4P7TA

Structural insights into higher-order assembly and function of the bacterial microcompartment protein pdua
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
85
structure length
85
Chain Sequence
QEALGMVETKGLTAAIEAADAMVDSANVMLVGYEKIGSGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into Higher Order Assembly and Function of the Bacterial Microcompartment Protein PduA.
pubmed doi rcsb
source organism Citrobacter freundii
molecule tags Structural protein, electron transport
molecule keywords Polyhedral bodies
total genus 21
structure length 85
sequence length 85
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4p7tA00
3SSRA 4QIGA 4PPDA 4QIFA 3SSQA 2A18A 3DN9A 2G13A 4OX6A 4DDFA 3BN4A 3H8YA 3NWGA 3CGIA 4QIVA 4RBTA 4QIEA 4RBVA 5L38A 2EWHA 4P2SA 2A1BA 3IA0A 4P7TA 3I96A 4AXJA 3VCDA 4OLPA 3I6PA 2A10A 3MPWA 4OX7A 5DJBA 3CIMA 4AXIA 4LIWA 4P7VA 4RBUA 3DNCA 3SSSA 3N79A 4OX8A 4OLOA 3NGKA 3MPYA 3PACA
chains in the Genus database with same CATH superfamily
5C42B 2GMJA 3AAWB 2UZAA 3CJKA 1CULA 2HG4A 1KD1T 1FNXH 2N7YA 1WD6A 3QIDA 4B9UA 1DAXA 1L3KA 3DM2B 2NUUG 1HNIB 4NASA 2J0XA 2MLZA 2F4VF 4OZ1A 4JV2A 2YNHA 2HMIA 2A2CA 2QYCA 4Q0BA 2IA6A 2EFPA 1VGYA 1Q7LB 1RWWB 1OYDA 2DHXA 3THTA 3N6LA 3CJRA 2CPEA 1VQSA 2E1RA 1N88A 7FD1A 4PWUA 5A2QU 2J6SA 3PW7A 4FF2A 1IQTA 2WOMB 1WF1A 2BOPA 2N4DA 2VFSA 1RAAB 3D0HE 3TAMA 5GAGI 2DR8A 1NK6A 2OPSA 2CXEA 3GJTB 2HQ3A 2ZHOA 4USWA 5E7OB 3C2PA 1T9WA 2J7KA 4UF4A 5J2MA 4RU2A 2QG9B 2EXUA 3PFOA 2R8HA 3MR2A 3I31A 2QIFA 3CJ0A 2DEJA 1UEUA 3H59A 2E5LF 3HDSA 1NDLA 1MW7A 4PKDB 4LFCJ 1HW9A 4L3KA 4ECYA 1FJEB 4NEYA 1XC9A 4Y6IA 5KT7A 4ED8A 2UVVA 2K7JA 4YUDA 1IM4A 3E01A 5CZVA 4XPEA 2AJ0A 1M5VC 5KFGA 4AYBD 3CCRS 3SSSA 1TMJA 1VK8A 2QYGA 2VBYA 1FE4A 5IM0A 2HRTA 1UP1A 3V4IA 1KFDA 1HPZA 1WWHA 1QAYA 3CDAA 4G65A 2DCUB 3CW2C 3SDEA 1R0CB 3K5LA 1FKPA 1FXRA 2B9EA 1YITS 2G9OA 2W9AA 3DI6B 2ZHBA 3PXGa 4ECQA 1VQ5S 5LMNJ 2HLTA 3T1AA 2VPYB 4Y2CA 4ANCA 3JTNA 4KPCA 1S6QB 3KLGB 3LWLA 1YZ7A 3TUZC 3TUIC 2V8GA 1NH8A 4FPIA 4U6PA 3EPGA 4WE1B 1F60B 3D7SB 1KSPA 1GK8A 2QLJB 4UQTA 3BEGB 3OVBA 5IV3A 5IWAJ 4URGA 2CNLB 4DV0J 1MSWD 2QTWA 1QTNB 2EFGA 4CTAB 1AUDA 1VR6A 4AL6A 4M5DA 3FZBA 1JK9B 1FX2A 1RP5A 2MLXA 2JLGA 5IWAF 5RUBA 2FLNA 1FT8A 2ZJQQ 4L3NA 5J1NA 3G82A 5HMXA 1SL2A 4IYQA 1KRPA 1X4AA 3UCUP 3QSIA 3FZ2A 5IQQA 4C9DA 3O1LA 3KLFB 1K8AT 2V94A 4J9MA 3FSYA 4TU9A 2DNQA 3N0VA 5D78A 3UFCX 2HBZB 5HJXA 1HR0F 2IFXA 2K1RA 4DV1F 3DM2A 2J8SA 1KTVA 3PJXA 5D4NA 1Q79A 2BYCA 1C1BA 2PMZD 4BBYA 1BGXT 2YNFB 3P5BP 1IKWB 1T8EA 1KHVA 1E6VA 1FD2A 1R8AA 1Y0HA 3W2WB 1UPMB 3FNNA 4DX8H 3VAIA 3UD3P 4NXMJ 2YKAA 4X84A 1UEKA 3BH7B 2MZTA 4NLDA 4F4ZA 1WORA 4MKAA 3PG9A 2OH2A 2GGPB 4DV5J 1IKYB 3ET6A 3MEKA 3C46A 4HHJA 2MKSA 2AX1A 1VQMS 1CJUB 3FMBA 2MXYA 2E29A 3MMAA 4MAKA 4QPTA 1SCJB 1U24A 2VD3A 4RWWA 5KFSA 3T19A 2LA4A 3BPSP 3L7OA 4ZLLA 4LF2A 3D67A 2IVMA 1GX6A 1V6HA 2FIUA 2CQ0A 2K2PA 3HHDA 4M1KA 4P2MA 5FDLA 3KJVA 4WFXA 3DLGB 4HACB 1PAEX 1TKZB 4B9MA 3MPDA 4JI6J 3MAAA 2AV5A 4QQBA 2JFKA 4C6AA 2AGQA 2KVIA 5K9FA 1ZH5A 4MFBB 1JLCA 3MPWA 1D9DA 5KG6A 2Z56B 4BWJA 1JX4A 4Q2LA 4NCGB 4A8OA 3RGIA 4ZJQA 2UP1A 4C98A 3NGKA 1VI7A 1G2EA 2BXJA 2ACMA 1JLCB 3LP0A 4OZ2A 2RE1A 1VISA 2MKKA 1XMOJ 4FYVB 3Q8UA 2QL7B 4HKQA 4RW8B 1NHKL 4XTTA 4YB1P 1ZA2B 4DSKA 1OSDA 4NZ6A 4KB7A 4WWSA 3CJ3A 5GAHU 4DS4A 3RRHA 2GJIA 1Y3JA 2MB0B 3ZTPA 2E5HA 2KG0A 1RWMB 1FJ7A 1U8SA 1X4CA 3GFXA 4F04B 4U7UD 1O5JA 2GNKA 4C3KA 3OTEA 3IG1B 4NZ7A 3OL6A 4C2MA 1S1UB 2YKNB 2IIHA 4DCPB 2KB2A 3PX6A 2ACYA 3T1YJ 1EZZB 2G2OA 1EKRA 2FZKB 3Q89A 5E3RA 4F4AA 1RWUA 2VHGA 4OIXA 4BC9A 4DV2J 5FD1A 2W9CA 2OUGA 1TK5A 2XQCA 1S97A 2Z57B 3G6YA 2ZNZA 3MMCB 4DEZA 4DV6J 1Z1ZA 1PC5A 4EYIB 1NKCA 4JI4F 3AOBA 3UWTA 4TQSA 4PWDA 2HBRB 1XR7A 2MQNA 4O0NA 1L3VA 2FQQB 3R7NB 4DWIA 2BDPA 2YKNA 3OUYA 2ERRA 3NOGA 4K4VA 3Q23A 1RU2A 4NRTA 2D9OA 2PC6A 2OSQA 2W24A 4TY9A 1SL0A 3DLHA 1TKXB 3DHXA 3THPA 2OKQA 3KK1A 2VIHA 2YX7A 3EGWB 3M32A 3CF5Q 2ZBRA 3D66A 1XMOF 2ASJA 3BGRB 4RW8A 4RW9B 2XZDB 2I0XA 4ZMMA 1UFWA 3BDPA 1AFIA 5GAHI 1FNOA 4WK3A 5LJ3Y 1YRTA 2UVRA 4UZBA 4LBPA 5F8HA 4ED1A 1Z4UA 2DGVA 1R3NA 2KN4A 2YNGA 3CJQA 3KNGA 1HIYA 3M7VA 1MMNA 2NXJA 2YQ3A 2WONA 3V2UC 1MMDA 2BABA 1S0OA 2AJ4A 4FF3A 1LXJA 4TQRA 3KG0A 3ETOA 2E66A 1FRMA 2GQCA 4PCQA 4X66J 4XDCA 3IBFB 4RL1A 5E3CA 2XMJA 2C3UA 2IMWP 1CEZA 3MDFA 1LWCB 1Q53A 2OEKA 1SPBP 3D3CJ 4I4BA 1NPRA 2IVYA 3AHPA 4NLTA 5A6PA 5EDWA 3CD5A 3OLAA 5GAEI 3TR5A 4X4RA 1AA1B 5A8KA 2IAJB 3BN7A 3NNCA 3VCDA 4WYWA 2ZITA 2DXEA 4WFNQ 2CPFA 2ZH4A 1NSAA 2GJFA 3N01A 2NQPA 2POKA 5DG8A 4LF7F 1RT7B 1FESA 3I6PA 3M30B 1R31A 3OV7A 2GGPA 4AXIA 3V4IB 4LIWA 3D0IE 4X62F 1JNRB 3LANA 1CG2A 1F5AA 3NLCA 4U8YA 3VTIA 5F8JA 4W92B 4NEZA 3DU5A 3M2VA 1S6PB 2M0GB 3V81B 4I7FB 1JKHA 1HWLA 1JLEA 2FD2A 2XYHB 1IKXA 3SSQA 4QW9A 4DUYF 1JWWA 2HGNA 2PA3A 2BJ1A 2V67A 1S1WA 3AH6A 4Y2MA 3W9HA 3VGVA 2YKOA 3F56A 1VQ9S 1WDDA 2Q1LA 3R1LA 1CLFA 3FUYA 1EJ7L 5DG9A 4A8WA 3PKMA 2LECA 2AF6A 2HLUA 3H5SA 4ZITA 2L41A 1N4LA 3KHLA 1LK5A 1NSQA 4DQIA 2IDLA 2DPIA 2DB1A 2AW0A 3LPYA 2R8IA 2PE8A 2GQQA 2JEGA 2ZH6A 3Q24A 5DLGA 3W5YA 4PEOA 3G82B 