4HTIA

Crystallographic structure of the membrane-proximal ectodomain of the human receptor-type protein-tyrosine phosphatase phogrin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
88
structure length
88
Chain Sequence
ARGYIVTDRDPLRPEEGRRLVEDVARLLQVPSSAFADVEVLGPAVTFKVSANVQNVTTEDVEKATVDNKDKLEETSGLKILQTGVGSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Receptor-type tyrosine-protein phosphatase N2
publication title X-ray structure of the mature ectodomain of phogrin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 21
structure length 88
sequence length 88
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2012-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11548 Receptor_IA-2 Protein-tyrosine phosphatase receptor IA-2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4htiA00
3N01A 2QT7A 4HTIA 3N4WA 3NG8A 3NP5A 4HTJA
chains in the Genus database with same CATH superfamily
3DOKA 3SCJE 4B02A 5HATA 1QUPA 4U6PA 2FC8A 1NK9A 1QE1B 4FDFA 2QLWA 4PG8A 4DFMA 1UJ4A 2DRAA 2WVEA 4ETXA 2ZD1B 1N34F 2DPIA 4ECTA 2EBEA 3C14B 2LECA 3P45B 4KHRA 5HROB 4ELUA 4JP8A 2WOMB 4PAAA 1U7LA 3M30B 1U24A 2AGQA 1FX2A 5ETSA 4F7VA 5EDWA 4TKTA 2V50A 1RKIA 2IMWP 2DVIA 1WSRA 4DV4J 1ZS6A 1WI6A 3NAIA 3NS6A 1WKJA 3K58A 4YY3F 4CT8A 2E7WA 2U2FA 4DCOB 1PKUA 1FJEB 2BOPA 1VBKA 3BJYA 4RUAA 3UR3C 1R8CA 3UVJA 5KFKA 3MR6A 1YG0A 2XSJA 1O5JA 3MEKA 4S0MA 5CYJA 4M5IA 4WCEQ 2W8KA 2NS1B 3FUYA 2J0QD 3OJUA 2OPRB 3QMQA 2O5DA 2WBRA 3F44A 1V3SA 1BMQB 3Q8RB 3D1OA 3BGFA 4I2QB 3H2LA 4DN9A 5EHHA 1LW2A 4BHQA 1KOOA 3QGHA 4PZVA 3BDPA 1PSDA 1DAXA 4J91A 5KG5A 2AJ1A 1N88A 3BGLA 2MLZA 2ZH4A 1SJQA 1R89A 4FN5A 1R8HA 2LQ8A 1KD1T 3C6TB 4L76A 5KFHA 3LWMA 2IMOA 1BE4A 2E1RA 3RRKA 1IWGA 4CH1A 1JX4A 2UU9F 2BOAA 2HQFA 2RIJA 3FCVA 3PRVA 4I2PA 1FKPA 1F9FA 2DB1A 4PQAA 4AYBD 3HHKA 4PG7A 3DN9A 4ID5B 1ZOTA 2XMWA 4ALZA 4QWAA 3ILLA 3M2VA 4GKJJ 3KLHB 4DFJA 3PW5A 1HW9A 3OVSA 1T05B 2WCXA 2QSWA 3CW2C 2R2TA 2CZVC 3H5XA 4DI6A 5GAEU 2B9WA 4JUZA 4OZLA 4DQSA 4H4OA 2ZJPQ 4EBDA 1VQ5S 3K17A 2V9KA 2IBOA 4LBPA 2IHR1 1IM4A 1SKRA 3I0SA 1Y7PA 3MFHA 2AF6A 4LSLA 2OEKA 4MKVA 2P6TA 3HT3A 1R0AA 3DHXA 4KHPJ 5GMEA 2V6AA 3GE9A 1N8RT 1SVDA 2BMBA 3KXDA 5F8GA 2F4FA 4ZS6A 1UWAA 1FDDA 3ZTSA 2ILZA 3TANA 4ZVRB 4MTPA 2EFOA 2ZOFA 4ZIVA 2BVZA 1AW0A 5AXLA 1RT2A 4A46A 3RU0A 4UY85 3G71S 1AFIA 4C8OA 1IKXA 2OAUA 2RD5C 1BQNA 2QJ3A 2F8MA 3H40A 3GSDA 1F60B 1TR0A 3LPYA 4CO1A 5AXKA 4CM0A 3EM1A 1Y5IB 2OEMA 4KR0B 3MGJA 1XNRJ 3DLEA 4OYAA 3W5XA 2GVDB 4DV7F 1XMQJ 3UCZP 2QN6B 7FD1A 3C14A 2N7CA 1GAOA 4CNZA 1REGX 5HROA 2HYIB 3M30A 4DL3A 1UVLA 2XC9A 4LFAF 2R2RA 2J9DE 5J2MB 2VDIA 4J9NA 4M5JA 3Q8QB 3PG9A 4ZKAA 1OPIA 1DJ0A 3CVKA 3FEYB 4NZ7A 1Q1KA 3C66A 1VQPS 2YKOA 2MZSA 1HBNA 