2NS1B

Crystal structure of the e. coli ammonia channel amtb complexed with the signal transduction protein glnk
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
113
structure length
113
Chain Sequence
SMKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEFSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTGEADEAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibitory complex of the transmembrane ammonia channel, AmtB, and the cytosolic regulatory protein, GlnK, at 1.96
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein/signaling protein
molecule keywords Ammonia channel
total genus 25
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ns1B00
2V5HG 2XULA 2XZWA 4AFFA 2CZ4A 4CO0A 1HWUA 4D3HA 2EG2A 4RWWA 1PILA 1NH8A 1UFLA 3M05A 4OZLA 3TA1A 1UMJA 1O5JA 2J9EA 3HLUA 4RX6A 2J9DE 3NCQA 2RD5C 1NAQA 2XBPA 5D4OA 3AA9A 3AH6A 3T9ZA 3MHYA 1V9OA 1VHFA 1UKUA 4ZK7M 3AA8A 1P1LA 1J2VA 4C3MA 1NZAA 3O5TB 1VFJA 1Q1KA 2EG1A 1GNKA 2ZFHA 3AHPA 5D4PA 1H3DA 4YB7A 2NUHA 1QY7A 4OZNA 4CO4A 2J9CA 4E98A 4Y65A 4USIA 4CNYA 4USJC 4R25A 3NCPA 1UL3A 2JJ4D 4D3GA 2O66A 1V3RA 3TA2A 2ZOMA 5D4NA 3N5BA 5L9NA 4IYQA 4YB6A 3NCRA 2GNKA 3O8WA 4OZJA 4CO5A 4CO1A 1KR4A 2E66A 4RWXA 1V3SA 4CNZA 5D4LA 2VD3A 1OSCA 3DFEA 2NUUG 4USHA 5DRKA 3OPKA 4C3KA 2DCLA 3BZQA 4NYOA 4CO3A 3L7PA 3X3UA 3CE8A 1O51A 1XK8A 2PIIA 2NS1B 2J9DA 2Z0GA 2O67A 2GX8A 4RLEA 1NH7A 4CO2A 3TA0A 3GSDA 5DS7A 3LF0A 1V6HA 4YB5A 4WK1A 4C3LA 2GW8A 2XG8A 4WK3A 4Y6IA 4NYPA
chains in the Genus database with same CATH superfamily
3BSAA 1C0UB 4CO0A 3TYTA 2DYAA 1OJ4A 2C2RA 2OI2A 3BO3A 5AT1B 2X3DA 5JXSA 3CJKA 3GIMA 2BJ7A 3CJRA 3OR2B 4JUZA 2N7CA 4WJBA 4RW9A 2FJXA 4C11A 4OYMA 3EVOA 1W2BR 1RK8A 2W7PA 3T5LA 4WFYA 1T03A 4P71A 2G9OA 1X4AA 1WJ9A 4DV1F 3R7SB 4EZ9A 2UUBF 2YKQA 3P45B 1REVA 2B7BB 2GA7A 3MEEA 4OJ1A 4IQXA 3IWXA 2MKJA 3FCHA 2AJFE 4IDKB 2MJNA 4KY3A 2LU2A 3N4WA 3G6ES 2HHVA 3A8JA 4ED0A 2YQ3A 3OTDA 5I3UB 3IRXA 1GQEA 2YQ0A 2AU0A 1CVJA 2R7SA 1VCTA 2NYHA 1CQMA 4BWJA 3CDEA 4U96A 5LMNJ 2IJRA 4NX9A 5LJ3Y 4DSIA 4RZRA 3MF5A 3Q2TC 3M6XA 4ZVPB 4ATNA 4CH0S 3A3PB 3HJVA 5AE2A 4CP5A 1AUDA 1WF2A 2GVDA 4FNIA 2VA3A 1DLOB 4NZ0A 4Y2KA 1W26A 1OPIA 1RU1A 2D41A 5CCLA 2IAJB 4RW6A 4CDIA 1FRJA 1FESA 2EKNA 5IQ6A 3GILA 3MFHA 4B9VA 1XNRF 1FHTA 3BV8A 5LJ5Y 2WTFA 3BBFA 2L9WA 2YXLA 3SQGA 4C0OC 4E8UA 3PR5B 2OKQA 3T1YF 3QAEA 4PWUA 2KJWA 4J9KA 4WXWA 4RU2A 2AYGA 2DR6A 1RADB 1RLCL 2GO8A 2MZTA 1RB0A 1F9HA 3ZZOA 3Q8QB 1NO8A 1U1KA 2EXUA 4I64A 3IBWA 1YHQS 2G0IA 4J9UE 1NXIA 5B0GA 5DDQC 2RS2A 2L08A 2ADCA 3BPDA 1N4LA 1M5VC 5DGAA 2AQ4A 2MEWA 2QN6B 3D66A 3N5FA 1JLGA 2MQQA 2ZHOA 1N88A 3GIJA 5J2NB 3OUYB 2E1CA 2E5LJ 4ZITA 3EVWA 1YZ6A 1UFKA 3BGOP 1QM9A 1LW0B 1TKTB 2CJAA 2KHCA 2WOMB 3D6HB 3BQ1A 1PYOB 2GO9A 1FXRA 1HWKA 4DR3J 4FS2A 1DJ0A 5IT0A 3OQ2A 1Z1ZA 1J5EJ 4B9MA 1SJRA 5L39A 1I5OB 2K7JA 3MCMA 4KHRA 4M5DB 3CDAA 1KEKA 4C8OA 2HHHJ 2IA0A 2ZKUA 1KQFB 1AB8A 1EQMA 3AAWB 1ICEB 2CVIA 2I5JB 3BKTA 2GAHC 1YSJA 2OEMA 3HD2A 1NSKL 4OMFG 2CQBA 1Q8KA 1RT4A 3TUJC 4KPCA 3U27A 2D3O1 4WP9A 4OHYA 2YNHB 3MEGA 4CNZA 2Y1JA 4K4TA 1OSCA 5E33A 2CNOB 1IJEB 4MIAA 1YJWS 3NEKA 1BE4A 4GO7X 1HHTP 1VI7A 2OMLA 3CD0A 1TUGB 4MK7A 4P2FA 4BWMA 1M1KT 1B99A 2BE2B 1S79A 1W25A 2DR9A 3TANA 2W01A 1Y3KA 3N01A 5DRKA 4B3RF 1N33J 1N0UA 3E2EA 4UZBA 2GAGC 4KH0B 2FHMA 4UT4A 2FC9A 4EFAC 2CRLA 1CQNA 1WOSA 1B0TA 1Q0NA 2QZ8A 4FNHA 1HI0P 4HTJA 4DLEA 1XMBA 3KKFA 4F0MA 4ECXA 2ZUGA 2OD6A 1YJVA 2ZH7A 1UA0A 2UXCF 4PCQA 5DDOC 2HBZB 3IM9A 1WKKA 4HHUA 4J5OA 2CNKB 5ETNA 2Q6BA 4FVMA 4HACB 4OHXA 3J81U 2ZDOA 5D78A 4KHPF 2FLNA 1XNQF 1RUSA 3LA0A 1IR2A 3HPOA 2G4BA 2VODA 3N6MA 4OFZA 4CLYA 3DRSB 4C3LA 5HN0A 2CJQA 1TL5A 5KFEA 3J7Z5 2CJ9A 3MM7A 4PXCA 1JLAB 3GV8B 4FF2A 2JFDA 2RF2A 1WHWA 1MROA 4DSFA 4EEYA 2AJQA 1RTZA 4J9RA 2QTWA 3F41A 1SUQB 3SQOP 4QYZJ 2L9DA 4ZOSA 3M9MB 1YJNS 4ICLB 1KQKA 4KJIA 1NCLA 1N48A 3QLHB 3A3NB 5E7OB 3ZFVA 2FLOA 4IRDA 1C1CA 4LFBF 2CWXA 4ED8A 2HNDA 4QWCA 4EI2A 1R3NA 4F0KA 1ZTTA 3RZAA 3OVSA 1AZSB 5ADZA 3UCUP 4KB7A 2OMOA 2CPXA 2KN4A 3M32A 2ZH6A 5D6GA 5F8GA 1ZS6A 2W25A 1YWXA 2PA3A 3BR8A 5C42B 3DLKA 3TEGA 1MNEA 1EIYB 4PYDA 4DCPB 4RBVA 4JV0A 2C42A 3FSXA 2E9ZA 3OL8A 3DLGA 3MMAA 1RTDB 3JQKA 3MPDA 3SIPB 1HNWF 1U2FA 3A12A 3T1YJ 4FYDA 2ZDPA 2C22A 1KP6A 2P6SA 2DHHA 2GJ2A 2WVFA 1PYSB 5T41A 4WWSA 1UVKA 3D2WA 2VL1A 2XM3A 3HF5A 5IT4A 3JYTB 3T41A 1FDDA 2EW9A 1S0NA 3IG1A 2ZFHA 4Y34A 5D4PA 3OR1A 1H3DA 1UZHA 1NM2A 1AUSL 2Z56B 4CM2A 2W8KA 3PO4A 5D0EA 1TQLA 1PJ6A 5M2PA 3CUNA 2V69A 1KFDA 2WSEC 5J2MB 1SPBP 2KTQA 1NK4A 5LMNF 3IRWP 2GGPB 3ISNC 3PO5A 4UOHA 5L46A 1C0UA 2VJVA 2OH2A 1D9AA 2D9PA 3V4IA 3ETMA 4LF8F 1BGXT 2P2CB 3CJKB 2OPPB 1JIHA 2YPYA 1FNMA 1RTJA 3QFHA 1S12A 1RXOB 4FPRA 5KFMA 3V6JA 2UUBJ 1J27A 4DV1J 1HYSA 3N5BA 1I51B 1X4GA 2BJ8A 1KQGB 3MPUB 1RBAA 3R9LA 5L9NA 5DG9A 2GNKA 4B9NA 2AF6A 2V8PA 3CO0P 2R8GA 2LCWA 1LXNA 4G6VB 1HW9A 3T9NA 4DS4A 2BANB 5JVHQ 1HWLA 2P9EA 3HX9A 1AT1B 1VJQA 4KIAA 2AV5A 4OZ2A 3I0SA 1U1NA 1IR0A 1RAHB 2C3YA 5CZVA 2YNIA 5D4LA 4DFKA 3EICA 3DGVA 4WP8A 5C7PA 5LL6d 4L76A 4ZP7A 2HIYA 3Q8VA 5CD4H 5HMYA 3OTOJ 1QTMA 5C2GA 1NPKA 1RHQB 2KYZA 