3UNYA 2CQ2A 2FVCA 4HHHA 4WU3A 3EXCX 3MF5A 4CDIA 5AE2A 3GYGA 1O51A 3PEHA 5C24B 1FWPA 1RAFB 2XGQA 4K4WA 3G6VA 3ZZUA 1TV6B 3K5OA 4EI2A 4PG8A 1EARA 1SIZA 2MZSA 3GP9A 2XCAA 5IZHA 2KH9A 2A18A 4I0WA 1CJKA 3KK3B 1HQUB 1NLKL 3ITHB 4A47A 2YY3A 2QA1A 4J9QA 5JUMA 2C2NA 2BKOA 2RIJA 1VHFA 4CH1A 1SJ3P 4JI7J 1ZPVA 2Z2LA 2GO8A 1TKTA 3PX0A 3I9ZA 3L7UA 1NCLA 2DRAA 2DNPA 2X1BA 4ZVQB 1VQ8S 3OBIA 1CULB 3BPDA 4ECRA 3TAPA 2HK3A 4GKJF 1FJGF 3BS9A 4UZCA 3KLEA 1RDRA 4L6V3 3J7YU 2OSRA 2MKJA 2OPPB 3QFWA 5HQ8A 5IM0B 1TU0B 4ZDNA 3PKYA 3OTOF 3LP2A 3MFIA 4RNNA 3PIOQ 2E5GA 1PKUA 3GMGA 4DX7A 2J6TA 3QT7A 3JB9k 4ZPAA 3JYTA 2MTLA 3JQMA 1WOOA 3GYXB 4RKUC 1FEHA 4NZ0A 3BBCA 4FXWA 5A8KB 4LFBJ 2A2DA 1UJ5A 1VHIA 3BN4A 3UI3A 3MTJA 1YJUA 1WEZA 2HK2A 2H65B 2ZE2B 3TA2A 5T14A 3FSIA 2BOAA 1KS2A 5K20B 2HVEA 4I1TA 2IRUA 4ZPTR 4PABA 3UCGA 3CMES 4YHHJ 1NZAA 2Y1RI 1RHJB 4ZVOB 4NLSA 3B4DA 2ZM6J 2OHDA 2ROGA 2VFRA 2RQCA 2D3OR 2RRNA 2VDIA 4CQ1A 3VF0B 3JQKA 4AD6A 5C2GA 1B3TA 1VQ4S 2HHVA 1WUUA 4MYUA 4CLTA 5IC4B 2YNGB 4DI6A 1Y5NB 3EXYA 4ER8A 2ATCB 2V2ZA 1Q82T 1W2BR 1PCAA 1PYSB 4LVNP 3AA9A 5F3ZA 3TZZA 4K50A 2KFNA 1C1CA 2AYMA 2MKCA 2YQ0A 3QNWB 2LEAA 5CAAA 2FHJD 2V69A 4L74A 4DN9A 3V6DA 1X9WA 4UY85 2HHSA 4JV0A 1RHRB 3O44A 2NXEA 3OR1B 2W01A 1L3UA 1HR0J 1XEZA 1UA1A 3IAM9 5J2NB 3T5HA 1N6QB 5DQHA 4C8MA 1J5OB 1SI9A 2V2KA 2XO7A 2JVOA 1Q81T 3RB6A 5EN1A 3JS9A 3M8QA 3DLEA 2I38A 1DLOA 1LW0B 4TNOA 5E33A 1FWKA 4A8KA 1IXKA 3IMQJ 2M3DA 4CLSA 4EGLA 2DNZA 1T3OA 2FJDB 3TVKA 4DG1A 3OTDA 4G1QA 5J2PA 1R8CA 3CXCR 2ALZA 5L39A 5KFRA 3B4MA 4OX9F 3L9ZA 2Z0GA 3O5TB 4M5GA 3OXFA 1J27A 4OX8A 3MPYA 3BO4A 2OFGX 4YHHF 1KLMB 4JI0J 4DL6A 2KI2A 3M9OB 1WKJA 3C6TA 1QE1B 1FRHA 2KRRA 2BANA 1S1XB 2G13A 2GA7A 3AXKA 4DL4A 1S1UA 4KFBB 4Y3CA 2HGMA 3MCSA 5D4OA 3JSYA 4AL7A 4B3MF 5IOLA 2N3LA 4KE5A 5HBMA 3CPWR 4ZVPB 1RZMA 4NMXA 2XC9A 4HYKA 3MMBA 3IWXA 1B4SA 1XJWB 3QT6A 3K2YA 4OYOA 3SBMA 1T05B 3CCUS 4W90B 3FEZA 4DQSA 5AXMA 1U1PA 4JI5J 3HHLC 1M5KC 2F40A 5A6WA 2QSFA 2VG5A 1VCTA 3I55S 1M5PC 3MR3A 2XLKA 2A6OA 1RT4B 1TP7A 1Q4RA 3KNAA 3KUEA 3MM8B 4NWBA 1IR0A 1KVIA 2HFUA 2RRAA 4RUHA 4F25A 5I3QA 4HT7A 3NS6A 4F7VA 1VQYA 1YJWS 2JL9A 3D4JA 4ZVFA 1N52B 5KG2A 1SJ4P 1NK9A 4UQGA 3BGRA 3GSDA 3GILA 4J9RA 4DL2A 4E2FB 1UETA 1X4FA 3G8QA 3VAGA 4DR3F 1U47A 2DR9A 4WFZA 3J81j 4JI2J 2ZVIA 5I3UB 4U96A 5HBMB 1H0HB 3VGTA 2IRXA 2QX0A 4DJBA 4ZJOA 2DNRA 3P96A 2DXDA 2R7VA 3GIRA 2RS8A 3TAQA 1R8HA 4KHMA 3DGPA 3D54A 5KT4A 2JEIA 1QE1A 3M6VA 2PN6A 1YBAA 4C11B 2YVSA 5DGAA 1XK8A 2IBOA 1VQ7S 2B4UA 3HSZA 1TQLA 3MCOA 1JJ4A 1FTRA 5LOQA 4NOHA 1QDUB 3OHAA 4USTA 1OPIA 3MEEB 4CH7A 3OHBA 3M1VA 4EEYA 4DR5J 4WU2A 1TL4A 4R8UA 2GMHA 1EQ0A 4RZRA 2V6AA 3KYLA 2AQ4A 3H2LA 4LQ9A 3IRWP 2DH9A 3I4PA 2MQPA 3G8SA 2HRUA 1SKWA 1LW0A 4DUZJ 2OGUA 3PRDA 2QO3A 6AT1B 2E7XA 3KKFA 4RBVA 3IAS9 5KFZA 4QWDA 4FYXB 1J5OA 2KYXA 3NP5A 3TP2A 3EMTA 1VQKS 1CQNA 3H40A 2MZJA 2NLWA 1D9AA 2ZUAA 3B6BA 3DXBA 2RUGA 1FWLA 3IS9A 3LP1A 4P75A 5B0CA 4RUAA 1YBTA 4LF6J 1CS4B 3EZUA 2WSEC 4O23A 5LSOA 3BH6B 4NXNF 3IGVA 5KFHA 4X4QA 1DTQA 4DLEA 1MN7A 2XSJA 1RT4A 4ECXA 2DGOA 3FBBA 1QTMA 2IM2A 2XNRA 5AXLA 2KHDA 3J81Y 1F2HA 1QD1A 2F8EX 1HBUB 4WBFA 3GV5B 1JLFA 4C8KA 1TAUA 1QJHA 3DLKB 3DC2A 5EWEA 3MAAB 1N33F 3QGGA 3X3UA 5A8WB 3HHLB 1H72C 2R7RA 1LFWA 2DHHA 2RSQA 3MTKA 4P74A 4UOHA 3OJSA 4LRAA 4ZCLA 5IS2A 2BQ3A 4A46A 3MCMA 2F4FA 2LP4A 4RW6A 3PR4A 4B9LA 2ZM6F 2B3TB 4MTPA 2IM3A 3W63A 1S9EA 1LWXA 2EFVA 2V8PA 1SQFA 2Y1LB 3BM7A 3EYZA 4ED0A 1UW4A 4WIQA 3FCVA 1LWFA 2MY8A 1CJTA 4Q2MA 1YJ9S 3QJJA 3QATA 1RYSA 2HNDB 4ZVSB 4YB7A 5DQIA 4CH0S 2BM1A 3CJTA 3K58A 2XZTB 1B70B 5T7LA 4ECVA 4LF8F 1XN9A 4ED5A 1N56A 3HP6A 4IO1A 1VRQC 4OI3A 3ILLA 4LT6A 1RAIB 1S5ZA 3LF0A 3PYEA 3QBCA 1IKVB 2CDQA 4QR1A 1MWZA 5ETQA 2DGWA 1FEEA 2MZRA 1NDPA 2CRLA 1CC8A 3FBCA 1GMWA 2MHEA 3LGHA 3WHIA 3DLEB 3EVOA 4EU0A 4YB5A 4J90A 1RA7A 4C0OC 2FYXA 3AQPA 3N28A 4XIUA 2BRKA 2DITA 3TA1A 1TL7A 1IBKF 3PW0A 1IBMF 2YPZA 5L46A 5HO4A 3GLJA 5F8MA 4K4ZA 3NL0A 1V9OA 4LR8A 5FJ4A 2Q3PA 1RWNB 4F4YA 2IHR1 2W2PP 1TV6A 5E3QA 1TL5A 1HHSA 3HI9A 3LA0A 1CPZA 4AFFA 3HJFA 1UAWA 3HKWA 1SXLA 4A8SA 2QL5B 4J9NA 3H2UB 4MYTA 4PQAA 1WC1A 3I4HX 5GADU 3KXDA 2GW8A 1P6TA 3KUGA 4OHZA 2V9WA 3NS7B 1N0VC 4JB8B 1RT2A 5G0RA 2JRSA 3Q0AA 1WJ9A 4DSEA 3TZXA 4G6VB 2AD9A 2FVRA 3GSIA 3LOUA 3T1YF 4ZP9A 3OJUA 4K2JA 3R7SB 1RTZA 1F0XA 1C0TB 2CJBA 2ZC3A 1AB8A 2GAGC 1RTIA 2B6AA 2RJZA 2ZE2A 2ILZA 5KFJA 1SVDA 3IA0A 4IFYB 5H9EJ 1NUEA 1WI6A 3WC0A 3ONQA 3CJ4A 3I0SA 3JTPA 3MUMP 4ERDA 1JKHB 3HSGA 2CPXA 2WVDA 1UKUA 2D3UA 3HKZD 4G1PA 4I2QA 4OZNA 3WQPA 4DZDA 3HM9A 4U95A 1XNRF 3R97A 4L72B 2VBXA 3BSCA 1HD1A 1HLWA 3QPIA 1QSSA 4DFKA 2MMYA 4M5JA 3GE9A 3OTBA 4BWMA 1GEHA 3JQJA 3EX7B 3BGFA 3EVWA 3U1LA 1F9EB 2EG1A 3BSOA 1RTJA 3GJQB 4NA1A 4P2XA 3VHQA 4QR2A 4RNMA 1YX2A 5A8RA 3NWRA 1SJFA 3ZTRA 4IFYA 3CULA 4CI0B 3M4XA 2JEFA 1UJ4A 1RTIB 1OQ3A 4O3RA 3AT1B 1LWEB 2A0FB 5CCLA 2O3DA 3JSRA 3EUNA 3AD9C 3V5RA 4ZVGA 4A4JA 1BQMB 1K73T 1WC4A 1M90T 3TVZA 2VH7A 3QAUA 1F3VA 2PFDA 4KGKA 1VMBA 3VAMA 1FRLA 1B64A 1A7GE 3M6WA 2EFNA 3SV3A 4KBIA 1MU2A 1WHXA 4KSEB 5L1KA 5A2QY 3J7A1 2NXCA 3TYTA 4CLYA 5C2CA 5F8LA 