1HNWJ 1XBWA 3W63A 4LF6F 3P4UB 1YDLA 1N5QA 1S6OA 3MM7B 2J8AA 1KN6A 3NGTA 2MB0B 4N41A 2ALYB 4V19X 2KG1A 2BUNA 4OHZA 1TK0A 3FFIB 1NB2A 1ZM9A 1DTQB 1RTIA 2FIUA 1RU1A 5IFMA 2LLZA 3J81Y 3ICLA 2RDDA 2OPRA 2PMWA 3IR7B 1Q7YT 1RT7B 1GTEA 2BQRA 5D8HB 1B64A 3LQVA 1RTHB 4I2QA 1UVKA 4LF9J 3A8IA 1UWBB 2HQIA 4W4MA 2YWWA 4F2SA 1WC5A 2G0IA 3O8WA 4OJ3A 2CNOB 2AQ4A 1HYSB 1HNZF 4RBVA 4HR2A 2BM0A 1Q53A 1QVFR 2LU1A 2GHVC 1LXNA 2F9JA 3JAMU 1RLDA 4UT4A 3KLIA 2KG0A 2M0GB 4BWJA 5H9EJ 3IBWA 3W9IA 1LFPA 2MLYA 4ECYA 4J9OA 3FC9A 5KTQA 4ID5A 3VALA 3NRBA 4C8MA 1VQMS 3Q2SC 3ZNJ1 2OTJS 3KLHA 2XWYA 1RWPB 4GVLA 3IBCB 3WZ0A 1UZDA 4FYDA 2V2ZA 2CZ4A 1B7FA 2ZUAA 3R5DA 2W4DA 3QGPA 2F4VF 4QPXA 2OI2A 4DV0J 3QJLA 2UXDF 1R6YA 2UUAJ 3TOQA 1YBTA 4UY8T 2BX6A 2PMZD 1Y0HA 2XEXA 3NAHA 1FVQA 4M5NA 4YP3A 4BWMA 2IJNA 3TA1A 2YWHA 4ED4A 1FE4A 1UEVA 2RQCA 2Y0BB 2HRTA 3VR1A 3IFEA 1T7PA 3NNAA 1X4DA 4DPTA 3MAAB 1VIOA 1P9QC 1UCNA 3GV8B 2AGOA 3EGWB 2B5JB 4HHJA 1A6LA 2G2OA 1YRUA 1XMOJ 1HWIA 1BY9A 3FDSA 5ETOA 1TKZB 4PXDA 4ECUA 4MJKA 3FZBA 3CDUA 3PX6A 3QSYB 2ASLA 1VR6A 4ZVPB 1U1QA 1VJQA 2CJQA 1L3SA 3KHGA 4DV6J 2YKAA 4O44B 5AT1B 1WKLA 4LF7J 3D1HA 1LNQA 1OY9A 3SV3A 1Z2ZA 4W98A 2OPQB 2GVDA 2UXCF 4P71A 1Z2LA 3RBEA 2H48B 2W4PA 2ZZTA 3G87A 2EFQA 4RR5A 2EK6A 5KFFA 1S99A 1IN0A 2HPUA 4TQSA 2MYFA 3CIMA 5KG4A 1Q4RA 3PKYA 3AQOA 4LQ9A 4C97A 2Z30B 3OSPA 4CZCA 1WC0A 1MWZA 4C8KA 4EFAC 3KUEA 1RP5A 3J7YI 4ECZA 3SQGB 3QRRA 1KFDA 4N76A 3RB4A 2C2KB 3EVOA 4KH0B 4DV2J 2X3GA 1UZHA 1W25A 3U27A 1NDPA 3VAMA 4YB7A 2AV5A 2IFXA 3MM7A 5ETQA 4DJBA 4OX7A 1QJHA 4LR9A 1RA6A 4DF4A 3AXKA 1NKEA 2C42A 4IRDA 2ASDA 4CTAA 2GX8A 2X1GA 1S9GA 3M32B 4QR2A 3QT6A 3FFIA 4DV3F 3EPGA 2IDLA 1TAQA 2JLFA 4G1IA 1S49A 2FTRA 4KGXB 1SL0A 2OD4A 2RB7A 2NXJA 2VG6A 2GGPA 2J0XA 1RT7A 4I7FB 3JS9A 3GPAA 3RB0A 4JBCA 5KT5A 4LUBA 2C1EB 2DPJA 2NPFA 2VPYB 1UWBA 2ZM6J 3MPDA 1ZH5A 4IO9Q 3IP0A 1KTQA 1HYSA 3IWLA 4V19J 3OFGA 7FDRA 3S01A 2KFYA 3CJ2A 5IT0A 3QGIA 3SSQA 1AZSB 2BM1A 3L7UA 3HSZA 3CMES 1LV5A 5GVQA 2C3YA 2MY8A 1YJRA 5F9LA 3IO1A 1IKYB 1XTZA 3PXGa 4RW7B 3D6HB 2ASJA 3HMJG 5MLCV 3KLFA 2W2MP 2RU9A 1VOMA 3MM9B 5CD4H 4NPOA 4ZOSA 4L75A 1IJEB 3BSOA 4XAKA 4KPYA 1ZZNA 1TL1B 3Q22A 4WFZA 1TKXB 4GVBB 3ZZPA 1JIHA 3M9MB 1QTNB 3X1LB 1RBOB 5H9EK 3LP2B 2UUWA 4CQ1A 3C46A 1VBXA 1NZAA 2QRRA 1SL1A 1SIWB 4ECSA 3OR1B 4YS2A 3OHBA 1U1LA 1P8GA 3MAAA 1NBEB 3FSYA 2B5JA 5KFDA 3M2UB 2RJZA 3TVKA 1RT4B 1KKHA 1T9XA 2SXLA 4DV4F 3T6JA 3OHAA 1TKZA 1UVIA 3FNNA 1R31A 3HF5A 2HVIA 3KK3B 1K73T 3Q83A 2VODA 1S0MA 4UZCA 1RHRB 2ZVIA 3A13A 4O44A 1HWKA 3M8QB 5L1JA 5IT9U 2N82B 1JMTA 3GIJA 3NLCA 2ZJRQ 1RHJB 2OPQA 1EQMA 2B43A 2CQ0A 4MYTA 1WOPA 3K5OA 4ZPAA 5JXSA 7AT1B 1HBUB 2CJ9A 2GAHC 2B7BB 2N4DA 1PAUB 2ZDOA 3PIOQ 3T1YJ 1ROFA 4UQTA 