3T5JA 3D54A 1R0CB 2I2YA 1FK9A 3D4JA 1YRXA 3F73A 1HA1A 2EKYA 4GKJJ 3BH6B 4O3PA 1U1QA 1IXKA 1U8SA 4LVOP 3PKMA 2FVSA 5L1IA 2RAQA 3BQ0A 4CCHA 1CJKA 3LGMA 2I1RA 1GX5A 1WUUA 2PSZA 2M9KA 2WAQD 1FEEA 4R5PB 1S72S 2J9DA 2XMWA 1OYEA 5DM7Q 4G3IA 3PG9A 2ZH9A 5L8RC 1Q95G 2WHOA 4OX8A 3GQCA 3DM2B 4R8UB 1S6PA 5C25A 3ZNUA 4BDPA 1ZM4A 3HSDA 4JI0J 2I6WA 3FRZA 5KFAA 1KVKA 4H4OA 4Y2CA 4KT0C 3OLBA 3J7YI 3PZPA 1VBZA 3TOQA 3R2CJ 4DPUA 3ZZYA 3VTIA 1N5SA 2CQ1A 2V5HG 4QYRA 4ZVOB 3R1LA 4AFFA 1HWUA 4PG7A 3JSMB 2ZBRA 3R2DJ 5KFUA 3VWSA 2MY8A 3C6TA 3LOUA 3PW5A 2DNHA 3Q83A 3AQOA 2XLKA 1JJCB 5KFHA 2R8KA 1NH8A 1A7GE 2GCFA 3EXCX 2W8LA 5KFKA 3QRPA 1RWWB 2ZBIA 4CM0A 2V4JA 1HBMB 1PKUA 1CJUA 2E44A 1S57A 3RRKA 1R43A 2W9BB 4IR1A 5D0HA 2R8IA 4BCAA 1NJIT 4AQYF 3HO1A 3MUMP 1SV5A 2VC0A 3QGHA 2KXFA 2PO4A 3BBCA 1LKZA 3G8QA 4O4GA 1MMNA 4QQBA 4L74A 2HZCA 1VRQC 2OFGX 1BC6A 2MKCA 2DY9A 3V5RA 4OX9F 2HRYA 4J9LA 3LWMA 4O3NA 5G0RA 3TRGA 4DL6A 1SJFA 4JI4F 1PAEX 1LFPA 2BRKA 3CTRA 5LMUJ 3TO8A 4C0BA 2NXEA 2XNQA 3IS9A 4OI6A 5EX3A 2RDIA 1BQNA 3MMBA 3W7BA 1R27B 2MQNA 1Q7YT 3KJQB 3M4XA 2CQPA 3QIPA 4QPXA 2AW0A 4DFJA 2AEJA 2RRBA 1FRXA 1ZA1B 1VHIA 3GFHA 3G82A 4K4YA 4K59A 2IA6A 4LRAA 2B4VA 2LQ5A 3ZTQA 2R8HA 1B7YB 3DRSA 1HHQA 3KUHA 1S6QB 1X9MA 1HBNB 1S1TA 4I4BA 4UUXA 4ZIVA 2XMAA 1JXVA 1YJRA 2B0GA 2UUTA 4KKOA 4PZVA 3UR3C 2MYFA 4CNYA 1X4FA 1VRUB 1ROFA 2KI2A 1JQGA 1VBXA 4GVBB 3ZZTA 3NMAA 4ED3A 1XC9A 1U1PA 4D3GA 1ZPVA 1KC8T 1RJJA 4B9SA 3GIKA 1YK9A 4ZDNA 4DG1B 4M63A 2BQRA 4UOCA 4DPWA 1VLYA 1TL3A 1JLCB 2BEFA 2DNZA 2NQPA 1RT7B 2DK2A 3SMZA 4NEZA 2Z8QA 2QYGA 5HMWA 3BGFA 4CO1A 5CAAA 5IV3A 1XJWB 1QVGR 4EU0A 5DO2A 4RUCA 2VHGA 3KLHB 2LEAA 5C42A 1FNOA 1UCNA 2HLUA 3FNNA 3UQSA 3GONA 1NPPA 1AFJA 3PFEA 2IYIA 2VF3A 3K5LA 1WEZA 4K2XA 4PYAA 1LWEA 1FX2A 1ZAXA 1B3TA 4DSJA 2HHXA 2XS5A 2HVZA 3GP9A 2AGPA 1GXLA 2OAUA 1S4EA 4ED2A 2NZ4A 2PFFB 2XC9A 1C4CA 1YIJS 4KHPJ 2FJBB 1WORA 2EEYA 3FC9A 3QAUA 3I4HX 4ZVFA 2R7OA 3ZZUA 3W8PA 4F26A 4K4SA 2ZH4A 4DV7F 1RT3B 2J7KA 4F4AA 4NLWA 2C3PA 3ET6A 1XK8A 1M5SA 2G13A 2R4FA 2RQ4A 3QT6A 2B9WA 2GIRA 3KG4A 4HEA9 5KG6A 4HDHA 1NK8A 2JWNA 4OQJA 2JEFA 1LFWA 3EM1A 4EMDA 1F6TA 2F40A 2C2NA 2XHCA 5BXIA 4RLEA 3CEDA 3MMCA 3D0HE 1ZETA 4DUYF 2GQ2A 2DXDA 2XLJA 1GH8A 4F7VA 2LYVA 2W7OA 4NXNJ 1GEHA 4NLUA 4B3RJ 1KLNA 1N33F 2R9LA 5AXLA 3BGRB 5HBMA 3H42A 2RH3A 3PRBA 2E7WA 1EARA 1F9FA 5F8JA 1RWNB 2HZVA 2HFVA 2KFNA 3D7SB 3R5DA 2HG4A 2CZ4A 4C9DA 2I38A 2Z30B 4WFXA 3T5KA 1NDLA 1T94A 1UW4A 2VDHA 4JI4J 2KRBA 1U7LA 4RJVA 1E6VA 1FI4A 1OY6A 3G82B 4QW8A 4M1KA 1Q5VA 1REVB 3TA1A 4V19X 4O23A 1S1UA 4YN3B 2WW8A 4DBQA 3DXBA 3BDPA 4ZN1A 2Q79A 1IKVA 3W66A 2DEIA 4XO0A 4Q8EA 2B6AB 2E1RA 5AXNA 1R0AB 2KZMA 2BYCA 2QO3A 2VG6B 1RAJA 1U2RA 2M0GB 2E29A 2CXEA 1X8DA 4U95A 3J80U 4QW9A 1Y00A 2QLFB 3EPGA 2JLGA 2E5LF 2EC0A 5CQGA 2DXFA 1SUQA 2B8QA 2MQMA 3EMTA 3H7HB 5HATA 3MCSA 1YDLA 4B9LA 1VHFA 2IRXA 3GFYA 4NRUA 4QIVA 1HBUB 3VZIA 2MZ1A 2BUNA 1UZDA 3KG0A 4FYXB 1H0HB 1RE1B 3IAM9 1J2VA 4DV5F 1Q79A 4NLOA 3K59A 1UVLA 3I9ZA 3GFZA 3HT3A 1S48A 4J37A 2RRNA 3OVAA 3AOAA 4AL6A 4JOUA 1NKBA 2E9RX 4JI8F 1LWEB 4WZMA 2CA9A 5CCMA 1B0VA 4OI1A 1RWMB 1R7IA 2UVRA 3PJXA 1RT6A 2H5EA 1E6YA 1BXNA 2IVFB 1X4HA 4E98A 3BN4A 3J7YU 4USIA 3OV7A 5DETA 3UDVA 4R0JA 1TL7B 2U1AA 1T0TV 1JLFA 1MU2B 2EBEA 4OI2A 5J2QB 1VQOS 3W3SA 1YRUA 5KFZA 3NCPA 4YMEA 1ZAWA 2B4PA 2Q43A 4MKBA 7FDRA 5KAKA 3C6TB 4K50A 3GG0A 3THVA 3OJSA 1YI2S 3P5TL 1LWCB 4DDFA 4P73A 2A2DA 1KSPA 2PEBA 5B0AA 1RABB 3HMJG 1CJUB 1YGYA 2X7IA 1NB7A 2BM1A 2UUAJ 2IBKA 2DRAA 1UFWA 4NCAA 3M2UA 4W98A 4MKYA 3SXLA 1PO6A 2QX0A 1VQPS 4V19J 3P49B 4P7VA 4DCJB 5C5JA 1F5CA 3HFKA 5EWGA 3T1HF 2KVQE 1PGZA 2V6AA 5LXYA 1NB2A 2JRSA 4RBTA 1XIQA 3TVZA 2Y8YA 3I5CA 2WVDA 1AYEA 1K1SA 4LF6J 1X31C 5ETOA 1HYSB 3J7A1 4DR7J 9ATCB 2XGPA 4OHVA 2HFOA 1N36F 5IQQA 1MMLA 1JLQB 2ZOFA 1OSDA 1UJ4A 2GFFA 2BVZA 5IC6B 3ENVA 4CRJA 3UR0A 5KT6A 2UXCJ 2DNYA 3QZ8A 3L7PA 1SVDA 2V8VA 2ERRA 3LALA 3A4TA 4NZ7A 3MFIA 2FJVA 1SXLA 4I2PA 3MR7A 1XWLA 3R5BA 3BR9A 2KH9A 3W61A 2IY5B 2IIHA 5SUHA 5IM0B 4FN5A 4JV5F 2QSFA 3HHNB 3BSNA 3OR2A 1SQGA 1N5YB 2EFNA 1F3FA 1MG7A 1P9YA 2OD4A 3ZZPA 2Z58B 2V2VA 4DR4J 3GR1A 4DN0A 1S0VA 3GSDA 2ZH2A 1RWOB 4ILLA 5KFIA 2E9TA 5IFMA 4UOFA 2W9AA 3UDCA 4PQUB 3PIPQ 4PQAA 2K3KA 2PD1A 2LMIA 4YB5A 2M8DB 1RHMB 1EP4B 2BJ1A 2E5GA 2FQQB 2IVMA 2KRRA 2ZJRQ 2DEJA 3TAPA 4EZ6A 4NXNF 4IDKA 3OTBA 4YR0A 4DQSA 3FRYA 1H74A 5BYRA 5DG7A 2DIUA 3HKWA 4HT7A 3MWBA 3J80Y 3H40A 3TARA 1B0PA 4CT9A 2RU3A 1X4EA 1PC5A 2KU7A 1SKWA 2ALZA 3L7OA 3D3BJ 4KSEB 2ZBCA 3AD9C 3RR8A 1Z2LA 4EK2A 2HHHF 3PVXA 2AZ3A 2RT3A 1J5OA 5DLGA 4DPYA 2LDYA 1H2VZ 3G71S 1U0HA 3KLGB 3M32B 3DXSX 1O5JA 2J9EA 4WYLA 4NI2A 4DUTA 1YKWA 3BPSP 2ZZMA 3X1LB 3CCUS 3BBBA 1SB6A 3MM5A 3SQGB 5KOWA 2X1FA 2C2EA 2M7SA 3DOMB 3W8GA 1TP7A 5A0YB 5GADI 3HVAA 4K4ZA 4OL8A 5HAOA 2IJFA 3QRRA 2XI3A 2VZ9A 3UN2A 1RT2B 1YX2A 3UE2A 5ETPA 1X4BA 4K5RA 1RAAB 4B17A 1K8AT 2YWGA 1LV5A 1JX4A 3GIIA 3M2RA 4O44B 3KFWX 1WNEA 4IR9A 1HHSA 1P1LA 2XZDB 3H90A 2GIFA 5T7LB 4XDCA 4C97A 3TI0A 4JI3F 5EGYA 2W9BA 5F9LA 5LSLA 3WZ0A 4UW2A 1ZM3A 3MAQA 3D9BA 2KDOA 3TP2A 2BE9B 3HHEA 2CWKA 3W9HA 3MI7X 3P96A 