4ZVUB

Caspase-7 wild-type bound to the caspase-6 cognate tetrapeptide inhibitor ac-veid-cho
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
93
structure length
93
Chain Sequence
YKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-7
publication title Reprogramming Caspase-7 Specificity by Regio-Specific Mutations and Selection Provides Alternate Solutions for Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 18
structure length 93
sequence length 93
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2015-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 4zvuB00
1RWKB 1RWOB 3GJSB 2QL9B 4DCOB 1PYOB 2FQQB 3EDQB 3R7BB 2H5IB 5IC6B 3R5JB 1RHRB 3SIPB 2QLFB 1SC1B 2H48B 4ZVTB 1RE1B 3D6MB 3QNWB 2H4WB 1RWVB 1I3OB 4ZVRB 2CDRB 2QLBB 3KJQB 1QTNB 4JB8B 1RWNB 1I51B 2Y1LB 2H51B 2Y0BB 3R7SB 1F9EB 3P45B 2QLJB 1QDUB 4ZVUB 2C2MB 1RWXB 2CNKB 2CJXB 3R6GB 2QL5B 1RHUB 1PAUB 3EDRB 2C2KB 3KJNB 1NMEB 2XYGB 2C2OB 4ZVSB 1SC4B 2DKOB 3GJQB 1ICEB 2H4YB 3R6LB 2H54B 2HBQB 3IBCB 2XYPB 3D6FB 2P2CB 3NS7B 3R7NB 4DCPB 2HBZB 3RJMB 2C1EB 2CNNB 3IBFB 1RHJB 3D6HB 2C2ZB 1RHMB 1RHKB 4ZVQB 5IC4B 5K20B 4DCJB 3P4UB 1GFWB 2H5JB 3GJRB 2XZDB 4ZVOB 3KJFB 2XZTB 2CNOB 2XYHB 2CNLB 1RWMB 1RHQB 4ZVPB 1SC3B 4LSZB 1RWPB 3GJTB 2QL7B 1IBCB 2HBYB 1BMQB 2HBRB 2CJYB 2H65B 1RWWB
chains in the Genus database with same CATH superfamily
3HMJG 2MSSA 4A8MP 2YKMA 3GIJA 2BQ3A 4WP8A 5KG4A 1RT1A 1FDAA 3R5JB 1LWFB 4QOTA 1TL5A 1PJ5A 4OYXA 1RAGB 2DR5A 3W2VA 2OPRA 4I6YA 1JJHA 1SL2A 2QZ8A 1OSDA 4CLLA 1RAAB 4HT7A 1ZTTA 1DTQB 2V68A 2VFUA 3NS7B 3R1HA 1VQ4S 1WF1A 4LUBA 3T1YF 2DNZA 3A1YG 4DV1J 3R1LA 3TOQA 2M8DB 4HACB 3TARA 1VQ8S 3J80Y 3OVBA 4B9UA 2DGSA 2F8MA 3ZZOA 2A6OA 4B3RJ 1T95A 1XMOJ 3DLJA 1FI4A 4QZVB 2DNGA 4ED2A 5E0OA 4ZOSA 3CCUS 4ILRA 4ETZA 2QL9B 2OLWA 4DXLA 5KFYA 3Q8PB 1X60A 3CULA 3T9ZA 2EC2A 4XPCA 3N79A 1N48A 2RKIB 4IQXA 2MQOA 3PO4A 3LWMA 1VBYA 1X4GA 5JVHQ 2V63A 1MROB 2FVRA 4D3HA 4FP9A 3ZTRA 4OJ1A 2XSJA 2HLTA 2DHSA 2VC0A 4NI2B 1A0OB 1MN9A 2UUTA 4A46A 2HAIA 1MMDA 1CJUB 1IKYB 4BWJA 2HHQA 2F8HA 2OIHA 2DNRA 4JI8F 1S0NA 2VICA 2PE8A 1Q8BA 2R2TA 3AXMA 2G0CA 3HVTB 3D67A 1HHQA 4HDGA 2VPWB 1UFLA 3C14B 2KG1A 4QYZJ 4HTIA 1VIOA 1TK5A 2GS8A 5EGYA 1B0TA 1X9SA 3KJFB 2I5JA 2CNLB 2ZUGA 1HI1A 1HNVA 5D0EA 4ECWA 3HSDA 3FRZA 2HQ3A 2JSXA 3M8SA 2UVUA 2IJFA 2BW7A 2VZ9A 1UA0A 3BPDA 1S57A 4NXMF 4NLUA 3AA8A 3WBZA 4A8YA 4QPTA 5CH7B 4RW9A 4WZMA 3TW0A 4LJMA 4UOGA 2KRRA 4DSIA 2PA3A 1D9DA 4PPDA 5DM7Q 2JOQA 1Q8IA 2GAHC 2EWHA 4DR5F 3VQSA 4Q7AA 5ETKA 3CSKA 4DUZF 4B9SA 3P5TL 4L6V3 3SQGB 1SUQB 2RDDA 3UD3P 2ZUAA 2HHHJ 4X66J 2R7RA 4GO5X 3HULA 3CJKA 3W66A 3KHGA 1NKBA 3PEHA 2XY6A 1KFDA 2JVOA 2KXFA 1SJ4P 4X2BA 2FJDB 4C0BA 2EFVA 2HNDB 2XWXA 2HHVA 4NA2A 2Z2LA 1TL7B 3TJ9A 4QYZK 2LA4A 3OXFA 1DLOA 4IG0B 5B0EA 2FLNA 4IFYA 2J7WA 2RSQA 2UV8A 1ZYQA 1M5VC 2NUHA 5KFUA 2FVCA 2JZ5A 2GHVC 3EGVA 4EK2A 4Q8FA 4F0KA 2I9SA 2R7UA 1R0BG 4QCLA 2Q43A 3CCVS 1N5SA 2EK6A 1U2CA 1RWVB 1S9EB 5KTQA 2W4CA 2DBBA 2ZKTA 3EGWB 4LT6A 1BQXA 2QLJB 5B0FA 4OYZA 2PO4A 1FK9B 2X3GA 1H7WA 3IAM9 3BZQA 4P10A 3UWTA 4G1QB 1X9MA 2AGQA 3E2EA 2ZD1B 3GIIA 1HD0A 4ZN1A 3N01A 2YQ0A 1XIQA 2EVZA 2CNNB 3UNGC 1QAXA 4WK3A 2MKJA 5C42A 4M5HA 1VRTA 5LOQA 4DSKA 4P7TA 3C6TA 3NOGA 3JSMB 2YX4A 2DXFA 3GJRB 3UO0A 4ZVOB 1U1QA 2R8IA 3CNQP 3CJQA 2PIIA 3M8WA 2Q1LA 4AD6A 3CDBA 4LRCA 3QWUA 2E5HA 3UDVA 3ISNC 2XO6A 3GJSB 3MCSA 5KFWA 2R7XA 2DXEA 1VK3A 2KDOA 1REGX 2V69A 4KPCA 3GV7B 2AYMA 2FJEB 2MZTA 2V9WA 2HS4A 1RT7B 2XMWA 4WTYA 1T9UA 1WG4A 3ZZRA 1HBNA 3OR1A 2DJWA 4YDDB 1WD6A 3ETOA 2DH9A 5T7LB 2OPPB 2MZRA 4ED1A 5KFLA 1TKXB 4C8YA 1C0UB 4PWDB 2PC6A 3HFVA 1UEUA 2GJIA 2BJ9A 4U7CA 3A3OB 3M2RA 3RUBL 1HMVA 2IA0A 3F0NA 1WC5A 2CQ3A 3H8YA 1C0TB 2CZ9A 1AZSB 5F9LA 4ZPWR 4OI6A 4DV1F 1ZH5A 3VGSA 4MFBB 3UDEA 2A2CA 5B7WA 3CCSS 2QL7B 1E6VA 4B3RF 3C8YA 4FN5A 1L3UA 1T03B 3KUEA 1XMOF 4FYVB 2WOMB 4OI0A 1I94J 4H4KA 3KHRA 4OYMA 3QIPA 2HNYA 4RW4A 3H0PA 2EEYA 3BGLA 1NB7A 2GIRA 2IJRA 5KT3A 1YRTA 4OQJA 4ITSA 2ZJRQ 4JI7J 4PRFA 3OTOJ 4A8FA 2HIYA 4NXNJ 3E01A 3NY0A 2X7IA 1GX5A 1H6KX 1R6YA 1JLGB 3QSYB 3KYLA 5A8WB 2AEJA 3K8WA 3Q24A 3T9NA 3MMAB 4IG3A 1NHKL 1DURA 1FRXA 3R5DA 3PM9A 3ZZYA 1V5VA 2XTJP 1WF2A 4N5SA 1GFWB 4IRKA 3HFZB 2WB1D 3VAFA 2KVQE 5KFPA 3M9NB 2UUAJ 3ZC4A 1U24A 4RJVA 2XCAA 3MEGB 4O4RA 1GXLA 1RTDB 4G1IA 1TVRA 3KK2A 1RHRB 3CDAA 3OFEA 4Y0FA 2A1BA 3QNWB 2HVIA 4U95A 4PG5A 4A48A 3HHLB 2Y1LB 3NXZA 3LOUA 2CPFA 1YG0A 2EFOA 3HHEA 2KU7A 1M5PC 3WQPA 4ETXA 1NM2A 2GC8A 1FTCA 1NMEB 1UFKA 4B3TJ 2M70A 2E7XA 1RISA 4I1TA 4LF4J 1X5SA 2HKEA 2XNRA 2KI2A 4F8RA 4DV5J 1B7FA 2BVZA 4LBPA 2WZ1A 3DGPA 3G6VA 1KNZA 2G1HA 4FNHA 2VASA 4R5PA 2HHHF 2ABYA 3R5BA 3NMRA 4F4ZA 2YVSA 3MPVA 1B4SA 2J0SD 1JK9B 3DRSA 2XG8A 5E7OB 4R8UA 3DN9A 1CC8A 4JI6J 2YNHA 3EUNA 1ZOTA 1YBTA 4XAKA 4L75A 4QIVA 1IJFB 5A0YA 2RS2A 1NJXA 4N47A 1VCTA 3ELHA 3M6WA 3B54A 2NYHA 2U2FA 3D4JA 2RUSA 3RU0A 3MD3A 1H74A 2HRUA 2CZ4A 3OVAA 1TFYA 3S8SA 4KT0C 3UR3C 1NCLA 3RG6A 3K0JA 1AB8A 3UNYA 3BGRB 3IA0A 4LRDA 3Q83A 4LF9J 4CZCA 4WWSA 1UEKA 1WOOA 2WSCC 3O44A 1VBZA 1TQLA 1KQKA 4CP5A 3HKZD 5EWEA 1S1WB 2R8GA 1OYDA 5IQ6A 2BW2A 1T7PA 2FDNA 4P52A 2HK3A 2RHSB 1HQEA 3OJUA 4O3SA 1O6XA 4KSEB 1BXNA 3H59A 4XTTA 1IWAA 4OFZA 3I56S 3KLGA 1CEZA 1X4FA 1T9XA 2A6MA 3BGFA 2KL8A 5KG2A 2MMYA 2HG4A 3M8PA 4PQUA 3J7Z5 2WB4A 1N5TA 1YKWA 2BEFA 2FYXA 2V4RA 3JTPA 1K44A 3MMCA 1UWBA 5A6PA 4PXBA 2G9OA 1T11A 2YTCA 2JFKA 3CJRA 3LP1A 1BQMA 3QRPA 4IOBA 3PIOQ 3SDEA 3OLBA 5KFZA 2BQUA 2WONA 4LRFA 4DV3J 3PCOB 1N6QB 3THPA 1B70B 4ELVA 2MYFA 2DNYA 4CH0S 4H4MA 4MT1A 2H9ZA 1H2UX 5AE2A 1FEHA 2NSBA 2VG7A 2NQPA 2IVMA 3KG0A 3RR8A 4GKJJ 4ES3A 3HSZA 4Y6IA 2KM8C 2VFSA 3BH6B 3I0RA 4JP8A 1H3DA 4I2QB 4I69A 1WF0A 4B3OB 2FJXA 2HRYA 3TA1A 4QR0A 5E3PA 3K7RA 3ISND 2ZH5A 2XI3A 5KFOA 3DLKB 1LWXA 3J80U 2MJUA 4F4YA 3GP9A 1RT2B 2YWHA 1R0AA 4KKOB 2NPFA 3BSAA 1FRMA 1LW0A 1HWIA 2FVSA 1NJZA 1XN9A 2VFVA 4KC5A 1Q79A 3BQ2A 1RCOB 3AOBA 2MQLA 1HQUB 1HLWA 2DGOA 1IKVA 5F8MA 1N8RT 4E8UA 4DR1F 4EWTA 4K5SA 4ZJQA 1I94F 3J7ZT 3GG1A 5EX3A 1N36J 1VIXA 1PBUA 4K7QA 2HHWA 1M1GA 2QL5B 5G0RA 2BJ8A 1IR2A 5ETRA 3HJVA 3M32A 3M8YA 2H5EA 1FRLA 1M0SA 4JI7F 1CVJA 3OTOF 4NXNF 2HFNA 4LRBA 1DHMA 5CXTA 3HCXA 5KFVA 1IQZA 4F0HA 4ZVFA 4WPAA 5AXMA 4C8MA 3V5RA 2IMWP 1BWVA 3MM7A 1T9VA 4F4KA 2CQDA 4BC7A 1TKTA 2UXCJ 2I38A 5GAGI 5J2PB 2CNOB 3OR2B 1N5QA 3PYFA 4JYAJ 3QMQA 2VG6A 3VWSA 4ECYA 4X62J 4CYUA 1KTQA 1T94A 2WW8A 1RYRA 2YWFA 2Q3PA 3T5JA 2EKYA 2RS8A 2UUAF 5FDLA 4DX5A 1JLQA 1UW9A 3MEEA 3DXBA 4OI1A 1JJ4A 2HQCA 4OX6A 5DGAA 3AJ1A 2CVIA 2HZAA 2H51B 3CDUA 2OKQA 4V19X 5LMUJ 2Y8WA 1T0TV 2CIMA 3I31A 4ZVSB 4DV4J 1ICEB 4RBTA 1XR5A 4E0DA 3W9IA 1H72C 3D9BA 5D4NA 4ED5A 1KLMB 4IR9A 2JFDA 4CQ1A 5DDPC 4LF4F 4M5GA 3UE2A 1HPZA 4DV5F 4LQ3A 2CQ1A 1U1OA 4DFKA 5CCLA 1OJ4A 2ILYA 3FKBA 2QO3A 1J2VA 1URRA 1RHQB 4KPYA 3HZEA 5J1EB 1ZAWA 4EU0A 1B0PA 3MPUB 1M1KT 1F5CA 4DPWA 4JI6F 4QIGA 3HJFA 4ZPBA 4YB6A 1U48A 3V4IA 1RTZA 1UVMA 5KT4A 5HATA 1TL1A 1WSVA 4KHPJ 1LXJA 2CQBA 4RR5A 2YPZA 1LWEB 3U1MA 1UP1A 2V0NA 4JI0J 3AH6A 3QAEA 3LW5C 3G8TA 1HNZJ 1Y11A 3DDIA 3ZTQA 3MHYA 4ER8A 4R0JA 2NREA 4J9PA 2B5JA 4RX6A 5DDQC 1GNKA 3I0SB 4LF9F 5L46A 5AE1A 1RTJB 1P1LA 1X0FA 4WP9A 2Q6BA 4OZNA 2AJFE 1FJ7A 1S1TA 3HT0A 3W3SA 4I0WA 2C2ZB 1OSCA 5HJXA 2RIJA 4TY8A 2ZDOA 1CLFA 5HLFB 2GFFA 4DG1B 1R0CB 3GJTB 2G2YA 4J9SA 2ZH3A 4NWBA 2ZHBA 3LPYA 1YHQS 5IS2A 1XR7A 1S79A 3NWRA 1UZHA 5E5NA 3SIPB 1YZ7A 3QT5A 2GO8A 2R4FA 3OUYB 1U2RA 2W1BA 4GKKJ 3GCWP 4DOZA 2QTWA 3NKYA 4PYAA 3PW4A 1HBMB 5FLXY 4DSFA 3QWPA 3LP2B 4EBDA 3UVJB 4X4TA 4DV3F 3BN7A 1H98A 2XMTA 3PVXA 2FLPA 4TLQA 1XMBA 4F36A 7FD1A 2B0GA 4JI2J 4LFAJ 3JQJA 3K2YA 2GZOA 3VZHA 3BYRA 2KN4A 4GKJF 1YX2A 1FT8A 1F6TA 2B51A 3TVYA 4LR7A 3QFWA 3KLFB 1FFSB 2VODA 1RAHB 2J9DE 2AKWB 2DEIA 4FXVA 1X5PA 4WIIA 1CC7A 3QFHA 1SIWB 2X1AA 2KYXA 2WVCA 3CCLS 4ANDA 4QWDA 2FQQB 2Q79A 3MR7A 1CS4A 5HQLA 3HZGA 2MKKA 3W2WB 3LO3A 3QGGA 4DQIA 1YWXA 1Q81T 4ZVRB 1RT6A 3KLEA 3TVZA 2KYZA 5DS7A 2NS1B 4UQGA 3CE8A 1QE1B 2YWKA 3I4PA 3R8YA 4W90B 2WSFC 1EP4A 3EGNA 2B8PA 5ETVA 4FF3A 2FHMA 2C3YA 2RRNA 1NJYA 4ED6A 4RNOA 1T3OA 1MU2A 5KOXA 1V9OA 1N36F 1S59A 1I6JA 1SI9A 4RUAA 3D0GE 1S6OA 4ZPAA 1SV5B 3V6HA 2MTLA 2BXJA 4EGLA 4Y3CA 3RB6A 1D9FA 1SB6A 1NKEA 5J1NA 1M5KC 3HHNB 4DPXA 3ITHA 3H5SA 4CRJA 3BB5A 2QSFA 3Q8VA 1OWXA 3KKFA 1IBLJ 1RABB 1SKRA 3DRXA 1UJ6A 5DG7A 5F8IA 2UXCF 1VRUB 2JLEA 1S6PB 2W2QP 3DFEA 4OZ0A 3BQ0A 2L08A 2KO1A 4FS1A 4JYAF 1UA1A 3W9JA 3BGUA 4X62F 2CAJA 1Q5YA 1N4LA 4USWA 2IA6A 3ZXWA 3KHHA 3CMAS 3SV4A 1D8YA 2JEGA 2B3TB 3U7JA 2VFRA 1K1SA 4P74A 4I7FA 4JV1A 2C28A 2QGFB 5LM7E 2AMCB 5HMWA 1PAUB 1WTFA 1WC6A 1Q53A 4YR2A 1KVJA 5KG1A 1S1UB 4NMLA 5LMUF 1S10A 2FHJA 1NSKL 4DV4F 2R2SA 4MJKA 2CFXA 3GILA 2ZH4A 1EETB 2HFUA 3IWXA 4B9LA 3PG9A 1TKZA 5AXLA 2R7TA 3R9LA 1J5OB 3TNVA 1RT5B 1NPPA 2DY1A 3BR8A 3PW0A 1WORA 2R3VA 4IDKA 3PNIA 4LQ9A 3PW7A 2P9CA 2AF6A 2AX0A 2XZWA 5IM0B 1YVFA 3CWJA 4PUOA 2XEXA 2VQEJ 3OTEA 1KR4A 3DOLA 3FGVA 5BYQA 3DLHA 2JEJA 1FJGF 3QAUA 3KK3B 2AIRB 3M30B 2B4OA 4DMZA 3IN5A 2DNOA 2HWHA 2OTLS 1N33J 3I5BA 3KK1B 5IT9Y 3I9V9 4KHPF 2ROEA 3RBDA 2K2PA 3BDPA 4MK7A 3QGHA 2RDJA 3O6QA 3PW5A 4ECXA 2UVWA 1FKOB 1U0HB 1HNZF 4NE9C 1X8DA 1Y4ZB 3H20A 4ZP8A 5DQHA 4K4UA 2N7CA 2P2CB 1YI2S 5LJ3Y 2HW3A 2KFNA 1S6UA 2XGPA 4DQSA 2F63A 3RYLA 4OHVA 2F3JA 3BYPA 4OHXA 2PI5A 1ZBTA 2WVBA 3VAMA 2K1RB 3D68A 3T3FA 2RKIA 3TANA 5HMZA 4CO2A 3KNGA 1MROA 3MR5A 2D3OR 3H2LA 1SQFA 4Y2KA 1JKHB 4X4PA 4CO1A 1P9YA 1HYSB 3NS6A 2ZVSA 2ZH9A 2GMHA 4NI2A 4ED7A 3M6UA 3GYGA 1RWNB 4KRWA 2W7OA 1GAOA 1IKYA 4K4XA 1QTMA 4BLGA 4GKKF 1VBXA 2V4JB 2GAGC 3C14A 2GQCA 3AB2B 3R3TA 4ICLB 2CUYA 2YNGB 1KWMA 1GMUA 1RHJB 2EBEA 1S9GA 5ETOA 4JI2F 4LFAF 4HH0A 4USTA 2ZHOA 2AU0A 1D0EA 2AQ4A 1DY3A 2M88A 4TQSA 1I1GA 4X4NA 4USHA 1JLCA 2LVWA 1F2GA 4DCOB 3BSCA 3CCQS 3PRBA 4OI2A 4A8SA 4X4SA 1G1XA 3CDEA 3PIPQ 3Q23A 3TVKA 1FRHA 2O5DA 1YSJA 4LF7J 3OV7A 2W7PA 1Y7PA 5F41A 2EFQA 1XBWA 3SQGA 3G6ES 1JLAA 3KMSA 3VALA 2VPXB 3JSBA 1QDUB 1FFGB 4RL1A 1GEHA 1U6ZA 3TJ8A 2ZZMA 1CSJA 3M1VA 4YEAA 2I1RA 1NJIT 3MAAB 3TUZC 4RW6B 2RF2A 1RUSA 4C8OA 1VMBA 2VFTA 1IWGA 2ZH6A 5HANA 3FSXA 4ZPVR 4KV8B 3B8HA 3DRRB 1RYSA 4LSNA 1LKZA 2HNDA 4IKAA 4ZCLA 5D15A 2W9CB 2X1FA 4IG0A 1PG5B 3MUVP 4DV7J 1V3RA 1T9YA 3BO4A 1KOHA 5F8JA 1Y9OA 2UVRA 3D7SB 3LANA 2B8QA 1T8EA 2FGOA 4F67A 1IBLF 1RT3B 5K14B 4LR9A 1LEOA 2CJYB 2GA7A 2DISA 1S9EA 5E2QA 5ETPA 1TK0A 3KFWX 3BH7B 2XMKA 1HNXJ 1DBDA 4ALZA 