2NS1B

Crystal structure of the e. coli ammonia channel amtb complexed with the signal transduction protein glnk
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
113
structure length
113
Chain Sequence
SMKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEFSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTGEADEAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/signaling protein
molecule keywords Ammonia channel
publication title Inhibitory complex of the transmembrane ammonia channel, AmtB, and the cytosolic regulatory protein, GlnK, at 1.96
pubmed doi rcsb
source organism Escherichia coli
total genus 25
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ns1B00
1P1LA 2EG2A 4R25A 1OSCA 4RWWA 4E98A 1O5JA 3L7PA 2J9CA 1UFLA 2XULA 1XK8A 4Y65A 4C3KA 4CO4A 4IYQA 3AH6A 4D3GA 5DS7A 2ZOMA 3TA1A 2NUHA 4WK1A 4YB7A 2GX8A 4YB6A 4C3LA 2RD5C 4USHA 4OZNA 5D4PA 4RX6A 1VFJA 3MHYA 4WK3A 4D3HA 3AA9A 2XBPA 2VD3A 4C3MA 3NCRA 3TA2A 1UMJA 1V9OA 5D4OA 5L9NA 3OPKA 5D4LA 3NCPA 1QY7A 5D4NA 4AFFA 4CO5A 1NH7A 4CO0A 4NYOA 2NS1B 4CO1A 1NZAA 4RLEA 1GNKA 4USIA 4CNYA 1HWUA 2XG8A 2NUUG 4Y6IA 1UL3A 3CE8A 3HLUA 3AA8A 4OZLA 2J9DA 1VHFA 2CZ4A 3AHPA 1NH8A 2GNKA 2V5HG 3NCQA 2O66A 4YB5A 4OZJA 2E66A 1PILA 3BZQA 4RWXA 4CO3A 3TA0A 4ZK7M 3O5TB 2O67A 1UKUA 3N5BA 4USJC 2JJ4D 1J2VA 2ZFHA 5DRKA 1NAQA 3O8WA 2Z0GA 1V3RA 2DCLA 3M05A 1KR4A 3X3UA 2J9EA 2PIIA 3LF0A 2XZWA 3DFEA 1O51A 2J9DE 4CNZA 3GSDA 4CO2A 2GW8A 1H3DA 4NYPA 1V6HA 1V3SA 1Q1KA 3T9ZA 2EG1A
chains in the Genus database with same CATH superfamily
3FEXB 2AD9A 2WVDA 4M5MA 2IC3A 3PZPA 4O44B 4ZVGA 1WC5A 2Y1JA 4TU7A 1FVQA 3W63A 2XSJB 3V6HA 3GTYX 5LL6d 4EFAC 3GPAA 4F3MA 2DH9A 1VC5A 3G6ES 3QWPA 4RNNA 1QVGR 3QRPA 4B9TA 4P7VA 2MEWA 3I5AA 2GC8A 2PT0A 3AQOA 2OEKA 1HNVA 1RLCL 3AFGA 1PGZA 1TL7B 3CJTA 7AT1B 3W64A 3Q23A 4JYAF 2ZKUA 3M8ZA 3KHGA 4RW9B 2CJBA 1U2CA 3DRRB 5HI7A 4A4JA 1FVSA 1S5ZA 1TL4A 3TVKA 2B51A 4E8UA 2WBMA 5THWA 5KG5A 4WP3A 2J0WA 2J6SA 4A8OA 3JSRA 4DFKA 1P9YA 1T3OA 1JX4A 1S59A 3RB3A 1VS3A 4DR6J 3CMQA 2HEKA 4TY9A 4DL0C 3R5GA 3K2YA 5CYMB 5GMEA 4WE1B 4QYZK 1DRZA 3ZC4A 4YOEA 1KEKA 2M0GB 4Q8FA 3OSPA 4ED3A 3PX4A 1RTJA 1RT6B 1S10A 5LMNJ 2EFPA 1LK7A 4ID5B 5F8HA 4KFBA 1SKUB 4C8LA 1WNEA 3J7YU 4NI2B 3FRYA 4PABA 4HTIA 2KRRA 3BGOP 4IQXA 5I3UA 2W01A 4EK2A 3R7SB 4AFFA 3CNQP 1TL1B 2RKIA 1WSVA 2QLBB 5GMKa 1RWNB 1S0NA 5M2PA 4NWBA 1M5PC 3LTOA 2G0IA 5KG6A 2B9EA 4ZIVA 3G8SA 2HLTA 3BO4A 1B0VA 1MROB 4ZP9A 4ZK7M 2EFNA 4J9VA 2P9EA 3R5CA 4I4BA 1D9FA 4JOUA 1FXRA 4QR2A 4CWBA 1E6YA 3KUHA 3OR2A 1SH0A 3D67A 1NNDA 1TL3B 4L75A 2DO0A 1AXQA 5HMZA 4CLSA 2AYEA 2GIFA 5CYJA 4NXNF 3GJRB 4ZPTR 3BQ2A 1QM9A 5CXTA 1TKTA 5FDLB 2ZM6F 1BLUA 3VWSA 4JP8A 4TQSA 2EG1A 5T7LA 2IDLA 2HGNA 2UUAF 3V4IB 3DXSX 1CJKB 4KH1B 5KAKA 1N32J 4JV0A 2RVJA 1RA7A 1DFDA 4ILMA 1VRUB 4LIWA 2DGTA 3HHNB 4Y28C 2RH3A 1FFSB 1I3OB 2H5IB 1L3SA 2AEJA 4DX7A 2G2OA 2IJRA 4YB6A 2MKIA 3VZHA 1IKYB 1UVLA 4A47A 2YX1A 1N6QB 4EO8A 4YFUA 1J5EJ 4FVMA 4Q8EA 2AX0A 1ZZFA 2C42A 4USUA 2BR0A 2EW9A 1R0BG 2EWHA 2W7OA 2LP4A 2OO4A 1CG2A 4QWBA 1J5OA 4OX9F 3KK3B 2BKOA 4ZCIA 1FO1A 2R7WA 2HNZB 1JKHA 5KOWA 1WTBA 4R8UA 1BQMA 2CADA 2KHDA 3AD9C 3EXYA 2NLWA 4OZ5A 2E5HA 2JX2A 1WC4A 3EDRB 3VAKA 2CPHA 2PD1A 3PCOB 2Q79A 3ISND 3GONA 2LU2A 2VPZB 2B9XA 3BQ1A 3Q24A 4PQAA 4FS1A 1XMQJ 3QBCA 3HX9A 3EWGA 4ER8A 1IKWB 1N52B 1XTZA 5LXRA 4ECZA 3H2UB 1FXDA 2XY5A 3D66A 2VG7A 5D4PA 5KFCA 2HWIA 1XNRF 2ZOFA 2OPSB 3DLEB 2OFHX 4UOHA 2H9ZA 4DSKA 3VQTA 3CEDA 2ASYA 2ZBPA 4GO5X 3D6TB 1N48A 2ZH2A 4GRSA 3H98A 2HYIB 1RABB 1L3TA 4LQ3A 5D6GA 3N5BA 2L08A 2RNEA 2DNGA 5FD1A 1TKXA 4AD6A 5D8HB 4ECSA 4RZRA 5DJBA 4CH1A 4QCLA 3KJVB 3PO5A 4OYIA 4BC9A 1CC8A 6AT1B 2W4DA 2IAJA 4PWUA 4WZQA 2JVRA 1Q8KA 3PVXA 4NASA 5L1JA 2BBEA 2XLJA 2CQ3A 3NRBA 3JTPA 3M9OB 3IBCB 3MM5B 4M5KA 4DR5J 1GXLA 2ZH9A 1WG4A 4DV7F 2WTFA 3D1HA 3DRRA 2M3DA 3SQGB 2LEBA 3TX0A 3JYTB 5HL7Q 3M8QB 1M5SA 2LYVA 3DC2A 3H5UA 4K4UA 4PZVA 4K8RA 4B9SA 2QT7A 2CWKA 2J9DA 3IG1B 2JFDA 4K5RA 3CMAS 3N6LA 4WE1A 1YRUA 3MXHP 2AJ1A 5G0RB 5GMDA 1YBAA 3VHQA 4ED8A 2V8VA 4FF1A 1FDAA 1JNRB 1RT6A 4S0MA 5A8WB 4DR3J 4KRWA 3AB2B 2JZ5A 5L1LA 5C25A 4RW4B 1S1UA 3C2PA 4N41A 1TAUA 2VZ9A 3CC7S 4DLEA 3UN3A 1X9MA 4R25A 5E33A 4KPYA 3HI9A 3OTDA 2IJFA 3CW2C 4LF9F 1FNOA 4DPOA 2A2DA 4HH1A 3BF4A 2V4QA 3QZ7A 1CJVA 2K2PA 3LALA 4M63A 2GA7A 3B78A 4ERDA 2KB2A 3Q8YA 2XLIA 1UW9A 3TQEA 3MR7A 1VRTA 2RMLA 1U8SA 1VISA 4K4ZA 4RW6B 3M6VA 1REVB 1SQFA 3OHAA 3C6TA 4IQMA 1QAXA 2OLWA 4EI2A 1Q0NA 2IVMA 2YNFB 2DR6A 3U1LA 2J0XA 3ZZPA 3BGFA 3OVBA 3BV8A 4PG7A 2EBGA 1S0VA 2JLFA 4OI4A 3H2LA 1FRJA 2CAJA 1RB0A 3M9NB 3L95X 3RRHA 1YG0A 2HQCA 1TKZB 2DNNA 4X2BA 2YWFA 7FDRA 1RWMB 3J7ZT 2CZVC 4CM0A 2B43A 3BSOA 1B7YB 1DZ5A 2HVIA 3WC0A 3T9ZA 1GXTA 1FKOA 2EG2A 2PDAA 4DN9A 3MAAA 3GFYA 2DEIA 2OKQA 1FJGJ 4TN2A 1S48A 3P45B 2CQ0A 3BR9A 2DR9A 2NZCA 1WELA 5ETTA 1TZ0A 3JAMY 4CM2A 3T6BA 3KK3A 4DV0J 1FD8A 3KMSA 4DF8A 2HNZA 4U95A 2NREA 1Q16B 4CYUA 2RQ4A 2EVZA 2CDRB 4USIA 3W1YC 1T9XA 4OI6A 3IS9B 1PBAA 1S6UA 5ETNA 2WRMA 3MPUB 3P49B 3CD7A 4P72A 5EWFA 4YDXA 2C3UA 2YNGA 4ZCMA 1WDTA 4LRCA 2WW8A 1FT8A 3DLBA 3HHEA 