1RJJA 4JV1A 4R8UB 3T3FA 1RWVB 3SQGA 5I42B 1JLBA 1IBKJ 1VQLS 4Y2CA 3D5MA 5GAHI 2M8HA 3HO1A 4JI5J 3TAQA 1GXTA 4OIXA 4OI6A 3NBPB 2AMCB 2CJAA 2AT1B 3LUYA 2ZDPA 4FF1A 4M8LA 3K5PA 3QT8A 1C0UB 3PRBA 2FVQA 3DLJA 4ZP6A 3M32A 1L3KA 3FJ2A 3PV8A 4U95A 1UEUA 4OHYA 4MK7A 3CNQP 1YZ7A 2VJVA 3CMQA 5HP1B 3EDQB 3RJMB 1QY7A 3J7YU 4C9DA 3AB4B 2COLA 2Z8QA 3X3UA 1Q5YA 1LFWA 4I7FA 2DR5A 3R2CJ 1TP7A 5KG6A 3UE2A 2JHEA 4D3HA 4RNHA 2CWXA 3ONQA 4NASA 1VLYA 5KFNA 3CJKB 1SPBP 4OJGA 1BD6A 4KHPF 5L1LA 3HKWA 2ZEJA 1HR0F 2FHOB 4USJC 1PGZA 4IR1A 2GJ2A 2IA0A 2MSSA 4KKOB 1Q8BA 1HA1A 3BGRB 4ZVUB 3DU6A 5KFMA 2W9BA 1KFSA 4NX9A 3ITHB 2DXEA 4LF8J 5E3QA 3LGNA 3EVMA 4X4SA 1JWWA 4ZN1A 2JZ5A 3LP0A 1WI8A 3H2VE 4TVAB 3M8PB 2HHTA 2YNGB 4UUWA 2MEWA 2L41A 2CDRB 1HFEL 2I38A 4LBIA 3BH6B 2CQ3A 1XMQF 1FWLA 1NEEA 2GO9A 1VQYA 1N6QB 1VMBA 2A3JA 1C4AA 3LP2A 1LQ9A 4C98A 1X7VA 4NWBA 5F41A 4Q43A 3KK1A 1KC8T 1VC0A 4OHVA 1U1KA 3CCES 3KWMA 2GIRA 2RHSB 5L39A 2IVYA 2ZH5A 1FERA 2DNKA 1NUEA 3QIPB 3C16B 1VRTB 1RT4A 2MZRA 2DO4A 4DCJB 1NM2A 1U8SA 2NLWA 1NH8A 3CE8A 5CYQB 4DL2A 2UUBJ 3U1NA 4U8VA 3L3CA 4ZJLA 1SXLA 1U2RA 5KFYA 4DU8A 1D0EA 1NKBA 3KK3A 2ZVSA 4B3TJ 4CLUA 3JSBA 1N4LA 1AUSL 1RT3B 3M4XA 4NZ6A 4EUVA 2L48A 3PKMA 2B8QA 4TLRA 1Q5VA 1SC4B 3HZGA 2IM1A 5KG7A 2ROPA 3J7AN 4DQPA 4MH8A 3RBDA 1I5OB 4OZ0A 4F4YA 3BPDA 5GADU 3HD1A 2KRRA 1HBUA 2J7KA 4LF5F 5A2QY 5L8RC 2Q3PA 1DY3A 1HL6A 1U48A 2V8DA 5ADZA 4OZ2A 2WONB 2F8EX 2YX1A 2BJ7A 5KFVA 4F0HA 1XWLA 1KEKA 1PG5B 3NOGA 2ZBCA 4R8UA 2FJEB 3MR2A 2OIHA 2HGNA 2A1BA 1IKVA 2W9AA 5I42A 4OJ1A 4LFBJ 3W2VB 1N5YB 3DHWC 1HI8A 3OL6A 4GC7A 2Q43A 1LWCB 4MAKA 3TWZA 4CLFA 3H42A 1A0OB 2DGSA 1JB0C 3B78A 3HHLC 1HNXJ 2DNNA 1QAXA 2VG7A 5D3GB 2MKHA 2YH0A 3Q89A 3D6TB 2AP6A 1NZ8A 2HQGA 3ENVA 2R2UA 2ZITA 1C0UA 2V68A 3LW5C 3AT1B 1JLEB 4QCLA 2VA2A 2N3LA 1TUWA 3WHIA 4E98A 1CQMA 2FVRA 1T9YA 4LSZB 2YQ1A 2E44A 5HP1A 4OX9J 3I82A 2QLXA 4GO7X 4IR9A 4DV0F 4AE5A 2Q79A 1IQZA 2I6WA 1ITPA 2UUAF 4KBIA 3WX4A 3S7RA 3SDEA 2I5JB 3O3LA 4OLPA 1RBAA 3PDNA 3G6YA 4DFPA 3V5RA 3T6BA 1WJ9A 5KT3A 3CJKA 1GH8A 1V3RA 2CQ2A 2HS4A 2BV3A 5EWFA 1ZTWA 1EARA 3OVBA 4QJVA 4R0EA 2VG5B 2QA2A 4KKOA 5E41A 3BGRA 4ZCMA 4O3QA 3ITHA 2F8HA 4P2XA 3CD7A 1XMOF 3TZWA 4NA1A 4C0OC 1S4EA 1RWKB 2WBMA 5KFXA 2V8GA 4J5OA 4NLOA 3TRGA 2V4JA 1VK8A 2ZZNA 4DG1B 9ATCB 2O66A 2GMJA 2M9KA 2YNGA 3A8KA 1TELA 4LF7F 3DRRB 2IPOB 2J5AA 2NSBA 4DSEA 4X65F 1N6QA 5A8WB 8RUCA 2BEFA 3IS9B 4OHXA 4HVZA 1ZAVA 2MKIA 2IIHA 1WEZA 3QIDA 4K5RA 4AXIA 4B3SJ 2OD6A 1T03B 4Z2XA 3CPWR 3QIPA 2CPDA 4GO5X 3THTA 3C16A 1T9UA 1VHFA 1VRTA 4K4TA 2N3OA 3OTOF 3D4JA 3RRHA 5CYQA 4DV2F 5T41A 2IBKA 4IDKB 4K4XA 1XIQA 5KG1A 1FDBA 3MUTP 1FEHA 3RBZA 2XYGB 1RT3A 3CJ8A 3TZZA 1NPRA 3A8EA 2VQFF 4O3RA 4L3NA 2ZBQA 3BQ0A 2VASA 4ITSA 