4XPCA 3OL8A 1XMBA 2V2QA 1OY9A 2YNIA 3EICA 2MLYA 4LSNA 2EEYA 1YZ6A 2N4CA 4ZPCA 4ED7A 1JLBB 2IY5B 2CQDA 3FGVA 4RNFA 1QSYA 4LF4F 4MH8A 3NCRA 3QIPA 2BQUA 3FJ2A 3CCMS 4OYXA 3DOKB 1S0MA 1REGX 1XQIA 3D1OA 4Q0BB 1Y00A 5LM7E 1MWQA 3OFGA 1QY7A 4IUFA 2QA2A 2J9EA 2Y3YA 4P71A 3PVXA 1R0AA 2N3OA 1HW8A 3BF4A 2CPDA 3ENWA 1TKDA 2DNGA 1F1BB 1NKEA 1X5OA 3C15B 3KK2A 1N34J 2F5GA 2EC2A 2GC8A 2CZ4A 4DN0A 2PI4A 4DU7A 2MQQA 1VQNS 4LRFA 1RQ0A 1X0FA 1R6VA 3Q2SC 4OJ1A 1Q0NA 1NK5A 1TFWA 1UEVA 4PG4A 1DARA 3G6XA 3A3PB 2DO0A 2VA3A 1PGZA 2HNDA 1FXDA 1CJVB 2GCFA 1N33J 2YX1A 2ZH5A 3KDOA 4NYZA 3CD7A 4PG6A 1D0EA 2F1FA 1UVIA 2V8DA 1PJ7A 1HBOA 2XTJP 1D09B 2CJ9A 3T9NA 4ZPVR 2CG4A 4JI3J 1O6XA 3W65A 4CO2A 4ZCIA 3W60A 1VJWA 1WEXA 1M5OC 1IM6A 1RT6A 2MPUA 2CAJA 1QAJA 5HATA 3MMJA 2V68A 3TX8A 4B3TJ 4N41A 1P9YA 3ADAC 1HQEA 1VQPS 2ASDA 1U1NA 1GMVA 5KFBA 1WEYA 3ILIA 4F2SA 1HI1A 2CQBA 2HZAA 4OX7A 3KOAA 2CADA 2WAQD 1FX4A 3GCXP 3R9LA 5BXIA 3Q8PB 1ZAVA 1SKSA 2X51A 3HVAA 2KTQA 2MKHA 4N47A 5D8HB 2UUCF 5HVHA 5K5MA 5H1SV 2VF3A 2QLXA 4CO0A 2XM3A 4RW9A 4K59A 4NCBA 4ZLJA 1RAHB 2EG2A 3S6EA 4YN3B 4F3MA 4PYDA 4YOEA 3K57A 2ASLA 5J2QA 1W7WA 3H8YA 3BZQA 4DFJA 2B7CB 3N4WA 4USIA 1KN6A 3KLHB 3DLBA 2J7WA 3B82A 5B7WA 1HQ2A 2J5AA 2K06A 3D5MA 5D4LA 5F3TA 2QZ8A 4I69A 4CT8A 3OUYB 3AFGA 2BANB 4U9RA 2H5JB 1BE4A 2HQDA 1CJUA 1M5SA 2YKPA 2D69A 4B9VA 1TK0A 4DZ6A 1W2IA 2HS3A 2K3KA 4KIAA 5JVGQ 4NCAA 2CVEA 4DLGA 1HI0P 2B56A 4M5IA 1X4DA 1UJ6A 2PMHA 3QSYB 3C3LA 4V1Ak 5DRKA 1APSA 4NXMF 5KFPA 4A48A 4N77A 1BC6A 2CQ3A 1YHQS 2YWWA 3VAKA 1PILA 3AD8C 3SSRA 4C11A 2R8KA 1VRUB 4FDFA 3QLHA 4C8OA 2Y8YA 1U25A 3PRBA 5LMNF 3SFUA 2FJAB 1NDCA 1SIWB 3C15A 4EO6A 3KK2B 4GO5X 2MSTA 1HWJA 3IG1A 1SUQB 1FFWB 3GWCA 4PPZA 4XAKA 2O67A 3AB4B 2VQFF 2R7SA 2JEJA 1BY9A 4OZJA 3ZZOA 2XMTA 2R7XA 2HWHA 2CQIA 2CQ4A 4OZ3A 3SCKE 1JB0C 3RAMA 3W7BA 4LF6F 1NK7A 4F4XA 1XNRJ 1NXIA 1UL3A 3M2UA 2UUTA 1U8WA 3QZ8A 2GX8A 1I94F 1HKAA 3HHEA 1JLBA 2ZH1A 4KV8A 2AHOB 1FA0A 3DHWC 3L3CA 4ILRA 4LSNB 1S59A 4I2PB 3JSMA 4LRCA 5HQMA 4DV3J 3I32A 4DR6F 4TYBA 3TZYA 3ZTSA 5I42B 4B3SF 1P27B 4PAAA 1VOMA 5AE3A 1KVJA 1F9FA 3CCLS 4ID5A 1RJJA 3KFWX 4Z37A 2QFJA 2EI5A 2EW9A 2I9SA 4URQU 2XCPA 4DCJB 3SYZA 1JJ2R 1S0NA 2B43A 1RT6B 4M63A 3SQOP 4YQWA 3TI0A 2P9CA 2ZWOA 3H90A 4X4OA 5F0WA 1R8PA 4J9OA 4RJVA 2RDDA 3IM9A 4A8YA 3TOQA 1RAOA 2EWHA 1VC0A 3FFIB 3MD1A 1RK8A 1YJTA 1U2CA 2P6SA 3BGLA 1T94A 2C3MA 3LQVA 3MEGB 4WYLA 3MUTP 4QCLA 3H20A 1RHQB 1RTJB 2GZOA 2KJWA 4ZIWA 3BDEA 1XR6A 4GKKJ 1DTTB 3F73A 2DT9A 4FPRA 4DHVA 4NXNJ 4I6WA 2MSSA 5ETPA 1Q1KA 4DV5F 4QU6A 3SQGA 1TL1A 4OMFG 3I0RB 4G1QB 1KQGB 1U0HB 2LU2A 2VJVA 4DFMA 1X4GA 2K7KA 4F8RA 1UVLA 4F36A 1D8YA 3I0SB 3POTA 2L9NA 3QWPA 1FDAA 2MGZB 1QM9A 4DR1F 1TKTB 4ZPBA 5GMEA 2HHQA 2LEBA 2G1HA 2RKIB 3M8RA 2QJ3A 1HHTP 3GG1A 1TL3B 4L76A 1QUPA 1N32F 3ICLA 2I8EA 2UXDF 2COLA 4GRSA 3WIUA 1SJ1A 2DR5A 2Q66A 3W66A 5IV4A 3QT5A 2VU5A 3QO9A 1NK0A 1JJCB 4OHXA 1RWOB 5HVFA 4A8XA 1B7YB 2MKIA 2E9RX 4R0JA 3BGUA 3MHYA 4LREA 1RE1B 1H74A 1SJRA 3W5ZA 2V8HA 3J80Y 2RQMA 2M52A 4P2SA 1T7PA 4AL5A 3JSBA 2PO4A 2C2OB 2MQOA 5DDPC 5L1LA 4LUBA 3LTOA 2GMLA 2LXFA 3HVRA 2HZCA 2HHPA 5CZXA 3PW5A 1KONA 4LBHA 4O4GA 2FHOB 1YK9A 2UVWA 2ZH2A 5B0DA 5KFXA 1EP4B 3MM6B 2XLIA 4QIVA 1XMQJ 1VRTB 1LQ9A 1LWEA 1HNIA 2VJUA 1S0VA 4WKYA 2ATLA 4FXDA 2QMUB 5E3PA 2FC8A 2ZDPA 4WP8A 4R25A 1YI2S 2XWXA 2BZ2A 2QLWA 5AXKA 1RLDA 3S01A 4WTOB 2XY5A 4FYYB 4EZ6A 3TX0A 2R7WA 4ANEA 1WOSA 1LW2A 1UMJA 5DQGA 2FLLA 3TNVA 4NLWA 3DRXA 3CCSS 5KG1A 1TFYA 2NPIA 3EM1A 2UUCJ 2HNYA 3DYAA 3FK4A 1VC5A 4X62J 2AYEA 1ZETA 2HHXA 1DY3A 2DISA 4ZP8A 3A4TA 2AJ1A 3TA0A 2BJDA 1NNDA 1XTZA 1H7WA 2IYIA 3MM9B 4JBCA 3W2VB 5GAEU 1SL1A 1VQLS 3FFIA 4OFZA 3DMJB 1MLAA 3T6JA 3PV8A 4OQJA 4DV4J 3M9NB 4IG3B 2L3MA 4H4KA 4WXWA 3WC2A 2IM0A 2ZJPQ 1I51B 3NGUA 2VFUA 1FD8A 1V3ZA 2ABYA 2CQCA 4FZVA 3QFHA 5G0RB 4DMZA 4QWAA 2F3JA 2B7BB 5KG4A 1U0SA 4DV4F 2ASYA 2M8HA 2KRBA 1J5EF 2FHKA 1DZ5A 1GTHA 4QYZK 2M4MA 1Y7PA 5CYQB 3QZ7A 4WZQA 5HP1A 4DV2F 2KU7A 3D1QA 1XIQA 3FMWA 2C3YA 3FRZA 4PR6A 2LDYA 1UVJA 3A8EA 3HHLD 5DETA 2RF2A 3GV7B 2HS0A 3NGDA 2UVUA 1SBRA 2XY6A 3TZWA 2E1PA 2VC0A 2YX4A 5FIIA 2MQLA 3Q8RB 2KM8C 1H2UX 2D7SA 4PXDA 1TKXA 3EGNA 5LMUF 4KRWA 4J7CA 2QEXS 4QIEA 1LOUA 2QL9B 1S12A 3OXGA 1AXQA 4F3QA 2ADBA 2FPHX 1FK9B 1S4FA 2GVDA 1KFSA 1ZAWA 3G9CA 3H98A 1FDNA 4R8UB 2HBYB 5HVGA 1U0HA 5LXYA 4X4PA 2CJYB 2J9CA 5H9EK 2CJQA 2HW3A 2VODA 5LSLA 5F9LA 5T7LB 4B9NA 4OI4A 1RWPB 2B5JA 2Z4PA 1VYAA 4LRBA 4TLQA 2CPJA 2W9CB 1MROB 2ZEJA 2Z8QA 1BQXA 3M8WA 4UOGA 4JV5J 5K8NA 3PACA 3DOMA 4XO0A 2HVIA 1GFWB 1RT7A 2SXLA 3NCPA 2UXCJ 4KH0B 3J80U 2XHCA 4DBQA 3CCVS 2BVZA 1VC6A 1T03A 3HF5A 3R5DA 3DGPB 1T9VA 3F44A 2VZ9A 3VQTA 3UDCA 4DDFA 3GV8B 2ZH9A 2P2CB 4IQMA 4K7QA 2I6WA 2G0JA 3U1MA 3VQSA 1WC3A 4NPOA 3DRRB 3O2IA 3NKYA 2AEJA 2RDIA 1WHYA 3T41A 2IRYA 2QGFB 3K5MA 1HBNA 3CC2S 3PHEA 5JVHQ 2XLJA 3BYRA 2CKWA 4IH5A 4NCGA 4MKBA 4B9SA 4E8UA 1HNZF 4OX9J 3TVYA 2EK6A 2ZOMA 2FUG9 4JI1F 1U6ZA 3MM8A 3IRXA 3R5CA 5CYJA 2M9KA 5IT9Y 3MXHP 3DFEA 2NXUA 2HVHA 3FBFA 3R5BA 5AT1B 2IYGA 5AJ3F 4DFPA 3M05A 7AT1B 1X5TA 5CCMA 4MFBA 4QW8A 5LSRA 1NJYA 4ZIVA 2QLFB 