4ZVUB

Caspase-7 wild-type bound to the caspase-6 cognate tetrapeptide inhibitor ac-veid-cho
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
93
structure length
93
Chain Sequence
YKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Reprogramming Caspase-7 Specificity by Regio-Specific Mutations and Selection Provides Alternate Solutions for Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-7
total genus 18
structure length 93
sequence length 93
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2015-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 4zvuB00
1F9EB 2Y1LB 1GFWB 2CJXB 3KJNB 3R6GB 2QLFB 2QLJB 5IC6B 2H48B 2QLBB 2XZTB 2HBQB 3KJQB 1I3OB 4ZVRB 1RE1B 3P45B 3GJRB 2HBRB 3GJQB 1QTNB 3EDQB 1QDUB 1RWWB 1PYOB 3GJTB 4ZVUB 1RHRB 2H51B 1RWOB 4JB8B 5IC4B 2CNLB 3D6HB 2P2CB 3IBFB 1ICEB 1SC3B 3IBCB 3R7SB 3RJMB 2C2OB 1RHJB 2HBYB 3R5JB 4ZVOB 2Y0BB 3R7BB 1RHQB 1RHMB 2CNOB 2HBZB 4ZVTB 5K20B 3QNWB 4ZVPB 4LSZB 3R6LB 3D6MB 3P4UB 2CNNB 1SC4B 3SIPB 2XYPB 1I51B 4ZVQB 1RWXB 1RWPB 2XYGB 1RWNB 4DCPB 2QL7B 1RWMB 2CJYB 1IBCB 2QL5B 3KJFB 2QL9B 2FQQB 4DCOB 1RHKB 2C1EB 3D6FB 2C2ZB 1NMEB 2H4WB 2C2KB 1RHUB 1BMQB 2CDRB 1SC1B 3R7NB 2H54B 1RWKB 2H5JB 2C2MB 2XZDB 2CNKB 3GJSB 3EDRB 2H65B 2XYHB 3NS7B 2H4YB 4ZVSB 4DCJB 1RWVB 2DKOB 1PAUB 2H5IB
chains in the Genus database with same CATH superfamily
1UW9A 1HL6A 1H2UX 3BR8A 3PFEA 1SJFA 4P10A 1RKIA 1N8RT 4B3OA 1IXKA 2F8EX 3PW4A 2PA3A 1PIEA 3LGNA 4CP5A 3Q8RB 2E1PA 4F0KA 3LPEA 2DPJA 3FQLA 3A3NB 2OI2A 2VFTA 2R42A 4FZVA 3WDOA 2HWTA 2R2TA 1NK0A 2NUUG 1XBWA 4NA3A 3WX4A 4CTAB 1U49A 4FNIA 4PCQA 3DLGA 4DQIA 3C3LA 1S6QA 2GMHA 1DJ0A 2CQBA 2M9KA 3DM2A 2J6UA 1LW0B 2J0XA 3M2UA 3UWTA 3EDQB 2ZNZA 5GAGI 5F9LA 1PC5A 3D4JA 3PYEA 1SUQB 3SQGB 1BQMA 2IVFB 3GJTB 2D9PA 1J27A 4DFMA 1WSVA 3LOUA 4QOTA 2CQ4A 2HLTA 1HWIA 3DRRB 1S72S 1NJZA 2VICA 1OPZA 3GCWP 2HHQA 1FRKA 1SH0A 2LVWA 5MAOA 3I0RA 4PWDB 2HQDA 2ZVSA 3DOMB 1ICEB 3DLEB 1VR6A 3WIVA 1BGXT 2RB7A 3ENWA 2C28A 3NNHA 3H5XA 1CQMA 1GK8A 3MECB 2YPZA 3AB2B 1KRPA 3HSGA 3NGDA 2JC0A 1VJQA 1N5YA 2RS8A 1BQNB 1YGYA 2N3OA 5ETVA 1A9NB 2ATCB 3FCVA 4G65A 4CO3A 4F4AA 2MKYA 2V4RA 4LF9J 3OHAA 5CZXA 4C3MA 1KVIA 3FBEA 2PDAA 1FKPA 3N01A 1UJ5A 4U9RA 1I1GA 1NCLA 3R6LB 2XY7A 1X0FA 1HI8A 2DGWA 1SV5A 1VLYA 3P4UB 4M5NA 4RW7B 5D0HA 2ZVIA 1S57A 2MTLA 4OV6A 5GMDA 4C8NA 1C0UB 4ID8A 4ECSA 1HQEA 4Y2KA 4IO9Q 4CNZA 1JWWA 1UETA 4C2MA 1TP7A 3FDSA 2ZDPA 3F44A 2CQHA 3M8ZA 2IVMA 4EGLA 4USMA 3QZ7A 4BLGA 3MR6A 2ZHAA 2XB2D 2YQ1A 2R7VA 3ZZ0A 1RAEB 2DIUA 3DGVA 3IWXA 1E6YA 2IRXA 1FE0A 4HTJA 5EDWA 2VASA 4ZPWR 4EK2A 1NZ8A 2G13A 3SV3A 2LEBA 3PW5A 1P6TA 1HR0J 3FK4A 2DRDA 4JI2J 2B3TB 2VG7B 2V4QA 2IA0A 4XK8C 4GKKF 3MAAA 4I7FB 1WTBA 2VIHA 1LWXA 2K8GA 4J9VA 1DAXA 4O4GB 4MIAA 4O3PA 5IWAJ 2XLJA 3ELHA 1EQ0A 2W2PP 3NCQA 4NLVA 4LJMA 3VGTA 3OR1A 1JXVA 3CE8A 9RUBA 1DURA 5HI7A 1KFDA 3OL6A 5J1EB 4F3MA 4ZCKA 5E0OA 1JJ4A 2UUAF 3RR8A 2H54B 2FJWA 2H5JB 2KRRA 2CJ9A 3HPOA 1BXNA 3D3BJ 1U0HA 1PBUA 2LQ8A 4QYZK 4QIVA 1M5SA 4DX6A 3I32A 1X9MA 3DRPB 1HBNB 3TWZA 3WBZA 1IJEB 1T95A 3PM9A 3KK2B 2IM3A 3CCLS 2VA2A 2XLKA 1LK5A 5A0YB 4P75A 5GVQA 3JTOA 3M32B 4JOUA 4WIQA 5D77A 3UD3P 2HNZA 4ZKAA 3HXMA 2ADCA 1C1BB 1KS2A 2JWNA 2KXHA 2V63A 4Y65A 1A0OB 1REVB 2KZMA 3PR5B 4Z7CA 3RTVA 5J2MB 5FLXY 2GAGC 3T1YJ 5D0EA 4ZIVA 3HKWA 1QTMA 1DLOA 1N0VC 4RUHA 4WF9Q 3GTYX 3B82A 1AUDA 1IKXB 1F6TA 3UDLA 4DV5F 4ITSA 3KK3A 1HNVB 1GFWB 2I5JB 2FVQA 1DY3A 1M0SA 3ENVA 4TN2A 5B0BA 1UWBA 1YQHA 1JK9B 1YKWA 3H42A 1TL3A 3UN5A 4J9OA 4KKOB 2R7WA 3HULA 4Q0BA 3CJKB 3IAS9 5HAOA 1NB7A 3MZIA 2EPIA 2DISA 2J5AA 1RT5B 4FP9A 2QLBB 3QATA 4K7QA 4NA1A 1BHNA 1N88A 4I6YA 4HTIA 3ZTRA 1U0HB 1IKWB 2DNGA 3HHLC 3RUBL 6FD1A 1NPKA 2IVYA 4U67Q 2VQEJ 5L1IA 3MPYA 2ZHBA 4EZ9A 4F8RA 4LFCF 2YNFA 1FFWB 3LGMA 4N8OA 1QDUB 4OHZA 4DV0J 1S1WA 1NDKA 1RT6B 3NOCA 3IR5B 4KGVB 1FKOB 2Q1LA 5D6GA 4CZCA 5GAEI 2YWGA 1B64A 2MKJA 3R5CA 2OEMA 4J91A 2DEJA 3AT1B 2RMLA 3KYLA 3D6HB 4KV8A 4OHVA 4ER8A 2J7WA 3G82B 5KAKA 2WTFA 3LO3A 3CJ2A 4Z2XA 2HHTA 2E5IA 4ZLNA 2EFQA 4KO0B 5IT9Y 4WYWA 3W62A 2OPSA 3AA8A 4USVA 3IG1B 4G6VB 4O0NA 2YH0A 2XGQA 1YRTA 1Q0NA 4N47A 4UOFA 4LSNB 5DG9A 4DG1B 3EE3A 1C1CB 1LW2B 4URQU 3UDEA 5C25B 2E5LF 3TUZC 4WU2A 1RXOB 4QW8A 2E9TA 1TL4A 2EFVA 5CD4H 1R89A 2EW9A 2NPIA 2IIHA 3GFYA 3VAHA 2UU9J 3M2VB 5J2PB 2CPIA 5CYMA 5ITHA 1SV5B 2GO8A 1VRUA 4P73A 3UO0A 4NCGA 1EHWA 4ES3A 3H5YA 1M5KC 2XS2A 4DR1F 4RJVA 2F9DA 1NHVA 3F73A 2GQ2A 1SC4B 1DTTB 3IMQJ 2XCPA 4ED0A 4N76A 1BC6A 4A8SA 3KNGA 2VODA 5CCMA 1G3OA 3HO1A 2LEAA 1RWXB 2VG5B 4DL2A 4KHPJ 5THWA 4O4RA 1KOOA 3GZ7A 3ITHA 3MM8B 5DZ7A 3N6MA 2KJVA 4DCPB 1DHMA 1SQGA 4NYOA 3PACA 2DITA 3TO8A 5E7OB 5L1KA 2BE2A 3EXCX 2QRRA 1V3SA 5FJ4A 3KNAA 2CJYB 5A8WA 3OR2A 1Z2LA 3UCUP 1WDTA 4K2XA 4OQJA 2MQ8A 2A6MA 1NH7A 4ZDNA 2ZM6J 4IRCA 1FVSA 4LFBJ 4I1TA 3A1YG 4DUYJ 2L9WA 5AT1B 4JV1A 1WEXA 2VU5A 3MMCA 2BJ3A 1YJVA 5D0GA 4YB7A 1CVJA 1S97A 1KEKA 2V2VA 4ECRA 1RT4A 4J90A 3PJXA 1G2EA 2CG4A 2QSWA 1NSAA 2J7KA 4NRTA 1UFKA 3F0NA 1U1MA 1KDNA 3QBCA 2VKRA 1JLQA 2HNYA 2AJFE 3RRKA 1M1KT 2W2NP 1W26A 5ADZA 2QLXA 2IRYA 2PO4A 3D0HE 4E98A 3AB4B 3N6NA 1CJTB 1UCNA 5M2UA 1NKCA 2OFGX 2JHEA 1GAOA 2IC3A 3LP0A 2QA4G 4PWWA 4DPWA 5T7LA 2J0QD 3B78A 3M2RA 4ELTA 2GVDB 2YNIB 1YRXA 1YDLA 2ZBRA 1HWLA 3CXCR 5L1LA 3PJ9A 4X2BA 2VH7A 2XWXA 4YEAA 4JI7F 1VRQC 2WK4A 5CYQA 5E3PA 2XLIA 1QM9A 2OSRA 4H54A 4ATNA 5FDLA 3KG4A 4G1IA 3CCMS 1HBOB 1EETB 3FBFA 3M7VA 1H72C 2CQCA 3GONA 5DM6Q 1GNKA 2BV3A 4QWAA 3AXKA 3TX0A 1RAGB 3FUYA 4DV1J 1YJUA 3DLKB 4ICLA 1MLAA 3KJNB 2DXDA 3TVZA 1RKJA 5J1NA 4C48A 6FDRA 1S10A 4OLPA 1ZTWA 3OJSA 4DS4A 3G82A 1C0TA 5E5NA 2KFZA 2PFFB 3IRXA 1WHWA 3FVYA 5J2NB 2J0WA 3HHDA 3C2PA 2OSQA 4ILRA 1MROA 4RW8A 2C3PA 1TAQA 5A76A 2LYVA 1UZHA 2JH3A 1R6VA 2I6WA 2YQ0A 3RZAA 4RNOA 2LECA 3DYAB 1CJVB 1HNWF 2GGPA 3I6PA 4JB8B 2G2ZA 2KT3A 1RISA 1WORA 1UFWA 1HA1A 1NSPA 2NS1B 2BJ7A 3TAQA 1N34J 1RGVA 3TUJC 4IQXA 1XNQJ 3GYNA 3MMBA 2KL8A 4NLWA 5DO2A 1RBOB 1YK9A 1B0PA 2AMCB 2KFYA 1QVGR 2XMVA 1IKVB 2FVSA 2HFUA 3SDEA 1J5OB 3C6UB 4B9LA 4O3RA 1RZMA 1F5CA 5CH7B 1FEEA 1SVDA 1KBRA 2EG1A 2ZNYA 3R5AA 4OYMA 1HNVA 2ROGA 4XDCA 1GMUA 1YJTA 3C19A 1IKXA 2AJ1A 1KHVA 2B9EA 4WP3A 2BANA 3D9BA 4FPRA 1SJ4P 2J7UA 4BHQA 3R27A 3TEHB 4UQGA 3MR2A 4CM2A 1JXLA 3P6YC 3V6DB 4ILMA 3PX0A 2LFVA 3MM9B 3NG8A 1T05B 1VQ8S 2RNEA 2V8HA 1D09B 3JAMY 1ZTTA 2HK2A 2BANB 2I9SA 5HBMA 1FT8A 2BKNA 2XYPB 3SIPB 4AYBD 4QPXA 3DXBA 3L3CA 4JI3F 3ADAC 4J9KA 3KK2A 3GV5B 1FRXA 2E1AA 3RGIA 4I6AA 4DV4F 2RRNA 2N82B 2R7XA 4N8NA 1X0PA 4URGA 1RWNB 3KUEA 2KG1A 2BYCA 3ZFVA 2G0JA 2BXJA 7FDRA 5IV3A 4DLGA 3AA9A 2CPJA 5FIIA 1VQMS 4JV2A 4DN0A 2P8IA 3CD0A 3IRWP 4DR5F 2WONA 1KLMB 2FJEB 2XG8A 3QMQA 3RBXA 4PWUA 1R8HA 1B4SA 3CEDA 4CO4A 1WHXA 5LMUF 3HJFA 2R7UA 1CJVA 2QL5B 4P7TA 3AD7C 2CRLA 2FY8A 3DOKB 4FYWB 3T1YF 1NK9A 4DSIA 4LF7J 2J9EA 1ZH5A 2C1EB 4GVBA 5KFIA 4DMZA 4EO8A 3V6KA 2J9CA 3EZOA 4AQYJ 4ES1A 1SKWA 3KLEB 1HNXJ 1JKHB 3PG9A 4U8VA 4IDKA 1LWEA 1HBUB 1NB2A 4KPCA 4URSA 2FTRA 2YNHB 1Q5YA 1N48A 1RU2A 2XO7A 1KVJA 4WTYA 4RBUA 2Q66A 3Q8UA 2RDJA 1SIZA 3UDCA 1U6BA 2MY7A 4CWBA 2BJEA 2Z2MA 3OTOJ 2DNPA 1Q1KA 3PDNA 2PIIA 3QRPA 3G4SS 2DY9A 2YKNA 2YNGA 4ZA1A 5LT5A 3KLFA 1URRA 2LQ5A 1M5OC 2Z2YB 2ZHOA 1TK5A 3EUNA 5C2GA 2MHEA 4CYUA 4NL5A 1ZA2B 3VVTA 3H2LA 2ASYA 4CRJA 3IS9B 5F8IA 3VAFA 1TUVA 3KFWX 1IWAA 3EXYA 4DI6A 4E8UA 2YNGB 3CNQP 1U8SA 3CMAS 4DX8H 1S0OA 1DTQA 2XEXA 3ZZZA 4FYYB 3UCZP 2FLPA 1HD1A 5GMEA 3DXSX 2LU1A 2LXFA 3G8SA 2R3VA 1FE4A 1H0HB 1HYSA 2YY3A 2VJUA 2V69A 5KFQA 5HROA 4DWIA 4LR8A 4LF8F 2VDHA 1UA0A 2R7TA 3SV4A 3FBBA 3J7YU 2PMHA 3PR4A 1UMJA 1Y9OA 3GFXA 4PG6A 4ENOA 1U1NA 2DRAA 3SYZA 4C8ZA 1RT4B 3THTA 4GVBB 3MCMA 3TAMB 3MUVP 1RE1B 3DOKA 3I31A 4C8OA 1X8DA 1FESA 1PAEX 1S5ZA 4PXCA 2ZBQA 5KT6A 3PIPQ 4EBCA 2F63A 1BQMB 1SI9A 2MLZA 2I38A 2WW8A 2DNLA 3OT9A 4MKBA 4MT1A 5E3CA 4DV6J 4PYDA 4QR0A 2FGCA 3G87A 1FNOA 2CQ2A 3SZ2A 1Q79A 1S12A 3MEEA 4I2PA 3J80Y 1NH8A 2W25A 4QIWD 3TJAA 3BO4A 4EZ6A 5I3PA 4DV2J 3O2IA 3KTQA 1LK7A 4X65F 1XMOF 3UNYA 1R8BA 4K0KF 2ZBCA 4DQQA 1LWFB 1P1LA 4AL6A 3B6BA 4TY8B 4ALZA 2HFSA 3PHTA 3BSCA 5HBMB 4F4XA 1QAIA 2EBEA 5KG6A 1HQ2A 2W2MP 4A8XA 3QT7A 3QGGA 3CWJA 4FBTA 2HW3A 4UUXA 1H3DA 3GR0A 5EX3A 3NGSA 1R0CB 5KG7A 1YBAA 1RHQB 3DNCA 3RB0A 2H3EB 1NO8A 4RNNA 2KFNA 1IBKF 3CSKA 4L75A 4IKAA 4DR3F 5C42B 1V5VA 2V2KA 3MCSA 1Q8IA 1TQLA 3FBCA 5KG0A 2QO3A 3CW2C 1FDBA 3D6MB 4NMXA 3BYRA 3NKYA 4CH0S 5IT4A 2GIRA 5KFKA 2ROEA 5T14A 1N0UA 3Q0AA 4DL4A 4ANDA 2UUWA 3A3PB 2ZH5A 1S0VA 1UKUA 2VD3A 2HQCA 3MMBB 3OTCA 1NPRA 3KDOA 2HGLA 3NCPA 3E8OA 2KDOA 3MEDB 2L41A 3QSYB 3HZEA 4C0OC 5DETA 2R9LA 2F4VJ 4OHWA 2ILZA 3N6LA 4K5SA 3PIOQ 1VQ6S 2BQRA 4BC9A 2MHNA 4IUFA 1RI7A 1SH2A 2G0IA 2GVZA 3W9HA 4P2MA 1J2VA 4UTGA 2R7RA 2DHHA 5G0RA 4MFBA 2HIYA 4LUBA 4RW6A 2BRLA 2HNDA 2FDNA 1S4EA 1JLAA 2L3MA 2N4DA 1PYSB 2PMWA 3CIMA 4CI0B 3KLVA 3RB6A 4NXMJ 2EKNA 4WPAA 2E5GA 1VOMA 3GMGA 3ILJA 4NZ0A 4WIIA 3SCLE 4WCEQ 1X60A 3UPFA 4FXDA 1X5SA 2VF3A 3JSMA 4IG0A 4LSLB 5K8OA 5DGAA 4BDPA 4WP9A 4LF4J 4ZCMA 3I9ZA 4OZ1A 1WDDA 1HNIB 4U8YA 4GO5X 1UWBB 1U02A 4L6V3 2K1RB 2HFVA 1BE4A 4NLTA 1BWVA 4WXWA 3TEGA 1YJ9S 5CYQB 3VAIA 1UVMA 2X1AA 4KGXB 4F4KA 3TI0A 2DGXA 2ZKTA 4JI4J 5ETNA 3NS7B 2C2RA 3K5NA 5AXKA 4BBYA 1UVNA 4KB7A 1HHQA 1KQKA 1S9FA 3MMAB 3T5KA 4B9VA 1OS5A 2DGSA 4FKXA 5KTQA 2HRYA 3HHLA 3MF5A 4OX6A 4GO7X 4M8LA 2XSJA 5DS7A 3US5A 1C1BA 3N4WA 1N54B 2R8IA 3L9ZA 3M32A 2M0GB 2KHCA 4ELVA 1GEHA 4QZVB 2CA9A 2CPXA 2Y1LB 1XWLA 5A8KB 2DO0A 4ED8A 2BKOA 2JSXA 3PEJA 3C8YA 2Z0GA 1H7XA 2M2BA 3ZTQA 2NXJA 4XPEA 2BVZA 2YKMA 3GYGA 2W7AA 5LJ3Y 2ZKUA 3POTB 3TUPA 3MEEB 1M90T 3DLLQ 3BS9A 4OI4A 2KO1A 4DL0C 3T1HF 4X4UA 3KDNA 3V4IB 2EKYA 2IM2A 3TX8A 2R2UA 4KGKA 2V9WA 5BYSA 3AHPA 4YS2A 5KFDA 4U7UD 1NXIA 2B9WA 3HHKA 4C97A 2W2QP 2C42A 2NXNA 2X1GA 3AQPA 1KR4A 3TAMA 2VG7A 4JI0J 3OW2R 4F0MA 2XO6A 2VBWA 3H20A 2KH9A 2WCXA 3NBPB 4U7UK 1F5AA 2W9BB 1SKRA 1B0VA 2Y1JA 1U25A 1V6HA 2CQ0A 1FXDA 2CNLB 3MDFA 1SB6A 3TZWA 2DNNA 3SMZA 4ZLJA 3EYZA 3HMJG 2P2CB 2D3ZA 3ET6B 4H4OB 3W66A 4USKA 5D4LA 2VB6A 2MGZA 2M70A 3KKFA 2B4PA 4D3HA 2MKHA 4AL5A 1NKBA 4JI8F 5D8HB 2AGPA 2LU2A 4WZQA 1CQNA 3A4TA 4MTPA 2RDDA 3KXDA 4TYAA 3WC0A 4WE1A 2B51A 4USJC 1Y0HA 4AUKA 1NK5A 4M5JA 2Q6CA 3SSSA 3R2CJ 4CM0A 3S01A 2B56A 2XS5A 2XMTA 1ZM9A 2WSCC 2ZH8A 3I5CA 2XI2A 4ZJOA 4EEYA 2ZOFA 2RKIA 2WOMB 3HJVA 3MMJA 2PGCA 3I4PA 1N5YB 3CJRA 2QYGA 3QAEA 4DSFA 1TKXB 2OPQB 2WB1D 2VZ9A 3QYYA 4DV1F 