4ZVUB

Caspase-7 wild-type bound to the caspase-6 cognate tetrapeptide inhibitor ac-veid-cho
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
93
structure length
93
Chain Sequence
YKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Reprogramming Caspase-7 Specificity by Regio-Specific Mutations and Selection Provides Alternate Solutions for Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-7
total genus 18
structure length 93
sequence length 93
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2015-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 4zvuB00
2XYHB 4ZVSB 5K20B 2Y0BB 3NS7B 4DCOB 3IBFB 4ZVUB 4DCJB 3RJMB 1QDUB 3R5JB 1RHKB 3KJFB 2HBRB 1IBCB 3EDQB 3D6HB 3IBCB 2H4WB 3P45B 1RHUB 4ZVRB 1RHJB 2XYPB 1RWWB 2QLBB 2C1EB 2QL9B 1RWVB 1SC4B 2XZDB 3P4UB 2FQQB 1SC3B 3D6FB 3GJSB 4ZVPB 3GJRB 1RWXB 2XYGB 1RHQB 4ZVTB 3R6LB 2H65B 2QLFB 2HBYB 1QTNB 3GJTB 1SC1B 3R6GB 2C2MB 3R7SB 2H51B 2HBZB 3D6MB 1I51B 4JB8B 2HBQB 3R7NB 2C2ZB 2C2KB 2CDRB 1F9EB 4ZVQB 2C2OB 2H4YB 1PYOB 1I3OB 1RWKB 2CJXB 4LSZB 2CNKB 2CNLB 1RHRB 1GFWB 1RWPB 3KJQB 2XZTB 2DKOB 2CJYB 2CNNB 2QL7B 1BMQB 2P2CB 2H5JB 2QL5B 5IC4B 1RWNB 1NMEB 2H5IB 3EDRB 4DCPB 2CNOB 3GJQB 3SIPB 3QNWB 2H48B 2Y1LB 1ICEB 1RHMB 2H54B 3R7BB 1RWOB 2QLJB 4ZVOB 1PAUB 3KJNB 5IC6B 1RE1B 1RWMB
chains in the Genus database with same CATH superfamily
3MEEA 4CO5A 1KOOA 3G8TA 5HAOA 4ZVSB 2F9JA 4WP8A 4RW8B 5KT5A 4DPUA 4B9NA 1U8WA 3EGNA 2BANB 5F9LA 2E66A 3V81B 3Q86A 4J9SA 3RYLA 4CO1A 4MFBB 2V68A 3EMTA 5DLGA 2FB0A 2HQCA 2RMLA 2W2OP 4Y0FA 1TL7A 4NLVA 3QZ7A 3MTKA 3ZNJ1 3CDAA 2KM8B 2E1CA 1T11A 1N6QB 3KJFB 4KR0B 1ROFA 5KG3A 4DQRA 1I94F 3FNNA 3PKYA 3EVMA 2CQIA 4C6AA 4C0OC 3JXOA 2R8HA 4TNOA 4L3NA 2QYGA 4G1IA 1O8BA 2VOPA 5L1IA 2ZH2A 4DMZA 1CJTA 2ASDA 1N36J 3QRPA 4CNZA 1RHUB 3SQGA 2HQFA 2MHNA 4AL6A 2CPFA 1V3RA 3QLHB 4KGXB 1WF1A 2DHGA 3UQSA 1VQYA 5HI7A 4P74A 4ZHRA 4JI7J 1R8CA 3CWJA 4TQRA 4Y2AA 1FKAF 2XZDB 4F2RA 1XC9A 1JMTA 2G2ZA 4U67Q 3ISNC 3BGRB 2HQDA 3OVAA 3LP0B 2NUHA 1E6YA 1LQ9A 1O51A 3AQOA 2R7VA 1S9EA 2RSQA 5IQ6A 2OMLA 1LK7A 3CF5Q 5D4LA 1H3DA 4WTOB 2ZNYA 4WE1B 4FS2A 2DO4A 1FNOA 3T5LA 2WSCC 3R6LB 4CIOA 4MYUA 1RAIB 2RHSB 3CJ2A 3W2VA 4EBEA 4NA1A 2VICA 1PC4A 4K4ZA 1FWKA 2PN6A 5GAEU 2FC8A 3TAPA 5BR8F 3SSSA 4DFJA 8ATCB 1VS3A 3BQ0A 2ZUGA 3ZZTA 5KFMA 5KT2A 4UF4A 5DQGA 5KFSA 3RBXA 3MM6B 5F8LA 4ZN1A 4JI4J 1HI8A 1R43A 2RU3A 4DV6F 2MKCA 4LSLB 2JEGA 2VFRA 1CC7A 2HQ3A 3NNHA 4LF1A 1K0TA 4F4ZA 4PXDA 1YDLA 2DNRA 5AXLA 4DSFA 1FRHA 4PWUA 2HVIA 4IO1A 2KZMA 3CJ8A 3H20A 1C1BB 2K8GA 4QWBA 2AYBA 1NLKL 5ETTA 2VQEJ 1WDTA 5A8RA 1GH8A 3HKZD 4IFVB 3D0GE 4K8RA 5DDQC 4WZMA 1S49A 4DG1A 3KJQB 2XLIA 4ZLPA 4K0KF 3FRYA 3BQ2A 1MMDA 4AE5A 3CCLS 1NZ8A 3DM2B 3LW5C 3PYEA 1DTTB 1L3KA 1WF2A 2M0GB 4MIBA 3TZZA 4B3SJ 1SI9A 2QX0A 1ZM4A 3ICLA 2JLEA 3W2WA 2ADBA 1RBAA 1LW2A 2AEMA 2CPJA 2FJAB 3H25A 4TXSA 1UWBB 3MFIA 3MCOA 4LBHA 3OFFA 4NZ6A 2ZC3A 4X4VA 2V4RA 1EETA 1FRLA 5A8KA 1Q86T 5J2QA 5AE3A 2AGOA 2OUGA 1YZ7A 2DNLA 3KHHA 4NYZA 4IDKA 3J81Y 2AJ4A 3J7ZT 1OWXA 2YPYA 1T9VA 3M7VA 1RWOB 3OL6A 4FDFA 3J7Z5 2MQLA 2VC0A 3QSIA 4F04B 1YIJS 2ZH6A 4JI7F 4PUOA 2KN4A 2VFVA 5DZ7A 3MM5B 1YRUA 3I0RA 3H4BA 3MM9A 3CJ5A 4DR4J 3SQGB 3T3FA 1D3WA 5ADZA 3I31A 3OFEA 3K0JA 1UPPA 1Y7PA 1OJ4A 2LP4A 4ZDNA 3VZHA 1BQMB 3C3LA 1UKUA 2DGVA 1FVSA 1MNEA 4ES1A 2MKYA 2V2KA 4DCOB 4U95A 2MKIA 3V81A 1M5VC 2Q66A 1ZS6A 2GJFA 2MZTA 4UUWA 4NASA 4USUA 4ELVA 5EUHA 1XNRF 1U4BA 2AZ3A 4PEOA 3J7A1 1R0AA 1NSPA 2YWEA 3HFKA 3S1TA 3HVTA 5BR8J 1KVIA 1F1BB 4WXOA 1P9YA 3P5TL 4C8OA 3JSMA 3IBCB 3RZAA 5F8IA 5LT5A 4BC9A 3OBIA 4USVA 1S0VA 1MMNA 1RAHB 2JSXA 4ZVGA 1UL3A 1JLCA 2MY7A 2JZ5A 3D5MA 1EX8A 4KGKA 4PYDA 5JXSA 5KFUA 2VUGA 4A48A 4CLZA 4GKJF 4YB7A 2RQ4A 2VF3A 4A8OA 2BQ3A 1RTIB 4ZN3A 5EX3A 2MQQA 4X4SA 1SXLA 4LRDA 1XBWA 5RUBA 2FIUA 5GMKa 1X4BA 2LU2A 1NKBA 2G1DA 2Z0GA 3ISZA 5L39A 1HI1A 1F3VA 1RHQB 4MK9A 3UD5A 4CLFA 3HP6A 2W9AA 2VJUA 3RW6A 2J9CA 4IOBA 1FXDA 3QMQA 2H65B 3LANA 2F8MA 4OI4A 4RW4B 2O5DA 3PEHA 5KFRA 3M8RA 3C15B 5IM0A 2IPOB 3HHLA 1HPZA 3UCZP 1U6ZA 4KHRA 1UAWA 1UJ6A 3M1VB 3U02A 4HVZA 1CVJA 3DI6A 3JSRA 2V67A 1S4EA 2Y8YA 2MZSA 1F5AA 4QW8A 1CS4B 5EHHA 2M2BA 3ITHA 5ETKA 1WF0A 1WORA 2V8GA 2A0FB 4MK8A 2RB7A 3QQCD 2XHWA 3HD1A 1AZSA 4L3KA 2IA0A 3RBEA 1TL4A 4LF7F 4P10A 3JQJA 4F4AA 2AV5A 2WW8A 2CDRB 2UUCJ 2V9KA 5CYQB 3A1YG 2J7UA 2JC1A 2WB4A 2FLLA 3EZ5A 1HMVB 3G82B 2W24A 3PJ9A 1IKYA 1GK8A 4O4GB 4F0KA 3EPIA 3JAMU 2J6TA 1ZZNA 4LR8A 1VRUA 2IJRA 3BSCA 3Q2SC 4Y00A 4NCGB 9RUBA 4J9MA 4ERDA 4C97A 5HL7Q 4ANCA 1VRQC 2WK4A 1RT7B 2UXCF 1NPKA 1S6PA 3AJ2A 3FSYA 4QIFA 2ATLA 1R8PA 1VQ5S 1W26A 3A12A 3BKTA 5CYMB 2MZRA 2ZHBA 2HS4A 1TFYA 2XQCA 2XS7A 3NWRA 6FDRA 4IG0B 1B99A 3KLVA 2KH9A 1T7PA 4GRSA 2J9EA 4FVCA 1DURA 5DG7A 2E1AA 3DOMA 1R27B 4L75A 2XSFA 2KYXA 4LSLA 2XY7A 3OXLA 1YJ9S 1S7HA 1RUSA 2KVIA 1FA0A 3B82A 2ZFHA 1GTEA 3SIPB 1BQMA 3EVOA 3NGTA 4FZVA 4ZCKA 2KFNA 4IG0A 2J76E 2YQ0A 4ZA1A 3ZZPA 5J2PB 3PIOQ 2VKRA 2IMWP 1HNZF 2ASLA 5CYMA 4OJ3A 3C6UB 3GG0A 2W2MP 1PAUB 1SQEA 4J9PA 2NXEA 1REVA 3K5LA 4DV3J 2CPDA 3TUIC 1HBNB 1WHYA 2C3PA 2C28A 4LFAF 4PG6A 2MKSA 1UVMA 2BJDA 2OEJA 2YNFB 4ZP8A 1SJRA 4KH0B 1C1CB 2FJVA 3S7RA 4N56A 2AYGA 1YJ7A 3M8QA 3NBPB 1S1TA 2HLTA 1B7FA 1AXQA 2HKEA 2IC3A 4P7TA 4KKOB 4FBUA 4DV1J 4YDXA 2PT0A 4OV1A 5CXTA 3CO0P 1S48A 1TZ0A 3KG4A 4CLUA 3I5AA 4I69A 1REVB 4HH1A 1D0EA 4QIEA 4NLDA 5CZXA 1FWPA 2Y9HA 2XMJA 3MPDA 4DR1J 2YKMA 3EZUA 3X3UA 3DM2A 4RNOA 2WB1D 1UA0A 1IBMJ 1CS4A 4DSEA 4ZIVA 3VAHA 2KT3A 5B0GA 1B4SA 3D6HB 3W7BA 2XNRA 3U1LA 5B0FA 1FX2A 1R0CB 1K9MT 1S1WA 1LFWA 2HFOA 4TYBA 4RW6A 4HKQA 4P2FA 4AQYJ 1SJ1A 3FC9A 3FUYA 2E5IA 3HHLB 2XULA 4ZCIA 4YN3B 2BV3A 3RBDA 3N28A 1N34F 4DBQA 1NDKA 3SYZA 1LWFB 3PFOA 2HHVA 5J1PA 4USJC 5K8PA 3QRRA 2MZJA 2QA4G 1YJVA 4ID5A 1N34J 2IAJB 4U7UD 3I5BA 4OX9F 3KK3B 3V4IA 1LXJA 4WK1A 5K8OA 2ZHAA 3DDNA 4RU2A 3PNIA 2YH0A 1VBZA 1P27B 2MEWA 4DUYJ 3Q8QB 4PZVA 4ZVTB 1C0UA 2RHQB 2Z2MA 2HYIB 5IT9Y 4PRFA 4DL0C 3KLGB 2XSJB 4J9NA 5I3UA 1FJCA 4YMEA 1RA7A 3TO8A 2P9EA 5J2MB 2JEIA 2V8DA 3PHEA 2IBKA 5LM7E 3I9ZA 2VG5B 4BBYA 2NQPA 1VQPS 3VWSA 4QPTA 2BBEA 2LFVA 4RBVA 3TJ8A 3TUZC 2RS2A 2ROEA 2MKKA 3W62A 2FD2A 1S9FA 1QUVA 2YX1A 1IBKJ 2I5JA 3D66A 2ZC4A 4PG7A 1SKRA 1RTJB 5KG7A 1P6TA 2NYHA 2LKZA 3CJKA 4GO5X 5B0CA 1U2RA 1X9WA 4JI1F 1LEOA 2HBQB 5EGYA 3D7SB 3HO1A 3LTOA 4ED2A 3VZIA 4CH0S 4JYAF 3MTJA 1MG7A 2YWGA 3ZZZA 1EQMA 2KG1A 4J9RA 2UVWA 3HI9A 3A4TA 4ZJLA 5GADI 1WEYA 4NL5A 2QT7A 1EIYB 3TX0A 2EBEA 1A9NB 3PW4A 4IRKA 1TTHB 3B6BA 1JJ4A 3MHYA 4YDDB 2CPZA 5F41A 1DQ9A 1DZ5A 3MM5A 4CZCA 3J80Y 3Q8SB 1HARA 4I1TA 5LJ5Y 4QIGA 4UOFA 1ZAVA 4Q0BA 2ERRA 5KTQA 4FN5A 2GX8A 2ZH8A 2XZWA 5C24B 3DRSB 4LSNA 2BXJA 2DNOA 5GAGU 1N0UA 2K1RB 2QL5B 1EARA 4MYTA 4Q0BB 2AX1A 1Q8KA 4CTAB 1WELA 1JXLA 1JKHB 2Q6CA 4P72A 2Y1RI 1LW2B 3NCQA 3S8SA 3ZC4A 5HMWA 1TFWA 2B9WA 1HD0A 1GXLA 3QNWB 2QLXA 2RILA 4OYAA 3D28A 2EVZA 4F3OA 4P75A 4OYXA 3D54A 4CLPA 1JLEB 1IBLJ 2PIIA 2EFGA 5GVQA 3WQPA 1FJ7A 2M8HA 1JLQA 4OHVA 2I6WA 2A2CA 5CAAA 5E3QA 5HSPA 2JVOA 2AD9A 2DEJA 3BYPA 1Y3JA 4XK8C 2GAHC 1RWMB 2MQMA 2EK6A 4IFVA 3W8PA 4X4OA 2KXHA 1VDHA 3LUYA 3TVYA 2KDOA 2Z56B 1GMWA 3G6XA 3ILJA 5AXMA 5IV3A 1NO8A 3DLGA 1AA1B 3D4JA 4KYZA 4PABA 3A3OB 1RT2A 2D74B 4QR2A 1U1LA 4ZVEA 4NLGA 4RW9A 1WOPA 3TI0A 4OV6A 1S97A 5T41A 2N4DA 2LVWA 4HACA 3AXKA 1U48A 4LR9A 4ZVUB 4K2XA 3UDEA 1X60A 2OPQA 3GPAA 5J1EB 1S0NA 2BRKA 2I9SA 2RDIA 5IZHA 3BF4A 2XGPA 4YFUA 3BB5A 2HGLA 1WTBA 3HK2A 5KAKA 3KLHB 3P3DA 3D0HE 3MECA 2VHGA 4NX9A 2UVVA 2GO9A 2HAFA 3PJXA 2R8IA 3T9NA 1H2TZ 1FESA 4MKVA 4I2PB 2DNMA 4ID5B 3PR4A 2XYPB 1EKSA 3KNAA 4C9DA 1QM9A 1NU4A 3TNVA 2YPZA 2R7RA 1FVQA 3L9ZA 1N8RT 2OPSA 2J9DE 2RRAA 4AL7A 1PKUA 2DGSA 2ZH7A 4NLYA 2R3VA 5D3GB 4KV8A 2ZH5A 4P6QA 4R0JA 3K17A 1DRZA 2CAJA 4ES2A 2QA2A 4Z7CA 3T41A 1S72S 1JLAB 1SBRA 1DQAA 3NY0A 2AJ2A 2R2UA 3BDPA 3BQ1A 3MMJA 2K06A 1RAFB 1GAOA 1SV5B 2V0NA 4X4TA 3T1HJ 1Z1ZA 1I5OB 3WBZA 1WSVA 5L1KA 1H0HB 1TKTA 2MSSA 3OJSA 1X0PA 2C2MB 4KHPF 5FLXY 1OY8A 2HLUA 2LU1A 2VBXA 3A3PB 3O2IA 4Z7YA 1ZH5A 3DLKB 3CJ4A 1IWAA 4F4XA 3CO9A 2DNZA 3OTDA 3ONQA 4E0DA 3AH6A 1IN0A 1KLMA 1HNIA 3BGOP 5LXRA 3I55S 4DL6A 3NP5A 1TK5A 4ZCLA 4DSLA 1HNVA 1RTIA 1UEKA 1HBNA 2GJ2A 4FPRA 5HK4A 1SJ3P 3MM7A 5HP1A 3FDSA 4A46A 4FBTA 3CJTA 4JI0F 2H4YB 3HVTB 4K2JA 4DU8A 4DV4F 4KC5A 1P1LA 3GFHA 4PKDB 5D4NA 4OI2A 2AZ1A 1WI6A 3JSMB 2HS0A 3ETOA 4I7FA 4KGVB 1UVLA 4DV4J 2DT9A 2IYGA 3MOJB 3DXSX 3LA0A 2FC9A 2M9KA 5CCMA 4ICLA 1SL0A 1VLOA 1Y11A 2YX7A 1YBTA 3CDBA 2UUBJ 1WC5A 2V6AA 4QYRA 2GQ2A 2CG4A 4O3PA 3BR9A 3DRSA 4LSNB 2XWXA 3O8WA 3QGIA 4PWDA 1KLMB 2DNKA 2IRYA 3M8YA 4IH5A 2CNNB 3C14B 4O3NA 4CLYA 1YJTA 3DYAB 1RSCA 3M8PA 4N7TA 4NPOA 2B6AB 2C3UA 2IVMA 2HHWA 2LCWA 4I6AA 5IFMA 2LXUA 3RGIA 2R7UA 5CHCB 3ZTRA 2AJQA 1NMEB 3CUNA 4FKXA 2Y0SD 2BA9A 2H5IB 4OZNA 1RAGB 2Z8QA 2HNYB 2XS2A 4OFZA 2QA1A 5LSOA 1HNWJ 1OY6A 1M1HA 4R5PB 4N5SA 2MQPA 1S6QB 4ZK7M 1BE4A 2LDIA 2Y3YA 1T9YA 3CJSA 5IS2A 3EWGA 4BWMA 1OS5A 1GEHA 3CCQS 3GIJA 1N6QA 2W7OA 2J7WA 3WDOA 2IRXA 4YQWA 1KHVA 2ZWPA 2AHOB 2DYAA 1JWWA 1NDPA 1MW7A 2CG8A 2CPEA 2L48A 3TRGA 3KLEB 3H5SA 4GKKF 1K1QA 2LEBA 5ETRA 2CQDA 3MECB 3IBFB 4LMZA 1ZAXA 1N32J 1S59A 1LK5A 3IG1B 5J2MA 4OHXA 3MMBA 2E9TA 2G1HA 1U24A 1S0OA 2DY9A 1HHTP 1MROB 2FLNA 1R7IA 3S6EA 2L9WA 1SH0A 4DL5A 3O1LA 4DR3J 2HRTA 2MLYA 3EX7B 2RIJA 1TKZB 1NHUA 1FWLA 1HQEA 2B9YA 3EDQB 1RT3B 1URRA 3HSGA 4DN0A 2E1RA 3C6UA 5LSRA 4GKJJ 2L08A 3GFXA 3EXYA 3HMJG 4DR3F 5JVHQ 1KS2A 1YBUA 2RJZA 5KT4A 4QYZJ 4X4RA 1LWFA 1H2UX 1S6OA 3ZTSA 1B0TA 3A8EA 3TARA 3W8GA 1G7CB 4DR5F 1NB7A 1FCAA 2VH7A 2AEJA 2B7CB 2DO0A 1RYSA 1Z2LA 2QGFB 4H4OA 3OTOF 1OMSA 2KRBA 3MPVA 4USHA 5A6PA 1VQ4S 4IRDA 4JV5J 3WX4A 2AT1B 2CQCA 3EPGA 1YQHA 2RRBA 3V6KA 4AUKA 2ZE2A 1T3NA 1CEZA 2XYGB 1DLOB 2A2DA 5KFTA 4Z2XA 4X62J 4JV5F 1UMJA 4TY8A 5C7PA 1XEZA 4LIWA 2OPRA 4LFBJ 3ENQA 4JI5J 1AYEA 4EYIB 1Z4UA 2IM0A 2QE5A 1HNIB 1X4AA 3MXHP 4ALZA 4LFBF 1IKXA 2XCAA 4LF9F 4HDGA 5KFQA 1F2GA 2PFDA 4Q2LA 1E6YB 1URNA 3GCXP 1EAYC 2ZHOA 2SXLA 2HNYA 3CNQP 3PW0A 3RRHA 2C22A 4FF1A 2OPPB 2WBMA 1CPZA 2HWHA 3AY0A 4UT4A 3KJVB 2GMLA 2C3OA 1LWEA 4ATNA 3CCUS 2D3OR 3CVKA 2B6AA 2DK2A 2XG8A 2E9ZA 5U47A 3ITHB 4KB7A 2EFNA 2DR7A 4JUZA 1TELA 1YITS 1F5BA 2OPPA 1JLFA 2O1PA 4MIWA 4DV7F 1U1NA 4MK7A 3M8SA 3IWNC 3MD3A 5LMNJ 3TQ1A 4V19J 5AJ3F 3H90A 2J0XA 2ZKUA 1W2IA 3BZQA 5HQLA 4DFMA 2UUAJ 2UXCJ 3MMAB 2KO1A 2HQGA 4PXBA 4WZQA 1NNDA 2FJEB 2OPSB 1TR0A 4HEA9 2DHSA 