4P7TA

Structural insights into higher-order assembly and function of the bacterial microcompartment protein pdua
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
85
structure length
85
Chain Sequence
QEALGMVETKGLTAAIEAADAMVDSANVMLVGYEKIGSGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into Higher Order Assembly and Function of the Bacterial Microcompartment Protein PduA.
pubmed doi rcsb
source organism Citrobacter freundii
molecule tags Structural protein, electron transport
molecule keywords Polyhedral bodies
total genus 21
structure length 85
sequence length 85
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4p7tA00
4PPDA 4RBVA 3DN9A 4AXIA 4P7TA 3I6PA 3BN4A 4OLOA 3NWGA 4OLPA 3IA0A 3H8YA 3VCDA 2A10A 4QIFA 3SSQA 4QIEA 3NGKA 3DNCA 4P7VA 4AXJA 3N79A 2A1BA 4P2SA 4QIVA 4DDFA 5DJBA 3SSRA 2A18A 3CIMA 4RBUA 3I96A 2EWHA 3CGIA 4RBTA 4OX8A 4LIWA 3SSSA 4OX7A 4QIGA 3MPYA 2G13A 4OX6A 3MPWA 5L38A 3PACA
chains in the Genus database with same CATH superfamily
3OW2R 3KWMA 2W2NP 4ELVA 3EDRB 3CD0A 3PTWA 2ASDA 1RUSA 2C2DA 4H4MA 1YGYA 1EETA 4H54A 3PRBA 4NYOA 5KG6A 2W1BA 4CLFA 4U7CA 1FNXH 2OTLS 3DLGA 2RHSB 1MW7A 4F4ZA 4DL3A 4OZJA 5JUMA 2O01C 1T02A 4QPXA 2EBGA 2HFZA 2MQLA 2W7PA 1KFDA 1C1CB 2BJDA 2V5HG 4R25A 5KFAA 5J1EA 3G9CA 2VBYA 3AA8A 1KP6A 2CQPA 4HTJA 4DBQA 4U95A 3IBFB 3UNGC 1SL1A 4PKDB 3SXLA 4WKRA 3I0RB 2C22A 2JEIA 4DV2F 1FRJA 2CQCA 2UUTA 1DJ0A 4MK8A 4I68A 2C3UA 3VZHA 1EP4B 3M8SA 3CC2S 1CULB 4DQSA 3KXDA 4L6V3 2EI5A 4NX9A 5ETSA 2P9EA 4LRAA 3UFCX 1YZ6A 4A8KA 1ZPWX 1ICEB 2EXUA 2XMJA 5GAHI 1S1VB 2H48B 2M70A 2YWFA 2B0GA 2B6AA 2CQIA 3FRYA 4LQ9A 4WP8A 4EUVA 4EO8A 2XY6A 3MEEA 2AW0A 4U6PA 4P52A 2E66A 6FDRA 1IJEB 3WC2A 2BVZA 1R31A 2DO0A 3ZZPA 3W2VA 4HYKA 4YR2A 2BE2A 1CJKB 1EX8A 3UPFA 1A9NB 1XK8A 2MQPA 3TQEA 4X4OA 4RW7A 3KHGA 4DV0J 1Q86T 1IBKF 2B5JB 4ZVPB 5L9NA 4CTAA 2IM2A 3VALA 3PNIA 5KFJA 2Q66A 3M1VB 1HNVA 1TKZB 2ZH4A 1DURA 3MURP 2F4VF 2DNYA 2CPZA 1LWXA 3V81A 2W9CA 1I6JA 1UW4A 1VQYA 2MHNA 2UXBF 5KT2A 2P6SA 1UVJA 1CJTB 2BOAA 3D4JA 4PYAA 4I1TA 3DOMA 4CO4A 4B02A 2E1AA 2VV5A 5CH7B 1DQAA 4LT6A 3X1LB 1X4HA 2UXDJ 1HQUB 4C11A 4FVMA 2MSTA 4LVNP 4ES1A 4DXLA 3TWZA 4ER8A 2QV6A 3ZTQA 3FSIA 4OV1A 2UVWA 1JWWA 4F3MA 3SQGB 2J9DE 1Q8LA 2DPIA 2A3JA 1FKPB 1DAXA 1VQ7S 3POTA 2GQQA 1VS3A 4RUBA 2XNRA 4ZPTR 1X4GA 1H73A 1C1BB 4DV5F 1PCAA 4C97A 4EU0A 3OTOF 1EKSA 4K4YA 3R1HA 3CULA 5E3CA 2ZUGA 3HZEA 2HNYB 4JV5J 5H1SV 2AEJA 2MMYA 4FNHA 4K4TA 2EEYA 4JB8B 3GJSB 2FJAB 5AXKA 3R5JB 4CYUA 4KAIA 2YKPA 1RWMB 1ELOA 4JI5F 2NZ4A 5E7OB 3M8WA 1MU2B 4LBHA 3CWJA 2HZAA 5T7LA 2ZOFA 5M2UA 1GMWA 3GR1A 1RBAA 3JSMB 4DR1F 3SBMA 2PMZD 3LAMA 3ZTRA 3CCZA 3RRGA 2RE1A 4USUA 1AA1B 2ZHBA 2R7VA 2HFOA 2HG4A 5AE1A 1Q1KA 2KYZA 4CI0B 3C19A 2ILYA 3VWSA 4ZP7A 3JAMY 2VL1A 2AYEA 5LSLA 2AYMA 1ZTTA 1FDBA 1NPRA 3QRRA 1NEEA 4HH1A 4ITSA 4RU9A 4ZA1A 1T3NA 5CCMA 1RT3A 1ZM2A 2G1DA 1S0OA 4ZVHA 5CYMA 1LWFA 2VG5B 1VQ5S 4BBYA 1F3FA 1IKXB 4OYAA 4EWTA 4NLGA 4K4UA 4ED8A 5EDWA 1XN9A 4G1QB 3US5A 1LFWA 1YK9A 1PO6A 1S1XB 1MMLA 4CLSA 1HHTP 1LWEA 2VKRA 3M6XA 4RW4A 3G6VA 1NHVA 4JI2F 4M1KA 4B9LA 4ZS6A 2V8PA 1N34F 1PKUA 4WYWA 4RZRA 2XGQA 2R7SA 2W7AA 2A1BA 1AROP 3HHDA 3Q2SC 4DUTA 4H4OB 3K8VA 1LWCB 3UDVA 3MMAB 4O3NA 3BO4A 4J37A 1HWJA 1UJ4A 3W5ZA 3IWNC 3EXYA 4DR5F 1SJ3P 2DITA 1RU1A 2Q3PA 4DR7J 1AXQA 3M32B 4Y2KA 2XWYA 4YUDA 2NR0A 1FXLA 1S1TB 1BD6A 1U8WA 4OYXA 4AL6A 2P2CB 4J9RA 1J5EJ 3FC9A 4J9QA 3J7AN 4K5SA 2ROEA 1L3UA 4TQRA 4DR7F 1HBUA 4UOHA 4DUZJ 4NCAA 4FKYA 2LQJA 2PFDA 1QLNA 2GAHC 1HW8A 2MKSA 5CQGA 1J2VA 5E3AA 1CVJA 3ENWA 2CJAA 2V69A 3Q23A 3KG4A 1X4BA 1D9AA 3C8YA 1IN0A 3ADAC 3L7PA 1H3DA 3UVJB 1X0FA 4LFCJ 1HMVA 3HI9A 2HNZB 4OHXA 5J2MB 1V5VA 2QJ3A 3X3UA 5LOQA 4DQPA 5KFGA 1KTQA 2LDYA 3GIMA 1R0BG 3OXLA 5F8JA 5HSPA 4JI0J 2OPPA 3JS9A 3K8WA 1HBMB 1RWWB 3NOGA 4F4WA 1TKXB 4JI8J 3R3TA 4NRTA 4CO0A 4LF6F 2HHQA 3QZ8A 2HBRB 3DI6A 2IYIA 3M2RB 3OTCA 3KK3B 2QE5A 2CQ3A 3CUNA 1KSPA 1OYEA 5C24B 4AXIA 2RQ4A 1NH8A 1OY6A 4WE1A 1FVSA 2FZKB 3I31A 3TEHB 1HR0J 2F5GA 1GNKA 4F3QA 2GJFA 4OX9F 1U25A 5A0YA 2HS0A 1B0TA 3OXFA 2DHHA 2H5IB 5K8NA 2K8GA 1NKBA 4PYDA 5D4NA 3KLVA 2BQ3A 3DNCA 1CSJA 2FGOA 2W2OP 2IJRA 2JJ4D 3DGVA 1C0UB 3IG1B 5KFZA 4WZMA 3VVUA 3HMJG 2V34A 4DSFA 3BBFA 4LF7F 2ACYA 3PO4A 3SV4A 1QTNB 3AOAA 3DRSB 1IWAA 1Y00A 2OFHX 3D9BA 1K1SA 1ZA2B 3EWGA 3MD3A 3BPDA 3GE9A 4WU2A 4XAKA 1WSVA 3QO9A 5CABA 1S49A 4A8XA 2LEAA 4KHRA 5CCLA 2CQ0A 2FJVA 1VQ9S 3D0IE 1WORA 1N56A 2UU9J 4U7UD 4ZKAA 3VQSA 1HBNB 1NSKL 1VISA 2ZE2A 3MM6A 1N34J 1UETA 4CIOA 4B3SF 4B9VA 1LW0B 1VRQC 1Z2ZA 3OFHA 1NXIA 3MMBA 1CULA 4USHA 2GMJA 2ZDOA 2BM0A 2PMHA 2KO1A 3Q86A 1RAOA 4ED4A 1N36F 1X4CA 2XO6A 3CJSA 2DB1A 2JFDA 2QMXA 3MEDB 4GVBA 4LBIA 4X62J 3PRVA 3V4IA 2OPPB 2RRBA 2K2PA 4OHYA 4AYBD 4TXSA 3SEOA 1FRIA 1ZZFA 4CH1A 1FJEB 5B0DA 3H4BA 1M5OC 5GADI 4S0MA 3QJPA 4Y34A 4ZPBA 5J2QA 2NREA 3W2VB 2JLEA 3PEHA 3S8SA 2PA3A 2VICA 1EKRA 1HBUB 4KHMA 2ASJA 1IQTA 2A0FB 4ECSA 1YRXA 3R8YA 3TANA 3G8SA 4MYTA 2R8KA 2YNIB 2DK2A 5HMYA 2HNDB 4P2FA 1S1TA 2ABYA 4MFBA 4DQRA 5BYSA 3PVXA 2HMIB 5C5JA 4CLYA 2J0SD 2QL5B 3ZZUA 3GFXA 1K9MT 4ATNA 2KT2A 2GIFA 