4TYAA 1S7HA 2GIFA 3IS9B 3CCWA 3QGIA 4C8NA 2V4QA 4AQYF 3BO3A 1Q8BA 3FCWA 3TUJC 4B3MJ 1WF0A 2W2MP 3MEDA 4Y2AA 1OSCA 3CWJA 3MURP 1RCOB 3TARA 2PEBA 1FVSA 5KAKA 4MIAA 1YSJA 4DR4F 2AGPA 1NU4A 2YKMB 3L4BC 1K47A 2V34A 1PJ6A 2HZVA 4BDPA 3A8IA 2DNNA 2WVCA 3LH2S 3TWZA 1I6JA 4N8OA 3CDEA 2G2YA 4PZVA 3W8PA 4EWTA 1HNXJ 1E6YB 3MOJB 4JUZA 1YJ7A 3UVJB 2CDRB 1IKYA 2APOA 1VQOS 3ISNC 1XERA 3M8PA 2NPFA 1TK8A 4P7VA 1U2FA 4H4MB 3I56S 1VLYA 2FVSA 3PM9A 2W25A 1UVKA 2HNZB 3UVJA 3RTVA 1S1TA 5EGYA 1E6VB 2VOOA 1DQAA 2FZGB 4LSLA 5KT3A 1WKKA 4ECZA 1AROP 3QRRA 1EETB 2IC3B 1UW9A 1FTCA 2BUNA 4OYMA 1Y5LB 4DS5A 3TJ8A 2WB4A 2BBEA 3K5NA 4A8QA 2OPRB 3CJ2A 1U1MA 3SCIE 2BJ3A 3W62A 5A0YB 4IG0A 5AE1A 4O44B 3SMZA 3DOKA 5J2NA 3QRQA 2F4VJ 2HKEA 1SV5B 1QAIA 1S10A 2D9PA 1K1SA 3PDNA 1U1LA 4F67A 4USJC 4GKJJ 1KWMA 2OIHA 5C7PA 3I9V9 1Q8LA 5FLXU 1RTDA 2YNIB 1PAUB 1RWXB 2YWKA 3MFHA 4J5OA 4CLZA 1X0PA 4K4XA 1VIOA 3LW5C 3NGTA 1YVFA 2ZBQA 4X4TA 1S77D 1KP6A 4EK2A 2H54B 5ETNA 3PYGA 3NXZA 4TU8A 2HWIA 4RW4B 2K3IA 3G2XA 4EBCA 1PC4A 4DL5A 2ZZMA 3M6UA 4CZCA 3RB3A 1ZTWA 3A3NB 4LFBF 1S6QA 3HFVA 2CJXB 3KLGA 4DF4A 3N6NA 4EUVA 2KHCA 5IXUA 4DPXA 7FDRA 2R4FA 1FRXA 2OD6A 3HX9A 4Q7AA 5KFYA 4EFAC 3K59A 4ZLPA 4F50A 1FHTA 2ZJRQ 2R8GA 1RTHB 5G4DA 3D0GE 3D1HA 1RHMB 3RRKA 1NSKL 1GX5A 2LMIA 2X3GA 3EE3A 3D6FB 1WOPA 3ENVA 2GHWA 3R27A 5KG3A 5SZTA 4USUA 4RNOA 2G1DA 1WG1A 2AT1B 3GR1A 3OVAA 3CMQA 2X3DA 1NM2A 1IKWA 1R6YA 4ZP6A 3H25A 1IJEB 5KFQA 5L9XA 4ED6A 3AJDA 3PCOB 4ETXA 2R8JA 1DURA 1ZOTA 1PJ5A 2K1RB 5T41A 1VRTA 4USMA 5LT5A 2OEMA 1FXLA 1HQUA 3ITHA 2C3OA 1JQGA 2XSFA 2XS7A 4CWBA 1S6OA 4NLRA 1NB7A 4DF8A 1ZM3A 4X4NA 2GVZB 4ZCKA 1T3NA 3EWGA 4ES2A 3UR0A 4Q5VA 2W2OP 1WHWA 4ZLNA 2C2RA 2HFSA 5MAOA 4DCOB 5IQ6A 2OPSB 3RZAA 5KFIA 4KPYA 3C6UA 4IH6A 3RAQA 3CEDA 2OMOA 4K8RA 4MK9A 3TAMB 4WCEQ 5ETRA 4CNYA 3J7AN 1CBKA 2LXIA 4OHVA 1X4HA 2ZOFA 3IFEA 4ILLA 3GB0A 3R3TA 1T9XA 3EJMA 3MM5B 3NOCA 1KTQA 4I68A 4TLRA 3M6XA 2CIMA 3EZOA 2Y0SD 4WE1A 2X1GA 1FRJA 5GVQA 4ELUA 3K5PA 3UN5A 2XWYA 1QUVA 1MNEA 3CGIA 3GQCA 4IG3A 4A8FA 1NRKA 2LFVA 4ZVHA 3UO0A 4BCAA 2Y9HA 3DMJA 1OIAA 3JXOA 1S9GA 4P7TA 1KBRA 3MM9A 2VPWB 4DV1J 1N32J 5IT0A 2GFFA 3B8HA 1S1VA 3KLIA 1RSCA 2ROPA 5C42A 4UTGA 1HNWF 3QJLA 1VBZA 3MUVP 1RAJA 2KKHA 3U02A 2BA9A 1HA1A 1PO6A 2QMWA 2VB6A 3SIPB 4CYUB 1MMLA 1UZDA 1H38A 1S76D 3ZZTA 4FBUA 2NYIA 4V19X 4I2QB 3UDVA 1WF2A 4ZOSA 3IO1A 3DCAA 2Y1JA 4WP9A 5F8GA 1UTAA 5JJBA 3RB0A 4E0DA 3MAHA 3OLBA 1TUGB 4QR0A 2LU1A 2WSFC 2JFDA 4IQXA 2XB2D 1AW0A 4QYZJ 2DH7A 3CDWA 1SH2A 3MM6A 2KZMA 1H6KX 4ID8A 1J5EJ 3HHLA 2OTLS 4O0IA 2KZZA 2HIYA 2R3VA 1D8ZA 3H4DA 2JVRA 1IBKJ 3NBPA 4B3SJ 1M5HA 3VR1A 4DV7J 2DO4A 4WKRA 1U1RA 2R7TA 4I67A 3R5AA 2MZQA 1WTFA 2NS1B 3M2RB 3C19A 2MHNA 4I56A 4NX9A 1IBLF 1D1UA 3H0PA 1R7IA 2KJVA 4OI0A 2KXNB 4GMKA 2E9ZA 2AGOA 2WOMA 5KOWA 2V9KA 4KV8B 1WKLA 3J7Z5 2R2UA 2FZCB 3W61A 4ECSA 2YWFA 1V5VA 4W4MA 4FF4A 3AOCA 3EGZA 3WZ0A 1KOOA 2H1YA 4CLUA 3ENAA 2BW2A 5A0YA 2YNHB 2HMIB 2VPZB 4H4KC 3KG4A 4OYWA 4DUZF 1K9MT 1HHQA 4RX6A 2DNOA 5L38A 2LLZA 5L1IA 1KNZA 3FVYA 4XDDA 1IR1A 3BR9A 5KT2A 3T5LA 4NYPA 4G3IA 1FVQA 2Z2ZA 4OLPA 3I5CA 2H4WB 3OD2A 3DXSX 1Q16B 4I7FA 1NPPA 4LSLB 1VRUA 3UQSA 5KFWA 2KG1A 3M1VB 4HH0A 4U7UK 3BSNA 3CD6S 5BYQA 3IP0A 2C28A 1R8BA 4FVCA 3NCQA 4YEAA 1N5YA 2ZZTA 3N5FA 4YDXA 3M8PB 4CT9A 3DNCA 1RT1B 5K14B 2UXCF 1RTHA 3I87A 2WTFA 3RBDA 1NJXA 4KGMA 4PYAA 2C2ZB 4FS1A 1C4CA 4EBEA 3FQLA 4D3HA 4IR1A 2DJWA 4UUWA 2ZH7A 4A8MP 4O3QA 2FVQA 2CNNB 2DNHA 1PBUA 2XYPB 3ZFVA 2XY7A 5E2QA 4RW6B 3THVA 5EHHA 2G0CA 2NZCA 1LXNA 3OXLA 5I3UA 1RGVA 1H98A 3EZ5A 1F6TA 1SQGA 4YB6A 4DUTA 2CYYA 5THWA 2RHSB 3DLKA 4Q44A 1RT3B 2W7OA 4AT1B 4JI8J 4K5SA 1HBUA 3QYYA 1WACA 1FRIA 3T5JA 5DG7A 1UVMA 4IOBA 3PY8A 4FKXA 1Y11A 3DDIA 3TJ9A 4IFVA 1S7IA 1ZM9A 5KG0A 4NE9C 3V6KA 2XSJB 3ZXWA 1RTDB 2MZ1A 2XMVA 4M8LA 3KJNB 4HH1A 3TW0A 4NLQA 3T3FA 1TMMA 2W7PA 2ZKTA 1KQKA 1HQEB 1Q78A 1JXVA 3A3OB 4URSA 4O3SA 1URNA 1YWXA 2DTJA 4HEA9 4PUOB 3TEHB 5J1EB 1Q95G 5CD4A 4F26A 1GH8A 3GIIA 4B3TF 1HBMB 1UWBB 1N5TA 2DHAA 2F9DA 3QAEA 4ICLB 3ZZPA 5HROB 1JLGB 5CYMA 2R2TA 2Y8WA 4K0KF 3UN3A 2KM8B 5D0RA 2IC3A 2V0NA 2Y0BB 2WBRA 1N5SA 3CDUA 3HO1A 3Q8QB 2NR0A 2CPHA 2OTJS 1K0TA 1N8RT 4K4TA 2XI3A 2DR6A 5DLFA 3VALA 1T9TA 2YQ1A 2DGQA 2AYGA 3VVUA 2HVDA 2UUBF 4FP9A 4AUKA 3SFGA 3CIZA 2MYFA 4P52A 2C1EB 2BEFA 2FLOA 1VBXA 4DV0F 2AX0A 2HSEB 3Q8SB 1ZZFA 1X7VA 4HL9A 1FJCA 3RW6A 1E6YA 4DG1B 4ZPWR 2C3PA 4ZA1A 4NI2A 2AYBA 3KHHA 1TZ0A 3ILJA 2KXHA 1JLAB 4N7TA 1DLOB 2PA8D 2E1AA 1YJRA 4M95A 4QWBA 1EHWA 3OW2R 1ZBTA 2E1MC 1NK4A 3U27A 3V4MA 4BHQA 3FDSA 3U1NA 5EWGA 2MEWA 3T6BA 3OTOJ 2BACA 3DLJA 5KFOA 1OMSA 1OPZA 2DGTA 2M7SA 3Q86A 1FCAA 4NLUA 5B0GA 5GAGU 4YP3A 4X2BA 1B7FA 4KR0B 5L8RC 3LP0B 4MKYA 3O6QA 2F65A 2VPXB 3P6YC 1TVRB 4O3PA 4J9SA 1LKZA 4J37A 4ZS6A 3B54A 4IFVB 2ZBPA 3R2DJ 4JYAJ 1GQEA 4RW7A 8RUCA 1U02A 3LO3A 5KOXA 2ZVSA 2L9WA 2ALYB 4MJKA 3W9IA 5KT5A 3NBPB 5KFCA 4ELVA 4R0EA 5E41A 2OELA 2DKOB 5GMDA 1M1KT 1X9MA 4ES1A 1HNZJ 3HSJA 3UDEA 4FYDA 2L48A 4UUXA 3MR5A 3HD2A 5DDRC 5FDLB 4Z7YA 1NJIT 2N82B 4RBTA 4K5RA 1VDHA 1X31C 2YWHA 1F5CA 4C0BA 2V4JA 1B0TA 4JI0F 1T03B 4FS2A 