4ZVUB

Caspase-7 wild-type bound to the caspase-6 cognate tetrapeptide inhibitor ac-veid-cho
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
93
structure length
93
Chain Sequence
YKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-7
publication title Reprogramming Caspase-7 Specificity by Regio-Specific Mutations and Selection Provides Alternate Solutions for Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 93
sequence length 93
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2015-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 4zvuB00
3D6MB 3IBCB 3KJNB 2DKOB 3GJTB 1NMEB 3R7NB 3KJFB 2QL9B 2Y1LB 4LSZB 1RHUB 2CDRB 4JB8B 3QNWB 1RE1B 2QL5B 2HBQB 2CNOB 2H4WB 1RHMB 4ZVPB 3P4UB 2Y0BB 2HBZB 1QTNB 1QDUB 2CJYB 2HBYB 3EDRB 1GFWB 3SIPB 3D6FB 3R5JB 1I3OB 1RWXB 1SC4B 3GJSB 2QLFB 1RHKB 1RHQB 3EDQB 2XYGB 2XZTB 2QLJB 2QLBB 2H54B 2CNNB 4DCOB 2FQQB 2H51B 2C2MB 3D6HB 2C2ZB 5IC6B 2HBRB 2QL7B 1RWPB 1PYOB 2CJXB 3GJRB 2XZDB 3GJQB 1I51B 1PAUB 1RWNB 1SC1B 1ICEB 1RWWB 2H5JB 3RJMB 2C2KB 4ZVQB 4ZVOB 4ZVTB 3R7BB 2P2CB 1RHRB 1RWMB 3KJQB 4ZVSB 3R7SB 2XYPB 1F9EB 3P45B 1BMQB 3R6GB 1RWVB 1IBCB 3IBFB 1RWOB 2CNKB 1RWKB 2CNLB 2H4YB 3R6LB 4ZVUB 2XYHB 5IC4B 4DCJB 4DCPB 3NS7B 4ZVRB 5K20B 2C2OB 2H65B 2H48B 1SC3B 2H5IB 1RHJB 2C1EB
chains in the Genus database with same CATH superfamily
4AXIA 3DDIA 3CCZA 4P74A 3VHQA 4NEZA 1RUSA 2D69A 1K0TA 3TVKA 4WK3A 1J2VA 2MPUA 3OLAA 2ZH9A 1LEOA 5L9NA 2CJQA 4DX6A 4NX9A 4P71A 2H4WB 5DDPC 4Z7CA 5IM0A 5DM7Q 3GFHA 4OHZA 2BQUA 4LRAA 2HRYA 4OZ2A 2HNZB 1OYDA 5E3CA 1XN9A 2HIYA 4R8UA 5D6GA 2UU9F 4G1QB 3G71S 1V6HA 3ZNJ1 5IT9U 2RQ4A 4I0WA 4CLPA 3G6VA 1VHIA 2IMOA 1WC3A 2PA3A 1TV6B 4DL7A 2OMOA 3ULHA 1IWGA 2ZKTA 3ZTPA 1QE1B 3M6XA 4LBHA 2FLOA 4TYBA 2AF6A 4ILRA 4A8WA 2U1AA 4Y2IA 3UDLA 1FRMA 3M32A 2VG5B 3UR3C 4LF7J 4CLUA 3FJ2A 4H4OB 4Q2MA 1OMSA 2HLUA 3KKFA 4NLWA 2GO9A 4QIGA 4F26A 1UPPA 1SH2A 2UXDF 4RJVA 4I67A 3C3LA 6FD1A 2YNHA 3NAIA 3V81A 1A6LA 4MIAA 3MFHA 3I82A 4NA1A 4YS2A 4USMA 1RAHB 1S59A 1ZAVA 3BQ1A 5IS2A 1ZH5A 2V63A 3KK1A 3SDEA 2ZD1A 1RAFB 1XNQJ 3CEDA 3SZ2A 2EG1A 1DRZA 2I2YA 3FQLA 3KLVA 1D3WA 5IM0B 1N8RT 2GIQA 2RDDA 4FPRA 2IC3A 2R2UA 4B08A 4KHRA 4R8UB 2C2EA 4MYTA 3HULA 4O4GA 2HVEA 5DJBA 5ITHA 1Y11A 1NSPA 1O0PA 3OHBA 2KXFA 1U1LA 2Y1RI 3BN4A 3AXMA 2EW9A 2XG8A 3SV3A 2CADA 3HPOA 1PIEA 1KQFB 4HI2A 2BR0A 2M7SA 1X5TA 4J9SA 2DIVA 3H7HB 4MTPA 2JLGA 1UWBB 2PI4A 4UZCA 5E3QA 4WXOA 1RWXB 4NLUA 4PWDA 3JXOA 2RHSB 3PW7A 1DFDA 4LBPA 4JI0J 3SFGA 4WFBQ 2XWXA 4MKAA 2XS2A 4Q7AA 3GTYX 4IG0B 1GXTA 2CRLA 4DX7A 3M32B 2XY6A 1VRTA 4R25A 1TAQA 3PCOB 2L41A 1HNVA 1SC1B 1Z4UA 1KEKA 2B56A 1IQTA 2PMWA 4LF5F 2MQQA 5I3PA 4J5OA 4EUVA 2DRDA 2DRAA 5K8PA 2VH7A 2YNHB 2MZ1A 3CCLS 3V81B 1XWLA 4A4JA 1F1BB 7FD1A 4B3RF 2HG4A 4DV7J 5KFAA 4QIEA 2I8EA 1P6TA 1VQ7S 3C6TA 3CJQA 1XEZA 1FX4A 1K8AT 2KFYA 2LYVA 2MQLA 5D78A 3KK1B 1Q8BA 1WI8A 4Q43A 2E29A 1LFWA 2ZD1B 4AXJA 1GX5A 5F9LA 1ACMB 1LK5A 4DQPA 2AW0A 3DI6A 3BR8A 1VQMS 1S97A 2FY1A 1X8DA 2M0GB 4U8VA 3GU0A 4I4BA 4QW8A 4ICLB 4O4GB 2CG4A 2QFJA 1ZAWA 4QJVA 5B0CA 1VGYA 2QLXA 4K5RA 3MTKA 2W2NP 1QUVA 3IR7B 1FT8A 4Z37A 3I4HX 1YJ9S 3DYAA 3ZTOA 3TAPA 1N32J 3KFWX 3PRVA 2RUSA 3PDNA 4TLQA 1KVJA 3HVTB 3R97A 5LSLA 4PWDB 1PYSB 3G86A 2BM0A 4CH1A 2IAJA 2ZC4A 3M8WA 2JHEA 4LF7F 1Y3KA 1U48A 1AZSA 1O51A 1VRTB 4GKKJ 2ZOFA 1HNVB 3CE8A 4ECVA 3TRGA 2KTQA 3AJ1A 5F3ZA 2DNRA 1QTNB 2FLLA 2HBYB 2J76E 1JIHA 4OJ1A 4L72B 4YMEA 1OY8A 3ETOA 2CQ4A 3AAWB 3QMQA 2K3KA 2JL9A 3M05A 1NH8A 2MQNA 2ZH8A 1FRJA 3H5YA 2DNKA 3C6TB 2K1RA 2XULA 2A2CA 2X1BA 1XNQF 5DETA 1R7IA 2MKSA 4C8MA 1U6FA 3JQKA 4DL5A 4PKDB 4K4XA 3FUYA 3HVRA 3M6WA 1KFDA 1WF2A 3RRHA 1U49A 3OUYA 2XGQA 5LL6d 3DI6B 1KSPA 1S6UA 3CJ8A 3IC1A 3LUYA 2COLA 2J9CA 4QR2A 4WU3A 4BBYA 4MK8A 3ILLA 3IRXA 4A8SA 3T1YF 2P6TA 2FJDB 4LSZB 3I56S 2DRBA 1UFLA 1FXDA 2KB2A 3K5PA 3DYAB 3JTNA 4ELUA 2DGTA 3W1YC 2YWEA 1L3UA 3K2YA 1IM6A 5HQ8A 1JX4A 4JI0F 3FQKA 1JJCB 2JC1A 1REGX 3KMSA 2QIFA 4EYIB 4YP3A 1DJ0A 4KTQA 2IAJB 3J80Y 2VIHA 1HARA 5HVGA 3OBIA 2CWXA 2B7CB 2GHPA 1AZSB 3CF5Q 3SI8A 1KR4A 2HHPA 4MK9A 4ILLA 1U26A 1RK8A 4I1TA 1QSSA 3PR5B 5DG9A 3UNGC 3OPKA 2V8HA 2GVDB 3KUEA 3OR2A 2ZH2A 2LXFA 4CO0A 2G4BA 1LW2A 1Y7PA 2BJ7A 3FEXB 4DV7F 4XTTA 2ERRA 1V3RA 2IRUA 2QC3A 2WZ1A 2RS8A 1PILA 4OZLA 5FDLA 5CHCB 4TQRA 2UP1A 3TZWA 2DNNA 5K14A 1VQYA 5HSPA 3CDEA 4CIOA 4NLSA 2XMAA 1T94A 4DX8H 1DQ9A 5LMNF 1L3KA 1DURA 2BEFA 5HAOA 4G1PA 3OUYB 2ZJPQ 2HLTA 2W8KA 1RBLA 2OELA 3ENAA 3KLIB 5M2RA 1V9OA 3TUJC 1Z1ZA 4LUBA 3IRXB 1DTQA 4J9KA 1VJQA 4F0KA 1RWNB 5D0GA 3MAAA 4DX5A 3R7BB 3NL0A 4JV1A 1N32F 4WU2A 5KFCA 4UY85 2FTRA 5HROB 1X5SA 4U9RA 1YG0A 3KLGA 3JAMY 1YRTA 3VAJA 4YEAA 1R8PA 3PXGa 1JMTA 3T3FA 2WRMA 1GMVA 5HLFA 3MEGB 4V19X 3W9JA 3DRYA 1F0XA 2CDQA 3H0PA 1NBEB 2OI2A 2P8IA 4RW4A 4GKKF 4NYOA 2CPYA 1GMWA 1REVA 4FF1A 5KFZA 4C6AA 3KMQA 4QIFA 2VA3A 4DR5J 4PXCA 2HAFA 3BQ2A 4A8FA 3NLCA 4ZA1A 3B78A 5KFRA 3ILOA 3SCKE 3K17A 3EDRB 2J7KA 4ECTA 4OHXA 1LW2B 1MWQA 4AT1B 2MGZA 1X4CA 1FEEA 3FKBA 1HBMA 2XO6A 3MCOA 5KFHA 4IH6A 1SKSA 1BUXA 5FDLB 3CJ2A 3DLHA 3F0NA 4W92B 2FHKA 3AA9A 2OEKA 5K14B 4DPWA 1UA0A 4RNMA 2B9WA 1UJ5A 2YNFA 5L38A 2NYIA 3CO0P 3C16B 5F0UA 3MMJA 2LVWA 2R7SA 1H3DA 4J9QA 3NAHA 3BO3A 4RWWA 2C2OB 2M2BA 2OD4A 3BREA 2VFVA 3K8WA 2NPIA 3QO9B 2QL9B 4X64J 3AB2B 4EMDA 1CQNA 3W66A 1WEYA 2FPHX 2POKA 1XMQJ 1IBKJ 1HYSA 3A4TA 2ZBCA 3EZOA 3MAAB 5IT4A 4K4ZA 4K0KJ 2HBQB 3GIIA 2XB2D 2WOMA 1FE4A 3GFXA 2FGCA 4LREA 4KRWA 2KL8A 2DCUB 2RE1A 3Q22A 4N8OA 5J1NA 1IBLJ 3KLGB 2EVZA 2EEYA 3AQPA 3EX7B 1Q4RA 3SBMA 5HLFB 4DCOB 1S99A 3D6HB 3OVSA 2OPSA 3VVUA 3N9UC 2OJ3A 2VPZB 2ZOMA 4RW4B 1TKTA 3PNIA 4Z7YA 2CJXB 4IRCA 2E1CA 4NCAA 2HQGA 4NLGA 2UUTA 2PDAA 2CPFA 5ADZA 2GO8A 1OSDA 4USKA 4KH1B 3M8PB 5KOXA 4DV3J 2ILZA 1TKXA 4WWSA 1NDPA 5L1LA 1CULA 1NJXA 2ZJRQ 4Y2KA 1QY7A 2XMKA 3CCRS 2MGZB 3PW2A 2CPXA 4JV2A 1F6TA 1D9AA 1HBMB 2LCWA 3HFKA 1Y4ZB 2EPIA 4DSJA 1Q78A 1ZYQA 1TTHB 2XWYA 4UY8T 2J9EA 3JB9k 1GAOA 4OYWA 1VJWA 3MM9A 4CLTA 1PGZA 3NNCA 2YY3A 3HDSA 2YNFB 3OFHA 5IFMA 4EBEA 5HMWA 5IOLA 4ZVEA 3QJJA 2XLKA 1C0UA 2GMJA 2CNNB 4N47A 1XK8A 3JQJA 2D3UA 2V8VA 1L3VA 1U2RA 3CDWA 4LRDA 3AOAA 3NGSA 4HLBA 4C3MA 4DV4J 2H5JB 2DR8A 4DV1J 4OI2A 2D3O1 3UW1A 2PSZA 4K4UA 1S1XB 2LP4A 2B5JA 2WOMB 2R7UA 1WHYA 3DRRA 3L9ZA 2OTLS 1URNA 3HI9A 2IY5B 4ZCLA 4OI0A 4ZITA 4EBDA 3X1LB 4XPEA 1RT3A 1P9QC 2ASDA 1CJKA 4IUFA 3BGUA 4PG8A 3F56A 4DQSA 4CTAA 3P6YC 2OPSB 2HHVA 2BJ9A 4ID8A 4DR5F 1V5IB 1GNKA 1TL7A 4ECXA 2EI5A 4JOUA 1RLDA 3FBCA 2CKWA 2QJ3A 3FZBA 4GO7X 4DBQA 4ANCA 2MKHA 1TKXB 2DGUA 2CQ0A 4NMXA 3RGIA 2W4PA 4DU8A 1VS3A 2KZMA 2YH1A 3CIZA 4CM2A 1KP6A 1HL6A 1QAYA 4ZPBA 3T5HA 2FVSA 1FHTA 1J5EJ 2R7XA 1U47A 3MD3A 4B3SJ 4MJKA 1DY3A 3MM9B 4ELTA 2BKOA 2DNYA 5KFKA 4PUOA 1RCOB 1N5YA 1GX6A 1IWAA 3CB4A 2DVIA 2XQCA 1C0UB 4X64F 3UPFA 3EM1A 1UA1A 2BQRA 2VD3A 4J37A 2L9WA 1XMQF 1IBKF 3X3UA 3BDPA 2R8GA 3M30A 5IT0A 2OPQA 1UMJA 4K0KF 5DM6Q 3RBDA 2PO4A 1AXQA 2ROGA 2EC0A 1S79A 2B5JB 3PW5A 1IBLF 2BE7D 2DR9A 1SC4B 3SYZA 4MKBA 3DRRB 3MPDA 4HH0A 4M63A 1ZPVA 4AE5A 1JLAB 4W4MA 2UVUA 3EXCX 1RT3B 3PV8A 1CJKB 1JXVA 4YHHJ 4CTAB 3OFFA 2BZ2A 2YBVA 1KTVA 1RJJA 3GV7B 1ICEB 1YLXA 1YK9A 4C8ZA 2JVOA 4RR5A 2X1FA 1TL7B 3ZC4A 2HWTA 2PEHA 5ETQA 3ZZPA 1FRIA 5K9FA 4EU0A 1H6KX 4HT5A 4RNOA 4DV3F 3GG0A 3B6BA 1WOSA 3C2PA 3CJ0A 3ZTRA 3BYPA 2L9NA 3LA0A 2MQ8A 3GG1A 3NGDA 1U0HB 4ZMMA 3QATA 4GMKA 4UF4A 2WB1D 1N6QA 2N4CA 1EARA 1LK7A 2ILYA 5B0GA 2CPDA 3D3CJ 3TVYA 4F50A 1CC8A 4U96A 4FKYA 1U1KA 1R6VA 4OJ3A 4AL5A 4ETXA 1NAQA 2ZBRA 2G1HA 1UJ6A 2G1DA 3EGVA 3N5BA 4LBIA 1XMOJ 1G6BA 2HZCA 3QT7A 4ED7A 4PUOB 2OGUA 2R7TA 1N5YB 2DGQA 4ZPVR 2C3PA 3QZ8A 2GQQA 4CO5A 3B4MA 4DV4F 3H8YA 3S01A 4DV1F 3W3SA 2YXLA 2GVZA 3M30B 3Q8QB 2C2KB 2LA6A 3V4IA 2OPQB 4IDKB 3L95X 3KDNA 3VGSA 2PC6A 5E3AA 4PQUA 4CNYA 4OLOA 1VQOS 4OJHA 4F4KA 1I6JA 1LV5A 4C48A 4M5GA 3HKWA 4HEA9 1NK4A 2JOQA 3D6MB 3LPEA 2JEFA 2AGQA 3VALA 3H5UA 2KVQE 1NJYA 1B64A 4G3IA 3H25A 1HR0J 2HGLA 4ZIWA 2BACA 5LM7E 5J2QA 2IM2A 3OL7A 3I6PA 3QJPA 1S48A 3QGHA 3PG9A 4MKYA 1M1HA 4ZPWR 4UZBA 4MIBA 3NGKA 1RU1A 4DXLA 3HF5A 3MUVP 2J7UA 5KFFA 2YKNA 1EIYB 1RKIA 4IOBA 1VDHA 2RMLA 4YY3J 4Q0BB 4NLOA 1Y5NB 4W90B 1J5EF 3EICA 1N6QB 5BR8J 1NK0A 5KFQA 2YTCA 1YRXA 4USUA 4QR0A 1Q5YA 3RB4A 2WSFC 1IJEB 1RWKB 2QE5A 5E7OB 4CLFA 3D9BA 3ZTSA 2D3OR 4OYZA 4CCHA 3R5CA 3K7RA 4O23A 5HBMA 3MUMP 3CD7A 4C8LA 2KDOA 5G0RB 4N76A 3ENQA 3WZ0A 2GVZB 4U7UK 4KAIA 2HQFA 3LP0A 2AJQA 3V4IB 4DMZA 3RB0A 5GAGU 2O1PA 2DGVA 4JP8A 4L3KA 3O5TB 4PQUB 2KH9A 1K47A 2KKHA 5JJBA 4FPIA 1GK8A 2OSRA 2JRSA 1M5OC 2G0IA 4L6V3 5RUBA 3LAMA 4PG6A 1WG5A 4C98A 3GONA 4YHHF 4LF1A 4TQSA 3PYFA 3BBFA 1BQMA 2DNQA 2L08A 1F2HA 4ZVQB 5J2QB 4HTIA 2FZKB 5B7WA 2DNZA 4ZKAA 5KFUA 4KGVB 3QT5A 2QTWA 3P45B 4M5MA 2ZBPA 1KLMA 1IBCB 4LT6A 2MLZA 2DITA 2WHOA 4DCJB 2JEIA 1GMWD 4WK1A 2GAGC 2FIUA 5B08A 3V4MA 1KRPA 2PN6A 2K7JA 2YKNB 2YH0A 3GJTB 2LQBA 1IN0A 5CCLA 2F63A 2UXBJ 3SQOP 1R0AB 4YDXA 2CQIA 4OX9J 5E41A 1TL4A 2GX8A 2V2KA 4ES1A 2HHWA 4A8MP 3T1HJ 2W24A 3DXBA 1XMOF 4ZJLA 2HW3A 3W8PA 3PRBA 3HT0A 1CJTA 3RAQA 2CQ2A 1KOHA 5HBMB 2V67A 4QYZJ 4GRSA 4ES3A 3KXDA 4K7QA 5D3GA 3SFUA 1EB0A 3M2UA 1WC4A 1WEZA 3IGVA 4WIQA 2JWNA 2ZVIA 2Y8WA 1RA6A 1SXLA 3E01B 2YQ0A 2IVMA 3LP0B 3TANA 1APSA 1SB6A 2KT2A 1BMQB 3RRGA 1N0VC 4DR6J 1ZA2B 5KFBA 4F3QA 2HVIA 1A9NB 3W60A 4P52A 1F60B 3U1NA 3VGUA 3DOMA 3KNGA 3KJNB 2B4PA 1RABB 1HR0F 3RW6A 5DDRC 1HQ2A 2DR7A 3BSAA 5CCMA 1BQMB 1LXJA 4F4YA 5D0EA 1E6VA 1WNEA 3I32A 4KPYA 2ZH1A 2DH7A 4P6QA 1KLMB 3TVZA 2LEAA 3GJSB 2HK3A 2Q66A 2VDHA 1WELA 4C8YA 2HHTA 4WZQA 4YY3F 1HMVA 1N5TA 5HMXA 5D4LA 3KHHA 1KN6A 3RB3A 1VR6A 5BR8F 4M8LA 5CYMB 1VQSA 5B0EA 5GAGI 5KFJA 1WC6A 2RQKA 4DLGA 2WB4A 1TUWA 1TL3B 1YITS 5DQGA 5B0FA 4QYZK 2ASJA 4ZVRB 3US5A 3TA2A 2YKQA 3TJ8A 1CJTB 4A48A 2CQBA 2AKWB 4Y2AA 4F25A 4WFNQ 3KTQA 2R7QA 2G2ZA 2VC0A 3BSCA 2I5JA 1SJRA 1T3NA 3POTA 2NR0A 2Q3PA 1TK0A 3QGIA 1RP5A 3M2UB 5D3GB 3PJ9A 2XNRA 3D3BJ 2HZAA 5B0AA 7FDRA 2DHGA 1FK9A 3PZPA 3UCGA 3Q83A 1IR2A 2X51A 1Q1KA 1NLKL 1Q7YT 3R2DJ 1S4EA 1LW0A 1UEKA 3PW0A 1YBUA 2K8GA 3DOMB 1OQ3A 3NXZA 4DFKA 4X4QA 1PAUB 2E7VA 2J6UA 3DHXA 2DXDA 3AD7C 3DC2A 5SUHA 3OFEA 2QEXS 1E6VB 1KONA 4J9RA 4CDIA 1C0TB 2A2DA 2CG8A 1X5OA 1ZZFA 3D1HA 3P49B 1DZ5A 3CJTA 3Q24A 2Q79A 1Y0HA 2RRBA 3FK4A 4TVAB 1M5PC 2N3OA 2MKCA 4FS2A 4ECUA 2UXBF 2QGFB 2VFRA 1FJCA 3MTJA 2BW7A 3BB5A 1U2CA 1JLCA 1MMLA 2XY5A 2DEJA 1ULRA 2BKPA 3T1HF 3GIJA 3KHLA 4LFBF 