3EDQB 4YN3B 5KFSA 4DN0A 2VHGA 4CLZA 3AQOA 3MURP 2HS3A 3W60A 3NNAA 2C3PA 4NLDA 2Z2MA 3OHBA 2H4WB 1U1LA 1IKWB 2MKSA 4DQRA 4G1QA 1I51B 2DNHA 2FZKB 2GCFA 1H0HB 4OYOA 1N5YB 2ZBCA 2YWWA 2A0FB 4RUCA 2CPXA 2G13A 3RBXA 3JSMA 4UW2A 4PQAA 2ZNYA 5D78A 2B9YA 2BDPA 3KLIB 4TU9A 4RPFA 4Z7YA 4ZPTR 4YR3A 5E3QA 5GADU 4C0HA 1FNXH 4DS4A 3WHIA 1EHWA 1SIZA 3CCZA 4PG6A 5ETNA 3L9ZA 1NKCA 4B3SF 1B7YB 1TU0B 1NHUA 3W62A 1L3VA 1S1VB 2OMLA 2AT1B 4N8OA 4UOHA 5DRKA 3LP0B 2RQ4A 3CCES 2CJKA 3CCMS 3CJ0A 4ECZA 1YBUA 5DQIA 2VQEF 1FVQA 5T7LA 3ET6B 4ID8A 2M8HA 1X4EA 5F8HA 1JLFB 2D7SA 1DARA 3KJQB 5J2QA 1TKXA 3QO9A 4P71A 2DIVA 2EW9A 4HI2A 2YH0A 3HLUA 1T05B 1IM6A 4HH1A 2KZZA 1LK5A 5LL6d 3SEOA 1N33F 5F3TA 2CQGA 1R8HA 1LW2B 1YRUA 4X84A 3N5FA 2HS0A 3NP5A 2VG5A 4X65J 4HEA9 4CT9A 3QATA 3A3NB 1R7IA 3CF5Q 4LF8J 4MFBA 3VF0B 2DR7A 5LSOA 2D69A 4MYUA 2YH1A 4QIEA 3MEDA 5IT0A 7AT1B 3ZNJ1 2VC1A 2VPYB 2MSTA 1ZA1B 2WOMA 2HQIA 1X5TA 3DLEA 1RAJA 3CCJS 1YITS 5CYQA 2V8PA 2GVDB 3POTB 3PKMA 1EQ0A 2G2ZA 3C3LA 5AJ3J 1KBRA 3EPIA 2W2MP 3H7HB 3P5BP 1N34J 1SH0A 2ZBRA 4WYWA 4GO7X 4I2PA 2L3MA 4KBIA 4WTOB 4YY3J 3OL8A 3QJLA 4HHUA 4RWWA 1JLGA 1X4BA 2F4FA 2CJXB 1RDRA 4OI3A 3BKTA 4PAAA 4K2JA 2JRSA 3HHLC 1RHUB 2WVDA 5C24B 3T6BA 4CWBA 5FLXU 3Q86A 2DT9A 4AYBD 3NGDA 1YJ7A 5DGBA 3KJVB 4USUA 1HFEL 4DCPB 3D5MA 4B9TA 3TUIC 3FQKA 1U7LA 4RZRA 1LWCB 2ILZA 3KDNA 4ZVQB 1T3NA 2IVFB 2QN6B 1U25A 2HQGA 4YUDA 2DPJA 1RTDA 2E1MC 1WEXA 4DZ6A 1CJTA 1IBCB 5JMNA 2RH3A 3LALA 1H2VZ 3HHLA 3NNCA 3M2VA 2F4VJ 3CD0A 2QA4G 2HRTA 1AYEA 2CDRB 4WU3A 3SSQA 3CJ4A 3C6UA 5H1SV 4CNZA 1P1TA 3O8WA 4LF7F 1CULB 3WZ0A 3D3BJ 2E5LF 3KOAA 3QSIA 4CO0A 1HL6A 4EBCA 2RE1A 4B17A 3E51A 5FIIA 4GC6A 3Q22A 1H38A 3T5KA 4C11B 5DM6Q 1HHTP 1FRIA 1G3OA 4DR2J 4IFVB 5LT5A 3V81B 4OHYA 2IC3A 4URQU 3W8GA 3IS9B 2M52A 5DZ7A 4DV7F 4ZVPB 4DU7A 5G4DA 4Y2CA 3CC2S 2HMIA 3RRGA 1NSQA 3UDLA 2R7VA 4ZCIA 1WSRA 1XMQJ 1S48A 3AODA 2YQ1A 3TEGA 2QLFB 1IR0A 3FVYA 3BGRA 1Q78A 5L1KA 1HNXF 2CPYA 3FNNA 4MKBA 2LDYA 5LXRA 1XC9A 1IBMJ 2IAJB 3CD6S 3DDKA 3PJXA 4OX9J 4W4MA 4AQYJ 2YKNB 5D4PA 1MMLA 2FC8A 2DNMA 4KTQA 4IUFA 2W8KA 1JQGA 4DV0J 2IYIA 2IRUA 3DRPA 4CTAB 3BV8A 3FSIA 1MG7A 4K0KF 2OPRB 4IOAQ 4PG4A 2OI2A 3GFYA 1VQNS 3W63A 3SSSA 3LGHA 1K1QA 1RWWB 4YMEA 2R2RA 1RTHA 1RACB 1YJ9S 1VFJA 4DR7J 2LQJA 2HVDA 5EUHA 5D0RA 2LEAA 3OQ2A 1N6QA 2UXBF 4F3OA 3DM2B 6AT1B 2DGUA 1RT4A 4O0IA 2BJ1A 2CPIA 1W2BR 4RUBA 2OELA 3M6VA 1SC6A 2OSRA 5CYMB 1B3TA 4DL3A 3L4BC 1HR0J 4I2QA 1IXKA 4EYIB 2YX7A 4B3OA 2DB1A 2WCXA 1B64A 2MZQA 4TQRA 3J7YU 2H54B 4K4TA 2DCLA 1B0VA 3HSGA 5A8KB 1Y00A 3DLKA 1GXTA 4MIBA 4X65F 2CQIA 2LMIA 3M8QB 1WG5A 1PGZA 5GVQA 2QT7A 4LF8F 3D3CJ 1K47A 4DFMA 3VAHA 1SJQA 3KWMA 4DLEA 3GIKA 5B0GA 2M9KA 1FNOA 5IOLA 2XSJB 3GE9A 4OJGA 2J76E 1L3SA 2NXEA 1HA1A 3B82A 1UPPA 3C16B 1VHIA 3UN3A 1S6QB 3H90A 1PKUA 3KMQA 3QRQA 3D1QA 2C3OA 1WI6A 1SC1B 2Z30B 4JI8J 5AJ3F 2YKPA 4QWEA 4ENOA 3M6XA 3ZZPA 4O23A 2NR0A 3R5CA 1N34F 2ZZNA 3N6NA 4FYYB 3T41A 2J8SA 2CJBA 3TWZA 2EK1A 2E1AA 1CPZA 4ZLLA 5F8LA 2X3DA 2MZJA 2IMOA 4PCQA 1X9WA 1ACMB 2DITA 4I68A 4EO6A 2HBZB 2ATLA 5J2PA 1NB2A 3HM9A 5KFCA 2FB0A 2I0XA 4KO0A 1U0SA 3SMZA 4PXDA 3HVRA 4NXMJ 1KS2A 2XNQA 2KKHA 3I82A 4FS2A 3WIVA 3CJ5A 3HXMA 1KP6A 3BBFA 4JBCA 3IBWA 3LA0A 2ROPA 3GV8B 2CWKA 2D9PA 2BBEA 3IWNC 1SCJB 2EI5A 4BBYA 3VVTA 5KG5A 3HD1A 5HL7Q 4C6AA 3DNCA 5CHCB 3N0VA 4DSJA 3NEKA 4ILLA 3TX0A 5L38A 4IR1A 3GWCA 3HHLD 1A6LA 1D1UA 2F4VF 1NPKA 1NO8A 1S4EA 3ENAA 3MDFA 3CJTA 3BKFA 1KLMA 5ETQA 1DLOB 2WBMA 4IFYB 3OTBA 2OH2A 1X4CA 2KT3A 3UN5A 3DLBA 1MLAA 2UP1A 2HLUA 3HVAA 3JAMU 4M5NA 1Y5IB 3MCMA 4MMOA 1RKJA 2DGTA 1IM4A 4NCAA 2UXDJ 4DCJB 4BS2A 3K58A 4DR2F 5IWAF 5KFGA 2Y1JA 5ITHA 1YRXA 2L48A 1NK4A 5D4OA 1L5UA 1J5EF 1HI8A 2BZ2A 3DGVA 5K5MA 2LXFA 3EXCX 2AP6A 1LWEA 3PFEA 1S7IA 4ELTA 1BUXA 1XMQF 3V4MA 3ADAC 3ULHA 3DHWC 5C42B 4DL2A 2DY9A 1VRTB 2OFHX 2OPQB 3RAQA 3BSOA 1RTJA 4MKVA 2M0GB 4RNNA 1IBMF 3EDRB 4IH5A 4LBHA 5EN1A 2ZOFA 3ENQA 2ZBPA 4OX9F 3IRWP 1VK8A 3EX7B 1MWQA 2ZBQA 2XYPB 3UW1A 5DZ6A 3V6JA 4G65A 1JXLA 2HFVA 5HLFA 1YLXA 4DG1A 4P72A 2YQ3A 4MKAA 4DV0F 2RQKA 3HT3A 4DHVA 1P6TA 3AD9C 3RAXA 4M8LA 3CJSA 2HURA 1TL4A 1OY8A 3LGMA 3SZ2A 2XC9A 1BMQB 4GVLA 2HHPA 4KE5A 1RKIA 4KH0B 3Q8QB 4YDXA 2FGCA 1ZZNA 1RCXB 2PDAA 4DL4A 5D3GA 1JIHA 3M2RB 2Z4PA 1X0PA 1HMVB 4ZVEA 4ZP6A 2IVYA 4DR7F 5KFNA 2FTRA 3UVJA 1EKSA 3Q0AA 3RW6A 3ILJA 2ZH7A 3EZ5A 4WFYA 4EO8A 2D9OA 2P9EA 1E6VB 1FDNA 4A47A 3EZOA 2WW4A 3CPWR 1S5ZA 2JLGA 2QLXA 1HR0F 2V8DA 3S7RA 3SBMA 3EXYA 3OJSA 5BYRA 2E1PA 4ZK7M 2AGPA 1NH7A 2J9EA 3QIPB 2HNYB 4RW4B 3ZTPA 2POKA 4OZ2A 3GSDA 2BMBA 1PIEA 2QEXS 2R8KA 3ZZ0A 4FDFA 2XS5A 1YQHA 5B0CA 5IZHA 5GAEU 1E6YA 1UJ4A 5JVGQ 3W2WA 2BANB 4USJC 1Y3KA 3NBPA 1HHSA 3PDNA 4AXJA 1JMTA 1CG2A 2J0WA 2ZM6J 1RXOB 2DNLA 5KT5A 2C3MA 3GSIA 4ZLJA 2PD1A 2V8HA 1M1HA 3ISZA 4C3LA 1V3SA 1BQNB 4FYDA 2EXUA 5E3CA 4CH7A 3K5LA 1NDCA 3RB3A 4GMKA 3CEDA 1NZAA 2DNQA 1RP5A 1SV5A 2HK2A 2VOOA 4ZIVA 1R27B 1F5BA 3KUHA 1SC4B 3O2IA 3FEZA 4F04B 4U6PA 3GPAA 3KNAA 2OEMA 3KK2B 2PMWA 1VQOS 3U27A 1LOUA 3K5OA 2OAUA 3LWLA 4ZA1A 2NCKL 2DO0A 1S6PA 2KJWA 5IC4B 3MM8A 3C2PA 3C66A 3VQTA 2M4MA 3C15A 1CJVB 4DJBA 4CLFA 1WHYA 2W8LA 2ZE2A 4F2SA 1W2IA 4NLXA 2E66A 2COLA 3TEHB 4DSLA 4ZVHA 2GGPB 2CQ2A 1BC6A 4DR4J 4R5PB 3EVMA 2RB7A 2ZH1A 3T1HJ 3MMBB 3DRSB 4R8UB 2D74B 3SCKE 1S1UA 2J0XA 5KT7A 1LFPA 1FDDA 3H2VE 5GMEA 3BEGB 3WC2A 1TUVA 5E33A 2PFFB 4P73A 3A4TA 2IBKA 2DD8S 2JC0A 3H4DA 5A0YB 4GVBB 3PX0A 1J5OA 2YX1A 1RT5A 1WC4A 4GC7A 3MZIA 1VDHA 2MKYA 2R8JA 4Y65A 1SKWA 1AT1B 2W4DA 4RU2A 1QLNA 5IM0A 2W01A 1HBOB 1W25A 3OTDA 4EEYA 2UU9J 4JI4J 4XK8C 3NMAA 5KFDA 2BABA 2GQQA 3N6MA 2UXDF 1QY7A 3FMWA 2AGOA 5C2CA 1C2PA 4LSZB 1WC3A 1GT8A 3M30A 4K59A 5HN0A 2I6WA 2KFYA 3NL0A 1VRQC 1NSAA 4ID5B 4DPTA 3PRVA 2JX2A 1Q16B 4ZDNA 1FX4A 4DPOA 2Z8QA 3SFGA 4JI5F 5HVGA 4TXSA 2QE5A 3GFXA 3RZAA 4OI4A 1U0HA 2CPJA 3CJ2A 4M5LA 3HDSA 5KFHA 4NA3A 1FE0A 3W5ZA 2OMOA 3G86A 1F9FA 1VJWA 3DRYA 3OXGA 3HF5A 3MTJA 3M8PB 7FDRA 1FEEA 1QSLA 2FVQA 4L72B 1KVKA 3DYAA 2IY5B 1QUPA 4A8QA 5EWFA 3B4MA 4CNYA 2UUBF 1UWBB 2RU9A 4JV0A 1S72S 2PMZD 3UDCA 1XTZA 4USVA 4K4WA 3LP1B 1BQMB 2L9DA 2OUGA 1U1RA 2N4DA 2K1RA 2M3DA 2CG4A 5DJBA 2CQCA 3X1LB 4M5MA 1P27B 2WONB 1KQGB 4I4BA 4RLEA 2BACA 4O44B 3T5LA 2IPOB 2C2RA 4ZIWA 2MQPA 4QR2A 3EICA 1ITPA 2MB0B 3NGSA 3EVWA 1O51A 2ZC3A 1PSDA 2K3IA 1V3ZA 2U1AA 3BR9A 3VR1A 3KLHA 1XNQJ 4LR8A 1W7WA 5JUMA 5DQGA 3W65A 3LPEA 3R5GA 1NLKL 3L09A 2GIQA 2HZCA 1H73A 2QC3A 3MMJA 3H98A 2Y0BB 4FZVA 1F9EB 3JYTA 4QBUA 2V8GA 5H9EJ 1VC5A 5IQQA 4ZHRA 1M5HA 2BKNA 4ICLA 1R0AB 3K5NA 2YXLA 1LW0B 4HKQA 4QYRA 2JC1A 4U8YA 4WXWA 2RD5C 4WF9Q 1AA1B 2Z2YB 2ROGA 1VQLS 1FFWB 2J9CA 3DMJB 3AD7C 2LA6A 3GFZA 2Z58B 4A8XA 1UWAA 3GIMA 4U9RA 2KM8B 2HZVA 4IOCQ 4PG8A 3IRXA 4PWWA 4DR1J 1UKUA 2JLFA 1YK9A 2R2UA 5G0RB 1PYTA 4NEZA 2BOAA 3B78A 3R27A 3M32B 1M90T 4A8KA 2AEFA 1VISA 2BJ3A 3MM5B 2APOA 4PKDB 3WX8A 1FTRA 1NNDA 3IGVA 4WYLA 5HBMA 4DF4A 4QWAA 1HW8A 2VD3A 5HMYA 3MM7B 3J7A1 2ZM6F 1PC4A 4RW6A 3GZ7A 2R7OA 3DC2A 1GH8A 4Q0BA 4KV8A 2VG6B 1TL3A 4Y00A 4TN2A 1NK6A 2ZJPQ 3TQEA 5JXSA 3RR7A 4MYTA 2H4YB 5K9FA 2W9CA 3BREA 3Q8SB 2NXCA 3A13A 1FKPA 1U2FA 4M1KA 3Q2TC 1NXIA 3LF0A 3NCPA 1GMVA 4RW7B 4HT5A 1DQAA 2HVEA 1HBUA 1UTAA 2MQMA 3PEJA 3WC0A 5I3UB 2BE2A 1XJWB 2XSFA 2B6AB 3O3LA 1EKRA 4F50A 4W92B 5KG3A 2DGXA 1AXQA 4DQQA 3TZXA 1JLBA 4N7TA 1IKWA 3NGRA 3SYZA 4KY3A 2C2NA 3TJAA 4O4GB 3BBBA 1FO1A 1P8GA 1HPZB 3FEYB 4RBUA 4NCGA 4Q2LA 2EFPA 4DR4F 3AOCA 2BX6A 3F73A 1AUSL 3P45B 3CC7S 3T1HF 4QW9A 2WAQD 3PJ9A 4QW8A 4C7QA 3OT9A 1X4HA 4JV2A 3AAWB 1Q7LB 2DIUA 3NAIA 3U1LA 1CJKB 3JTNA 1T02A 4OYBA 2BRKA 3V4IB 2JH3A 3W1YC 2WTFA 2GV1A 4YS2A 5DG8A 1X5OA 1TL1B 4LF1A 4UQTA 3PR5B 4ZN3A 8RUCA 4ANEA 1MWZA 1IQTA 3VGTA 4LF6F 1RB0A 3OTCA 2UU9F 1FX2A 4JI4F 2B5JB 1WJ9A 5HAOA 3D2WA 2FHOB 3RRHA 3CD7A 3ET6A 3IM9A 2QYCA 1JLFA 1Z4UA 2B4UA 1IKXA 2F40A 2HYIB 4L76A 3M2UA 3TUJC 1S1TB 2V5HG 1FJEB 2OSQA 1U1MA 1LW2A 1JLEB 4DPUA 4K4SA 1FE4A 1LQ9A 4RWXA 4FF2A 4P6QA 4K5RA 1WOPA 4LREA 2OPSA 3AXKA 3VZIA 3NRBA 1UJ5A 2LQBA 2DTJA 1YJTA 4B3MJ 3IM8A 3MOZA 3WX4A 2K06A 1Y0HA 1F5AA 4ZCKA 3J81Y 1BHNA 2GVDA 3POTA 1UVIA 4USMA 4D3GA 4QWCA 4Z37A 3FK4A 2JEIA 3DOMA 3DOKB 3QJJA 4KHRA 3UI3A 5DDOC 3MOJB 5BJRA 2RQCA 3PX6A 3QZ8A 4KQZA 3R7BB 2ZBIA 2A2DA 2I8EA 4NRUA 2VU5A 4F7VA 3PKYA 4U7UK 2G2OA 5F8GA 1XNQF 2AD9A 5C24A 4FYWB 2ACYA 4U67Q 3WIUA 1T9TA 2MXYA 3KJVA 2DH8A 2C2MB 1C1BA 3MD1A 4CLSA 5KFFA 1RU2A 1K0TA 4UF4A 3P8BB 2DHGA 1UVJA 3G4SS 4P2FA 1GX6A 4O3PA 5J1PA 2CYYA 1RT6B 1KKHA 1RHKB 3RTVA 1VR6A 3PYDA 1TMMA 3KG1A 1NRKA 1RTIA 4Z7CA 3ENVA 4M95A 2XZDB 2MHEA 3CW2C 4OZ3A 4PXCA 1MU2B 3G87A 1NDLA 3T6JA 2PEBA 3DI6B 2DR9A 2UZAA 1ELOA 1PYOB 1R8PA 1RK8A 1SH3A 5I3PA 3ITHB 3H5UA 5AXNA 1CULA 3IGNA 2RQMA 2IDLA 1N32J 1FWKA 1S99A 3VCDA 1DTTA 3AOAA 1YZ6A 1RADB 2YNIB 4NRTA 3ZTSA 4X64F 3V6DA 1TUWA 3R6GB 2IHR1 4OYIA 4F26A 1WELA 2C42A 4WE1B 1N54B 1RA6A 3DLGB 2HWTA 1URNA 3VVUA 3PX4A 5I4MA 4CLUA 4QWBA 3RJMB 2MY8A 2R42A 3UCUP 2V6AA 5KT2A 3G2XA 3HHKA 1O0PA 2HQDA 1S0VA 2BQRA 2AYEA 4I7FB 3BS9A 2J5AA 4DQPA 3CB4A 2HVZA 4NLYA 2WSEC 1ZPWX 1RWMB 3MCOA 3VAJA 1NK0A 1EX8A 2VIHA 5ADZA 2DXDA 4OYWA 2K7JA 3AFGA 2IAJA 2DHAA 5IC6B 1FA0A 2MQ8A 3TAMB 2YKQA 1PC5A 3ONQA 2ZH8A 2YKNA 2HAFA 2BV3A 4H4OB 1KVIA 3VAGA 2XCPA 1UW4A 4J37A 5A2QY 3GONA 4NLSA 1QD1A 4IDKB 4PYDA 2CKWA 2GHWA 3ILLA 3PV8A 1U1NA 3M4XA 4ZKAA 4PUOB 2LCWA 1YBAA 3GR0A 4CTAA 2AJQA 4DDFA 1UZDA 3DOLB 1Q82T 3R7NB 1UETA 1KQFB 4J9QA 1REVB 3GLJA 3CMES 2ADBA 1VOMA 3V6KA 4OV6A 1FJGJ 3FUYA 1NJWA 1JWWA 2QFJA 1SQEA 4ZJLA 1F60B 3DM2A 4HTJA 1TELA 2GQ2A 1WC0A 3LQVA 1NAQA 1IVZA 4DSEA 2AX1A 2IBOA 4NASA 5CYMA 3W61A 1R31A 1JB0C 4DF8A 2CQ4A 4AL5A 2FZCB 3FCVA 2LKZA 2QYGA 3C19A 1YIJS 2RRAA 5KAKA 3NOCA 4K4YA 1NZ8A 5B0DA 4Y34A 1RWXB 4RNMA 5F0UA 1QVGR 4CO5A 5CD4H 4B9VA 5A8KA 2KJVA 3SXLA 3DU5A 1KHVA 2SXLA 2XMVA 2D3O1 2XMMA 5L1JA 1NBEB 3M8QA 4ZITA 4IQMA 4TYBA 1Z2LA 1PJ7A 1T9WA 3MR6A 2XLIA 5KT6A 5GADI 2L41A 3NGKA 2HIQA 4IO1A 4OIXA 4LIWA 4OV1A 1WHVA 1G4CA 4ERDA 2RT3A 3C16A 2ZOGA 1VQ5S 4V19J 4N41A 4B3MF 1FXDA 3MECA 1S6QA 4WP3A 3T1AA 2G4BA 2FJWA 3N9UC 5RUBA 1PCAA 3EPGA 3S6EA 4UOFA 3VGVA 2Y8YA 3PJWA 3BDEA 2MLZA 4M5JA 3QJPA 2JJ4D 4TNOA 2GHPA 5C25A 4NX9A 3RBZA 2NZCA 3JSYA 3H2UB 4ELUA 4URSA 2Z2ZA 1S9GB 4MH8A 5LMNJ 5E3AA 4IRDA 5D4LA 2UV8G 3AT1B 2O1PA 1AUDA 2V2KA 4X4OA 2XLJA 2B4VA 2FZGB 2CA9A 3R97A 4C8NA 3FBBA 1JLCB 4PG7A 1DQ8A 3D54A 4XDDA 4EZ6A 5DLFA 4OZLA 2QA4S 2HWIA 1ZETA 