2HBQB 3GJRB 4A8MP 2CZ9A 2RF2B 4KT0C 2HGLA 2Y0SD 2A2DA 2UUCJ 3JQMA 2ILYA 3AH6A 3ZTPA 3HVTA 4IG3B 1OJ4A 1CJUA 1EP4B 1DLOB 5KFGA 5A0YA 1WDDA 2WONA 4K4SA 4GKKF 3ZZOA 3NG8A 2QMUB 4NEZA 3VCDA 1C4CA 4U7UD 1RZMA 5D4OA 5ETVA 4JB8B 4ZLLA 3DLHA 2GJIA 3W2VA 4C11B 4FZVA 2QFJA 2VIHA 4LF1A 5EX3A 4DL7A 3FBEA 4USVA 3G6VA 2EC0A 1VIXA 3T19A 5B08A 1QD1A 3IN5A 1UFWA 5D3GA 4OYMA 2IVFB 3SYZA 1OY8A 3CEDA 3OQ2A 4Y65A 3ZTOA 2XO7A 2CPEA 5E3RA 2ZNYA 1JLEA 2NSCA 3U02A 5LJ5Y 2P6SA 1H73A 1NK6A 1PYSB 1VQKS 3DKDA 3POTB 4ZCKA 4AT1B 1ZETA 2J76E 3GONA 2HFSA 5B0EA 3Q8PB 3BSAA 4P52A 3SCIE 4JI8J 2WW4A 2BR0A 2IYGA 2V2KA 2QL5B 1QVGR 4JI6J 4PG4A 1RWNB 3OFFA 2NYIA 4CI0B 4NLUA 2F63A 3K59A 3VV2B 5IC4B 1NPPA 3NGRA 3K5MA 1U6BA 3A8JA 1XNQJ 3R5GA 1S0VA 2C2RA 2W7PA 3MZIA 1PILA 4FF3A 4TY8B 3ULHA 5J2NB 3DMJA 1HI1A 2MLXA 2XWXA 2DEJA 3J80U 3HXMA 2G1HA 2CPHA 4I68A 2CPYA 5HO4A 4F3OA 5J1EA 2D69A 1YHQS 1RAOA 3KK2A 1OO0B 1KVJA 1CJTA 3ZXWA 2NXNA 3FMBA 2C2OB 5LL6d 3QPIA 2GVZA 4DLEA 3KJVB 3RBXA 2G2YA 3UN2A 1U02A 3R6LB 4DG1A 4LR8A 2HHPA 1X0FA 1S6PB 2Z57B 4A8WA 4J9QA 2DHXA 3AOCA 2G0CA 3DC2A 4KAIA 4UTGA 4ECVA 2N4CA 3BGOP 1FNXH 4XDCA 3DRRA 4ICLB 3R7SB 1DHMA 1FA0A 3KHLA 3ETMA 2YH1A 2XMTA 3MM5A 1OQ3A 3MURP 4M95A 2R7RA 3SCLE 2H5IB 1WUUA 3IS9A 4P7TA 5HQMA 3UDCA 1CS4B 4IG0A 5M2PA 3H5UA 3T1YF 2GHPA 2FJDB 4KC5A 2XLKA 2YPYA 3ENQA 4QR1A 3MMCA 2JL9A 3GCXP 4DUYF 2FC9A 2VBYA 4C2MA 1TZ0A 3CD5A 1D8YA 1ZPWX 5KT7A 5K9FA 3DRYA 2RUGA 1PC4A 2W2QP 4C8NA 2ZBIA 1Y5LB 2RF2A 1FK9A 1N56A 1YJ7A 1J27A 4L3KA 4DX8H 4P7VA 3QSIA 4DLGA 1FD2A 4ZVHA 1K0VA 1RT1B 4A8SA 3R97A 1PYTA 3IM8A 2DTJA 5KG2A 3D6MB 2GV1A 4NLRA 1DLOA 5I3UB 1FXDA 1IM6A 4YR0A 5D0HA 2DNYA 3UDLA 2Z2MA 2QGFB 4OV6A 2I1RA 4QIEA 1N52B 2QMWA 2J6SA 3TA2A 3MUVP 2WAQD 4F0MA 2R8GA 1U25A 1SCJB 4OYWA 2CQDA 4Q8EA 4RW9B 1MG7A 2UV8A 2I9SA 4FXVA 1UMJA 2A18A 4DSLA 2Q66A 2RAQA 4WTYA 4RW4B 4CDIA 3GIIA 3ZO7A 3QATA 4LF8F 4TYAA 5KT2A 5G0RB 1S6QA 1YIJS 3PJWA 5IQQA 3M8RA 3A3PB 3IWXA 3ETOA 1SJ1A 1H0HB 3POTA 1D8ZA 2X51A 4ZVTB 5ETRA 3K7RA 2OO4A 3NCQA 4Q7AA 1S1UA 5FLXU 1TVRB 5BYQA 2QIFA 1P1LA 2RQKA 5L1KA 2VFTA 3PTWA 3W5YA 4WFBQ 3N4WA 2CNLB 4XPEA 2DNHA 1C0TB 2YX4A 5H9FJ 4QWCA 3HSGA 2KFNA 2E5LF 3LWLA 1HHTP 1HD1A 2J8SA 4TY8A 1R0CB 5KFPA 2DNQA 2FD2A 1T9VA 5KFZA 5F8IA 2PMHA 5DZ7A 1HNVB 1S0OA 5HMZA 2PEBA 2B8PA 1N32F 5LSOA 1J5OA 3N6MA 2YY3A 3CC7S 2E29A 3PW0A 1MMNA 1JXVA 3KJVA 1NSPA 5KFEA 2RNEA 3DLGB 3I0RA 2HHVA 2K3IA 4JI0F 2Z2ZA 2RQMA 4HI1A 2IM0A 3IM9A 2M52A 1S12A 1X4FA 3V4IB 1S6PA 5HQLA 2DNPA 3PCOB 5L38A 5KFWA 2UZAA 1YJUA 3I9ZA 3P5TL 4ICLA 2Y9HA 1TL4A 2HVZA 4YOEA 2NPIA 1FKAF 3N0VA 1GXUA 1IXKA 3D0GE 4PWUA 1OSDA 1V6HA 2QLJB 3CO0P 1CS4A 4OI3A 2RDJA 1JLFB 4Q0BB 1FI4A 1UETA 2LQ9A 1WC6A 3ET6B 2PE8A 4ZP7A 1JNZB 3NGSA 3CC4S 