4P7TA

Structural insights into higher-order assembly and function of the bacterial microcompartment protein pdua
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
85
structure length
85
Chain Sequence
QEALGMVETKGLTAAIEAADAMVDSANVMLVGYEKIGSGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein, electron transport
molecule keywords Polyhedral bodies
publication title Structural Insights into Higher Order Assembly and Function of the Bacterial Microcompartment Protein PduA.
pubmed doi rcsb
source organism Citrobacter freundii
total genus 21
structure length 85
sequence length 85
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4p7tA00
4OX8A 3H8YA 3DNCA 2A1BA 4OLPA 3SSRA 4RBUA 2A18A 2A10A 3MPWA 4P7TA 4PPDA 3CGIA 4RBVA 3I6PA 2G13A 3NWGA 4P2SA 3VCDA 4QIFA 4QIEA 5L38A 4AXIA 3SSQA 4AXJA 4QIGA 3CIMA 4OX6A 3PACA 4RBTA 3BN4A 4LIWA 3DN9A 3NGKA 3SSSA 4QIVA 3N79A 3IA0A 5DJBA 3MPYA 4OX7A 3I96A 4OLOA 2EWHA 4P7VA 4DDFA
chains in the Genus database with same CATH superfamily
4FVMA 4FN5A 2PMHA 1I3OB 2IRUA 4NCGA 5KG3A 1MW7A 3H7HB 1AYEA 1PO6A 1IWAA 4YHHF 1RT3B 1VQMS 2X7IA 4QWDA 2FY8A 5JMNA 3PKMA 3N4WA 4A8FA 2YPZA 1T9YA 3AH6A 2QIFA 1FKOB 4NA1A 3C16B 2W25A 2Z0GA 3NGUA 2Z8QA 2HHXA 1C0TB 4QR0A 2CNLB 3PACA 5BYQA 4DR1J 2M2BA 2W4CA 2C22A 3J81Y 4ZVSB 4NI2A 2CPHA 1LW0A 2VV5A 2K3KA 4R25A 5IV3A 1CJVA 2JVOA 3GE9A 3LAMA 4RBVA 4ICLB 3N0VA 2ZZTA 2LEAA 1FNXH 2IFXA 2W7AA 3AOBA 3I32A 1EB0A 2MQ8A 2ZBQA 3NMAA 4DUYJ 3HSZA 4KGVB 1U49A 1R8AA 4UY8T 2HBQB 3DMJA 1N48A 3VAHA 5GADI 2CJAA 2B9WA 5J2QA 1LEOA 1OY9A 2AGQA 2GIRA 3MEEA 2QLFB 2IDLA 1IKXB 2E5HA 3C6TA 3MR5A 1Y7PA 2FZGB 2CVIA 3CDEA 3MFHA 1WHXA 3K58A 5AXMA 4HT7A 1YTYA 5KFQA 5DQGA 1TAUA 3OW2R 2MYFA 4O4RA 3OR1A 2AU0A 1JIHA 2HS3A 4RW6A 3BO4A 2BJ3A 1JLEB 3ZZTA 2ZZNA 4CRJA 1T0TV 2OJ3A 3AXKA 4OMFG 4F25A 2ALZA 3Q0AA 1KD1T 2U1AA 1ZM2A 2ADBA 5GAEI 2J0SD 1U8SA 1T95A 1VDHA 2PFDA 2IYGA 1C1BA 2JH3A 2IRXA 1HW8A 2MLZA 4RUHA 4HI1A 3NRBA 2CJYB 5E2QA 1YZ6A 5D3GA 2M0GB 5L1KA 4RW8B 1NDLA 2J9DE 5D0RA 1GMWA 5EGYA 3NG8A 5F8JA 3OT9A 4I7FA 4ZVUB 3TI0A 2UUAJ 1WTFA 1FI4A 1YLXA 3JTOA 4AQYJ 5HLFB 2RQMA 2ZOFA 3V6JA 1AUDA 2QA4S 1SKRA 2UXBJ 1WG5A 1EARA 3R5BA 4ED0A 1OQ6A 1R0AA 4L75A 1NK8A 2VASA 1K9MT 2YH0A 2BX6A 1L3KA 1M5OC 5ETKA 3TZWA 4PPDA 4TY9A 4YUDA 3D7SB 2C2MB 1SV5B 2HQ3A 2BDPA 3N28A 4B3SF 3HHLA 2KM8C 1RT7B 4I2PA 1QJHA 2OPRA 3SFUA 1TR0A 2VF3A 2CJQA 2N7YA 1NMEB 4DL7A 4WZMA 3K8WA 4ILLA 1K73T 4NZ6A 3QT6A 4FPRA 2ADCA 1VC6A 2HWIA 5K8PA 1Q53A 8ATCB 1S7IA 3HCXA 3PW7A 2XMKA 2F1FA 4LR8A 1TVRA 2G13A 4DG1B 3EYZA 3W66A 3NNHA 2XZDB 1ZPWX 1Q79A 4M5LA 4CO3A 4ZIVA 1MN7A 2UVRA 3T19A 2LEBA 1CQNA 2BQ3A 1S9EA 5IV4A 3FVYA 3PZPA 2RUGA 2N3LA 5D77A 1NSKL 5GAHI 4ZVQB 3TNVA 3W9IA 2AJFE 4LBIA 4I64A 2HQFA 1RWMB 2DNYA 2IJRA 5SZTA 4OYPA 3HHNB 1V9OA 4A47A 1SJQA 1RAOA 2QSWA 2KN4A 4NL5A 4MYTA 4OYZA 2XHWA 4KYZA 2JDJA 4ZPWR 1HWLA 2CPXA 2BE2A 4OYIA 1RLDA 2Q3PA 4O23A 4YQWA 3RZAA 3H20A 2F4VF 2ZUAA 4X65F 3DFEA 4DL4A 2KJVA 1TELA 4IO1A 1FX4A 2QLXA 4CO1A 3MURP 2BRLA 5D0EA 3PX6A 4M8LA 1L3TA 3C46A 4F3QA 3B4MA 3PCOB 3OR2A 3H90A 2YKOA 4H4KC 1TL3A 2B4PA 2V68A 1AUSL 3CT9A 2WBRA 1EZZB 4QU7A 2NYHA 1M90T 3AQPA 2ZUGA 2AQ4A 3H5YA 1NJYA 1Y5NB 4ED8A 2LQ9A 5JJBA 1UMJA 2MDAA 1QAIA 1QM9A 4FXWA 1FFWB 2MKKA 1L3UA 2OEMA 1RT5B 4RO0A 4YOEA 3LW5C 4K4VA 1MWZA 3UCGA 1V3ZA 2CQDA 3MEDA 4ZLJA 3GIIA 1IQZA 1R89A 4OZ2A 4GKJF 2X1GA 3I9V9 5E33A 3R7SB 4ECXA 4OZLA 3PY8A 1R8PA 4AE5A 5J1NA 4DV3F 2XLJA 1N33J 4HR2A 4EWTA 3K5LA 3RYLA 2EC2A 2EKYA 3AHPA 3B78A 3O5TB 1SCJB 2KVIA 4OZ3A 3NKYA 4HL9A 3B4DA 4ZOSA 1WNEA 3J80U 4P2FA 5KOWA 5B0EA 2F40A 1B0VA 1LNQA 1CBKA 4G1IA 1RAFB 3BGRA 4X62J 2OKQA 2YQ3A 5DS7A 1JNZB 2KT2A 2V50A 2VD3A 4C0OC 1JLBB 3BDEA 3BBCA 4HI2A 3S1TA 1FJCA 1U4BA 4J91A 2JSXA 4JI7F 2EFNA 1ZH5A 1FESA 3DOKB 5B0DA 2GGPB 3WDOA 1Q82T 4PPZA 3T5KA 5KFKA 2ZVIA 4HYKA 4CQ1A 1C1CB 3PDNA 4N8NA 5D0HA 2OUGA 4PXEA 3W9JA 1WSVA 4O44A 2Y1IA 2MHNA 3RBEA 1URRA 3V81B 5K14B 4LF5F 3JQMA 2ZH4A 2IJNA 1RCOB 3UO0A 5ETSA 3US5A 4Q44A 2JLGA 3R97A 4NCGB 2Q6CA 3OHAA 2FVPA 2DNPA 4DSLA 3CPWR 3HVWA 3QQCD 3MM9A 2DCUB 3MM6B 4HVZA 3MM7A 1GMVA 1IKYA 1LXNA 2DISA 3PNIA 1SKWA 2KHDA 1KTVA 2VKRA 3KLHA 4M5GA 3HT0A 2DB1A 2B4VA 1HHSA 2DNZA 4CI0B 2VKZG 1O6XA 2HKEA 4NI2B 2HEKA 1LW0B 2HHPA 3PHEA 3JYTA 1NKCA 4WTOB 1CJVB 3FEYB 4AYBD 2QMWA 1QLNA 4A8XA 3BN7A 1GT8A 2C2DA 1U02A 4OJGA 4P72A 2L41A 4YHHJ 2GZOA 2DGXA 2M9KA 1YJNS 2OPPA 1WG4A 3G2XA 3UCUP 4DV6F 1SQFA 3CCSS 2PA3A 1N5YB 1I6JA 4K4WA 3ZZYA 1R6YA 2NPIA 2WVDA 3SEOA 5EUHA 1N52B 1SC3B 3NS5A 1GFWB 1YRXA 1RBAA 1TMMA 4UY85 3HJVA 1RACB 2VQEJ 3Q8SB 1TP7A 1Q8KA 3V2UC 3EXCX 4NLDA 3BN4A 1S10A 1OMSA 4I2QB 3RB4A 2V2VA 2MEWA 1EAYC 2VH7A 4ILRA 3JSMA 1O5JA 4FKYA 3AOCA 3I0SB 4QPTA 1RBLA 4USVA 1SH2A 1F3VA 2R8GA 4HHHA 4DSFA 1HNVB 5THWA 5L9XA 4X4VA 2Z58B 1NJZA 5C5JA 3S8SA 3QBCA 1CQMA 1NB7A 3KK1B 1HI1A 3M1VB 2HHUA 3GYGA 3HHEA 3OL7A 3DLEB 3EDQB 2F63A 3KG0A 4Y2CA 4Y00A 1ITPA 1G2EA 2V6AA 2RRNA 4AL5A 2VJVA 1G4CA 1OSDA 2DNOA 3ILOA 1LFWA 3PW4A 5CYMB 4JI0F 1G7CB 2O67A 4C11A 3UNYA 2A0FB 3W2WB 1VHIA 3L7PA 5SUHA 4CLWA 1RZMA 2CPEA 5KT2A 5DDQC 5ITHA 4JI2J 3QFHA 