3LGNA 4JI7J 3I96A 4IFYA 1FT8A 4FDFA 2VQFF 3M9OB 2MZJA 3FKBA 4CO4A 2KXHA 2I9SA 4IUFA 4JV5J 4M5MA 2LQJA 3BYPA 3R6LB 9RUBA 3PDNA 1RTJB 2EVZA 2IM2A 2ZBQA 2RMLA 3BH7B 3O6QA 3Q86A 3OT9A 4OX6A 3D28A 4PG8A 3CCTA 1FJEB 1T02A 2EK6A 4XAKA 4J9QA 1FKOB 3IGVA 4B3TF 1K0VA 3TAQA 1L3TA 2Y1RI 4B3SJ 4TVAB 2R7XA 3FK4A 2YX1A 1O6XA 1IBKJ 4KBIA 1HQEA 2VFRA 2NPFA 3BSCA 2H65B 3I0SB 3IWLA 3IXQA 4WIQA 4NLGA 2ACMA 1KLMB 4WXOA 1R0AA 3RR7A 1QSLA 2ZD1A 1JB0C 1KR4A 3PCOB 4NMXA 1DRZA 4AYBD 4YEAA 5GAHU 1IBCB 5KFRA 1YBAA 2XY5A 4P9SA 2Z2LA 3QQCD 2ZVSA 1RT5B 1UAWA 1G2EA 2K1RB 3K8VA 2D1CA 3MM8A 1VDHA 2MSSA 3DRYA 4XPEA 1M5PC 4LFCF 2XMTA 4W92B 1EETB 1YVFA 4YHHJ 2OSQA 4DV3F 2UP1A 4TLQA 4XIUA 1RT7A 4GRSA 4DPTA 1KBRA 2HQDA 3H5SA 2BQUA 1FTCA 2QEXS 2RHSB 2KZZA 4HI2A 3UD4P 5KFSA 6FD1A 2BOPA 2OIHA 2ZUAA 2MJUA 5KTQA 2HVEA 3FMBA 2Q66A 2J6UA 1IQTA 2DB1A 3V6KA 1FWLA 2OPSB 4ECUA 4V1Ak 2E7XA 5B7WA 1QDUB 4U8YA 3SV3A 6FDRA 1UW9A 2PMZD 4B9UA 2O1PA 5FDLB 1U48A 3KLIB 5DQHA 1D3WA 2YNGB 2MMYA 1M90T 4LRFA 1B70B 4ZPAA 3W9JA 4F4YA 3ILLA 3OFGA 1HI1A 2QIFA 5L1KA 4DV5J 3FFIB 3HHLA 4OLPA 4WFAQ 2WW4A 1WC3A 3RBDA 3QPIA 1XMQJ 3WHIA 2J6SA 4IRKA 1RBLA 2FD2A 2PGCA 4KV8B 3SYZA 1L3UA 4JI6J 2AHOB 2HS3A 2IM3A 4IFYB 2DT9A 3VCDA 1A0OB 3PW7A 2CG8A 3I87A 3EDRB 4LF5J 4KGMA 3NGRA 3A8EA 3CULA 3DLGB 3MMAB 4JI1J 3TVYA 3PRVA 3EZOA 3VGVA 2ZM6F 3F56A 4MYUA 5B09A 2GMHA 1S9GA 4LF9F 3LP2A 4ZPWR 4M5JA 1V3ZA 4LRBA 2XGQA 5LXRA 1WHYA 3HKZD 5B0FA 5BR8J 4DV2J 2B5JA 2XBPA 4M5KA 5BYQA 3IM8A 1RAIB 1M5KC 2OO4A 3R3TA 4QR0A 3T9ZA 1U45A 1SC3B 1V9OA 2FPHX 3DOLB 4I6AA 2XY6A 1VQ8S 2CJBA 2QG9B 3LUYA 1GTEA 3OHAA 3OFEA 4ES2A 1ZZNA 2HHUA 2ZVIA 5MAOA 4RU9A 8RUCA 3FMWA 4LUBA 5THWA 2CVEA 1NZAA 2IM1A 3NXZA 4KGKA 4KGVB 2LLZA 3RJMB 2KXNB 2EBGA 1S7IA 3CT9A 3F44A 4URSA 4ZVEA 4CT8A 1T95A 3BN7A 3W2WB 4EBEA 2W2PP 5HQ8A 4OYBA 3RW6A 3WC2A 3CDBA 1N32J 4LMZA 3OTCA 1KOHA 5JJBA 4TYAA 3SCLE 1S10A 2NUHA 2JSXA 3D0GE 3GB0A 1NRKA 1Q8LA 3PW0A 4OZNA 3H4DA 2Y9HA 1X7VA 3CJTA 3DDKA 3AODA 4U67Q 5KFVA 1HNXJ 4U7CA 2G0JA 3LAMA 2XCPA 2MKHA 2DTJA 2ROGA 1HNZF 3KK3B 5E5NA 3CCJS 3UDLA 1U25A 1T3NA 1GXTA 3OLAA 5HI7A 2JC0A 3IGNA 3KLEB 4IKAA 3MPWA 5CHCB 1XMOJ 4LBHA 1SCJB 1WF1A 3I6PA 3DOKA 2MGZB 3IRXB 2PE8A 3KK2A 4EWTA 3C8YA 1JLBB 4E0DA 3C15B 5CXTA 2EFQA 3ISND 3G6XA 3SFUA 3H4BA 1PJ5A 2HNYB 4CH7A 3CC7S 1IWAA 2CQ4A 1NU4A 2OPQB 3GU0A 3WC0A 4RW7A 3JAMY 3QRQA 4WU3A 1U6ZA 2FZGB 1NSAA 2QV6A 4KO0B 4KHMA 5A0YA 3TX8A 2P6TA 2YNGA 4ZCIA 2Y1IA 3RAQA 1Q8BA 2HVDA 1WACA 4DCOB 1DQ9A 5B08A 3DYAA 5IOLA 3FZBA 1ACMB 1HMVB 1UA1A 2EC2A 2GMLA 3NAHA 2QFIA 2YKOA 1S7HA 4FXWA 4NLRA 3ZTRA 4X65F 2DCUB 4DR1J 1HR0J 1HARA 1FF2A 1RT3A 4CLPA 2AJ4A 4RNNA 4JI2J 2EK1A 1KVJA 2HWHA 4Y2AA 6AT1B 4X66F 2DNKA 4DR5J 2HYIB 4CO3A 5L9XA 4J9OA 5D77A 3L4BC 2QE5A 1TKTA 1QVFR 3H5UA 3N28A 1VJWA 3SCIE 5DM6Q 3HM9A 4C8NA 2NPIA 1XQIA 3JB9k 1P8GA 5BJRA 4XPCA 4DF8A 2F8EX 3BGRA 1F60B 2IM0A 2AX1A 3C19A 1RGVA 4CWBA 2Q3PA 4YFUA 4F50A 1FNXH 1CC8A 1HQUA 4F4XA 3DNCA 3OXFA 1CJTA 1JLQA 2M8HA 3E8OA 2A6OA 4ECSA 5F41A 2IDEA 4TXSA 1CJVB 5IWAF 1WC4A 2LVWA 3KHRA 1SI9A 4I2QB 4NYPA 2DHSA 4DU7A 3H2UB 3MECA 2SXLA 3H59A 2HS0A 4ZVHA 2EWHA 3SSSA 2LXIA 2DHAA 3FBCA 3KDNA 3ZTOA 4D3HA 5KFPA 3C66A 4CYUB 4FKXA 5KFDA 1IQZA 3VQSA 4EGLA 1FFSB 1SIWB 1FVSA 2QL7B 4Q2LA 3C3LA 3ITHB 2LFVA 2A6MA 2WB4A 5KG1A 1IKXA 3HVTA 1H6KX 2ZD1B 5J1EB 1S1XA 3I0RA 3M05A 3KHHA 1IKWA 4MH8A 3G8TA 4ILMA 3N9UC 3NBPA 3FEYB 4RNMA 1JJHA 1Q53A 3M8PB 4O0NA 3U02A 2K2PA 1Y10A 2P5VA 1U1RA 1RYRA 2OFHX 4OYXA 2NREA 5EWFA 2BJ9A 3FBBA 3MM8B 4RX6A 4LF7J 3GYGA 2DH9A 4I6YA 1JNZB 1RAEB 2RD5C 2YTCA 5KG5A 5D3GB 4DSLA 2AP6A 2MQLA 2AYEA 3D1QA 3AXMA 5K5MA 5LT5A 2R2RA 2W4CA 3DI6A 4KRWA 5AXMA 3PW4A 2L9NA 3E51A 3J7ZT 3PW2A 1SKUB 1VQLS 2KT5A 3NOCA 1KVIA 3JSBA 3BO2A 1X9SA 1G4CA 1RA6A 3JTPA 4RW7B 3VGUA 4FBUA 2DXEA 1PSDA 2FIUA 1R8PA 4QR2A 4LF4F 3KNAA 4GVBA 2VG5B 3VGTA 4WFBQ 2FHJD 3MR5A 2OPSA 1LWFB 1T3OA 2APOA 3DCAA 1BMQB 3M2VA 2UUCF 2ZC3A 2ROEA 1S9EA 2X1GA 4JI0F 1WWHA 2VG7A 1VISA 2VASA 1Q7LB 1OO0B 1DZ5A 1VQMS 3KMQA 4DL4A 1F1BB 2W24A 2W4DA 2MTLA 3PM9A 3QLHA 1JMTA 3LTOA 3QT7A 4ANCA 3G2XA 1NK5A 1F5AA 2RIJA 1FERA 2AX0A 5GAGU 1NBEB 1RZMA 3NGUA 5KFOA 4Q5VA 1OWXA 4WBFA 4EYIB 1NLKL 4ZVQB 1CG2A 1IBMJ 1JJ4A 2Q1LA 2ADBA 2CUYA 4I0WA 3HXMA 2HVHA 4C6AA 1BQMA 4Y28C 4ED1A 1R0BG 5D15A 3FCVA 3DLKB 3JSYA 2J0QD 2P8IA 4AUKA 3POTB 3G8SA 1S9GB 4WZQA 4FYVB 3H2VE 3HI9A 4PG5A 3V2UC 1RTDA 3I82A 5F8IA 2J8SA 2RSQA 3TZYA 1ZPWX 1ULRA 1WC5A 2YKAA 3Q8UA 5K9FA 1HQ2A 4I2QA 4DN9A 1Q78A 3KDOA 3MECB 5ETLA 1DY3A 4ZVUB 2UUCJ 3F0NA 1TUVA 4B9TA 1W7WA 3L95X 4WKRA 4DR4F 4N56A 3CW2C 2DR7A 5J2MA 3VAFA 3VR1A 1WKLA 1PG5B 3MOJB 2CAJA 2UXBJ 2LXUA 3BZQA 3V4IB 2RB7A 2W2MP 1UPMB 2WSCC 2XMUA 4K4WA 1RAGB 1Y5IB 4ELVA 2NCKL 3KLVA 3AJ2A 4DZDA 1HI8A 2Z0GA 2XYGB 2XSFA 4NXMJ 4K7QA 3GIRA 4OI4A 2GX8A 2DH7A 3E3XA 4CO2A 4RW8A 4HH0A 3PX6A 1OPZA 2L41A 4N77A 3KWMA 2QMXA 5KT4A 3KLEA 3IBCB 1CSJA 1F5BA 1S77D 2LQ8A 3CJ8A 2E1AA 1QUPA 4KR0B 5ETQA 3N79A 3W9IA 1WD6A 4P75A 4Y6IA 2UVWA 4Q43A 5H9EK 1T05A 2QMUB 1X5OA 5I3PA 2H1YA 4F3OA 4DZ6A 2XMMA 2CJYB 2VG5A 2FDNA 1HNWJ 3CIMA 4NOHA 4LSLA 2F7VA 4TU7A 3DDIA 4AT1B 2R2SA 2VONA 