1F5AA 5DQGA 3G96A 2W7AA 2LLZA 2A18A 3TNVA 2LXFA 4I6YA 5I42A 2C3PA 3G4SS 2OP5A 4OYBA 1SUQA 1AB8A 1FWLA 4C3LA 1PSDA 1CPZA 4JI0F 5BYRA 5IT4A 1NB2A 1HR0J 3I31A 4DV3J 2B4UA 5KG3A 4X84A 1YX2A 3TUJC 1UVJA 4OYOA 4LF8J 3DRSA 4N7TA 2E1PA 1QUPA 1UL3A 4G6VB 2CPEA 4PRFA 4JI2F 1WKLA 5HJXA 2KXHA 1AFJA 3NGTA 2VBXA 1B64A 5A8KB 3GJQB 3FBCA 3CIZA 1ZAXA 4USJC 4WFXA 3UDVA 4TKTA 2Z0GA 3SCLE 1V3RA 5HQMA 5CQGA 3KOAA 2KM8B 3MM5A 3M1VB 5ETLA 4RNMA 3D2WA 3RGIA 4DQPA 4ED2A 4BLGA 4DX6A 2QMUB 2CNLB 4JBCA 2W1BA 5CAAA 2ZOGA 4P2MA 3R7NB 3LAKA 4ZCKA 3GR0A 2MY7A 4NLTA 2XO6A 3UCZP 3R27A 4FDFA 5IC4B 2DNLA 4BCAA 4DQSA 5LJ5Y 4ZJOA 3P8BB 4V19J 4CH7A 2MJNA 1LEOA 1WHWA 4Y0FA 3SYZA 5F0UA 1NKEA 2CPYA 1QJHA 2ZH3A 4DV2F 1S4EA 1ICEB 2QFIA 5C42B 4O4RA 3CXCR 1RWXB 1PILA 3T1HF 1Q7LB 4A8MP 2LVWA 1S9EA 2V63A 1VHIA 4EZ9A 1YJNS 2BRKA 1GXUA 1S72S 3B54A 5EDWA 1JLGB 4ZP8A 3PR4A 4FS2A 2YWHA 4DG1A 3EZOA 3TAMB 1NBEB 2PMHA 3UNGC 2C3YA 4MFBB 1T11A 2CQIA 4MH8A 3MEEA 4NYPA 3ETOA 2CNNB 4PXEA 5J2NB 4DS4A 2J8AA 3VQSA 1JLAA 3G2XA 5JMNA 4MYTA 4D3GA 2XMWA 2V34A 8ATCB 1GX5A 2Q6BA 2YNFA 3NKYA 3WC2A 1OPIA 3PHTA 1O8BA 3NCRA 2RQCA 2X51A 1GT8A 3MFIA 1PG5B 2VG5B 1V9OA 3TWZA 1ZTWA 3ZTSA 2JRSA 1FX2A 3S01A 4RUHA 4IRKA 3NL0A 5K8OA 3LPYA 4ZJLA 1TR0A 1TKZA 2X1GA 2VIHA 3PXGa 3D28A 4OZLA 5B0CA 4C8OA 4X4PA 1P1TA 3CO9A 1AYEA 4I1TA 2E66A 3BGRA 3LP2A 1KVJA 5HP1A 3ENQA 1HA1A 4C8KA 1SJ1A 4ZPDA 3A3PB 1YJVA 3TZYA 1XMOF 3E3XA 2MJUA 2UVVA 4NLXA 3GFXA 3MMJA 4LSNB 2UU9J 2OGUA 1SV5B 3W2WB 1VQMS 5CA5A 1HQEA 2VC0A 3PEJA 4B3MJ 3OL6A 1VIXA 1QUVA 4CLKA 3GWCA 5KG0A 3OTOJ 2FLNA 4M8LA 2ZH7A 4J37A 2VFUA 5H9FK 3M2VA 5JJBA 1N0UA 3GV8B 3IM8A 2VH7A 2D69A 4QWDA 1FHTA 3HHLC 2GIQA 1DQAA 2OUGA 3MAQA 1R6VA 1WF2A 3M8SA 4U96A 4HACA 1IKXB 2JDJA 1Q8BA 4DSFA 2NS1B 1N34J 4C0HA 3PIOQ 2CJKA 3TUPA 3HLUA 4IH7A 4LFAF 1UTAA 4DU8A 3QRRA 1C1BA 1T9UA 1KHWA 4FBUA 3K5OA 1IWAA 3NGDA 1PJ6A 1IBKJ 1KP6A 2IRUA 2GAGC 1AT1B 3W60A 4P6QA 2N7YA 3LP0B 1VBYA 4QPXA 2QC3A 1JJ2R 4UOGA 2L48A 1GMVA 3PJ9A 1Q7YT 3H7HB 1U2FA 3QJLA 1LXNA 2CQ1A 2G13A 2EC0A 2J9EA 5GADI 4M5HA 3Q8UA 4UW2A 1LFPA 1U1MA 2HAFA 1HIYA 3FQKA 2JLGA 1MW7A 5EX3A 3RW7A 4F7VA 3BYPA 3FSYA 1RSCA 2V8HA 1RWPB 4JB8B 1VGYA 2QV6A 3I0RA 2H4WB 2QSFA 4WF9Q 4RKUC 5IT9Y 1APSA 3BR8A 1Z2LA 3UR3C 1I94J 4IG0A 3RBXA 1U24A 2OELA 2DHSA 4CO1A 1IM4A 2JSXA 1LW0A 2VB6A 4H4OB 4O3QA 3JTOA 2B6AB 4H4KC 4F4ZA 1N33J 4AT1B 5HK4A 2ZNYA 2K1RB 4K0KJ 2L9DA 3TX8A 3CPWR 4IFVA 1X5PA 4FN5A 2D41A 1H0HB 2GHVC 3TANA 2R8GA 2QG9B 1ZPWX 1HQUB 1RTIA 4DPWA 1H38A 1VI7A 2ROGA 4DFPA 2EBEA 5B0DA 3ET6A 2RU3A 2C3OA 1M5OC 1EKSA 4PEOA 2YXLA 2KYZA 3SSQA 3I9ZA 3JQKA 1CJTB 1RHMB 3P3DA 1YLXA 3NMAA 2P5VA 5H1SV 2DVIA 3UD5A 2VV5A 1HMVB 3V5RA 5E7OB 2I2YA 1HI1A 2GVZB 3TA1A 2AEMA 1QAYA 2XMAA 4TVAB 1ZM4A 2DGWA 3MURP 2RD5C 2N4DA 4USTA 4NA3A 4QOTA 3ZTOA 4I68A 1KVIA 3J7AN 3DI6B 2GMHA 3CCMS 5JXSA 4DX8H 2V69A 4EBDA 2V2VA 3D0HE 1LW2A 1NK9A 3PR5B 1TUGB 1SH2A 3FJ2A 2FVCA 4R0EA 3MD1A 1U26A 2ZHOA 2RIJA 1MNEA 1C0UB 1KONA 5IM0A 4O4GB 2C2DA 3MMCB 3PJWA 5KG4A 2JJ4D 2YKPA 7FD1A 1WORA 3O3LA 4Y34A 2GZOA 1AW0A 1TMMA 4R5PA 1YHQS 2ZH6A 2E1AA 1RA6A 4X4VA 4C11A 1F1BB 4I64A 1KQGB 2G2ZA 3DFEA 4PXCA 2DYAA 3N01A 2F40A 2UXDJ 3GYGA 2B9YA 3A4TA 2PA8D 1Q95G 2HRUA 1U48A 2BQUA 4PWWA 3ILLA 4KJIA 3AB4B 2ZHAA 1UA1A 1SIZA 2Y9HA 1FRXA 3AD8C 4WXOA 5HLFB 1R0CB 1FFWB 1DQ8A 5BR8F 1NRKA 4LSZB 4PQUB 4F4KA 4A8FA 4QU6A 2WVCA 5KFUA 1LWEB 2EKNA 4JV1A 1BWEA 5KFPA 1HWJA 2ZJPQ 3V4MA 4UY8T 3DDIA 1ELOA 3MECB 1S6PB 1Q5VA 4KH0B 2LDIA 3W2WA 1EZZB 4XDCA 3T5JA 2BOAA 1P27B 3QWUA 1CC7A 2EFOA 3NNCA 4X66F 4LF1A 1LOUA 3ZTPA 4WTOB 1X4AA 4ZMMA 3BQ0A 1HNZJ 4K4VA 4CQ1A 1S6QB 1RT4B 1SJ4P 2W8KA 4OYAA 2E1MC 4OYZA 1S9GB 2JOQA 4TQRA 5E5NA 3UN2A 2JEIA 4FKYA 2HFZA 2QA2A 2KZZA 1DTTA 1LFWA 3V6KA 4I69A 1REGX 5F41A 2HHWA 1IBLF 1NDPA 3X1LB 2XWXA 1HPZA 4WK3A 1S1XB 3FCVA 2HGMA 2Q1LA 3ADAC 4I7FB 2BXJA 5CH7B 2EK1A 2GS8A 1B3TA 4A48A 2V2ZA 3A8KA 1FDNA 2MQQA 3AXKA 1VC6A 3LP0A 1EQMA 1GX6A 1G1XA 4JV5F 2FUG9 3I0SA 4ELUA 2WVEA 1F5BA 3M2RB 3RRGA 2GO9A 1VQ6S 3OBIA 1SPBP 1FWKA 4LF6F 4QBUA 5E3AA 2CXEA 3IBFB 4PAAA 2XI2A 1OIAA 1PIEA 1HD1A 4RNHA 2DR5A 1Y4ZB 1CULB 2M5YA 2QA1A 1H2VZ 4FYYB 1WG5A 2W9BB 2UUTA 3H8YA 3UNYA 2CJAA 2OHDA 4Z37A 1SC1B 4KY3A 4OYXA 4N47A 3BBBA 5CABA 3H0PA 2LFVA 5FLXY 4G1QA 5D3GB 2GVDB 3SBMA 4H4OA 2B6AA 4W92B 3MPVA 3K7RA 1NPPA 4MJKA 3K17A 2K1RA 4NLWA 1ITPA 1UWBB 3RBZA 3NXZA 3Q2TC 2UXBF 1MMLA 1S7HA 4B3TF 4WU2A 2R7OA 3GIKA 1KQSR 4IO9Q 1FRKA 1Q4RA 2WVBA 3PYGA 4CLPA 1WKKA 5J1NA 2XB2D 2LCWA 3QAEA 3UR0A 2N3LA 4IFYB 3F44A 3PX6A 4DCJB 2GMLA 1RYSA 4W98A 4X4SA 2E44A 3HHLD 1HFEL 3QJJA 1TK5A 2DNZA 3BH7B 4J9UE 5HVGA 2HQGA 4LVNP 2YTCA 4DL5A 2FHJD 1BC6A 4ILLA 4CI0B 5L38A 4IG3B 2BW2A 3QYYA 2IBOA 4CDIA 3JB9k 1RCOB 2BACA 2MDAA 1G6BA 1RYRA 1HWKA 2FLLA 2DNQA 3DLKB 2HAIA 1NM2A 2OTLS 4V19X 3DRYA 3QO9B 3S1TA 3FFIB 5A6PA 4O4GA 4F0MA 1JK9B 3V2UC 5MAOA 4LFBF 4NYOA 2XS7A 3RB0A 1NDKA 2HVDA 1W2BR 5GADU 2EKYA 2EC2A 2Z2ZA 2VICA 3NBPB 1JLFA 5GAEU 5AJ3F 4YB5A 4NXMJ 2PN6A 2IM2A 4H4MA 2CG4A 4RR5A 5L9XA 3W9JA 1B70B 4G1IA 3U27A 4WXWA 4M5JA 3OXGA 4L3NA 1T9VA 2D3UA 2YKMB 1RADB 2NXEA 2LU1A 4DR7J 1KR4A 3X3UA 3EPIA 4RUAA 