3BREA 2WVFA 1N5QA 1PJ6A 1R0AB 2CPFA 3A12A 5C25A 3Q8RB 3CUNA 4AL7A 4N76A 2DGQA 1WF0A 3CCRS 3MAAA 1WC3A 3QZ7A 2J76E 1FWPA 2FYXA 3AT1B 4NRTA 3MPYA 4M5DB 3W2VA 2XEXA 4JV5F 1REVA 5J2NA 4NLWA 2BOAA 3SBMA 1RAGB 4DPYA 3T6JA 4MK9A 1TL4A 1WKLA 2OPRB 1XEZA 3KYLA 2LVWA 4A4JA 4L72B 4OI2A 3GFXA 3IBCB 4ELTA 4YMEA 2XSJB 1TVRB 5KFXA 3QAEA 3L4BC 1OPZA 3PRDA 5L8RC 4KC5A 2I6WA 3DM2B 2W01A 2Y0BB 3T41A 2HFOA 1WUUA 3A8EA 1XK8A 3IBFB 3N9UC 4RJVA 1JKHA 4B3SJ 5BXIA 2X1BA 4B3RJ 3CXCR 2MQLA 3A13A 2QRRA 3UE2A 3GLJA 3KHLA 3G8QA 3GJQB 2XHCA 3H2VE 3UDLA 3PEJA 3FFIB 1V5VA 1GX5A 1HNZF 2RMLA 3VGVA 5AXNA 4OIXA 2JVRA 3TJ8A 4ZP6A 1HQUB 5B7WA 1FKPB 2GQ2A 4ZLLA 2ASJA 3FSXA 2BE2B 2GJ2A 3DLGA 4WP3A 2ILZA 1HMVB 4NXMJ 4EBDA 5MLCV 2XQCA 3KJFB 4ZPCA 2WSFC 4QWAA 3FMWA 3FNNA 4UZBA 4DV0F 1FTRA 1TKXB 2DVIA 1NHUA 1O51A 4LSZB 4UTGA 3DOLB 2R7OA 4WE1B 3I6PA 3AD9C 4K5SA 5I3UB 3OFHA 2YY3A 3KLGA 3MUMP 1IQTA 3AQOA 3F73A 5HBMA 5F0WA 3TO8A 4W92B 2PO4A 2F4VJ 1NDCA 4P75A 4YDXA 2ZM6J 2AHOB 2CDRB 2QLWA 2OHDA 1TMJA 1UVKA 3CEDA 2F4FA 3MMCA 3BKTA 3MEDB 2IVFB 4IKAA 3C6UA 2ZKUA 5IT0A 3BBBA 5I42B 4QWEA 3R1LA 1S57A 3AD7C 3MD1A 5D4OA 1ZTWA 1KVKA 5LMNF 4ZP8A 4F26A 4IDKA 2X3GA 5LL6d 4QIWD 3AXMA 3RJMB 4K4YA 5IZHA 2HNDA 4WYLA 2WAQD 2VONA 1UEVA 1YWXA 1CC7A 1LQ9A 3RTVA 1FD2A 4H4KA 5GAEU 2LCWA 5ETMA 4ZHRB 4KPCA 1DTTB 2LXUA 3G96A 4DQPA 5F9NA 1RA7A 2MZ1A 5HAOA 1IR1A 1N4LA 4GVBA 2CWXA 2UUBF 4YB7A 4QWBA 3EVWA 2YQ1A 1IBMF 2AJQA 1JQGA 2V8GA 2XBPA 3E3XA 4PQUB 4O44B 2LEPA 3CB4A 3ELHA 3H42A 2H65B 4DCJB 4R8UB 3EZ5A 2CFXA 2UVUA 4GKKJ 2CJXB 1QUVA 2AIRB 1VBYA 2MJNA 1RU2A 3ITHB 4DL5A 1VLOA 2FPHX 2DGUA 4DQSA 1ZTTA 1M5PC 1SH3A 4DPOA 5DO2A 4N8OA 2FB0A 3NBPA 3VAIA 2BANA 2EVZA 3G9CA 2GW8A 2E5IA 3MUTP 2R3VA 3THTA 2MKSA 1AFIA 2MQNA 3P96A 3MHYA 4ID5A 3GMGA 3H25A 3C8YA 1GX6A 5IOLA 4RX6A 1N8RT 1JX4A 4FYXB 2XMVA 3M7VA 2M7SA 2KXNB 1YDLA 4FYWB 4DWIA 3NLCA 2K3IA 1WKJA 4XTTA 2FJVA 5G4DA 3GFHA 1XC9A 5GAGI 4LFBF 2AGPA 3BJYA 2F8EX 3CD6S 5A6PA 1DRZA 2DNGA 5IXUA 1FEEA 4ECWA 2L9NA 5DLGA 3PM9A 3SCKE 1PYSB 3RRHA 2NS1B 1TL1B 2XB2D 3WBZA 2PC6A 2IPOB 4OV6A 4OZ0A 4OQJA 1F5AA 1WJ9A 4N56A 7FDRA 3I82A 3U02A 2HBZB 3CJRA 3TZZA 3BEGB 2N7CA 4LFCJ 3CJSA 4DPUA 4C8YA 2UP1A 2UV8G 5KT7A 1QAXA 1KQKA 1BD6A 1H0HB 1X60A 1BUXA 5KFHA 1KWMA 4EO8A 2KL8A 2KYXA 5LJ5Y 4FXDA 3JSMB 3D1HA 4DV6J 2QLBB 2LDYA 3N5BA 1XERA 1XNRF 3DRPA 5L46A 3SXLA 3DCAA 2BOPA 4QOTA 3WHIA 3LP2B 3M6UA 4C4WA 5DLFA 4HDGA 1JLAB 1HBNA 4UOHA 1DTQB 3BR9A 5GVQA 1DBDA 4DSEA 3TVKA 3CJ2A 4X4TA 1IWGA 4NWBA 1RWWB 3C19A 4OX8A 2W7OA 2IRYA 3R5CA 4OI1A 4ZP7A 1HR0F 2KRBA 4NLOA 4ECQA 1CG2A 2AV5A 5JVGQ 3EVMA 4PEOA 2CNOB 2XNRA 3QJLA 3ILIA 1X4EA 3V6HA 4H4MB 1LWEA 3C3LA 2DRAA 2XYHB 5EWFA 2FJEB 4C11B 2JFKA 1JJCB 3UW1A 2WBMA 1FE0A 4DQRA 3TUIC 3FBEA 1U0HB 3TAMB 3AODA 5BYSA 1OIAA 1RCXB 2MSTA 3BPSP 3CD7A 3DOMA 1IXKA 3WIVA 1FD8A 3NY0A 3D2WA 3CTRA 2XY5A 4BC7A 5CH7B 2VQFF 1RT2B 4B3OA 4LT6A 4LF6F 4XDCA 2CNKB 2A10A 1REVB 1VCTA 1BC6A 2PDAA 1HBOA 2YVSA 3FBBA 3DXBA 4UUXA 5AXKA 3KLIA 2K7KA 4CNZA 1ELOA 3T1YF 4BDPA 1HPZA 5ETPA 2GIQA 3TX8A 4DOZA 2D69A 1WDDA 4USHA 4BBYA 4LF9J 2N4CA 5ETTA 3GV5B 2ATCB 1Y5IB 2BJEA 1DQ9A 3JB9k 2VJUA 1RTJB 2RSQA 4Q0BB 3MDFA 5BR8F 2C2NA 2DY9A 2AT1B 3LWMA 2EPIA 1S1XA 2B8PA 3DGVA 3SQOP 1NRKA 1Y3JA 3RU0A 4OJ1A 3MECB 3M2RB 1U1NA 3CVKA 2QFIA 3NNAA 4OJHA 2PIIA 3J7YI 2YKNA 5D4PA 2LQ8A 4F4AA 5ETNA 2FVSA 1FRMA 3VF0B 3BGOP 1UZDA 2M52A 2A3JA 4IOCQ 3JSYA 2UU9F 3T6BA 4ED4A 4F0HA 1HA1A 1WOSA 4ELVA 4F4KA 4OZ5A 4Z7YA 4ZMMA 1S9FA 2KTQA 1KNZA 3RR7A 4DBQA 1UWBA 2XTJP 1RP5A 2E29A 3LP0B 1VGYA 4X64J 2FC8A 1NK0A 3LP1B 4CCHA 4ECSA 2WB1D 5CHCB 1F5BA 2EBEA 3IA0A 2XZTB 2VG6A 1CJUA 2NLWA 3BYPA 4PXDA 2L48A 2UUWA 2Q6BA 2F5GA 2AZ3A 4LF7J 3CD0A 2BE9B 5D4NA 3CF5Q 2OSRA 3NL0A 5DZ6A 3H59A 3TVYA 3DLKA 5GMDA 2RKIA 1UJ5A 2ZJRQ 4K0KF 5HBMB 4YP3A 1UP1A 2AWZA 1Y9OA 4R5PA 4CLKA 3W62A 1VQ9S 4RNOA 4DL6A 2E5LF 2C28A 2R8IA 4NLSA 3QNWB 4BHQA 1B70B 5A8RB 1QE1B 4RKUC 2E5GA 1I51B 2AP6A 3K0JA 3M6WA 2CPIA 1FK9A 2VIHA 2P6SA 2R8JA 3MMCB 1EKSA 4DV0J 3PYDA 4PG5A 1TL7B 2PMWA 2JLFA 1KFDA 1UVMA 3V4IA 1T9TA 2V2KA 3MR6A 5EX3A 2AX1A 2DIVA 2HBYB 1JLGA 1IUJA 1RTHB 3AFGA 4NRUA 1ZM4A 1H6KX 4DV2F 3RBDA 4RW7A 2GVDA 2O66A 3EM1A 2AYEA 2ZH7A 5CAAA 2DIUA 1H2VZ 2HNDB 1VQYA 1LKZA 4DV5J 2D1CA 1CLFA 3D54A 1LV5A 2NZ4A 2W2QP 3CC2S 4ANCA 1S76D 2VBXA 1XR5A 2EKNA 4O4GA 8RUCA 2DNLA 2ZC4A 3D3CJ 1R8CA 4FF1A 2DH8A 2RQKA 3KK2A 2F9JA 4IYQA 4F0MA 1RTDA 3EUNA 1EIYB 4IFVB 3ULHA 1YJRA 4GVBB 3HVTB 4ZA1A 5LMNJ 1KVIA 1TKZA 4MAKA 2X51A 1U6FA 2CZ4A 3FK4A 4NMXA 2AYMA 2HNZA 3C2PA 3D68A 1V6HA 3G71S 1S0VA 3HFKA 4PQAA 4ZCLA 1RGVA 5IQQA 1S6PA 5B09A 2VHGA 1LWCA 3F0NA 4AXJA 2CKWA 3HJFA 2J9CA 2POKA 2QA2A 5J1EB 3NBPB 3BSOA 4GO5X 2BANB 2AJ0A 2UUBJ 1OQ3A 5I3PA 4I0WA 5A2QU 2YX1A 1HL6A 3R7NB 4EUVA 4Y2IA 4ID5B 1HNWF 5LMUJ 5KG7A 4JI8F 1H2UX 1RWVB 3LH2S 3SSRA 3I4HX 5D78A 2ZH9A 5HQMA 5AE3A 4ZVOB 2YNGA 1EQ0A 3ZNJ1 4MKVA 2KG0A 1SUQA 2ZITA 3G8TA 3OJUA 4KO0A 2OLWA 5F41A 3I9ZA 2D3UA 2W2NP 3UNGC 2B3TB 1IKWB 5JVHQ 4ZCIA 2EG1A 1B7YB 4DR7J 1JJHA 4U8YA 1BQNA 3QGIA 4DN0A 2KVQE 3DI6A 3KNGA 4I6YA 4Y65A 2X1FA 1UW9A 4WXOA 3M8PA 4ALZA 5J2MA 5KFFA 3NCQA 