3AY0A 1TKDA 1ELOA 2D9OA 2G1DA 1TTHB 1J5OB 1KKHA 2IFXA 3GLJA 4J90A 3K89A 2JDJA 2VG7B 3TQEA 1IM6A 4KO0A 1PJ7A 4OJGA 2YBVA 4A8KA 1FRMA 1LQ9A 1UFLA 1H2TZ 2EI5A 3FDSA 2BOAA 4PKDB 3W63A 4RW9B 4USWA 4WFNQ 3EYZA 4DR2F 4MFBA 3KLIA 5RUBA 5F3ZA 3OL7A 5K8PA 4NRTA 1T03B 2F9DA 2ZH5A 4ED6A 2ILYA 4IG0A 3NNAA 3GG1A 2Y8WA 4LFBJ 1PAUB 4X4SA 2NXUA 2RUSA 3NCQA 1KONA 1YQHA 3H8YA 3UWTA 2AZ1A 3OSPA 3CJ5A 2CNNB 4N76A 1UVNA 4P10A 1EX8A 2LDIA 5T7LA 4N8OA 4Y3CA 2UVUA 4LR8A 4NYZA 3A1YG 3AA8A 4N5SA 2KG0A 2MDAA 1TK5A 1CEZA 4JI2F 5IT9U 2AYMA 4NLXA 4DQRA 2NXNA 4LIWA 2R7QA 3EXYA 3FEZA 4PXDA 4X84A 5DDRC 4BHQA 4M5IA 5J1PA 3GMGA 2Z2MA 1U02A 4KE5A 4ZS6A 4DJBA 1U26A 2MKIA 4IO9Q 2EG1A 2FUG9 1BLUA 2ZNYA 1GAOA 1LOUA 2KFYA 4I67A 3CJSA 1OIAA 2WBMA 4CI0B 1CJVA 2CZVC 4NLSA 3ZZ0A 1SH2A 8AT1B 1URRA 2X1BA 3H5YA 2DO0A 3MR2A 5EN1A 3ZNJ1 1C1BA 4OYPA 2VBXA 3PJ9A 3N6NA 3CJ0A 3VVUA 4DHVA 5KFFA 2ZJQQ 4WU2A 2WVCA 2V0NA 3UCGA 4QIWD 2ATLA 1TZ0A 2LA4A 1KWMA 4CYUA 2VFVA 3PEJA 4O3OA 3NL0A 1NDPA 3V6DA 3OUYA 2CNLB 5J2NA 2HW3A 2V8DA 4NLYA 1EQ0A 2KT3A 2V67A 1KS2A 5ETSA 1RISA 1SJ1A 4NLPA 3DLLQ 4YY3J 1FE4A 4HKQA 5LSOA 4IRCA 4PEOA 2HFNA 2QYCA 1HNZJ 3I9V9 1XERA 4JYAJ 1RT1B 2B9YA 3SBMA 4DFPA 3CPWR 2MHNA 2PC6A 2BJ3A 1X0PA 2F65A 2KVIA 2O5DA 3R5JB 3D67A 4YP3A 3C46A 1TFWA 3M6WA 2RKIB 3HHKA 5C24B 2QC3A 2H3EB 3ONQA 1HIYA 1YLXA 4LSLB 3RB6A 1AFIA 4GKKJ 4ZVRB 2NUUG 3N6LA 4X4VA 2VBYA 1PYTA 3MPVA 1UJ5A 1S6QA 4PABA 3S8SA 1DARA 4DR3F 1NK9A 1YJUA 1DQAA 1K44A 4KKOB 5A6WA 2F8MA 4TQSA 1LK5A 1RACB 3QMQA 3HHLD 4IOBA 4CLUA 1UJ6A 1R89A 4C98A 1F0XA 3NRBA 3M1VA 2JVOA 1S76D 4ECVA 2MLYA 4HTIA 1S49A 1N34F 4KFBB 2QA2A 1N5TA 4NPOA 1LWXA 2H54B 5KFCA 3TWZA 2B9XA 1WF0A 2CPJA 2CPZA 4ZA1A 1UWAA 2MQ8A 4PG6A 4NA1A 1T11A 4DG1A 4TU9A 4DFMA 1S4FA 1YJ7A 2CQ3A 2QJ3A 3I32A 1IBLJ 1S1WA 5HP1B 4DQPA 2D3ZA 5H1SV 1UP1A 1FEHA 3G86A 4JV1A 2FJEB 3K8WA 3NGDA 4F0HA 4OZ1A 4WK3A 5U47A 3KLHA 2CPEA 3TEHB 3AJ1A 1RWUA 5H9FK 4F3QA 4CLLA 1FJGF 3DGPA 3FUYA 3T19A 3TUZC 2A3JA 3VAMA 5CYQB 3CJ3A 1RT2A 1NK0A 1X0FA 2XYHB 5E3CA 4WKYA 3DLHA 4KPYA 2RNEA 5GAEU 3R5CA 1S6UA 1UETA 5HMZA 2JOQA 3RW7A 3W5ZA 1QAYA 3NKYA 3LH2S 3Q89A 4IH7A 2X51A 4RUBA 2DJWA 2C2MB 3IA0A 4OHWA 3CCVS 1QAJA 4K0KJ 4LVNP 1ZM2A 3QBCA 1I94F 4A8YA 3KJFB 2BX6A 4X4OA 2PI5A 1X4CA 1N5QA 2GQCA 1RTIB 3HFZB 3QGPA 4JI5J 4J91A 2MZSA 3NNHA 2JEIA 3AB4B 3MHYA 2FTRA 5A2QU 4WE1A 4ZHRB 1S1XB 2CPIA 1IKWB 1RHKB 4LREA 1S0MA 3MR3A 1AW0A 2H5IB 3C16A 4RNOA 3PNIA 1RT1A 4GMKA 3M8PA 2EPIA 1S1VB 4LBIA 2NLWA 4OX7A 5KG2A 3M30B 3PFOA 4LR7A 4OJ3A 3PIOQ 4GKKF 2O3DA 2HQ3A 4OZ0A 2RKIA 2XWYA 1SJ4P 5CYMB 2W2OP 1JK9B 2CQDA 2CJKA 1P27B 1SC6A 2JX2A 2QRRA 3D68A 3IR5B 1FKPB 4M5NA 4AXJA 1MWZA 5IS2A 1WKJA 2BRLA 2E5IA 5HJXA 1OQ3A 4WF9Q 2CPFA 3TR5A 3JQJA 3MM7B 1FD2A 3PEHA 5KG3A 1VOMA 3CXCR 2X1AA 5FLXU 1SKRA 1OY8A 2G2OA 2MSTA 3KUGA 3OTEA 2OPRB 3HCXA 3PYEA 3GR0A 3GPAA 3ILJA 2D74B 1KD1T 2FVQA 1JXLA 2PA8D 3KOAA 2GV1A 4Q0BB 3MM6B 2DNRA 3RG6A 3HSZA 4L73A 4YDXA 3TJ9A 3NY0A 3IO1A 4N7TA 2MXYA 2HVIA 4YS2A 2DITA 3QATA 1C1CB 2MZQA 3MTJA 3AJDA 3BS9A 3R6GB 2ZE2B 2Q6CA 3BF4A 1SJQA 2QLXA 2AIRB 2COLA 2I8EA 2YPZA 2C1EB 2WCXA 4WFZA 1MLAA 2HURA 1XN9A 3BO4A 1XTZA 4LT6A 3US5A 3OBIA 3OJUA 4F4ZA 4ECRA 1AROP 2B7CB 1WTBA 1CC7A 5IZHA 3TUPA 4ID8A 1H73A 4HDGA 1R6YA 1TKXA 2HWTA 3HULA 2V63A 3BREA 3NWGA 3PX4A 1DTQB 4USHA 3GSIA 1FJCA 2V2QA 2ACYA 3AT1B 1RAFB 1YZ7A 1YG0A 3CCRS 3J81Y 1DTTB 5FDLA 1IKYA 1CS4A 1QE1B 1SC1B 1VS3A 2CKWA 3LPEA 4P2SA 3CGIA 2CQHA 1F2HA 1RI7A 5B0DA 4X4UA 4NCGB 3DHWC 2QA4G 3KJVA 1WOPA 2NS1B 4XTTA 2AKWB 2XYPB 2IAJA 4RW6B 5E0OA 4USVA 4USMA 5H9EJ 1X4DA 1Q16B 1U0SA 2CIMA 2J76E 4CLWA 4MK8A 3TA0A 4R5PA 3RB3A 2ASDA 1VIOA 1XR6A 2DGVA 3FVYA 4G65A 3KHGA 4DV0F 1TKZA 3O3LA 5DDPC 3C14B 4B3MF 2CPDA 4DR2J 1IWGA 1JKHB 4X62J 4OI3A 2HFSA 5ITHA 2NYIA 2W4PA 3S6EA 3JAMU 1MSWD 2A2CA 3B4MA 3GE9A 5F0WA 4ZLPA 2VIHA 2HQCA 1X5PA 3CMAS 2IRYA 4C11B 1H38A 2DPJA 2V94A 2F4VF 3GCXP 2QFJA 1LW0A 1N56A 4QYZK 1IUJA 4FPIA 4CLSA 3JSMA 2VQEF 4NLVA 4Q2MA 1MMDA 1UMJA 4FXVA 1RSCA 2BR0A 3D1OA 1UTAA 2C28A 1TK8A 4LR9A 4U7UD 1NK7A 1KHVA 4OYZA 1KN6A 3LAKA 2ATCB 1KOOA 1VR6A 2J9DE 2W9CA 2AEFA 3Q8RB 3MM9A 3VHQA 1NAQA 3EZUA 4ETXA 4QR1A 1N5YA 1FXDA 4U9RA 5HQLA 1AA1B 2DNQA 3IP0A 2DHGA 2M4MA 3MMJA 1DLOA 3R7NB 4ZK7M 5KT3A 2HFUA 4J9SA 4PPZA 1FD8A 4K2JA 4GO5X 4LBPA 1NJXA 1I6JA 1WELA 4F04B 2XS2A 1GMWD 4MAKA 4ENOA 5DLFA 2UXDF 2J8AA 3EE3A 2C3OA 1N36J 4K4VA 3CF5Q 4LF1A 4P7TA 3RBXA 3KK2B 3QT5A 1QUVA 3RBEA 5CYJA 2GHPA 1TKXB 3MPYA 4OYIA 3T1HJ 5HVGA 4P72A 2KG1A 4FF4A 2R7TA 1DHMA 5M2RA 4QWDA 2J9CA 2VFTA 3ETOA 2B8PA 2HWIA 1T9XA 5KG4A 3BKFA 3S1TA 4UZCA 3GZ7A 3K58A 3DGPB 2WOMA 1P6TA 3GV7B 2UUAF 1BQMB 4NI2B 1UEVA 5DQIA 4A48A 2DGQA 4RW4A 1Y0HA 5CYQA 2J5AA 4UOGA 2R7WA 2AJ2A 2XMKA 3DOMA 4FKYA 4Z7CA 4OZ5A 3BJYA 4ECYA 4DPXA 2VFSA 1NNDA 3WX4A 4L75A 3H0PA 4UUWA 4XK8C 3TA2A 5A8WA 3EZ5A 5CA5A 4O4RA 2I5JA 2N4DA 3W65A 3ZXWA 2FJWA 3M2RB 4O44A 2C2KB 4YUDA 1UVMA 1MWQA 2BDPA 3UD3P 1VRTA 2V68A 4RO0A 4DUZJ 5J2PA 4CO5A 1C1BB 3FGVA 5HQMA 3QGGA 2EFVA 5I42B 4J9MA 2GHWA 3UI3A 1RWPB 1HBOB 2IDLA 4IQMA 3VF0B 2A10A 5KT5A 2AGQA 2J6TA 3VAGA 1QJHA 2VPZB 4JI8J 4IOCQ 1L3VA 4DS5A 