3W60A 4OHZA 4GKKJ 2GO8A 1T9WA 1LOUA 2XZTB 3ETMA 3HULA 2XI3A 3CC7S 3TANA 3T5HA 2ZDPA 4EI2A 4A8KA 4RNNA 4CH1A 2J7KA 2R7QA 4TY9A 2HGNA 1Q53A 2NLWA 1S77D 2ILZA 2VFSA 3FEXB 3GIRA 2H5JB 1Q95G 2VBZA 2D3ZA 3QGHA 3HKWA 1NSQA 3SEOA 4EO8A 4PQUB 1HNVB 1KOHA 1RWNB 2B7BB 2HPUA 4I6WA 4PYAA 3UNYA 1AFJA 5A8RB 2Q1LA 4ZOSA 3VVTA 3GQCA 2DIVA 3CD5A 2HVDA 4DZDA 3PYDA 1ELOA 2HIYA 2G0CA 3KLGA 2EFOA 1FNMA 3SFGA 2YNHB 4TQSA 1IVZA 2JRSA 2N7YA 5IQQA 2EEYA 2P6TA 2G2YA 3IA0A 3MURP 4ID8A 1QVGR 2ZWOA 4QWDA 2KZZA 4XDCA 3UFCX 1LW0A 3G71S 1TK0A 4NZ0A 4UOGA 1IQZA 4LREA 5ETQA 2YQ1A 3NNAA 3DU5A 2CZ4A 1KD1T 4NYPA 5HMZA 2R7SA 4JI3F 3B4MA 3GFYA 3MCSA 1GX6A 3WC2A 1X5PA 4TLQA 5DM7Q 2FJDB 2R8JA 3VQTA 5KFLA 4H4MB 1RCOB 2NUUG 2RVJA 3TEGA 4LF2A 1EJ7L 1WHXA 4KV8B 3Q8PB 5I42B 2OO4A 1D09B 2XO6A 4B3SF 2WSFC 2MJNA 3CCWA 3TX8A 4C11A 2LA4A 1JJCB 4JV1A 5GAEI 4CI0B 4P2XA 2W7PA 3OPKA 2W9BB 5DDPC 3RRKA 1IM6A 3MM9B 3DHWC 4WKYA 2P6SA 3DOKB 3H7HB 4YY3F 5KFVA 4CTAA 5I4MA 3WX8A 2HBRB 2ASJA 3SV3A 1KRPA 2PI4A 3DCAA 3TJAA 4LF9J 2CXEA 1S9EB 3FBFA 3WZ0A 1NEEA 2GW8A 5KOXA 2UP1A 1ZM3A 2DH7A 3ENVA 3HZGA 3P45B 5D77A 4LF4J 4YY3J 4ER8A 1RP5A 4URQU 1HQ2A 3LAKA 5ITHA 3GV5B 3DMJB 3DOLB 2NR0A 2Y1IA 3TAMA 1J27A 1JXEA 4NEYA 2QL9B 5HVFA 3A13A 1N36F 1QJHA 3UO0A 2EC0A 2Q43A 5G0RA 3BSOA 4OL8A 2FJXA 1M1GA 2UUCF 1M5KC 2G13A 5F8MA 3IP0A 4DX8H 4C8ZA 2O67A 3BS9A 4DV7J 2ZE2B 1YVFA 5E5NA 2OSRA 3D0IE 3LP1B 4WXWA 1M5OC 3PKMA 1VIOA 3GJSB 3GJRB 1CJUA 1HQUB 1KQGB 3POTA 4OYWA 4ZVPB 3LQVA 4ANDA 5KFWA 1VBKA 5ETMA 4ECXA 3Q8VA 4DPTA 1YK9A 4ZKAA 2RRNA 1IUJA 2FHJA 2OH2A 2V34A 4B3MJ 3QGGA 2BE7D 1NJYA 3QJPA 1Q16B 2CWXA 4M94A 2B9XA 2W1BA 4IO9Q 4P52A 5DDOC 1U49A 3P8BB 4NA3A 3LOUA 4M5DB 5AXKA 2RDJA 3JTNA 4O0NA 3UWTA 1AFIA 3G8QA 2NSCA 3F0NA 3LALA 2ZH1A 3R6GB 2PEBA 3TYTA 3QBCA 1WHVA 1JLEA 4DU7A 3EYZA 2BR0A 1AW0A 2DGTA 4KBIA 5BJRA 3PR5B 3CCRS 3RAXA 1X31C 2H5EA 2JC0A 2WVCA 2XHCA 3MDFA 2UXDF 4L6V3 1K44A 1HWUA 2UV8G 3D6MB 4E2FB 1JKHA 4YEAA 3G6ES 1RT7A 1FFWB 1TU0B 1WC6A 2EK1A 3R8YA 3W65A 5I3UB 1V5IB 4A8SA 2FJWA 4JI4F 2CJAA 2DNYA 3BV8A 3C66A 3MPYA 5DRKA 1PYTA 2MGZA 3E3XA 4ECTA 3HVAA 3IC1A 4UZCA 3SDEA 4JI8J 3HT0A 5KFHA 1T8EA 1AZSB 2LQ9A 3NS5A 3IAS9 2CNKB 4LFAJ 3KK3A 2Y1JA 1RHRB 1QD1A 3BYRA 4Y3CA 4ZP6A 2V69A 3DLHA 3UN3A 2FY8A 1GFWB 1DARA 2CUYA 4ZPWR 3VV2B 4I2QA 4R8UB 2ABYA 3W2WB 3BJYA 3NOGA 2G0IA 3I0SB 3HM9A 1HR0F 3MPWA 1FEEA 4RJVA 2VQEF 3T9ZA 1T94A 4OZ3A 1AB8A 4HDHA 4DZ6A 2OI2A 3BBFA 4IQXA 5A8WB 3KK1B 1CJKB 2FZGB 2O01C 2P2CB 4CRJA 2DGOA 4OZLA 1RYRA 4P7VA 5KFJA 1WOOA 3ELHA 2IJNA 4LBPA 5I3PA 5E3CA 3ZFVA 2Y1LB 1NK8A 1U7LA 3I0SA 1NSKL 2E5HA 4DXLA 3MAQA 2H54B 3IWLA 5CH7B 4CM2A 1G3OA 3VCDA 4LF8J 4KKOA 1R6YA 3JYTA 1CULA 1NH7A 3ZZRA 2O66A 2PGCA 4I2PA 2YVSA 3ET6B 4A8YA 3MR2A 3Q89A 4DS4A 4NA2A 1YHQS 1DJ0A 3N0VA 4NLPA 1N56A 1NHKL 2ACMA 3BGLA 4OQJA 4JI1J 2VBWA 2M4MA 3TA2A 3ZZ0A 3CULA 2V4JB 3TWZA 3RR8A 1QSSA 2XM3A 2R7XA 2GZOA 2G0JA 2DNGA 4IG3B 1A7GE 1YWXA 5A2QU 4DR4F 1X7VA 2E5JA 5EWGA 4K50A 4U9RA 5IT9U 4B3MF 2QTWA 2D7SA 2PA8D 1SL1A 4FF4A 4P2MA 4H54A 1U1PA 1U45A 4YB5A 5J2PA 2WZ1A 3R5JB 4WF9Q 3W3SA 4O23A 2BX6A 3ZTQA 4RW9B 4DL4A 2OTJS 1GMWD 2BUNA 1HWKA 3WC0A 1U1KA 4URSA 4FNIA 3TQEA 4LRFA 4XDDA 1JNZB 4ECZA 2F8HA 2BEFA 1SJFA 3KLFA 1U6BA 5A2QY 4NMXA 5KFPA 2RQKA 1TVRA 3POTB 4DUTA 2B0GA 4X2BA 1HLWA 4EK2A 4USTA 4CYUA 5K14B 5LJ3Y 2HIQA 3VAKA 4ECRA 1OPIA 2KYZA 1Y9OA 3DLKA 2DNPA 2OSQA 3SSRA 5KG6A 2W9CA 1S76D 1Q78A 2MY8A 2QRRA 2DGXA 2Q3PA 3H5UA 2NYIA 2UU9J 2X1BA 4L74A 1FTRA 3IR5B 4ZHRB 3UPFA 1UETA 4KRWA 3SMZA 7AT1B 5K8NA 5T14A 5KT6A 3LWLA 2R7TA 1LXNA 5F0UA 3UD3P 4BC7A 5A8WA 3QWPA 1RAAB 4C8MA 3MFHA 1WHWA 2I0XA 1SIZA 4Y28C 4CNYA 1RTHA 3CCSS 1JLGB 4C48A 3FZBA 4UZBA 1IR0A 4WYWA 1U1RA 2BOPA 1CQNA 2OD6A 2HAIA 4MH8A 1U47A 1XR6A 3KLEA 3BO2A 3TZYA 5D0GA 4QR1A 2RQMA 3IS9B 2HVEA 4DUZJ 4OZ1A 3CDUA 1HWJA 5DZ6A 4ES3A 1VISA 2AW0A 2B4PA 4HHJA 1L5UA 2BE2A 4DQQA 4OI0A 4OI6A 4L73A 4CLWA 5E3AA 4QU6A 2H51B 1FKPB 1Q7LB 3JTOA 2HVZA 1I51B 4YR0A 3MUMP 3JS9A 3PG9A 1J2VA 4FS1A 1A0OB 1MWZA 1OSDA 2RD5C 3GONA 3TW0A 1F9EB 1ZA2B 2WOMB 3B8HA 3TOQA 5CCLA 4XO0A 5G4DA 2PDAA 2QMUB 2VBYA 4F0HA 1PYOB 4IH6A 1SKWA 4KHMA 1VK3A 2DISA 3GR0A 1L3TA 2K7JA 3PDNA 1HQEB 2BKPA 4U7CA 4F02A 1VIXA 2MJUA 1IM4A 3EXCX 4DUYF 3KHLA 1FO1A 1FRMA 3MEGB 4V1Ak 4HT7A 1JXVA 3KKFA 1X5SA 2GCFA 1X4HA 2DGQA 2HZAA 4ICLB 1JNRB 4J9VA 4DHVA 5C42A 2HHTA 1RK8A 2DKOB 2RH3A 3H2LA 3MWBA 1CJUB 1HQUA 1IWGA 3KUGA 4I7FB 2QFIA 3ZZOA 2KFYA 2ZH4A 3MAHA 4QIVA 4DR6J 3BBCA 4PQUA 5T7LB 3QT6A 3FFIA 1RAOA 1GMUA 2YKAA 4ILMA 2IDEA 2ZBRA 4Q8FA 2PD1A 2RDDA 2ZOFA 5E0OA 1V6HA 3SXLA 3PW5A 1FXLA 4DR6F 1KVKA 3UVJA 4ZPTR 1B0VA 1WTFA 4PXCA 3CGIA 1PBAA 3BGRA 4DJBA 1X9SA 4O3RA 2CVIA 1ZTWA 1VQ6S 3DGPB 4KT0C 4Q43A 3ILOA 1DTQB 1S1VA 4DV0J 3AFGA 5IC6B 2Z2ZA 1YX2A 1XMQF 1WD6A 3QLHA 4C4WA 1LWEB 1N54B 4PQAA 3UDLA 3A8KA 2RT3A 1BGXT 3AAWB 3M30A 2MHEA 1X4DA 3LH2S 1DTQA 1W2BR 1NK4A 5BXIA 3OV7A 3MOZA 1CJVB 3K8VA 1BQNA 1IKXB 1VQSA 1OPZA 4WP9A 5AE1A 4DSJA 2GQCA 3C8YA 2N7CA 1FHTA 4ELUA 1NCLA 3BKUA 2DHAA 1W25A 5HO4A 3QZ8A 3E2EA 5F8NA 2QC3A 3QFWA 4DLEA 1S1VB 3VGUA 3BREA 5D0RA 2N3OA 3T1HF 5A8KB 4IR9A 2V5HG 4QOTA 1U25A 4NRUA 4WU2A 3MR3A 2ASYA 3KDNA 2F9DA 3RAMA 4K4XA 2VPYB 3VTIA 4CQ1A 4U6PA 3I9V9 3SSQA 4EZ9A 5HATA 3MUVP 3CD0A 1RKJA 4B3RJ 2YNHA 2CZ9A 3N9UC 4LVNP 4KO0B 4RKUC 4EU0A 1T9UA 3IRXB 4X64F 2ZM6F 4DFPA 2MTLA 1RWVB 3V6DB 4AQYF 3TUJC 2FVSA 2BJ1A 2B4OA 1TAUA 4I68A 4I56A 2MZ1A 4J91A 2U1AA 2UXBJ 4X64J 1H7WA 2E9RX 2DPIA 1PGZA 1Q4RA 1N5SA 5DDRC 4HHHA 3D2WA 4C8YA 2J6UA 4DPWA 1QVFR 3VAJA 4N41A 2IJFA 3PW7A 1RDRA 2G9OA 3M2RB 1H72C 3K89A 4OX6A 4NXNF 1S9GB 4K4TA 4LQ3A 1FXRA 3IN5A 3LP2A 4NOHA 1RQ0A 1VLYA 2J0QD 4OYOA 3NAHA 3QIPA 4M5NA 3C2PA 1HBOA 3GYXB 2VDIA 5FD1A 3MEKA 3QO9A 3GG1A 1BUXA 1BLUA 1G4CA 2GNKA 5DO2A 4EMDA 2EBGA 4M1KA 3UR3C 2CPIA 4Y2CA 1QSLA 4XPCA 4IFYA 4XTTA 5DETA 1XMOJ 1FDBA 2A3JA 2P8IA 3HJFA 3DNCA 2KHCA 5HANA 1R0BG 4M5JA 5JMNA 3PX0A 1GNKA 3CCMS 1V9OA 3KUEA 5KT7A 5AJ3J 4FXDA 4ZVQB 4C2MA 4Y34A 3OLBA 2CPYA 2DPJA 1G2EA 3LPEA 3NBPA 2KFZA 2K1RA 5KFFA 4XIUA 3SDEB 1UEVA 3R2DJ 4KAIA 1RGVA 5C24A 3T19A 3G8SA 2IDLA 4KJIA 1S79A 2UUTA 2KT5A 1HBMA 1NK7A 2PI5A 3TA0A 2VQFJ 1TK8A 1PILA 3DOKA 4YB1P 1NZAA 2DH8A 2HSEB 1SC6A 1G6BA 1KTQA 3HCXA 4M5GA 5LXYA 2XY6A 3PV8A 4W90B 1T02A 2I1RA 2MYFA 2QL7B 2VKZG 3DDKA 1F3FA 1H38A 2UVUA 3EGZA 2Q6BA 5CABA 1FKOB 3VAGA 1S1XA 2CQPA 4NI2B 5IC4B 4AD6A 2OIHA 3M9NB 2AJ1A 4RBTA 2OAUA 5K5MA 5JUMA 4EGLA 3JB9k 2HZVA 2W4DA 3T6JA 5BYRA 5C5JA 2KKHA 2ZD1B 2C2NA 3M2UA 2JHEA 2O3DA 3WIUA 1S1XB 2VFTA 2D3O1 4Q8EA 2FVQA 4AL5A 1DFDA 2WSEC 3P96A 2E5LJ 3CT9A 1NDCA 1FFSB 1MMLA 1QAYA 2YXLA 3QFHA 1RE1B 1TMMA 1W7WA 2WW4A 4RW7B 4CLTA 4RUCA 1WC3A 4DWIA 3VGVA 2VG5A 3GP9A 3QT7A 3OTOJ 2XYHB 4WK3A 2XMKA 4B3TJ 3B78A 2E5LF 2VPWB 3QT5A 2DNHA 5LL6d 3HHKA 4TU9A 3HFVA 4NXMJ 4UUXA 2JNJA 4ECUA 1U0HB 4BCAA 4B3TF 4I0WA 1IJEB 4CM0A 2LDYA 2YBVA 1BWVA 2B8QA 1F9FA 1S57A 1SPBP 2C3MA 4NLSA 4B9MA 3KNGA 3NAIA 4LF5F 2JVRA 2X7IA 4ZITA 1C2PA 8AT1B 1TUVA 3PFEA 2CDQA 3DKDA 2ZBCA 4IYQA 3VGSA 1DAXA 2A6MA 4K5RA 3K5MA 3N5FA 3RB3A 2BRLA 2H4WB 2AX0A 1F2HA 2BKNA 3OW2R 2ZITA 4X66J 1IR1A 1RHJB 5FDLB 2GHWA 1F60B 4J90A 3CMAS 4EEYA 1U0SA 1K47A 4E98A 4YB6A 4F25A 5E41A 1NM2A 2JDJA 2OGUA 1EQ0A 1RBLA 1MU2A 3KG1A 4OMFG 3RU0A 4KPYA 5THWA 1SQGA 3DRXA 2Z57B 3MAAB 4CO3A 4J9QA 4GC6A 2ZOGA 1JK9B 3FMBA 2DIUA 2YKOA 1SVDA 3E01A 4P9SA 3H40A 2EXUA 1Y3KA 2AJ0A 3R27A 3UDCA 2HEKA 1S1TB 1JLGA 3HHEA 2RKIB 2UV8A 1S1UA 3NWGA 1XNRJ 2NS1B 4JV0A 3TR5A 4F67A 1KP6A 2DH9A 5HLFA 1YJRA 3SCLE 1QAIA 2ZJRQ 3KG0A 3P49B 4UY85 2DEIA 2ALYB 2W4PA 3GJTB 1NBEB 2GHVC 2MQ8A 3IM9A 4LRBA 3W5YA 4UY8T 2OPRB 1YGYA 3CJ0A 3MR5A 3I4HX 2OELA 2ILYA 3AXMA 1WNEA 3JSBA 2FGCA 4NMLA 3C6TA 5K14A 1WEZA 5HQMA 2VPXB 3M4XA 4KH1B 1L3VA 2J6SA 4YOEA 4NLQA 5B0DA 5IWAF 4HYKA 3KLFB 2XI2A 1RLDA 4RPFA 5HJXA 3ZZYA 2A10A 4FPIA 4Q7AA 1S7IA 4USMA 3DRRB 1N88A 2CQ1A 2J8AA 4UQTA 4WCEQ 2F3JA 1TKXB 1RWKB 2B8PA 2D41A 2RF2A 3ILLA 3N5BA 2LEPA 2HHHF 3A3NB 4RR5A 2LQBA 4J37A 2X1FA 2YNGA 2RNEA 5IV4A 4DR2J 1BWEA 1FRXA 1B70B 4PUOB 2W2PP 1LWXA 2R4FA 4DX5A 3R9LA 3PO5A 1R6VA 1VRUB 3OXGA 2IC3B 2JLFA 1KKHA 5KOWA 1ULRA 2DBBA 2NCKL 4DF4A 3SI8A 1HMVA 3R97A 4YUDA 1KLNA 1BQXA 2AJFE 5D4OA 2HFNA 4JI6F 2YH1A 1H73A 1SJ4P 4A8MP 2WVBA 4L72B 5DLFA 2KVQE 1WDDA 3GWCA 1FI4A 3KWMA 3HD2A 2PEHA 2CKWA 3FBEA 2CJKA 3HSZA 3ISND 2MQNA 5EDWA 1D1UA 5ETPA 4LF4F 1SQFA 4OJ1A 4USKA 4ZVOB 1BXNA 3FMWA 3LGHA 1QAXA 1O0PA 2WTFA 3G6VA 2B56A 4P73A 1R8HA 5J1NA 5LMNF 4DSIA 3PX6A 3NEKA 1TQLA 1XERA 3BN4A 2UUAF 3DHXA 2DNQA 4DPXA 5AE2A 1X8DA 5KT3A 1FD2A 2ZH3A 3BO3A 1PYSB 1D9DA 3MEGA 2R2TA 2NXJA 4I2QB 4K4SA 3N01A 1TL7B 1WC4A 2WBRA 3C6TB 4X4PA 3M6UA 4ZLLA 3G86A 3M2RA 4I4BA 4F4WA 2DR8A 3ZTPA 4ED7A 1PAEX 1TL1A 4TN2A 3VHQA 3FQKA 1PC5A 2I8EA 3NG8A 3UCGA 4A8FA 5L9XA 1RT5A 1DBDA 1ZA1B 3GYGA 3QYYA 5B0AA 1HNXF 2E1PA 1UVKA 2OKQA 4PAAA 3C19A 3PRVA 2FJBB 4NE9C 4ZVRB 5H9FJ 4DV5J 3H0PA 4DQSA 4IUFA 1CC8A 4B9LA 3CTRA 3QJLA 1RABB 3V6DA 3A8IA 2C1EB 2GGPA 3FCVA 5A0YB 3EICA 5D6GA 4X65F 1TL1B 1SC4B 4CLLA 3VQSA 1P8GA 2HHQA 2MLZA 4MKAA 4RUBA 3RUBL 1XWLA 4ELTA 2V8VA 4M5KA 3M2UB 3CIZA 3CCJS 2VC1A 1RT4B 4DR5J 4R25A 1RJJA 1X4GA 1I1GA 1SH2A 1Q79A 4NLWA 3UR0A 1R31A 4MIAA 3UN5A 3OSNA 5C25A 1FTCA 2GMHA 5GADU 4OZ5A 2IMOA 3KLIB 1CJVA 4ZS6A 4DPOA 3MZIA 4DR2F 1D9FA 2ZBPA 2VA3A 2CZVC 4K0KJ 1T03A 2VA2A 3W9JA 5F8HA 2C42A 1KNZA 3LP1A 4OJHA 2V8PA 3JTPA 4MT1A 2X51A 2KB2A 4G6VB 4N8OA 4PXEA 2IVYA 3L95X 1NH8A 1WKJA 4EO6A 5GAHI 1IBMF 3MD1A 2BW2A 4MKBA 4AXIA 4JI5F 3Q8UA 3M30B 2M3DA 3GV7B 3VR1A 1OIAA 1T9XA 4PG4A 4K5SA 4DEZA 5C25B 2JFKA 3BN7A 5GAGI 4UQGA 3CSKA 1WSRA 3I4PA 1EP4B 2F65A 1Z2ZA 2LECA 2ROPA 2JEFA 4ENOA 3QATA 2C2RA 5D3GA 5IXUA 1TV6A 3PIPQ 3PY8A 1N33F 2DJWA 2QV6A 2C2OB 2C2DA 2VG6B 4Q45A 1KONA 2KL8A 4JOUA 1L3UA 4DX7A 5I3QA 3N4WA 3OHBA 3PW2A 1UEUA 2B4UA 3K58A 2PE8A 4D3GA 3GR1A 2F4VF 3TA1A 3GCWP 2Z30B 4J5OA 3GZ7A 5CZVA 1RWPB 1P9QC 3I96A 1H7XA 5CA5A 1C0UB 1SJQA 3EM1A 2BABA 2BW7A 2PMZD 1B7YB 2F4FA 3MCNA 4WJBA 3AB4B 4CP5A 2ZJQQ 1APSA 2BACA 3DLLQ 2BE9B 4P71A 3SFUA 2GA7A 3QIPB 1ZM2A 2QO3A 2WONB 3AJ1A 3P6YC 5DJBA 1SH3A 2V9WA 3T1YJ 1NXIA 5J1EA 5KG2A 1TKTB 1SKUB 3HVWA 2NPFA 2F7VA 2QN6B 4MJKA 3VVUA 1UTAA 2D9OA 2VU5A 2WOMA 3A8JA 3JSYA 4QBUA 3LGNA 5HVHA 1M1KT 3IGNA 1XTZA 2HMIB 1GMVA 3PACA 3TEHB 2WONA 4O4GA 5FIIA 1E6VB 4A8XA 1ICEB 5KG4A 4HR2A 1L3SA 3G87A 4FYWB 1VYAA 3MM6A 3THPA 3J7YU 3FCHA 1HYSB 3KJNB 3GSDA 3M2VB 3ILIA 