4ZVUB

Caspase-7 wild-type bound to the caspase-6 cognate tetrapeptide inhibitor ac-veid-cho
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
93
structure length
93
Chain Sequence
b'YKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-7
publication title Reprogramming Caspase-7 Specificity by Regio-Specific Mutations and Selection Provides Alternate Solutions for Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 18
structure length 93
sequence length 93
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2015-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 4zvuB00
1RHJB 3RJMB 1SC4B 2CNLB 4DCPB 1RE1B 2H51B 1RHUB 3NS7B 2C2ZB 3KJQB 4JB8B 2CNKB 2Y1LB 2CNNB 1RWOB 2XYPB 3IBFB 1RHRB 2C2OB 2H5JB 3IBCB 1RWXB 2H65B 1RHKB 3R7BB 4ZVOB 3R5JB 3D6HB 3P4UB 2P2CB 2QL7B 3EDQB 1QDUB 2CDRB 2QL5B 2FQQB 2XYGB 1RHMB 5IC4B 2HBQB 2C2KB 1RWNB 3R6LB 1IBCB 1I51B 1PYOB 1RWMB 2QLJB 3D6FB 5IC6B 3R7NB 2C2MB 1PAUB 1BMQB 3GJQB 2H4YB 2QL9B 3QNWB 4ZVTB 4DCJB 1GFWB 4ZVPB 3SIPB 2C1EB 2H48B 3KJFB 1NMEB 4ZVQB 3R6GB 3D6MB 2CNOB 1RHQB 1RWWB 4DCOB 4ZVRB 3R7SB 3GJSB 2Y0BB 3P45B 2XYHB 2HBRB 4ZVSB 1RWVB 4LSZB 3GJRB 3KJNB 1F9EB 2XZDB 2XZTB 1RWPB 1SC1B 2CJYB 3GJTB 2H4WB 2DKOB 3EDRB 2HBZB 2QLBB 4ZVUB 5K20B 1SC3B 2HBYB 1QTNB 2H5IB 2QLFB 2CJXB 2H54B 1ICEB 1RWKB 1I3OB
chains in the Genus database with same CATH superfamily
1NPRA 1RBAA 1KFSA 2M8HA 3H5YA 4JUZA 4OV6A 2AJ2A 1WF2A 3LGNA 2NR0A 3V81A 3AA8A 5KFBA 3KLHA 1RHKB 2K1RB 3EDQB 2F7VA 3MUVP 1M1KT 2NXCA 1F9HA 2RQMA 4C3MA 1QUPA 1RWNB 2UXBF 4ILRA 4DUZJ 4CO3A 3QYYA 3FBBA 5J2QA 4GC7A 1M90T 3MM5B 3U1LA 1YJ9S 2HZVA 4C3LA 3WC2A 1IQTA 2KHDA 4KHPF 3DRRB 1NDCA 3LP1A 8RUCA 5A8KA 3RRGA 1T03B 1HNVA 1RADB 2QMUB 5KFSA 1NUEA 1QVGR 1PJ6A 4UT4A 3C2PA 2GMLA 4EU0A 1FE0A 1FXRA 1N4LA 2ZBRA 4LJMA 4WXOA 1S6PA 5IWAF 4GKJF 3DFEA 2C2EA 2JNJA 3GIJA 1YIJS 1NNDA 1JIHA 3C66A 2QLFB 4L3KA 3MOJB 5D4PA 4OI6A 3M2RA 2YH1A 2ATCB 3CJKB 1RB0A 1Y0HA 4WP8A 4DEZA 2BW2A 4K4WA 2RS2A 2UVRA 1GAOA 1KVIA 1YG0A 4A8WA 4RU2A 3M7VA 4PUOB 1CLFA 1S1UB 3PJWA 1VHFA 4DFPA 4KFBB 3D1HA 3ENAA 1WC4A 2JEFA 5JMNA 1IM6A 5EGYA 2FY1A 4ZP7A 4OX9J 3KUEA 4B17A 1TKXA 2NUUG 1VISA 5THWA 1E6YA 1PCAA 1BD6A 1KOOA 3ELHA 1T9YA 2KFNA 4NA3A 4QZVB 1FXDA 5B7WA 2COLA 1UJ4A 4O3QA 2J9DA 3B78A 1RAOA 2GIQA 2RQ4A 2RMLA 3GR1A 1X5PA 2VG6B 2PA3A 2ZJQQ 1GTHA 2Z8QA 1NCLA 2ALZA 2XGQA 1IVZA 1WJ9A 4FKYA 2CQBA 4ZJOA 4PUOA 3DLEA 3SMZA 3SV4A 4KFBA 4N7TA 2F8EX 1WDTA 1N34J 2FJEB 3TEGA 4L72B 3BPDA 3EZOA 2EVZA 2DNKA 1R43A 5ETMA 1U0SA 3GV7B 1FK9B 3U02A 4O0IA 1AFIA 4DR4F 2MMYA 4F3OA 2O01C 3BKTA 4X4TA 5C25B 3U27A 1YDLA 3HVWA 4ITSA 4ETXA 3HVRA 2WONA 2XLKA 2VG6A 3M6WA 2OSRA 1KVKA 3X1LB 3C8YA 4MYUA 3A8IA 3GPAA 3SCKE 3GQCA 2KFZA 4KGZB 3J7A1 2N7YA 1HNXJ 2QSWA 1YBTA 2Z56B 2ZKUA 4M1KA 3RBXA 2MHEA 5J1PA 4V19X 1D8YA 1TK8A 2QSFA 3N28A 2M88A 2UUBJ 1ZAWA 5J1EA 3HVAA 1UFLA 3K17A 1RKJA 4DL0C 4RW4B 3IAM9 2RB7A 3GFZA 2H5IB 2GVZB 3HF5A 1S9GA 2UUCJ 3MR2A 3CVKA 3SI8A 4GKKF 2CQPA 5C25A 1A0OB 2GO8A 1FWPA 2IY5B 4P74A 1FDDA 1UFWA 2G0JA 2YNFB 3QMQA 2MQOA 2ZBIA 1O5JA 2ZZNA 4DR7F 3K5OA 2OIHA 5BR8F 3HZEA 5HROB 2MQMA 4N56A 2YXLA 2QE5A 3MM7A 3JYTB 5A0YB 3I0RB 2Y1JA 1TL3B 1EB0A 1PJ5A 1SKWA 1K9MT 4RPFA 2LCWA 2DIUA 5ETOA 5A2QU 4BCAA 3P5TL 3QO9A 1NSPA 4X65F 1GX5A 3NEKA 4RW4A 3NL0A 3TUJC 4IKAA 3DDKA 1RWWB 4R25A 1X0PA 3PIOQ 2ZC3A 1WC1A 3CCRS 4NLPA 2DR7A 2MDAA 2D3ZA 2WSEC 3NOGA 4ZITA 2EKNA 4NZ7A 4DR6F 1A9NB 3I96A 4FBTA 4H4KA 5HROA 1HNWF 2PT0A 5H9FJ 3VAGA 2HPUA 3JYTA 3CC7S 3EX7B 3GFYA 4LF9F 4IQXA 1UZDA 5CZVA 2J6SA 1HNIB 3CF5Q 4PG7A 2VU5A 5BXIA 1B64A 1SL0A 2EBGA 3WX4A 1V6HA 4H4MB 3HKWA 5F8JA 2IMOA 2MGZA 3M8ZA 1SJ3P 3CT9A 3ILLA 2HGMA 1RZMA 3PXGa 5IS2A 3F73A 4J91A 2O3DA 2MQQA 1HKAA 2A3JA 1C0TB 4X4QA 3VALA 4LF6J 4UF4A 2BRKA 3M8QB 3RG6A 1U47A 2VA2A 2IM0A 1S9FA 3GJRB 3VGTA 1RWPB 4NXMF 4LVOP 1O8BA 3AH6A 1RTHB 4LFCJ 2ATLA 1WI8A 3N79A 2LDYA 1UVLA 3GIMA 1UVMA 2FIUA 3AAWB 3K0JA 1QD1A 3T1AA 2BABA 3BB5A 5D4OA 1X4EA 4IRDA 3T1YJ 1Q5YA 4NWBA 3OFEA 3GSDA 2C2ZB 1C2PA 2AW0A 2OPQB 4JB8B 4M5DB 2LU2A 5CD4A 2HVEA 4KR0B 1S1VB 2JH3A 1WC0A 4LF2A 2UXCJ 1R8CA 4FNHA 4QBUA 3M9MB 3TANA 2CG4A 1HD1A 1RU1A 1XMOJ 1AFJA 1LWFB 1RSCA 4G1QB 5KT2A 1MWYA 1W25A 1TL1A 4DCJB 4EZ6A 2DH8A 1RTHA 1R8BA 3V4IA 1RT6B 4XTTA 4ZDNA 3OHBA 4DL3A 3LWLA 1F5AA 4A8FA 1LEOA 2BUNA 3OR1B 2XY5A 5KFLA 2KRRA 1KD1T 4ED7A 1LK7A 2ZUAA 4Q2LA 4U96A 1S1XB 1CJVB 1IBKF 2DH7A 4AXJA 4F26A 1OQ6A 1SVDA 3W65A 1REVA 3T9ZA 5B0FA 5KFMA 5GADI 5HO4A 1RT3B 4X66F 5HMYA 1RT5A 4CLYA 4RLEA 1V3ZA 3OLBA 2LA6A 3H7HB 4C8MA 3BH7B 2MXYA 3LP0B 2KXHA 3V6HA 1C0UB 4WF9Q 3MTKA 2IJNA 3OUYB 1WG1A 3CUNA 1RT6A 2NZ4A 3S01A 2DPIA 2Q1LA 1TV6B 3DI6A 3QIPB 2QMXA 3PRVA 1N48A 4KO0A 1HMVA 1IKYA 3AOBA 3MPWA 3O2IA 1S1XA 4LF1A 2R2TA 1VQSA 2HKEA 2CNOB 4NL5A 3A8EA 2Q79A 2DBBA 3AJ1A 3P45B 1RT3A 3I32A 2F3JA 4OZNA 2E44A 3G2XA 4I2QA 3QT8A 1GMWD 2N4CA 3J7YU 1IN0A 1KHVA 3PVXA 4MFBB 3W1YC 2CPHA 4EWTA 1KSPA 1UW4A 2HQGA 1PG5B 1QAYA 1WC5A 1UEKA 4QW8A 3N9UC 2H3EB 2G1DA 4QWDA 1O0PA 3DRSB 1UA1A 1GXTA 1RJJA 2B5JA 4QCLA 1QSSA 4PQUA 2A18A 5A76A 5KFJA 4EYHB 3R5JB 3BM7A 2J8AA 4B3OB 2E9RX 3R1HA 5KFGA 1JNRB 4PG6A 2MKYA 1TVRB 1K1QA 5KFUA 3H5SA 1QY7A 3EMTA 5ETTA 2KYZA 1O6XA 4FYWB 1GFWB 1N56A 1HBNB 3MPUB 1R8PA 3SZ2A 4RW9B 1S6QA 3MUTP 1D9AA 2GAGC 4HR2A 4J9VA 3L95X 4K59A 2HWHA 4PWWA 2W8KA 2ZH4A 2O5DA 4TYAA 3BGLA 2Z2YB 2UXDJ 3NGUA 2CPXA 3W5ZA 1ZZFA 1N0UA 1GXLA 4PYDA 4B3OA 2Z4PA 3C19A 1VRTA 2CNLB 2R8IA 1RT7B 1X31C 2Y8WA 3Q86A 4RUHA 2QJ3A 1RHRB 2CFXA 2GO9A 4IUFA 1FO1A 3CXCR 1XNQJ 2PFDA 2BQ3A 4PRFA 5HVFA 1NB7A 4A8OA 3I0SB 4DV7J 3R6LB 2IFXA 1N33F 2AKWB 2OAUA 2M3DA 3HULA 1QVFR 2QA4S 5ETVA 3TUZC 4QPXA 3NGKA 4ZMMA 4AL7A 2PC6A 1T9WA 4C0HA 3KJFB 2UU9J 1U0HB 4PXBA 2LEBA 3BQ2A 3W8PA 5M2RA 4B3MF 1QTMA 3TAPA 4WKRA 4ZVRB 1NHVA 4UOCA 5E3CA 4J9QA 3ZZ0A 3G9CA 5T41A 3KDNA 1BWEA 2YNIB 2OLWA 3UR0A 1RCOB 2QZ8A 4P6QA 3MHYA 2B9WA 2VQFJ 1KTQA 2HWIA 2FTRA 4HH0A 5K14B 2LQBA 3GZ7A 4B9LA 2V8GA 4O3PA 4DCPB 2R8JA 2W2PP 4QU6A 5IT4A 1RT2B 3NMAA 4FYDA 1NKEA 4DOZA 2AYBA 1RWOB 4PABA 1VQOS 3V2UC 3O8WA 4OMFG 4JI0F 4AL6A 3F41A 3D54A 2QLXA 2ZKTA 2FLNA 2ASLA 1WKLA 2DHSA 3ENWA 5K8NA 2CQ2A 3QRQA 3SDEA 2XMWA 1RTDB 4C6AA 2L9DA 2YNHA 4IDKA 2OFGX 3UW1A 2H4YB 3BSCA 2IAJA 2XNRA 3LGHA 3DU5A 1U09A 3NBPA 1NU4A 4P75A 1HA1A 4A8QA 1VJQA 2LXUA 4F4ZA 5KFZA 2HG4A 1CS4B 2BKNA 3RW6A 5HL7Q 4EO8A 1OMSA 1TL7B 4N8OA 4ENOA 4J9RA 3EVOA 4CIOA 4OI0A 4YHHJ 4K0KF 4ZVUB 2E1AA 4B3SF 4KGXB 4DSFA 5K8OA 1N36F 3L09A 3TEHB 2MSTA 5B0CA 3DC2A 3LANA 1UFKA 1PKUA 2CXEA 1NRKA 4X84A 2R7TA 1UWBB 4KYZA 4PYAA 2MHNA 4G3IA 2F5GA 1IKWA 4OYMA 3M9NB 1HBMA 2B8QA 3LH2S 2OPSB 4GO5X 4C11B 1DY3A 3GMGA 3CJ2A 4TLQA 5L38A 1U1PA 3D6FB 4OI1A 1LKZA 5IXUA 4NXNJ 2EWHA 5ADZA 1QSLA 1TL7A 5E2QA 3OJUA 4ZS6A 2JZ5A 2YKNB 4FPIA 1TKZA 3QIDA 1JLCB 5KFHA 3G96A 2QV6A 2JEJA 2KRBA 1UA0A 4DV5F 4FYYB 3KLFA 2AJ1A 3POTB 2EG1A 1ZM4A 1S1TA 4J37A 1VMBA 1WKKA 2HBZB 2V4QA 1FDNA 2AV5A 5BYRA 1APSA 4C7QA 1ZAXA 1XMQJ 1P6TA 2B9EA 2V34A 1Y3JA 2I0XA 3T1HF 4RW8B 3UN2A 1EP4B 4LQ9A 4CLTA 1UEVA 2VICA 2EFNA 1VQ4S 5ETKA 4URGA 3HHLD 5K8MA 1I1GA 2DR5A 1GNKA 1M5KC 5JVGQ 3SFGA 4HLBA 3R5GA 3QRRA 2HK2A 1JXLA 4RNMA 2DNPA 4X4NA 3R7NB 4O44A 2C2MB 1FESA 3KG1A 3POTA 1NH7A 2GC8A 2Y1IA 3DU6A 1M5OC 1N32F 5AE1A 3THPA 4DUZF 3DMJB 1IBMJ 1H74A 3BR8A 1I5OB 3CCSS 4ED0A 1NBEB 3TUPA 1UL3A 1FKPB 4Q45A 3M8RA 1GTEA 3U1NA 1RA6A 3PO5A 3N6MA 1PILA 1SQEA 1JNZB 2CJBA 4RW8A 3BR9A 2VF3A 4XIUA 3TQEA 2E5LF 4USHA 2W7OA 5B0BA 2PN6A 3PYDA 2L08A 4I6AA 3MI7X 2B3TB 4USKA 4ZK7M 1CEZA 4CO1A 5KOXA 2DH9A 4YY3J 3M8PA 2I5JA 4AYBD 4M5GA 1TUVA 1RI7A 4HL9A 2R8HA 3BO4A 4RX6A 3EVWA 5EWEA 5ETNA 4IH5A 4PPZA 2Y1LB 3IO1A 1R89A 4P72A 1WACA 3BGFA 5AT1B 3CSKA 4HVZA 1DTQA 3BJYA 2EFOA 2YKAA 4J5OA 3UWTA 1TMJA 3KK2A 2W2OP 4NX9A 5KFDA 4L6V3 3KLGB 4QWEA 3GONA 1MU2B 4HACA 3MEEB 1T8EA 1HQUA 3R5DA 4F2SA 4EI2A 2CQIA 1U25A 4B3RF 2JC0A 2WB4A 1JKHB 1FTRA 1RDRA 2C3PA 2OPPA 2AHOB 5AE3A 4U8VA 3IBWA 1S5ZA 2ZBPA 4IO1A 4CO4A 3TUIC 5B0EA 5CCMA 1ROFA 5DDOC 4N41A 2HGNA 1L3VA 1CJTA 2NSBA 4Q2MA 3BH6B 3HD1A 3T5JA 5JUMA 2UV8G 1H98A 5D8HB 3V6DB 1ZH5A 3W9JA 2C22A 3JAMU 1N5VA 1FFGB 4IG0A 3NS7B 5EWGA 3J7Z5 1FX4A 3HVTB 4D3GA 4O3NA 3Q8RB 3C3LA 2J7KA 2VOOA 2JLEA 1JX4A 2FVQA 1JKHA 4J9KA 5LL6d 2JEGA 4ED4A 4C8KA 1WSRA 4LRFA 1BQNB 1N34F 1S1WB 2QEXS 1CSJA 1SIWB 4N76A 5I3UA 1TFWA 4ZPVR 2FHJD 3DKDA 5E7OB 5FDLA 2YWWA 2A6MA 1VRUB 2WW8A 2GZOA 5K8PA 3QZ7A 4HT7A 1REGX 4HHJA 1L3SA 4EK2A 2GAHC 4YOEA 1DLOA 1VYAA 3A3NB 3LGMA 1NSAA 5HI7A 1TK0A 4MMOA 3NGTA 1F0XA 3G6VA 1U1NA 1LWEB 1N8RT 1RT1A 3W62A 1PIEA 2G4BA 1NSKL 2FHKA 2FB0A 3NGSA 2YKMA 1S1WA 2RF2B 3MCSA 1M5HA 2JLGA 1UJ6A 4DSKA 2CKWA 5D78A 4CH1A 4NOHA 4W98A 5DG7A 3H25A 3KMSA 3FMWA 2J0WA 1FEEA 4EEYA 1D9DA 4QR1A 4A8KA 2GGPA 2Q6BA 1ITPA 4DLEA 1U6FA 1X0FA 2ERRA 3WQPA 1MNEA 3OV7A 2OEKA 3HPOA 5AXMA 1LWEA 2NCKL 2J76E 3PFEA 2V67A 3N5FA 3OW2R 3JB9k 3GILA 4USWA 2DNGA 2F4VF 1KEKA 2RNEA 1S48A 5T7LA 3RR8A 4YN3B 6AT1B 3BBFA 4ELTA 4H4OB 5F8GA 3AY0A 2XZTB 5LXRA 1IJFB 2E5HA 3I6PA 3DOKA 1MMDA 2BJ1A 2YVSA 4TU9A 1VQPS 2OEMA 4ELUA 5EWFA 3IXQA 5KOWA 1IWGA 2KL8A 2LXFA 2PI4A 3RB6A 2V6AA 4ZPTR 4A8YA 2HHTA 2HW3A 4OYIA 4KT0C 1WC6A 1ZM3A 2W01A 3K2YA 5D6GA 4IOCQ 3QLHB 3CMAS 3D1OA 5I42A 1UPMB 5EX0A 4HH1A 3EVMA 3J7ZT 1FRJA 5D3GB 1F5BA 1Y3KA 4XO0A 3CO9A 4OHXA 4AXIA 2AGPA 5J2PB 1ACMB 1B0TA 1KS2A 1R0AA 3BGRA 1KLMA 3ADAC 3SIPB 2A6OA 2W2MP 2V50A 4ZHRB 2VBXA 2B6AB 3OFGA 2CA9A 4ECVA 2HZAA 4Y28C 3ZZOA 2QX0A 3LAKA 3GJSB 2DR6A 4TU7A 4P9SA 3MXHP 1H2TZ 3UNYA 4USUA 4OX7A 1D0EA 5A8RB 2RUGA 4Y0FA 4WTOB 4UW2A 1VC6A 3K89A 5D15A 2VH7A 1XEZA 2CZVC 1K0TA 2KU7A 3C14B 4C98A 2BW7A 4Y00A 5CZXA 3NNCA 1FA0A 2DISA 2HFSA 4WZMA 3I9V9 4U7UD 4R8UB 1YTYA 3S8SA 2CPZA 3H40A 2MLYA 3T1YF 5C42B 4UOHA 5E5NA 2GNKA 4ZPBA 4OYPA 2MQPA 2V5HG 3PJ9A 4ELVA 2Q6CA 4DV2J 3Q2SC 1H3DA 4IR1A 1S10A 1B7FA 3N6LA 2UXCF 2QN6B 4YDDB 1DARA 1GMVA 3O5TB 2XTJP 1P1TA 3TOQA 1DTTB 1LXNA 2BACA 4ZLLA 4O3SA 4RBUA 2DNZA 4U95A 3DLGB 2EK1A 3BDPA 3J81j 2O1PA 1F3FA 3KJVB 3R7SB 3MEDB 3ISNC 3G6ES 2PI5A 2AEMA 4ETZA 4LSZB 3CCWA 2WSFC 5FD1A 2LFVA 2XC9A 1G4CA 3TYTA 4B9SA 4KGVB 4CM0A 3PDNA 4HKQA 4CRJA 2BE9B 1XNRJ 2ZOGA 3QJPA 1RGVA 5KT5A 4FXWA 4ZP8A 3SQGA 2E7VA 1VQMS 2KJWA 3W7BA 4DF4A 1LV5A 3JTOA 1KBRA 1CULA 3PYGA 3FNNA 3RGIA 1DURA 2DGXA 5HMZA 4CT8A 3ZC4A 3E01A 4USMA 2A2DA 2BA9A 4DU8A 3EGNA 2ZFHA 3OTBA 2MYFA 2IJFA 5GMEA 2VPYB 2A0FB 2P8IA 1WKJA 2FHMA 5C24A 2IRXA 3T9NA 1FDBA 2MZ1A 4RW7B 4ZVPB 