2H5JB 4M8LA 2ABYA 4WE1B 4ZHRA 4ZVGA 1UVJA 4CLTA 5JMNA 4PRFA 1IBLF 3RU0A 5K8MA 4RUAA 4J9PA 2HBRB 4TQRA 4N47A 3X3UA 1JXEA 1H2UX 3UVJB 3A13A 3AOCA 1RHJB 4NA3A 1FKOA 3EJMA 4WTYA 3PKYA 5E3RA 3K0JA 2WK4A 2AD9A 5AE1A 1NDKA 4P52A 3PV8A 2O67A 3ET6B 5C24A 1H72C 3QNWB 4CH1A 4F2SA 3AD7C 4Q44A 3HJFA 2VJUA 1NPRA 4ELTA 1IKXB 1EJ7L 3D0IE 4ZPVR 4ED4A 3M8RA 1V6HA 3PYFA 3EUNA 3RBZA 3CD5A 1T05B 3MMCB 4A8XA 2UU9J 2OP5A 4Q0BA 1MROB 2XG8A 4HI1A 5DZ6A 2M52A 1U1MA 1JLEA 3HZEA 1ZBTA 4LIRA 1VQ4S 1HL6A 1WG5A 3C6UB 2DRDA 1SKSA 2HHQA 3HT0A 2K1RA 2YKNB 5K8OA 3RB0A 3J7AN 4AL7A 1TL3B 1WI6A 4G1QB 2H9ZA 3D6TB 1SQFA 1FDNA 4NLDA 4TYBA 4NLQA 5KFTA 2DKOB 3W5XA 4B02A 3Q24A 4DUZF 2IVYA 3ENWA 2ZITA 5K14B 2R7UA 4K4XA 2MHEA 2WRMA 3CMQA 4QWEA 1QSSA 5IWAJ 3QWPA 2HK2A 4IG0B 3TVKA 3MR6A 1RWVB 3SCJE 2A1BA 2KL8A 1U6FA 1Y9OA 2DH8A 3DRXA 4F02A 2M88A 1HKAA 2NSCA 5FIIA 2HGNA 4DR6J 4DUYJ 2Z2ZA 4YR2A 4RW4B 4PG4A 5F9NA 1LWFA 2ASYA 3DMJA 3M2VB 4LSZB 2XO6A 1HNVA 1GTHA 2P9CA 3CNQP 3GYXB 3CC2S 1IBMF 3U1NA 4FBTA 2VBZA 1IKVB 3AA9A 2V2KA 2Z2YB 4LFAF 2YNIB 3QJLA 1DTTA 2ZH3A 3DN9A 1FA0A 1CS4B 1IKYB 3QT8A 2VG6A 5HVFA 5I4MA 1M5HA 3U7JA 2M3DA 1IJFB 3RB4A 1EHWA 4LQ3A 2WBRA 2HQGA 5KT7A 2KT2A 1GMWA 2XTJP 2ZBPA 4DR5F 2NXJA 5B0BA 3LWLA 4TLRA 3JYTA 1HBUA 4DLGA 4QIFA 5LSRA 4OJHA 1Q81T 4DV6J 1HR0F 2OEJA 2RQKA 2WB1D 3OR1B 1NHVA 4QWBA 4PWWA 4EO6A 4X65J 1EAYC 4LF4J 2B4OA 4ZN3A 3BSOA 3U1MA 2IMWP 1K0TA 2M70A 5HBMB 5EDWA 2GVZB 3G6VA 2ZEJA 4TY8A 4ZJLA 3TZXA 2D69A 4IG3A 4QJVA 1B64A 1ZTWA 2DRBA 3VAIA 1HNIA 4RUHA 1GT8A 2VKRA 5HROB 2VKZG 1L3SA 4Q8FA 3IWNC 2WONB 3HVRA 2EFPA 2HQIA 3MAAA 1WC0A 1E6VB 2JJ4D 1RU2A 1TL7A 2RQMA 4DR6F 2GIQA 2IBOA 4OIXA 5CYMA 2GMJA 2GC8A 1WHXA 4FF1A 4HHHA 5D4NA 2LECA 3CD7A 2R42A 3DOLA 3AOBA 4IYQA 1LWCA 1RKIA 5KFNA 2VUGA 4I1TA 2KYXA 1VBKA 4RPFA 1H7WA 5AJ3J 3WX8A 3B4DA 3FBFA 4DX6A 3MM9B 1G6BA 2B43A 2ZKTA 3N0VA 4I56A 5KFWA 3Q0AA 3JTOA 1V3SA 1BD6A 1FKAF 1MWYA 2ZZNA 2DGXA 4ILRA 1FWPA 1HBMA 2YWFA 1N52B 4DXLA 3M8ZA 2RE1A 1Y5LB 1S6OA 3RGIA 1S99A 2N4CA 2XS7A 4MIBA 4WIIA 2W2NP 4YR3A 3RAMA 1SH0A 4CQ1A 2JFKA 2OTLS 2UU9F 3CD6S 4U6PA 2MKSA 1VYAA 4NE9C 4IFVB 4M5GA 5K14A 1V5VA 4DV0J 3V6HA 2CQ2A 4K5SA 1T8EA 3MCNA 4CLFA 3Q2SC 4KFBA 4CLZA 5D8HB 2NSBA 2FVCA 4HL9A 2OUGA 2DHXA 4F3MA 4X4TA 2ZZTA 4NA2A 5F8HA 3DLEB 3MEEB 4U8VA 2OJ3A 2G0CA 3PTWA 2LEBA 3ILOA 1TAQA 4KH1B 3W64A 4ED7A 1RT6B 4MK9A 4QBUA 3MD1A 5A6PA 3MZIA 5GAEI 4DV2F 2WVEA 2UXBF 1K47A 2JNJA 5KFYA 3ULHA 1DTQA 1D09B 3GJRB 3PHTA 1VIXA 4HLBA 4EO8A 2VICA 3O1LA 1D8ZA 4AQYJ 5AXKA 1NDCA 2ZM6J 1RKJA 2DVIA 3HZGA 1FJ7A 4JI1F 5LOQA 2FHJA 2GVDB 4Q45A 3A8IA 5B0CA 3K5MA 4U7UK 1HWJA 4DV6F 2BJDA 3AQPA 1Y3JA 3P5BP 1HBNA 1S1TB 5A8WB 3K5NA 3QJJA 4UY85 1RTHA 2IRUA 2HSEB 4JI6F 3S7RA 4HT5A 1EP4A 1HMVA 4ZP6A 4L72B 2HBYB 3M7VA 1ZOTA 2ZWPA 4ALZA 5L1LA 2XMVA 1VRTB 4F36A 4OZ3A 2CPHA 4YOEA 1R8AA 1OQ6A 1RYSA 1BUXA 1T9WA 5DZ7A 1WEXA 2JZ5A 2C2OB 2QA1A 2MPUA 3AXKA 3IFEA 4NL5A 1UEUA 1QAXA 1HBOA 1Y11A 2W1BA 1JKHA 4N8NA 4QIGA 2G2YA 3W2VA 1OY9A 3HLUA 4RR5A 2B4UA 3GJTB 3Q22A 2BQ3A 3DRPB 2VA2A 4X4PA 4H4MA 5G0RB 3MUTP 1G7CB 2PMWA 2NZCA 4ID5A 3HFVA 3CO9A 2DNNA 1U49A 3PY8A 5M2UA 4HVZA 4WTOB 1X9WA 3D1HA 3FSYA 3RUBL 3IS9B 5H9FJ 2V2ZA 4DV4F 4ETZA 1BQNB 4A8OA 2YWHA 3UVJA 1RA7A 3QSYB 3PYDA 1WDTA 3MTKA 2YQ1A 2DNLA 3LP0A 5KFGA 2J0SD 5CH7B 4C7QA 3MEGB 3FQLA 2DY1A 4Q7AA 3LQVA 1N0VC 1GNKA 3RTVA 2FVRA 2XLIA 1PIEA 4KC5A 3R1HA 1UVIA 3V81A 1FRHA 3ITHA 1NJWA 3WQPA 3KK1A 3OL6A 4MYTA 2BW7A 3HP6A 3Q23A 4I68A 4IFVA 2ZH1A 3DKDA 1X5SA 3M8SA 2CPYA 2XNRA 4FXDA 1KRPA 2ZC4A 4JI5F 1O0PA 3OW2R 2PEHA 2N82B 3FCWA 4R25A 3R97A 3BM7A 1VQ5S 1TK0A 2EFOA 3IR7B 1VQKS 3H2LA 4NLTA 1I94J 2FLLA 2F63A 1I3OB 4IOAQ 4X64F 4E2FB 2HRUA 1Q4RA 2O66A 2C2ZB 3HHLC 4RNHA 3UNYA 1V5IB 4Y2MA 1S97A 4B3OB 2KFZA 3KNGA 2XZTB 3SCKE 4LF9J 2AT1B 2HIQA 3M8QB 2ZE2A 3HSJA 2KKHA 1TL1B 3NS6A 4DX8H 3NCRA 4MTPA 2VQEJ 1RWKB 4DV4J 4LF8J 1U0HB 4GVLA 3RAXA 3MXHP 3JS9A 2MY7A 2X3GA 4ZJQA 4OYAA 3DU6A 3MM5B 1HW8A 2DD8S 1TELA 5L1JA 4X2BA 5IT9Y 3J81j 4I69A 4ED5A 1IR1A 2HS4A 4RWXA 5GMKa 3EVMA 2POKA 5T14A 4M5LA 1FJGJ 4ZLNA 1UWBB 4JB8B 4YB1P 2QLJB 3I4PA 1S9EB 3GFXA 2FZCB 3P8BB 3CCZA 3T1AA 2B6AA 4X62F 4EBCA 2GJFA 2RUGA 2RU9A 2L3MA 1QE1A 3DRRB 4DI6A 4LRDA 4FS1A 3KJNB 2IC3B 2AYBA 2EFGA 2BBEA 3E01A 4LSNB 1WG4A 2IMOA 1U8WA 1JJ2R 4A8SA 1F9EB 3QGIA 1TUWA 4M5HA 3VQTA 2R2TA 3W2VB 2DGWA 2GVZA 3CJQA 3DRPA 3DU5A 2LKZA 3VZHA 4OI0A 1FRLA 2HGMA 4L6V3 3UO0A 4ID5B 3C14A 4IH6A 4J7CA 4X66J 4CTAA 3KYLA 3VAJA 2BZ2A 2V9WA 4QU6A 1TV6A 2RRAA 5HANA 5DS7A 4ZCMA 5EUHA 4Y00A 1KFSA 3LF0A 5E41A 1SL1A 4M94A 3KUEA 2ASLA 2V9KA 2A18A 3ZO7A 3KLFB 2D3OR 3GCWP 1VMBA 4USKA 3TUIC 1E6YB 1VC5A 1L5UA 4N41A 4ZJOA 3GJSB 3FEXB 5J1NA 3DLJA 3FBEA 5GVQA 5KFQA 3OL9A 3MEDA 2W7AA 1FFWB 2M5YA 1K9MT 4TN2A 1RHRB 2BJEA 2VH7A 4NEYA 4RWWA 1R6VA 5SZTA 2ZH8A 1O8BA 4FZVA 4NASA 3DHXA 1FVQA 2F4FA 3W5YA 2BE7D 4HYKA 3DLBA 2LU1A 4W90B 1HFEL 3OFFA 3UN5A 2OLWA 1EB0A 2XCAA 3OHBA 1XNQJ 1Z2ZA 3KXDA 2Z57B 1RT5A 2CADA 3NOGA 5A8RB 3R7BB 3UFCX 1RQ0A 3IN5A 1T9VA 3M2UB 1C4AA 2LEPA 2BABA 2C3UA 4ANDA 4B3TJ 3H5XA 1EETA 4FP9A 2FLPA 3LP2B 4W4MA 3D5MA 1GX6A 4RW8B 5CD4A 1HNXF 1U4BA 