4DR3J 3TQ1A 3CCWA 2I0XA 2VG6A 3QO9A 1MNEA 2OI2A 5HMZA 3N5FA 3IR6B 1RT6B 1M5OC 4PCQA 3U1MA 1FWLA 2R3VA 3FRYA 1HHSA 4RW6B 3IGNA 2KU7A 1IBMJ 3RRKA 2W01A 4LF5J 4LFCF 5I42A 3R7SB 3DLEB 2OPSB 4PR6A 1HW8A 4NLDA 1RISA 2YWFA 3PEHA 5G4DA 2QIFA 4QW8A 5DDRC 5C25A 2K06A 5FLXY 5CQGA 2XQCA 5KFFA 2QG9B 1PYSB 2ZH6A 2RF2A 1ZA1B 1NK7A 1X5SA 3V6JA 5HLFA 2GVZA 3I5AA 4B9MA 2CPIA 5DETA 3P45B 2X1BA 2QTWA 1FJEB 3OD2A 4TY8B 2DT9A 4JI1F 2ACMA 2WW4A 5DG7A 1DQ9A 5CYMA 2HS0A 2YBVA 4LSNB 2KFNA 2NXJA 2P9GA 2HBQB 4DHVA 4I7FB 2EK6A 2EKYA 4HEA9 2AJQA 3QLHA 4J37A 3SDEA 2G0JA 3TZXA 3FBCA 3RR8A 1GH8A 1TL3B 4PWUA 5LXRA 2HK3A 5F9LA 2AIRB 1S0VA 1B0PA 4QWAA 4P72A 1PC5A 2AZ3A 1HNXF 1S1VA 1HMVB 2WONA 1F5AA 4DL2A 3DYAA 1HWUA 3IRXB 2B5JB 2R7XA 2HFUA 4I6YA 3VR1A 3N4WA 3EGWB 4Q2MA 3K57A 1JJHA 1U24A 4EUVA 4CT8A 2I8EA 2GC8A 1QAXA 5F41A 4FKYA 3NBPA 4V19X 1DTTB 3K5LA 1TL7A 3RGIA 1OS5A 4TU7A 4L3KA 1R43A 1XMBA 5D0GA 2HMIA 2E1PA 5JUMA 3PKYA 2HWHA 2KG0A 3SSRA 3S7RA 3LP2A 4BS2A 2ZE2A 4CT9A 4A47A 2MZRA 1U02A 5J2PA 3PACA 1TP7A 2HZCA 5B09A 5CHCB 2ASLA 1NB2A 3MM7B 3U1NA 3UDCA 2CQDA 4I69A 1U47A 2MQ8A 1NO8A 4N56A 4K2XA 3GR0A 2F9JA 3GCXP 3BGRB 3G6VA 4CRJA 2MMYA 1C4CA 1RTJA 1DAXA 1VMBA 4NCGA 2ASDA 1R89A 2V2KA 2C2ZB 1EP4A 2HHHJ 2W7AA 4UOHA 2KT5A 2AGOA 4ZVHA 3GSIA 2GVDB 1VK3A 2J8AA 2FC9A 5KFIA 3FMBA 1V6HA 4FVCA 4RUAA 1HIYA 2ZWPA 1W2BR 4BCAA 4FXDA 1EQ0A 5GAHU 4TU9A 1SC3B 1RWOB 3VVTA 2DYAA 1HPZB 4F4YA 1DY3A 2VJUA 2DHAA 4KPCA 4JI5J 3IXQA 5E7OB 2HGMA 1S6OA 4NOHA 5EX3A 1Y5IB 3MXHP 5C7PA 1WC0A 1SBRA 4ZPVR 2J9EA 3OV7A 3FKBA 5ETMA 4KHRA 3DMJB 4KGZB 4DCPB 1F9EB 2CQPA 4DXLA 4DCOB 3UN5A 2PEBA 3HKWA 1VK8A 4ILRA 1RWUA 5DJBA 5F8LA 1AB8A 2OTJS 1NHUA 3CIMA 1CJTB 3NKYA 3CJ3A 1R0AA 2LQ8A 2ASJA 1CULB 5KT3A 4CO4A 1Z1ZA 