3PEJA 3HHLD 4PWDB 4QIWD 5KFEA 2V4RA 2MGZA 1N52B 4R0EA 3G8TA 2ZZMA 1RHKB 2H54B 1TL1A 1S48A 3CD5A 3EJMA 4FP9A 3ZTPA 2BJ9A 3EE3A 2KB2A 4H4KC 3MOZA 4B9TA 1WC5A 1JLBA 2HZVA 2V63A 2R7RA 2NXNA 3LW5C 5B0CA 1HD0A 3I9ZA 3PYFA 4QOTA 5F3ZA 1N5YA 2HK2A 2PI5A 3PFOA 4X4QA 1WC3A 1UWAA 2GHPA 2OP5A 5CYQA 1YJUA 2XGPA 3Q0AA 1NSAA 2R2TA 1EARA 4FBUA 1GMVA 1GT8A 3CDBA 3KJVA 5LMNF 4IFVA 3VCDA 3K89A 3QT5A 4HACB 1UW9A 1RWUA 3AQPA 3BM7A 3NOCA 2UUBJ 5KFPA 4LF7J 4JYAF 2CKWA 2HQFA 2RHQB 3IM8A 2PC6A 1PYTA 4C3MA 2RKIB 4PXBA 3PW0A 1T9TA 3JQKA 3QSIA 5K14A 2GQCA 5HO4A 4GKKF 4FPIA 2GQ2A 1NNDA 2D41A 4ICLB 2H3EB 2WAQD 4LBPA 5DS7A 4RUCA 3KUHA 4DLGA 4GMKA 3LPYA 3SFGA 3ETOA 5T41A 3VGSA 4KSEB 3ILJA 4CYUB 5B7WA 2MTLA 4USJC 3CEDA 3NGDA 2CQ1A 2MZRA 3B4MA 2YX1A 1S59A 1M5SA 3C6TA 3DMJA 4ZVEA 3UR0A 3W8PA 3J80Y 3MUTP 1S76D 3KNAA 4YDXA 4DX7A 3KJQB 2B51A 2KI2A 2XZTB 2V4JB 1QSYA 3I32A 2AJ1A 1WC1A 1ZS6A 2ZH5A 5D15A 2D74B 4CLKA 1F5AA 1RE1B 5KAKA 1TAQA 2KG1A 2FVSA 4IUFA 1RLDA 4CDIA 2ZBQA 2HWHA 5KFYA 3EVWA 2AIRB 2D69A 2KN4A 4OI0A 2OAUA 5KOXA 4DCPB 1FT8A 1WJ9A 4ALZA 2NXUA 4DV3J 4GC7A 3QGHA 5MAOA 1P9YA 2IMOA 5D4OA 1IM4A 1M0SA 1L3KA 1OPZA 2MHEA 4NPOA 3TJAA 1QSLA 2WVBA 1O51A 3VAHA 1QVFR 4M95A 2HHWA 2E9ZA 3DCAA 1IBCB 1YIJS 2JVOA 2K06A 1Q0NA 3R5CA 1X9WA 2CJYB 5G4DA 1VQLS 4LQ3A 4PUOB 4HR2A 5GMEA 5HVGA 4ZIVA 3BGLA 2RT3A 3N4WA 3UD4P 2VZ9A 3NWRA 1AYEA 2F9DA 2DXEA 2KL8A 4J7CA 1SJFA 5G0RB 3M8YA 1I1GA 3TEGA 1RHRB 2UV8A 3HD1A 4I6YA 3WDOA 1C0TA 2ZC4A 4W4MA 4IFYB 3VAKA 3TAMA 3R2DJ 2R4FA 4J9MA 1P1TA 2AV5A 3RAQA 3NS6A 3R5DA 3DDKA 5H9FK 2R7WA 4NI2A 3BV8A 1U49A 3RR8A 3H5YA 1LWFB 1F9HA 2VG5A 3Q22A 2YNFA 1OIAA 1NU4A 1U09A 2FZGB 4JI1J 1OMSA 1VMBA 1TR0A 2V50A 3D28A 4X65J 3R1LA 4PQUA 3TUIC 4C0HA 3H5SA 3CJ0A 3HSJA 4WF9Q 3IGVA 1SC4B 3MCNA 3CMES 1XR5A 1JX4A 3UCUP 2VB6A 2B4UA 1NB2A 3MCOA 3RGIA 4QBUA 1IBMF 1FJCA 4NL5A 1RHQB 4X66F 3W61A 3JSRA 3NWGA 3QT7A 1TAUA 1WF0A 1X5OA 2NQPA 1X8DA 1XIQA 1RWPB 1WKKA 3AB2B 2ILZA 4NLTA 5KT4A 2OPQB 4JBCA 2AX0A 2H51B 3HVTA 2ZKTA 3CJ5A 2QLWA 4P73A 4TKTA 2HVDA 3H2VE 1N5YB 1YBTA 4QW8A 3OUYB 4DN0A 2WTFA 3P3DA 1WKJA 1TV6A 4N8OA 4KC5A 3DXBA 1NJXA 1LXNA 4Z2XA 2KM8B 3M8RA 4H4MB 2Y1IA 5E33A 4KPYA 3QGIA 1CJVA 4FS2A 3QAEA 4RW6A 2R8GA 1VLYA 3CJ2A 3BQ1A 2GFFA 4DL5A 3ITHA 2OPSB 2CJXB 2ZD1B 2CFXA 1TL7A 2H5EA 2J7UA 3M8PA 3CJKB 2DNMA 2ZVSA 4WXOA 4MIBA 3WC0A 5GADU 4C0BA 3MHYA 3NXZA 5D78A 2W4PA 3MAAB 4CO3A 2RU9A 4RU2A 3ILLA 3V4MA 3C16A 3V6JA 2IDEA 2L3MA 3BO3A 1M1KT 2G2YA 1YZ7A 1HMVB 2CRLA 1TMMA 3V2UC 2VG7A 1F9EB 2YBVA 2CQ2A 2EVZA 5J1NA 2GIRA 2AX1A 2LA4A 4IH6A 1GFWB 4DL6A 2VDIA 3NMRA 4JI3F 4DR6J 1HWUA 2HHHJ 3LGNA 4KJIA 2E9RX 4LRDA 3CT9A 4Y2AA 3BBCA 4Z7CA 3K0JA 1FCAA 3BKTA 1HL6A 2MKHA 3UN5A 2HHVA 2NUUG 2OPQA 1DTQB 4NZ7A 5A0YB 4NLOA 5LJ5Y 4NEZA 2C3MA 2U2FA 1T0TV 1FERA 1UP1A 4LR9A 2EBEA 1MWYA 2B6AB 3SDEA 4JI4F 1D3WA 1N32J 3EVMA 2KKHA 2VODA 1I94F 3CD7A 2H1YA 1Q4RA 2M0GB 2MDAA 2DR6A 3IS9A 2WB4A 3SSQA 2BUNA 2Z58B 3UO0A 3DKDA 4DQIA 3EGZA 3N79A 4LFBF 1DHMA 2DRBA 5IT9U 1C4AA 1FFGB 4JI4J 2YPYA 5HP1A 1XMQJ 1S6PB 1HBOA 5KFRA 1MLAA 2ZD1A 2CQGA 4X65F 2X1AA 2KFYA 3RZAA 4KE5A 1N33F 4TLRA 4N77A 4HH0A 2RB7A 3SQOP 2N3OA 4EZ9A 1TKTB 2D9OA 2KT3A 2R7XA 2RAQA 4EO6A 2B9EA 4PQUB 1D8ZA 2UXCF 3M4XA 3TA1A 3SIPB 1RAHB 1JXEA 1K44A 2DY9A 2DR5A 1Y11A 1S6QA 3OTBA 2RIJA 3CD6S 5B0EA 2Z57B 4F50A 1BQMB 4CLWA 2QMUB 4KFBB 8RUCA 4FBTA 3SZ2A 1YJWS 1M5KC 3L4BC 5F8GA 3DM2B 1EAYC 3D7SB 2ZZNA 3KHLA 2WW8A 4RNNA 2VONA 1L5UA 2BANB 1JLAA 1GX5A 1QE1B 2DGTA 1PJ7A 2YKOA 3BGOP 2ALYB 3HVTB 4V19X 4ED2A 2VPZB 3WIVA 1U26A 2BJ8A 2M9KA 4O0IA 4MJKA 4PQAA 3JYTA 3QYYA 3Q24A 2FVQA 5L1KA 5E3QA 5DDPC 1ZM9A 4L3KA 1WC4A 4LREA 1XNRF 3W5XA 3SCIE 4U7UK 2CJBA 2CPYA 3T41A 1P9QC 1GQEA 2V2KA 3OT9A 3HJFA 2CPFA 1OY9A 2WB1D 3M8QA 4FNIA 4ZPDA 4JOUA 2Q6BA 2XCAA 1Q8IA 3O3LA 3K57A 2GJ2A 4AL5A 4IKAA 2G9OA 2DNLA 2F8EX 2P9CA 2GV1A 3MPUB 5LM7E 4F8RA 4UY8T 1NH7A 1RYSA 4NZ0A 1ZYQA 5KT3A 3I4PA 3MM9B 2UVVA 1FDDA 3DFEA 4NLVA 5ETQA 2XC9A 1NK0A 3D5MA 4J9KA 2DR9A 3OVBA 2LA6A 2R7OA 4WTYA 2R2UA 3T3FA 3HHEA 3LP1A 5THWA 3LF0A 2EG1A 1B0VA 1FE4A 2F7VA 1TTHB 5B0AA 9ATCB 2MY8A 4BLGA 2D3OR 2HQDA 1MROA 2XSFA 5LMUJ 5L9XA 2BR0A 1SJRA 3M30A 2ADBA 3FCHA 4Y0FA 4M94A 1U0HA 4N8NA 4KH0B 3V5RA 3LQVA 3LWMA 1CQMA 5K14B 4M5JA 1NHKL 4YMEA 1LK7A 2JNJA 3A8EA 2OEKA 4UT4A 2FGCA 3NKYA 4IR1A 2RVJA 3GJQB 1JJ4A 2AGPA 4IRDA 1IKWB 2HRTA 4P9SA 1CLFA 2KHCA 1Y5NB 3FBBA 3IR7B 2FUG9 4WFAQ 4N5SA 2ZH8A 1F60B 1SJ1A 1XTZA 1RTHB 2FB0A 3CF5Q 3FNNA 2V2ZA 3G86A 4RBTA 3OLAA 2R7QA 3A8KA 4OHZA 2I5JB 1Q95G 3E01A 2K7KA 4ZVSB 3OSPA 4O44B 1Y10A 1TKTA 1DARA 1YTYA 2I9SA 4GC6A 1KDNA 5SZTA 3ISZA 1FNMA 2OI2A 2QA4G 3PX0A 5I3UA 4DSKA 1QJHA 3MM6B 4LF8J 2DHGA 4URQU 3PW7A 1HNVB 1TKZA 3BGFA 3KNGA 1YRUA 1FK9A 1U0SA 1WKLA 4ZVOB 3HD2A 3HSDA 3NCPA 2K7JA 3MMBB 4HTIA 5IC6B 3J81Y 3NGUA 4PCQA 4XDDA 1N48A 3NGKA 2N4DA 3I0RA 3K2YA 1FRMA 3LH2S 5J1PA 2V2QA 2Y8WA 4DV1F 2OTJS 3O8WA 3E51A 3GZ7A 3EPGA 3LP0A 2F3JA 2XWXA 4OZLA 4F0MA 5DGBA 2V9WA 4F2RA 1Y0HA 3CGIA 1WI8A 1RT7B 4KV8B 1JLAB 2BANA 2F9JA 2HFSA 1RTIB 4OIXA 2CAJA 3M8ZA 4L3NA 4UUWA 2QSFA 5A8KB 4U67Q 1H7XA 1VR6A 1X5SA 2LFVA 2FY8A 3BSCA 