4OLOA 4EYHB 1DURA 4B08A 4X4QA 1B4SA 3CCLS 1CLFA 1HD1A 3MAHA 1FDAA 3ILIA 4H54A 2LQBA 1N54B 4WPAA 1CBKA 3OXGA 2VQFJ 2PDAA 1RWXB 1VFJA 1ZA2B 2OPRA 1Q1KA 2JEGA 1PCAA 5ETKA 1WC1A 2GS8A 2RVJA 4USTA 5MLCV 3Q8SB 4LF6F 4DR7F 3QO9A 4QZVB 4B3MJ 3FSIA 3RRGA 1YBUA 2WSFC 2ZWOA 3AHPA 4XDDA 4IH5A 5IXUA 1Q5YA 1ITPA 5IM0A 3NAIA 1M1HA 1F3VA 3BQ2A 1S59A 3RRHA 2OELA 4HR2A 2F5GA 3AB2B 1CULB 4H4KA 2E5JA 4C2MA 4BS2A 4ELUA 3OFHA 2DNPA 3L09A 4USJC 4UQTA 4RKUC 3EX7B 3TX0A 5DG8A 1VC6A 3JTNA 1UL3A 1J5EF 3KK3A 2BKNA 3FQKA 4P74A 3QWUA 2JEJA 4Z2XA 2R2UA 2JH3A 4EBDA 3CC4S 2IJNA 3DOKB 4TY8B 2HAFA 5EX0A 4LF5F 2DGSA 1TFYA 2CQGA 2L48A 2B56A 3HDSA 3R27A 3ZTPA 3C15A 2RDDA 2CDQA 4A8WA 2B5JB 3PYGA 2E66A 2HNYA 5HROA 1XMQF 3SFGA 4F4WA 4LF7F 1XR7A 3MAAB 3MGJA 2AJ0A 5DQGA 4PWDA 4K0KF 3KLGA 7AT1B 2HHPA 1ZM9A 1HD0A 4F2RA 4TNOA 2MZRA 3I56S 1T9UA 2OSRA 3QIDA 1QTNB 4MMOA 2XHWA 2HNZB 4OV1A 3CJ2A 3M9NB 1XNRJ 4X4NA 2XMJA 2E1MC 4RBUA 2ZHAA 3LP0B 1XBWA 2JC1A 2UVVA 3LANA 4X64J 3W2WA 4C3KA 4BBYA 1I1GA 2DCLA 3PJWA 4A8FA 1MN9A 1R31A 1X60A 2R7VA 1RT4B 1A6LA 3DDNA 2VDIA 4HHJA 4MIWA 5ETMA 2DNOA 3NMRA 4O4GB 1WEYA 4P2XA 4RL1A 3R5GA 1N6QA 2FY8A 1NHUA 1NH7A 1WDDA 4PQUA 4O3RA 3B54A 4DSEA 5EWEA 4ZLLA 3LW5C 1WSRA 3M6VA 4ECTA 1T9TA 1PBAA 4I7FB 4PAAA 4YHHF 1JLEB 5F0UA 4DV3J 1KTVA 1A9NB 2N3LA 4OHZA 2H51B 2OGUA 2MGZA 2HKEA 1HQUB 1WSVA 2V8HA 3B8HA 4PPDA 1BWEA 2B3TB 2PT0A 2DISA 2QLBB 4B3OA 2IHR1 3DLEA 3A3OB 4F4KA 2W9CB 2XZWA 3M8QA 4ZPTR 3C2PA 3NWRA 2CDRB 3QIPB 3MD3A 1NMEB 4ZP8A 1REGX 4A47A 2EG2A 5KT2A 4JYAF 4O3QA 3WDOA 3CMES 2XY7A 1S9FA 1VGYA 2JL9A 3UPFA 3EPIA 3T5HA 1NJYA 3BDEA 5KFLA 1KTQA 2JVRA 3NGTA 4OZLA 4DEZA 4DPOA 5A2QY 3G87A 1HQEB 2V50A 3QFWA 3L9ZA 3AD8C 1UWBA 1KQSR 3ICLA 2JHEA 1IBKF 4ER8A 4C8YA 3I0RB 2MKYA 1OYDA 4LF2A 1VRUA 1FE0A 4FYWB 1BHNA 3G6YA 1ZZFA 4DL2A 1EZZB 1FRIA 1TR0A 2YY3A 3DRRA 2YWWA 3HSGA 4AD6A 4BC9A 3MCOA 1YRTA 4A8QA 4R0EA 1WHVA 2H4YB 3NG8A 4ZP9A 3SSRA 3EGZA 3I55S 1LEOA 1TVRA 1S1WB 4ZMMA 4F25A 5I3UA 5KOXA 4QCLA 1RCOB 3TNVA 2CYYA 3SDEA 1OS5A 1RHUB 4C8KA 3ENQA 2ZOGA 5LM7E 4AE5A 4CZCA 1K73T 3ZC4A 3B6BA 1OMSA 2HNDB 2WZ1A 4KQZA 4C8LA 1WG1A 3NS5A 1ZH5A 1IVZA 2HAIA 2F3JA 3KG1A 5D0RA 2OHDA 5IV4A 2C2DA 4H4MB 1KHWA 1NZ8A 3FZ2A 4O0IA 1DQ8A 2AGOA 2D7SA 4JI3J 3KLFA 4YB7A 3O44A 1SC4B 1RDRA 5KFXA 4NWBA 2E7VA 3ISZA 2O01C 1VQSA 5EHHA 1DAXA 2FB0A 1M0SA 1P9QC 2Y3YA 2Z4PA 5K8NA 3SI8A 1U1OA 1ZAVA 2ZNZA 4P2MA 3ENAA 3PXGa 4KYZA 2IYGA 2BXJA 4Z7YA 3CIZA 2J0WA 5I42A 4OYOA 2K7KA 3EDQB 1N34J 3ZZZA 5FD1A 2XB2D 4DX7A 1YITS 3T6BA 2B51A 3MOZA 4ZCLA 2DPIA 1FXLA 4CLKA 2Y0BB 3SEOA 1V3RA 4K4UA 3EGNA 2V4QA 3I5AA 4F67A 2VOOA 3GWCA 4J9NA 3EGVA 3GV5B 2HBQB 3IAS9 4G1IA 2FC8A 4BLGA 5A8KB 3TW0A 2RQCA 2VC1A 3GYNA 2BKOA 5HVHA 4M5DA 5HL7Q 4OZJA 1NJZA 1NHKL 2HRTA 2VB6A 4ES1A 2GJIA 4ZLJA 4C8ZA 3B82A 1LNQA 3VGSA 3M30A 1LK7A 5CABA 2VD3A 3DI6B 1SBRA 2H48B 2LA6A 3VAKA 4PUOA 5HO4A 5AJ3F 4DMZA 2FHOB 4YY3F 1JNRB 4IO1A 2ILZA 2YKMA 4UTGA 1NEEA 3GTYX 3JSRA 2PMHA 2I0XA 5GAHI 5E2QA 4QU7A 2FHKA 1XEZA 3UD5A 4DL0C 2J7UA 3JQMA 3OVBA 4NYOA 1S1UB 4NXMF 1VQ9S 2A0FB 3FJ2A 3MURP 2PIIA 3PRDA 3QJPA 3MM6A 3OD2A 2LP4A 2YKNA 2LXFA 5KFBA 5ETRA 3G9CA 4G1QA 2KM8B 4DV7J 2K8GA 1D9FA 2FGCA 2E1PA 2JLFA 2FVPA 1H7XA 4QPTA 4UY8T 1WTFA 4F8RA 1B7FA 3UCZP 1FK9B 4OYWA 1TVRB 4LJMA 3E01B 4LSNA 1QD1A 3LO3A 4UF4A 1DBDA 2M2BA 3IC1A 4HACA 2HK3A 3THTA 1G3OA 1QAIA 2QT7A 1L3KA 4KV8A 3MEKA 2RDJA 3V4MA 1TMJA 3DMJB 4I6WA 3L3CA 2YVSA 3CCES 1H98A 4Y2IA 4ZIWA 3HHDA 1GMUA 2K06A 2KB2A 4A46A 2NR0A 1T9YA 1HPZB 4WP3A 1S6PB 5C25B 4GC7A 2G1HA 3SSQA 3CCMS 2IPOB 3IMQJ 2CFXA 1PILA 4DOZA 3KHLA 4FF3A 4LFAJ 1JLBA 3I31A 1FTRA 3B78A 5HSPA 4ECZA 1F2GA 3TZZA 4MKAA 5FJ4A 1Q8IA 1U24A 4ANEA 4BC7A 4A4JA 5F3TA 1YBTA 2PI4A 1NSPA 1SL0A 3HD1A 2UZAA 3TJAA 2NXCA 1RBOB 4MKVA 1NKCA 2HNZA 3R5AA 3PR4A 1NK6A 1U1LA 2YH1A 3JXOA 2RJZA 2FJAB 2BV3A 2DGUA 2R3VA 2W2QP 4P6QA 1AZSA 1RCXB 3AH6A 3NP5A 2QA4S 4ERDA 3KMSA 3DYAB 3TJ8A 5F8LA 4IG3B 5C2CA 1TKZB 1LW2A 2K3IA 4JBCA 1R8CA 5FLXY 5B0EA 3K2YA 2BKPA 3R8YA 1HNIB 5CZXA 2Y0SD 3Q8PB 4C8MA 2E5HA 2QGFB 4KGXB 1WOOA 2CZ9A 2WONA 3O2IA 2HQFA 5JUMA 1R8HA 2DBBA 2QL9B 2ZJPQ 2DR5A 2XEXA 3OTOF 2GQQA 3P6YC 2MQPA 4AL5A 2YNFA 2GZOA 2HMIB 1SJ3P 3NLCA 1YTYA 2XWXA 1UPPA 2OEKA 3AFGA 4ZVTB 1TU0B 2DGTA 7FD1A 5K20B 1QY7A 2LQ9A 3CDWA 3TAMA 5L38A 2YKPA 1Y4ZB 2QL5B 3IG1B 4RNFA 2XQCA 4Y65A 4FVCA 3TZWA 2QMWA 3OSNA 4OV6A 5G4DA 2F8HA 2KHDA 3GJQB 2D3UA 1KDNA 3MMBB 3T6JA 1IM4A 3ADAC 2DIVA 3H25A 4I2PB 1VK8A 4DL7A 1TL1A 2VBWA 1BQXA 1S5ZA 3CDUA 2YWKA 3QO9B 5GMEA 3OXLA 4LRCA 4DL3A 5ETVA 2BE2A 2OPQA 2ZHBA 3V6DB 4YB6A 4MFBB 1WI8A 5DJBA 1UEKA 3H20A 3K5OA 1QSYA 3MDFA 1VQNS 3BGUA 3IR6B 3L7UA 4AXIA 4A8MP 2FY1A 3CCWA 2YWEA 4USUA 2KJVA 3M8YA 1CULA 2VPXB 2MB0B 2KO1A 3HVTB 5J1EA 2P9GA 1NUEA 4ES3A 2XSJB 4K8RA 4C0HA 2BANA 3CCSS 4LFCJ 5HJYA 1VQYA 2RHQB 3D6MB 3K17A 2MKKA 2PFDA 1R8BA 2IC3A 5DGBA 3NNCA 3LP1A 3EWGA 2VV5A 2QSWA 3G4SS 2YX4A 3SDEB 2KM8C 1FDBA 1Q82T 1Q86T 1PBUA 5D3GA 4WYWA 3ZTSA 4NCBA 1GMVA 5GADU 1SH3A 2Y1LB 1JLCA 3VVTA 2VOPA 2HHWA 1MW7A 2U2FA 3HVWA 3M6UA 3NGKA 2YH0A 4QIEA 1D1UA 5KG7A 1C0TA 1NKEA 3CE8A 2UV8A 3CJ4A 1O51A 1RTHB 3BKUA 2GHVC 4CTAB 