5KFOA 9ATCB 2D9PA 1WKJA 2DR6A 4F50A 2XBPA 3M2RA 2CYYA 2DITA 3CPWR 2VG5A 2V8PA 3MM5B 4FN5A 2YTCA 4X4NA 3F56A 3HVRA 2G13A 2FHJD 4OL8A 2DISA 2L9DA 2HQFA 1WORA 3B78A 3ITHB 3D3BJ 1UJ6A 2DY1A 3BBFA 2CVIA 3HHEA 4BHQA 2UV8G 4F3MA 1Q79A 5I3UB 2OJ3A 2HFZA 1IR1A 2X1GA 2F4VJ 2CVEA 2WVFA 2DK2A 1DFDA 2HQ3A
chains in the Genus database with same CATH topology
4OX9F 4LQ3A 1ZM2A 5F8NA 3QIPB 1HPZA 4X4SA 2VFSA 4PQUA 3R1LA 1S6QB 2NSCA 3IFEA 1AW0A 1K0TA 2FLOA 2ZHBA 1S9EB 4D3GA 2HGLA 1GTHA 3CC7S 2ZZMA 1D0EA 3D54A 3DLGB 4LFAF 2XMWA 4F3OA 3LGMA 1FE4A 1U1LA 2ZFHA 1A7GE 5H9FJ 3HLUA 3LW5C 3LP0A 2XCAA 1DQ8A 4N8OA 2XY5A 2CPYA 3DMJA 3FEXB 1U1RA 2AX1A 4DN9A 3MM9A 4DQQA 2VBXA 5L1JA 3KG0A 1KLNA 3MFIA 2LU1A 1UVNA 3X1LB 3E51A 2FHKA 3DU5A 4AXIA 3Q8RB 4NCBA 2OSRA 3NGKA 3PX4A 2Q1LA 2ZOMA 4C11A 4WKRA 2LDYA 3IO1A 4RW4B 2O66A 3CCZA 2OO4A 5F9NA 5LJ5Y 1VQKS 2KTQA 2VH7A 4AFFA 1HBOB 3I4PA 2VASA 4WFAQ 2ZH5A 2P5VA 1HR0F 3ULHA 1XR7A 2LLZA 4WXWA 4MAKA 2DR7A 1NU4A 3Q22A 4R0JA 1O5JA 3KJVA 4K59A 1QUPA 2C22A 4ZCMA 2FJXA 2Z2MA 2OPRB 4RZRA 1TQLA 2J6UA 2PDAA 4E8UA 2ZH9A 3VAJA 3MUMP 3OTEA 1UW4A 2A2CA 3UQSA 4DF8A 1S97A 2WW8A 3K58A 2ACYA 1NKCA 2M2BA 5FDLB 3MFHA 4DFKA 4F3QA 1K73T 3FJ2A 1SUQB 3PVXA 4NA2A 3DDKA 2DHXA 3GR1A 3OL9A 4DV4F 4YOEA 4MFBA 1I6JA 1RTHA 2V9KA 1C4AA 4RNNA 1SH3A 3MM5A 2DRAA 1P27B 3IG1A 3T5HA 3N0VA 5B0GA 1Q1KA 1S0OA 1GX5A 1Z4UA 1IBKF 5B0BA 4GC7A 3TUJC 4Q8EA 5GADU 3TO8A 2UZAA 3U1LA 4LSLB 2VPWB 5HN0A 4FNIA 3RAMA 2FTRA 2JSXA 4R5PB 4C4WA 3MM6A 5KFWA 3DRRA 3FEYB 1VFJA 4HT5A 2GJIA 4C3LA 2V4RA 2W8KA 2R2RA 5A0YA 1HYSB 3ITHA 2NQPA 3OXFA 3R5CA 1IKVA 5D4LA 3RRHA 2MGZA 4ECVA 4EZ6A 2KM8B 3S1TA 3SDEB 2JJ4D 2O67A 1NK6A 5DO2A 3AY0A 2W8LA 3W2VB 2DNMA 3DOKB 3HVWA 2R7WA 1RKIA 4C8ZA 1A6LA 4C8YA 