5HLFA 3KHHA 1Y3JA 1M1HA 1Q1KA 4LBHA 2HVHA 2VOPA 5K14B 1B99A 4M94A 1BXNA 5DQHA 4R0JA 2QL9B 3QATA 1U47A 3K5LA 1Z2ZA 4NLOA 1AA1B 3NAHA 3G82B 1LWEA 4NRTA 1RT2A 4P2XA 1UWAA 4GKJF 3CJ2A 3QSIA 2DEJA 6FDRA 5J2MB 3RTVA 1X5TA 4KGXB 2J7UA 3CJ4A 2D3OR 4LBIA 2M4MA 2RILA 3DLHA 4I2PB 1KD1T 1IBCB 2K3IA 3AODA 2BKPA 3KJFB 1N5VA 5KG7A 2PA3A 4OX7A 4NEZA 4OYWA 4Q45A 3CD0A 2KVIA 1S6QA 5LT5A 2MKKA 4JYAJ 4OV6A 3Q8SB 3SXLA 3EGVA 2IFXA 3PM9A 1RU1A 1JXEA 4DEZA 4A8QA 3FUYA 3LGHA 1T8EA 1DLOA 2VC1A 3MMAA 2XCAA 5DETA 1CVJA 4ZVRB 4NPOA 3FCWA 5KFMA 5B0AA 2LA6A 2UXCF 5BYSA 2XMMA 4OHXA 1ZM9A 2YX4A 5HO4A 3IWXA 1ZZNA 4I7FA 1GMUA 1LWFB 3NS7B 1S1VA 3DGPB 4EUVA 3CD5A 5IQ6A 2W2MP 2HVZA 1UJ5A 4XIUA 3QT5A 4KGKA 4J91A 2Y0SD 4JI7F 1OYEA 3K0JA 2R4FA 4UZBA 4USHA 2JEGA 2H1YA 2VD3A 2AZ3A 2MLZA 2CPFA 5J2QB 3BN4A 4OZ3A 4URSA 3WQPA 1X4EA 3TARA 3OW2R 2MPUA 3AJ2A 3CCRS 1XR5A 2DT9A 3R2DJ 2PO4A 5IOLA 3OXFA 1WI6A 2FVQA 2CZ4A 4TY8A 2R7VA 3H25A 4KQZA 4QYRA 2ZD1B 3HZGA 3MMBA 4EU0A 1HBMB 2F9JA 4PKDB 2HHUA 3HD2A 2YKQA 2ZC4A 4OFZA 2DR8A 2ROEA 2LMIA 2O01C 3MD3A 1RAEB 3KNAA 4UY85 1G3OA 4CNZA 1KBRA 2XGQA 4HL9A 1RWOB 3Q86A 4ICLA 3MFHA 5DQIA 4TLRA 3OHBA 1O5JA 3RAMA 2R2RA 4J5OA 3PYEA 1T03A 1BUXA 2AJ2A 3HHDA 1WTFA 3PX0A 2I6WA 2PFFB 1EAYC 2Q3PA 2V8DA 1SJFA 3QMQA 4TXSA 2DY9A 4TU9A 2E9RX 3QFWA 5L9NA 2UV8A 1K1SA 3QGHA 1D3WA 4MKBA 2KDOA 3OR1A 3KJQB 5JVHQ 3RBEA 4WU3A 4PPDA 3EX7B 2JL9A 2ZVIA 5KOXA 1ZS6A 3EVOA 1RQ0A 3CJKA 4OX9J 2KXFA 4U8VA 2B8QA 4DMZA 5GAHI 4TYBA 3QT7A 1RACB 2ZFHA 2CPXA 4ZLNA 2WSEC 1OS5A 2RHSB 4DR1F 4NRUA 1FJ7A 3QQCD 3DU6A 3I9V9 1PBUA 2BE9B 4X64F 4K2JA 5LXYA 3FRZA 3FBEA 1PC5A 4F8RA 4E98A 4LSLA 5CD4H 1FK9B 4OMFG 4I2QA 4PPZA 1N56A 2E5JA 2BKNA 1NXIA 4A8WA 5D77A 3I55S 4Y65A 1DAXA 2AP6A 3OTBA 3QNWB 3DLLQ 3BJYA 4HLBA 5JVGQ 4FPRA 4ZPBA 2FDNA 3QLHB 5ADZA 3J81U 1N4LA 2XO7A 1HWLA 4B9UA 4CO0A 3VZIA 4GVBB 4RLEA 2RJZA 2VBYA 3RU0A 2R7SA 3K8VA 4ZVOB 1XN9A 4ILRA 2ZH8A 3E01A 3KG4A 4XK8C 1D1UA 2QO3A 2R7UA 4ANEA 2I8EA 1JLBB 4NZ6A 5K14A 1KLMB 1RT1B 2WOMB 2MGZB 1SL0A 2FQQB 5IFMA 1RTDB 3OL7A 2FJXA 1I5OB 3G82A 1N5SA 3DYAA 3PG9A 3J7A1 1Y5LB 3SMZA 1Y10A 3NOGA 5A76A 5AE3A 4I2PA 1HNIB 3M8RA 3BSCA 1U6FA 1DQ9A 4U8YA 3M4XA 2XMJA 5RUBA 1Q86T 3T5HA 5DS7A 1VJWA 4GVLA 2APOA 4NLSA 5F8JA 5KG1A 2KJWA 4DUTA 3FNNA 4DV7J 5J1EB 4O0IA 3CCQS 4UF4A 3T6JA 2PFDA 2OPRA 5KFRA 2XMVA 3HHLB 2HQIA 2VG6A 1OY9A 1RKIA 4U6PA 2LDYA 4Y6IA 5J2PA 3GV5B 3KUEA 1JXVA 3DGVA 1SBRA 1NMEB 3C6UB 4PR6A 3QIDA 2WW4A 3JSMB 1U1KA 4K4WA 2ZE2B 3A3NB 2POKA 3OLBA 4I67A 1A9NB 2P6TA 3MPYA 1WF1A 3H40A 3KKFA 1NK7A 4F25A 4C6AA 3VF0B 2CZ9A 2W2PP 3RYLA 5LM7E 1IM6A 3A3OB 3ENVA 3H4BA 3CMES 3HULA 1YJWS 2RRBA 3PJXA 1FJEB 4ZVQB 4OQJA 3D0IE 4A8XA 3HPOA 4ED6A 2DNPA 3MM8B 1T95A 4P2FA 3SSRA 1UVMA 4G65A 2IVYA 2ZD1A 3DM2B 3AOAA 1YSJA 3MUVP 3MM6B 4LRBA 1WHXA 2F5GA 1T7PA 2R8JA 3OFFA 3KLFA 2M88A 4WFNQ 2LKZA 1KQKA 2HIYA 3C15B 5CCMA 1PCAA 1FRMA 4MIAA 5ETQA 3V6DB 1J5EF 2C22A 4NA1A 5A0YB 5EN1A 4LMZA 3CF5Q 1JNZB 3M7VA 1GAOA 4EBCA 3ULHA 3KLIB 1XJWB 1NK8A 4IDKB 1RT7A 1D9DA 4J9SA 2DD8S 5AT1B 4N8OA 2E7VA 1W25A 1X4HA 5KTQA 3IR5B 5HQLA 3NWRA 1V6HA 3AY0A 2DXDA 4M5NA 2QL7B 3QIPA 3G6VA 1HW8A 2R8HA 4ED5A 2FJBB 1JWWA 3L7PA 4F2RA 2IC3B 3NMRA 1NDCA 4N77A 1N88A 4PG6A 3HSJA 3CCZA 4WYLA 2HK3A 2HHVA 4NCBA 2J76E 4M95A 1M1GA 5DG8A 4USKA 3P6YC 2LQBA 4U9RA 3EMTA 4FF3A 4OYMA 1NSQA 4ZPWR 3VGUA 3TO8A 2QYCA 1RJJA 2ASLA 5IV3A 2B9WA 4QIEA 4FF2A 4QWCA 2EEYA 5D0EA 1HNVB 1C1CB 1WD6A 9RUBA 4JI8F 4QIWD 4EYIB 1U09A 2D9PA 2JNJA 3IRWP 3CCES 1CJUA 3LGMA 3O8WA 2XZDB 3GU0A 2QYGA 1YJUA 2A3JA 3OD2A 4JI3F 4CLZA 3PNIA 5D78A 5C24A 2J9DE 2PE8A 4NE9C 2I5JA 1NCLA 2KT2A 2I1RA 3BKUA 1X7VA 4F26A 4RBTA 1R31A 1PAEX 1DARA 4USVA 1MWYA 4J7CA 4C3KA 3O6QA 5DGBA 3BPSP 1L3KA 2ZNZA 4AXJA 1RTJB 2VJVA 1V3ZA 4L72B 3TJAA 4WKYA 1JLBA 1S1WA 4GC7A 4P2SA 2WOMA 4GKKF 5I3UB 1HBOA 4CO5A 1HKAA 5HJYA 2FHKA 2GFFA 1KDNA 2RKIB 4DL2A 3NY0A 4DR5F 3NNHA 5BJRA 3UDLA 4JI2J 4KGMA 3FMBA 3M8YA 4PG4A 4DSLA 5DG7A 2XYPB 3DOMB 1NAQA 3C3LA 1HI0P 5KFFA 2LQJA 3OR2B 3V81A 3OL9A 2P9GA 4OJGA 2PIIA 4L74A 2JC1A 1WUUA 4NLVA 2HHQA 3EM1A 2LQ5A 2RHQB 3C16A 5T7LB 2NSCA 2BJEA 1JLCA 3IXQA 2FJDB 3HHLA 2V50A 3DOKA 5KFAA 5KT2A 3OTCA 5GAGI 3K5PA 2IVFB 3CJRA 4B3SJ 3CDAA 4U7UK 2ZWPA 3T1YF 3GYXB 3RG6A 3JSMA 3OPKA 3PW5A 1RGVA 2V8GA 4RJVA 2A6OA 4DLGA 4A8KA 4Y3CA 1NJWA 2HHSA 1S97A 2QJ3A 1N5YA 1Q5YA 2YWGA 1RAOA 2DY1A 1TFWA 3E2EA 1TKDA 2DGUA 3G6XA 1DTQA 3Q8PB 4OI1A 1JKHB 2YPZA 1Y7PA 4R8UB 2HFVA 1BQMB 1VR6A 2QRRA 1K44A 4FZVA 2HZVA 2KYXA 4DV1F 1V3SA 4DWIA 1KKHA 4YY3F 1S77D 3RR7A 1RAFB 4B02A 4DHVA 3JSBA 3D5MA 1U0HA 2HQ3A 3SCKE 1N5QA 3B8HA 3BPDA 4ED4A 3FEYB 2K7KA 1S9FA 4FYWB 3LP1A 2WSFC 3M8PA 3FC9A 2VG7B 3V6DA 4ITSA 2H51B 4H4KA 3CJ8A 2YY3A 3NWGA 4O0NA 1FJGF 4C98A 5HSPA 2C2RA 3MDFA 3GG0A 1AUSL 2BRLA 2XG8A 3PW2A 2NUUG 4B08A 4ELTA 1VHFA 2FB0A 4DV0F 1WI8A 2GQQA 2UVUA 2BQ3A 4XO0A 2XGPA 1MU2B 2BE2B 2AF6A 3G9CA 4WFAQ 1XMOJ 3JAMU 3NLCA 5KFOA 2YNIA 2JVOA 3D54A 3OTEA 1TKXB 2IRXA 2RF2A 2X1FA 4NOHA 4NCAA 1OQ6A 1NUEA 3PO4A 3ZZ0A 3M2UA 3OFEA 1C0TB 4ZVPB 1TK8A 2PI4A 2OPPA 4DV4J 1XK8A 1VK8A 4ZHRA 2IAJB 3GIJA 1XNQF 2GX8A 3G8QA 3NOCA 1C1CA 4HH0A 4O3NA 1UPMB 4ID8A 3LA0A 2V67A 5D4LA 4HDGA 4DV5F 1YBUA 3HM9A 3GB0A 1YITS 2MZRA 1GH8A 4TNOA 4LFAJ 2KG0A 2G9OA 4DV3F 3HF5A 3GCWP 5AXKA 1YJRA 4F4YA 2WONA 2B56A 3TVYA 3T5LA 1T0TV 1JB0C 1IJEB 2DO4A 2CFXA 4YMEA 2V0NA 4WCEQ 1IBMJ 1SVDA 1FX4A 2XMKA 1QSLA 1FXLA 2CPIA 4RPFA 2HFSA 1RWVB 5C25B 1S1UB 3AT1B 2CQCA 4ECYA 3EYZA 3HZEA 1VQLS 1LWXA 2MHNA 1RHQB 4MK7A 2BANA 1WEZA 1VQ9S 3M32A 3PFEA 2NUHA 4NA2A 4F02A 1B4SA 2BJDA 4RUCA 3K57A 4DI6A 4OZNA 2VBZA 1CJVB 1FF2A 2UUWA 3H20A 4O3SA 1VOMA 2XBPA 4P10A 4AYBD 2J7KA 5LSOA 3MEGA 3DMJA 1UFKA 1RK8A 1VRTB 1FDDA 2KN4A 3DOMA 4ZVFA 5HVHA 1ZH5A 4KKOA 1HHTP 1Y9OA 3DNCA 3C6TB 5DZ6A 3ITHA 2MQMA 1LKZA 3PDNA 1IN0A 2VQEF 5DG9A 2MY8A 1VCTA 3P5TL 1Y5IB 2O67A 3CCWA 4C48A 3DRXA 2PEBA 2R2TA 1BGXT 1IVZA 5LSLA 3FEZA 3PW7A 1QTMA 3LH2S 2VDIA 5HMWA 1C2PA 1R0AA 1FKOB 3I5BA 2BV3A 1UVNA 2W24A 3MAAB 4ANDA 3W7BA 5BXIA 2AU0A 4RW7B 3OJUA 3CGIA 3VCDA 5C5JA 3HVWA 2NPIA 4TLQA 3MR6A 3RB6A 4LBPA 4ZA1A 2DH7A 3W5ZA 4M5DA 3ZFVA 3KHRA 1WOPA 3LQVA 1PAUB 2V4JA 5IWAF 5BYQA 2HPUA 2AWZA 2YBVA 4CYUB 5E41A 3PYFA 2KZMA 2H54B 4CLUA 4ECXA 2XS5A 3FBBA 5L1KA 2IMWP 2AX1A 5KFDA 1H7XA 2HQDA 3O1LA 1A6LA 2IIHA 3ONQA 2RT3A 2QE5A 4RWXA 2UVWA 3THTA 4KC5A 3IRXA 1S0MA 1LV5A 3M8WA 4L6V3 2YNGB 5ETVA 3IFEA 2BJ3A 3BBFA 3DN9A 5F8GA 5A8RA 2M8HA 3R8YA 2HGLA 1KFSA 2W9CB 4CTAA 1O0PA 3P4UB 5I42B 2QA4S 1TUWA 1NPKA 3D6MB 1RP5A 2UU9F 4B3OA 1G4CA 3OXLA 1MN9A 4ED0A 5E2QA 1SUQB 4LIRA 4B3MF 5BR8J 3N28A 1RT5A 4F0KA 1MU2A 1VLOA 1P8GA 2HMIA 1LQ9A 2BE2A 1UAWA 3OV7A 3IM9A 1M90T 1AZSA 3H59A 2WB1D 1F2HA 3BH6B 1RU2A 3DRSB 2MZQA 1IR0A 2MSSA 2OPQA 3ENAA 5EGYA 3BDPA 1RISA 4HI1A 5HROB 1WACA 1NJIT 2FYXA 4X66J 2OSRA 1C0TA 2HNYA 3IAM9 1XC9A 2G0JA 2HQFA 3CCVS 3PRDA 1EHWA 1NHVA 2L9WA 2J0SD 5A6WA 2RDJA 4J9RA 1HWIA 1IBKF 4AUKA 1K0TA 4DQQA 2MQ8A 2N3OA 2EXUA 4AL5A 4CO4A 4ZVSB 5GVQA 3VGVA 1FTCA 4KT0C 4ECUA 1IBLJ 4LFCF 2YWWA 1IXKA 1BQNA 2IDEA 2KFYA 3R5DA 2E9TA 3RRKA 1FESA 3IGNA 2UP1A 4JV5J 2IPOB 4JI6F 2P9CA 3BKTA 2ZITA 2LEAA 1VQ5S 2G1HA 3VAIA 4YDDB 2M8DB 4LF6J 1TAQA 4OJ1A 3TEGA 4RNFA 4E2FB 2GHWA 2Z56B 1S9EB 2XM3A 4YHHF 2XZTB 5IT9U 3PYDA 2O5DA 3EZUA 4MKYA 3Q22A 1MWQA 3T5KA 4C97A 2XNQA 4DG1B 1QSSA 4DDFA 4Q43A 3MEEB 3HJFA 3TZXA 3EXCX 2K3KA 5M2RA 2XHCA 2BUNA 4LQ9A 2UUCJ 1QSYA 5KFQA 4ES1A 4C2MA 4KV8A 3WBZA 1JLAB 1YK9A 5HQ8A 2M9KA 3UVJB 3BDEA 3CCLS 3QT8A 3AD7C 1F3VA 2XHWA 3SQOP 1UZHA 3VGSA 4J9OA 2UXBJ 4B3TJ 4WKRA 1IR1A 1K47A 4KBIA 4ZN3A 2NYIA 1DURA 1LWCA 3L7OA 1D0EA 2NZ4A 2IYIA 4OJ3A 3BGRB 3LP2B 5HP1B 3C66A 3M6WA 1HHQA 1EKRA 4WBFA 4YR2A 1N5TA 1CQNA 1F5CA 2OEMA 4RW7A 3HJVA 2C2ZB 2H3EB 1HQEB 4P7TA 5F3ZA 4NCGA 1NU4A 1NKCA 1Q82T 3KWMA 2ZH1A 5ETKA 5C7PA 5CZVA 3JS9A 2CA9A 3NAIA 2R2SA 4FNIA 4ZVUB 3M2VB 2MQOA 2AKWB 4WWSA 4OHZA 1PO6A 2Y0BB 3QSYB 4FP9A 4HACB 1OO0B 3AJDA 3O44A 4UTGA 5DO2A 3GILA 4DR4J 3EUNA 1G2EA 3AHPA 5AJ3J 1FE0A 4ENOA 3BM7A 4LF5J 1HARA 3CT9A 4ZVEA 3BBCA 1C1BB 2C2MB 3H90A 5HANA 5D15A 2W9CA 1SH3A 4G1PA 2I9SA 5KFLA 3IO1A 4FXWA 4QIGA 3DOLB 2NCKL 1VIOA 5LSRA 3GSDA 2OAUA 5CHCB 1QLNA 3ENWA 3CTRA 4NLPA 4W90B 1NSKL 2RQMA 4BDPA 1UJ4A 1URNA 1NJZA 2FPHX 2IHR1 4RNOA 2GJ2A 3DLGA 2B7BB 4YR3A 2MHEA 1NEEA 2MKSA 3T41A 1EB0A 2VBWA 3I0RB 1LK5A 2AYGA 1YGYA 3US5A 3VTIA 5HROA 5DLGA 5D4OA 5CCLA 1FFGB 2ZZTA 4IG0B 3M30A 1VLYA 1JJCB 3DDKA 4WFYA 4EGLA 2HBQB 1LW0B 2DITA 1MMDA 4HDHA 2BM0A 1R8PA 5LOQA 1ZPVA 4IFVB 4KHMA 5F3TA 1T05A 4MAKA 3ZNJ1 3C14A 1EP4B 1RTIB 1HBNA 4IUFA 4WYWA 2QTWA 3RJMB 3D0GE 2LXUA 2V94A 4M5IA 3FCHA 2E5LF 1GEHA 4I6WA 2RU9A 2WHOA 3ET6B 1ZA1B 4DSIA 3BYRA 2F8EX 4QW8A 2HHHJ 2FZGB 4LUBA 4PG8A 2CPJA 1RHKB 2NR0A 1WG1A 2HNDA 3W2VA 1WEYA 1WHYA 2AHOB 2BYCA 2FY8A 1BY9A 4YEAA 1VBXA 3T1AA 1SL1A 3MOJB 4OV1A 2FJAB 3GYNA 5KG2A 2Y1IA 2DGQA 3SV4A 2HS0A 2DGSA 4ECQA 2I0XA 2X3GA 4ZIWA 1LW2B 3CULA 5SUHA 1YRXA 4DSJA 3GFZA 4ETXA 4UUWA 5I4MA 4HKQA 3CDWA 1S1TA 5IM0B 3UO0A 2PSZA 1QVFR 1ZAVA 1X0FA 1PYSB 3MEKA 1S99A 2VFRA 2YNHA 4ED1A 4O23A 1FI4A 3UVJA 2UUBF 5H9FJ 4R5PB 2XCPA 4A8YA 2DK2A 4C11B 3MWBA 4CH0S 4DL3A 2DXEA 3WX4A 2P8IA 2OFGX 3SZ2A 4HVZA 4DUZJ 3KDNA 4U67Q 1KSPA 2DHGA 3ILIA 3GJTB 1GQEA 3SCJE 3P96A 4YB7A 5CZXA 5KFKA 2DIUA 1D9AA 3CUNA 2JC0A 3FK4A 4OYPA 3CWJA 2AMCB 3B4DA 3CSKA 1IKVA 4Y2MA 3RB4A 3LW5C 4YQWA 3UWTA 4P73A 3UD4P 1ZM3A 2MLXA 5EWEA 4C8ZA 3B6BA 1NB7A 2AGPA 2NXNA 4NLQA 2XI3A 4DL7A 4C7QA 1HD0A 1RTHB 2G1DA 2YKNA 1FKPA 1UJ6A 3H5XA 5LMUJ 4DR1J 4NXMF 2ZZMA 3SIPB 1HNWF 2XY7A 2VL1A 3GMGA 2WVFA 3U1NA 4X64J 3UPFA 4F0HA 1ACMB 3KMQA 1UW4A 5EUHA 2QN6B 5I3QA 2OD6A 2C2KB 4WZMA 4IRCA 1TV6A 1DTTB 1RE1B 3ETMA 3M6XA 2P2CB 4C8NA 1HPZB 3BREA 4IO1A 4K4SA 2OEJA 3HVTB 2F3JA 3HMJG 2CQ4A 1VBZA 2MQPA 4K4YA 4PG5A 1S76D 1T9YA 3J81j 1YRTA 5KFGA 2IBKA 1EX8A 3I0SB 3DOLA 2CVIA 1NZ8A 2FVSA 4CO3A 3DRPB 4ZVHA 4X4TA 3KDOA 2K8GA 4QR1A 1F0XA 1H98A 1JLEA 5KFZA 1SB6A 2U1AA 4K50A 1FRLA 1SQGA 1Q8IA 4O3RA 1EQ0A 1D8ZA 3MM9A 1L3UA 5K8NA 2Y3YA 1Q78A 5D0RA 8AT1B 4ECVA 2WB4A 1OMSA 4G1QB 2GV1A 4RL1A 4DN0A 3FMWA 4UOFA 2CPDA 3D6HB 3I4PA 3MUMP 1RCXB 2FY1A 5F9NA 3OL8A 3G87A 2LEPA 1EP4A 4KYZA 1HNXJ 3W8GA 3FKBA 2E1CA 2YH1A 2B4VA 1U1OA 2MQLA 4IKAA 4F4WA 3OQ2A 4PXDA 5ETSA 2FJVA 5HBMA 3TZZA 3J80U 1K73T 4U7CA 