4LFBF 1Y3KA 4PQUB 2VF3A 1BLUA 2BW7A 2MSTA 1D1UA 4U67Q 1NU4A 2G9OA 2UXBJ 4DMZA 1RWWB 5K8NA 2RRNA 3PW7A 1NSQA 2QTWA 4Q2LA 5ETLA 2UU9J 1HNXF 4NRTA 2V8PA 3B4DA 4DV5F 1AB8A 4K0KF 2DR6A 5E2QA 4NCAA 2QA4G 4JOUA 1Y11A 1U49A 2POKA 4Z7CA 2W25A 1M5PC 3MMJA 4M5GA 2WTFA 2FY1A 3NS5A 5HANA 4WYWA 2HHXA 3CGIA 3QYYA 1XR7A 1RABB 2BKPA 1AUDA 2PGCA 3DYAB 5D4LA 6FDRA 3BDEA 2ADBA 9RUBA 3GU0A 1RT1A 3G82B 4HTJA 1QTMA 1PIEA 2OUGA 1SC3B 5CXTA 5DQIA 3MPYA 3TAPA 1OIAA 4DUZJ 3OW2R 1YK9A 3SXLA 2FJXA 1CULA 1XMBA 1O6XA 1RE1B 2GZOA 4F04B 2BJ3A 1DARA 5IT9Y 2RE1A 3M1VB 1RXOB 2DCUB 1XQIA 2J7UA 5EX0A 1YJTA 3Q24A 4USIA 3H4BA 3EUNA 3G2XA 1NCLA 1EIYB 5JVGQ 1SJRA 2JDJA 1JJCB 2FHMA 4P73A 1U1NA 3SFGA 4ATNA 5DGBA 4RW4A 2XY7A 1I6JA 1X4HA 4LJMA 2F65A 4X4PA 1FFGB 1TK8A 1EHWA 4NMLA 1S5ZA 1QSLA 2GAGC 2DGVA 1FDAA 3RTVA 3UPFA 1DTTB 4C0HA 3JQKA 3BS9A 2CFXA 1ELOA 3TVZA 5KFCA 4DV7J 2P5VA 1VQSA 1KR4A 1N0UA 1URNA 5C42B 4QYZJ 5IWAF 2OEJA 4XK8C 1DQAA 4DX6A 5EGYA 2DO0A 2W24A 3MCMA 2BDPA 4ED8A 3KKFA 1FD8A 3MUMP 3E01B 3KFWX 4X4VA 2D3OR 3FRYA 3LALA 4RWWA 3EZ5A 1HPZB 3VZHA 3K57A 5T7LB 4QWBA 1BXNA 3M9NB 3TO8A 1Q8KA 2XS5A 4X4UA 4AL6A 3MDFA 3PYGA 4UOFA 2ZFHA 3E3XA 5EN1A 3VHQA 1MW7A 2RUSA 3E51A 3G4SS 1T3NA 1EJ7L 3DLGA 5DO2A 2AJQA 2GQ2A 1ULRA 3CCJS 1FCAA 2YWFA 1GQEA 5H9FK 4C7QA 2NREA 3V4IA 1CJKA 1EKRA 3PR5B 3H59A 2D74B 1SL2A 4ZHRA 4RJVA 1SB6A 2XMMA 4DSIA 1MROB 2UUCF 1SV5B 3J81j 2C3OA 4RBUA 5DG7A 3KUHA 2LU2A 1PBUA 2MMYA 3PR4A 2A0FB 1S1VB 2D3UA 2CVIA 3DLLQ 2XMAA 1JLFA 4Q0BA 2CQBA 1IBLF 3V6HA 3BEGB 2BXJA 1RTDB 1SKSA 2HRUA 2F9DA 3IC1A 5EWEA 1C1BB 2AJFE 3O1LA 4USUA 2GA7A 4PQUA 3W60A 1XR5A 1CQNA 2RKIA 2KM8B 3RAMA 3BKTA 1RHQB 3D0IE 2GMLA 2DNRA 4C8ZA 3PX4A 1NKCA 5B0AA 4YHHF 4A48A 1CSJA 1NO8A 4X64F 5AJ3J 2CQPA 1V3ZA 3HVRA 2XSFA 1FXRA 4CLYA 1FT8A 2BJ9A 4LRCA 2VDHA 2Y1JA 1NJYA 2MHNA 1FKOB 2DYAA 4CO2A 4P10A 5FJ4A 1HI0P 4J9PA 3MMAB 4JV0A 4MYUA 2KU7A 2OMOA 1U6ZA 4M5DB 3IRWP 1V9OA 1YLXA 3DYAA 2VOPA 2W2OP 3KOAA 2HFUA 1P9YA 3G82A 2VC0A 4PXBA 2DH9A 4WFXA 4UOGA 4UF4A 2D3ZA 1KRPA 4K4ZA 5GMKa 4JI6F 3EVWA 1VYAA 1SQGA 3M6WA 2FLOA 2FZCB 4DV1F 3M1VA 5FD1A 1R6VA 1NSKL 3PJ9A 3NMAA 4E2FB 3OUYB 1VCTA 3KJQB 2P9CA 1RK8A 3BGUA 4ZLJA 4Z37A 2LCWA 1WOSA 3K8WA 4B9MA 5IC6B 4YMEA 5F8NA 3AODA 2QLFB 1HBOB 1X4EA 3CD0A 1A9NB 3VVTA 3R1HA 1B70B 3N9UC 3KHRA 4CLZA 1X8DA 1NRKA 4O4RA 3DRPB 5DDOC 5IZHA 4WKYA 2UVWA 1AROP 2HHHJ 3W65A 2E5HA 3T9ZA 2RVJA 1YJNS 3ZZRA 1RT6B 2ADCA 3TP2A 1U6FA 2M70A 3DOMA 3H20A 4ED1A 4GC6A 3L9ZA 4KTQA 4PYAA 4Y6IA 5C42A 4F8RA 4LFCJ 4NLGA 2DGTA 1ZM3A 3P6YC 3MCOA 4P2FA 2AX1A 4LMZA 3DGPB 1RDRA 4ECQA 4M5MA 2NXCA 3AJDA 3IRXB 2DK2A 4IH6A 4YFUA 3FRZA 4IFVB 3ZZZA 3TARA 3BR8A 4DR7F 2EXUA 3OL7A 5E5NA 2KDOA 1KSPA 1RGVA 3Q8UA 2NZCA 2B4OA 3GYNA 1KWMA 4WP8A 