1RAEB 3C6UB 2KG0A 3BSOA 2YWKA 3TAMA 4NYZA 3I4PA 3CC2S 2Y8YA 3IFEA 4XPCA 3OR2A 1LWCB 4EBCA 3H5XA 5L8RC 3W5YA 5B0GA 3TVKA 2BQRA 2GHWA 2ZDPA 4DG1B 2QGFB 3IM9A 5HJXA 1R7IA 4ZIVA 1XMBA 2LDIA 4C8ZA 2EFGA 4M5HA 2QFIA 2APOA 2G13A 4OYOA 2B43A 2HQCA 3MPDA 4JI7J 4RW6A 2NPFA 1NLKL 2B9YA 1YBAA 4L3NA 2EFVA 3ZO7A 4X64J 2F1FA 3VQSA 4C8NA 5IQ6A 3MECB 4A8SA 1Y11A 2GMJA 2VQEJ 3AJ2A 3SYZA 3IS9A 3O1LA 2XZWA 3H59A 3CJ4A 1IKVA 3K57A 1SIZA 5KT4A 2DEIA 2Z0GA 2CPIA 1QAJA 2DR9A 2HMIA 4O3OA 3CMES 1AXQA 4TU8A 1PC4A 2YKQA 1OYEA 3MMAB 4M8LA 1MN7A 5MAOA 1JLBB 2BV3A 4B9VA 4WPAA 4NZ0A 3KJNB 2CPEA 4CLLA 3L9ZA 2E1MC 3TZWA 1U2RA 4RWXA 5JJBA 2BE2A 2H54B 1FDAA 5KFOA 1N6QB 2C3MA 2AF6A 3M32B 5E33A 1N5YB 2UXDF 2MQNA 3MR3A 2W9CA 2EK6A 1HQ2A 1F2HA 4P7VA 2ZE2B 4YS2A 3P6YC 3PR5B 2HFZA 2YNGA 4OX8A 1HW8A 3J81U 1HWJA 4X62J 4LF7J 4NPOA 4PXCA 2RDDA 4NA1A 3CD7A 5M2PA 4UZCA 1TU0B 1S59A 3CDEA 4GO7X 3H2VE 2HHHJ 1JLBA 3KUHA 4P10A 5CHCB 4DV7F 4LSLA 2V94A 4FBUA 3R3TA 3NS5A 2UUWA 5FLXU 2MLZA 3D6TB 3QJLA 3ETMA 2EBEA 1YWXA 4ZVEA 1OIAA 4NLUA 4FN5A 2RU3A 2KG1A 3DRXA 4Z2XA 1FFWB 3QRPA 2QG9B 1VBKA 2FY8A 2HQDA 2JLFA 1RQ0A 2H1YA 2C3UA 1XQIA 5HLFB 3HM9A 3HCXA 2KN4A 4LSNA 3MM9B 1PO6A 1SUQA 5L9XA 1Q16B 3MCMA 3BKUA 2VQFF 1HQEA 5DDPC 2EW9A 2LVWA 4Y2CA 4K4VA 1VLOA 4ICLB 2MKSA 1RLCL 1UVKA 2RKIB 2ZH3A 3QZ8A 4DFMA 3CIMA 1Q8BA 3FQKA 4NLWA 5F8NA 3C15B 4LFAF 1NK8A 3L4BC 1XC9A 2UVWA 3ENVA 4TY8B 4DV1J 4DL7A 1HNZJ 1FKOA 2GX8A 3HSJA 2F9JA 4U8YA 5IV4A 4Y2IA 1TK5A 5A6PA 4K5SA 1FEHA 5CYMB 9ATCB 1YJVA 4UOFA 4OHWA 3HT3A 5LSRA 4DQRA 4M5NA 1NB2A 3AXKA 4I64A 4USJC 3JQMA 2D74B 2M70A 1Q7YT 3FFIB 1X8DA 2Y0SD 2CJYB 3QT6A 3CCMS 2XM3A 1RTJB 1UVJA 4OZ3A 4OHYA 2RHSB 2VFTA 1RWKB 3PYFA 2J9CA 5DO2A 4LVNP 4F8RA 3C6TB 3TZXA 4JOUA 4K4XA 1UTAA 1EAYC 4TY8A 5L1IA 4DWIA 3MMCB 3Q89A 4WYWA 1Y5LB 4RUCA 2R2RA 2HYIB 1MMLA 3RRKA 2JVOA 3FBCA 2ABYA 1OY8A 4IFYB 3KOAA 4OZLA 1YZ6A 4ID5B 3I5AA 3GCWP 4K2JA 1L5UA 1KWMA 2ADBA 2MZTA 2HAIA 3M6XA 1TKTB 3PW0A 2GFFA 2O66A 2BVZA 4MK7A 4Q0BB 2CQ3A 3Q83A 4BBYA 3FMBA 3RYLA 2OO4A 4TXSA 4ZVHA 3DLHA 4ECTA 4M5KA 2OD6A 2YX7A 3GJTB 1ZAVA 2DYAA 1X7VA 2MB0B 1URRA 2U1AA 2HLTA 4ED2A 5DG8A 4LT6A 1MG7A 3CTRA 1S57A 2IM1A 3DM2B 3MAHA 3KLIA 5HAOA 1W26A 1U26A 4A8XA 5D0EA 1VQ9S 5KFYA 2ZH6A 4F7VA 2B9XA 2AX1A 4Q8FA 1XERA 3ITHB 2YH0A 5F8LA 4NLOA 3KHHA 2VBWA 1XMQF 3IAS9 4X4RA 1R31A 3W2VA 2RHQB 4IH7A 1BUXA 3GSIA 1N88A 3D1QA 2DD8S 1JLEB 5L1KA 2JFDA 4DX5A 3MF5A 4DR5J 2IPOB 5KFEA 1MN9A 2KJVA 1IBLF 1S76D 2R9LA 3GV5B 2HNYB 1M1GA 4J9LA 2HIYA 2IC3A 2M4MA 1OSCA 4KAIA 1M5PC 2XMAA 4I6WA 2QC3A 3CCTA 3VGUA 1WUUA 2VPXB 4NMLA 4F2RA 3AODA 4OLOA 4X4UA 4URQU 4PR6A 2XCAA 4MKBA 2XEXA 2CYYA 2DR8A 1VC5A 2AZ1A 4RJVA 2XO6A 3EZUA 4UY8T 4DSJA 3FUYA 2IHR1 3UPFA 3TVZA 1JLAB 1EETB 5EX3A 1U1OA 3RBZA 2R4FA 4LF8J 1XIQA 2QL5B 1NK9A 2QO3A 3NNHA 3BBBA 3W64A 3OL6A 4QIGA 3CDWA 1IR1A 4CNYA 4OFZA 4O0NA 3R2DJ 3VCDA 2H48B 2PGCA 4LF5J 2OPRB 4MKVA 3F44A 2L9NA 5DDRC 3KFWX 1UVNA 5HVGA 1VQ5S 1T11A 1S97A 1A6LA 5GAHU 3VAHA 2MSSA 3ZZPA 3LA0A 2GS8A 1W7WA 2CJKA 2VG7B 3KHGA 3ZNJ1 2B7BB 1LOUA 2GJFA 2XWXA 2WRMA 5K5MA 4KV8B 4ECQA 3JQKA 1BY9A 3KK1A 5IV3A 4Q7AA 1Y9OA 1PBUA 5HMXA 4O4GA 1WOSA 3JSYA 2GJIA 3BSAA 3UN3A 2CJAA 3DHXA 4DL6A 3RBEA 4WWSA 4RNFA 1D3WA 4Y2MA 2OPRA 4MIBA 1S4FA 4PCQA 2HBQB 4ER8A 5KFFA 1Z1ZA 4DX6A 1FHTA 2GHVC 2GCFA 2RS8A 4DPXA 4ZCMA 1XN9A 1XR7A 1NSQA 3D3BJ 2J6UA 3CC4S 2HNDB 2VDHA 3Q23A 1TELA 2E9ZA 3VGVA 4DI6A 1Z2ZA 1Y5IB 3KYLA 1EHWA 1VCTA 2IBOA 1J5OB 1R6YA 4KV8A 5HSPA 3RB4A 3K8VA 2N3OA 2P6TA 2KHCA 2NSCA 4RBVA 1HR0J 5H9EJ 4LRCA 1KKHA 1C1BA 4DR3J 5BJRA 2LEPA 3HDSA 3Q8SB 3DOLB 2MKCA 2CWKA 1LW2A 1RHJB 4F67A 1YRUA 3TRGA 4PEOA 1TAQA 4CO2A 3CEDA 2BBEA 4CLUA 3ISZA 1NH8A 3M2VB 3UVJA 4I0WA 2NZCA 3V6JA 1N5TA 1X5OA 4Z7YA 1JLQA 4NLSA 4QWAA 3W9IA 2BKPA 4CDIA 3LOUA 3DDIA 3LQVA 1HWUA 2AX0A 1G3OA 2OP5A 1S7IA 4DQIA 1UEUA 5KFPA 1NZ8A 1OYDA 4C48A 2VC0A 2ZBCA 1AROP 5F41A 2CVEA 3HT0A 3FEZA 3N5BA 1YJRA 4F36A 3U7JA 2JSXA 5IZHA 1SH2A 1T05A 3CCVS 3DOMB 3JQJA 1HBUB 3RTVA 2FHOB 3BS9A 1JJHA 3AT1B 5EUHA 3MM6B 2K3KA 4JI1F 5GMDA 2V2QA 1Q8KA 3JSRA 4FF4A 5LSOA 4R0JA 4J7CA 2CAJA 2CG8A 5LMUJ 2OTJS 3CJRA 4QR2A 4QYZJ 5HQ8A 4KBIA 4H4KC 1WTBA 1R3NA 4WU2A 2KVQE 5AJ3F 1JLFB 3CB4A 3S1TA 3MM8B 5CYQB 2PMHA 1RT4B 2X1FA 5A8WB 2DY9A 1FT8A 3M1VB 4HI2A 2V9WA 2V2KA 4P71A 5KFTA 1T02A 4DPOA 3GIRA 2WW4A 4KPYA 1OO0B 4J90A 1QE1B 1WOPA 3DLJA 1U8SA 3WC0A 2CADA 1T95A 3ILIA 3ULHA 1T3NA 2YTCA 3PTWA 4X4PA 3VAKA 2HS0A 3ZTRA 1IM4A 2ZH1A 3SXLA 1ZPWX 1CJKB 3B6BA 3OVAA 1RAFB 3MMBB 2YWHA 4MTPA 1WHYA 1YJ7A 1PC5A 4IOBA 2DEJA 4LUBA 3NRBA 5HMWA 4B9MA 2FC9A 1IKXA 4QJVA 3OPKA 3ZTSA 1RAJA 1SV5B 3OQ2A 3EDRB 2L41A 1SXLA 3GG1A 2Q3PA 5IT9U 4JV2A 1IJEB 5IWAJ 4JI8J 3IRXA 2LQJA 4JI2F 4CYUA 1H7WA 2D3O1 4MK9A 4OJ3A 2FLOA 2CQ1A 5J2NB 3WBZA 5L9NA 5SZTA 4FYXB 3RAMA 2DITA 2ZH5A 2H65B 5D4NA 2CJQA 3MAAB 1HYSB 2QYCA 2V4JB 1VFJA 4BC9A 2CDRB 2CZ9A 1CJKA 3CE8A 3MMBA 3DGPA 3BBCA 5JXSA 4CO0A 1BQMB 5BYSA 5DDQC 4DV2F 3PZPA 2ZJPQ 2XS5A 2DCLA 2QMWA 4H54A 2K1RA 5SUHA 2A1BA 1D1UA 2KYXA 1RAIB 3EYZA 1AYEA 3H42A 3SSSA 4GMKA 2VPZB 2QRRA 2MLXA 2MEWA 4ECUA 1ZA1B 4OZ5A 2VKRA 1HYSA 3N01A 4PPDA 5B0DA 2V9KA 3MM5A 3EXCX 2XBPA 3DRRA 3AXMA 2GJ2A 3PX0A 2EFQA 4LF4J 2NYIA 3D2WA 3FCHA 3HSDA 4NCGB 2XLIA 1T03A 4F02A 2DNYA 1HWKA 2YX1A 1GMWA 1XNRF 4ZOSA 4F0MA 4F50A 2FVSA 4K4UA 2AYGA 1HLWA 3ILJA 4QWBA 2AWZA 2F65A 4F3MA 2KZZA 5F9NA 4J9PA 5KT6A 1RAAB 1OWXA 4CH7A 2RAQA 2HFUA 4FZVA 1WHXA 1Y5NB 2FJAB 5KFCA 4NCBA 1G6BA 2R3VA 3CJKA 1Y00A 1FRKA 2ROGA 4CP5A 1T9XA 2MKKA 2ZBQA 1WHVA 2WVBA 4DV4F 2X3GA 1FJEB 5CAAA 1H72C 1X4DA 4BLGA 2DTJA 1WNEA 5LJ5Y 1VRQC 1S1UA 3ZXWA 1F9EB 3IC1A 3HHEA 2MJNA 5I3QA 1RTIB 4TKTA 2W1BA 2HHUA 2XI2A 1U7LA 4GKKJ 1U45A 1HHSA 3FCWA 4YB6A 2CJ9A 1VR6A 7FD1A 2PIIA 3DYAB 2FVRA 5KG4A 1JK9B 1OPIA 1E6VB 1VK8A 4K4YA 1HHTP 2J7WA 2P2CB 4JI7F 3HSZA 4DR7J 4CLSA 4N47A 2ZM6F 3RW7A 3M4XA 3MR7A 1CBKA 5BR8J 2AEJA 2BJ8A 3V5RA 2FGOA 1NJIT 5J2MB 4WBFA 1BC6A 4LRAA 2ZOFA 2QT7A 3GU0A 4V1Ak 1ULRA 2BXJA 3AHPA 2W4PA 1GMUA 4C8LA 1VQYA 1SPBP 4X65J 1FK9A 4UUWA 4L73A 2HVHA 2HBRB 2XCPA 3BYPA 5HN0A 4NEZA 4DV0J 1WF0A 3TJAA 4CTAB 1LQ9A 1QAXA 1B3TA 2VG5B 1YLXA 3D5MA 3SCJE 4ECZA 2DNLA 1X4AA 2M7SA 3M6VA 4I7FB 2XSJB 4DR6J 5C2GA 2WOMB 4DX8H 3AA9A 3CD0A 4DHVA 2BANB 2RILA 2OMOA 1F60B 2R2UA 2SXLA 1AA1B 2H5JB 4WFZA 1YJWS 3D66A 1FVSA 4HTJA 2L9WA 4LF9J 3AB4B 3SCIE 3BQ1A 3Q0AA 4X2BA 1QM9A 1LFWA 1B4SA 1LNQA 3RR7A 1KR4A 1N5QA 2HRUA 3HKZD 3VR1A 3HFKA 4ZCIA 2GVZA 3QSYB 2DXDA 3EICA 4X62F 2AJQA 4ES2A 2D1CA 4R0EA 4LREA 2YNFA 4QU7A 2D69A 4DQQA 2XQCA 2HHHF 2ACYA 3KK3B 1TMMA 1MSWD 2XSJA 3QGGA 2RIJA 3J80Y 4OI3A 4L76A 4NE9C 4BS2A 5A0YA 3I0RA 2GIRA 1TL3A 2V0NA 4NXMJ 3A3OB 2Z57B 3PG9A 2WVFA 3MCOA 1SKRA 3UDVA 5FIIA 3DRPB 4WK1A 3EGWB 4TY9A 5JVHQ 2ZD1B 4MKAA 2ZEJA 2V63A 4ATNA 2MQLA 4YFUA 1YI2S 1RKIA 1U4BA 1HBOB 1U1MA 2BQUA 1MROB 2VB6A 4KY3A 3TP2A 2FJWA 2BYCA 1S77D 5ETPA 3DLKB 3THVA 2DGOA 1T94A 2OFHX 3WX8A 1D9FA 1RBOB 1YBUA 3TR5A 1BMQB 1CJUB 4NI2B 5F0WA 1K8AT 2JVRA 1OY6A 1HPZB 1P9YA 4JV5J 3D0GE 1HNIA 2BMBA 5E3QA 4WZQA 2WZ1A 3ZZUA 1FERA 4DV1F 3DRPA 4H4MA 2AU0A 3CW2C 2FZKB 3JTPA 4KQZA 5LM7E 3VZIA 6FD1A 2ZHAA 1S6UA 1RWUA 4HT5A 5AXKA 1ZPVA 1RABB 2WBMA 4MIAA 3HHLB 1PAEX 1U2FA 1SH0A 5KG0A 4UZBA 4DR2F 3BF4A 3TVYA 4IH6A 1HARA 3VQTA 1C0TA 4WFYA 3UQSA 1S6OA 4OZ2A 4RNNA 1NAQA 3LWMA 1NK0A 4WFAQ 3W2WB 5LMNF 3EWGA 3M8QA 3FK4A 1WORA 3CCJS 5F8HA 4HTIA 1KDNA 4IR9A 4JI6J 3VF0B 2FUG9 1M5SA 3B82A 2GVDB 2YWFA 2Z2ZA 2XMMA 3ILOA 3QGHA 4NMXA 2E29A 4NYOA 3EPGA 1FD8A 2XMUA 1RUSA 3G6XA 2Q43A 2OPQA 4ERDA 4M5DA 4CLWA 4YDXA 3HHLA 1XWLA 2HIQA 3NKYA 1X5SA 1S1VA 5KT3A 2LA4A 2CIMA 4BWJA 3GIIA 1NHKL 1SKUB 3G4SS 3OSNA 4UQGA 3AQOA 5L39A 3D28A 3MPVA 3PHTA 3PM9A 1N5SA 1LWFA 3CDUA 5F0UA 2CPDA 4G1QA 5E0OA 4M5IA 2UVVA 2XB2D 4DS5A 2ILYA 2GVDA 2BM0A 1YRXA 2MPUA 1VHIA 2KZMA 2RD5C 1YSJA 3PR4A 2HNZB 3PEJA 1SH3A 4CO5A 3KLEB 3IBCB 3OR1A 2B4OA 4LR7A 2V4RA 3US5A 2LQ9A 4BHQA 3IN5A 2FQQB 1UP1A 2XYGB 2ZWPA 4IFVB 2MKHA 4FVCA 1CJVA 3OFFA 2PDAA 3L7UA 3B8HA 2YY3A 5DGBA 3C16B 5HVHA 2DO4A 5DJBA 4DSIA 8ATCB 2V8PA 3R2CJ 2P6SA 1RK8A 4DBQA 3KMQA 3LP0A 4OYZA 4DDFA 2VDIA 1C0UA 6FDRA 3J7AN 4ANCA 4OJ1A 3GB0A 3OUYA 2V8HA 2OEJA 1X5TA 3FQLA 4ZPDA 1C1CB 4ZN3A 2DKOB 1TV6A 3QIPA 1CC8A 3TA2A 4FVMA 3IR7B 1KOHA 4MK8A 2XG8A 3GYXB 4DV3F 2NREA 5DLGA 3W9HA 2DO0A 3NCPA 5K9FA 4IQMA 1WG5A 3C16A 4QWCA 3K58A 1GXUA 2LU1A 4WP3A 4C3KA 4MFBA 3UI3A 3T5LA 1RHMB 4OJHA 2XMVA 2UUTA 4OZ1A 4NZ6A 3DRSA 3HK2A 4E0DA 1C1CA 2ZZMA 2DJWA 1UCNA 5E3PA 1R8HA 3QQCD 3ET6B 3R9LA 1VBZA 2IRYA 4ZPAA 2FHJA 4B3MJ 2XMTA 4XDCA 3LO3A 5HANA 4PWDB 1SC1B 1TVRA 4ED1A 4IO9Q 4I2PB 2ZNZA 3A13A 1WC3A 1Q4RA 4I67A 2DGQA 3QT5A 4OJGA 1HBNA 2J0QD 4NRTA 4ZKAA 1AB8A 4RW9A 2XS2A 3U1MA 2GV1A 2K7KA 4DPWA 3O6QA 2CNNB 4OZ0A 2VFSA 3OFHA 4Y34A 2JRSA 2L48A 2MY8A 3EZ5A 3MWBA 1KONA 4KRWA 3ZTOA 2E5GA 4WE1B 3MR6A 2HS4A 4NLQA 1W2BR 5GADU 4BWMA 3HLUA 3T6JA 3SSQA 2FPHX 3VZHA 2YWEA 1RT7A 4C0OC 4HEA9 4N8NA 3HZGA 5HBMB 2M9KA 4I2PA 1TKDA 1ZZNA 3MCNA 4DCOB 4DFJA 1KLNA 3GP9A 4NYPA 3I0SA 2KM8B 2AJ4A 1U2CA 4LQ3A 2IA0A 2FLLA 1RLDA 4QR0A 2AQ4A 1XK8A 4K4SA 4DZ6A 3OSPA 1HR0F 1RYRA 3FZBA 4YR2A 4WE1A 3RJMB 5HATA 2CDQA 3ZZYA 1U0HA 4W92B 2W4CA 4PQAA 3TZYA 1ZM2A 1SQGA 1RISA 2FJBB 4MT1A 3K8WA 4A4JA 4A8MP 4ES1A 3OVBA 4WFXA 3OTOJ 3GR0A 2VODA 1IR2A 2YNIA 4EMDA 2ASJA 1L3TA 2F40A 1AZSB 1VQLS 5K14A 3KNAA 1PYOB 3NP5A 2JOQA 1LW0B 4ZJLA 1EZZB 4R5PB 1RT2A 2W9BB 2AP6A 2BE7D 3EXYA 4KC5A 3FSYA 1X4HA 2DY1A 1R0CB 4FF2A 4YB7A 2F8HA 2DGUA 3MPYA 3V81B 1WWHA 3T19A 3KLHB 2CQHA 3BPSP 4YUDA 1U1LA 5FJ4A 1FNMA 1RTDA 3UNGC 1G1XA 4RNOA 4B9TA 5B0AA 4ED5A 5J2QB 3TNVA 3H98A 2FDNA 4KKOB 3OLAA 5LMUF 3LP1B 1LW0A 3CJTA 1CS4A 1X4CA 1VJWA 5A8KB 1HNVB 2R2SA 3I82A 2A10A 3D6HB 4LIWA 3M8WA 2OGUA 3JAMY 1U1KA 1HWIA 2QIFA 5KAKA 1HI8A 3ISND 1FJGJ 4ANDA 2B0GA 1WTFA 3RB0A 3R5BA 3PX6A 1NO8A 5CCLA 1S6PB 4LR9A 5T14A 2OTLS 4A46A 1HL6A 1UWBA 3E8OA 3M2RB 4CWBA 1MW7A 2DK2A 3IR5B 1N32J 2OPSA 2KO1A 2HHPA 3ZZTA 2K3IA 4C11A 1FI4A 3OTDA 1UMJA 5G0RB 4KKOA 5CQGA 4FS2A 2XS7A 4OLPA 1L3KA 3W61A 1Q1KA 4EO6A 2KI2A 2E5LJ 4J9UE 4RR5A 3NLCA 2ROEA 2W7PA 2YKNA 5E41A 2VC1A 1RAHB 4YP3A 1RA7A 1JLCA 2JC1A 4WK3A 1TKXB 1E6YB 1DAXA 3MFHA 2CNKB 3KDOA 4JI8F 2LQ8A 4DZDA 1QDUB 3A8JA 2ALYB 5C2CA 3SFUA 2QLJB 3UCUP 5G0RA 3PNIA 2PSZA 4FDFA 1JJ2R 2ZVIA 4DJBA 1HIYA 4F0KA 1Q95G 4PZVA 3NMRA 1EP4A 3Q22A 3DLEB 4B3RJ 1U1QA 1Q0NA 5L1JA 4I69A 1RBLA 1F5CA 1XR5A 3ZFVA 4JI4J 4RZRA 2X1BA 3CCZA 