1C4CA 3L7OA 1TMJA 3I87A 3SCLE 3QIDA 5LXYA 2MLYA 5IXUA 2M7SA 2VH7A 4KAIA 3CXCR 1HNWJ 1ZZFA 2FUG9 4YQWA 4WJBA 1RHMB 1TV6B 1YJNS 2K7KA 1DZ5A 3CD5A 2MDAA 5A76A 1JLAB 2XY7A 1WDDA 3M1VB 1Q95G 1N0UA 1EB0A 5SUHA 2AHOB 2RF2B 1U47A 4WFXA 3TR5A 1FDBA 1DAXA 4DZDA 2B56A 3GR1A 2HFOA 4LSNB 2K8GA 2W9BA 2E1RA 3KDOA 4LSLA 3IR6B 4ECRA 3R5AA 4J9NA 2JL9A 4LRAA 3W7BA 1RLCL 3D28A 1N32F 1F3FA 1QAYA 4CCHA 2RUGA 1RA7A 2IJNA 3FFIB 3ILIA 3S01A 1TZ0A 2CPHA 3FC9A 2F7VA 1S1XA 3CIZA 4R25A 4DUYJ 1RI7A 4JI3F 1OIAA 2E1CA 2MY7A 3MF5A 1C1CB 5A8RA 2F5GA 3K5PA 3OD2A 4DL6A 3DDNA 4LF5J 3IBFB 4HHHA 2YWGA 2MHNA 3K17A 4O3OA 1H2TZ 2QRRA 3ZZTA 2GVZB 2VOPA 1S9FA 2W2NP 1NEEA 3CJ8A 2HBYB 5HROA 5E3RA 1VBKA 3P3DA 5E41A 3IR5B 2OPQA 1TUGB 1ULRA 1UVLA 3S1TA 5J2NA 5ETLA 4IH6A 4DFPA 1GMWD 1KD1T 2QFIA 2DHXA 4ES1A 3G82B 4MK9A 2FJBB 5K8OA 1ZAVA 2Q6CA 2QIFA 2XO7A 4NLRA 2KT2A 4FVMA 1VLOA 4Q44A 5HI7A 3TI0A 2CXEA 4DPYA 1WI8A 3IMQJ 4B3SJ 2R8HA 1SL0A 2OEJA 2KXNB 1S49A 2HPUA 5EX0A 4P2SA 2CQHA 2ATCB 5F3ZA 1LWFA 1ZM3A 4BCAA 4Y2IA 3FCWA 5J2QB 3QO9B 3UCZP 4H4KC 2FPHX 3IXQA 1WNEA 4KFBB 1VS3A 5SZTA 1MMNA 5B08A 4EZ9A 2DR8A 3AD8C 3D6TB 5DLGA 2IYGA 2VG5B 2WVEA 3T5HA 4OX8A 2KB2A 1KLNA 1DTQA 3A3PB 4ED0A 1VI7A 3L3CA 5CCMA 2VONA 4ZVTB 1G7CB 3MEDB 3RRKA 4HACA 1KRPA 1YJRA 2XLKA 2RAQA 2W24A 1N0VC 1NPRA 4P9SA 1IN0A 3DLEB 2C2KB 2VV5A 5CYQB 2C2OB 1UPMB 3NLCA 1U26A 1UAWA 2MGZB 4DU8A 3BQ1A 2O66A 4I2PB 3D6HB 3OSPA 4FF1A 4ZLPA 1NU4A 2MQQA 2IM0A 3TZZA 3MR2A 2BANA 4WU2A 3SQOP 4RW8B 4J9UE 3W64A 2G1DA 3GFHA 2ZFHA 3B6BA 3J81U 4G1PA 3VTIA 4K50A 3A8KA 1BQNA 3FBFA 4LF2A 1K73T 1CJUA 2DNPA 4YOEA 2PI4A 2HQFA 4X4RA 3HVTA 5IV3A 3GYNA 2XI2A 1RE1B 3GB0A 4H54A 1U49A 1XQIA 1PO6A 3KTQA 1K9MT 3KUGA 4AE5A 4NZ7A 2LDIA 2OEKA 1R8BA 4MK8A 5L9NA 5LMNF 4CLTA 1CJTB 4ED4A 3J7YI 2YKAA 1KONA 4F4AA 1V6HA 2O3DA 5HVFA 5GAHU 1R8AA 2KH9A 4C48A 2NPIA 3M2VB 4C2MA 1IBKJ 3PHTA 2P8IA 4M5DB 1APSA 4TY9A 1CJVA 1D8ZA 5BYSA 3FMBA 4KB7A 5K8NA 3UR0A 3PACA 3C6UB 5HP1B 1FVSA 2IM2A 3F41A 1HNWF 4OLPA 2Y3YA 2GGPA 3N6LA 1HWLA 5DETA 2V67A 2QSWA 4MTPA 4X66F 3TX8A 2E5LJ 3MMBA 1X31C 1WKLA 2BYCA 1SUQA 4N76A 1FJCA 4PEOA 3L7UA 1FWLA 3Q8UA 3F44A 4RNHA 3N28A 4DWIA 3JAMY 1D9AA 2RVJA 3CC4S 3X3UA 4WKYA 2IC3B 2Y1IA 2HGNA 4ECQA 4GVBA 3EVOA 1TL7A 3CO0P 2V2ZA 2HMIB 2XS2A 1VC0A 4ZJOA 1W26A 3GQCA 2NYIA 3G96A 2L9WA 3QT8A 1HARA 1WHXA 4NYPA 1HD1A 5LSRA 1HBOA 3EE3A 3M8ZA 1QSYA 3THTA 4DUYF 1X7VA 2B7BB 1A9NB 4F4XA 4CH1A 2QA2A 2AJ0A 2RJZA 4NLVA 4A8WA 1U09A 4LF5F 3G71S 5CA5A 4OMFG 2YWEA 4ID5A 1YJUA 2DCUB 1FK9A 2M5YA 3RAMA 1WTBA 4KGZB 5L1LA 3IR7B 2ZD1A 2V34A 2MZ1A 3DRPB 1S77D 1FESA 2HHSA 4HDHA 5BR8J 3MCNA 1UCNA 1F3VA 1FXRA 4EYHB 1VQ7S 4FXWA 2D3UA 4E98A 3RGIA 3NAHA 4A8OA 1GXUA 5HK4A 4HLBA 4K0KJ 4C8LA 3E8OA 5A2QU 4K4VA 3NG8A 5M2RA 4J9MA 3DXSX 2HSEB 1RTHB 2OGUA 3FSYA 2HBQB 2Y9HA 2EPIA 2XWYA 2MKIA 2QJ3A 3MM9B 3DU6A 1KFSA 4EFAC 4GRSA 3JSRA 1OY6A 5AXKA 4W98A 4ECVA 5HQMA 3AHPA 1RT4B 3MM6B 4O44A 1WOSA 4WFBQ 3L7PA 4UZCA 4WFNQ 5HQ8A 2BKPA 1RT7A 1F9HA 5KFBA 2OD4A 2E9ZA 2UXBJ 1Z2ZA 1FRJA 2KRBA 2LEPA 3RBEA 4I6AA 2RDIA 5D0GA 2KHCA 1XNRJ 4QIWD 3RW7A 2OPPA 3PYGA 1BE4A 4Q43A 2EFGA 3I5AA 4LBIA 1C0UA 4PWDA 2F9JA 1S0MA 2CPDA 3IG1B 2C22A 4UY85 1QAIA 3RB0A 2DH7A 2VL1A 1X4AA 5I42B 5J2MB 1C0TA 1R8CA 1AFJA 1AZSA 5B0AA 1H7XA 4WKRA 1ROFA 3DMJA 2LXUA 5IV4A 4PWUA 3JQKA 3PW2A 1T03A 1R6VA 2YNFB 3MUMP 4J9OA 2FY8A 4ECSA 4K2XA 2VBYA 2OTJS 1LFWA 4PPZA 3P49B 4DL7A 3MR3A 2KVIA 5D8HB 3MFHA 4CO3A 4XPEA 5KG6A 1SXLA 4YP3A 2H5JB 3MM5A 2RHQB 5ETMA 5F0WA 2NUUG 2XGQA 3IP0A 4DLGA 2Y0SD 4MKYA 1PILA 4CI0B 3UD4P 2V50A 3PO5A 5A8WA 4YB1P 3K57A 4FYXB 3MMAA 2H48B 4FPRA 4KO0B 1KC8T 4AUKA 1U4BA 1O8BA 2YPYA 4NOHA 4DS5A 2XHCA 2ZWOA 2CNKB 1WC1A 2VKRA 4FVCA 4LFBJ 4C3KA 4J9KA 4UY8T 4RW7A 1AROP 2LQ8A 3MEGA 3QLHB 5M2PA 2P6SA 4ZPDA 1EAYC 2WBRA 2DPIA 5KOWA 1TAQA 5I3UA 5T14A 3EGZA 1IBKF 2OP5A 2B6AA 2MJNA 2V94A 1EZZB 3PZPA 5GAEI 4QPXA 4M5IA 4O3RA 4JUZA 1JNRB 1RJJA 1V5IB 4EUVA 3A8IA 4B3TF 1IUJA 4FKYA 3NWGA 4O4GA 4NL5A 1RBAA 1RWPB 2EG2A 1Y10A 2PT0A 4J90A 5C7PA 4Z2XA 4J9VA 5CD4A 3FRYA 4RBVA 3FJ2A 4UT4A 1RBOB 2H5IB 3BN4A 3OFGA 3Q8YA 3FQLA 2J0QD 4F25A 2HNZB 1VQSA 2BUNA 1Q4RA 4USIA 4PXEA 2LYVA 1SKSA 2E7WA 1CJKA 3HP6A 5KFEA 2IIHA 4FKXA 1CQMA 2ASYA 3BM7A 4OLOA 3I32A 5IWAJ 2JEFA 3FDSA 4ANCA 3R6LB 1HNIB 1HQ2A 4C4WA 1J5EJ 2ZKUA 5EWGA 2DVIA 1UVNA 2ZWPA 3PFOA 3MWBA 3D66A 4KGKA 4U8VA 1SH2A 2VKZG 4Y28C 3IWLA 5FD1A 3UN2A 4MIWA 4CLKA 1C4AA 2ZZTA 2CQPA 5DDRC 3HFKA 2ERRA 2H65B 5T41A 1JLEA 4CM0A 1RGVA 2PA8D 1S1WA 3EWGA 4L3KA 3D6MB 1S97A 3TAPA 2HFSA 2X1GA 3ZO7A 4YR0A 2YKMB 1CBKA 4F0MA 5BR8F 1RT1B 2GJFA 4L3NA 2LU2A 4CDIA 2ASLA 3CCTA 2HFZA 5CQGA 3W2VB 3D0HE 1OS5A 3D0IE 5D3GB 2BJ7A 1NDKA 4TU8A 4RU9A 5GMDA 4IH7A 4DL5A 4ECTA 4ZP7A 2PMHA 4P2XA 1WHWA 3SV3A 2B43A 5CAAA 3DOKA 1SJ3P 3FBCA 4LVNP 3NS5A 2VQFJ 4YHHJ 4PR6A 1JJ2R 3OBIA 2AZ3A 2E44A 1ZM4A 3FZBA 2E9TA 4DV6J 1LK7A 3FZ2A 4F2RA 4MIAA 4HI1A 4LFCJ 1D3WA 4WFAQ 1XNRF 2R7QA 2CJ9A 3PHEA 1EIYB 2FLOA 1N5VA 3MPYA 5D6GA 3KHLA 1NDPA 2A10A 2ZITA 2VJUA 4IO9Q 4OZ1A 4FXDA 1HKAA 2UUWA 1U45A 4C8ZA 1QJHA 4C3MA 3VGUA 1Q86T 1Y5NB 1JNZB 2JDJA 1L3TA 1DJ0A 4KGXB 1E6YB 2YBVA 4DR3J 4LVOP 2O67A 1RT2A 1D09B 4KKOA 3NBPB 2W7AA 4N8NA 1PYSB 1Y3JA 1KEKA 3CGIA 2BR0A 3QT7A 1RQ0A 3M05A 1HQUA 1LNQA 1K0VA 3NNHA 4XO0A 1KHWA 2ALYB 2BKOA 1ZPVA 2HHTA 1HWJA 3DI6A 3PR4A 4NEYA 4QU7A 2D3ZA 3ILOA 2KFZA 3H25A 1FWPA 4OHZA 4FF4A 1VJQA 2VUGA 4BHQA 3OVSA 4RNFA 4PZVA 3UPFA 4KR0B 2F9DA 3Q2SC 2I5JB 4HVZA 2DR6A 2YNIA 3OL9A 1HNVB 2G0IA 4TYAA 1DFDA 1KN6A 2AW0A 3ZTOA 3O5TB 4WE1A 3MM8B 2X1BA 4Q8EA 4U7UD 3G9CA 2LLZA 4QIFA 1RZMA 3DLGA 3C15B 1KSPA 2ADCA 3OR2A 4RW9B 2ZE2B 4AL7A 2J7KA 3KG4A 2XYGB 3G6YA 4AFFA 3PTWA 4TU7A 2CG8A 5M2UA 4LFBF 3CTRA 3QT6A 5KFIA 2GMLA 3BO3A 3WDOA 4X4VA 5KFKA 2XM3A 2DHHA 5KFXA 3MGJA 1OO0B 2PN6A 3MFIA 3I6PA 3CJKB 3N4WA 4C8KA 1OY9A 2VA3A 2FC9A 2DRDA 5MLCV 3MPDA 4XIUA 4EBEA 1GK8A 4DR6J 3TAMA 4K4ZA 4A4JA 1RAEB 2RMLA 5IT4A 3I4HX 3F56A 4DV2J 3DCAA 5EHHA 5H9FJ 4H4OA 1WWHA 4PABA 3OFFA 5D0HA 1Q0NA 2MLXA 2N82B 5LSLA 2F1FA 1CQNA 5CZXA 3W5YA 1G6BA 3H5YA 4TLRA 2GO9A 3FEXB 6FD1A 4YFUA 2QLBB 3MPWA 3EYZA 5CABA 2CPEA 4UOCA 4J9RA 2ZH2A 4DL0C 3AJDA 2N3OA 2Z57B 5J1EA 3KJNB 5K8PA 1AW0A 4ATNA 1REVA 1QSSA 2CJQA 4K8RA 3QPIA 3Q8RB 3V2UC 1XK8A 4JI0F 2XBPA 4UUWA 4WCEQ 3W8PA 3K5MA 4JI5J 1YJVA 5C5JA 3ZNUA 2ZHAA 4QR1A 1PBAA 3HPOA 3DYAB 2HHUA 2HBRB 3LH2S 3P96A 3C6TB 1RWKB 3I0SA 3MAHA 4L73A 1GTHA 4URGA 2MPUA 3TZWA 4XDCA 2XY5A 5H9FK 4F4WA 2UUBJ 4IRCA 4JOUA 4KIAA 1QTNB 2C3UA 3AY0A 2WK4A 4E2FB 1NK5A 4ZS6A 3CT9A 4OYAA 1WACA 1FHTA 3TYTA 4WZQA 2BA9A 1HBNB 3OR1B 3KLHB 1KTVA 3HD2A 1G2EA 5KG0A 3M8RA 4B08A 2VF3A 4OJHA 2VPZB 4I67A 3HX9A 4F3MA 2D1CA 5L1IA 3OUYA 3OHAA 2N3LA 4G6VB 3JYTB 3KXDA 3B4DA 4ZHRB 4ED8A 1M5OC 1HBMA 2VQFF 3LAMA 5D77A 4YHHF 5GAGU 6FDRA 3LP2A 2Z56B 1BWEA 2R9LA 3K59A 4DV6F 1MN7A 1S76D 5U47A 1FRKA 3L95X 1RWOB 2NSCA 1TR0A 1WUUA 1Q8LA 4LFCF 5JJBA 1JXVA 4CM2A 4G3IA 1VLYA 3CCRS 2BJDA 2MZSA 1FERA 3QYYA 3IRXB 4QJVA 5KFAA 4NA1A 1MW7A 1RAOA 3SI8A 3KLFA 1FF2A 2DNKA 3MUTP 4WXOA 3JS9A 4OHWA 5F9NA 2GX8A 2NXNA 3GV5B 2E5IA 2JNJA 3H4BA 3AA9A 4DR3F 5AT1B 5CZVA 1TV6A 1ZM9A 1AFIA 4AXIA 2OO4A 1KQSR 2O01C 4J5OA 5HBMB 1YDLA 3PY8A 1A7GE 1R43A 4ZVGA 3E01B 3H42A 3Q89A 2W4PA 3OSNA 4CLPA 2DYAA 3U02A 4UZBA 4Q0BB 4MAKA 2DO4A 2V4QA 1QE1A 4IG3B 1Q1KA 4ZP9A 1TL3B 2IRXA 3GG0A 3NCRA 3BGOP 3FBEA 1EARA 4ILMA 2VDIA 9RUBA 3BSNA 3H5XA 4Y2MA 1QVFR 1ZAXA 5L9XA 1OMSA 2CZVC 1FKPB 3PYEA 2WVFA 1S7HA 1HI0P 2IM3A 3FFIA 1EQMA 4JI1J 2F65A 1HBUB 3GU0A 1TVRB 1HWUA 3AB4B 3N5BA 2KXHA 2BE2B 1C1CA 3G8SA 3R2CJ 2H3EB 4YB5A 3I55S 1VHFA 3CDWA 1VRUA 4HYKA 4OZJA 3JB9k 1JLBB 5I3QA 3D6FB 4LMZA 2DK2A 2CADA 2GVZA 2FJAB 3TAQA 1IR1A 3OL7A 4NCGB 1SJ1A 4CIOA 2HGLA 3TP2A 2GW8A 4NYZA 5K20B 2B9XA 3O1LA 2KG0A 3DGPB 3GTYX 3VAIA 1FNMA 3I5CA 2BRLA 2PFDA 2NZ4A 3LAKA 3BO2A 1TKDA 3CO9A 2AZ1A 3G82A 4N77A 2FHJD 2I2YA 4V1Ak 5C2GA 3BJYA 4DR6F 2IDEA 2YY3A 3IAS9 4DV2F 3W5XA 2YNHB 1RBLA 4QU6A 2XMUA 1EETA 1VC6A 1YTYA 4AT1B 3A8EA 2J7UA 2VDHA 1WDTA 3UFCX 3CVKA 3CIMA 2C2EA 1VQMS 3PXGa 5HJYA 3TA2A 2G0JA 1XERA 4O3NA 2M2BA 1GTEA 1F2HA 2AJ1A 2ZJQQ 4LF6J 2E9RX 3HSJA 2EBGA 4WIQA 1IKXB 3M2UB 2GNKA 4KFBA 4ZLNA 2FD2A 4FBUA 1RAFB 2L9NA 3NGTA 2LECA 3KK3A 2Z0GA 4FPIA 2FLLA 3P6YC 3A8JA 3P4UB 1TFWA 2XMJA 3KK1A 1NHVA 2UUCJ 1NSPA 1TP7A 2KTQA 1HQEB 1HW9A 2OPSB 3GCXP 1FKOA 1QAJA 1BY9A 3OL6A 3QGPA 3DLLQ 4C0OC 1NK7A 3KLGB 1F0XA 1UVKA 4PQUB 4J9LA 1NK8A 1U8SA 1UEVA 5ETSA 4DFJA 2HVHA 2LQ5A 3LTOA 3UD5A 2J6TA 3UCGA 4FNIA 2MGZA 3MMCB 3HO1A 4HR2A 2RILA 3I96A 1SQGA 1SPBP 1VQKS 3MXHP 1JXEA 3DOMB 1WEZA 2W9AA 5LJ5Y 5EDWA 4IYQA 4I6WA 1LV5A 2EG1A 3SDEB 2V9KA 1IJEB 2BM1A 2N4CA 3NCQA 1TK8A 2CRLA 2JWNA 2DRBA 2LU1A 4OYPA 2DNNA 4CLYA 3IBCB 4BWMA 4B9MA 9ATCB 5DG9A 2QA1A 4KJIA 4RW8A 3TZYA 3TUPA 1B99A 4H4MB 2J6UA 1JKHA 5THWA 2VG7B 1HYSA 1Q5VA 3MTKA 2D41A 4X4QA 2RU3A 1BGXT 1U6FA 1OYEA 3I0RB 1C1BB 2P5VA 4M5KA 1ZTWA 1SC3B 2JVRA 3BKUA 5HVHA 2ZNZA 3QBCA 4RKUC 1P9QC 5AE3A 4S0MA 2V4JA 1N88A 3ZZZA 3U1NA 2B9EA 3A12A 4Y2AA 2GMJA 4NYOA 3JTOA 2CWXA 5B09A 2FJVA 2YNGA 1RWUA 3ICLA 5KG7A 2ZOMA 4B02A 1RTIB 2B4PA 1N56A 3OPKA 2QX0A 1MNEA 5L8RC 5A6WA 1IKVB 4ZPCA 2A3JA 4M5DA 3OLAA 1GQEA 3CUNA 4C97A 2OFGX 2V8VA 4EI2A 2W2OP 4YB7A 3TQ1A 2R7SA 2CJAA 5GMKa 2KZMA 5HP1A 4UTGA 1S0OA 3SCIE 2C1EB 5IFMA 3W9HA 4KH1B 1X4DA 2MQNA 4USKA 1DTTB 1RAIB 3QRRA 3QGIA 3V6DB 3THVA 2XYHB 2BM0A 1WEYA 1FKAF 3RB4A 3VAKA 3MAAA 4ED3A 4X64J 4HL9A 1TKTB 4JV5J 2DGVA 2R7WA 1U1KA 4OX7A 1LXNA 3CCWA 1FXLA 3DRRA 3G8QA 3HKWA 4FBTA 4CYUB 3QZ7A 3GIRA 2DRAA 5H9EK 4I56A 4DX8H 5MAOA 4DUTA 4JB8B 4J7CA 3GYXB 3R7SB 5FDLB 4JI1F 2ZC4A 3TRGA 4CO4A 3BF4A 1JLQB 4ZVUB 2E7VA 3MEEB 4C98A 2XMAA 2ACMA 3M9MB 3ZFVA 2XS7A 1RT3A 2E5GA 2FVPA 5K14A 1SJFA 4ZMMA 4DN9A 5HMXA 5KFMA 5HSPA 2FY1A 1Y5LB 1FCAA 1YGYA 3TO8A 4F02A 3IFEA 4DX7A 3K8VA 2H1YA 5L39A 1TTHB 3M9OB 2HGMA 4BDPA 1QM9A 2LFVA 5KFRA 2EKNA 2ZEJA 1YJWS 1MWYA 1N5YA 2XQCA 4NZ6A 3H40A 2MKHA 1R3NA 3GMGA 4OZ5A 5HO4A 2VA2A 4WBFA 1BD6A 2DGQA 2Y1RI 1L3KA 2OJ3A 4M94A 1SBRA 1I5OB 2AJ2A 1UFWA 1TAUA 3KLIA 4X4UA 1UL3A 3MEKA 2A18A 2RRBA 1WKKA 1XEZA 3MM9A 1ZS6A 1U8WA 2WHOA 2X51A 1S1VA 3MM6A 4I64A 2DKOB 2C2DA 2B9WA 3DKDA 5ETTA 2ASJA 3T1YJ 1NUEA 4WK1A 2ZVIA 3LP0A 4HHJA 2OHDA 2XHWA 2DEJA 4NLPA 1RLDA 3D1OA 3MAQA 3JQMA 3D1HA 3EMTA 4AL6A 5IT9U 3PRDA 2BOPA 2BE7D 1N52B 2LQ9A 4EMDA 2BE9B 2AV5A 4TKTA 2AYBA 1WG1A 2XB2D 1T05A 2VBZA 2CPZA 3IG1A 4WFZA 4UUXA 3J81j 2IFXA 1PAEX 