2E1RA 2E5GA 2KXNB 1CSJA 3ISZA 2IYGA 3MF5A 3IC1A 3VAMA 1RT3A 1AROP 4ZP7A 2HW3A 4H54A 1RAIB 1XWLA 3HFZB 1SJRA 4K2XA 2C2EA 2COLA 4L76A 4Y2AA 3R5JB 1ZA2B 2KVQE 1JLQB 2ZJQQ 2E5IA 4IR9A 3TRGA 2HLUA 1TVRA 3KUGA 1PC4A 2GJIA 4B3RF 4UQGA 2FD2A 5F8LA 3GCXP 2NYHA 1GK8A 2DRDA 2Q66A 3FVYA 2QGFB 4HI2A 4NMLA 2MB0B 4IOBA 1S7IA 5KFYA 4LREA 1VQ7S 5KT4A 2KL8A 4ZITA 1RBOB 1U49A 4WIIA 2V5HG 1ZETA 4YN3B 3MEDA 1JLFB 2RE1A 1CS4A 2A1BA 2ILYA 3H5YA 1PJ7A 4H4MB 2V68A 5KFEA 3PTWA 3OFHA 2R7XA 3CJQA 3Q83A 5K5MA 3PW4A 2MKYA 2VQFF 3POTA 1QE1A 4A8SA 4GMKA 1YIJS 2BJ1A 1VQNS 3V6JA 2A2CA 4HHJA 2GGPA 4L3KA 3PHEA 1H2TZ 3PY8A 2HURA 1FA0A 3TJ9A 2HHTA 4UT4A 2AGQA 4OJHA 3HVAA 3SDEA 4NMXA 3CD6S 3UCUP 2CJXB 3C19A 3F73A 1SJQA 1HYSA 3KLHB 4K7QA 1RT2B 1FE4A 3OUYA 4X65J 1H72C 1CQMA 4P75A 5AXLA 3EICA 3HCXA 3SCIE 4KHPF 1RTHA 1NSAA 4B9NA 2YH0A 2LA4A 5C2CA 1HBUA 4OI2A 5J1PA 4WFZA 2KH9A 1RHRB 2HZAA 4Q2MA 4JI1F 2O66A 2GCFA 1RXOB 3F0NA 1RLDA 4CZCA 3H42A 1X4DA 3BEGB 4JI8J 2AW0A 4ECRA 4CP5A 2EI5A 2Z4PA 2G0CA 2V6AA 3D1OA 1QAJA 1OSDA 4HEA9 2OI2A 1DLOB 4JI3J 1WOOA 2B7CB 3HD1A 3MMAB 2HIQA 3W9IA 2HZCA 5KFBA 5C2GA 1S79A 3UDCA 2DBBA 1F6TA 3UW1A 3HVTA 1FNXH 4O44A 3ZZTA 2O3DA 2ZBIA 1S1VB 2XSJA 3PFOA 2DPIA 1Y0HA 4JI5J 2M52A 2HBZB 1KNZA 4X4OA 3MHYA 1KS2A 4QWAA 4KR0B 3TA2A 4Z2XA 1VQOS 3DRPA 4GKKJ 3DHWC 2M7SA 5A2QY 4URGA 1UVIA 1KHVA 3KFWX 1TL7A 1RTZA 4RW9A 2JH3A 4DR2F 2DJWA 2GNKA 4OZJA 4QU7A 4TY8B 1PYTA 3N79A 1SKWA 1X60A 2DNMA 2V9KA 2X7IA 3N0VA 4RBVA 2FVPA 3MMBB 4F4AA 3CDBA 2FVRA 2LQ8A 2VUGA 4XDDA 2W2QP 5CYMA 1JJHA 1PKUA 2C2OB 3NGRA 3TAQA 1R7IA 1S4FA 2Y1RI 1U6BA 2ATCB 1RHJB 2JHEA 4QPTA 3K58A 4LF7J 2DR7A 4ICLB 1YBTA 4ZOSA 1UFLA 4ID5A 1SXLA 4N5SA 2NQPA 3G71S 2XY6A 1XEZA 4NI2A 1T03B 2JLEA 1M5VC 4Q2LA 4OX6A 1R6YA 1JJ4A 2JEFA 2AJFE 4DFJA 3BSAA 2JEJA 3T1YJ 4PCQA 4OLOA 2DGXA 2R7RA 1TL1A 3MCNA 2KI2A 2PGCA 2QLJB 3EE3A 1B0TA 4DBQA 5B0FA 1F9HA 4K4TA 3TR5A 1RAJA 4B9VA 1WC6A 3OR1B 3TYTA 2C1EB 3VAGA 2U2FA 1PYOB 4LRFA 4XAKA 2VPXB 5D0GA 1MROA 3BB5A 1FCAA 2DHHA 4X62F 1RHUB 2DNKA 3CJKB 3UN5A 3Q2SC 1JLQA 1TL3A 3IGVA 1KVKA 4B17A 1TMJA 4DX5A 1SCJB 5FDLA 2AJ0A 5CD4A 4DSEA 2VDHA 2IJNA 4DV1J 3KNGA 1BD6A 4I6AA 3V4IA 4YY3J 1CJKA 1FRHA 2DCUB 3WDOA 1UFWA 2OSQA 2FHMA 1BQXA 2CDQA 3N6NA 2CRLA 1VRUA 3CIMA 4LSLB 3VAHA 4I2QB 1YQHA 4HT5A 4AQYF 3N6MA 4ECWA 2HKEA 3HKZD 5F8MA 2ZOMA 4FF4A 2BE7D 4WK1A 1IKYA 3KXDA 2YPYA 1SJ3P 1X4CA 4K4XA 1N6QA 3R1HA 2W2OP 3AOBA 4J9LA 4OLPA 3OVAA 2MZ1A 3SFUA 4WFBQ 2IMOA 1RAAB 3KK2B 4IR1A 2H5JB 2N4CA 4OI0A 3I32A 5T14A 5F9LA 4LF4J 2Z30B 4QIVA 3CE8A 3K8WA 3HSGA 3PRVA 3E01B 3U02A 3UCGA 2B4OA 1J27A 1D8YA 2QIFA 4CT9A 1YDLA 2E9ZA 1N0VC 2FC9A 3L9ZA 3HFKA 1NLKL 3H5SA 3I4HX 3TOQA 3KLHA 3DYAB 2ZEJA 2XMTA 4DUYF 3FSIA 2CYYA 3GFHA 2F8MA 4CT8A 1P1LA 1UEUA 3NG8A 1OSCA 3JQJA 4JV2A 4NLGA 5DZ7A 1X4GA 3BKFA 2FC8A 1IKWA 4URQU 4X4UA 5IZHA 2MQNA 1XNQJ 5M2UA 2QMWA 2BMBA 4MT1A 2ACYA 5IQQA 2MSTA 2DGVA 4NEYA 2OPSA 3DLEA 1UMJA 1BHNA 1KOHA 4DV5J 4EO6A 1Z1ZA 3GG1A 3C46A 2OPRB 3NS6A 2AYMA 2VG6B 1NHKL 4YS2A 4WP8A 2A10A 4N76A 5T41A 3LANA 5J2PB 2ZKTA 1ZM2A 2I38A 3OLAA 3ZTRA 5DGAA 5K8MA 2A6MA 1WSRA 2EFQA 1IQZA 2RAQA 2F4VF 2VF3A 5K20B 1NK6A 1M5KC 1K1QA 4J9NA 1UA0A 1X4BA 3FZ2A 1BMQB 3KJVA 1C4AA 3I6PA 4JUZA 3THVA 4OL8A 3UD3P 2VA2A 4CO2A 3A8IA 4QZVB 2ASDA 1OWXA 1FNMA 3EGZA 2R2UA 1KTVA 1GMWA 3NEKA 1YKWA 2KG1A 3QJPA 1UPPA 1BE4A 1C4CA 4MK8A 3SQGA 3CCSS 3UI3A 2KTQA 3JYTA 4F3QA 1KQFB 2HFOA 3IR7B 3M8QA 2FZKB 5DM6Q 2CVEA 3LGNA 5LJ3Y 4J9KA 3EDQB 4C8MA 4B3SF 3IG1A 2ZHBA 1UVKA 3KLFB 3MOZA 2DNYA 4OIXA 2MLYA 1T3NA 3Q8VA 4NXNJ 5G0RA 2VQEJ 4JI4F 3A12A 2J6TA 2ZM6J 4FYXB 1QTNB 5E3PA 2R3VA 5KFHA 2UUAJ 1KRPA 2X3DA 5KFTA 5A8WA 3LWMA 2GQ2A 5L8RC 4DV6F 3NGSA 9ATCB 4RW4A 1RT7B 3H4DA 4FVCA 2HFUA 4HR2A 2R8IA 2B3TB 1R8HA 4Y2IA 3MM7B 3GQCA 2Y1LB 3QIPB 4KPCA 4J9PA 3WHIA 4WP9A 3H2VE 4RW8B 1N36F 2GHPA 3IWLA 3KLEB 3HO1A 1H2UX 2F4FA 4EEYA 1KLNA 3D3CJ 3TI0A 3CJ0A 4RW6A 1REVA 3R97A 3IN5A 3K5MA 5IWAJ 2YQ0A 4DPYA 1U1PA 5F8NA 2W8LA 2OIHA 4NYZA 1FJCA 4UZCA 3K5NA 4FYDA 2VJUA 1SQEA 3ILOA 4XTTA 1EARA 3LPEA 1JXLA 3PIPQ 1TUVA 1HLWA 2DHXA 1S57A 5DDOC 2DH8A 1CJUB 3WIUA 1VYAA 2ZH4A 1U2RA 1ZOTA 1T9WA 1W7WA 3DKDA 3U1MA 3W8PA 2YX7A 5C24B 4ZLLA 3EZ5A 5H9EJ 1TP7A 1U4BA 2SXLA 3LAMA 3U7JA 4LR7A 2I5JB 2MKHA 2D9OA 3MTKA 4MKAA 3KK2A 2D1CA 4U7UD 3BS9A 1XNRJ 2F9DA 1NK4A 2XMUA 2W4PA 2LXIA 1RAHB 1XERA 2ROPA 2BW7A 1TK0A 3GLJA 5DLFA 3NP5A 4HHUA 4ZP6A 3THPA 4DV4F 1S1WB 1NZAA 3IS9A 1HBOB 2CQPA 4UUXA 2VFVA 2HHXA 3CO0P 1E6VB 2BM1A 2L41A 4KE5A 5F8IA 1U1QA 2C28A 2BJ7A 2EFVA 3L7UA 1IJFB 4OHVA 4DR6F 1NSPA 5AE2A 3W62A 3NNAA 1U45A 5ETMA 2ZUAA 4M5GA 2AJ4A 3TZWA 3RAXA 2B4PA 3V81B 2YKOA 1R89A 1YZ6A 4PWDB 2ZBQA 3GE9A 4ALZA 1WOSA 4CLLA 3BSNA 2ALZA 3C16B 4KHRA 2XC9A 3ICLA 1JLCB 2NPFA 5LMNF 3DOKB 1IBMF 1XBWA 2DISA 2QSWA 2QL5B 4WTYA 4LFCJ 5GAEI 1F9EB 4ZKAA 5IS2A 3CJSA 3MCOA 3WZ0A 1Y5NB 1W26A 4QW9A 3HHKA 3KK1B 4JI6J 1HL6A 2RRNA 3J7Z5 5B0BA 2MZTA 1NH8A 3NCQA 4MIWA 1ZTTA 4HT7A 1SC4B 1N5YB 3CCTA 2IM1A 5A8KA 3AQPA 1UEKA 4BWMA 3LUYA 3TUIC 4P74A 4X4RA 2F8HA 4YHHJ 1X9SA 2QLFB 1WJ9A 1DTQB 4LF9J 5U47A 5L39A 2RDIA 3M1VA 2L9NA 4PYDA 2IA0A 4G3IA 1O51A 4C4WA 1Q53A 