2MY7A 3RU0A 1KQSR 3NAIA 1X4GA 2DCUB 2KT5A 4NLXA 2E1CA 3SV3A 3PJXA 2H4WB 9RUBA 2XGPA 1FRHA 2CQGA 3FEYB 1SJ1A 2WONB 1K0VA 1JQGA 2W7AA 3DMJA 2R7RA 3FRZA 3MAQA 4EUVA 2EC2A 4CT9A 3GIKA 1FKPA 4J9SA 4JBCA 1EKSA 4LF4F 3PCOB 3P4UB 2G2YA 2YKPA 4P2FA 2IBKA 5DQGA 4ZPWR 3K5MA 2WB1D 5J1EB 2B51A 2IVMA 4OX9F 3KUGA 2PFFB 5LT5A 4PWUA 2KTQA 2FLPA 1UJ5A 4LFBJ 2HZCA 3SQOP 3IGNA 2K7JA 4B02A 3VHQA 1S9GB 2GIFA 1PBAA 4ZVGA 2BJ7A 3PYEA 2CUYA 2BJEA 4ZCLA 1XJWB 1KFDA 2D9OA 3HJFA 1NM2A 1DHMA 4ZVSB 3KLGA 2NXNA 1J27A 1KRPA 5D77A 1MU2A 3QSIA 3MEEA 4XDDA 4YQWA 1FXLA 3IWXA 1M0SA 3FRYA 2I38A 2JWNA 3MM7B 2YWGA 2C28A 2HK3A 1KC8T 3OXLA 2QA4G 3I87A 3F56A 2DNQA 2ZWOA 4KJIA 3QO9B 2G0IA 2XMKA 1Q86T 3IR6B 4TYBA 1FNOA 2E5IA 1X60A 1UZHA 3G6YA 3CNQP 4FXDA 4F4WA 3MR5A 3V6DA 3VGSA 2DHHA 3MEGB 1FNXH 3BYRA 2BOAA 2RUSA 2DGVA 3IGVA 1HNXF 2V8VA 1RTZA 1T3OA 3HVTA 4GVBB 5DETA 3G71S 4LMZA 4N5SA 2UUAJ 2UUBF 2D3UA 2B4VA 2F4VJ 2D41A 2XYHB 1BQNA 2OH2A 4F3QA 3LTOA 2UZAA 3Q8PB 3TARA 4EZ9A 2ROPA 3IP0A 4EBDA 1YVFA 2UUCF 1VRUA 2MGZB 3D67A 4DV0F 3MD3A 3NG8A 3FGVA 3NY0A 4KIAA 2H51B 2R7WA 1FJCA 1GEHA 3KLVA 2IMWP 3MEGA 1N54B 2HEKA 4ED6A 1PGZA 1FWKA 2HQIA 4X4OA 3HX9A 1ZYQA 3UDCA 2ZH9A 4GVBA 4OZJA 1S99A 5AE2A 2DVIA 3DDNA 3TJ8A 4EFAC 1EJ7L 2I1RA 1DJ0A 3QWPA 4DR1J 4ZP9A 1HW9A 2RF2A 3J7YI 1WOOA 2DNNA 4E2FB 2RVJA 4HDHA 2PEBA 3CCQS 3FZ2A 3GYNA 2DNMA 3JSBA 2GA7A 2WK4A 2XZDB 4WFBQ 2LYVA 1G2EA 3TA1A 4ILLA 2FD2A 1YZ7A 1F3VA 1RHUB 3TI0A 4CLFA 1TL1B 2Z2MA 2MZSA 3DGVA 4ZA1A 4ECXA 4F25A 4V19J 2L3MA 2OHDA 1OSDA 1RWXB 3GCXP 3V4IB 4H4OA 3G8TA 3TWZA 2UV8A 1CVJA 3P5BP 3LALA 4I6YA 3RAQA 3R8YA 1Q81T 1ZS6A 2EI5A 1NHUA 1WI6A 4DL4A 3FBFA 3B4DA 4LBHA 1FRIA 3G86A 1REVB 3BGOP 2R42A 4TN2A 3D0IE 3KG0A 2RRAA 4LF6F 1I94J 2VA3A 1ZBTA 1OY9A 1RT5B 3QLHA 1JJ4A 2KXNB 2ZZTA 5GAGI 2XO7A 1FRLA 2LQ5A 5KG2A 2GHPA 1T7PA 4JV5F 3CWJA 4LFCF 5D3GA 5KG5A 3FSIA 5EN1A 5J2PA 4NEYA 3PV8A 4ZPCA 2M52A 4CLZA 3P8BB 3M2UB 2VUGA 3LAMA 2RQCA 4ZHRA 3DI6B 2CPYA 2DB1A 3K59A 2B6AA 1HMVB 4KO0B 3BQ0A 1LFPA 3MMJA 1IKYB 2FJDB 3HHNB 2DXEA 5GVQA 4QIVA 3KTQA 5A8RA 2GW8A 1VOMA 1XMOF 5CYJA 3NS6A 2EPIA 3QT7A 4KHMA 4I2QB 1U8WA 4ECWA 4NLTA 3C14A 2I2YA 1IBCB 4JI6F 1PYSB 2F63A 5IC6B 4OHVA 2C3YA 2DRDA 2V8DA 2DXFA 4QIWD 3FVYA 3T6BA 4MH8A 3J81Y 2Z58B 3N4WA 4R8UA 3UD3P 2C3OA 1X9SA 3T41A 2EEYA 1FD2A 3OL8A 3M2UA 3KHRA 5C42A 2B5JB 3Q8YA 3J80U 1U49A 1NKBA 4PQUB 3W8GA 2FVCA 2JJ4D 1VQ6S 3T3FA 4CLPA 1FKAF 3I5BA 5FLXY 1NK7A 1R27B 1TR0A 4EYIB 3PW7A 1DTTA 1SC6A 4DPTA 3HHKA 4LRDA 3S6EA 4Y3CA 3DLGA 2Z30B 1NPKA 1WHWA 2Y3YA 3KJVA 3MEDA 2ADCA 3PHEA 2J7UA 2LXIA 3BO2A 2H5EA 1S6QB 5IQQA 4XK8C 1KVJA 4MIWA 1RP5A 5C7PA 4ECSA 1U6ZA 3FBEA 1PJ7A 2R7OA 1FJ7A 2ILZA 3PO4A 4WXWA 2HHQA 4KH0B 3AFGA 4RBTA 1DFDA 2FJXA 3AD8C 2BX6A 4KGKA 5KTQA 2YKOA 2C2DA 1VRTB 1NDLA 2P9GA 3MD1A 3UCZP 1YGYA 1YITS 5IT0A 2ZH8A 3UO0A 4C4WA 2EXUA 2D3OR 4QYRA 4ZLJA 3CJQA 4JP8A 4EBEA 4GC6A 2HQFA 1HI0P 2LP4A 4K5RA 4AFFA 4RW7A 1LXJA 4DF8A 4UUXA 3C6UA 4KGMA 1SC4B 1VQ8S 1M5VC 2W25A 1ZETA 3A3PB 2WCXA 3GWCA 3D9BA 3T5HA 1LWCA 2IJRA 2BRLA 2VKZG 2WVDA 1S0NA 5GAGU 2RU9A 3PW5A 4DG1A 1RYSA 4WKYA 5KG3A 1Z2LA 1B99A 3BN4A 4OI4A 2M0GB 3LUYA 2I8EA 1BE4A 5LJ3Y 1GX6A 2XY6A 5DRKA 1S9EB 3GTYX 2C42A 2E7XA 3MECA 1S4EA 5LSLA 3GE9A 4OV1A 3NNAA 1JXEA 3HFZB 4ZP6A 2R7SA 1NJZA 3SDEB 4AUKA 2VIHA 5DQIA 2AGQA 3B54A 4ZVFA 2NXUA 2YNHB 4IDKB 1QUVA 2RH3A 1SKSA 4M5LA 2IAJB 2ZH2A 2OJ3A 4GRSA 4FF3A 1XNQF 4F4YA 3MMAA 3NBPB 3OT9A 3W60A 2KH9A 1MMNA 4MAKA 1KN6A 3DRYA 4Q44A 1FVQA 4P7TA 2J9DE 5HP1B 1DQ8A 1S9EA 1B70B 2D9PA 4DSEA 1N6QA 1I51B 3M32A 2XNQA 1N5YA 4LFAJ 3W66A 4QIEA 3GJQB 2KFYA 3DNCA 1O51A 2QFJA 2UU9F 3FDSA 4ECYA 4PG8A 2ZE2A 5KFNA 1YRTA 4RKUC 4L74A 1VIOA 4NCAA 3I55S 2HGLA 1S0OA 4IRCA 5IOLA 3UDLA 4RL1A 4FYVB 4DQSA 2AJFE 3VAJA 4DQPA 1P9QC 1WEXA 2IYGA 3HSGA 1IKWB 1HBMB 3HD2A 3FC9A 4P2SA 4HHHA 2E7WA 2XWYA 2AZ3A 1QTNB 2XY7A 3HXMA 1QLNA 4UQTA 3T5KA 2YPYA 2LEAA 5HP1A 2CWXA 3EUNA 2RT3A 1TKZB 2VFUA 3K5PA 1DZ5A 3K5LA 4YB1P 3AD9C 2PEHA 3KLFB 3FSXA 4CM2A 2FGCA 5D0GA 3OTOF 1S1TB 5HLFA 4B3TJ 3ENQA 1FWLA 5DM7Q 2QTWA 3MM9A 4FF1A 3E2EA 3DN9A 1YHQS 4JV0A 4JI3J 3OJSA 4WTYA 4DN0A 2CPFA 3R1LA 2RDIA 3ZNUA 4UY85 2AYEA 4I68A 2F8MA 4ICLA 4U6PA 5D0HA 2RKIA 2RRBA 1IUJA 4YHHF 1T9UA 3TX8A 1KHWA 3BN7A 3C15A 3OL7A 3UR3C 2KB2A 1S7HA 3H0PA 2B7CB 1R0BG 1P8GA 2V2VA 4O44B 4Y65A 1ZTTA 4YEAA 5CYMA 1RU2A 3PKMA 2IM2A 2PE8A 5KFIA 3P49B 1MWZA 3TZZA 2NS1B 2RQKA 3FFIA 3HI9A 2FZGB 5KFWA 1U6BA 2LECA 3CD5A 2POKA 2GQQA 3MUMP 2K06A 1RTJA 3VAFA 1SL2A 3GFXA 4DN9A 4NXNF 3UFCX 2OMLA 4PXDA 2DNOA 1TL4A 3H2LA 3NAHA 3M8PB 3C6TA 3TQ1A 1TQLA 2I5JB 3QPIA 4C8OA 1FJGF 2AT1B 4MYTA 1IBLJ 2ZHOA 3D6MB 1V3SA 3MMCA 1UWAA 2R8GA 2NXEA 2DT9A 3NGRA 4TQSA 1KNZA 1KP6A 2KDOA 1DTQB 3THTA 4GVLA 4IFYA 3KK2B 2ACMA 3G8QA 2QLBB 2KT2A 4ID5A 3PRBA 5DG9A 4AQYJ 4HACB 1H2UX 3ICLA 1TKTA 1HQUB 4CQ1A 2K8GA 4LRBA 1IXKA 1Q8LA 4Q0BA 5ETRA 2R7VA 4DV6J 2FZCB 2MKIA 2OPPB 2VZ9A 1J5EJ 1MLAA 3HMJG 1DQ9A 4MJKA 2R8KA 2I6WA 4QIFA 1VBXA 4DL2A 3IWNC 1PSDA 4W4MA 1VI7A 2DNHA 4F4KA 5IC4B 4PXEA 1T9TA 1DQAA 1CJTB 3TX0A 1RWMB 3DM2A 3W63A 3DLBA 2AYMA 1IBMF 3VVTA 3QATA 3HFVA 1V5IB 4M94A 3ITHA 4DLGA 2HS3A 1HD0A 2IDEA 5D0RA 4ZVQB 4IG0B 2BZ2A 2AJ0A 3OXFA 2PMWA 3I4HX 3GLJA 3SEOA 4RUBA 2WHOA 1JLEA 4WYLA 5BYQA 2AMCB 4YY3F 4JI4F 2VL1A 4ZLNA 4KPCA 5I3UB 4PG5A 3FJ2A 3H5UA 2GMHA 5FDLB 4ANEA 5GMKa 1VIXA 2VJVA 2HNYA 7AT1B 3VWSA 3UN5A 3QJJA 2IYIA 3GFHA 3CJ5A 3W3SA 1DLOB 3LF0A 3R7BB 4ED8A 2FYXA 3BO3A 3Q2TC 2DHXA 1H0HB 2C2KB 1N0VC 4KTQA 2DHAA 2HWTA 1RT1B 4Z7CA 4K4ZA 2YX4A 3HJVA 4P73A 1C4AA 4OX6A 1H73A 2MTLA 1YKWA 2M5YA 1R8AA 5KFVA 5D4LA 2YKMB 3UCGA 1JLAA 2B4UA 1EETA 3R6GB 1U24A 2NUHA 4LFBF 5ITHA 2ASYA 4K7QA 5HQLA 1WG4A 1YJTA 1UAWA 4HI1A 2E1PA 1CQMA 1F9FA 4ZN1A 2GGPB 3WDOA 2R7UA 1AUSL 5I4MA 2H9ZA 2N4DA 2N3LA 3MEKA 4BDPA 3KHLA 4USTA 2M8DB 4DUTA 5I3PA 4DFKA 3PW4A 1UW9A 2VV5A 4YMEA 2WAQD 1UVIA 3ZZRA 2G9OA 3FKBA 4B08A 3OBIA 5IT9Y 5T7LB 3I9ZA 2RJZA 4IG3B 3MZIA 4F04B 1HWLA 2VG7A 1W2IA 1FTCA 2HVIA 2BM1A 3HHDA 3SCLE 3DOKB 4YB5A 2R7QA 3MOZA 4CNZA 3EGZA 3PEHA 1NJXA 4JI5J 4DXLA 3RAXA 1X9MA 2VBYA 3RUBL 1DBDA 2KKHA 4JYAJ 5B09A 5CD4H 2QYGA 3R97A 2OELA 1BXNA 4Q5VA 3P96A 2YBVA 4ZCKA 5I42B 4JI1J 1EKRA 2HVZA 3AD7C 2UUAF 1G7CB 4C8YA 4LR8A 4J9NA 2XHCA 1SJ4P 2HNDA 4IG3A 2CRLA 1R0AB 1NDPA 3BGRB 3ZZZA 1KLMB 2OD4A 1URNA 1J5OA 4WCEQ 2XYPB 1RAGB 1ZOTA 5AJ3J 4KE5A 4C0BA 3Q8UA 2JL9A 1RCXB 1UPPA 1OS5A 3KWMA 3A4TA 4URSA 1SJFA 2YQ3A 2MKJA 1K44A 1VK3A 4OQJA 3GYGA 3DOLA 4DUYJ 1S12A 3QBCA 1PAUB 2XLJA 5LOQA 3ETOA 2M2BA 4PAAA 3I5CA 3Q24A 4OYWA 4D3HA 1F1BB 1M1HA 4DR1F 4XAKA 3M8SA 3M2VA 3H4DA 4LBPA 3CCLS 2VBZA 3NCRA 1AUDA 2U2FA 8AT1B 1CPZA 2V69A 1ZTWA 3P3DA 2YPZA 4HDGA 2Y9HA 2K2PA 3M30B 3PACA 4OYXA 1JWWA 1I3OB 1VQKS 1H38A 4DSLA 3O44A 4JI2J 2HURA 4Z37A 1TFYA 2X51A 2AD9A 3DOMA 3G82B 1HBUA 2F4FA 2UXBJ 3MM6A 4U9RA 1TZ0A 4LIRA 1WDDA 3CULA 4PKDB 2JHEA 1DRZA 1EQ0A 1GK8A 2NQPA 4O4RA 1JJCB 4KHPJ 1CC7A 5CA5A 1R6VA 3NXZA 3AOCA 3A12A 2JFKA 4ZVTB 2DRAA 2EG2A 5GAEI 4WFNQ 1CG2A 1JLFA 3BREA 4HHUA 3SQGB 3OL9A 3MM8A 1NMEB 3MURP 5CYQA 5HJYA 4USIA 3M30A 1RT4A 5A8WA 3M1VA 2HFVA 4GKJJ 3QAEA 3CJSA 1CULB 1NPPA 4U7UK 3JXOA 1NK5A 3G8SA 1I94F 2HVDA 4RNHA 2UVUA 3E01B 4PG4A 3G82A 3W5XA 1QE1A 5LXYA 1SI9A 2R7XA 1TUWA 3E51A 3H90A 3HO1A 2XI3A 4NLGA 5C24B 3E3XA 3SSRA 5HK4A 4NLVA 1U48A 4F4XA 5ETSA 2WSCC 3IWLA 3TAMB 1Q8IA 2Q66A 2WTFA 2CPJA 1HHQA 2C2NA 3LPYA 2CVIA 1SV5A 1F2GA 3OR2B 4DU7A 1QAIA 2YQ1A 3VVUA 3C46A 3IG1B 2ZHBA 3UD5A 4ILMA 2KVIA 4P52A 1KTVA 5J2NA 1VQ7S 2QL9B 2VJUA 5KFKA 5A2QY 2BOPA 1X9WA 5CABA 2BEFA 3CD6S 1C4CA 3NOCA 1I6JA 2HAFA 2BKOA 3HP6A 3HHLC 4QPTA 3MAAA 5DGAA 2V4JA 4RW6B 1K73T 4DV4J 2B8PA 2QLWA 2BR0A 1TTHB 1QSYA 3H8YA 4Y6IA 3H2UB 1HI1A 3CJ0A 2ZNYA 3D0HE 3CO0P 1SC3B 3TO8A 1BQMA 1V3RA 1Z4UA 3Q8VA 3BSNA 1XBWA 4N77A 1WSVA 4X4VA 3IS9B 1U02A 4DPYA 2VOPA 4YR3A 1IKVB 4DR4J 2HFOA 2WVEA 3KJQB 3EJMA 4OYAA 3S7RA 3IG1A 3BKFA 2W8LA 2HMIB 2AIRB 3R5CA 5G4DA 1ZA2B 2KT3A 3QGPA 1WF1A 1N52B 2BJ9A 4M5MA 5EHHA 4B9NA 4F0HA 2J0XA 2ZM6J 2E9TA 3IRWP 2A2CA 1BQXA 4ECRA 2X7IA 3CJ3A 4NCGA 4Q8EA 1B7YB 4EGLA 2BE2B 1BGXT 2J8SA 2C1EB 5F3ZA 2ASDA 5RUBA 3KNGA 2VD3A 5EDWA 3RBDA 3MDFA 1YJUA 3PIPQ 3DXBA 2W9CB 1K1SA 5H9EK 3QAUA 2LLZA 3QGIA 2RSQA 1BLUA 2YNGB 4K2XA 2GQCA 1KQKA 4C9DA 4TVAB 1FX2A 2RRNA 1ICEB 1WEZA 4FXVA 1Y7PA 1S72S 4P2XA 2W2QP 1A7GE 2N7CA 2MZRA 4LSLB 2X1AA 2HSEB 4X64F 1S49A 5GAEU 4O3RA 5DLFA 5L1LA 2E5JA 4DMZA 5ETQA 3R27A 3QFHA 2XMJA 3LP2B 1KQGB 1VGYA 5KG6A 1B0PA 3L7PA 1RTIA 2VQEF 4IRKA 5AXNA 2HRTA 2G2ZA 5MLCV 3D68A 5IM0B 2DRBA 2Z2LA 3OD2A 1XTZA 4UOGA 2YQ0A 4ES3A 3CJ8A 2GQ2A 1EX8A 4LSNB 3DYAA 1SUQB 1D09B 3CDBA 1AT1B 3DXSX 1E6VA 1HQEB 3UDEA 2W2NP 2JEIA 5KG1A 2FJVA 1RWVB 3PX4A 2FC8A 2MZJA 4S0MA 3CCES 1HNWJ 4QYZK 5F3TA 5J2MA 2XHWA 3RRHA 1Y10A 1S79A 4J9MA 1SCJB 4IOAQ 1FFSB 4I1TA 3LP2A 4U67Q 1B0VA 1YK9A 4QOTA 4NLRA 4E98A 3CMQA 3N6NA 3EPIA 1FKOB 5IM0A 2DPJA 3QWUA 4DS4A 2W4DA 4LF7F 1Q5VA 4ZVOB 4CTAA 1XR6A 4K4TA 1IQZA 1TL5A 2VG5A 3PKYA 1H6KX 4HYKA 2QA1A 1S0VA 5DZ7A 4NRUA 4CLKA 1V9OA 3MTJA 3MGJA 3L3CA 3NCQA 4I7FA 3UE2A 3UD4P 1X4FA 2MJUA 3TA0A 2WOMA 3RB3A 1PYTA 1OPZA 2BANA 3DHWC 1Q79A 1IWAA 3BGUA 5F8MA 1VC0A 5A6WA 2Y0BB 3JTNA 4KB7A 1K47A 2DNRA 5H1SV 3NGDA 4TQRA 2KXFA 4AL5A 1RACB 2J5AA 4DX7A 2AEFA 1BHNA 1SJRA 4ID8A 1Q53A 2VASA 4DR2J 5B08A 5HQMA 3KK3A 2P9CA 1VDHA 2BDPA 1X4BA 4G1IA 3CPWR 2J6TA 2J0SD 5LMNJ 4W90B 4WIQA 4MKYA 1JMTA 1NJWA 2ZUGA 2HRYA 4F4AA 7FDRA 4OYBA 1HNZF 4AE5A 4OI2A 5GAHI 3BV8A 4OL8A 3QNWB 4OIXA 4ZJQA 2ZD1A 2KM8C 4YR0A 3KKFA 3GV8B 3N0VA 3KLIB 4B3TF 4I56A 2ZDOA 3PW2A 1NK6A 1JLGB 2I9SA 1HBOA 1TP7A 1FE4A 4JI3F 1AW0A 1MROA 1SL1A 1IBKJ 4CCHA 5C5JA 3DLKA 3VV2B 4RUAA 4C2MA 2IM3A 3G87A 4X66J 3AOAA 2ZITA 3W2VB 3A1YG 3CGIA 3I56S 1GH8A 1CJUA 4NI2A 3FCVA 2IA6A 3CDAA 3IM8A 2PMZD 1HPZA 1NJYA 3NWGA 1MWQA 1QJHA 5KFAA 4BC7A 3QFWA 3PY8A 2UP1A 1WEYA 5CH7B 3M8YA 2B56A 4FS1A 5IFMA 2WVCA 3VTIA 3LW5C 3TAQA 2AGOA 1SJQA 1L3UA 2X1GA 2IC3B 2WBRA 3Q8QB 3ZTQA 1LK5A 3ONQA 1NZAA 2IIHA 5KFRA 3EGVA 1YJNS 1JLGA 2DIVA 3MFIA 5U47A 3WZ0A 3AJDA 4RO0A 3W2WA 2JDJA 3DLLQ 5DQHA 1Q7LB 1H2VZ 4Q43A 3K7RA 1SBRA 1ELOA 3SBMA 2BJ3A 1VQNS 1WELA 1U1RA 2EC0A 2DHGA 1NXIA 2HQ3A 1NK4A 2J9EA 1TUGB 4O23A 2PA8D 2HHWA 2E66A 4NASA 2DGTA 4QQBA 3OHAA 2HHSA 2NLWA 1FCAA 3D7SB 5KT7A 2IVYA 4ALZA 1YQHA 4DPUA 4M63A 3OTCA 5AXLA 4DV3J 5ETLA 1Y4ZB 4AQYF 2C2OB 2EFPA 2VPWB 3I31A 4CH0S 2DGWA 2ZOMA 4DV6F 3M05A 1NDKA 2HHXA 1J5EF 4M5JA 1V5VA 