3GE9A 2XNRA 3CJ0A 5I3UA 5A8KB 4C0BA 5EWFA 3HK2A 1QAJA 4ZPWR 1RT3A 3M6UA 5KG2A 1RDRA 4DS4A 2EG1A 2DNGA 1S9GA 2QA2A 1FCAA 5FD1A 3MUVP 1U2FA 2I2YA 4WK1A 3VAFA 1ZH5A 1D3WA 2OP5A 4KO0B 3J7YU 3Q8PB 2MKSA 1UJ4A 1XEZA 4GO7X 3FGVA 1P1TA 4E98A 1KD1T 1O51A 2GMLA 3U7JA 2B7BB 2RH3A 3O5TB 4DSEA 4CH0S 2W4CA 4DX8H 1BQNB 1T02A 2W7PA 2EFOA 3SCJE 2N4DA 3PR4A 2NS1B 1X7VA 2P6SA 1Q78A 1E6VB 2DGTA 3K59A 1SI9A 3MEKA 3QIPA 2V9WA 4DQPA 4PPDA 2DBBA 1S6QA 5GAEI 2KDOA 3VTIA 5J1PA 4O0IA 1YQHA 1C1BB 2AQ4A 2PI5A 4MH8A 2JEFA 1S9EA 3W3SA 4OZJA 2ZH2A 2E5GA 2GO8A 3ZZTA 1N5TA 2DHGA 2DIUA 3DLGA 3S01A 3N5BA 4A8SA 2DRBA 3BSAA 1JXLA 2KM8C 2XLKA 1G6BA 2IVMA 5KG3A 5DDOC 3GV8B 3I9ZA 4TYAA 5HQ8A 1TUVA 2JH3A 3HVTB 4R25A 5E3PA 1HD0A 1YRTA 4NLVA 2JX2A 1JJ4A 5KFVA 4OHVA 4LF4F 1ZM3A 4ED2A 2VOOA 2Z2LA 2HHVA 1P9QC 2ZH8A 3K8VA 3T1HF 2CQGA 5KT5A 3GV7B 4CQ1A 4RW4A 3PV8A 4X4VA 1F5BA 1H0HB 1ZM4A 5CXTA 1U6FA 2AJ0A 4PRFA 4IG3A 1HBOA 1K1QA 4BBYA 1I94F 2E9RX 2DCLA 2IM0A 3IGVA 1R6YA 2MHEA 3OTBA 4X65F 4J9KA 1L5UA 2ZC3A 3PFEA 3PW5A 1WD6A 5HBMB 3A8EA 4O23A 4WXOA 4XDDA 3GIIA 4G1PA 4DFJA 3DCAA 2JLEA 2KO1A 2RNEA 4YR0A 5ADZA 2OPRA 5BJRA 3NP5A 3F73A 2OFHX 2J7WA 3PW2A 3MCSA 4NZ0A 2C2DA 2YNFB 4Y28C 1G2EA 2CJQA 3R1HA 2ZH3A 1NJXA 3ZZRA 1LV5A 3QPIA 3DLHA 1VIXA 4NL5A 1QAYA 3NRBA 3BQ1A 3HPOA 4USIA 5FDLA 1X4FA 3KHRA 1SUQA 2BDPA 3WC2A 1FTRA 3CD5A 3RAXA 1UETA 3D5MA 2XMVA 4URGA 2PIIA 2FC8A 1L3UA 2C3YA 4IH7A 2PC6A 4USHA 2AU0A 2B56A 3OVSA 1S1XB 4B3MF 4JI3F 1U6BA 2LEAA 4WFBQ 2POKA 4ECUA 5DLGA 3PJXA 3KK2B 1F5CA 5IXUA 3BQ2A 4NLPA 3KG1A 4LSLA 1UA1A 4ELUA 1X5TA 4DL6A 1X9WA 2FY1A 3U02A 4DG1B 4R5PA 1BLUA 2Y1IA 4IQXA 1VIOA 2IMOA 2RMLA 1TL4A 2COLA 4JV0A 4ICLB 2KZMA 3KOAA 4CCHA 4WFZA 2UP1A 1KFDA 2QSFA 3DLKB 1N33F 2KXFA 2HWTA 