1XNQF 1S57A 3BV8A 3KG1A 2EKYA 2VFTA 2IVFB 3VVTA 3NS5A 2BKNA 5KFNA 2W8KA 3DOMB 3VAJA 4ZK7M 3CC4S 1HPZB 1RT1A 3GTYX 3PHTA 5K14A 1MROA 1P1LA 2AMCB 5SUHA 3CD0A 1LV5A 3ZTOA 1RAGB 2IJRA 4FXVA 5ETKA 1RAEB 2XZWA 3NAHA 1DQ8A 2DH8A 2IJNA 2JC0A 1V3RA 3F41A 2X1AA 3HVTB 1UVNA 2JLFA 4HTJA 1YLXA 3H5UA 1RB0A 1FKOB 2C2DA 1X4BA 5KFEA 4UOCA 1AZSA 2J8AA 5L1JA 2XI2A 2CPYA 1S9GB 3BBFA 4CO3A 4GC7A 2IMOA 2Z30B 1A0OB 2ZOGA 4NLPA 2VOPA 2A6MA 2CPIA 2XMWA 3KLFA 3KK3A 2W8LA 2VQFJ 5EWFA 1AYEA 2FJWA 3PZPA 4DR2F 4EZ9A 4GKKF 4X64F 5D0EA 4LF9F 1G3OA 2JH3A 2VBZA 4ATNA 3BBBA 1IWAA 1X5SA 2CA9A 2CUYA 4P2FA 3PW2A 1RKJA 3V6JA 4X65J 4LF5F 3CO0P 3N5BA 5C24A 2AZ1A 2LQJA 2IJFA 4DXLA 5HLFB 4PG5A 1DRZA 1VS3A 2DCLA 3W9JA 3C14B 5EX3A 3K17A 4HDHA 4EO8A 5B0EA 2BE2B 4RUCA 4O3OA 4Q8EA 2MKYA 5ITHA 4K4SA 1GXUA 4RR5A 4TY8A 2FB0A 1IUJA 3GYNA 1SC1B 1G4CA 5KFAA 2F8HA 4KKOA 4TN2A 4AXJA 3LWMA 3HMJG 3PJ9A 5EX0A 3DI6A 4CNZA 2FJEB 2ZH3A 1AZSB 1IKVA 3JYTB 1G1XA 5KFKA 3M2VB 3I0RA 3GCWP 3Q8VA 2RU3A 5HMZA 1KLNA 3ZO7A 3UE2A 1RADB 1D9FA 2HAIA 4J9UE 1N0UA 4DUYJ 3CSKA 3OT9A 3TJAA 5J2PB 3SZ2A 2V5HG 2ZUGA 2XS2A 2QN6B 3A8JA 1S1VB 3IR6B 3KLIB 4DPUA 4YR2A 3ZC4A 2QA4S 1NO8A 1C4AA 4TU7A 4OZ0A 3J7YI 1KDNA 4LFCF 2AJQA 2WB1D 4KQZA 4U8VA 3GIMA 3HJVA 3MOZA 3H7HB 1DFDA 1T11A 3AQOA 3R8YA 1FF2A 1VK3A 2HQGA 2OAUA 4LFAJ 3LGNA 4BC7A 1RHUB 4QIWD 5IFMA 3VAFA 4EYHB 2HHUA 5D3GB 4JI4J 4O4RA 3GIKA 3HHKA 1IBCB 5A8WA 5B09A 4M5HA 1NEEA 3C14A 4D3GA 1BLUA 3ULHA 1WC6A 5CHCB 1KHWA 4RW7B 5DJBA 3WX4A 2B9YA 3KHRA 3CCQS 2DRDA 1JXLA 1XWLA 4QOTA 3NNHA 2JOQA 5DM6Q 4I2PA 5DZ6A 3JSMB 3V6HA 4DR7F 3GR0A 3D9BA 1QAXA 2I5JA 4H54A 2DNMA 5LXRA 3HSDA 4CLPA 2J76E 3M2UB 1FE0A 3LP1B 1OY6A 1V5IB 1KVKA 1SKUB 3ETMA 3L09A 1Y10A 3FBEA 4ED3A 3PTWA 4IOAQ 1Y9OA 4C7QA 2AJFE 4C0HA 2LDIA 3MR6A 2WSCC 3RW7A 1T0TV 2E5IA 2RD5C 3ILOA 2VICA 1KC8T 2DVIA 2VDHA 3ENQA 1P8GA 4LF8J 1ICEB 1YRXA 1FFSB 1FJGJ 2E7WA 2KFYA 2ZH8A 1ZTTA 3R5JB 5DGBA 1IKXB 1BQNA 2EBGA 3M8SA 4JV1A 1UCNA 1WC0A 3BQ0A 3MEEA 2LVWA 1WG5A 3HVTA 4CLWA 1RYRA 3R2CJ 4H4OB 4CM2A 1N48A 2EK1A 1ITPA 4Q45A 4OLOA 4ZVEA 2YKQA 2DEIA 2AP6A 2BJEA 2KT3A 1LNQA 3AODA 1HNVB 3D3BJ 3MM7A 2CNOB 5D4PA 1NJZA 4IH7A 4WF9Q 1WC5A 4YR0A 1DHMA 3L7PA 4ZN1A 1S9EB 2B51A 2LQ5A 4NA2A 4OYAA 4K2XA 4B08A 2W9BB 3M9MB 2RVJA 2B4PA 5HLFA 1SB6A 1J2VA 2HBQB 4Y2IA 2UXDJ 5J2QB 2U2FA 5J1EA 1U26A 3MEDB 3RBZA 2A1BA 4YY3F 4IR9A 3Q2TC 2DHGA 3QRPA 3CUNA 3LAKA 3SI8A 2R42A 3CDBA 2A10A 4FVMA 4NYOA 2CFXA 2WONB 6FD1A 4HR2A 1UA0A 1L5UA 1VQ6S 4ITSA 2PIIA 4LR9A 1TVRA 1DTQB 4Z7CA 4J9LA 3DOLA 1R89A 2L08A 2HQCA 1X9SA 5BR8J 1REVA 2CWKA 1H2TZ 2LCWA 4WFBQ 5IT4A 3DN9A 1S48A 1X60A 2C2MB 2DGSA 3DLGA 4HACA 1L3TA 4IG0B 3M32B 4JI6F 5HJYA 5KG5A 3KJVB 4DV7F 5BR8F 2JLEA 2DBBA 3G4SS 3K0JA 4PWWA 1FFGB 2GV1A 3FKBA 1XR5A 5C25A 2NREA 2XMMA 3CCTA 1NJWA 2C2KB 3MPVA 1ZA1B 2L9DA 2VKRA 5IC6B 1EQMA 5CABA 4PWDB 4HI1A 4P6QA 1YG0A 3CTRA 3MZIA 1S1TB 2BE7D 2AWZA 4GC6A 1SKRA 2CG8A 2UUBJ 4IRDA 3M8ZA 6FDRA 3QGHA 1AT1B 4H4MA 5E0OA 1GTEA 3TANA 3PX4A 4OZ5A 3P8BB 3FQKA 4OHWA 2IDEA 2Q79A 4E98A 4K4YA 1X4EA 3RYLA 3OSNA 3RRGA 3HK2A 2ZD1B 3A13A 4DV3F 4WIIA 1S79A 4HI2A 4OV1A 1S9FA 1HYSB 2FY8A 3TO8A 2OLWA 3M8QB 5HI7A 1U6BA 4ICLA 5HROA 3BJYA 1HI8A 3O3LA 4CLFA 4ED2A 4IRCA 2O1PA 3ZTQA 4LIRA 1Q7YT 2EBEA 4JI5F 1Q5VA 3OR1A 3PO5A 2LA6A 1SJQA 1WSVA 2ILYA 3DGVA 3V6DB 2HHHF 1YDLA 2R7UA 2VASA 2OMLA 3QWUA 3RBXA 4QYRA 5M2PA 1RABB 2UV8A 1OY8A 3PNIA 4ELTA 1U2RA 3K89A 3OL9A 2DNYA 2O01C 2XHWA 3CIMA 1O0PA 2OFHX 4ZJLA 3W64A 2FJXA 3ZZYA 2FDNA 1RCXB 3WBZA 4JI1J 3MI7X 2VG5B 2LQBA 2GIQA 4KY3A 1Q8KA 4YMEA 4LVOP 4DPYA 1IN0A 4ECTA 4QIGA 1ULRA 1RISA 3PJWA 2CJAA 1ACMB 5H9FJ 3CNQP 1X8DA 2BRLA 4Y34A 2QLBB 4OHYA 4QBUA 3NWGA 5MLCV 2E44A 4DQRA 1HMVA 3HZGA 5K8MA 1RT5A 2UU9F 1HL6A 1U49A 2D74B 1YTYA 2BR0A 4DR4J 3J81U 2CQ1A 2P9GA 1NHUA 5DO2A 2FHMA 1F9HA 3IC1A 1NDKA 2VG6A 3T1HJ 2EC0A 1H7XA 2FVPA 4WK1A 3K7RA 4ZVTB 5HL7Q 3RUBL 2B5JB 3D2WA 3CMAS 3RBEA 4Q43A 1N5QA 2CZ9A 1M1GA 4JYAF 5DZ7A 4X4VA 4PPDA 3E01B 2WW8A 3AA8A 3FCHA 2B8PA 2ROEA 1S4EA 2GAHC 4XK8C 1JMTA 2PDAA 4YS2A 5KTQA 2VQEJ 3H4BA 4B3RF 3PIPQ 1YBUA 2BV3A 1H3DA 3GZ7A 4U67Q 2GJ2A 4DX5A 1N6QA 5I3PA 3EDRB 1RT2B 2R9LA 2GS8A 2VC1A 4F2RA 1QVFR 3OR2B 1RKIA 2Q6BA 3C8YA 1NK8A 1C1CB 1XNQJ 2IM1A 3GG0A 3DDNA 3Q83A 4ZP7A 5EUHA 4USKA 3GPAA 4X65F 3PW4A 4LSZB 4DL3A 4LF5J 1Q5YA 3UR3C 5KFLA 2RT3A 3PYDA 3M2RA 5HQLA 3BQ2A 2DY9A 3VGSA 1BHNA 1M1HA 2BMBA 4X4UA 2OP5A 5CYQA 1FI4A 5D77A 2WK4A 2J7UA 2MQ8A 1VJQA 4MIBA 4MK8A 1ZM2A 3J7ZT 4ECWA 5F9NA 1U1KA 3U7JA 1BQMA 1QVGR 5D3GA 1GNKA 1BWVA 2HS4A 5M2UA 5CQGA 2OI2A 5KT6A 2RKIA 2RU9A 1NBEB 2W4CA 5JMNA 1NHVA 3E3XA 3MCNA 5DM7Q 4N56A 4B9TA 1S1WB 4DX6A 1HWKA 1RUSA 2B4VA 2ZC4A 2RILA 1I3OB 2EPIA 1HWIA 2CPZA 1V3SA 1RU1A 2IPOB 2LXUA 3SDEB 3GONA 4N76A 2M5YA 2J6UA 4X64J 1NAQA 3SV4A 4B3RJ 4B3OA 1SH0A 2JNJA 4IDKB 2HYIB 1NPKA 2OEJA 3H42A 3MPUB 4NLVA 3LP2B 3IBWA 1FDBA 4PXEA 2ZBCA 4WFAQ 2J0QD 4OYZA 4ZHRA 2KFZA 3NNAA 1DTTA 2QRRA 3MD3A 2I1RA 1W25A 3M30A 4OL8A 1CJTB 2O66A 2EKNA 4DPWA 4UY8T 2VONA 1Q86T 2UUAJ 1VFJA 3W1YC 2IAJA 2QFIA 3R7BB 2U1AA 3G6ES 4HDGA 1A6LA 2ZDOA 2BM0A 2PMWA 4LRDA 4TY8B 4KHPF 4FNIA 1NH7A 