2OD6A 1Z1ZA 3K89A 1DRZA 2FHKA 4TY8B 2UUCF 3LGNA 5I42A 5J2MA 1PJ6A 4ZCMA 1NH8A 4C9DA 1VQYA 4N56A 3ZZUA 3BPSP 5BXIA 3HHDA 2NXJA 3HK2A 3CMQA 2IM1A 2P6TA 1OPIA 3LUYA 1FD8A 4KGMA 1VQ9S 4OJ3A 1R89A 1KOOA 5K8MA 2KT5A 5KFJA 3MECB 3ETMA 2YNFA 4NCBA 3IO1A 5KFTA 4KYZA 3J7AN 1SKUB 2W25A 3T19A 1DQ9A 3C46A 2HHXA 4DX6A 1KDNA 4TVAB 3TA0A 4QQBA 1HIYA 5C25B 4BC9A 4KHMA 1ZM2A 4YY3F 1XR6A 2CQ0A 2KHDA 2N7YA 2PEHA 3SCJE 3HI9A 3KLVA 1F1BB 2P9GA 1JJCB 2JHEA 1U1PA 1OPZA 2K3KA 1U02A 3E3XA 3IC1A 4OL8A 2QLWA 1SL1A 8AT1B 3BBCA 4NLQA 3VHQA 1MSWD 3QQCD 1K8AT 2WRMA 3AQPA 1VQ6S 3ENWA 1XWLA 4ECUA 2RNEA 3HVWA 4R0EA 4Q2MA 1JX4A 1U6BA 5KFQA 4NPOA 1LWCA 5FJ4A 1SJRA 1M5SA 2BJEA 2NXUA 1CS4B 4DEZA 4DR5J 2AJ4A 2ASDA 3QLHA 4DUZJ 5CYJA 4CT8A 2MEWA 4U96A 2J6SA 2MKCA 3KLEB 2VJVA 3GJQB 2QMXA 4P7VA 4RO0A 3EZUA 1EP4B 2W9BB 4LSLB 4NLGA 1SVDA 2J8AA 2GIFA 1RU1A 1HWKA 3AJ2A 1O5JA 2E29A 4CLWA 3US5A 2V2VA 2XULA 4NLWA 2QMUB 4O0NA 4DI6A 4KGVB 2LP4A 2LXIA 3OFHA 4ES2A 2XZTB 2AWZA 3SFUA 1VQPS 1S12A 2ZDPA 2CDQA 1S1XB 2V2QA 5B0BA 3UQSA 3SSRA 2HNZA 2VBWA 3OXLA 4J91A 2EFNA 1RSCA 1J27A 3M7VA 3OW2R 5A8RB 2LEBA 4NMXA 4F3QA 2AYGA 4JV5F 1QUVA 4JI3J 4C11A 1I3OB 2CVEA 4NLOA 4Q45A 2EC0A 3G6XA 4P75A 8ATCB 1VGYA 1HNIA 4IFVA 3V81A 3VV2B 4DBQA 2NLWA 3MI7X 2YKOA 3R2DJ 2QV6A 2HEKA 1UMJA 2QMWA 2FIUA 3IS9A 4L74A 1NK9A 5HROB 3CJ3A 2PGCA 5GAHI 1OQ3A 2E5JA 2ALZA 1ZA2B 2F8EX 1BLUA 2W2PP 4RUHA 1VYAA 5J2NB 2IRYA 2QG9B 3NGUA 2GJ2A 3EJMA 3I9ZA 4NLTA 2B7CB 1Q7YT 4NZ0A 3FCHA 4Q5VA 2PSZA 4P2MA 1FD2A 1GMWA 2J9DA 3EM1A 1WKJA 1OQ6A 1S4FA 4B9NA 2VBXA 3JXOA 1EJ7L 4AQYF 2VB6A 2UVVA 5F8NA 4M63A 2Q66A 3DHXA 2DGWA 1Q8KA 5DO2A 4O3QA 2AEMA 1TKZB 4LIRA
chains in the Genus database with same CATH topology
1RWKB 1RWOB 3GJSB 2QL9B 4DCOB 1PYOB 2FQQB 3EDQB 3R7BB 2H5IB 5IC6B 3R5JB 1RHRB 3SIPB 2QLFB 1SC1B 2H48B 4ZVTB 1RE1B 3D6MB 3QNWB 2H4WB 1RWVB 1I3OB 4ZVRB 2CDRB 2QLBB 3KJQB 1QTNB 4JB8B 1RWNB 1I51B 2Y1LB 2H51B 2Y0BB 3R7SB 1F9EB 3P45B 2QLJB 1QDUB 4ZVUB 2C2MB 1RWXB 2CNKB 2CJXB 3R6GB 2QL5B 1RHUB 1PAUB 3EDRB 2C2KB 3KJNB 1NMEB 2XYGB 2C2OB 4ZVSB 1SC4B 2DKOB 3GJQB 1ICEB 2H4YB 3R6LB 2H54B 2HBQB 3IBCB 2XYPB 3D6FB 2P2CB 3NS7B 3R7NB 4DCPB 2HBZB 3RJMB 2C1EB 2CNNB 3IBFB 1RHJB 3D6HB 2C2ZB 1RHMB 1RHKB 4ZVQB 5IC4B 5K20B 4DCJB 3P4UB 1GFWB 2H5JB 3GJRB 2XZDB 4ZVOB 3KJFB 2XZTB 2CNOB 2XYHB 2CNLB 1RWMB 1RHQB 4ZVPB 1SC3B 4LSZB 1RWPB 3GJTB 2QL7B 1IBCB 2HBYB 1BMQB 2HBRB 2CJYB 2H65B 1RWWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RWK B;  1RWO B;  3GJS B;  2QL9 B;  4DCO B;  1PYO B;  2FQQ B;  3EDQ B;  3R7B B;  2H5I B;  5IC6 B;  3R5J B;  1RHR B;  3SIP B;  2QLF B;  1SC1 B;  2H48 B;  4ZVT B;  1RE1 B;  3D6M B;  3QNW B;  2H4W B;  1RWV B;  1I3O B;  4ZVR B;  2CDR B;  2QLB B;  3KJQ B;  1QTN B;  4JB8 B;  1RWN B;  1I51 B;  2Y1L B;  2H51 B;  2Y0B B;  3R7S B;  1F9E B;  3P45 B;  2QLJ B;  1QDU B;  4ZVU B;  2C2M B;  1RWX B;  2CNK B;  2CJX B;  3R6G B;  2QL5 B;  1RHU B;  1PAU B;  3EDR B;  2C2K B;  3KJN B;  1NME B;  2XYG B;  2C2O B;  4ZVS B;  1SC4 B;  2DKO B;  3GJQ B;  1ICE B;  2H4Y B;  3R6L B;  2H54 B;  2HBQ B;  3IBC B;  2XYP B;  3D6F B;  2P2C B;  3NS7 B;  3R7N B;  4DCP B;  2HBZ B;  3RJM B;  2C1E B;  2CNN B;  3IBF B;  1RHJ B;  3D6H B;  2C2Z B;  1RHM B;  1RHK B;  4ZVQ B;  5IC4 B;  5K20 B;  4DCJ B;  3P4U B;  1GFW B;  2H5J B;  3GJR B;  2XZD B;  4ZVO B;  3KJF B;  2XZT B;  2CNO B;  2XYH B;  2CNL B;  1RWM B;  1RHQ B;  4ZVP B;  1SC3 B;  4LSZ B;  1RWP B;  3GJT B;  2QL7 B;  1IBC B;  2HBY B;  1BMQ B;  2HBR B;  2CJY B;  2H65 B;  1RWW B; 
#chains in the Genus database with same CATH topology
 3HMJ G;  2MSS A;  4A8M P;  2YKM A;  3GIJ A;  2BQ3 A;  4WP8 A;  5KG4 A;  1RT1 A;  1FDA A;  3R5J B;  1LWF B;  4QOT A;  1TL5 A;  1PJ5 A;  4OYX A;  1RAG B;  2DR5 A;  3W2V A;  2OPR A;  4I6Y A;  1JJH A;  1SL2 A;  2QZ8 A;  1OSD A;  4CLL A;  1RAA B;  4HT7 A;  1ZTT A;  1DTQ B;  2V68 A;  2VFU A;  3NS7 B;  3R1H A;  1VQ4 S;  1WF1 A;  4LUB A;  3T1Y F;  2DNZ A;  3A1Y G;  4DV1 J;  3R1L A;  3TOQ A;  2M8D B;  4HAC B;  3TAR A;  1VQ8 S;  3J80 Y;  3OVB A;  4B9U A;  2DGS A;  2F8M A;  3ZZO A;  2A6O A;  4B3R J;  1T95 A;  1XMO J;  3DLJ A;  1FI4 A;  4QZV B;  2DNG A;  4ED2 A;  5E0O A;  4ZOS A;  3CCU S;  4ILR A;  4ETZ A;  2QL9 B;  2OLW A;  4DXL A;  5KFY A;  3Q8P B;  1X60 A;  3CUL A;  3T9Z A;  2EC2 A;  4XPC A;  3N79 A;  1N48 A;  2RKI B;  4IQX A;  2MQO A;  3PO4 A;  3LWM A;  1VBY A;  1X4G A;  5JVH Q;  2V63 A;  1MRO B;  2FVR A;  4D3H A;  4FP9 A;  3ZTR A;  4OJ1 A;  2XSJ A;  2HLT A;  2DHS A;  2VC0 A;  4NI2 B;  1A0O B;  1MN9 A;  2UUT A;  4A46 A;  2HAI A;  1MMD A;  1CJU B;  1IKY B;  4BWJ A;  2HHQ A;  2F8H A;  2OIH A;  2DNR A;  4JI8 F;  1S0N A;  2VIC A;  2PE8 A;  1Q8B A;  2R2T A;  3AXM A;  2G0C A;  3HVT B;  3D67 A;  1HHQ A;  4HDG A;  2VPW B;  1UFL A;  3C14 B;  2KG1 A;  4QYZ J;  4HTI A;  1VIO A;  1TK5 A;  2GS8 A;  5EGY A;  1B0T A;  1X9S A;  3KJF B;  2I5J A;  2CNL B;  2ZUG A;  1HI1 A;  1HNV A;  5D0E A;  4ECW A;  3HSD A;  3FRZ A;  2HQ3 A;  2JSX A;  3M8S A;  2UVU A;  2IJF A;  2BW7 A;  2VZ9 A;  1UA0 A;  3BPD A;  1S57 A;  4NXM F;  4NLU A;  3AA8 A;  3WBZ A;  4A8Y A;  4QPT A;  5CH7 B;  4RW9 A;  4WZM A;  3TW0 A;  4LJM A;  4UOG A;  2KRR A;  4DSI A;  2PA3 A;  1D9D A;  4PPD A;  5DM7 Q;  2JOQ A;  1Q8I A;  2GAH C;  2EWH A;  4DR5 F;  3VQS A;  4Q7A A;  5ETK A;  3CSK A;  4DUZ F;  4B9S A;  3P5T L;  4L6V 3;  3SQG B;  1SUQ B;  2RDD A;  3UD3 P;  2ZUA A;  2HHH J;  4X66 J;  2R7R A;  4GO5 X;  3HUL A;  3CJK A;  3W66 A;  3KHG A;  1NKB A;  3PEH A;  2XY6 A;  1KFD A;  2JVO A;  2KXF A;  1SJ4 P;  4X2B A;  2FJD B;  4C0B A;  2EFV A;  2HND B;  2XWX A;  2HHV A;  4NA2 A;  2Z2L A;  1TL7 B;  3TJ9 A;  4QYZ K;  2LA4 A;  3OXF A;  1DLO A;  4IG0 B;  5B0E A;  2FLN A;  4IFY A;  2J7W A;  2RSQ A;  2UV8 A;  1ZYQ A;  1M5V C;  2NUH A;  5KFU A;  2FVC A;  2JZ5 A;  2GHV C;  3EGV A;  4EK2 A;  4Q8F A;  4F0K A;  2I9S A;  2R7U A;  1R0B G;  4QCL A;  2Q43 A;  3CCV S;  1N5S A;  2EK6 A;  1U2C A;  1RWV B;  1S9E B;  5KTQ A;  2W4C A;  2DBB A;  2ZKT A;  3EGW B;  4LT6 A;  1BQX A;  2QLJ B;  5B0F A;  4OYZ A;  2PO4 A;  1FK9 B;  2X3G A;  1H7W A;  3IAM 9;  3BZQ A;  4P10 A;  3UWT A;  4G1Q B;  1X9M A;  2AGQ A;  3E2E A;  2ZD1 B;  3GII A;  1HD0 A;  4ZN1 A;  3N01 A;  2YQ0 A;  1XIQ A;  2EVZ A;  2CNN B;  3UNG C;  1QAX A;  4WK3 A;  2MKJ A;  5C42 A;  4M5H A;  1VRT A;  5LOQ A;  4DSK A;  4P7T A;  3C6T A;  3NOG A;  3JSM B;  2YX4 A;  2DXF A;  3GJR B;  3UO0 A;  4ZVO B;  1U1Q A;  2R8I A;  3CNQ P;  3CJQ A;  2PII A;  3M8W A;  2Q1L A;  4AD6 A;  3CDB A;  4LRC A;  3QWU A;  2E5H A;  3UDV A;  3ISN C;  2XO6 A;  3GJS B;  3MCS A;  5KFW A;  2R7X A;  2DXE A;  1VK3 A;  2KDO A;  1REG X;  2V69 A;  4KPC A;  3GV7 B;  2AYM A;  2FJE B;  2MZT A;  2V9W A;  2HS4 A;  1RT7 B;  2XMW A;  4WTY A;  1T9U A;  1WG4 A;  3ZZR A;  1HBN A;  3OR1 A;  2DJW A;  4YDD B;  1WD6 A;  3ETO A;  2DH9 A;  5T7L B;  2OPP B;  2MZR A;  4ED1 A;  5KFL A;  1TKX B;  4C8Y A;  1C0U B;  4PWD B;  2PC6 A;  3HFV A;  1UEU A;  2GJI A;  2BJ9 A;  4U7C A;  3A3O B;  3M2R A;  3RUB L;  1HMV A;  2IA0 A;  3F0N A;  1WC5 A;  2CQ3 A;  3H8Y A;  1C0T B;  2CZ9 A;  1AZS B;  5F9L A;  4ZPW R;  4OI6 A;  4DV1 F;  1ZH5 A;  3VGS A;  4MFB B;  3UDE A;  2A2C A;  5B7W A;  3CCS S;  2QL7 B;  1E6V A;  4B3R F;  3C8Y A;  4FN5 A;  1L3U A;  1T03 B;  3KUE A;  1XMO F;  4FYV B;  2WOM B;  4OI0 A;  1I94 J;  4H4K A;  3KHR A;  4OYM A;  3QIP A;  2HNY A;  4RW4 A;  3H0P A;  2EEY A;  3BGL A;  1NB7 A;  2GIR A;  2IJR A;  5KT3 A;  1YRT A;  4OQJ A;  4ITS A;  2ZJR Q;  4JI7 J;  4PRF A;  3OTO J;  4A8F A;  2HIY A;  4NXN J;  3E01 A;  3NY0 A;  2X7I A;  1GX5 A;  1H6K X;  1R6Y A;  1JLG B;  3QSY B;  3KYL A;  5A8W B;  2AEJ A;  3K8W A;  3Q24 A;  3T9N A;  3MMA B;  4IG3 A;  1NHK L;  1DUR A;  1FRX A;  3R5D A;  3PM9 A;  3ZZY A;  1V5V A;  2XTJ P;  1WF2 A;  4N5S A;  1GFW B;  4IRK A;  3HFZ B;  2WB1 D;  3VAF A;  2KVQ E;  5KFP A;  3M9N B;  2UUA J;  3ZC4 A;  1U24 A;  4RJV A;  2XCA A;  3MEG B;  4O4R A;  1GXL A;  1RTD B;  4G1I A;  1TVR A;  3KK2 A;  1RHR B;  3CDA A;  3OFE A;  4Y0F A;  2A1B A;  3QNW B;  2HVI A;  4U95 A;  4PG5 A;  4A48 A;  3HHL B;  2Y1L B;  3NXZ A;  3LOU A;  2CPF A;  1YG0 A;  2EFO A;  3HHE A;  2KU7 A;  1M5P C;  3WQP A;  4ETX A;  1NM2 A;  2GC8 A;  1FTC A;  1NME B;  1UFK A;  4B3T J;  2M70 A;  2E7X A;  1RIS A;  4I1T A;  4LF4 J;  1X5S A;  2HKE A;  2XNR A;  2KI2 A;  4F8R A;  4DV5 J;  1B7F A;  2BVZ A;  4LBP A;  2WZ1 A;  3DGP A;  3G6V A;  1KNZ A;  2G1H A;  4FNH A;  2VAS A;  4R5P A;  2HHH F;  2ABY A;  3R5B A;  3NMR A;  4F4Z A;  2YVS A;  3MPV A;  1B4S A;  2J0S D;  1JK9 B;  3DRS A;  2XG8 A;  5E7O B;  4R8U A;  3DN9 A;  1CC8 A;  4JI6 J;  2YNH A;  3EUN A;  1ZOT A;  1YBT A;  4XAK A;  4L75 A;  4QIV A;  1IJF B;  5A0Y A;  2RS2 A;  1NJX A;  4N47 A;  1VCT A;  3ELH A;  3M6W A;  3B54 A;  2NYH A;  2U2F A;  3D4J A;  2RUS A;  3RU0 A;  3MD3 A;  1H74 A;  2HRU A;  2CZ4 A;  3OVA A;  1TFY A;  3S8S A;  4KT0 C;  3UR3 C;  1NCL A;  3RG6 A;  3K0J A;  1AB8 A;  3UNY A;  3BGR B;  3IA0 A;  4LRD A;  3Q83 A;  4LF9 J;  4CZC A;  4WWS A;  1UEK A;  1WOO A;  2WSC C;  3O44 A;  1VBZ A;  1TQL A;  1KQK A;  4CP5 A;  3HKZ D;  5EWE A;  1S1W B;  2R8G A;  1OYD A;  5IQ6 A;  2BW2 A;  1T7P A;  2FDN A;  4P52 A;  2HK3 A;  2RHS B;  1HQE A;  3OJU A;  4O3S A;  1O6X A;  4KSE B;  1BXN A;  3H59 A;  4XTT A;  1IWA A;  4OFZ A;  3I56 S;  3KLG A;  1CEZ A;  1X4F A;  1T9X A;  2A6M A;  3BGF A;  2KL8 A;  5KG2 A;  2MMY A;  2HG4 A;  3M8P A;  4PQU A;  3J7Z 5;  2WB4 A;  1N5T A;  1YKW A;  2BEF A;  2FYX A;  2V4R A;  3JTP A;  1K44 A;  3MMC A;  1UWB A;  5A6P A;  4PXB A;  2G9O A;  1T11 A;  2YTC A;  2JFK A;  3CJR A;  3LP1 A;  1BQM A;  3QRP A;  4IOB A;  3PIO Q;  3SDE A;  3OLB A;  5KFZ A;  2BQU A;  2WON A;  4LRF A;  4DV3 J;  3PCO B;  1N6Q B;  3THP A;  1B70 B;  4ELV A;  2MYF A;  2DNY A;  4CH0 S;  4H4M A;  4MT1 A;  2H9Z A;  1H2U X;  5AE2 A;  1FEH A;  2NSB A;  2VG7 A;  2NQP A;  2IVM A;  3KG0 A;  3RR8 A;  4GKJ J;  4ES3 A;  3HSZ A;  4Y6I A;  2KM8 C;  2VFS A;  3BH6 B;  3I0R A;  4JP8 A;  1H3D A;  4I2Q B;  4I69 A;  1WF0 A;  4B3O B;  2FJX A;  2HRY A;  3TA1 A;  4QR0 A;  5E3P A;  3K7R A;  3ISN D;  2ZH5 A;  2XI3 A;  5KFO A;  3DLK B;  1LWX A;  3J80 U;  2MJU A;  4F4Y A;  3GP9 A;  1RT2 B;  2YWH A;  1R0A A;  4KKO B;  2NPF A;  3BSA A;  1FRM A;  1LW0 A;  1HWI A;  2FVS A;  1NJZ A;  1XN9 A;  2VFV A;  4KC5 A;  1Q79 A;  3BQ2 A;  1RCO