4L3NA 4YB7A 4JV5F 3CJKB 3CTRA 2ZOGA 3W2VA 3DOKA 3VZIA 4WYWA 3OUYB 2B51A 3CWJA 1GQEA 3PO5A 4TYBA 5A8KA 4D3HA 2UXDF 2RDIA 3FCHA 1GNKA 5AE2A 2B9XA 4ECZA 4K50A 2ZM6F 3H5YA 4B17A 2IJFA 1NK4A 2VFVA 4JI8F 4X4RA 4KO0A 3IBWA 4ED1A 4ZP6A 4LT6A 4QR2A 3PDNA 3TA0A 2FVPA 1HHTP 2MQLA 3NNAA 3DOLB 2BBEA 1RP5A 3LANA 3CCES 1BQNA 4A8FA 4WE1B 1N34F 3KG4A 1E6VA 5K8NA 3KLEB 4Q44A 2VPXB 1GXLA 3N9UC 1WEYA 1QTMA 4I67A 1C1BA 1H2TZ 4P2SA 4Q45A 1L3KA 2FHOB 3G6ES 1MWYA 4CO3A 2D41A 3HI9A 1RT4B 2YQ3A 3RB3A 4YB6A 4DLEA 2R8GA 3FSIA 2GW8A 3MTJA 1N4LA 3BDPA 2CQIA 1FT8A 2VKRA 1BWEA 3CJ4A 5GADI 2VD3A 3MPVA 1IQZA 2E44A 1R31A 2K1RB 3DN9A 1X4CA 4IG0B 3HVTA 3WZ0A 4B9UA 1Y7PA 2R7OA 5AXNA 5EDWA 5B0DA 1Y3KA 5CA5A 1TL1B 4ZPDA 3AH6A 3QJPA 1WEXA 3SQGB 5M2PA 5I3QA 3H5UA 1QSLA 1S0NA 3BQ0A 4AUKA 3EGNA 4CTAB 1KTVA 3I0SB 3QGIA 2PGCA 2MZ1A 4J9NA 3DRYA 1X5OA 3O1LA 2RRNA 2DGVA 1UP1A 1GAOA 5KG4A 2DNOA 5D77A 4KV8B 2MQOA 5HBMA 3I6PA 4QWCA 1TK5A 5DRKA 1LK5A 3FQKA 4Y2IA 2J9DE 4QIWD 4J9OA 4HT7A 1HNZF 3BN7A 4IRDA 2KFZA 2MJUA 3KK1B 1FRXA 3VAGA 4J9PA 2XS2A 2YNFA 3FSXA 2DH9A 3OFEA 4KGKA 3V5RA 4Q5VA 1UFLA 4QIVA 1XR5A 1NH7A 2DGXA 2D7SA 1KHWA 2ZKUA 1FDAA 3QZ8A 1NK9A 3H59A 3M8RA 2I38A 3IA0A 4ZPAA 4U9RA 4M1KA 4C8NA 1ZPWX 1D8ZA 3AAWB 4CO5A 1FDNA 1YI2S 4RUCA 2V94A 1S1XA 3QAUA 4NLTA 4B9NA 2KRBA 2R7RA 2XSJB 1CQMA 1SL0A 3OFFA 3KK2A 1X4BA 1ZYQA 2QLWA 3IWLA 2R8IA 2E7WA 2Q79A 1VBZA 1WG4A 4DG1A 2Q3PA 3TVYA 1Z2ZA 3P6YC 4ICLA 1TAQA 1QVGR 3CSKA 3CDUA 1VS3A 3KFWX 1XN9A 4X84A 4A4JA 3DLKA 3NMAA 1NZAA 1ZAXA 1N6QB 4IO1A 3WBZA 3DRSB 3CJKA 4C8MA 3KK3B 5F8IA 1B0TA 1OQ6A 4X62F 3AQPA 3OUYA 4J9MA 4K4ZA 4NZ7A 2QSWA 1XC9A 1VRUB 2DGUA 1LW0B 2QE5A 5J2MB 2K7JA 2KJWA 2VKZG 1WTFA 4DF4A 4KPYA 3UCGA 2ROPA 2XC9A 3LH2S 4XPCA 2YNHB 2KZZA 