2LMIA 2D3O1 1LWEB 4I69A 3QWPA 3OTBA 3JSRA 1KTVA 1TFYA 1SH0A 4J9MA 1M5OC 1EB0A 1O8BA 2KJVA 3CJRA 1JK9B 4JV2A 4CCHA 4BC9A 4NXNJ 3CULA 3WDOA 4DV3J 3M2RB 4W90B 2R7TA 3QGGA 2X1FA 1VFJA 4FPIA 2QL7B 1X31C 3H8YA 4LQ3A 1FHTA 4Q45A 1MROA 2UUTA 2K3KA 1UAWA 4ZDNA 1RYSA 2DHSA 3TQ1A 4O0IA 2LDIA 3MM8B 1EZZB 4CLSA 3KDOA 2LFVA 4IH7A 4ZVEA 4LRAA 1RTDA 3H2UB 1CC7A 1GMWD 4CO3A 4RPFA 1C1BA 4IH5A 4C6AA 2MQNA 2R8JA 2BQUA 3AA9A 4NYOA 1RU2A 1NLKL 2HVDA 2JJ4D 1QAIA 1WACA 1FKOA 1RWOB 1K8AT 3FQLA 3T5JA 5M2UA 2HZAA 5M2RA 2WB4A 1QLNA 2XMKA 3LO3A 4M5DA 4ECWA 3TZYA 1TL7B 2B4UA 3CDBA 5KG0A 4ZCLA 2XY6A 1SJ3P 4IQXA 4WP3A 3AOAA 4QPTA 2IM2A 3LTOA 2FQQB 2XULA 3D66A 2HVHA 3RR7A 5C7PA 3I5BA 5D78A 1E6VB 3OFHA 3OUYA 2V4QA 3MAHA 5KFTA 3OL9A 1FJCA 1WHYA 2EFNA 5DRKA 2B6AB 2ZUGA 3EMTA 2MGZB 3S1TA 4DL6A 1PJ5A 2LP4A 4CT9A 1X9SA 4HDHA 5J2QB 2VQEJ 3IGNA 1OYDA 5GMDA 1JLCA 2DR9A 4PYDA 4WJBA 3OJSA 3EE3A 4DN0A 2HLUA 3AJ2A 2M88A 4HT7A 3G96A 1RT6A 3CT9A 4WFNQ 4F36A 1H2UX 1GX6A 3P5BP 3PW2A 4KV8B 1X5SA 5D15A 1T95A 1GT8A 1IR0A 3I55S 2L08A 3MD1A 3I32A 3BBFA 4URSA 2MQQA 3FSIA 3N01A 2IC3A 3IG1B 3HK2A 5T14A 5L1IA 3B4MA 3DGPA 4B9TA 2BE2A 1T02A 3RW7A 2CNKB 2DNOA 1B0VA 2VBWA 2O01C 3NNHA 1SQEA 1Y00A 2ZBRA 2FLNA 2LQJA 2QFIA 2UXBF 3VAFA 3J7ZT 1PCAA 3MPWA 4K5SA 2I8EA 4OJHA 1K9MT 2E7VA 2XM3A 5BXIA 1RAHB 4FS2A 4ECXA 2DY1A 2EG1A 2MHEA 3J80Y 1MWQA 3TUZC 2VV5A 4KSEB 3M2RA 4GRSA 6FD1A 4AQYF 3I96A 2OSQA 2U1AA 2RHQB 1NK8A 2DISA 3LA0A 3PEJA 3N79A 2ZH1A 2QC3A 2AIRB 1RKJA 2H1YA 3IR5B 2FUG9 1U0SA 4LVOP 2J9EA 3MR7A 2W7OA 3MM8A 4EZ6A 4ENOA 1HIYA 4DUZF 4NLPA 1S57A 1HQUB 4ZA1A 3TZXA 4KH1B 1RT5B 1WG1A 3HSJA 5CZVA 1WDTA 3J81U 1X9WA 1DQ8A 3KJFB 4A8KA 1HLWA 2EWHA 4WK3A 1WG5A 2DGQA 1KOHA 1AYEA 4RUCA 2MQMA 3NCRA 1HR0J 2LDYA 4KY3A 2NCKL 2V34A 4FYXB 3V6DA 4U8YA 3MTJA 3F56A 3CCMS 4Y2KA 3DI6B 3WIUA 3HVWA 4KGMA 4ED6A 1BHNA 2EFVA 3AFGA 1UKUA 2ZHAA 4LF4F 1IR2A 2C2NA 2BZ2A 3ZFVA 2AGPA 4XO0A 2OPSB 1JQGA 1OY6A 1QAYA 4I6WA 1TL7A 5CQGA 4JI2J 1IVZA 3PHEA 2JNJA 1QE1A 3Q86A 2CPZA 1UA1A 2AEMA 2JEFA 2XHWA 4AL7A 2HQCA 2MZQA 2ZD1A 1TKDA 3K0JA 2QMXA 2L3MA 1J2VA 4I4BA 2AX0A 2WOMA 2W9CB 4EGLA 5G4DA 5DQGA 2FHKA 3OT9A 4HLBA 3CCVS 4ZVFA 2ZHOA 2R9LA 3UN3A 1VBZA 5D0GA 5A8KB 4AFFA 1WSVA 4JI1F 4DEZA 2DITA 1WF2A 1T11A 2G13A 2BANB 2KXNB 2B6AA 2QA4S 3CJTA 3H5SA 2DNZA 1S79A 1WHXA 2WSCC 1RACB 2R7XA 2XZDB 4XDDA 1RAAB 1JJ4A 1U1RA 4JV5F 2JEIA 3U1LA 3GQCA 3OXLA 3CCTA 3GFYA 1NH7A 2OPPB 2XYHB 2JEJA 2H54B 3GFHA 1S7IA 4ZJOA 2DNLA 2PO4A 4H4KC 4WFYA 2IRXA 2IM3A 5CYMB 4LF5J 3D3BJ 2MQ8A 5CCLA 4PEOA 4FYYB 3IG1A 1TU0B 2G2ZA 2KYZA 5E7OB 1NSAA 1UVMA 5KOWA 4FYWB 4B17A 4QBUA 4F4XA 2KXHA 4OFZA 1OPZA 2A6OA 4PCQA 4MKBA 1N36F 5F0UA 4HI2A 3CJ3A 2W7AA 5D0EA 3IR6B 2KN4A 1F9HA 2KT5A 3JTOA 4DS5A 1M5HA 3C6TA 