B;  3AOB A;  2MQL A;  1HQU B;  1HLW A;  2DGO A;  1IKV A;  5F8M A;  1N8R T;  4E8U A;  4DR1 F;  4EWT A;  4K5S A;  4ZJQ A;  1I94 F;  3J7Z T;  3GG1 A;  5EX3 A;  1N36 J;  1VIX A;  1PBU A;  4K7Q A;  2HHW A;  1M1G A;  2QL5 B;  5G0R A;  2BJ8 A;  1IR2 A;  5ETR A;  3HJV A;  3M32 A;  3M8Y A;  2H5E A;  1FRL A;  1M0S A;  4JI7 F;  1CVJ A;  3OTO F;  4NXN F;  2HFN A;  4LRB A;  1DHM A;  5CXT A;  3HCX A;  5KFV A;  1IQZ A;  4F0H A;  4ZVF A;  4WPA A;  5AXM A;  4C8M A;  3V5R A;  2IMW P;  1BWV A;  3MM7 A;  1T9V A;  4F4K A;  2CQD A;  4BC7 A;  1TKT A;  2UXC J;  2I38 A;  5GAG I;  5J2P B;  2CNO B;  3OR2 B;  1N5Q A;  3PYF A;  4JYA J;  3QMQ A;  2VG6 A;  3VWS A;  4ECY A;  4X62 J;  4CYU A;  1KTQ A;  1T94 A;  2WW8 A;  1RYR A;  2YWF A;  2Q3P A;  3T5J A;  2EKY A;  2RS8 A;  2UUA F;  5FDL A;  4DX5 A;  1JLQ A;  1UW9 A;  3MEE A;  3DXB A;  4OI1 A;  1JJ4 A;  2HQC A;  4OX6 A;  5DGA A;  3AJ1 A;  2CVI A;  2HZA A;  2H51 B;  3CDU A;  2OKQ A;  4V19 X;  5LMU J;  2Y8W A;  1T0T V;  2CIM A;  3I31 A;  4ZVS B;  4DV4 J;  1ICE B;  4RBT A;  1XR5 A;  4E0D A;  3W9I A;  1H72 C;  3D9B A;  5D4N A;  4ED5 A;  1KLM B;  4IR9 A;  2JFD A;  4CQ1 A;  5DDP C;  4LF4 F;  4M5G A;  3UE2 A;  1HPZ A;  4DV5 F;  4LQ3 A;  2CQ1 A;  1U1O A;  4DFK A;  5CCL A;  1OJ4 A;  2ILY A;  3FKB A;  2QO3 A;  1J2V A;  1URR A;  1RHQ B;  4KPY A;  3HZE A;  5J1E B;  1ZAW A;  4EU0 A;  1B0P A;  3MPU B;  1M1K T;  1F5C A;  4DPW A;  4JI6 F;  4QIG A;  3HJF A;  4ZPB A;  4YB6 A;  1U48 A;  3V4I A;  1RTZ A;  1UVM A;  5KT4 A;  5HAT A;  1TL1 A;  1WSV A;  4KHP J;  1LXJ A;  2CQB A;  4RR5 A;  2YPZ A;  1LWE B;  3U1M A;  1UP1 A;  2V0N A;  4JI0 J;  3AH6 A;  3QAE A;  3LW5 C;  3G8T A;  1HNZ J;  1Y11 A;  3DDI A;  3ZTQ A;  3MHY A;  4ER8 A;  4R0J A;  2NRE A;  4J9P A;  2B5J A;  4RX6 A;  5DDQ C;  1GNK A;  3I0S B;  4LF9 F;  5L46 A;  5AE1 A;  1RTJ B;  1P1L A;  1X0F A;  4WP9 A;  2Q6B A;  4OZN A;  2AJF E;  1FJ7 A;  1S1T A;  3HT0 A;  3W3S A;  4I0W A;  2C2Z B;  1OSC A;  5HJX A;  2RIJ A;  4TY8 A;  2ZDO A;  1CLF A;  5HLF B;  2GFF A;  4DG1 B;  1R0C B;  3GJT B;  2G2Y A;  4J9S A;  2ZH3 A;  4NWB A;  2ZHB A;  3LPY A;  1YHQ S;  5IS2 A;  1XR7 A;  1S79 A;  3NWR A;  1UZH A;  5E5N A;  3SIP B;  1YZ7 A;  3QT5 A;  2GO8 A;  2R4F A;  3OUY B;  1U2R A;  2W1B A;  4GKK J;  3GCW P;  4DOZ A;  2QTW A;  3NKY A;  4PYA A;  3PW4 A;  1HBM B;  5FLX Y;  4DSF A;  3QWP A;  3LP2 B;  4EBD A;  3UVJ B;  4X4T A;  4DV3 F;  3BN7 A;  1H98 A;  2XMT A;  3PVX A;  2FLP A;  4TLQ A;  1XMB A;  4F36 A;  7FD1 A;  2B0G A;  4JI2 J;  4LFA J;  3JQJ A;  3K2Y A;  2GZO A;  3VZH A;  3BYR A;  2KN4 A;  4GKJ F;  1YX2 A;  1FT8 A;  1F6T A;  2B51 A;  3TVY A;  4LR7 A;  3QFW A;  3KLF B;  1FFS B;  2VOD A;  1RAH B;  2J9D E;  2AKW B;  2DEI A;  4FXV A;  1X5P A;  4WII A;  1CC7 A;  3QFH A;  1SIW B;  2X1A A;  2KYX A;  2WVC A;  3CCL S;  4AND A;  4QWD A;  2FQQ B;  2Q79 A;  3MR7 A;  1CS4 A;  5HQL A;  3HZG A;  2MKK A;  3W2W B;  3LO3 A;  3QGG A;  4DQI A;  1YWX A;  1Q81 T;  4ZVR B;  1RT6 A;  3KLE A;  3TVZ A;  2KYZ A;  5DS7 A;  2NS1 B;  4UQG A;  3CE8 A;  1QE1 B;  2YWK A;  3I4P A;  3R8Y A;  4W90 B;  2WSF C;  1EP4 A;  3EGN A;  2B8P A;  5ETV A;  4FF3 A;  2FHM A;  2C3Y A;  2RRN A;  1NJY A;  4ED6 A;  4RNO A;  1T3O A;  1MU2 A;  5KOX A;  1V9O A;  1N36 F;  1S59 A;  1I6J A;  1SI9 A;  4RUA A;  3D0G E;  1S6O A;  4ZPA A;  1SV5 B;  3V6H A;  2MTL A;  2BXJ A;  4EGL A;  4Y3C A;  3RB6 A;  1D9F A;  1SB6 A;  1NKE A;  5J1N A;  1M5K C;  3HHN B;  4DPX A;  3ITH A;  3H5S A;  4CRJ A;  3BB5 A;  2QSF A;  3Q8V A;  1OWX A;  3KKF A;  1IBL J;  1RAB B;  1SKR A;  3DRX A;  1UJ6 A;  5DG7 A;  5F8I A;  2UXC F;  1VRU B;  2JLE A;  1S6P B;  2W2Q P;  3DFE A;  4OZ0 A;  3BQ0 A;  2L08 A;  2KO1 A;  4FS1 A;  4JYA F;  1UA1 A;  3W9J A;  3BGU A;  4X62 F;  2CAJ A;  1Q5Y A;  1N4L A;  4USW A;  2IA6 A;  3ZXW A;  3KHH A;  3CMA S;  3SV4 A;  1D8Y A;  2JEG A;  2B3T B;  3U7J A;  2VFR A;  1K1S A;  4P74 A;  4I7F A;  4JV1 A;  2C28 A;  2QGF B;  5LM7 E;  2AMC B;  5HMW A;  1PAU B;  1WTF A;  1WC6 A;  1Q53 A;  4YR2 A;  1KVJ A;  5KG1 A;  1S1U B;  4NML A;  5LMU F;  1S10 A;  2FHJ A;  1NSK L;  4DV4 F;  2R2S A;  4MJK A;  2CFX A;  3GIL A;  2ZH4 A;  1EET B;  2HFU A;  3IWX A;  4B9L A;  3PG9 A;  1TKZ A;  5AXL A;  2R7T A;  3R9L A;  1J5O B;  3TNV A;  1RT5 B;  1NPP A;  2DY1 A;  3BR8 A;  3PW0 A;  1WOR A;  2R3V A;  4IDK A;  3PNI A;  4LQ9 A;  3PW7 A;  2P9C A;  2AF6 A;  2AX0 A;  2XZW A;  5IM0 B;  1YVF A;  3CWJ A;  4PUO A;  2XEX A;  2VQE J;  3OTE A;  1KR4 A;  3DOL A;  3FGV A;  5BYQ A;  3DLH A;  2JEJ A;  1FJG F;  3QAU A;  3KK3 B;  2AIR B;  3M30 B;  2B4O A;  4DMZ A;  3IN5 A;  2DNO A;  2HWH A;  2OTL S;  1N33 J;  3I5B A;  3KK1 B;  5IT9 Y;  3I9V 9;  4KHP F;  2ROE A;  3RBD A;  2K2P A;  3BDP A;  4MK7 A;  3QGH A;  2RDJ A;  3O6Q A;  3PW5 A;  4ECX A;  2UVW A;  1FKO B;  1U0H B;  1HNZ F;  4NE9 C;  1X8D A;  1Y4Z B;  3H20 A;  4ZP8 A;  5DQH A;  4K4U A;  2N7C A;  2P2C B;  1YI2 S;  5LJ3 Y;  2HW3 A;  2KFN A;  1S6U A;  2XGP A;  4DQS A;  2F63 A;  3RYL A;  4OHV A;  2F3J A;  3BYP A;  4OHX A;  2PI5 A;  1ZBT A;  2WVB A;  3VAM A;  2K1R B;  3D68 A;  3T3F A;  2RKI A;  3TAN A;  5HMZ A;  4CO2 A;  3KNG A;  1MRO A;  3MR5 A;  2D3O R;  3H2L A;  1SQF A;  4Y2K A;  1JKH B;  4X4P A;  4CO1 A;  1P9Y A;  1HYS B;  3NS6 A;  2ZVS A;  2ZH9 A;  2GMH A;  4NI2 A;  4ED7 A;  3M6U A;  3GYG A;  1RWN B;  4KRW A;  2W7O A;  1GAO A;  1IKY A;  4K4X A;  1QTM A;  4BLG A;  4GKK F;  1VBX A;  2V4J B;  2GAG C;  3C14 A;  2GQC A;  3AB2 B;  3R3T A;  4ICL B;  2CUY A;  2YNG B;  1KWM A;  1GMU A;  1RHJ B;  2EBE A;  1S9G A;  5ETO A;  4JI2 F;  4LFA F;  4HH0 A;  4UST A;  2ZHO A;  2AU0 A;  1D0E A;  2AQ4 A;  1DY3 A;  2M88 A;  4TQS A;  1I1G A;  4X4N A;  4USH A;  1JLC A;  2LVW A;  1F2G A;  4DCO B;  3BSC A;  3CCQ S;  3PRB A;  4OI2 A;  4A8S A;  4X4S A;  1G1X A;  3CDE A;  3PIP Q;  3Q23 A;  3TVK A;  1FRH A;  2O5D A;  1YSJ A;  4LF7 J;  3OV7 A;  2W7P A;  1Y7P A;  5F41 A;  2EFQ A;  1XBW A;  3SQG A;  3G6E S;  1JLA A;  3KMS A;  3VAL A;  2VPX B;  3JSB A;  1QDU B;  1FFG B;  4RL1 A;  1GEH A;  1U6Z A;  3TJ8 A;  2ZZM A;  1CSJ A;  3M1V A;  4YEA A;  2I1R A;  1NJI T;  3MAA B;  3TUZ C;  4RW6 B;  2RF2 A;  1RUS A;  4C8O A;  1VMB A;  2VFT A;  1IWG A;  2ZH6 A;  5HAN A;  3FSX A;  4ZPV R;  4KV8 B;  3B8H A;  3DRR B;  1RYS A;  4LSN A;  1LKZ A;  2HND A;  4IKA A;  4ZCL A;  5D15 A;  2W9C B;  2X1F A;  4IG0 A;  1PG5 B;  3MUV P;  4DV7 J;  1V3R A;  1T9Y A;  3BO4 A;  1KOH A;  5F8J A;  1Y9O A;  2UVR A;  3D7S B;  3LAN A;  2B8Q A;  1T8E A;  2FGO A;  4F67 A;  1IBL F;  1RT3 B;  5K14 B;  4LR9 A;  1LEO A;  2CJY B;  2GA7 A;  2DIS A;  1S9E A;  5E2Q A;  5ETP A;  1TK0 A;  3KFW X;  3BH7 B;  2XMK A;  1HNX J;  1DBD A;  4ALZ A;  3EDQ B;  4YN3 B;  5KFS A;  4DN0 A;  2VHG A;  4CLZ A;  3AQO A;  3MUR P;  2HS3 A;  3W60 A;  3NNA A;  2C3P A;  4NLD A;  2Z2M A;  3OHB A;  2H4W B;  1U1L A;  1IKW B;  2MKS A;  4DQR A;  4G1Q A;  1I51 B;  2DNH A;  2FZK B;  2GCF A;  1H0H B;  4OYO A;  1N5Y B;  2ZBC A;  2YWW A;  2A0F B;  4RUC A;  2CPX A;  2G13 A;  3RBX A;  3JSM A;  4UW2 A;  4PQA A;  2ZNY A;  5D78 A;  2B9Y A;  2BDP A;  3KLI B;  4TU9 A;  4RPF A;  4Z7Y A;  4ZPT R;  4YR3 A;  5E3Q A;  5GAD U;  4C0H A;  1FNX H;  4DS4 A;  3WHI A;  1EHW A;  1SIZ A;  3CCZ A;  4PG6 A;  5ETN A;  3L9Z A;  1NKC A;  4B3S F;  1B7Y B;  1TU0 B;  1NHU A;  3W62 A;  1L3V A;  1S1V B;  2OML A;  2AT1 B;  4N8O A;  4UOH A;  5DRK A;  3LP0 B;  2RQ4 A;  3CCE S;  2CJK A;  3CCM S;  3CJ0 A;  4ECZ A;  1YBU A;  5DQI A;  2VQE F;  1FVQ A;  5T7L A;  3ET6 B;  4ID8 A;  2M8H A;  1X4E A;  5F8H A;  1JLF B;  2D7S A;  1DAR A;  3KJQ B;  5J2Q A;  1TKX A;  3QO9 A;  4P71 A;  2DIV A;  2EW9 A;  4HI2 A;  2YH0 A;  3HLU A;  1T05 B;  1IM6 A;  4HH1 A;  2KZZ A;  1LK5 A;  5LL6 d;  3SEO A;  1N33 F;  5F3T A;  2CQG A;  1R8H A;  1LW2 B;  1YRU A;  4X84 A;  3N5F A;  2HS0 A;  3NP5 A;  2VG5 A;  4X65 J;  4HEA 9;  4CT9 A;  3QAT A;  3A3N B;  1R7I A;  3CF5 Q;  4LF8 J;  4MFB A;  3VF0 B;  2DR7 A;  5LSO A;  2D69 A;  4MYU A;  2YH1 A;  4QIE A;  3MED A;  5IT0 A;  7AT1 B;  3ZNJ 1;  2VC1 A;  2VPY B;  2MST A;  1ZA1 B;  2WOM A;  2HQI A;  1X5T A;  3DLE A;  1RAJ A;  3CCJ S;  1YIT S;  5CYQ A;  2V8P A;  2GVD B;  3POT B;  3PKM A;  1EQ0 A;  2G2Z A;  3C3L A;  5AJ3 J;  1KBR A;  3EPI A;  2W2M P;  3H7H B;  3P5B P;  1N34 J;  1SH0 A;  2ZBR A;  4WYW A;  4GO7 X;  4I2P A;  2L3M A;  4KBI A;  4WTO B;  4YY3 J;  3OL8 A;  3QJL A;  4HHU A;  4RWW A;  1JLG A;  1X4B A;  2F4F A;  2CJX B;  1RDR A;  4OI3 A;  3BKT A;  4PAA A;  4K2J A;  2JRS A;  3HHL C;  1RHU B;  2WVD A;  5C24 B;  3T6B A;  4CWB A;  5FLX U;  3Q86 A;  2DT9 A;  4AYB D;  3NGD A;  1YJ7 A;  5DGB A;  3KJV B;  4USU A;  1HFE L;  4DCP B;  3D5M A;  4B9T A;  3TUI C;  3FQK A;  1U7L A;  4RZR A;  1LWC B;  2ILZ A;  3KDN A;  4ZVQ B;  1T3N A;  2IVF B;  2QN6 B;  1U25 A;  2HQG A;  4YUD A;  2DPJ A;  1RTD A;  2E1M C;  1WEX A;  4DZ6 A;  1CJT A;  1IBC B;  5JMN A;  2RH3 A;  3LAL A;  1H2V Z;  3HHL A;  3NNC A;  3M2V A;  2F4V J;  3CD0 A;  2QA4 G;  2HRT A;  1AYE A;  2CDR B;  4WU3 A;  3SSQ A;  3CJ4 A;  3C6U A;  5H1S V;  4CNZ A;  1P1T A;  3O8W A;  4LF7 F;  1CUL B;  3WZ0 A;  3D3B J;  2E5L F;  3KOA A;  3QSI A;  4CO0 A;  1HL6 A;  4EBC A;  2RE1 A;  4B17 A;  3E51 A;  5FII A;  4GC6 A;  3Q22 A;  1H38 A;  3T5K A;  4C11 B;  5DM6 Q;  1HHT P;  1FRI A;  1G3O A;  4DR2 J;  4IFV B;  5LT5 A;  3V81 B;  4OHY A;  2IC3 A;  4URQ U;  3W8G A;  3IS9 B;  2M52 A;  5DZ7 A;  4DV7 F;  4ZVP B;  4DU7 A;  5G4D A;  4Y2C A;  3CC2 S;  2HMI A;  3RRG A;  1NSQ A;  3UDL A;  2R7V A;  4ZCI A;  1WSR A;  1XMQ J;  1S48 A;  3AOD A;  2YQ1 A;  3TEG A;  2QLF B;  1IR0 A;  3FVY A;  3BGR A;  1Q78 A;  5L1K A;  1HNX F;  2CPY A;  3FNN A;  4MKB A;  2LDY A;  5LXR A;  1XC9 A;  1IBM J;  2IAJ B;  3CD6 S;  3DDK A;  3PJX A;  4OX9 J;  4W4M A;  4AQY J;  2YKN B;  5D4P A;  1MML A;  2FC8 A;  2DNM A;  4KTQ A;  4IUF A;  2W8K A;  1JQG A;  4DV0 J;  2IYI A;  2IRU A;  3DRP A;  4CTA B;  3BV8 A;  3FSI A;  1MG7 A;  4K0K F;  2OPR B;  4IOA Q;  4PG4 A;  2OI2 A;  3GFY A;  1VQN S;  3W63 A;  3SSS A;  3LGH A;  1K1Q A;  1RWW B;  4YME A;  2R2R A;  1RTH A;  1RAC B;  1YJ9 S;  1VFJ A;  4DR7 J;  2LQJ A;  2HVD A;  5EUH A;  5D0R A;  2LEA A;  3OQ2 A;  1N6Q A;  2UXB F;  4F3O A;  3DM2 B;  6AT1 B;  2DGU A;  1RT4 A;  4O0I A;  2BJ1 A;  2CPI A;  1W2B R;  4RUB A;  2OEL A;  3M6V A;  1SC6 A;  2OSR A;  5CYM B;  1B3T A;  4DL3 A;  3L4B