5L39A 2NPFA 5A6PA 2J5AA 2YNIA 1T03B 2M9KA 1Q53A 4KHPF 2DO0A 2GA7A 4Y34A 2BW2A 2FJDB 3IWXA 3VAIA 1U1KA 3DOLA 3MAHA 2DGSA 2YKPA 4NX9A 4JUZA 2RRBA 3RBDA 1N0UA 2EWHA 3K0JA 3GSDA 3TARA 4IRKA 1HBUB 2O5DA 3PEJA 4WE1A 1N54B 3MF5A 3KLEA 1XMQF 3JAMY 4USJC 2GGPB 2GV1A 4URSA 4IO9Q 3QJJA 4IQMA 1FHTA 2L48A 1U1NA 2B3TB 4OJ1A 3CVKA 4C7QA 5EGYA 4UQTA 4IOAQ 2FVRA 1RT4A 4ETZA 1IUJA 2KHCA 1UL3A 2UUTA 4J5OA 4WIIA 1G3OA 1LWFB 1SH0A 2M8DB 3JSMB 1HQEB 2FIUA 4YY3F 5J1EB 5JJBA 3I0RB 1S6UA 3H8YA 4MK7A 5CH7B 1R27B 3SCLE 2K1RA 4OJ3A 4O3NA 4IG0A 1LFPA 2XG8A 3CE8A 2KH9A 4RBTA 1PGZA 3TNVA 1RGVA 1TL1A 3ZZUA 5D4OA 1LWCB 3SQGA 4A46A 4AYBD 1N5QA 5HROB 3MUTP 2Y0SD 4KKOB 4OLOA 5KFXA 3JTOA 4F26A 4YMEA 1FKAF 4C0HA 4CTAA 3PM9A 3I0SA 5KFTA 2XSFA 3FZBA 4ZPCA 4DR5F 2WRMA 4JYAF 1WF2A 3HMJG 3IRWP 3HKZD 4QWDA 1FVQA 5IS2A 2FHMA 4KV8A 3VAHA 3M6VA 3OXGA 1GTEA 3CCMS 2MJNA 1S72S 2V8GA 3GIJA 5IQ6A 2RUGA 5CZVA 2IMWP 1MW7A 4DV1F 3RB6A 3THPA 2D74B 5CCLA 2DH8A 2ZDPA 2RDJA 2B9WA 2DNKA 4OFZA 1QSYA 2K3KA 4OQJA 3GFHA 3POTB 3QGPA 3KK1A 4URQU 1IJEB 2HLUA 3E01B 1P1LA 2CPDA 5C24B 3CCSS 3KMQA 1FRKA 4I1TA 3HJFA 3KLGB 1N5SA 2A1BA 5ITHA 2KHDA 2XCPA 4GO5X 1SJ3P 4QYZJ 1VQ5S 1VBXA 3H4BA 2OTLS 1FE0A 4LF8F 4ZPTR 1MSWD 4X4OA 2IA0A 3PRDA 1TFWA 2AJ4A 3KYLA 1XNQF 5KG0A 3BDEA 4OIXA 4FYDA 4ETXA 1S1WB 4N77A 3G9CA 1LOUA 1WTBA 2XSJA 1YVFA 4OI1A 2PT0A 4QU6A 4KJIA 1X4GA 3FQLA 4WFNQ 1W2IA 1SKRA 1WNEA 2RS8A 4B3OB 5KFRA 3CUNA 3N6NA 2W4DA 4IOBA 2EPIA 2L08A 2WSFC 5HO4A 3KHGA 3UD4P 1HNVB 2OSQA 4ECYA 1FVSA 3DDNA 1Y4ZB 4KE5A 3KHHA 1NAQA 3ETOA 1N6QA 3SSQA 3T1AA 4ECTA 3TA1A 3DRSA 3GB0A 2OAUA 2ZNZA 2ZBIA 2VQFF 3KK3A 1U45A 1FRIA 2BRLA 2GX8A 1S99A 4WFYA 4ED8A 2M52A 3CO9A 1VRUA 1LW0A 3DNCA 1SC6A 1M90T 1YJVA 4B3SF 3J7A1 3M6WA 4IFVB 