1Q86T 5ETRA 2RDJA 1NO8A 2ACYA 1DARA 4G6VB 4MK8A 1CJTA 1PAUB 3CCWA 4ZJOA 4B17A 1F9EB 5ETLA 2HMIA 2XGQA 1Q7LB 4DDFA 3OTOF 1U26A 4KV8B 1HBUA 1BLUA 3CJKB 4C0HA 1NH8A 2HAIA 4YY3F 3IWLA 1HNXF 1ZZNA 1HBMA 3PO5A 5CZVA 2KKHA 4WXWA 2EC0A 3CMQA 3QRPA 1B64A 3W5XA 2DRBA 1TK0A 3A4TA 1ZYQA 1YGYA 1PGZA 2CWKA 4F50A 5A0YA 4TY8A 4QWCA 4IG0A 1OSCA 1VK3A 3HLUA 1NNDA 2GFFA 4USUA 4U95A 1F9HA 1FRIA 5FIIA 4QIEA 5E7OB 3MCSA 3M8QB 2ZBRA 1U1PA 2VFTA 4K59A 1FRXA 1T05A 5KFYA 1YJ9S 4V19X 4BCAA 1LWEB 1NZ8A 1HWJA 1EETA 1GMWD 2L9WA 4DR3F 4O3RA 3W3SA 3PYEA 4FNIA 3C66A 2KZZA 4I6WA 2HSEB 3MM8A 3FDSA 4EGLA 2L3MA 3HKWA 3NMRA 1LXJA 4OHYA 2MY8A 3H4DA 1VYAA 3IGNA 1AZSA 4USTA 4J5OA 3PV8A 5DG7A 4W4MA 4XPCA 4DUYF 2HZCA 3GYXB 1RT3A 4HH0A 3MPDA 3NEKA 4B3OB 1KR4A 1UETA 2L08A 3MM5B 3IXQA 4PWDB 1YK9A 2WRMA 4RNHA 1FKOA 3H0PA 3C16A 3QMQA 1UFKA 1C0TA 1F9FA 4CM0A 2V8PA 3CJ8A 2VOPA 3K5OA 2M8HA 4P52A 4CYUB 2AEMA 3HHLD 2HK2A 1RYSA 3FBCA 4DUZJ 5IT9U 1C0UB 3G87A 2NREA 1UJ4A 1HIYA 3PIPQ 3EX7B 3DYAA 1UVIA 1J2VA 2H3EB 2F9DA 2VQFJ 2L9DA 1AA1B 1O8BA 5AE2A 4LF6J 3ETMA 4KKOA 1VQOS 4NCAA 1S1XB 2CG8A 1LK5A 1W2BR 4U8VA 4DU7A 3BQ1A 4UOCA 3X3UA 3QATA 2ZBIA 1IN0A 1XWLA 4LRBA 1AFJA 4OI0A 3JSBA 3H5UA 1S49A 4DFKA 2HZAA 4I1TA 1IVZA 2Q43A 3PYGA 4ZVTB 5HQ8A 4QPXA 4O0IA 4OYBA 4OHZA 5G0RB 3FCHA 1GNKA 1FVSA 1SIZA 4ED1A 1K47A 5K8NA 4WFXA 1JLEA 4PRFA 1F0XA 2QZ8A 4ED5A 2OI2A 2IM1A 2B51A 1VQ7S 1XTZA 1RHQB 2M88A 3MMAB 4DUTA 3KNAA 3KUEA 1CJUB 2DNKA 2CA9A 4AQYF 1OYDA 4JI1J 3TA0A 3D66A 5HMWA 2E1MC 5AJ3F 3DRYA 4WU2A 1I94J 3SIPB 5GAGU 2LQBA 4O3QA 5A76A 4LSLB 3GILA 2LMIA 1ZETA 3K7RA 3FSIA 3BSNA 2B5JB 4RW8A 2O1PA 3DRSB 1X4DA 2UZAA 3HSJA 4TKTA 3N01A 4MH8A 4RNMA 3UFCX 2B9YA 1FK9B 3IR7B 3QAUA 2Z56B 1FRKA 6AT1B 5HLFA 3O6QA 3GR1A 1RWXB 2HS4A 3EPIA 2JFDA 4TU8A 2NZCA 3V4IB 4OI4A 4FPIA 4E2FB 2NUUG 1RKJA 2RNEA 5EHHA 3M9MB 4FYVB 1W7WA 1LOUA 2QL7B 3CJTA 2GVDB 1VC0A 5T41A 4OYOA 4RZRA 3EGWB 3POTB 3CO9A 1S12A 2HAFA 1SVDA 3KHRA 5CCMA 2DGOA 2MLYA 1QTMA 3TAPA 1NKEA 2W9CB 2J6UA 5H9EJ 2MB0B 4CWBA 4LRCA 2CQ2A 3R5DA 1RT7A 4D3GA 1YRTA 5J2PA 1FNOA 2CADA 4O4GB 5D15A 1H98A 1KDNA 2XLIA 4A8SA 3QIDA 2B9XA 5HI7A 3KK2B 4J9MA 2IIHA 5LSRA 1RTDB 1S77D 2V9KA 4X66J 2WB4A 4DG1A 4B9VA 4F2SA 2AJ4A 4J9VA 4IRCA 4ED7A 5KFRA 3M8SA 3NGRA 2LA4A 4WPAA 2MPUA 5EWGA 1NXIA 3MXHP 4KH1B 2LFVA 3R5GA 3R3TA 1JWWA 2W4PA 4OX6A 1LWCB 4ETZA 2D3OR 2DPJA 3U1MA 3P4UB 1SXLA 3KLVA 4A8MP 2GV1A 1WACA 2A6OA 2IM2A 1BHNA 2W1BA 1YSJA 2I2YA 3QT5A 2W9AA 1SQGA 4X4RA 1FF2A 1ZBTA 2KDOA 2RDIA 3G86A 4JUZA 2FVCA 3IN5A 1ULRA 3OFFA 3M6VA 1RHUB 2ZBCA 2DGTA 4U6PA 2C2OB 4I6AA 2NQPA 3T1HF 2I8EA 3SCLE 3BKUA 5IS2A 4K8RA 1X9MA 2DH9A 2BACA 4J9KA 4DL0C 3D6HB 2RQCA 3PJXA 5M2RA 1BE4A 2DBBA 3AB4B 1NKBA 1ICEB 3DDIA 2Y9HA 4KTQA 2CVEA 3GB0A 4WU3A 1KEKA 4PABA 1HNWJ 2IA6A 3QRQA 4DLEA 4DX5A 1DZ5A 1J5OB 2DITA 5KG2A 2VDHA 3TX0A 2UVVA 3D6FB 2GHPA 4X62F 3VWSA 1Y3KA 2VG5B 1CJTB 2OPSA 1YJVA 2RH3A 3CJQA 3AJDA 1LWXA 4QJVA 2HMIB 2HVHA 2QT7A 3OUYA 1DURA 2GNKA 1XIQA 6FD1A 2XS7A 2RS8A 4RLEA 4ERDA 1B99A 3OTBA 2UUCJ 3MR7A 3RB3A 2DXEA 2C3MA 3JTPA 4ECUA 1N0UA 1RAHB 3DLBA 2J7KA 3FZ2A 1Q95G 2VBWA 2COLA 2E1RA 4CP5A 1VISA 4ED2A 1KBRA 4LF8J 3RBZA 4ED6A 4MT1A 4M5HA 1X8DA 4CT8A 5LM7E 1E6YB 3GIMA 2QSFA 4DV1F 3CWJA 3L7UA 2JX2A 3IMQJ 3MWBA 3OTOJ 1N5SA 2RB7A 1RWKB 1J5EJ 3MCMA 4KE5A 4ENOA 2HRYA 5CQGA 3QPIA 3IBWA 2GGPA 3PRBA 1T05B 2LP4A 2LQ5A 1NPPA 4X4SA 1C1CA 5KFCA 2AYGA 2FHMA 4B9MA 4DR4F 2AEJA 3BPDA 1PKUA 1RU1A 1TUGB 4JV0A 2UXDJ 4K2XA 2BA9A 3R2CJ 2KB2A 4NYZA 4KBIA 3V81A 2Y1LB 5K14A 2BEFA 1IM4A 4NLUA 1XJWB 3DRRB 1FJ7A 1QY7A 4V1Ak 1VI7A 3GZ7A 2OFHX 2YKAA 3NAIA 1SI9A 2HVZA 2M70A 4X2BA 2MZJA 1JXVA 3MM6A 4JI4F 4FXVA 4J9PA 5HP1A 3U7JA 3NNCA 5KFVA 3SV3A 3F56A 1V3SA 3TW0A 4LRAA 3RRKA 4QYZJ 4OX9J 3M2UA 3THPA 2BQUA 1NDPA 4KFBB 4DR3J 5B08A 2R2UA 4I67A 2EK6A 3OPKA 3VZHA 4L76A 3NAHA 1FJEB 3EDRB 2DO4A 1S1WB 3M32A 4K4ZA 1S9GA 1RYRA 2HURA 2VQEF 2MQPA 3DYAB 4DFPA 3VAKA 3VGUA 2LECA 2CYYA 4A8KA 2MKJA 4IR9A 2R2RA 4KKOB 1QAJA 3K17A 2XMTA 1S72S 2MTLA 4IG3B 1N5YA 3JSRA 1D9FA 4ZVFA 2C3YA 1U0SA 2XZWA 4B9LA 2VUGA 2APOA 4F4WA 3BQ0A 4TVAB 4IOBA 3GTYX 2ZNYA 1WC4A 3PXGa 3Q89A 2HHTA 1T9WA 3J81U 3IP0A 1N34F 4I2QA 2DXFA 3SSQA 3ILLA 4U7UD 4LREA 1Z2LA 2BBEA 3B6BA 2RRBA 4HEA9 2CZVC 3I0SA 1B4SA 1UPMB 2NUHA 2ZC3A 2UXCF 1EX8A 1HNVA 4ED3A 2JC0A 4ZJLA 1VRTB 1XNQF 4C97A 3TP2A 2J0QD 4JI2F 4EBCA 3KK1A 3M1VA 1HARA 3DLEA 2FQQB 2V8DA 1S99A 3P8BB 3KKFA 4Q43A 2W4DA 5IM0B 4DSJA 1AT1B 2W2OP 5CYMA 2FHJA 4ECVA 1G3OA 1ROFA 1ZZFA 5F9LA 2DPIA 3W2WA 3AD8C 4WFBQ 5LOQA 5AJ3J 2MQOA 1HD1A 1M1GA 1U47A 2XMJA 3E01B 1K44A 3TR5A 1VIXA 2IBOA 2XCAA 1T94A 1N56A 1X0FA 1SJRA 2GAGC 4K2JA 4ZVHA 4P74A 3T9NA 4Q2LA 5F8LA 2OIHA 3IRXA 4M5DA 2HIYA 2VG7B 9ATCB 2KXHA 1ZPVA 2DHGA 4H4OB 4IRDA 4O0NA 4C2MA 4UF4A 2W24A 4FF2A 2QN6B 1FA0A 3WX4A 4U7UK 1TZ0A 5DM7Q 4B3RF 4X4OA 2XCPA 1KLNA 2XMAA 5J2PB 1FJGJ 2CNNB 2JHEA 4C8LA 2R8HA 1VR6A 4F36A 2DGWA 1GQEA 2ZHOA 1WC6A 4EFAC 3GIJA 5ETOA 2XSJA 3LALA 5IC4B 3H4BA 2QE5A 2EEYA 3IC1A 5KAKA 1XMOF 1RKIA 4ZVGA 4UT4A 4DR6F 3DM2A 4F3OA 4ECRA 1X5TA 3H8YA 2HRTA 2IDEA 2VPXB 4WTYA 1FX2A 1WOOA 4ZS6A 4JI6J 3MCNA 2E9RX 2VA2A 