3MM6A 3NNCA 3AOAA 1FTRA 2XZWA 4HH0A 4YB6A 3G6ES 3WX8A 2POKA 4GKJF 1UZDA 3CDBA 5IOLA 5GMKa 3IGVA 3Q8QB 3H2UB 1JKHA 4F04B 2HWHA 2BW7A 3I82A 4A48A 3LAMA 4F3OA 1X4AA 2WVCA 1UEVA 3AOBA 3SBMA 2XMAA 2RILA 2QE5A 2ZH7A 3OJUA 3SCIE 3BSOA 1MWZA 3D3CJ 5F41A 4DFJA 2OAUA 2DR7A 3VAGA 4EU0A 1WJ9A 1XNRF 1IKWA 3HVRA 4DV7F 4JI1F 2WONB 1IR1A 2UV8A 4IOAQ 3UD4P 1VQSA 2VOPA 1C2PA 1HBMA 1UPPA 4C11B 3O6QA 4IYQA 3QWUA 5L8RC 3L7PA 4CH1A 1RHUB 1F2HA 3CJKA 2H5EA 5EWFA 1NPPA 3PW2A 3HSZA 4NOHA 2DD8S 1ULRA 1HNZJ 2HYIB 2Z30B 1ROFA 1JLGA 2VPWB 2NLWA 4IOCQ 2EK6A 1PGZA 1WC4A 3IP0A 4X4SA 1RAHB 2V2ZA 5KT7A 2XNRA 3MXHP 2HHWA 4PAAA 2MZTA 1T3NA 4B3OB 2J0SD 3MI7X 4V1Ak 2DPIA 2AQ4A 3PW0A 5BR8J 2BKPA 4DUYF 3ZXWA 2DHSA 2AJ0A 4J7CA 4K8RA 3NWGA 2OH2A 1XTZA 2WAQD 3QIPA 4J37A 2ZM6F 1BQXA 2XMMA 4Q5VA 3RAXA 4DV3F 2WZ1A 1HYSB 2C2EA 2J8AA 2OPPA 1TKXA 2OPQA 2ZWPA 4DR3J 2C2NA 3THPA 4FXWA 1DQ8A 1JJHA 1XMQF 1RQ0A 1K8AT 3GIIA 4JI1J 2H5IB 3DRPA 5HP1B 4QJVA 3HVTA 3RU0A 1IWGA 4LF2A 4CO0A 2RAQA 3CJ5A 1IKVA 3FNNA 1CBKA 1EX8A 2CJXB 4FF4A 3PRVA 3LPYA 4IRKA 3CULA 3TARA 5JMNA 3OV7A 1FJCA 1N5TA 2HG4A 2K7KA 1JNRB 7FD1A 1LWCB 4XO0A 1RP5A 5JVHQ 5EX0A 2KYXA 5F3ZA 2VC1A 1R0AB 3E3XA 1CJUA 4TLQA 4HVZA 5ETMA 4X4RA 1CPZA 3DDNA 1K47A 2M5YA 4I7FA 1L3UA 1D9DA 4Q2MA 1GXTA 4LFCJ 3VAMA 3ULHA 2W24A 5B0EA 1S99A 3M8QB 4CLKA 3TQEA 3QZ8A 1MMNA 3D5MA 4PYAA 2VFSA 1HD0A 3IM8A 4S0MA 1UJ4A 3BPDA 3D6TB 3LP2B 2UVWA 2O67A 3V6HA 3MAHA 4HT5A 1VQPS 1F1BB 2FHKA 3GIJA 2B4VA 3CCWA 2W9BA 1S48A 5B0FA 2OJ3A 1R31A 3PCOB 1SIWB 4KFBB 3IO1A 4ZK7M 3NAIA 3SSQA 3U02A 3UFCX 5B09A 1VQLS 1HBOA 2DR8A 3KMQA 2C2OB 3EGNA 1WKLA 2BZ2A 2MQMA 2DNRA 3W65A 4I56A 3T5LA 1RADB 2CQGA 4QWDA 1WD6A 1OY9A 3D66A 1H74A 4QW9A 2UV8G 4K4TA 1U8WA 2LA6A 5IT0A 4M5KA 1W7WA 3JYTB 2OPRA 3CO0P 4NI2A 5IM0A 2GAHC 2GVDA 1N36J 1OO0B 2ZUGA 2MZ1A 2NUHA 2OO4A 2HQFA 3BQ0A 2W7PA 3JQMA 4FN5A 1NJXA 4Q7AA 2VPYB 3EPIA 1WF1A 4LSZB 1RU1A 1IJFB 5K5MA 1Y5IB 3H5SA 2OP5A 2OPPB 4O3NA 5IWAF 4QWCA 4HYKA 3HHNB 2ZH1A 2D69A 4ED3A 3Q2SC 5KFRA 1X5PA 1NM2A 2B0GA 2CPDA 2CZVC 2RUSA 3ZO7A 4O0IA 2FHOB 3DLHA 1HLWA 3G6YA 2DK2A 1FDNA 1FRMA 3EICA 4K59A 5SZTA 1L3SA 3DI6A 4JI8J 1VBXA 2R4FA 3GILA 2MPUA 4IG0B 3UDVA 3OHBA 3DRRA 2DXFA 3ILIA 4DFKA 4MK7A 1T3OA 2K2PA 3BPSP 4KHMA 4RO0A 1L3TA 3CO9A 2UZAA 4OZ5A 9ATCB 3FQKA 3CJ0A 3ISZA 1D1UA 3QGPA 3KJFB 3ETOA 1UVJA 1Y11A 4ZJQA 5F8MA 1NHUA 4JYAJ 3W2VA 2DR6A 2M4MA 1LFWA 5DDQC 1NMEB 2HURA 2AJ2A 1KSPA 4HH1A 1T7PA 1OQ6A 1ZM3A 2NSBA 4DV4J 5LXYA 4IFVB 2Z8QA 1U1PA 3R7NB 1JLAB 5KT2A 2XQCA 4DSEA 2N7YA 4CH7A 1WUUA 4MAKA 1FJEB 2OKQA 4EYIB 5HLFB 1HKAA 4RNMA 1NBEB 5DLFA 5IS2A 3CCQS 2OGUA 3P5BP 2COLA 4EYHB 3M8PB 3BM7A 2NQPA 3ZZTA 3UD5A 3RBDA 4CLSA 3T19A 1K1QA 4V19J 4A47A 5KFZA 4AQYF 1HNXF 4LF6J 4YB5A 1RTIA 1WSRA 1CS4B 4WYLA 4H4KC 2KM8B 2GCFA 4LF7F 4OZNA 5HVFA 2DKOB 3W7BA 3BYPA 5GADU 2P6TA 2QFIA 4F50A 1FWKA 2QIFA 5FDLB 3CDWA 4KO0A 3KHGA 1WC0A 1XMOJ 2OTLS 4RWXA 2DR9A 1NSQA 1QJHA 1IVZA 1T9UA 3PRDA 3GCXP 1W2BR 4MH8A 4TU9A 4QIGA 3SXLA 4FDFA 2HHPA 4NLUA 5D15A 4K4SA 4EBEA 2ASDA 2KTQA 2VFVA 1UPMB 4DSJA 1Y3JA 2RDIA 2KU7A 3EGWB 1IKYB 1LFPA 4AXIA 5DLGA 3OL7A 1FKOA 2HMIB 4OI0A 3J7A1 5KG4A 3W2VB 5HQLA 3DMJB 3HSDA 1RCOB 3ET6A 3TZYA 4CLWA 4YHHF 2QT7A 5KFGA 1HR0F 5H1SV 3VGUA 2N7CA 2HPUA 2QA4S 2ZH4A 3PTWA 5DG7A 4FKYA 2DO4A 2GMLA 4OZ3A 3G8QA 2LMIA 1TVRB 2HVEA 1U6FA 4DPTA 4GRSA 2MQLA 3BB5A 2RH3A 1RTDA 2YKQA 1SJ1A 3QT6A 4LF1A 1MU2B 3VF0B 2BACA 1O5JA 1XIQA 1Q8KA 2CQ1A 2IMOA 2XI3A 3FEZA 3PYFA 4ZPCA 2G2OA 1RTJB 1P8GA 1XJWB 1P9YA 3ONQA 4C6AA 3MR3A 2UUCF 3R5JB 3LANA 3OD2A 5HK4A 1FJGJ 2LXIA 4OL8A 2JVOA 1ZA1B 4NXNJ 1MMDA 2Y0BB 4FVCA 3VQTA 4ES2A 3OVBA 3R7BB 4XAKA 2B9XA 2Z2LA 1G7CB 1JLFB 4UT4A 4PQUA 1K0VA 2VHGA 1IBLJ 2EC2A 1Y3KA 3GV7B 5MLCV 4PXBA 1FD2A 2RE1A 2RQ4A 2VG5A 4WJBA 1GMWA 3MOZA 4OHYA 3KMSA 3NXZA 4LRBA 3M8YA 1OYDA 5KFYA 1Y7PA 3DU5A 6AT1B 3OLBA 2FC8A 1VISA 2EEYA 2HGMA 2YWHA 3HD1A 3HHLB 3EPGA 4ZP8A 1GXUA 2KT2A 3DOLA 5DRKA 4NCGB 3CD6S 2I2YA 5E3QA 2KVQE 1MN9A 4FF2A 4DF8A 2EWHA 4DF4A 3LW5C 3GWCA 3PJWA 4EO6A 4W92B 2Z57B 5H9FJ 1JMTA 3AAWB 1H2TZ 2VKZG 1NLKL 3BKTA 1TMJA 1RK8A 1NAQA 3QAUA 4TU8A 2I0XA 1N36F 3MTJA 2VQFJ 5AJ3F 1AFIA 4LQ9A 1RWUA 4DDFA 3KLEA 4KFBA 3R3TA 2FVRA 2LA4A 2ZBIA 3L4BC 1LEOA 1JLBA 3DFEA 4FYXB 5F3TA 8ATCB 3CC2S 1XNRJ 3PNIA 4HR2A 4DV6F 1RB0A 1TKTB 2IHR1 5DG8A 1AZSB 1F9FA 4BCAA 1PC4A 1R0BG 3Q24A 4IDKB 4ED6A 1NK6A 4ED4A 2H1YA 2RRAA 1IUJA 1N56A 2CDRB 5CHCB 3CGIA 3KK1A 3CCJS 4O3SA 3L7UA 3VGSA 4JI3J 2KZZA 2E7WA 4WWSA 3KUHA 4RKUC 2LLZA 1NNDA 5IQ6A 2XC9A 2J6SA 4QU6A 3HF5A 5C7PA 4RW7A 4X64J 3GJSB 4ZITA 4RZRA 3DRSA 1VGYA 1FD8A 1VBYA 1H2VZ 4KY3A 4DQSA 1FRJA 3O44A 3OL8A 4DR7F 1FX2A 3U27A 3TA1A 4DV0F 1S1UA 2E5LJ 2C3UA 5IXUA 2ZH3A 1F3VA 1TL3B 1R27B 1KTQA 1VC6A 1U2RA 4Q43A 4X4NA 2RVJA 3BR9A 4OZ0A 3UI3A 3K5OA 1RWVB 1GTHA 2YX1A 1PAUB 2BMBA 3N5BA 2B4UA 4OHXA 4L76A 1VFJA 2B9YA 2E1MC 4USTA 5A6WA 5M2PA 2GFFA 1WG5A 5B7WA 4ECXA 2FJXA 3CTRA 4X84A 1EKRA 4ZN3A 4KGMA 2MSSA 2MQNA 3KLHB 3I0RB 1CJKA 2ZOMA 2HKEA 1UAWA 3T6JA 4DX5A 4TQSA 4PWDA 1HWJA 4DPXA 5KFPA 2QLFB 2AF6A 3EVOA 4NMLA 3D1HA 4ED7A 1PJ6A 3OVSA 4KJIA 3FRZA 1LNQA 2M8HA 2RU9A 2V0NA 4MYUA 1A6LA 4X4PA 2V50A 4B9MA 2YPYA 3LA0A 2QA2A 3N9UC 1JLGB 4USWA 1VI7A 1S77D 2HBRB 5KT4A 1RSCA 1YWXA 3UN3A 4DOZA 3BH6B 2VBYA 4U95A 3S6EA 2NYHA 3W2WB 5HMZA 1LW0A 3K17A 3HVWA 2F9JA 4B08A 4C8KA 3KJVA 1B0TA 1S6QB 2V5HG 1NEEA 2VPXB 3IM9A 4ZPBA 2MKSA 2AX0A 2DNHA 4NZ7A 1AZSA 3H98A 2GC8A 3M9OB 1UFLA 5HJXA 1CC7A 1N5QA 2HHHF 2AJQA 1OY8A 2JC1A 4LRFA 4NASA 4CO2A 1RYSA 2E9RX 1NRKA 3BBBA 1S1VB 4DJBA 3Q2TC 2AEFA 2L9DA 4DV7J 3S7RA 3MCNA 1Q8BA 4Y2AA 5J2NA 3G71S 4JV5F 3I0SB 2DJWA 2K7JA 4B3RF 1CS4A 4Q8EA 3N0VA 3LP1B 4F4YA 1FX4A 4QBUA 1WF0A 2FZKB 2QGFB 2BOPA 1S76D 1T11A 1YJ7A 1ZS6A 3BN4A 3MEKA 2V67A 5CQGA 4OYPA 4CQ1A 5C42A 2GJIA 2XULA 4DHVA 5U47A 4ANEA 5K20B 2QG9B 1ZZNA 4QYRA 2R8JA 1HQEB 5HVHA 5F8GA 1VQYA 1GQEA 1WOPA 2YKPA 2C2DA 4B3SF 4DUZF 4X66F 4LBIA 5DDRC 1X7VA 4OYIA 2B4OA 4QQBA 4J9SA 1EJ7L 5CAAA 2UUAJ 1YIJS 2AHOB 3C6TB 5H9EJ 1DRZA 3NL0A 3MPUB 2XYGB 3NMRA 1OSDA 4K4VA 3PRBA 3GSDA 4JI5J 4K4UA 2D1CA 4G3IA 1TFWA 1RT3B 2KB2A 5IFMA 3KLGA 1U1OA 2B8QA 3H4BA 3PW7A 2ZE2A 3BDEA 2ZBPA 1AA1B 2IJNA 3H90A 4LT6A 3QT8A 5T41A 4E2FB 1JNZB 4IH7A 1IQTA 3TR5A 4OI6A 4PPDA 3GSIA 3UNGC 4UY8T 4PRFA 2YX7A 1PSDA 2BOAA 4B9NA 3EWGA 4A46A 2RU3A 4QR1A 2X7IA 2ZZTA 4JV0A 2AT1B 2M3DA 3R5BA 1D9FA 1NUEA 2WBRA 1YZ6A 3C14A 4F26A 5JJBA 4A8MP 2ZH9A 2QSFA 3N79A 5D4NA 4AFFA 4DV3J 1D8YA 3D1OA 5B0AA 2NR0A 3OL9A 1FXLA 2GIQA 2YKMB 3HT0A 3M6VA 3WQPA 5BXIA 1R8CA 4FYVB 4CLTA 4NLRA 3LF0A 4A8WA 5AXMA 4A8OA 2UUBJ 4QR2A 4FPIA 2Q79A 1TELA 1VRTB 2WSEC 3W9JA 5ETKA 3MPDA 4ZJLA 4N41A 5B0DA 2VQFF 4OFZA 3POTA 4XTTA 3GU0A 4L73A 4MJKA 4RBTA 3BGRB 5A8WB 1DZ5A 1OQ3A 4B9TA 3ZZPA 1XERA 4LMZA 2ROPA 4K4ZA 3QGIA 3TZXA 2CKWA 3FKBA 2H4YB 2KJWA 4G1PA 5D78A 2E7XA 3PX4A 4NXNF 1NDLA 4R25A 3R1LA 3DRYA 1VJWA 2JZ5A 3HHEA 2IM0A 3IS9A 5EN1A 1EARA 3ICLA 3C66A 4TLRA 4ZPTR 2FLNA 2VBZA 2PE8A 2RHQB 4LSNA 3A8IA 4MIWA 4OX7A 1KHWA 5HO4A 1SL2A 1ZAXA 3MMAA 3ISNC 3V6JA 1ZBTA 1OWXA 3M8WA 3W61A 2ZJQQ 1HWKA 3Q83A 4KRWA 3LP1A 1Z2ZA 2BQ3A 1RAOA 4X4TA 2DNZA 5E33A 2YNHA 3FFIA 1V3RA 3TA2A 4I64A 3CIZA 3SDEB 3ZNJ1 1J5OA 2VOOA 1FHTA 3V81B 2F8MA 4NLOA 3P45B 5G0RB 5JXSA 4DFPA 4M5GA 2YKAA 4CLYA 4OYOA 3JSMB 3CCSS 1S1VA 3GIMA 1TL1A 2H9ZA 2HSEB 1MNEA 3DDKA 2QYCA 1T8EA 1YITS 1APSA 2DH8A 4RLEA 1IBMJ 5KG5A 3TW0A 4LR9A 1LXNA 2XSFA 4KV8B 4QIEA 2J76E 4ZVUB 4YDDB 1D9AA 4BWJA 1TKDA 1MMLA 1LXJA 1XMQJ 2P9EA 1R0AA 1UEKA 1B99A 2NCKL 1QY7A 3G2XA 3H59A 2C3MA 5DDOC 1NJYA 3TQ1A 1TL1B 2R8HA 3T5JA 1JLCB 4H4MB 4KHPF 1TZ0A 1TTHB 1RT6A 5E41A 2CWXA 4O44B 2NYIA 4KKOA 4ECZA 2HFNA 5KFVA 4CLZA 3FFIB 1S49A 2HBYB 4O3OA 2BBEA 2MQQA 3ZNUA 3MFHA 4ZN1A 4DL7A 1S1XA 5KFOA 3BKUA 3OTOF 5DGBA 2N3LA 1Q7YT 4ZLPA 2RRBA 2YQ3A 2XMWA 4KQZA 4ZLLA 1X4FA 4GC7A 5H9EK 1CJKB 3RB3A 3D28A 4ZVTB 4KYZA 3BGFA 4TYBA 3R5GA 4C0BA 3V6DA 1G6BA 4JUZA 4UOGA 4WXOA 1VS3A 2R7OA 2QMXA 3D2WA 2OD4A 1KLNA 1HMVB 2ZZNA 1BY9A 4A4JA 5LOQA 1S9EB 2AKWB 1VBZA 5DM7Q 4ZVQB 1CG2A 3K8WA 2IYGA 3RYLA 1L3VA 2KT5A 3M30A 3VZHA 1DQAA 1REVA 3DC2A 1NU4A 7AT1B 1EB0A 1CJTA 3BH7B 3T9NA 3VWSA 3I55S 1S9GA 4OZJA 2VV5A 2O3DA 2Z2ZA 3T9ZA 1RWMB 1X31C 3KHHA 4PR6A 4F2SA 5KFWA 1FWLA 4J9RA 2IBKA 2CYYA 4PXDA 3BF4A 2Q6BA 4WU3A 1Y10A 3RR7A 2N4CA 1EKSA 4KR0B 1WG4A 2QL9B 2GX8A 4L3NA 4C8MA 1U09A 1UP1A 2BM0A 4OZLA 1S6UA 2AWZA 2W8KA 3FJ2A 4PEOA 5FD1A 1TK8A 5BYQA 2O01C 2CPEA 3CJSA 2C2ZB 4IH5A 4NLYA 1T03B 3C14B 1F60B 2AEJA 1SL0A 4M94A 1DQ9A 5A8RB 5HQMA 1B7FA 3M4XA 2HQGA 2HAIA 4IOBA 1EZZB 3EX7B 4DQRA 2JFDA 1S59A 2Q43A 3UE2A 1SC1B 3LP2A 4A8KA 4F02A 1JLBB 5GAHU 4TNOA 4R0EA 4DU8A 3FCHA 2HHHJ 1SCJB 4M5IA 4YP3A 4PG5A 2ZE2B 4PQAA 2MXYA 4C8LA 2V34A 3P49B 3AD9C 4F0HA 2ZITA 1MWYA 2WRMA 3ILOA 3MM8A 2H65B 4B17A 1DFDA 1F9HA 3EZUA 2V2QA 1RBAA 5KT3A 3C6TA 4LREA 1Q82T 1LWCA 1X4HA 3L09A 2BJ8A 4I4BA 4WE1B 5CCLA 2CPFA 1K9MT 3H25A 1WHVA 1PILA 2UXBJ 1C4AA 2DCLA 4YB1P 2DGUA 2G2YA 4Y0FA 1N33J 3EVWA 2E1CA 2EBGA 2UXDJ 2GHVC 3HVTB 2HWIA 4R5PB 4M5MA 5HP1A 1BD6A 1T9XA 5KFBA 1F9EB 3SCJE 1RLDA 3M9MB 3M8SA 5K8NA 2CJAA 2BX6A 4ECYA 2ACYA 2U2FA 1L5UA 4MMOA 1KOHA 2CFXA 2XWYA 5KG1A 3IR6B 5CA5A 1LWEB 1VQOS 3NBPA 3QWPA 3DOMA 3DKDA 1XN9A 2R8KA 3T41A 3R2DJ 4N7TA 2IY5B 4CLUA 3K57A 1RT2B 4TY9A 4ZVRB 1SL1A 2WHOA 2KRBA 3W8PA 4DU7A 4CDIA 3G86A 2HZAA 3AFGA 2NZ4A 3SQGA 2XCAA 4J9MA 3PO4A 3K5PA 2GS8A 3HZGA 5A8RA 1UA1A 3M2UB 1TL5A 3O3LA 4OI1A 3KJVB 3OR2B 3PV8A 3BQ1A 5HMWA 1HBMB 5KFXA 4C11A 1YX2A 3TZZA 2DHXA 2YNFB 4J9PA 3OXFA 1KNZA 5JVGQ 3CC7S 2JFKA 2M88A 3OVAA 3NP5A 4WP8A 4FF1A 1FNMA 3DU6A 3D0IE 3PEHA 2CVIA 1AROP 1TUGB 2FLOA 3FCWA 5F9NA 3LWMA 1QSLA 1Q95G 4MYTA 2DB1A 1S9GB 2V8PA 1O51A 3AQOA 3DM2B 5G4DA 4NCBA 1P27B 4HDHA 2E7VA 3DCAA 2C3YA 2OLWA 4NLXA 4NLPA 3L7OA 4KE5A 3MM9A 4HI2A 3N28A 4P2SA 5LMUJ 4FS1A 4DL3A 3BV8A 4B02A 1QE1A 1WHYA 1RHMB 2FUG9 1AYEA 4N77A 4ZPVR 3P96A 3VAKA 4RW9B 2ILYA 4JI4F 3M2VA 5J2PA 3NNAA 1HI0P 3VCDA 3MM6B 1GX5A 2F65A 3QNWB 4QU7A 3W5YA 3W9IA 5F8NA 2IRUA 2CXEA 2IMWP 1P9QC 1O0PA 2CNNB 2K1RA 2RKIB 2WOMA 3EJMA 4DUTA 4WKYA 2IBOA 4ED2A 2QC3A 4LF4F 1VQNS 2G1DA 2W9CB 1SKSA 4LR7A 4RU2A 4LSLA 4P72A 2FIUA 4OX8A 5HVGA 4DPOA 2XGPA 2RF2B 4UOCA 1U47A 3HM9A 5EWEA 5D3GA 3CB4A 4HL9A 4PKDB 2CJKA 4K50A 1HPZB 2KXFA 4ZVFA 3IFEA 1N52B 1TU0B 5LM7E 4JI6F 2OMOA 4ECQA 1KQGB 2ZH6A 1TK0A 1H7WA 2KHDA 4BC7A 4MFBB 1XC9A 3GE9A 4K4YA 1OYEA 1DBDA 3FZ2A 4H4MA 3ZTPA 4X62J 5HLFA 