2XO7A 2BMBA 3NLCA 2D9PA 1S12A 3IRXA 2L3MA 2B4VA 2HW3A 3M8ZA 4Y2KA 3J80U 4LF6F 2BE2B 5KFGA 2VG7B 2RS8A 3DGVA 2FHMA 3W5XA 1JX4A 4C8NA 1EB0A 2DNNA 2CWKA 2UZAA 1RISA 4QWEA 1HR0J 2AF6A 3NS7B 4TU8A 4JI3J 4ED4A 1FE4A 1NJZA 2WRMA 3ULHA 4F4KA 4CT9A 2GQQA 3AOBA 3F56A 3GFZA 4IFYB 1IKWB 4C0BA 2HRUA 2KG0A 1VBYA 1RTDB 4K4UA 4J7CA 1FRKA 3W5ZA 4GVBB 3F73A 1KFSA 3CD6S 1TP7A 1U09A 4ZLNA 1P1TA 3OLAA 1SUQA 3W64A 2ZNZA 5DG9A 1HBOB 3KMSA 4C8KA 5D78A 4ANEA 5F3ZA 2DCLA 2ZM6J 1RI7A 1ZZFA 4RW4A 4M5LA 4WIQA 3BKFA 4CO2A 3M9MB 3KJVA 1OY9A 1OQ6A 1RACB 4HL9A 1AUDA 1CJTB 2KJWA 1UA1A 2FVCA 4UTGA 1RB0A 2QLBB 4W98A 2HS3A 4H4KA 4NLOA 3Q0AA 5KFOA 3SZ2A 1VBXA 2FVRA 2N3LA 4K4YA 3WIVA 3HHNB 2HK2A 2DD8S 3EZOA 3J81j 4RWXA 5M2PA 1ZAWA 1U0HA 2MDAA 2XWYA 2ZOMA 3D6FB 3CJKB 3THTA 1RWXB 1U2FA 4DR7F 4TY8B 2F4VJ 3FVYA 3U1MA 2X3GA 3TUPA 4ED8A 4DS5A 3ZTOA 3UNGC 2R7WA 1GQEA 5JJBA 4QU7A 4OHWA 1Q81T 2ZVIA 2IY5B 2WHOA 1WG1A 2YKPA 1FF2A 2JL9A 1FJEB 4IH7A 3PM9A 1O6XA 3ET6A 3E51A 1HHSA 1MSWD 1EKRA 3FBCA 4WPAA 2WCXA 1O5JA 4NCAA 2RAQA 2E29A 2M7SA 1C0TB 2MKHA 2GIFA 2KRRA 4Q5VA 1G1XA 3DLBA 4F8RA 2CPHA 2CJ9A 2IM2A 4NI2A 2FY1A 1D8ZA 5GMEA 1YRTA 3PJWA 4JB8B 4OYIA 4KFBA 3R7NB 3OVBA 4PCQA 3JYTB 5B09A 3MI7X 4KE5A 1X0FA 4B9SA 4B9TA 1T95A 2UXDJ 4G1QA 2NPIA 2WAQD 3UE2A 1CBKA 4LR7A 2F8EX 4NWBA 4DF8A 3I0RB 3KK1A 2XLKA 2G2OA 1Y00A 2CFXA 2VV5A 4HLBA 4Z37A 2XLJA 1SB6A 3LO3A 5DS7A 1CQMA 2VQFF 3AOAA 3IMQJ 3SBMA 3IG1A 1JB0C 1EZZB 4G1PA 2IIHA 3K5NA 3OTEA 1HBUA 4HTJA 2RU9A 2YX4A 1FDDA 4ECYA 1CJKA 1KEKA 3N79A 3VAIA 3PZPA 2DR6A 1K1SA 4UOHA 4ZJQA 1XN9A 2HFSA 4LQ9A 3TAQA 3HSDA 4X4QA 2V4QA 2MQOA 2AGQA 1YG0A 1BMQB 3NKYA 4WFNQ 1Y5IB 3D6TB 2XGQA 2AYMA 1VJQA 2KT2A 3CDEA 2DHHA 2VJVA 1WG4A 2CQBA 2CIMA 2K3KA 2GVDB 3M8WA 4I64A 4RX6A 5C2GA 2VG7A 1N5YA 2DR5A 1N5TA 2XMVA 4OLOA 3K59A 4OLPA 3FSIA 4RU9A 1IQTA 1T9TA 4B9UA 3T1AA 3OFGA 2KI2A 3K2YA 3Q2TC 2M52A 4K7QA 1RT5B 3GLJA 5L8RC 3IWXA 2JOQA 1HYSA 4OYZA 3NGDA 2KTQA 2LA6A 3GILA 4EYHB 2B5JA 3K5PA 5KFDA 3R5DA 4ECQA 2RQCA 4ZIWA 3KLHA 2F1FA 4LF8F 5ETNA 2VOOA 5D8HB 2YNGB 2Z4PA 3ZNUA 2IAJA 4NXMF 1IKVB 4WFXA 2OFHX 4WP3A 1HWIA 2GVZA 1TVRB 5C2CA 2Y0BB 3D1OA 4LF5J 2AEFA 2DRDA 3QIDA 3RG6A 3MF5A 1U02A 5KFEA 1MN9A 1Q8BA 4NXNJ 2BJ7A 1PSDA 2D69A 1I94J 1X5TA 2J0SD 4USIA 1S6UA 2VFUA 3VAFA 1QDUB 3RB0A 3R3TA 5F3TA 4ILRA 2J5AA 4ED0A 3R1HA 3IS9A 1DHMA 2VG6A 3AOCA 4N77A 4KO0A 2VODA 1RCXB 4DSKA 1T05A 4ZCMA 2MKJA 3U7JA 2CJBA 2QZ8A 5B7WA 2V94A 4HH0A 4O0IA 3OSPA 1HNWF 4LRCA 4O44A 5D0EA 4Y2MA 3W9IA 3H98A 4EWTA 2HGMA 2AQ4A 1SKSA 3CJ3A 4FYDA 1Y10A 1TL3B 2Z58B 2W7AA 3OUYB 2R8KA 3NNCA 1FEHA 3NRBA 4KY3A 2LLZA 1B0PA 1IKYB 1X5OA 5A6WA 2KXFA 3Q83A 1TV6B 2E7VA 2FHOB 2GIQA 4E8UA 5EWFA 4XPEA 4DV0F 1EETB 3MUTP 1VOMA 2ZDOA 2HHPA 1EP4A 1SIWB 1RT1B 1XR5A 3ADAC 2OLWA 2KU7A 1DY3A 1WI8A 2WVEA 4M5HA 1V5VA 4PPDA 2KM8C 3PO4A 1PJ6A 1UW4A 3SCKE 1BY9A 3NOCA 4ZJOA 2CQHA 2YNIA 3MAAA 3NGSA 2NXUA 3EGWB 3M32A 3GTYX 2OMOA 4HI1A 4ZPAA 3NCPA 4RWWA 3IM8A 5F0WA 5DGBA 2HURA 2YWHA 2PA3A 2ZZNA 3BM7A 4KGZB 1BD6A 1HFEL 3OL9A 1QE1A 2LYVA 2R7OA 5BYSA 1QTNB 2M5YA 1VR6A 3C15A 5IM0B 3I5CA 3PYFA 1ZOTA 3DOMB 1UFLA 2HVHA 4DX6A 2DGUA 5D4PA 1VRTA 4N47A 3UN2A 2H3EB 2BANA 3MGJA 4C3MA 2IBOA 3RTVA 3UVJB 1QLNA 4MFBA 4ZPDA 3JAMY 4KHPJ 2E1MC 5DQIA 1NAQA 3MPUB 1LV5A 4LRAA 1TUWA 1FERA 2BQRA 1J5EJ 2B5JB 4AT1B 6AT1B 5IOLA 4JP8A 3D67A 4HTIA 3KK2A 3BO4A 3FZ2A 3BEGB 3I32A 3G6YA 5HLFB 4LSZB 1JLBB 1JIHA 1OSCA 2BDPA 1KQFB 1GX5A 4DL2A 4RUAA 4JI0J 2NSBA 1NK0A 2BJEA 1V3SA 4IOCQ 3R2CJ 1RBOB 1ACMB 1DQ8A 1SCJB 4UW2A 4O3SA 4UOCA 1GTHA 1H74A 1VRTB 2EW9A 3H59A 2FUG9 3GE9A 4Y2IA 1JJ2R 3I82A 2MZQA 1R8AA 1YJWS 3DRPA 3BDEA 4ZP7A 3MMAA 4WYLA 3H8YA 1MU2B 4KGMA 3PEJA 2P9GA 2FVPA 3R5GA 4OHYA 1RWUA 3S01A 3M6VA 3AQPA 3FCWA 1WKKA 2LQ5A 3DI6B 4KQZA 4WFYA 2LXFA 3NGKA 2LXIA 1FKPA 3AT1B 1BQNB 2EWHA 2LQ8A 3EDRB 4DCPB 1QAJA 2YNIB 1VHFA 4B08A 3GV8B 2AU0A 5DM6Q 1U1QA 2A1BA 2ZBQA 4BWJA 4ILLA 3PCOB 4AYBD 1IXKA 2DXDA 2CQ2A 3MR7A 4J9UE 3FBBA 3OD2A 4LVOP 1C4AA 4U8VA 2R2SA 3HLUA 4CWBA 2ZEJA 5AXNA 3BH6B 5KFXA 3LPYA 2YNFA 2DY1A 5KFNA 3HVRA 1UZHA 5DG8A 4FYXB 1TL3A 3N6NA 1NPRA 2J8SA 2CJQA 2RE1A 5K20B 1XNQF 1CLFA 3LGMA 3BBBA 4RNHA 1RTHB 3FKBA 5J2QB 5HVGA 4M5IA 2PO4A 3GIKA 2Z2YB 3CPWR 4F2SA 1C1CA 1FD8A 2LQJA 2IFXA 2V2QA 1NK9A 1UWBA 4NRTA 1NRKA 2Y8WA 1XNQJ 3BR8A 2KJVA 1YBAA 3RJMB 3FFIB 2QA4S 2OHDA 2D1CA 1B3TA 1OYDA 4O44B 4RW8A 1CSJA 3QPIA 2BZ2A 2MB0B 4DLGA 1T05B 3P5BP 1Q82T 1DLOA 1F0XA 1ZPWX 2BYCA 2W2QP 4OIXA 1WWHA 4B3OB 9ATCB 5H1SV 5ETOA 5HMXA 5GMDA 3LWMA 2XY5A 3J7AN 2RUGA 4X65J 3HT3A 1FJGJ 4QZVB 1KN6A 2HQIA 3JQMA 2G4BA 1Q5VA 1N0VC 3F44A 2KXNB 4ETXA 2XMMA 1VQLS 2ATCB 4A8WA 1X4CA 1TKZA 4MTPA 3PYGA 1LW0B 1NPPA 1U6FA 2GGPB 2WVFA 5A0YA 4ETZA 4B3RF 1VC6A 1PO6A 3GB0A 4N8NA 2FQQB 5IT4A 3H4DA 2AYEA 1Q5YA 4Q44A 2B51A 4TYAA 2W8KA 2HFZA 1ZYQA 1JLAA 3UW1A 4W92B 1N52B 1RA6A 2AWZA 1U8SA 4F3MA 2CA9A 4OYMA 3ZZUA 4IG3A 5SUHA 4DI6A 2ALZA 2UXBF 4P2SA 2JH3A 1UZDA 1V3ZA 4BLGA 2HFUA 4CLSA 4F4YA 2UUBF 3V5RA 2DR9A 1FE0A 1TUGB 3OL8A 1FNXH 4N76A 3QSYB 1VK8A 7FD1A 5HBMB 4GMKA 1HI0P 1QY7A 1F6TA 2H1YA 3G2XA 3EJMA 4A47A 3FK4A 4TLRA 1PBUA 3KHGA 4X4NA 3Q22A 2GC8A 3MMCA 3TVKA 1HPZB 3D9BA 3AA8A 3M6XA 1N5VA 5HQ8A 4RW6B 2XMTA 4RLEA 4U96A 4R5PA 2JX2A 2QEXS 2EKYA 5GAHU 4LFCF 4MMOA 4F3QA 1XMOF 3B54A 2QMXA 1UWAA 2CYYA 1UPMB 2XS5A 1PJ7A 1H6KX 1R89A 3RW7A 4LFCJ 4FVMA 3M32B 1HW9A 4OI1A 3DN9A 5F8JA 4YP3A 1OQ3A 1Y5NB 2CJXB 2FTRA 2PSZA 5J2NA 1UW9A 2CNLB 2QSWA 3I56S 3LP2B 2W01A 1MN7A 1CG2A 3AJDA 4FYVB 2BVZA 2CPXA 4CYUB 3HDSA 2NZCA 4DV2J 4FF3A 1YRXA 2MXYA 3Q8YA 3OTBA 4JV2A 5FJ4A 1RADB 1N4LA 3RRGA 3C16A 3BPSP 3DLGB 4WTYA 3T5JA 4B9VA 3C14A 2XSJA 2JWNA 3EUNA 1NDLA 3M6WA 5M2UA 2F63A 2R2RA 2CJYB 4OX8A 3CJRA 3HJVA 1WKLA 3KYLA 3K5OA 2GIRA 1ITPA 4EUVA 3U27A 3HHLD 3C46A 3TZXA 1XMBA 2RUSA 4DV6J 2H9ZA 5DGAA 3CCTA 2YWFA 1YJUA 2K3IA 2YWKA 1LKZA 1HNXJ 2ACYA 4J9LA 2VASA 4RZRA 2MMYA 3HF5A 3IGVA 3NMRA 5IWAJ 3V6JA 4C8LA 3MCMA 4DV3F 1K73T 4QYZK 1VI7A 3H2VE 2QLJB 3UD4P 5B0BA 3CMQA 1Q8IA 2AP6A 2I38A 1F5CA 2OEMA 3C16B 2GFFA 4OYBA 4JI8F 1VQKS 2X3DA 3ENWA 2V63A 1H2VZ 1VHIA 4M63A 4AFFA 2HHHJ 1BHNA 2XTJP 2QSFA 2JLGA 3R1LA 2HRYA 4NEZA 2V2ZA 2CQ4A 1S5ZA 4IQMA 1RT3A 3J7YI 4FXWA 2HNDB 4WWSA 4WIIA 4Q2MA 1U26A 4QJVA 3CW2C 2VZ9A 3OVSA 4LIRA 4X62F 2XMWA 3G9CA 4DR1F 4GVLA 3RB4A 2YKNB 2BKOA 4CO0A 3FEYB 1KQKA 4ZLJA 3G82A 3HXMA 2X1GA 3M8QB 2DB1A 2W8LA 2VIHA 3IBWA 3L7OA 4CDIA 4ECVA 4ED6A 4JI6J 3RB6A 1M5SA 3DMJA 3DOLA 1S10A 4IR1A 1PIEA 3CCZA 2GVDA 1WC1A 5ETSA 3CCES 3E01B 2XCPA 1IKWA 4IOAQ 1M5PC 2AMCB 4L76A 4B3OA 1NJWA 3T5KA 2V2VA 3HZEA 3GIMA 2ZVSA 2XC9A 3OR2A 5HROB 3NS6A 1RWWB 2E7XA 3QWUA 4I67A 1AUSL 5LSLA 3EE3A 2NREA 1RT6B 4ZMMA 2W9BA 1Y4ZB 2OJ3A 3P4UB 4M8LA 5HBMA 3TVZA 2EFPA 5MLCV 2L9NA 4X66F 4C11B 1X9MA 2Z2LA 2E5GA 1S6QA 2ZZTA 2HHUA 4C98A 1C1BA 2OFGX 3L3CA 3MM8A 4F26A 3M05A 2XB2D 4ECWA 2A6OA 3DU6A 4HHUA 4ZVHA 2GVZB 1UCNA 2FHKA 2EFVA 1VMBA 2CRLA 3VALA 3O44A 2VONA 2PMHA 4ZPBA 1LWCB 2X1AA 3KOAA 2QLFB 1VC0A 2HBYB 3IAM9 1SC1B 4HACB 4NCGA 3SQOP 1UFKA 4PR6A 3X1LB 1FX4A 1RT2B 3MM8B 3PRDA 1RU2A 1WOSA 3QAEA 3LAMA 3MMBB 4S0MA 3IO1A 5JVGQ 4WKRA 3AD7C 4D3HA 1S1WB 2N4CA 3FQLA 5E7OB 4DPYA 2IA6A 1WEXA 1NKCA 2QJ3A 3CD7A 3KDOA 4ZPCA 4DQPA 4U8YA 1MWYA 1WG5A 1Q1KA 2CVEA 2P5VA 5L1JA 4EZ6A 3D1QA 2HHSA 4QWAA 1I3OB 1N48A 1IR2A 2OD4A 1KFDA 3L7PA 4W4MA 8RUCA 2N82B 1R0AB 3KXDA 5MAOA 3CC4S 5KG0A 2F5GA 2R9LA 5CD4A 2BJ9A 2MLXA 2YKQA 3D3BJ 3H42A 2CQ3A 4TVAB 4C3KA 1IBLF 2GAGC 3KFWX 4C3LA 3THVA 2ZZMA 3IXQA 3GIIA 2PC6A 4EBDA 1QE1B 4PPZA 5LOQA 3SCIE 1FK9B 3SCJE 5L9NA 1Y5LB 2BM1A 2IM3A 4LUBA 1NHVA 2ADCA 3NMAA 2YKNA 1R3NA 3CB4A 2FLPA 3CMES 3OQ2A 1PG5B 4G1QB 5K9FA 5AT1B 2VDHA 3HHLC 1YSJA 4DUZF 1KC8T 4MKYA 1PJ5A 3OL7A 2HNDA 3PHTA 3DYAA 3M8PB 2QLWA 5ETLA 1NK6A 2EC2A 4FKYA 2W4CA 2XBPA 2D3UA 3H5YA 5I42A 1C0TA 3GJQB 4H4MA 4IDKB 1S4FA 1N5QA 1RT1A 2H48B 4LF7J 4ZVFA 5EWEA 1FK9A 3PTWA 5FDLA 3K8WA 1AT1B 3KLIA 4WFZA 4B17A 3CCVS 1HD1A 4PG8A 4RO0A 3GYNA 1A6LA 3CC2S 5E33A 3PXGa 4OJGA 3W63A 4CT8A 6FD1A 2BJ3A 1Y0HA 2CQGA 2EG1A 2J9DA 4Y65A 5T7LA 4URGA 1SL2A 3AHPA 1YKWA 3SV4A 1UP1A 3V4MA 2EG2A 7FDRA 2L9DA 1K8AT 2I5JB 3IR7B 2POKA 1RAJA 2K7KA 2FLOA 2P9CA 1LNQA 3QJJA 2UVRA 4I6YA 5CD4H 1UJ5A 2OEKA 3I6PA 2ZH9A 5LMUF 3BGUA 2ZUAA 4RNFA 3OTCA 2F40A 5E2QA 2GMJA 3IRWP 4BS2A 4F50A 2HFVA 3DXBA 2EKNA 5C42B 1U1OA 3O6QA 3B4DA 1WC0A 3VGTA 1QSYA 3V4IB 3KK2B 2FDNA 4YHHF 3T1YF 1RHKB 2RKIA 1VQNS 4WU3A 2M8DB 2QFJA 5CYQA 3W9HA 5IT0A 4J9KA 3CE8A 5KFCA 3PX4A 3NGRA 4ED1A 2QYCA 1SV5A 4KTQA 1IBCB 4YHHJ 2NXCA 4U7UK 5J2NB 4YR3A 4FF2A 5KG1A 2UU9F 1J5OB 1IBKF 3NL0A 4OX9J 1HNZJ 5KFYA 4M5DA 3UI3A 3GU0A 1AROP 1VJWA 2ZD1A 1RTZA 2DVIA 3KMQA 5ETVA 5EX0A 1NJXA 2MPUA 2EFQA 1KHWA 1ZBTA 4LBIA 4DV5F 2B3TB 2FGOA 3OR1A 1YLXA 3W66A 1FKOA 1TMJA 4O4RA 4OZ0A 4LF6J 4K59A 4TKTA 3CXCR 1SC3B 5FLXU 2C2EA 1R8BA 2HNZA 1VQOS 4ED5A 2YKMB 1NKEA 5KFZA 4QR0A 1XQIA 1DTTA 4NLRA 3OJUA 3R5CA 1HBMB 2IYIA 1YZ6A 1VC5A 2ZJPQ 5CQGA 3OHAA 3OUYA 1GXTA 2GHPA 1KVJA 2XMAA 1VQ8S 1HBUB 3RAQA 1UVNA 4X4UA 3US5A 4QPXA 1QUPA 2BM0A 3M9OB 3R7SB 3BSNA 4OI3A 1HIYA 4K4VA 3G4SS 1WUUA 4KSEB 4QIWD 2QIFA 2J0WA 1YI2S 2HBZB 1ZETA 4RW7A 5B08A 2IM1A 3MEDA 4NLTA 2AGPA 1HKAA 1T0TV 4NCBA 1K0VA 1YTYA 3DRRA 4PG5A 1Q8LA 2C2KB 3CJQA 1T3OA 3L09A 1U1MA 2DXFA 4ZPVR 2YTCA 3R5BA 2AKWB 1KQSR 1FFGB 1XIQA 2FHJD 3HX9A 3QO9B 1PCAA 1UJ4A 3D1HA 3FRZA 3LF0A 1J5OA 3E8OA 4OZ2A 1TKXA 4CCHA 2VB6A 1N33J 4R0EA 2UUWA 4HI2A 5SZTA 4K4WA 1NSAA 4A8QA 4IRCA 1HA1A 3BSAA 3GMGA 2B43A 2GS8A 3QAUA 5M2RA 1S6PB 3J81U 1UVJA 3ZO7A 5L1LA 2LMIA 3MEDB 3CDWA 1FDNA 4KPCA 3F41A 5KFAA 4USWA 3W2VB 1H98A 5KFKA 4B02A 1IKVA 5D15A 2DCUB 3CEDA 3WHIA 2HG4A 3NCRA 4H4KC 4CO4A 1ZTTA 4WE1A 2OTLS 3QRQA 2R8GA 2E7WA 3HHDA 5L38A 1KSPA 3MM7B 3QGPA 4QW9A 3N6LA 1S1UB 3AD8C 3TJ9A 3D3CJ 5HP1B 2JFDA 4ECSA 1GT8A 1F9HA 1WACA 4F0MA 2IHR1 2V4JA 2FZKB 2BOAA 4A4JA 4DDFA 1RT6A 2OP5A 1VGYA 4XAKA 5H9FK 2HHXA 1XMQJ 2K2PA 1ZPVA 2IRUA 3OR2B 5HROA 1RHMB 1CULB 5DQHA 5A76A 1RAEB 4RBUA 3AD9C 2GV1A 2MSTA 3VF0B 3W1YC 3HSJA 4DFKA 3KTQA 1RU1A 1RLCL 5KFBA 2DTJA 3IR6B 3G96A 2C3YA 4DOZA 1HWLA 1SUQB 2NXNA 3MMCB 5D0HA 4RUHA 4DL7A 2M88A 3K7RA 1NJIT 1HL6A 2HZCA 4WFAQ 1JQGA 1JLFB 1VCTA 4WFBQ 1FT8A 1XR7A 4O3QA 3M1VA 1RT4A 2M70A 2KHDA 3PVXA 1VQ9S 1OYEA 2JEJA 1JJHA 1RTJA 1QTMA 4DCJB 4AXJA 2QG9B 1RXOB 3DRPB 5KFIA 3Q8RB 4GC7A 2YWWA 4QCLA 4X84A 3DLEA 2E44A 3FJ2A 1FDAA 4R8UA 4ITSA 4DQIA 2W2NP 3OFHA 2COLA 2MGZB 1S9GA 4DV1F 4C7QA 1B64A 