2JEJA 4NXMF 1ZAVA 3IGVA 1E6VB 2VA3A 1UVJA 2Z4PA 1URNA 1Y10A 4NE9C 1UVLA 3HFZB 4F4ZA 2AMCB 3AA9A 1KFSA 4Q8EA 4NZ7A 4NLPA 2GJFA 4F7VA 3FFIA 2A2CA 4RWXA 3WX8A 3MR3A 3K59A 3VR1A 1T9XA 4YR0A 2R2TA 1LWFB 1KTQA 1HQUA 3GCWP 1FKPA 5F8IA 4UW2A 3D67A 2QL5B 1XR6A 1VFJA 3LGNA 3CJ5A 1CPZA 1YJWS 3MR2A 2R7QA 1WD6A 1HMVA 2NCKL 2HHHJ 2G2OA 2DR5A 2ZM6F 1AROP 2D9PA 3PW5A 2OH2A 1U1KA 3I31A 1HNIB 4QZVB 5L38A 1TKXA 2EXUA 2K1RB 2GMJA 3G6XA 2BJ8A 1EHWA 2XI2A 3DOLA 2GS8A 3T1AA 4J9UE 4WE1A 3C14B 5HQLA 1MNEA 3BH7B 5I3UA 3H98A 2ASDA 4JV1A 4ZVRB 3LGMA 1QUPA 1VOMA 2EBGA 1X4GA 2HVIA 1VLYA 1WELA 3M8WA 5KG1A 1R43A 3GJTB 2XY6A 1VBZA 1FVQA 1HKAA 2KH9A 3EGNA 1X5OA 2YNFB 1H2TZ 2EK1A 5L1JA 3GG0A 2PFFB 3VCDA 1MU2B 4XO0A 5H1SV 3T1HJ 2EG2A 1JJ2R 1PYTA 1NH7A 3CIMA 5IT4A 2OPSB 2B7BB 4Q5VA 4XIUA 5F8NA 1D09B 2ZOMA 3GSDA 4IOAQ 1DJ0A 3OUYB 2C2KB 1K1QA 3SDEB 1WEYA 5I42A 4LF4J 2BKNA 2OMLA 2KRRA 3VV2B 4NA3A 1L5UA 2C3PA 4U96A 2DJWA 3OTCA 4LFAF 3M8ZA 3HZEA 4TNOA 1H72C 2WONB 4ID8A 4RW9A 4DQQA 4KH0B 5DJBA 1CS4A 2FVQA 3DNCA 1GXTA 2DEIA 1KOHA 1NHVA 2DHSA 2RAQA 3H2UB 1IBKJ 1OPIA 4KR0B 4ZHRA 3T3FA 1ZM3A 4GKKF 1DTTA 2OPQA 4K5RA 1WI8A 3B8HA 2VICA 1U24A 2LKZA 2ZEJA 5KT5A 3HD1A 2GJIA 5A6WA 2IYIA 3ISNC 2FUG9 2QX0A 3FC9A 5FDLB 5D6GA 5DGBA 1HFEL 1FDDA 1TK5A 4HKQA 2OTJS 4C8KA 2I9SA 4QR2A 4PUOB 2PMZD 5CYJA 4HACB 2WTFA 3S7RA 1WF1A 4PQUA 3W60A 3HPOA 3SYZA 3KFWX 3DLHA 2KXFA 1AXQA 2VDIA 1HLWA 1B0PA 1RXOB 4FNHA 4DV1J 4R8UA 5DM6Q 3LAKA 4B3MF 3R9LA 3ITHA 2BXJA 2B4OA 2XWXA 3TRGA 1JMTA 2V94A 4NPOA 1NK9A 4KJIA 3CW2C 5L39A 1UFWA 3T5JA 2XO6A 3CC4S 1X9WA 4EK2A 1XMQJ 5HP1B 1P9QC 4QR1A 5HVHA 3HX9A 3MZIA 5IQ6A 1GTHA 2XS5A 4DR4J 3M2UB 4WK3A 4LIRA 5E3QA 1SH0A 1D0EA 2W8LA 2YTCA 3NS7B 1FEHA 5C24B 1GEHA 2HQDA 1Q5YA 2LDIA 3QT8A 4PZVA 2QLJB 2G2ZA 3MTKA 3H2LA 2RIJA 3V6KA 3M32B 4LFCF 1S9GB 3RAMA 2V0NA 1JK9B 2JL9A 3OFGA 2RHQB 1HI8A 5A8KB 4FYYB 5L9NA 4DCOB 4NLQA 4JI4J 4ZKAA 3PVXA 2Z2YB 1SQEA 4CLFA 4TXSA 2E7XA 3OXFA 3H40A 1KSPA 4DSIA 3OQ2A 5KFUA 2QGFB 2B43A 4KT0C 4RUCA 4NCBA 1N5TA 4CM2A 4OLOA 1TL1A 1SB6A 1R0BG 2IAJA 3HP6A 1IKVB 1KN6A 1SKUB 1S6QB 2HIQA 1BY9A 1Y4ZB 3GIRA 1A9NB 1RWPB 2H9ZA 2HFZA 4O3SA 4KHPJ 5KFSA 3L09A 1CC8A 4EBEA 2RD5C 2RHSB 5CA5A 1D9AA 5D0GA 2FZKB 5KFTA 1M1HA 2PN6A 4RUBA 1WC1A 1MMLA 2CQHA 3W9HA 4EZ6A 3CDUA 3J7Z5 5ETVA 3HM9A 4F67A 1HHTP 3ENWA 1S59A 2QG9B 1RADB 3CNQP 3IWNC 4B9UA 1XN9A 3PTWA 2CJ9A 5HMZA 3LP2A 2ZVSA 1JLAA 4PWUA 3MAQA 3CCMS 2CZ9A 3R8YA 1DTQA 2KHCA 4KGKA 3DGPB 4NZ0A 4Z37A 3QWUA 4ITSA 4DR5J 2JLEA 1S4FA 3AB2B 2BM0A 1R8HA 2CPJA 3RR8A 4MKYA 1JLQA 4F8RA 3HZGA 4UUWA 2Z2ZA 4JB8B 5H9FJ 2LA6A 3I0RA 3NCRA 1N34J 4W98A 1TKTA 2IM3A 1U09A 3TUPA 4H4MA 5KFWA 1WORA 4E0DA 3KHHA 1S1VB 3QO9B 1LW2B 1X31C 3S6EA 2YKMB 4TQRA 2UXCJ 3OBIA 4WFNQ 4YR2A 1XNQJ 1U0HA 3Q2SC 5ETQA 3TAMA 5B0BA 4HH1A 4YDDB 2KU7A 4OFZA 3ENVA 2H5EA 4N41A 5EX0A 2NXNA 1I1GA 1C4CA 2C42A 3TEGA 1S1UA 4TN2A 2CQIA 4TU7A 4LF9F 1VMBA 4UOFA 4LR9A 2E7WA 3MEKA 3KG4A 3KMSA 3IRXB 4USMA 1RT2A 3HVRA 4QW8A 2YWFA 1NDKA 3CC7S 5KFDA 3KMQA 4O3NA 4PAAA 2K06A 3NOGA 2QMUB 3TANA 5HMXA 2ZH5A 3MD3A 1TKDA 5DDOC 3QRRA 3ZXWA 1W25A 1VQ5S 4DF8A 1UEUA 1YX2A 2FIUA 1S4EA 4YEAA 3MMBB 3FCVA 4WP9A 1VK8A 2QC3A 4B3TJ 3VAGA 1ZAWA 3L9ZA 1GTEA 1WHYA 1VRUB 1KS2A 3FQKA 4GO7X 2H4WB 3E51A 4BLGA 1RTJA 1NK6A 4Q0BA 4P9SA 3PFEA 4AD6A 4DEZA 3W1YC 6FDRA 4ER8A 2HQGA 2IVYA 4CZCA 2FVRA 4X64F 1P1LA 1Q7YT 1HWKA 1RBOB 3MGJA 3MECA 2E9ZA 3M2RA 4CLUA 2GA7A 3FRZA 4YR3A 2CG4A 1X4CA 1LK7A 4C8MA 1DAXA 3ONQA 5KG5A 2ASYA 4YFUA 2ACMA 4M94A 4Y2KA 1RT4A 3MFIA 2OGUA 3RRGA 2HFNA 4LF7F 1GH8A 4DU8A 3IM8A 3JAMY 4MIAA 4U67Q 1T11A 2AF6A 4K4SA 3ICLA 3CCJS 1RT6B 1XMOJ 2CQPA 2FHOB 1C4AA 2Y1RI 1A7GE 2C3OA 4DZDA 4DR6J 1G1XA 3LP0A 3O1LA 3HKZD 2HBRB 2C2EA 3O2IA 3O44A 4ZVPB 3LP1A 2KFZA 3AAWB 4DV4F 3ZNUA 5H9FK 1NU4A 4FS1A 2O5DA 2NYIA 3TJAA 1TQLA 2QL9B 4FBTA 1ZA1B 1WEZA 2FD2A 3P3DA 3KLFA 2XS2A 1KP6A 3GR0A 3L95X 4ZVEA 3DKDA 3BS9A 2HQCA 3UI3A 2BJ1A 3R6GB 2IM0A 3OL6A 1FTCA 4M1KA 2XLKA 3Q8YA 1K1SA 2VL1A 5A8RA 1QE1A 2VFRA 2DHAA 3JAMU 4DV5F 3LPEA 2AGOA 2RQ4A 3W8GA 4Z2XA 2BZ2A 5A8WB 3OV7A 3TA1A 4HHUA 4ATNA 4I69A 4OJ3A 2Q66A 1VQ6S 3UN3A 2VPWB 1S6UA 4QW9A 1TL7A 5KFIA 2HLUA 1CULB 4CH1A 1HQ2A 3T5HA 4WFYA 2YX4A 4D3HA 2BR0A 5KT3A 1RTHA 1R0CB 1PC4A 2DHHA 2XO7A 4WP8A 3WC0A 2QYCA 4KHRA 2IMWP 1U48A 3OL8A 2CJKA 4JOUA 2YNHA 2HHVA 1DQAA 4RW9B 1N6QB 2CPDA 5AE1A 1KHVA 1HI0P 4IH7A 1CS4B 2PEBA 4ZLPA 3P6YC 3U1NA 3WC2A 2WVCA 2BVZA 4O3OA 1CJKB 4A8YA 4J9RA 1B0TA 2YH1A 1NAQA 1H73A 4NMLA 4J9SA 2OPQB 1YQHA 4USKA 2HYIB 3I87A 1UZHA 4OI6A 1PBUA 4IQMA 4IFVA 3KJVB 3HVTA 2X3DA 4J7CA 3KDNA 1UEKA 2YNIB 3PEHA 1Z4UA 4J90A 1B3TA 1P27B 4LFAJ 4FF4A 5LMUF 2P6TA 3MTJA 1T9VA 3OVAA 2QFJA 3K57A 4M5MA 1HWUA 3LGHA 3NOCA 3U27A 5KTQA 2BKPA 1P6TA 2R7RA 1HQEA 2R7WA 1VQPS 2HGLA 5J1EA 4ECZA 2MZRA 5HMYA 3G82B 4OYWA 3CIZA 4B08A 2R42A 3IS9B 2ZH1A 4NLYA 4KGMA 2XM3A 2F8MA 4MK7A 1JLCB 2B8QA 2PT0A 4WWSA 1GMUA 4DR7F 1RLCL 2IMOA 5I4MA 4IFYB 2DNNA 1NK7A 2M4MA 4DPWA 1PILA 3KJNB 2Z57B 1FWLA 4OYAA 1YBTA 4I4BA 4B3MJ 3EGZA 2BJ9A 2JEFA 5K5MA 1QD1A 3RAQA 2FTRA 2MY7A 2RE1A 5HK4A 5JUMA 2BMBA 2R7UA 4ZPAA 3SCIE 1IKWA 1RUSA 2A6MA 