1G1XA 4WKRA 1AW0A 2BE9B 3QIDA 2GVZB 1FWPA 1RAIB 1YHQS 2JLFA 4PZVA 2XM3A 1H6KX 5A2QU 3QJPA 3OPKA 2MKCA 5LMNF 5I4MA 2FZGB 5DDPC 3T3FA 3HX9A 4LFAF 3MAAB 4DV2F 2MY8A 5LMNJ 1KP6A 1N34F 1VQ5S 2DHAA 1MROB 2YBVA 4GMKA 2CQPA 4CLFA 3CUNA 2UUTA 1EAYC 4UUWA 4DN9A 1OY6A 3GFZA 2V6AA 1Z1ZA 2HGNA 1QAJA 5H9FK 3J81j 4PUOB 1JJCB 5HL7Q 2CPYA 3V4IA 4MK9A 2QTWA 1Q8LA 3DLJA 3LUYA 3MEGA 1DLOB 4IH6A 5T7LB 4PXEA 3IR7B 3TRGA 3FSIA 2ZOGA 2X51A 2HVIA 4J9UE 4OX9F 2RQCA 5GAGU 2DRBA 2HS3A 2X1FA 2FZCB 3HSJA 4M5LA 1IR0A 2CZ4A 2NZCA 2HVDA 3O5TB 1HI1A 3RRHA 2HNZB 4L74A 3ZZRA 1R6YA 3MPVA 1ACMB 1SJRA 4DZDA 1TV6A 3IN5A 2FGOA 3X1LB 1N32F 2AX1A 1VHFA 2E29A 2ZDOA 1Q81T 3M2RB 1LWFA 5L9XA 3JXOA 1JLFA 2XSJB 4YR3A 4F4ZA 2LXUA 3F56A 2NSCA 4RW4B 1D3WA 4V19X 4A8YA 2APOA 4NXMF 4Y6IA 4OYAA 1Y5LB 3CMES 2LDYA 3OSNA 4AXJA 5LXRA 1RTJA 3V4MA 2NXCA 3EGZA 1GMVA 2YXLA 4FNHA 1T94A 3VALA 1JX4A 1FI4A 2BJ1A 3PY8A 4YHHJ 3CJQA 3GJRB 3HFKA 2W4PA 3FGVA 3SSRA 1UVKA 2E1RA 4U6PA 4ETXA 1I94J 3DHWC 1QUPA 4PG8A 1PYOB 3UN2A 4B3SJ 2JOQA 2C3OA 3MAQA 5KFMA 1RTHA 4Q45A 2HQ3A 2BABA 1OPIA 3W5ZA 5SUHA 3W1YC 2AD9A 3JSBA 1JIHA 2QA1A 1FXRA 1B7YB 2BRKA 1QSSA 4DR6F 5ETQA 4ZCIA 2RS2A 1AFJA 1IKYA 2JEGA 2E66A 2HHXA 3KLGB 5D4OA 1R8AA 1VRUB 2B7BB 2AGQA 1QLNA 1F0XA 3W8GA 1RUSA 2OMLA 2HHVA 2QX0A 2EXUA 3TP2A 2JX2A 1RTZA 4DR7J 3GPAA 3OFFA 3BJYA 3UVJA 1FKPB 1OSCA 2HBZB 3PFOA 3M9NB 2GNKA 4M5HA 1HIYA 2CWKA 2O5DA 4FXVA 2A1BA 1C1CA 1LW2A 4LBHA 4X4OA 3KLFB 4BS2A 4LF5F 4Q2LA 2MZQA 3BKFA 4LF5J 4Q8FA 1VC0A 3SFUA 3Q23A 5B0GA 3UR0A 1FKAF 1I51B 4ID5A 1N33F 5C24A 1LV5A 3MECA 4GKJJ 4K5RA 1U1QA 4KH0B 5I3UB 1N5VA 1X5TA 4X4QA 1KONA 1FVQA 3DLEA 3NS5A 3M8RA 2KG0A 3D54A 1REGX 3MR5A 1NJIT 3BEGB 3NY0A 2PSZA 1SC6A 1S1WB 4WTOB 3IA0A 2V68A 2CDQA 3I4HX 3QSIA 1NKEA 5L9NA 1Q5VA 4ECUA 1K44A 4RUCA 3LAKA 3VR1A 3BQ2A 3E51A 3QRRA 1IQZA 4C0HA 5EGYA 3TANA 4RX6A 5KFCA 4IFYB 3VV2B 4DR4F 3D6FB 4NPOA 3MUTP 5F0WA 2XMKA 2XNQA 2H4WB 4HHUA 3PKMA 2JLGA 2PEHA 2DYAA 2XHCA 4USUA 3P5TL 5KG3A 1GX6A 1SXLA 3GFHA 3QFHA 2XS7A 4HI1A 2IM1A 3JTNA 3HI9A 4YY3J 3W63A 2D7SA 3DLBA 4P52A 2YWWA 3TOQA 2DHGA 3M30B 3MWBA 3OUYA 1KN6A 1RT5A 1ZM4A 3V2UC 4RNFA 1RAJA 3AD8C 1ZETA 2DIVA 3DI6B 1X9SA 1FFSB 4CT8A 5J2MA 1T9TA 1FNXH 3BDPA 1T05A 2E5JA 2CPHA 2XYHB 3KLHA 1FK9B 2CJQA 3NCRA 3W64A 4R8UB 4R8UA 2AGOA 2QLWA 2XMUA 3KK3B 4Y00A 1HQUB 3NLCA 4KBIA 2E5HA 1SQEA 4RWWA 3FMWA 4USIA 3DGPB 1X5OA 3M1VB 1WOSA 2YX4A 5A0YA 4E0DA 2K06A 1WG1A 1LKZA 1OIAA 5GADI 3BO3A 1DTQB 2XY5A 2VC0A 3BREA 3AXMA 3C6UA 2A0FB 2HHUA 3G8TA 1S1XB 2A3JA 3LALA 1WF2A 2PA8D 1MN7A 2W4CA 2W2OP 4KHRA 1JQGA 4NRUA 1L3KA 2XBPA 1FRLA 3J7YI 1SKUB 2HRUA 3JYTA 3JB9k 1KQSR 1WC5A 5J1EA 5IT9U 1RA7A 2FJAB 1T9WA 3PYGA 4WFYA 4Z37A 2RT3A 4N5SA 1T9YA 1B70B 3AY0A 2HBQB 1FEHA 1XR6A 4K4XA 4OYZA 1M5PC 2QJ3A 2J6TA 1H98A 2QFJA 3HLUA 3F41A 4DR2F 2PD1A 1PJ5A 1NDCA 4IO1A 2NREA 3CT9A 4FS2A 2V8DA 3CJ8A 3J81Y 4ERDA 1TL7B 3MM5A 3ZTOA 4MKAA 3OLAA 1N32J 2IA6A 2GJ2A 2LP4A 1RWOB 2H51B 3V81A 4M63A 3KOAA 1VK3A 5LSOA 2EVZA 5DQGA 3M8QA 3OBIA 5GAEU 1RYRA 3DLKA 2GO9A 1ZPVA 2CUYA 4LVNP 3KLIB 2AEMA 2QV6A 5ETRA 2DY1A 4DSKA 1CEZA 4NLSA 2RF2A 1HHTP 1FA0A 2DT9A 2ALZA 4ZPDA 4QCLA 2XTJP 4RU9A 3Q22A 1CJUB 3PKYA 2OD6A 3K59A 3BGOP 4FBUA 3SCKE 1KTVA 4LIWA 2ASJA 2DEIA 4EWTA 1ZAWA 4M1KA 2MKKA 3T5HA 5AE3A 4P74A 4TQRA 2ZH2A 3TA0A 3MD3A 3EGVA 2ATLA 3DOLB 4U7CA 1YBUA 3FZBA 4DR2J 2FB0A 2PMZD 3WZ0A 4NCAA 2BJ9A 2KM8C 4LFAJ 5KFFA 2OTJS 4EBDA 2YTCA 1HWUA 4YMEA 3JQJA 3KG1A 2DTJA 2VJVA 2Y1IA 1PYTA 1U2CA 3PYDA 4ZPAA 1UEUA 3TJ8A 1JJ2R 1SJ3P 2EFPA 3AH6A 2AZ3A 3TUIC 4NEYA 2O1PA 3K89A 4AT1B 1BQNA 3N5FA 8RUCA 2AZ1A 3GR1A 4CCHA 4P7VA 5J2QA 4Q44A 2DR5A 4IR9A 4CO1A 2PI4A 1V5IB 4WK1A 3OQ2A 1GTEA 5AE2A 1UVLA 4LFBF 5KFAA 1RTDB 3R97A 1S6PA 1EP4B 1WC1A 2JJ4D 3RRGA 3L95X 2FQQB 2DNOA 1AXQA 2WVFA 3VZIA 1B3TA 5CYJA 1BUXA 1GMWD 3DLGB 4ED5A 2RJZA 2MZSA 2M7SA 3BGLA 3FEXB 3QT5A 5RUBA 4X65J 2UVRA 5DZ6A 3OFHA 2OFHX 2V4JB 4LRAA 3LGHA 1FJ7A 3VQSA 5J1PA 1GH8A 2RIJA 2XMJA 3CCES 3GG1A 3S1TA 5GAHI 1BWEA 1RWKB 1RT3A 1QSYA 1PG5B 3AJDA 5A2QY 4RW8B 3CCZA 2ALYB 5CD4A 1U1LA 2AIRB 2D74B 1E6VA 1S7HA 3OFEA 4B3MF 4P2XA 2Y9HA 4JV5J 2ABYA 2OHDA 4I2QB 2WVDA 3G6XA 4OV1A 2W7OA 4DLEA 4C3KA 2MQOA 4DR5J 1FJGF 3MD1A 3IBWA 4LF6F 2MJUA 3MEDA 3E2EA 2U1AA 2K3KA 4RUAA 4ICLB 4QWBA 1I5OB 1N6QA 2YKOA 4DG1A 2W01A 4DCJB 2OIHA 5F0UA 4TU7A 4W4MA 1HW9A 1YJNS 1PJ7A 4O23A 4Y2IA 4ELUA 2B7CB 2VDIA 2LEPA 2WW4A 1LQ9A 3VHQA 2BDPA 3PHEA 1YZ7A 4G1QB 4C98A 3FSYA 2DNYA 3G9CA 3P8BB 4DZ6A 3BGUA 3AJ2A 1S4FA 3C15A 5ETPA 3ZTSA 3U1LA 3M8PA 4OI2A 4Y28C 2A6OA 2M8DB 1Q86T 4GC6A 2EG2A 2XZTB 1QUVA 3K5LA 1TL7A 3KJQB 3MM5B 4M5DA 3PX6A 3ZC4A 3B4MA 3A12A 4MKYA 3TVKA 3MGJA 3KHRA 4LRCA 3GJQB 1VIXA 2GA7A 1IN0A 1S0NA 2AYGA 5K8PA 4NLDA 1EQMA 1ZAVA 4NX9A 1V9OA 2EI5A 3BN7A 2F3JA 4YDXA 2GQCA 1AUSL 3C46A 4ZOSA 4DBQA 1HPZA 2R7SA 4ZP7A 1FFGB 2V4JA 1TKZB 5K14A 3H5UA 1VQ9S 2L9NA 3ILLA 4I2PB 2OEKA 4RL1A 5IC4B 2AV5A 2BM1A 4HEA9 2ZEJA 3MOJB 4ECTA 3MMCB 4CO5A 3KUGA 3CDAA 3LQVA 3JS9A 1FDAA 4WZMA 5AXLA 2VA3A 3GG0A 2ZC3A 4YY3F 1CULB 2GQQA 4F3QA 3UW1A 4ZVOB 2A2DA 4NWBA 2AP6A 3FEYB 2VG6B 3DGPA 3M05A 5DJBA 3HFZB 4OJHA 4EI2A 8AT1B 5BR8F 1X9WA 4UZBA 4OIXA 2V94A 2HFZA 2MLYA 2LQ9A 3ITHB 2J9DE 2MZRA 3CJTA 4OYBA 3MURP 2W1BA 4TVAB 4B3TF 1H38A 1QAYA 5K9FA 2ZFHA 5D0RA 4ZHRA 1U6ZA 3H40A 1IBMF 3PXGa 3U1NA 2MKIA 1AB8A 1DTTA 3VGVA 5KFNA 3OUYB 1M5VC 3CF5Q 1HNWJ 3D0GE 2L48A 5ETOA 2Y8YA 3G6VA 2FLLA 1TUWA 3J80U 5CYMB 4XPCA 1M5HA 2MYFA 5IM0B 1VK8A 3IWNC 2CQDA 4PABA 2J9DA 4UF4A 4EMDA 5LSRA 2GV1A 4B3MJ 1XNQF 4CYUB 2L08A 4J9QA 2UVUA 3NGTA 2Z4PA 2MEWA 1QD1A 2QL7B 3VAJA 2CG8A 3U7JA 1LOUA 5KOXA 4JP8A 1K73T 2VUGA 1WKJA 1HNIA 2MMYA 2PFDA 4ZCLA 2VONA 4JI2F 1YLXA 5F8HA 1J5EF 2OPSB 1JLEB 5LJ5Y 3K2YA 1RA6A 3FC9A 4NZ6A 4H4KA 3CPWR 2DXEA 4IR1A 1IBKJ 5I42B 4DCOB 5I42A 1RDRA 1E6YB 4W98A 3J7ZT 4DR1J 4O3QA 1U48A 4YR2A 3OTDA 2PN6A 1RBLA 2B6AB 4IG3B 4IG3A 2HNDB 3ZZOA 4ANCA 5I3UA 3M6WA 3QJJA 1BMQB 1WACA 1Y4ZB 3M6XA 1ELOA 1OMSA 2KI2A 2Q3PA 3EM1A 3MHYA 4LRDA 1EIYB 3U1MA 1HNZF 3CCTA 2FYXA 4DPYA 1Z4UA 2F1FA 5C24B 5KG2A 4UZCA 1MG7A 4I68A 2DNKA 2JL9A 3A8EA 2ZJRQ 4MK8A 4JBCA 3HT3A 1UW4A 2F40A 4C4WA 2BW2A 1PCAA 3HHLD 3CCUS 1KLMA 3GLJA 2CADA 4X64F 1FRHA 2WVEA 4LF9F 1FDDA 3ZZYA 1NK7A 2AW0A 5HANA 3OXGA 4DXLA 4Q0BB 1YJWS 3PVXA 4DL5A 1VYAA 2BEFA 3HFVA 3RAMA 2MB0B 4WFZA 1MW7A 5E2QA 5KFHA 4PQUB 1HARA 3C16B 4P9SA 2ERRA 1YVFA 2QN6B 4PG7A 2FJVA 2LDIA 3BGRA 3CJ3A 4ED1A 3G96A 2MQPA 1FF2A 3W60A 3FMBA 1FO1A 2HRTA 3VTIA 5C5JA 3DRXA 4F36A 4CIOA 4DSLA 1VDHA 1VRTA 4NA2A 1HQUA 5BJRA 1N4LA 2CAJA 2FD2A 4NEZA 1MU2A 3WHIA 4NYPA 1FK9A 2JVRA 5IC6B 1U2FA 3HDSA 3HD2A 4CT9A 2D3OR 1SJQA 4J9LA 2JEFA 2D3UA 1TVRA 4TY8A 1I3OB 2WSFC 5CABA 3RAQA 1BLUA 4YOEA 5K14B 3E01B 1SUQA 1CULA 1S6OA 1JXEA 3BBFA 4Y3CA 4XDDA 4LIRA 5KFEA 1QTNB 3QFWA 4C3LA 1Q16B 4L72B 2Y8WA 5HMXA 3QRQA 1S1TA 5L39A 3HCXA 5KFTA 4DUZJ 3D68A 4DS5A 3DMJA 4TKTA 2UXBF 2W4DA 1S1TB 5AE1A 1QVFR 1KFSA 2GGPB 3CD5A 2HMIA 3QQCD 3UQSA 3ZZUA 4P6QA 1D8ZA 4WFNQ 1SC3B 3IBCB 3JSYA 3R7SB 1FCAA 1Q53A 3R8YA 4KGZB 5ETTA 1S9EA 3VVUA 3J81U 3K58A 3D7SB 1CSJA 5CZVA 3UCGA 4ECWA 2E44A 4LF8J 3ENQA 5HQ8A 2ZUAA 2CZ9A 1WC6A 3IRXB 2AYMA 4J9NA 4KTQA 1X4CA 5IQQA 1RT1B 5AJ3J 2EFGA 3SQOP 2UU9F 4KH1B 2HZCA 4RUBA 3MM7A 2ZJPQ 3I9V9 2YH1A 1KVKA 4QWEA 1Q4RA 4B9SA 2W9AA 3EMTA 3H0PA 2GMJA 2P9CA 1PBAA 4P2FA 3TYTA 3QJLA 5AXNA 4ZVPB 2FHJD 4JI0F 1O8BA 4PUOA 1C0UA 1EETA 1HHSA 1T0TV 1VLOA 4RPFA 4DV5J 1F3FA 2MZJA 1U0SA 2P5VA 4K2JA 4Z7YA 4X66J 4O44A 3D67A 2XY6A 3SI8A 3BO2A 4AE5A 1KKHA 2ZD1A 3H4DA 2ZC4A 2J8SA 2YNIA 5L1JA 3Q89A 4HLBA 4P71A 2MSTA 1KQFB 1VC5A 2DBBA 4NE9C 3UVJB 1WNEA 2YKNB 3K0JA 2CQ3A 1U24A 2IC3B 3LP0B 1F2GA 3BZQA 3R5DA 2Y0SD 2VL1A 5HATA 1TR0A 4WK3A 2X1BA 3NEKA 2GHWA 2DVIA 2HS4A 4HT7A 3QLHA 1WELA 1TMMA 1RJJA 1IBCB 1XR7A 2Z56B 2FVCA 4H4OA 4CNYA 3I56S 3SEOA 1WEYA 1Q7LB 3CVKA 4NYZA 3A3OB 3JQKA 4WBFA 1X4DA 1P1TA 1ZZFA 2KYZA 4ZS6A 2PT0A 3GIKA 1S6PB 2X3GA 4UOHA 1PO6A 4JYAF 3T6BA 5ETLA 4ZVGA 2UXCJ 3AODA 3RG6A 5D3GB 4Y2MA 1U26A 2UXDF 1F5BA 4ETZA 4UY85 3RBEA 4KSEB 1JLEA 5JUMA 5L46A 4DQPA 3NGKA 3J7Z5 4B9UA 2JLEA 3DN9A 3A8KA 4OMFG 5ETSA 4ZVHA 1C4CA 3PZPA 1NK8A 3Q8PB 2EC0A 1FERA 4MIBA 1CC8A 2XHWA 1TFYA 2VQEF 3OTEA 1M1HA 2JEJA 4I0WA 3T1AA 4F2RA 4RW9A 4GKKJ 4L3KA 4LQ3A 2JRSA 2F5GA 2DH9A 5D4PA 1VIOA 1W25A 2G0CA 4MKVA 3IGNA 3GV8B 4HACB 4HACA 2LQJA 3CC4S 1M1GA 2DCUB 2LKZA 1TV6B 3OTBA 2F8HA 2FPHX 3GP9A 4WFXA 3CCRS 2HHSA 1XQIA 1NSKL 3HVAA 2DH7A 4C8YA 4YQWA 2IPOB 5FLXU 3NAHA 2F4VF 2IYIA 1T02A 1Y5NB 3GYXB 1PKUA 3ETMA 2QLJB 3JTPA 4QPTA 3KK1B 3T1HJ 2ADBA 2B8PA 2F7VA 5E3AA 2FJBB 3LH2S 3QGHA 3JSRA 2B5JB 4YFUA 2OELA 2R2SA 3EZ5A 3FRYA 3RW7A 4CLPA 3QLHB 1VHIA 1ITPA 5HMYA 1N5SA 3PO5A 3NGUA 3ISND 2WVBA 1I94F 4OLOA 3DYAA 4ECVA 2FJDB 1URNA 4A8FA 1WTFA 1Y00A 4CLLA 5K8MA 2D41A 1HFEL 2AU0A 2V9KA 4WFBQ 2VBXA 1GXLA 1SH3A 4ILLA 1U4BA 2K3IA 1K1SA 2JDJA 3CDEA 3IBFB 4FYDA 5HSPA 2BUNA 5L38A 3NMAA 2EFNA 2IDEA 3UR3C 1RHJB 1C0TB 2GIFA 4R5PA 4OYWA 3KHLA 2QMUB 4OZ2A 5CXTA 4I69A 1V3ZA 1S79A 2IDLA 2A18A 4A8QA 2NXEA 5HN0A 2DGTA 5IV4A 2X3DA 2ZD1B 2DGVA 4JI6J 2B43A 4F7VA 3M1VA 5BYRA 3TNVA 2IAJA 2HVHA 2BJDA 4FF3A 1UJ6A 1S7IA 2I5JA 3I0SA 4NLQA 1X4EA 4RNHA 3IAM9 1R7IA 2FHMA 3GQCA 1WOOA 1R3NA 4I67A 3QO9A 2VFRA 2LQBA 2ZZMA 1IM6A 4OJGA 5LL6d 3MM7B 4K0KJ 1RWPB 3H8YA 4OYXA 1KC8T 3CCVS 2O66A 4J5OA 2KXNB 3I5AA 4OJ1A 2BQUA 2D3O1 3QPIA 4AL7A 1YBTA 5M2RA 5HJYA 1JLQB 1RAAB 2HNYB 3HP6A 3RB4A 1U1RA 2E9ZA 2EFOA 1HBNA 3W2WA 4UQTA 4ZP9A 3W3SA 2GZOA 2PC6A 2RHSB 3NS6A 1ZOTA 2Y1RI 1YI2S 2HZVA 4QIFA 2C22A 2RSQA 5KFSA 2FHJA 3V5RA 4N56A 2M52A 2CQIA 4ZIWA 5F8LA 2G4BA 2FY1A 1WKKA 4YN3B 3WC2A 1RCXB 2RQKA 1NHKL 4FVMA 4DL6A 1K0TA 2C2KB 4AD6A 2G9OA 3I5BA 4U96A 3MFIA 1EP4A 3LTOA 1NZAA 2JNJA 1D0EA 2AJ4A 2HAFA 3D1QA 4IFYA 1A7GE 2LCWA 2PEBA 3E01A 4KIAA 4RR5A 1R8PA 1X4BA 4D3GA 4F67A 5F8JA 4KC5A 3QO9B 3C15B 3J7AN 2BE2B 2CNKB 1G4CA 1WEZA 3C16A 1RT2A 2IFXA 4KT0C 2ASLA 3GB0A 4G1QA 3EDRB 3B54A 3HKZD 3TAPA 4Y2CA 1IBLF 3RW6A 5HROB 4C9DA 1XK8A 4UW2A 2NPFA 1QAXA 2QZ8A 3H7HB 4F25A 1S1UB 1WWHA 2Y3YA 1Q78A 4ZMMA 3Q8VA 1KD1T 2NXUA 5IZHA 3NGRA 1SQFA 1YG0A 3AJ1A 1RTIB 5EUHA 5DQHA 1RT7B 1VBKA 4ZVSB 1VQKS 4B3TJ 2UXCF 1XR5A 3DRSB 3M6UA 5KT5A 4KPYA 2SXLA 2WBMA 4GVLA 4ID5B 4DR4J 2DGOA 1NK4A 1TAUA 1YJRA 4X4VA 4I2QA 1OJ4A 2UUBF 3R9LA 2CJBA 4LVOP 5KFUA 2HK3A 3I96A 1RT7A 2OUGA 4USHA 1JLCA 2CIMA 3B4DA 4EUVA 5C25A 1U45A 1VMBA 2R8GA 3Q8SB 4I6WA 3R6GB 4OI3A 3Q86A 4ZP6A 