2AYGA 2Z4PA 3C66A 2YKMA 2EK6A 5KFNA 4IG3A 2M5YA 1RA7A 5J2MA 3NWRA 4ED5A 1RTIA 3MM6A 4NI2B 3M1VA 2PD1A 4RNHA 2I5JB 3E51A 5KAKA 2ZHBA 2NS1B 2YWHA 4O4RA 1RT2A 4F04B 2GS8A 1TP7A 1D09B 5HN0A 2E7XA 1MROA 3MR3A 4ATNA 1HQUA 2D7SA 1BHNA 1FK9B 1CG2A 5C5JA 5HJYA 3EYZA 2H4YB 4CO1A 4V1Ak 3PW4A 1IBMJ 3VAKA 1LW0B 4PWWA 4ZN1A 4Y2CA 1WHWA 1Z2ZA 2C22A 2RUGA 2Y8YA 1NSAA 1UVKA 3BH6B 3RR7A 2IM3A 3DN9A 1S57A 2R4FA 4TYAA 3TQEA 3CDAA 5ETVA 1TZ0A 3E3XA 3ITHA 4RU9A 1RT4B 5KFMA 1SBRA 4IQXA 3HT3A 2Z56B 3FBBA 1G3OA 4PPDA 2AZ3A 2JEJA 1QAIA 3NG8A 3S6EA 1FD8A 3C6UA 5L46A 1YVFA 4PAAA 3AFGA 5I4MA 2VBXA 2YQ3A 1NCLA 4O3OA 3GE9A 4OZJA 3PYEA 1DQAA 2BBEA 3TWZA 1WTBA 4BC7A 1JLCB 2HQIA 1KNZA 2DHAA 1W7WA 3SV4A 3VQSA 3PFEA 2YKMB 1CLFA 2D1CA 4IG3B 4DSEA 2NQPA 4G1IA 2V0NA 3VGTA 5EGYA 3OV7A 2V2QA 3UD5A 3I5AA 2JJ4D 4F2SA 3SCIE 1F9FA 4QBUA 1T9TA 1UVMA 4WBFA 1S5ZA 3B8HA 1BGXT 4F4ZA 5KG0A 4M5HA 4MMOA 1MROB 2Y0BB 1HQUB 2VKZG 3HHLD 1S0OA 3IWXA 1S9GA 1ZOTA 5L1JA 2DHXA 2CWKA 4P2MA 2F5GA 4M5LA 2O01C 4C3LA 1S9FA 1RBOB 3WIVA 4Y28C 1ZS6A 1NPKA 3GB0A 1S1TA 2IPOB 4X4PA 1NB7A 1NPPA 2ADCA 1H2UX 1RHRB 1JLBA 3W5XA 2F40A 3ITHB 3PX6A 1HW9A 1VYAA 3DGPA 1UETA 1NU4A 4NCBA 3M8YA 1RCXB 5K20B 1KQGB 1TUGB 2YX7A 2GJIA 3Q8SB 1X9MA 1X4DA 2F7VA 1HWIA 2XMJA 4OZ5A 4M5DB 2O3DA 4K4WA 1H72C 4YFUA 1RE1B 3GMGA 2V4JA 1Q79A 4A8YA 2CQDA 3BZQA 5DRKA 3S7RA 5IQ6A 3D7SB 1KBRA 2VFSA 5LOQA 5EX3A 5ETKA 1WORA 1R0CB 1QSYA 1HI1A 1EJ7L 3ZO7A 2WVBA 1WI6A 3ZZZA 1S76D 4OYMA 1KC8T 4RL1A 5HQLA 4MYUA 1KD1T 1NUEA 1N5SA 5HL7Q 2NXCA 1B3TA 4FKXA 4TN2A 3M9NB 4N41A 1BWEA 5J2PA 1C1BA 5GMEA 1QAXA 5LXRA 4Q5VA 3SCLE 5F41A 2Y1JA 3QLHA 2HHHJ 2AIRB 3TUIC 1SUQA 2W9BB 1IBMF 3BV8A 4CLYA 1O8BA 1FDBA 4WTYA 1S9GB 4KR0B 4NXMJ 1IQZA 4RUHA 1F5CA 1FWLA 2HQ3A 3IBCB 4KO0A 5HMZA 1Y5LB 4A8OA 5J1EA 1WJ9A 1YJTA 3M4XA 4I2PA 4KH0B 2ZBQA 2WVEA 2JX2A 2D74B 3VAHA 5CYQA 3MOJB 2NSBA 4N56A 1F2GA 1PC4A 5KT3A 1IXKA 3PFOA 4USJC 1EHWA 4IOCQ 1JLBB 1OWXA 1TU0B 1OJ4A 5D15A 2UUCJ 2BJ8A 1S12A 2XMTA 4DPOA 3PY8A 2VPYB 4RBUA 3DGPB 4NLTA 2IYGA 3O3LA 3BYRA 1KHVA 2YWGA 3SQGA 3GFZA 1MU2A 5BYRA 2H3EB 3FZ2A 2PMZD 3PVXA 1YSJA 1AUSL 2W4CA 4DOZA 5CYJA 4J9NA 2Z2YB 4NA3A 3QSIA 1VBKA 2V4JB 4J91A 4KIAA 1AFIA 4F67A 2D3ZA 4R5PA 2BE2A 4NLRA 3IS9A 4ZVUB 2CPIA 4F36A 2ZDPA 4I68A 2P6SA 1RHJB 1J5OA 1KS2A 2W01A 1F3FA 2UZAA 4YB1P 2E9TA 4LRFA 2OPRB 5F8LA 4D3GA 2ZDOA 3WDOA 5HVHA 5JVGQ 4NWBA 3UDVA 3N4WA 2GV1A 5J2PB 1C1BB 5FLXU 5F0WA 2EG2A 1KWMA 3QLHB 3QJLA 1B7FA 5B0BA 1SUQB 1RKJA 4USVA 4CH0S 1XQIA 3KUGA 1RYSA 2QSFA 2OH2A 4MAKA 3AOCA 1KOOA 4KO0B 1VC6A 3MM8A 1FWPA 5J1EB 3H4BA 3E8OA 2HBRB 2KU7A 3UI3A 2CFXA 1P27B 3DMJA 5ETNA 2MKJA 4KV8A 5KFOA 5CYQB 4OIXA 4HDHA 4ZVOB 2J0SD 1WD6A 5HP1A 1BWVA 4FYYB 3CCQS 2Y3YA 3MCMA 5ETRA 4FYVB 2VF3A 4ZLLA 3IBFB 2XMUA 3V6HA 2V8GA 1NZ8A 1VK8A 1ZAXA 9ATCB 3UD4P 2PI5A 1W2BR 3SQGB 2ZZMA 1NO8A 1MU2B 2MZQA 3I0RB 3LWLA 2R8IA 2JLEA 3TA0A 5KG7A 3MGJA 5LSOA 2KG0A 4CLZA 2N3LA 3QNWB 4B9NA 2CVEA 1YBAA 1B0TA 1S1VA 1L3TA 4CP5A 2RDIA 2QX0A 3EZ5A 3RU0A 2FUG9 1HNXJ 4ZS6A 1VQ5S 3CJRA 2BE2B 2XEXA 2A10A 2XMVA 4ZVFA 1J5OB 4NOHA 4L3NA 4ED8A 2BXJA 5IXUA 5ETOA 3HFVA 1Y9OA 3NCPA 5KFEA 1OSCA 4B9MA 3M8RA 3TEHB 4RUBA 2RJZA 4ZPDA 1HI8A 4CZCA 1SJFA 3PJXA 2WVFA 4F3MA 2XO7A 1C4AA 1O6XA 1CC7A 1EETB 3L4BC 3VGVA 2Z2LA 1HNZJ 3THPA 1S6QB 4X4VA 1X4BA 2JZ5A 1H74A 3IWNC 1RZMA 4OI3A 2UXDJ 3D1OA 2NXJA 4X4UA 3H2VE 2GZOA 3MM8B 3JS9A 1VRUA 3P5BP 4DWIA 3KG4A 4DR1J 5CXTA 3DMJB 3PIOQ 4KV8B 4OX6A 5KT5A 3MPWA 2QO3A 5DDOC 3EXYA 5HP1B 2OD6A 2HQCA 1JWWA 3T9ZA 2ZITA 2UUCF 2AJ2A 2DO0A 3UCZP 2OO4A 4HVZA 1FKAF 1RTZA 4LF8F 4UTGA 2DR5A 2E5LJ 2Q6CA 1VCTA 1SKWA 4K4VA 4YUDA 1UVNA 3MPVA 2DR6A 2R3VA 3H90A 1YHQS 2UVVA 3MHYA 4KFBA 3CULA 3W7BA 3NNHA 1Q86T 1PAEX 4JI3F 2LDIA 1M90T 5AT1B 1EZZB 4DV5J 2E1RA 5C24A 4GC6A 4ZVSB 3CC7S 1S1VB 4HHHA 1LKZA 4NZ7A 1P1LA 2YWFA 2ZBIA 2AYEA 3VTIA 2P9CA 4DUZJ 4HH1A 1T3OA 2QT7A 2IMWP 4ZK7M 1ZTTA 5IC4B 2F8HA 3AJ2A 1QE1A 1FA0A 4QR1A 4F0MA 3CUNA 1ITPA 4DR7J 1ZM2A 4B3MJ 4P73A 3P8BB 1WEXA 3SSQA 3TP2A 1TMJA 2R42A 3NMAA 1UCNA 1PYTA 2R9LA 1R31A 4FXWA 2NXEA 3ILJA 3V2UC 3MM7A 1Q7LB 1Y10A 1ZBTA 4CLLA 2VG5A 4QYRA 1OPIA 3EGNA 3ZFVA 3C15A 3NWGA 3OR1B 4DEZA 3HD1A 2XYGB 3OW2R 3LANA 2NREA 4HTJA 3K5LA 2H51B 2CJ9A 1S49A 1OY9A 2FC8A 3VAIA 4O0IA 4K2JA 3VCDA 5KFTA 1FDNA 1UVLA 2VZ9A 1VRUB 4YB6A 3GYGA 1NH7A 2AHOB 4IKAA 4JV0A 2F4FA 3CVKA 1T8EA 5AXLA 2VFUA 4ZVHA 4F4XA 3MR5A 3OLBA 2YVSA 4X2BA 2LA4A 2MQPA 2KO1A 1QUPA 4KFBB 4Q8FA 5A6WA 4E8UA 1FVQA 4F4WA 2FYXA 3S1TA 2WTFA 1C2PA 4F8RA 3FBFA 4DR3J 2XMMA 4KGKA 3W2WA 5C24B 1I1GA 1HNXF 3GR1A 3Q8VA 1RAAB 2G13A 3KK3A 5KG4A 2QA4S 2GMLA 1R8BA 3QZ7A 2AYMA 3AOBA 4K50A 3D0IE 1UWBA 1GT8A 1HBOA 3CD5A 4ZP9A 3OT9A 5I3QA 4NCGA 4JI8J 4IG0A 3CGIA 4TY9A 4PPZA 3MM7B 1SL1A 4J9MA 4ECZA 2BRKA 1WOOA 3HMJG 3BPDA 1HNZF 5LSRA 3C15B 2VBWA 2DHHA 1LQ9A 2I1RA 4MH8A 2IJNA 3JSRA 1H2TZ 3NS5A 1S0VA 4DR1F 2ALZA 3GP9A 2WONA 4ZVGA 2B0GA 3ZZ0A 3NEKA 1RAIB 1QVGR 2ZH6A 2DNPA 5EX0A 1OS5A 2E5JA 4NYPA 3MD1A 2RHQB 1JJ4A 2MKKA 3UN2A 4A46A 2LEBA 2E5LF 1VQKS 1QM9A 1KQKA 3AB4B 1S6PA 3FEZA 1EQMA 3RUBL 1BQXA 2P9EA 3LPYA 3TUZC 1D9DA 1X31C 4E2FB 2AGOA 5DQHA 4MIWA 3T1AA 1XNRF 4DV5F 2RF2A 4CI0B 3BS9A 4K4YA 4ICLA 4MFBB 4OYOA 3R7SB 2QMXA 3W2WB 4DUZF 2HURA 1Y3JA 2VOOA 2CNLB 4UW2A 3DLKA 2J9DE 3T1YJ 2VOPA 2I9SA 3KK3B 3DNCA 2YKPA 2BUNA 2IHR1 4DR7F 2BRLA 4B3MF 2KFZA 3RW7A 1R8AA 3LP2B 3HVTA 1HBOB 4ZLNA 2DPIA 1S1WA 4UOFA 3TUPA 3QT6A 4NCGB 4OZ3A 1UVJA 5H1SV 2EK1A 4UQTA 2N82B 2F65A 3HSDA 2HYIB 4EGLA 3MXHP 2RQCA 3M2RA 1LWEA 5G4DA 1HNWJ 3GV8B 1NJIT 2RB7A 5T7LA 1B4SA 4Q45A 5LXYA 3GCWP 2UUAJ 1FTRA 4LR8A 1CJVA 4DPYA 5IC6B 3GPAA 2DYAA 5I42B 4ZPTR 1H98A 1HIYA 5E3PA 2F1FA 1RU2A 2WONB 4A8KA 1WC1A 2IM0A 3KG0A 2CJBA 4RW7B 3TQ1A 2Y9HA 5DDQC 1PJ7A 3QRPA 5HVFA 3OXFA 3GSDA 4YQWA 1SJQA 3HHEA 1U6ZA 1RAGB 1S6PB 2HNDA 3N79A 4LIWA 3EVMA 3W61A 5LMNJ 4EWTA 1VBXA 4DR3F 4FDFA 4PCQA 2CXEA 3H59A 1H73A 3RRKA 4AD6A 3WC0A 1B0VA 3OFGA 4WF9Q 3HFZB 2RF2B 2JEGA 3LGHA 4ZOSA 4TY8A 3W62A 3PR4A 2KT5A 1YBTA 1NM2A 2U2FA 3DLKB 1T03B 1M1GA 4TXSA 4PXBA 2ZUGA 2JH3A 5A8WA 2B9XA 5J2NA 3CCTA 4C0BA 4JV5J 2GIFA 2F9DA 3R1HA 4LF2A 2V2ZA 1LWFA 4JI8F 4V19J 1VC5A 1M0SA 4RX6A 1S1WB 3UD3P 5AE2A 2C2RA 4DQIA 2KXHA 1FF2A 2I0XA 3N0VA 3BGRA 3AHPA 3RR8A 2HPUA 3F41A 3UQSA 5GMKa 3Q86A 2IRYA 4PWUA 2MYFA 2I6WA 3CCMS 4U6PA 3K5NA 1OIAA 2IRXA 1LFPA 3M2RB 1LWEB 2RIJA 2FZCB 2H65B 4OI6A 1N56A 4QWAA 5T7LB 3FDSA 1SH3A 2GVDA 1CJVB 2AJ1A 3NBPA 1WDTA 3CO9A 4LSLA 4ZP6A 3LP1A 4PABA 1O5JA 3MMAA 2VQEJ 1GXUA 1RAOA 1SQEA 3OTDA 1RTDA 4DN9A 2OHDA 1NSKL 4QZVB 1YX2A 2QYGA 1RDRA 1FEHA 1YZ7A 2J7WA 4EZ6A 3EPGA 1VBZA 4ZJQA 3MWBA 2ASYA 4ER8A 4Y6IA 4NEYA 3K89A 1HI0P 2AGPA 2WW8A 1T95A 4DV6F 1HBUA 3JSYA 2HNDB 3KDOA 1F3VA 4NL5A 3M9OB 3QGPA 4NMLA 2MSSA 1PJ6A 2XSFA 2F8MA 1SQFA 5HI7A 3Q0AA 1TKDA 5D0RA 5FLXY 3KLIA 4LSNA 4WIIA 1W25A 3HP6A 1RISA 4DL4A 2EFVA 1HWKA 3GIMA 2QN6B 4I2QA 5AXMA 1CEZA 3LAKA 4Q8EA 4TY8B 1JJ2R 1ZTWA 3J81U 2A18A 4QWCA 2AEFA 3IAS9 4EYHB 3THTA 4M95A 4B9SA 5A8WB 5HROA 5CAAA 5J2NB 3PEHA 1U1QA 4DPTA 4JYAJ 1D1UA 4X65J 2W9AA 5ETMA 1UW9A 3MEGA 3HK2A 1LWFB 3ADAC 1SV5A 4DV0F 1UAWA 5CD4A 3HZGA 4JI6J 3MEDA 1MWYA 3BGRB 4O44A 2BX6A 3NOGA 3AY0A 1HNWF 4M1KA 2EFPA 4Y34A 2DXFA 1LWXA 1X4GA 3N28A 3GLJA 1RHKB 3L7OA 5H9EJ 3UN3A 2UUAF 1T11A 1DBDA 4DS4A 4B3OA 4ZJOA 1NK7A 2HGNA 2MZSA 4KHMA 5SZTA 1NDLA 3NBPB 4LF6J 1DARA 3D0HE 4A8XA 1FVSA 1WKLA 4LSLB 4DDFA 1HKAA 3LP1B 1JKHB 3MMAB 5E0OA 4CLSA 2KYZA 4ES2A 1UKUA 5K5MA 2BANA 3ZZRA 2Z58B 1RTDB 3MAHA 1NJZA 1YI2S 2AQ4A 2GA7A 5IQQA 2HVHA 4ZCMA 1HBUB 3DLJA 2G0JA 3C16A 4OHWA 1Z2LA 1WKJA 2WBMA 1TKZA 1IKWB 3U1MA 5EWEA 3BGLA 3EVWA 2YWKA 4H4MA 1GQEA 2QL5B 5D4PA 3QO9A 4LSNB 2HFZA 1U6BA 4B9TA 5MAOA 4L76A 4I2QB 5EWFA 4G6VB 4I6YA 2B8PA 3BPSP 2J6SA 3FBEA 1V3SA 2HKEA 3OTBA 1UWAA 2ATCB 4JV5F 2KFNA 4P72A 3M7VA 1FE0A 2C2ZB 3RYLA 3CPWR 5THWA 1FO1A 2OAUA 2V4RA 4CQ1A 1UFWA 4MKVA 3T5JA 2L3MA 5DGAA 3SCJE 3HXMA 4O3RA 2F3JA 2XNQA 3I4PA 3VZHA 2F9JA 2RILA 4IH5A 1SV5B 2MZRA 2GJ2A 3MEDB 5H9EK 4O44B 1KVIA 3CW2C 3DM2A 1HA1A 2W7PA 2DKOB 3M8PA 2A6MA 3R7NB 4B3OB 3OTEA 3W5YA 4LRBA 1VOMA 1WTFA 4CRJA 5ETSA 9RUBA 2WSCC 2VQEF 2WVCA 2VG7B 2VBYA 2BOPA 1KDNA 4F2RA 1EKSA 1VISA 2BANB 1XR6A 1P9YA 4FVMA 1RYRA 3PHEA 4DQRA 4E0DA 3UNYA 1Q0NA 3L09A 1FI4A 4X62J 2OSQA 1M5KC 4LFCJ 2VA2A 3C8YA 1TKZB 4OX8A 3BN7A 1SI9A 4RUAA 3FVYA 1RWWB 2A6OA 4H4MB 4L73A 1HFEL 4FYWB 4IH7A 1M5SA 5F3TA 3G6XA 3IRWP 3FRYA 1S1XA 1XR5A 4DSIA 3HHKA 4WTOB 3QFWA 1RT1A 4CM0A 4JYAF 4I64A 1XERA 2CJKA 4X65F 4I6AA 5KFYA 3CCSS 4NA2A 3SMZA 4JI6F 1S1UB 2RQMA 2W9CA 3GIKA 3Q8YA 3HD2A 3WX8A 4NYZA 2EFOA 3DM2B 3ZZUA 1YTYA 3EDQB 1FD2A 4WE1A 4X84A 3RTVA 2DBBA 5K8MA 1SH0A 7AT1B 4K59A 3I0SA 3QIPA 4LF6F 1FJEB 1VQLS 3K0JA 1NRKA 3HM9A 3IGNA 2HAIA 3K57A 3GSIA 2XC9A 1RWMB 4DFPA 4ILMA 3ICLA 5L1KA 1BC6A 4ZLJA 5JXSA 2QMWA 5DG7A 2AEMA 2QFIA 4C8OA 2DB1A 2UVRA 4JI5F 4OYBA 3QFHA 4CO4A 4JI4J 4NLXA 1NPRA 4KGXB 2MXYA 1HWJA 2NUHA 3KJVA 3MURP 2DK2A 4JB8B 4K2XA 4C0OC 1GEHA 4QOTA 1FRXA 2HFVA 2W2QP 3P4UB 4NLQA 3HJFA 4RW6B 1S0MA 1GFWB 1RT6A 1KVKA 4N7TA 2LQ8A 1NXIA 4ZP8A 1AUDA 4X4RA 2MKIA 1MMDA 3HX9A 3M2VA 1RT1B 3HSGA 1T05A 2PT0A 3J7AN 2NPFA 2MDAA 4WJBA 1JLAA 4NZ6A 3RAXA 2XHCA 4XDCA 2W9CB 3ETMA 1C4CA 1EX8A 2KYXA 5D77A 2R8JA 1NDCA 1T02A 2AV5A 2G2YA 3KUHA 1SKRA 2FVCA 4J90A 1WC0A 1PO6A 1DAXA 2M88A 2B3TB 3HLUA 1JNZB 4WE1B 4E98A 1TQLA 1MN7A 2OKQA 4IQMA 3CJKA 2YX1A 4USHA 4ITSA 2ZOGA 2GCFA 2M8HA 3I0SB 3QIPB 2C2DA 1U0HA 3K8VA 5IV3A 4ECRA 3MAQA 4QCLA 2ADBA 1YKWA 3N01A 1P1TA 4EBCA 2DY9A 1OYEA 4WXWA 1FESA 4DG1A 4X62F 1UW4A 1JXEA 2R7WA 1FJ7A 1XMBA 2HS3A 4LFCF 1Q53A 1K1SA 3ET6A 1U02A 3FFIA 4J9VA 3KJVB 2YX4A 1JXLA 2VBZA 4ZVTB 2MMYA 2AWZA 3IR6B 4WFAQ 2GW8A 2P2CB 3V6DA 2RNEA 2BQ3A 3TO8A 3P96A 2FLNA 4AYBD 1RAJA 1RT6B 4IDKA 1FKPA 4RWXA 3PYDA 4DZDA 2H5IB 5I3UA 2RS2A 1U2FA 2LU2A 3M2VB 1TVRA 1SPBP 1T05B 2DY1A 2CJAA 2Z8QA 1T9XA 4YN3B 1Q8IA 4B9LA 2KN4A 1PSDA 2F8EX 2YPZA 2V4QA 2OPPA 2O67A 2B51A 3TAQA 3AXKA 1FFWB 2GFFA 3C46A 4Q2LA 5D0HA 1WHXA 5A0YA 1DTTA 1QD1A 2ZE2A 3M8QA 3NP5A 4O3PA 2MKYA 4NPOA 4PXDA 3CJKB 1HD0A 1N36J 1FJGJ 3PHTA 3OVAA 3IFEA 2K06A 1R27B 3EPIA 1BQNA 2LU1A 5M2PA 5F8NA 5E33A 3HSZA 2KHDA 4DSKA 3A1YG 4Q0BA 3EE3A 1YDLA 3TX0A 3Q8UA 2R7VA 3DOKA 4Y65A 2M4MA 1MWZA 5KT7A 4JI4F 3QGGA 3CSKA 3WC2A 4RNFA 1RTHA 4AL7A 1NZAA 1X0FA 2YQ1A 4DG1B 4GVBA 5K8NA 3GCXP 4C97A 4LF4J 3CMES 1FDDA 3ET6B 1YJUA 3FFIB 3UN5A 2N4DA 3UCUP 5A2QY 1VQPS 4K8RA 4ENOA 4C0HA 3Q8RB 