2V4RA 1FWKA 4PWDB 2JLEA 1CJKB 1FRKA 2H4WB 3THPA 2ALYB 5I3QA 3K57A 1CJTB 1U09A 1U2CA 3CB4A 2N3OA 2C3MA 2ASJA 1Y7PA 4ICLA 3CVKA 2BA9A 4L3KA 5D0GA 5ETTA 3UN3A 4TY9A 1D9DA 1LW2B 2CJXB 3UDEA 4JV2A 5J2PB 2HFZA 2MLXA 5GAGI 4DX5A 1VQ7S 3MEDB 1DFDA 2AWZA 3P4UB 4EUVA 5HP1A 2VU5A 1MN7A 3MUVP 4DSKA 4M95A 1QLNA 2UXDJ 2MLZA 2V34A 3K5PA 1GK8A 2XULA 1VBYA 1P1TA 2BM0A 4ZKAA 4S0MA 5E3AA 3NBPB 1GXUA 2FYXA 4YDDB 4J9VA 3KTQA 5A8RA 1FCAA 4I7FA 1T7PA 1ZYQA 3QYYA 2HHSA 4PXEA 2BW2A 3NGSA 8ATCB 4H4KC 4PUOB 3ZZRA 3P3DA 5HLFA 4B3SF 2V4JB 3VAHA 2MQOA 1XMOF 2HZAA 2YKMB 2AEMA 2B9EA 2DNGA 2BACA 4ITSA 5D4OA 3UNGC 2RS8A 4QWAA 1SV5B 4GC6A 1S0OA 3HK2A 2FJDB 4URQU 1M5OC 1JWWA 2XI2A 2XO7A 3KK1B 1URNA 2F9JA 3RYLA 1VLOA 2R8JA 1UKUA 1N8RT 1TL4A 1HLWA 2CQ0A 3M1VB 4DF4A 2GGPA 3PX0A 1U47A 5E3PA 4C3MA 1KLMA 2DGOA 3O5TB 4HH1A 1N5VA 2YX7A 1D8YA 4JI7F 5A76A 4ECWA 4ECQA 2OTJS 2OPPA 3WIUA 1K1QA 2XSJA 3C6UA 4O3SA 1RP5A 2HGLA 3CSKA 2AMCB 3C16B 3H98A 4MJKA 1W2IA 1RAOA 3LPYA 3UW1A 4DQQA 1EKSA 4ZPBA 5JVGQ 1D0EA 5HMXA 2VPWB 3LP1B 1YJTA 3BGLA 2J0XA 3D6FB 1C2PA 3NS7B 4TKTA 5LMUF 3T3FA 4UQGA 5BYSA 4KTQA 1TMMA 4NZ6A 5AE3A 4YQWA 1RLDA 1VK3A 1FKPA 3W1YC 4X4RA 2VPYB 3Q8YA 4OX9J 4NMLA 1XR5A 1C0TB 2CG4A 2F4VJ 2UUWA 2HLTA 1HPZA 5BR8F 3BEGB 5KFJA 3EGWB 1HNVB 1EKRA 1SQEA 3PHEA 3POTA 4KAIA 4C4WA 3K7RA 3SZ2A 5HK4A 1AXQA 4TU8A 3G96A 1X5TA 3SV4A 1JLAA 2CQCA 2J7WA 2ZOMA 4Z37A 2R7RA 2RF2B 1KNZA 1PC4A 2ROPA 4DR1F 2HHTA 4WCEQ 3W60A 3QZ7A 1FO1A 1YJ9S 5F8NA 1CPZA 3O8WA 1G1XA 4ZVSB 2FGOA 1GFWB 3W62A 2G2ZA 5IC4B 2RILA 3CWJA 1HWIA 2BMBA 3D3CJ 1JLFB 1LXJA 1MU2A 4CIOA 5J2QA 1TAUA 2DR8A 4KGZB 2F1FA 1RTIA 2V8GA 3DFEA 2HEKA 3I5BA 4L3NA 4C48A 2UV8G 3ELHA 3FFIA 3HHLB 1BWVA 4G1PA 4ZPDA 3DM2A 4ZCKA 4R8UA 4URGA 3VALA 4DWIA 1U6BA 2VFUA 3LGHA 3WBZA 2QLWA 3TQ1A 1TV6B 3VV2B 4FYYB 1Y5NB 4H4OB 1S1VA 4JP8A 5A8KA 1VC0A 3OPKA 3A8KA 3V81B 3CCQS 1Z4UA 1SL2A 1JLGB 2YNFB 2HMIA 1N6QB 1SIZA 1WC6A 2N7YA 5F8MA 5HLFB 3PACA 4PXBA 3S01A 4DQIA 3WIVA 1M1GA 4ZPCA 4QOTA 3TAMB 2HPUA 1FX4A 4Y0FA 4NCGA 4DL5A 1FFGB 3KJVB 2DNMA 4DU8A 1IN0A 1BY9A 3BB5A 2CQIA 3U1LA 3DC2A 4PR6A 5KG0A 1VQ6S 4GKJF 1APSA 5GMDA 2AJ1A 2DO4A 1NSQA 3QSIA 2PN6A 3M8WA 4MT1A 4WK1A 1N32F 2FZKB 2WVBA 2GW8A 3BYRA 2YNHA 5E3QA 4LQ9A 3IBFB
chains in the Genus database with same CATH topology
3BSAA 1C0UB 4CO0A 3TYTA 2C2RA 3BO3A 5JXSA 3CJKA 3GIMA 3OR2B 4JUZA 2N7CA 4WJBA 4RW9A 2FJXA 4C11A 1W2BR 1RK8A 2W7PA 3T5LA 4WFYA 1T03A 2G9OA 1X4AA 4DV1F 4EZ9A 2UUBF 2YKQA 1REVA 2B7BB 2GA7A 3MEEA 4OJ1A 4IQXA 3IWXA 2MKJA 3FCHA 2AJFE 4IDKB 2MJNA 3G6ES 2LU2A 3N4WA 2HHVA 4ED0A 2YQ3A 3OTDA 5I3UB 3IRXA 1GQEA 1CVJA 2AU0A 2R7SA 1CQMA 4BWJA 3CDEA 4DSIA 5LJ3Y 4NX9A 3Q2TC 4RZRA 3MF5A 3M6XA 4ATNA 4CH0S 5AE2A 1AUDA 1WF2A 4FNIA 2VA3A 1DLOB 4NZ0A 4Y2KA 1OPIA 1K9MT 2D41A 5CCLA 2IAJB 4RW6A 5IQ6A 1FRJA 1FESA 3GILA 1XNRF 3MFHA 4B9VA 1FHTA 5LJ5Y 2WTFA 4E8UA 2L9WA 3SQGA 4C0OC 3PR5B 2OKQA 3T1YF 3QAEA 4PWUA 2KJWA 4J9KA 4WXWA 4RU2A 2AYGA 2GO8A 2MZTA 3Q8QB 3ZZOA 1NO8A 1U1KA 4I64A 3IBWA 1YHQS 5DDQC 5B0GA 2RS2A 2ADCA 2L08A 1N4LA 1M5VC 5DGAA 2AQ4A 3N5FA 2MQQA 1JLGA 3GIJA 2ZHOA 1N88A 5J2NB 3OUYB 2E1CA 4ECYA 3BQ1A 4J9RA 1QM9A 1LW0B 1TKTB 2CJAA 2KHCA 2WOMB 4FS2A 4ECZA 2GO9A 1NB7A 1FXRA 1HWKA 3CC7S 1DJ0A 5IT0A 3OQ2A 1Z1ZA 4B9MA 1SJRA 5L39A 2K7JA 4M5DB 4KHRA 4C8OA 3CDAA 1KEKA 2IA0A 2ZKUA 1KQFB 3AAWB 1S9FA 2CVIA 2I5JB 1YSJA 3TUJC 4OMFG 2MB0B 3U27A 2CQBA 1RT4A 4OHYA 2YNHB 3MEGA 4CNZA 2Y1JA 4K4TA 1OSCA 5E33A 1IJEB 4MIAA 1YJWS 1HHTP 4GO7X 1VI7A 2OMLA 3CD0A 4MK7A 4BWMA 1M1KT 2BE2B 1S79A 1W25A 2DR9A 3TANA 1Y3KA 3N01A 5DRKA 4B3RF 1N0UA 3E2EA 2FHMA 2FC9A 4EFAC 2CRLA 1CQNA 1B0TA 2QZ8A 4FNHA 1HI0P 4HTJA 4DLEA 1XMBA 3KKFA 4ECXA 2ZUGA 2OD6A 1YJVA 2ZH7A 1UA0A 2UXCF 4PCQA 5DDOC 4J5OA 2Q6BA 4FVMA 4OHXA 2ZDOA 5D78A 4KHPF 2FLNA 1XNQF 3HPOA 2G4BA 2VODA 3N6MA 4OFZA 3DRSB 4C3LA 5HN0A 2CJQA 1TL5A 5KFEA 3J7Z5 2CJ9A 3MM7A 4PXCA 1JLAB 3GV8B 4FF2A 2JFDA 2RF2A 1WHWA 1MROA 4DSFA 4EEYA 2AJQA 3F41A 1SUQB 4QYZJ 2L9DA 4ZOSA 3M9MB 1YJNS 4ICLB 1KQKA 4KJIA 1N48A 3QLHB 5E7OB 3ZFVA 2FLOA 4IRDA 1C1CA 4LFBF 4ED8A 2HNDA 4QWCA 1ZTTA 1R3NA 3RZAA 3OVSA 5ADZA 3UCUP 4KB7A 2OMOA 2CPXA 2KN4A 3M32A 2ZH6A 5D6GA 5F8GA 2W25A 1YWXA 2PA3A 3BR8A 5C42B 3DLKA 1MNEA 4RBVA 4JV0A 2C42A 3FSXA 2E9ZA 3OL8A 3DLGA 3MMAA 1RTDB 1HNWF 1U2FA 4FYDA 2ZDPA 2C22A 5T41A 2P6SA 2GJ2A 3Q0AA 1NK7A 3D2WA 1UVKA 2VL1A 3HF5A 5IT4A 3JYTB 1FDDA 2EW9A 1S0NA 3IG1A 2ZFHA 4Y34A 5D4PA 3OR1A 1H3DA 2W8KA 3PO4A 1TQLA 5M2PA 3CUNA 5J2MB 1KFDA 2WSEC 2KTQA 1NK4A 5LMNF 3IRWP 2GGPB 3ISNC 3PO5A 1C0UA 1D9AA 2D9PA 3V4IA 4LF8F 1BGXT 3CJKB 2OPPB 1JIHA 1FNMA 1RTJA 4FPRA 5KFMA 3V6JA 1HYSA 3N5BA 5DG9A 1X4GA 5L9NA 1KQGB 4B9NA 2GNKA 2AF6A 2R8GA 2LCWA 1LXNA 4G6VB 1HW9A 3T9NA 4DS4A 2BANB 5JVHQ 1HWLA 2P9EA 3HX9A 4KIAA 2AV5A 3I0SA 1U1NA 1IR0A 2C3YA 5CZVA 2YNIA 5D4LA 4DFKA 5LL6d 4ZP7A 5CD4H 5HMYA 1QTMA 2KYZA 3T5JA 3D54A 2I2YA 1FK9A 3F73A 1YRXA 1HA1A 2EKYA 4O3PA 1U1QA 1IXKA 1U8SA 4LVOP 3PKMA 2FVSA 5L1IA 3BQ0A 4CCHA 3LGMA 2I1RA 1GX5A 2PSZA 2M9KA 2WAQD 1FEEA 4R5PB 1S72S 2J9DA 2XMWA 4G3IA 5DM7Q 2ZH9A 5L8RC 4OX8A 2WHOA 3GQCA 3DM2B 4R8UB 1S6PA 5C25A 4BDPA 1ZM4A 3FRZA 