2B6AA 4BWMA 3EVMA 5B0CA 2MJNA 2MLXA 5B08A 2H48B 3IG1A 3CMQA 1FTCA 1TKTA 4IFVA 4R0JA 5DQIA 2VPZB 4DR6J 2P9GA 3X3UA 1SPBP 1T9VA 4Y34A 1RAFB 3KLIA 1U1KA 2KN4A 2AYEA 2MDAA 4M95A 4IRDA 1JB0C 1GT8A 2HLUA 2YWKA 3P3DA 1UWAA 2Z58B 1HBUA 1RWWB 1H73A 2HQIA 1XMBA 3RBZA 3A8JA 4IQMA 3R1HA 3DHXA 3OXLA 1W2IA 4DEZA 1RHRB 4HHJA 3K7RA 5EHHA 1AT1B 4LBPA 1RTHB 2RUGA 5C2CA 1YSJA 2V8GA 3LWLA 3O8WA 1YRUA 3O1LA 1T03A 5J2QB 1HW8A 3OFGA 2A10A 4DPUA 1WI8A 1ZM2A 3BBCA 3KG0A 3K5MA 2UVVA 1SBRA 2DNMA 3RJMB 3MUMP 1UTAA 2I8EA 3HK2A 3KWMA 5A8KA 2GHPA 4RBVA 4B3RJ 2RD5C 1J5EJ 3GIRA 4CTAA 1IM4A 2CNOB 2R7QA 2DNQA 1O6XA 3MPWA 4RW4A 2PI5A 1X4GA 4W90B 2HS0A 2YWEA 2QMWA 2BE7D 2HVZA 2VFUA 1R43A 1WI6A 2I1RA 4ZHRB 2AYBA 5KFLA 2IJRA 2OPRB 4KAIA 4NI2B 2GJFA 1HMVA 1S0MA 2UP1A 2EK1A 4NLGA 2BR0A 3TJ9A 2HEKA 3IC1A 2ZWOA 4TXSA 4ZVEA 3B8HA 1MSWD 4JI5F 2IAJB 2V8VA 2VG6A 2JEIA 3DDIA 3JAMU 1U7LA 3CDUA 5I3QA 3BSNA 1ZYQA 3MEGB 3S8SA 3A13A 3NWRA 2OEJA 3K8VA 1KWMA 1WC3A 2F4FA 3WIUA 4F4WA 1RLCL 4X62F 1UVIA 3NRBA 2KVIA 3AOCA 2IJFA 2YVSA 2P6SA 1ZPWX 5EWGA 3MCOA 2DGQA 1RABB 2A2CA 5KFJA 4DX7A 4RW6B 3OR1B 1RHKB 3TVYA 3IWLA 4M5DB 1NJWA 3IXQA 1TKZA 3FSXA 2WB4A 2QEXS 2BA9A 3SFGA 2FVPA 3ENAA 4HHHA 3OSPA 5KOWA 4O4GA 2D9OA 4C7QA 1VQ4S 1DARA 4YUDA 2FC9A 1IR2A 4K4WA 2CPZA 2RQMA 4HDGA 3THVA 2KKHA 1VQ7S 1I6JA 4XIUA 3H2VE 2CVEA 1RACB 2C2MB 3MTKA 3W5XA 2HFOA 4HKQA 4PG4A 2XZDB 4EFAC 4WFAQ 1CLFA 3I87A 2B5JA 2UUCJ 2W9CA 2ACMA 4YR0A 2GW8A 3CJ4A 5LSLA 2MGZB 2W8LA 1N6QB 1VCTA 2HIQA 4OX9J 1NDPA 5A6PA 2R2RA 3BSAA 4QYZJ 4OJ3A 3CD7A 3NOGA 5E3RA 2G1HA 4PPZA 1RT1A 1YTYA 1MWQA 3QIPB 3Q8YA 4JI7J 1XEZA 1FRIA 1QE1B 3MR7A 1UL3A 2YWFA 1E6VB
chains in the Genus database with same CATH topology
1F9EB 2Y1LB 1GFWB 2CJXB 3KJNB 3R6GB 2QLFB 2QLJB 5IC6B 2H48B 2QLBB 2XZTB 2HBQB 3KJQB 1I3OB 4ZVRB 1RE1B 3P45B 3GJRB 2HBRB 3GJQB 1QTNB 3EDQB 1QDUB 1RWWB 1PYOB 3GJTB 4ZVUB 1RHRB 2H51B 1RWOB 4JB8B 5IC4B 2CNLB 3D6HB 2P2CB 3IBFB 1ICEB 1SC3B 3IBCB 3R7SB 3RJMB 2C2OB 1RHJB 2HBYB 3R5JB 4ZVOB 2Y0BB 3R7BB 1RHQB 1RHMB 2CNOB 2HBZB 4ZVTB 5K20B 3QNWB 4ZVPB 4LSZB 3R6LB 3D6MB 3P4UB 2CNNB 1SC4B 3SIPB 2XYPB 1I51B 4ZVQB 1RWXB 1RWPB 2XYGB 1RWNB 4DCPB 2QL7B 1RWMB 2CJYB 1IBCB 2QL5B 3KJFB 2QL9B 2FQQB 4DCOB 1RHKB 2C1EB 3D6FB 2C2ZB 1NMEB 2H4WB 2C2KB 1RHUB 1BMQB 2CDRB 1SC1B 3R7NB 2H54B 1RWKB 2H5JB 2C2MB 2XZDB 2CNKB 3GJSB 3EDRB 2H65B 2XYHB 3NS7B 2H4YB 4ZVSB 4DCJB 1RWVB 2DKOB 1PAUB 2H5IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9E B;  2Y1L B;  1GFW B;  2CJX B;  3KJN B;  3R6G B;  2QLF B;  2QLJ B;  5IC6 B;  2H48 B;  2QLB B;  2XZT B;  2HBQ B;  3KJQ B;  1I3O B;  4ZVR B;  1RE1 B;  3P45 B;  3GJR B;  2HBR B;  3GJQ B;  1QTN B;  3EDQ B;  1QDU B;  1RWW B;  1PYO B;  3GJT B;  4ZVU B;  1RHR B;  2H51 B;  1RWO B;  4JB8 B;  5IC4 B;  2CNL B;  3D6H B;  2P2C B;  3IBF B;  1ICE B;  1SC3 B;  3IBC B;  3R7S B;  3RJM B;  2C2O B;  1RHJ B;  2HBY B;  3R5J B;  4ZVO B;  2Y0B B;  3R7B B;  1RHQ B;  1RHM B;  2CNO B;  2HBZ B;  4ZVT B;  5K20 B;  3QNW B;  4ZVP B;  4LSZ B;  3R6L B;  3D6M B;  3P4U B;  2CNN B;  1SC4 B;  3SIP B;  2XYP B;  1I51 B;  4ZVQ B;  1RWX B;  1RWP B;  2XYG B;  1RWN B;  4DCP B;  2QL7 B;  1RWM B;  2CJY B;  1IBC B;  2QL5 B;  3KJF B;  2QL9 B;  2FQQ B;  4DCO B;  1RHK B;  2C1E B;  3D6F B;  2C2Z B;  1NME B;  2H4W B;  2C2K B;  1RHU B;  1BMQ B;  2CDR B;  1SC1 B;  3R7N B;  2H54 B;  1RWK B;  2H5J B;  2C2M B;  2XZD B;  2CNK B;  3GJS B;  3EDR B;  2H65 B;  2XYH B;  3NS7 B;  2H4Y B;  4ZVS B;  4DCJ B;  1RWV B;  2DKO B;  1PAU B;  2H5I B; 
#chains in the Genus database with same CATH topology
 1UW9 A;  1HL6 A;  1H2U X;  3BR8 A;  3PFE A;  1SJF A;  4P10 A;  1RKI A;  1N8R T;  4B3O A;  1IXK A;  2F8E X;  3PW4 A;  2PA3 A;  1PIE A;  3LGN A;  4CP5 A;  3Q8R B;  2E1P A;  4F0K A;  3LPE A;  2DPJ A;  3FQL A;  3A3N B;  2OI2 A;  2VFT A;  2R42 A;  4FZV A;  3WDO A;  2HWT A;  2R2T A;  1NK0 A;  2NUU G;  1XBW A;  4NA3 A;  3WX4 A;  4CTA B;  1U49 A;  4FNI A;  4PCQ A;  3DLG A;  4DQI A;  3C3L A;  1S6Q A;  2GMH A;  1DJ0 A;  2CQB A;  2M9K A;  3DM2 A;  2J6U A;  1LW0 B;  2J0X A;  3M2U A;  3UWT A;  3EDQ B;  2ZNZ A;  5GAG I;  5F9L A;  1PC5 A;  3D4J A;  3PYE A;  1SUQ B;  3SQG B;  1BQM A;  2IVF B;  3GJT B;  2D9P A;  1J27 A;  4DFM A;  1WSV A;  3LOU A;  4QOT A;  2CQ4 A;  2HLT A;  1HWI A;  3DRR B;  1S72 S;  1NJZ A;  2VIC A;  1OPZ A;  3GCW P;  2HHQ A;  1FRK A;  1SH0 A;  2LVW A;  5MAO A;  3I0R A;  4PWD B;  2HQD A;  2ZVS A;  3DOM B;  1ICE B;  3DLE B;  1VR6 A;  3WIV A;  1BGX T;  2RB7 A;  3ENW A;  2C28 A;  3NNH A;  3H5X A;  1CQM A;  1GK8 A;  3MEC B;  2YPZ A;  3AB2 B;  1KRP A;  3HSG A;  3NGD A;  2JC0 A;  1VJQ A;  1N5Y A;  2RS8 A;  1BQN B;  1YGY A;  2N3O A;  5ETV A;  1A9N B;  2ATC B;  3FCV A;  4G65 A;  4CO3 A;  4F4A A;  2MKY A;  2V4R A;  4LF9 J;  3OHA A;  5CZX A;  4C3M A;  1KVI A;  3FBE A;  2PDA A;  1FKP A;  3N01 A;  1UJ5 A;  4U9R A;  1I1G A;  1NCL A;  3R6L B;  2XY7 A;  1X0F A;  1HI8 A;  2DGW A;  1SV5 A;  1VLY A;  3P4U B;  4M5N A;  4RW7 B;  5D0H A;  2ZVI A;  1S57 A;  2MTL A;  4OV6 A;  5GMD A;  4C8N A;  1C0U B;  4ID8 A;  4ECS A;  1HQE A;  4Y2K A;  4IO9 Q;  4CNZ A;  1JWW A;  1UET A;  4C2M A;  1TP7 A;  3FDS A;  2ZDP A;  3F44 A;  2CQH A;  3M8Z A;  2IVM A;  4EGL A;  4USM A;  3QZ7 A;  4BLG A;  3MR6 A;  2ZHA A;  2XB2 D;  2YQ1 A;  2R7V A;  3ZZ0 A;  1RAE B;  2DIU A;  3DGV A;  3IWX A;  1E6Y A;  2IRX A;  1FE0 A;  4HTJ A;  5EDW A;  2VAS A;  4ZPW R;  4EK2 A;  1NZ8 A;  2G13 A;  3SV3 A;  2LEB A;  3PW5 A;  1P6T A;  1HR0 J;  3FK4 A;  2DRD A;  4JI2 J;  2B3T B;  2VG7 B;  2V4Q A;  2IA0 A;  4XK8 C;  4GKK F;  3MAA A;  4I7F B;  1WTB A;  2VIH A;  1LWX A;  2K8G A;  4J9V A;  1DAX A;  4O4G B;  4MIA A;  4O3P A;  5IWA J;  2XLJ A;  3ELH A;  1EQ0 A;  2W2P P;  3NCQ A;  4NLV A;  4LJM A;  3VGT A;  3OR1 A;  1JXV A;  3CE8 A;  9RUB A;  1DUR A;  5HI7 A;  1KFD A;  3OL6 A;  5J1E B;  4F3M A;  4ZCK A;  5E0O A;  1JJ4 A;  2UUA F;  3RR8 A;  2H54 B;  2FJW A;  2H5J B;  2KRR A;  2CJ9 A;  3HPO A;  1BXN A;  3D3B J;  1U0H A;  1PBU A;  2LQ8 A;  4QYZ K;  4QIV A;  1M5S A;  4DX6 A;  3I32 A;  1X9M A;  3DRP B;  1HBN B;  3TWZ A;  3WBZ A;  1IJE B;  1T95 A;  3PM9 A;  3KK2 B;  2IM3 A;  3CCL S;  2VA2 A;  2XLK A;  1LK5 A;  5A0Y B;  4P75 A;  5GVQ A;  3JTO A;  3M32 B;  4JOU A;  4WIQ A;  5D77 A;  3UD3 P;  2HNZ A;  4ZKA A;  3HXM A;  2ADC A;  1C1B B;  1KS2 A;  2JWN A;  2KXH A;  2V63 A;  4Y65 A;  1A0O B;  1REV B;  2KZM A;  3PR5 B;  4Z7C A;  3RTV A;  5J2M B;  5FLX Y;  2GAG C;  3T1Y J;  5D0E A;  4ZIV A;  3HKW A;  1QTM A;  1DLO A;  1N0V C;  4RUH A;  4WF9 Q;  3GTY X;  3B82 A;  1AUD A;  1IKX B;  1F6T A;  3UDL A;  4DV5 F;  4ITS A;  3KK3 A;  1HNV B;  1GFW B;  2I5J B;  2FVQ A;  1DY3 A;  1M0S A;  3ENV A;  4TN2 A;  5B0B A;  1UWB A;  1YQH A;  1JK9 B;  1YKW A;  3H42 A;  1TL3 A;  3UN5 A;  4J9O A;  4KKO B;  2R7W A;  3HUL A;  4Q0B A;  3CJK B;  3IAS 9;  5HAO A;  1NB7 A;  3MZI A;  2EPI A;  2DIS A;  2J5A A;  1RT5 B;  4FP9 A;  2QLB B;  3QAT A;  4K7Q A;  4NA1 A;  1BHN A;  1N88 A;  4I6Y A;  4HTI A;  3ZTR A;  1U0H B;  1IKW B;  2DNG A;  3HHL C;  3RUB L;  6FD1 A;  1NPK A;  2IVY A;  4U67 Q;  2VQE J;  5L1I A;  3MPY A;  2ZHB A;  4EZ9 A;  4F8R A;  4LFC F;  2YNF A;  1FFW B;  3LGM A;  4N8O A;  1QDU B;  4OHZ A;  4DV0 J;  1S1W A;  1NDK A;  1RT6 B;  3NOC A;  3IR5 B;  4KGV B;  1FKO B;  2Q1L A;  5D6G A;  4CZC A;  5GAE I;  2YWG A;  1B64 A;  2MKJ A;  3R5C A;  2OEM A;  4J91 A;  2DEJ A;  3AT1 B;  2RML A;  3KYL A;  3D6H B;  4KV8 A;  4OHV A;  4ER8 A;  2J7W A;  3G82 B;  5KAK A;  2WTF A;  3LO3 A;  3CJ2 A;  4Z2X A;  2HHT A;  2E5I A;  4ZLN A;  2EFQ A;  4KO0 B;  5IT9 Y;  4WYW A;  3W62 A;  2OPS A;  3AA8 A;  4USV A;  3IG1 B;  4G6V B;  4O0N A;  2YH0 A;  2XGQ A;  1YRT A;  1Q0N A;  4N47 A;  4UOF A;  4LSN B;  5DG9 A;  4DG1 B;  3EE3 A;  1C1C B;  1LW2 B;  4URQ U;  3UDE A;  5C25 B;  2E5L F;  3TUZ C;  4WU2 A;  1RXO B;  4QW8 A;  2E9T A;  1TL4 A;  2EFV A;  5CD4 H;  1R89 A;  2EW9 A;  2NPI A;  2IIH A;  3GFY A;  3VAH A;  2UU9 J;  3M2V B;  5J2P B;  2CPI A;  5CYM A;  5ITH A;  1SV5 B;  2GO8 A;  1VRU A;  4P73 A;  3UO0 A;  4NCG A;  1EHW A;  4ES3 A;  3H5Y A;  1M5K C;  2XS2 A;  4DR1 F;  4RJV A;  2F9D A;  1NHV A;  3F73 A;  2GQ2 A;  1SC4 B;  1DTT B;  3IMQ J;  2XCP A;  4ED0 A;  4N76 A;  1BC6 A;  4A8S A;  3KNG A;  2VOD A;  5CCM A;  1G3O A;  3HO1 A;  2LEA A;  1RWX B;  2VG5 B;  4DL2 A;  4KHP J;  5THW A;  4O4R A;  1KOO A;  3GZ7 A;  3ITH A;  3MM8 B;  5DZ7 A;  3N6M A;  2KJV A;  4DCP B;  1DHM A;  1SQG A;  4NYO A;  3PAC A;  2DIT A;  3TO8 A;  5E7O B;  5L1K A;  2BE2 A;  3EXC X;  2QRR A;  1V3S A;  5FJ4 A;  3KNA A;  2CJY B;  5A8W A;  3OR2 A;  1Z2L A;  3UCU P;  1WDT A;  4K2X A;  4OQJ A;  2MQ8 A;  2A6M A;  1NH7 A;  4ZDN A;  2ZM6 J;  4IRC A;  1FVS A;  4LFB J;  4I1T A;  3A1Y G;  4DUY J;  2L9W A;  5AT1 B;  4JV1 A;  1WEX A;  2VU5 A;  3MMC A;  2BJ3 A;  1YJV A;  5D0G A;  4YB7 A;  1CVJ A;  1S97 A;  1KEK A;  2V2V A;  4ECR A;  1RT4 A;  4J90 A;  3PJX A;  1G2E A;  2CG4 A;  2QSW A;  1NSA A;  2J7K A;  4NRT A;  1UFK A;  3F0N A;  1U1M A;  1KDN A;  3QBC A;  2VKR A;  1JLQ A;  2HNY A;  2AJF E;  3RRK A;  1M1K T;  2W2N P;  1W26 A;  5ADZ A;  2QLX A;  2IRY A;  2PO4 A;  3D0H E;  4E98 A;  3AB4 B;  3N6N A;  1CJT B;  1UCN A;  5M2U A;  1NKC A;  2OFG X;  2JHE A;  1GAO A;  2IC3 A;  3LP0 A;  2QA4 G;  4PWW A;  4DPW A;  5T7L A;  2J0Q D;  3B78 A;  3M2R A;  4ELT A;  2GVD B;  2YNI B;  1YRX A;  1YDL A;  2ZBR A;  1HWL A;  3CXC R;  5L1L A;  3PJ9 A;  4X2B A;  2VH7 A;  2XWX A;  4YEA A;  4JI7 F;  1VRQ C;  2WK4 A;  5CYQ A;  5E3P A;  2XLI A;  1QM9 A;  2OSR A;  4H54 A;  4ATN A;  5FDL A;  3KG4 A;  4G1I A;  3CCM S;  1HBO B;  1EET B;  3FBF A;  3M7V A;  1H72 C;  2CQC A;  3GON A;  5DM6 Q;  1GNK A;  2BV3 A;  4QWA A;  3AXK A;  3TX0 A;  1RAG B;  3FUY A;  4DV1 J;  1YJU A;  3DLK B;  4ICL A;  1MLA A;  3KJN B;  2DXD A;  3TVZ A;  1RKJ A;  5J1N A;  4C48 A;  6FDR A;  1S10 A;  4OLP A;  1ZTW A;  3OJS A;  4DS4 A;  3G82 A;  1C0T A;  5E5N A;  2KFZ A;  2PFF B;  3IRX A;  1WHW A;  3FVY A;  5J2N B;  2J0W A;  3HHD A;  3C2P A;  2OSQ A;  4ILR A;  1MRO A;  4RW8 A;  2C3P A;  1TAQ A;  5A76 A;  2LYV A;  1UZH A;  2JH3 A;  1R6V A;  2I6W A;  2YQ0 A;  3RZA A;  4RNO A;  2LEC A;  3DYA B;  1CJV B;  1HNW F;  2GGP A;  3I6P A;  4JB8 B;  2G2Z A;  2KT3 A;  1RIS A;  1WOR A;  1UFW A;  1HA1 A;  1NSP A;  2NS1 B;  2BJ7 A;  3TAQ A;  1N34 J;  1RGV A;  3TUJ C;  4IQX A;  