1CBKA 4J9NA 2DY1A 4DV7F 4DR3J 5J2QB 3AQOA 4M5KA 1ZAWA 2JFKA 4WU3A 5I3PA 2MQMA 4DX5A 3CCLS 1YI2S 2QFIA 3AHPA 4FXDA 4DF4A 2AJ4A 4WIQA 4AT1B 3D66A 1YBUA 4WWSA 4ELUA 4FS1A 1HI1A 3B78A 2LQ8A 1UVLA 5J2PB 5FJ4A 2C3PA 5AXLA 1Q5VA 5I4MA 2M52A 1CS4A 2W2MP 2IBKA 3Q8UA 3S7RA 2GVDB 2A6MA 4G1IA 1VQ4S 2XG8A 3M2UB 1WD6A 2DH9A 3FBFA 4I64A 1OS5A 4M5GA 5F9NA 2ZZTA 5DGAA 3KLGB 2AGOA 3ET6A 1E6YA 5LJ3Y 1PC5A 1VQ8S 1TFWA 3Q8VA 1MMNA 2VPXB 3CJKA 4F7VA 5HQMA 4MIWA 1BGXT 2B9YA 1KTVA 3E8OA 4RW7B 4A8OA 4ZHRB 4QIGA 2BQRA 2HHTA 2DJWA 3GILA 4B9MA 1NPKA 4ZVTB 1I3OB 2YNFB 4NCGB 3EXCX 3DOKB 5D0GA 3OV7A 3Q8QB 1KVIA 1TP7A 2IRYA 4Y28C 1OQ6A 5AT1B 3CDWA 1T95A 1NDCA 1SQFA 5GAGU 5L1JA 2RF2B 4MK9A 2DCLA 5E41A 2GS8A 4ZCLA 1OSCA 2YKNA 5GVQA 2NPIA 1RHMB 1PBAA 1KBRA 1U24A 4USKA 5A6PA 2D3O1 1S7HA 1W7WA 3A8IA 3AXKA 3MEKA 3W64A 5L39A 4YP3A 4DL2A 4QWDA 5IV3A 2XLKA 2GNKA 3K5LA 3AD8C 2HVIA 2OKQA 2AQ4A 3BYRA 3MEDA 4UZBA 5ETOA 5HL7Q 4DDFA 2RUSA 3MWBA 1B0PA 1DLOB 3DLJA 3FSYA 2D3UA 2MZQA 3VQTA 2P6TA 4EYIB 4LR7A 2C2MB 4R8UB 1JJ2R 3HDSA 2L41A 2CG8A 3FMBA 1JJCB 2XHCA 3RBZA 3D1OA 3EZ5A 4F4YA 2MJUA 3AB4B 2BKNA 4F26A 3OL7A 2E5LF 1EQ0A 4ZPWR 3UDCA 1KR4A 2EFGA 2QYCA 5I3QA 2MQQA 2I38A 1HKAA 1LWCA 4LFCF 3WQPA 3L09A 1FF2A 2GO9A 2QT7A 2YTCA 2E1PA 4HDGA 3LTOA 3FFIA 2DRAA 3CCVS 4C8YA 2JDJA 3CJ8A 3DU5A 3MMCB 3W5YA 3BH7B 4YN3B 1VFJA 1T9YA 3K5MA 3HK2A 5A8RB 4OYOA 4P7VA 4PG4A 4TYAA 2XMAA 1YJVA 3MFHA 2XB2D 2B43A 5KFSA 1RCOB 3LAKA 3D1HA 3HHLC 1Z1ZA 4K8RA 3G6ES 3RR7A 2UUAF 1OJ4A 3OPKA 1B7FA 4A8FA 1U1QA 2QO3A 4DOZA 1UWBA 2EC2A 2DXFA 4OJGA 2AZ3A 3ZZOA 4P75A 5KFOA 1AB8A 2O3DA 1S4EA 3VAIA 3LGMA 5CYMB 2M8DB 1WWHA 2ZWPA 4CWBA 3I0SA 2LQ5A 3PX6A 5GAHU 1C4CA 3IFEA 3A3OB 4JI5J 1AW0A 3V6HA 4WFNQ 1S57A 2HQCA 4I2PA 4U8YA 4ECZA 3M2RA 2CPHA 3TP2A 3BDPA 2E1MC 3CCTA 1RT6B 2MQ8A 4H4OA 2DD8S 2D3ZA 1TKXA 3H2UB 3BJYA 4B9UA 4RUHA 4M5IA 5J2PA 1TUGB 4NLWA 2DKOB 4ERDA 2BABA 3T9NA 3S6EA 3JQMA 4AXJA 3EUNA 2LP4A 3O1LA 2GX8A 2HFNA 5IV4A 2FJEB 3FSXA 1O6XA 3DXSX 2VASA 1PJ5A 3DMJB 1ZAVA 2LQBA 3LOUA 5IOLA 3R7SB 5KFQA 3PX4A 4JV2A 1GXUA 2V4JA 1HI8A 3BEGB 3UVJA 2L9WA 1Q82T 1NO8A 3M8QB 3QT6A 2IPOB 1JNZB 4DU7A 2IA6A 2BM1A 2Z56B 5CD4A 2DGXA 4ANEA 2WOMA 1TL5A 2C1EB 5EHHA 4B3MF 4KIAA 2ZWOA 1VC5A 1KFSA 4FYVB 3TRGA 2CNNB 4ANDA 4DL7A 4RBVA 1VQOS 3NG8A 4HI1A 2Z2MA 4W98A 5EX3A 5KFUA 3MR6A 4HHUA 2V67A 2VF3A 4Y65A 3W63A 4PWUA 1ZETA 4IQMA 2FC8A 2GHVC 3BKUA 4DHVA 5HI7A 3H42A 3TAQA 4ILRA 2BV3A 2AZ1A 1ROFA 2DNQA 4UOCA 4ZCMA 3ILIA 4DR4J 4MT1A 5IZHA 3MR2A 2R9LA 2X3DA 4CRJA 1NCLA 4YS2A 3RRHA 2E44A 1KN6A 1WEZA 3JYTB 4KGVB 1J5OB 3T6BA 3U02A 2PD1A 2DO4A 5FD1A 3M9OB 3OQ2A 2X7IA 4ZJOA 1A0OB 1KEKA 1ZZNA 2F65A 2FPHX 3KOAA 1SKSA 3RTVA 4IH5A 1UAWA 4PRFA 4DFKA 2JL9A 4RKUC 1F1BB 2QLBB 4KY3A 4NXMJ 5C2GA 4QWEA 3M05A 4DSLA 1CJKA 5D3GA 2PMWA 3W2WA 1VLOA 3NGSA 4QR1A 1RTZA 2VUGA 4WK1A 2NPFA 5C25B 1WOPA 1RT6A 3MM7B 1KLMB 4DX8H 3EX7B 3CCSS 5B08A 1Q81T 2DNRA 4L75A 1NRKA 2CWXA 3HP6A 3C3LA 3V81B 4NEYA 3JXOA 4A8MP 4KGKA 5HANA 2V94A 5ETMA 3GV8B 3NAIA 4CO5A 1CJTA 2GA7A 5AJ3J 4KGXB 2D9PA 1KQSR 4JI8F 3IR5B 3RB0A 4EI2A 5C2CA 5IWAF 3Q8PB 4LUBA 5D0EA 4YY3J 4F2SA 4DCJB 1RAAB 3BPSP 1UFWA 2DEIA 3PYGA 3RW7A 3JSBA 4GO5X 3RU0A 3MMCA 5E0OA 2B3TB 3HFKA 1K0VA 5F0WA 1S10A 1LW2B 4OYIA 3M2VA 3D0HE 3MPWA 2J8SA 1JKHA 5A8RA 3KLHA 4OX9J 4O3PA 1S79A 1VK3A 1DTTA 3WHIA 3CMQA 4BCAA 2L9DA 1SIWB 1JLBB 1RBOB 2E5LJ 1K0TA 3HVAA 3GP9A 3POTB 4J9LA 1GAOA 1AFJA 2VKZG 2R7TA 1GXTA 3I9V9 3VGTA 4DV6J 3GYXB 3ONQA 1NKCA 2J6UA 1VC0A 4GKKJ 1YX2A 2RDIA 2CJQA 4X4UA 2YNHB 1S99A 2AJFE 1WC6A 3IR6B 4I2QB 3UE2A 3KMSA 4P2SA 2PT0A 4WYLA 3L9ZA 2HLTA 3M1VA 3FCVA 2F63A 5K8PA 4ZN3A 2ATLA 4O23A 3UW1A 3MM8B 1BMQB 1S9GA 2VH7A 2HMIA 4ZN1A 2YWHA 2W9CB 1RI7A 3PACA 3T19A 1N0UA 4NYPA 2HNDA 3MAHA 4D3GA 3K58A 4B9SA 4RO0A 2P8IA 1RSCA 4OI6A 4LSNA 2AJQA 3D6TB 1RAIB 3D68A 2AHOB 1XR6A 3OR1A 3MCSA 4Q0BA 1KONA 1BC6A 3OVAA 5DDQC 1UFKA 2XMKA 4HVZA 3CO0P 1VGYA 4FF2A 1XBWA 2Q6CA 4RPFA 2ERRA 2HSEB 4LFAJ 1KOHA 1T03A 2EFVA 4A46A 1RWOB 3KG0A 2ZH7A 2ZITA 1XWLA 2KT5A 3I5AA 1DRZA 3CIMA 3I96A 3QWPA 4ES3A 1TL4A 2B7CB 1T11A 5DQHA 2J8AA 2JC1A 3KLIB 3MPDA 1S77D 4ECWA 3P49B 3W60A 2DPJA 2VQEF 5HK4A 3Q89A 2FJWA 2PFFB 3M2UA 2Q43A 3C6UA 1V6HA 4I2QA 2D1CA 1IKVA 1R6VA 2NYIA 3TO8A 4TY8A 3W2WB 5IS2A 2C3YA 1FESA 2E29A 4G3IA 1NZAA 2D7SA 5AE2A 5B09A 5HN0A 3IBWA 3SV3A 1EETB 4Y3CA 4YHHF 1TUVA 2DNZA 2YNHA 3LWLA 1LKZA 1XQIA 1H2VZ 4AQYJ 2YX7A 4C9DA 3SCJE 5HLFA 2HIQA 1XR7A 2ZNZA 4ILMA 4X64J 1L3VA 2IJFA 4PEOA 2A18A 1YG0A 3S01A 3GQCA 4K2JA 4DMZA 3FUYA 2F40A 3C46A 4CO1A 5KT6A 3RB3A 3QFHA 2ZHAA 3HHLA 1XERA 1YJ7A 2CPIA 2WBRA 3PIOQ 5DG7A 4CM2A 2FDNA 1WELA 3ILOA 3VAJA 1R8HA 2HEKA 1N5QA 5H9EK 3SYZA 3RB6A 2PEBA 4ZVQB 4PG6A 2VPYB 5D0HA 2JRSA 2HKEA 1YJNS 2UUWA 1MSWD 5DQIA 2UXCJ 3I5BA 3I87A 2CWKA 3DM2A 3QIPB 4XK8C 1S9FA 4PUOA 3EGVA 2EFQA 4UQGA 3VAFA 1G1XA 1U02A 3OXGA 2CQ4A 2QA2A 4DLEA 1M1HA 4KGZB 4M5LA 1KD1T 4NYZA 4LF9F 4Q2MA 2AEFA 4RW8A 3GIRA 5HAOA 2FD2A 2HS4A 1VJWA 1R3NA 1OSDA 2HRYA 4B17A 5F9LA 4ZVFA 1SQGA 3UD3P 1FX4A 4O4RA 3T5HA 3FQLA 2KJVA 1K8AT 4LF9J 3BB5A 3IWLA 3LGHA 3AJ2A 4ZITA 2B9WA 2BKPA 3H40A 1UJ6A 3CDAA 