4OX7A 3BPDA 2DGWA 2XMUA 3IFEA 2BJ8A 5L46A 4DN9A 5H9EK 1YJNS 1I6JA 2A18A 4CH7A 5K8MA 4DL3A 3QT8A 3ENAA 5EN1A 3M2VA 4FNHA 4OZJA 3TP2A 1M5HA 2EPIA 3O5TB 2DHXA 4JBCA 5H9EJ 4CLKA 4FYYB 3H5XA 1NUEA 2R42A 3UCUP 3AODA 1TAQA 4WBFA 1NB2A 1UVIA 5CYJA 2IVFB 2VL1A 2GJIA 2JJ4D 2OPQB 1TL5A 2YY3A 2VPZB 3Q24A 5KG5A 1EHWA 5HN0A 2AIRB 3K57A 2FPHX 4M5MA 3W61A 4YS2A 3FGVA 1RZMA 2HWIA 3DDIA 5BYQA 4TU7A 3DC2A 1X4FA 3OXFA 2WVDA 4OYPA 1KTVA 3DLJA 4LJMA 1D8YA 4BDPA 2I2YA 3LP0A 5HMYA 3I87A 2VD3A 3EVWA 5E3RA 4M95A 1FRJA 4DR7J 1KR4A 2LEAA 2XNQA 3NXZA 1Q7YT 4V19X 4MAKA 1BC6A 2BQUA 1JLQB 1MLAA 3GSIA 3Q23A 3MR6A 5LMUJ 3JQKA 2DXEA 3H2UB 3EGVA 4NLUA 4Y6IA 3D68A 1U2CA 5B0EA 4GVBA 2DRBA 2W25A 2HK3A 1REGX 1M90T 2CADA 4IKAA 5G0RB 3RR7A 2PFFB 2FYXA 4LT6A 3BH7B 2V50A 2C2ZB 3DGPA 4NYOA 3TAMB 1Q0NA 1N5YB 1KDNA 3KHRA 4DV2F 4QQBA 4EBCA 3DRYA 2HNZB 4EFAC 3T6BA 3NGUA 1NK5A 3FSXA 3DLEB 3HFZB 1RTDA 2DITA 4BHQA 1C4CA 2YQ3A 1X4EA 3R5AA 1XK8A 4PWWA 4ZP9A 5F8GA 1IJFB 3CIMA 4JYAJ 4J9OA 5E3PA 4GO7X 4NLXA 2B9EA 3OR1B 4C0HA 4QWCA 3HPOA 1TKDA 4F36A 3O3LA 1XJWB 3UDVA 3VAMA 1VQ7S 4G65A 4O3OA 4JI2J 2ROGA 4DG1B 1OO0B 1ZM9A 2RF2B 2XEXA 1KWMA 2EI5A 2ZKTA 3TZWA 1T03B 3MEEB 1N32F 2DRAA 1S0MA 2APOA 4H4OB 2QMWA 3AB2B 3OT9A 4RL1A 4JI2F 1GXUA 1S99A 3FEZA 3N6MA 3U1NA 3PRBA 3AA9A 1VQMS 2HMIA 5F9NA 3ZXWA 1UFWA 3L7UA 1VFJA 1KBRA 2Q79A 2HWTA 4FP9A 3V6HA 2CNOB 1E6VA 4KFBB 4RNMA 4YR2A 2L41A 4NZ7A 1D9AA 4FXVA 2NZ4A 1JLBA 1LWCA 4KIAA 2FZCB 2V8HA 3DFEA 2W9CB 2PMWA 2CQ0A 4ED3A 1J5EF 3R7BB 1FJGF 1LFPA 3V2UC 2ZBIA 2U2FA 4PWDB 1RKIA 4G3IA 3L4BC 4HT5A 3RBZA 1MWQA 1FRIA 1MROA 1HW8A 1HHQA 3BGFA 1M0SA 5HJYA 4F7VA 1JLCB 3KUHA 1WJ9A
chains in the Genus database with same CATH topology
2XYHB 4ZVSB 5K20B 2Y0BB 3NS7B 4DCOB 3IBFB 4ZVUB 4DCJB 3RJMB 1QDUB 3R5JB 1RHKB 3KJFB 2HBRB 1IBCB 3EDQB 3D6HB 3IBCB 2H4WB 3P45B 1RHUB 4ZVRB 1RHJB 2XYPB 1RWWB 2QLBB 2C1EB 2QL9B 1RWVB 1SC4B 2XZDB 3P4UB 2FQQB 1SC3B 3D6FB 3GJSB 4ZVPB 3GJRB 1RWXB 2XYGB 1RHQB 4ZVTB 3R6LB 2H65B 2QLFB 2HBYB 1QTNB 3GJTB 1SC1B 3R6GB 2C2MB 3R7SB 2H51B 2HBZB 3D6MB 1I51B 4JB8B 2HBQB 3R7NB 2C2ZB 2C2KB 2CDRB 1F9EB 4ZVQB 2C2OB 2H4YB 1PYOB 1I3OB 1RWKB 2CJXB 4LSZB 2CNKB 2CNLB 1RHRB 1GFWB 1RWPB 3KJQB 2XZTB 2DKOB 2CJYB 2CNNB 2QL7B 1BMQB 2P2CB 2H5JB 2QL5B 5IC4B 1RWNB 1NMEB 2H5IB 3EDRB 4DCPB 2CNOB 3GJQB 3SIPB 3QNWB 2H48B 2Y1LB 1ICEB 1RHMB 2H54B 3R7BB 1RWOB 2QLJB 4ZVOB 1PAUB 3KJNB 5IC6B 1RE1B 1RWMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XYH B;  4ZVS B;  5K20 B;  2Y0B B;  3NS7 B;  4DCO B;  3IBF B;  4ZVU B;  4DCJ B;  3RJM B;  1QDU B;  3R5J B;  1RHK B;  3KJF B;  2HBR B;  1IBC B;  3EDQ B;  3D6H B;  3IBC B;  2H4W B;  3P45 B;  1RHU B;  4ZVR B;  1RHJ B;  2XYP B;  1RWW B;  2QLB B;  2C1E B;  2QL9 B;  1RWV B;  1SC4 B;  2XZD B;  3P4U B;  2FQQ B;  1SC3 B;  3D6F B;  3GJS B;  4ZVP B;  3GJR B;  1RWX B;  2XYG B;  1RHQ B;  4ZVT B;  3R6L B;  2H65 B;  2QLF B;  2HBY B;  1QTN B;  3GJT B;  1SC1 B;  3R6G B;  2C2M B;  3R7S B;  2H51 B;  2HBZ B;  3D6M B;  1I51 B;  4JB8 B;  2HBQ B;  3R7N B;  2C2Z B;  2C2K B;  2CDR B;  1F9E B;  4ZVQ B;  2C2O B;  2H4Y B;  1PYO B;  1I3O B;  1RWK B;  2CJX B;  4LSZ B;  2CNK B;  2CNL B;  1RHR B;  1GFW B;  1RWP B;  3KJQ B;  2XZT B;  2DKO B;  2CJY B;  2CNN B;  2QL7 B;  1BMQ B;  2P2C B;  2H5J B;  2QL5 B;  5IC4 B;  1RWN B;  1NME B;  2H5I B;  3EDR B;  4DCP B;  2CNO B;  3GJQ B;  3SIP B;  3QNW B;  2H48 B;  2Y1L B;  1ICE B;  1RHM B;  2H54 B;  3R7B B;  1RWO B;  2QLJ B;  4ZVO B;  1PAU B;  3KJN B;  5IC6 B;  1RE1 B;  1RWM B; 
#chains in the Genus database with same CATH topology
 3MEE A;  4CO5 A;  1KOO A;  3G8T A;  5HAO A;  4ZVS B;  2F9J A;  4WP8 A;  4RW8 B;  5KT5 A;  4DPU A;  4B9N A;  1U8W A;  3EGN A;  2BAN B;  5F9L A;  2E66 A;  3V81 B;  3Q86 A;  4J9S A;  3RYL A;  4CO1 A;  4MFB B;  2V68 A;  3EMT A;  5DLG A;  2FB0 A;  2HQC A;  2RML A;  2W2O P;  4Y0F A;  1TL7 A;  4NLV A;  3QZ7 A;  3MTK A;  3ZNJ 1;  3CDA A;  2KM8 B;  2E1C A;  1T11 A;  1N6Q B;  3KJF B;  4KR0 B;  1ROF A;  5KG3 A;  4DQR A;  1I94 F;  3FNN A;  3PKY A;  3EVM A;  2CQI A;  4C6A A;  4C0O C;  3JXO A;  2R8H A;  4TNO A;  4L3N A;  2QYG A;  4G1I A;  1O8B A;  2VOP A;  5L1I A;  2ZH2 A;  4DMZ A;  1CJT A;  2ASD A;  1N36 J;  3QRP A;  4CNZ A;  1RHU B;  3SQG A;  2HQF A;  2MHN A;  4AL6 A;  2CPF A;  1V3R A;  3QLH B;  4KGX B;  1WF1 A;  2DHG A;  3UQS A;  1VQY A;  5HI7 A;  4P74 A;  4ZHR A;  4JI7 J;  1R8C A;  3CWJ A;  4TQR A;  4Y2A A;  1FKA F;  2XZD B;  4F2R A;  1XC9 A;  1JMT A;  2G2Z A;  4U67 Q;  3ISN C;  3BGR B;  2HQD A;  3OVA A;  3LP0 B;  2NUH A;  1E6Y A;  1LQ9 A;  1O51 A;  3AQO A;  2R7V A;  1S9E A;  2RSQ A;  5IQ6 A;  2OML A;  1LK7 A;  3CF5 Q;  5D4L A;  1H3D A;  4WTO B;  2ZNY A;  4WE1 B;  4FS2 A;  2DO4 A;  1FNO A;  3T5L A;  2WSC C;  3R6L B;  4CIO A;  4MYU A;  1RAI B;  2RHS B;  3CJ2 A;  3W2V A;  4EBE A;  4NA1 A;  2VIC A;  1PC4 A;  4K4Z A;  1FWK A;  2PN6 A;  5GAE U;  2FC8 A;  3TAP A;  5BR8 F;  3SSS A;  4DFJ A;  8ATC B;  1VS3 A;  3BQ0 A;  2ZUG A;  3ZZT A;  5KFM A;  5KT2 A;  4UF4 A;  5DQG A;  5KFS A;  3RBX A;  3MM6 B;  5F8L A;  4ZN1 A;  4JI4 J;  1HI8 A;  1R43 A;  2RU3 A;  4DV6 F;  2MKC A;  4LSL B;  2JEG A;  2VFR A;  1CC7 A;  2HQ3 A;  3NNH A;  4LF1 A;  1K0T A;  4F4Z A;  4PXD A;  1YDL A;  2DNR A;  5AXL A;  4DSF A;  1FRH A;  4PWU A;  2HVI A;  4IO1 A;  2KZM A;  3CJ8 A;  3H20 A;  1C1B B;  2K8G A;  4QWB A;  2AYB A;  1NLK L;  5ETT A;  2VQE J;  1WDT A;  5A8R A;  1GH8 A;  3HKZ D;  4IFV B;  3D0G E;  4K8R A;  5DDQ C;  4WZM A;  1S49 A;  4DG1 A;  3KJQ B;  2XLI A;  4ZLP A;  4K0K F;  3FRY A;  3BQ2 A;  1MMD A;  4AE5 A;  3CCL S;  1NZ8 A;  3DM2 B;  3LW5 C;  3PYE A;  1DTT B;  1L3K A;  1WF2 A;  2M0G B;  4MIB A;  3TZZ A;  4B3S J;  1SI9 A;  2QX0 A;  1ZM4 A;  3ICL A;  2JLE A;  3W2W A;  2ADB A;  1RBA A;  1LW2 A;  2AEM A;  2CPJ A;  2FJA B;  3H25 A;  4TXS A;  1UWB B;  3MFI A;  3MCO A;  4LBH A;  3OFF A;  4NZ6 A;  2ZC3 A;  4X4V A;  2V4R A;  1EET A;  1FRL A;  5A8K A;  1Q86 T;  5J2Q A;  5AE3 A;  2AGO A;  2OUG A;  1YZ7 A;  2DNL A;  3KHH A;  4NYZ A;  4IDK A;  3J81 Y;  2AJ4 A;  3J7Z T;  1OWX A;  2YPY A;  1T9V A;  3M7V A;  1RWO B;  3OL6 A;  4FDF A;  3J7Z 5;  2MQL A;  2VC0 A;  3QSI A;  4F04 B;  1YIJ S;  2ZH6 A;  4JI7 F;  4PUO A;  2KN4 A;  2VFV A;  5DZ7 A;  3MM5 B;  1YRU A;  3I0R A;  3H4B A;  3MM9 A;  3CJ5 A;  4DR4 J;  3SQG B;  3T3F A;  1D3W A;  5ADZ A;  3I31 A;  3OFE A;  3K0J A;  1UPP A;  1Y7P A;  1OJ4 A;  2LP4 A;  4ZDN A;  3VZH A;  1BQM B;  3C3L A;  1UKU A;  2DGV A;  1FVS A;  1MNE A;  4ES1 A;  2MKY A;  2V2K A;  4DCO B;  4U95 A;  2MKI A;  3V81 A;  1M5V C;  2Q66 A;  1ZS6 A;  2GJF A;  2MZT A;  4UUW A;  4NAS A;  4USU A;  4ELV A;  5EUH A;  1XNR F;  1U4B A;  2AZ3 A;  4PEO A;  3J7A 1;  1R0A A;  1NSP A;  2YWE A;  3HFK A;  3S1T A;  3HVT A;  5BR8 J;  1KVI A;  1F1B B;  4WXO A;  1P9Y A;  3P5T L;  4C8O A;  3JSM A;  3IBC B;  3RZA A;  5F8I A;  5LT5 A;  4BC9 A;  3OBI A;  4USV A;  1S0V A;  1MMN A;  1RAH B;  2JSX A;  4ZVG A;  1UL3 A;  1JLC A;  2MY7 A;  2JZ5 A;  3D5M A;  1EX8 A;  4KGK A;  4PYD A;  5JXS A;  5KFU A;  2VUG A;  4A48 A;  4CLZ A;  4GKJ F;  4YB7 A;  2RQ4 A;  2VF3 A;  4A8O A;  2BQ3 A;  1RTI B;  4ZN3 A;  5EX3 A;  2MQQ A;  4X4S A;  1SXL A;  4LRD A;  1XBW A;  5RUB A;  2FIU A;  5GMK a;  1X4B A;  2LU2 A;  1NKB A;  2G1D A;  2Z0G A;  3ISZ A;  5L39 A;  1HI1 A;  1F3V A;  1RHQ B;  4MK9 A;  3UD5 A;  4CLF A;  3HP6 A;  2W9A A;  2VJU A;  3RW6 A;  2J9C A;  4IOB A;  1FXD A;  3QMQ A;  2H65 B;  3LAN A;  2F8M A;  4OI4 A;  4RW4 B;  2O5D A;  3PEH A;  5KFR A;  3M8R A;  3C15 B;  5IM0 A;  2IPO B;  3HHL A;  1HPZ A;  3UCZ P;  1U6Z A;  4KHR A;  1UAW A;  1UJ6 A;  3M1V B;  3U02 A;  4HVZ A;  1CVJ A;  3DI6 A;  3JSR A;  2V67 A;  1S4E A;  2Y8Y A;  2MZS A;  1F5A A;  4QW8 A;  1CS4 B;  5EHH A;  2M2B A;  3ITH A;  5ETK A;  1WF0 A;  1WOR A;  2V8G A;  2A0F B;  4MK8 A;  2RB7 A;  3QQC D;  2XHW A;  3HD1 A;  1AZS A;  4L3K A;  2IA0 A;  3RBE A;  1TL4 A;  4LF7 F;  4P10 A;  3JQJ A;  4F4A A;  2AV5 A;  2WW8 A;  2CDR B;  2UUC J;  2V9K A;  5CYQ B;  3A1Y G;  2J7U A;  2JC1 A;  2WB4 A;  2FLL A;  3EZ5 A;  1HMV B;  3G82 B;  2W24 A;  3PJ9 A;  1IKY A;  1GK8 A;  4O4G B;  4F0K A;  3EPI A;  3JAM U;  2J6T A;  1ZZN A;  4LR8 A;  1VRU A;  2IJR A;  3BSC A;  3Q2S C;  4Y00 A;  4NCG B;  9RUB A;  4J9M A;  4ERD A;  4C97 A;  5HL7 Q;  4ANC A;  1VRQ C;  2WK4 A;  1RT7 B;  2UXC F;  1NPK A;  1S6P A;  3AJ2 A;  3FSY A;  4QIF A;  2ATL A;  1R8P A;  1VQ5 S;  1W26 A;  3A12 A;  3BKT A;  5CYM B;  2MZR A;  2ZHB A;  2HS4 A;  1TFY A;  2XQC A;  2XS7 A;  3NWR A;  6FDR A;  4IG0 B;  1B99 A;  3KLV A;  2KH9 A;  1T7P A;  4GRS A;  2J9E A;  4FVC A;  1DUR A;  5DG7 A;  2E1A A;  3DOM A;  1R27 B;  4L75 A;  2XSF A;  2KYX A;  4LSL A;  2XY7 A;  3OXL A;  1YJ9 S;  1S7H A;  1RUS A;  2KVI A;  1FA0 A;  3B82 A;  2ZFH A;  1GTE A;  3SIP B;  1BQM A;  3EVO A;  3NGT A;  4FZV A;  4ZCK A;  2KFN A;  4IG0 A;  2J76 E;  2YQ0 A;  4ZA1 A;  3ZZP A;  5J2P B;  3PIO Q;  2VKR A;  2IMW P;  1HNZ F;  2ASL A;  5CYM A;  4OJ3 A;  3C6U B;  3GG0 A;  2W2M P;  1PAU B;  1SQE A;  4J9P A;  2NXE A;  1REV A;  3K5L A;  4DV3 J;  2CPD A;  3TUI C;  1HBN B;  1WHY A;  2C3P A;  2C28 A;  4LFA F;  4PG6 A;  2MKS A;  1UVM A;  2BJD A;  2OEJ A;  2YNF B;  4ZP8 A;  1SJR A;  4KH0 B;  1C1C B;  2FJV A;  3S7R A;  4N56 A;  2AYG A;  1YJ7 A;  3M8Q A;  3NBP B;  1S1T A;  2HLT A;  1B7F A;  1AXQ A;  2HKE A;  2IC3 A;  4P7T A;  4KKO B;  4FBU A;  4DV1 J;  4YDX A;  2PT0 A;  4OV1 A;  5CXT A;  3CO0 P;  1S48 A;  1TZ0 A;  3KG4 A;  4CLU A;  3I5A A;  4I69 A;  1REV B;  4HH1 A;  1D0E A;  4QIE A;  4NLD A;  5CZX A;  1FWP A;  2Y9H A;  2XMJ A;  3MPD A;  4DR1 J;  2YKM A;  3EZU A;  3X3U A;  3DM2 A;  4RNO A;  2WB1 D;  1UA0 A;  1IBM J;  1CS4 A;  4DSE A;  4ZIV A;  3VAH A;  2KT3 A;  5B0G A;  1B4S A;  3D6H B;  3W7B A;  2XNR A;  3U1L A;  5B0F A;  1FX2 A;  1R0C B;  1K9M T;  1S1W A;  1LFW A;  2HFO A;  4TYB A;  4RW6 A;  4HKQ A;  4P2F A;  4AQY J;  1SJ1 A;  3FC9 A;  3FUY A;  2E5I A;  3HHL B;  2XUL A;  4ZCI A;  4YN3 B;  2BV3 A;  3RBD A;  3N28 A;  1N34 F;  4DBQ A;  1NDK A;  3SYZ A;  1LWF B;  3PFO A;  2HHV A;  5J1P A;  4USJ C;  5K8P A;  3QRR A;  2MZJ A;  2QA4 G;  1YJV A;  4ID5 A;  1N34 J;  2IAJ B;  4U7U D;  3I5B A;  4OX9 F;  3KK3 B;  3V4I A;  1LXJ A;  4WK1 A;  5K8O A;  2ZHA A;  3DDN A;  4RU2 A;  3PNI A;  2YH0 A;  1VBZ A;  1P27 B;  2MEW A;  4DUY J;  3Q8Q B;  4PZV A;  4ZVT