2HRYA 1U1LA 2ACMA 4F2SA 4NLUA 2DXFA 4I56A 3CC2S 1N32F 1I1GA 1U0HB 2J7WA 2O1PA 3W9HA 1VQ8S 3RAQA 3AXMA 3DHXA 3R1LA 4FNHA 4DU7A 4D3HA 2V8PA 2ZBRA 3LP1B 4ZS6A 3M8PB 3T9NA 1X9WA 2B5JB 2OMOA 1VC0A 2IA6A 5G4DA 5C42A 2DIVA 1RWWB 5EWGA 2MZJA 3HSDA 4Q44A 2VPWB 1Q81T 3QFHA 2P6SA 3TA0A 2ZDPA 3FZBA 3O5TB 1X0PA 3O2IA 3MM7A 1JLGA 4B9MA 3AJ1A 3EPGA 3TAMA 4RW8A 2CPZA 1WEXA 2DCLA 2FZCB 4MFBA 1H73A 1U1NA 4IH5A 2F1FA 3CCUS 2YNIB 1QAIA 3KLEA 2H5EA 2RF2B 1WF0A 2GW8A 3RZAA 5J2NA 4HYKA 2J5AA 3F56A 4KO0B 3R3TA 1ZBTA 4BS2A 1K8AT 2AIRB 3QPIA 3M2UB 2Y8YA 2MYFA 2XULA 4OHYA 2KU7A 4NLYA 2OPPB 1XMQF 3TW0A 5I3PA 4ZHRB 2YQ3A 2MXYA 4A46A 3ZXWA 2VG5A 3BO3A 1M5HA 2AYBA 2QLXA 1N8RT 2FGOA 3R5AA 1SC6A 3M6UA 8RUCA 2XNRA 4DL6A 2Z2YB 1M0SA 4IH6A 4ANCA 3PKMA 3HVRA 1NK0A 2WONB 4M1KA 1A0OB 5CYQB 5DDRC 1J2VA 2KFZA 1TELA 1R3NA 4LSNA 2F7VA 1SV5A 1SKRA 3W5XA 3I5CA 4FPIA 3PKYA 2XZWA 1VQPS 4MYUA 2HHPA 3MCMA 3Q89A 1L5UA 4JI0J 3MCSA 3EJMA 2V9WA 3NGUA 1SKSA 2D3O1 1RUSA 3MZIA 3QGPA 2BANB 3M32B 1NJYA 1H6KX 4CLTA 1E6VA 1D09B 2KFNA 2DHAA 2HWHA 4DPUA 4PUOB 2QX0A 3AOCA 1IKXA 2MKCA 4Y00A 3E51A 4Z7YA 3NCPA 2LECA 3MEGB 1FKAF 4RU9A 3DMJB 1XR6A 2MKJA 5AXNA 4NL5A 4IOAQ 2NSBA 4KKOB 3VALA 5HMYA 3I96A 5IC6B 1MSWD 3ITHB 2AQ4A 2WSCC 2XYGB 2ILZA 2VU5A 1U1RA 4PWDA 4WJBA 1KWMA 1WWHA 4ETZA 3PACA 1YWXA 2XQCA 2RSQA 5K8PA 2QEXS 4DR3F 2E5LJ 2C2NA 1RBLA 3HT0A 1B0PA 3IWNC 3CVKA 3QGGA 2W9AA 2D74B 5GAHU 2Z2MA 1DBDA 4UOCA 1R0AB 2W4CA 2J9CA 2HRTA 2VODA 2YVSA 3KK1A 3D68A 4DV2J 4ZPCA 2BABA 3MGJA 2GJFA 4FXDA 3I56S 4M5DB 2D7SA 5ITHA 3T1HJ 2UUCF 1QY7A 1R8BA 2CIMA 1LXJA 3R6GB 2VPYB 1VQKS 2V4JB 4F4XA 1R8CA 4RBUA 2VASA 2BA9A 2VOOA 1AUDA 5ETPA 3TQ1A 1XR7A 1HQUA 2PC6A 1DY3A 4KTQA 1U6ZA 1WC3A 2QA4G 3ZO7A 4XPCA 3IA0A 4P71A 1VBKA 4DJBA 3W5YA 4MKVA 3IRXB 4XPEA 1S6OA 2F65A 5E3CA 2UUBJ 2CNOB 2L3MA 4PYAA 2J6UA 1F60B 1LNQA 1H3DA 3GP9A 3HK2A 3SSSA 3FBFA 1UEVA 3N4WA 1CJTA 5A8RB 2CQBA 2B5JA 2ZBCA 2E7WA 1HMVA 1U02A 4CTAB 3RUBL 2GVZA 3CDUA 1B7FA 2VHGA 4B3OB 4C0OC 4EYHB 2KO1A 3DI6A 4ELVA 4C9DA 4C3MA 2YWKA 3ZZRA 5L1IA 1NDLA 4QYZJ 2DNRA 1RT5B 2DB1A 4LRAA 1V5IB 3PW0A 1NPRA 1TQLA 1NHUA 4DZDA 2HMIB 2HS4A 1RWUA 3EGWB 1AZSB 1C0UA 2FGCA 3VAFA 2RS2A 2ZVSA 2ALYB 2OPQB 3MMCA 2EK6A 2AEFA 4KO0A 3TAPA 2RRAA 2ZC3A 3HSZA 4F3OA 2FTRA 2G2YA 4DR4F 2E29A 2NXUA 2HNYB 3UQSA 1MMNA 3M05A 4LF5F 3JTNA 1HNWJ 1Q8LA 2CUYA 3N9UC 5AE1A 3F41A 4DQIA 5SZTA 2GAHC 3KJNB 1JQGA 1G7CB 4AXIA 3HFVA 2C3MA 1ROFA 1FEHA 1RWKB 5FIIA 2ZWOA 1BWVA 3Q8QB 2WCXA 4X4NA 3DU5A 2RDDA 1KTQA 1Y11A 2DPJA 2Q43A 3A8JA 1HHSA 1BQNB 1HR0F 4PQUA 2VFTA 3CDEA 3RW6A 3ZZOA 2HWTA 5CYQA 1ULRA 4CIOA 2H48B 3KHLA 4LF8F 3QT6A 3MECA 2XWYA 1S6PA 4DOZA 1EJ7L 4ZJQA 4ATNA 3DDNA 4EBEA 4QJVA 3CCJS 1X8DA 3GR1A 3ZZUA 4CLFA 4DZ6A 4MTPA 2Y8WA 4ZLJA 4DXLA 1RAGB 3MUTP 1RT4A 1OPZA 3Q0AA 3QRQA 2ZUGA 1XIQA 1DHMA 2M70A 2CJQA 1S9GA 3MR3A 4Q0BB 3WIVA 4CRJA 4CCHA 2IM3A 4PUOA 3OSNA 2R8KA 4KSEB 1M1KT 3LWLA 4L73A 4O3OA 3GZ7A 3VAJA 1TL5A 1URRA 1AFIA 2RUGA 2KT3A 1UP1A 4WPAA 4IRDA 4KV8B 1S1XA 4BBYA 4BC7A 1F2GA 1F9FA 1VK3A 2HHHF 1SC3B 3D9BA 4YR0A 3T3FA 2PEHA 4NZ7A 1YZ7A 1VQSA 2RS8A 2Z8QA 4I0WA 3M2RA 3J80Y 1CLFA 4HTJA 4F36A 4DF4A 2OMLA 2N82B 5DM7Q 3BN7A 1LWCB 3W3SA 3MTJA 1RBAA 1IR2A 1R27B 1YTYA 1X31C 3JXOA 3HT3A 1WC1A 4Z7CA 1CULA 1FWPA 2R42A 1Q79A 2VKRA 2ADBA 2W9BA 2D3ZA 1R43A 5F0WA 4FXVA 1JMTA 4TU8A 4M5LA 4BHQA 1W2IA 1GFWB 1MG7A 1H7WA 1SIWB 3P5BP 5D3GA 2GVDA 4NCGB 4DQRA 2E7XA 3AH6A 4B3RJ 1OY8A 1NJXA 4N8NA 2LQ9A 1X5SA 4DS5A 2V2QA 3A1YG 1UWBA 2QMXA 2XYHB 4DUZF 2AT1B 1FDBA 2GO8A 2ZJRQ 5B0EA 2HBRB 1A7GE 1GNKA 4LJMA 3PRBA 5HATA 3VVTA 1Y00A 2H4YB 4IFYA 3HP6A 3AAWB 2HK2A 3ZNUA 2X1AA 4LRDA 1VMBA 1K0VA 1X4FA 2EPIA 3VR1A 2CNKB 2ZDOA 2BZ2A 3MAHA 4BWJA 2VQFJ 5JUMA 3RBDA 1RDRA 4IG3A 5E3RA 2KJVA 1S0OA 4YP3A 1ZAWA 3KG1A 3TEHB 1OQ3A 3FDSA 1KFDA 1KC8T 4F67A 2VA3A 2KKHA 5KFJA 3OTOF 5LMUF 4USMA 3DLKA 3OT9A 4LR8A 5DDPC 5B0GA 1WC0A 3PV8A 5AXMA 3DLGB 1UETA 3K89A 4FKXA 3QO9A 5KT3A 3FFIA 5KFVA 4RX6A 1VFJA 3AA9A 2VFSA 4KIAA 4C0BA 3GIIA 1WDDA 4KHPJ 5B08A 2N7CA 2XLKA 1JIHA 2J8SA 4ES2A 1IUJA 3ILJA 5HAOA 1N34F 4NLRA 3M30B 3NBPA 5GAGU 1KOOA 2Z57B 5KT6A 4JI1J 2BEFA 2IM0A 2FLPA 2WK4A 1H74A 3KLGB 3EVMA 1VQ4S 5IXUA 2DNHA 1T02A 1DJ0A 4Q7AA 2YKMA 1T05B 3C14B 2HVEA 3UFCX 2RQKA 1HBNB 1HQ2A 1MLAA 3K59A 4P9SA 2DRAA 4O3PA 1UZDA 3R5BA 2OD4A 3S7RA 1P9QC 4KAIA 3TP2A 3GIMA 5IT0A 4MMOA 1VQYA 2XTJP 5J2MA 3R6LB 2HNDB 2HG4A 3W2VB 5KT5A 3EVWA 2UVRA 2W25A 3MR5A 3ZZYA 1EETB 1T9TA 1X5OA 4QIFA 1I94F 4ZVTB 3IP0A 4USWA 5D4NA 2FJWA 1NH7A 2FLOA 3IMQJ 3E8OA 3OJSA 4QR0A 1U25A 2ASJA 5H9EK 1N33F 4DR2J 4Q0BA 4K0KF 4C8YA 2F63A 2OH2A 4DFMA 2Z2LA 2GMJA 4P52A 4ZDNA 1HNXF 5HVFA 1S1TB 1QDUB 1TU0B 2DTJA 2J0QD 1U8WA 3BGLA 2HS3A 3GIRA 2YNHB 3MPDA 2CJYB 3CJ5A 4K5SA 2QZ8A 3ZTQA 2ADCA 2XSFA 1VDHA 3VVUA 2QFJA 1LWFA 1OYDA 3DGPA 2R7TA 2FIUA 2G4BA 2AZ1A 2RUSA 1K9MT 4J9QA 5KFXA 3MI7X 2PMZD 2NXJA 3M9MB 2CQHA 1IQTA 5KFSA 4MK9A 4Y2CA 5J2QA 4RU2A 2V4RA 2IRYA 2ABYA 3DLJA 2DKOB 2PI5A 2HFNA 4DCOB 1N54B 2HBYB 1FD2A 1RI7A 1IKVB 1YJ9S 1HWUA 3NGKA 4LR9A 4DPTA 4GC6A 2BX6A 2OJ3A 3DCAA 1PJ5A 4RUBA 4EZ6A 3SI8A 5L46A 4X62J 3BZQA 3J7YI 1HBMA 2CJ9A 2CQGA 