1FDNA 1LK5A 4QZVB 4RWXA 2MPUA 1ZAXA 3MI7X 3JTOA 4P2MA 2RU3A 3PR4A 4KHPJ 2OPRB 2HAIA 3UQSA 2CIMA 2APOA 2QA1A 1CJUB 1MU2A 2XYGB 5T7LB 3KLFB 3H7HB 2ADCA 2M2BA 3KDNA 4ZDNA 1Q78A 3DLLQ 2J76E 2P5VA 5KFCA 3NAHA 2PSZA 2AJ2A 2QZ8A 1N4LA 4RJVA 1UWBB 3C66A 5BJRA 5BR8J 4ZPCA 1B99A 5DO2A 1BWEA 1JIHA 4K4SA 1QM9A 1ZPVA 3R2CJ 2SXLA 2AJ0A 4HHJA 1HYSB 4K50A 2RNEA 1RTJA 4Q7AA 1F3VA 3OL8A 3HVRA 4Y6IA 3BO2A 2W25A 3G82A 3OFGA 3HO1A 3CE8A 2W2QP 2IDLA 4CLTA 3ENVA 1FKPA 3KMQA 2F8HA 2ZH2A 5FLXY 4NASA 4YHHJ 1M5HA 3A4TA 4C0OC 2JC0A 1IKVB 2OSQA 1UPPA 2XNQA 1N5VA 4A8WA 3LUYA 3NGTA 3QIPA 2FIUA 4MMOA 3DOLA 5AE3A 4J9PA 4QU6A 1ZOTA 1JLCA 2Y1JA 4J5OA 4QIFA 3N01A 2CADA 2PGCA 1SJQA 4R5PB 1QUPA 3BR8A 2AYGA 2C2KB 5IFMA 1IXKA 4KQZA 4JI1F 3WX4A 2J6SA 2CQDA 2MZTA 2Y0SD 2Q1LA 4PABA 3PY8A 4WZQA 1HBNA 4FYWB 2FZCB 4PWDA 2YNIA 3HF5A 5KFIA 3M8PB 1F5BA 3V6DB 4E98A 3QGGA 9RUBA 3A1YG 4JUZA 3U1NA 1NK4A 1SJ4P 2HGMA 2MZJA 3CJRA 3J81j 3MR5A 4NLYA 2HIYA 4QWCA 1JMTA 2ROPA 2Z4PA 4N56A 4PZVA 5KFBA 2E5JA 1KLNA 2A2CA 1NJWA 1TQLA 3M9MB 5EWFA 4GKJF 1KHVA 1Q8KA 1RHUB 1TVRA 2PN6A 2VC0A 1MMDA 4A47A 2L9NA 1S5ZA 3CIZA 4WFZA 2MB0B 3AJDA 1JJHA 3TUPA 1ZH5A 4JI7F 2EKYA 2GHWA 3QIDA 3J7Z5 2KXNB 3MAQA 1DFDA 2IAJA 5H9EJ 1S0NA 4DSIA 3ELHA 1RT5B 3K59A 2Q79A 2H4YB 2XEXA 1SCJB 4UZCA 5C7PA 4ZVUB 2BDPA 3HHNB 2VG7B 4DPTA 3N6MA 2LVWA 4DUYJ 4PG5A 2UXBJ 1GTHA 1V3SA 1HWKA 4X4SA 1U4BA 2DXDA 2OD4A 3P8BB 4G6VB 1D09B 3ZZZA 2FLLA 4BC7A 3HPOA 1VBXA 1CS4B 1WHYA 4NA3A 2BJ7A 4C8LA 1X60A 2MYFA 1S9GB 1HFEL 2FLNA 2ZM6J 1D0EA 3EVOA 2OD6A 4FYYB 4FVCA 4QR2A 5BYRA 2LXIA 5M2PA 2DBBA 2OGUA 7AT1B 4IDKA 1Q7YT 2XI3A 1C0TB 3U27A 5L46A 2UVRA 3AD7C 3MCMA 4W92B 2X1BA 4G65A 2VA3A 1ZBTA 4M63A 3ZNUA 3J7YI 3IN5A 2HFVA 4C7QA 3P6YC 4NLQA 3F44A 4FN5A 3SSRA 3UCGA 5HMWA 4HLBA 4IG3B 4C98A 2CQBA 2OH2A 4J9OA 4Q8EA 1JLEA 5HJXA 1FJGF 1SQEA 3HSGA 1JKHB 2LKZA 4OJHA 1MG7A 2FY1A 2ZDPA 1FTCA 2XO7A 1X9SA 2JSXA 3LP2B 4HL9A 1VQMS 5CZXA 1RKJA 2UV8G 5F8NA 1N5SA 1H7WA 5LMUF 2OJ3A 3MTJA 1HI0P 1U1KA 2LU2A 3D3CJ 1NAQA 4DS4A 2AGQA 1IR1A 2YH0A 5CZVA 2FJDB 2KZMA 4IOBA 4K7QA 1RADB 3GPAA 2VC1A 3M9NB 2ZOGA 2XMTA 2M5YA 4QJVA 1UTAA 3V6KA 2VOOA 1T7PA 2IAJB 3DGPA 3W8GA 4DV4J 1UVMA 1RA6A 2BMBA 3I82A 1VQSA 2KVQE 4HEA9 2Y3YA 1IJFB 2XZDB 1DBDA 1IKWA 4DV0F 2HBQB 1IBKJ 3T5JA 4NXNF 3H25A 5KFLA 4DV4F 2WK4A 3FZ2A 1R8BA 2HQ3A 3Q83A 1RABB 4IFYA 4B08A 4DS5A 3V6DA 4YR3A 3QJJA 4CQ1A 4F4KA 4ANCA 2Y8YA 1RT2B 1HA1A 3TA0A 1GMUA 1QTMA 4CH7A 3KUEA 1LXJA 2FHJD 3TARA 1RT4A 1U1PA 1XMOF 3QLHA 2HW3A 3CTRA 4K0KJ 3PXGa 1MROB 2VBXA 1A6LA 2OO4A 4X4NA 4OZ1A 1FA0A 5I3UB 2YQ0A 3H59A 2BBEA 3MFIA 3LP1B 4J9UE 3MECB 5CHCB 2GO8A 4ECVA 4YOEA 3NBPB 5ETTA 4K0KF 4Q8FA 2E5IA 1IR0A 1VQPS 4QIVA 3DRPA 3UN3A 1XNQF 1VQKS 4DG1B 5GMKa 3L7UA 4F3OA 3MOJB 2WRMA 1P8GA 1R7IA 4ZPAA 1XNRJ 4KKOB 4WJBA 3D6HB 4DPWA 3CXCR 5HBMA 3CJQA 3SCLE 4DV7J 4G1QA 4JV5F 2RH3A 2POKA 2OEJA 1BQNA 2XY5A 2GZOA 2V8GA 4LRBA 2XMWA 5DQGA 2G0JA 4OX6A 4X4RA 1X4DA 2KH9A 3SQGA 4N41A 3KLEA 1MWZA 2VBWA 3G96A 1JLFA 2MEWA 4ID5B 1NK8A 2YWGA 4NLXA 1WDTA 5CYJA 2XI2A 2E7VA 1HD1A 2GMHA 3FKBA 2QSWA 2OUGA 3EMTA 3NS7B 4YB6A 5AJ3F 1JK9B 4HT7A 4C3LA 1LEOA 2WSCC 4O3SA 2EKNA 1IKYA 1FJGJ 2YWWA 1PILA 3AOCA 2WW4A 1W2BR 1BY9A 3UD5A 3G4SS 3JSMA 3KTQA 3M32A 4DSEA 3LALA 3B6BA 1CJUA 2HVEA 2XHWA 1RJJA 1WOOA 4RNOA 2GMLA 4NMXA 4NLPA 4DV2J 2XTJP 2RSQA 4KR0B 3THTA 2IVYA 1JQGA 3WZ0A 3OLBA 2GJIA 1X0PA 2G1HA 5L1LA 1VC6A 5KT7A 1S4FA 2RILA 3CDEA 6FD1A 3UDEA 1HNXF 2MLXA 4UOFA 1VRTA 1YWXA 3GWCA 4TLQA 1RHJB 1S12A 1IKXA 2CPDA 3PJ9A 4OYMA 4XTTA 1RTDA 3M7VA 4DL0C 2VFUA 3DLBA 2IA0A 5DM6Q 1X7VA 2CPXA 4NRUA 1NK9A 1YQHA 3H5UA 3QAUA 4CNYA 2VJVA 4NXNJ 3U1LA 2LECA 2LQ9A 3OL9A 1X5PA 2I6WA 3Q8RB 1BQNB 5F8HA 3OR2B 4QYZJ 1RKIA 4ZPVR 3F0NA 3GIIA 2BQUA 4JI2J 4YEAA 5IT4A 2QTWA 4KKOA 1LV5A 2JZ5A 1OY8A 1S1UB 1VRUA 2RKIA 4IFVB 1URNA 4KB7A 3QPIA 4I69A 1OPIA 1XMOJ 3IC1A 3G8QA 2IBOA 1PGZA 3QFWA 1RBLA 1RT2A 4XDCA 1HLWA 1PSDA 1WF1A 3DU6A 3IXQA 2ZJPQ 2HGNA 4MKAA 1N6QA 1UA1A 4DZ6A 3QATA 4DPOA 4F0KA 1WUUA 1YJRA 3T5KA 2E9TA 2AWZA 1BE4A 2IJNA 5HMZA 4PXDA 4NXMF 4V19J 2JH3A 2K3KA 2RQMA 2XZWA 3D2WA 3DOKA 5KG1A 2DRDA 4I6WA 2UUAJ 1OYDA 1RP5A 1S7IA 2YKMB 3IGNA 3O2IA 4IG0B 4QIEA 5LXRA 2F8MA 4GO7X 4ZHRA 3MUVP 4LVOP 1L3TA 2DNKA 2YKNB 1YSJA 4WE1B 3BGRB 4DFJA 2QLFB 1SL2A 1QSSA 3B4DA 4OX8A 4TN2A 5DZ7A 1R0AA 2W4CA 1EP4A 3BH6B 2IC3A 4FPRA 4O3OA 3PHEA 1FX2A 2O66A 2ZH9A 1HQ2A 4CLZA 5GAEU 1H6KX 1SVDA 2FVRA 1QD1A 3GR0A 3BGUA 4AE5A 3KFWX 4B3OA 1G6BA 1WHVA 4F4AA 5D6GA 2DYAA 3GYNA 5KG2A 2MY7A 4CH0S 5IQ6A 3GONA 3T1HJ 3TJ9A 2ZUAA 3F56A 3DRRA 3PDNA 5KG7A 3DLGB 4L73A 1WF2A 4CTAB 4I56A 2W7OA 3QT8A 5KG4A 4ELTA 1FRKA 4O4GB 5DRKA 2YX4A 4P6QA 3GFYA 1HNWF 3NGRA 2B9XA 2DNGA 3P45B 3QRPA 1C0UA 3IG1A 3P4UB 1S0VA 4LIWA 4EYHB 3UDLA 1B70B 2G13A 4DR2F 2BJEA 3JSYA 3EYZA 2WCXA 5FDLA 5F41A 2C2RA 3GTYX 2CPEA 5H9FJ 1RA7A 4DEZA 4BWJA 1NJYA 1LW0A 1WEXA 3BN4A 3DC2A 3FBCA 3OFEA 4KYZA 1RYRA 3CDUA 4DR4F 2HHPA 1H72C 2Y9HA 4OL8A 3FRZA 1TU0B 2ZE2B 2FJBB 1SL0A 1T3OA 3KK3A 1VDHA 1RT5A 2JX2A 4A4JA 4EFAC 1JLEB 1X9MA 4L72B 2V9KA 2PA8D 5F8LA 2XLIA 1FRHA 3ETMA 2DTJA 3H20A 1T9WA 2FVPA 2Y0BB 3PG9A 1NK5A 