2FVRA 5KTQA 1LWCA 3V6DB 2DPJA 4DL0C 5G0RA 2EKYA 1N0UA 2UXCJ 1FKPB 1FNMA 2OMLA 1KQSR 2Z2ZA 3QWPA 2CQPA 3KNAA 1IJFB 5I3UB 2Q6BA 1HWLA 2OP5A 1TVRB 4DZ6A 3FSYA 2GNKA 3UR0A 3QIDA 3MMBA 3TARA 2JLFA 4B9UA 2V5HG 4FNHA 3BH7B 1FNOA 3MPUB 4BHQA 2OPPB 1SIZA 1CJUA 3FMWA 1K0VA 3MZIA 1WF1A 3AH6A 4LVNP 3MEKA 1Q8KA 2XI2A 3K5MA 3KHGA 4RBVA 5A0YB 1DTTB 2ZE2B 3M8QB 1S7HA 4OYIA 4H4KC 2CAJA 4ZLPA 4KHPJ 3OQ2A 3EMTA 2B4UA 1BQNB 4KJIA 5F9NA 4BS2A 3J81Y 3THVA 4IRKA 2SXLA 1VQ9S 3DOKB 3KYLA 2DIUA 5D8HB 1JK9B 4NLPA 4PXEA 1R0AA 3FSIA 3SDEB 1S77D 1OPZA 3AQOA 2CPZA 1RTHB 5KFXA 3CTRA 3IN5A 2W7OA 3CT9A 3MR2A 4GVBB 5KFWA 1K1QA 2MJUA 4DV2J 4KBIA 5DZ7A 1AYEA 3HZEA 5IZHA 2IC3B 3TYTA 1UP1A 1LWCB 5KFSA 1UEUA 1RACB 5DLFA 3TZXA 3UO0A 3ZNUA 3E01A 1YIJS 2FJEB 3LQVA 4BDPA 1T9YA 4NLYA 1N88A 2QMUB 5DG8A 2HHSA 4M5IA 3OL9A 2FJBB 3MMBB 3MPYA 4ECYA 3B82A 2ZH3A 5ETLA 4DR4J 1CJUB 3SIPB 2WCXA 4P10A 3H2UB 1SKUB 4CO2A 2RU3A 4ED2A 2QSWA 1X4EA 1ZM4A 2KM8C 4UOCA 1N36F 2CIMA 2DNLA 5AXNA 2E44A 1FJGF 1Q5VA 1F5AA 2FD2A 4DSLA 2XZDB 4NRTA 1VBYA 4P7VA 5CZXA 2IVFB 1JLQA 2XBPA 1U45A 3OSNA 2HSEB 2W2MP 3GWCA 1JNRB 3PEJA 4BLGA 2Z57B 1D9FA 1JLFA 3KLHA 4W98A 1XIQA 5CYMA 3LWMA 4B17A 2CQHA 4IOAQ 1VLYA 3BGFA 3NS7B 1UFKA 2W1BA 4HHUA 3A3OB 2NYHA 1TAUA 1N52B 1TL3A 1VLOA 1RGVA 4LF4F 2ZFHA 4Y2MA 4LFBJ 4WZMA 2IIHA 3H98A 5KT4A 3BSOA 4TLRA 2CQGA 2DGXA 4EFAC 4KY3A 2CQ3A 1FCAA 3MCSA 5DZ6A 3TZYA 3VF0B 2LQ9A 5FD1A 3OD2A 1RHMB 3CCWA 3V6JA 3VWSA 2LQ5A 1NEEA 1FNXH 1X4FA 4J9LA 2UXCF 4ID5A 3OVBA 1F9HA 2OLWA 1VIOA 3P5TL 4QWBA 3HCXA 3A3PB 3BF4A 4FZVA 4KKOA 2X1GA 1RADB 4CT9A 4QPTA 3TW0A 4F7VA 1I51B 4DHVA 2RU9A 1WUUA 2W2PP 4NASA 3TZZA 5MLCV 3VAGA 1QSLA 4ED4A 3KK2A 4KGMA 3I31A 3PX0A 1SJ1A 2ZHOA 3DLLQ 3OXLA 4OJGA 1KHWA 2AJ4A 3ENWA 2MJNA 2VL1A 1A0OB 2YNGA 4LJMA 5HMYA 2QZ8A 1JQGA 3NMRA 1WACA 2AP6A 4L75A 3VR1A 4KHPF 2B9EA 1C0TA 3EZUA 3MUTP 5CZVA 5KFPA 2OFGX 2JSXA 2VASA 2V94A 2Z0GA 2VV5A 1RXOB 1JLQB 4XPCA 3N6MA 2CPEA 3PO5A 3NRBA 4IYQA 2D9OA 3TX8A 4DS5A 1RQ0A 1JLFB 3KLHB 2FB0A 2K1RB 3WHIA 1PCAA 2Y1IA 1R8HA 2XLIA 2AX0A 1NKEA 3R1LA 4DLEA 2L48A 2IA6A 2QL7B 3R5AA 2I38A 4JUZA 4DV2F 4M5KA 3BJYA 4F3OA 4NI2A 4ZPCA 2X3GA 2QLWA 4A47A 1MNEA 1NK8A 1ZM3A 2XI3A 2ZZTA 2OTJS 3D28A 1PG5B 2R2TA 4LR9A 4ID5B 5T14A 4HACA 2J0XA 3EWGA 4QU7A 2PFDA 2HS4A 2AMCB 4JI2J 4LMZA 1UTAA 3TI0A 2HEKA 3BBCA 4KKOB 4PG7A 2O5DA 1EAYC 5H9FJ 1N48A 2A3JA 3MR6A 5KOWA 2CDRB 1ZZNA 3D0GE 1QLNA 2BJ3A 3T5KA 2DD8S 4DR4F 1SJ3P 1T9WA 4ZVPB 3KK2B 3A3NB 2IVYA 1X4HA 2KJVA 4H4KA 4ED6A 3GYNA 2PMHA 4P75A 2Z30B 1RHQB 3LGNA 4WYWA 3IMQJ 4DFJA 5KG3A 2YNGB 1RT4A 4P2XA 1R3NA 3W8GA 2JDJA 5CA5A 1KLNA 2ZWOA 2B6AA 3BKUA 4GKJJ 3DLEA 3A8IA 3OR2B 2JVRA 3CXCR 1VMBA 1AT1B 4HHJA 2IBOA 3FNNA 4HKQA 5KFIA 3HJVA 2N7YA 2E5IA 1LXNA 4K4SA 3IM8A 2MLXA 1A7GE 2BJEA 5JUMA 4C7QA 4KB7A 3ZZTA 3R9LA 1WSVA 2MTLA 4PG4A 4EO6A 3S8SA 4ECQA 4WP3A 3PACA 2W2OP 3DLGA 2FLPA 1NHKL 5L1IA 1IKYA 2R2SA 2DHSA 4U95A 1X5PA 1TUVA 3NS6A 2HFSA 2P5VA 3D6FB 2FHOB 1HHQA 2UVWA 2RH3A 3CCVS 1DTQB 4WP8A 2UUWA 5H9FK 1S4FA 4HACB 3KLEA 2W4DA 4FP9A 3GV5B 1BY9A 3G96A 1AFJA 2ZKUA 2VUGA 4UQGA 3HHLC 3JSBA 3OJSA 2QRRA 4WP9A 1WF0A 2BJ1A 1FRKA 5LT5A 4OFZA 4ZPAA 5DS7A 8ATCB 3T5LA 4FXDA 2VQFJ 5KG6A 3LW5C 2NLWA 4QIWD 2ZEJA 4URSA 1IKVA 1EQ0A 3I9V9 3EGWB 1REVB 1U25A 2V6AA 1GH8A 1CVJA 1UPMB 6FDRA 3W63A 3BKTA 2E5HA 2PFFB 4WKYA 3ZZOA 4N8NA 4YOEA 5GADU 2B6AB 2PA8D 5U47A 1QTMA 2AT1B 3DLEB 2J0QD 4FVCA 2ROPA 1CQMA 3OL8A 2QG9B 4WYLA 2XGPA 5IT9Y 3IBWA 2O66A 4X4NA 3Q23A 5F8IA 4M5DA 3LF0A 2FY8A 2QA4G 1G2EA 2LKZA 3NGTA 2VODA 3WBZA 1R89A 2XZTB 2QLBB 3C14A 1HW8A 4ZDNA 3MCNA 4JI1J 3DOLA 3PKMA 2PGCA 1CBKA 3NNAA 1MG7A 1Y00A 4IFVA 4FBTA 4DUTA 1URRA 3DLGB 1XR7A 4DUYJ 1IM4A 1IKYB 3ISNC 4Z2XA 1K44A 2LMIA 3NKYA 2IM1A 1IR0A 3MECA 4WFXA 1FX2A 2DO4A 1HHSA 1NHVA 4LRCA 1SL0A 3W2VA 4P9SA 3OJUA 1HYSB 4JI2F 2WAQD 2LXIA 3A8EA 3O6QA 3KLEB 2RAQA 2HHUA 3MR7A 1JLEA 3DFEA 2W9BA 3LH2S 4DL3A 3CCUS 2X1AA 2KM8B 5F8JA 2V9KA 4G65A 5CABA 4RW8A 3FCHA 4F4AA 4C9DA 3DRPA 2CPHA 4TKTA 1HNIA 1IKVB 4ED0A 1TKTB 2DGWA 3IP0A 2YNIA 1X0PA 2EBGA 1F5BA 2PIIA 4GKJF 4ZCIA 3HVAA 4NXNJ 3FEYB 2RKIA 3OSPA 4Y00A 2OIHA 1CULB 1MMNA 5KG2A 2FJVA 2FJXA 3L7UA 4PZVA 5HJXA 2D9PA 1UL3A 3RG6A 2RD5C 2LXUA 1ROFA 3DHWC 4KPCA 2JFDA 2IBKA 3C14B 2E1AA 2UV8A 3GZ7A 4HDGA 3B54A 2W8LA 3DOLB 4URQU 4OHVA 2K3IA 4P2SA 5E3RA 5KFDA 2V34A 4IFVB 3BR9A 4OYPA 5K8OA 4GC7A 3B4DA 1Q16B 4WKRA 4HL9A 1V5VA 2FHMA 2GGPA 4RU2A 2OPRA 2HFUA 2GJFA 5A8RA 3T6JA 3MECB 4B9VA 2WW4A 2D41A 1P8GA 1I5OB 2B7BB 2EFNA 1UEVA 3W2VB 3LALA 1NK9A 3GR0A 3J7A1 5GADI 4LFAJ 3H5SA 1S6OA 2KRBA 2DNMA 2FVQA 5EN1A 1JLEB 2KI2A 4ZCKA 3G6YA 1YJRA 3CNQP 3UVJA 3A8KA 1LNQA 3M6VA 1RSCA 1WKKA 2G9OA 2E1MC 4F0HA 2VQFF 2L9DA 3KJQB 3TJ9A 4RW8B 4EEYA 1T7PA 2MLYA 1BE4A 3DRPB 1XJWB 1TELA 2XCPA 1HWUA 3R8YA 1OO0B 2QA1A 2FDNA 1HNIB 3K58A 1RT5A 2MZTA 2ALYB 4M94A 3CCES 3QBCA 1FRLA 1H0HB 1YGYA 2YNIB 1K9MT 2ZM6J 3JYTA 4RNNA 3H42A 3ONQA 1HQEA 1QJHA 3O8WA 2BYCA 4O3QA 4NRUA 1G4CA 2J5AA 2RKIB 4KT0C 4LF8J 1FWKA 3D2WA 8AT1B 1N4LA 1QAJA 3I0RA 3CMAS 4KYZA 3CD6S 2ZNYA 5F8MA 2HRTA 1Q82T 4RZRA 2HMIA 3CC4S 3BBBA 3W9IA 1CSJA 2G2OA 2B4VA 2MHEA 2VC1A 4DL6A 2ASLA 1VI7A 4JI3J 2CQCA 4JI1F 3QRRA 1TFWA 3OXGA 2BM1A 4TU8A 4OYXA 2LFVA 3ILIA 2RSQA 3R27A 4USIA 4TU7A 3JTPA 5D4NA 3RJMB 4DUYF 2VPXB 2B43A 2N7CA 3JTOA 2HZVA 5GMDA 2M70A 3HHLA 3CMQA 2XM3A 1U8WA 2C2NA 1Q81T 4X4SA 2GGPB 4P7TA 5A8RB 3IAM9 2WSEC 5EUHA 2XS7A 2QYCA 4NE9C 3H4DA 2IYIA 1EETA 4I7FA 3DLBA 5A76A 3H20A 2Y1LB 1YRUA 1S6QA 3A8JA 1RTJA 3UVJB 2MQMA 1D8ZA 5AE3A 5BJRA 2CNOB 4LVOP 1RLCL 1SQGA 2VONA 1BD6A 2E9ZA 1ZM9A 3DU6A 2HFOA 5GVQA 5GAEU 3H40A 4ETZA 2EKNA 3OTOJ 4O0NA 3FGVA 5C2GA 3GYXB 3N6NA 5DQIA 3KHRA 3PRDA 4ERDA 1RT5B 2AEJA 3SSRA 4ZP7A 1SL2A 4NXNF 4ED1A 3JYTB 3RAMA 1HQEB 1NHUA 3IXQA 2H5EA 2DH9A 3CJ4A 4WFYA 2FZGB 2BDPA 2CUYA 2DISA 2H1YA 1RI7A 1W26A 5F8GA 1SC6A 3H2LA 1F9EB 4FN5A 2JFKA 4A8QA 2B8QA 3BGOP 2LLZA 1U1RA 3LOUA 2HMIB 3ZZYA 4B3SF 1U24A 3N6LA 3AJDA 3I9ZA 3CJ5A 4NLDA 4USWA 1YZ6A 1YJNS 2Q1LA 4DU7A 4OV6A 2NCKL 2M8DB 2ZHAA 2ACYA 1L5UA 4FF3A 3QQCD 2VU5A 2M52A 3HHLB 2R8HA 2IDLA 3T9NA 4IRDA 3PM9A 1NDKA 2KG1A 4LFAF 4K5SA 2AZ1A 5IWAJ 1IKXA 1WDDA 2FQQB 4RW9A 1G7CB 4RBTA 1ZPWX 4I7FB 2DEIA 1LOUA 2BJDA 1FERA 3OR1A 1DQ8A 4EI2A 1HLWA 4L74A 3UDCA 3FSXA 4TU9A 2ZUAA 1RTJB 1OQ6A 4CYUA 3CIMA 2CNKB 2K7KA 5A8KA 1E6YA 4IFYA 2J6TA 1VIXA 1PBUA 1N5VA 1SVDA 1WG1A 4QQBA 2ZM6F 2IFXA 4X4TA 1HHTP 3KJFB 1WG4A 4B3TJ 2FVPA 1NKBA 4CLWA 2VG6A 3ELHA 2ZH5A 2CQ1A 2DT9A 3R5GA 4ALZA 4OI1A 4DPUA 3R5JB 5ETTA 1WSRA 2HRUA 5GAHU 1DLOA 5C42A 4DF8A 1XNRJ 2MEWA 4X66J 3I5BA 1Y5IB 2V8DA 1VQNS 2XY7A 2GC8A 3MEEA 4UOGA 1FDAA 3DKDA 4P2FA 5GAEI 4YR0A 4AQYJ 4BCAA 1VQ6S 3DCAA 1HPZA 2UV8G 1MW7A 4PQAA 3U27A 1IVZA 2KJWA 4AFFA 3TOQA 4DFMA 3QSYB 4HI1A 1EP4A 1IKXB 1JB0C 4RW9B 5FIIA 5ETPA 3U02A 3PKYA 2DCLA 5JMNA 1YWXA 2RRAA 2RRNA 2RT3A 5C2CA 1SIWB 4UUWA 1NKCA 3VAMA 3G9CA 4CYUB 2J9DA 1QDUB 3OTOF 2CYYA 4XIUA 4ZHRA 5A8KB 4JI7J 3R2CJ 1E6YB 4IFYB 3T41A 5FJ4A 2ABYA 4C3KA 4XO0A 4LF9J 2C3OA 3Q89A 1TK5A 3E2EA 3BEGB 4KSEB 3H5XA 2C2MB 2R7RA 4J9UE 1NK5A 3NOCA 3SSSA 3IM9A 1RWPB 3R5BA 3F73A 2X3DA 3D1QA 4CT8A 2HVZA 2ACMA 3IG1A 2VG6B 1L3SA 2W7AA 5HK4A 4BWJA 3IA0A 5AXKA 1TK8A 2Q43A 1VFJA 2HQDA 2XMWA 4IO1A 3NCQA 5D4OA 4GVLA 1DLOB 2HVDA 4ZN3A 1UJ4A 5C42B 1MSWD 1FRHA 2H48B 4MFBA 4DPXA 5JVHQ 3WQPA 2OEMA 3CDBA 2DGOA 2KRRA 4CO3A 3TJAA 3D67A 4U7UD 1I94J 3D4JA 3O2IA 4AUKA 2X7IA 3D5MA 1HD1A 2BKNA 4ZIVA 3LP2A 4OYAA 3MEEB 3M8SA 2HBZB 2VICA 1X60A 2NUUG 4ANEA 1R6YA 3QAEA 2GQCA 4QW9A 4RUCA 5IWAF 1HPZB 3LO3A 3F44A 5L8RC 1EP4B 3MFIA 4FF4A 3VVTA 3GFYA 4OZNA 3DU5A 1R8CA 4U8YA 5CD4H 3HHDA 5HANA 5GAHI 3Q2SC 5I42A 2HHQA 2MB0B 2A1BA 1U7LA 2IJRA 4DL2A 4DF4A 2UUBJ 4FS1A 4ZHRB 4R0JA 2DNGA 2QA2A 3K59A 4RW7A 1RB0A 3A13A 1SC3B 1FFSB 5IV4A 1RWUA 5LMUJ 2M9KA 4B3TF 2IJFA 2ZNZA 3IWLA 3LTOA 3FCVA 4C4WA 1S0NA 4YR2A 4IO9Q 1U0SA 5CQGA 4DQQA 3IG1B 1OY6A 3SEOA 2XSJA 4S0MA 4DV6J 3IR5B 2OFHX 5HO4A 1MN9A 3MM5A 4URGA 2MSTA 1HMVB 4LR7A 1FTCA 2BOAA 4I6WA 4Y3CA 4OX9F 2DJWA 2V8PA 3QT8A 2NXUA 2EBEA 2B9YA 4NZ0A 1YJ7A 4X66F 3VAFA 4OI4A 3EUNA 1M5HA 5E2QA 5KFGA 1VK3A 1T03A 1GXLA 2V69A 4FYDA 3HO1A 1BLUA 4J9OA 2XTJP 1RT7A 3JQMA 2DTJA 4AQYF 4UUXA 2WBRA 2E7WA 3WIUA 1H38A 3R6GB 2VJVA 3POTB 2VHGA 4QWEA 1UVIA 3G82A 4CNZA 4DV0J 1TL5A 4DR6F 3OHAA 5KT2A 2FHJA 3D54A 2B4OA 4BC9A 3TR5A 1GMUA 1SCJB 2OEJA 3W9HA 2DNOA 2J8SA 1EKRA 2NZCA 2W25A 3A12A 4JI7F 5EWGA 3G4SS 3CJ3A 4LF9F 4ANDA 5C7PA 4B02A 2J8AA 1X9SA 4C8NA 3PX4A 2HGMA 2GHWA 3PYGA 2GIRA 1NNDA 3AA8A 4HYKA 3I5CA 4CWBA 2MQOA 4R0EA 1YQHA 4YB7A 2XSJB 1T9UA 1JLGA 4N5SA 4FF2A 3MM5B 2JNJA 1N34J 4FYXB 1D8YA 4ECSA 1S9EA 3T6BA 2E66A 4JBCA 5KFLA 2WVDA 2LEPA 3J7Z5 1X7VA 1T0TV 4PEOA 2VPWB 1RHUB 1I94F 3GILA 2BABA 5J2MB 1GTHA 4LQ9A 1RTIB 3MM6B 1RT7B 6AT1B 2AX1A 3BKFA 3M1VB 3CDUA 4DSFA 2CJYB 4J7CA 2EC2A 2VJUA 3QRQA 4WPAA 4PR6A 3G82B 1MLAA 1RT2B 1U1PA 4M5NA 2BV3A 5A2QU 3HVWA 5KG5A 4C8KA 1GTEA 2F4VJ 3NGRA 2PE8A 3TNVA 3W64A 3N5FA 3GIRA 3HHNB 1G1XA 4O3NA 4IR1A 2NSCA 4TNOA 1NB2A 2XYPB 2H9ZA 3R3TA 2UUBF 4H54A 3QYYA 4KE5A 4DCPB 5BYSA 2BVZA 1JKHA 5LMUF 4HT7A 2C1EB 4X4OA 1ELOA 2HFNA 1KTQA 3O1LA 3ZXWA 2LQJA 2GQ2A 3KLFA 4KC5A 1D0EA 4N77A 2KZZA 8RUCA 2ATLA 2YPYA 4KQZA 1XBWA 3G2XA 1YJWS 4DJBA 1VRQC 1N33J 3OL6A 3NY0A 4OL8A 2XHWA 4ELVA 4USTA 2HS0A 1TR0A 3M6UA 4RKUC 2XCAA 1IKWA 3C6UB 1FFGB 3UE2A 1JLGB 1AB8A 1VC0A 2JC0A 3W65A 2MY7A 1S9EB 3EJMA 5J1PA 4CLKA 3BDEA 2XS5A 2YKOA 3C19A 3NGUA 2K2PA 1DHMA 2MHNA 4DR2J 1W2IA 1M5VC 4J9PA 3MF5A 3J7YU 3I96A 2J0WA 3RB6A 2C3UA 1AROP 3KWMA 2FC9A 1TMMA 3ISND 1M1KT 2VFTA 2VKRA 3JSMA 2MZJA 1JJHA 3BQ0A 3R6LB 5AJ3J 4QWDA 3AD9C 2FJAB 3L7PA 3EVOA 3KOAA 4I69A 3ENVA 3V5RA 3CJSA 3CWJA 2M3DA 1R0BG 2KHCA 3FCWA 1Q95G 1H7WA 1X4AA 1Q8LA 3MOZA 5F8HA 3OTCA 1PJ5A 2ZC3A 2G0CA 1S72S 2RVJA 2E1PA 1UZHA 3BM7A 2KT3A 4Y0FA 3NCRA 1U1NA 3DDNA 5CH7B 3KG1A 1ZA1B 1NJWA 2HIQA 5E5NA 5DLGA 2IDEA 2QV6A 4F02A 2R7OA 1S1TB 1RBAA 1AA1B 4OV1A 2QLJB 2VG7A 3U1LA 2BE9B 3J7ZT 3R5DA 3U7JA 1BXNA 2MY8A 4OZ0A 2LECA 4YDDB 1WHVA 4RPFA 1SJ4P 1H2VZ 3KLFB 1FXLA 2P9GA 3GJQB 1FKOA 1WWHA 2FGOA 3P3DA 2KXNB 2GMHA 4JI5J 2E5GA 3AD8C 1U1OA 4OQJA 1RWVB 3G8QA 1KKHA 1N34F 5B0DA 2EXUA 4OLPA 3HSJA 2ZWPA 3VV2B 2AJ0A 3QPIA 3TA1A 4UOHA 2C42A 3M9MB 3CC2S 4WCEQ 4QPXA 3D6TB 4GO5X 1ZETA 4XK8C 3J81j 3PO4A 2C3YA 1NMEB 2Y0SD 4IR9A 3TAMA 1PC5A 2HWIA 3FRZA 4HR2A 3I87A 3CD0A 1PBAA 5LJ3Y 1TL1A 5T41A 4OHYA 2LDYA 3PJWA 1S1UA 3JSMB 