4N7TA 2R7OA 4ZPTR 1VRUB 5AJ3F 3BPSP 4RUHA 1U8WA 1TFWA 1R3NA 2ZH9A 2UVUA 2P2CB 1VLOA 3ILOA 2P9GA 5HVFA 1ZA2B 3DRSB 4DF8A 3I6PA 3CCUS 3DLKB 3S6EA 2ZNZA 5F0WA 2LXUA 5IXUA 1Q0NA 3HPOA 2JOQA 4U7UK 3MI7X 4ZIWA 4NL5A 1T05A 3IWNC 1RAEB 2YNHB 4F67A 3AXMA 1X4CA 4A8FA 1F9EB 2BBEA 1FJGJ 2J9DA 3DLBA 2I0XA 5IS2A 4P75A 3MECB 1UP1A 3VGTA 4F26A 1HQUA 2PA8D 3CMAS 3JSYA 4K4WA 5HQ8A 1NMEB 3UWTA 4CNYA 2GFFA 3MCSA 1Q16B 3PYFA 2A10A 2XS2A 3EGVA 2AD9A 2QYGA 3P96A 2DJWA 1ZTTA 3D6FB 3W8GA 3DI6A 3GG0A 4DR2J 2R8HA 4I56A 1RI7A 3KNAA 2Y1RI 4CO5A 1S9EB 4YEAA 4DL5A 3EGZA 1OQ6A 2LVWA 1ZYQA 2VBXA 1TV6B 3KLEB 4HH1A 3FBFA 3RB3A 1FJ7A 3HI9A 1GMVA 1VQ8S 5HVGA 3R6GB 1SC6A 3HDSA 2XCAA 4TQRA 3M8SA 2HHHF 4K4YA 2CIMA 2ERRA 2NUHA 4WXOA 1MLAA 2RH3A 2BW2A 2B56A 3TJ8A 3QO9B 2UVRA 3KDNA 3BSNA 4X65J 3ZZTA 2V69A 2YBVA 4LFCF 2MKSA 1H74A 1F5CA 4J9SA 2W9CA 1ZAXA 3NGUA 3R8YA 1EETB 1BWEA 3H5YA 1UJ5A 3MMBB 1RADB 2DHGA 5A8KA 2CKWA 5J2MA 1WC1A 2MJNA 3FBCA 4M63A 4CWBA 3EZUA 4JI3J 1ZBTA 2BANA 4ELVA 2WB1D 1MNEA 2FPHX 4QW8A 5E0OA 5KFJA 2XY5A 3OTOJ 1VQNS 2VFVA 3W64A 1YX2A 3O6QA 4TN2A 3T5LA 2XZWA 4ZLNA 1LOUA 3R1LA 4PR6A 1FRMA 1DBDA 1SUQB 2VQFJ 2OPPA 2VICA 2MXYA 1N5SA 4NXNF 3TAMB 4M5KA 1DTQA 3CC2S 1D09B 4IKAA 1ZZFA 4RBTA 1FDNA 2KYXA 2JC1A 2PSZA 3BKFA 5CYMA 4QIVA 5KT4A 2FVPA 1XJWB 4GKKJ 2DRDA 1RTHA 3D7SB 2M2BA 2AYBA 5F9NA 2YKMB 4QR0A 2V67A 3ISNC 3BO4A 3OL8A 2K06A 2E5IA 4NLDA 2CRLA 3TQEA 3OXFA 4OYBA 4ZCIA 2AJ2A 3O44A 4X4OA 3QWUA 3JSMB 4Q5VA 1W2IA 5C25B 4HYKA 2KFZA 4RU9A 4L72B 4TU8A 3JB9k 4AD6A 4TNOA 4K50A 3M6UA 4M1KA 4ECRA 1VRUA 3G6ES 2JX2A 2M8DB 5HN0A 4BBYA 5DETA 2GO8A 1TMMA 3G8SA 3VGSA 3A3OB 1YJ9S 2DT9A 1FFWB 1Q8IA 1NJIT 5K14B 4RNOA 5HMYA 1BWVA 4NLTA 1TUVA 2D9OA 1CEZA 1UVJA 3HX9A 3G8TA 3DLKA 4FKXA 4KGKA 1X5OA 2V94A 1RLCL 1YBAA 2JVRA 1HNIB 4YR2A 3N6NA 5I3PA 4KYZA 2UVVA 3MECA 5ITHA 3NGDA 2HBRB 2M7SA 1FTRA 3HKZD 4NXMF 3QRQA 1M1HA 5KFOA 4IRKA 3LH2S 2XNQA 4KGZB 2PI4A 2BE9B 3MEGB 4IOCQ 1N33J 4NA2A 3PIPQ 2CYYA 2XGQA 1KLNA 1FF2A 3UVJB 1XK8A 2C28A 3H7HB 1KNZA 3N5BA 1YKWA 4O23A 2XSJB 2VONA 3HJVA 2R7VA 2H5JB 3Q0AA 1C1CB 2WZ1A 3KLEA 1Y4ZB 5F8MA 2VQEF 3BO2A 2KZMA 4OYOA 1NHKL 4NLQA 3EGNA 2CJXB 5B0FA 2PIIA 1W26A 3GCWP 3MR3A 2LKZA 5CCMA 2NR0A 1C2PA 3QO9A 1A7GE 2VH7A 1S9FA 4UW2A 1LKZA 2BJ1A 1URRA 2ROGA 3GSIA 4C0BA 3R7NB 1ZA1B 4X4NA 2PFFB 4KB7A 1EETA 3HFKA 4NLXA 3GZ7A 3MMBA 4OZ5A 4YN3B 5A8RB 1EKSA 2KVQE 4FVMA 1ZM2A 1MMLA 2ASYA 3Q23A 3CCWA 3SQOP 4I2PB 1B7YB 2ZH7A 1VQ6S 2HIYA 5D77A 4LREA 3TA0A 1UFLA 4DUYJ 3NOCA 4Z7YA 3GR0A 3AD8C 3M2VB 5BYSA 1YJVA 3ZZUA 3MPVA 4ID8A 3O2IA 1F0XA 4CLTA 3N6LA 4U9RA 3GP9A 2R7QA 2KH9A 4H4OB 5D0RA 4DR3F 3HHLB 3EPIA 3I0SB 4X4TA 3TAMA 4LSLB 2O67A 1R0AB 3QJJA 3VAGA 2KHDA 1LW0B 3TW0A 3D28A 4KGVB 4WU3A 3TUJC 2HNYB 