1NK6A 1NB7A 4BDPA 4ZMMA 5CXTA 3F73A 1EB0A 3BGRA 2CUYA 1RTHA 2DT9A 3U7JA 4O0NA 5A8KA 1FXRA 2EWHA 4Y2IA 1NUEA 1UEUA 3KDOA 4USIA 5D8HB 2O5DA 3W62A 1CG2A 1F2GA 2UUBF 4OQJA 3E01B 4ECXA 3A3PB 2DH7A 3CW2C 1MN7A 1F0XA 3P5TL 4ILLA 3IAM9 2CNLB 4GVBB 4CT8A 4OI2A 3HFZB 5DLGA 5ETKA 3ICLA 4IDKB 2F4FA 2BZ2A 1TV6B 3LO3A 1VRUB 3VVTA 4MH8A 2ZJQQ 2DGUA 4HKQA 4DZDA 2FJXA 4ED5A 3MAAA 3MM5A 1KLMA 2NZCA 3VV2B 4FF1A 4NCBA 1URRA 3EZOA 1DY3A 3ET6B 2EPIA 1Y3JA 5U47A 3BSOA 5GAEI 3FMWA 4O44A 3T6JA 1R27B 4I67A 3MM7A 3SCKE 4ZIWA 2C3OA 1G4CA 5K8MA 2UUCF 2ZNYA 2Y1RI 1G7CB 1R0AB 3AY0A 5ETLA 1RTIA 4OX7A 2E7WA 1HR0F 2JEGA 4JI6J 3K5OA 1UFLA 3G82B 3NP5A 4K4WA 2BE7D 1T8EA 4QW9A 3LP0B 1J5OA 2JEJA 5I42B 1BLUA 4DV6F 2BW7A 5HBMB 3PKMA 1UZHA 3KK2A 4UY85 5EWEA 1PYSB 3HJVA 3KLHB 2ALZA 1D9FA 2C2NA 4M5DB 3ZTSA 4MKYA 3DRPB 5J2NB 4J90A 4C3KA 2VFSA 2KZZA 5HVFA 2FHOB 2DR7A 5A8WB 2KXFA 5E3PA 3NMAA 4EZ6A 2IVFB 2CYYA 4X66J 1NKEA 3R6LB 3PW5A 2R7UA 2AF6A 3VF0B 2K1RB 3PM9A 5AXMA 2L08A 1R89A 1ZTWA 4LMZA 1CQNA 4OFZA 1DQ9A 1RU2A 4HDHA 4KTQA 5A6WA 4C8MA 3GG0A 2ZEJA 1BWVA 4ZK7M 4WBFA 4NOHA 3L3CA 4M5MA 3KUGA 3QGPA 1RQ0A 3H4DA 4B3SJ 5JJBA 1I51B 2G0IA 3NNAA 2ATCB 3FQKA 2KVIA 2LYVA 3FJ2A 3JQJA 3K5PA 4PPDA 3R5AA 5KFNA 2J6TA 4B9NA 3HHKA 3TAMB 1TL1B 1FWLA 2DEJA 2J0XA 1S1XA 2C2ZB 3DDNA 1HNIA 3M6WA 3OTDA 3KJFB 1PYOB 2KU7A 1JLGA 2HWTA 2Z0GA 3N5FA 2BX6A 1U2CA 4RW4B 4AD6A 3TZXA 4X62F 1N0VC 2BJ3A 2H5JB 4KFBA 4LF2A 4DG1A 2IFXA 2HWIA 2V8VA 4TNOA 1EHWA 1SC3B 4CCHA 2BA9A 1F2HA 1XEZA 2CJ9A 4CM0A 4JP8A 2NXCA 1JXVA 1HYSA 1L3SA 1HQEB 4MIAA 3DLKA 2B4PA 4RLEA 2ASLA 2HS3A 2DIVA 4LFAF 5C42A 3DLEB 1R8PA 3RB4A 3TZWA 4OZ5A 3T5LA 1SC1B 3BKFA 1EIYB 3BR9A 4DF8A 2B56A 1H74A 3HKWA 1R43A 4JV0A 4ECQA 4A8SA 1O5JA 4ZCIA 2HQIA 4ZP8A 5KFVA 2F1FA 2XMUA 1U8SA 2OEMA 3OBIA 3KLEB 3OR2A 5J2NA 2BE9B 1T05B 3ZO7A 2J7KA 1RDRA 2K1RA 3CPWR 4DSJA 2V8HA 2CNKB 3B54A 2GW8A 1W25A 3FFIB 1UZDA 4F04B 4DFMA 2EC0A 3W3SA 3CJ4A 1GX6A 2OSRA 3CCRS 4PXEA 2M88A 4OMFG 3H90A 2H65B 4KO0A 3OR1B 1AZSB 1Y9OA 4JI6F 4ECYA 2E7XA 1K73T 1JNRB 3GFZA 2NLWA 4LFBJ 2MQOA 2JOQA 1VHIA 1HWIA 4I7FB 3J7YU 3VHQA 3OHAA 3PW4A 3DRYA 3C15B 5L8RC 3T9ZA 1SIZA 3D3BJ 1Y3KA 3AT1B 2XYHB 3MPVA 2XYPB 2R2RA 3CCQS 1RK8A 2ZVIA 1NPPA 2XM3A 2UP1A 2FHMA 2B4OA 7FDRA 3PYEA 1KOOA 1RAJA 1FFWB 1DLOA 2ZBRA 3EDQB 1SPBP 3UN2A 2XBPA 4ZOSA 5SUHA 1U2FA 4OZ0A 3NS5A 3R7BB 3TVZA 2DR8A 4WK3A 4IO9Q 2CZ9A 3BYPA 4F0HA 4HHHA 4ID8A 4RW9B 4BWMA 3Q8SB 1T03B 4K4VA 2RMLA 2HHUA 2HVZA 4LJMA 1C2PA 4MKVA 1SKWA 1REVA 2YNGA 3HVWA 4ES2A 2DHXA 3EM1A 5IT9Y 3DRRB 4NE9C 1WNEA 4XIUA 4MAKA 2X1FA 5E2QA 2C42A 3ITHB 4KH1B 3A8JA 3PKYA 2R8HA 2BE2B 5HLFB 4TY8B 5IXUA 2PI4A 1K1QA 1YVFA 5BXIA 4XPEA 2IVMA 1FRXA 2QG9B 4WFXA 1IBLJ 4TU7A 4UW2A 5B0BA 1FFSB 2RS8A 3VTIA 3E2EA 1S6UA 1RWXB 3MZIA 4MFBB 4DV3F 1WTBA 1UL3A 2QLJB 5D4PA 3QMQA 3CCWA 4UOGA 3LP2A 4I7FA 3OJUA 1Y5IB 5LSRA 4I4BA 2JWNA 4KRWA 1RT4B 4RUAA 4C8KA 4IG0A 3CB4A 2C28A 1Q5YA 4IOCQ 1SXLA 3DRXA 3CCJS 2HHHF 3FEXB 2NCKL 1NDPA 3NY0A 4Y2CA 5E3RA 1PC4A 1RT7A 3QBCA 2ZOMA 2W2PP 2KYXA 2RS2A 3C15A 1FKOB 2BXJA 5IC4B 2XY7A 2N4CA 4LRCA 5HROB 4LRFA 4E2FB 4USTA 2W9BA 4ED0A 4QWAA 1HIYA 3UNYA 3TI0A 2GAGC 1N32F 4P7TA 2MZ1A 3OD2A 1UVIA 4WPAA 5KG5A 1YJ9S 4LF1A 2YNGB 5B0GA 2N3LA 4B3OB 4LF4F 3MMAA 2QGFB 3P96A 8AT1B 1IR2A 2LEBA 1FWPA 3PJWA 5LXYA 4RL1A 5JMNA 2DNNA 5ETRA 1ACMB 2GVZB 4ZLLA 2R8JA 4LF4J 3OHBA 6AT1B 2MZSA 3P5BP 1DZ5A 3NNCA 4Q45A 4URGA 5HQ8A 1TKDA 5L1IA 3W1YC 1HNZJ 2IMWP 2BKOA 2W8KA 3PRDA 3W66A 4CP5A 3PIPQ 3D6MB 3T1YJ 5FIIA 3NRBA 1U47A 5ADZA 3BREA 5ITHA 3KJNB 2QMWA 1FXDA 1P1LA 1DTTB 2VA2A 1U1MA 3GMGA 1HBMA 1FJ7A 2WONA 1UCNA 2NYHA 4EK2A 5FLXU 4ECUA 1RTDB 1NM2A 2B4VA 1S1WB 2BEFA 3C14B 1LW2A 3KHHA 2BOPA 2KFZA 4NA1A 4C4WA 1P27B 3AH6A 3HCXA 4QPTA 4P71A 2DNOA 3FCWA 3CCES 4GKJJ 2HNZA 3PW2A 3MD1A 3NNHA 2LDIA 4LF8F 3PJXA 4ECTA 1YKWA 2RRAA 2F4VJ 2CDQA 4U9RA 2ZBIA 1XMQF 1WHXA 4USMA 1B4SA 1TELA 3TW0A 2AYBA 2G2ZA 2PIIA 4P72A 2B7BB 4U96A 1EZZB 4D3HA 3TZZA 2OHDA 2EK6A 2UZAA 4E0DA 4QCLA 1JLCB 2IIHA 3NCQA 2MKJA 1U0HB 3IRXB 3WBZA 1ULRA 2ASYA 1S1UA 2IM3A 4W90B 2DCUB 3IAS9 2FLPA 4DJBA 2IY5B 1OQ3A 3N28A 1MN9A 3GJRB 3DHXA 3RUBL 4B3RJ 3HFVA 3DLHA 1KVJA 3H0PA 5KFDA 4ETXA 1FTRA 1MNEA 1RWVB 3F41A 5HJYA 4B3TF 3CSKA 2M7SA 5D0RA 4R5PA 4LIRA 3BQ0A 3OFFA 1V9OA 1H2UX 5CAAA 2ZKUA 3DOLB 4OLPA 1UPMB 1SBRA 5BR8F 3KYLA 4KGMA 3BSAA 4UUXA 1U2RA 2HQGA 3FGVA 2AEMA 3ISNC 4PXCA 2AU0A 1NLKL 4QYZK 1WG4A 2K3IA 3CO9A 3TUZC 2IM1A 2RDDA 3KK1A 4DR1J 4JI3J 1N5TA 4DR6F 1QY7A 2HYIB 1T9UA 2UVUA 1GEHA 3DYAB 4ZJLA 2HZCA 1SUQB 2I1RA 2ZH3A 3BS9A 3DOMB 2JHEA 2HPUA 4ZLPA 2HFUA 4ETZA 1QAYA 4C8NA 5L38A 3OJSA 4FDFA 4OI4A 2Z2YB 5DLFA 2MKYA 4A8YA 4NWBA 4TU8A 2V0NA 1AFIA 1QVGR 2OMLA 5A8WA 2NSCA 2YQ1A 2FQQB 4I2PB 4M8LA 4ZVGA 5IQQA 4E8UA 3TVYA 1FWKA 1JLQA 1QDUB 4J91A 4KPCA 3U1MA 1M5PC 3JB9k 2WVCA 1KS2A 3I0SB 4IQXA 4O3RA 5HMXA 3GFHA 2M3DA 4ZVRB 4N7TA 3O44A 5F3TA 4K5RA 3BQ2A 1N33J 4CO2A 3AODA 4X4TA 2YPZA 1HNZF 2X51A 4DPYA 2Z2LA 5ETVA 2AD9A 5E5NA 3J80U 1VHFA 1UMJA 1RCXB 3BZQA 1A7GE 1KRPA 1JLGB 3S1TA 4Z7YA 1RT3B 1O0PA 3L95X 1M90T 3DGPB 4LF5F 1NK7A 3PR5B 3GU0A 2GIQA 2AMCB 2QLXA 3VGVA 1NDLA 