B;  1C0U A;  2RHQ B;  2Z2M A;  2HYI B;  5IT9 Y;  4PRF A;  4DL0 C;  3KLG B;  2XSJ B;  4J9N A;  5I3U A;  1FJC A;  4YME A;  1RA7 A;  3TO8 A;  2P9E A;  5J2M B;  2JEI A;  2V8D A;  3PHE A;  2IBK A;  5LM7 E;  3I9Z A;  2VG5 B;  4BBY A;  2NQP A;  1VQP S;  3VWS A;  4QPT A;  2BBE A;  2LFV A;  4RBV A;  3TJ8 A;  3TUZ C;  2RS2 A;  2ROE A;  2MKK A;  3W62 A;  2FD2 A;  1S9F A;  1QUV A;  2YX1 A;  1IBK J;  2I5J A;  3D66 A;  2ZC4 A;  4PG7 A;  1SKR A;  1RTJ B;  5KG7 A;  1P6T A;  2NYH A;  2LKZ A;  3CJK A;  4GO5 X;  5B0C A;  1U2R A;  1X9W A;  4JI1 F;  1LEO A;  2HBQ B;  5EGY A;  3D7S B;  3HO1 A;  3LTO A;  4ED2 A;  3VZI A;  4CH0 S;  4JYA F;  3MTJ A;  1MG7 A;  2YWG A;  3ZZZ A;  1EQM A;  2KG1 A;  4J9R A;  2UVW A;  3HI9 A;  3A4T A;  4ZJL A;  5GAD I;  1WEY A;  4NL5 A;  2QT7 A;  1EIY B;  3TX0 A;  2EBE A;  1A9N B;  3PW4 A;  4IRK A;  1TTH B;  3B6B A;  1JJ4 A;  3MHY A;  4YDD B;  2CPZ A;  5F41 A;  1DQ9 A;  1DZ5 A;  3MM5 A;  4CZC A;  3J80 Y;  3Q8S B;  1HAR A;  4I1T A;  5LJ5 Y;  4QIG A;  4UOF A;  1ZAV A;  4Q0B A;  2ERR A;  5KTQ A;  4FN5 A;  2GX8 A;  2ZH8 A;  2XZW A;  5C24 B;  3DRS B;  4LSN A;  2BXJ A;  2DNO A;  5GAG U;  1N0U A;  2K1R B;  2QL5 B;  1EAR A;  4MYT A;  4Q0B B;  2AX1 A;  1Q8K A;  4CTA B;  1WEL A;  1JXL A;  1JKH B;  2Q6C A;  4P72 A;  2Y1R I;  1LW2 B;  3NCQ A;  3S8S A;  3ZC4 A;  5HMW A;  1TFW A;  2B9W A;  1HD0 A;  1GXL A;  3QNW B;  2QLX A;  2RIL A;  4OYA A;  3D28 A;  2EVZ A;  4F3O A;  4P75 A;  4OYX A;  3D54 A;  4CLP A;  1JLE B;  1IBL J;  2PII A;  2EFG A;  5GVQ A;  3WQP A;  1FJ7 A;  2M8H A;  1JLQ A;  4OHV A;  2I6W A;  2A2C A;  5CAA A;  5E3Q A;  5HSP A;  2JVO A;  2AD9 A;  2DEJ A;  3BYP A;  1Y3J A;  4XK8 C;  2GAH C;  1RWM B;  2MQM A;  2EK6 A;  4IFV A;  3W8P A;  4X4O A;  2KXH A;  1VDH A;  3LUY A;  3TVY A;  2KDO A;  2Z56 B;  1GMW A;  3G6X A;  3ILJ A;  5AXM A;  5IV3 A;  1NO8 A;  3DLG A;  1AA1 B;  3D4J A;  4KYZ A;  4PAB A;  3A3O B;  1RT2 A;  2D74 B;  4QR2 A;  1U1L A;  4ZVE A;  4NLG A;  4RW9 A;  1WOP A;  3TI0 A;  4OV6 A;  1S97 A;  5T41 A;  2N4D A;  2LVW A;  4HAC A;  3AXK A;  1U48 A;  4LR9 A;  4ZVU B;  4K2X A;  3UDE A;  1X60 A;  2OPQ A;  3GPA A;  5J1E B;  1S0N A;  2BRK A;  2I9S A;  2RDI A;  5IZH A;  3BF4 A;  2XGP A;  4YFU A;  3BB5 A;  2HGL A;  1WTB A;  3HK2 A;  5KAK A;  3KLH B;  3P3D A;  3D0H E;  3MEC A;  2VHG A;  4NX9 A;  2UVV A;  2GO9 A;  2HAF A;  3PJX A;  2R8I A;  3T9N A;  1H2T Z;  1FES A;  4MKV A;  4I2P B;  2DNM A;  4ID5 B;  3PR4 A;  2XYP B;  1EKS A;  3KNA A;  4C9D A;  1QM9 A;  1NU4 A;  3TNV A;  2YPZ A;  2R7R A;  1FVQ A;  3L9Z A;  1N8R T;  2OPS A;  2J9D E;  2RRA A;  4AL7 A;  1PKU A;  2DGS A;  2ZH7 A;  4NLY A;  2R3V A;  5D3G B;  4KV8 A;  2ZH5 A;  4P6Q A;  4R0J A;  3K17 A;  1DRZ A;  2CAJ A;  4ES2 A;  2QA2 A;  4Z7C A;  3T41 A;  1S72 S;  1JLA B;  1SBR A;  1DQA A;  3NY0 A;  2AJ2 A;  2R2U A;  3BDP A;  3BQ1 A;  3MMJ A;  2K06 A;  1RAF B;  1GAO A;  1SV5 B;  2V0N A;  4X4T A;  3T1H J;  1Z1Z A;  1I5O B;  3WBZ A;  1WSV A;  5L1K A;  1H0H B;  1TKT A;  2MSS A;  3OJS A;  1X0P A;  2C2M B;  4KHP F;  5FLX Y;  1OY8 A;  2HLU A;  2LU1 A;  2VBX A;  3A3P B;  3O2I A;  4Z7Y A;  1ZH5 A;  3DLK B;  3CJ4 A;  1IWA A;  4F4X A;  3CO9 A;  2DNZ A;  3OTD A;  3ONQ A;  4E0D A;  3AH6 A;  1IN0 A;  1KLM A;  1HNI A;  3BGO P;  5LXR A;  3I55 S;  4DL6 A;  3NP5 A;  1TK5 A;  4ZCL A;  4DSL A;  1HNV A;  1RTI A;  1UEK A;  1HBN A;  2GJ2 A;  4FPR A;  5HK4 A;  1SJ3 P;  3MM7 A;  5HP1 A;  3FDS A;  4A46 A;  4FBT A;  3CJT A;  4JI0 F;  2H4Y B;  3HVT B;  4K2J A;  4DU8 A;  4DV4 F;  4KC5 A;  1P1L A;  3GFH A;  4PKD B;  5D4N A;  4OI2 A;  2AZ1 A;  1WI6 A;  3JSM B;  2HS0 A;  3ETO A;  4I7F A;  4KGV B;  1UVL A;  4DV4 J;  2DT9 A;  2IYG A;  3MOJ B;  3DXS X;  3LA0 A;  2FC9 A;  2M9K A;  5CCM A;  4ICL A;  1SL0 A;  1VLO A;  1Y11 A;  2YX7 A;  1YBT A;  3CDB A;  2UUB J;  1WC5 A;  2V6A A;  4QYR A;  2GQ2 A;  2CG4 A;  4O3P A;  3BR9 A;  3DRS A;  4LSN B;  2XWX A;  3O8W A;  3QGI A;  4PWD A;  1KLM B;  2DNK A;  2IRY A;  3M8Y A;  4IH5 A;  2CNN B;  3C14 B;  4O3N A;  4CLY A;  1YJT A;  3DYA B;  1RSC A;  3M8P A;  4N7T A;  4NPO A;  2B6A B;  2C3U A;  2IVM A;  2HHW A;  2LCW A;  4I6A A;  5IFM A;  2LXU A;  3RGI A;  2R7U A;  5CHC B;  3ZTR A;  2AJQ A;  1NME B;  3CUN A;  4FKX A;  2Y0S D;  2BA9 A;  2H5I B;  4OZN A;  1RAG B;  2Z8Q A;  2HNY B;  2XS2 A;  4OFZ A;  2QA1 A;  5LSO A;  1HNW J;  1OY6 A;  1M1H A;  4R5P B;  4N5S A;  2MQP A;  1S6Q B;  4ZK7 M;  1BE4 A;  2LDI A;  2Y3Y A;  1T9Y A;  3CJS A;  5IS2 A;  3EWG A;  4BWM A;  1OS5 A;  1GEH A;  3CCQ S;  3GIJ A;  1N6Q A;  2W7O A;  2J7W A;  3WDO A;  2IRX A;  4YQW A;  1KHV A;  2ZWP A;  2AHO B;  2DYA A;  1JWW A;  1NDP A;  1MW7 A;  2CG8 A;  2CPE A;  2L48 A;  3TRG A;  3KLE B;  3H5S A;  4GKK F;  1K1Q A;  2LEB A;  5ETR A;  2CQD A;  3MEC B;  3IBF B;  4LMZ A;  1ZAX A;  1N32 J;  1S59 A;  1LK5 A;  3IG1 B;  5J2M A;  4OHX A;  3MMB A;  2E9T A;  2G1H A;  1U24 A;  1S0O A;  2DY9 A;  1HHT P;  1MRO B;  2FLN A;  1R7I A;  3S6E A;  2L9W A;  1SH0 A;  4DL5 A;  3O1L A;  4DR3 J;  2HRT A;  2MLY A;  3EX7 B;  2RIJ A;  1TKZ B;  1NHU A;  1FWL A;  1HQE A;  2B9Y A;  3EDQ B;  1RT3 B;  1URR A;  3HSG A;  4DN0 A;  2E1R A;  3C6U A;  5LSR A;  4GKJ J;  2L08 A;  3GFX A;  3EXY A;  3HMJ G;  4DR3 F;  5JVH Q;  1KS2 A;  1YBU A;  2RJZ A;  5KT4 A;  4QYZ J;  4X4R A;  1LWF A;  1H2U X;  1S6O A;  3ZTS A;  1B0T A;  3A8E A;  3TAR A;  3W8G A;  1G7C B;  4DR5 F;  1NB7 A;  1FCA A;  2VH7 A;  2AEJ A;  2B7C B;  2DO0 A;  1RYS A;  1Z2L A;  2QGF B;  4H4O A;  3OTO F;  1OMS A;  2KRB A;  3MPV A;  4USH A;  5A6P A;  1VQ4 S;  4IRD A;  4JV5 J;  3WX4 A;  2AT1 B;  2CQC A;  3EPG A;  1YQH A;  2RRB A;  3V6K A;  4AUK A;  2ZE2 A;  1T3N A;  1CEZ A;  2XYG B;  1DLO B;  2A2D A;  5KFT A;  4Z2X A;  4X62 J;  4JV5 F;  1UMJ A;  4TY8 A;  5C7P A;  1XEZ A;  4LIW A;  2OPR A;  4LFB J;  3ENQ A;  4JI5 J;  1AYE A;  4EYI B;  1Z4U A;  2IM0 A;  2QE5 A;  1HNI B;  1X4A A;  3MXH P;  4ALZ A;  4LFB F;  1IKX A;  2XCA A;  4LF9 F;  4HDG A;  5KFQ A;  1F2G A;  2PFD A;  4Q2L A;  1E6Y B;  1URN A;  3GCX P;  1EAY C;  2ZHO A;  2SXL A;  2HNY A;  3CNQ P;  3PW0 A;  3RRH A;  2C22 A;  4FF1 A;  2OPP B;  2WBM A;  1CPZ A;  2HWH A;  3AY0 A;  4UT4 A;  3KJV B;  2GML A;  2C3O A;  1LWE A;  4ATN A;  3CCU S;  2D3O R;  3CVK A;  2B6A A;  2DK2 A;  2XG8 A;  2E9Z A;  5U47 A;  3ITH B;  4KB7 A;  2EFN A;  2DR7 A;  4JUZ A;  1TEL A;  1YIT S;  1F5B A;  2OPP A;  1JLF A;  2O1P A;  4MIW A;  4DV7 F;  1U1N A;  4MK7 A;  3M8S A;  3IWN C;  3MD3 A;  5LMN J;  3TQ1 A;  4V19 J;  5AJ3 F;  3H90 A;  2J0X A;  2ZKU A;  1W2I A;  3BZQ A;  5HQL A;  4DFM A;  2UUA J;  2UXC J;  3MMA B;  2KO1 A;  2HQG A;  4PXB A;  4WZQ A;  1NND A;  2FJE B;  2OPS B;  1TR0 A;  4HEA 9;  2DHS A;  3W60 A;  4OHZ A;  4GKK J;  2GO8 A;  1T9W A;  1LOU A;  2XZT B;  3ETM A;  3HUL A;  2XI3 A;  3CC7 S;  3TAN A;  3T5H A;  2ZDP A;  4EI2 A;  4A8K A;  4RNN A;  4CH1 A;  2J7K A;  2R7Q A;  4TY9 A;  2HGN A;  1Q53 A;  2NLW A;  1S77 D;  2ILZ A;  2VFS A;  3FEX B;  3GIR A;  2H5J B;  1Q95 G;  2VBZ A;  2D3Z A;  3QGH A;  3HKW A;  1NSQ A;  3SEO A;  4EO8 A;  4PQU B;  1HNV B;  1KOH A;  1RWN B;  2B7B B;  2HPU A;  4I6W A;  4PYA A;  3UNY A;  1AFJ A;  5A8R B;  2Q1L A;  4ZOS A;  3VVT A;  3GQC A;  2DIV A;  3CD5 A;  2HVD A;  4DZD A;  3PYD A;  1ELO A;  2HIY A;  2G0C A;  3KLG A;  2EFO A;  1FNM A;  3SFG A;  2YNH B;  4TQS A;  1IVZ A;  2JRS A;  2N7Y A;  5IQQ A;  2EEY A;  2P6T A;  2G2Y A;  3IA0 A;  3MUR P;  4ID8 A;  1QVG R;  2ZWO A;  4QWD A;  2KZZ A;  4XDC A;  3UFC X;  1LW0 A;  3G71 S;  1TK0 A;  4NZ0 A;  4UOG A;  1IQZ A;  4LRE A;  5ETQ A;  2YQ1 A;  3NNA A;  3DU5 A;  2CZ4 A;  1KD1 T;  4NYP A;  5HMZ A;  2R7S A;  4JI3 F;  3B4M A;  3GFY A;  3MCS A;  1GX6 A;  3WC2 A;  1X5P A;  4TLQ A;  5DM7 Q;  2FJD B;  2R8J A;  3VQT A;  5KFL A;  4H4M B;  1RCO B;  2NUU G;  2RVJ A;  3TEG A;  4LF2 A;  1EJ7 L;  1WHX A;  4KV8 B;  3Q8P B;  5I42 B;  2OO4 A;  1D09 B;  2XO6 A;  4B3S F;  2WSF C;  2MJN A;  3CCW A;  3TX8 A;  4C11 A;  2LA4 A;  1JJC B;  4JV1 A;  5GAE I;  4CI0 B;  4P2X A;  2W7P A;  3OPK A;  2W9B B;  5DDP C;  3RRK A;  1IM6 A;  3MM9 B;  3DHW C;  4WKY A;  2P6S A;  3DOK B;  3H7H B;  4YY3 F;  5KFV A;  4CTA A;  5I4M A;  3WX8 A;  2HBR B;  2ASJ A;  3SV3 A;  1KRP A;  2PI4 A;  3DCA A;  3TJA A;  4LF9 J;  2CXE A;  1S9E B;  3FBF A;  3WZ0 A;  1NEE A;  2GW8 A;  5KOX A;  2UP1 A;  1ZM3 A;  2DH7 A;  3ENV A;  3HZG A;  3P45 B;  5D77 A;  4LF4 J;  4YY3 J;  4ER8 A;  1RP5 A;  4URQ U;  1HQ2 A;  3LAK A;  5ITH A;  3GV5 B;  3DMJ B;  3DOL B;  2NR0 A;  2Y1I A;  3TAM A;  1J27 A;  1JXE A;  4NEY A;  2QL9 B;  5HVF A;  3A13 A;  1N36 F;  1QJH A;  3UO0 A;  2EC0 A;  2Q43 A;  5G0R A;  3BSO A;  4OL8 A;  2FJX A;  1M1G A;  2UUC F;  1M5K C;  2G13 A;  5F8M A;  3IP0 A;  4DX8 H;  4C8Z A;  2O67 A;  3BS9 A;  4DV7 J;  2ZE2 B;  1YVF A;  5E5N A;  2OSR A;  3D0I E;  3LP1 B;  4WXW A;  1M5O C;  3PKM A;  1VIO A;  3GJS B;  3GJR B;  1CJU A;  1HQU B;  1KQG B;  3POT A;  4OYW A;  4ZVP B;  3LQV A;  4AND A;  5KFW A;  1VBK A;  5ETM A;  4ECX A;  3Q8V A;  4DPT A;  1YK9 A;  4ZKA A;  2RRN A;  1IUJ A;  2FHJ A;  2OH2 A;  2V34 A;  4B3M J;  3QGG A;  2BE7 D;  1NJY A;  3QJP A;  1Q16 B;  2CWX A;  4M94 A;  2B9X A;  2W1B A;  4IO9 Q;  4P52 A;  5DDO C;  1U49 A;  3P8B B;  4NA3 A;  3LOU A;  4M5D B;  5AXK A;  2RDJ A;  3JTN A;  4O0N A;  3UWT A;  1AFI A;  3G8Q A;  2NSC A;  3F0N A;  3LAL A;  2ZH1 A;  3R6G B;  2PEB A;  3TYT A;  3QBC A;  1WHV A;  1JLE A;  4DU7 A;  3EYZ A;  2BR0 A;  1AW0 A;  2DGT A;  4KBI A;  5BJR A;  3PR5 B;  3CCR S;  3RAX A;  1X31 C;  2H5E A;  2JC0 A;  2WVC A;  2XHC A;  3MDF A;  2UXD F;  4L6V 3;  1K44 A;  1HWU A;  2UV8 G;  3D6M B;  4E2F B;  1JKH A;  4YEA A;  3G6E S;  1RT7 A;  1FFW B;  1TU0 B;  1WC6 A;  2EK1 A;  3R8Y A;  3W65 A;  5I3U B;  1V5I B;  4A8S A;  2FJW A;  4JI4 F;  2CJA A;  2DNY A;  3BV8 A;  3C66 A;  3MPY A;  5DRK A;  1PYT A;  2MGZ A;  3E3X A;  4ECT A;  3HVA A;  3IC1 A;  4UZC A;  3SDE A;  4JI8 J;  3HT0 A;  5KFH A;  1T8E A;  1AZS B;  2LQ9 A;  3NS5 A;  3IAS 9;  2CNK B;  4LFA J;  3KK3 A;  2Y1J A;  1RHR B;  1QD1 A;  3BYR A;  4Y3C A;  4ZP6 A;  2V69 A;  3DLH A;  3UN3 A;  2FY8 A;  1GFW B;  1DAR A;  2CUY A;  4ZPW R;  3VV2 B;  4I2Q A;  4R8U B;  2ABY A;  3W2W B;  3BJY A;  3NOG A;  2G0I A;  3I0S B;  3HM9 A;  1HR0 F;  3MPW A;  1FEE A;  4RJV A;  2VQE F;  3T9Z A;  1T94 A;  4OZ3 A;  1AB8 A;  4HDH A;  4DZ6 A;  2OI2 A;  3BBF