2ZNZA 3GV7B 5T7LB 3Q8QB 3HULA 3VAMA 4DXLA 1RQ0A 2IAJB 3CE8A 4AUKA 2VFUA 2D3ZA 1WC5A 4CNYA 3OTDA 4LVOP 4QYRA 3JXOA 4N5SA 2CRLA 3LO3A 3GIKA 3G4SS 3AJ2A 3F41A 5KFMA 2Y0SD 3D3BJ 3EE3A 2Q79A 4EMDA 3BB5A 1WKKA 1WF2A 3JQJA 2HVEA 3CCQS 4KV8A 4OZNA 3K5MA 3CJKA 4BS2A 4MYUA 3BBFA 3UDCA 2GQQA 2HNYB 3DHXA 1VQ4S 5HVGA 4RBUA 3NXZA 3PR4A 3VGTA 2XI3A 3HHDA 9RUBA 3HHKA 2VOOA 4ZK7M 3FEZA 2MGZB 1HYSA 1YG0A 1NB2A 2MKCA 4PCQA 4J9OA 4RU9A 2K7JA 2RRAA 1Q8IA 4ZN3A 3LF0A 2IA0A 3S01A 1YHQS 3F44A 3IRWP 2WVBA 4ZP9A 4A46A 4FF3A 5KFAA 4B9SA 3IG1B 3DDNA 4L3NA 5B0AA 4C9DA 1JLQB 2J9DA 4CH7A 1PC5A 4YB5A 3I0RB 3M8QA 1VHFA 3W8PA 4FKXA 4RNFA 3BGUA 3AOAA 1S6OA 1U1LA 3EJMA 1TKTB 3HFVA 2C1EB 1TFWA 3UDEA 3AJ1A 3UDVA 5HSPA 2CDQA 2N4DA 2ERRA 3HI9A 3HK2A 2QTWA 2CUYA 3MEGB 3ZTPA 3GP9A 3W64A 1D1UA 1MN9A 4OYXA 4DUZF 2I0XA 4DR2J 4ES3A 1U1MA 4WKYA 4X4UA 3TQ1A 1S1UB 4M63A 3NS6A 3R27A 1Y00A 1F1BB 3RW6A 1VJQA 2YWWA 2BV3A 1XR7A 2HW3A 2XULA 3J80Y 5B0GA 1RTIA 2ILYA 1S1TB 1JLFB 3MM5A 4PWDA 3B54A 2WZ1A 2AZ1A 5LJ3Y 4V19J 2EFQA 4CYUA 2PI4A 2K8GA 1Q78A 1N36J 1S5ZA 3PFOA 2ZBPA 1C0UA 3MI7X 3QJJA 3BO2A 4LBHA 2XNQA 4RPFA 2VFSA 3NWRA 3PJWA 1VC5A 4NEYA 2GO9A 2DGSA 2HVDA 1T8EA 4NLGA 2P2CB 3OLAA 4DLGA 4Y0FA 2Q1LA 4F02A 2WOMB 1U8WA 2V67A 5DG9A 1X4AA 3VZIA 4DV7F 1FFGB 3D1QA 2YKPA 2A2DA 3DC2A 3W65A 2FLLA 4KY3A 2PGCA 1T7PA 2FDNA 4JI1F 4F2RA 2GVZA 3IO1A 1JJ4A 1RT4B 2ZH6A 1I94F 1TFYA 2CQCA 4ZJQA 1R27B 1PYOB 5CXTA 1N0VC 1IM6A 1K0VA 2D74B 2V34A 4J9NA 5G0RA 5LSOA 2B0GA 4WBFA 2PE8A 3KTQA 2FJAB 2R9LA 4AT1B 2I5JB 1B7FA 1YRUA 2MHEA 2DNHA 1IJFB 3ET6B 3MMAA 3ZFVA 3UN5A 3HO1A 2JZ5A 2DR8A 2H51B 3N6LA 2E1PA 4IQXA 4OI3A 4M5IA 4Z7CA 3NGTA 5F8GA 1V5IB 4YN3B 1KQSR 2VZ9A 1L3VA 4F4YA 3C15B 4LSLA 1DLOA 3K89A 3KLFB 1FXDA 3V6DB 1U1OA 3D9BA 4E98A 1A0OB 4L6V3 1WHVA 4F04B 2HQIA 3W5YA 1U2RA 2B5JA 3ZO7A 2LLZA 3DRSA 4X4PA 3HDSA 4JYAF 2ROGA 1TAQA 4NX9A 1PJ5A 2B7CB 4KGZB 1S0NA 4DV4J 3MOJB 3LOUA 3E2EA 4Y6IA 1QSLA 1UA0A 3A8JA 3CDAA 2QYGA 4W90B 5B0FA 4PG4A 1PIEA 2C2ZB 2ZH2A 2CQ3A 2AD9A 1MWYA 4X66F 4ZLNA 5HJXA 4XAKA 1OY8A 4QIGA 3R5AA 3TQEA 1F2HA 1KQGB 5HATA 3POTA 4MKAA 1WDTA 3QFWA 4P10A 1DFDA 2YNHB 1KLMA 4E8UA 5D4LA 3CGIA 2V4RA 2W9CA 2DNQA 2ZE2A 3DMJB 3K5PA 3BGFA 1OJ4A 1GXUA 5KFGA 1SC1B 2DR7A 4F4XA 5MAOA 2HRUA 1RAJA 1KVJA 2JEIA 3LWLA 5KT4A 3I5CA 4N7TA 4ZN1A 5J2QB 1Q1KA 2KT5A 1EJ7L 3MEEB 1DHMA 1M5KC 4LUBA 3C6TB 1F3FA 3MCOA 8AT1B 1N5VA 1NSQA 3KK3A 1NSAA 2KJWA 4ES2A 3CJ3A 3KJQB 4DCPB 4PR6A 3RAXA 1T02A 1Y0HA 2CAJA 3OR1B 4RW6B 5K20B 5CABA 3OLBA 1TV6A 2IHR1 3GFYA 2MSSA 4CO4A 4J37A 4NOHA 3A8KA 1HQEB 4CO5A 2I1RA 4WYWA 3OJSA 4ZCMA 5L1LA 2P9EA 2HHWA 5DQHA 4FVCA 3ZZRA 1C1BB 2QJ3A 3ZZPA 3M30A 1T3NA 4C0BA 4B02A 1RE1B 3G6VA 3EICA 5D3GB 1ZOTA 3TOQA 2CQ0A 4DN9A 2FJXA 4PG6A 3HSGA 2GAHC 2DD8S 1NLKL 4WF9Q 5HO4A 2OMOA 2ZZMA 2G0CA 2G2YA 4I7FB 2YX7A 4M5NA 3H5XA 5KOXA 1OYEA 2CQ4A 2Y8WA 3AA8A 3Q8VA 1UAWA 1FNMA 3KWMA 4RW4A 2MJUA 2UUCF 4G3IA 4Q45A 3V5RA 3VALA 3M9NB 2GC8A 3HF5A 2E9TA 1J5OA 4Y3CA 3LQVA 2AJ1A 4ETXA 2EFPA 2J0XA 2C3UA 5U47A 3Q2TC 4Q2MA 1BWVA 1CEZA 4LF8F 4KQZA 2YKQA 1T03A 4G1PA 3DDKA 2UUTA 4M5JA 3GPAA 1YIJS 2VG5A 1F6TA 3ENAA 3VHQA 3GONA 4NLTA 1U6BA 1PG5B 3HHLB 2Y1JA 3AY0A 3D4JA 4JV2A 2JEGA 4I2PB 3D5MA 3FBFA 3RUBL 5E3CA 4UQGA 2XC9A 1CVJA 1J5EF 3MOZA 4ES1A 2W2MP 3VTIA 1FDBA 4X4NA 2ROPA 2GMHA 2FHKA 1ZAXA 4HDHA 4P6QA 1U45A 2E1CA 1BGXT 4X84A 2DYAA 3A3NB 2RF2A 3QZ8A 2G0JA 3ENQA 4C8OA 2MZTA 3P5BP 1HYSB 1YJTA 2O3DA 2PSZA 4DS4A 4IRKA 1HHQA 1VQ8S 4GVLA 1QSSA 4LSNA 2UXDF 1VQKS 1FCAA 4U7CA 1M5SA 1J27A 3LPYA 3CULA 1N54B 2FLNA 1E6YA 1S9EB 3I96A 3HMJG 2HHSA 2MKYA 1MSWD 3M9OB 1SL0A 3PG9A 2CQ1A 1MLAA 5LXRA 4Q7AA 3P45B 3SCJE 4AXIA 4C98A 1RAEB 4CLZA 1IJEB 1MMNA 1REGX 4P71A 1FWKA 2YBVA 3ZTOA 2Y3YA 5HL7Q 2YWEA 4OX9F 2OEKA 2HS0A 3QSIA 2XWYA 1KKHA 1C2PA 4A8QA 3R7BB 1O0PA 2FHJD 4K50A 1QAYA 1FXLA 3CCZA 5DDRC 3DRRA 3W7BA 3SQGA 1U25A 2R7XA 4H54A 4O3PA 5C7PA 2FC9A 1TTHB 1ACMB 2V4QA 1Q0NA 2CJBA 2W8KA 3A1YG 3BH6B 5HVFA 1OS5A 4NLXA 3OR2B 3T5LA 1TL3B 1N88A 1RTIB 3DLJA 3OL9A 3NWGA 1BWEA 4CTAA 2IJFA 4OYMA 2QA4G 2VPYB 4DF4A 4DS5A 2KT3A 4KFBA 3TEHB 1RJJA 3OXLA 1UWAA 2ZD1A 4BWJA 4NLRA 2HWTA 2VODA 5GADU 1R31A 4X65J 2W9BA 4WCEQ 1YZ7A 2LU2A 4IH6A 1S1WA 1WC0A 3EGVA 2B6AA 4P2XA 5DQIA 3BDPA 3GWCA 5I3QA 3J81j 1NM2A 2WW4A 2YXLA 3KG1A 2Z2MA 1RI7A 1YKWA 1Q81T 2B9EA 3LA0A 2XSFA 4LVNP 2A1BA 3Q86A 2QMXA 3GG1A 1AB8A 3OTEA 4CIOA 4TYBA 2CPZA 4NYOA 2M8DB 1N32F 4IG3A 3RGIA 3PX0A 3TZXA 4NYPA 1U1RA 3VGSA 4Y28C 3CDBA 1SIWB 2W2PP 4MKBA 2GVZB 2WVEA 3BGRB 4CO0A 3KLEA 2WHOA 4GKJJ 3BV8A 3OSPA 2E66A 2G1HA 4WJBA 4DFJA 1RWUA 1WWHA 2ZKTA 1FRLA 3IR5B 3FKBA 4DV3J 3OD2A 4DV7J 3GV8B 2G1DA 2V5HG 2ASLA 1YITS 4S0MA 4AFFA 2ZHAA 2VB6A 4OV1A 1DY3A 4A48A 5M2PA 5KFBA 2J5AA 2ATLA 4PWWA 4CLPA 3J7AN 2FY1A 1VRTA 2BJDA 3IR6B 1APSA 3CCES 5K9FA 2HFVA 2F8HA 5ADZA 3HVAA 4TLRA 5E0OA 4NLVA 1BQXA 1DLOB 3GJSB 3MPVA 1QTNB 3MAHA 1UA1A 4EYHB 2Z2LA 2UVWA 2G0IA 3MUVP 2KYZA 2DRDA 3TJ9A 4JI7J 4J9QA 4CLTA 3SZ2A 3MM9B 1U1QA 5IM0A 1RSCA 2JOQA 3PW0A 2DNRA 1IBLF 1WHWA 3M2VA 4EYIB 1NPKA 2O01C 3MM7B 4GC6A 1IKYB 2ZH3A 1ZS6A 2HK3A 3KLHB 3QLHA 3D1OA 1FJGF 1W2IA 2VC0A 2DNMA 