2J7KA 1HA1A 1H2UX 2IYGA 2WSCC 2YNHA 3LWMA 5MAOA 3QGGA 5D4NA 5KFGA 4ED3A 1WG5A 1M5VC 2A10A 1KVJA 4CO0A 3RBEA 3PO4A 2NYIA 3VF0B 3QAEA 3NS6A 4ECQA 4N76A 3VAMA 4NXNF 4GKKF 3I82A 4CH7A 3L7PA 3VCDA 2OH2A 3JSBA 1C2PA 1KNZA 2NPIA 3H2VE 4XPEA 4DV3F 1HBUA 3SYZA 3MPYA 1P8GA 5B7WA 4UQGA 1U8SA 4OHZA 1NB7A 2GHWA 4U7CA 4DQSA 2GGPA 5E3RA 5EWGA 5L1KA 3K5MA 2EFQA 4O4RA 2VFTA 4ZDNA 3GWCA 4PG8A 3KLHB 3FZ2A 5DGBA 4DSFA 3TOQA 4ED5A 4FBTA 1UMJA 4C8KA 3PFOA 3J7Z5 1R8PA 3PXGa 5HP1B 2K7KA 1LWFA 3SEOA 1SL1A 2UUAF 2LKZA 4ITSA 1C1CB 2Y1RI 4LIRA 2ZH1A 3JSMA 1HQEA 4NRUA 3BO2A 5J1EA 1R8HA 4DEZA 2BANB 3I0RA 1T05B 3CD0A 3SFGA 4ALZA 2VUGA 4K4WA 3IS9B 3O44A 2W4PA 1H7WA 2QA1A 4WJBA 4NYOA 2KJVA 3MGJA 3HFKA 1Q8IA 4C2MA 5IZHA 4Q0BB 2B4UA 2E1CA 3J80Y 3CC2S 3VQSA 4UY85 1AFIA 1LWCA 1CQNA 2RD5C 5HROA 2UXCF 3I87A 4KKOA 5JXSA 4ZCIA 2JEGA 4DDFA 1L3TA 4PG6A 2LECA 3TI0A 2BUNA 2O3DA 2ZH7A 2IVFB 1WI6A 3CDWA 1VBYA 2HS4A 5F8HA 2FJBB 3KLVA 4O3QA 3T6JA 1JKHB 5KFLA 4ZMMA 4AE5A 4OZNA 2EFNA 2B43A 4H4KC 1YRUA 4ZVGA 2LQJA 1IM4A 5LSLA 2AW0A 2RVJA 3D1OA 3GIMA 4FZVA 2UVRA 1C0UB 3POTA 1N5VA 1U4BA 2MKIA 5KT2A 1AUDA 3CMES 2Z4PA 4DL0C 1M5SA 3E01A 4DR6F 5C24A 1TV6B 4QQBA 4NRTA 4TNOA 3V6DB 3KLGA 5B0EA 1APSA 1WHYA 4J9SA 1QSSA 2FLNA 2CDQA 3M9MB 2DGOA 4EZ9A 3D28A 4MIWA 1KRPA 3MOZA 5KFCA 3GYNA 2N3OA 1ZPVA 4IG3B 4LUBA 4OI2A 1KFSA 4FF1A 5EWEA 5L8RC 3DLBA 2LA4A 4F02A 1OIAA 1XERA 1QAIA 3VZHA 3EXYA 4ZKAA 2FDNA 4O44B 2JEJA 2IRUA 1S1WA 1MMDA 2DGWA 1XTZA 5KFJA 4CNYA 4H4OB 4DV5F 2KN4A 4TKTA 4HHJA 5K14B 2B4OA 4R0EA 3MR3A 3T5JA 1YBAA 2L3MA 2ATLA 4B3OA 2FGCA 3E8OA 2UU9F 3IR7B 2OKQA 5GAHI 5D6GA 1HNVA 2BOPA 3SCIE 2AX0A 4RNHA 4LJMA 2GNKA 2L9NA 1NJYA 1S48A 4EYIB 1UA0A 5L38A 5FIIA 3I96A 3GFXA 4I2PB 1FD2A 3WX4A 4NYZA 1FNMA <