2CZ4A 4DR5F 1GQEA 1TAUA 2B4PA 4FKXA 3GG0A 3LPEA 1S0MA 3WIUA 3AB2B 4A47A 4KSEB 3BZQA 2MQ8A 2HNZA 2RE1A 3KLEA 1NEEA 1RHQB 1Q78A 3KK1B 2CQ0A 1FRMA 4O4GB 4IFVA 4WP9A 1SB6A 3RZAA 5M2UA 2X3DA 4NA2A 3H4BA 5DZ6A 4AD6A 1T0TV 5E3AA 2VFRA 1ZM9A 1FRXA 4E8UA 1EIYB 4DL5A 5KFXA 4FNIA 4LBIA 2V68A 4G6VB 4Y2AA 3O3LA 3KXDA 5DS7A 4RU9A 2NYHA 4TLRA 2ZH7A 4LF8F 2Y1RI 1NKCA 4RWWA 1N33J 2VONA 5DM6Q 3CIZA 2D7SA 2LMIA 1P1LA 4X4SA 2VHGA 1RXOB 3KG4A 1Q82T 3TJ9A 3PFOA 4L75A 1C1BB 4K8RA 2OKQA 4J9OA 2MZQA 4LF5F 2HFNA 4WU3A 4KHRA 1LW2B 2RDJA 4AT1B 3IMQJ 1VLYA 5H9FK 1SQFA 3K5NA 3FEXB 3UVJB 3VAIA 3B4MA 2CQ4A 4G1PA 1JLQB 4QW9A 2IDLA 1GT8A 2HBYB 2C2RA 2W9AA 1J2VA 2P5VA 3JS9A 4Y2KA 1HFEL 1FF2A 5F9LA 4WIIA 5KG7A 3BEGB 4FP9A 4TNOA 2OI2A 2NXJA 3ET6A 4JI0J 3D4JA 2FVPA 3IBFB 3V4MA 4PWDA 2PO4A 2QL7B 1T05B 3R5AA 3D3CJ 4NLDA 2IVFB 1YX2A 2PD1A 1OQ3A 4M95A 1VBYA 5CXTA 1UETA 3BDEA 3L7OA 2G0CA 2ZC4A 2HHVA 2CQDA 2P9EA 2OUGA 5F8IA 3V6KA 3PRDA 4K0KJ 3DCAA 2NPIA 2QA2A 4JI5F 5E3RA 4B3SJ 1N36J 2G1HA 1KQFB 2BJDA 4DR3F 1CQNA 3F0NA 1D8ZA 4G65A 2E1RA 4USVA 1H7XA 4JYAF 4I4BA 3OTEA 5K20B 3M9OB 4NLYA 3A8KA 5KFQA 2ZVSA 4FPRA 2CJXB 4JV1A 4CI0B 5HBMA 3VAMA 1T9VA 3OVSA 4P2MA 2XSFA 1RE1B 1JXVA 3H20A 4OHZA 1UKUA 3NWRA 4CZCA 5L46A 4U7CA 3JSMB 1BWVA 3IA0A 4K50A 5J1NA 3TW0A 2F9DA 1F6TA 1JB0C 4B9UA 3AQPA 3WIVA 1IR0A 3M6UA 2LKZA 4UTGA 3OXGA 1LWXA 2IRUA 1EQMA 1IKXB 2XULA 4WJBA 3CCUS 4IYQA 2OSQA 2HLUA 4DV5J 4A48A 1WD6A 4XPEA 1P27B 3IRXB 3WHIA 4CYUB 2VFVA 3X3UA 4C97A 4ED3A 4DUYF 2JX2A 3ZTPA 2ZJRQ 2V2ZA 4ZIWA 2CQCA 2DGSA 1OJ4A 2O67A 1AZSA 3EM1A 3JSMA 2G2OA 3EE3A 2EKYA 1VS3A 2W24A 4ZLPA 2N82B 3T1HJ 4R5PA 1EARA 2W9BA 4KH1B 3DGPB
chains in the Genus database with same CATH topology
1RHJB 3RJMB 1SC4B 2CNLB 4DCPB 1RE1B 2H51B 1RHUB 3NS7B 2C2ZB 3KJQB 4JB8B 2CNKB 2Y1LB 2CNNB 1RWOB 2XYPB 3IBFB 1RHRB 2C2OB 2H5JB 3IBCB 1RWXB 2H65B 1RHKB 3R7BB 4ZVOB 3R5JB 3D6HB 3P4UB 2P2CB 2QL7B 3EDQB 1QDUB 2CDRB 2QL5B 2FQQB 2XYGB 1RHMB 5IC4B 2HBQB 2C2KB 1RWNB 3R6LB 1IBCB 1I51B 1PYOB 1RWMB 2QLJB 3D6FB 5IC6B 3R7NB 2C2MB 1PAUB 1BMQB 3GJQB 2H4YB 2QL9B 3QNWB 4ZVTB 4DCJB 1GFWB 4ZVPB 3SIPB 2C1EB 2H48B 3KJFB 1NMEB 4ZVQB 3R6GB 3D6MB 2CNOB 1RHQB 1RWWB 4DCOB 4ZVRB 3R7SB 3GJSB 2Y0BB 3P45B 2XYHB 2HBRB 4ZVSB 1RWVB 4LSZB 3GJRB 3KJNB 1F9EB 2XZDB 2XZTB 1RWPB 1SC1B 2CJYB 3GJTB 2H4WB 2DKOB 3EDRB 2HBZB 2QLBB 4ZVUB 5K20B 1SC3B 2HBYB 1QTNB 2H5IB 2QLFB 2CJXB 2H54B 1ICEB 1RWKB 1I3OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RHJ B;  3RJM B;  1SC4 B;  2CNL B;  4DCP B;  1RE1 B;  2H51 B;  1RHU B;  3NS7 B;  2C2Z B;  3KJQ B;  4JB8 B;  2CNK B;  2Y1L B;  2CNN B;  1RWO B;  2XYP B;  3IBF B;  1RHR B;  2C2O B;  2H5J B;  3IBC B;  1RWX B;  2H65 B;  1RHK B;  3R7B B;  4ZVO B;  3R5J B;  3D6H B;  3P4U B;  2P2C B;  2QL7 B;  3EDQ B;  1QDU B;  2CDR B;  2QL5 B;  2FQQ B;  2XYG B;  1RHM B;  5IC4 B;  2HBQ B;  2C2K B;  1RWN B;  3R6L B;  1IBC B;  1I51 B;  1PYO B;  1RWM B;  2QLJ B;  3D6F B;  5IC6 B;  3R7N B;  2C2M B;  1PAU B;  1BMQ B;  3GJQ B;  2H4Y B;  2QL9 B;  3QNW B;  4ZVT B;  4DCJ B;  1GFW B;  4ZVP B;  3SIP B;  2C1E B;  2H48 B;  3KJF B;  1NME B;  4ZVQ B;  3R6G B;  3D6M B;  2CNO B;  1RHQ B;  1RWW B;  4DCO B;  4ZVR B;  3R7S B;  3GJS B;  2Y0B B;  3P45 B;  2XYH B;  2HBR B;  4ZVS B;  1RWV B;  4LSZ B;  3GJR B;  3KJN B;  1F9E B;  2XZD B;  2XZT B;  1RWP B;  1SC1 B;  2CJY B;  3GJT B;  2H4W B;  2DKO B;  3EDR B;  2HBZ B;  2QLB B;  4ZVU B;  5K20 B;  1SC3 B;  2HBY B;  1QTN B;  2H5I B;  2QLF B;  2CJX B;  2H54 B;  1ICE B;  1RWK B;  1I3O B; 
#chains in the Genus database with same CATH topology
 1NPR A;  1RBA A;  1KFS A;  2M8H A;  3H5Y A;  4JUZ A;  4OV6 A;  2AJ2 A;  1WF2 A;  3LGN A;  2NR0 A;  3V81 A;  3AA8 A;  5KFB A;  3KLH A;  1RHK B;  2K1R B;  3EDQ B;  2F7V A;  3MUV P;  1M1K T;  2NXC A;  1F9H A;  2RQM A;  4C3M A;  1QUP A;  1RWN B;  2UXB F;  4ILR A;  4DUZ J;  4CO3 A;  3QYY A;  3FBB A;  5J2Q A;  4GC7 A;  1M90 T;  3MM5 B;  3U1L A;  1YJ9 S;  2HZV A;  4C3L A;  3WC2 A;  1IQT A;  2KHD A;  4KHP F;  3DRR B;  1NDC A;  3LP1 A;  8RUC A;  5A8K A;  3RRG A;  1T03 B;  1HNV A;  1RAD B;  2QMU B;  5KFS A;  1NUE A;  1QVG R;  1PJ6 A;  4UT4 A;  3C2P A;  2GML A;  4EU0 A;  1FE0 A;  1FXR A;  1N4L A;  2ZBR A;  4LJM A;  4WXO A;  1S6P A;  5IWA F;  4GKJ F;  3DFE A;  2C2E A;  2JNJ A;  3GIJ A;  1YIJ S;  1NND A;  1JIH A;  3C66 A;  2QLF B;  4L3K A;  3MOJ B;  5D4P A;  4OI6 A;  3M2R A;  2YH1 A;  2ATC B;  3CJK B;  1RB0 A;  1Y0H A;  4WP8 A;  4DEZ A;  2BW2 A;  4K4W A;  2RS2 A;  2UVR A;  1GAO A;  1KVI A;  1YG0 A;  4A8W A;  4RU2 A;  3M7V A;  4PUO B;  1CLF A;  1S1U B;  3PJW A;  1VHF A;  4DFP A;  4KFB B;  3D1H A;  3ENA A;  1WC4 A;  2JEF A;  5JMN A;  1IM6 A;  5EGY A;  2FY1 A;  4ZP7 A;  4OX9 J;  3KUE A;  4B17 A;  1TKX A;  2NUU G;  1VIS A;  5THW A;  1E6Y A;  1PCA A;  1BD6 A;  1KOO A;  3ELH A;  1T9Y A;  2KFN A;  4NA3 A;  4QZV B;  1FXD A;  5B7W A;  2COL A;  1UJ4 A;  4O3Q A;  2J9D A;  3B78 A;  1RAO A;  2GIQ A;  2RQ4 A;  2RML A;  3GR1 A;  1X5P A;  2VG6 B;  2PA3 A;  2ZJQ Q;  1GTH A;  2Z8Q A;  1NCL A;  2ALZ A;  2XGQ A;  1IVZ A;  1WJ9 A;  4FKY A;  2CQB A;  4ZJO A;  4PUO A;  3DLE A;  3SMZ A;  3SV4 A;  4KFB A;  4N7T A;  2F8E X;  1WDT A;  1N34 J;  2FJE B;  3TEG A;  4L72 B;  3BPD A;  3EZO A;  2EVZ A;  2DNK A;  1R43 A;  5ETM A;  1U0S A;  3GV7 B;  1FK9 B;  3U02 A;  4O0I A;  1AFI A;  4DR4 F;  2MMY A;  4F3O A;  2O01 C;  3BKT A;  4X4T A;  5C25 B;  3U27 A;  1YDL A;  3HVW A;  4ITS A;  4ETX A;  3HVR A;  2WON A;  2XLK A;  2VG6 A;  3M6W A;  2OSR A;  1KVK A;  3X1L B;  3C8Y A;  4MYU A;  3A8I A;  3GPA A;  3SCK E;  3GQC A;  2KFZ A;  4KGZ B;  3J7A 1;  2N7Y A;  1HNX J;  2QSW A;  1YBT A;  2Z56 B;  2ZKU A;  4M1K A;  3RBX A;  2MHE A;  5J1P A;  4V19 X;  1D8Y A;  1TK8 A;  2QSF A;  3N28 A;  2M88 A;  2UUB J;  1ZAW A;  5J1E A;  3HVA A;  1UFL A;  3K17 A;  1RKJ A;  4DL0 C;  4RW4 B;  3IAM 9;  2RB7 A;  3GFZ A;  2H5I B;  2GVZ B;  3HF5 A;  1S9G A;  2UUC J;  3MR2 A;  3CVK A;  3SI8 A;  4GKK F;  2CQP A;  5C25 A;  1A0O B;  2GO8 A;  1FWP A;  2IY5 B;  4P74 A;  1FDD A;  1UFW A;  2G0J A;  2YNF B;  3QMQ A;  2MQO A;  2ZBI A;  1O5J A;  2ZZN A;  4DR7 F;  3K5O A;  2OIH A;  5BR8 F;  3HZE A;  5HRO B;  2MQM A;  4N56 A;  2YXL A;  2QE5 A;  3MM7 A;  3JYT B;  5A0Y B;  3I0R B;  2Y1J A;  1TL3 B;  1EB0 A;  1PJ5 A;  1SKW A;  1K9M T;  4RPF A;  2LCW A;  2DIU A;  5ETO A;  5A2Q U;  4BCA A;  3P5T L;  3QO9 A;  1NSP A;  4X65 F;  1GX5 A;  3NEK A;  4RW4 A;  3NL0 A;  3TUJ C;  4IKA A;  3DDK A;  1RWW B;  4R25 A;  1X0P A;  3PIO Q;  2ZC3 A;  1WC1 A;  3CCR S;  4NLP A;  2DR7 A;  2MDA A;  2D3Z A;  2WSE C;  3NOG A;  4ZIT A;  2EKN A;  4NZ7 A;  4DR6 F;  1A9N B;  3I96 A;  4FBT A;  4H4K A;  5HRO A;  1HNW F;  2PT0 A;  5H9F J;  3VAG A;  2HPU A;  3JYT A;  3CC7 S;  3EX7 B;  3GFY A;  4LF9 F;  4IQX A;  1UZD A;  5CZV A;  2J6S A;  1HNI B;  3CF5 Q;  4PG7 A;  2VU5 A;  5BXI A;  1B64 A;  1SL0 A;  2EBG A;  3WX4 A;  1V6H A;  4H4M B;  3HKW A;  5F8J A;  2IMO A;  2MGZ A;  3M8Z A;  1SJ3 P;  3CT9 A;  3ILL A;  2HGM A;  1RZM A;  3PXG a;  5IS2 A;  3F73 A;  4J91 A;  2O3D A;  2MQQ A;  1HKA A;  2A3J A;  1C0T B;  4X4Q A;  3VAL A;  4LF6 J;  4UF4 A;  2BRK A;  3M8Q B;  3RG6 A;  1U47 A;  2VA2 A;  2IM0 A;  1S9F A;  3GJR B;  3VGT A;  1RWP B;  4NXM F;  4LVO P;  1O8B A;  3AH6 A;  1RTH B;  4LFC J;  2ATL A;  1WI8 A;  3N79 A;  2LDY A;  1UVL A;  3GIM A;  1UVM A;  2FIU A;  3AAW B;  3K0J A;  1QD1 A;  3T1A A;  2BAB A;  3BB5 A;  5D4O A;  1X4E A;  4IRD A;  3T1Y J;  1Q5Y A;  4NWB A;  3OFE A;  3GSD A;  2C2Z B;  1C2P A;  2AW0 A;  2OPQ B;  4JB8 B;  4M5D B;  2LU2 A;  5CD4 A;  2HVE A;  4KR0 B;  1S1V B;  2JH3 A;  1WC0 A;  4LF2 A;  2UXC J;  1R8C A;  4FNH A;  4QBU A;  3M9M B;  3TAN A;  2CG4 A;  1HD1 A;  1RU1 A;  1XMO J;  1AFJ A;  1LWF B;  1RSC A;  4G1Q B;  5KT2 A;  1MWY A;  1W25 A;  1TL1 A;  4DCJ B;  4EZ6 A;  2DH8 A;  1RTH A;  1R8B A;  3V4I A;  1RT6 B;  4XTT A;  4ZDN A;  3OHB A;  4DL3 A;  3LWL A;  1F5A A;  4A8F A;  1LEO A;  2BUN A;  3OR1 B;  2XY5 A;  5KFL A;  2KRR A;  1KD1 T;  4ED7 A;  1LK7 A;  2ZUA A;  4Q2L A;  4U96 A;  1S1X B;  1CJV B;  1IBK F;  2DH7 A;  4AXJ A;  4F26 A;  1OQ6 A;  1SVD A;  3W65 A;  1REV A;  3T9Z A;  5B0F A;  5KFM A;  5GAD I;  5HO4 A;  1RT3 B;  4X66 F;  5HMY A;  1RT5 A;  4CLY A;  4RLE A;  1V3Z A;  3OLB A;  2LA6 A;  3H7H B;  4C8M A;  3BH7 B;  2MXY A;  3LP0 B;  2KXH A;  3V6H A;  1C0U B;  4WF9 Q;  3MTK A;  2IJN A;  3OUY B;  1WG1 A;  3CUN A;  1RT6 A;  2NZ4 A;  3S01 A;  2DPI A;  2Q1L A;  1TV6 B;  3DI6 A;  3QIP B;  2QMX A;  3PRV A;  1N48 A;  4KO0 A;  1HMV A;  1IKY A;  3AOB A;  3MPW A;  3O2I A;  1S1X A;  4LF1 A;  2R2T A;  1VQS A;  2HKE A;  2CNO B;  4NL5 A;  3A8E A;  2Q79 A;  2DBB A;  3AJ1 A;  3P45 B;  1RT3 A;  3I32 A;  2F3J A;  4OZN A;  2E44 A;  3G2X A;  4I2Q A;  3QT8 A;  1GMW D;  2N4C A;  3J7Y U;  1IN0 A;  1KHV A;  3PVX A;  4MFB B;  3W1Y C;  2CPH A;  4EWT A;  1KSP A;  1UW4 A;  2HQG A;  1PG5 B;  1QAY A;  1WC5 A;  1UEK A;  4QW8 A;  3N9U C;  2H3E B;  2G1D A;  4QWD A;  1O0P A;  3DRS B;  1UA1 A;  1GXT A;  1RJJ A;  2B5J A;  4QCL A;  1QSS A;  4PQU A;  2A18 A;  5A76 A;  5KFJ A;  4EYH B;  3R5J B;  3BM7 A;  2J8A A;  4B3O B;  2E9R X;  3R1H A;  5KFG A;  1JNR B;  4PG6 A;  2MKY A;  1TVR B;  1K1Q A;  5KFU A;  3H5S A;  1QY7 A;  3EMT A;  5ETT A;  2KYZ A;  1O6X A;  4FYW B;  1GFW B;  1N56 A;  1HBN B;  3MPU B;  1R8P A;  3SZ2 A;  4RW9 B;  1S6Q A;  3MUT P;  1D9A A;  2GAG C;  4HR2 A;  4J9V A;  3L95 X;  4K59 A;  2HWH A;  4PWW A;  2W8K A;  2ZH4 A;  2O5D A;  4TYA A;  3BGL A;  2Z2Y B;  2UXD J;  3NGU A;  2CPX A;  3W5Z A;  1ZZF A;  1N0U A;  1GXL A;  4PYD A;  4B3O A;  2Z4P A;  3C19 A;  1VRT A;  2CNL B;  2R8I A;  1RT7 B;  1X31 C;  2Y8W A;  3Q86 A;  4RUH A;  2QJ3 A;  1RHR B;  2CFX A;  2GO9 A;  4IUF A;  1FO1 A;  3CXC R;  1XNQ J;  2PFD A;  2BQ3 A;  4PRF A;  5HVF A;  1NB7 A;  4A8O A;  3I0S B;  4DV7 J;  3R6L B;  2IFX A;  1N33 F;  2AKW B;  2OAU A;  2M3D A;  3HUL A;  1QVF R;  2QA4 S;  5ETV A;  3TUZ C;  4QPX A;  3NGK A;  4ZMM A;  4AL7 A;  2PC6 A;  1T9W A;  4C0H A;  3KJF B;  2UU9 J;  1U0H B;  4PXB A;  2LEB A;  3BQ2 A;  3W8P A;  5M2R A;  4B3M F;  1QTM A;  3TAP A;  4WKR A;  4ZVR B;  1NHV A;  4UOC A;  5E3C A;  4J9Q A;  3ZZ0 A;  3G9C A;  5T41 A;  3KDN A;  1BWE A;  2YNI B;  2OLW A;  3UR0 A;  1RCO B;  2QZ8 A;  4P6Q A;  3MHY A;  2B9W A;  2VQF J;  1KTQ A;  2HWI A;  2FTR A;  4HH0 A;  5K14 B;  