3BO4A 3RBZA 4AL6A 3AODA 4FNIA 2HNYA 2GHVC 2F4VF 3GQCA 2DH8A 2APOA 1N54B 2ZZNA 2V2VA 1H7XA 2VDIA 1PYOB 2XZWA 4PRFA 3ISZA 3Q2TC 2CA9A 2OUGA 5AE1A 5DGBA 3UDEA 1XC9A 3DGVA 4I2PB 2HHXA 5L9XA 3RBXA 3PTWA 2VB6A 1RAEB 4ECWA 2YKAA 4QIVA 4EZ9A 4UT4A 4OMFG 2DGSA 4QU6A 2NZ4A 3J7YI 2R8KA 3DDKA 3G6ES 3J80U 4DI6A 1FKOB 1N33F 4Q44A 2EWHA 2AYBA 2AD9A 2BW2A 1VHFA 4WFZA 1B70B 2GAHC 5HATA 2HK2A 5M2UA 1FXRA 3FC9A 2H54B 2DNHA 3T19A 2UU9J 2WK4A 3MI7X 4RW6A 1TFYA 2ZH7A 2HWHA 1CS4A 2BA9A 1C1CA 4DR2F 3TEGA 4PYDA 3TAMB 4R5PB 1XTZA 2XLJA 3IS9B 3BO2A 3SXLA 1UZDA 4DN0A 5KFVA 2CZVC 1CPZA 1TL1B 5AJ3F 4MK7A 4PG5A 1B7YB 3MMCA 2XYHB 5EDWA 2CZ4A 1QVFR 2CVIA 2HNYB 3AT1B 4RLEA 3QWUA 3D68A 3EGZA 5A6PA 1NK6A 2ZJQQ 2HHHF 3DRSA 4YR3A 3W5ZA 3ZTQA 5C25A 1J27A 3HKZD 2NXNA 4NXMF 3FMBA 1HBNA 5LJ5Y 4FXVA 3MDFA 1PKUA 3RZAA 4K4TA 4MT1A 2ZVSA 2FJWA 3VZIA 2QLFB 1K73T 4C11A 3JAMU 2EFQA 3O44A 3D66A 4U7CA 1IR1A 2Z2MA 3L3CA 5B09A 2KVIA 5HQMA 1S10A 4BWMA 3RBEA 1VQ8S 2PEBA 4KGZB 4PYAA 4RO0A 5DO2A 1AW0A 4LQ3A 4ED3A 4CH7A 2EFGA 4NLVA 3QAUA 2RDJA 2HNZA 2ROEA 1RWOB 2BMBA 4U67Q 4FBUA 3BSNA 1WOPA 1U09A 5EHHA 4G1QA 5L39A 1NSQA 1U4BA 3G8TA 3Q8PB 2IA0A 1R43A 4LIRA 3V6KA 4OX7A 1TV6A 5BXIA 1CS4B 1C1CB 2A0FB 1V3ZA 3UFCX 3LGMA 1B99A 3DRXA 3UWTA 4XAKA 3I55S 2ZH4A 5KT6A 2AJFE 3G87A 3M8ZA 1N5QA 1WC5A 4D3HA 2R2RA 1I3OB 2V50A 2CZ9A 4C2MA 1S7IA 5BYQA 3MMCB 2CPJA 2V9WA 3K5OA 2C3MA 4OZ1A 1U8SA 4XDDA 4EO8A 1VQ4S 3DRSB 4H4OA 1KFSA 4I56A 3IO1A 3WX4A 4M5JA 3GJRB 1U1MA 1B0PA 1YJVA 1T9VA 5C25B 2C28A 2YWWA 1X9WA 1HBNB 4LF5J 3DXSX 3CCJS 2AU0A 3PIPQ 4YB5A 2V68A 2DXEA 3VQTA 4O3SA 2FHJD 2E9RX 4EK2A 5KG1A 4C11B 1IUJA 3G8SA 4B3RJ
chains in the Genus database with same CATH topology
3D6MB 3IBCB 3KJNB 2DKOB 3GJTB 1NMEB 3R7NB 3KJFB 2QL9B 2Y1LB 4LSZB 1RHUB 2CDRB 4JB8B 3QNWB 1RE1B 2QL5B 2HBQB 2CNOB 2H4WB 1RHMB 4ZVPB 3P4UB 2Y0BB 2HBZB 1QTNB 1QDUB 2CJYB 2HBYB 3EDRB 1GFWB 3SIPB 3D6FB 3R5JB 1I3OB 1RWXB 1SC4B 3GJSB 2QLFB 1RHKB 1RHQB 3EDQB 2XYGB 2XZTB 2QLJB 2QLBB 2H54B 2CNNB 4DCOB 2FQQB 2H51B 2C2MB 3D6HB 2C2ZB 5IC6B 2HBRB 2QL7B 1RWPB 1PYOB 2CJXB 3GJRB 2XZDB 3GJQB 1I51B 1PAUB 1RWNB 1SC1B 1ICEB 1RWWB 2H5JB 3RJMB 2C2KB 4ZVQB 4ZVOB 4ZVTB 3R7BB 2P2CB 1RHRB 1RWMB 3KJQB 4ZVSB 3R7SB 2XYPB 1F9EB 3P45B 1BMQB 3R6GB 1RWVB 1IBCB 3IBFB 1RWOB 2CNKB 1RWKB 2CNLB 2H4YB 3R6LB 4ZVUB 2XYHB 5IC4B 4DCJB 4DCPB 3NS7B 4ZVRB 5K20B 2C2OB 2H65B 2H48B 1SC3B 2H5IB 1RHJB 2C1EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D6M B;  3IBC B;  3KJN B;  2DKO B;  3GJT B;  1NME B;  3R7N B;  3KJF B;  2QL9 B;  2Y1L B;  4LSZ B;  1RHU B;  2CDR B;  4JB8 B;  3QNW B;  1RE1 B;  2QL5 B;  2HBQ B;  2CNO B;  2H4W B;  1RHM B;  4ZVP B;  3P4U B;  2Y0B B;  2HBZ B;  1QTN B;  1QDU B;  2CJY B;  2HBY B;  3EDR B;  1GFW B;  3SIP B;  3D6F B;  3R5J B;  1I3O B;  1RWX B;  1SC4 B;  3GJS B;  2QLF B;  1RHK B;  1RHQ B;  3EDQ B;  2XYG B;  2XZT B;  2QLJ B;  2QLB B;  2H54 B;  2CNN B;  4DCO B;  2FQQ B;  2H51 B;  2C2M B;  3D6H B;  2C2Z B;  5IC6 B;  2HBR B;  2QL7 B;  1RWP B;  1PYO B;  2CJX B;  3GJR B;  2XZD B;  3GJQ B;  1I51 B;  1PAU B;  1RWN B;  1SC1 B;  1ICE B;  1RWW B;  2H5J B;  3RJM B;  2C2K B;  4ZVQ B;  4ZVO B;  4ZVT B;  3R7B B;  2P2C B;  1RHR B;  1RWM B;  3KJQ B;  4ZVS B;  3R7S B;  2XYP B;  1F9E B;  3P45 B;  1BMQ B;  3R6G B;  1RWV B;  1IBC B;  3IBF B;  1RWO B;  2CNK B;  1RWK B;  2CNL B;  2H4Y B;  3R6L B;  4ZVU B;  2XYH B;  5IC4 B;  4DCJ B;  4DCP B;  3NS7 B;  4ZVR B;  5K20 B;  2C2O B;  2H65 B;  2H48 B;  1SC3 B;  2H5I B;  1RHJ B;  2C1E B; 
#chains in the Genus database with same CATH topology
 4AXI A;  3DDI A;  3CCZ A;  4P74 A;  3VHQ A;  4NEZ A;  1RUS A;  2D69 A;  1K0T A;  3TVK A;  4WK3 A;  1J2V A;  2MPU A;  3OLA A;  2ZH9 A;  1LEO A;  5L9N A;  2CJQ A;  4DX6 A;  4NX9 A;  4P71 A;  2H4W B;  5DDP C;  4Z7C A;  5IM0 A;  5DM7 Q;  3GFH A;  4OHZ A;  2BQU A;  4LRA A;  2HRY A;  4OZ2 A;  2HNZ B;  1OYD A;  5E3C A;  1XN9 A;  2HIY A;  4R8U A;  5D6G A;  2UU9 F;  4G1Q B;  3G71 S;  1V6H A;  3ZNJ 1;  5IT9 U;  2RQ4 A;  4I0W A;  4CLP A;  3G6V A;  1VHI A;  2IMO A;  1WC3 A;  2PA3 A;  1TV6 B;  4DL7 A;  2OMO A;  3ULH A;  1IWG A;  2ZKT A;  3ZTP A;  1QE1 B;  3M6X A;  4LBH A;  2FLO A;  4TYB A;  2AF6 A;  4ILR A;  4A8W A;  2U1A A;  4Y2I A;  3UDL A;  1FRM A;  3M32 A;  2VG5 B;  3UR3 C;  4LF7 J;  4CLU A;  3FJ2 A;  4H4O B;  4Q2M A;  1OMS A;  2HLU A;  3KKF A;  4NLW A;  2GO9 A;  4QIG A;  4F26 A;  1UPP A;  1SH2 A;  2UXD F;  4RJV A;  4I67 A;  3C3L A;  6FD1 A;  2YNH A;  3NAI A;  3V81 A;  1A6L A;  4MIA A;  3MFH A;  3I82 A;  4NA1 A;  4YS2 A;  4USM A;  1RAH B;  1S59 A;  1ZAV A;  3BQ1 A;  5IS2 A;  1ZH5 A;  2V63 A;  3KK1 A;  3SDE A;  2ZD1 A;  1RAF B;  1XNQ J;  3CED A;  3SZ2 A;  2EG1 A;  1DRZ A;  2I2Y A;  3FQL A;  3KLV A;  1D3W A;  5IM0 B;  1N8R T;  2GIQ A;  2RDD A;  4FPR A;  2IC3 A;  2R2U A;  4B08 A;  4KHR A;  4R8U B;  2C2E A;  4MYT A;  3HUL A;  4O4G A;  2HVE A;  5DJB A;  5ITH A;  1Y11 A;  1NSP A;  1O0P A;  3OHB A;  2KXF A;  1U1L A;  2Y1R I;  3BN4 A;  3AXM A;  2EW9 A;  2XG8 A;  3SV3 A;  2CAD A;  3HPO A;  1PIE A;  1KQF B;  4HI2 A;  2BR0 A;  2M7S A;  1X5T A;  4J9S A;  2DIV A;  3H7H B;  4MTP A;  2JLG A;  1UWB B;  2PI4 A;  4UZC A;  5E3Q A;  4WXO A;  1RWX B;  4NLU A;  4PWD A;  3JXO A;  2RHS B;  3PW7 A;  1DFD A;  4LBP A;  4JI0 J;  3SFG A;  4WFB Q;  2XWX A;  4MKA A;  2XS2 A;  4Q7A A;  3GTY X;  4IG0 B;  1GXT A;  2CRL A;  4DX7 A;  3M32 B;  2XY6 A;  1VRT A;  4R25 A;  1TAQ A;  3PCO B;  2L41 A;  1HNV A;  1SC1 B;  1Z4U A;  1KEK A;  2B56 A;  1IQT A;  2PMW A;  4LF5 F;  2MQQ A;  5I3P A;  4J5O A;  4EUV A;  2DRD A;  2DRA A;  5K8P A;  2VH7 A;  2YNH B;  2MZ1 A;  3CCL S;  3V81 B;  1XWL A;  4A4J A;  1F1B B;  7FD1 A;  4B3R F;  2HG4 A;  4DV7 J;  5KFA A;  4QIE A;  2I8E A;  1P6T A;  1VQ7 S;  3C6T A;  3CJQ A;  1XEZ A;  1FX4 A;  1K8A T;  2KFY A;  2LYV A;  2MQL A;  5D78 A;  3KK1 B;  1Q8B A;  1WI8 A;  4Q43 A;  2E29 A;  1LFW A;  2ZD1 B;  4AXJ A;  1GX5 A;  5F9L A;  1ACM B;  1LK5 A;  4DQP A;  2AW0 A;  3DI6 A;  3BR8 A;  1VQM S;  1S97 A;  2FY1 A;  1X8D A;  2M0G B;  4U8V A;  3GU0 A;  4I4B A;  4QW8 A;  4ICL B;  4O4G B;  2CG4 A;  2QFJ A;  1ZAW A;  4QJV A;  5B0C A;  1VGY A;  2QLX A;  4K5R A;  3MTK A;  2W2N P;  1QUV A;  3IR7 B;  1FT8 A;  4Z37 A;  3I4H X;  1YJ9 S;  3DYA A;  3ZTO A;  3TAP A;  1N32 J;  3KFW X;  3PRV A;  2RUS A;  3PDN A;  4TLQ A;  1KVJ A;  3HVT B;  3R97 A;  5LSL A;  4PWD B;  1PYS B;  3G86 A;  2BM0 A;  4CH1 A;  2IAJ A;  2ZC4 A;  3M8W A;  2JHE A;  4LF7 F;  1Y3K A;  1U48 A;  1AZS A;  1O51 A;  1VRT B;  4GKK J;  2ZOF A;  1HNV B;  3CE8 A;  4ECV A;  3TRG A;  2KTQ A;  3AJ1 A;  5F3Z A;  2DNR A;  1QTN B;  2FLL A;  2HBY B;  2J76 E;  1JIH A;  4OJ1 A;  4L72 B;  4YME A;  1OY8 A;  3ETO A;  2CQ4 A;  3AAW B;  3QMQ A;  2K3K A;  2JL9 A;  3M05 A;  1NH8 A;  2MQN A;  2ZH8 A;  1FRJ A;  3H5Y A;  2DNK A;  3C6T B;  2K1R A;  2XUL A;  2A2C A;  2X1B A;  1XNQ F;  5DET A;  1R7I A;  2MKS A;  4C8M A;  1U6F A;  3JQK A;  4DL5 A;  4PKD B;  4K4X A;  3FUY A;  3HVR A;  3M6W A;  1KFD A;  1WF2 A;  3RRH A;  1U49 A;  3OUY A;  2XGQ A;  5LL6 d;  3DI6 B;  1KSP A;  1S6U A;  3CJ8 A;  3IC1 A;  3LUY A;  2COL A;  2J9C A;  4QR2 A;  4WU3 A;  4BBY A;  4MK8 A;  3ILL A;  3IRX A;  4A8S A;  3T1Y F;  2P6T A;  2FJD B;  4LSZ B;  3I56 S;  2DRB A;  1UFL A;  1FXD A;  2KB2 A;  3K5P A;  3DYA B;  3JTN A;  4ELU A;  2DGT A;  3W1Y C;  2YWE A;  1L3U A;  3K2Y A;  1IM6 A;  5HQ8 A;  1JX4 A;  4JI0 F;  3FQK A;  1JJC B;  2JC1 A;  1REG X;  3KMS A;  2QIF A;  4EYI B;  4YP3 A;  1DJ0 A;  4KTQ A;  2IAJ B;  3J80 Y;  2VIH A;  1HAR A;  5HVG A;  3OBI A;  2CWX A;  2B7C B;  2GHP A;  1AZS B;  3CF5 Q;  3SI8 A;  1KR4 A;  2HHP A;  4MK9 A;  4ILL A;  1U26 A;  1RK8 A;  4I1T A;  1QSS A;  3PR5 B;  5DG9 A;  3UNG C;  3OPK A;  2V8H A;  2GVD B;  3KUE A;  3OR2 A;  2ZH2 A;  2LXF A;  4CO0 A;  2G4B A;  1LW2 A;  1Y7P A;  2BJ7 A;  3FEX B;  4DV7 F;  4XTT A;  2ERR A;  1V3R A;  2IRU A;  2QC3 A;  2WZ1 A;  2RS8 A;  1PIL A;  4OZL A;  5FDL A;  5CHC B;  4TQR A;  2UP1 A;  3TZW A;  2DNN A;  5K14 A;  1VQY A;  5HSP A;  3CDE A;  4CIO A;  4NLS A;  2XMA A;  1T94 A;  4DX8 H;  1DQ9 A;  5LMN F;  1L3K A;  1DUR A;  2BEF A;  5HAO A;  4G1P A;  3OUY B;  2ZJP Q;  2HLT A;  2W8K A;  1RBL A;  2OEL A;  3ENA A;  3KLI B;  5M2R A;  1V9O A;  3TUJ C;  1Z1Z A;  4LUB A;  3IRX B;  1DTQ A;  4J9K A;  1VJQ A;  4F0K A;  1RWN B;  5D0G A;  3MAA A;  4DX5 A;  3R7B B;  3NL0 A;  4JV1 A;  1N32 F;  4WU2 A;  5KFC A;  4UY8 5;  2FTR A;  5HRO B;  1X5S A;  4U9R A;  1YG0 A;  3KLG A;  3JAM Y;  1YRT A;  3VAJ A;  4YEA A;  1R8P A;  3PXG a;  1JMT A;  3T3F A;  2WRM A;  1GMV A;  5HLF A;  3MEG B;  4V19 X;  3W9J A;  3DRY A;  1F0X A;  2CDQ A;  3H0P A;  1NBE B;  2OI2 A;  2P8I A;  4RW4 A;  4GKK F;  4NYO A;  2CPY A;  1GMW A;  1REV A;  4FF1 A;  5KFZ A;  4C6A A;  3KMQ A;  4QIF A;  2VA3 A;  4DR5 J;  4PXC A;  2HAF A;  3BQ2 A;  4A8F A;  3NLC A;  4ZA1 A;  3B78 A;  5KFR A;  3ILO A;  3SCK E;  3K17 A;  3EDR B;  2J7K A;  4ECT A;  4OHX A;  1LW2 B;  1MWQ A;  4AT1 B;  2MGZ A;  1X4C A;  1FEE A;  3FKB A;  1HBM A;  2XO6 A;  3MCO A;  5KFH A;  4IH6 A;  1SKS A;  1BUX A;  5FDL B;  3CJ2 A;  3DLH A;  3F0N A;  4W92 B;  2FHK A;  3AA9 A;  2OEK A;  5K14 B;  4DPW A;  1UA0 A;  4RNM A;  2B9W A;  1UJ5 A;  2YNF A;  5L38 A;  2NYI A;  3CO0 P;  3C16 B;  5F0U A;  3MMJ A;  2LVW A;  2R7S A;  1H3D A;  4J9Q A;  3NAH A;  3BO3 A;  4RWW A;  2C2O B;  2M2B A;  2OD4 A;  3BRE A;  2VFV A;  3K8W A;  2NPI A;  3QO9 B;  2QL9 B;  4X64 J;  3AB2 B;  4EMD A;  1CQN A;  3W66 A;  1WEY A;  2FPH X;  2POK A;  1XMQ J;  1IBK J;  1HYS A;  3A4T A;  2ZBC A;  3EZO A;  3MAA B;  5IT4 A;  4K4Z A;  4K0K J;  2HBQ B;  3GII A;  2XB2 D;  2WOM A;  1FE4 A;  3GFX A;  2FGC A;  4LRE A;  4KRW A;  2KL8 A;  2DCU B;  2RE1 A;  3Q22 A;  4N8O A;  5J1N A;  1IBL J;  3KLG B;  2EVZ A;  2EEY A;  3AQP A;  3EX7 B;  1Q4R A;  3SBM A;  5HLF B;  4DCO B;  1S99 A;  3D6H B;  3OVS A;  2OPS A;  3VVU A;  3N9U C;  2OJ3 A;  2VPZ B;  2ZOM A;  4RW4 B;  1TKT A;  3PNI A;  4Z7Y A;  2CJX B;  4IRC A;  2E1C A;  4NCA A;  2HQG A;  4NLG A;  2UUT A;  2PDA A;  2CPF A;  5ADZ A;  2GO8 A;  1OSD A;  4USK A;  4KH1 B;  3M8P B;  5KOX A;  4DV3 J;  2ILZ A;  1TKX A;  4WWS A;  1NDP A;  5L1L A;  1CUL A;  1NJX A;  2ZJR Q;  4Y2K A;  1QY7 A;  2XMK A;  3CCR S;  2MGZ B;  3PW2 A;  2CPX A;  4JV2 A;  1F6T A;  1D9A A;  1HBM B;  2LCW A;  3HFK A;  1Y4Z B;  2EPI A;  4DSJ A;  1Q78 A;  1ZYQ A;  1TTH B;  2XWY A;  4UY8 T;  2J9E A;  3JB9 k;  1GAO A;  4OYW A;  1VJW A;  3MM9 A;  4CLT A;  1PGZ A;  3NNC A;  2YY3 A;  3HDS A;  2YNF B;  3OFH A;  5IFM A;  4EBE A;  5HMW A;  5IOL A;  4ZVE A;  3QJJ A;  2XLK A;  1C0U A;  2GMJ A;  2CNN B;  4N47 A;  1XK8 A;  3JQJ A;  2D3U A;  2V8V A;  1L3V A;  1U2R A;  3CDW A;  4LRD A;  3AOA A;  3NGS A;  4HLB A;  4C3M A;  4DV4 J;  2H5J B;  2DR8 A;  4DV1 J;  4OI2 A;  2D3O 1;  3UW1 A;  2PSZ A;  4K4U A;  1S1X B;  2LP4 A;  2B5J A;  2WOM B;  2R7U A;  1WHY A;  3DRR A;  3L9Z A;  2OTL S;  1URN A;  3HI9 A;  2IY5 B;  4ZCL A;  4OI0 A;  4ZIT A;  4EBD A;  3X1L B;  4XPE A;  1RT3 A;  1P9Q C;  2ASD A;  1CJK A;  4IUF A;  3BGU A;  4PG8 A;  3F56 A;  4DQS A;  4CTA A;  3P6Y C;  2OPS B;  2HHV A;  2BJ9 A;  4ID8 A;  4DR5 F;  1V5I B;  1GNK A;  1TL7 A;  4ECX A;  2EI5 A;  4JOU A;  1RLD A;  3FBC A;  2CKW A;  2QJ3 A;  3FZB A;  4GO7 X;  4DBQ A;  4ANC A;  2MKH A;  1TKX B;  2DGU A;  2CQ0 A;  4NMX A;  3RGI A;  2W4P A;  4DU8 A;  1VS3 A;  2KZM A;  2YH1 A;  3CIZ A;  4CM2 A;  1KP6 A;  1HL6 A;  1QAY A;  4ZPB A;  3T5H A;  2FVS A;  1FHT A;  1J5E J;  2R7X A;  1U47 A;  3MD3 A;  4B3S J;  4MJK A;  1DY3 A;  3MM9 B;  4ELT A;  2BKO A;  2DNY A;  5KFK A;  4PUO A;  1RCO B;  1N5Y A;  1GX6 A;  1IWA A;  3CB4 A;  2DVI A;  2XQC A;  1C0U B;  4X64 F;  3UPF A;  3EM1 A;  1UA1 A;  2BQR A;  2VD3 A;  4J37 A;  2L9W A;  1XMQ F;  1IBK F;  3X3U A;  3BDP A;  2R8G A;  3M30 A;  5IT0 A;  2OPQ A;  1UMJ A;  4K0K F;  5DM6 Q;  3RBD A;  2PO4 A;  1AXQ A;  2ROG A;  2EC0 A;  1S79 A;  2B5J B;  3PW5 A;  1IBL F;  2BE7 D;  2DR9 A;  1SC4 B;  3SYZ A;  4MKB A;  3DRR B;  3MPD A;  4HH0 A;  4M63 A;  1ZPV A;  4AE5 A;  1JLA B;  4W4M A;  2UVU A;  3EXC X;  1RT3 B;  3PV8 A;  1CJK B;  1JXV A;  4YHH J;  4CTA B;  3OFF A;  2BZ2 A;  2YBV A;  1KTV A;  1RJJ A;  3GV7 B;  1ICE B;  1YLX A;  1YK9 A;  4C8Z A;  2JVO A;  4RR5 A;  2X1F A;  1TL7 B;  3ZC4 A;  2HWT A;  2PEH A;  5ETQ A;  3ZZP A;  1FRI A;  5K9F A;  4EU0 A;  1H6K X;  4HT5 A;  4RNO A;  4DV3 F;  3GG0 A;  3B6B A;  1WOS A;  3C2P A;  3CJ0 A;  3ZTR A;  3BYP A;  2L9N A;  3LA0 A;  2MQ8 A;  3GG1 A;  3NGD A;  1U0H B;  4ZMM A;  3QAT A;  4GMK A;  4UF4 A;  2WB1 D;  1N6Q A;  2N4C A;  1EAR A;  1LK7 A;  2ILY A;  5B0G A;  2CPD A;  3D3C J;  3TVY A;  4F50 A;  1CC8 A;  4U96 A;  4FKY A;  1U1K A;  1R6V A;  4OJ3 A;  4AL5 A;  4ETX A;  1NAQ A;  2ZBR A;  2G1H A;  1UJ6 A;  2G1D A;  3EGV A;  3N5B A;  4LBI A;  1XMO J;  1G6B A;  2HZC A;  3QT7 A;  4ED7 A;  4PUO B;  2OGU A;  2R7T A;  1N5Y B;  2DGQ A;  4ZPV R;  2C3P A;  3QZ8 A;  2GQQ A;  4CO5 A;  3B4M A;  4DV4 F;  3H8Y A;  3S01 A;  4DV1 F;  3W3S A;  2YXL A;  2GVZ A;  3M30 B;  3Q8Q B;  2C2K B;  2LA6 A;  3V4I A;  2OPQ B;  4IDK B;  3L95 X;  3KDN A;  3VGS A;  2PC6 A;  5E3A A;  4PQU A;  4CNY A;  4OLO A;  1VQO S;  4OJH A;  4F4K A;  1I6J A;  1LV5 A;  4C48 A;  4M5G A;  3HKW A;  4HEA 9;  1NK4 A;  2JOQ A;  3D6M B;  3LPE A;  2JEF A;  2AGQ A;  3VAL A;  3H5U A;  2KVQ E;  1NJY A;  1B64 A;  4G3I A;  3H25 A;  1HR0 J;  2HGL A;  4ZIW A;  2BAC A;  5LM7 E;  5J2Q A;  2IM2 A;  3OL7 A;  3I6P A;  3QJP A;  1S48 A;  3QGH A;  3PG9 A;  4MKY A;  1M1H A;  4ZPW R;  4UZB A;  4MIB A;  3NGK A;  1RU1 A;  4DXL A;  3HF5 A;  3MUV P;  2J7U A;  5KFF A;  2YKN A;  1EIY B;  1RKI A;  4IOB A;  1VDH A;  2RML A;  4YY3 J;  4Q0B B;  4NLO A;  1Y5N B;  4W90 B;  1J5E F;  3EIC A;  1N6Q B;  5BR8 J;  1NK0 A;  5KFQ A;  2YTC A;  1YRX A;  4USU A;  4QR0 A;  1Q5Y A;  3RB4 A;  2WSF C;  1IJE B;  1RWK B;  2QE5 A;  5E7O B;  4CLF A;  3D9B A;  3ZTS A;  2D3O R;  4OYZ A;  4CCH A;  3R5C A;  3K7R A;  4O23 A;  5HBM A;  3MUM P;  3CD7 A;  4C8L A;  2KDO A;  5G0R B;  4N76 A;  3ENQ A;  3WZ0 A;  2GVZ B;  4U7U K;  4KAI A;  2HQF A;  3LP0 A;  2AJQ A;  3V4I B;  4DMZ A;  3RB0 A;  5GAG U;  2O1P A;  2DGV A;  4JP8 A;  4L3K A;  3O5T B;  4PQU B;  2KH9 A;  1K47 A;  2KKH A;  5JJB A;  4FPI A;  1GK8 A;  2OSR A;  2JRS A;  1M5O C;  2G0I A;  4L6V 3;  5RUB A;  3LAM A;  4PG6 A;  1WG5 A;  4C98 A;  3GON A;  4YHH F;  4LF1 A;  4TQS A;  3PYF A;  3BBF A;  1BQM A;  2DNQ A;  2L08 A;  1F2H A;  4ZVQ B;  5J2Q B;  4HTI A;  2FZK B;  5B7W A;  2DNZ A;  4ZKA A;  5KFU A;  4KGV B;  3QT5 A;  2QTW A;  3P45 B;  4M5M A;  2ZBP A;  1KLM A;  1IBC B;  4LT6 A;  2MLZ A;  2DIT A;  2WHO A;  4DCJ B;  2JEI A;  1GMW D;  4WK1 A;  2GAG C;  2FIU A;  5B08 A;  3V4M A;  1KRP A;  2PN6 A;  2K7J A;  2YKN B;  2YH0 A;  3GJT B;  2LQB A;  1IN0 A;  5CCL A;  2F63 A;  2UXB J;  3SQO P;  1R0A B;  4YDX A;  2CQI A;  4OX9 J;  5E41 A;  1TL4 A;  2GX8 A;  2V2K A;  4ES1 A;  2HHW A;  4A8M P;  3T1H J;  2W24 A;  3DXB A;  1XMO F;  4ZJL A;  2HW3 A;  3W8P A;  3PRB A;  3HT0 A;  1CJT A;  3RAQ A;  2CQ2 A;  1KOH A;  5HBM B;  2V67 A;  4QYZ J;  4GRS A;  4ES3 A;  3KXD A;  4K7Q A;  5D3G A;  3SFU A;  1EB0 A;  3M2U A;  1WC4 A;  1WEZ A;  3IGV A;  4WIQ A;  2JWN A;  2ZVI A;  2Y8W A;  1RA6 A;  1SXL A;  3E01 B;  2YQ0 A;  2IVM A;  3LP0 B;  3TAN A;  1APS A;  1SB6 A;  2KT2 A;  1BMQ B;  3RRG A;  1N0V C;  4DR6 J;  1ZA2 B;  5KFB A;  4F3Q A;  2HVI A;  1A9N B;  3W60 A;  4P52 A;  1F60 B;  3U1N A;  3VGU A;  3DOM A;  3KNG A;  3KJN B;  2B4P A;  1RAB B;  1HR0 F;  3RW6 A;  5DDR C;  1HQ2 A;  2DR7 A;  3BSA A;  5CCM A;  1BQM B;  1LXJ A;  4F4Y A;  5D0E A;  1E6V A;  1WNE A;  3I32 A;  4KPY A;  2ZH1 A;  2DH7 A;  4P6Q A;  1KLM B;  3TVZ A;  2LEA A;  3GJS B;  2HK3 A;  2Q66 A;  2VDH A;  1WEL A;  4C8Y A;  2HHT A;  4WZQ A;  4YY3 F;  1HMV A;  1N5T A;  5HMX A;  5D4L A;  3KHH A;  1KN6 A;  3RB3 A;  1VR6 A;  5BR8 F;  4M8L A;  5CYM B;  1VQS A;  5B0E A;  5GAG I;  5KFJ A;  1WC6 A;  2RQK A;  4DLG A;  2WB4 A;  1TUW A;  1TL3 B;  1YIT S;  5DQG A;  5B0F A;  4QYZ K;  2ASJ A;  4ZVR B;  3US5 A;  3TA2 A;  2YKQ A;  3TJ8 A;  1CJT B;  4A48 A;  2CQB A;  2AKW B;  4Y2A A;  4F25 A;  4WFN Q;  3KTQ A;  2R7Q A;  2G2Z A;  2VC0 A;  3BSC A;  2I5J A;  1SJR A;  1T3N A;  3POT A;  2NR0 A;  2Q3P A;  1TK0 A;  3QGI A;  1RP5 A;  3M2U B;  5D3G B;  3PJ9 A;  2XNR A;  3D3B J;  2HZA A;  5B0A A;  7FDR A;  2DHG A;  1FK9 A;  3PZP A;  3UCG A;  3Q83 A;  1IR2 A;  2X51 A;  1Q1K A;  1NLK L;  1Q7Y T;  3R2D J;  1S4E A;  1LW0 A;  1UEK A;  3PW0 A;  1YBU A;  2K8G A;  3DOM B;  1OQ3 A;  3NXZ A;  4DFK A;  4X4Q A;  1PAU B;  2E7V A;  2J6U A;  3DHX A;  2DXD A;  3AD7 C;  3DC2 A;  5SUH A;  3OFE A;  2QEX S;  1E6V B;  1KON A;  4J9R A;  4CDI A;  1C0T B;  2A2D A;  2CG8 A;  1X5O A;  1ZZF A;  3D1H A;  3P49 B;  1DZ5 A;  3CJT A;  3Q24 A;  2Q79 A;  1Y0H A;  2RRB A;  3FK4 A;  4TVA B;  1M5P C;  2N3O A;  2MKC A;  4FS2 A;  4ECU A;  2UXB F;  2QGF B;  2VFR A;  1FJC A;  3MTJ A;  2BW7 A;  3BB5 A;  1U2C A;  1JLC A;  1MML A;  2XY5 A;  2DEJ A;  1ULR A;  2BKP A;  3T1H F;  3GIJ A;  3KHL A;  4LFB F;  2AYG A;  2Z4P A;  3C66 A;  2YKM A;  2EK6 A;  5KFN A;  4IG3 A;  2M5Y A;  1RA7 A;  5J2M A;  3NWR A;  4ED5 A;  1RTI A;  3MM6 A;  4NI2 B;  3M1V A;  2PD1 A;  4RNH A;  2I5J B;  3E51 A;  5KAK A;  2ZHB A;  2NS1 B;  2YWH A;  4O4R A;  1RT2 A;  4F04 B;  2GS8 A;  1TP7 A;  1D09 B;  5HN0 A;  2E7X A;  1MRO A;  3MR3 A;  4ATN A;  1HQU A;  2D7S A;  1BHN A;  1FK9 B;  1CG2 A;  5C5J A;  5HJY A;  3EYZ A;  2H4Y B;  4CO1 A;  4V1A k;  3PW4 A;  1IBM J;  3VAK A;  1LW0 B;  4PWW A;  4ZN1 A;  4Y2C A;  1WHW A;  1Z2Z A;  2C22 A;  2RUG A;  2Y8Y A;  1NSA A;  1UVK A;  3BH6 B;  3RR7 A;  2IM3 A;  3DN9 A;  1S57 A;  2R4F A;  4TYA A;  3TQE A;  3CDA A;  5ETV A;  1TZ0 A;  3E3X A;  3ITH A;  4RU9 A;  1RT4 B;  5KFM A;  1SBR A;  4IQX A;  3HT3 A;  2Z56 B;  3FBB A;  1G3O A;  4PPD A;  2AZ3 A;  2JEJ A;  1QAI A;  3NG8 A;  3S6E A;  1FD8 A;  3C6U A;  5L46 A;  1YVF A;  4PAA A;  3AFG A;  5I4M A;  2VBX A;  2YQ3 A;  1NCL A;  4O3O A;  3GE9 A;  4OZJ A;  3PYE A;  1DQA A;  2BBE A;  3TWZ A;  1WTB A;  4BC7 A;  1JLC B;  2HQI A;  1KNZ A;  2DHA A;  1W7W A;  3SV4 A;  3VQS A;  3PFE A;  2YKM B;  1CLF A;  2D1C A;  4IG3 B;  4DSE A;  2NQP A;  4G1I A;  2V0N A;  3VGT A;  5EGY A;  3OV7 A;  2V2Q A;  3UD5 A;  3I5A A;  2JJ4 D;  4F2S A;  3SCI E;  1F9F A;  4QBU A;  1T9T A;  1UVM A;  4WBF A;  1S5Z A;  3B8H A;  1BGX T;  4F4Z A;  5KG0 A;  4M5H A;  4MMO A;  1MRO B;  2Y0B B;  1HQU B;  2VKZ G;  3HHL D;  1S0O A;  3IWX A;  1S9G A;  1ZOT A;  5L1J A;  2DHX A;  2CWK A;  4P2M A;  2F5G A;  4M5L A;  2O01 C;  4C3L A;  1S9F A;  1RBO B;  3WIV A;  4Y28 C;  1ZS6 A;  1NPK A;  3GB0 A;  1S1T A;  2IPO B;  4X4P A;  1NB7 A;  1NPP A;  2ADC A;  1H2U X;  1RHR B;  1JLB A;  3W5X A;  2F40 A;  3ITH B;  3PX6 A;  1HW9 A;  1VYA A;  3DGP A;  1UET A;  1NU4 A;  4NCB A;  3M8Y A;  1RCX B;  5K20 B;  1KQG B;  1TUG B;  2YX7 A;  2GJI A;  3Q8S B;  1X9M A;  1X4D A;  2F7V A;  1HWI A;  2XMJ A;  4OZ5 A;  4M5D B;  2O3D A;  4K4W A;  1H72 C;  4YFU A;  1RE1 B;  3GMG A;  2V4J A;  1Q79 A;  4A8Y A;  2CQD A;  3BZQ A;  5DRK A;  3S7R A;  5IQ6 A;  3D7S B;  1KBR A;  2VFS A;  5LOQ A;  5EX3 A;  5ETK A;  1WOR A;  1R0C B;  1QSY A;  1HI1 A;  1EJ7 L;  3ZO7 A;  2WVB A;  1WI6 A;  3ZZZ A;  1S76 D;  4OYM A;  1KC8 T;  4RL1 A;  5HQL A;  4MYU A;  1KD1 T;  1NUE A;  1N5S A;  5HL7 Q;  2NXC A;  1B3T A;  4FKX A;  4TN2 A;  3M9N B;  4N41 A;  1BWE A;  5J2P A;  1C1B A;  5GME A;  1QAX A;  5LXR A;  4Q5V A;  3SCL E;  5F41 A;  2Y1J A;  3QLH A;  2HHH J;  2AIR B;  3TUI C;  1SUQ A;  2W9B B;  1IBM F;  3BV8 A;  4CLY A;  1O8B A;  1FDB A;  4WTY A;  1S9G B;  4KR0 B;  4NXM J;  1IQZ A;  4RUH A;  1F5C A;  1FWL A;  2HQ3 A;  3IBC B;  4KO0 A;  5HMZ A;  1Y5L B;  4A8O A;  5J1E A;  1WJ9 A;  1YJT A;  3M4X A;  4I2P A;  4KH0 B;  2ZBQ A;  2WVE A;  2JX2 A;  2D74 B;  3VAH A;  5CYQ A;  3MOJ B;  2NSB A;  4N56 A;  1F2G A;  1PC4 A;  5KT3 A;  1IXK A;  3PFO A;  4USJ C;  1EHW A;  4IOC Q;  1JLB B;  1OWX A;  1TU0 B;  1OJ4 A;  5D15 A;  2UUC J;  2BJ8 A;  1S12 A;  2XMT A;  4DPO A;  3PY8 A;  2VPY B;  4RBU A;  3DGP B;  4NLT A;  2IYG A;  3O3L A;  3BYR A;  1KHV A;  2YWG A;  3SQG A;  3GFZ A;  1MU2 A;  5BYR A;  2H3E B;  3FZ2 A;  2PMZ D;  3PVX A;  1YSJ A;  1AUS L;  2W4C A;  4DOZ A;  5CYJ A;  4J9N A;  2Z2Y B;  4NA3 A;  3QSI A;  1VBK A;  2V4J B;  4J91 A;  4KIA A;  1AFI A;  4F67 A;  2D3Z A;  4R5P A;  2BE2 A;  4NLR A;  3IS9 A;  4ZVU B;  2CPI A;  4F36 A;  2ZDP A;  4I68 A;  2P6S A;  1RHJ B;  1J5O A;  1KS2 A;  2W01 A;  1F3F A;  2UZA A;  4YB1 P;  2E9T A;  4LRF A;  2OPR B;  5F8L A;  4D3G A;  2ZDO A;  3WDO A;  5HVH A;  5JVG Q;  4NWB A;  3UDV A;  3N4W A;  2GV1 A;  5J2P B;  1C1B B;  5FLX U;  5F0W A;  2EG2 