4KGZB 3MR7A 3W5XA 4CO1A 2BE2A 4ZVUB 2B4OA 2LKZA 4KGXB 4ENOA 4ID5B 5J2MB 2V4RA 1ZPWX 2J0SD 2P9EA 1WELA 4N5SA 3BQ1A 3CCJS 2ZZNA 4KHPJ 5I42A 1FKAF 2KYZA 3PFEA 4R5PA 3C6UB 2DPJA 2FGOA 2XEXA 3NRBA 4B02A 1S6UA 1S99A 5D0GA 2M70A 3OFEA 5HK4A 1JLQB 4LQ3A 3QO9B 5B0AA 1EX8A 2BKPA 2Z58B 3HPOA 3OR2A 4ETZA 3RR8A 3DU6A 1VLOA 3R1HA 5ETTA 4LF9J 4UOFA 5D0HA 1RWVB 1PBAA 5F8IA 2LQ8A 4MKVA 3VZHA 3UW1A 1HD0A 1Q8IA 3ELHA 4PG7A 3TEGA 5C5JA 2HQIA 3HULA 1I94J 1SUQA 5F41A 1KKHA 1WG4A 1U7LA 1Z2ZA 1PYTA 2F63A 3GJRB 3JAMU 2VV5A 3POTB 4NLXA 2MGZA 1JLEB 1FRKA 1JNZB 2PT0A 2W2QP 3NGSA 1U09A 3QLHB 4KC5A 3CJKB 1S6PA 5M2RA 1NZ8A 3WDOA 4C3LA 2P5VA 4P9SA 2KVQE 1VBYA 1TL1B 1FNMA 3MMCA 3US5A 3HLUA 4WJBA 5KFDA 2DGXA 1VBKA 2XMUA 3IXQA 2ZFHA 3S7RA 4OYPA 4W98A 2VG6B 3TQ1A 1S49A 2D3O1 4ANDA 4DR7J 2HHTA 3QT8A 4C8YA 4J9KA 3OTCA 4F0MA 2C2EA 1LWFB 2H5EA 2JJ4D 3EDQB 3FRYA 3DRSB 1XMQF 2PFFB 2V4JB 1Z2LA 2IBKA 2HHWA 1HYSA 3MWBA 2C22A 1RT5B 2YKMA 1U45A 4GVBA 1CVJA 5H9FK 1HMVB 2AEFA 2GQ2A 3Q22A 4KJIA 3P5TL 4OI6A 3LUYA 4I6YA 4AQYJ 3CC7S 1H2VZ 2AU0A 3BYPA 2VG7A 4N8NA 2JSXA 3IGNA 2XS5A 3AOAA 1C0UB 2LQ9A 4P72A 5HSPA 1MWYA 4J9PA 1YJNS 4JOUA 4O3NA 4DSLA 3RR7A 1JLFB 4PRFA 3I5AA 3T9ZA 4KTQA 3DOLB 3CCES 1WHVA 4CP5A 2NCKL 4LMZA 1JJHA 1OJ4A 2GHPA 5KFTA 4DL7A 3KMQA 1UZHA 2YWGA 4LF4J 1IBMJ 4Y65A 2JHEA 4FNHA 2F7VA 2G2ZA 2DNLA 1CS4A 2XMKA 1RT3A 3A1YG 1L3SA 4LR7A 2VQEF 2CQHA 4DV6F 3BGOP 5D15A 1TKZA 4IO9Q 1ZYQA 3MMBB 2VG7B 4ALZA 1T05A 1YGYA 2M8DB 4C8ZA 2CQGA 2HURA 3IBCB 2PEHA 2X1FA 2P8IA 3RAXA 5CXTA 2VKZG 1DQ9A 3P4UB 2E9TA 3I82A 4CO4A 1OO0B 3NAIA 1BXNA 2RMLA 1B0PA 2CZVC 2ZD1A 3CJ5A 2RRBA 4P73A 4DR5F 3RJMB 3DRSA 2JC1A 2ADCA 3DLLQ 2MDAA 3AJ2A 3MM7B 2VL1A 4DR1J 1RI7A 1NKBA 4CLKA 3MECB 1R27B 2H5IB 3C66A 1WDTA 4JP8A 1X5PA 3AB2B 1ZZNA 4C97A 2LEPA 1N5YB 4V19J 4H4OA 4OJ3A 5A76A 3BREA 1FDDA 3MECA 1M0SA 2UUWA 3D28A 5ETMA 1CSJA 3PO4A 3MGJA 1BQNB 5CH7B 1P9QC 2GVDB 3VZIA 3JTOA 3RG6A 5CYMB 1R0AB 2FGCA 5ETVA 5C25B 2H48B 3KLHA 2BJ9A 3K8WA 1R0BG 4ILMA 4LF1A 3SEOA 2VBWA 3SXLA 2PGCA 2RHQB 3OL7A 4ECUA 2HHHJ 2YTCA 4HT5A 1WI8A 1WSRA 1ZS6A 1RXOB 2H9ZA 3HCXA 5DS7A 5HANA 3HZEA 4RO0A 3UDLA 2V8VA 2VA2A 2I5JB 5DDQC 1N54B 2O5DA 2Z2MA 4UT4A 2E7VA 2HIQA 2RF2B 1OWXA 4IRKA 1HNWJ 1DBDA 1B0VA 4LF7J 5GADI 3D68A 5ADZA 3H5XA 1AFJA 3AD7C 1PYOB 4TXSA 4QWCA 4M5DB 2FC9A 2WVBA 1RHKB 2BE9B 4S0MA 2KXFA 3VGUA 2DK2A 1BUXA 4CTAA 2XO6A 4DSIA 2YH1A 2W4PA 2W1BA 2OJ3A 2J9DA 4OYIA 2XGPA 1JIHA 1BD6A 4NL5A 3BO2A 2KO1A 1YQHA 1RWKB 1IR2A 4KO0A 2A3JA 2RQ4A 4KYZA 4DSJA 3HHNB 3DRPA 3G86A 2Q43A 4JV5F 3ZZ0A 4YR3A 1SC3B 1TUWA 5B0BA 1RA6A 3G87A 5A8RB 3MMAB 5L9NA 3NMRA 3C6TB 4DOZA 2K8GA 2MJNA 1KLMA 1GT8A 4ZPDA 3VAHA 2BW7A 4F3OA 2W4DA 2PD1A 4ZHRB 4DSFA 2B8QA 1N36J 1SC6A 2PSZA 5BJRA 5J1PA 3QJPA 4KAIA 1SC4B 2W2NP 3AY0A 1LFPA 1XBWA 2RUSA 3HT0A 3W2WA 1IJFB 2FJBB 5DDOC 4PQUB 4WP3A 5K8PA 5LMUJ 1RBLA 4OJHA 3KTQA 1U4BA 3OVSA 3PR5B 1N36F 2FY1A 1H73A 3QQCD 1FK9A 1C1BB 2EVZA 2XULA 3FEXB 4KKOB 2E5LJ 3HFZB 4L73A 4M5KA 1C0TA 3AJ1A 3NEKA 2CJKA 4BS2A 1YIJS 5AJ3J 5JXSA 2VUGA 2GIRA 2CVIA 2DIVA 2V50A 2WVFA 2X7IA 3E8OA 3QIPB 4O4GB 3LPEA 2UU9J 4JI7F 3HVWA 2E5JA 4MIWA 4HHUA 3WX8A 2M2BA 3TUPA 4CCHA 3H5YA 1URRA 8AT1B 2QV6A 4R5PB 3R5GA 3O8WA 2WBMA 3A8KA 4HVZA 1KR4A 1Y4ZB 5HP1B 4Y28C 4FF1A 3WIVA 3RU0A 1MU2B 2D41A 1PSDA 3EGVA 4M5LA 3HXMA 2EFQA 4QIFA 4X4SA 1NB2A 1TUVA 2WVEA 4CIOA 4F02A 2DY1A 3IN5A 2OO4A 4NMLA 1Y5IB 3UN2A 2FHJA 1RLCL 1MG7A 2HQFA 5KG7A 2AIRB 3ZZZA 2HFNA 2HFZA 2YXLA 1JXEA 3CCZA 2NYHA 3QGPA 2QSWA 3L95X 1GXLA 3HD1A 4OV6A 4QJVA 2OPQA 4M5NA 3I96A 3W2VA 4YDDB 1K0VA 2D3ZA 2H51B 2JWNA 4QPXA 4QWEA 1LEOA 2Q6CA 1FKOA 4RLEA 3UCZP 4K4UA 1SQEA 4OZLA 3BKTA 3SQGB 4RBUA 3LALA 4NLOA 2HNYB 3DYAB 2RDJA 2CNKB 2RQKA 3CJ8A 1CQMA 1EKSA 2OPPA 4IDKA 1YKWA 4CO5A 1KEKA 2YPYA 4RUBA 2NSBA 1T02A 3KLEB 2XYGB 1EIYB 2R2RA 1IBLJ 2B9XA 5BYRA 1GMWD 1T9UA 1WNEA 1I1GA 3EVMA 3GJSB 2AKWB 2CQPA 3CJSA 2OPQB 2MJUA 4RPFA 4TKTA 2FLPA 4Y0FA 3T1HF 2B6AB 4KT0C 3LGMA 3ZNJ1 4F4WA 2WZ1A 1HNXF 4UW2A 3KJFB 4KO0B 1EP4A 4C48A 4J9VA 2YWEA 1CJKB 4RW4A 2QC3A 3CT9A 4K0KJ 3MM5A 4Z2XA 4KHRA 1UPPA 4CRJA 2E1CA 1PG5B 5GMKa 3KJQB 3OPKA 1Y3KA 4IKAA 3CE8A 2DHSA 1NSPA 2UV8G 3VWSA 2ZWPA 3UNGC 3P49B 4YFUA 4ZN3A 1PIEA 4WPAA 4M94A 1TTHB 5BYSA 2DD8S 2XG8A 2GVZA 3C16A 3JAMY 4JI2F 4ED4A 2ZNYA 1SV5A 1UFLA 4MMOA 3H2VE 2IA0A 2RS2A 1RBOB 1TL7B 4Y2KA 1TL3A 2ZBIA 3P45B 2DR7A 2YH0A 4EMDA 9RUBA 1AUSL 1SH3A 5KFFA 3BR8A 3CB4A 3TRGA 4DQQA 2B9WA 5B0FA 3UD4P 8ATCB 3IR5B 1F2GA 1K1QA 2WCXA 5ETOA 1RACB 3G96A 3I5BA 2Z2YB 3V81A 3S1TA 4IOCQ 2HVZA 2QT7A 4PQUA 2HNZA 1HWUA 4M5MA 5ETLA 1R43A 4C4WA 2XNQA 3GU0A 4DPOA 2DRBA 4P10A 2JX2A 1G6BA 2DIUA 2MQMA 4PXCA 5KFUA 4F0HA 3OSPA 2HRYA 1QLNA 4QZVB 4F4KA 3T5KA 3G8TA 2DYAA 2PI5A 1MN9A 4G1IA 4CYUA 2UXBF 1K44A 1S72S 3CO9A 1FERA 2D1CA 3MEGA 1BMQB 3CVKA 4NA3A 2BX6A 4OX6A 5E5NA 5ETSA 4C3MA 3EPIA 1U48A 3DRPB 1JLGA 1TELA 2LYVA 1F5BA 2HEKA 1QSLA 2H4YB 3UPFA 4DR3J 5HMYA 2UXBJ 1D3WA 2HPUA 4MT1A 2V63A 2WRMA 4CLLA 4OI2A 5F0UA 1LWCA 3TQEA 4CM0A 4X66F 3OFFA 3GIJA 3KHGA 4DR2J 4PUOA 3K8VA 3SCJE 3D6TB 2XMAA 5HMWA 1EB0A 1T9YA 1REVB 2RAQA 1NMEB 2HWTA 1G7CB 5LL6d 2WHOA 