3G8TA 1S12A 4AL6A 1Y3KA 2YKNB 1FKPB 3WX8A 3HKWA 2ZZNA 5MLCV 2DRBA 3W61A 1YVFA 1YJ7A 3I82A 4Q5VA 3FSXA 2UXDF 3EGNA 2WBRA 4RWWA 3KYLA 4YUDA 1U7LA 3S6EA 1OJ4A 2KHCA 4RO0A 2BOPA 4AQYJ 2AV5A 3FQLA 4NZ0A 4LFBJ 1TV6B 2IY5B 3SFGA 4EWTA 2W2NP 2Z58B 2B0GA 1Z4UA 1SI9A 3HDSA 4CLYA 5HN0A 4J90A 5EHHA 3TJ8A 2WAQD 2ZH5A 2QLWA 4LT6A 5IV4A 3UE2A 4KGZB 4NLDA 4X65F 3AA8A 2K7JA 3R9LA 2MTLA 2RB7A 4AE5A 1L3VA 3HXMA 4OHWA 3D6FB 1XMBA 5B7WA 2BDPA 2A0FB 5E0OA 1O6XA 5DDQC 4QWEA 4J9MA 2FJEB 1CBKA 1UKUA 2KM8C 5DRKA 2YWEA 3IR6B 4EMDA 5KFWA 3C8YA 2W7PA 1HNZF 2M2BA 3A8EA 1KN6A 4ES3A 3BGUA 4DUYJ 3B4MA 4GKJJ 1WKJA 3BO2A 1UCNA 1JLEB 1QD1A 3KTQA 2Q6CA 1FK9A 3ZZZA 3D3BJ 2VONA 4ZPVR 1WHVA 1R8AA 3MM9B 3RR8A 1MN7A 2DGOA 3MPWA 4ZLPA 2X1BA 2AGOA 4IYQA 2JWNA 1S49A 2CQDA 2GIRA 2DNOA 2ERRA 4N56A 3QLHA 1MWZA 5EX0A 3KLGA 3W66A 2CWXA 4GVBA 1TFYA 3Q8RB 2R7QA 4JI5F 1NO8A 3ISNC 1IWGA 4KFBB 3TUZC 3IAS9 5ETRA 2FHOB 3B82A 2YQ1A 2EFGA 1U0SA 4WIQA 1KLMA 2UXCJ 1NKBA 1FEEA 1RT1A 4ZPAA 1SL2A 2MGZA 2VKZG 4X4QA 2BJ8A 4Y2KA 3R7BB 1RTDA 5D0HA 2H65B 3DXBA 4OZ0A 5HBMB 3S8SA 2MZSA 2BVZA 2F4VJ 5ETOA 3VV2B 2R9LA 3JSYA 4OI3A 4OZ1A 5A2QU 1XQIA 4MIBA 4UQTA 4JI7J 1GTHA 1I6JA 1EETA 1HNIA 4QQBA 4IOCQ 1RT3B 3FGVA 2MMYA 4ZN1A 3PEHA 3NS5A 2NXCA 1VRQC 2ATLA 1E6YB 3L3CA 3LO3A 2CQ2A 3L09A 2HSEB 3SV3A 1TVRB 4DPXA 1OY6A 4ED7A 3OVSA 1TKTB 5J1EA 1RZMA 1FRIA 2B8PA 2AJQA 2UV8G 3T19A 6FD1A 5FLXU 4LF7F 1ZYQA 2FHJA 4CNYA 1V5VA 5KFNA 3QAUA 4YB1P 2XS2A 1GMWD 3C6UA 4GO7X 2CKWA 4LF2A 3GJSB 3CB4A 3D7SB 1EIYB 2ZE2A 4JI4J 3MEDB 4OZ2A 4LVOP 3L4BC 3OFGA 1CS4B 3KG0A 1FERA 1HW9A 2UZAA 4K59A 4HHHA 5HMXA 3I87A 5KFIA 1FTRA 1TTHB 4AL7A 4DV6J 4KGVB 4DCPB 2GQCA 5B09A 3LF0A 3POTB 1QE1B 3D1QA 1J5OB 4FBTA 2GGPB 4TYAA 3CJ3A 3JQMA 1HI8A 1VJQA 4OX8A 1YJTA 2OTJS 1F3FA 3KLVA 3MM8A 1N36J 2XEXA 2V2KA 3SDEB 2WZ1A 4ZCLA 3W65A 3TVZA 1HYSB 3G86A 3D4JA 3VGTA 3OUYB 3G6YA 4B9LA 5E3QA 3DM2A 4CLWA 3MM6A 1NK5A 5FJ4A 4KB7A 1CEZA 3A13A 2BJ9A 3C15A 5KT7A 2CG8A 2PMWA 4FYVB 1YI2S 1HBUB 3QGIA 4W4MA 2KT5A 4DL4A 4F04B 5A0YA 2YKAA 2JFKA 3N5FA 4V1Ak 4F50A 2KRBA 3ELHA 2BQRA 3KLIA 4LF4F 4PXBA 4E0DA 4NX9A 1I51B 1GTEA 1P6TA 3MR2A 4IDKA 5K9FA 3QZ8A 3GV7B 3UDEA 3R2CJ 1RKJA 1T94A 3J81Y 4DR7F 4ECTA 2K06A 3GSIA 3CC4S 3LOUA 3SEOA 3IBWA
chains in the Genus database with same CATH topology
3FEXB 2AD9A 4ALZA 3MEEB 2IBOA 3JB9k 3BSNA 3HJFA 2ALZA 2BACA 2MDAA 1G6BA 3EXCX 2K3KA 2IC3A 5M2RA 2BUNA 3PZPA 1RYRA 4KHRA 4O44B 4LQ9A 4ZVGA 2XC9A 1QSYA 2Y1JA 3ICLA 4ES1A 5KFQA 4TU7A 1FVQA 1JLCB 2NPFA 4C2MA 4KV8A 3WBZA 1JLAB 5LMNF 3DOKB 2XSJB 1HWKA 5HQ8A 1IBMF 2FLLA 2DNQA 2M9KA 1XBWA 3DLKB 2DISA 2QSWA 3V6HA 2HAIA 3BDEA 4WTYA 2OTLS 5GAEI 4V19X 3CCLS 5LL6d 4EFAC 4ZKAA 3DRYA 3QO9B 3S1TA 2XHWA 3FFIB 5A6PA 5IS2A 4O4GA 4F3MA 2DH9A 1VC5A 3G6ES 3QWPA 4J9OA 4RNNA 3WZ0A 1JK9B 3V2UC 5MAOA 4LFBF 4NYOA 1QVGR 2XS7A 4B9TA 4WKRA 4P7VA 1Y5NB 3RB0A 3I5AA 4KBIA 2GC8A 1W2BR 2PT0A 3AQOA 4QW9A 3HHKA 3KK1B 5GADU 2EKYA 1HL6A 2RRNA 3J7Z5 1HNVA 1PGZA 5B0BA 2NYIA 2MZTA 3NBPB 1JLFA 1NH8A 3Q23A 5GAEU 4JYAF 3NCQA 2ZKUA 1DURA 1LWCA 4MIWA 5AJ3F 1ZTTA 4YB5A 3KHGA 4HT7A 3L7OA 1D0EA 4RW9B 2NZ4A 2CJBA 3CCTA 1N5YB 2IM1A 3DRRB 2PN6A 5A8KA 5HI7A 2IYIA 4A4JA 1FVSA 3AQPA 2IM2A 4H4MA 4BWMA 1TL4A 3LUYA 2B51A 3BGRB 4OJ3A 2CG4A 2WBMA 3LP2B 5THWA 3TVKA 3TUIC 4E8UA 5KG5A 5HP1B 2J0WA 5L9XA 2J6SA 4A8OA 3JSRA 4X4RA 4DFKA 2F8HA 1T3OA 3C66A 3M6WA 1X9SA 1JX4A 4G1IA 3U27A 3RB3A 1VS3A 4WXWA 1DFDA 3OXGA 4L3NA 2D3UA 4YR2A 1DTQB 2YKMB 5U47A 5L39A 2RDIA 3M1VA 2L9NA 4TY9A 1N5TA 2IA0A 4DL0C 1CQNA 2LU1A 1F5CA 3K2YA 1KR4A 3X3UA 5CYMB 4G3IA 4RW7A 4WE1B 3EPIA 1O51A 4RUAA 5HLFA 4C4WA 3KHHA 1Q53A 1Y3JA 1DRZA 2HRYA 1U1LA 1Q1KA 2HVHA 2VOPA 5K14B 3ZC4A 4YOEA 1HQEB 1KEKA 2M0GB 4M94A 4Q8FA 5DQHA 4P7TA 4R0JA 4F2SA 5F3ZA 3OSPA 1U47A 4NLUA 4NCGA 4I56A 1NU4A 3K5LA 4ED3A 1Z2ZA 1NKCA 3PX4A 4NLOA 3CC2S 1N32F 1Q82T 3KWMA 1I1GA 2ZH1A 3NAHA 1RTJA 1RT6B 2J7WA 1S10A 1LWEA 2O1PA 4NRTA 1VQ8S 3RAQA 5CZVA 1RT2A 2EFPA 3DHXA 1LK7A 4ID5B 4GKJF 3R1LA 3CJ2A 4FNHA 3NAIA 6FDRA 5F8HA 5J2MB 4KFBA 2R2SA 4FNIA 4C8LA 1WNEA 3J7YU 3RTVA 3M2VB 1X5TA 2MQOA 4D3HA 2J7UA 3FRYA 3CJ4A 2D3OR 2M4MA 2RILA 3DLHA 4HTIA 2KRRA 4I2PB 4IQXA 4OHZA 1KD1T 5I3UA 1PO6A 2K3IA 3LP1B 4ZS6A 3M8PB 3T9NA 1X9WA 1N5VA 2B5JB 5KG7A 4AFFA 2OMOA 2PA3A 4FP9A 1TL1B 1VC0A 2IA6A 1OO0B 2RKIA 4PWDB 4OX7A 4Q45A 3O44A 5DO2A 5GMKa 3GILA 5G4DA 1S0NA 5M2PA 3CD0A 2KVIA 5C42A 4NWBA 1M5PC 2DIVA 3EUNA 1G2EA 5KG6A 1S6QA 3AHPA 5LT5A 2MKKA 3Q8SB 3SXLA 5EWGA 3G8SA 1FE0A 2MZJA 3BM7A 4Q44A 2HLTA 1HARA 3BO4A 2VPWB 3CT9A 4ZVEA 1Q81T 1C1BB 2IFXA 3PM9A 2P6SA 1B0VA 1MROB 4ZP9A 3TA0A 4ZK7M 2EFNA 1JXEA 2ZDPA 3FZBA 3O5TB 4DEZA 4A8QA 2P9EA 1X0PA 3R5CA 3O2IA 4I4BA 1D9FA 2W9CA 3MM7A 4JOUA 1JLGA 1FXRA 4QR2A 4B9MA 1E6YA 1SH3A 3OR2A 4G1PA 1DLOA 2I9SA 1SH0A 1T8EA 1NNDA 1TL3B 5KFLA 3IO1A 2DO0A 2VC1A 3MMAA 1AXQA 2XCAA 3AJ1A 5DETA 5HMZA 3EPGA 1CVJA 3TAMA 4RW8A 4NPOA 2CPZA 4FXWA 4QIGA 1WEXA 2AYEA 2DCLA 5CYJA 5KFMA 4NXNF 4MFBA 5B0AA 2LA6A 4IH5A 1U1NA 2F1FA 3DOLB 3CCUS 4ZPTR 2YNIB 3BQ2A 1QAIA 3KLEA 2UXCF 4B9VA 5BYSA 1QM9A 5CXTA 1TKTA 1VIOA 2H5EA 5LSRA 5FDLB 2XMMA 3GSDA 2RF2B 1BLUA 1WF0A 