A;  1KWM A;  3QLH B;  3QJL A;  1B7F A;  5B0B A;  1SUQ B;  1RKJ A;  4USV A;  4CH0 S;  1XQI A;  3KUG A;  1RYS A;  2QSF A;  2OH2 A;  4MAK A;  3AOC A;  1KOO A;  4KO0 B;  1VC6 A;  3MM8 A;  1FWP A;  5J1E B;  3H4B A;  3E8O A;  2HBR B;  2KU7 A;  3UI3 A;  2CFX A;  1P27 B;  3DMJ A;  5ETN A;  2MKJ A;  4KV8 A;  5KFO A;  5CYQ B;  4OIX A;  4HDH A;  4ZVO B;  2J0S D;  1WD6 A;  5HP1 A;  1BWV A;  4FYY B;  3CCQ S;  2Y3Y A;  3MCM A;  5ETR A;  4FYV B;  2VF3 A;  4ZLL A;  3IBF B;  2XMU A;  3V6H A;  2V8G A;  1NZ8 A;  1VK8 A;  1ZAX A;  9ATC B;  3UD4 P;  2PI5 A;  1W2B R;  3SQG B;  2ZZM A;  1NO8 A;  1MU2 B;  2MZQ A;  3I0R B;  3LWL A;  2R8I A;  2JLE A;  3TA0 A;  5KG7 A;  3MGJ A;  5LSO A;  2KG0 A;  4CLZ A;  2N3L A;  3QNW B;  4B9N A;  2CVE A;  1YBA A;  1B0T A;  1S1V A;  1L3T A;  4CP5 A;  2RDI A;  2QX0 A;  3EZ5 A;  3RU0 A;  2FUG 9;  1HNX J;  4ZS6 A;  1VQ5 S;  3CJR A;  2BE2 B;  2XEX A;  2A10 A;  2XMV A;  4ZVF A;  1J5O B;  4NOH A;  4L3N A;  4ED8 A;  2BXJ A;  5IXU A;  5ETO A;  3HFV A;  1Y9O A;  3NCP A;  5KFE A;  1OSC A;  4B9M A;  3M8R A;  3TEH B;  4RUB A;  2RJZ A;  4ZPD A;  1HI8 A;  4CZC A;  1SJF A;  3PJX A;  2WVF A;  4F3M A;  2XO7 A;  1C4A A;  1O6X A;  1CC7 A;  1EET B;  3L4B C;  3VGV A;  2Z2L A;  1HNZ J;  3THP A;  1S6Q B;  4X4V A;  1X4B A;  2JZ5 A;  1H74 A;  3IWN C;  1RZM A;  4OI3 A;  2UXD J;  3D1O A;  2NXJ A;  4X4U A;  3H2V E;  2GZO A;  3MM8 B;  3JS9 A;  1VRU A;  3P5B P;  4DWI A;  3KG4 A;  4DR1 J;  5CXT A;  3DMJ B;  3PIO Q;  4KV8 B;  4OX6 A;  5KT5 A;  3MPW A;  2QO3 A;  5DDO C;  3EXY A;  5HP1 B;  2OD6 A;  2HQC A;  1JWW A;  3T9Z A;  2ZIT A;  2UUC F;  2AJ2 A;  2DO0 A;  3UCZ P;  2OO4 A;  4HVZ A;  1FKA F;  1RTZ A;  4LF8 F;  4UTG A;  2DR5 A;  2E5L J;  2Q6C A;  1VCT A;  1SKW A;  4K4V A;  4YUD A;  1UVN A;  3MPV A;  2DR6 A;  2R3V A;  3H90 A;  1YHQ S;  2UVV A;  3MHY A;  4KFB A;  3CUL A;  3W7B A;  3NNH A;  1Q86 T;  1PAE X;  4JI3 F;  2LDI A;  1M90 T;  5AT1 B;  1EZZ B;  4DV5 J;  2E1R A;  5C24 A;  4GC6 A;  4ZVS B;  3CC7 S;  1S1V B;  4HHH A;  1LKZ A;  4NZ7 A;  1P1L A;  2YWF A;  2ZBI A;  2AYE A;  3VTI A;  2P9C A;  4DUZ J;  4HH1 A;  1T3O A;  2QT7 A;  2IMW P;  4ZK7 M;  1ZTT A;  5IC4 B;  2F8H A;  3AJ2 A;  1QE1 A;  1FA0 A;  4QR1 A;  4F0M A;  3CUN A;  1ITP A;  4DR7 J;  1ZM2 A;  4B3M J;  4P73 A;  3P8B B;  1WEX A;  3SSQ A;  3TP2 A;  1TMJ A;  2R42 A;  3NMA A;  1UCN A;  1PYT A;  2R9L A;  1R31 A;  4FXW A;  2NXE A;  3ILJ A;  3V2U C;  3MM7 A;  1Q7L B;  1Y10 A;  1ZBT A;  4CLL A;  2VG5 A;  4QYR A;  1OPI A;  3EGN A;  3ZFV A;  3C15 A;  3NWG A;  3OR1 B;  4DEZ A;  3HD1 A;  2XYG B;  3OW2 R;  3LAN A;  2NRE A;  4HTJ A;  3K5L A;  2H51 B;  2CJ9 A;  1S49 A;  1OY9 A;  2FC8 A;  3VAI A;  4O0I A;  4K2J A;  3VCD A;  5KFT A;  1FDN A;  1UVL A;  2VZ9 A;  1VRU B;  4YB6 A;  3GYG A;  1NH7 A;  2AHO B;  4IKA A;  4JV0 A;  2F4F A;  3CVK A;  1T8E A;  5AXL A;  2VFU A;  4ZVH A;  4F4X A;  3MR5 A;  3OLB A;  2YVS A;  4X2B A;  2LA4 A;  2MQP A;  2KO1 A;  1QUP A;  4KFB B;  4Q8F A;  5A6W A;  4E8U A;  1FVQ A;  4F4W A;  2FYX A;  3S1T A;  2WTF A;  1C2P A;  4F8R A;  3FBF A;  4DR3 J;  2XMM A;  4KGK A;  3W2W A;  5C24 B;  1I1G A;  1HNX F;  3GR1 A;  3Q8V A;  1RAA B;  2G13 A;  3KK3 A;  5KG4 A;  2QA4 S;  2GML A;  1R8B A;  3QZ7 A;  2AYM A;  3AOB A;  4K50 A;  3D0I E;  1UWB A;  1GT8 A;  1HBO A;  3CD5 A;  4ZP9 A;  3OT9 A;  5I3Q A;  4NCG A;  4JI8 J;  4IG0 A;  3CGI A;  4TY9 A;  4PPZ A;  3MM7 B;  1SL1 A;  4J9M A;  4ECZ A;  2BRK A;  1WOO A;  3HMJ G;  3BPD A;  1HNZ F;  5LSR A;  3C15 B;  2VBW A;  2DHH A;  1LQ9 A;  2I1R A;  4MH8 A;  2IJN A;  3JSR A;  1H2T Z;  3NS5 A;  1S0V A;  4DR1 F;  2ALZ A;  3GP9 A;  2WON A;  4ZVG A;  2B0G A;  3ZZ0 A;  3NEK A;  1RAI B;  1QVG R;  2ZH6 A;  2DNP A;  5EX0 A;  1OS5 A;  2E5J A;  4NYP A;  3MD1 A;  2RHQ B;  1JJ4 A;  2MKK A;  3UN2 A;  4A46 A;  2LEB A;  2E5L F;  1VQK S;  1QM9 A;  1KQK A;  3AB4 B;  1S6P A;  3FEZ A;  1EQM A;  3RUB L;  1BQX A;  2P9E A;  3LPY A;  3TUZ C;  1D9D A;  1X31 C;  4E2F B;  2AGO A;  5DQH A;  4MIW A;  3T1A A;  1XNR F;  4DV5 F;  2RF2 A;  4CI0 B;  3BS9 A;  4K4Y A;  4ICL A;  4MFB B;  4OYO A;  3R7S B;  2QMX A;  3W2W B;  4DUZ F;  2HUR A;  1Y3J A;  2VOO A;  2CNL B;  4UW2 A;  3DLK A;  2J9D E;  3T1Y J;  2VOP A;  2I9S A;  3KK3 B;  3DNC A;  2YKP A;  2BUN A;  2IHR 1;  4DR7 F;  2BRL A;  4B3M F;  2KFZ A;  3RW7 A;  1R8A A;  3LP2 B;  3HVT A;  1HBO B;  4ZLN A;  2DPI A;  1S1W A;  4UOF A;  3TUP A;  3QT6 A;  4NCG B;  4OZ3 A;  1UVJ A;  5H1S V;  2EK1 A;  4UQT A;  2N82 B;  2F65 A;  3HSD A;  2HYI B;  4EGL A;  3MXH P;  2RQC A;  3M2R A;  1LWE A;  5G4D A;  1HNW J;  3GV8 B;  1NJI T;  2RB7 A;  5T7L A;  1B4S A;  4Q45 A;  5LXY A;  3GCW P;  2UUA J;  1FTR A;  4LR8 A;  1CJV A;  4DPY A;  5IC6 B;  3GPA A;  2DYA A;  5I42 B;  4ZPT R;  1H98 A;  1HIY A;  5E3P A;  2F1F A;  1RU2 A;  2WON B;  4A8K A;  1WC1 A;  2IM0 A;  3KG0 A;  2CJB A;  4RW7 B;  3TQ1 A;  2Y9H A;  5DDQ C;  1PJ7 A;  3QRP A;  5HVF A;  3OXF A;  3GSD A;  4YQW A;  1SJQ A;  3HHE A;  1U6Z A;  1RAG B;  1S6P B;  2HND A;  3N79 A;  4LIW A;  3EVM A;  3W61 A;  5LMN J;  4EWT A;  1VBX A;  4DR3 F;  4FDF A;  4PCQ A;  2CXE A;  3H59 A;  1H73 A;  3RRK A;  4AD6 A;  3WC0 A;  1B0V A;  3OFG A;  4WF9 Q;  3HFZ B;  2RF2 B;  2JEG A;  3LGH A;  4ZOS A;  4TY8 A;  3W62 A;  3PR4 A;  2KT5 A;  1YBT A;  1NM2 A;  2U2F A;  3DLK B;  1T03 B;  1M1G A;  4TXS A;  4PXB A;  2ZUG A;  2JH3 A;  5A8W A;  2B9X A;  5J2N A;  3CCT A;  4C0B A;  4JV5 J;  2GIF A;  2F9D A;  3R1H A;  4LF2 A;  2V2Z A;  1LWF A;  4JI8 F;  4V19 J;  1VC5 A;  1M0S A;  4RX6 A;  1S1W B;  3UD3 P;  5AE2 A;  2C2R A;  4DQI A;  2KXH A;  1FF2 A;  2I0X A;  3N0V A;  3BGR A;  3AHP A;  3RR8 A;  2HPU A;  3F41 A;  3UQS A;  5GMK a;  3Q86 A;  2IRY A;  4PWU A;  2MYF A;  2I6W A;  3CCM S;  4U6P A;  3K5N A;  1OIA A;  2IRX A;  1LFP A;  3M2R B;  1LWE B;  2RIJ A;  2FZC B;  2H65 B;  4OI6 A;  1N56 A;  4QWA A;  5T7L B;  3FDS A;  1SH3 A;  2GVD A;  1CJV B;  2AJ1 A;  3NBP A;  1WDT A;  3CO9 A;  4LSL A;  4ZP6 A;  3LP1 A;  4PAB A;  1O5J A;  3MMA A;  2VQE J;  1GXU A;  1RAO A;  1SQE A;  3OTD A;  1RTD A;  4DN9 A;  2OHD A;  1NSK L;  4QZV B;  1YX2 A;  2QYG A;  1RDR A;  1FEH A;  1YZ7 A;  2J7W A;  4EZ6 A;  3EPG A;  1VBZ A;  4ZJQ A;  3MWB A;  2ASY A;  4ER8 A;  4Y6I A;  4NEY A;  3K89 A;  1HI0 P;  2AGP A;  2WW8 A;  1T95 A;  4DV6 F;  1HBU A;  3JSY A;  2HND B;  3KDO A;  1F3V A;  4NL5 A;  3M9O B;  3QGP A;  4NML A;  2MSS A;  1PJ6 A;  2XSF A;  2F8M A;  1SQF A;  5HI7 A;  3Q0A A;  1TKD A;  5D0R A;  5FLX Y;  3KLI A;  4LSN A;  4WII A;  1W25 A;  3HP6 A;  1RIS A;  4DL4 A;  2EFV A;  1HWK A;  3GIM A;  2QN6 B;  4I2Q A;  5AXM A;  1CEZ A;  3LAK A;  4Q8E A;  4TY8 B;  1JJ2 R;  1ZTW A;  3J81 U;  2A18 A;  4QWC A;  2AEF A;  3IAS 9;  4EYH B;  3THT A;  4M95 A;  4B9S A;  5A8W B;  5HRO A;  5CAA A;  5J2N B;  3PEH A;  1U1Q A;  4DPT A;  4JYA J;  1D1U A;  4X65 J;  2W9A A;  5ETM A;  1UW9 A;  3MEG A;  3HK2 A;  1LWF B;  3ADA C;  1SV5 A;  4DV0 F;  1UAW A;  5CD4 A;  3HZG A;  4JI6 J;  3MED A;  1MWY A;  3BGR B;  4O44 A;  2BX6 A;  3NOG A;  3AY0 A;  1HNW F;  4M1K A;  2EFP A;  4Y34 A;  2DXF A;  1LWX A;  1X4G A;  3N28 A;  3GLJ A;  1RHK B;  3L7O A;  5H9E J;  3UN3 A;  2UUA F;  1T11 A;  1DBD A;  4DS4 A;  4B3O A;  4ZJO A;  1NK7 A;  2HGN A;  2MZS A;  4KHM A;  5SZT A;  1NDL A;  3NBP B;  4LF6 J;  1DAR A;  3D0H E;  4A8X A;  1FVS A;  1WKL A;  4LSL B;  4DDF A;  1HKA A;  3LP1 B;  1JKH B;  3MMA B;  5E0O A;  4CLS A;  2KYZ A;  4ES2 A;  1UKU A;  5K5M A;  2BAN A;  3ZZR A;  2Z58 B;  1RTD B;  3MAH A;  1NJZ A;  1YI2 S;  2AQ4 A;  2GA7 A;  5IQQ A;  2HVH A;  4ZCM A;  1HBU B;  3DLJ A;  2G0J A;  3C16 A;  4OHW A;  1Z2L A;  1WKJ A;  2WBM A;  1TKZ A;  1IKW B;  3U1M A;  5EWE A;  3BGL A;  3EVW A;  2YWK A;  4H4M A;  1GQE A;  2QL5 B;  5D4P A;  3QO9 A;  4LSN B;  2HFZ A;  1U6B A;  4B9T A;  5MAO A;  4L76 A;  4I2Q B;  5EWF A;  4G6V B;  4I6Y A;  2B8P A;  3BPS P;  2J6S A;  3FBE A;  1V3S A;  2HKE A;  3OTB A;  1UWA A;  2ATC B;  4JV5 F;  2KFN A;  4P72 A;  3M7V A;  1FE0 A;  2C2Z B;  3RYL A;  3CPW R;  5THW A;  1FO1 A;  2OAU A;  2V4R A;  4CQ1 A;  1UFW A;  4MKV A;  3T5J A;  2L3M A;  5DGA A;  3SCJ E;  3HXM A;  4O3R A;  2F3J A;  2XNQ A;  3I4P A;  3VZH A;  2F9J A;  2RIL A;  4IH5 A;  1SV5 B;  2MZR A;  2GJ2 A;  3MED B;  5H9E K;  4O44 B;  1KVI A;  3CW2 C;  3DM2 A;  1HA1 A;  2W7P A;  2DKO B;  3M8P A;  2A6M A;  3R7N B;  4B3O B;  3OTE A;  3W5Y A;  4LRB A;  1VOM A;  1WTF A;  4CRJ A;  5ETS A;  9RUB A;  2WSC C;  2VQE F;  2WVC A;  2VG7 B;  2VBY A;  2BOP A;  1KDN A;  4F2R A;  1EKS A;  1VIS A;  2BAN B;  1XR6 A;  1P9Y A;  4FVM A;  1RYR A;  3PHE A;  4DQR A;  4E0D A;  3UNY A;  1Q0N A;  3L09 A;  1FI4 A;  4X62 J;  2OSQ A;  1M5K C;  4LFC J;  2VA2 A;  3C8Y A;  1TKZ B;  4OX8 A;  3BN7 A;  1SI9 A;  4RUA A;  3FVY A;  1RWW B;  2A6O A;  4H4M B;  4L73 A;  1HFE L;  4FYW B;  4IH7 A;  1M5S A;  5F3T A;  3G6X A;  3IRW P;  3FRY A;  1S1X A;  1XR5 A;  4DSI A;  3HHK A;  4WTO B;  3QFW A;  1RT1 A;  4CM0 A;  4JYA F;  4I64 A;  1XER A;  2CJK A;  4X65 F;  4I6A A;  5KFY A;  3CCS S;  4NA2 A;  3SMZ A;  4JI6 F;  1S1U B;  2RQM A;  2W9C A;  3GIK A;  3Q8Y A;  3HD2 A;  3WX8 A;  4NYZ A;  2EFO A;  3DM2 B;  3ZZU A;  1YTY A;  3EDQ B;  1FD2 A;  4WE1 A;  4X84 A;  3RTV A;  2DBB A;  5K8M A;  1SH0 A;  7AT1 B;  4K59 A;  3I0S A;  3QIP A;  4LF6 F;  1FJE B;  1VQL S;  3K0J A;  1NRK A;  3HM9 A;  3IGN A;  2HAI A;  3K57 A;  3GSI A;  2XC9 A;  1RWM B;  4DFP A;  4ILM A;  3ICL A;  5L1K A;  1BC6 A;  4ZLJ A;  5JXS A;  2QMW A;  5DG7 A;  2AEM A;  2QFI A;  4C8O A;  2DB1 A;  2UVR A;  4JI5 F;  4OYB A;  3QFH A;  4CO4 A;  4JI4 J;  4NLX A;  1NPR A;  4KGX B;  2MXY A;  1HWJ A;  2NUH A;  3KJV A;  3MUR P;  2DK2 A;  4JB8 B;  4K2X A;  4C0O C;  1GEH A;  4QOT A;  1FRX A;  2HFV A;  2W2Q P;  3P4U B;  4NLQ A;  3HJF A;  4RW6 B;  1S0M A;  1GFW B;  1RT6 A;  1KVK A;  4N7T A;  2LQ8 A;  1NXI A;  4ZP8 A;  1AUD A;  4X4R A;  2MKI A;  1MMD A;  3HX9 A;  3M2V A;  1RT1 B;  3HSG A;  1T05 A;  2PT0 A;  3J7A N;  2NPF A;  2MDA A;  4WJB A;  1JLA A;  4NZ6 A;  3RAX A;  2XHC A;  4XDC A;  2W9C B;  3ETM A;  1C4C A;  1EX8 A;  2KYX A;  5D77 A;  2R8J A;  1NDC A;  1T02 A;  2AV5 A;  2G2Y A;  3KUH A;  1SKR A;  2FVC A;  4J90 A;  1WC0 A;  1PO6 A;  1DAX A;  2M88 A;  2B3T B;  3HLU A;  1JNZ B;  4WE1 B;  4E98 A;  1TQL A;  1MN7 A;  2OKQ A;  4IQM A;  3CJK A;  2YX1 A;  4USH A;  4ITS A;  2ZOG A;  