3E01A 4YS2A 3VVUA 4USIA 3JTNA 4LF5J 4KSEB 1FT8A 3QGPA 3JYTB 4C3MA 3Q83A 1FRHA 2FJDB 4LMZA 3KOAA 1FDNA 4JYAJ 2LYVA 2H54B 3BKFA 2MQQA 1GXLA 4LQ9A 1KLMB 2GCFA 2VG7A 3OVBA 3QSYB 4H4OA 2FGOA 4JI6F 2HPUA 4KHMA 2ZE2B 2MLXA 2KFYA 4F3MA 4DFMA 4JI3F 2OPPB 2FJWA 4EI2A 3I5AA 1S0MA 1F5CA 1SJ1A 3J7A1 4DPTA 4M5KA 3IWXA 1EP4A 3MPUB 1QDUB 4Y34A 2QA1A 2KZMA 3FJ2A 2RJZA 1KHWA 3JQKA 2RS2A 5GAHU 3KK3B 3UR3C 3UR0A 1S48A 4C8NA 1JXLA 4EO6A 4JI5F 3KHGA 3FGVA 5EDWA 1K0TA 2J8AA 3UD5A 2HHHF 1E6VA 1TV6B 3ZZZA 2EFOA 2JNJA 3W63A 1KC8T 4ZCKA 2D7SA 3R2DJ 1GK8A 3WQPA 1HWIA 2XMMA 1RAIB 5HN0A 4A8OA 5FJ4A 5F0UA 3V4MA 4DX6A 1VQNS 3ISZA 5E3RA 5T14A 4LR7A 1UFLA 5CYQA 1LWFA 1BQMA 3M30B 2LXFA 2MQMA 2V9WA 1QVGR 1UTAA 2NPFA 1TU0B 3CCLS 1VQLS 5C42A 3OHBA 2JC1A 2XMWA 5KT6A 2M3DA 2MMYA 3FEXB 3MF5A 1HNIA 2AX0A 1JNRB 3DHWC 1Y11A 4EU0A 2FZCB 2K1RA 3UVJA 4P73A 3GJRB 3G6YA 3GU0A 3X1LB 4UZCA 4NASA 3C14A 2FJBB 4LF4F 1UL3A 3UD4P 4XK8C 1Y5LB 3U1LA 2SXLA 4OHVA 4RW4B 1KONA 1MG7A 3RW7A 2J7UA 5L1IA 5E5NA 4WZQA 4FZVA 4DL2A 5F3TA 4ZPBA 5C25B 3O3LA 3UQSA 3HXMA 3MAAB 3CD5A 2YNFA 1YJUA 1MU2A 1RHJB 3W2VB 4RUAA 4QU6A 1T03B 1SJFA 5J2NB 2RILA 2B56A 2ZDPA 3VAJA 2BABA 4JI0J 1IBKF 3D0GE 4OL8A 4LRDA 2N82B 3BM7A 2R8KA 4N77A 3SDEA 3ZTQA 5K8MA 4FDFA 5H9EK 3P49B 3D0HE 4ECYA 4DHVA 5KG4A 4PXBA 2DCLA 4KGXB 1X7VA 3IAM9 2RF2B 4ANDA 2DR9A 4MIWA 2AYBA 2GHVC 2WONA 1MROA 4MTPA 4C3LA 4R0JA 4LJMA 3QGHA 1X5PA 4LSNB 4JV5J 4TU9A 1NJIT 4FS2A 4LQ3A 4WFAQ 2BW2A 3RG6A 1JKHB 2OD4A 2YWGA 3LANA 3MPWA 1ZM9A 5F8HA 3WIUA 4IUFA 2YWKA 2KFNA 3DXSX 1SJ3P 4URSA 1OO0B 1XMQF 4HTJA 3I56S 3NCPA 5BJRA 5FDLA 2JWNA 3O8WA 1VJWA 1HD0A 4LF2A 1X4BA 4PUOA 2MKHA 4M95A 2GO8A 2DEJA 3NP5A 4HACA 1UJ6A 3PW2A 3K5NA 2KM8B 3DLGB 2GX8A 3HT3A 5KFPA 4I56A 3N6NA 4WKRA 4CT9A 3SQGB 3I55S 3M05A 5K8OA 2P9GA 2PEHA 2HZVA 1DQ8A 3NGDA 1NUEA 1HNZJ 3BGLA 1H74A 2MKIA 4LRFA 4RBTA 2MZSA 4OHXA 4CTAB 2QV6A 4G1QA 3KLGB 4DPXA 1F60B 5C24A 3TUJC 2UV8A 2ZD1B 2W9BB 5B0CA 2HGNA 4ZPDA 3Q23A 4J9LA 4KHPF 2D3O1 2N3OA 1SJ4P 2B6AB 4C7QA 3W61A 5DG8A 5A8KA 1UKUA 2NXCA 3C6UB 2ZJPQ 2BKOA 5KFZA 1X0PA 2J6SA 4BWMA 1S7HA 5J1PA 1FXRA 3IM9A 2B4UA 1QSYA 1V3RA 3TYTA 4L74A 3EVOA 5EN1A 1NCLA 3L3CA 1IKVA 3ILJA 4IDKB 3QIPA 1S6QA 3J7ZT 5F3ZA 1JB0C 2VC1A 3ZC4A 2XG8A 1Q16B 4QIFA 1YBAA 5IWAF 3A3OB 4DR5F 5A2QY 5JXSA 3KLEB 3CJ0A 5HROA 5KFOA 3UPFA 3TA2A 2OD6A 2ABYA 1T9UA 1Z2ZA 4CO2A 1K8AT 4HT5A 3FRYA 1YI2S 3SSSA 1NJXA 2RUSA 3TAQA 1U2FA 2BQRA 1H3DA 1N32J 1VRQC 2BYCA 3L7OA 5KFNA 3CSKA 3A8IA 3D6MB 5DETA 2ZJQQ 2H5IB 2IC3A 4RNNA 1G6BA 1U7LA 3M8YA 2R2SA 1FDAA 3DGPA 1S0OA 2HHQA 1FKAF 1RHRB 3FCWA 4K4UA 5IC6B 1U2CA 2HFSA 3FUYA 2RU3A 4USWA 3CMAS 1Q4RA 3T9ZA 3FQLA 4CLLA 3RB6A 1W26A 2V4JA 2JJ4D 1FHTA 2CXEA 2ZDOA 3M2VB 4PYAA 2ROEA 2EI5A 2KG1A 2D9OA 1IBMJ 2ZWPA 2EW9A 5BYRA 1S1VA 2DT9A 3QO9A 4ZPTR 1LW2A 4HLBA 2YKMA 3QLHB 1Q8BA 4C8ZA 4TYAA 1PAEX 4WK1A 4QYZK 4ZPVR 2MZQA 3PHTA 2F7VA 1OWXA 3EPGA 4B3TF 1NZAA 5E41A 3FSYA 3PRVA 1Q8LA 1IBLJ 4A8WA 2VFVA 2DTJA 3ZTRA 4CH0S 1NK4A 1A6LA 1RT1A 4PG8A 4QBUA 4QQBA 3A3PB 2NR0A 3RB0A 2DO0A 4PKDB 4GRSA 3GCXP 1UPPA 2BM1A 3OFEA 1EP4B 5DZ7A 1T3OA 3MMBA 1X4FA 1WEXA 4DL3A 3DU5A 1YBUA 2DH7A 4NXNF 1F2GA 4CLSA 2OP5A 2NSBA 3VQSA 4P2SA 4LFBJ 5RUBA 3Q22A 4PYDA 1VRUA 3I5BA 1TUWA 2H48B 2NSCA 3TVZA 4IO9Q 3KUGA 2ALYB 1SKSA 2RU9A 2WCXA 3ZTSA 2IY5B 5DRKA 4JI3J 2H4YB 5KFLA 1WG1A 2ZFHA 4MFBA 3BZQA 4K4TA 4OZ1A 2XGPA 2R7VA 2LU1A 2WSEC 1WSRA 4UQTA 3SFGA 3DRPB 3M4XA 2HG4A 3E8OA 1FRJA 2VPZB 4NA2A 3TUZC 2CQGA 1RWNB 3QWPA 4I68A 5CYQB 3UWTA 4RL1A 3MMJA 1HBNB 2NXUA 1IR2A 1RT6A 4ILMA 1BQMB 3VVTA 2HLTA 3BYRA 4TQSA 4JI5J 4B9TA 2BJ7A 3OXGA 1H7WA 4HTIA 5DDPC 5C42B 4EEYA 1SBRA 1SPBP 1NSPA 3Q24A 1X9SA 4X4QA 4KIAA 2V8VA 2K2PA 4WFZA 2OFGX 4LF1A 1RWOB 4P7TA 1NEEA 5IT9Y 1XNRJ 3UVJB 2LXIA 2FLOA 4DMZA 2E7VA 2XYPB 3WZ0A 1SC6A 5KFEA 3B82A 3R1HA 5CD4A 1HW9A 3UD3P 4DR1F 2HGMA 4GMKA 4YB6A 3ISND 1RK8A 1FFSB 3M8RA 1WTBA 2R7SA 4RU2A 4UOGA 2DXDA 2HFUA 2F65A 2J8SA 1P9YA 2ZH8A 5CD4H 3DOMB 1GAOA 4FBUA 3EMTA 7AT1B 1HR0J 3H5SA 1D3WA 3DU6A 2CPYA 4DQIA 1JXEA 2M5YA 1NHKL 4R0EA 1KRPA 1UCNA 5A8WA 2KI2A 3QGGA 5C2CA 2VU5A 3ADAC 1HBOB 1M5VC 2P5VA 4ZDNA 1P1TA 1U6ZA 1WOPA 2YPYA 3KLIB 4YB1P 1CULA 3PIOQ 2WSCC 5AXLA 2H1YA 4MIBA 1HPZB 1XBWA 4Y2AA 2XY7A 4ICLA 2CQBA 1PJ7A 2GMLA 1MROB 1N6QA 4ECTA 2BUNA 5DGAA 2DK2A 1I5OB 4G65A 1FERA 3BSAA 1RTZA 1H38A 3PJ9A 3LUYA 1CJKA 3TARA 3ZZOA 3VQTA 1RAAB 4K4XA 3DLLQ 2YKNB 4URQU 1IKXA 2IBKA 1IR0A 4P2MA 3T1YJ 3KJVA 2RT3A 4DZ6A 4IR1A 2C2RA 2YNIA 3QJPA 4C6AA 1KQFB 3GSIA 3SI8A 5FD1A 2JRSA 1M1KT 3EZUA 2WW8A 3NGSA 1SL2A 2NXEA 2FLPA 5BR8J 2U2FA 2XYGB 1UWBB 1TL5A 1SL1A 3DN9A 1X5SA 1RDRA 3W5ZA 2E5JA 2AJ2A 2QO3A 1R3NA 5LSLA 3G82A 2UUAF 2VG6B 1VIOA 4DX8H 3TWZA 3IS9A 2G4BA 3CCVS 4URGA 1LFPA 5E3AA 3ETOA 1NPRA 3HHLC 3CMES 2UXBF 1JLCA 1YJ7A 2UU9J 1PCAA 1RHKB 1VQSA 4G1QB 4IFYA 3DLKB 2RKIB 3SMZA 1YVFA 2OO4A 2LQJA 4R5PB 2ZWOA 2R4FA 4LIWA 2ZOGA 3R5JB 1MMDA 4ELUA 5KG6A 3PYFA 4GC7A 2AKWB 1L3SA 2GQCA 3BSCA 1NK5A 2E44A 1FO1A 2BRKA 4WIIA 2DGVA 4JBCA 4FP9A 3GFZA 1S97A 3OVSA 1JLGB 4USJC 5T7LA 1AW0A 3BO3A 2KO1A 4K0KJ 3G8SA 4RW7B 2PI5A 2E5LJ 1M5HA 3QIPB 2AEFA 3LTOA 7FD1A 