1XNQ J;  3GYN A;  3MMB A;  2KL8 A;  4NLW A;  5DO2 A;  1RBO B;  1YK9 A;  1B0P A;  2AMC B;  2KFY A;  1QVG R;  2XMV A;  1IKV B;  2FVS A;  2HFU A;  3SDE A;  1J5O B;  3C6U B;  4B9L A;  4O3R A;  1RZM A;  1F5C A;  5CH7 B;  1FEE A;  1SVD A;  1KBR A;  2EG1 A;  2ZNY A;  3R5A A;  4OYM A;  1HNV A;  2ROG A;  4XDC A;  1GMU A;  1YJT A;  3C19 A;  1IKX A;  2AJ1 A;  1KHV A;  2B9E A;  4WP3 A;  2BAN A;  3D9B A;  4FPR A;  1SJ4 P;  2J7U A;  4BHQ A;  3R27 A;  3TEH B;  4UQG A;  3MR2 A;  4CM2 A;  1JXL A;  3P6Y C;  3V6D B;  4ILM A;  3PX0 A;  2LFV A;  3MM9 B;  3NG8 A;  1T05 B;  1VQ8 S;  2RNE A;  2V8H A;  1D09 B;  3JAM Y;  1ZTT A;  2HK2 A;  2BAN B;  2I9S A;  5HBM A;  1FT8 A;  2BKN A;  2XYP B;  3SIP B;  4AYB D;  4QPX A;  3DXB A;  3L3C A;  4JI3 F;  3ADA C;  4J9K A;  3KK2 A;  3GV5 B;  1FRX A;  2E1A A;  3RGI A;  4I6A A;  4DV4 F;  2RRN A;  2N82 B;  2R7X A;  4N8N A;  1X0P A;  4URG A;  1RWN B;  3KUE A;  2KG1 A;  2BYC A;  3ZFV A;  2G0J A;  2BXJ A;  7FDR A;  5IV3 A;  4DLG A;  3AA9 A;  2CPJ A;  5FII A;  1VQM S;  4JV2 A;  4DN0 A;  2P8I A;  3CD0 A;  3IRW P;  4DR5 F;  2WON A;  1KLM B;  2FJE B;  2XG8 A;  3QMQ A;  3RBX A;  4PWU A;  1R8H A;  1B4S A;  3CED A;  4CO4 A;  1WHX A;  5LMU F;  3HJF A;  2R7U A;  1CJV A;  2QL5 B;  4P7T A;  3AD7 C;  2CRL A;  2FY8 A;  3DOK B;  4FYW B;  3T1Y F;  1NK9 A;  4DSI A;  4LF7 J;  2J9E A;  1ZH5 A;  2C1E B;  4GVB A;  5KFI A;  4DMZ A;  4EO8 A;  3V6K A;  2J9C A;  3EZO A;  4AQY J;  4ES1 A;  1SKW A;  3KLE B;  1HNX J;  1JKH B;  3PG9 A;  4U8V A;  4IDK A;  1LWE A;  1HBU B;  1NB2 A;  4KPC A;  4URS A;  2FTR A;  2YNH B;  1Q5Y A;  1N48 A;  1RU2 A;  2XO7 A;  1KVJ A;  4WTY A;  4RBU A;  2Q66 A;  3Q8U A;  2RDJ A;  1SIZ A;  3UDC A;  1U6B A;  2MY7 A;  4CWB A;  2BJE A;  2Z2M A;  3OTO J;  2DNP A;  1Q1K A;  3PDN A;  2PII A;  3QRP A;  3G4S S;  2DY9 A;  2YKN A;  2YNG A;  4ZA1 A;  5LT5 A;  3KLF A;  1URR A;  2LQ5 A;  1M5O C;  2Z2Y B;  2ZHO A;  1TK5 A;  3EUN A;  5C2G A;  2MHE A;  4CYU A;  4NL5 A;  1ZA2 B;  3VVT A;  3H2L A;  2ASY A;  4CRJ A;  3IS9 B;  5F8I A;  3VAF A;  1TUV A;  3KFW X;  1IWA A;  3EXY A;  4DI6 A;  4E8U A;  2YNG B;  3CNQ P;  1U8S A;  3CMA S;  4DX8 H;  1S0O A;  1DTQ A;  2XEX A;  3ZZZ A;  4FYY B;  3UCZ P;  2FLP A;  1HD1 A;  5GME A;  3DXS X;  2LU1 A;  2LXF A;  3G8S A;  2R3V A;  1FE4 A;  1H0H B;  1HYS A;  2YY3 A;  2VJU A;  2V69 A;  5KFQ A;  5HRO A;  4DWI A;  4LR8 A;  4LF8 F;  2VDH A;  1UA0 A;  2R7T A;  3SV4 A;  3FBB A;  3J7Y U;  2PMH A;  3PR4 A;  1UMJ A;  1Y9O A;  3GFX A;  4PG6 A;  4ENO A;  1U1N A;  2DRA A;  3SYZ A;  4C8Z A;  1RT4 B;  3THT A;  4GVB B;  3MCM A;  3TAM B;  3MUV P;  1RE1 B;  3DOK A;  3I31 A;  4C8O A;  1X8D A;  1FES A;  1PAE X;  1S5Z A;  4PXC A;  2ZBQ A;  5KT6 A;  3PIP Q;  4EBC A;  2F63 A;  1BQM B;  1SI9 A;  2MLZ A;  2I38 A;  2WW8 A;  2DNL A;  3OT9 A;  4MKB A;  4MT1 A;  5E3C A;  4DV6 J;  4PYD A;  4QR0 A;  2FGC A;  3G87 A;  1FNO A;  2CQ2 A;  3SZ2 A;  1Q79 A;  1S12 A;  3MEE A;  4I2P A;  3J80 Y;  1NH8 A;  2W25 A;  4QIW D;  3TJA A;  3BO4 A;  4EZ6 A;  5I3P A;  4DV2 J;  3O2I A;  3KTQ A;  1LK7 A;  4X65 F;  1XMO F;  3UNY A;  1R8B A;  4K0K F;  2ZBC A;  4DQQ A;  1LWF B;  1P1L A;  4AL6 A;  3B6B A;  4TY8 B;  4ALZ A;  2HFS A;  3PHT A;  3BSC A;  5HBM B;  4F4X A;  1QAI A;  2EBE A;  5KG6 A;  1HQ2 A;  2W2M P;  4A8X A;  3QT7 A;  3QGG A;  3CWJ A;  4FBT A;  2HW3 A;  4UUX A;  1H3D A;  3GR0 A;  5EX3 A;  3NGS A;  1R0C B;  5KG7 A;  1YBA A;  1RHQ B;  3DNC A;  3RB0 A;  2H3E B;  1NO8 A;  4RNN A;  2KFN A;  1IBK F;  3CSK A;  4L75 A;  4IKA A;  4DR3 F;  5C42 B;  1V5V A;  2V2K A;  3MCS A;  1Q8I A;  1TQL A;  3FBC A;  5KG0 A;  2QO3 A;  3CW2 C;  1FDB A;  3D6M B;  4NMX A;  3BYR A;  3NKY A;  4CH0 S;  5IT4 A;  2GIR A;  5KFK A;  2ROE A;  5T14 A;  1N0U A;  3Q0A A;  4DL4 A;  4AND A;  2UUW A;  3A3P B;  2ZH5 A;  1S0V A;  1UKU A;  2VD3 A;  2HQC A;  3MMB B;  3OTC A;  1NPR A;  3KDO A;  2HGL A;  3NCP A;  3E8O A;  2KDO A;  3MED B;  2L41 A;  3QSY B;  3HZE A;  4C0O C;  5DET A;  2R9L A;  2F4V J;  4OHW A;  2ILZ A;  3N6L A;  4K5S A;  3PIO Q;  1VQ6 S;  2BQR A;  4BC9 A;  2MHN A;  4IUF A;  1RI7 A;  1SH2 A;  2G0I A;  2GVZ A;  3W9H A;  4P2M A;  1J2V A;  4UTG A;  2R7R A;  2DHH A;  5G0R A;  4MFB A;  2HIY A;  4LUB A;  4RW6 A;  2BRL A;  2HND A;  2FDN A;  1S4E A;  1JLA A;  2L3M A;  2N4D A;  1PYS B;  2PMW A;  3CIM A;  4CI0 B;  3KLV A;  3RB6 A;  4NXM J;  2EKN A;  4WPA A;  2E5G A;  1VOM A;  3GMG A;  3ILJ A;  4NZ0 A;  4WII A;  3SCL E;  4WCE Q;  1X60 A;  3UPF A;  4FXD A;  1X5S A;  2VF3 A;  3JSM A;  4IG0 A;  4LSL B;  5K8O A;  5DGA A;  4BDP A;  4WP9 A;  4LF4 J;  4ZCM A;  3I9Z A;  4OZ1 A;  1WDD A;  1HNI B;  4U8Y A;  4GO5 X;  1UWB B;  1U02 A;  4L6V 3;  2K1R B;  2HFV A;  1BE4 A;  4NLT A;  1BWV A;  4WXW A;  3TEG A;  1YJ9 S;  5CYQ B;  3VAI A;  1UVM A;  2X1A A;  4KGX B;  4F4K A;  3TI0 A;  2DGX A;  2ZKT A;  4JI4 J;  5ETN A;  3NS7 B;  2C2R A;  3K5N A;  5AXK A;  4BBY A;  1UVN A;  4KB7 A;  1HHQ A;  1KQK A;  1S9F A;  3MMA B;  3T5K A;  4B9V A;  1OS5 A;  2DGS A;  4FKX A;  5KTQ A;  2HRY A;  3HHL A;  3MF5 A;  4OX6 A;  4GO7 X;  4M8L A;  2XSJ A;  5DS7 A;  3US5 A;  1C1B A;  3N4W A;  1N54 B;  2R8I A;  3L9Z A;  3M32 A;  2M0G B;  2KHC A;  4ELV A;  1GEH A;  4QZV B;  2CA9 A;  2CPX A;  2Y1L B;  1XWL A;  5A8K B;  2DO0 A;  4ED8 A;  2BKO A;  2JSX A;  3PEJ A;  3C8Y A;  2Z0G A;  1H7X A;  2M2B A;  3ZTQ A;  2NXJ A;  4XPE A;  2BVZ A;  2YKM A;  3GYG A;  2W7A A;  5LJ3 Y;  2ZKU A;  3POT B;  3TUP A;  3MEE B;  1M90 T;  3DLL Q;  3BS9 A;  4OI4 A;  2KO1 A;  4DL0 C;  3T1H F;  4X4U A;  3KDN A;  3V4I B;  2EKY A;  2IM2 A;  3TX8 A;  2R2U A;  4KGK A;  2V9W A;  5BYS A;  3AHP A;  4YS2 A;  5KFD A;  4U7U D;  1NXI A;  2B9W A;  3HHK A;  4C97 A;  2W2Q P;  2C42 A;  2NXN A;  2X1G A;  3AQP A;  1KR4 A;  3TAM A;  2VG7 A;  4JI0 J;  3OW2 R;  4F0M A;  2XO6 A;  2VBW A;  3H20 A;  2KH9 A;  2WCX A;  3NBP B;  4U7U K;  1F5A A;  2W9B B;  1SKR A;  1B0V A;  2Y1J A;  1U25 A;  1V6H A;  2CQ0 A;  1FXD A;  2CNL B;  3MDF A;  1SB6 A;  3TZW A;  2DNN A;  3SMZ A;  4ZLJ A;  3EYZ A;  3HMJ G;  2P2C B;  2D3Z A;  3ET6 B;  4H4O B;  3W66 A;  4USK A;  5D4L A;  2VB6 A;  2MGZ A;  2M70 A;  3KKF A;  2B4P A;  4D3H A;  2MKH A;  4AL5 A;  1NKB A;  4JI8 F;  5D8H B;  2AGP A;  2LU2 A;  4WZQ A;  1CQN A;  3A4T A;  4MTP A;  2RDD A;  3KXD A;  4TYA A;  3WC0 A;  4WE1 A;  2B51 A;  4USJ C;  1Y0H A;  4AUK A;  1NK5 A;  4M5J A;  2Q6C A;  3SSS A;  3R2C J;  4CM0 A;  3S01 A;  2B56 A;  2XS5 A;  2XMT A;  1ZM9 A;  2WSC C;  2ZH8 A;  3I5C A;  2XI2 A;  4ZJO A;  4EEY A;  2ZOF A;  2RKI A;  2WOM B;  3HJV A;  3MMJ A;  2PGC A;  3I4P A;  1N5Y B;  3CJR A;  2QYG A;  3QAE A;  4DSF A;  1TKX B;  2OPQ B;  2WB1 D;  2VZ9 A;  3QYY A;  4DV1 F;  3MM6 A;  3NNC A;  3AOA A;  1FTR A;  2XZW A;  4HH0 A;  4YB6 A;  3G6E S;  3WX8 A;  2POK A;  4GKJ F;  1UZD A;  3CDB A;  5IOL A;  5GMK a;  3IGV A;  3Q8Q B;  3H2U B;  1JKH A;  4F04 B;  2HWH A;  2BW7 A;  3I82 A;  4A48 A;  3LAM A;  4F3O A;  1X4A A;  2WVC A;  1UEV A;  3AOB A;  3SBM A;  2XMA A;  2RIL A;  2QE5 A;  2ZH7 A;  3OJU A;  3SCI E;  3BSO A;  1MWZ A;  3D3C J;  5F41 A;  4DFJ A;  2OAU A;  2DR7 A;  3VAG A;  4EU0 A;  1WJ9 A;  1XNR F;  1IKW A;  3HVR A;  4DV7 F;  4JI1 F;  2WON B;  1IR1 A;  2UV8 A;  4IOA Q;  3UD4 P;  1VQS A;  2VOP A;  1C2P A;  1HBM A;  1UPP A;  4C11 B;  3O6Q A;  4IYQ A;  3QWU A;  5L8R C;  3L7P A;  4CH1 A;  1RHU B;  1F2H A;  3CJK A;  2H5E A;  5EWF A;  1NPP A;  3PW2 A;  3HSZ A;  4NOH A;  2DD8 S;  1ULR A;  1HNZ J;  2HYI B;  2Z30 B;  1ROF A;  1JLG A;  2VPW B;  2NLW A;  4IOC Q;  2EK6 A;  1PGZ A;  1WC4 A;  3IP0 A;  4X4S A;  1RAH B;  2V2Z A;  5KT7 A;  2XNR A;  3MXH P;  2HHW A;  4PAA A;  2MZT A;  1T3N A;  4B3O B;  2J0S D;  3MI7 X;  4V1A k;  2DPI A;  2AQ4 A;  3PW0 A;  5BR8 J;  2BKP A;  4DUY F;  3ZXW A;  2DHS A;  2AJ0 A;  4J7C A;  4K8R A;  3NWG A;  2OH2 A;  1XTZ A;  2WAQ D;  3QIP A;  4J37 A;  2ZM6 F;  1BQX A;  2XMM A;  4Q5V A;  3RAX A;  4DV3 F;  2WZ1 A;  1HYS B;  2C2E A;  2J8A A;  2OPP A;  1TKX A;  2OPQ A;  2ZWP A;  4DR3 J;  2C2N A;  3THP A;  4FXW A;  1DQ8 A;  1JJH A;  1XMQ F;  1RQ0 A;  1K8A T;  3GII A;  4JI1 J;  2H5I B;  3DRP A;  5HP1 B;  4QJV A;  3HVT A;  3RU0 A;  1IWG A;  4LF2 A;  4CO0 A;  2RAQ A;  3CJ5 A;  1IKV A;  3FNN A;  1CBK A;  1EX8 A;  2CJX B;  4FF4 A;  3PRV A;  3LPY A;  4IRK A;  3CUL A;  3TAR A;  5JMN A;  3OV7 A;  1FJC A;  1N5T A;  2HG4 A;  2K7K A;  1JNR B;  7FD1 A;  1LWC B;  4XO0 A;  1RP5 A;  5JVH Q;  5EX0 A;  2KYX A;  5F3Z A;  2VC1 A;  1R0A B;  3E3X A;  1CJU A;  4TLQ A;  4HVZ A;  5ETM A;  4X4R A;  1CPZ A;  3DDN A;  1K47 A;  2M5Y A;  4I7F A;  1L3U A;  1D9D A;  4Q2M A;  1GXT A;  4LFC J;  3VAM A;  3ULH A;  2W24 A;  5B0E A;  1S99 A;  3M8Q B;  4CLK A;  3TQE A;  3QZ8 A;  1MMN A;  3D5M A;  4PYA A;  2VFS A;  1HD0 A;  3IM8 A;  4S0M A;  1UJ4 A;  3BPD A;  3D6T B;  3LP2 B;  2UVW A;  2O67 A;  3V6H A;  3MAH A;  4HT5 A;  1VQP S;  1F1B B;  2FHK A;  3GIJ A;  2B4V A;  3CCW A;  2W9B A;  1S48 A;  5B0F A;  2OJ3 A;  1R31 A;  3PCO B;  1SIW B;  4KFB B;  3IO1 A;  4ZK7 M;  3NAI A;  3SSQ A;  3U02 A;  3UFC X;  5B09 A;  1VQL S;  1HBO A;  2DR8 A;  3KMQ A;  2C2O B;  3EGN A;  1WKL A;  2BZ2 A;  2MQM A;  2DNR A;  3W65 A;  4I56 A;  3T5L A;  1RAD B;  2CQG A;  4QWD A;  1WD6 A;  1OY9 A;  3D66 A;  1H74 A;  4QW9 A;  2UV8 G;  4K4T A;  1U8W A;  2LA6 A;  5IT0 A;  4M5K A;  1W7W A;  3JYT B;  2OPR A;  3CO0 P;  4NI2 A;  5IM0 A;  2GAH C;  2GVD A;  1N36 J;  1OO0 B;  2ZUG A;  2MZ1 A;  2NUH A;  2OO4 A;  2HQF A;  3BQ0 A;  2W7P A;  3JQM A;  4FN5 A;  1NJX A;  4Q7A A;  2VPY B;  3EPI A;  1WF1 A;  4LSZ B;  1RU1 A;  1IJF B;  5K5M A;  1Y5I B;  3H5S A;  2OP5 A;  2OPP B;  4O3N A;  5IWA F;  4QWC A;  4HYK A;  3HHN B;  2ZH1 A;  2D69 A;  4ED3 A;  3Q2S C;  5KFR A;  1X5P A;  1NM2 A;  2B0G A;  2CPD A;  2CZV C;  2RUS A;  3ZO7 A;  4O0I A;  2FHO B;  3DLH A;  1HLW A;  3G6Y A;  2DK2 A;  1FDN A;  1FRM A;  3EIC A;  4K59 A;  5SZT A;  1L3S A;  3DI6 A;  4JI8 J;  1VBX A;  2R4F A;  3GIL A;  2MPU A;  4IG0 B;  3UDV A;  3OHB A;  3DRR A;  2DXF A;  3ILI A;  4DFK A;  4MK7 A;  1T3O A;  2K2P A;  3BPS P;  4KHM A;  4RO0 A;  1L3T A;  3CO9 A;  2UZA A;  4OZ5 A;  9ATC B;  3FQK A;  3CJ0 A;  3ISZ A;  1D1U A;  3QGP A;  3KJF B;  3ETO A;  1UVJ A;  1Y11 A;  4ZJQ A;  5F8M A;  1NHU A;  4JYA J;  3W2V A;  2DR6 A;  2M4M A;  1LFW A;  5DDQ C;  1NME B;  2HUR A;  2AJ2 A;  1KSP A;  4HH1 A;  1T7P A;  