2LQB A;  3GZ7 A;  4B9L A;  2V8G A;  4O3P A;  4DCP B;  2R8J A;  2W2P P;  4QU6 A;  5IT4 A;  1RT2 B;  3NMA A;  4FYD A;  1NKE A;  4DOZ A;  2AYB A;  1RWO B;  4PAB A;  1VQO S;  3V2U C;  3O8W A;  4OMF G;  4JI0 F;  4AL6 A;  3F41 A;  3D54 A;  2QLX A;  2ZKT A;  2FLN A;  2ASL A;  1WKL A;  2DHS A;  3ENW A;  5K8N A;  2CQ2 A;  3QRQ A;  3SDE A;  2XMW A;  1RTD B;  4C6A A;  2L9D A;  2YNH A;  4IDK A;  2OFG X;  3UW1 A;  2H4Y B;  3BSC A;  2IAJ A;  2XNR A;  3LGH A;  3DU5 A;  1U09 A;  3NBP A;  1NU4 A;  4P75 A;  1HA1 A;  4A8Q A;  1VJQ A;  2LXU A;  4F4Z A;  5KFZ A;  2HG4 A;  1CS4 B;  2BKN A;  3RW6 A;  5HL7 Q;  4EO8 A;  1OMS A;  1TL7 B;  4N8O A;  4ENO A;  4J9R A;  3EVO A;  4CIO A;  4OI0 A;  4YHH J;  4K0K F;  4ZVU B;  2E1A A;  4B3S F;  4KGX B;  4DSF A;  5K8O A;  1N36 F;  3L09 A;  3TEH B;  2MST A;  5B0C A;  3DC2 A;  3LAN A;  1UFK A;  1PKU A;  2CXE A;  1NRK A;  4X84 A;  2R7T A;  1UWB B;  4KYZ A;  4PYA A;  2MHN A;  4G3I A;  2F5G A;  1IKW A;  4OYM A;  3M9N B;  1HBM A;  2B8Q A;  3LH2 S;  2OPS B;  4GO5 X;  4C11 B;  1DY3 A;  3GMG A;  3CJ2 A;  4TLQ A;  5L38 A;  1U1P A;  3D6F B;  4OI1 A;  1LKZ A;  5IXU A;  4NXN J;  2EWH A;  5ADZ A;  1QSL A;  1TL7 A;  5E2Q A;  3OJU A;  4ZS6 A;  2JZ5 A;  2YKN B;  4FPI A;  1TKZ A;  3QID A;  1JLC B;  5KFH A;  3G96 A;  2QV6 A;  2JEJ A;  2KRB A;  1UA0 A;  4DV5 F;  4FYY B;  3KLF A;  2AJ1 A;  3POT B;  2EG1 A;  1ZM4 A;  1S1T A;  4J37 A;  1VMB A;  1WKK A;  2HBZ B;  2V4Q A;  1FDN A;  2AV5 A;  5BYR A;  1APS A;  4C7Q A;  1ZAX A;  1XMQ J;  1P6T A;  2B9E A;  2V34 A;  1Y3J A;  2I0X A;  3T1H F;  4RW8 B;  3UN2 A;  1EP4 B;  4LQ9 A;  4CLT A;  1UEV A;  2VIC A;  2EFN A;  1VQ4 S;  5ETK A;  4URG A;  3HHL D;  5K8M A;  1I1G A;  2DR5 A;  1GNK A;  1M5K C;  5JVG Q;  3SFG A;  4HLB A;  3R5G A;  3QRR A;  2HK2 A;  1JXL A;  4RNM A;  2DNP A;  4X4N A;  3R7N B;  4O44 A;  2C2M B;  1FES A;  3KG1 A;  3POT A;  1NH7 A;  2GC8 A;  2Y1I A;  3DU6 A;  1M5O C;  1N32 F;  5AE1 A;  3THP A;  4DUZ F;  3DMJ B;  1IBM J;  1H74 A;  3BR8 A;  1I5O B;  3CCS S;  4ED0 A;  1NBE B;  3TUP A;  1UL3 A;  1FKP B;  4Q45 A;  3M8R A;  1GTE A;  3U1N A;  1RA6 A;  3PO5 A;  3N6M A;  1PIL A;  1SQE A;  1JNZ B;  2CJB A;  4RW8 A;  3BR9 A;  2VF3 A;  4XIU A;  3TQE A;  2E5L F;  4USH A;  2W7O A;  5B0B A;  2PN6 A;  3PYD A;  2L08 A;  4I6A A;  3MI7 X;  2B3T B;  4USK A;  4ZK7 M;  1CEZ A;  4CO1 A;  5KOX A;  2DH9 A;  4YY3 J;  3M8P A;  2I5J A;  4AYB D;  4M5G A;  1TUV A;  1RI7 A;  4HL9 A;  2R8H A;  3BO4 A;  4RX6 A;  3EVW A;  5EWE A;  5ETN A;  4IH5 A;  4PPZ A;  2Y1L B;  3IO1 A;  1R89 A;  4P72 A;  1WAC A;  3BGF A;  5AT1 B;  3CSK A;  4HVZ A;  1DTQ A;  3BJY A;  2EFO A;  2YKA A;  4J5O A;  3UWT A;  1TMJ A;  3KK2 A;  2W2O P;  4NX9 A;  5KFD A;  4L6V 3;  3KLG B;  4QWE A;  3GON A;  1MU2 B;  4HAC A;  3MEE B;  1T8E A;  1HQU A;  3R5D A;  4F2S A;  4EI2 A;  2CQI A;  1U25 A;  4B3R F;  2JC0 A;  2WB4 A;  1JKH B;  1FTR A;  1RDR A;  2C3P A;  2OPP A;  2AHO B;  5AE3 A;  4U8V A;  3IBW A;  1S5Z A;  2ZBP A;  4IO1 A;  4CO4 A;  3TUI C;  5B0E A;  5CCM A;  1ROF A;  5DDO C;  4N41 A;  2HGN A;  1L3V A;  1CJT A;  2NSB A;  4Q2M A;  3BH6 B;  3HD1 A;  3T5J A;  5JUM A;  2UV8 G;  1H98 A;  5D8H B;  3V6D B;  1ZH5 A;  3W9J A;  2C22 A;  3JAM U;  1N5V A;  1FFG B;  4IG0 A;  3NS7 B;  5EWG A;  3J7Z 5;  1FX4 A;  3HVT B;  4D3G A;  4O3N A;  3Q8R B;  3C3L A;  2J7K A;  2VOO A;  2JLE A;  1JX4 A;  2FVQ A;  1JKH A;  4J9K A;  5LL6 d;  2JEG A;  4ED4 A;  4C8K A;  1WSR A;  4LRF A;  1BQN B;  1N34 F;  1S1W B;  2QEX S;  1CSJ A;  1SIW B;  4N76 A;  5I3U A;  1TFW A;  4ZPV R;  2FHJ D;  3DKD A;  5E7O B;  5FDL A;  2YWW A;  2A6M A;  1VRU B;  2WW8 A;  2GZO A;  5K8P A;  3QZ7 A;  4HT7 A;  1REG X;  4HHJ A;  1L3S A;  4EK2 A;  2GAH C;  4YOE A;  1DLO A;  1VYA A;  3A3N B;  3LGM A;  1NSA A;  5HI7 A;  1TK0 A;  4MMO A;  3NGT A;  1F0X A;  3G6V A;  1U1N A;  1LWE B;  1N8R T;  1RT1 A;  3W62 A;  1PIE A;  2G4B A;  1NSK L;  2FHK A;  2FB0 A;  3NGS A;  2YKM A;  1S1W A;  2RF2 B;  3MCS A;  1M5H A;  2JLG A;  1UJ6 A;  4DSK A;  2CKW A;  5D78 A;  4CH1 A;  4NOH A;  4W98 A;  5DG7 A;  3H25 A;  3KMS A;  3FMW A;  2J0W A;  1FEE A;  4EEY A;  1D9D A;  4QR1 A;  4A8K A;  2GGP A;  2Q6B A;  1ITP A;  4DLE A;  1U6F A;  1X0F A;  2ERR A;  3WQP A;  1MNE A;  3OV7 A;  2OEK A;  3HPO A;  5AXM A;  1LWE A;  2NCK L;  2J76 E;  3PFE A;  2V67 A;  3N5F A;  3OW2 R;  3JB9 k;  3GIL A;  4USW A;  2DNG A;  2F4V F;  1KEK A;  2RNE A;  1S48 A;  5T7L A;  3RR8 A;  4YN3 B;  6AT1 B;  3BBF A;  4ELT A;  4H4O B;  5F8G A;  3AY0 A;  2XZT B;  5LXR A;  1IJF B;  2E5H A;  3I6P A;  3DOK A;  1MMD A;  2BJ1 A;  2YVS A;  4TU9 A;  1VQP S;  2OEM A;  4ELU A;  5EWF A;  3IXQ A;  5KOW A;  1IWG A;  2KL8 A;  2LXF A;  2PI4 A;  3RB6 A;  2V6A A;  4ZPT R;  4A8Y A;  2HHT A;  2HW3 A;  4OYI A;  4KT0 C;  1WC6 A;  1ZM3 A;  2W01 A;  3K2Y A;  5D6G A;  4IOC Q;  3QLH B;  3CMA S;  3D1O A;  5I42 A;  1UPM B;  5EX0 A;  4HH1 A;  3EVM A;  3J7Z T;  1FRJ A;  5D3G B;  1F5B A;  1Y3K A;  4XO0 A;  3CO9 A;  4OHX A;  4AXI A;  2AGP A;  5J2P B;  1ACM B;  1B0T A;  1KS2 A;  1R0A A;  3BGR A;  1KLM A;  3ADA C;  3SIP B;  2A6O A;  2W2M P;  2V50 A;  4ZHR B;  2VBX A;  2B6A B;  3OFG A;  2CA9 A;  4ECV A;  2HZA A;  4Y28 C;  3ZZO A;  2QX0 A;  3LAK A;  3GJS B;  2DR6 A;  4TU7 A;  4P9S A;  3MXH P;  1H2T Z;  3UNY A;  4USU A;  4OX7 A;  1D0E A;  5A8R B;  2RUG A;  4Y0F A;  4WTO B;  4UW2 A;  1VC6 A;  3K89 A;  5D15 A;  2VH7 A;  1XEZ A;  2CZV C;  1K0T A;  2KU7 A;  3C14 B;  4C98 A;  2BW7 A;  4Y00 A;  5CZX A;  3NNC A;  1FA0 A;  2DIS A;  2HFS A;  4WZM A;  3I9V 9;  4U7U D;  4R8U B;  1YTY A;  3S8S A;  2CPZ A;  3H40 A;  2MLY A;  3T1Y F;  5C42 B;  4UOH A;  5E5N A;  2GNK A;  4ZPB A;  4OYP A;  2MQP A;  2V5H G;  3PJ9 A;  4ELV A;  2Q6C A;  4DV2 J;  3Q2S C;  1H3D A;  4IR1 A;  1S10 A;  1B7F A;  3N6L A;  2UXC F;  2QN6 B;  4YDD B;  1DAR A;  1GMV A;  3O5T B;  2XTJ P;  1P1T A;  3TOQ A;  1DTT B;  1LXN A;  2BAC A;  4ZLL A;  4O3S A;  4RBU A;  2DNZ A;  4U95 A;  3DLG B;  2EK1 A;  3BDP A;  3J81 j;  2O1P A;  1F3F A;  3KJV B;  3R7S B;  3MED B;  3ISN C;  3G6E S;  2PI5 A;  2AEM A;  4ETZ A;  4LSZ B;  3CCW A;  2WSF C;  5FD1 A;  2LFV A;  2XC9 A;  1G4C A;  3TYT A;  4B9S A;  4KGV B;  4CM0 A;  3PDN A;  4HKQ A;  4CRJ A;  2BE9 B;  1XNR J;  2ZOG A;  3QJP A;  1RGV A;  5KT5 A;  4FXW A;  4ZP8 A;  3SQG A;  2E7V A;  1VQM S;  2KJW A;  3W7B A;  4DF4 A;  1LV5 A;  3JTO A;  1KBR A;  1CUL A;  3PYG A;  3FNN A;  3RGI A;  1DUR A;  2DGX A;  5HMZ A;  4CT8 A;  3ZC4 A;  3E01 A;  4USM A;  2A2D A;  2BA9 A;  4DU8 A;  3EGN A;  2ZFH A;  3OTB A;  2MYF A;  2IJF A;  5GME A;  2VPY B;  2A0F B;  2P8I A;  1WKJ A;  2FHM A;  5C24 A;  2IRX A;  3T9N A;  1FDB A;  2MZ1 A;  4RW7 B;  4ZVP B;  1RAE B;  3C6U B;  2KG0 A;  3BSO A;  2YWK A;  3TAM A;  4NYZ A;  3I4P A;  3CC2 S;  2Y8Y A;  3IFE A;  4XPC A;  3OR2 A;  1LWC B;  4EBC A;  3H5X A;  5L8R C;  3W5Y A;  5B0G A;  3TVK A;  2BQR A;  2GHW A;  2ZDP A;  4DG1 B;  2QGF B;  3IM9 A;  5HJX A;  1R7I A;  4ZIV A;  1XMB A;  2LDI A;  4C8Z A;  2EFG A;  4M5H A;  2QFI A;  2APO A;  2G13 A;  4OYO A;  2B43 A;  2HQC A;  3MPD A;  4JI7 J;  4RW6 A;  2NPF A;  1NLK L;  2B9Y A;  1YBA A;  4L3N A;  2EFV A;  3ZO7 A;  4X64 J;  2F1F A;  3VQS A;  4C8N A;  5IQ6 A;  3MEC B;  4A8S A;  1Y11 A;  2GMJ A;  2VQE J;  3AJ2 A;  3SYZ A;  3IS9 A;  3O1L A;  2XZW A;  3H59 A;  3CJ4 A;  1IKV A;  3K57 A;  1SIZ A;  5KT4 A;  2DEI A;  2Z0G A;  2CPI A;  1QAJ A;  2DR9 A;  2HMI A;  4O3O A;  3CME S;  1AXQ A;  4TU8 A;  1PC4 A;  2YKQ A;  1OYE A;  3MMA B;  4M8L A;  1MN7 A;  5MAO A;  1JLB B;  2BV3 A;  4B9V A;  4WPA A;  4NZ0 A;  3KJN B;  2CPE A;  4CLL A;  3L9Z A;  2E1M C;  3TZW A;  1U2R A;  4RWX A;  5JJB A;  2BE2 A;  2H54 B;  1FDA A;  5KFO A;  1N6Q B;  2C3M A;  2AF6 A;  3M32 B;  5E33 A;  1N5Y B;  2UXD F;  2MQN A;  3MR3 A;  2W9C A;  2EK6 A;  1HQ2 A;  1F2H A;  4P7V A;  2ZE2 B;  4YS2 A;  3P6Y C;  3PR5 B;  2HFZ A;  2YNG A;  4OX8 A;  1HW8 A;  3J81 U;  1HWJ A;  4X62 J;  4LF7 J;  4NPO A;  4PXC A;  2RDD A;  4NA1 A;  3CD7 A;  5M2P A;  4UZC A;  1TU0 B;  1S59 A;  3CDE A;  4GO7 X;  3H2V E;  2HHH J;  1JLB A;  3KUH A;  4P10 A;  5CHC B;  4DV7 F;  4LSL A;  2V94 A;  4FBU A;  3R3T A;  3NS5 A;  2UUW A;  5FLX U;  2MLZ A;  3D6T B;  3QJL A;  3ETM A;  2EBE A;  1YWX A;  4ZVE A;  1OIA A;  4NLU A;  4FN5 A;  2RU3 A;  2KG1 A;  3DRX A;  4Z2X A;  1FFW B;  3QRP A;  2QG9 B;  1VBK A;  2FY8 A;  2HQD A;  2JLF A;  1RQ0 A;  2H1Y A;  2C3U A;  1XQI A;  5HLF B;  3HM9 A;  3HCX A;  2KN4 A;  4LSN A;  3MM9 B;  1PO6 A;  1SUQ A;  5L9X A;  1Q16 B;  3MCM A;  3BKU A;  2VQF F;  1HQE A;  5DDP C;  2EW9 A;  2LVW A;  4Y2C A;  4K4V A;  1VLO A;  4ICL B;  2MKS A;  1RLC L;  1UVK A;  2RKI B;  2ZH3 A;  3QZ8 A;  4DFM A;  3CIM A;  1Q8B A;  3FQK A;  4NLW A;  5F8N A;  3C15 B;  4LFA F;  1NK8 A;  3L4B C;  1XC9 A;  2UVW A;  3ENV A;  4TY8 B;  4DV1 J;  4DL7 A;  1HNZ J;  1FKO A;  2GX8 A;  3HSJ A;  2F9J A;  4U8Y A;  5IV4 A;  4Y2I A;  1TK5 A;  5A6P A;  4K5S A;  1FEH A;  5CYM B;  9ATC B;  1YJV A;  4UOF A;  4OHW A;  3HT3 A;  5LSR A;  4DQR A;  4M5N A;  1NB2 A;  3AXK A;  4I64 A;  4USJ C;  3JQM A;  2D74 B;  2M70 A;  1Q7Y T;  3FFI B;  1X8D A;  2Y0S D;  2CJY B;  3QT6 A;  3CCM S;  2XM3 A;  1RTJ B;  1UVJ A;  4OZ3 A;  4OHY A;  2RHS B;  2VFT A;  1RWK B;  3PYF A;  2J9C A;  5DO2 A;  4LVN P;  4F8R A;  3C6T B;  3TZX A;  4JOU A;  4K4X A;  1UTA A;  1EAY C;  4TY8 A;  5L1I A;  4DWI A;  3MMC B;  3Q89 A;  4WYW A;  1Y5L B;  4RUC A;  2R2R A;  2HYI B;  1MML A;  3RRK A;  2JVO A;  3FBC A;  2ABY A;  1OY8 A;  4IFY B;  3KOA A;  4OZL A;  1YZ6 A;  4ID5 B;  3I5A A;  3GCW P;  4K2J A;  1L5U A;  1KWM A;  2ADB A;  2MZT A;  2HAI A;  3M6X A;  1TKT B;  3PW0 A;  2GFF A;  2O66 A;  2BVZ A;  4MK7 A;  4Q0B B;  2CQ3 A;  3Q83 A;  4BBY A;  3FMB A;  3RYL A;  2OO4 A;  4TXS A;  4ZVH A;  3DLH A;  4ECT A;  4M5K A;  2OD6 A;  2YX7 A;  3GJT B;  1ZAV A;  2DYA A;  1X7V A;  2MB0 B;  1URR A;  2U1A A;  2HLT A;  4ED2 A;  5DG8 A;  4LT6 A;  1MG7 A;  3CTR A;  1S57 A;  2IM1 A;  3DM2 B;  3MAH A;  3KLI A;  5HAO A;  1W26 A;  1U26 A;  4A8X A;  5D0E A;  1VQ9 S;  5KFY A;  2ZH6 A;  4F7V A;  2B9X A;  2AX1 A;  4Q8F A;  1XER A;  3ITH B;  2YH0 A;  5F8L A;  4NLO A;  3KHH A;  2VBW A;  1XMQ F;  3IAS 9;  4X4R A;  1R31 A;  3W2V A;  2RHQ B;  4IH7 A;  1BUX A;  3GSI A;  1N88 A;  3D1Q A;  2DD8 S;  1JLE B;  5L1K A;  2JFD A;  4DX5 A;  3MF5 A;  4DR5 J;  2IPO B;  5KFE