A;  4IQX A;  5A8W B;  3KK1 B;  1CJK B;  2FZG B;  2O01 C;  2P2C B;  4CRJ A;  2DGO A;  4OZL A;  1RYR A;  4P7V A;  5KFJ A;  1WOO A;  3ELH A;  2IJN A;  4LBP A;  5I3P A;  5E3C A;  3ZFV A;  2Y1L B;  1NK8 A;  1U7L A;  3I0S A;  1NSK L;  2E5H A;  4DXL A;  3MAQ A;  2H54 B;  3IWL A;  5CH7 B;  4CM2 A;  1G3O A;  3VCD A;  4LF8 J;  4KKO A;  1R6Y A;  3JYT A;  1CUL A;  1NH7 A;  3ZZR A;  2O66 A;  2PGC A;  4I2P A;  2YVS A;  3ET6 B;  4A8Y A;  3MR2 A;  3Q89 A;  4DS4 A;  4NA2 A;  1YHQ S;  1DJ0 A;  3N0V A;  4NLP A;  1N56 A;  1NHK L;  2ACM A;  3BGL A;  4OQJ A;  4JI1 J;  2VBW A;  2M4M A;  3TA2 A;  3ZZ0 A;  3CUL A;  2V4J B;  3TWZ A;  3RR8 A;  1QSS A;  2XM3 A;  2R7X A;  2GZO A;  2G0J A;  2DNG A;  4IG3 B;  1A7G E;  1YWX A;  5A2Q U;  4DR4 F;  1X7V A;  2E5J A;  5EWG A;  4K50 A;  4U9R A;  5IT9 U;  4B3M F;  2QTW A;  2D7S A;  2PA8 D;  1SL1 A;  4FF4 A;  4P2M A;  4H54 A;  1U1P A;  1U45 A;  4YB5 A;  5J2P A;  2WZ1 A;  3R5J B;  4WF9 Q;  3W3S A;  4O23 A;  2BX6 A;  3ZTQ A;  4RW9 B;  4DL4 A;  2OTJ S;  1GMW D;  2BUN A;  1HWK A;  3WC0 A;  1U1K A;  4URS A;  4FNI A;  3TQE A;  4LRF A;  4XDD A;  1JNZ B;  4ECZ A;  2F8H A;  2BEF A;  1SJF A;  3KLF A;  1U6B A;  5A2Q Y;  4NMX A;  5KFP A;  2RQK A;  1TVR A;  3POT B;  4DUT A;  2B0G A;  4X2B A;  1HLW A;  4EK2 A;  4UST A;  4CYU A;  5K14 B;  5LJ3 Y;  2HIQ A;  3VAK A;  4ECR A;  1OPI A;  2KYZ A;  1Y9O A;  3DLK A;  2DNP A;  2OSQ A;  3SSR A;  5KG6 A;  2W9C A;  1S76 D;  1Q78 A;  2MY8 A;  2QRR A;  2DGX A;  2Q3P A;  3H5U A;  2NYI A;  2UU9 J;  2X1B A;  4L74 A;  1FTR A;  3IR5 B;  4ZHR B;  3UPF A;  1UET A;  4KRW A;  3SMZ A;  7AT1 B;  5K8N A;  5T14 A;  5KT6 A;  3LWL A;  2R7T A;  1LXN A;  5F0U A;  3UD3 P;  4BC7 A;  5A8W A;  3QWP A;  1RAA B;  4C8M A;  3MFH A;  1WHW A;  2I0X A;  1SIZ A;  4Y28 C;  4CNY A;  1RTH A;  3CCS S;  1JLG B;  4C48 A;  3FZB A;  4UZB A;  1IR0 A;  4WYW A;  1U1R A;  2BOP A;  1CQN A;  2OD6 A;  2HAI A;  4MH8 A;  1U47 A;  1XR6 A;  3KLE A;  3BO2 A;  3TZY A;  5D0G A;  4QR1 A;  2RQM A;  3IS9 B;  2HVE A;  4DUZ J;  4OZ1 A;  3CDU A;  1HWJ A;  5DZ6 A;  4ES3 A;  1VIS A;  2AW0 A;  2B4P A;  4HHJ A;  1L5U A;  2BE2 A;  4DQQ A;  4OI0 A;  4OI6 A;  4L73 A;  4CLW A;  5E3A A;  4QU6 A;  2H51 B;  1FKP B;  1Q7L B;  3JTO A;  2HVZ A;  1I51 B;  4YR0 A;  3MUM P;  3JS9 A;  3PG9 A;  1J2V A;  4FS1 A;  1A0O B;  1MWZ A;  1OSD A;  2RD5 C;  3GON A;  3TW0 A;  1F9E B;  1ZA2 B;  2WOM B;  3B8H A;  3TOQ A;  5CCL A;  4XO0 A;  5G4D A;  2PDA A;  2QMU B;  2VBY A;  4F0H A;  1PYO B;  4IH6 A;  1SKW A;  4KHM A;  1VK3 A;  2DIS A;  3GR0 A;  1L3T A;  2K7J A;  3PDN A;  1HQE B;  2BKP A;  4U7C A;  4F02 A;  1VIX A;  2MJU A;  1IM4 A;  3EXC X;  4DUY F;  3KHL A;  1FO1 A;  1FRM A;  3MEG B;  4V1A k;  4HT7 A;  1JXV A;  3KKF A;  1X5S A;  2GCF A;  1X4H A;  2DGQ A;  2HZA A;  4ICL B;  1JNR B;  4J9V A;  4DHV A;  5C42 A;  2HHT A;  1RK8 A;  2DKO B;  2RH3 A;  3H2L A;  3MWB A;  1CJU B;  1HQU A;  1IWG A;  3KUG A;  4I7F B;  2QFI A;  3ZZO A;  2KFY A;  2ZH4 A;  3MAH A;  4QIV A;  4DR6 J;  3BBC A;  4PQU A;  5T7L B;  3QT6 A;  3FFI A;  1RAO A;  1GMU A;  2YKA A;  4ILM A;  2IDE A;  2ZBR A;  4Q8F A;  2PD1 A;  2RDD A;  2ZOF A;  5E0O A;  1V6H A;  3SXL A;  3PW5 A;  1FXL A;  4DR6 F;  1KVK A;  3UVJ A;  4ZPT R;  1B0V A;  1WTF A;  4PXC A;  3CGI A;  1PBA A;  3BGR A;  4DJB A;  1X9S A;  4O3R A;  2CVI A;  1ZTW A;  1VQ6 S;  3DGP B;  4KT0 C;  4Q43 A;  3ILO A;  1DTQ B;  1S1V A;  4DV0 J;  3AFG A;  5IC6 B;  2Z2Z A;  1YX2 A;  1XMQ F;  1WD6 A;  3QLH A;  4C4W A;  1LWE B;  1N54 B;  4PQA A;  3UDL A;  3A8K A;  2RT3 A;  1BGX T;  3AAW B;  3M30 A;  2MHE A;  1X4D A;  3LH2 S;  1DTQ A;  1W2B R;  1NK4 A;  5BXI A;  3OV7 A;  3MOZ A;  1CJV B;  3K8V A;  1BQN A;  1IKX B;  1VQS A;  1OPZ A;  4WP9 A;  5AE1 A;  4DSJ A;  2GQC A;  3C8Y A;  2N7C A;  1FHT A;  4ELU A;  1NCL A;  3BKU A;  2DHA A;  1W25 A;  5HO4 A;  3QZ8 A;  3E2E A;  5F8N A;  2QC3 A;  3QFW A;  4DLE A;  1S1V B;  3VGU A;  3BRE A;  5D0R A;  2N3O A;  3T1H F;  5A8K B;  4IR9 A;  2V5H G;  4QOT A;  1U25 A;  4NRU A;  4WU2 A;  3MR3 A;  2ASY A;  3KDN A;  2F9D A;  3RAM A;  4K4X A;  2VPY B;  3VTI A;  4CQ1 A;  4U6P A;  3I9V 9;  3SSQ A;  4EZ9 A;  5HAT A;  3MUV P;  3CD0 A;  1RKJ A;  4B3R J;  2YNH A;  2CZ9 A;  3N9U C;  4LVN P;  4KO0 B;  4RKU C;  4EU0 A;  1T9U A;  3IRX B;  4X64 F;  2ZM6 F;  4DFP A;  2MTL A;  1RWV B;  3V6D B;  4AQY F;  3TUJ C;  2FVS A;  2BJ1 A;  2B4O A;  1TAU A;  4I68 A;  4I56 A;  2MZ1 A;  4J91 A;  2U1A A;  2UXB J;  4X64 J;  1H7W A;  2E9R X;  2DPI A;  1PGZ A;  1Q4R A;  1N5S A;  5DDR C;  4HHH A;  3D2W A;  4C8Y A;  2J6U A;  4DPW A;  1QVF R;  3VAJ A;  4N41 A;  2IJF A;  3PW7 A;  1RDR A;  2G9O A;  3M2R B;  1H72 C;  3K89 A;  4OX6 A;  4NXN F;  1S9G B;  4K4T A;  4LQ3 A;  1FXR A;  3IN5 A;  3LP2 A;  4NOH A;  1RQ0 A;  1VLY A;  2J0Q D;  4OYO A;  3NAH A;  3QIP A;  4M5N A;  3C2P A;  1HBO A;  3GYX B;  2VDI A;  5FD1 A;  3MEK A;  3QO9 A;  3GG1 A;  1BUX A;  1BLU A;  1G4C A;  2GNK A;  5DO2 A;  4EMD A;  2EBG A;  4M1K A;  3UR3 C;  2CPI A;  4Y2C A;  1QSL A;  4XPC A;  4IFY A;  4XTT A;  5DET A;  1XMO J;  1FDB A;  2A3J A;  2P8I A;  3HJF A;  3DNC A;  2KHC A;  5HAN A;  1R0B G;  4M5J A;  5JMN A;  3PX0 A;  1GNK A;  3CCM S;  1V9O A;  3KUE A;  5KT7 A;  5AJ3 J;  4FXD A;  4ZVQ B;  4C2M A;  4Y34 A;  3OLB A;  2CPY A;  2DPJ A;  1G2E A;  3LPE A;  3NBP A;  2KFZ A;  2K1R A;  5KFF A;  4XIU A;  3SDE B;  1UEV A;  3R2D J;  4KAI A;  1RGV A;  5C24 A;  3T19 A;  3G8S A;  2IDL A;  4KJI A;  1S79 A;  2UUT A;  2KT5 A;  1HBM A;  1NK7 A;  2PI5 A;  3TA0 A;  2VQF J;  1TK8 A;  1PIL A;  3DOK A;  4YB1 P;  1NZA A;  2DH8 A;  2HSE B;  1SC6 A;  1G6B A;  1KTQ A;  3HCX A;  4M5G A;  5LXY A;  2XY6 A;  3PV8 A;  4W90 B;  1T02 A;  2I1R A;  2MYF A;  2QL7 B;  2VKZ G;  3DDK A;  1F3F A;  1H38 A;  2UVU A;  3EGZ A;  2Q6B A;  5CAB A;  1FKO B;  3VAG A;  1S1X A;  2CQP A;  4NI2 B;  5IC4 B;  4AD6 A;  2OIH A;  3M9N B;  2AJ1 A;  4RBT A;  2OAU A;  5K5M A;  5JUM A;  4EGL A;  3JB9 k;  2HZV A;  2W4D A;  3T6J A;  5BYR A;  5C5J A;  2KKH A;  2ZD1 B;  2C2N A;  3M2U A;  2JHE A;  2O3D A;  3WIU A;  1S1X B;  2VFT A;  2D3O 1;  4Q8E A;  2FVQ A;  4AL5 A;  1DFD A;  2WSE C;  3P96 A;  2E5L J;  3CT9 A;  1NDC A;  1FFS B;  1MML A;  1QAY A;  2YXL A;  3QFH A;  1RE1 B;  1TMM A;  1W7W A;  2WW4 A;  4RW7 B;  4CLT A;  4RUC A;  1WC3 A;  4DWI A;  3VGV A;  2VG5 A;  3GP9 A;  3QT7 A;  3OTO J;  2XYH B;  4WK3 A;  2XMK A;  4B3T J;  3B78 A;  2E5L F;  2VPW B;  3QT5 A;  2DNH A;  5LL6 d;  3HHK A;  4TU9 A;  3HFV A;  4NXM J;  4UUX A;  2JNJ A;  4ECU A;  1U0H B;  4BCA A;  4B3T F;  4I0W A;  1IJE B;  4CM0 A;  2LDY A;  2YBV A;  1BWV A;  2B8Q A;  1F9F A;  1S57 A;  1SPB P;  2C3M A;  4NLS A;  4B9M A;  3KNG A;  3NAI A;  4LF5 F;  2JVR A;  2X7I A;  4ZIT A;  1C2P A;  8AT1 B;  1TUV A;  3PFE A;  2CDQ A;  3DKD A;  2ZBC A;  4IYQ A;  3VGS A;  1DAX A;  2A6M A;  4K5R A;  3K5M A;  3N5F A;  3RB3 A;  2BRL A;  2H4W B;  2AX0 A;  1F2H A;  2BKN A;  3OW2 R;  2ZIT A;  4X66 J;  1IR1 A;  1RHJ B;  5FDL B;  2GHW A;  1F60 B;  4J90 A;  3CMA S;  4EEY A;  1U0S A;  1K47 A;  4E98 A;  4YB6 A;  4F25 A;  5E41 A;  1NM2 A;  2JDJ A;  2OGU A;  1EQ0 A;  1RBL A;  1MU2 A;  3KG1 A;  4OMF G;  3RU0 A;  4KPY A;  5THW A;  1SQG A;  3DRX A;  2Z57 B;  3MAA B;  4CO3 A;  4J9Q A;  4GC6 A;  2ZOG A;  1JK9 B;  3FMB A;  2DIU A;  2YKO A;  1SVD A;  3E01 A;  4P9S A;  3H40 A;  2EXU A;  1Y3K A;  2AJ0 A;  3R27 A;  3UDC A;  2HEK A;  1S1T B;  1JLG A;  3HHE A;  2RKI B;  2UV8 A;  1S1U A;  3NWG A;  1XNR J;  2NS1 B;  4JV0 A;  3TR5 A;  4F67 A;  1KP6 A;  2DH9 A;  5HLF A;  1YJR A;  3SCL E;  1QAI A;  2ZJR Q;  3KG0 A;  3P49 B;  4UY8 5;  2DEI A;  2ALY B;  2W4P A;  3GJT B;  1NBE B;  2GHV C;  2MQ8 A;  3IM9 A;  4LRB A;  3W5Y A;  4UY8 T;  2OPR B;  1YGY A;  3CJ0 A;  3MR5 A;  3I4H X;  2OEL A;  2ILY A;  3AXM A;  1WNE A;  3JSB A;  2FGC A;  4NML A;  3C6T A;  5K14 A;  1WEZ A;  5HQM A;  2VPX B;  3M4X A;  4KH1 B;  1L3V A;  2J6S A;  4YOE A;  4NLQ A;  5B0D A;  5IWA F;  4HYK A;  3KLF B;  2XI2 A;  1RLD A;  4RPF A;  5HJX A;  3ZZY A;  2A10 A;  4FPI A;  4Q7A A;  1S7I A;  4USM A;  3DRR B;  1N88 A;  2CQ1 A;  2J8A A;  4UQT A;  4WCE Q;  2F3J A;  1TKX B;  1RWK B;  2B8P A;  2D41 A;  2RF2 A;  3ILL A;  3N5B A;  2LEP A;  2HHH F;  3A3N B;  4RR5 A;  2LQB A;  4J37 A;  2X1F A;  2YNG A;  2RNE A;  5IV4 A;  4DR2 J;  1BWE A;  1FRX A;  1B70 B;  4PUO B;  2W2P P;  1LWX A;  2R4F A;  4DX5 A;  3R9L A;  3PO5 A;  1R6V A;  1VRU B;  3OXG A;  2IC3 B;  2JLF A;  1KKH A;  5KOW A;  1ULR A;  2DBB A;  2NCK L;  4DF4 A;  3SI8 A;  1HMV A;  3R97 A;  4YUD A;  1KLN A;  1BQX A;  2AJF E;  5D4O A;  2HFN A;  4JI6 F;  2YH1 A;  1H73 A;  1SJ4 P;  4A8M P;  2WVB A;  4L72 B;  5DLF A;  2KVQ E;  1WDD A;  3GWC A;  1FI4 A;  3KWM A;  3HD2 A;  2PEH A;  2CKW A;  3FBE A;  2CJK A;  3HSZ A;  3ISN D;  2MQN A;  5EDW A;  1D1U A;  5ETP A;  4LF4 F;  1SQF A;  4OJ1 A;  4USK A;  4ZVO B;  1BXN A;  3FMW A;  3LGH A;  1QAX A;  1O0P A;  2WTF A;  3G6V A;  2B56 A;  4P73 A;  1R8H A;  5J1N A;  5LMN F;  4DSI A;  3PX6 A;  3NEK A;  1TQL A;  1XER A;  3BN4 A;  2UUA F;  3DHX A;  2DNQ A;  4DPX A;  5AE2 A;  1X8D A;  5KT3 A;  1FD2 A;  2ZH3 A;  3BO3 A;  1PYS B;  1D9D A;  3MEG A;  2R2T A;  2NXJ A;  4I2Q B;  4K4S A;  3N01 A;  1TL7 B;  1WC4 A;  2WBR A;  3C6T B;  4X4P A;  3M6U A;  4ZLL A;  3G86 A;  3M2R A;  4I4B A;  4F4W A;  2DR8 A;  3ZTP A;  4ED7 A;  1PAE X;  1TL1 A;  4TN2 A;  3VHQ A;  3FQK A;  1PC5 A;  2I8E A;  3NG8 A;  3UCG A;  4A8F A;  5L9X A;  1RT5 A;  1DBD A;  1ZA1 B;  3GYG A;  3QYY A;  5B0A A;  1HNX F;  2E1P A;  1UVK A;  2OKQ A;  4PAA A;  3C19 A;  3PRV A;  2FJB B;  4NE9 C;  4ZVR B;  5H9F J;  4DV5 J;  3H0P A;  4DQS A;  4IUF A;  1CC8 A;  4B9L A;  3CTR A;  3QJL A;  1RAB B;  3V6D A;  3A8I A;  2C1E B;  2GGP A;  3FCV A;  5A0Y B;  3EIC A;  5D6G A;  4X65 F;  1TL1 B;  1SC4 B;  4CLL A;  3VQS A;  1P8G A;  2HHQ A;  2MLZ A;  4MKA A;  4RUB A;  3RUB L;  1XWL A;  4ELT A;  2V8V A;  4M5K A;  3M2U B;  3CIZ A;  3CCJ S;  2VC1 A;  1RT4 B;  4DR5 J;  4R25 A;  1RJJ A;  1X4G A;  1I1G A;  1SH2 A;  1Q79 A;  4NLW A;  3UR0 A;  1R31 A;  4MIA A;  3UN5 A;  3OSN A;  5C25 A;  1FTC A;  2GMH A;  5GAD U;  4OZ5 A;  2IMO A;  3KLI B;  1CJV A;  4ZS6 A;  4DPO A;  3MZI A;  4DR2 F;  1D9F A;  2ZBP A;  2VA3 A;  2CZV C;  4K0K J;  1T03 A;  2VA2 A;  3W9J A;  5F8H A;  2C42 A;  1KNZ A;  3LP1 A;  4OJH A;  2V8P A;  3JTP A;  4MT1 A;  2X51 A;  2KB2 A;  4G6V B;  4N8O A;  4PXE A;  2IVY A;  3L95 X;  1NH8 A;  1WKJ A;  4EO6 A;  5GAH I;  1IBM F;  3MD1 A;  2BW2 A;  4MKB A;  4AXI A;  4JI5 F;  3Q8U A;  3M30 B;  2M3D A;  3GV7 B;  3VR1 A;  1OIA A;  1T9X A;  4PG4 A;  4K5S A;  4DEZ A;  5C25 B;  2JFK A;  3BN7 A;  5GAG I;  4UQG A;  3CSK A;  1WSR A;  3I4P A;  1EP4 B;  2F65 A;  1Z2Z A;  2LEC A;  2ROP A;  2JEF A;  4ENO A;  3QAT A;  2C2R A;  5D3G A;  5IXU A;  1TV6 A;  3PIP Q;  3PY8 A;  1N33 F;  2DJW A;  2QV6 A;  2C2O B;  2C2D A;  2VG6 B;  4Q45 A;  1KON A;  2KL8 A;  4JOU A;  1L3U A;  4DX7 A;  5I3Q A;  3N4W A;  3OHB A;  3PW2 A;  1UEU A;  2B4U A;  3K58 A;  2PE8 A;  4D3G A;  3GR1 A;  2F4V F;  3TA1 A;  3GCW P;  2Z30 B;  4J5O A;  3GZ7 A;  5CZV A;  1RWP B;  1P9Q C;  3I96 A;  1H7X A;  5CA5 A;  1C0U B;  1SJQ A;  3EM1 A;  2BAB A;  2BW7 A;  2PMZ D;  1B7Y B;  2F4F A;  3MCN A;  4WJB A;  3AB4 B;  4CP5 A;  2ZJQ Q;  1APS A;  2BAC A;  3DLL Q;  2BE9 B;  4P71 A;  3SFU A;  2GA7 A;  3QIP B;  1ZM2 A;  2QO3 A;  2WON B;  3AJ1 A;  3P6Y C;  5DJB A;  1SH3 A;  2V9W A;  3T1Y J;  1NXI A;  5J1E A;  5KG2 A;  1TKT B;  1SKU B;  3HVW A;  2NPF A;  2F7V A;  2QN6 B;  4MJK A;  3VVU A;  1UTA A;  2D9O A;  2VU5 A;  2WOM A;  3A8J A;  3JSY A;  4QBU A;  3LGN A;  5HVH A;  1M1K T;  3IGN A;  1XTZ A;  2HMI B;  1GMV A;  3PAC A;  3TEH B;  2WON A;  4O4G A;  5FII A;  1E6V B;  4A8X A;  1ICE B;  5KG4 A;  4HR2 A;  1L3S A;  3G87 A;  4FYW B;  1VYA A;  3MM6 A;  3THP A;  3J7Y U;  3FCH A;  1HYS B;  3KJN B;  3GSD A;  3M2V B;  3ILI A;  2XO7 A;  2BMB A;  3NLC A;  2D9P A;  1S12 A;  3IRX A;  2L3M A;  2B4V A;  2HW3 A;  3M8Z A;  4Y2K A;  3J80 U;  4LF6 F;  2BE2 B;  5KFG A;  2VG7 B;  2RS8 A;  3DGV A;  2FHM A;  3W5X A;  1JX4 A;  4C8N A;  1EB0 A;  2DNN A;  2CWK A;  2UZA A;  1RIS A;  4QWE A;  1HR0 J;  2AF6 A;  3NS7 B;  4TU8 A;  4JI3 J;  4ED4 A;  1FE4 A;  1NJZ A;  2WRM A;  3ULH A;  4F4K A;  4CT9 A;  2GQQ A;  3AOB A;  3F56 A;  3GFZ A;  4IFY B;  1IKW B;  4C0B A;  2HRU A;  2KG0 A;  1VBY A;  1RTD B;  4K4U A;  4J7C A;  1FRK A;  3W5Z A;  4GVB B;  3F73 A;  1KFS A;  3CD6 S;  1TP7 A;  1U09 A;  4ZLN A;  1P1T A;  3OLA A;  1SUQ A;  3W64 A;  2ZNZ A;  5DG9 A;  1HBO B;  3KMS A;  4C8K A;  5D78 A;  4ANE A;  5F3Z A;  2DCL A;  2ZM6 J;  1RI7 A;  1ZZF A;  4RW4 A;  4M5L A;  4WIQ A;  3BKF A;  4CO2 A;  3M9M B;  3KJV A;  1OY9 A;  1OQ6 A;  1RAC B;  4HL9 A;  1AUD A;  1CJT B;  2KJW A;  1UA1 A;  2FVC A;  4UTG A;  1RB0 A;  2QLB B;  4W98 A;  2HS3 A;  4H4K A;  4NLO A;  3Q0A A;  5KFO A;  3SZ2 A;  1VBX A;  2FVR A;  2N3L A;  4K4Y A;  3WIV A;  3HHN B;  2HK2 A;  2DD8 S;  3EZO A;  3J81 j;  4RWX A;  5M2P A;  1ZAW A;  1U0H A;  2MDA A;  2XWY A;  2ZOM A;  3D6F B;  3CJK B;  3THT A;  1RWX B;  1U2F A;  4DR7 F;  4TY8 B;  2F4V J;  3FVY A;  3U1M A;  2X3G A;  3TUP A;  4ED8 A;  4DS5 A;  3ZTO A;  3UNG C;  2R7W A;  1GQE A;  5JJB A;  4QU7 A;  4OHW A;  1Q81 T;  2ZVI A;  2IY5 B;  2WHO A;  1WG1 A;  2YKP A;  1FF2 A;  2JL9 A;  1FJE B;  4IH7 A;  3PM9 A;  1O6X A;  3ET6 A;  3E51 A;  1HHS A;  1MSW D;  1EKR A;  3FBC A;  4WPA A;  2WCX A;  1O5J A;  4NCA A;  2RAQ A;  2E29 A;  2M7S A;  1C0T B;  2MKH A;  2GIF A;  2KRR A;  4Q5V A;  1G1X A;  3DLB A;  4F8R A;  2CPH A;  2CJ9 A;  2IM2 A;  4NI2 A;  2FY1 A;  1D8Z A;  5GME A;  1YRT A;  3PJW A;  4JB8 B;  4OYI A;  4KFB A;  3R7N B;  3OVB A;  4PCQ A;  3JYT B;  5B09 A;  3MI7 X;  4KE5 A;  1X0F A;  4B9S A;  4B9T A;  1T95 A;  2UXD J;  4G1Q A;  2NPI A;  2WAQ D;  3UE2 A;  1CBK A;  4LR7 A;  2F8E X;  4NWB A;  4DF8 A;  3I0R B;  3KK1 A;  2XLK A;  2G2O A;  1Y00 A;  2CFX A;  2VV5 A;  4HLB A;  4Z37 A;  2XLJ A;  1SB6 A;  3LO3 A;  5DS7 A;  1CQM A;  2VQF F;  3AOA A;  3IMQ J;  3SBM A;  3IG1 A;  1JB0 C;  1EZZ B;  4G1P A;  2IIH A;  3K5N A;  3OTE A;  1HBU A;  4HTJ A;  2RU9 A;  2YX4 A;  1FDD A;  4ECY A;  1CJK A;  1KEK A;  3N79 A;  3VAI A;  3PZP A;  2DR6 A;  1K1S A;  4UOH A;  4ZJQ A;  1XN9 A;  2HFS A;  4LQ9 A;  3TAQ A;  3HSD A;  4X4Q A;  2V4Q A;  2MQO A;  2AGQ A;  1YG0 A;  1BMQ B;  3NKY A;  4WFN Q;  1Y5I B;  3D6T B;  2XGQ A;  2AYM A;  1VJQ A;  2KT2 A;  3CDE A;  2DHH A;  2VJV A;  1WG4 A;  2CQB A;  2CIM A;  2K3K A;  2GVD B;  3M8W A;  4I64 A;  4RX6 A;  5C2G A;  2VG7 A;  1N5Y A;  2DR5 A;  1N5T A;  2XMV A;  4OLO A;  3K59 A;  4OLP A;  3FSI A;  4RU9 A;  1IQT A;  1T9T A;  4B9U A;  3T1A A;  3OFG A;  2KI2 A;  3K2Y A;  3Q2T C;  2M52 A;  4K7Q A;  1RT5 B;  3GLJ A;  5L8R C;  3IWX A;  2JOQ A;  1HYS A;  4OYZ A;  3NGD A;  2KTQ A;  2LA6 A;  3GIL A;  4EYH B;  2B5J A;  3K5P A;  5KFD A;  3R5D A;  4ECQ A;  2RQC A;  4ZIW A;  3KLH A;  2F1F A;  4LF8 F;  5ETN A;  2VOO A;  5D8H B;  2YNG B;  2Z4P A;  3ZNU A;  2IAJ A;  4NXM F;  1IKV B;  4WFX A;  2OFH X;  4WP3 A;  1HWI A;  2GVZ A;  1TVR B;  5C2C A;  2Y0B B;  3D1O A;  4LF5 J;  2AEF A;  2DRD A;  3QID A;  3RG6 A;  3MF5 A;  1U02 A;  5KFE A;  1MN9 A;  1Q8B A;  4NXN J;  2BJ7 A;  1PSD A;  2D69 A;  1I94 J;  1X5T A;  2J0S D;  4USI A;  1S6U A;  2VFU A;  3VAF A;  1QDU B;  3RB0 A;  3R3T A;  5F3T A;  4ILR A;  2J5A A;  4ED0 A;  3R1H A;  3IS9 A;  1DHM A;  2VG6 A;  3AOC A;  4N77 A;  4KO0 A;  2VOD A;  1RCX B;  4DSK A;  1T05 A;  4ZCM A;  2MKJ A;  3U7J A;  2CJB A;  2QZ8 A;  5B7W A;  2V94 A;  4HH0 A;  4O0I A;  3OSP A;  1HNW F;  4LRC A;  4O44 A;  5D0E A;  4Y2M A;  3W9I A;  3H98 A;  4EWT A;  2HGM A;  2AQ4 A;  1SKS A;  3CJ3 A;  4FYD A;  1Y10 A;  1TL3 B;  2Z58 B;  2W7A A;  3OUY B;  2R8K A;  3NNC A;  1FEH A;  3NRB A;  4KY3 A;  2LLZ A;  1B0P A;  1IKY B;  1X5O A;  5A6W A;  2KXF A;  3Q83 A;  1TV6 B;  2E7V A;  2FHO B;  2GIQ A;  4E8U A;  5EWF A;  4XPE A;  4DV0 F;  1EET B;  3MUT P;  1VOM A;  2ZDO A;  2HHP A;  1EP4 A;  1SIW B;  1RT1 B;  1XR5 A;  3ADA C;  2OLW A;  2KU7 A;  1DY3 A;  1WI8 A;  2WVE A;  4M5H A;  1V5V A;  4PPD A;  2KM8 C;  3PO4 A;  1PJ6 A;  1UW4 A;  3SCK E;  1BY9 A;  3NOC A;  4ZJO A;  2CQH A;  2YNI A;  3MAA A;  3NGS A;  2NXU A;  3EGW B;  3M32 A;  3GTY X;  2OMO A;  4HI1 A;  4ZPA A;  3NCP A;  4RWW A;  3IM8 A;  5F0W A;  5DGB A;  2HUR A;  2YWH A;  2PA3 A;  2ZZN A;  3BM7 A;  4KGZ B;  1BD6 A;  1HFE L;  3OL9 A;  1QE1 A;  2LYV A;  2R7O A;  5BYS A;  1QTN B;  2M5Y A;  1VR6 A;  3C15 A;  5IM0 B;  3I5C A;  3PYF A;  1ZOT A;  3DOM B;  1UFL A;  2HVH A;  4DX6 A;  2DGU A;  5D4P A;  1VRT A;  4N47 A;  3UN2 A;  2H3E B;  2BAN A;  3MGJ A;  4C3M A;  2IBO A;  3RTV A;  3UVJ B;  1QLN A;  4MFB A;  4ZPD A;  3JAM Y;  4KHP J;  2E1M C;  5DQI A;  1NAQ A;  3MPU B;  1LV5 A;  4LRA A;  1TUW A;  1FER A;  2BQR A;  1J5E J;  2B5J B;  4AT1 B;  6AT1 B;  5IOL A;  4JP8 A;  3D67 A;  4HTI A;  3KK2 A;  3BO4 A;  3FZ2 A;  3BEG B;  3I32 A;  3G6Y A;  5HLF B;  4LSZ B;  1JLB B;  1JIH A;  1OSC A;  2BDP A;  1KQF B;  1GX5 A;  4DL2 A;  4RUA A;  4JI0 J;  2NSB A;  1NK0 A;  2BJE A;  1V3S A;  4IOC Q;  3R2C J;  1RBO B;  1ACM B;  1DQ8 A;  1SCJ B;  4UW2 A;  4O3S A;  4UOC A;  1GTH A;  1H74 A;  1VRT B;  2EW9 A;  3H59 A;  2FUG 9;  3GE9 A;  4Y2I A;  1JJ2 R;  3I82 A;  2MZQ A;  1R8A A;  1YJW S;  3DRP A;  3BDE A;  4ZP7 A;  3MMA A;  4WYL A;  3H8Y A;  1MU2 B;  4KGM A;  3PEJ A;  2P9G A;  2FVP A;  3R5G A;  4OHY A;  1RWU A;  3S01 A;  3M6V A;  3AQP A;  3FCW A;  1WKK A;  2LQ5 A;  3DI6 B;  4KQZ A;  4WFY A;  2LXF A;  3NGK A;  2LXI A;  1FKP A;  3AT1 B;  1BQN B;  2EWH A;  2LQ8 A;  3EDR B;  4DCP B;  1QAJ A;  2YNI B;  1VHF A;  4B08 A;  3GV8 B;  2AU0 A;  5DM6 Q;  1U1Q A;  2A1B A;  2ZBQ A;  4BWJ A;  4ILL A;  3PCO B;  4AYB D;  1IXK A;  2DXD A;  2CQ2 A;  3MR7 A;  4J9U E;  3FBB A;  3OD2 A;  4LVO P;  1C4A A;  4U8V A;  2R2S A;  3HLU A;  4CWB A;  2ZEJ A;  5AXN A;  3BH6 B;  5KFX A;  3LPY A;  2YNF A;  2DY1 A;  5KFN A;  3HVR A;  1UZH A;  5DG8 A;  4FYX B;  1TL3 A;  3N6N A;  1NPR A;  2J8S A;  2CJQ A;  2RE1 A;  5K20 B;  1XNQ F;  1CLF A;  3LGM A;  3BBB A;  4RNH A;  1RTH B;  3FKB A;  5J2Q B;  5HVG A;  4M5I A;  2PO4 A;  3GIK A;  2Z2Y B;  3CPW R;  4F2S A;  1C1C A;  1FD8 A;  2LQJ A;  2IFX A;  2V2Q A;  1NK9 A;  1UWB A;  4NRT A;  1NRK A;  2Y8W A;  1XNQ J;  3BR8 A;  2KJV A;  1YBA A;  3RJM B;  3FFI B;  2QA4 S;  2OHD A;  2D1C A;  1B3T A;  1OYD A;  4O44 B;  4RW8 A;  1CSJ A;  3QPI A;  2BZ2 A;  2MB0 B;  4DLG A;  1T05 B;  3P5B P;  1Q82 T;  1DLO A;  1F0X A;  1ZPW X;  2BYC A;  2W2Q P;  4OIX A;  1WWH A;  4B3O B;  9ATC B;  5H1S V;  5ETO A;  5HMX A;  5GMD A;  3LWM A;  2XY5 A;  3J7A N;  2RUG A;  4X65 J;  3HT3 A;  1FJG J;  4QZV B;  1KN6 A;  2HQI A;  3JQM A;  2G4B A;  1Q5V A;  1N0V C;  3F44 A;  2KXN B;  4ETX A;  2XMM A;  1VQL S;  2ATC B;  4A8W A;  1X4C A;  1TKZ A;  4MTP A;  3PYG A;  1LW0 B;  1NPP A;  1U6F A;  2GGP B;  2WVF A;  5A0Y A;  4ETZ A;  4B3R F;  1VC6 A;  1PO6 A;  3GB0 A;  4N8N A;  2FQQ B;  5IT4 A;  3H4D A;  2AYE A;  1Q5Y A;  4Q44 A;  2B51 A;  4TYA A;  2W8K A;  2HFZ A;  1ZYQ A;  1JLA A;  3UW1 A;  4W92 B;  1N52 B;  1RA6 A;  2AWZ A;  1U8S A;  4F3M A;  2CA9 A;  4OYM A;  3ZZU A;  4IG3 A;  5SUH A;  4DI6 A;  2ALZ A;  2UXB F;  4P2S A;  2JH3 A;  1UZD A;  1V3Z A;  4BLG A;  2HFU A;  4CLS A;  4F4Y A;  2UUB F;  3V5R A;  2DR9 A;  1FE0 A;  1TUG B;  3OL8 A;  1FNX H;  4N76 A;  3QSY B;  1VK8 A;  7FD1 A;  5HBM B;  4GMK A;  1HI0 P;  1QY7 A;  1F6T A;  2H1Y A;  3G2X A;  3EJM A;  4A47 A;  3FK4 A;  4TLR A;  1PBU A;  3KHG A;  4X4N A;  3Q22 A;  2GC8 A;  3MMC A;  3TVK A;  1HPZ B;  3D9B A;  3AA8 A;  3M6X A;  1N5V A;  5HQ8 A;  4RW6 B;  2XMT A;  4RLE A;  4U96 A;  4R5P A;  2JX2 A;  2QEX S;  2EKY A;  5GAH U;  4LFC F;  4MMO A;  4F3Q A;  1XMO F;  3B54 A;  2QMX A;  1UWA A;  2CYY A;  1UPM B;  2XS5 A;  1PJ7 A;  1H6K X;  1R89 A;  3RW7 A;  4LFC J;  4FVM A;  3M32 B;  1HW9 A;  4OI1 A;  3DN9 A;  5F8J A;  4YP3 A;  1OQ3 A;  1Y5N B;  2CJX B;  2FTR A;  2PSZ A;  5J2N A;  1UW9 A;  2CNL B;  2QSW A;  3I56 S;  3LP2 B;  2W01 A;  1MN7 A;  1CG2 A;  3AJD A;  4FYV B;  2BVZ A;  2CPX A;  4CYU B;  3HDS A;  2NZC A;  4DV2 J;  4FF3 A;  1YRX A;  2MXY A;  3Q8Y A;  3OTB A;  4JV2 A;  5FJ4 A;  1RAD B;  1N4L A;  3RRG A;  3C16 A;  3BPS P;  3DLG B;  4WTY A;  3T5J A;  4B9V A;  3C14 A;  2XSJ A;  2JWN A;  3EUN A;  1NDL A;  3M6W A;  5M2U A;  2F63 A;  2R2R A;  2CJY B;  4OX8 A;  3CJR A;  3HJV A;  1WKL A;  3KYL A;  3K5O A;  2GIR A;  1ITP A;  4EUV A;  3U27 A;  3HHL D;  3C46 A;  3TZX A;  1XMB A;  2RUS A;  4DV6 J;  2H9Z A;  5DGA A;  3CCT A;  2YWF A;  1YJU A;  2K3I A;  2YWK A;  1LKZ A;  1HNX J;  2ACY A;  4J9L A;  2VAS A;  4RZR A;  2MMY A;  3HF5 A;  3IGV A;  3NMR A;  5IWA J;  3V6J A;  4C8L