2GW8A 2OAUA 4OHXA 5CHCB 3RZAA 1ZM9A 3VWSA 5J2NA 4HYKA 1QLNA 2J5AA 2YX4A 3ENWA 2EG1A 4TQSA 3F56A 5HO4A 3IWXA 3CTRA 5T7LA 4KO0B 4NLPA 4W90B 1ZZNA 4I7FA 2HGNA 3R3TA 2UUAF 1ZBTA 1LWFB 3V4IB 2RQMA 3DXSX 4BS2A 4BDPA 1S1VA 1UJ4A 5KAKA 1K8AT 1URNA 4EUVA 3QPIA 3M2UB 3CD5A 5IQ6A 1NJZA 2MYFA 2HVZA 2FPHX 4JV0A 1UJ5A 2RVJA 2IHR1 2XULA 4OHYA 1RA7A 4RNOA 4XIUA 2KU7A 4NLYA 4ILMA 1VRUB 2GJ2A 3DLGA 2B7BB 2DGTA 2OPPB 4LIWA 4YR3A 4KGKA 1XMQF 3HHNB 4Y28C 2MHEA 3TW0A 2RH3A 5I3PA 1NEEA 2Y0SD 4ZHRB 1L3SA 2MKSA 4JI7F 3K0JA 2R4FA 2YQ3A 2VBWA 4YB6A 3I0RB 2MKIA 2MXYA 4USHA 3VZHA 1LK5A 1IKYB 1UVLA 4A46A 2JEGA 2AYGA 4A47A 2VG5A 1YGYA 3BO3A 2VD3A 2YX1A 3US5A 3VTIA 2CPFA 1M5HA 4EO8A 5J2QB 3BN4A 1N6QB 4YFUA 2AYBA 2QLXA 4URSA 5DLGA 1X4EA 5HROA 5D4OA 5CCLA 3TARA 1N8RT 2FGOA 3R5AA 3OW2R 2MPUA 1SC6A 4IG0B 3M30A 1VLYA 3AJ2A 4FVMA 4Q8EA 3CCRS 3M6UA 2XNRA 3DDKA 1XR5A 2AX0A 2DT9A 4WFYA 1ZZFA 4DL6A 2C42A 2PO4A 4EGLA 2BR0A 2EW9A 3OXFA 2EWHA 2W7OA 1LW0B 1M0SA 1WI6A 2DITA 2FVQA 2CZ4A 4TY8A 1MMDA 4HDHA 2R7VA 2OO4A 3H25A 4IH6A 2BM0A 4KQZA 4QYRA 1R8PA 1CG2A 3PKMA 4QWBA 1J5OA 1ZPVA 4OX9F 2ZD1B 3HVRA 3HZGA 3MMBA 4IFVB 3KK3B 4KHMA 4ZCIA 1NK0A 1FO1A 5F3TA 2WONB 2HNZB 4EU0A 2R7WA 4M1KA 1HBMB 4MAKA 1T05A 1JKHA 5CYQB 2F9JA 5KOWA 1J2VA 5DDRC 1EP4B 4PKDB 1WTBA 4R8UA 2HHUA 1RTIB 2KFZA 2YKQA 1HBNA 2ZC4A 4OFZA 2DR8A 1BQMA 1R3NA 2KHDA 2ROEA 3EXYA 2NLWA 4OZ5A 4IUFA 4LSNA 2E5HA 4WYWA 2JX2A 2F7VA 2LMIA 2O01C 1SV5A 3D0GE 2LXUA 2V94A 1SKRA 3VAKA 3MD3A 3FCHA 2E5LF 3I5CA 3PKYA 2CPHA 3KNAA 2PD1A 4UY85 1G3OA 2XZWA 4I6WA 2RU9A 1VQPS 2WHOA 2Q79A 4CNZA 4MYUA 2XGQA 2HHPA 4HL9A 3ISND 2LU2A 2VPZB 4DSIA 1L5UA 2F8EX 2B9XA 4QW8A 3BQ1A 3MCSA 4ICLA 3MFHA 5DQIA 2V9WA 4TLRA 3OHBA 1O5JA 4LUBA 3Q24A 4PG8A 4PQAA 3RAMA 2R2RA 4J5OA 4FS1A 2CPJA 1SKSA 2NR0A 1WG1A 2HNDA 3PX0A 3HX9A 3HHDA 3W2VA 1T03A 1WTFA 3MZIA 3QGPA 2BANB 1WEYA 3M32B 2PFFB 1NJYA 1IKWB 1H6KX 1E6VA 2Q3PA 1N52B 1XTZA 5LXRA 4ECZA 3H2UB 2V8DA 1FXDA 1SJFA 3QMQA 2KFNA 2DHAA 2XY5A 2HWHA 2VG7A 1WHYA 5D4PA 4TXSA 2BYCA 1BY9A 4PUOB 5KFCA 4TU9A 1IKXA 4YEAA 1VBXA 3T1AA 1SL1A 2E9RX 3MOJB 2HWIA 2MKCA 4Y00A 5L9NA 3E51A 4OV1A 2FJAB 3GYNA 1XNRF 2ZOFA 3NCPA 2OPSB 3DLEB 2LECA 2OFHX 2UV8A 5KG2A 1K1SA 2Y1IA 3QGHA 2H9ZA 3MEGB 1FKAF 4DSKA 3VQTA 3CEDA 1D3WA 2ASYA 4MKBA 2DGQA 3DMJB 2KDOA 4RU9A 3OR1A 3SV4A 1XR6A 4GO5X 2MKJA 5JVHQ 5AXNA 2HS0A 1N48A 4NL5A 4IOAQ 2NSBA 4KKOB 2DGSA 4ECQA 2I0XA 2X3GA 2ZH2A 3VALA 3RBEA 1LW2B 4WU3A 3CULA 3H98A 4PPDA 5HMYA 3I96A 2HYIB 3EX7B 1MSWD 2JL9A 5KOXA 3ITHB 2AQ4A 5SUHA 1YRXA 4DSJA 1RQ0A 3GFZA 2WSCC 3CJKA 4ETXA 2ILZA 4UUWA 5I4MA 2KXFA 1U1RA 4HKQA 3CDWA 4PWDA 4WJBA 4DMZA 5GAHI 1S1TA 4TYBA 5IM0B 1WWHA 1L3TA 4LQ3A 4ETZA 2PSZA 1QVFR 3PACA 1ZAVA 3N5BA 5D6GA 1X0FA 2ZFHA 1YWXA 2CPXA 2L08A 2RNEA 3MEKA 2RSQA 1S99A 2VFRA 2DNGA 2WSEC 5FD1A 2YNHA 1TKXA 4ED1A 5K8PA 5D8HB 1OS5A 4ECSA 2QEXS 4RZRA 4DR3F 5DJBA 4O23A 4DR1F 4CH1A 4NRUA 2UUBF 1FJ7A 5H9FJ 4R5PB 2XCPA 3DU6A 1B0PA 3IWNC 3I9V9 4A8YA 4QCLA 3CVKA 4X64F 2DK2A 4C11B 3KJVB 3PO5A 3QGGA 3MWBA 2W9AA 2D74B 5LXYA 3FRZA 4CH0S 4DL3A 3WX4A 1PC5A 4BC9A 4F8RA 2OFGX 3SZ2A 1CC8A 5GAHU 4HVZA 4E98A 4LSLA 5CD4H 1FK9B 4OMFG 2Z2MA 4I2QA 4PPZA 2W4DA 4U67Q 2IAJA 4PWUA 1KSPA 1DBDA 2DHGA 4UOCA 2E5JA 1R0AB 2W4CA 1N56A 2J9CA 4A8WA 4WZQA 2JVRA 5D77A 3I55S 4Y65A 3PVXA 5L1JA 2VODA 2BBEA 2YVSA 1DAXA 2XLJA 2CQ3A 3NRBA 3JTPA 1GQEA 3KK1A 2AP6A 3M9OB 3SCJE 3MM5B 3OTBA 3P96A 4YB7A 5CZXA 1GXLA 3DLLQ 3BJYA 4HLBA 4ZPCA 2BABA 3MGJA 4FPRA 2ZH9A 5JVGQ 5KFKA 1WG4A 2DIUA 4ZPBA 4DV7F 1D9AA 3CUNA 2WTFA 2JC0A 3D1HA 4FXDA 3DRRA 2M3DA 3I56S 3SQGB 2FDNA 3CWJA 3QLHB 2LEBA 4M5DB 2D7SA 5ITHA 5ADZA 3JYTB 1N4LA 3B4DA 2UUCF 1QY7A 1R8BA 2CIMA 1LXJA 5HL7Q 2XO7A 1HWLA 4B9UA 2VPYB 4CO0A 3CSKA 1IKVA 3M8QB 3VZIA 1M5SA 4RLEA 2RJZA 1VQKS 2LYVA 3DC2A 3H5UA 2V4JB 2VBYA 3RU0A 2R7SA 4Y2MA 4K4UA 4F4XA 3K8VA 1R8CA 1XN9A 4RBUA 4B9SA 2QT7A 3RB4A 2J9DA 2VASA 3LW5C 4ILRA 4YQWA 2ZH8A 3E01A 3UWTA 3KG4A 3IG1B 4XK8C 2BA9A 2JFDA 2QO3A 1D1UA 4K5RA 2VOOA 3UD4P 4DR6F 3CMAS 3N6LA 2R7UA 4WE1A 1AUDA 1ZM3A 5EWEA 1YRUA 2I8EA 4C8ZA 3TQ1A 1XR7A 3MXHP 1JLBB 1HQUA 2AJ1A 2PC6A 4KTQA 5G0RB 1NB7A 1U6ZA 4NZ6A 5K14A 2AGPA 4NLQA 2QA4G 1KLMB 2XI3A 4XPCA 1RT1B 1YBAA 3IA0A 4C7QA 4DL7A 2WOMB 1HD0A 2MGZB 4ED8A 1RTHB 1SL0A 2V8VA 2G1DA 2YKNA 1FKPA 1UJ6A 4FF1A 5IFMA 1RTDB 1FDAA 1JNRB 4DJBA 3OL7A 2FJXA 3IRXB 1RT6A 3H5XA 4XPEA 1N5SA 1S6OA 5A8WB 3DYAA 4NXMF 2ZZMA 4KRWA 5E3CA 1HNWF 3J7A1 2XY7A 1Y5LB 2VL1A 3AB2B 3GMGA 2L3MA 3SMZA 3U1NA 2JZ5A 2J6UA 5L1LA 1F60B 5C25A 4RW4B 1H3DA 3UPFA 1S1UA 3C2PA 4N41A 1TAUA 3HK2A 5AE3A 2VZ9A 3CC7S 3SSSA 3KMQA 4DLEA 1UW4A 5EUHA 1UEVA 3N4WA 1HNIB 4I2PA 1X9MA 4R25A 5E33A 4KPYA 5A8RB 3M8RA 3BSCA 1U6FA 1DQ9A 3M4XA 2CQBA 3HI9A 5I3QA 2B5JA 2XMJA 2IJFA 3OTDA 2OD6A 2ZBCA 2E7WA 1HMVA 4LF9F 1FNOA 4CTAB 4IRCA 4WZMA 4DPOA 1TV6A 1Q86T 1DTTB 3T5HA 2A2DA 3CDUA 4HH1A 1B7FA 5DS7A 1VJWA 3BF4A 2APOA 4NLSA 2V4QA 3QZ7A 5F8JA 5KG1A 4B3OB 3M6XA 1K9MT 2KJWA 2K2PA 3LALA 4C0OC 4M63A 2GA7A 4EYHB 2KO1A 3FNNA 3DI6A 3B78A 4C8NA 4ELVA 4C9DA 1HPZB 4ERDA 5J1EB 4C3MA 2KB2A 2YWKA 4O0IA 2XLIA 3ZZRA 3BREA 5L1IA 4IO1A 3CCQS 4K4SA 1VRTA 2RMLA 3HVTB