A;  1MN9 A;  2KJV A;  1IBL F;  1S76 D;  2R9L A;  3GV5 B;  2HNY B;  1M1G A;  4J9L A;  2HIY A;  2IC3 A;  2M4M A;  1OSC A;  4KAI A;  1M5P C;  2XMA A;  4I6W A;  2QC3 A;  3CCT A;  3VGU A;  1WUU A;  2VPX B;  4NML A;  4F2R A;  3AOD A;  4OLO A;  4X4U A;  4URQ U;  4PR6 A;  2XCA A;  4MKB A;  2XEX A;  2CYY A;  2DR8 A;  1VC5 A;  2AZ1 A;  4RJV A;  2XO6 A;  3EZU A;  4UY8 T;  4DSJ A;  3FUY A;  2IHR 1;  3UPF A;  3TVZ A;  1JLA B;  1EET B;  5EX3 A;  1U1O A;  3RBZ A;  2R4F A;  4LF8 J;  1XIQ A;  2QL5 B;  1NK9 A;  2QO3 A;  3NNH A;  3BBB A;  3W64 A;  3OL6 A;  4QIG A;  3CDW A;  1IR1 A;  4CNY A;  4OFZ A;  4O0N A;  3R2D J;  3VCD A;  2H48 B;  2PGC A;  4LF5 J;  2OPR B;  4MKV A;  3F44 A;  2L9N A;  5DDR C;  3KFW X;  1UVN A;  5HVG A;  1VQ5 S;  1T11 A;  1S97 A;  1A6L A;  5GAH U;  3VAH A;  2MSS A;  3ZZP A;  3LA0 A;  2GS8 A;  1W7W A;  2CJK A;  2VG7 B;  3KHG A;  3ZNJ 1;  2B7B B;  1LOU A;  2GJF A;  2XWX A;  2WRM A;  5K5M A;  4KV8 B;  4ECQ A;  3JQK A;  1BY9 A;  3KK1 A;  5IV3 A;  4Q7A A;  1Y9O A;  1PBU A;  5HMX A;  4O4G A;  1WOS A;  3JSY A;  2GJI A;  3BSA A;  3UN3 A;  2CJA A;  3DHX A;  4DL6 A;  3RBE A;  4WWS A;  4RNF A;  1D3W A;  4Y2M A;  2OPR A;  4MIB A;  1S4F A;  4PCQ A;  2HBQ B;  4ER8 A;  5KFF A;  1Z1Z A;  4DX6 A;  1FHT A;  2GHV C;  2GCF A;  2RS8 A;  4DPX A;  4ZCM A;  1XN9 A;  1XR7 A;  1NSQ A;  3D3B J;  2J6U A;  3CC4 S;  2HND B;  2VDH A;  3Q23 A;  1TEL A;  2E9Z A;  3VGV A;  4DI6 A;  1Z2Z A;  1Y5I B;  3KYL A;  1EHW A;  1VCT A;  2IBO A;  1J5O B;  1R6Y A;  4KV8 A;  5HSP A;  3RB4 A;  3K8V A;  2N3O A;  2P6T A;  2KHC A;  2NSC A;  4RBV A;  1HR0 J;  5H9E J;  4LRC A;  1KKH A;  1C1B A;  4DR3 J;  5BJR A;  2LEP A;  3HDS A;  3Q8S B;  3DOL B;  2MKC A;  2CWK A;  1LW2 A;  1RHJ B;  4F67 A;  1YRU A;  3TRG A;  4PEO A;  1TAQ A;  4CO2 A;  3CED A;  2BBE A;  4CLU A;  3ISZ A;  1NH8 A;  3M2V B;  3UVJ A;  4I0W A;  2NZC A;  3V6J A;  1N5T A;  1X5O A;  4Z7Y A;  1JLQ A;  4NLS A;  4QWA A;  3W9I A;  2BKP A;  4CDI A;  3LOU A;  3DDI A;  3LQV A;  1HWU A;  2AX0 A;  1G3O A;  2OP5 A;  1S7I A;  4DQI A;  1UEU A;  5KFP A;  1NZ8 A;  1OYD A;  4C48 A;  2VC0 A;  2ZBC A;  1ARO P;  5F41 A;  2CVE A;  3HT0 A;  3FEZ A;  3N5B A;  1YJR A;  4F36 A;  3U7J A;  2JSX A;  5IZH A;  1SH2 A;  1T05 A;  3CCV S;  3DOM B;  3JQJ A;  1HBU B;  3RTV A;  2FHO B;  3BS9 A;  1JJH A;  3AT1 B;  5EUH A;  3MM6 B;  2K3K A;  4JI1 F;  5GMD A;  2V2Q A;  1Q8K A;  3JSR A;  4FF4 A;  5LSO A;  4R0J A;  4J7C A;  2CAJ A;  2CG8 A;  5LMU J;  2OTJ S;  3CJR A;  4QR2 A;  4QYZ J;  5HQ8 A;  4KBI A;  4H4K C;  1WTB A;  1R3N A;  4WU2 A;  2KVQ E;  5AJ3 F;  1JLF B;  3CB4 A;  3S1T A;  3MM8 B;  5CYQ B;  2PMH A;  1RT4 B;  2X1F A;  5A8W B;  2DY9 A;  1FT8 A;  3M1V B;  4HI2 A;  2V9W A;  2V2K A;  4P71 A;  5KFT A;  1T02 A;  4DPO A;  3GIR A;  2WW4 A;  4KPY A;  1OO0 B;  4J90 A;  1QE1 B;  1WOP A;  3DLJ A;  1U8S A;  3WC0 A;  2CAD A;  1T95 A;  3ILI A;  3ULH A;  1T3N A;  2YTC A;  3PTW A;  4X4P A;  3VAK A;  2HS0 A;  3ZTR A;  1IM4 A;  2ZH1 A;  3SXL A;  1ZPW X;  1CJK B;  3B6B A;  3OVA A;  1RAF B;  3MMB B;  2YWH A;  4MTP A;  1WHY A;  1YJ7 A;  1PC5 A;  4IOB A;  2DEJ A;  4LUB A;  3NRB A;  5HMW A;  4B9M A;  2FC9 A;  1IKX A;  4QJV A;  3OPK A;  3ZTS A;  1RAJ A;  1SV5 B;  3OQ2 A;  3EDR B;  2L41 A;  1SXL A;  3GG1 A;  2Q3P A;  5IT9 U;  4JV2 A;  1IJE B;  5IWA J;  4JI8 J;  3IRX A;  2LQJ A;  4JI2 F;  4CYU A;  1H7W A;  2D3O 1;  4MK9 A;  4OJ3 A;  2FLO A;  2CQ1 A;  5J2N B;  3WBZ A;  5L9N A;  5SZT A;  4FYX B;  3RAM A;  2DIT A;  2ZH5 A;  2H65 B;  5D4N A;  2CJQ A;  3MAA B;  1HYS B;  2QYC A;  2V4J B;  1VFJ A;  4BC9 A;  2CDR B;  2CZ9 A;  1CJK A;  3CE8 A;  3MMB A;  3DGP A;  3BBC A;  5JXS A;  4CO0 A;  1BQM B;  5BYS A;  5DDQ C;  4DV2 F;  3PZP A;  2ZJP Q;  2XS5 A;  2DCL A;  2QMW A;  4H54 A;  2K1R A;  5SUH A;  2A1B A;  1D1U A;  2KYX A;  1RAI B;  3EYZ A;  1AYE A;  3H42 A;  3SSS A;  4GMK A;  2VPZ B;  2QRR A;  2MLX A;  2MEW A;  4ECU A;  1ZA1 B;  4OZ5 A;  2VKR A;  1HYS A;  3N01 A;  4PPD A;  5B0D A;  2V9K A;  3MM5 A;  3EXC X;  2XBP A;  3DRR A;  3AXM A;  2GJ2 A;  3PX0 A;  2EFQ A;  4LF4 J;  2NYI A;  3D2W A;  3FCH A;  3HSD A;  4NCG B;  2XLI A;  1T03 A;  4F02 A;  2DNY A;  1HWK A;  2YX1 A;  1GMW A;  1XNR F;  4ZOS A;  4F0M A;  4F50 A;  2FVS A;  4K4U A;  2AYG A;  1HLW A;  3ILJ A;  4QWB A;  2AWZ A;  2F65 A;  4F3M A;  2KZZ A;  5F9N A;  4J9P A;  5KT6 A;  1RAA B;  1OWX A;  4CH7 A;  2RAQ A;  2HFU A;  4FZV A;  1WHX A;  1Y5N B;  2FJA B;  5KFC A;  4NCB A;  1G6B A;  2R3V A;  3CJK A;  1Y00 A;  1FRK A;  2ROG A;  4CP5 A;  1T9X A;  2MKK A;  2ZBQ A;  1WHV A;  2WVB A;  4DV4 F;  2X3G A;  1FJE B;  5CAA A;  1H72 C;  1X4D A;  4BLG A;  2DTJ A;  1WNE A;  5LJ5 Y;  1VRQ C;  1S1U A;  3ZXW A;  1F9E B;  3IC1 A;  3HHE A;  2MJN A;  5I3Q A;  1RTI B;  4TKT A;  2W1B A;  2HHU A;  2XI2 A;  1U7L A;  4GKK J;  1U45 A;  1HHS A;  3FCW A;  4YB6 A;  2CJ9 A;  1VR6 A;  7FD1 A;  2PII A;  3DYA B;  2FVR A;  5KG4 A;  1JK9 B;  1OPI A;  1E6V B;  1VK8 A;  4K4Y A;  1HHT P;  2J7W A;  2P2C B;  4JI7 F;  3HSZ A;  4DR7 J;  4CLS A;  4N47 A;  2ZM6 F;  3RW7 A;  3M4X A;  3MR7 A;  1CBK A;  5BR8 J;  2AEJ A;  2BJ8 A;  3V5R A;  2FGO A;  1NJI T;  5J2M B;  4WBF A;  1BC6 A;  4LRA A;  2ZOF A;  2QT7 A;  3GU0 A;  4V1A k;  1ULR A;  2BXJ A;  3AHP A;  2W4P A;  1GMU A;  4C8L A;  1VQY A;  1SPB P;  4X65 J;  1FK9 A;  4UUW A;  4L73 A;  2HVH A;  2HBR B;  2XCP A;  3BYP A;  5HN0 A;  4NEZ A;  4DV0 J;  1WF0 A;  3TJA A;  4CTA B;  1LQ9 A;  1QAX A;  1B3T A;  2VG5 B;  1YLX A;  3D5M A;  3SCJ E;  4ECZ A;  2DNL A;  1X4A A;  2M7S A;  3M6V A;  4I7F B;  2XSJ B;  4DR6 J;  5C2G A;  2WOM B;  4DX8 H;  3AA9 A;  3CD0 A;  4DHV A;  2BAN B;  2RIL A;  2OMO A;  1F60 B;  2R2U A;  2SXL A;  1AA1 B;  2H5J B;  4WFZ A;  1YJW S;  3D66 A;  1FVS A;  4HTJ A;  2L9W A;  4LF9 J;  3AB4 B;  3SCI E;  3BQ1 A;  3Q0A A;  4X2B A;  1QM9 A;  1LFW A;  1B4S A;  1LNQ A;  3RR7 A;  1KR4 A;  1N5Q A;  2HRU A;  3HKZ D;  3VR1 A;  3HFK A;  4ZCI A;  2GVZ A;  3QSY B;  2DXD A;  3EIC A;  4X62 F;  2AJQ A;  4ES2 A;  2D1C A;  4R0E A;  4LRE A;  2YNF A;  4QU7 A;  2D69 A;  4DQQ A;  2XQC A;  2HHH F;  2ACY A;  3KK3 B;  1TMM A;  1MSW D;  2XSJ A;  3QGG A;  2RIJ A;  3J80 Y;  4OI3 A;  4L76 A;  4NE9 C;  4BS2 A;  5A0Y A;  3I0R A;  2GIR A;  1TL3 A;  2V0N A;  4NXM J;  3A3O B;  2Z57 B;  3PG9 A;  2WVF A;  3MCO A;  1SKR A;  3UDV A;  5FII A;  3DRP B;  4WK1 A;  3EGW B;  4TY9 A;  5JVH Q;  2ZD1 B;  4MKA A;  2ZEJ A;  2V63 A;  4ATN A;  2MQL A;  4YFU A;  1YI2 S;  1RKI A;  1U4B A;  1HBO B;  1U1M A;  2BQU A;  1MRO B;  2VB6 A;  4KY3 A;  3TP2 A;  2FJW A;  2BYC A;  1S77 D;  5ETP A;  3DLK B;  3THV A;  2DGO A;  1T94 A;  2OFH X;  3WX8 A;  1D9F A;  1RBO B;  1YBU A;  3TR5 A;  1BMQ B;  1CJU B;  4NI2 B;  5F0W A;  1K8A T;  2JVR A;  1OY6 A;  1HPZ B;  1P9Y A;  4JV5 J;  3D0G E;  1HNI A;  2BMB A;  5E3Q A;  4WZQ A;  2WZ1 A;  3ZZU A;  1FER A;  4DV1 F;  3DRP A;  4H4M A;  2AU0 A;  3CW2 C;  2FZK B;  3JTP A;  4KQZ A;  5LM7 E;  3VZI A;  6FD1 A;  2ZHA A;  1S6U A;  1RWU A;  4HT5 A;  5AXK A;  1ZPV A;  1RAB B;  2WBM A;  4MIA A;  3HHL B;  1PAE X;  1U2F A;  1SH0 A;  5KG0 A;  4UZB A;  4DR2 F;  3BF4 A;  3TVY A;  4IH6 A;  1HAR A;  3VQT A;  1C0T A;  4WFY A;  3UQS A;  1S6O A;  4OZ2 A;  4RNN A;  1NAQ A;  3LWM A;  1NK0 A;  4WFA Q;  3W2W B;  5LMN F;  3EWG A;  3M8Q A;  3FK4 A;  1WOR A;  3CCJ S;  5F8H A;  4HTI A;  1KDN A;  4IR9 A;  4JI6 J;  3VF0 B;  2FUG 9;  1M5S A;  3B82 A;  2GVD B;  2YWF A;  2Z2Z A;  2XMM A;  3ILO A;  3QGH A;  4NMX A;  2E29 A;  4NYO A;  3EPG A;  1FD8 A;  2XMU A;  1RUS A;  3G6X A;  2Q43 A;  2OPQ A;  4ERD A;  4M5D A;  4CLW A;  4YDX A;  3HHL A;  1XWL A;  2HIQ A;  3NKY A;  1X5S A;  1S1V A;  5KT3 A;  2LA4 A;  2CIM A;  4BWJ A;  3GII A;  1NHK L;  1SKU B;  3G4S S;  3OSN A;  4UQG A;  3AQO A;  5L39 A;  3D28 A;  3MPV A;  3PHT A;  3PM9 A;  1N5S A;  1LWF A;  3CDU A;  5F0U A;  2CPD A;  4G1Q A;  5E0O A;  4M5I A;  2UVV A;  2XB2 D;  4DS5 A;  2ILY A;  2GVD A;  2BM0 A;  1YRX A;  2MPU A;  1VHI A;  2KZM A;  2RD5 C;  1YSJ A;  3PR4 A;  2HNZ B;  3PEJ A;  1SH3 A;  4CO5 A;  3KLE B;  3IBC B;  3OR1 A;  2B4O A;  4LR7 A;  2V4R A;  3US5 A;  2LQ9 A;  4BHQ A;  3IN5 A;  2FQQ B;  1UP1 A;  2XYG B;  2ZWP A;  4IFV B;  2MKH A;  4FVC A;  1CJV A;  3OFF A;  2PDA A;  3L7U A;  3B8H A;  2YY3 A;  5DGB A;  3C16 B;  5HVH A;  2DO4 A;  5DJB A;  4DSI A;  8ATC B;  2V8P A;  3R2C J;  2P6S A;  1RK8 A;  4DBQ A;  3KMQ A;  3LP0 A;  4OYZ A;  4DDF A;  2VDI A;  1C0U A;  6FDR A;  3J7A N;  4ANC A;  4OJ1 A;  3GB0 A;  3OUY A;  2V8H A;  2OEJ A;  1X5T A;  3FQL A;  4ZPD A;  1C1C B;  4ZN3 A;  2DKO B;  1TV6 A;  3QIP A;  1CC8 A;  3TA2 A;  4FVM A;  3IR7 B;  1KOH A;  4MK8 A;  2XG8 A;  3GYX B;  4DV3 F;  2NRE A;  5DLG A;  3W9H A;  2DO0 A;  3NCP A;  5K9F A;  4IQM A;  1WG5 A;  3C16 A;  4QWC A;  3K58 A;  1GXU A;  2LU1 A;  4WP3 A;  4C3K A;  4MFB A;  3UI3 A;  3T5L A;  1RHM B;  4OJH A;  2XMV A;  2UUT A;  4OZ1 A;  4NZ6 A;  3DRS A;  3HK2 A;  4E0D A;  1C1C A;  2ZZM A;  2DJW A;  1UCN A;  5E3P A;  1R8H A;  3QQC D;  3ET6 B;  3R9L A;  1VBZ A;  2IRY A;  4ZPA A;  2FHJ A;  4B3M J;  2XMT A;  4XDC A;  3LO3 A;  5HAN A;  4PWD B;  1SC1 B;  1TVR A;  4ED1 A;  4IO9 Q;  4I2P B;  2ZNZ A;  3A13 A;  1WC3 A;  1Q4R A;  4I67 A;  2DGQ A;  3QT5 A;  4OJG A;  1HBN A;  2J0Q D;  4NRT A;  4ZKA A;  1AB8 A;  4RW9 A;  2XS2 A;  3U1M A;  2GV1 A;  2K7K A;  4DPW A;  3O6Q A;  2CNN B;  4OZ0 A;  2VFS A;  3OFH A;  4Y34 A;  2JRS A;  2L48 A;  2MY8 A;  3EZ5 A;  3MWB A;  1KON A;  4KRW A;  3ZTO A;  2E5G A;  4WE1 B;  3MR6 A;  2HS4 A;  4NLQ A;  1W2B R;  5GAD U;  4BWM A;  3HLU A;  3T6J A;  3SSQ A;  2FPH X;  3VZH A;  2YWE A;  1RT7 A;  4C0O C;  4HEA 9;  4N8N A;  3HZG A;  5HBM B;  2M9K A;  4I2P A;  1TKD A;  1ZZN A;  3MCN A;  4DCO B;  4DFJ A;  1KLN A;  3GP9 A;  4NYP A;  3I0S A;  2KM8 B;  2AJ4 A;  1U2C A;  4LQ3 A;  2IA0 A;  2FLL A;  1RLD A;  4QR0 A;  2AQ4 A;  1XK8 A;  4K4S A;  4DZ6 A;  3OSP A;  1HR0 F;  1RYR A;  3FZB A;  4YR2 A;  4WE1 A;  3RJM B;  5HAT A;  2CDQ A;  3ZZY A;  1U0H A;  4W92 B;  2W4C A;  4PQA A;  3TZY A;  1ZM2 A;  1SQG A;  1RIS A;  2FJB B;  4MT1 A;  3K8W A;  4A4J A;  4A8M P;  4ES1 A;  3OVB A;  4WFX A;  3OTO J;  3GR0 A;  2VOD A;  1IR2 A;  2YNI A;  4EMD A;  2ASJ A;  1L3T A;  2F40 A;  1AZS B;  1VQL S;  5K14 A;  3KNA A;  1PYO B;  3NP5 A;  2JOQ A;  1LW0 B;  4ZJL A;  1EZZ B;  4R5P B;  1RT2 A;  2W9B B;  2AP6 A;  2BE7 