3M6XA 3GYNA 3G6ES 3OSNA 1EKRA 4IH5A 2OAUA 1SV5A 5LXYA 4QIVA 3N79A 4Y2MA 4DI6A 3FZBA 4ZITA 4ZIWA 5HROB 2AW0A 4BC9A 1VBKA 2F3JA 4K7QA 3CCUS 2WK4A 1RISA 3Q8UA 2HNYA 4U9RA 2YQ0A 1ZA2B 4XDDA 1VS3A 1X4HA 4DV2J 2R7TA 4C3KA 1D8YA 3QT7A 5KFJA 2MGZA 1TK8A 1TKZB 4F0KA 4N47A 4ANEA 2D41A 2V2QA 3FMBA 1RB0A 2VBYA 4DSKA 4KAIA 3PX4A 2IC3B 2PD1A 2NXJA 3CO0P 2P8IA 3D28A 3THVA 2HNZB 5IWAJ 4L73A 1BXNA 3BF4A 5GMEA 3PO4A 4QCLA 1EQMA 1S6PB 3IG1A 4DR2F 4DX7A 5HANA 2W7PA 3EZOA 2I38A 1RHMB 4Q8FA 3D6TB 1RA6A 4JP8A 2V4JB 3BQ2A 5LT5A 4PXCA 1PSDA 3BR8A 3IFEA 4AL6A 1S79A 1WI6A 3PR5B 5CCLA 1IBCB 3CJ4A 1BMQB 2CIMA 5KG0A 4HHJA 2J9EA 3MEGA 4KRWA 3TZYA 1N36F 2YNGB 5C2GA 2FGCA 5EWEA 2BE7D 4OHWA 3R6LB 2J6TA 4L3KA 5D8HB 5E3PA 1SUQB 2DKOB 4EZ9A 1XQIA 4KO0B 2V63A 2H5JB 4CDIA 2HWHA 1S1TA 1JLFA 1NJWA 2E1AA 1R6VA 1D8ZA 4XPEA 3ZZ0A 3D0IE 1RT1B 1N33F 1M0SA 4NEZA 5CZXA 1BQNB 4JI8J 3EXYA 1NBEB 2YWHA 3DI6B 3PKYA 2OEJA 4DJBA 3M8PB 2V8HA 5J2MB 4MJKA 1RT5A 5IFMA 2Y8YA 3GQCA 2ZHBA 3RBXA 3ZZUA 3J7YU 2GIFA 1PBAA 3NGKA 5F8MA 5FLXY 4CLYA 2DR6A 4OX7A 3P5TL 3QYYA 4LBPA 2EFVA 4WIQA 3VAFA 1HBUB 2WOMA 3I4PA 1OY6A 5GMKa 3IAS9 3Q8PB 4C48A 4RWWA 3EWGA 3HSDA 2RVJA 1HBMB 4MFBB 2DY1A 1SC4B 3UCZP 2J0WA 2V69A 1QVFR 3UN2A 2P9CA 5HJYA 2MXYA 3K8VA 2RDDA 1RABB 2Z30B 2OTLS 2EWHA 5A0YB 4NXNJ 4TY8B 4OZJA 4IG0B 3KXDA 4OLPA 1JLBA 1R8BA 5AT1B 1UVNA 3CCTA 2G9OA 5M2UA 3JS9A 3K2YA 2OELA 4KPYA 1XMBA 1UW4A 4P7VA 3DRXA 2I5JA 1KOOA 3CDWA 2EFGA 3KUHA 3N5FA 4YY3J 3DOKA 1H7XA 1P8GA 1HNXJ 2PA8D 2J7WA 2DHXA 3ET6A 1R7IA 2BW7A 1Q5VA 5FLXU 1TUVA 4FYDA 1MWQA 3KDOA 1Z1ZA 4KB7A 1D9DA 3N6MA 1EETB 1VBXA 4MMOA 2OSQA 2VBZA 2QEXS 2V2ZA 3HD2A 2GHWA 2IVMA 2A18A 3C15A 1CSJA 3MM8B 3SV4A 2X1AA 4TLQA 4B9NA 3V6DA 2XMUA 1FE4A 4PG7A 4RR5A 1AZSB
chains in the Genus database with same CATH topology
2B6AA 4FVMA 2KTQA 4FN5A 1KNZA 5DQIA 3BDPA 2FVQA 3DNCA 3GWCA 5I3QA 2PMHA 4DBQA 3RR7A 1UWBA 1GXTA 2IRUA 4NCGA 1RP5A 5KG3A 1MW7A 1KOHA 2E29A 1NHVA 1VGYA 2DHSA 3LP0B 3H2UB 3KG1A 2Z2MA 2FC8A 1NK0A 1PO6A 1RI7A 4YHHF 1OPIA 3LP1B 1RT3B 4KR0B 4ZHRA 3T3FA 1ZM3A 1Q81T 4CCHA 4ECSA 2WB1D 4GKKF 1DTTA 1VQMS 5CHCB 1F5BA 2EBEA 2OPQA 1WI8A 4K5RA 4QWDA 3B8HA 3IA0A 2VG6A 2XSFA 3PKMA 3N4WA 1U24A 4A8FA 2LKZA 4LVNP 2A1BA 2NLWA 5KT5A 2QMXA 3GG1A 4PXDA 3AH6A 2GJIA 2L48A 2QIFA 1FKOB 3OTEA 5A6WA 2IYIA 3ISNC 4NA1A 4CIOA 4TYBA 2CPZA 4NYOA 2UUWA 2W25A 2Q6BA 2Z0GA 4IG3A 2FUG9 2M8DB 1N32F 2Z8QA 3PX0A 2HHXA 1C0TB 4QR0A 5FDLB 5D6GA 3CD0A 3PACA 5BYQA 5DGBA 1HFEL 2M2BA 1FDDA 2W4CA 2C22A 4NYPA 3J81Y 5D4NA 1TK5A 3CF5Q 1U1RA 4Y28C 2OSRA 4HKQA 4C8KA 2OTJS 3CDBA 2I9SA 4QR2A 1SIWB 3NL0A 4PUOB 2CPHA 1LW0A 2PMZD 2VV5A 3H59A 4MKBA 3TVYA 3DLKA 2RKIA 2K3KA 1UJ5A 5CYJA 2ZJRQ 4K0KF 4R25A 5HBMB 4YP3A 2WTFA 3BGRB 1UP1A 1WF1A 2AWZA 2JVOA 3S7RA 1Y9OA 3GE9A 4R5PA 3LAMA 3HPOA 4PQUA 4RBVA 3SYZA 3KFWX 4ICLB 3DLHA 2KXFA 3N0VA 4RNOA 1VQ9S 4CO0A 1AXQA 4DL6A 2E5LF 2LEAA 2C28A 2R8IA 4NLSA 3KLEA 1FNXH 2IFXA 2W7AA 1B0PA 2WHOA 3I32A 4BHQA 4FNHA 4R8UA 5A8RB 3NMAA 1QE1B 4RKUC 5DM6Q 1U49A 2E5GA 3LAKA 2AP6A 3K0JA 3OSPA 2E66A 3M6WA 4WJBA 4B3MF 2CPIA 1FK9A 3ITHA 1R8AA 4UY8T 3DMJA 2BXJA 4DFJA 1RWUA 2P6SA 1WWHA 2B4OA 2XWXA 2R8JA 3MMCB 1N48A 3TRGA 1JMTA 1FRLA 2ZKTA 3IR5B 2V94A 3VAHA 5GADI 4NPOA 1NK9A 4KJIA 5L39A 4PG5A 3GV8B 1UFWA 3T5JA 2G1DA 2V5HG 2CJAA 2ASLA 2B9WA 1YITS 3CC4S 5J2QA 1X9WA 4AFFA 2ZHAA 2JLFA 1P9QC 4QR1A 2VB6A 1KFDA 4OV1A 5HP1B 1UVMA 4A48A 2AGQA 2GIRA 3MEEA 3V4IA 5M2PA 3HX9A 3MZIA 1IKXB 5IQ6A 2E5HA 5KFBA 2V2KA 2J5AA 3MR6A 3C6TA 2ATLA 5EX3A 2AX1A 2DIVA 1GTHA 2XS5A 1JLGA 1IUJA 1RTHB 3M2UB 4NRUA 1ZM4A 2FY1A 1VRTA 2BJDA 3IR6B 1H6KX 4WK3A 3MR5A 4DV2F 1APSA 1Y7PA 3RBDA 4LIRA 5E3QA 3CCES 5K9FA 1SH0A 4RW7A 2O66A 1D0EA 2W8LA 2F8HA 2AYEA 2YTCA 5ADZA 3HVAA 2CVIA 3CDEA 3MFHA 4TLRA 1FEHA 5E0OA 5C24B 4NLVA 1WHXA 2ZH7A 2DIUA 3K58A 5AXMA 1H2VZ 1BQXA 1DLOB 4HT7A 2HNDB 2LDIA 1YTYA 5KFQA 3MPVA 5DQGA 3MAHA 1VQYA 1LKZA 1TAUA 3OW2R 3MTKA 1UA1A 4EYHB 2D1CA 2Z2LA 3H2LA 1CLFA 2RIJA 2MYFA 4O4RA 3OR1A 2AU0A 1JIHA 2HS3A 4RW6A 3V6KA 2UVWA 3M32B 3D54A 1LV5A 4LFCF 1S9GB 3BO4A 2NZ4A 3MUVP 3RAMA 2V0NA 1JK9B 2KYZA 3CC2S 1JLEB 2JL9A 3OFGA 4J9QA 1HI8A 5A8KB 3ZZTA 1S76D 3SZ2A 3MM9B 2VBXA 5L9NA 5IM0A 1XR5A 1U1QA 2ZZNA 2JOQA 4NLQA 3PW0A 2OJ3A 4O4GA 2DNRA 4OMFG 4ZKAA 2DNLA 4F25A 3PVXA 1IBLF 1SQEA 1WHWA 2ALZA 3M2VA 3Q0AA 4EYIB 1KD1T 4TXSA 2E7XA 2ZC4A 2U1AA 1R8CA 2O01C 3MM7B 3OXFA 3H40A 4FF1A 2DH8A 4GC6A 1IKYB 1KSPA 1ZM2A 2RQKA 4DSIA 3KK2A 2ADBA 2ZH3A 5GAEI 2F9JA 3OQ2A 4IYQA 5KFUA 2J0SD 1U8SA 1RTDA 2B43A 3EUNA 1T95A 4IFVB 3ULHA 3KLHB 1YJRA 4KT0C 4RUCA 3QLHA 4NCBA 1N5TA 3D1OA 3HVTB 4OLOA 4ZA1A 1TL1A 1W2IA 1FJGF 1SB6A 1KVIA 2IAJA 2IYGA 1TKZA 2VC0A 4MAKA 1C1BA 2DNMA 2JH3A 2X51A 3E01A 3HP6A 1IKVB 1KN6A 2IRXA 1U6FA 2CZ4A 4USIA 1HW8A 1S6QB 2HIQA 1BY9A 3JTNA 1Y4ZB 4RUHA 4HI1A 3NRBA 4KSEB 1A9NB 1FT8A 3QGPA 3JYTB 2H9ZA 2AYMA 5E2QA 2HNZA 3C2PA 5D3GA 2HFZA 4O3SA 1V6HA 2M0GB 3G71S 5KFSA 5L1KA 1S0VA 4C3MA 3HFKA 3L09A 4PQAA 4ZCLA 4RW8B 1FRHA 2FJDB 1RGVA 4LMZA 3KOAA 5IQQA 1CC8A 4EBEA 1FDNA 1S6PA 2RD5C 2J9DE 2LYVA 2MQQA 5B09A 5EGYA 5CA5A 1D9AA 1GXLA 1KLMB 2GCFA 2VG7A 1LWCA 4LQ9A 3OVBA 