4DI6A 2AT1B 1D9DA 1VJQA 2NXEA 5DZ6A 5CD4H 3D67A 4OYZA 3M6VA 2HLUA 1TL3B 3IMQJ 3SFUA 2DHSA 1EQMA 3HZGA 1WTFA 2L48A 3QLHB 5B0FA 4DV1J 3AA9A 4IG3A 1G3OA 1SC6A 1ZM4A 2LEPA 3B8HA 2MJNA 1WDDA 2H4WB 1NHUA 4WP3A 2M8HA 1VI7A 3HHLB 4L74A 5KFKA 1PAUB 1RWKB 2HNYA 1F6TA 3DDIA 4HT5A 4OI1A 2DNHA 1TUWA 4B3RF 4DV5J 1RWNB 1Y7PA 3ZZYA 4J9SA 4IRKA 2HURA 3H98A 4CLUA 3J7ZT 2AP6A 4AL7A 2V4QA 2HGLA 4B3TJ 1XNQJ 1YITS 2UXDF 2J0QD 4YB5A 1CJVB 4IYQA 2IRUA 1UEKA 3QWUA 4YDDB 2I0XA 1U7LA 1WOSA 2OIHA 3GB0A 5KOWA 2DIUA 4K4XA 3HT0A 3NL0A 3ENAA 5DDRC 1R8AA 4ZCKA 4O4GA 1UVNA 4OZ2A 2MQNA 4DR3F 5KT5A 2VHGA 3PCOB 4FXWA 1VYAA 5K5MA 2G0CA 2HK3A 4BS2A 2O1PA 3C16B 1CC8A 1HBOB 1WC0A 2CA9A 4Z37A 4FKXA 4ZP9A 1WI6A 4YFUA 2GVDA 1GMWD 2KDOA 3EZUA 5DJBA 5C25A 3NLCA 4MTPA 1HNXJ 1N88A 2OELA 4I6AA 3TOQA 4CNZA 2BACA 1M1GA 1Z2LA 5RUBA 3BF4A 5J2MA 5FDLB 4Q44A 1B3TA 3EGNA 3HSZA 4K2XA 2RJZA 1H0HB 1X4FA 4WP9A 4FYXB 5KFTA 3W7BA 5IT0A 3I55S 1GTEA 3EICA 2C2EA 1FRLA 3TR5A 1NZ8A 3M2VB 2G2OA 4KV8A 2WBMA 4WFBQ 4ED6A 3Q2TC 5EN1A 4J9VA 2V68A 4QWBA 4DR2J 2IHR1 4MK7A 4FF4A 1KVKA 3CVKA 3H8YA 3ZXWA 3VR1A 1PBUA 2COLA 5EX0A 4P74A 1QUVA 2EFNA 3AOBA 4K4ZA 1VQNS 2HVHA 2WVDA 4NCGA 1JLQB 3FEZA 2VQFF 2YH1A 4WCEQ 4LSLA 4DX6A 1N54B 1FKOA 1YDLA 2EW9A 2OMOA 3L7OA 3IP0A 2NUHA 2N82B 2MXYA 3GIKA 1UA0A 1XC9A 4UF4A 3GCXP 4OYPA 3OTEA 1N36J 1GK8A 2QC3A 1GH8A 3BBBA 2WSFC 2FHKA 3DRSA 3MM8A 2E5HA 3SDEB 3HX9A 4DUZF 1RB0A 2JVRA 2ZC3A 3KKFA 2XMMA 5ETPA 2C2OB 2LXUA 4OHVA 4NLSA 3R6GB 4CT9A 4LF6J 1S9EA 5JVHQ 1WACA 2VG6B 2JEFA 2DISA 1TL3A 2RD5C 1Q8BA 2YXLA 4A8QA 1J5EF 2HHXA 2DGVA 3MMJA 3MM9A 4EGLA 4NI2B 3VAMA 1TK5A 4JI0F 5F8MA 1F5CA 2OPSA 2RF2A 1KNZA 1HHQA 1XMBA 1FNOA 1X4AA 3O6QA 3MEGA 2WVFA 5C24A 1FKAF 3QQCD 4OZ3A 4FZVA 4YB1P 4R0JA 1UKUA 4OYWA 1RT1A 1VRTB 4QQBA 3OTOJ 4USVA 3D54A 3J81U 2KM8C 3QNWB 3VZIA 1FDAA 5KFFA 1W26A 4K59A 1WG1A 5D77A 2KFNA 4C8OA 5DG9A 3HKZD 1J27A 2XSJA 2HAFA 3AFGA 3THPA 5HVHA 5GAGI 1IQZA 2VFRA 2Z2ZA 1KQGB 3DLKB 1KHWA 2A2DA 4C8ZA 2R3VA 3IO1A 4OV6A 1ZM3A 3IRWP 3GV5B 2OFGX 1SH3A 2M4MA 4EBCA 3BDEA 2EFPA 2R8IA 4DCOB 2WOMB 3G6XA 3UCZP 2PE8A 4WFYA 2QEXS 2WVEA 1IWGA 3RRKA 1N8RT 2AKWB 3PHTA 2NXJA 4KO0B 5KFXA 2W8LA 4ZP6A 1P6TA 2QIFA 2QX0A 2CDRB 2QYGA 3T1HF 1S9EB 1V3ZA 3MDFA 5DDOC 2ZH6A 1LOUA 1HNIB 5A2QY 2UU9F 3R5BA 3OL6A 1YBAA 3AJ1A 2DGOA 3ZTOA 2RQCA 2NSBA 3QZ7A 4GVLA 1HNWJ 1Q53A 1VQ6S 3D0GE 3RBDA 1WG5A 1FEHA 2MGZB 1U48A 2GC8A 1HQUA 4C11B 2YWEA 4WXWA 1HARA 4KT0C 1FVQA 2OLWA 3ISND 3KLFA 1I94J 1H38A 2QRRA 1FK9B 2QL7B 5K9FA 5C42B 1S97A 1QAJA 1LWEB 4NLRA 3RYLA 1DQ8A 5EGYA 3GIJA 4ECRA 4DQQA 4P2XA 4F02A 3KG1A 2E5GA 3M6UA 2BRKA 2VDHA 5MLCV 3OSNA 4DR5J 4EBEA 3PO5A 5D3GB 4OHWA 4Y2MA 1U45A 2B8PA 4IO1A 2GCFA 3W9IA 2MKCA 3RG6A 5K8OA 4NLUA 5DM7Q 2U1AA 2H9ZA 3R9LA 2VPWB 3I4HX 4CLLA 4ENOA 2KJWA 1KQFB 1JLFB 2CZ4A 4ID5A 3SSSA 4PG8A 3G6YA 1VBZA 2CJKA 1C1BA 2CXEA 2IYGA 1Z4UA 3GYGA 4X4PA 2VJUA 1HW9A 1JXLA 4IRCA 4JV1A 3B82A 2XSJB 5JVGQ 3TYTA 1APSA 3SMZA 2CVEA 3PZPA 1KKHA 2KRBA 2VFTA 2PO4A 2VG6A 4TVAB 1O8BA 3JTNA 1IKYB 2J9CA 3N9UC 5HP1B 4BHQA 3RBXA 3W9HA 4WKYA 3N5BA 2A10A 3C6TB 1K47A 2CVIA 3IS9B 2UUCJ 4Q2LA 2XLJA 3NBPA 1NSPA 2IRXA 3G71S 4C6AA 1IVZA 1Y5LB 3MM5B 3EPIA 1HPZA 2GGPA 2BYCA 4AFFA 1UJ5A 3W65A 1SI9A 2QN6B 2XMVA 5KG0A 1Q79A 3CJTA 1SV5B 3RAMA 5IM0B 2RDJA 2RRNA 4M5NA 2VIHA 1YJTA 5ETNA 2MSSA 4ED7A 5EWGA 3J7A1 2ACMA 2E1CA 3KJVB 2PEHA 2DHAA 1RT1B 4C2MA 2FYXA 3DYAA 2J9DA 4YY3F 2J7WA 3OVSA 5KG3A 4ED3A 4WIIA 5LMNJ 1H2TZ 2XQCA 4CZCA 1E6VA 1TK8A 2VFVA 2Y1LB 3FEYB 2O67A 4M5HA 3NEKA 3CMAS 4P10A 5BYQA 4RW9A 1S0MA 3Q8YA 2YKAA 3MXHP 1IBMJ 1VBKA 2LMIA 2Z8QA 1SH2A 4F25A 1S72S 2PDAA 5JXSA 1XJWB 2X3GA 4DPUA 4UQTA 3MF5A 1PJ6A 1R8CA 5AXNA 4Q43A 3RAXA 4IR9A 3NCRA 3MUMP 2EFOA 3DHWC 4DL4A 4B3MJ 1E6YB 3WX8A 4IOAQ 4DU8A 1OO0B 1PIEA 1WEYA 5GMDA 4JYAJ 2B5JA 1RACB 3C6UB 4NA2A 1S6PA 1FHTA 2CPJA 2ROGA 1IM6A 1U1OA 1HHSA 5KFMA 4YR0A 3QO9B 1C1CA 1FO1A 2V6AA 2DGWA 2VQFJ 4QU7A 3MR3A 4NMLA 2KG0A 1V5IB 1U6ZA 2CZVC 2HBZB 2N7YA 1UVKA 3DN9A 4PWWA 4OI3A 3ULHA 4F67A 3HXMA 1B64A 1V3RA 1TVRB 2WHOA 4QR0A 4FYDA 1Q16B 3IWXA 4QYRA 1BHNA 2KHDA 5J1EB 3VGUA 1B7YB 4PAAA 2X1GA 3QSYB 1U6BA 2N7CA 2LCWA 3N6LA 2QFJA 3LA0A 1LNQA 3W9JA 1RISA 1IBLF 1AUDA 2I2YA 4OYBA 4Q0BB 1U1RA 5HROA 1EJ7L 1VBYA 3CCMS 1R6YA 2J0WA 1MWQA 1VOMA 2CNOB 5A2QU 1LQ9A 1FE0A 1SV5A 1YLXA 3WIUA 5DG8A 4RNHA 4RR5A 3OUYA 1SKRA 2Z30B 1RAEB 3FZBA 2FLOA 3TJ8A 3O5TB 3BSNA 3TAPA 3TA2A 2DVIA 4R8UA 3GSDA 3T1AA 3M30B 4N76A 3QRQA 3DI6B 3THVA 3CC4S 3DLEA 4U8VA 4GRSA 4PPZA 1KQKA 1ITPA 2W24A 4H4KA 3UWTA 4UTGA 1IUJA 1TL7B 4ZLNA 1CEZA 5LL6d 4LSLB 2XCPA 3CJ3A 4V1Ak 2VQEJ 2YY3A 3N6NA 4RW6B 2J5AA 1H98A 2EG2A 3PYDA 4RX6A 1T9VA 2NS1B 3RJMB 2FHJA 3ZZ0A 5IWAJ 4X64F 5CA5A 4EBDA 2JLFA 4L76A 4URSA 1TZ0A 2YKMA 3TX8A 1N6QB 1PG5B 2I5JA 4LSNB 1G2EA 3PV8A 2V2VA 3CNQP 1F9FA 3G2XA 3H5XA 1RAGB 2LLZA 3G87A 4NZ6A 1D1UA 1NBEB 3A13A 3N0VA 1VK8A 2MLZA 5IM0A 1AZSA 2BW2A 3MR7A 4XPCA 1VCTA 3VAGA 4F4XA 3TQ1A 1FI4A 4WTOB 3FK4A 3HLUA 3UR3C 2E1RA 3GG1A 1JB0C 2IM0A 2HBYB 1R0CB 2GGPB 1HPZB 2ZHOA 2RUGA 3ENQA 3PFEA 3KLGA 1AT1B 4LSZB 1WHWA 1VIXA 2VU5A 3ZZRA 5LT5A 3T1YF 1TFYA 5HQLA 2XULA 