D;  3EXY A;  4KC5 A;  3FSY A;  1X4H A;  2DY1 A;  1R0C B;  4FF2 A;  4YB7 A;  2F8H A;  2DGU A;  3MPY A;  3V81 B;  1WWH A;  3T19 A;  3KLH B;  2CQH A;  3BPS P;  4YUD A;  1U1L A;  5FJ4 A;  1FNM A;  1RTD A;  3UNG C;  1G1X A;  4RNO A;  4B9T A;  5B0A A;  4ED5 A;  5J2Q B;  3TNV A;  3H98 A;  2FDN A;  4KKO B;  3OLA A;  5LMU F;  3LP1 B;  1LW0 A;  3CJT A;  1CS4 A;  1X4C A;  1VJW A;  5A8K B;  1HNV B;  2R2S A;  3I82 A;  2A10 A;  3D6H B;  4LIW A;  3M8W A;  2OGU A;  3JAM Y;  1U1K A;  1HWI A;  2QIF A;  5KAK A;  1HI8 A;  3ISN D;  1FJG J;  4AND A;  2B0G A;  1WTF A;  3RB0 A;  3R5B A;  3PX6 A;  1NO8 A;  5CCL A;  1S6P B;  4LR9 A;  5T14 A;  2OTL S;  4A46 A;  1HL6 A;  1UWB A;  3E8O A;  3M2R B;  4CWB A;  1MW7 A;  2DK2 A;  3IR5 B;  1N32 J;  2OPS A;  2KO1 A;  2HHP A;  3ZZT A;  2K3I A;  4C11 A;  1FI4 A;  3OTD A;  1UMJ A;  5G0R B;  4KKO A;  5CQG A;  4FS2 A;  2XS7 A;  4OLP A;  1L3K A;  3W61 A;  1Q1K A;  4EO6 A;  2KI2 A;  2E5L J;  4J9U E;  4RR5 A;  3NLC A;  2ROE A;  2W7P A;  2YKN A;  5E41 A;  2VC1 A;  1RAH B;  4YP3 A;  1RA7 A;  1JLC A;  2JC1 A;  4WK3 A;  1TKX B;  1E6Y B;  1DAX A;  3MFH A;  2CNK B;  3KDO A;  4JI8 F;  2LQ8 A;  4DZD A;  1QDU B;  3A8J A;  2ALY B;  5C2C A;  3SFU A;  2QLJ B;  3UCU P;  5G0R A;  3PNI A;  2PSZ A;  4FDF A;  1JJ2 R;  2ZVI A;  4DJB A;  1HIY A;  4F0K A;  1Q95 G;  4PZV A;  3NMR A;  1EP4 A;  3Q22 A;  3DLE B;  4B3R J;  1U1Q A;  1Q0N A;  5L1J A;  4I69 A;  1RBL A;  1F5C A;  1XR5 A;  3ZFV A;  4JI4 J;  4RZR A;  2X1B A;  3CCZ A;  2MY7 A;  3RU0 A;  1KQS R;  3NAI A;  1X4G A;  2DCU B;  2KT5 A;  4NLX A;  2E1C A;  3SV3 A;  3PJX A;  2H4W B;  9RUB A;  2XGP A;  1FRH A;  2CQG A;  3FEY B;  1SJ1 A;  2WON B;  1K0V A;  1JQG A;  2W7A A;  3DMJ A;  2R7R A;  3FRZ A;  3MAQ A;  4EUV A;  2EC2 A;  4CT9 A;  3GIK A;  1FKP A;  4J9S A;  4JBC A;  1EKS A;  4LF4 F;  3PCO B;  3P4U B;  2G2Y A;  2YKP A;  4P2F A;  2IBK A;  5DQG A;  4ZPW R;  3K5M A;  2WB1 D;  5J1E B;  2B51 A;  2IVM A;  4OX9 F;  3KUG A;  2PFF B;  5LT5 A;  4PWU A;  2KTQ A;  2FLP A;  1UJ5 A;  4LFB J;  2HZC A;  3SQO P;  3IGN A;  2K7J A;  4B02 A;  3VHQ A;  1S9G B;  2GIF A;  1PBA A;  4ZVG A;  2BJ7 A;  3PYE A;  2CUY A;  2BJE A;  4ZCL A;  1XJW B;  1KFD A;  2D9O A;  3HJF A;  1NM2 A;  1DHM A;  4ZVS B;  3KLG A;  2NXN A;  1J27 A;  1KRP A;  5D77 A;  1MU2 A;  3QSI A;  3MEE A;  4XDD A;  4YQW A;  1FXL A;  3IWX A;  1M0S A;  3FRY A;  2I38 A;  2JWN A;  3MM7 B;  2YWG A;  2C28 A;  2HK3 A;  1KC8 T;  3OXL A;  2QA4 G;  3I87 A;  3F56 A;  2DNQ A;  2ZWO A;  4KJI A;  3QO9 B;  2G0I A;  2XMK A;  1Q86 T;  3IR6 B;  4TYB A;  1FNO A;  2E5I A;  1X60 A;  1UZH A;  3G6Y A;  3CNQ P;  4FXD A;  4F4W A;  3MR5 A;  3V6D A;  3VGS A;  2DHH A;  3MEG B;  1FNX H;  3BYR A;  2BOA A;  2RUS A;  2DGV A;  3IGV A;  1HNX F;  2V8V A;  1RTZ A;  1T3O A;  3HVT A;  4GVB B;  5DET A;  3G71 S;  4LMZ A;  4N5S A;  2UUA J;  2UUB F;  2D3U A;  2B4V A;  2F4V J;  2D41 A;  2XYH B;  1BQN A;  2OH2 A;  4F3Q A;  3LTO A;  2UZA A;  3Q8P B;  3TAR A;  4EZ9 A;  2ROP A;  3IP0 A;  4EBD A;  1YVF A;  2UUC F;  1VRU A;  2MGZ B;  3D67 A;  4DV0 F;  3MD3 A;  3NG8 A;  3FGV A;  3NY0 A;  4KIA A;  2H51 B;  2R7W A;  1FJC A;  1GEH A;  3KLV A;  2IMW P;  3MEG A;  1N54 B;  2HEK A;  4ED6 A;  1PGZ A;  1FWK A;  2HQI A;  4X4O A;  3HX9 A;  1ZYQ A;  3UDC A;  2ZH9 A;  4GVB A;  4OZJ A;  1S99 A;  5AE2 A;  2DVI A;  3DDN A;  3TJ8 A;  4EFA C;  1EJ7 L;  2I1R A;  1DJ0 A;  3QWP A;  4DR1 J;  4ZP9 A;  1HW9 A;  2RF2 A;  3J7Y I;  1WOO A;  2DNN A;  4E2F B;  2RVJ A;  4HDH A;  2PEB A;  3CCQ S;  3FZ2 A;  3GYN A;  2DNM A;  3JSB A;  2GA7 A;  2WK4 A;  2XZD B;  4WFB Q;  2LYV A;  1G2E A;  3TA1 A;  4ILL A;  2FD2 A;  1YZ7 A;  1F3V A;  1RHU B;  3TI0 A;  4CLF A;  1TL1 B;  2Z2M A;  2MZS A;  3DGV A;  4ZA1 A;  4ECX A;  4F25 A;  4V19 J;  2L3M A;  2OHD A;  1OSD A;  1RWX B;  3GCX P;  3V4I B;  4H4O A;  3G8T A;  3TWZ A;  2UV8 A;  1CVJ A;  3P5B P;  3LAL A;  4I6Y A;  3RAQ A;  3R8Y A;  1Q81 T;  1ZS6 A;  2EI5 A;  1NHU A;  1WI6 A;  4DL4 A;  3FBF A;  3B4D A;  4LBH A;  1FRI A;  3G86 A;  1REV B;  3BGO P;  2R42 A;  4TN2 A;  3D0I E;  3KG0 A;  2RRA A;  4LF6 F;  1I94 J;  2VA3 A;  1ZBT A;  1OY9 A;  1RT5 B;  3QLH A;  1JJ4 A;  2KXN B;  2ZZT A;  5GAG I;  2XO7 A;  1FRL A;  2LQ5 A;  5KG2 A;  2GHP A;  1T7P A;  4JV5 F;  3CWJ A;  4LFC F;  5D3G A;  5KG5 A;  3FSI A;  5EN1 A;  5J2P A;  4NEY A;  3PV8 A;  4ZPC A;  2M52 A;  4CLZ A;  3P8B B;  3M2U B;  2VUG A;  3LAM A;  2RQC A;  4ZHR A;  3DI6 B;  2CPY A;  2DB1 A;  3K59 A;  2B6A A;  1HMV B;  4KO0 B;  3BQ0 A;  1LFP A;  3MMJ A;  1IKY B;  2FJD B;  3HHN B;  2DXE A;  5GVQ A;  4QIV A;  3KTQ A;  5A8R A;  2GW8 A;  1VOM A;  1XMO F;  5CYJ A;  3NS6 A;  2EPI A;  3QT7 A;  4KHM A;  4I2Q B;  1U8W A;  4ECW A;  4NLT A;  3C14 A;  2I2Y A;  1IBC B;  4JI6 F;  1PYS B;  2F63 A;  5IC6 B;  4OHV A;  2C3Y A;  2DRD A;  2V8D A;  2DXF A;  4QIW D;  3FVY A;  3T6B A;  4MH8 A;  3J81 Y;  2Z58 B;  3N4W A;  4R8U A;  3UD3 P;  2C3O A;  1X9S A;  3T41 A;  2EEY A;  1FD2 A;  3OL8 A;  3M2U A;  3KHR A;  5C42 A;  2B5J B;  3Q8Y A;  3J80 U;  1U49 A;  1NKB A;  4PQU B;  3W8G A;  2FVC A;  2JJ4 D;  1VQ6 S;  3T3F A;  4CLP A;  1FKA F;  3I5B A;  5FLX Y;  1NK7 A;  1R27 B;  1TR0 A;  4EYI B;  3PW7 A;  1DTT A;  1SC6 A;  4DPT A;  3HHK A;  4LRD A;  3S6E A;  4Y3C A;  3DLG A;  2Z30 B;  1NPK A;  1WHW A;  2Y3Y A;  3KJV A;  3MED A;  2ADC A;  3PHE A;  2J7U A;  2LXI A;  3BO2 A;  2H5E A;  1S6Q B;  5IQQ A;  4XK8 C;  1KVJ A;  4MIW A;  1RP5 A;  5C7P A;  4ECS A;  1U6Z A;  3FBE A;  1PJ7 A;  2R7O A;  1FJ7 A;  2ILZ A;  3PO4 A;  4WXW A;  2HHQ A;  4KH0 B;  3AFG A;  4RBT A;  1DFD A;  2FJX A;  3AD8 C;  2BX6 A;  4KGK A;  5KTQ A;  2YKO A;  2C2D A;  1VRT B;  1NDL A;  2P9G A;  3MD1 A;  3UCZ P;  1YGY A;  1YIT S;  5IT0 A;  2ZH8 A;  3UO0 A;  4C4W A;  2EXU A;  2D3O R;  4QYR A;  4ZLJ A;  3CJQ A;  4JP8 A;  4EBE A;  4GC6 A;  2HQF A;  1HI0 P;  2LP4 A;  4K5R A;  4AFF A;  4RW7 A;  1LXJ A;  4DF8 A;  4UUX A;  3C6U A;  4KGM A;  1SC4 B;  1VQ8 S;  1M5V C;  2W25 A;  1ZET A;  3A3P B;  2WCX A;  3GWC A;  3D9B A;  3T5H A;  1LWC A;  2IJR A;  2BRL A;  2VKZ G;  2WVD A;  1S0N A;  5GAG U;  2RU9 A;  3PW5 A;  4DG1 A;  1RYS A;  4WKY A;  5KG3 A;  1Z2L A;  1B99 A;  3BN4 A;  4OI4 A;  2M0G B;  3LUY A;  2I8E A;  1BE4 A;  5LJ3 Y;  1GX6 A;  2XY6 A;  5DRK A;  1S9E B;  3GTY X;  2C42 A;  2E7X A;  3MEC A;  1S4E A;  5LSL A;  3GE9 A;  4OV1 A;  3NNA A;  1JXE A;  3HFZ B;  4ZP6 A;  2R7S A;  1NJZ A;  3SDE B;  4AUK A;  2VIH A;  5DQI A;  2AGQ A;  3B54 A;  4ZVF A;  2NXU A;  2YNH B;  4IDK B;  1QUV A;  2RH3 A;  1SKS A;  4M5L A;  2IAJ B;  2ZH2 A;  2OJ3 A;  4GRS A;  4FF3 A;  1XNQ F;  4F4Y A;  3MMA A;  3NBP B;  3OT9 A;  3W60 A;  2KH9 A;  1MMN A;  4MAK A;  1KN6 A;  3DRY A;  4Q44 A;  1FVQ A;  4P7T A;  2J9D E;  5HP1 B;  1DQ8 A;  1S9E A;  1B70 B;  2D9P A;  4DSE A;  1N6Q A;  1I51 B;  3M32 A;  2XNQ A;  1N5Y A;  4LFA J;  3W66 A;  4QIE A;  3GJQ B;  2KFY A;  3DNC A;  1O51 A;  2QFJ A;  2UU9 F;  3FDS A;  4ECY A;  4PG8 A;  2ZE2 A;  5KFN A;  1YRT A;  4RKU C;  4L74 A;  1VIO A;  4NCA A;  3I55 S;  2HGL A;  1S0O A;  4IRC A;  5IOL A;  3UDL A;  4RL1 A;  4FYV B;  4DQS A;  2AJF E;  3VAJ A;  4DQP A;  1P9Q C;  1WEX A;  2IYG A;  3HSG A;  1IKW B;  1HBM B;  3HD2 A;  3FC9 A;  4P2S A;  4HHH A;  2E7W A;  2XWY A;  2AZ3 A;  1QTN B;  2XY7 A;  3HXM A;  1QLN A;  4UQT A;  3T5K A;  2YPY A;  2LEA A;  5HP1 A;  2CWX A;  3EUN A;  2RT3 A;  1TKZ B;  2VFU A;  3K5P A;  1DZ5 A;  3K5L A;  4YB1 P;  3AD9 C;  2PEH A;  3KLF B;  3FSX A;  4CM2 A;  2FGC A;  5D0G A;  3OTO F;  1S1T B;  5HLF A;  4B3T J;  3ENQ A;  1FWL A;  5DM7 Q;  2QTW A;  3MM9 A;  4FF1 A;  3E2E A;  3DN9 A;  1YHQ S;  4JV0 A;  4JI3 J;  3OJS A;  4WTY A;  4DN0 A;  2CPF A;  3R1L A;  2RDI A;  3ZNU A;  4UY8 5;  2AYE A;  4I68 A;  2F8M A;  4ICL A;  4U6P A;  5D0H A;  2RKI A;  2RRB A;  1IUJ A;  4YHH F;  1T9U A;  3TX8 A;  1KHW A;  3BN7 A;  3C15 A;  3OL7 A;  3UR3 C;  2KB2 A;  1S7H A;  3H0P A;  2B7C B;  1R0B G;  1P8G A;  2V2V A;  4O44 B;  4Y65 A;  1ZTT A;  4YEA A;  5CYM A;  1RU2 A;  3PKM A;  2IM2 A;  2PE8 A;  5KFI A;  3P49 B;  1MWZ A;  3TZZ A;  2NS1 B;  2RQK A;  3FFI A;  3HI9 A;  2FZG B;  5KFW A;  1U6B A;  2LEC A;  3CD5 A;  2POK A;  2GQQ A;  3MUM P;  2K06 A;  1RTJ A;  3VAF A;  1SL2 A;  3GFX A;  4DN9 A;  4NXN F;  3UFC X;  2OML A;  4PXD A;  2DNO A;  1TL4 A;  3H2L A;  3NAH A;  3M8P B;  3C6T A;  3TQ1 A;  1TQL A;  2I5J B;  3QPI A;  4C8O A;  1FJG F;  2AT1 B;  4MYT A;  1IBL J;  2ZHO A;  3D6M B;  1V3S A;  3MMC A;  1UWA A;  2R8G A;  2NXE A;  2DT9 A;  3NGR A;  4TQS A;  1KNZ A;  1KP6 A;  2KDO A;  1DTQ B;  3THT A;  4GVL A;  4IFY A;  3KK2 B;  2ACM A;  3G8Q A;  2QLB B;  2KT2 A;  4ID5 A;  3PRB A;  5DG9 A;  4AQY J;  4HAC B;  1H2U X;  3ICL A;  1TKT A;  1HQU B;  4CQ1 A;  2K8G A;  4LRB A;  1IXK A;  1Q8L A;  4Q0B A;  5ETR A;  2R7V A;  4DV6 J;  2FZC B;  2MKI A;  2OPP B;  2VZ9 A;  1J5E J;  1MLA A;  3HMJ G;  1DQ9 A;  4MJK A;  2R8K A;  2I6W A;  4QIF A;  1VBX A;  4DL2 A;  3IWN C;  1PSD A;  4W4M A;  1VI7 A;  2DNH A;  4F4K A;  5IC4 B;  4PXE A;  1T9T A;  1DQA A;  1CJT B;  3TX0 A;  1RWM B;  3DM2 A;  3W63 A;  3DLB A;  2AYM A;  1IBM F;  3VVT A;  3QAT A;  3HFV A;  1V5I B;  4M94 A;  3ITH A;  4DLG A;  2HS3 A;  1HD0 A;  2IDE A;  5D0R A;  4ZVQ B;  4IG0 B;  2BZ2 A;  2AJ0 A;  3OXF A;  2PMW A;  3I4H X;  3GLJ A;  3SEO A;  4RUB A;  2WHO A;  1JLE A;  4WYL A;  5BYQ A;  2AMC B;  4YY3 F;  4JI4 F;  2VL1 A;  4ZLN A;  4KPC A;  5I3U B;  4PG5 A;  3FJ2 A;  3H5U A;  2GMH A;  5FDL B;  4ANE A;  5GMK a;  1VIX A;  2VJV A;  2HNY A;  7AT1 B;  3VWS A;  3UN5 A;  3QJJ A;  2IYI A;  3GFH A;  3CJ5 A;  3W3S A;  1DLO B;  3LF0 A;  3R7B B;  4ED8 A;  2FYX A;  3BO3 A;  3Q2T C;  2DHX A;  1H0H B;  2C2K B;  1N0V C;  4KTQ A;  2DHA A;  2HWT A;  1RT1 B;  4Z7C A;  4K4Z A;  2YX4 A;  3HJV A;  4P73 A;  1C4A A;  4OX6 A;  1H73 A;  2MTL A;  1YKW A;  2M5Y A;  1R8A A;  5KFV A;  5D4L A;  2YKM B;  3UCG A;  1JLA A;  2B4U A;  1EET A;  3R6G B;  1U24 A;  2NUH A;  4LFB F;  5ITH A;  2ASY A;  4K7Q A;  5HQL A;  1WG4 A;  1YJT A;  1UAW A;  4HI1 A;  2E1P A;  1CQM A;  1F9F A;  4ZN1 A;  2GGP B;  3WDO A;  2R7U A;  1AUS L;  5I4M A;  2H9Z A;  2N4D A;  2N3L A;  3MEK A;  4BDP A;  3KHL A;  4UST A;  2M8D B;  4DUT A;  5I3P A;  4DFK A;  3PW4 A;  1UW9 A;  2VV5 A;  4YME A;  2WAQ D;  1UVI A;  3ZZR A;  2G9O A;  3FKB A;  4B08 A;  3OBI A;  5IT9 Y;  5T7L B;  3I9Z A;  2RJZ A;  4IG3 B;  3MZI A;  4F04 B;  1HWL A;  2VG7 A;  1W2I A;  1FTC A;  2HVI A;  2BM1 A;  3HHD A;  3SCL E;  3DOK B;  4YB5 A;  2R7Q A;  3MOZ A;  4CNZ A;  3EGZ A;  3PEH A;  1NJX A;  4JI5 J;  4DXL A;  3RAX A;  1X9M A;  2VBY A;  3RUB L;  1DBD A;  2KKH A;  4JYA J;  5B09 A;  5CD4 H;  2QYG A;  3R97 A;  2OEL A;  1BXN A;  4Q5V A;  3P96 A;  2YBV A;  4ZCK A;  5I42 B;  4JI1 J;  1EKR A;  2HVZ A;  3AD7 C;  2UUA F;  1G7C B;  4C8Y A;  4LR8 A;  4J9N A;  2XHC A;  1SJ4 P;  2HND A;  4IG3 A;  2CRL A;  1R0A B;  1NDP A;  3BGR B;  3ZZZ A;  1KLM B;  2OD4 A;  1URN A;  1J5O A;  4WCE Q;  2XYP B;  1RAG B;  1ZOT A;  5AJ3 J;  4KE5 A;  4C0B A;  3Q8U A;  2JL9 A;  1RCX B;  1UPP A;  1OS5 A;  3KWM A;  3A4T A;  4URS A;  1SJF A;  2YQ3 A;  2MKJ A;  1K44 A;  1VK3 A;  4OQJ A;  3GYG A;  3DOL A;  4DUY J;  1S12 A;  3QBC A;  1PAU B;  2XLJ A;  5LOQ A;  3ETO A;  2M2B A;  4PAA A;  3I5C A;  3Q24 A;  4OYW A;  4D3H A;  1F1B B;  1M1H A;  4DR1 F;  4XAK A;  3M8S A;  3M2V A;  3H4D A;  4LBP A;  3CCL S;  2VBZ A;  3NCR A;  1AUD A;  2U2F A;  8AT1 B;  1CPZ A;  2V69 A;  1ZTW A;  3P3D A;  2YPZ A;  4HDG A;  2Y9H A;  2K2P A;  3M30 B;  3PAC A;  4OYX A;  1JWW A;  1I3O B;  1VQK S;  1H38 A;  4DSL A;  3O44 A;  4JI2 J;  2HUR A;  4Z37 A;  1TFY A;  2X51 A;  2AD9 A;  3DOM A;  3G82 B;  1HBU A;  2F4F A;  2UXB J;  3MM6 A;  4U9R A;  1TZ0 A;  4LIR A;  1WDD A;  3CUL A;  4PKD B;  2JHE A;  1DRZ A;  1EQ0 A;  1GK8 A;  2NQP A;  4O4R A;  1JJC B;  4KHP J;  1CC7 A;  5CA5 A;  1R6V A;  3NXZ A;  3AOC A;  3A12 A;  2JFK A;  4ZVT B;  2DRA A;  2EG2 A;  5GAE I;  4WFN Q;  1CG2 A;  1JLF A;  3BRE A;  4HHU A;  3SQG B;  3OL9 A;  3MM8 A;  1NME B;  3MUR P;  5CYQ A;  5HJY A;  4USI A;  3M30 A;  1RT4 A;  5A8W A;  3M1V A;  2HFV A;  4GKJ J;  3QAE A;  3CJS A;  1CUL B;  1NPP A;  4U7U K;  3JXO A;  1NK5 A;  3G8S A;  1I94 F;  2HVD A;  4RNH A;  2UVU A;  3E01 B;  4PG4 A;  3G82 A;  3W5X A;  1QE1 A;  5LXY A;  1SI9 A;  2R7X A;  1TUW A;  3E51 A;  3H90 A;  3HO1 A;  2XI3 A;  4NLG A;  5C24 B;  3E3X A;  3SSR A;  5HK4 A;  4NLV A;  1U48 A;  4F4X A;  5ETS A;  2WSC C;  3IWL A;  3TAM B;  1Q8I A;  2Q66 A;  2WTF A;  2CPJ A;  1HHQ A;  2C2N A;  3LPY A;  2CVI A;  1SV5 A;  1F2G A;  3OR2 B;  4DU7 A;  1QAI A;  2YQ1 A;  3VVU A;  3C46 A;  3IG1 B;  2ZHB A;  3UD5 A;  4ILM A;  2KVI A;  4P52 A;  1KTV A;  5J2N A;  1VQ7 S;  2QL9 B;  2VJU A;  5KFK A;  5A2Q Y;  2BOP A;  1X9W A;  5CAB A;  2BEF A;  3CD6 S;  1C4C A;  3NOC A;  1I6J A;  2HAF A;  2BKO A;  3HP6 A;  3HHL C;  4QPT A;  3MAA A;  5DGA A;  2V4J A;  4RW6 B;  1K73 T;  4DV4 J;  2B8P A;  2QLW A;  2BR0 A;  1TTH B;  1QSY A;  3H8Y A;  4Y6I A;  3H2U B;  1HI1 A;  3CJ0 A;  2ZNY A;  3D0H E;  3CO0 P;  1SC3 B;  3TO8 A;  1BQM A;  1V3R A;  1Z4U A;  3Q8V A;  3BSN A;  1XBW A;  4N77 A;  1WSV A;  4X4V A;  3IS9 B;  1U02 A;  4DPY A;  2VOP A;  4YR3 A;  1IKV B;  4DR4 J;  2HFO A;  2WVE A;  3KJQ B;  3EJM A;  4OYA A;  3S7R A;  3IG1 A;  3BKF A;  2W8L A;  2HMI B;  2AIR B;  3R5C A;  5G4D A;  1ZA2 B;  2KT3 A;  3QGP A;  1WF1 A;  1N52 B;  2BJ9 A;  4M5M A;  5EHH A;  4B9N A;  4F0H A;  2J0X A;  2ZM6 J;  2E9T A;  3IRW P;  2A2C A;  1BQX A;  4ECR A;  2X7I A;  3CJ3 A;  4NCG A;  4Q8E A;  1B7Y B;  4EGL A;  2BE2 B;  1BGX T;  2J8S A;  2C1E B;  5F3Z A;  2ASD A;  5RUB A;  3KNG A;  2VD3 A;  5EDW A;  3RBD A;  3MDF A;  1YJU A;  3PIP Q;  3DXB A;  2W9C B;  1K1S A;  5H9E K;  3QAU A;  2LLZ A;  3QGI A;  2RSQ A;  1BLU A;  2YNG B;  4K2X A;  2GQC A;  1KQK A;  4C9D A;  4TVA B;  1FX2 A;  2RRN A;  1ICE B;  1WEZ A;  4FXV A;  1Y7P A;  1S72 S;  4P2X A;  2W2Q P;  1A7G E;  2N7C A;  2MZR A;  4LSL B;  2X1A A;  2HSE B;  4X64 F;  1S49 A;  5GAE U;  4O3R A;  5DLF A;  5L1L A;  2E5J A;  4DMZ A;  5ETQ A;  3R27 A;  3QFH A;  2XMJ A;  3LP2 B;  1KQG B;  1VGY A;  5KG6 A;  1B0P A;  3L7P A;  1RTI A;  2VQE F;  4IRK A;  5AXN A;  2HRT A;  2G2Z A;  5MLC V;  3D68 A;  5IM0 B;  2DRB A;  2Z2L A;  3OD2 A;  1XTZ A;  4UOG A;  2YQ0 A;  4ES3 A;  3CJ8 A;  2GQ2 A;  1EX8 A;  4LSN B;  3DYA A;  1SUQ B;  1D09 B;  3CDB A;  1AT1 B;  3DXS X;  1E6V A;  1HQE B;  3UDE A;  2W2N P;  2JEI A;  5KG1 A;  2FJV A;  1RWV B;  3PX4 A;  2FC8 A;  2MZJ A;  4S0M A;  3CCE S;  1HNW J;  4QYZ K;  5F3T A;  5J2M A;  2XHW A;  3RRH A;  1Y10 A;  1S79 A;  4J9M A;  1SCJ B;  4IOA Q;  1FFS B;  4I1T A;  3LP2 A;  4U67 Q;  1B0V A;  1YK9 A;  4QOT A;  4NLR A;  4E98 A;  3CMQ A;  3N6N A;  3EPI A;  1FKO B;  5IM0 A;  2DPJ A;  3QWU A;  4DS4 A;  2W4D A;  4LF7 F;  1Q5V A;  4ZVO B;  4CTA A;  1XR6 A;  4K4T A;  1IQZ A;  1TL5 A;  2VG5 A;  3PKY A;  1H6K X;  4HYK A;  2QA1 A;  1S0V A;  5DZ7 A;  4NRU A;  4CLK A;  1V9O A;  3MTJ A;  3MGJ A;  3L3C A;  3NCQ A;  4I7F A;  3UE2 A;  3UD4 P;  1X4F A;  2MJU A;  3TA0 A;  2WOM A;  3RB3 A;  1PYT A;  1OPZ A;  2BAN A;  3DHW C;  1Q79 A;  1IWA A;  3BGU A;  5F8M A;  1VC0 A;  5A6W A;  2Y0B B;  3JTN A;  4KB7 A;  1K47 A;  2DNR A;  5H1S V;  3NGD A;  4TQR A;  2KXF A;  4AL5 A;  1RAC B;  2J5A A;  4DX7 A;  2AEF A;  1BHN A;  1SJR A;  4ID8 A;  1Q53 A;  2VAS A;  4DR2 J;  5B08 A;  5HQM A;  3KK3 A;  2P9C A;  1VDH A;  2BDP A;  1X4B A;  4G1I A;  3CPW R;  2J6T A;  2J0S D;  5LMN J;  4W90 B;  4WIQ A;  4MKY A;  1JMT A;  1NJW A;  2ZUG A;  2HRY A;  4F4A A;  7FDR A;  4OYB A;  1HNZ F;  4AE5 A;  4OI2 A;  5GAH I;  3BV8 A;  4OL8 A;  3QNW B;  4OIX A;  4ZJQ A;  2ZD1 A;  2KM8 C;  4YR0 A;  3KKF A;  3GV8 B;  3N0V A;  3KLI B;  4B3T F;  4I56 A;  2ZDO A;  3PW2 A;  1NK6 A;  1JLG B;  2I9S A;  1HBO A;  1TP7 A;  1FE4 A;  4JI3 F;  1AW0 A;  1MRO A;  1SL1 A;  1IBK J;  4CCH A;  5C5J A;  3DLK A;  3VV2 B;  4RUA A;  4C2M A;  2IM3 A;  3G87 A;  4X66 J;  3AOA A;  2ZIT A;  3W2V B;  3A1Y G;  3CGI A;  3I56 S;  1GH8 A;  1CJU A;  4NI2 A;  3FCV A;  2IA6 A;  3CDA A;  3IM8 A;  2PMZ D;  1HPZ A;  1NJY A;  3NWG A;  1MWQ A;  1QJH A;  5KFA A;  4BC7 A;  3QFW A;  3PY8 A;  2UP1 A;  1WEY A;  5CH7 B;  3M8Y A;  2B56 A;  4FS1 A;  5IFM A;  2WVC A;  3VTI A;  3LW5 C;  3TAQ A;  2AGO A;  1SJQ A;  1L3U A;  2X1G A;  2IC3 B;  2WBR A;  3Q8Q B;  3ZTQ A;  1LK5 A;  3ONQ A;  1NZA A;  2IIH A;  5KFR A;  3EGV A;  1YJN S;  1JLG A;  2DIV A;  3MFI A;  5U47 A;  3WZ0 A;  3AJD A;  4RO0 A;  3W2W A;  2JDJ A;  3DLL Q;  5DQH A;  1Q7L B;  1H2V Z;  4Q43 A;  3K7R A;  1SBR A;  1ELO A;  3SBM A;  2BJ3 A;  1VQN S;  1WEL A;  1U1R A;  2EC0 A;  2DHG A;  1NXI A;  2HQ3 A;  1NK4 A;  2J9E A;  1TUG B;  4O23 A;  2PA8 D;  2HHW A;  2E66 A;  4NAS A;  2DGT A;  4QQB A;  3OHA A;  2HHS A;  2NLW A;  1FCA A;  3D7S B;  5KT7 A;  2IVY A;  4ALZ A;  1YQH A;  4DPU A;  4M63 A;  3OTC A;  5AXL A;  4DV3 J;  5ETL A;  1Y4Z B;  4AQY F;  2C2O B;  2EFP A;  2VPW B;  3I31 A;  4CH0 S;  2DGW A;  2ZOM A;  4DV6 F;  3M05 A;  1NDK A;  2HHX A;  1J5E F;  4M5J A;  1V5V A;  2CZ4 A;  4DR5 F;  1GQE A;  1TAU A;  2B4P A;  4FKX A;  3GG0 A;  3LPE A;  1S0M A;  3WIU A;  3AB2 B;  4A47 A;  4KSE B;  3BZQ A;  2MQ8 A;  2HNZ A;  2RE1 A;  3KLE A;  1NEE A;  1RHQ B;  1Q78 A;  3KK1 B;  2CQ0 A;  1FRM A;  4O4G B;  4IFV A;  4WP9 A;  1SB6 A;  3RZA A;  5M2U A;  2X3D A;  4NA2 A;  3H4B A;  5DZ6 A;  4AD6 A;  1T0T V;  5E3A A;  2VFR A;  1ZM9 A;  1FRX A;  4E8U A;  1EIY B;  4DL5 A;  5KFX A;  4FNI A;  4LBI A;  2V68 A;  4G6V B;  4Y2A A;  3O3L A;  3KXD A;  5DS7 A;  4RU9 A;  2NYH A;  4TLR A;  2ZH7 A;  4LF8 F;  2Y1R I;  1NKC A;  4RWW A;  1N33 J;  2VON A;  5DM6 Q;  3CIZ A;  2D7S A;  2LMI A;  1P1L A;  4X4S A;  2VHG A;  1RXO B;  3KG4 A;  1Q82 T;  3TJ9 A;  3PFO A;  4L75 A;  1C1B B;  4K8R A;  2OKQ A;  4J9O A;  2MZQ A;  4LF5 F;  2HFN A;  4WU3 A;  4KHR A;  1LW2 B;  2RDJ A;  4AT1 B;  3IMQ J;  1VLY A;  5H9F K;  1SQF A;  3K5N A;  3FEX B;  3UVJ B;  3VAI A;  3B4M A;  2CQ4 A;  4G1P A;  1JLQ B;  4QW9 A;  2IDL A;  1GT8 A;  2HBY B;  2C2R A;  2W9A A;  1J2V A;  2P5V A;  3JS9 A;  4Y2K A;  1HFE L;  1FF2 A;  5F9L A;  4WII A;  5KG7 A;  3BEG B;  4FP9 A;  4TNO A;  2OI2 A;  2NXJ A;  3ET6 A;  4JI0 J;  3D4J A;  2FVP A;  3IBF B;  3V4M A;  4PWD A;  2PO4 A;  2QL7 B;  1T05 B;  3R5A A;  3D3C J;  4NLD A;  2IVF B;  1YX2 A;  2PD1 A;  1OQ3 A;  4M95 A;  1VBY A;  5CXT A;  1UET A;  3BDE A;  3L7O A;  2G0C A;  2ZC4 A;  2HHV A;  2CQD A;  2P9E A;  2OUG A;  5F8I A;  3V6K A;  3PRD A;  4K0K J;  3DCA A;  2NPI A;  2QA2 A;  4JI5 F;  5E3R A;  4B3S J;  1N36 J;  2G1H A;  1KQF B;  2BJD A;  4DR3 F;  1CQN A;  3F0N A;  1D8Z A;  4G65 A;  2E1R A;  4USV A;  1H7X A;  4JYA F;  4I4B A;  3OTE A;  5K20 B;  3M9O B;  4NLY A;  3A8K A;  5KFQ A;  2ZVS A;  4FPR A;  2CJX B;  4JV1 A;  4CI0 B;  5HBM A;  3VAM A;  1T9V A;  3OVS A;  4P2M A;  2XSF A;  1RE1 B;  1JXV A;  3H20 A;  4OHZ A;  1UKU A;  3NWR A;  4CZC A;  5L46 A;  4U7C A;  3JSM B;  1BWV A;  3IA0 A;  4K50 A;  5J1N A;  3TW0 A;  2F9D A;  1F6T A;  1JB0 C;  4B9U A;  3AQP A;  3WIV A;  1IR0 A;  3M6U A;  2LKZ A;  4UTG A;  3OXG A;  1LWX A;  2IRU A;  1EQM A;  1IKX B;  2XUL A;  4WJB A;  3CCU S;  4IYQ A;  2OSQ A;  2HLU A;  4DV5 J;  4A48 A;  1WD6 A;  4XPE A;  1P27 B;  3IRX B;  3WHI A;  4CYU B;  2VFV A;  3X3U A;  4C97 A;  4ED3 A;  4DUY F;  2JX2 A;  3ZTP A;  2ZJR Q;  2V2Z A;  4ZIW A;  2CQC A;  2DGS A;  1OJ4 A;  2O67 A;  1AZS A;  3EM1 A;  3JSM A;  2G2O A;  3EE3 A;  2EKY A;  1VS3 A;  2W24 A;  4ZLP A;  2N82 B;  3T1H J;  4R5P A;  1EAR A;  2W9B A;  4KH1 B;  3DGP B; 
#chains in the Genus database with same CATH homology
 1RHJ B;  3RJM B;  1SC4 B;  2CNL B;  4DCP B;  1RE1 B;  2H51 B;  1RHU B;  3NS7 B;  2C2Z B;  3KJQ B;  4JB8 B;  2CNK B;  2Y1L B;  2CNN B;  1RWO B;  2XYP B;  3IBF B;  1RHR B;  2C2O B;  2H5J B;  3IBC B;  1RWX B;  2H65 B;  1RHK B;  3R7B B;  4ZVO B;  3R5J B;  3D6H B;  3P4U B;  2P2C B;  2QL7 B;  3EDQ B;  1QDU B;  2CDR B;  2QL5 B;  2FQQ B;  2XYG B;  1RHM B;  5IC4 B;  2HBQ B;  2C2K B;  1RWN B;  3R6L B;  1IBC B;  1I51 B;  1PYO B;  1RWM B;  2QLJ B;  3D6F B;  5IC6 B;  3R7N B;  2C2M B;  1PAU B;  1BMQ B;  3GJQ B;  2H4Y B;  2QL9 B;  3QNW B;  4ZVT B;  4DCJ B;  1GFW B;  4ZVP B;  3SIP B;  2C1E B;  2H48 B;  3KJF B;  1NME B;  4ZVQ B;  3R6G B;  3D6M B;  2CNO B;  1RHQ B;  1RWW B;  4DCO B;  4ZVR B;  3R7S B;  3GJS B;  2Y0B B;  3P45 B;  2XYH B;  2HBR B;  4ZVS B;  1RWV B;  4LSZ B;  3GJR B;  3KJN B;  1F9E B;  2XZD B;  2XZT B;  1RWP B;  1SC1 B;  2CJY B;  3GJT B;  2H4W B;  2DKO B;  3EDR B;  2HBZ B;  2QLB B;  4ZVU B;  5K20 B;  1SC3 B;  2HBY B;  1QTN B;  2H5I B;  2QLF B;  2CJX B;  2H54 B;  1ICE B;  1RWK B;  1I3O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...