C;  1HR0 J;  4I2Q A;  1IXK A;  4EYI B;  2YX7 A;  4B3O A;  2DB1 A;  2WCX A;  1B64 A;  2MZQ A;  4TQR A;  3J7Y U;  2H54 B;  4K4T A;  2DCL A;  1B0V A;  3HSG A;  5A8K B;  1Y00 A;  3DLK A;  1GXT A;  4MIB A;  4X65 F;  2CQI A;  2LMI A;  3M8Q B;  1WG5 A;  1PGZ A;  5GVQ A;  2QT7 A;  4LF8 F;  3D3C J;  1K47 A;  4DFM A;  3VAH A;  1SJQ A;  3KWM A;  4DLE A;  3GIK A;  5B0G A;  2M9K A;  1FNO A;  5IOL A;  2XSJ B;  3GE9 A;  4OJG A;  2J76 E;  1L3S A;  2NXE A;  1HA1 A;  3B82 A;  1UPP A;  3C16 B;  1VHI A;  3UN3 A;  1S6Q B;  3H90 A;  1PKU A;  3KMQ A;  3QRQ A;  3D1Q A;  2C3O A;  1WI6 A;  1SC1 B;  2Z30 B;  4JI8 J;  5AJ3 F;  2YKP A;  4QWE A;  4ENO A;  3M6X A;  3ZZP A;  4O23 A;  2NR0 A;  3R5C A;  1N34 F;  2ZZN A;  3N6N A;  4FYY B;  3T41 A;  2J8S A;  2CJB A;  3TWZ A;  2EK1 A;  2E1A A;  1CPZ A;  4ZLL A;  5F8L A;  2X3D A;  2MZJ A;  2IMO A;  4PCQ A;  1X9W A;  1ACM B;  2DIT A;  4I68 A;  4EO6 A;  2HBZ B;  2ATL A;  5J2P A;  1NB2 A;  3HM9 A;  5KFC A;  2FB0 A;  2I0X A;  4KO0 A;  1U0S A;  3SMZ A;  4PXD A;  3HVR A;  4NXM J;  1KS2 A;  2XNQ A;  2KKH A;  3I82 A;  4FS2 A;  3WIV A;  3CJ5 A;  3HXM A;  1KP6 A;  3BBF A;  4JBC A;  3IBW A;  3LA0 A;  2ROP A;  3GV8 B;  2CWK A;  2D9P A;  2BBE A;  3IWN C;  1SCJ B;  2EI5 A;  4BBY A;  3VVT A;  5KG5 A;  3HD1 A;  5HL7 Q;  4C6A A;  3DNC A;  5CHC B;  3N0V A;  4DSJ A;  3NEK A;  4ILL A;  3TX0 A;  5L38 A;  4IR1 A;  3GWC A;  3HHL D;  1A6L A;  1D1U A;  2F4V F;  1NPK A;  1NO8 A;  1S4E A;  3ENA A;  3MDF A;  3CJT A;  3BKF A;  1KLM A;  5ETQ A;  1DLO B;  2WBM A;  4IFY B;  3OTB A;  2OH2 A;  1X4C A;  2KT3 A;  3UN5 A;  3DLB A;  1MLA A;  2UP1 A;  2HLU A;  3HVA A;  3JAM U;  4M5N A;  1Y5I B;  3MCM A;  4MMO A;  1RKJ A;  2DGT A;  1IM4 A;  4NCA A;  2UXD J;  4DCJ B;  4BS2 A;  3K58 A;  4DR2 F;  5IWA F;  5KFG A;  2Y1J A;  5ITH A;  1YRX A;  2L48 A;  1NK4 A;  5D4O A;  1L5U A;  1J5E F;  1HI8 A;  2BZ2 A;  3DGV A;  5K5M A;  2LXF A;  3EXC X;  2AP6 A;  1LWE A;  3PFE A;  1S7I A;  4ELT A;  1BUX A;  1XMQ F;  3V4M A;  3ADA C;  3ULH A;  3DHW C;  5C42 B;  4DL2 A;  2DY9 A;  1VRT B;  2OFH X;  2OPQ B;  3RAQ A;  3BSO A;  1RTJ A;  4MKV A;  2M0G B;  4RNN A;  1IBM F;  3EDR B;  4IH5 A;  4LBH A;  5EN1 A;  2ZOF A;  3ENQ A;  2ZBP A;  4OX9 F;  3IRW P;  1VK8 A;  3EX7 B;  1MWQ A;  2ZBQ A;  2XYP B;  3UW1 A;  5DZ6 A;  3V6J A;  4G65 A;  1JXL A;  2HFV A;  5HLF A;  1YLX A;  4DG1 A;  4P72 A;  2YQ3 A;  4MKA A;  4DV0 F;  2RQK A;  3HT3 A;  4DHV A;  1P6T A;  3AD9 C;  3RAX A;  4M8L A;  3CJS A;  2HUR A;  1TL4 A;  1OY8 A;  3LGM A;  3SZ2 A;  2XC9 A;  1BMQ B;  4GVL A;  2HHP A;  4KE5 A;  1RKI A;  4KH0 B;  3Q8Q B;  4YDX A;  2FGC A;  1ZZN A;  1RCX B;  2PDA A;  4DL4 A;  5D3G A;  1JIH A;  3M2R B;  2Z4P A;  1X0P A;  1HMV B;  4ZVE A;  4ZP6 A;  2IVY A;  4DR7 F;  5KFN A;  2FTR A;  3UVJ A;  1EKS A;  3Q0A A;  3RW6 A;  3ILJ A;  2ZH7 A;  3EZ5 A;  4WFY A;  4EO8 A;  2D9O A;  2P9E A;  1E6V B;  1FDN A;  4A47 A;  3EZO A;  2WW4 A;  3CPW R;  1S5Z A;  2JLG A;  2QLX A;  1HR0 F;  2V8D A;  3S7R A;  3SBM A;  3EXY A;  3OJS A;  5BYR A;  2E1P A;  4ZK7 M;  2AGP A;  1NH7 A;  2J9E A;  3QIP B;  2HNY B;  4RW4 B;  3ZTP A;  2POK A;  4OZ2 A;  3GSD A;  2BMB A;  1PIE A;  2QEX S;  2R8K A;  3ZZ0 A;  4FDF A;  2XS5 A;  1YQH A;  5B0C A;  5IZH A;  5GAE U;  1E6Y A;  1UJ4 A;  5JVG Q;  3W2W A;  2BAN B;  4USJ C;  1Y3K A;  3NBP A;  1HHS A;  3PDN A;  4AXJ A;  1JMT A;  1CG2 A;  2J0W A;  2ZM6 J;  1RXO B;  2DNL A;  5KT5 A;  2C3M A;  3GSI A;  4ZLJ A;  2PD1 A;  2V8H A;  1M1H A;  3ISZ A;  4C3L A;  1V3S A;  1BQN B;  4FYD A;  2EXU A;  5E3C A;  4CH7 A;  3K5L A;  1NDC A;  3RB3 A;  4GMK A;  3CED A;  1NZA A;  2DNQ A;  1RP5 A;  1SV5 A;  2HK2 A;  2VOO A;  4ZIV A;  1R27 B;  1F5B A;  3KUH A;  1SC4 B;  3O2I A;  3FEZ A;  4F04 B;  4U6P A;  3GPA A;  3KNA A;  2OEM A;  3KK2 B;  2PMW A;  1VQO S;  3U27 A;  1LOU A;  3K5O A;  2OAU A;  3LWL A;  4ZA1 A;  2NCK L;  2DO0 A;  1S6P A;  2KJW A;  5IC4 B;  3MM8 A;  3C2P A;  3C66 A;  3VQT A;  2M4M A;  3C15 A;  1CJV B;  4DJB A;  4CLF A;  1WHY A;  2W8L A;  2ZE2 A;  4F2S A;  1W2I A;  4NLX A;  2E66 A;  2COL A;  3TEH B;  4DSL A;  4ZVH A;  2GGP B;  2CQ2 A;  1BC6 A;  4DR4 J;  4R5P B;  3EVM A;  2RB7 A;  2ZH1 A;  3T1H J;  3MMB B;  3DRS B;  4R8U B;  2D74 B;  3SCK E;  1S1U A;  2J0X A;  5KT7 A;  1LFP A;  1FDD A;  3H2V E;  5GME A;  3BEG B;  3WC2 A;  1TUV A;  5E33 A;  2PFF B;  4P73 A;  3A4T A;  2IBK A;  2DD8 S;  2JC0 A;  3H4D A;  5A0Y B;  4GVB B;  3PX0 A;  1J5O A;  2YX1 A;  1RT5 A;  1WC4 A;  4GC7 A;  3MZI A;  1VDH A;  2MKY A;  2R8J A;  4Y65 A;  1SKW A;  1AT1 B;  2W4D A;  4RU2 A;  1QLN A;  5IM0 A;  2W01 A;  1HBO B;  1W25 A;  3OTD A;  4EEY A;  2UU9 J;  4JI4 J;  4XK8 C;  3NMA A;  5KFD A;  2BAB A;  2GQQ A;  3N6M A;  2UXD F;  1QY7 A;  3FMW A;  2AGO A;  5C2C A;  1C2P A;  4LSZ B;  1WC3 A;  1GT8 A;  3M30 A;  4K59 A;  5HN0 A;  2I6W A;  2KFY A;  3NL0 A;  1VRQ C;  1NSA A;  4ID5 B;  4DPT A;  3PRV A;  2JX2 A;  1Q16 B;  4ZDN A;  1FX4 A;  4DPO A;  2Z8Q A;  3SFG A;  4JI5 F;  5HVG A;  4TXS A;  2QE5 A;  3GFX A;  3RZA A;  4OI4 A;  1U0H A;  2CPJ A;  3CJ2 A;  4M5L A;  3HDS A;  5KFH A;  4NA3 A;  1FE0 A;  3W5Z A;  2OMO A;  3G86 A;  1F9F A;  1VJW A;  3DRY A;  3OXG A;  3HF5 A;  3MTJ A;  3M8P B;  7FDR A;  1FEE A;  1QSL A;  2FVQ A;  4L72 B;  1KVK A;  3DYA A;  2IY5 B;  1QUP A;  4A8Q A;  5EWF A;  3B4M A;  4CNY A;  2UUB F;  1UWB B;  2RU9 A;  4JV0 A;  1S72 S;  2PMZ D;  3UDC A;  1XTZ A;  4USV A;  4K4W A;  3LP1 B;  1BQM B;  2L9D A;  2OUG A;  1U1R A;  2N4D A;  2K1R A;  2M3D A;  2CG4 A;  5DJB A;  2CQC A;  3X1L B;  4M5M A;  1P27 B;  2WON B;  1KQG B;  4I4B A;  4RLE A;  2BAC A;  4O44 B;  3T5L A;  2IPO B;  2C2R A;  4ZIW A;  2MQP A;  4QR2 A;  3EIC A;  1ITP A;  2MB0 B;  3NGS A;  3EVW A;  1O51 A;  2ZC3 A;  1PSD A;  2K3I A;  1V3Z A;  2U1A A;  3BR9 A;  3VR1 A;  3KLH A;  1XNQ J;  4LR8 A;  1W7W A;  5JUM A;  5DQG A;  3W65 A;  3LPE A;  3R5G A;  1NLK L;  3L09 A;  2GIQ A;  2HZC A;  1H73 A;  2QC3 A;  3MMJ A;  3H98 A;  2Y0B B;  4FZV A;  1F9E B;  3JYT A;  4QBU A;  2V8G A;  5H9E J;  1VC5 A;  5IQQ A;  4ZHR A;  1M5H A;  2BKN A;  4ICL A;  1R0A B;  3K5N A;  2YXL A;  1LW0 B;  4HKQ A;  4QYR A;  2JC1 A;  4U8Y A;  4WXW A;  2RD5 C;  4WF9 Q;  1AA1 B;  2Z2Y B;  2ROG A;  1VQL S;  1FFW B;  2J9C A;  3DMJ B;  3AD7 C;  2LA6 A;  3GFZ A;  2Z58 B;  4A8X A;  1UWA A;  3GIM A;  4U9R A;  2KM8 B;  2HZV A;  4IOC Q;  4PG8 A;  3IRX A;  4PWW A;  4DR1 J;  1UKU A;  2JLF A;  1YK9 A;  2R2U A;  5G0R B;  1PYT A;  4NEZ A;  2BOA A;  3B78 A;  3R27 A;  3M32 B;  1M90 T;  4A8K A;  2AEF A;  1VIS A;  2BJ3 A;  3MM5 B;  2APO A;  4PKD B;  3WX8 A;  1FTR A;  1NND A;  3IGV A;  4WYL A;  5HBM A;  4DF4 A;  4QWA A;  1HW8 A;  2VD3 A;  5HMY A;  3MM7 B;  3J7A 1;  2ZM6 F;  1PC4 A;  4RW6 A;  3GZ7 A;  2R7O A;  3DC2 A;  1GH8 A;  4Q0B A;  4KV8 A;  2VG6 B;  1TL3 A;  4Y00 A;  4TN2 A;  1NK6 A;  2ZJP Q;  3TQE A;  5JXS A;  3RR7 A;  4MYT A;  2H4Y B;  5K9F A;  2W9C A;  3BRE A;  3Q8S B;  2NXC A;  3A13 A;  1FKP A;  1U2F A;  4M1K A;  3Q2T C;  1NXI A;  3LF0 A;  3NCP A;  1GMV A;  4RW7 B;  4HT5 A;  1DQA A;  2HVE A;  1HBU A;  1UTA A;  2MQM A;  3PEJ A;  3WC0 A;  5I3U B;  2BE2 A;  1XJW B;  2XSF A;  2B6A B;  3O3L A;  1EKR A;  4F50 A;  4W92 B;  5KG3 A;  2DGX A;  1AXQ A;  4DQQ A;  3TZX A;  1JLB A;  4N7T A;  1IKW A;  3NGR A;  3SYZ A;  4KY3 A;  2C2N A;  3TJA A;  4O4G B;  3BBB A;  1FO1 A;  1P8G A;  1HPZ B;  3FEY B;  4RBU A;  4NCG A;  4Q2L A;  2EFP A;  4DR4 F;  3AOC A;  2BX6 A;  3F73 A;  1AUS L;  3P45 B;  3CC7 S;  3T1H F;  4QW9 A;  2WAQ D;  3PJ9 A;  4QW8 A;  4C7Q A;  3OT9 A;  1X4H A;  4JV2 A;  3AAW B;  1Q7L B;  2DIU A;  3NAI A;  3U1L A;  1CJK B;  3JTN A;  1T02 A;  4OYB A;  2BRK A;  3V4I B;  2JH3 A;  3W1Y C;  2WTF A;  2GV1 A;  4YS2 A;  5DG8 A;  1X5O A;  1TL1 B;  4LF1 A;  4UQT A;  3PR5 B;  4ZN3 A;  8RUC A;  4ANE A;  1MWZ A;  1IQT A;  3VGT A;  4LF6 F;  1RB0 A;  3OTC A;  2UU9 F;  1FX2 A;  4JI4 F;  2B5J B;  1WJ9 A;  5HAO A;  3D2W A;  2FHO B;  3RRH A;  3CD7 A;  3ET6 A;  3IM9 A;  2QYC A;  1JLF A;  1Z4U A;  2B4U A;  1IKX A;  2F40 A;  2HYI B;  4L76 A;  3M2U A;  3TUJ C;  1S1T B;  2V5H G;  1FJE B;  2OSQ A;  1U1M A;  1LW2 A;  1JLE B;  4DPU A;  4K4S A;  1FE4 A;  1LQ9 A;  4RWX A;  4FF2 A;  4P6Q A;  4K5R A;  1WOP A;  4LRE A;  2OPS A;  3AXK A;  3VZI A;  3NRB A;  1UJ5 A;  2LQB A;  2DTJ A;  1YJT A;  4B3M J;  3IM8 A;  3MOZ A;  3WX4 A;  2K06 A;  1Y0H A;  1F5A A;  4ZCK A;  3J81 Y;  1BHN A;  2GVD A;  3POT A;  1UVI A;  4USM A;  4D3G A;  4QWC A;  4Z37 A;  3FK4 A;  2JEI A;  3DOM A;  3DOK B;  3QJJ A;  4KHR A;  3UI3 A;  5DDO C;  3MOJ B;  5BJR A;  2RQC A;  3PX6 A;  3QZ8 A;  4KQZ A;  3R7B B;  2ZBI A;  2A2D A;  2I8E A;  4NRU A;  2VU5 A;  4F7V A;  3PKY A;  4U7U K;  2G2O A;  5F8G A;  1XNQ F;  2AD9 A;  5C24 A;  4FYW B;  2ACY A;  4U67 Q;  3WIU A;  1T9T A;  2MXY A;  3KJV A;  2DH8 A;  2C2M B;  1C1B A;  3MD1 A;  4CLS A;  5KFF A;  1RU2 A;  1K0T A;  4UF4 A;  3P8B B;  2DHG A;  1UVJ A;  3G4S S;  4P2F A;  1GX6 A;  4O3P A;  5J1P A;  2CYY A;  1RT6 B;  1KKH A;  1RHK B;  3RTV A;  1VR6 A;  3PYD A;  1TMM A;  3KG1 A;  1NRK A;  1RTI A;  4Z7C A;  3ENV A;  4M95 A;  2XZD B;  2MHE A;  3CW2 C;  4OZ3 A;  4PXC A;  1MU2 B;  3G87 A;  1NDL A;  3T6J A;  2PEB A;  3DI6 B;  2DR9 A;  2UZA A;  1ELO A;  1PYO B;  1R8P A;  1RK8 A;  1SH3 A;  5I3P A;  3ITH B;  3H5U A;  5AXN A;  1CUL A;  3IGN A;  2RQM A;  2IDL A;  1N32 J;  1FWK A;  1S99 A;  3VCD A;  1DTT A;  3AOA A;  1YZ6 A;  1RAD B;  2YNI B;  4NRT A;  3ZTS A;  4X64 F;  3V6D A;  1TUW A;  3R6G B;  2IHR 1;  4OYI A;  4F26 A;  1WEL A;  2C42 A;  4WE1 B;  1N54 B;  1RA6 A;  3DLG B;  2HWT A;  1URN A;  3VVU A;  3PX4 A;  5I4M A;  4CLU A;  4QWB A;  3RJM B;  2MY8 A;  2R42 A;  3UCU P;  2V6A A;  5KT2 A;  3G2X A;  3HHK A;  1O0P A;  2HQD A;  1S0V A;  2BQR A;  2AYE A;  4I7F B;  3BS9 A;  2J5A A;  4DQP A;  3CB4 A;  2HVZ A;  4NLY A;  2WSE C;  1ZPW X;  1RWM B;  3MCO A;  3VAJ A;  1NK0 A;  1EX8 A;  2VIH A;  5ADZ A;  2DXD A;  4OYW A;  2K7J A;  3AFG A;  2IAJ A;  2DHA A;  5IC6 B;  1FA0 A;  2MQ8 A;  3TAM B;  2YKQ A;  1PC5 A;  3ONQ A;  2ZH8 A;  2YKN A;  2HAF A;  2BV3 A;  4H4O B;  1KVI A;  3VAG A;  2XCP A;  1UW4 A;  4J37 A;  5A2Q Y;  3GON A;  4NLS A;  1QD1 A;  4IDK B;  4PYD A;  2CKW A;  2GHW A;  3ILL A;  3PV8 A;  1U1N A;  3M4X A;  4ZKA A;  4PUO B;  2LCW A;  1YBA A;  3GR0 A;  4CTA A;  2AJQ A;  4DDF A;  1UZD A;  3DOL B;  1Q82 