2J9EA 3I56S 1RZMA 4EMDA 4A48A 4OJ1A 1I5OB 3AXMA 3I5CA 4TQSA 4ZLJA 1HQEA 4X4VA 3D1QA 3JTPA 4AUKA 2HHSA 4DPXA 5A76A 3FVYA 1W2IA 4DFPA 2YQ3A 1UEVA 2IC3B 4YB7A 5F8IA 1E6VB 3TX0A 2FC9A 2YWKA 3IBCB 5KFHA 5M2RA 4DN9A 1X4EA 1NDKA 2A6OA 3ZNJ1 3GLJA 3TZYA 3GV7B 2XS7A 1PAEX 2BJ1A 5F0UA 2R2SA 3K17A 4FXVA 4FF3A 1T05A 2ZBCA 3MPYA 3R7NB 8ATCB 4DUYF 2KTQA 1NMEB 4HI2A 2LU1A 4C48A 5EUHA 3ZZTA 1X31C 1REVB 2ZFHA 4ED1A 1U1LA 3I6PA 3GJTB 3MGJA 2LXFA 1X5TA 2YVSA 2XS5A 1NSQA 4OLOA 1RAFB 3A12A 1REGX 3QJLA 3CC7S 3LPEA 1LFPA 2EK1A 4LR8A 3TNVA 2ZM6F 3MECA 4KHPF 4OJ3A 2DGQA 2HRUA 3KK1B 5DETA 3CCUS 2KXHA 4N47A 4MYUA 1TK0A 3EGWB 2R42A 2ZH1A 2VD3A 4BC9A 1SUQA 4RNFA 1DTQA 4OZNA 1QE1A 1KWMA 2W01A 4RBUA 5CYQB 5T14A 3MEGB 1T9XA 1Q7LB 3AD9C 4X84A 1HWLA 2QA4S 1YHQS 1WSRA 1BXNA 4USWA 5D4LA 1U1NA 2RQKA 5K20B 3RW6A 4HACA 3KK2B 4RW8B 5KTQA 2MLYA 3GCWP 2W9AA 4Q5VA 2V8DA 4NLDA 1RGVA 3SI8A 2XS2A 1FD8A 2KRRA 2B8QA 5HATA 2VOPA 1RXOB 3BN7A 3TUJC 1Y4ZB 4YQWA 4AQYF 1KC8T 7FD1A 3IM9A 1RTJB 1S6OA 2P9GA 3D6FB 3FBEA 5G0RA 4PG7A 2WZ1A 2MKIA 3KHRA 2CG4A 1TMJA 2CQHA 2ZJRQ 3FDSA 1NJZA 2VBZA 1D8YA 2YKQA 2I8EA 2OPRA 4MKBA 5LSOA 1CC7A 5KFWA 2BRLA 1QAXA 1QAIA 1FEEA 4Y00A 4ICLA 3ZC4A 3UI3A 1NJIT 2DH8A 2GVZA 2DGSA 3ZFVA 3H2LA 1BQMA 4TU9A 2MKKA 1SKUB 2ZBPA 3HM9A 4CLPA 2WSEC 1M5VC 1U6FA 1S6QB 2W4DA 4XO0A 4JI7J 3MTKA 3K7RA 3GSIA 4O3QA 4EEYA 4ZJQA 2JLGA 1SB6A 4DWIA 4LF5J 2DNPA 4TY9A 4M5DA 2WONB 1YRTA 1RLCL 3E3XA 3IA0A 2W9BB 1S1WA 3C14A 5I42A 2QL9B 1BQXA 4F36A 3AAWB 1OWXA 3V4IB 1CPZA 3RBEA 3MEEB 3HULA 4G1PA 4IH7A 2G4BA 4RWWA 1ZA1B 3R97A 4X2BA 1VIOA 1S1VA 4RNMA 1FD2A 4KBIA 1GXLA 3R5GA 3A3NB 3KLIA 4PR6A 1SH0A 2FTRA 3LANA 3JAMU 1T94A 3K5NA 3HT3A 3TVKA 2FVCA 3IRXA 3R27A 3C2PA 4TYBA 4I0WA 1BUXA 1AUSL
chains in the Genus database with same CATH topology
3OW2R 3KWMA 4ELVA 3CD0A 2ASDA 4H4MA 1YGYA 1EETA 4H54A 3PRBA 4NYOA 5KG6A 4U7CA 1FNXH 2OTLS 3DLGA 1MW7A 4F4ZA 4DL3A 4OZJA 5JUMA 2O01C 1T02A 4QPXA 2EBGA 2HFZA 2MQLA 2W7PA 1KFDA 1C1CB 2BJDA 2V5HG 4R25A 5KFAA 5J1EA 3G9CA 2VBYA 3AA8A 2CQPA 4HTJA 4DBQA 1SL1A 4WKRA 3UNGC 4PKDB 3SXLA 3I0RB 2C22A 2JEIA 1FRJA 2CQCA 2UUTA 1DJ0A 4MK8A 4I68A 2C3UA 3VZHA 1EP4B 3M8SA 3CC2S 4DQSA 4L6V3 2EI5A 4NX9A 2P9EA 3UFCX 4A8KA 1ZPWX 2XMJA 5GAHI 1S1VB 2M70A 2YWFA 2B0GA 2B6AA 2CQIA 3FRYA 4LQ9A 4EUVA 4EO8A 2XY6A 3MEEA 2AW0A 4U6PA 3WC2A 2E66A 6FDRA 1IJEB 2BVZA 1R31A 2DO0A 3ZZPA 3W2VA 4HYKA 4YR2A 2BE2A 1A9NB 3UPFA 1XK8A 2MQPA 4X4OA 4RW7A 3KHGA 1Q86T 1IBKF 2B5JB 5L9NA 4CTAA 2IM2A 3VALA 3PNIA 5KFJA 2Q66A 3M1VB 1HNVA 1TKZB 2ZH4A 1DURA 2F4VF 2DNYA 2CPZA 3V81A 2W9CA 1UW4A 1VQYA 2MHNA 2UXBF 5KT2A 2P6SA 1UVJA 4I1TA 3DOMA 4CO4A 4B02A 2E1AA 2VV5A 5CH7B 1DQAA 4LT6A 3X1LB 1X4HA 1HQUB 4C11A 4FVMA 2MSTA 4LVNP 4ES1A 2UVWA 2QV6A 3FSIA 4OV1A 1JWWA 4F3MA 3SQGB 2J9DE 1Q8LA 2DPIA 2A3JA 1FKPB 1DAXA 1VQ7S 3POTA 1VS3A 2GQQA 2XNRA 4ZPTR 1X4GA 1C1BB 4DV5F 4EU0A 4C97A 3CULA 3OTOF 4K4YA 3R1HA 5E3CA 2ZUGA 3HZEA 2HNYB 5H1SV 4FNHA 2MMYA 4K4TA 2FJAB 5AXKA 4KAIA 2YKPA 1ELOA 4JI5F 2NZ4A 5E7OB 1MU2B 5T7LA 3CWJA 1DRZA 1QAIA 2ZOFA 5M2UA 3GR1A 3JSMB 4DR1F 2PMZD 3LAMA 3CCZA 3RRGA 2RE1A 2ZHBA 2HFOA 2HG4A 5AE1A 1Q1KA 2KYZA 4CI0B 3JAMY 2ILYA 3VWSA 4ZP7A 2VL1A 2AYEA 5LSLA 2AYMA 1ZTTA 1FDBA 1NEEA 4HH1A 4ITSA 4RU9A 4ZA1A 1T3NA 5CCMA 1RT3A 1ZM2A 2G1DA 1S0OA 4ZVHA 5CYMA 1LWFA 2VG5B 1VQ5S 4BBYA 1IKXB 4EWTA 4NLGA 4K4UA 4ED8A 5EDWA 1XN9A 4G1QB 3US5A 1LFWA 1PO6A 1S1XB 1MMLA 1HHTP 1LWEA 2VKRA 3M6XA 4RW4A 3G6VA 1NHVA 4JI2F 4M1KA 4B9LA 4ZS6A 1N34F 4WYWA 4RZRA 2XGQA 2R7SA 2W7AA 2A1BA 1AROP 3HHDA 3Q2SC 4H4OB 3K8VA 1LWCB 3MMAB 4O3NA 3BO4A 4J37A 1HWJA 1UJ4A 3IWNC 3EXYA 4DR5F 1SJ3P 2DITA 2Q3PA 1FXLA 1AXQA 3M32B 4Y2KA 2XWYA 4YUDA 2NR0A 1S1TB 1BD6A 4AL6A 4J9RA 4J9QA 4K5SA 2ROEA 1L3UA 4TQRA 4DR7F 1HBUA 1QLNA 4NCAA 2LQJA 5CQGA 1HW8A 2MKSA 5E3AA 1J2VA 1CVJA 3ENWA 2CJAA 3Q23A 2E9ZA 3KG4A 1X4BA 1D9AA 3C8YA 1IN0A 3L7PA 1H3DA 1X0FA 1HMVA 3HI9A 2HNZB 4OHXA 5J2MB 3X3UA 4DQPA 5KFGA 1KTQA 2LDYA 3GIMA 3OXLA 5F8JA 2OPPA 3K8WA 1HBMB 4F4WA 1TKXB 3R3TA 4NRTA 4CO0A 4LF6F 2HHQA 3QZ8A 3DI6A 2IYIA 3M2RB 3OTCA 3KK3B 2QE5A 2CQ3A 3CUNA 1KSPA 5C24B 4AXIA 2RQ4A 1NH8A 4WE1A 1FVSA 3I31A 1GNKA 4F3QA 4OX9F 1U25A 5A0YA 2HS0A 1B0TA 3OXFA 5K8NA 2K8GA 1NKBA 5D4NA 3KLVA 2BQ3A 3DNCA 1CSJA 2FGOA 2JJ4D 1C0UB 3IG1B 5KFZA 4WZMA 3HMJG 4DSFA 4LF7F 2ACYA 3PO4A 3SV4A 3MD3A 3DRSB 1Y00A 2OFHX 4WU2A 3SDEA 1K1SA 4XDDA 5DQIA 4XAKA 3GE9A 3QO9A 1S49A 4A8XA 2LEAA 4KHRA 5CCLA 2CQ0A 2FJVA 1VQ9S 3D0IE 1N56A 4ZKAA 3VQSA 1HBNB 2ZE2A 3MM6A 1UETA 4CIOA 4B3SF 4B9VA 1LW0B 3OFHA 1Z2ZA 4USHA 3MMBA 2GMJA 2ZDOA 2BM0A 2PMHA 2KO1A 1N36F 1X4CA 2DB1A 2JFDA 2QMXA 3MEDB 3V4IA 2OPPB 2RRBA 2K2PA 4OHYA 4AYBD 4TXSA 3SEOA 1FRIA 1ZZFA 4CH1A 1FJEB 5B0DA 3H4BA 1M5OC 5GADI 3QJPA 4Y34A 4ZPBA 5J2QA 2NREA 3W2VB 2JLEA 3PEHA 3S8SA 2PA3A 1HBUB 4KHMA 2ASJA 1IQTA 4ECSA 1YRXA 3TANA 3G8SA 4MYTA 2R8KA 2YNIB 2DK2A 5HMYA 2HNDB 4DQRA 1S1TA 2ABYA 4MFBA 2HMIB 5BYSA 3PVXA 5C5JA 2J0SD 3ZZUA 3GFXA 1K9MT 4ATNA 2KT2A 3PEJA 3HHLD 4PWDB 4QIWD 5KFEA 2V4RA 2MGZA 1N52B 4R0EA 3G8TA 2ZZMA 1TL1A 3CD5A 1S48A 4FP9A 4H4KC 2KB2A 3MOZA 4B9TA 1JLBA 2R7RA 3LW5C 5B0CA 1HD0A 3I9ZA 