2EFOA 1TAQA 3BB5A 5E3AA 1KQSR 1UWAA 1GAOA 2H3EB 3PRVA 5F8NA 4FYWB 2N7CA 3NY0A 4GVLA 1WTBA 3KWMA 1A9NB 2MY7A 3A12A 3N6MA 4TVAB 5I4MA 3BSAA 2R2SA 2XBPA 5IT9U 5CD4H 2I2YA 4JI8F 4AE5A 1ZAXA 3M8YA 4O44A 3D6HB 5HN0A 4PXBA 1GMUA 1O8BA 2RB7A 1OYEA 3Q8YA 4NRUA 4B17A 1OS5A 3PYFA 4DL0C 4YY3J 3KK1B 4HLBA 2OPRA 4GVBB 3QMQA 1C2PA 1TR0A 4KFBA 3E51A 2QMXA 1JLAA 1HBOB 2P6TA 1EETA 1P1TA 1S1XA 2AEMA 4HTIA 2R7OA 4NI2B 5LJ5Y 1U1OA 2HAFA 3BKUA 3ISND 4FKYA 1HNVA 4LJMA 2AZ3A 4BLGA 1CJVA 1IQZA 2JDJA 4WXOA 4B3OB 4QU7A 4RU9A 1W26A 5HAOA 2C42A 2DNKA 2NXNA 1FO1A 4GO7X 4ZVRB 4I64A 2UUAF 2G4BA 3AXMA 3P3DA 4LBIA 4F0KA 2RNEA 3G71S 2NZ4A 1ZM4A 3NG8A 1ELOA 3F0NA 3FC9A 2HGLA 3IWLA 3GFZA 3B78A 3R6GB 4OYBA 5U47A 1GXTA 3SCLE 2QE5A 5CA5A 5D6GA 4FBTA 1DJ0A 2YNFA 3FSXA 1HARA 2F8MA 3OQ2A 4RWXA 5KFMA 1B99A 3KUHA 4KH1B 4U7CA 1U1QA 3W8GA 2BQRA 1T95A 2G0IA 3ISZA 2GHVC 3HFKA 3KMSA 2J9DE 3X1LB 3ZNUA 1KQFB 1HBMA 1UWBA 3S8SA 9ATCB 2FTRA 4L75A 2DGUA 1I5OB 1N5VA 2HFOA 4DR6J 3IWNC 4RNHA 1UFKA 3OFHA 2V2VA 4NLYA 4OJGA 3VV2B 3ZZRA 1BWEA 2AJ2A 2DXFA 5AXNA 1ROFA 3HT3A 4USVA 2B0GA 3C16B 1EAYC 1JLQA 4ES3A 3RB4A 1IVZA 2NSCA 4FN5A 4C8LA 1IWGA 5B08A 2ZKUA 3N79A 4DQPA 1F3FA 3KDNA 3IR7B 3IRXB 4MK7A 2WW4A 2BJ8A 1LK7A 2ZHAA 3BKFA 4J91A 3KLVA 4ZCMA 2F9JA 3D6MB 2NUHA 2W7AA 1YJVA 1C0UA 2JZ5A 5KFVA 4WFYA 3R6LB 4Y00A 2CWXA 2M88A 4USHA 2Y1IA 2R7QA 2FJVA 4Q8FA 2KT2A 2KDOA 3DRYA 4JI3F 4WZMA 3GFYA 1HBNB 5K8OA 4NLGA 3LAMA 2QA4G 3DRRA 3IM8A 1YRUA 2RH3A 1CC7A 1OQ6A 4OI1A 4ZKAA 1RBAA 3E2EA 2W9BA 4LFAF 3DKDA 4DU8A 4WTYA 2HFVA 2BJ7A 4DPTA 1U6FA 1FKPB 3PEJA 1N34F 4EBDA 1HFEL 2J0WA 3NMAA 3GFHA 3UD5A 2GO9A 2KT5A 3ET6B 3FEYB 2OD4A 2VFVA 3N9UC 5FLXY 3MAQA 3W3SA 3NGRA 3DDKA 1KOHA 2KL8A 4I6AA 1VIXA 1LW2B 4KGVB 2YBVA
chains in the Genus database with same CATH topology
5C42B 2GMJA 3AAWB 2UZAA 3CJKA 2HG4A 1KD1T 2N7YA 1WD6A 3QIDA 4B9UA 1DAXA 1L3KA 3DM2B 2NUUG 1HNIB 2J0XA 2F4VF 4OZ1A 4JV2A 2YNHA 2HMIA 2A2CA 2QYCA 4Q0BA 2IA6A 2EFPA 1VGYA 1Q7LB 2DHXA 3THTA 3N6LA 2CPEA 1VQSA 2E1RA 1N88A 7FD1A 4PWUA 2J6SA 4FF2A 3PW7A 1IQTA 2WOMB 1WF1A 2BOPA 2N4DA 2VFSA 3D0HE 3TAMA 5GAGI 1NK6A 2OPSA 2HQ3A 2ZHOA 5E7OB 3C2PA 2J7KA 5J2MA 4RU2A 3PFOA 2R8HA 3MR2A 3I31A 2QIFA 3CJ0A 3H59A 1UEUA 2E5LF 3HDSA 1MW7A 4PKDB 1HW9A 4ECYA 1FJEB 1XC9A 2UVVA 4Y6IA 5KT7A 4ED8A 2K7JA 4YUDA 1IM4A 3E01A 5CZVA 4XPEA 2AJ0A 1M5VC 5KFGA 4AYBD 3CCRS 3SSSA 1VK8A 2VBYA 1FE4A 5IM0A 1UP1A 3V4IA 1KFDA 1HPZA 1WWHA 1QAYA 3CDAA 2DCUB 3SDEA 3K5LA 1FKPA 1FXRA 2G9OA 2W9AA 3DI6B 2ZHBA 3PXGa 4ECQA 1VQ5S 2HLTA 3T1AA 2VPYB 4Y2CA 3JTNA 1S6QB 3KLGB 3LWLA 3TUZC 3TUIC 2V8GA 1NH8A 4U6PA 3EPGA 4WE1B 1F60B 1KSPA 4UQTA 3BEGB 3OVBA 4URGA 1MSWD 4CTAB 2EFGA 1AUDA 4AL6A 4M5DA 3FZBA 1JK9B 1RP5A 2JLGA 5IWAF 2FLNA 1FT8A 2ZJQQ 4L3NA 5J1NA 5HMXA 1SL2A 4IYQA 1KRPA 1X4AA 3UCUP 3FZ2A 5IQQA 4C9DA 3O1LA 3KLFB 1K8AT 2V94A 4J9MA 3FSYA 4TU9A 2DNQA 3N0VA 5D78A 3UFCX 1HR0F 2IFXA 2K1RA 4DV1F 3DM2A 1KTVA 3PJXA 5D4NA 1Q79A 2BYCA 1C1BA 2PMZD 4BBYA 1BGXT 2YNFB 1IKWB 1T8EA 1KHVA 1E6VA 1FD2A 1R8AA 1Y0HA 3W2WB 3VAIA 3FNNA 4DX8H 3UD3P 2YKAA 4X84A 2MZTA 4NLDA 4F4ZA 4MKAA 2OH2A 2GGPB 1IKYB 3MEKA 3C46A 4HHJA 2MKSA 2AX1A 1VQMS 3FMBA 2MXYA 2E29A 3MMAA 4MAKA 4QPTA 1U24A 2VD3A 4RWWA 5KFSA 3T19A 2LA4A 3L7OA 2IVMA 1GX6A 1V6HA 2FIUA 2CQ0A 2K2PA 3HHDA 4M1KA 5FDLA 3KJVA 4WFXA 3DLGB 1TKZB 4B9MA 2AV5A 4QQBA 2JFKA 2KVIA 5K9FA 1ZH5A 4MFBB 1JLCA 3MPWA 1D9DA 5KG6A 4BWJA 1JX4A 4Q2LA 4NCGB 4A8OA 2UP1A 4C98A 3NGKA 1VI7A 1G2EA 2BXJA 1JLCB 3LP0A 2RE1A 2MKKA 4HKQA 4RW8B 4YB1P 1OSDA 4NZ6A 4KB7A 5GAHU 3CJ3A 4DS4A 3RRHA 2MB0B 2GJIA 1Y3JA 2E5HA 2KG0A 1FJ7A 1U8SA 1X4CA 3GFXA 1O5JA 2GNKA 4C3KA 3OTEA 3IG1B 4NZ7A 3OL6A 4C2MA 1S1UB 2YKNB 2KB2A 3PX6A 2ACYA 5E3RA 1RWUA 4OIXA 4BC9A 5FD1A 2W9CA 1TK5A 1S97A 3G6YA 2ZNZA 3MMCB 4DEZA 1Z1ZA 1PC5A 4EYIB 1NKCA 4JI4F 4TQSA 3UWTA 4PWDA 1XR7A 2MQNA 1L3VA 4DWIA 2BDPA 2YKNA 3OUYA 2ERRA 4K4VA 3Q23A 3DLHA 4NRTA 2D9OA 2PC6A 2OSQA 2W24A 4TY9A 1SL0A 1TKXB 3DHXA 3THPA 2OKQA 3KK1A 2YX7A 3EGWB 3M32A 3CF5Q 1XMOF 2ASJA 3BGRB 4RW8A 4RW9B 2I0XA 4ZMMA 1UFWA 3BDPA 1AFIA 5GAHI 1FNOA 4WK3A 5LJ3Y 1YRTA 2UVRA 5F8HA 4ED1A 1Z4UA 2DGVA 1R3NA 2KN4A 2YNGA 3KNGA 4NCGA 4YB6A 3V2UC 1MMNA 2YQ3A 2WONA 1S0OA 1MMDA 2BABA 4FF3A 2AJ4A 1LXJA 4TQRA 3KG0A 3ETOA 2E66A 1FRMA 2GQCA 4PCQA 4XDCA 5E3CA 2XMJA 2C3UA 2IMWP 1CEZA 3MDFA 1LWCB 1Q53A 4I4BA 4NLTA 5A6PA 2IVYA 3AHPA 5EDWA 3CD5A 3OLAA 5GAEI 3TR5A 4X4RA 5A8KA 2IAJB 3BN7A 3NNCA 3VCDA 4WYWA 2ZITA 4WFNQ 2CPFA 2ZH4A 3N01A 2NQPA 2POKA 5DG8A 4LF7F 1RT7B 1FESA 3I6PA 3M30B 1R31A 3OV7A 2GGPA 4AXIA 3V4IB 4LIWA 3D0IE 4X62F 1JNRB 3LANA 1CG2A 1F5AA 3NLCA 3VTIA 5F8JA 4W92B 3DU5A 3M2VA 1S6PB 2M0GB 3V81B 4I7FB 1JKHA 1HWLA 1JLEA 2FD2A 3SSQA 1IKXA 4QW9A 4DUYF 2AGQA 1JWWA 2HGNA 2PA3A 3AH6A 1VQ9S 1S1WA 4Y2MA 2YKOA 3F56A 2Q1LA 3R1LA 5DG9A 4A8WA 3PKMA 2LECA 2AF6A 2HLUA 3H5SA 2L41A 1N4LA 3KHLA 1LK5A 4DQIA 2DPIA 2DB1A 2AW0A 3LPYA 2R8IA 2PE8A 2GQQA 2JEGA 2ZH6A 3Q24A 5DLGA 2CQ2A 2FVCA 5C24B 4WU3A 3EXCX 3MF5A 5AE2A 5HLFA 4QYZJ 1O51A 3PEHA 4K4WA 2XGQA 3G6VA 3ZZUA 1TV6B 3K5OA 4PG8A 1SIZA 2MZSA 2KH9A 2XCAA 5IZHA 2A18A 4I0WA 3KK3B 1HQUB 3ITHB 4A47A 4J9QA 