2GCF A;  2M8H A;  3I0S B;  3QIP B;  2C2D A;  1U0H A;  3K8V A;  5IV3 A;  4ECR A;  3MAQ A;  4QCL A;  2ADB A;  1YKW A;  3N01 A;  1P1T A;  4EBC A;  2DY9 A;  1OYE A;  4WXW A;  1FES A;  4DG1 A;  4X62 F;  1UW4 A;  1JXE A;  2R7W A;  1FJ7 A;  1XMB A;  2HS3 A;  4LFC F;  1Q53 A;  1K1S A;  3ET6 A;  1U02 A;  3FFI A;  4J9V A;  3KJV B;  2YX4 A;  1JXL A;  2VBZ A;  4ZVT B;  2MMY A;  2AWZ A;  3IR6 B;  4WFA Q;  2GW8 A;  2P2C B;  3V6D A;  2RNE A;  2BQ3 A;  3TO8 A;  3P96 A;  2FLN A;  4AYB D;  1RAJ A;  1RT6 B;  4IDK A;  1FKP A;  4RWX A;  3PYD A;  4DZD A;  2H5I B;  5I3U A;  2RS2 A;  1U2F A;  2LU2 A;  3M2V B;  1TVR A;  1SPB P;  1T05 B;  2DY1 A;  2CJA A;  2Z8Q A;  1T9X A;  4YN3 B;  1Q8I A;  4B9L A;  2KN4 A;  1PSD A;  2F8E X;  2YPZ A;  2V4Q A;  2OPP A;  2O67 A;  2B51 A;  3TAQ A;  3AXK A;  1FFW B;  2GFF A;  3C46 A;  4Q2L A;  5D0H A;  1WHX A;  5A0Y A;  1DTT A;  1QD1 A;  2ZE2 A;  3M8Q A;  3NP5 A;  4O3P A;  2MKY A;  4NPO A;  4PXD A;  3CJK B;  1HD0 A;  1N36 J;  1FJG J;  3PHT A;  3OVA A;  3IFE A;  2K06 A;  1R27 B;  3EPI A;  1BQN A;  2LU1 A;  5M2P A;  5F8N A;  5E33 A;  3HSZ A;  2KHD A;  4DSK A;  3A1Y G;  4Q0B A;  3EE3 A;  1YDL A;  3TX0 A;  3Q8U A;  2R7V A;  3DOK A;  4Y65 A;  2M4M A;  1MWZ A;  5KT7 A;  4JI4 F;  3QGG A;  3CSK A;  3WC2 A;  4RNF A;  1RTH A;  4AL7 A;  1NZA A;  1X0F A;  2YQ1 A;  4DG1 B;  4GVB A;  5K8N A;  3GCX P;  4C97 A;  4LF4 J;  3CME S;  1FDD A;  3ET6 B;  1YJU A;  3FFI B;  3UN5 A;  2N4D A;  3UCU P;  5A2Q Y;  1VQP S;  4K8R A;  4ENO A;  4C0H A;  3Q8R B;  2FVR A;  5KTQ A;  1LWC A;  3V6D B;  2DPJ A;  4DL0 C;  5G0R A;  2EKY A;  1N0U A;  2UXC J;  1FKP B;  1FNM A;  2OML A;  1KQS R;  2Z2Z A;  3QWP A;  2CQP A;  3KNA A;  1IJF B;  5I3U B;  2Q6B A;  1HWL A;  2OP5 A;  1TVR B;  4DZ6 A;  3FSY A;  2GNK A;  3UR0 A;  3QID A;  3MMB A;  3TAR A;  2JLF A;  4B9U A;  2V5H G;  4FNH A;  3BH7 B;  1FNO A;  3MPU B;  4BHQ A;  2OPP B;  1SIZ A;  1CJU A;  3FMW A;  1K0V A;  3MZI A;  1WF1 A;  3AH6 A;  4LVN P;  3MEK A;  1Q8K A;  2XI2 A;  3K5M A;  3KHG A;  4RBV A;  5A0Y B;  1DTT B;  2ZE2 B;  3M8Q B;  1S7H A;  4OYI A;  4H4K C;  2CAJ A;  4ZLP A;  4KHP J;  3OQ2 A;  3EMT A;  2B4U A;  1BQN B;  4KJI A;  5F9N A;  4BS2 A;  3J81 Y;  3THV A;  4IRK A;  2SXL A;  1VQ9 S;  3DOK B;  3KYL A;  2DIU A;  5D8H B;  1JK9 B;  4NLP A;  4PXE A;  1R0A A;  3FSI A;  3SDE B;  1S77 D;  1OPZ A;  3AQO A;  2CPZ A;  1RTH B;  5KFX A;  3CTR A;  3IN5 A;  2W7O A;  3CT9 A;  3MR2 A;  4GVB B;  5KFW A;  1K1Q A;  2MJU A;  4DV2 J;  4KBI A;  5DZ7 A;  1AYE A;  3HZE A;  5IZH A;  2IC3 B;  3TYT A;  1UP1 A;  1LWC B;  5KFS A;  1UEU A;  1RAC B;  5DLF A;  3TZX A;  3UO0 A;  3ZNU A;  3E01 A;  1YIJ S;  2FJE B;  3LQV A;  4BDP A;  1T9Y A;  4NLY A;  1N88 A;  2QMU B;  5DG8 A;  2HHS A;  4M5I A;  3OL9 A;  2FJB B;  3MMB B;  3MPY A;  4ECY A;  3B82 A;  2ZH3 A;  5ETL A;  4DR4 J;  1CJU B;  3SIP B;  2WCX A;  4P10 A;  3H2U B;  1SKU B;  4CO2 A;  2RU3 A;  4ED2 A;  2QSW A;  1X4E A;  1ZM4 A;  2KM8 C;  4UOC A;  1N36 F;  2CIM A;  2DNL A;  5AXN A;  2E44 A;  1FJG F;  1Q5V A;  1F5A A;  2FD2 A;  4DSL A;  2XZD B;  4NRT A;  1VBY A;  4P7V A;  5CZX A;  2IVF B;  1JLQ A;  2XBP A;  1U45 A;  3OSN A;  2HSE B;  2W2M P;  3GWC A;  1JNR B;  3PEJ A;  4BLG A;  2Z57 B;  1D9F A;  1JLF A;  3KLH A;  4W98 A;  1XIQ A;  5CYM A;  3LWM A;  4B17 A;  2CQH A;  4IOA Q;  1VLY A;  3BGF A;  3NS7 B;  1UFK A;  2W1B A;  4HHU A;  3A3O B;  2NYH A;  1TAU A;  1N52 B;  1TL3 A;  1VLO A;  1RGV A;  4LF4 F;  2ZFH A;  4Y2M A;  4LFB J;  4WZM A;  2IIH A;  3H98 A;  5KT4 A;  3BSO A;  4TLR A;  2CQG A;  2DGX A;  4EFA C;  4KY3 A;  2CQ3 A;  1FCA A;  3MCS A;  5DZ6 A;  3TZY A;  3VF0 B;  2LQ9 A;  5FD1 A;  3OD2 A;  1RHM B;  3CCW A;  3V6J A;  3VWS A;  2LQ5 A;  1NEE A;  1FNX H;  1X4F A;  4J9L A;  2UXC F;  4ID5 A;  3OVB A;  1F9H A;  2OLW A;  1VIO A;  3P5T L;  4QWB A;  3HCX A;  3A3P B;  3BF4 A;  4FZV A;  4KKO A;  2X1G A;  1RAD B;  4CT9 A;  4QPT A;  3TW0 A;  4F7V A;  1I51 B;  4DHV A;  2RU9 A;  1WUU A;  2W2P P;  4NAS A;  3TZZ A;  5MLC V;  3VAG A;  1QSL A;  4ED4 A;  3KK2 A;  4KGM A;  3I31 A;  3PX0 A;  1SJ1 A;  2ZHO A;  3DLL Q;  3OXL A;  4OJG A;  1KHW A;  2AJ4 A;  3ENW A;  2MJN A;  2VL1 A;  1A0O B;  2YNG A;  4LJM A;  5HMY A;  2QZ8 A;  1JQG A;  3NMR A;  1WAC A;  2AP6 A;  4L75 A;  3VR1 A;  4KHP F;  2B9E A;  1C0T A;  3EZU A;  3MUT P;  5CZV A;  5KFP A;  2OFG X;  2JSX A;  2VAS A;  2V94 A;  2Z0G A;  2VV5 A;  1RXO B;  1JLQ B;  4XPC A;  3N6M A;  2CPE A;  3PO5 A;  3NRB A;  4IYQ A;  2D9O A;  3TX8 A;  4DS5 A;  1RQ0 A;  1JLF B;  3KLH B;  2FB0 A;  2K1R B;  3WHI A;  1PCA A;  2Y1I A;  1R8H A;  2XLI A;  2AX0 A;  1NKE A;  3R1L A;  4DLE A;  2L48 A;  2IA6 A;  2QL7 B;  3R5A A;  2I38 A;  4JUZ A;  4DV2 F;  4M5K A;  3BJY A;  4F3O A;  4NI2 A;  4ZPC A;  2X3G A;  2QLW A;  4A47 A;  1MNE A;  1NK8 A;  1ZM3 A;  2XI3 A;  2ZZT A;  2OTJ S;  3D28 A;  1PG5 B;  2R2T A;  4LR9 A;  4ID5 B;  5T14 A;  4HAC A;  2J0X A;  3EWG A;  4QU7 A;  2PFD A;  2HS4 A;  2AMC B;  4JI2 J;  4LMZ A;  1UTA A;  3TI0 A;  2HEK A;  3BBC A;  4KKO B;  4PG7 A;  2O5D A;  1EAY C;  5H9F J;  1N48 A;  2A3J A;  3MR6 A;  5KOW A;  2CDR B;  1ZZN A;  3D0G E;  1QLN A;  2BJ3 A;  3T5K A;  2DD8 S;  4DR4 F;  1SJ3 P;  1T9W A;  4ZVP B;  3KK2 B;  3A3N B;  2IVY A;  1X4H A;  2KJV A;  4H4K A;  4ED6 A;  3GYN A;  2PMH A;  4P75 A;  2Z30 B;  1RHQ B;  3LGN A;  4WYW A;  3IMQ J;  4DFJ A;  5KG3 A;  2YNG B;  1RT4 A;  4P2X A;  1R3N A;  3W8G A;  2JDJ A;  5CA5 A;  1KLN A;  2ZWO A;  2B6A A;  3BKU A;  4GKJ J;  3DLE A;  3A8I A;  3OR2 B;  2JVR A;  3CXC R;  1VMB A;  1AT1 B;  4HHJ A;  2IBO A;  3FNN A;  4HKQ A;  5KFI A;  3HJV A;  2N7Y A;  2E5I A;  1LXN A;  4K4S A;  3IM8 A;  2MLX A;  1A7G E;  2BJE A;  5JUM A;  4C7Q A;  4KB7 A;  3ZZT A;  3R9L A;  1WSV A;  2MTL A;  4PG4 A;  4EO6 A;  3S8S A;  4ECQ A;  4WP3 A;  3PAC A;  2W2O P;  3DLG A;  2FLP A;  1NHK L;  5L1I A;  1IKY A;  2R2S A;  2DHS A;  4U95 A;  1X5P A;  1TUV A;  3NS6 A;  2HFS A;  2P5V A;  3D6F B;  2FHO B;  1HHQ A;  2UVW A;  2RH3 A;  3CCV S;  1DTQ B;  4WP8 A;  2UUW A;  5H9F K;  1S4F A;  4HAC B;  3KLE A;  2W4D A;  4FP9 A;  3GV5 B;  1BY9 A;  3G96 A;  1AFJ A;  2ZKU A;  2VUG A;  4UQG A;  3HHL C;  3JSB A;  3OJS A;  2QRR A;  4WP9 A;  1WF0 A;  2BJ1 A;  1FRK A;  5LT5 A;  4OFZ A;  4ZPA A;  5DS7 A;  8ATC B;  3T5L A;  4FXD A;  2VQF J;  5KG6 A;  3LW5 C;  2NLW A;  4QIW D;  2ZEJ A;  4URS A;  1IKV A;  1EQ0 A;  3I9V 9;  3EGW B;  1REV B;  1U25 A;  2V6A A;  1GH8 A;  1CVJ A;  1UPM B;  6FDR A;  3W63 A;  3BKT A;  2E5H A;  2PFF B;  4WKY A;  3ZZO A;  4N8N A;  4YOE A;  5GAD U;  2B6A B;  2PA8 D;  5U47 A;  1QTM A;  2AT1 B;  3DLE B;  2J0Q D;  4FVC A;  2ROP A;  1CQM A;  3OL8 A;  2QG9 B;  4WYL A;  2XGP A;  5IT9 Y;  3IBW A;  2O66 A;  4X4N A;  3Q23 A;  5F8I A;  4M5D A;  3LF0 A;  2FY8 A;  2QA4 G;  1G2E A;  2LKZ A;  3NGT A;  2VOD A;  3WBZ A;  1R89 A;  2XZT B;  2QLB B;  3C14 A;  1HW8 A;  4ZDN A;  3MCN A;  4JI1 J;  3DOL A;  3PKM A;  2PGC A;  1CBK A;  3NNA A;  1MG7 A;  1Y00 A;  4IFV A;  4FBT A;  4DUT A;  1URR A;  3DLG B;  1XR7 A;  4DUY J;  1IM4 A;  1IKY B;  3ISN C;  4Z2X A;  1K44 A;  2LMI A;  3NKY A;  2IM1 A;  1IR0 A;  3MEC A;  4WFX A;  1FX2 A;  2DO4 A;  1HHS A;  1NHV A;  4LRC A;  1SL0 A;  3W2V A;  4P9S A;  3OJU A;  1HYS B;  4JI2 F;  2WAQ D;  2LXI A;  3A8E A;  3O6Q A;  3KLE B;  2RAQ A;  2HHU A;  3MR7 A;  1JLE A;  3DFE A;  2W9B A;  3LH2 S;  4DL3 A;  3CCU S;  2X1A A;  2KM8 B;  5F8J A;  2V9K A;  4G65 A;  5CAB A;  4RW8 A;  3FCH A;  4F4A A;  4C9D A;  3DRP A;  2CPH A;  4TKT A;  1HNI A;  1IKV B;  4ED0 A;  1TKT B;  2DGW A;  3IP0 A;  2YNI A;  1X0P A;  2EBG A;  1F5B A;  2PII A;  4GKJ F;  4ZCI A;  3HVA A;  4NXN J;  3FEY B;  2RKI A;  3OSP A;  4Y00 A;  2OIH A;  1CUL B;  1MMN A;  5KG2 A;  2FJV A;  2FJX A;  3L7U A;  4PZV A;  5HJX A;  2D9P A;  1UL3 A;  3RG6 A;  2RD5 C;  2LXU A;  1ROF A;  3DHW C;  4KPC A;  2JFD A;  2IBK A;  3C14 B;  2E1A A;  2UV8 A;  3GZ7 A;  4HDG A;  3B54 A;  2W8L A;  3DOL B;  4URQ U;  4OHV A;  2K3I A;  4P2S A;  5E3R A;  5KFD A;  2V34 A;  4IFV B;  3BR9 A;  4OYP A;  5K8O A;  4GC7 A;  3B4D A;  1Q16 B;  4WKR A;  4HL9 A;  1V5V A;  2FHM A;  2GGP A;  4RU2 A;  2OPR A;  2HFU A;  2GJF A;  5A8R A;  3T6J A;  3MEC B;  4B9V A;  2WW4 A;  2D41 A;  1P8G A;  1I5O B;  2B7B B;  2EFN A;  1UEV A;  3W2V B;  3LAL A;  1NK9 A;  3GR0 A;  3J7A 1;  5GAD I;  4LFA J;  3H5S A;  1S6O A;  2KRB A;  2DNM A;  2FVQ A;  5EN1 A;  1JLE B;  2KI2 A;  4ZCK A;  3G6Y A;  1YJR A;  3CNQ P;  3UVJ A;  3A8K A;  1LNQ A;  3M6V A;  1RSC A;  1WKK A;  2G9O A;  2E1M C;  4F0H A;  2VQF F;  2L9D A;  3KJQ B;  3TJ9 A;  4RW8 B;  4EEY A;  1T7P A;  2MLY A;  1BE4 A;  3DRP B;  1XJW B;  1TEL A;  2XCP A;  1HWU A;  3R8Y A;  1OO0 B;  2QA1 A;  2FDN A;  1HNI B;  3K58 A;  1RT5 A;  2MZT A;  2ALY B;  4M94 A;  3CCE S;  3QBC A;  1FRL A;  1H0H B;  1YGY A;  2YNI B;  1K9M T;  2ZM6 J;  3JYT A;  4RNN A;  3H42 A;  3ONQ A;  1HQE A;  1QJH A;  3O8W A;  2BYC A;  4O3Q A;  4NRU A;  1G4C A;  2J5A A;  2RKI B;  4KT0 C;  4LF8 J;  1FWK A;  3D2W A;  8AT1 B;  1N4L A;  1QAJ A;  3I0R A;  3CMA S;  4KYZ A;  3CD6 S;  2ZNY A;  5F8M A;  2HRT A;  1Q82 T;  4RZR A;  2HMI A;  3CC4 S;  3BBB A;  3W9I A;  1CSJ A;  2G2O A;  2B4V A;  2MHE A;  2VC1 A;  4DL6 A;  2ASL A;  1VI7 A;  4JI3 J;  2CQC A;  4JI1 F;  3QRR A;  1TFW A;  3OXG A;  2BM1 A;  4TU8 A;  4OYX A;  2LFV A;  3ILI A;  2RSQ A;  3R27 A;  4USI A;  4TU7 A;  3JTP A;  5D4N A;  3RJM B;  4DUY F;  2VPX B;  2B43 A;  2N7C A;  3JTO A;  2HZV A;  5GMD A;  2M70 A;  3HHL A;  3CMQ A;  2XM3 A;  1U8W A;  2C2N A;  1Q81 T;  4X4S A;  2GGP B;  4P7T A;  5A8R B;  3IAM 9;  2WSE C;  5EUH A;  2XS7 A;  2QYC A;  4NE9 C;  3H4D A;  2IYI A;  1EET A;  4I7F A;  3DLB A;  5A76 A;  3H20 A;  2Y1L B;  1YRU A;  1S6Q A;  3A8J A;  1RTJ A;  3UVJ B;  2MQM A;  1D8Z A;  5AE3 A;  5BJR A;  2CNO B;  4LVO P;  1RLC L;  1SQG A;  2VON A;  1BD6 A;  2E9Z A;  1ZM9 A;  3DU6 A;  2HFO A;  5GVQ A;  5GAE U;  3H40 A;  4ETZ A;  2EKN A;  3OTO J;  4O0N A;  3FGV A;  5C2G A;  3GYX B;  3N6N A;  5DQI A;  3KHR A;  3PRD A;  4ERD A;  1RT5 B;  2AEJ A;  3SSR A;  4ZP7 A;  1SL2 A;  4NXN F;  4ED1 A;  3JYT B;  3RAM A;  1HQE B;  1NHU A;  3IXQ A;  2H5E A;  2DH9 A;  3CJ4 A;  4WFY A;  2FZG B;  2BDP A;  2CUY A;  2DIS A;  2H1Y A;  1RI7 A;  1W26 A;  5F8G A;  1SC6 A;  3H2L A;  1F9E B;  4FN5 A;  2JFK A;  4A8Q A;  2B8Q A;  3BGO P;  2LLZ A;  1U1R A;  