2PI5A 4QOTA 5F3ZA 1N5YA 3PFOA 4X4QA 2GHPA 2OP5A 2XGPA 3Q0AA 5CYQA 1YJUA 2R2TA 4FBUA 1GT8A 3CDBA 3KJVA 5LMNF 4IFVA 3VCDA 1RWUA 3AQPA 3BM7A 4JYAF 5KFPA 2CKWA 2PC6A 4C3MA 2RKIB 4PXBA 3PW0A 4GKKF 5K14A 2GQCA 5HO4A 2GQ2A 1NNDA 2D41A 4ICLB 2WAQD 5DS7A 4RUCA 4DLGA 4GMKA 3LPYA 3SFGA 3ETOA 5T41A 4KSEB 5B7WA 4USJC 3CEDA 3NGDA 2CQ1A 2MZRA 3B4MA 2YX1A 3DMJA 1M5SA 3C6TA 3UR0A 4ZVEA 3J80Y 1S76D 3MUTP 3KNAA 4YDXA 2B51A 2KI2A 2V4JB 1QSYA 3I32A 2AJ1A 2ZH5A 5KAKA 2D74B 1F5AA 2KG1A 1TAQA 2FVSA 4IUFA 5KFYA 2HWHA 2KN4A 4OI0A 2OAUA 5KOXA 1FT8A 4ALZA 4GC7A 2NXUA 3QGHA 5MAOA 2IMOA 5D4OA 1IM4A 1M0SA 1L3KA 1OPZA 2MHEA 4NPOA 1QSLA 3VAHA 1O51A 2HHWA 4M95A 3DCAA 1YIJS 2JVOA 3R5CA 1X9WA 5G4DA 1VQLS 4LQ3A 4PUOB 3BGLA 2RT3A 3N4WA 3UD4P 2VZ9A 2F9DA 1SJFA 5G0RB 1I1GA 2UV8A 4I6YA 3WDOA 1C0TA 2ZC4A 3VAKA 4IFYB 3TAMA 2R4FA 4J9MA 1P1TA 2AV5A 3RAQA 3NS6A 3R5DA 3DDKA 2R7WA 1U49A 3RR8A 3H5YA 1LWFB 2VG5A 3Q22A 2YNFA 1OIAA 1NU4A 1U09A 1VMBA 3D28A 1TR0A 3R1LA 4PQUA 3TUIC 4C0HA 3H5SA 3CJ0A 4WF9Q 3IGVA 3CMES 1XR5A 1JX4A 3UCUP 2VB6A 2B4UA 1IBMF 4QBUA 1FJCA 4NL5A 4X66F 3JSRA 3NWGA 1TAUA 1WF0A 1X5OA 2NQPA 1X8DA 3AB2B 2ILZA 4NLTA 5KT4A 2OPQB 4JBCA 2AX0A 3HVTA 2ZKTA 3CJ5A 2QLWA 4TKTA 3H2VE 1N5YB 4QW8A 3OUYB 4DN0A 2WTFA 3P3DA 1TV6A 4N8OA 4KC5A 3DXBA 1NJXA 1LXNA 4Z2XA 2KM8B 3M8RA 4H4MB 2Y1IA 5E33A 3QGIA 4FS2A 3QAEA 4RW6A 2R8GA 1VLYA 3CJ2A 3BQ1A 2GFFA 4DL5A 3ITHA 2OPSB 2ZD1B 2CFXA 2H5EA 2J7UA 3M8PA 3CJKB 2DNMA 2ZVSA 4WXOA 4MIBA 3WC0A 5GADU 4C0BA 3MHYA 5D78A 2W4PA 4CO3A 2RU9A 4RU2A 3V4MA 3V6JA 2L3MA 3BO3A 1M1KT 1HMVB 2CRLA 3V2UC 2VG7A 2CQ2A 2EVZA 5J1NA 2GIRA 2AX1A 2LA4A 4IH6A 4DL6A 3NMRA 4JI3F 1HWUA 4KJIA 3LGNA 2E9RX 3CT9A 4Y2AA 3K0JA 1FCAA 1HL6A 2MKHA 2HHVA 2NUUG 2OPQA 1DTQB 4NZ7A 5A0YB 4NLOA 5LJ5Y 2C3MA 2U2FA 1FERA 1UP1A 2EBEA 1MWYA 2B6AB 4JI4F 1D3WA 2KKHA 2VODA 3CD7A 1Q4RA 2M0GB 2MDAA 3IS9A 2WB4A 3SSQA 2BUNA 4DQIA 3EGZA 3N79A 4LFBF 1DHMA 2DRBA 1C4AA 5HP1A 1S6PB 1HBOA 5KFRA 4X65F 2ZD1A 2CQGA 2X1AA 2KFYA 3RZAA 4KE5A 1N33F 4TLRA 4N77A 4HH0A 2RB7A 2N3OA 4EZ9A 1TKTB 2D9OA 2KT3A 2R7XA 4EO6A 4PQUB 1D8ZA 2UXCF 3M4XA 3TA1A 1JXEA 2DR5A 1S6QA 3OTBA 2RIJA 3CD6S 5B0EA 4F50A 1BQMB 4FBTA 4KFBB 3SZ2A 1YJWS 1M5KC 5F8GA 3DM2B 2ZZNA 3KHLA 2WW8A 4RNNA 2VONA 1L5UA 1JLAA 1GX5A 1QE1B 2YKOA 2BANB 2DGTA 3HVTB 4V19X 4ED2A 2VPZB 3JYTA 1U26A 2M9KA 4O0IA 4MJKA 4PQAA 3Q24A 3QYYA 2FVQA 5L1KA 5E3QA 5DDPC 1ZM9A 1XNRF 3SCIE 4U7UK 2CJBA 2CPYA 1P9QC 1GQEA 2V2KA 3HJFA 2CPFA 2WB1D 3M8QA 4ZPDA 4FNIA 4JOUA 2Q6BA 2XCAA 1Q8IA 3O3LA 4AL5A 2GJ2A 4IKAA 2G9OA 2DNLA 2F8EX 2P9CA 2GV1A 4F8RA 4UY8T 1NH7A 1RYSA 4NZ0A 1ZYQA 5KT3A 3I4PA 3MM9B 2UVVA 1FDDA 3DFEA 4NLVA 2DR9A 2XC9A 1NK0A 3D5MA 4J9KA 3OVBA 2LA6A 2R7OA 4WTYA 2R2UA 3T3FA 3HHEA 3LP1A 5THWA 3LF0A 2EG1A 1B0VA 1FE4A 2F7VA 5B0AA 2MY8A 2D3OR 1MROA 2XSFA 2BR0A 5L9XA 1SJRA 3M30A 2ADBA 3FCHA 4M94A 3V5RA 4N8NA 3LQVA 3LWMA 1CQMA 5K14B 4YMEA 1LK7A 3A8EA 2FGCA 3NKYA 4IR1A 2RVJA 1JJ4A 1CLFA 2AGPA 4IRDA 1IKWB 2KHCA 1Y5NB 3IR7B 2FUG9 4WFAQ 4N5SA 2ZH8A 1F60B 1SJ1A 1XTZA 1RTHB 2FB0A 3CF5Q 3FNNA 4RBTA 3G86A 3OLAA 2R7QA 4OHZA 2I5JB 3E01A 2K7KA 3OSPA 4O44B 1TKTA 1DARA 1YTYA 2I9SA 4GC6A 5SZTA 3ISZA 1FNMA 2QA4G 3PX0A 5I3UA 4DSKA 1QJHA 3MM6B 2DHGA 4URQU 3PW7A 1HNVB 1TKZA 3BGFA 3KNGA 1YRUA 1FK9A 3K57A 2C2DA 4HTIA 3NCPA 2K7JA 3MMBB 3J81Y 1N48A 4PCQA 3NGKA 2N4DA 3I0RA 3K2YA 1FRMA 3LH2S 5J1PA 4DV1F 2OTJS 3O8WA 3E51A 3GZ7A 3EPGA 3LP0A 2F3JA 2XWXA 4OZLA 5DGBA 2V9WA 4F2RA 1Y0HA 3CGIA 1WI8A 1RT7B 4KV8B 1JLAB 2BANA 2F9JA 4OIXA 1RTIB 4UUWA 4U67Q 2HHSA 4L3NA 2QSFA 5A8KB 1H7XA 1X5SA 3BSCA 4J9NA 5J2QB 4DV7F 3AQOA 4WU3A 1ZAWA 2JFKA 5I3PA 2MQMA 3CCLS 1YI2S 4FXDA 3AHPA 4DF4A 2AJ4A 4ELUA 4FS1A 1HI1A 3B78A 1UVLA 5J2PB 5FJ4A 2C3PA 5AXLA 5I4MA 2M52A 2IBKA 3S7RA 4G1IA 1VQ4S 2XG8A 3M2UB 1WD6A 2DH9A 4I64A 5DGAA 1OS5A 2AGOA 3KLGB 1E6YA 5LJ3Y 1PC5A 1VQ8S 1TFWA 1MMNA 2VPXB 3CJKA 4MIWA 1BGXT 2B9YA 1KTVA 3E8OA 4RW7B 4A8OA 4ZHRB 4QIGA 2BQRA 2HHTA 2DJWA 3GILA 4B9MA 2YNFB 4NCGB 3EXCX 3DOKB 3OV7A 3Q8QB 1KVIA 1TP7A 2IRYA 4Y28C 1OQ6A 3CDWA 1T95A 5GAGU 5L1JA 2RF2B 4MK9A 2DCLA 4ZCLA 1OSCA 2YKNA 5GVQA 2NPIA 4ECYA 1U24A 5A6PA 1S7HA 3MEKA 4YP3A 5L39A 4DL2A 4QWDA 2XLKA 2GNKA 3K5LA 2HVIA 2OKQA 2AQ4A 3MEDA 5HL7Q 4DDFA 3MWBA 1B0PA 1DLOB 3DLJA 3FSYA 2D3UA 2MZQA 3VQTA 2P6TA 4EYIB 4R8UB 1JJ2R 3HDSA 2L41A 3FMBA 3EZ5A 4F4YA 3D1OA 2MJUA 3AB4B 4F26A 3OL7A 4ZPWR 3UDCA 1KR4A 2EFGA 2QYCA 5I3QA 2MQQA 2I38A 1LWCA 4LFCF 3L09A 1FF2A 2GO9A 2QT7A 2YTCA 4HDGA 3FFIA 2DRAA 3CCVS 4C8YA 2JDJA 3MMCB 3DU5A 1VFJA 3K5MA 3HK2A 5A8RB 3MFHA 4P7VA 4PG4A 4TYAA 2XB2D 1YJVA 2B43A 5KFSA 3LAKA 3D1HA 3HHLC 1Z1ZA 3G6ES 3RR7A 2UUAF 3OPKA 1B7FA 4A8FA 1U1QA 2QO3A 4DOZA 1UWBA 4OJGA 5AJ3F 3ZZOA 5KFOA 2O3DA 3VAIA 3LGMA 5CYMB 2M8DB 1WWHA 3I0SA 2LQ5A 3PX6A 5GAHU 1C4CA 3IFEA 1AW0A 3V6HA 4WFNQ 4I2PA 4ECZA 3M2RA 2CPHA 3TP2A 3BDPA 2E1MC 3CCTA 1RT6B 4H4OA 2DD8S 2D3ZA 1TKXA 3H2UB 3BJYA 4B9UA 4RUHA 5J2PA 4NLWA 4ERDA 2BABA 3T9NA 3S6EA 4DV2F 4AXJA 3EUNA 4Y0FA 3O1LA 2GX8A 2HFNA 2E5LF 2FJEB 3FSXA 3DXSX 4E8UA 2VASA 3DMJB 3LOUA 1ZAVA 2LQBA 5KFQA 3PX4A 4JV2A 1GXUA 3BEGB 1HI8A 2V4JA 1Q82T 2L9WA 1NO8A 3M8QB 1JNZ<