1OQ6 A;  1ZM3 A;  2NSB A;  4DV4 J;  5LXY A;  4IFV B;  2Z8Q A;  1U1P A;  3R7N B;  1JLA B;  5KT2 A;  2XQC A;  4DSE A;  2N7Y A;  4CH7 A;  1WUU A;  4MAK A;  1FJE B;  2OKQ A;  4EYI B;  5HLF B;  1HKA A;  4RNM A;  1NBE B;  5DLF A;  5IS2 A;  3CCQ S;  2OGU A;  3P5B P;  2COL A;  4EYH B;  3M8P B;  3BM7 A;  2NQP A;  3ZZT A;  3UD5 A;  3RBD A;  4CLS A;  3T19 A;  1K1Q A;  4V19 J;  4A47 A;  5KFZ A;  4AQY F;  1HNX F;  4LF6 J;  4YB5 A;  1RTI A;  1WSR A;  1CS4 B;  4WYL A;  4H4K C;  2KM8 B;  2GCF A;  4LF7 F;  4OZN A;  5HVF A;  2DKO B;  3W7B A;  3BYP A;  5GAD U;  2P6T A;  2QFI A;  4F50 A;  1FWK A;  2QIF A;  5FDL B;  3CDW A;  4KO0 A;  3KHG A;  1WC0 A;  1XMO J;  2OTL S;  4RWX A;  2DR9 A;  1NSQ A;  1QJH A;  1IVZ A;  1T9U A;  3PRD A;  3GCX P;  1W2B R;  4MH8 A;  4TU9 A;  4QIG A;  3SXL A;  4FDF A;  2HHP A;  4NLU A;  5D15 A;  4K4S A;  4EBE A;  2ASD A;  2KTQ A;  2VFV A;  1UPM B;  4DSJ A;  1Y3J A;  2RDI A;  2KU7 A;  3EGW B;  1IKY B;  1LFP A;  4AXI A;  5DLG A;  3OL7 A;  1FKO A;  2HMI B;  4OI0 A;  3J7A 1;  5KG4 A;  3W2V B;  5HQL A;  3DMJ B;  3HSD A;  1RCO B;  3ET6 A;  3TZY A;  4CLW A;  4YHH F;  2QT7 A;  5KFG A;  1HR0 F;  5H1S V;  3VGU A;  2N7C A;  2HPU A;  2QA4 S;  2ZH4 A;  3PTW A;  5DG7 A;  4FKY A;  2DO4 A;  2GML A;  4OZ3 A;  3G8Q A;  2LMI A;  1TVR B;  2HVE A;  1U6F A;  4DPT A;  4GRS A;  2MQL A;  3BB5 A;  2RH3 A;  1RTD A;  2YKQ A;  1SJ1 A;  3QT6 A;  4LF1 A;  1MU2 B;  3VF0 B;  2BAC A;  1O5J A;  1XIQ A;  1Q8K A;  2CQ1 A;  2IMO A;  2XI3 A;  3FEZ A;  3PYF A;  4ZPC A;  2G2O A;  1RTJ B;  1P8G A;  1XJW B;  1P9Y A;  3ONQ A;  4C6A A;  3MR3 A;  2UUC F;  3R5J B;  3LAN A;  3OD2 A;  5HK4 A;  1FJG J;  2LXI A;  4OL8 A;  2JVO A;  1ZA1 B;  4NXN J;  1MMD A;  2Y0B B;  4FVC A;  3VQT A;  4ES2 A;  3OVB A;  3R7B B;  4XAK A;  2B9X A;  2Z2L A;  1G7C B;  1JLF B;  4UT4 A;  4PQU A;  1K0V A;  2VHG A;  1IBL J;  2EC2 A;  1Y3K A;  3GV7 B;  5MLC V;  4PXB A;  1FD2 A;  2RE1 A;  2RQ4 A;  2VG5 A;  4WJB A;  1GMW A;  3MOZ A;  4OHY A;  3KMS A;  3NXZ A;  4LRB A;  3M8Y A;  1OYD A;  5KFY A;  1Y7P A;  3DU5 A;  6AT1 B;  3OLB A;  2FC8 A;  1VIS A;  2EEY A;  2HGM A;  2YWH A;  3HD1 A;  3HHL B;  3EPG A;  4ZP8 A;  1GXU A;  2KT2 A;  3DOL A;  5DRK A;  4NCG B;  3CD6 S;  2I2Y A;  5E3Q A;  2KVQ E;  1MN9 A;  4FF2 A;  4DF8 A;  2EWH A;  4DF4 A;  3LW5 C;  3GWC A;  3PJW A;  4EO6 A;  4W92 B;  2Z57 B;  5H9F J;  1JMT A;  3AAW B;  1H2T Z;  2VKZ G;  1NLK L;  3BKT A;  1TMJ A;  1RK8 A;  1NAQ A;  3QAU A;  4TU8 A;  2I0X A;  1N36 F;  3MTJ A;  2VQF J;  5AJ3 F;  1AFI A;  4LQ9 A;  1RWU A;  4DDF A;  3KLE A;  4KFB A;  3R3T A;  2FVR A;  2LA4 A;  2ZBI A;  3L4B C;  1LEO A;  1JLB A;  3DFE A;  4FYX B;  5F3T A;  8ATC B;  3CC2 S;  1XNR J;  3PNI A;  4HR2 A;  4DV6 F;  1RB0 A;  1TKT B;  2IHR 1;  5DG8 A;  1AZS B;  1F9F A;  4BCA A;  1PC4 A;  1R0B G;  3Q24 A;  4IDK B;  4ED6 A;  1NK6 A;  4ED4 A;  2H1Y A;  2RRA A;  1IUJ A;  1N56 A;  2CDR B;  5CHC B;  3CGI A;  3KK1 A;  3CCJ S;  4O3S A;  3L7U A;  3VGS A;  4JI3 J;  2KZZ A;  2E7W A;  4WWS A;  3KUH A;  4RKU C;  2LLZ A;  1NND A;  5IQ6 A;  2XC9 A;  2J6S A;  4QU6 A;  3HF5 A;  5C7P A;  4RW7 A;  4X64 J;  3GJS B;  4ZIT A;  4RZR A;  3DRS A;  1VGY A;  1FD8 A;  1VBY A;  1H2V Z;  4KY3 A;  4DQS A;  1FRJ A;  3O44 A;  3OL8 A;  4DR7 F;  1FX2 A;  3U27 A;  3TA1 A;  4DV0 F;  1S1U A;  2E5L J;  2C3U A;  5IXU A;  2ZH3 A;  1F3V A;  1TL3 B;  1R27 B;  1KTQ A;  1VC6 A;  1U2R A;  4Q43 A;  4X4N A;  2RVJ A;  3BR9 A;  4OZ0 A;  3UI3 A;  3K5O A;  1RWV B;  1GTH A;  2YX1 A;  1PAU B;  2BMB A;  3N5B A;  2B4U A;  4OHX A;  4L76 A;  1VFJ A;  2B9Y A;  2E1M C;  4UST A;  5A6W A;  5M2P A;  2GFF A;  1WG5 A;  5B7W A;  4ECX A;  2FJX A;  3CTR A;  4X84 A;  1EKR A;  4ZN3 A;  4KGM A;  2MSS A;  2MQN A;  3KLH B;  3I0R B;  1CJK A;  2ZOM A;  2HKE A;  1UAW A;  3T6J A;  4DX5 A;  4TQS A;  4PWD A;  1HWJ A;  4DPX A;  5KFP A;  2QLF B;  2AF6 A;  3EVO A;  4NML A;  3D1H A;  4ED7 A;  1PJ6 A;  3OVS A;  4KJI A;  3FRZ A;  1LNQ A;  2M8H A;  2RU9 A;  2V0N A;  4MYU A;  1A6L A;  4X4P A;  2V50 A;  4B9M A;  2YPY A;  3LA0 A;  2QA2 A;  3N9U C;  1JLG B;  4USW A;  1VI7 A;  1S77 D;  2HBR B;  5KT4 A;  1RSC A;  1YWX A;  3UN3 A;  4DOZ A;  3BH6 B;  2VBY A;  4U95 A;  3S6E A;  2NYH A;  3W2W B;  5HMZ A;  1LW0 A;  3K17 A;  3HVW A;  2F9J A;  4B08 A;  4C8K A;  3KJV A;  1B0T A;  1S6Q B;  2V5H G;  1NEE A;  2VPX B;  3IM9 A;  4ZPB A;  2MKS A;  2AX0 A;  2DNH A;  4NZ7 A;  1AZS A;  3H98 A;  2GC8 A;  3M9O B;  1UFL A;  5HJX A;  1CC7 A;  1N5Q A;  2HHH F;  2AJQ A;  1OY8 A;  2JC1 A;  4LRF A;  4NAS A;  4CO2 A;  1RYS A;  2E9R X;  1NRK A;  3BBB A;  1S1V B;  4DJB A;  3Q2T C;  2AEF A;  2L9D A;  4DV7 J;  3S7R A;  3MCN A;  1Q8B A;  4Y2A A;  5J2N A;  3G71 S;  4JV5 F;  3I0S B;  2DJW A;  2K7J A;  4B3R F;  1CS4 A;  4Q8E A;  3N0V A;  3LP1 B;  4F4Y A;  1FX4 A;  4QBU A;  1WF0 A;  2FZK B;  2QGF B;  2BOP A;  1S76 D;  1T11 A;  1YJ7 A;  1ZS6 A;  3BN4 A;  3MEK A;  2V67 A;  5CQG A;  4OYP A;  4CQ1 A;  5C42 A;  2GJI A;  2XUL A;  4DHV A;  5U47 A;  4ANE A;  5K20 B;  2QG9 B;  1ZZN A;  4QYR A;  2R8J A;  1HQE B;  5HVH A;  5F8G A;  1VQY A;  1GQE A;  1WOP A;  2YKP A;  2C2D A;  4B3S F;  4DUZ F;  4X66 F;  4LBI A;  5DDR C;  1X7V A;  4OYI A;  2B4O A;  4QQB A;  4J9S A;  1EJ7 L;  5CAA A;  2UUA J;  1YIJ S;  2AHO B;  3C6T B;  5H9E J;  1DRZ A;  3NL0 A;  3MPU B;  2XYG B;  3NMR A;  1OSD A;  4K4V A;  3PRB A;  3GSD A;  4JI5 J;  4K4U A;  2D1C A;  4G3I A;  1TFW A;  1RT3 B;  2KB2 A;  5IFM A;  3KLG A;  1U1O A;  2B8Q A;  3H4B A;  3PW7 A;  2ZE2 A;  3BDE A;  2ZBP A;  1AA1 B;  2IJN A;  3H90 A;  4LT6 A;  3QT8 A;  5T41 A;  4E2F B;  1JNZ B;  4IH7 A;  1IQT A;  3TR5 A;  4OI6 A;  4PPD A;  3GSI A;  3UNG C;  4UY8 T;  4PRF A;  2YX7 A;  1PSD A;  2BOA A;  4B9N A;  3EWG A;  4A46 A;  2RU3 A;  4QR1 A;  2X7I A;  2ZZT A;  4JV0 A;  2AT1 B;  2M3D A;  3R5B A;  1D9F A;  1NUE A;  2WBR A;  1YZ6 A;  3C14 A;  4F26 A;  5JJB A;  4A8M P;  2ZH9 A;  2QSF A;  3N79 A;  5D4N A;  4AFF A;  4DV3 J;  1D8Y A;  3D1O A;  5B0A A;  2NR0 A;  3OL9 A;  1FXL A;  2GIQ A;  2YKM B;  3HT0 A;  3M6V A;  3WQP A;  5BXI A;  1R8C A;  4FYV B;  4CLT A;  4NLR A;  3LF0 A;  4A8W A;  5AXM A;  4A8O A;  2UUB J;  4QR2 A;  4FPI A;  2Q79 A;  1TEL A;  1VRT B;  2WSE C;  3W9J A;  5ETK A;  3MPD A;  4ZJL A;  4N41 A;  5B0D A;  2VQF F;  4OFZ A;  3POT A;  4XTT A;  3GU0 A;  4L73 A;  4MJK A;  4RBT A;  3BGR B;  5A8W B;  1DZ5 A;  1OQ3 A;  4B9T A;  3ZZP A;  1XER A;  4LMZ A;  2ROP A;  4K4Z A;  3QGI A;  3TZX A;  2CKW A;  3FKB A;  2H4Y B;  2KJW A;  4G1P A;  5D78 A;  2E7X A;  3PX4 A;  4NXN F;  1NDL A;  4R25 A;  3R1L A;  3DRY A;  1VJW A;  2JZ5 A;  3HHE A;  2IM0 A;  3IS9 A;  5EN1 A;  1EAR A;  3ICL A;  3C66 A;  4TLR A;  4ZPT R;  2FLN A;  2VBZ A;  2PE8 A;  2RHQ B;  4LSN A;  3A8I A;  4MIW A;  4OX7 A;  1KHW A;  5HO4 A;  1SL2 A;  1ZAX A;  3MMA A;  3ISN C;  3V6J A;  1ZBT A;  1OWX A;  3M8W A;  3W61 A;  2ZJQ Q;  1HWK A;  3Q83 A;  4KRW A;  3LP1 A;  1Z2Z A;  2BQ3 A;  1RAO A;  4X4T A;  2DNZ A;  5E33 A;  2YNH A;  3FFI A;  1V3R A;  3TA2 A;  4I64 A;  3CIZ A;  3SDE B;  3ZNJ 1;  1J5O A;  2VOO A;  1FHT A;  3V81 B;  2F8M A;  4NLO A;  3P45 B;  5G0R B;  5JXS A;  4DFP A;  4M5G A;  2YKA A;  4CLY A;  4OYO A;  3JSM B;  3CCS S;  1S1V A;  3GIM A;  1TL1 A;  2H9Z A;  2HSE B;  1MNE A;  3DDK A;  2QYC A;  1T8E A;  1YIT S;  1APS A;  2DH8 A;  4RLE A;  1IBM J;  5KG5 A;  3TW0 A;  4LR9 A;  1LXN A;  2XSF A;  4KV8 B;  4QIE A;  2J76 E;  4ZVU B;  4YDD B;  1D9A A;  4BWJ A;  1TKD A;  1MML A;  1LXJ A;  1XMQ J;  2P9E A;  1R0A A;  1UEK A;  1B99 A;  2NCK L;  1QY7 A;  3G2X A;  3H59 A;  2C3M A;  5DDO C;  1NJY A;  3TQ1 A;  1TL1 B;  2R8H A;  3T5J A;  1JLC B;  4H4M B;  4KHP F;  1TZ0 A;  1TTH B;  1RT6 A;  5E41 A;  2CWX A;  4O44 B;  2NYI A;  4KKO A;  4ECZ A;  2HFN A;  5KFV A;  4CLZ A;  3FFI B;  1S49 A;  2HBY B;  4O3O A;  2BBE A;  2MQQ A;  3ZNU A;  3MFH A;  4ZN1 A;  4DL7 A;  1S1X A;  5KFO A;  3BKU A;  3OTO F;  5DGB A;  2N3L A;  1Q7Y T;  4ZLP A;  2RRB A;  2YQ3 A;  2XMW A;  4KQZ A;  4ZLL A;  1X4F A;  4GC7 A;  5H9E K;  1CJK B;  3RB3 A;  3D28 A;  4ZVT B;  4KYZ A;  3BGF A;  4TYB A;  3R5G A;  4C0B A;  3V6D A;  1G6B A;  4JUZ A;  4UOG A;  4WXO A;  1VS3 A;  2R7O A;  2QMX A;  3D2W A;  2OD4 A;  1KLN A;  1HMV B;  2ZZN A;  1BY9 A;  4A4J A;  5LOQ A;  1S9E B;  2AKW B;  1VBZ A;  5DM7 Q;  4ZVQ B;  1CG2 A;  3K8W A;  2IYG A;  3RYL A;  1L3V A;  2KT5 A;  3M30 A;  3VZH A;  1DQA A;  1REV A;  3DC2 A;  1NU4 A;  7AT1 B;  1EB0 A;  1CJT A;  3BH7 B;  3T9N A;  3VWS A;  3I55 S;  1S9G A;  4OZJ A;  2VV5 A;  2O3D A;  2Z2Z A;  3T9Z A;  1RWM B;  1X31 C;  3KHH A;  4PR6 A;  4F2S A;  5KFW A;  1FWL A;  4J9R A;  2IBK A;  2CYY A;  4PXD A;  3BF4 A;  2Q6B A;  4WU3 A;  1Y10 A;  3RR7 A;  2N4C A;  1EKS A;  4KR0 B;  1WG4 A;  2QL9 B;  2GX8 A;  4L3N A;  4C8M A;  1U09 A;  1UP1 A;  2BM0 A;  4OZL A;  1S6U A;  2AWZ A;  2W8K A;  3FJ2 A;  4PEO A;  5FD1 A;  1TK8 A;  5BYQ A;  2O01 C;  2CPE A;  3CJS A;  2C2Z B;  4IH5 A;  4NLY A;  1T03 B;  3C14 B;  1F60 B;  2AEJ A;  1SL0 A;  4M94 A;  1DQ9 A;  5A8R B;  5HQM A;  1B7F A;  3M4X A;  2HQG A;  2HAI A;  4IOB A;  1EZZ B;  3EX7 B;  4DQR A;  2JFD A;  1S59 A;  2Q43 A;  3UE2 A;  1SC1 B;  3LP2 A;  4A8K A;  4F02 A;  1JLB B;  5GAH U;  4TNO A;  4R0E A;  4DU8 A;  3FCH A;  2HHH J;  1SCJ B;  4M5I A;  4YP3 A;  4PG5 A;  2ZE2 B;  4PQA A;  2MXY A;  4C8L A;  2V34 A;  3P49 B;  3AD9 C;  4F0H A;  2ZIT A;  1MWY A;  2WRM A;  3ILO A;  3MM8 A;  2H65 B;  4B17 A;  1DFD A;  1F9H A;  3EZU A;  2V2Q A;  1RBA A;  5KT3 A;  3C6T A;  4LRE A;  1Q82 T;  1LWC A;  1X4H A;  3L09 A;  2BJ8 A;  4I4B A;  4WE1 B;  5CCL A;  2CPF A;  1K9M T;  3H25 A;  1WHV A;  1PIL A;  2UXB J;  1C4A A;  2DCL A;  4YB1 P;  2DGU A;  2G2Y A;  4Y0F A;  1N33 J;  3EVW A;  2E1C A;  2EBG A;  2UXD J;  2GHV C;  3HVT B;  2HWI A;  4R5P B;  4M5M A;  5HP1 A;  1BD6 A;  1T9X A;  5KFB A;  1F9E B;  3SCJ E;  1RLD A;  3M9M B;  3M8S A;  5K8N A;  2CJA A;  2BX6 A;  4ECY A;  2ACY A;  2U2F A;  1L5U A;  4MMO A;  1KOH A;  2CFX A;  2XWY A;  5KG1 A;  3IR6 B;  5CA5 A;  1LWE B;  1VQO S;  3NBP A;  3QWP A;  3DOM A;  3DKD A;  1XN9 A;  2R8K A;  3T41 A;  3R2D J;  4N7T A;  2IY5 B;  4CLU A;  3K57 A;  1RT2 B;  4TY9 A;  4ZVR B;  1SL1 A;  2WHO A;  2KRB A;  3W8P A;  4DU7 A;  4CDI A;  3G86 A;  2HZA A;  3AFG A;  2NZ4 A;  3SQG A;  2XCA A;  4J9M A;  3PO4 A;  3K5P A;  2GS8 A;  3HZG A;  5A8R A;  1UA1 A;  