3LOU A;  2HMI B;  3ZZY A;  4B3S F;  1U24 A;  3N6L A;  3AJD A;  3I9Z A;  3CJ5 A;  4NLD A;  4USW A;  1YZ6 A;  1YJN S;  2Q1L A;  4DU7 A;  4OV6 A;  2NCK L;  2M8D B;  2ZHA A;  2ACY A;  1L5U A;  4FF3 A;  3QQC D;  2VU5 A;  2M52 A;  3HHL B;  2R8H A;  2IDL A;  3T9N A;  4IRD A;  3PM9 A;  1NDK A;  2KG1 A;  4LFA F;  4K5S A;  2AZ1 A;  5IWA J;  1IKX A;  1WDD A;  2FQQ B;  4RW9 A;  1G7C B;  4RBT A;  1ZPW X;  4I7F B;  2DEI A;  1LOU A;  2BJD A;  1FER A;  3OR1 A;  1DQ8 A;  4EI2 A;  1HLW A;  4L74 A;  3UDC A;  3FSX A;  4TU9 A;  2ZUA A;  1RTJ B;  1OQ6 A;  4CYU A;  3CIM A;  2CNK B;  2K7K A;  5A8K A;  1E6Y A;  4IFY A;  2J6T A;  1VIX A;  1PBU A;  1N5V A;  1SVD A;  1WG1 A;  4QQB A;  2ZM6 F;  2IFX A;  4X4T A;  1HHT P;  3KJF B;  1WG4 A;  4B3T J;  2FVP A;  1NKB A;  4CLW A;  2VG6 A;  3ELH A;  2ZH5 A;  2CQ1 A;  2DT9 A;  3R5G A;  4ALZ A;  4OI1 A;  4DPU A;  3R5J B;  5ETT A;  1WSR A;  2HRU A;  5GAH U;  1DLO A;  5C42 A;  4DF8 A;  1XNR J;  2MEW A;  4X66 J;  3I5B A;  1Y5I B;  2V8D A;  1VQN S;  2XY7 A;  2GC8 A;  3MEE A;  4UOG A;  1FDA A;  3DKD A;  4P2F A;  5GAE I;  4YR0 A;  4AQY J;  4BCA A;  1VQ6 S;  3DCA A;  1HPZ A;  2UV8 G;  1MW7 A;  4PQA A;  3U27 A;  1IVZ A;  2KJW A;  4AFF A;  3TOQ A;  4DFM A;  3QSY B;  4HI1 A;  1EP4 A;  1IKX B;  1JB0 C;  4RW9 B;  5FII A;  5ETP A;  3U02 A;  3PKY A;  2DCL A;  5JMN A;  1YWX A;  2RRA A;  2RRN A;  2RT3 A;  5C2C A;  1SIW B;  4UUW A;  1NKC A;  3VAM A;  3G9C A;  4CYU B;  2J9D A;  1QDU B;  3OTO F;  2CYY A;  4XIU A;  4ZHR A;  5A8K B;  4JI7 J;  3R2C J;  1E6Y B;  4IFY B;  3T41 A;  5FJ4 A;  2ABY A;  4C3K A;  4XO0 A;  4LF9 J;  2C3O A;  3Q89 A;  1TK5 A;  3E2E A;  3BEG B;  4KSE B;  3H5X A;  2C2M B;  2R7R A;  4J9U E;  1NK5 A;  3NOC A;  3SSS A;  3IM9 A;  1RWP B;  3R5B A;  3F73 A;  2X3D A;  3D1Q A;  4CT8 A;  2HVZ A;  2ACM A;  3IG1 A;  2VG6 B;  1L3S A;  2W7A A;  5HK4 A;  4BWJ A;  3IA0 A;  5AXK A;  1TK8 A;  2Q43 A;  1VFJ A;  2HQD A;  2XMW A;  4IO1 A;  3NCQ A;  5D4O A;  4GVL A;  1DLO B;  2HVD A;  4ZN3 A;  1UJ4 A;  5C42 B;  1MSW D;  1FRH A;  2H48 B;  4MFB A;  4DPX A;  5JVH Q;  3WQP A;  2OEM A;  3CDB A;  2DGO A;  2KRR A;  4CO3 A;  3TJA A;  3D67 A;  4U7U D;  1I94 J;  3D4J A;  3O2I A;  4AUK A;  2X7I A;  3D5M A;  1HD1 A;  2BKN A;  4ZIV A;  3LP2 A;  4OYA A;  3MEE B;  3M8S A;  2HBZ B;  2VIC A;  1X60 A;  2NUU G;  4ANE A;  1R6Y A;  3QAE A;  2GQC A;  4QW9 A;  4RUC A;  5IWA F;  1HPZ B;  3LO3 A;  3F44 A;  5L8R C;  1EP4 B;  3MFI A;  4FF4 A;  3VVT A;  3GFY A;  4OZN A;  3DU5 A;  1R8C A;  4U8Y A;  5CD4 H;  3HHD A;  5HAN A;  5GAH I;  3Q2S C;  5I42 A;  2HHQ A;  2MB0 B;  2A1B A;  1U7L A;  2IJR A;  4DL2 A;  4DF4 A;  2UUB J;  4FS1 A;  4ZHR B;  4R0J A;  2DNG A;  2QA2 A;  3K59 A;  4RW7 A;  1RB0 A;  3A13 A;  1SC3 B;  1FFS B;  5IV4 A;  1RWU A;  5LMU J;  2M9K A;  4B3T F;  2IJF A;  2ZNZ A;  3IWL A;  3LTO A;  3FCV A;  4C4W A;  1S0N A;  4YR2 A;  4IO9 Q;  1U0S A;  5CQG A;  4DQQ A;  3IG1 B;  1OY6 A;  3SEO A;  2XSJ A;  4S0M A;  4DV6 J;  3IR5 B;  2OFH X;  5HO4 A;  1MN9 A;  3MM5 A;  4URG A;  2MST A;  1HMV B;  4LR7 A;  1FTC A;  2BOA A;  4I6W A;  4Y3C A;  4OX9 F;  2DJW A;  2V8P A;  3QT8 A;  2NXU A;  2EBE A;  2B9Y A;  4NZ0 A;  1YJ7 A;  4X66 F;  3VAF A;  4OI4 A;  3EUN A;  1M5H A;  5E2Q A;  5KFG A;  1VK3 A;  1T03 A;  1GXL A;  2V69 A;  4FYD A;  3HO1 A;  1BLU A;  4J9O A;  2XTJ P;  1RT7 A;  3JQM A;  2DTJ A;  4AQY F;  4UUX A;  2WBR A;  2E7W A;  3WIU A;  1H38 A;  3R6G B;  2VJV A;  3POT B;  2VHG A;  4QWE A;  1UVI A;  3G82 A;  4CNZ A;  4DV0 J;  1TL5 A;  4DR6 F;  3OHA A;  5KT2 A;  2FHJ A;  3D54 A;  2B4O A;  4BC9 A;  3TR5 A;  1GMU A;  1SCJ B;  2OEJ A;  3W9H A;  2DNO A;  2J8S A;  1EKR A;  2NZC A;  2W25 A;  3A12 A;  4JI7 F;  5EWG A;  3G4S S;  3CJ3 A;  4LF9 F;  4AND A;  5C7P A;  4B02 A;  2J8A A;  1X9S A;  4C8N A;  3PX4 A;  2HGM A;  2GHW A;  3PYG A;  2GIR A;  1NND A;  3AA8 A;  4HYK A;  3I5C A;  4CWB A;  2MQO A;  4R0E A;  1YQH A;  4YB7 A;  2XSJ B;  1T9U A;  1JLG A;  4N5S A;  4FF2 A;  3MM5 B;  2JNJ A;  1N34 J;  4FYX B;  1D8Y A;  4ECS A;  1S9E A;  3T6B A;  2E66 A;  4JBC A;  5KFL A;  2WVD A;  2LEP A;  3J7Z 5;  1X7V A;  1T0T V;  4PEO A;  2VPW B;  1RHU B;  1I94 F;  3GIL A;  2BAB A;  5J2M B;  1GTH A;  4LQ9 A;  1RTI B;  3MM6 B;  1RT7 B;  6AT1 B;  2AX1 A;  3BKF A;  3M1V B;  3CDU A;  4DSF A;  2CJY B;  4J7C A;  2EC2 A;  2VJU A;  3QRQ A;  4WPA A;  4PR6 A;  3G82 B;  1MLA A;  1RT2 B;  1U1P A;  4M5N A;  2BV3 A;  5A2Q U;  3HVW A;  5KG5 A;  4C8K A;  1GTE A;  2F4V J;  3NGR A;  2PE8 A;  3TNV A;  3W64 A;  3N5F A;  3GIR A;  3HHN B;  1G1X A;  4O3N A;  4IR1 A;  2NSC A;  4TNO A;  1NB2 A;  2XYP B;  2H9Z A;  3R3T A;  2UUB F;  4H54 A;  3QYY A;  4KE5 A;  4DCP B;  5BYS A;  2BVZ A;  1JKH A;  5LMU F;  4HT7 A;  2C1E B;  4X4O A;  1ELO A;  2HFN A;  1KTQ A;  3O1L A;  3ZXW A;  2LQJ A;  2GQ2 A;  3KLF A;  4KC5 A;  1D0E A;  4N77 A;  2KZZ A;  8RUC A;  2ATL A;  2YPY A;  4KQZ A;  1XBW A;  3G2X A;  1YJW S;  4DJB A;  1VRQ C;  1N33 J;  3OL6 A;  3NY0 A;  4OL8 A;  2XHW A;  4ELV A;  4UST A;  2HS0 A;  1TR0 A;  3M6U A;  4RKU C;  2XCA A;  1IKW A;  3C6U B;  1FFG B;  3UE2 A;  1JLG B;  1AB8 A;  1VC0 A;  2JC0 A;  3W65 A;  2MY7 A;  1S9E B;  3EJM A;  5J1P A;  4CLK A;  3BDE A;  2XS5 A;  2YKO A;  3C19 A;  3NGU A;  2K2P A;  1DHM A;  2MHN A;  4DR2 J;  1W2I A;  1M5V C;  4J9P A;  3MF5 A;  3J7Y U;  3I96 A;  2J0W A;  3RB6 A;  2C3U A;  1ARO P;  3KWM A;  2FC9 A;  1TMM A;  3ISN D;  1M1K T;  2VFT A;  2VKR A;  3JSM A;  2MZJ A;  1JJH A;  3BQ0 A;  3R6L B;  5AJ3 J;  4QWD A;  3AD9 C;  2FJA B;  3L7P A;  3EVO A;  3KOA A;  4I69 A;  3ENV A;  3V5R A;  3CJS A;  3CWJ A;  2M3D A;  1R0B G;  2KHC A;  3FCW A;  1Q95 G;  1H7W A;  1X4A A;  1Q8L A;  3MOZ A;  5F8H A;  3OTC A;  1PJ5 A;  2ZC3 A;  2G0C A;  1S72 S;  2RVJ A;  2E1P A;  1UZH A;  3BM7 A;  2KT3 A;  4Y0F A;  3NCR A;  1U1N A;  3DDN A;  5CH7 B;  3KG1 A;  1ZA1 B;  1NJW A;  2HIQ A;  5E5N A;  5DLG A;  2IDE A;  2QV6 A;  4F02 A;  2R7O A;  1S1T B;  1RBA A;  1AA1 B;  4OV1 A;  2QLJ B;  2VG7 A;  3U1L A;  2BE9 B;  3J7Z T;  3R5D A;  3U7J A;  1BXN A;  2MY8 A;  4OZ0 A;  2LEC A;  4YDD B;  1WHV A;  4RPF A;  1SJ4 P;  1H2V Z;  3KLF B;  1FXL A;  2P9G A;  3GJQ B;  1FKO A;  1WWH A;  2FGO A;  3P3D A;  2KXN B;  2GMH A;  4JI5 J;  2E5G A;  3AD8 C;  1U1O A;  4OQJ A;  1RWV B;  3G8Q A;  1KKH A;  1N34 F;  5B0D A;  2EXU A;  4OLP A;  3HSJ A;  2ZWP A;  3VV2 B;  2AJ0 A;  3QPI A;  3TA1 A;  4UOH A;  2C42 A;  3M9M B;  3CC2 S;  4WCE Q;  4QPX A;  3D6T B;  4GO5 X;  1ZET A;  4XK8 C;  3J81 j;  3PO4 A;  2C3Y A;  1NME B;  2Y0S D;  4IR9 A;  3TAM A;  1PC5 A;  2HWI A;  3FRZ A;  4HR2 A;  3I87 A;  3CD0 A;  1PBA A;  5LJ3 Y;  1TL1 A;  5T41 A;  4OHY A;  2LDY A;  3PJW A;  1S1U A;  3JSM B;  3BO4 A;  3RBZ A;  4AL6 A;  3AOD A;  4FNI A;  2HNY A;  2GHV C;  2F4V F;  3GQC A;  2DH8 A;  2APO A;  1N54 B;  2ZZN A;  2V2V A;  1H7X A;  2VDI A;  1PYO B;  2XZW A;  4PRF A;  3ISZ A;  3Q2T C;  2CA9 A;  2OUG A;  5AE1 A;  5DGB A;  3UDE A;  1XC9 A;  3DGV A;  4I2P B;  2HHX A;  5L9X A;  3RBX A;  3PTW A;  2VB6 A;  1RAE B;  4ECW A;  2YKA A;  4QIV A;  4EZ9 A;  4UT4 A;  4OMF G;  2DGS A;  4QU6 A;  2NZ4 A;  3J7Y I;  2R8K A;  3DDK A;  3G6E S;  3J80 U;  4DI6 A;  1FKO B;  1N33 F;  4Q44 A;  2EWH A;  2AYB A;  2AD9 A;  2BW2 A;  1VHF A;  4WFZ A;  1B70 B;  2GAH C;  5HAT A;  2HK2 A;  5M2U A;  1FXR A;  3FC9 A;  2H54 B;  2DNH A;  3T19 A;  2UU9 J;  2WK4 A;  3MI7 X;  4RW6 A;  1TFY A;  2ZH7 A;  2HWH A;  1CS4 A;  2BA9 A;  1C1C A;  4DR2 F;  3TEG A;  4PYD A;  3TAM B;  4R5P B;  1XTZ A;  2XLJ A;  3IS9 B;  3BO2 A;  3SXL A;  1UZD A;  4DN0 A;  5KFV A;  2CZV C;  1CPZ A;  1TL1 B;  5AJ3 F;  4MK7 A;  4PG5 A;  1B7Y B;  3MMC A;  2XYH B;  5EDW A;  2CZ4 A;  1QVF R;  2CVI A;  2HNY B;  3AT1 B;  4RLE A;  3QWU A;  3D68 A;  3EGZ A;  5A6P A;  1NK6 A;  2ZJQ Q;  2HHH F;  3DRS A;  4YR3 A;  3W5Z A;  3ZTQ A;  5C25 A;  1J27 A;  3HKZ D;  2NXN A;  4NXM F;  3FMB A;  1HBN A;  5LJ5 Y;  4FXV A;  3MDF A;  1PKU A;  3RZA A;  4K4T A;  4MT1 A;  2ZVS A;  2FJW A;  3VZI A;  2QLF B;  1K73 T;  4C11 A;  3JAM U;  2EFQ A;  3O44 A;  3D66 A;  4U7C A;  1IR1 A;  2Z2M A;  3L3C A;  5B09 A;  2KVI A;  5HQM A;  1S10 A;  4BWM A;  3RBE A;  1VQ8 S;  2PEB A;  4KGZ B;  4PYA A;  4RO0 A;  5DO2 A;  1AW0 A;  4LQ3 A;  4ED3 A;  4CH7 A;  2EFG A;  4NLV A;  3QAU A;  2RDJ A;  2HNZ A;  2ROE A;  1RWO B;  2BMB A;  4U67 Q;  4FBU A;  3BSN A;  1WOP A;  1U09 A;  5EHH A;  4G1Q A;  5L39 A;  1NSQ A;  1U4B A;  3G8T A;  3Q8P B;  2IA0 A;  1R43 A;  4LIR A;  3V6K A;  4OX7 A;  1TV6 A;  5BXI A;  1CS4 B;  1C1C B;  2A0F B;  1V3Z A;  3UFC X;  3LGM A;  1B99 A;  3DRX A;  3UWT A;  4XAK A;  3I55 S;  2ZH4 A;  5KT6 A;  2AJF E;  3G87 A;  3M8Z A;  1N5Q A;  1WC5 A;  4D3H A;  2R2R A;  1I3O B;  2V50 A;  2CZ9 A;  4C2M A;  1S7I A;  5BYQ A;  3MMC B;  2CPJ A;  2V9W A;  3K5O A;  2C3M A;  4OZ1 A;  1U8S A;  4XDD A;  4EO8 A;  1VQ4 S;  3DRS B;  4H4O A;  1KFS A;  4I56 A;  3IO1 A;  3WX4 A;  4M5J A;  3GJR B;  1U1M A;  1B0P A;  1YJV A;  1T9V A;  5C25 B;  2C28 A;  2YWW A;  1X9W A;  1HBN B;  4LF5 J;  3DXS X;  3CCJ S;  2AU0 A;  3PIP Q;  4YB5 A;  2V68 A;  2DXE A;  3VQT A;  4O3S A;  2FHJ D;  2E9R X;  4EK2 A;  5KG1 A;  4C11 B;  1IUJ A;  3G8S A;  4B3R J; 
#chains in the Genus database with same CATH homology
 3D6M B;  3IBC B;  3KJN B;  2DKO B;  3GJT B;  1NME B;  3R7N B;  3KJF B;  2QL9 B;  2Y1L B;  4LSZ B;  1RHU B;  2CDR B;  4JB8 B;  3QNW B;  1RE1 B;  2QL5 B;  2HBQ B;  2CNO B;  2H4W B;  1RHM B;  4ZVP B;  3P4U B;  2Y0B B;  2HBZ B;  1QTN B;  1QDU B;  2CJY B;  2HBY B;  3EDR B;  1GFW B;  3SIP B;  3D6F B;  3R5J B;  1I3O B;  1RWX B;  1SC4 B;  3GJS B;  2QLF B;  1RHK B;  1RHQ B;  3EDQ B;  2XYG B;  2XZT B;  2QLJ B;  2QLB B;  2H54 B;  2CNN B;  4DCO B;  2FQQ B;  2H51 B;  2C2M B;  3D6H B;  2C2Z B;  5IC6 B;  2HBR B;  2QL7 B;  1RWP B;  1PYO B;  2CJX B;  3GJR B;  2XZD B;  3GJQ B;  1I51 B;  1PAU B;  1RWN B;  1SC1 B;  1ICE B;  1RWW B;  2H5J B;  3RJM B;  2C2K B;  4ZVQ B;  4ZVO B;  4ZVT B;  3R7B B;  2P2C B;  1RHR B;  1RWM B;  3KJQ B;  4ZVS B;  3R7S B;  2XYP B;  1F9E B;  3P45 B;  1BMQ B;  3R6G B;  1RWV B;  1IBC B;  3IBF B;  1RWO B;  2CNK B;  1RWK B;  2CNL B;  2H4Y B;  3R6L B;  4ZVU B;  2XYH B;  5IC4 B;  4DCJ B;  4DCP B;  3NS7 B;  4ZVR B;  5K20 B;  2C2O B;  2H65 B;  2H48 B;  1SC3 B;  2H5I B;  1RHJ B;  2C1E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...