5KFAA 4H4OA 4Y2CA 4KT0C 3OLBA 3J7YI 3PZPA 1VBZA 3TOQA 3ZZYA 3VTIA 1N5SA 2CQ1A 2V5HG 4QYRA 3R1LA 4AFFA 1HWUA 4PG7A 3JSMB 5KFUA 3VWSA 2MY8A 3C6TA 3LOUA 3PW5A 2DNHA 3AQOA 2XLKA 5KFHA 2R8KA 1NH8A 1A7GE 2GCFA 3EXCX 2W8LA 5KFKA 2ZBIA 2V4JA 1HBMB 2E44A 3RRKA 1R43A 2W9BB 4IR1A 1NJIT 2R8IA 4BCAA 3HO1A 4AQYF 3MUMP 1SV5A 2VC0A 3QGHA 2KXFA 2PO4A 3G8QA 1LKZA 4QQBA 4O4GA 1MMNA 2HZCA 1BC6A 2OFGX 2MKCA 3V5RA 4OX9F 2HRYA 4J9LA 3LWMA 4O3NA 5G0RA 3TRGA 4DL6A 1SJFA 4JI4F 2BRKA 1LFPA 3CTRA 3TO8A 4C0BA 2XNQA 3IS9A 4OI6A 5EX3A 2RDIA 1BQNA 3MMBA 3W7BA 1R27B 2MQNA 1Q7YT 3M4XA 2CQPA 3QIPA 4QPXA 2AW0A 4DFJA 2RRBA 1FRXA 3GFHA 4K4YA 4K59A 2IA6A 2B4VA 2LQ5A 2R8HA 3DRSA 1S6QB 1X9MA 1HBNB 1S1TA 4I4BA 4UUXA 3V81B 1NK9A 2UUTA 1YJRA 2B0GA 4KKOA 3UR3C 2MYFA 4CNYA 1X4FA 1VRUB 1ROFA 2KI2A 1VBXA 3ZZTA 3NMAA 4ED3A 1XC9A 1U1PA 4D3GA 1ZPVA 1KC8T 1RJJA 4B9SA 3GIKA 4ZDNA 4DG1B 4M63A 2BQRA 4UOCA 1VLYA 1TL3A 1JLCB 2DNZA 2NQPA 1RT7B 2DK2A 3SMZA 2Z8QA 5HMWA 3BGFA 4CO1A 1QVGR 4EU0A 5DO2A 4RUCA 3KLHB 2LEAA 5C42A 1FNOA 3FNNA 2HLUA 3UQSA 1AFJA 3PFEA 2IYIA 3K5LA 1WEZA 4K2XA 1LWEA 1ZAXA 4DSJA 2HHXA 2XS5A 2HVZA 2AGPA 1GXLA 2OAUA 2NZ4A 4ED2A 2PFFB 2XC9A 1C4CA 1YIJS 2FJBB 3QAUA 4ZVFA 3I4HX 2R7OA 3ZZUA 4K4SA 4F26A 2ZH4A 4DV7F 1RT3B 2J7KA 4NLWA 2C3PA 3T1AA 1XK8A 1M5SA 2G13A 2R4FA 2RQ4A 4HEA9 2B9WA 2GIRA 3KG4A 5KG6A 4HDHA 1NK8A 2JWNA 4OQJA 2JEFA 1LFWA 2F40A 4RLEA 3CEDA 3MMCA 3D0HE 1ZETA 4DUYF 2GQ2A 2XLJA 1GH8A 2W7OA 2LYVA 1N33F 4NLUA 1KLNA 2R9LA 5AXLA 3BGRB 5HBMA 2RH3A 3PRBA 2E7WA 1F9FA 5F8JA 2KFNA 3R5DA 2HG4A 2CZ4A 4C9DA 2I38A 4WFXA 3T5KA 1T94A 1UW4A 2KRBA 1U7LA 1E6VA 4QW8A 4M1KA 1REVB 3TA1A 4V19X 4O23A 1S1UA 2WW8A 4DBQA 3DXBA 3BDPA 2Q79A 1IKVA 4XO0A 4Q8EA 2B6AB 2E1RA 5AXNA 1R0AB 2KZMA 2BYCA 2QO3A 2VG6B 1RAJA 1U2RA 2M0GB 2E29A 1X8DA 2JLGA 4QW9A 3EPGA 1Y00A 2E5LF 2EC0A 5CQGA 1SUQA 2MQMA 3MCSA 4B9LA 1VHFA 2IRXA 3GFYA 4NRUA 4QIVA 1HBUB 3VZIA 2MZ1A 2BUNA 3KG0A 1H0HB 3IAM9 1J2VA 4DV5F 1Q79A 4NLOA 3K59A 1UVLA 3I9ZA 3GFZA 3HT3A 1S48A 4J37A 2RRNA 3OVAA 4AL6A 4JOUA 1NKBA 4JI8F 1LWEB 4WZMA 5CCMA 1B0VA 4OI1A 1R7IA 2UVRA 3PJXA 1RT6A 2H5EA 1E6YA 2IVFB 1X4HA 4E98A 3BN4A 3J7YU 4USIA 3OV7A 5DETA 4R0JA 2U1AA 4OI2A 1JLFA 1MU2B 2EBEA 5J2QB 1VQOS 3W3SA 1YRUA 5KFZA 3NCPA 4YMEA 1ZAWA 2B4PA 2Q43A 4MKBA 7FDRA 5KAKA 3C6TB 4K50A 3GG0A 3THVA 3OJSA 1YI2S 3P5TL 1LWCB 4DDFA 1KSPA 2A2DA 5B0AA 3HMJG 1YGYA 2BM1A 2DRAA 1UFWA 4NCAA 3M2UA 4MKYA 3SXLA 1PO6A 1VQPS 4V19J 3P49B 4P7VA 5C5JA 1F5CA 3HFKA 5EWGA 3T1HF 1PGZA 5LXYA 2JRSA 4RBTA 3TVZA 3I5CA 1K1SA 3J7A1 1HYSB 2XGPA 4OHVA 2HFOA 1N36F 5IQQA 2ZOFA 1MMLA 1JLQB 1OSDA 1UJ4A 2GFFA 2BVZA 3UR0A 3ENVA 5KT6A 2DNYA 3L7PA 2V8VA 2ERRA 3LALA 4NZ7A 3MFIA 2FJVA 1SXLA 4I2PA 1XWLA 3R5BA 3BR9A 2KH9A 5SUHA 5IM0B 4FN5A 4JV5F 2QSFA 3HHNB 3BSNA 3OR2A 1N5YB 2EFNA 2OD4A 3ZZPA 3GR1A 4DN0A 1S0VA 3GSDA 2ZH2A 4ILLA 5KFIA 2E9TA 5IFMA 2W9AA 3UDCA 4PQUB 3PIPQ 4PQAA 2K3KA 2PD1A 2LMIA 4YB5A 2M8DB 2E5GA 1EP4B 2IVMA 2KRRA 2ZJRQ 3TAPA 4EZ6A 4NXNF 4IDKA 3OTBA 4YR0A 4DQSA 3FRYA 5BYRA 5DG7A 2DIUA 3HKWA 4HT7A 3MWBA 3J80Y 3H40A 3TARA 1B0PA 4CT9A 2RU3A 1X4EA 1PC5A 2KU7A 1SKWA 2ALZA 3L7OA 4KSEB 2ZBCA 3RR8A 1Z2LA 2HHHF 3PVXA 2RT3A 1J5OA 5DLGA 2LDYA 1H2VZ 3G71S 3KLGB 3M32B 3DXSX 1O5JA 2J9EA 4WYLA 2ZZMA 3X1LB 3CCUS 1SB6A 3MM5A 3SQGB 5KOWA 2X1FA 2C2EA 2M7SA 1TP7A 5A0YB 5GADI 3HVAA 4K4ZA 4OL8A 2IJFA 2XI3A 2VZ9A 1RT2B 3UE2A 1X4BA 4K5RA 4B17A 1K8AT 1JX4A 2YWGA 1LV5A 3GIIA 3M2RA 4O44B 3KFWX 1WNEA 4IR9A 1HHSA 1P1LA 3TI0A 5T7LB 4C97A 4XDCA 4JI3F 5EGYA 2W9BA 5F9LA 5LSLA 3WZ0A 4UW2A 1ZM3A 3MAQA 2KDOA 3TP2A 3HHEA 3MI7X 3P96A 3LGNA 3I96A 4IFYA 1FT8A 2VQFF 3M9OB 2MZJA 4CO4A 2KXHA 2I9SA 4IUFA 2LQJA 3PDNA 1RTJB 2EVZA 2IM2A 4OX6A 2RMLA 3O6QA 4PG8A 3D28A 3CCTA 1FJEB 1T02A 2EK6A 4XAKA 4J9QA 1FKOB 3IGVA 4B3TF 3TAQA 1L3TA 2Y1RI 2R7XA 2YX1A 4KBIA 1HQEA 2VFRA 2NPFA 3BSCA 3I0SB 3IWLA 3IXQA 4NLGA 1KLMB 4WXOA 1R0AA 3RR7A 1QSLA 2ZD1A 1JB0C 1KR4A 1DRZA 4AYBD 4YEAA 5GAHU 2XY5A 5KFRA 1YBAA 2Z2LA 2ZVSA 1RT5B 1UAWA 1G2EA 2K1RB 3K8VA 2D1CA 3MM8A 2MSSA 3DRYA 4XPEA 1M5PC 2XMTA 4W92B 1EETB 1YVFA 2OSQA 4DV3F 2UP1A 4TLQA 4XIUA 1RT7A 3H5SA 2BQUA 1FTCA 2QEXS 2KZZA 4HI2A 3UD4P 5KFSA 6FD1A 2BOPA 2OIHA 2MJUA 5KTQA 3FMBA 2Q66A 2J6UA 1IQTA 2DB1A 3V6KA 2OPSB 4ECUA 2E7XA 5B7WA 3SV3A 6FDRA 2PMZD 4B9UA 2O1PA 5FDLB 1U48A 3KLIB 5DQHA 1D3WA 2YNGB 2MMYA 1M90T 4ZPAA 4F4YA 3OFGA 1HI1A 2QIFA 5L1KA 3RBDA 3FFIB 3HHLA 4OLPA 4WFAQ 3QPIA 4IRKA 2J6SA 2FD2A 4KV8B 2PGCA 1L3UA 3SYZA 2HS3A 2IM3A 4IFYB 2DT9A 3VCDA 3PW7A 3I87A 3CULA 4KGMA 3A8EA 3DLGB 3MMAB 3TVYA 2ZM6F 3F56A 4MYUA 5B09A 2GMHA 1S9GA 4LF9F 3LP2A 4ZPWR 1V3ZA 2XGQA 5LXRA 1WHYA 3HKZD 5B0FA 2B5JA 2XBPA 5BYQA 1M5KC 2OO4A 3R3TA 4QR0A 3T9ZA 1U45A 1VQ8S 1V9OA 2FPHX 3DOLB 4I6AA 2XY6A 2E9RX 2CJBA 3LUYA 1GTEA 3OHAA 3OFEA 4ES2A 1ZZNA 2HHUA 5MAOA 4RU9A 3FMWA 4LUBA 5THWA 2CVEA 1NZAA 2IM1A 2KXNB 4KGKA 4IRCA 2LLZA 2EBGA 3CT9A 3F44A 4URSA 4ZVEA 4CT8A 1T95A 3BN7A 3W2WB 4EBEA 5HQ8A 3RW6A 3WC2A 3CDBA 4LMZA 3OTCA 1KOHA 5JJBA 4TYAA 3SCLE 2NUHA 2JSXA 3D0GE 3GB0A 1NRKA 1Q8LA 3PW0A 4OZNA 3H4DA 1X7VA 3DDKA 4U67Q 5KFVA 4U7CA 3LAMA 2XCPA 2MKHA 2DTJA 2ROGA 1HNZF 3KK3B