3M2U B;  1TL5 A;  3O3L A;  4OI1 A;  3KJV B;  3OR2 B;  3PV8 A;  3BQ1 A;  5HMW A;  1HBM B;  5KFX A;  4C11 A;  1YX2 A;  3TZZ A;  2DHX A;  2YNF B;  4J9P A;  3OXF A;  1KNZ A;  5JVG Q;  3CC7 S;  2JFK A;  2M88 A;  3OVA A;  3NP5 A;  4WP8 A;  4FF1 A;  1FNM A;  3DU6 A;  3D0I E;  3PEH A;  2CVI A;  1ARO P;  1TUG B;  2FLO A;  3FCW A;  5F9N A;  3LWM A;  1QSL A;  1Q95 G;  4MYT A;  2DB1 A;  1S9G B;  2V8P A;  1O51 A;  3AQO A;  3DM2 B;  5G4D A;  4NCB A;  1P27 B;  4HDH A;  2E7V A;  3DCA A;  2C3Y A;  2OLW A;  4NLX A;  4NLP A;  3L7O A;  4KE5 A;  3MM9 A;  4HI2 A;  3N28 A;  4P2S A;  5LMU J;  4FS1 A;  4DL3 A;  3BV8 A;  4B02 A;  1QE1 A;  1WHY A;  1RHM B;  2FUG 9;  1AYE A;  4N77 A;  4ZPV R;  3P96 A;  3VAK A;  4RW9 B;  2ILY A;  4JI4 F;  3M2V A;  5J2P A;  3NNA A;  1HI0 P;  3VCD A;  3MM6 B;  1GX5 A;  2F65 A;  3QNW B;  4QU7 A;  3W5Y A;  3W9I A;  5F8N A;  2IRU A;  2CXE A;  2IMW P;  1P9Q C;  1O0P A;  2CNN B;  2K1R A;  2RKI B;  2WOM A;  3EJM A;  4DUT A;  4WKY A;  2IBO A;  4ED2 A;  2QC3 A;  4LF4 F;  1VQN S;  2G1D A;  2W9C B;  1SKS A;  4LR7 A;  4RU2 A;  4LSL A;  4P72 A;  2FIU A;  4OX8 A;  5HVG A;  4DPO A;  2XGP A;  2RF2 B;  4UOC A;  1U47 A;  3HM9 A;  5EWE A;  5D3G A;  3CB4 A;  4HL9 A;  4PKD B;  2CJK A;  4K50 A;  1HPZ B;  2KXF A;  4ZVF A;  3IFE A;  1N52 B;  1TU0 B;  5LM7 E;  4JI6 F;  2OMO A;  4ECQ A;  1KQG B;  2ZH6 A;  1TK0 A;  1H7W A;  2KHD A;  4BC7 A;  4MFB B;  1XC9 A;  3GE9 A;  4K4Y A;  1OYE A;  1DBD A;  3FZ2 A;  4H4M A;  3ZTP A;  4X62 J;  5HLF A;  1G1X A;  4WKR A;  1AW0 A;  2BE9 B;  3QID A;  2GVZ B;  1FWP A;  1RAI B;  1YHQ S;  2JLF A;  4PZV A;  2XM3 A;  1H6K X;  5A2Q U;  3QJP A;  3OPK A;  2MKC A;  5LMN F;  5I4M A;  2FZG B;  5DDP C;  3T3F A;  3HX9 A;  4LFA F;  3MAA B;  4DV2 F;  2MY8 A;  5LMN J;  1KP6 A;  1N34 F;  1VQ5 S;  2DHA A;  1MRO B;  2YBV A;  4GMK A;  2CQP A;  4CLF A;  3CUN A;  2UUT A;  1EAY C;  4UUW A;  4DN9 A;  1OY6 A;  3GFZ A;  2V6A A;  1Z1Z A;  2HGN A;  1QAJ A;  5H9F K;  3J81 j;  4PUO B;  1JJC B;  5HL7 Q;  2CPY A;  3V4I A;  4MK9 A;  2QTW A;  1Q8L A;  3DLJ A;  3LUY A;  3MEG A;  1DLO B;  4IH6 A;  5T7L B;  4PXE A;  3IR7 B;  3TRG A;  3FSI A;  2ZOG A;  2X51 A;  2HVI A;  4J9U E;  4OX9 F;  2RQC A;  5GAG U;  2DRB A;  2HS3 A;  2X1F A;  2FZC B;  3HSJ A;  4M5L A;  1IR0 A;  2CZ4 A;  2NZC A;  2HVD A;  3O5T B;  1HI1 A;  3RRH A;  2HNZ B;  4L74 A;  3ZZR A;  1R6Y A;  3MPV A;  1ACM B;  1SJR A;  4DZD A;  1TV6 A;  3IN5 A;  2FGO A;  3X1L B;  1N32 F;  2AX1 A;  1VHF A;  2E29 A;  2ZDO A;  1Q81 T;  3M2R B;  1LWF A;  5L9X A;  3JXO A;  1JLF A;  2XSJ B;  4YR3 A;  4F4Z A;  2LXU A;  3F56 A;  2NSC A;  4RW4 B;  1D3W A;  4V19 X;  4A8Y A;  2APO A;  4NXM F;  4Y6I A;  4OYA A;  1Y5L B;  3CME S;  2LDY A;  3OSN A;  4AXJ A;  5LXR A;  1RTJ A;  3V4M A;  2NXC A;  3EGZ A;  1GMV A;  2YXL A;  4FNH A;  1T94 A;  3VAL A;  1JX4 A;  1FI4 A;  2BJ1 A;  3PY8 A;  4YHH J;  3CJQ A;  3GJR B;  3HFK A;  2W4P A;  3FGV A;  3SSR A;  1UVK A;  2E1R A;  4U6P A;  4ETX A;  1I94 J;  3DHW C;  1QUP A;  4PG8 A;  1PYO B;  3UN2 A;  4B3S J;  2JOQ A;  2C3O A;  3MAQ A;  5KFM A;  1RTH A;  4Q45 A;  2HQ3 A;  2BAB A;  1OPI A;  3W5Z A;  5SUH A;  3W1Y C;  2AD9 A;  3JSB A;  1JIH A;  2QA1 A;  1FXR A;  1B7Y B;  2BRK A;  1QSS A;  4DR6 F;  5ETQ A;  4ZCI A;  2RS2 A;  1AFJ A;  1IKY A;  2JEG A;  2E66 A;  2HHX A;  3KLG B;  5D4O A;  1R8A A;  1VRU B;  2B7B B;  2AGQ A;  1QLN A;  1F0X A;  3W8G A;  1RUS A;  2OML A;  2HHV A;  2QX0 A;  2EXU A;  3TP2 A;  2JX2 A;  1RTZ A;  4DR7 J;  3GPA A;  3OFF A;  3BJY A;  3UVJ A;  1FKP B;  1OSC A;  2HBZ B;  3PFO A;  3M9N B;  2GNK A;  4M5H A;  1HIY A;  2CWK A;  2O5D A;  4FXV A;  2A1B A;  1C1C A;  1LW2 A;  4LBH A;  4X4O A;  3KLF B;  4BS2 A;  4LF5 F;  4Q2L A;  2MZQ A;  3BKF A;  4LF5 J;  4Q8F A;  1VC0 A;  3SFU A;  3Q23 A;  5B0G A;  3UR0 A;  1FKA F;  1I51 B;  4ID5 A;  1N33 F;  5C24 A;  1LV5 A;  3MEC A;  4GKJ J;  4K5R A;  1U1Q A;  4KH0 B;  5I3U B;  1N5V A;  1X5T A;  4X4Q A;  1KON A;  1FVQ A;  3DLE A;  3NS5 A;  3M8R A;  2KG0 A;  3D54 A;  1REG X;  3MR5 A;  1NJI T;  3BEG B;  3NY0 A;  2PSZ A;  1SC6 A;  1S1W B;  4WTO B;  3IA0 A;  2V68 A;  2CDQ A;  3I4H X;  3QSI A;  1NKE A;  5L9N A;  1Q5V A;  4ECU A;  1K44 A;  4RUC A;  3LAK A;  3VR1 A;  3BQ2 A;  3E51 A;  3QRR A;  1IQZ A;  4C0H A;  5EGY A;  3TAN A;  4RX6 A;  5KFC A;  4IFY B;  3VV2 B;  4DR4 F;  3D6F B;  4NPO A;  3MUT P;  5F0W A;  2XMK A;  2XNQ A;  2H4W B;  4HHU A;  3PKM A;  2JLG A;  2PEH A;  2DYA A;  2XHC A;  4USU A;  3P5T L;  5KG3 A;  1GX6 A;  1SXL A;  3GFH A;  3QFH A;  2XS7 A;  4HI1 A;  2IM1 A;  3JTN A;  3HI9 A;  4YY3 J;  3W63 A;  2D7S A;  3DLB A;  4P52 A;  2YWW A;  3TOQ A;  2DHG A;  3M30 B;  3MWB A;  3OUY A;  1KN6 A;  1RT5 A;  1ZM4 A;  3V2U C;  4RNF A;  1RAJ A;  3AD8 C;  1ZET A;  2DIV A;  3DI6 B;  1X9S A;  1FFS B;  4CT8 A;  5J2M A;  1T9T A;  1FNX H;  3BDP A;  1T05 A;  2E5J A;  2CPH A;  2XYH B;  3KLH A;  1FK9 B;  2CJQ A;  3NCR A;  3W64 A;  4R8U B;  4R8U A;  2AGO A;  2QLW A;  2XMU A;  3KK3 B;  4Y00 A;  1HQU B;  3NLC A;  4KBI A;  2E5H A;  1SQE A;  4RWW A;  3FMW A;  4USI A;  3DGP B;  1X5O A;  3M1V B;  1WOS A;  2YX4 A;  5A0Y A;  4E0D A;  2K06 A;  1WG1 A;  1LKZ A;  1OIA A;  5GAD I;  3BO3 A;  1DTQ B;  2XY5 A;  2VC0 A;  3BRE A;  3AXM A;  3C6U A;  2A0F B;  2HHU A;  3G8T A;  1S1X B;  2A3J A;  3LAL A;  1WF2 A;  2PA8 D;  1MN7 A;  2W4C A;  2W2O P;  4KHR A;  1JQG A;  4NRU A;  1L3K A;  2XBP A;  1FRL A;  3J7Y I;  1SKU B;  2HRU A;  3JYT A;  3JB9 k;  1KQS R;  1WC5 A;  5J1E A;  5IT9 U;  1RA7 A;  2FJA B;  1T9W A;  3PYG A;  4WFY A;  4Z37 A;  2RT3 A;  4N5S A;  1T9Y A;  1B70 B;  3AY0 A;  2HBQ B;  1FEH A;  1XR6 A;  4K4X A;  4OYZ A;  1M5P C;  2QJ3 A;  2J6T A;  1H98 A;  2QFJ A;  3HLU A;  3F41 A;  4DR2 F;  2PD1 A;  1PJ5 A;  1NDC A;  4IO1 A;  2NRE A;  3CT9 A;  4FS2 A;  2V8D A;  3CJ8 A;  3J81 Y;  4ERD A;  1TL7 B;  3MM5 A;  3ZTO A;  4MKA A;  3OLA A;  1N32 J;  2IA6 A;  2GJ2 A;  2LP4 A;  1RWO B;  2H51 B;  3V81 A;  4M63 A;  3KOA A;  1VK3 A;  5LSO A;  2EVZ A;  5DQG A;  3M8Q A;  3OBI A;  5GAE U;  1RYR A;  3DLK A;  2GO9 A;  1ZPV A;  2CUY A;  4LVN P;  3KLI B;  2AEM A;  2QV6 A;  5ETR A;  2DY1 A;  4DSK A;  1CEZ A;  4NLS A;  2RF2 A;  1HHT P;  1FA0 A;  2DT9 A;  2ALZ A;  4ZPD A;  4QCL A;  2XTJ P;  4RU9 A;  3Q22 A;  1CJU B;  3PKY A;  2OD6 A;  3K59 A;  3BGO P;  4FBU A;  3SCK E;  1KTV A;  4LIW A;  2ASJ A;  2DEI A;  4EWT A;  1ZAW A;  4M1K A;  2MKK A;  3T5H A;  5AE3 A;  4P74 A;  4TQR A;  2ZH2 A;  3TA0 A;  3MD3 A;  3EGV A;  2ATL A;  3DOL B;  4U7C A;  1YBU A;  3FZB A;  4DR2 J;  2FB0 A;  2PMZ D;  3WZ0 A;  4NCA A;  2BJ9 A;  2KM8 C;  4LFA J;  5KFF A;  2OTJ S;  4EBD A;  2YTC A;  1HWU A;  4YME A;  3JQJ A;  3KG1 A;  2DTJ A;  2VJV A;  2Y1I A;  1PYT A;  1U2C A;  3PYD A;  4ZPA A;  1UEU A;  3TJ8 A;  1JJ2 R;  1SJ3 P;  2EFP A;  3AH6 A;  2AZ3 A;  3TUI C;  4NEY A;  2O1P A;  3K89 A;  4AT1 B;  1BQN A;  3N5F A;  8RUC A;  2AZ1 A;  3GR1 A;  4CCH A;  4P7V A;  5J2Q A;  4Q44 A;  2DR5 A;  4IR9 A;  4CO1 A;  2PI4 A;  1V5I B;  4WK1 A;  3OQ2 A;  1GTE A;  5AE2 A;  1UVL A;  4LFB F;  5KFA A;  1RTD B;  3R97 A;  1S6P A;  1EP4 B;  1WC1 A;  2JJ4 D;  3RRG A;  3L95 X;  2FQQ B;  2DNO A;  1AXQ A;  2WVF A;  3VZI A;  1B3T A;  5CYJ A;  1BUX A;  1GMW D;  3DLG B;  4ED5 A;  2RJZ A;  2MZS A;  2M7S A;  3BGL A;  3FEX B;  3QT5 A;  5RUB A;  4X65 J;  2UVR A;  5DZ6 A;  3OFH A;  2OFH X;  2V4J B;  4LRA A;  3LGH A;  1FJ7 A;  3VQS A;  5J1P A;  1GH8 A;  2RIJ A;  2XMJ A;  3CCE S;  3GG1 A;  3S1T A;  5GAH I;  1BWE A;  1RWK B;  1RT3 A;  1QSY A;  1PG5 B;  3AJD A;  5A2Q Y;  4RW8 B;  3CCZ A;  2ALY B;  5CD4 A;  1U1L A;  2AIR B;  2D74 B;  1E6V A;  1S7H A;  3OFE A;  4B3M F;  4P2X A;  2Y9H A;  4JV5 J;  2ABY A;  2OHD A;  4I2Q B;  2WVD A;  3G6X A;  4OV1 A;  2W7O A;  4DLE A;  4C3K A;  2MQO A;  4DR5 J;  1FJG F;  3MD1 A;  3IBW A;  4LF6 F;  2MJU A;  3MED A;  3E2E A;  2U1A A;  2K3K A;  4RUA A;  4ICL B;  4QWB A;  1I5O B;  1N6Q A;  2YKO A;  4DG1 A;  2W01 A;  4DCJ B;  2OIH A;  5F0U A;  4TU7 A;  4W4M A;  1HW9 A;  1YJN S;  1PJ7 A;  4O23 A;  4Y2I A;  4ELU A;  2B7C B;  2VDI A;  2LEP A;  2WW4 A;  1LQ9 A;  3VHQ A;  2BDP A;  3PHE A;  1YZ7 A;  4G1Q B;  4C98 A;  3FSY A;  2DNY A;  3G9C A;  3P8B B;  4DZ6 A;  3BGU A;  3AJ2 A;  1S4F A;  3C15 A;  5ETP A;  3ZTS A;  3U1L A;  3M8P A;  4OI2 A;  4Y28 C;  2A6O A;  2M8D B;  1Q86 T;  4GC6 A;  2EG2 A;  2XZT B;  1QUV A;  3K5L A;  1TL7 A;  3KJQ B;  3MM5 B;  4M5D A;  3PX6 A;  3ZC4 A;  3B4M A;  3A12 A;  4MKY A;  3TVK A;  3MGJ A;  3KHR A;  4LRC A;  3GJQ B;  1VIX A;  2GA7 A;  1IN0 A;  1S0N A;  2AYG A;  5K8P A;  4NLD A;  1EQM A;  1ZAV A;  4NX9 A;  1V9O A;  2EI5 A;  3BN7 A;  2F3J A;  4YDX A;  2GQC A;  1AUS L;  3C46 A;  4ZOS A;  4DBQ A;  1HPZ A;  2R7S A;  4ZP7 A;  1FFG B;  2V4J A;  1TKZ B;  5K14 A;  3H5U A;  1VQ9 S;  2L9N A;  3ILL A;  4I2P B;  2OEK A;  4RL1 A;  5IC4 B;  2AV5 A;  2BM1 A;  4HEA 9;  2ZEJ A;  3MOJ B;  4ECT A;  3MMC B;  4CO5 A;  3KUG A;  3CDA A;  3LQV A;  3JS9 A;  1FDA A;  4WZM A;  5AXL A;  2VA3 A;  3GG0 A;  2ZC3 A;  4YY3 F;  1CUL B;  2GQQ A;  4F3Q A;  3UW1 A;  4ZVO B;  2A2D A;  4NWB A;  2AP6 A;  3FEY B;  2VG6 B;  3DGP A;  3M05 A;  5DJB A;  3HFZ B;  4OJH A;  4EI2 A;  8AT1 B;  5BR8 F;  1X9W A;  4UZB A;  4OIX A;  2V94 A;  2HFZ A;  2MLY A;  2LQ9 A;  3ITH B;  2J9D E;  2MZR A;  3CJT A;  4OYB A;  3MUR P;  2W1B A;  4TVA B;  4B3T F;  1H38 A;  1QAY A;  5K9F A;  2ZFH A;  5D0R A;  4ZHR A;  1U6Z A;  3H40 A;  1IBM F;  3PXG a;  3U1N A;  2MKI A;  1AB8 A;  1DTT A;  3VGV A;  5KFN A;  3OUY B;  1M5V C;  3CF5 Q;  1HNW J;  3D0G E;  2L48 A;  5ETO A;  2Y8Y A;  3G6V A;  2FLL A;  1TUW A;  3J80 U;  5CYM B;  4XPC A;  1M5H A;  2MYF A;  5IM0 B;  1VK8 A;  3IWN C;  2CQD A;  4PAB A;  2J9D A;  4UF4 A;  4EMD A;  5LSR A;  2GV1 A;  4B3M J;  1XNQ F;  4CYU B;  2L08 A;  4J9Q A;  2UVU A;  3NGT A;  2Z4P A;  2MEW A;  1QD1 A;  2QL7 B;  3VAJ A;  2CG8 A;  3U7J A;  1LOU A;  5KOX A;  4JP8 A;  1K73 T;  2VUG A;  1WKJ A;  1HNI A;  2MMY A;  2PFD A;  4ZCL A;  2VON A;  4JI2 F;  1YLX A;  5F8H A;  1J5E F;  2OPS B;  1JLE B;  5LJ5 Y;  3K2Y A;  1RA6 A;  3FC9 A;  4NZ6 A;  4H4K A;  3CPW R;  2DXE A;  4IR1 A;  1IBK J;  5I42 B;  4DCO B;  5I42 A;  1RDR A;  1E6Y B;  4W98 A;  3J7Z T;  4DR1 J;  4O3Q A;  1U48 A;  4YR2 A;  3OTD A;  2PN6 A;  1RBL A;  2B6A B;  4IG3 B;  4IG3 A;  2HND B;  3ZZO A;  4ANC A;  5I3U A;  3M6W A;  3QJJ A;  