2YY3A 2QA1A 5JUMA 2RIJA 1VHFA 4CH1A 1SJ3P 1ZPVA 2Z2LA 2GO8A 1TKTA 3PX0A 3I9ZA 2DRAA 2DNPA 2X1BA 1VQ8S 3OBIA 4ECRA 3TAPA 4GKJF 1FJGF 3BS9A 3KLEA 1RDRA 4L6V3 3J7YU 2OSRA 2MKJA 2OPPB 5HQ8A 3OTOF 5IM0B 4ZDNA 3PKYA 3LP2A 3MFIA 4RNNA 3PIOQ 2E5GA 3GMGA 2J6TA 3JB9k 4ZPAA 3JYTA 3GYXB 4RKUC 1FEHA 4NZ0A 4FXWA 5A8KB 2A2DA 1UJ5A 3BN4A 3UI3A 5T14A 3MTJA 1YJUA 1WEZA 2ZE2B 3TA2A 3FSIA 1KS2A 4I1TA 2IRUA 4ZPTR 3UCGA 3CMES 1NZAA 2Y1RI 4NLSA 3B4DA 2ROGA 2VFRA 2RQCA 2D3OR 2RRNA 4CQ1A 3VF0B 1VQ4S 2HHVA 4MYUA 2YNGB 1Y5NB 3EXYA 1Q82T 1W2BR 4LVNP 3AA9A 5F3ZA 4K50A 2KFNA 1C1CA 2AYMA 2MKCA 2LEAA 4UY85 2FHJD 2HHSA 4DN9A 1X9WA 3V6DA 4JV0A 3O44A 1L3UA 3OR1B 1XEZA 1UA1A 3IAM9 5J2NB 3T5HA 1N6QB 5DQHA 4C8MA 1J5OB 1SI9A 2V2KA 2XO7A 2JVOA 1Q81T 3RB6A 5EN1A 3M8QA 3DLEA 1DLOA 1LW0B 2I38A 4TNOA 5E33A 4A8KA 1IXKA 2M3DA 4EGLA 2DNZA 1T3OA 2FJDB 3TVKA 4DG1A 3OTDA 4G1QA 5J2PA 1R8CA 3CXCR 2ALZA 5L39A 5KFRA 3B4MA 4OX9F 2Z0GA 3O5TB 3OXFA 4OX8A 3MPYA 3BO4A 2OFGX 4YHHF 1KLMB 4DL6A 2KI2A 3M9OB 3C6TA 1QE1B 1FRHA 2KRRA 2BANA 1S1XB 2G13A 2GA7A 4DL4A 1S1UA 4KFBB 4Y3CA 2HGMA 3MCSA 5D4OA 3JSYA 4AL7A 4B3MF 2N3LA 4KE5A 5HBMA 3CPWR 2XC9A 4HYKA 3MMBA 3IWXA 1T05B 4W90B 3K2YA 3CCUS 3FEZA 4DQSA 5AXMA 1U1PA 3HHLC 1M5KC 2F40A 5A6WA 2QSFA 2VG5A 3I55S 1M5PC 3MR3A 2XLKA 1RT4B 1TP7A 1Q4RA 3KNAA 3MM8B 4NWBA 1IR0A 1KVIA 2RRAA 4RUHA 5I3QA 4HT7A 3NS6A 1YJWS 1VQYA 1NK9A 2JL9A 4ZVFA 1SJ4P 1N52B 5KG2A 4UQGA 3BGRA 3GSDA 3GILA 4J9RA 4DL2A 1UETA 1X4FA 3G8QA 3VAGA 4DR3F 1U47A 2DR9A 4WFZA 5I3UB 5HBMB 1H0HB 2IRXA 4DJBA 2DNRA 3P96A 2R7VA 2RS8A 3TAQA 1R8HA 4KHMA 3DGPA 3D54A 5KT4A 1QE1A 3M6VA 2PN6A 1YBAA 4C11B 2YVSA 5DGAA 1XK8A 2IBOA 1VQ7S 2B4UA 1TQLA 1JJ4A 1FTRA 4NOHA 3OHAA 1OPIA 3MEEB 4CH7A 3OHBA 3M1VA 4EEYA 4WU2A 1TL4A 4R8UA 2GMHA 4RZRA 3KYLA 2AQ4A 3H2LA 4LQ9A 3IRWP 2DH9A 3I4PA 2MQPA 3G8SA 2HRUA 1SKWA 1LW0A 3PRDA 2QO3A 2E7XA 3KKFA 4RBVA 3IAS9 5KFZA 4QWDA 1J5OA 2KYXA 3NP5A 3TP2A 1VQKS 1CQNA 3H40A 2MZJA 2NLWA 1D9AA 3DXBA 3LP1A 5B0CA 2RUGA 4RUAA 3IS9A 3EZUA 2WSEC 4O23A 5LSOA 4NXNF 3IGVA 5KFHA 4X4QA 1DTQA 4DLEA 1QTMA 2XSJA 1RT4A 4ECXA 2DGOA 2IM2A 2XNRA 5AXLA 2KHDA 3J81Y 2F8EX 1HBUB 3GV5B 1JLFA 4C8KA 1TAUA 1QJHA 3DLKB 3DC2A 5EWEA 1N33F 3QGGA 3X3UA 5A8WB 3HHLB 2R7RA 1LFWA 3MTKA 2RSQA 3OJSA 4ZCLA 5IS2A 2BQ3A 4A46A 4B9LA 4RW6A 3PR4A 2ZM6F 2B3TB 4MTPA 2IM3A 1S9EA 2EFVA 4ED0A 3BM7A 3EYZA 1UW4A 1LWFA 2MY8A 4Q2MA 1YJ9S 3QJJA 1RYSA 2HNDB 4YB7A 5DQIA 4CH0S 2BM1A 3K58A 5T7LA 4ECVA 4LF8F 1XN9A 4ED5A 1N56A 3HP6A 4IO1A 4OI3A 4LT6A 3LF0A 4CNYA 4F25A 1IKVB 2CDQA 4QR1A 1MWZA 2DGWA 1FEEA 2MZRA 2CRLA 1CC8A 2MHEA 3DLEB 4EU0A 4YB5A 1RA7A 4C0OC 3AQPA 3N28A 4XIUA 2BRKA 2DITA 3TA1A 1IBKF 1IBMF 3PW0A 5F8MA 5HO4A 4K4ZA 5FJ4A 3NL0A 1V9OA 2Q3PA 4F4YA 2IHR1 1TV6A 5E3QA 1TL5A 1HHSA 3HI9A 1CPZA 4AFFA 3HJFA 1UAWA 3HKWA 1SXLA 4A8SA 4J9NA 3H2UB 4MYTA 4PQAA 3I4HX 5GADU 2GW8A 1P6TA 4OHZA 2V9WA 1N0VC 5G0RA 1RT2A 4DSEA 2JRSA 3Q0AA 2FVRA 4G6VB 2AD9A 3LOUA 3T1YF 4ZP9A 3OJUA 1F0XA 1C0TB 2CJBA 2ZC3A 2ZE2A 1RTIA 2B6AA 2RJZA 2ILZA 5KFJA 3IA0A 4IFYB 5H9EJ 1WI6A 3WC0A 3ONQA 3CJ4A 3I0SA 3JTPA 3MUMP 4ERDA 1JKHB 2CPXA 3HKZD 1UKUA 2D3UA 4G1PA 4I2QA 4OZNA 3HM9A 1XNRF 4L72B 2VBXA 3BSCA 1HD1A 3QPIA 1QSSA 4DFKA 2MMYA 3GE9A 3OTBA 4BWMA 3EX7B 3BGFA 3U1LA 2EG1A 3BSOA 1RTJA 4NA1A 4RNMA 4QR2A 5A8RA 1SJFA 4IFYA 3CULA 2JEFA 3M4XA 4O3RA 1UJ4A 1RTIB 1OQ3A 1LWEB 5CCLA 2O3DA 3JSRA 3EUNA 3V5RA 4ZVGA 4A4JA 1BQMB 1K73T 1M90T 3TVZA 2VH7A 3QAUA 4KGKA 3VAMA 1VMBA 1B64A 1FRLA 1A7GE 3M6WA 2EFNA 3SV3A 4KBIA 1MU2A 1WHXA 4KSEB 5L1KA 5A2QY 3J7A1 3TYTA 5F8LA 4XPCA 3OL8A 1XMBA 2YNIA 4LSNA 2N4CA 4ZPCA 4ED7A 1JLBB 2CQDA 3FGVA 4RNFA 1QSYA 4LF4F 4MH8A 3NCRA 3QIPA 2BQUA 3FJ2A 3CCMS 1S0MA 3DOKB 4Q0BB 3D1OA 1Y00A 3OFGA 1QY7A 4IUFA 2QA2A 2J9EA 3PVXA 1R0AA 2N3OA 1HW8A 3BF4A 2CPDA 3ENWA 1TKDA 2DNGA 1NKEA 1X5OA 3KK2A 2GC8A 2CZ4A 4DN0A 2PI4A 2MQQA 1VQNS 1RQ0A 1X0FA 3Q2SC 4OJ1A 1NK5A 1TFWA 1UEVA 4PG4A 1DARA 2DO0A 2VA3A 1PGZA 2HNDA 1FXDA 2GCFA 2YX1A 2ZH5A 4NYZA 3CD7A 4PG6A 1D0EA 2F1FA 1UVIA 2V8DA 1HBOA 2CJ9A 3T9NA 4ZPVR 2CG4A 4CO2A 4ZCIA 1VJWA 1WEXA 1M5OC 4I67A 1RT6A 2MPUA 1QAJA 3MMJA 3TX8A 4N41A 1HQEA 1VQPS 2ASDA 1U1NA 5KFBA 1WEYA 4F2SA 1HI1A 2CQBA 4OX7A 3KOAA 2WAQD 3Q8PB 1ZAVA 1SKSA 2X51A 3HVAA 2MKHA 4N47A 5D8HB 2UUCF 5K5MA 5H1SV 2QLXA 4CO0A 4NCBA 4RW9A 4K59A 2EG2A 3S6EA 4F3MA 4YOEA 3K57A 2ASLA 5J2QA 3H8YA 3BZQA 4DFJA 2B7CB 3N4WA 4USIA 1KN6A 3KLHB 3DLBA 2J7WA 3B82A 5B7WA 2J5AA 3D5MA 4CT8A 3OUYB 5D4LA 5F3TA 2QZ8A 4I69A 2BANB 4U9RA 2YKPA 1M5SA 4B9VA 1TK0A 1W2IA 2HS3A 2K3KA 4KIAA 5JVGQ 4NCAA 2CVEA 4DLGA 1HI0P 2B56A 1X4DA 1UJ6A 2PMHA 1APSA 3C3LA 5DRKA 4NXMF 5KFPA 4A48A 4N77A 1BC6A 2CQ3A 1YHQS 3VAKA 1PILA 3SSRA 2R8KA 4C11A 1VRUB 4C8OA 3QLHA 1U25A 3PRBA 5LMNF 3SFUA 2FJAB 4EO6A 1SIWB 3KK2B 4GO5X 2MSTA 1HWJA 3IG1A 1SUQB 3GWCA 4PPZA 4XAKA 2O67A 3AB4B 2VQFF 2R7SA 2JEJA 1BY9A 4OZJA 3ZZOA 2XMTA 2R7XA 2HWHA 2CQIA 2CQ4A 3SCKE 3W7BA 1JB0C 3RAMA 4LF6F 4F4XA 1UL3A 3M2UA 2UUTA 3QZ8A 2GX8A 1I94F 3HHEA 1JLBA 2ZH1A 4KV8A 3L3CA 1FA0A 3DHWC 4ILRA 4LSNB 4I2PB 3JSMA 3I32A 4DR6F 4TYBA 5I42B 4B3SF 1P27B 1VOMA 5AE3A 1F9FA 3CCLS 4ID5A 1RJJA 3KFW<