3NG8A 4H4OA 2FGOA 4JI6F 4AXJA 5KFTA 2CKWA 3HJFA 5F8JA 2HPUA 2J9CA 2PN6A 4I7FA 2POKA 2QA2A 4KHMA 2ZE2B 5J1EB 3TI0A 2KFYA 1MMLA 4F3MA 4DFMA 4JI3F 1WTFA 2OPPB 3JTOA 2CQHA 2FJWA 3I5AA 5HLFB 2RQMA 1S0MA 4EZ6A 3CDUA 3NBPB 1F5CA 3BSOA 3J7Z5 2ZOFA 4GO5X 1SJ1A 2BANB 2AJ0A 3V6JA 3J7A1 1AUDA 3HM9A 1OQ3A 4F67A 1HHTP 5I3PA 4I0WA 2YX1A 3ENWA 2QA4S 1SKRA 1HL6A 3IWXA 1EP4A 1WG5A 3IWNC 4EUVA 3R5BA 4Y2IA 4ED0A 4B9UA 1XN9A 4Y34A 2QA1A 4ID5B 1OQ6A 1HNWF 3FJ2A 2CJ9A 2RJZA 1R0AA 2KZMA 5KG7A 4JI8F 5HMZA 1NK8A 1KHWA 2VASA 3LP2A 1K9MT 1H2UX 2YH0A 2RS2A 1L3KA 2ZVSA 1M5OC 1JLAA 4PWUA 5GAHU 3MAQA 3LH2S 3SSRA 3I4HX 3CCMS 1DTQA 2KHCA 3KK3B 4KGKA 4NZ0A 5D78A 4Z37A 2ZH9A 3QWUA 4PPDA 4ITSA 5AE3A 2JLEA 2YNGA 4TY9A 3UR3C 3UR0A 1S48A 1S4FA 3AB2B 4C8NA 2BM0A 4EO6A 1JXLA 1R8HA 2CPJA 4JI5F 4YUDA 3RR8A 3KHGA 3FGVA 5EDWA 4MKYA 1K0TA 1JLQA 1SV5B 2HQ3A 4F8RA 2KG0A 3HZGA 4UUWA 1SUQA 2BDPA 3N28A 2ZITA 2LA6A 3I0RA 3NCRA 5H9FJ 2J8AA 3OJUA 3G8TA 2HHHF 1E6VA 1TV6B 3ZZZA 2EFOA 4KO0A 4B3SF 3HHLA 2OLWA 5F41A 1TKTA 2KM8C 3I9ZA 2D3UA 1RT7B 2IM3A 1KC8T 4I2PA 4ZCKA 1QJHA 2OPRA 3SFUA 3UNGC 1TR0A 2D7SA 2CJQA 1U09A 2N7YA 4H4MA 5KFWA 2B3TB 4E0DA 4DL7A 3KHHA 4WZMA 3K8WA 4ILLA 1K73T 1HWIA 4NZ6A 4FPRA 2XMMA 1IKWB 5HN0A 4ZCIA 5JVHQ 2ADCA 2EG1A 4A8OA 1S1VB 1VC6A 2HWIA 5K8PA 3QO9B 5FJ4A 1Q53A 1LW2B 5F0UA 3V4MA 1JJHA 3S6EA 1BQNA 2YKMB 3QGIA 4TQRA 3OBIA 4DN0A 1VQNS 3ISZA 5E3RA 5T14A 1UFLA 3DI6A 3PW7A 2XMKA 2F1FA 3KNGA 4I6YA 1TVRA 2G13A 5CYQA 4WFNQ 4YR2A 4Y65A 4DG1B 3Q2SC 3TAMA 2X1FA 5B0BA 1LWFA 4HH1A 3EYZA 1BQMA 4WXOA 3M8PA 4ALZA 4YDDB 3NNHA 3M30B 5J2MA 2LXFA 2KU7A 1ZPWX 1Q79A 4OFZA 2MQMA 2V9WA 3ENVA 2H5EA 5KFFA 3NCQA 1QVGR 4N41A 5EX0A 1I1GA 1Q86T 4CO3A 1C4CA 2NPFA 2RDJA 1NO8A 2UVRA 2C42A 2ACYA 3T19A 1DARA 4G6VB 4MK8A 1S1UA 4TN2A 2CQIA 2LEBA 4TU7A 4LF9F 1CQNA 1VMBA 3CCWA 4B17A 3CCLS 1VQLS 5C42A 3OHBA 2BQ3A 2JC1A 2XMWA 1S9EA 2E7WA 3FVYA 3MEKA 3PZPA 2HMIA 3KG4A 5KT6A 3KMSA 2RUGA 2M3DA 2XGQA 3IRXB 2N3LA 5D77A 1RT2A 1Q7LB 2MMYA 4DDFA 3OTOF 1U26A 3FEXB 4KV8B 3MF5A 3HVRA 5GAHI 1HBUA 1HNIA 4QW8A 1BLUA 2AX0A 1JNRB 3CJKB 2YWFA 3CC7S 5KFDA 3KMQA 3TNVA 3DHWC 2AJFE 4I64A 4C0HA 1NH8A 4O3NA 2DNYA 4EU0A 2HAIA 2K1RA 4YY3F 3IWLA 5SZTA 1HNXF 1ZZNA 1HBMA 3G6YA 3TANA 3HHNB 1V9OA 5HMXA 4A47A 2ZH5A 3MD3A 5CZVA 1TKDA 2KKHA 3PO5A 3X1LB 5DDOC 1SJQA 4WXWA 2FJBB 2EC0A 4LF4F 1UL3A 3UD4P 1W25A 4XK8C 2QSWA 4DF8A 1VQ5S 1B64A 2KN4A 1Y5LB 4NL5A 4MYTA 3U1LA 1UEUA 2DRBA 2SXLA 2FIUA 4OHVA 1TK0A 4RW4B 1KONA 3RW7A 2J7UA 2XHWA 5L1IA 2JDJA 4ZPWR 1HWLA 1ZYQA 5E5NA 4YEAA 4FZVA 4WZQA 3MMBB 4DL2A 1YGYA 5F3TA 4ZPBA 2CPXA 5C25B 1PGZA 2BE2A 1VK8A 4F50A 2Q3PA 4O23A 5A0YA 3O3LA 3UQSA 4YQWA 4TY8A 4QWCA 3RZAA 3HXMA 3H20A 4IG0A 3CD5A 3VAGA 1ZAWA 1GTEA 2F4VF 1WHYA 2YNFA 1OSCA 1VK3A 3HLUA 4X65F 1NNDA 3DFEA 2GFFA 4DL4A 1YJUA 2KJVA 1VRUB 1KS2A 3FQKA 4GO7X 4IO1A 3E51A 1MU2A 3W2VB 1RTJA 4RUAA 1NK6A 4Q0BA 4QU6A 2QLXA 1FRIA 4CO1A 1SJFA 3PFEA 1T03B 5J2NB 3MURP 2BRLA 5FIIA 4QIEA 4DEZA 2RILA 2B56A 2ZDPA 3VAJA 2BABA 6FDRA 2FVRA 2IVYA 5E7OB 4CZCA 4X64F 1P1LA 1Q7YT 3MCSA 3M8QB 1IBKF 1HWKA 3D0GE 3PX6A 1U1PA 4M8LA 2VFTA 4K59A 3MGJA 3MECA 1L3TA 3C46A 2E9ZA 3M2RA 1FRXA 4F3QA 4OL8A 3B4MA 2N82B 3BM7A 2R8KA 3OR2A 1T05A 2YKOA 2GA7A 1TL3A 3FRZA 4H4KC 4YR3A 2B4PA 4N77A 3SDEA 2CG4A 1X4CA 5KFYA 1LK7A 4C8MA 3CT9A 1YJ9S 2WBRA 4V19X 5K8MA 4BCAA 4QU7A 1LWEB 1HWJA 3P49B 1M90T 3AQPA 1DAXA 3ONQA 5KG5A 1EETA 2ZUGA 3D0HE 2ASYA 3H5YA 2AQ4A 4ECYA 4YFUA 1NJYA 4M94A 4Y2KA 1RT4A 4DHVA 3MFIA 1Y5NB 2L9WA 4DR3F 5KG4A 4ED8A 4PXBA 2DCLA 4O3RA 3RRGA 2HFNA 2LQ9A 1X7VA 5JJBA 3IAM9 4LF7F 1GH8A 3W3SA 1UMJA 4FNIA 3JAMY 4MIAA 4U67Q 2RF2B 2MDAA 3C66A 1QAIA 2DR9A 2AF6A 4MIWA 1QM9A 3ICLA 4I6WA 3CCJS 4K4SA 3MM8A 1RT6B 4FXWA 2CQPA 2AYBA 2KZZA 3FDSA 4EGLA 2GHVC 2FHOB 2MKKA 2L3MA 3HKWA 3NMRA 2WONA 1L3UA 1LXJA 4OHYA 1C4AA 2MY8A 1A7GE 1MROA 2C3OA 2Y1RI 1RT5B 4MTPA 4LJMA 4R0JA 4C3LA 3H4DA 3QGHA 4YOEA 1X5PA 3LW5C 4LSNB 3IGNA 4K4VA 1MWZA 3UCGA 4J5OA 4TU9A 1NJIT 4FS2A 1G1XA 1V3ZA 3PV8A 4LQ3A 2CQDA 4WFAQ 3MEDA 3LP0A 2BW2A 3O1LA 1IQZA 1R89A 3HKZD 3GIIA 5DG7A 2C2EA 3O2IA 1JKHB 3O44A 2OD4A 4XPCA 4GKJF 2X1GA 3I9V9 4DUYF 2HZCA 3GYXB 1RT3A 3LP1A 2YWGA 3LANA 3MPWA 4HH0A 5E33A 4ECXA 1ZM9A 2KFZA 5F8HA 3AAWB 4OZLA 3PY8A 4B3OB 4DV4F 1KR4A 1UETA 1R8PA 4AE5A 2L08A 3MM5B 1NU4A 5J1NA 4FS1A 3IXQA 4PWDB 4IUFA 2O5DA 2WRMA 2NYIA 4DV3F 2XLJA 4RNHA 1FKOA 1TQLA 2YWKA 3QMQA 4EWTA 3K5LA 2KFNA 4FBTA 3RYLA 1WEZA 3DXSX 1SJ3P 4URSA 1OO0B 2EKYA 3AHPA 1XMQF 4HTJA 3I56S 3NCPA 5BJRA 1C0TA 5FDLA 3B78A 1F9FA 2JWNA 3O5TB 3O8WA 1VJWA 1HD0A 2FD2A 2VOPA 2KVIA 3K5OA 2M8HA 3NKYA 3P3DA 3B4DA 4HL9A 4ZOSA 1WNEA 3KLFA 2XS2A 1X4BA 5KOWA 4PUOA 3GR0A 2MKHA 5B0EA 3HHLD 3L95X 4ZVEA 4M95A 2GO8A 3BS9A 2F40A 1RYSA 1B0VA 4G1IA 3UI3A 3NP5A 3BGRA 1UJ6A 1C0UB 2OKQA 3PW2A 2YQ3A 2NREA 2IM0A 5DS7A 3K5NA 1JNZB 3OL6A 2KM8B 1UJ4A 1FTCA 3DLGB 2GX8A 4M1KA 2KT2A 2XLKA 3HT3A 2VD3A 5KFPA 1K1SA 3PIPQ 3EX7B 3DYAA 4C0OC 1JLBB 2VL1A 1UVIA 5A8RA 1J2VA 1QE1A 2F9DA 3BDEA 2VFRA 4I56A 3N6NA 2DHAA 4WKRA 4HI2A 4DV5F 2L9DA 2AGOA 4CT9A 1O8BA 2RQ4A 3SQGB 3I55S 5AE2A 3M05A 5K8OA 2P9GA 3S1TA 4Z2XA 2BZ2A 5A8WB