1BMQ B;  1WAC A;  1Y4Z B;  3M6X A;  1ELO A;  1OMS A;  2KI2 A;  2Q3P A;  3EM1 A;  3MHY A;  4LRD A;  1EIY B;  3U1M A;  1HNZ F;  3CCT A;  2FYX A;  4DPY A;  1Z4U A;  2F1F A;  5C24 B;  5KG2 A;  4UZC A;  1MG7 A;  4I68 A;  2DNK A;  2JL9 A;  3A8E A;  2ZJR Q;  4MK8 A;  4JBC A;  3HT3 A;  1UW4 A;  2F40 A;  4C4W A;  2BW2 A;  1PCA A;  3HHL D;  3CCU S;  1KLM A;  3GLJ A;  2CAD A;  4X64 F;  1FRH A;  2WVE A;  4LF9 F;  1FDD A;  3ZZY A;  1NK7 A;  2AW0 A;  5HAN A;  3OXG A;  4DXL A;  4Q0B B;  1YJW S;  3PVX A;  4DL5 A;  1VYA A;  2BEF A;  3HFV A;  3RAM A;  2MB0 B;  4WFZ A;  1MW7 A;  5E2Q A;  5KFH A;  4PQU B;  1HAR A;  3C16 B;  4P9S A;  2ERR A;  1YVF A;  2QN6 B;  4PG7 A;  2FJV A;  2LDI A;  3BGR A;  3CJ3 A;  4ED1 A;  3G96 A;  2MQP A;  1FF2 A;  3W60 A;  3FMB A;  1FO1 A;  2HRT A;  3VTI A;  5C5J A;  3DRX A;  4F36 A;  4CIO A;  4DSL A;  1VDH A;  1VRT A;  4NA2 A;  1HQU A;  5BJR A;  1N4L A;  2CAJ A;  2FD2 A;  4NEZ A;  1MU2 A;  3WHI A;  4NYP A;  1FK9 A;  2JVR A;  5IC6 B;  1U2F A;  3HDS A;  3HD2 A;  4CT9 A;  2D3O R;  1SJQ A;  4J9L A;  2JEF A;  2D3U A;  1TVR A;  4TY8 A;  1I3O B;  2WSF C;  5CAB A;  3RAQ A;  1BLU A;  4YOE A;  5K14 B;  3E01 B;  1SUQ A;  1CUL A;  1S6O A;  1JXE A;  3BBF A;  4Y3C A;  4XDD A;  4LIR A;  5KFE A;  1QTN B;  3QFW A;  4C3L A;  1Q16 B;  4L72 B;  2Y8W A;  5HMX A;  3QRQ A;  1S1T A;  5L39 A;  3HCX A;  5KFT A;  4DUZ J;  3D68 A;  4DS5 A;  3DMJ A;  4TKT A;  2UXB F;  2W4D A;  1S1T B;  5AE1 A;  1QVF R;  1KFS A;  2GGP B;  3CD5 A;  2HMI A;  3QQC D;  3UQS A;  3ZZU A;  4P6Q A;  1D8Z A;  4WFN Q;  1SC3 B;  3IBC B;  3JSY A;  3R7S B;  1FCA A;  1Q53 A;  3R8Y A;  4KGZ B;  5ETT A;  1S9E A;  3VVU A;  3J81 U;  3K58 A;  3D7S B;  1CSJ A;  5CZV A;  3UCG A;  4ECW A;  2E44 A;  4LF8 J;  3ENQ A;  5HQ8 A;  2ZUA A;  2CZ9 A;  1WC6 A;  3IRX B;  2AYM A;  4J9N A;  4KTQ A;  1X4C A;  5IQQ A;  1RT1 B;  5AJ3 J;  2EFG A;  3SQO P;  2UU9 F;  4KH1 B;  2HZC A;  4RUB A;  3MM7 A;  2ZJP Q;  3I9V 9;  2YH1 A;  1KVK A;  4QWE A;  1Q4R A;  4B9S A;  2W9A A;  3EMT A;  3H0P A;  2GMJ A;  2P9C A;  1PBA A;  4P2F A;  3TYT A;  3QJL A;  5AXN A;  4ZVP B;  2FHJ D;  4JI0 F;  1O8B A;  4PUO A;  1C0U A;  1EET A;  1HHS A;  1T0T V;  1VLO A;  4RPF A;  4DV5 J;  1F3F A;  2MZJ A;  1U0S A;  2P5V A;  4K2J A;  4Z7Y A;  4X66 J;  4O44 A;  3D67 A;  2XY6 A;  3SI8 A;  3BO2 A;  4AE5 A;  1KKH A;  2ZD1 A;  3H4D A;  2ZC4 A;  2J8S A;  2YNI A;  5L1J A;  3Q89 A;  4HLB A;  4P71 A;  2MST A;  1KQF B;  1VC5 A;  2DBB A;  4NE9 C;  3UVJ B;  1WNE A;  2YKN B;  3K0J A;  2CQ3 A;  1U24 A;  2IC3 B;  3LP0 B;  1F2G A;  3BZQ A;  3R5D A;  2Y0S D;  2VL1 A;  5HAT A;  1TR0 A;  4WK3 A;  2X1B A;  3NEK A;  2GHW A;  2DVI A;  2HS4 A;  4HT7 A;  3QLH A;  1WEL A;  1TMM A;  1RJJ A;  1IBC B;  1XR7 A;  2Z56 B;  2FVC A;  4H4O A;  4CNY A;  3I56 S;  3SEO A;  1WEY A;  1Q7L B;  3CVK A;  4NYZ A;  3A3O B;  3JQK A;  4WBF A;  1X4D A;  1P1T A;  1ZZF A;  2KYZ A;  4ZS6 A;  2PT0 A;  3GIK A;  1S6P B;  2X3G A;  4UOH A;  1PO6 A;  4JYA F;  3T6B A;  5ETL A;  4ZVG A;  2UXC J;  3AOD A;  3RG6 A;  5D3G B;  4Y2M A;  1U26 A;  2UXD F;  1F5B A;  4ETZ A;  4UY8 5;  3RBE A;  4KSE B;  1JLE A;  5JUM A;  5L46 A;  4DQP A;  3NGK A;  3J7Z 5;  4B9U A;  2JLE A;  3DN9 A;  3A8K A;  4OMF G;  5ETS A;  4ZVH A;  1C4C A;  3PZP A;  1NK8 A;  3Q8P B;  2EC0 A;  1FER A;  4MIB A;  1CC8 A;  2XHW A;  1TFY A;  2VQE F;  3OTE A;  1M1H A;  2JEJ A;  4I0W A;  3T1A A;  4F2R A;  4RW9 A;  4GKK J;  4L3K A;  4LQ3 A;  2JRS A;  2F5G A;  2DH9 A;  5D4P A;  1VIO A;  1W25 A;  2G0C A;  4MKV A;  3IGN A;  3GV8 B;  4HAC B;  4HAC A;  2LQJ A;  3CC4 S;  1M1G A;  2DCU B;  2LKZ A;  1TV6 B;  3OTB A;  2F8H A;  2FPH X;  3GP9 A;  4WFX A;  3CCR S;  2HHS A;  1XQI A;  1NSK L;  3HVA A;  2DH7 A;  4C8Y A;  4YQW A;  2IPO B;  5FLX U;  3NAH A;  2F4V F;  2IYI A;  1T02 A;  1Y5N B;  3GYX B;  1PKU A;  3ETM A;  2QLJ B;  3JTP A;  4QPT A;  3KK1 B;  3T1H J;  2ADB A;  2B8P A;  2F7V A;  5E3A A;  2FJB B;  3LH2 S;  3QGH A;  3JSR A;  2B5J B;  4YFU A;  2OEL A;  2R2S A;  3EZ5 A;  3FRY A;  3RW7 A;  4CLP A;  3QLH B;  1VHI A;  1ITP A;  5HMY A;  1N5S A;  3PO5 A;  3NGU A;  3ISN D;  2WVB A;  1I94 F;  4OLO A;  3DYA A;  4ECV A;  2FJD B;  1URN A;  4A8F A;  1WTF A;  1Y00 A;  4CLL A;  5K8M A;  2D41 A;  1HFE L;  2AU0 A;  2V9K A;  4WFB Q;  2VBX A;  1GXL A;  1SH3 A;  4ILL A;  1U4B A;  2K3I A;  1K1S A;  2JDJ A;  3CDE A;  3IBF B;  4FYD A;  5HSP A;  2BUN A;  5L38 A;  3NMA A;  2EFN A;  2IDE A;  3UR3 C;  1RHJ B;  1C0T B;  2GIF A;  4R5P A;  4OYW A;  3KHL A;  2QMU B;  4OZ2 A;  5CXT A;  4I69 A;  1V3Z A;  1S79 A;  2IDL A;  2A18 A;  4A8Q A;  2NXE A;  5HN0 A;  2DGT A;  5IV4 A;  2X3D A;  2ZD1 B;  2DGV A;  4JI6 J;  2B43 A;  4F7V A;  3M1V A;  5BYR A;  3TNV A;  2IAJ A;  2HVH A;  2BJD A;  4FF3 A;  1UJ6 A;  1S7I A;  2I5J A;  3I0S A;  4NLQ A;  1X4E A;  4RNH A;  3IAM 9;  1R7I A;  2FHM A;  3GQC A;  1WOO A;  1R3N A;  4I67 A;  3QO9 A;  2VFR A;  2LQB A;  2ZZM A;  1IM6 A;  4OJG A;  5LL6 d;  3MM7 B;  4K0K J;  1RWP B;  3H8Y A;  4OYX A;  1KC8 T;  3CCV S;  2O66 A;  4J5O A;  2KXN B;  3I5A A;  4OJ1 A;  2BQU A;  2D3O 1;  3QPI A;  4AL7 A;  1YBT A;  5M2R A;  5HJY A;  1JLQ B;  1RAA B;  2HNY B;  3HP6 A;  3RB4 A;  1U1R A;  2E9Z A;  2EFO A;  1HBN A;  3W2W A;  4UQT A;  4ZP9 A;  3W3S A;  2GZO A;  2PC6 A;  2RHS B;  3NS6 A;  1ZOT A;  2Y1R I;  1YI2 S;  2HZV A;  4QIF A;  2C22 A;  2RSQ A;  5KFS A;  2FHJ A;  3V5R A;  4N56 A;  2M52 A;  2CQI A;  4ZIW A;  5F8L A;  2G4B A;  2FY1 A;  1WKK A;  4YN3 B;  3WC2 A;  1RCX B;  2RQK A;  1NHK L;  4FVM A;  4DL6 A;  1K0T A;  2C2K B;  4AD6 A;  2G9O A;  3I5B A;  4U96 A;  3MFI A;  1EP4 A;  3LTO A;  1NZA A;  2JNJ A;  1D0E A;  2AJ4 A;  2HAF A;  3D1Q A;  4IFY A;  1A7G E;  2LCW A;  2PEB A;  3E01 A;  4KIA A;  4RR5 A;  1R8P A;  1X4B A;  4D3G A;  4F67 A;  5F8J A;  4KC5 A;  3QO9 B;  3C15 B;  3J7A N;  2BE2 B;  2CNK B;  1G4C A;  1WEZ A;  3C16 A;  1RT2 A;  2IFX A;  4KT0 C;  2ASL A;  3GB0 A;  4G1Q A;  3EDR B;  3B54 A;  3HKZ D;  3TAP A;  4Y2C A;  1IBL F;  3RW6 A;  5HRO B;  4C9D A;  1XK8 A;  4UW2 A;  2NPF A;  1QAX A;  2QZ8 A;  3H7H B;  4F25 A;  1S1U B;  1WWH A;  2Y3Y A;  1Q78 A;  4ZMM A;  3Q8V A;  1KD1 T;  2NXU A;  5IZH A;  3NGR A;  1SQF A;  1YG0 A;  3AJ1 A;  1RTI B;  5EUH A;  5DQH A;  1RT7 B;  1VBK A;  4ZVS B;  1VQK S;  4B3T J;  2UXC F;  1XR5 A;  3DRS B;  3M6U A;  5KT5 A;  4KPY A;  2SXL A;  2WBM A;  4GVL A;  4ID5 B;  4DR4 J;  2DGO A;  1NK4 A;  1TAU A;  1YJR A;  4X4V A;  4I2Q A;  1OJ4 A;  2UUB F;  3R9L A;  2CJB A;  4LVO P;  5KFU A;  2HK3 A;  3I96 A;  1RT7 A;  2OUG A;  4USH A;  1JLC A;  2CIM A;  3B4D A;  4EUV A;  5C25 A;  1U45 A;  1VMB A;  2R8G A;  3Q8S B;  4I6W A;  3R6G B;  4OI3 A;  3Q86 A;  4ZP6 A;  2B6A A;  4BWM A;  3EVM A;  5B0C A;  2MJN A;  2MLX A;  5B08 A;  2H48 B;  3IG1 A;  3CMQ A;  1FTC A;  1TKT A;  4IFV A;  4R0J A;  5DQI A;  2VPZ B;  4DR6 J;  2P9G A;  3X3U A;  1SPB P;  1T9V A;  4Y34 A;  1RAF B;  3KLI A;  1U1K A;  2KN4 A;  2AYE A;  2MDA A;  4M95 A;  4IRD A;  1JB0 C;  1GT8 A;  2HLU A;  2YWK A;  3P3D A;  1UWA A;  2Z58 B;  1HBU A;  1RWW B;  1H73 A;  2HQI A;  1XMB A;  3RBZ A;  3A8J A;  4IQM A;  3R1H A;  3DHX A;  3OXL A;  1W2I A;  4DEZ A;  1RHR B;  4HHJ A;  3K7R A;  5EHH A;  1AT1 B;  4LBP A;  1RTH B;  2RUG A;  5C2C A;  1YSJ A;  2V8G A;  3LWL A;  3O8W A;  1YRU A;  3O1L A;  1T03 A;  5J2Q B;  1HW8 A;  3OFG A;  2A10 A;  4DPU A;  1WI8 A;  1ZM2 A;  3BBC A;  3KG0 A;  3K5M A;  2UVV A;  1SBR A;  2DNM A;  3RJM B;  3MUM P;  1UTA A;  2I8E A;  3HK2 A;  3KWM A;  5A8K A;  2GHP A;  4RBV A;  4B3R J;  2RD5 C;  1J5E J;  3GIR A;  4CTA A;  1IM4 A;  2CNO B;  2R7Q A;  2DNQ A;  1O6X A;  3MPW A;  4RW4 A;  2PI5 A;  1X4G A;  4W90 B;  2HS0 A;  2YWE A;  2QMW A;  2BE7 D;  2HVZ A;  2VFU A;  1R43 A;  1WI6 A;  2I1R A;  4ZHR B;  2AYB A;  5KFL A;  2IJR A;  2OPR B;  4KAI A;  4NI2 B;  2GJF A;  1HMV A;  1S0M A;  2UP1 A;  2EK1 A;  4NLG A;  2BR0 A;  3TJ9 A;  2HEK A;  3IC1 A;  2ZWO A;  4TXS A;  4ZVE A;  3B8H A;  1MSW D;  4JI5 F;  2IAJ B;  2V8V A;  2VG6 A;  2JEI A;  3DDI A;  3JAM U;  1U7L A;  3CDU A;  5I3Q A;  3BSN A;  1ZYQ A;  3MEG B;  3S8S A;  3A13 A;  3NWR A;  2OEJ A;  3K8V A;  1KWM A;  1WC3 A;  2F4F A;  3WIU A;  4F4W A;  1RLC L;  4X62 F;  1UVI A;  3NRB A;  2KVI A;  3AOC A;  2IJF A;  2YVS A;  2P6S A;  1ZPW X;  5EWG A;  3MCO A;  2DGQ A;  1RAB B;  2A2C A;  5KFJ A;  4DX7 A;  4RW6 B;  3OR1 B;  1RHK B;  3TVY A;  3IWL A;  4M5D B;  1NJW A;  3IXQ A;  1TKZ A;  3FSX A;  2WB4 A;  2QEX S;  2BA9 A;  3SFG A;  2FVP A;  3ENA A;  4HHH A;  3OSP A;  5KOW A;  4O4G A;  2D9O A;  4C7Q A;  1VQ4 S;  1DAR A;  4YUD A;  2FC9 A;  1IR2 A;  4K4W A;  2CPZ A;  2RQM A;  4HDG A;  3THV A;  2KKH A;  1VQ7 S;  1I6J A;  4XIU A;  3H2V E;  2CVE A;  1RAC B;  2C2M B;  3MTK A;  3W5X A;  2HFO A;  4HKQ A;  4PG4 A;  2XZD B;  4EFA C;  4WFA Q;  1CLF A;  3I87 A;  2B5J A;  2UUC J;  2W9C A;  2ACM A;  4YR0 A;  2GW8 A;  3CJ4 A;  5LSL A;  2MGZ B;  2W8L A;  1N6Q B;  1VCT A;  2HIQ A;  4OX9 J;  1NDP A;  5A6P A;  2R2R A;  3BSA A;  4QYZ J;  4OJ3 A;  3CD7 A;  3NOG A;  5E3R A;  2G1H A;  4PPZ A;  1RT1 A;  1YTY A;  1MWQ A;  3QIP B;  3Q8Y A;  4JI7 J;  1XEZ A;  1FRI A;  1QE1 B;  3MR7 A;  1UL3 A;  2YWF A;  1E6V B; 
#chains in the Genus database with same CATH homology
 1F9E B;  2Y1L B;  1GFW B;  2CJX B;  3KJN B;  3R6G B;  2QLF B;  2QLJ B;  5IC6 B;  2H48 B;  2QLB B;  2XZT B;  2HBQ B;  3KJQ B;  1I3O B;  4ZVR B;  1RE1 B;  3P45 B;  3GJR B;  2HBR B;  3GJQ B;  1QTN B;  3EDQ B;  1QDU B;  1RWW B;  1PYO B;  3GJT B;  4ZVU B;  1RHR B;  2H51 B;  1RWO B;  4JB8 B;  5IC4 B;  2CNL B;  3D6H B;  2P2C B;  3IBF B;  1ICE B;  1SC3 B;  3IBC B;  3R7S B;  3RJM B;  2C2O B;  1RHJ B;  2HBY B;  3R5J B;  4ZVO B;  2Y0B B;  3R7B B;  1RHQ B;  1RHM B;  2CNO B;  2HBZ B;  4ZVT B;  5K20 B;  3QNW B;  4ZVP B;  4LSZ B;  3R6L B;  3D6M B;  3P4U B;  2CNN B;  1SC4 B;  3SIP B;  2XYP B;  1I51 B;  4ZVQ B;  1RWX B;  1RWP B;  2XYG B;  1RWN B;  4DCP B;  2QL7 B;  1RWM B;  2CJY B;  1IBC B;  2QL5 B;  3KJF B;  2QL9 B;  2FQQ B;  4DCO B;  1RHK B;  2C1E B;  3D6F B;  2C2Z B;  1NME B;  2H4W B;  2C2K B;  1RHU B;  1BMQ B;  2CDR B;  1SC1 B;  3R7N B;  2H54 B;  1RWK B;  2H5J B;  2C2M B;  2XZD B;  2CNK B;  3GJS B;  3EDR B;  2H65 B;  2XYH B;  3NS7 B;  2H4Y B;  4ZVS B;  4DCJ B;  1RWV B;  2DKO B;  1PAU B;  2H5I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...