T;  3R7N B;  1UET A;  1KQF B;  4J9Q A;  1REV B;  3GLJ A;  3CME S;  2ADB A;  1VOM A;  3V6K A;  4OV6 A;  1FJG J;  3FUY A;  1NJW A;  1JWW A;  2QFJ A;  1SQE A;  4ZJL A;  1F60 B;  3DM2 A;  4HTJ A;  1TEL A;  2GQ2 A;  1WC0 A;  3LQV A;  1NAQ A;  1IVZ A;  4DSE A;  2AX1 A;  2IBO A;  4NAS A;  5CYM A;  3W61 A;  1R31 A;  1JB0 C;  4DF8 A;  2CQ4 A;  4AL5 A;  2FZC B;  3FCV A;  2LKZ A;  2QYG A;  3C19 A;  1YIJ S;  2RRA A;  5KAK A;  3NOC A;  4K4Y A;  1NZ8 A;  5B0D A;  4Y34 A;  1RWX B;  4RNM A;  5F0U A;  1QVG R;  4CO5 A;  5CD4 H;  4B9V A;  5A8K A;  2KJV A;  3SXL A;  3DU5 A;  1KHV A;  2SXL A;  2XMV A;  2D3O 1;  2XMM A;  5L1J A;  1NBE B;  3M8Q A;  4ZIT A;  4IQM A;  4TYB A;  1Z2L A;  1PJ7 A;  1T9W A;  3MR6 A;  2XLI A;  5KT6 A;  5GAD I;  2L41 A;  3NGK A;  2HIQ A;  4IO1 A;  4OIX A;  4LIW A;  4OV1 A;  1WHV A;  1G4C A;  4ERD A;  2RT3 A;  3C16 A;  2ZOG A;  1VQ5 S;  4V19 J;  4N41 A;  4B3M F;  1FXD A;  3MEC A;  1S6Q A;  4WP3 A;  3T1A A;  2G4B A;  2FJW A;  3N9U C;  5RUB A;  1PCA A;  3EPG A;  3S6E A;  4UOF A;  3VGV A;  2Y8Y A;  3PJW A;  3BDE A;  2MLZ A;  4M5J A;  3QJP A;  2JJ4 D;  4TNO A;  2GHP A;  5C25 A;  4NX9 A;  3RBZ A;  2NZC A;  3JSY A;  3H2U B;  4ELU A;  4URS A;  2Z2Z A;  1S9G B;  4MH8 A;  5LMN J;  5E3A A;  4IRD A;  5D4L A;  2UV8 G;  3AT1 B;  2O1P A;  1AUD A;  2V2K A;  4X4O A;  2XLJ A;  2B4V A;  2FZG B;  2CA9 A;  3R97 A;  4C8N A;  3FBB A;  1JLC B;  4PG7 A;  1DQ8 A;  3D54 A;  4XDD A;  4EZ6 A;  5DLF A;  4OZL A;  2QA4 S;  2HWI A;  1ZET A;  1C4C A;  3L7O A;  1TMJ A;  3I87 A;  3SCL E;  3QID A;  5LXY A;  2MLY A;  5IXU A;  2M7S A;  2VH7 A;  4KAI A;  3CXC R;  1HNW J;  1ZZF A;  2FUG 9;  4YQW A;  4WJB A;  1RHM B;  1TV6 B;  1YJN S;  2K7K A;  1DZ5 A;  3CD5 A;  2MDA A;  5A76 A;  1JLA B;  2XY7 A;  1WDD A;  3M1V B;  1Q95 G;  1N0U A;  1EB0 A;  5SUH A;  2AHO B;  2RF2 B;  1U47 A;  4WFX A;  3TR5 A;  1FDB A;  1DAX A;  4DZD A;  2B56 A;  3GR1 A;  2HFO A;  4LSN B;  2K8G A;  2W9B A;  2E1R A;  3KDO A;  4LSL A;  3IR6 B;  4ECR A;  3R5A A;  4J9N A;  2JL9 A;  4LRA A;  3W7B A;  1RLC L;  3D28 A;  1N32 F;  1F3F A;  1QAY A;  4CCH A;  2RUG A;  1RA7 A;  2IJN A;  3FFI B;  3ILI A;  3S01 A;  1TZ0 A;  2CPH A;  3FC9 A;  2F7V A;  1S1X A;  3CIZ A;  4R25 A;  4DUY J;  1RI7 A;  4JI3 F;  1OIA A;  2E1C A;  2MY7 A;  3MF5 A;  1C1C B;  5A8R A;  2F5G A;  3K5P A;  3OD2 A;  4DL6 A;  3DDN A;  4LF5 J;  3IBF B;  4HHH A;  2YWG A;  2MHN A;  3K17 A;  4O3O A;  1H2T Z;  2QRR A;  3ZZT A;  2GVZ B;  2VOP A;  1S9F A;  2W2N P;  1NEE A;  3CJ8 A;  2HBY B;  5HRO A;  5E3R A;  1VBK A;  3P3D A;  5E41 A;  3IR5 B;  2OPQ A;  1TUG B;  1ULR A;  1UVL A;  3S1T A;  5J2N A;  5ETL A;  4IH6 A;  4DFP A;  1GMW D;  1KD1 T;  2QFI A;  2DHX A;  4ES1 A;  3G82 B;  4MK9 A;  2FJB B;  5K8O A;  1ZAV A;  2Q6C A;  2QIF A;  2XO7 A;  4NLR A;  2KT2 A;  4FVM A;  1VLO A;  4Q44 A;  5HI7 A;  3TI0 A;  2CXE A;  4DPY A;  1WI8 A;  3IMQ J;  4B3S J;  2R8H A;  1SL0 A;  2OEJ A;  2KXN B;  1S49 A;  2HPU A;  5EX0 A;  4P2S A;  2CQH A;  2ATC B;  5F3Z A;  1LWF A;  1ZM3 A;  4BCA A;  4Y2I A;  3FCW A;  5J2Q B;  3QO9 B;  3UCZ P;  4H4K C;  2FPH X;  3IXQ A;  1WNE A;  4KFB B;  1VS3 A;  5SZT A;  1MMN A;  5B08 A;  4EZ9 A;  2DR8 A;  3AD8 C;  3D6T B;  5DLG A;  2IYG A;  2VG5 B;  2WVE A;  3T5H A;  4OX8 A;  2KB2 A;  1KLN A;  1DTQ A;  3A3P B;  4ED0 A;  1VI7 A;  3L3C A;  5CCM A;  2VON A;  4ZVT B;  1G7C B;  3MED B;  3RRK A;  4HAC A;  1KRP A;  1YJR A;  2XLK A;  2RAQ A;  2W24 A;  1N0V C;  1NPR A;  4P9S A;  1IN0 A;  3DLE B;  2C2K B;  2VV5 A;  5CYQ B;  2C2O B;  1UPM B;  3NLC A;  1U26 A;  1UAW A;  2MGZ B;  4DU8 A;  3BQ1 A;  2O66 A;  4I2P B;  3D6H B;  3OSP A;  4FF1 A;  4ZLP A;  1NU4 A;  2MQQ A;  2IM0 A;  3TZZ A;  3MR2 A;  2BAN A;  4WU2 A;  3SQO P;  4RW8 B;  4J9U E;  3W64 A;  2G1D A;  3GFH A;  2ZFH A;  3B6B A;  3J81 U;  4G1P A;  3VTI A;  4K50 A;  3A8K A;  1BQN A;  3FBF A;  4LF2 A;  1K73 T;  1CJU A;  2DNP A;  4YOE A;  2PI4 A;  2HQF A;  4X4R A;  3HVT A;  5IV3 A;  3GYN A;  2XI2 A;  1RE1 B;  3GB0 A;  4H54 A;  1U49 A;  1XQI A;  1PO6 A;  3KTQ A;  1K9M T;  3KUG A;  4AE5 A;  4NZ7 A;  2LDI A;  2OEK A;  1R8B A;  4MK8 A;  5L9N A;  5LMN F;  4CLT A;  1CJT B;  4ED4 A;  3J7Y I;  2YKA A;  1KON A;  4F4A A;  1V6H A;  2O3D A;  5HVF A;  5GAH U;  1R8A A;  2KH9 A;  4C48 A;  2NPI A;  3M2V B;  4C2M A;  1IBK J;  3PHT A;  2P8I A;  4M5D B;  1APS A;  4TY9 A;  1CJV A;  1D8Z A;  5BYS A;  3FMB A;  4KB7 A;  5K8N A;  3UR0 A;  3PAC A;  3C6U B;  5HP1 B;  1FVS A;  2IM2 A;  3F41 A;  1HNW F;  4OLP A;  2Y3Y A;  2GGP A;  3N6L A;  1HWL A;  5DET A;  2V67 A;  2QSW A;  4MTP A;  4X66 F;  3TX8 A;  2E5L J;  3MMB A;  1X31 C;  1WKL A;  2BYC A;  1SUQ A;  4N76 A;  1FJC A;  4PEO A;  3L7U A;  1FWL A;  3Q8U A;  3F44 A;  4RNH A;  3N28 A;  4DWI A;  3JAM Y;  1D9A A;  2RVJ A;  3CC4 S;  3X3U A;  4WKY A;  2IC3 B;  2Y1I A;  2HGN A;  4ECQ A;  4GVB A;  3EVO A;  1TL7 A;  3CO0 P;  2V2Z A;  2HMI B;  2XS2 A;  1VC0 A;  4ZJO A;  1W26 A;  3GQC A;  2NYI A;  3G96 A;  2L9W A;  3QT8 A;  1HAR A;  1WHX A;  4NYP A;  1HD1 A;  5LSR A;  1HBO A;  3EE3 A;  3M8Z A;  1QSY A;  3THT A;  4DUY F;  1X7V A;  2B7B B;  1A9N B;  4F4X A;  4CH1 A;  2QA2 A;  2AJ0 A;  2RJZ A;  4NLV A;  4A8W A;  1U09 A;  4LF5 F;  3G71 S;  5CA5 A;  4OMF G;  2YWE A;  4ID5 A;  1YJU A;  2DCU B;  1FK9 A;  2M5Y A;  3RAM A;  1WTB A;  4KGZ B;  5L1L A;  3IR7 B;  2ZD1 A;  2V34 A;  2MZ1 A;  3DRP B;  1S77 D;  1FES A;  2HHS A;  4HDH A;  5BR8 J;  3MCN A;  1UCN A;  1F3V A;  1FXR A;  4EYH B;  1VQ7 S;  4FXW A;  2D3U A;  4E98 A;  3RGI A;  3NAH A;  4A8O A;  1GXU A;  5HK4 A;  4HLB A;  4K0K J;  4C8L A;  3E8O A;  5A2Q U;  4K4V A;  3NG8 A;  5M2R A;  4J9M A;  3DXS X;  2HSE B;  1RTH B;  2OGU A;  3FSY A;  2HBQ B;  2Y9H A;  2EPI A;  2XWY A;  2MKI A;  2QJ3 A;  3MM9 B;  3DU6 A;  1KFS A;  4EFA C;  4GRS A;  3JSR A;  1OY6 A;  5AXK A;  4W98 A;  4ECV A;  5HQM A;  3AHP A;  1RT4 B;  3MM6 B;  4O44 A;  1WOS A;  4WFB Q;  3L7P A;  4UZC A;  4WFN Q;  5HQ8 A;  2BKP A;  1RT7 A;  1F9H A;  5KFB A;  2OD4 A;  2E9Z A;  2UXB J;  1Z2Z A;  1FRJ A;  2KRB A;  2LEP A;  3RBE A;  4I6A A;  2RDI A;  5D0G A;  2KHC A;  1XNR J;  4QIW D;  3RW7 A;  2OPP A;  3PYG A;  1BE4 A;  4Q43 A;  2EFG A;  3I5A A;  4LBI A;  1C0U A;  4PWD A;  2F9J A;  1S0M A;  2CPD A;  3IG1 B;  2C22 A;  4UY8 5;  1QAI A;  3RB0 A;  2DH7 A;  2VL1 A;  1X4A A;  5I42 B;  5J2M B;  1C0T A;  1R8C A;  1AFJ A;  1AZS A;  5B0A A;  1H7X A;  4WKR A;  1ROF A;  3DMJ A;  2LXU A;  5IV4 A;  4PWU A;  3JQK A;  3PW2 A;  1T03 A;  1R6V A;  2YNF B;  3MUM P;  4J9O A;  2FY8 A;  4ECS A;  4K2X A;  2VBY A;  2OTJ S;  1LFW A;  4PPZ A;  3P49 B;  4DL7 A;  3MR3 A;  2KVI A;  5D8H B;  3MFH A;  4CO3 A;  4XPE A;  5KG6 A;  1SXL A;  4YP3 A;  2H5J B;  3MM5 A;  2RHQ B;  5ETM A;  5F0W A;  2NUU G;  2XGQ A;  3IP0 A;  4DLG A;  2Y0S D;  4MKY A;  1PIL A;  4CI0 B;  3UD4 P;  2V50 A;  3PO5 A;  5A8W A;  4YB1 P;  3K57 A;  4FYX B;  3MMA A;  2H48 B;  4FPR A;  4KO0 B;  1KC8 T;  4AUK A;  1U4B A;  1O8B A;  2YPY A;  4NOH A;  4DS5 A;  2XHC A;  2ZWO A;  2CNK B;  1WC1 A;  2VKR A;  4FVC A;  4LFB J;  4C3K A;  4J9K A;  4UY8 T;  4RW7 A;  1ARO P;  2LQ8 A;  3MEG A;  3QLH B;  5M2P A;  2P6S A;  4ZPD A;  1EAY C;  2WBR A;  2DPI A;  5KOW A;  1TAQ A;  5I3U A;  5T14 A;  3EGZ A;  1IBK F;  2OP5 A;  2B6A A;  2MJN A;  2V94 A;  1EZZ B;  3PZP A;  5GAE I;  4QPX A;  4M5I A;  4O3R A;  4JUZ A;  1JNR B;  1RJJ A;  1V5I B;  4EUV A;  3A8I A;  4B3T F;  1IUJ A;  4FKY A;  3NWG A;  4O4G A;  4NL5 A;  1RBA A;  1RWP B;  2EG2 A;  1Y10 A;  2PT0 A;  4J90 A;  5C7P A;  4Z2X A;  4J9V A;  5CD4 A;  3FRY A;  4RBV A;  3FJ2 A;  4UT4 A;  1RBO B;  2H5I B;  3BN4 A;  3OFG A;  3Q8Y A;  3FQL A;  2J0Q D;  4F25 A;  2HNZ B;  1VQS A;  2BUN A;  1Q4R A;  4USI A;  4PXE A;  2LYV A;  1SKS A;  2E7W A;  1CJK A;  3HP6 A;  5KFE A;  2IIH A;  4FKX A;  1CQM A;  2ASY A;  3BM7 A;  4OLO A;  3I32 A;  5IWA J;  2JEF A;  3FDS A;  4ANC A;  3R6L B;  1HNI B;  1HQ2 A;  4C4W A;  1J5E J;  2ZKU A;  5EWG A;  2DVI A;  1UVN A;  2ZWP A;  3PFO A;  3MWB A;  3D66 A;  4KGK A;  4U8V A;  1SH2 A;  2VKZ G;  4Y28 C;  3IWL A;  5FD1 A;  3UN2 A;  4MIW A;  4CLK A;  1C4A A;  2ZZT A;  2CQP A;  5DDR C;  3HFK A;  2ERR A;  2H65 B;  5T41 A;  1JLE A;  4CM0 A;  1RGV A;  2PA8 D;  1S1W A;  3EWG A;  4L3K A;  3D6M B;  1S97 A;  3TAP A;  2HFS A;  2X1G A;  3ZO7 A;  4YR0 A;  2YKM B;  1CBK A;  4F0M A;  5BR8 F;  1RT1 B;  2GJF A;  4L3N A;  2LU2 A;  4CDI A;  2ASL A;  3CCT A;  2HFZ A;  5CQG A;  3W2V B;  3D0H E;  1OS5 A;  3D0I E;  5D3G B;  2BJ7 A;  1NDK A;  4TU8 A;  4RU9 A;  5GMD A;  4IH7 A;  4DL5 A;  4ECT A;  4ZP7 A;  2PMH A;  4P2X A;  1WHW A;  3SV3 A;  2B43 A;  5CAA A;  3DOK A;  1SJ3 P;  3FBC A;  4LVN P;  3NS5 A;  2VQF J;  4YHH J;  4PR6 A;  1JJ2 R;  3OBI A;  2AZ3 A;  2E44 A;  1ZM4 A;  3FZB A;  2E9T A;  4DV6 J;  1LK7 A;  3FZ2 A;  4F2R A;  4MIA A;  4HI1 A;  4LFC J;  1D3W A;  4WFA Q;  1XNR F;  2R7Q A;  2CJ9 A;  3PHE A;  1EIY B;  2FLO A;  1N5V A;  3MPY A;  5D6G A;  3KHL A;  1NDP A;  2A10 A;  2ZIT A;  2VJU A;  4IO9 Q;  4OZ1 A;  4FXD A;  1HKA A;  2UUW A;  1U45 A;  4C8Z A;  1QJH A;  4C3M A;  3VGU A;  1Q86 T;  1Y5N B;  1JNZ B;  2JDJ A;  1L3T A;  1DJ0 A;  4KGX B;  1E6Y B;  2YBV A;  4DR3 J;  4LVO P;  2O67 A;  1RT2 A;  1D09 B;  4KKO A;  3NBP B;  2W7A A;  4N8N A;  1PYS B;  1Y3J A;  1KEK A;  3CGI A;  2BR0 A;  3QT7 A;  1RQ0 A;  3M05 A;  1HQU A;  1LNQ A;  1K0V A;  3NNH A;  4XO0 A;  1KHW A;  2ALY B;  2BKO A;  1ZPV A;  2HHT A;  1HWJ A;  3DI6 A;  3PR4 A;  4NEY A;  4QU7 A;  2D3Z A;  3ILO A;  2KFZ A;  3H25 A;  1FWP A;  4OHZ A;  4FF4 A;  1VJQ A;  2VUG A;  4BHQ A;  3OVS A;  4RNF A;  4PZV A;  3UPF A;  4KR0 B;  2F9D A;  3Q2S C;  2I5J B;  4HVZ A;  2DR6 A;  2YNI A;  3OL9 A;  1HNV B;  2G0I A;  4TYA A;  1DFD A;  1KN6 A;  2AW0 A;  3ZTO A;  3O5T B;  4WE1 A;  3MM8 B;  2X1B A;  4Q8E A;  4U7U D;  3G9C A;  2LLZ A;  4QIF A;  1RZM A;  3DLG A;  3C15 B;  1KSP A;  2ADC A;  3OR2 A;  4RW9 B;  2ZE2 B;  4AL7 A;  2J7K A;  3KG4 A;  2XYG B;  3G6Y A;  4AFF A;  3PTW A;  4TU7 A;  2CG8 A;  5M2U A;  4LFB F;  3CTR A;  3QT6 A;  5KFI A;  2GML A;  3BO3 A;  3WDO A;  4X4V A;  5KFK A;  2XM3 A;  2DHH A;  5KFX A;  3MGJ A;  1OO0 B;  2PN6 A;  3MFI A;  3I6P A;  3CJK B;  3N4W A;  4C8K A;  1OY9 A;  2VA3 A;  2FC9 A;  2DRD A;  5MLC V;  3MPD A;  4XIU A;  4EBE A;  1GK8 A;  4DR6 J;  3TAM A;  4K4Z A;  4A4J A;  1RAE B;  2RML A;  5IT4 A;  3I4H