A;  3MCM A;  4DV3 F;  1K73 T;  4QYZ K;  1VI7 A;  3H2V E;  2QLJ B;  3UD4 P;  5B0B A;  3CMQ A;  1Q8I A;  2AP6 A;  2I38 A;  1F5C A;  2OEM A;  3C16 B;  2GFF A;  4OYB A;  4JI8 F;  1VQK S;  2X3D A;  3ENW A;  2V63 A;  1H2V Z;  1VHI A;  4M63 A;  4AFF A;  2HHH J;  1BHN A;  2XTJ P;  2QSF A;  2JLG A;  3R1L A;  2HRY A;  4NEZ A;  2V2Z A;  2CQ4 A;  1S5Z A;  4IQM A;  1RT3 A;  3J7Y I;  4FXW A;  2HND B;  4WWS A;  4WII A;  4Q2M A;  1U26 A;  4QJV A;  3CW2 C;  2VZ9 A;  3OVS A;  4LIR A;  4X62 F;  2XMW A;  3G9C A;  4DR1 F;  4GVL A;  3RB4 A;  2YKN B;  2BKO A;  4CO0 A;  3FEY B;  1KQK A;  4ZLJ A;  3G82 A;  3HXM A;  2X1G A;  3M8Q B;  2DB1 A;  2W8L A;  2VIH A;  3IBW A;  3L7O A;  4CDI A;  4ECV A;  4ED6 A;  4JI6 J;  3RB6 A;  1M5S A;  3DMJ A;  3DOL A;  1S10 A;  4IR1 A;  1PIE A;  3CCZ A;  2GVD A;  1WC1 A;  5ETS A;  3CCE S;  3E01 B;  2XCP A;  1IKW A;  4IOA Q;  1M5P C;  2AMC B;  4L76 A;  4B3O A;  1NJW A;  3T5K A;  2V2V A;  3HZE A;  3GIM A;  2ZVS A;  2XC9 A;  3OR2 A;  5HRO B;  3NS6 A;  1RWW B;  2E7X A;  3QWU A;  4I67 A;  1AUS L;  5LSL A;  3EE3 A;  2NRE A;  1RT6 B;  4ZMM A;  2W9B A;  1Y4Z B;  2OJ3 A;  3P4U B;  4M8L A;  5HBM A;  3TVZ A;  2EFP A;  5MLC V;  2L9N A;  4X66 F;  4C11 B;  1X9M A;  2Z2L A;  2E5G A;  1S6Q A;  2ZZT A;  2HHU A;  4C98 A;  1C1B A;  2OFG X;  3L3C A;  3MM8 A;  4F26 A;  3M05 A;  2XB2 D;  4ECW A;  2A6O A;  3DU6 A;  4HHU A;  4ZVH A;  2GVZ B;  1UCN A;  2FHK A;  2EFV A;  1VMB A;  2CRL A;  3VAL A;  3O44 A;  2VON A;  2PMH A;  4ZPB A;  1LWC B;  2X1A A;  3KOA A;  2QLF B;  1VC0 A;  2HBY B;  3IAM 9;  1SC1 B;  4HAC B;  4NCG A;  3SQO P;  1UFK A;  4PR6 A;  3X1L B;  1FX4 A;  1RT2 B;  3MM8 B;  3PRD A;  1RU2 A;  1WOS A;  3QAE A;  3LAM A;  3MMB B;  4S0M A;  3IO1 A;  5JVG Q;  4WKR A;  3AD7 C;  4D3H A;  1S1W B;  2N4C A;  3FQL A;  5E7O B;  4DPY A;  2IA6 A;  1WEX A;  1NKC A;  2QJ3 A;  3CD7 A;  3KDO A;  4ZPC A;  4DQP A;  4U8Y A;  1MWY A;  1WG5 A;  1Q1K A;  2CVE A;  2P5V A;  5L1J A;  4EZ6 A;  3D1Q A;  2HHS A;  4QWA A;  1I3O B;  1N48 A;  1IR2 A;  2OD4 A;  1KFD A;  3L7P A;  4W4M A;  8RUC A;  2N82 B;  1R0A B;  3KXD A;  5MAO A;  3CC4 S;  5KG0 A;  2F5G A;  2R9L A;  5CD4 A;  2BJ9 A;  2MLX A;  2YKQ A;  3D3B J;  3H42 A;  2CQ3 A;  4TVA B;  4C3K A;  1IBL F;  2GAG C;  3KFW X;  4C3L A;  3THV A;  2ZZM A;  3IXQ A;  3GII A;  2PC6 A;  4EBD A;  1QE1 B;  4PPZ A;  5LOQ A;  3SCI E;  1FK9 B;  3SCJ E;  5L9N A;  1Y5L B;  2BM1 A;  2IM3 A;  4LUB A;  1NHV A;  2ADC A;  3NMA A;  2YKN A;  1R3N A;  3CB4 A;  2FLP A;  3CME S;  3OQ2 A;  1PG5 B;  4G1Q B;  5K9F A;  5AT1 B;  2VDH A;  3HHL C;  1YSJ A;  4DUZ F;  1KC8 T;  4MKY A;  1PJ5 A;  3OL7 A;  2HND A;  3PHT A;  3DYA A;  3M8P B;  2QLW A;  5ETL A;  1NK6 A;  2EC2 A;  4FKY A;  2W4C A;  2XBP A;  2D3U A;  3H5Y A;  5I42 A;  1C0T A;  3GJQ B;  4H4M A;  4IDK B;  1S4F A;  1N5Q A;  1RT1 A;  2H48 B;  4LF7 J;  4ZVF A;  5EWE A;  1FK9 A;  3PTW A;  5FDL A;  3K8W A;  1AT1 B;  3KLI A;  4WFZ A;  4B17 A;  3CCV S;  1HD1 A;  4PG8 A;  4RO0 A;  3GYN A;  1A6L A;  3CC2 S;  5E33 A;  3PXG a;  4OJG A;  3W63 A;  4CT8 A;  6FD1 A;  2BJ3 A;  1Y0H A;  2CQG A;  2EG1 A;  2J9D A;  4Y65 A;  5T7L A;  4URG A;  1SL2 A;  3AHP A;  1YKW A;  3SV4 A;  1UP1 A;  3V4M A;  2EG2 A;  7FDR A;  2L9D A;  1K8A T;  2I5J B;  3IR7 B;  2POK A;  1RAJ A;  2K7K A;  2FLO A;  2P9C A;  1LNQ A;  3QJJ A;  2UVR A;  4I6Y A;  5CD4 H;  1UJ5 A;  2OEK A;  3I6P A;  2ZH9 A;  5LMU F;  3BGU A;  2ZUA A;  4RNF A;  3OTC A;  2F40 A;  5E2Q A;  2GMJ A;  3IRW P;  4BS2 A;  4F50 A;  2HFV A;  3DXB A;  2EKN A;  5C42 B;  1U1O A;  3O6Q A;  3B4D A;  1WC0 A;  3VGT A;  1QSY A;  3V4I B;  3KK2 B;  2FDN A;  4YHH F;  3T1Y F;  1RHK B;  2RKI A;  1VQN S;  4WU3 A;  2M8D B;  2QFJ A;  5CYQ A;  3W9H A;  5IT0 A;  4J9K A;  3CE8 A;  5KFC A;  3PX4 A;  3NGR A;  4ED1 A;  2QYC A;  1SV5 A;  4KTQ A;  1IBC B;  4YHH J;  2NXC A;  4U7U K;  5J2N B;  4YR3 A;  4FF2 A;  5KG1 A;  2UU9 F;  1J5O B;  1IBK F;  3NL0 A;  4OX9 J;  1HNZ J;  5KFY A;  4M5D A;  3UI3 A;  3GU0 A;  1ARO P;  1VJW A;  2ZD1 A;  1RTZ A;  2DVI A;  3KMQ A;  5ETV A;  5EX0 A;  1NJX A;  2MPU A;  2EFQ A;  1KHW A;  1ZBT A;  4LBI A;  4DV5 F;  2B3T B;  2FGO A;  3OR1 A;  1YLX A;  3W66 A;  1FKO A;  1TMJ A;  4O4R A;  4OZ0 A;  4LF6 J;  4K59 A;  4TKT A;  3CXC R;  1SC3 B;  5FLX U;  2C2E A;  1R8B A;  2HNZ A;  1VQO S;  4ED5 A;  2YKM B;  1NKE A;  5KFZ A;  4QR0 A;  1XQI A;  1DTT A;  4NLR A;  3OJU A;  3R5C A;  1HBM B;  2IYI A;  1YZ6 A;  1VC5 A;  2ZJP Q;  5CQG A;  3OHA A;  3OUY A;  1GXT A;  2GHP A;  1KVJ A;  2XMA A;  1VQ8 S;  1HBU B;  3RAQ A;  1UVN A;  4X4U A;  3US5 A;  4QPX A;  1QUP A;  2BM0 A;  3M9O B;  3R7S B;  3BSN A;  4OI3 A;  1HIY A;  4K4V A;  3G4S S;  1WUU A;  4KSE B;  4QIW D;  2QIF A;  2J0W A;  1YI2 S;  2HBZ B;  1ZET A;  4RW7 A;  5B08 A;  2IM1 A;  3MED A;  4NLT A;  2AGP A;  1HKA A;  1T0T V;  4NCB A;  1K0V A;  1YTY A;  3DRR A;  4PG5 A;  1Q8L A;  2C2K B;  3CJQ A;  1T3O A;  3L09 A;  1U1M A;  2DXF A;  4ZPV R;  2YTC A;  3R5B A;  2AKW B;  1KQS R;  1FFG B;  1XIQ A;  2FHJ D;  3HX9 A;  3QO9 B;  1PCA A;  1UJ4 A;  3D1H A;  3FRZ A;  3LF0 A;  1J5O A;  3E8O A;  4OZ2 A;  1TKX A;  4CCH A;  2VB6 A;  1N33 J;  4R0E A;  2UUW A;  4HI2 A;  5SZT A;  4K4W A;  1NSA A;  4A8Q A;  4IRC A;  1HA1 A;  3BSA A;  3GMG A;  2B43 A;  2GS8 A;  3QAU A;  5M2R A;  1S6P B;  3J81 U;  1UVJ A;  3ZO7 A;  5L1L A;  2LMI A;  3MED B;  3CDW A;  1FDN A;  4KPC A;  3F41 A;  5KFA A;  4USW A;  3W2V B;  1H98 A;  5KFK A;  4B02 A;  1IKV A;  5D15 A;  2DCU B;  3CED A;  3WHI A;  2HG4 A;  3NCR A;  4H4K C;  4CO4 A;  1ZTT A;  4WE1 A;  2OTL S;  3QRQ A;  2R8G A;  2E7W A;  3HHD A;  5L38 A;  1KSP A;  3MM7 B;  3QGP A;  4QW9 A;  3N6L A;  1S1U B;  3AD8 C;  3TJ9 A;  3D3C J;  5HP1 B;  2JFD A;  4ECS A;  1GT8 A;  1F9H A;  1WAC A;  4F0M A;  2IHR 1;  2V4J A;  2FZK B;  2BOA A;  4A4J A;  4DDF A;  1RT6 A;  2OP5 A;  1VGY A;  4XAK A;  5H9F K;  2HHX A;  1XMQ J;  2K2P A;  1ZPV A;  2IRU A;  3OR2 B;  5HRO A;  1RHM B;  1CUL B;  5DQH A;  5A76 A;  1RAE B;  4RBU A;  3AD9 C;  2GV1 A;  2MST A;  3VF0 B;  3W1Y C;  3HSJ A;  4DFK A;  3KTQ A;  1RU1 A;  1RLC L;  5KFB A;  2DTJ A;  3IR6 B;  3G96 A;  2C3Y A;  4DOZ A;  1HWL A;  1SUQ B;  2NXN A;  3MMC B;  5D0H A;  4RUH A;  4DL7 A;  2M88 A;  3K7R A;  1NJI T;  1HL6 A;  2HZC A;  4WFA Q;  1JQG A;  1JLF B;  1VCT A;  4WFB Q;  1FT8 A;  1XR7 A;  4O3Q A;  3M1V A;  1RT4 A;  2M70 A;  2KHD A;  3PVX A;  1VQ9 S;  1OYE A;  2JEJ A;  1JJH A;  1RTJ A;  1QTM A;  4DCJ B;  4AXJ A;  2QG9 B;  1RXO B;  3DRP B;  5KFI A;  3Q8R B;  4GC7 A;  2YWW A;  4QCL A;  4X84 A;  3DLE A;  2E44 A;  3FJ2 A;  1FDA A;  4R8U A;  4ITS A;  4DQI A;  2W2N P;  3OFH A;  2COL A;  2MGZ B;  1S9G A;  4DV1 F;  4C7Q A;  1B64 A;  4OX7 A;  3BPD A;  2DGW A;  2XMU A;  3IFE A;  2BJ8 A;  5L46 A;  4DN9 A;  5H9E K;  1YJN S;  1I6J A;  2A18 A;  4CH7 A;  5K8M A;  4DL3 A;  3QT8 A;  3ENA A;  5EN1 A;  3M2V A;  4FNH A;  4OZJ A;  3TP2 A;  1M5H A;  2EPI A;  3O5T B;  2DHX A;  4JBC A;  5H9E J;  4CLK A;  4FYY B;  3H5X A;  1NUE A;  2R42 A;  3UCU P;  3AOD A;  1TAQ A;  4WBF A;  1NB2 A;  1UVI A;  5CYJ A;  2IVF B;  2VL1 A;  2GJI A;  2JJ4 D;  2OPQ B;  1TL5 A;  2YY3 A;  2VPZ B;  3Q24 A;  5KG5 A;  1EHW A;  5HN0 A;  2AIR B;  3K57 A;  2FPH X;  4M5M A;  3W61 A;  4YS2 A;  3FGV A;  1RZM A;  2HWI A;  3DDI A;  5BYQ A;  4TU7 A;  3DC2 A;  1X4F A;  3OXF A;  2WVD A;  4OYP A;  1KTV A;  3DLJ A;  4LJM A;  1D8Y A;  4BDP A;  2I2Y A;  3LP0 A;  5HMY A;  3I87 A;  2VD3 A;  3EVW A;  5E3R A;  4M95 A;  1FRJ A;  4DR7 J;  1KR4 A;  2LEA A;  2XNQ A;  3NXZ A;  1Q7Y T;  4V19 X;  4MAK A;  1BC6 A;  2BQU A;  1JLQ B;  1MLA A;  3GSI A;  3Q23 A;  3MR6 A;  5LMU J;  3JQK A;  2DXE A;  3H2U B;  3EGV A;  4NLU A;  4Y6I A;  3D68 A;  1U2C A;  5B0E A;  4GVB A;  2DRB A;  2W25 A;  2HK3 A;  1REG X;  1M90 T;  2CAD A;  4IKA A;  5G0R B;  3RR7 A;  2PFF B;  2FYX A;  4LT6 A;  3BH7 B;  2V50 A;  2C2Z B;  3DGP A;  4NYO A;  3TAM B;  1Q0N A;  1N5Y B;  1KDN A;  3KHR A;  4DV2 F;  4QQB A;  4EBC A;  3DRY A;  2HNZ B;  4EFA C;  3T6B A;  3NGU A;  1NK5 A;  3FSX A;  3DLE B;  3HFZ B;  1RTD A;  2DIT A;  4BHQ A;  1C4C A;  2YQ3 A;  1X4E A;  3R5A A;  1XK8 A;  4PWW A;  4ZP9 A;  5F8G A;  1IJF B;  3CIM A;  4JYA J;  4J9O A;  5E3P A;  4GO7 X;  4NLX A;  2B9E A;  3OR1 B;  4C0H A;  4QWC A;  3HPO A;  1TKD A;  4F36 A;  3O3L A;  1XJW B;  3UDV A;  3VAM A;  1VQ7 S;  4G65 A;  4O3O A;  4JI2 J;  2ROG A;  4DG1 B;  1OO0 B;  1ZM9 A;  2RF2 B;  2XEX A;  1KWM A;  2EI5 A;  2ZKT A;  3TZW A;  1T03 B;  3MEE B;  1N32 F;  2DRA A;  1S0M A;  2APO A;  4H4O B;  2QMW A;  3AB2 B;  3OT9 A;  4RL1 A;  4JI2 F;  1GXU A;  1S99 A;  3FEZ A;  3N6M A;  3U1N A;  3PRB A;  3AA9 A;  1VQM S;  2HMI A;  5F9N A;  3ZXW A;  1UFW A;  3L7U A;  1VFJ A;  1KBR A;  2Q79 A;  2HWT A;  4FP9 A;  3V6H A;  2CNO B;  1E6V A;  4KFB B;  4RNM A;  4YR2 A;  2L41 A;  4NZ7 A;  1D9A A;  4FXV A;  2NZ4 A;  1JLB A;  1LWC A;  4KIA A;  2FZC B;  2V8H A;  3DFE A;  2W9C B;  2PMW A;  2CQ0 A;  4ED3 A;  1J5E F;  3R7B B;  1FJG F;  1LFP A;  3V2U C;  2ZBI A;  2U2F A;  4PWD B;  1RKI A;  4G3I A;  3L4B C;  4HT5 A;  3RBZ A;  1MWQ A;  1FRI A;  1MRO A;  1HW8 A;  1HHQ A;  3BGF A;  1M0S A;  5HJY A;  4F7V A;  1JLC B;  3KUH A;  1WJ9 A; 
#chains in the Genus database with same CATH homology
 2XYH B;  4ZVS B;  5K20 B;  2Y0B B;  3NS7 B;  4DCO B;  3IBF B;  4ZVU B;  4DCJ B;  3RJM B;  1QDU B;  3R5J B;  1RHK B;  3KJF B;  2HBR B;  1IBC B;  3EDQ B;  3D6H B;  3IBC B;  2H4W B;  3P45 B;  1RHU B;  4ZVR B;  1RHJ B;  2XYP B;  1RWW B;  2QLB B;  2C1E B;  2QL9 B;  1RWV B;  1SC4 B;  2XZD B;  3P4U B;  2FQQ B;  1SC3 B;  3D6F B;  3GJS B;  4ZVP B;  3GJR B;  1RWX B;  2XYG B;  1RHQ B;  4ZVT B;  3R6L B;  2H65 B;  2QLF B;  2HBY B;  1QTN B;  3GJT B;  1SC1 B;  3R6G B;  2C2M B;  3R7S B;  2H51 B;  2HBZ B;  3D6M B;  1I51 B;  4JB8 B;  2HBQ B;  3R7N B;  2C2Z B;  2C2K B;  2CDR B;  1F9E B;  4ZVQ B;  2C2O B;  2H4Y B;  1PYO B;  1I3O B;  1RWK B;  2CJX B;  4LSZ B;  2CNK B;  2CNL B;  1RHR B;  1GFW B;  1RWP B;  3KJQ B;  2XZT B;  2DKO B;  2CJY B;  2CNN B;  2QL7 B;  1BMQ B;  2P2C B;  2H5J B;  2QL5 B;  5IC4 B;  1RWN B;  1NME B;  2H5I B;  3EDR B;  4DCP B;  2CNO B;  3GJQ B;  3SIP B;  3QNW B;  2H48 B;  2Y1L B;  1ICE B;  1RHM B;  2H54 B;  3R7B B;  1RWO B;  2QLJ B;  4ZVO B;  1PAU B;  3KJN B;  5IC6 B;  1RE1 B;  1RWM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...