X;  3F56 A;  4DV2 J;  3DCA A;  5EHH A;  5H9F J;  4H4O A;  1WWH A;  4PAB A;  3OFF A;  5D0H A;  1Q0N A;  2MLX A;  2N82 B;  5LSL A;  2F1F A;  1CQN A;  5CZX A;  3W5Y A;  1G6B A;  3H5Y A;  4TLR A;  2GO9 A;  3FEX B;  6FD1 A;  4YFU A;  2QLB B;  3MPW A;  3EYZ A;  5CAB A;  2CPE A;  4UOC A;  4J9R A;  2ZH2 A;  4DL0 C;  3AJD A;  2N3O A;  2Z57 B;  5J1E A;  3KJN B;  5K8P A;  1AW0 A;  4ATN A;  1REV A;  1QSS A;  2CJQ A;  4K8R A;  3QPI A;  3Q8R B;  3V2U C;  1XK8 A;  4JI0 F;  2XBP A;  4UUW A;  4WCE Q;  3W8P A;  3K5M A;  4JI5 J;  1YJV A;  5C5J A;  3ZNU A;  2ZHA A;  4QR1 A;  1PBA A;  3HPO A;  3DYA B;  2HHU A;  2HBR B;  3LH2 S;  3P96 A;  3C6T B;  1RWK B;  3I0S A;  3MAH A;  4L73 A;  1GTH A;  4URG A;  2MPU A;  3TZW A;  4XDC A;  2XY5 A;  5H9F K;  4F4W A;  2UUB J;  4IRC A;  4JOU A;  4KIA A;  1QTN B;  2C3U A;  3AY0 A;  2WK4 A;  4E2F B;  1NK5 A;  4ZS6 A;  3CT9 A;  4OYA A;  1WAC A;  1FHT A;  3TYT A;  4WZQ A;  2BA9 A;  1HBN B;  3OR1 B;  3KLH B;  1KTV A;  3HD2 A;  1G2E A;  5KG0 A;  3M8R A;  4B08 A;  2VF3 A;  4OJH A;  2VPZ B;  4I67 A;  3HX9 A;  4F3M A;  2D1C A;  5L1I A;  3OUY A;  3OHA A;  2N3L A;  4G6V B;  3JYT B;  3KXD A;  3B4D A;  4ZHR B;  4ED8 A;  1M5O C;  1HBM A;  2VQF F;  3LAM A;  5D77 A;  4YHH F;  5GAG U;  6FDR A;  3LP2 A;  2Z56 B;  1BWE A;  2R9L A;  3K59 A;  4DV6 F;  1MN7 A;  1S76 D;  5U47 A;  1FRK A;  3L95 X;  1RWO B;  2NSC A;  1TR0 A;  1WUU A;  1Q8L A;  4LFC F;  5JJB A;  1JXV A;  4CM2 A;  4G3I A;  1VLY A;  3CCR S;  2BJD A;  2MZS A;  1FER A;  3QYY A;  3IRX B;  4QJV A;  5KFA A;  4NA1 A;  1MW7 A;  1RAO A;  3SI8 A;  3KLF A;  1FF2 A;  2DNK A;  3MUT P;  4WXO A;  3JS9 A;  4OHW A;  5F9N A;  2GX8 A;  2NXN A;  3GV5 B;  2E5I A;  2JNJ A;  3H4B A;  3AA9 A;  4DR3 F;  5AT1 B;  5CZV A;  1TV6 A;  1ZM9 A;  1AFI A;  4AXI A;  2OO4 A;  1KQS R;  2O01 C;  4J5O A;  5HBM B;  1YDL A;  3PY8 A;  1A7G E;  1R43 A;  4ZVG A;  3E01 B;  3H42 A;  3Q89 A;  2W4P A;  3OSN A;  4CLP A;  2DYA A;  3U02 A;  4UZB A;  4Q0B B;  4MAK A;  2DO4 A;  2V4Q A;  1QE1 A;  4IG3 B;  1Q1K A;  4ZP9 A;  1TL3 B;  2IRX A;  3GG0 A;  3NCR A;  3BGO P;  3FBE A;  1EAR A;  4ILM A;  2VDI A;  9RUB A;  3BSN A;  3H5X A;  4Y2M A;  1QVF R;  1ZAX A;  5L9X A;  1OMS A;  2CZV C;  1FKP B;  3PYE A;  2WVF A;  1S7H A;  1HI0 P;  2IM3 A;  3FFI A;  1EQM A;  4JI1 J;  2F65 A;  1HBU B;  3GU0 A;  1TVR B;  1HWU A;  3AB4 B;  3N5B A;  2KXH A;  2BE2 B;  1C1C A;  3G8S A;  3R2C J;  2H3E B;  4YB5 A;  3I55 S;  1VHF A;  3CDW A;  1VRU A;  4HYK A;  4OZJ A;  3JB9 k;  1JLB B;  5I3Q A;  3D6F B;  4LMZ A;  2DK2 A;  2CAD A;  2GVZ A;  2FJA B;  3TAQ A;  1IR1 A;  3OL7 A;  4NCG B;  1SJ1 A;  4CIO A;  2HGL A;  3TP2 A;  2GW8 A;  4NYZ A;  5K20 B;  2B9X A;  3O1L A;  2KG0 A;  3DGP B;  3GTY X;  3VAI A;  1FNM A;  3I5C A;  2BRL A;  2PFD A;  2NZ4 A;  3LAK A;  3BO2 A;  1TKD A;  3CO9 A;  2AZ1 A;  3G82 A;  4N77 A;  2FHJ D;  2I2Y A;  4V1A k;  5C2G A;  3BJY A;  4DR6 F;  2IDE A;  2YY3 A;  3IAS 9;  4DV2 F;  3W5X A;  2YNH B;  1RBL A;  4QU6 A;  2XMU A;  1EET A;  1VC6 A;  1YTY A;  4AT1 B;  3A8E A;  2J7U A;  2VDH A;  1WDT A;  3UFC X;  3CVK A;  3CIM A;  2C2E A;  1VQM S;  3PXG a;  5HJY A;  3TA2 A;  2G0J A;  1XER A;  4O3N A;  2M2B A;  1GTE A;  1F2H A;  2AJ1 A;  2ZJQ Q;  4LF6 J;  2E9R X;  3HSJ A;  2EBG A;  4WIQ A;  1IKX B;  3M2U B;  2GNK A;  4KFB A;  4ZLN A;  2FD2 A;  4FBU A;  1RAF B;  2L9N A;  3NGT A;  2LEC A;  3KK3 A;  2Z0G A;  4FPI A;  2FLL A;  3P6Y C;  3A8J A;  3P4U B;  1TFW A;  2XMJ A;  3KK1 A;  1NHV A;  2UUC J;  1NSP A;  1TP7 A;  2KTQ A;  1HQE B;  1HW9 A;  2OPS B;  3GCX P;  1FKO A;  1QAJ A;  1BY9 A;  3OL6 A;  3QGP A;  3DLL Q;  4C0O C;  1NK7 A;  3KLG B;  1F0X A;  1UVK A;  4PQU B;  4J9L A;  1NK8 A;  1U8S A;  1UEV A;  5ETS A;  4DFJ A;  2HVH A;  2LQ5 A;  3LTO A;  3UD5 A;  2J6T A;  3UCG A;  4FNI A;  2MGZ A;  3MMC B;  3HO1 A;  4HR2 A;  2RIL A;  3I96 A;  1SQG A;  1SPB P;  1VQK S;  3MXH P;  1JXE A;  3DOM B;  1WEZ A;  2W9A A;  5LJ5 Y;  5EDW A;  4IYQ A;  4I6W A;  1LV5 A;  2EG1 A;  3SDE B;  2V9K A;  1IJE B;  2BM1 A;  2N4C A;  3NCQ A;  1TK8 A;  2CRL A;  2JWN A;  2DRB A;  2LU1 A;  4OYP A;  2DNN A;  4CLY A;  3IBC B;  4BWM A;  4B9M A;  9ATC B;  5DG9 A;  2QA1 A;  4KJI A;  4RW8 A;  3TZY A;  3TUP A;  1B99 A;  4H4M B;  2J6U A;  1JKH A;  5THW A;  2VG7 B;  1HYS A;  1Q5V A;  3MTK A;  2D41 A;  4X4Q A;  2RU3 A;  1BGX T;  1U6F A;  1OYE A;  3I0R B;  1C1B B;  2P5V A;  4M5K A;  1ZTW A;  1SC3 B;  2JVR A;  3BKU A;  5HVH A;  2ZNZ A;  3QBC A;  4RKU C;  1P9Q C;  5AE3 A;  4S0M A;  2V4J A;  1N88 A;  3ZZZ A;  3U1N A;  2B9E A;  3A12 A;  4Y2A A;  2GMJ A;  4NYO A;  3JTO A;  2CWX A;  5B09 A;  2FJV A;  2YNG A;  1RWU A;  3ICL A;  5KG7 A;  2ZOM A;  4B02 A;  1RTI B;  2B4P A;  1N56 A;  3OPK A;  2QX0 A;  1MNE A;  5L8R C;  5A6W A;  1IKV B;  4ZPC A;  2A3J A;  4M5D A;  3OLA A;  1GQE A;  3CUN A;  4C97 A;  2OFG X;  2V8V A;  4EI2 A;  2W2O P;  4YB7 A;  3TQ1 A;  2R7S A;  2CJA A;  5GMK a;  2KZM A;  5HP1 A;  4UTG A;  1S0O A;  3SCI E;  2C1E B;  5IFM A;  3W9H A;  4KH1 B;  1X4D A;  2MQN A;  4USK A;  1DTT B;  1RAI B;  3QRR A;  3QGI A;  3V6D B;  3THV A;  2XYH B;  2BM0 A;  1WEY A;  1FKA F;  3RB4 A;  3VAK A;  3MAA A;  4ED3 A;  4X64 J;  4HL9 A;  1TKT B;  4JV5 J;  2DGV A;  2R7W A;  1U1K A;  4OX7 A;  1LXN A;  3CCW A;  1FXL A;  3DRR A;  3G8Q A;  3HKW A;  4FBT A;  4CYU B;  3QZ7 A;  3GIR A;  2DRA A;  5H9E K;  4I56 A;  4DX8 H;  5MAO A;  4DUT A;  4JB8 B;  4J7C A;  3GYX B;  3R7S B;  5FDL B;  4JI1 F;  2ZC4 A;  3TRG A;  4CO4 A;  3BF4 A;  1JLQ B;  4ZVU B;  2E7V A;  3MEE B;  4C98 A;  2XMA A;  2ACM A;  3M9M B;  3ZFV A;  2XS7 A;  1RT3 A;  2E5G A;  2FVP A;  5K14 A;  1SJF A;  4ZMM A;  4DN9 A;  5HMX A;  5KFM A;  5HSP A;  2FY1 A;  1Y5L B;  1FCA A;  1YGY A;  3TO8 A;  4F02 A;  3IFE A;  4DX7 A;  3K8V A;  2H1Y A;  5L39 A;  1TTH B;  3M9O B;  2HGM A;  4BDP A;  1QM9 A;  2LFV A;  5KFR A;  2EKN A;  2ZEJ A;  1YJW S;  1MWY A;  1N5Y A;  2XQC A;  4NZ6 A;  3H40 A;  2MKH A;  1R3N A;  3GMG A;  4OZ5 A;  5HO4 A;  2VA2 A;  4WBF A;  1BD6 A;  2DGQ A;  2Y1R I;  1L3K A;  2OJ3 A;  4M94 A;  1SBR A;  1I5O B;  2AJ2 A;  1UFW A;  1TAU A;  3KLI A;  4X4U A;  1UL3 A;  3MEK A;  2A18 A;  2RRB A;  1WKK A;  1XEZ A;  3MM9 A;  1ZS6 A;  1U8W A;  2WHO A;  2X51 A;  1S1V A;  3MM6 A;  4I64 A;  2DKO B;  2C2D A;  2B9W A;  3DKD A;  5ETT A;  2ASJ A;  3T1Y J;  1NUE A;  4WK1 A;  2ZVI A;  3LP0 A;  4HHJ A;  2OHD A;  2XHW A;  2DEJ A;  4NLP A;  1RLD A;  3D1O A;  3MAQ A;  3JQM A;  3D1H A;  3EMT A;  4AL6 A;  5IT9 U;  3PRD A;  2BOP A;  2BE7 D;  1N52 B;  2LQ9 A;  4EMD A;  2BE9 B;  2AV5 A;  4TKT A;  2AYB A;  1WG1 A;  2XB2 D;  1T05 A;  2VBZ A;  2CPZ A;  3IG1 A;  4WFZ A;  4UUX A;  3J81 j;  2IFX A;  1PAE X;  2OD6 A;  1Z1Z A;  3K89 A;  1DRZ A;  2FHK A;  4TY8 B;  2UUC F;  3LGN A;  5I42 A;  5J2M A;  1PJ6 A;  4ZCM A;  1NH8 A;  4C9D A;  1VQY A;  4N56 A;  3ZZU A;  3BPS P;  5BXI A;  3HHD A;  2NXJ A;  3HK2 A;  3CMQ A;  2IM1 A;  2P6T A;  1OPI A;  3LUY A;  1FD8 A;  4KGM A;  1VQ9 S;  4OJ3 A;  1R89 A;  1KOO A;  5K8M A;  2KT5 A;  5KFJ A;  3MEC B;  3ETM A;  2YNF A;  4NCB A;  3IO1 A;  5KFT A;  4KYZ A;  3J7A N;  1SKU B;  2W25 A;  3T19 A;  1DQ9 A;  3C46 A;  2HHX A;  4DX6 A;  1KDN A;  4TVA B;  3TA0 A;  4QQB A;  1HIY A;  5C25 B;  4BC9 A;  4KHM A;  1ZM2 A;  4YY3 F;  1XR6 A;  2CQ0 A;  2KHD A;  2N7Y A;  2PEH A;  3SCJ E;  3HI9 A;  3KLV A;  1F1B B;  2P9G A;  1JJC B;  2JHE A;  1U1P A;  1OPZ A;  2K3K A;  1U02 A;  3E3X A;  3IC1 A;  4OL8 A;  2QLW A;  1SL1 A;  8AT1 B;  3BBC A;  4NLQ A;  3VHQ A;  1MSW D;  3QQC D;  1K8A T;  2WRM A;  3AQP A;  1VQ6 S;  3ENW A;  1XWL A;  4ECU A;  2RNE A;  3HVW A;  4R0E A;  4Q2M A;  1JX4 A;  1U6B A;  5KFQ A;  4NPO A;  1LWC A;  5FJ4 A;  1SJR A;  1M5S A;  2BJE A;  2NXU A;  1CS4 B;  4DEZ A;  4DR5 J;  2AJ4 A;  2ASD A;  3QLH A;  4DUZ J;  5CYJ A;  4CT8 A;  2MEW A;  4U96 A;  2J6S A;  2MKC A;  3KLE B;  2VJV A;  3GJQ B;  2QMX A;  4P7V A;  4RO0 A;  3EZU A;  1EP4 B;  2W9B B;  4LSL B;  4NLG A;  1SVD A;  2J8A A;  2GIF A;  1RU1 A;  1HWK A;  3AJ2 A;  1O5J A;  2E29 A;  4CLW A;  3US5 A;  2V2V A;  2XUL A;  4NLW A;  2QMU B;  4O0N A;  4DI6 A;  4KGV B;  2LP4 A;  2LXI A;  3OFH A;  4ES2 A;  2XZT B;  2AWZ A;  3SFU A;  1VQP S;  1S12 A;  2ZDP A;  2CDQ A;  1S1X B;  2V2Q A;  5B0B A;  3UQS A;  3SSR A;  2HNZ A;  2VBW A;  3OXL A;  4J91 A;  2EFN A;  1RSC A;  1J27 A;  3M7V A;  3OW2 R;  5A8R B;  2LEB A;  4NMX A;  4F3Q A;  2AYG A;  4JV5 F;  1QUV A;  4JI3 J;  4C11 A;  1I3O B;  2CVE A;  4NLO A;  4Q45 A;  2EC0 A;  3G6X A;  4P75 A;  8ATC B;  1VGY A;  1HNI A;  4IFV A;  3V81 A;  3VV2 B;  4DBQ A;  2NLW A;  3MI7 X;  2YKO A;  3R2D J;  2QV6 A;  2HEK A;  1UMJ A;  2QMW A;  2FIU A;  3IS9 A;  4L74 A;  1NK9 A;  5HRO B;  3CJ3 A;  2PGC A;  5GAH I;  1OQ3 A;  2E5J A;  2ALZ A;  1ZA2 B;  2F8E X;  1BLU A;  2W2P P;  4RUH A;  1VYA A;  5J2N B;  2IRY A;  2QG9 B;  3NGU A;  2GJ2 A;  3EJM A;  3I9Z A;  4NLT A;  2B7C B;  1Q7Y T;  4NZ0 A;  3FCH A;  4Q5V A;  2PSZ A;  4P2M A;  1FD2 A;  1GMW A;  2J9D A;  3EM1 A;  1WKJ A;  1OQ6 A;  1S4F A;  4B9N A;  2VBX A;  3JXO A;  1EJ7 L;  4AQY F;  2VB6 A;  2UVV A;  5F8N A;  4M63 A;  2Q66 A;  3DHX A;  2DGW A;  1Q8K A;  5DO2 A;  4O3Q A;  2AEM A;  1TKZ B;  4LIR A; 
#chains in the Genus database with same CATH homology
 1RWK B;  1RWO B;  3GJS B;  2QL9 B;  4DCO B;  1PYO B;  2FQQ B;  3EDQ B;  3R7B B;  2H5I B;  5IC6 B;  3R5J B;  1RHR B;  3SIP B;  2QLF B;  1SC1 B;  2H48 B;  4ZVT B;  1RE1 B;  3D6M B;  3QNW B;  2H4W B;  1RWV B;  1I3O B;  4ZVR B;  2CDR B;  2QLB B;  3KJQ B;  1QTN B;  4JB8 B;  1RWN B;  1I51 B;  2Y1L B;  2H51 B;  2Y0B B;  3R7S B;  1F9E B;  3P45 B;  2QLJ B;  1QDU B;  4ZVU B;  2C2M B;  1RWX B;  2CNK B;  2CJX B;  3R6G B;  2QL5 B;  1RHU B;  1PAU B;  3EDR B;  2C2K B;  3KJN B;  1NME B;  2XYG B;  2C2O B;  4ZVS B;  1SC4 B;  2DKO B;  3GJQ B;  1ICE B;  2H4Y B;  3R6L B;  2H54 B;  2HBQ B;  3IBC B;  2XYP B;  3D6F B;  2P2C B;  3NS7 B;  3R7N B;  4DCP B;  2HBZ B;  3RJM B;  2C1E B;  2CNN B;  3IBF B;  1RHJ B;  3D6H B;  2C2Z B;  1RHM B;  1RHK B;  4ZVQ B;  5IC4 B;  5K20 B;  4DCJ B;  3P4U B;  1GFW B;  2H5J B;  3GJR B;  2XZD B;  4ZVO B;  3KJF B;  2XZT B;  2CNO B;  2XYH B;  2CNL B;  1RWM B;  1RHQ B;  4ZVP B;  1SC3 B;  4LSZ B;  1RWP B;  3GJT B;  2QL7 B;  1IBC B;  2HBY B;  1BMQ B;  2HBR B;  2CJY B;  2H65 B;  1RWW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...