2B51A 3CXCR 3A3NB 4DL4A 1L3UA 2XZTB 5DLFA 1GX5A 2B0GA 4B9SA 1Q79A 5RUBA 5HJYA 2A2CA 4DSKA 5ETPA 2VFUA 2R42A 2NZ4A 2I2YA 3JSMA 5C25A 5A2QU 4FNHA 2YKQA 1IKXB 4PPDA 4P2MA 3QT5A 1IKWB 3QLHB 1WC4A 1AZSA 2BA9A 4LR7A 2FVSA 3C19A 3DLEB 2CNNB 3CJ5A 1MN7A 4OZJA 3T5KA 4P9SA 2CQ1A 5DM6Q 2JEGA 1TL3B 5LOQA 3PHTA 4RW8B 5K14A 1IKYA 4J9VA 4QIFA 4J9KA 1BQXA 4R5PB 4RW7A 2BQ3A 3MWBA 4B3RF 1G2EA 4FBTA 1HQ2A 2CADA 3MM9A 4JI2F 3MEDB 2IAJB 3WC2A 1HNIA 2BRKA 4CLLA 5KOXA 3TJAA 2NQPA 3D68A 1TL1A 3LAKA 3BQ1A 2GQCA 1V5IB 1LEOA 1TKXA 4GVBA 2L9NA 4K7QA 3MM6B 2XHCA 5K5MA 2W1BA 2D9PA 4CH7A 4DQRA 2MZJA 4N47A 2E5LJ 5DDPC 1HBNB 4WIIA 3AA8A 3HP6A 3OR1A 3MEGA 5C24B 4KRWA 4USTA 4A47A 3MD3A 4NRUA 1N32J 2VKRA 2F5GA 3M2UA 2RU3A 2MPUA 3I9V9 1RTIB 4DL0C 2QV6A 1T9WA 1C1CA 4MT1A 4EZ9A 3RYLA 3S8SA 3R9LA 4H54A 4F3QA 2KZZA 2D41A 3G8QA 1WORA 4ANDA 4JI0J 3N28A 4N8OA 1TAUA 1MWYA 4USKA 2IA6A 3H98A 2VOOA 2NYHA 3M8QA 2DCLA 1RWMB 3BREA 2VPZB 5HBMB 4O3OA 2BJDA 5FDLB 3KUGA 4TYBA 2C2EA 1KONA 2CPXA 4ZPDA 1AXQA 4HDGA 5BJRA 3NL0A 1G3OA 5A8RA 3AD7C 4CM2A 3FGVA 3KLIB 4I0WA 3C2PA 1DFDA 1PYOB 5J2PB 4RZRA 1AT1B 1UPMB 3ILJA 2HW3A 3QFHA 2IRUA 1U4BA 1T94A 1NB7A 5LM7E 3HJFA 1H98A 3ENAA 2ZZMA 4ZPCA 3BYPA 3I56S 2E5GA 3GLJA 3NBPA 1Q81T 4DV5J 2H4WB 4EBCA 4K0KJ 1M5KC 1NJWA 4L73A 3AB2B 4CLWA 1BGXT 4F4WA 3HHLA 2JSXA 3AJ1A 4G6VB 2KB2A 2RMLA 3PM9A 2LEPA 3TYTA 3DDNA 3EICA 1DQ9A 4DSJA 2LXIA 1OWXA 3ZZ0A 1LW0A 1U2FA 4MIWA 1CJVB 3QJPA 2J0SD 2BKNA 2HNYA 2XLJA 1S76D 3ADAC 1RAJA 1FJGF 5GAHU 4W92B 4N8NA 4KO0B 2E9RX 4UOHA 2XGPA 3ZNUA 4PKDB 3V2UC 3W2WB 2HFZA 3DXSX 1IKWA 2IVMA 3HULA 3QLHA 3RR8A 3A1YG 3MOZA 1U09A 1I94F 2ZE2B 4URGA 2HMIB 4ZJQA 2JLEA 3VAIA 3HFVA 3SV4A 1JKHB 1HARA 5I4MA 4DR2F 1HWUA 1U1OA 1UVNA 3KYLA 5KFLA 1TL3A 2XCPA 5C2CA 2HHSA 3T1HF 3R5BA 4RW8A 2VA3A 1EAYC 2ROEA 2B9YA 3QBCA 4R5PA 2V4RA 2ZC4A 4H4MB 4ZPBA 1YGYA 2O3DA 2UP1A 3TUIC 1X4AA 4ZITA 4I6AA 3W66A 3M8PA 1M5SA 3MEDA 2IAJA 2DNMA 3D67A 4O0NA 5HAOA 2VU5A 1YRTA 4KHMA 2DXDA 2XYPB 1N5VA 5IWAJ 2VL1A 3GJTB 3MM6A 4JI7J 4L6V3 2W2NP 4Y34A 3T5HA 2V8VA 1IBMJ 4YB6A 1FESA 1HWJA 4ED0A 4PUOB 1NDCA 2PD1A 2HHWA 5C24A 1HKAA 1GXLA 3OVAA 3L09A 2HQ3A 1RCXB 2DR8A 5LJ3Y 4JI3F 2E9ZA 4K8RA 4ILLA 4CTAB 4OZ3A 4MK8A 1S9GB 3UI3A 5LMUF 3I4PA 2DIVA 3N5FA 3OBIA 2FJWA 3CF5Q 1WD6A 1YBUA 4Y2IA 3CD6S 3QAEA 4FS1A 3WBZA 2VG6B 2GGPB 2EW9A 1QM9A 2RQ4A 4YB5A 5MAOA 5K8PA 2HWIA 1VQ7S 3UCGA 3L7PA 2CJKA 3TVYA 2K1RB 1SJ4P 2FZGB 3ZTRA 4DU7A 1RTZA 5HBMA 5FDLA 3OD2A 2R7UA 3IXQA 1S72S 3GFXA 2AZ1A 3M8WA 4OI4A 4JI4F 1LWXA 3CWJA 2HZCA 2EI5A 4WK1A 2IDEA 1IBLJ 2QG9B 2RDIA 2C2ZB 2DIUA 4P74A 5BYRA 4MKAA 4XTTA 4IYQA 4KQZA 1TUGB 2QLBB 5J2PA 2DKOB 1N5YA 1BQMB 2VJUA 3GV7B 5IV3A 5B7WA 1LWCA 4YHHJ 3KLFB 4X64J 1NJXA 3HHLD 2Z0GA 4FF4A 3OR2B 4KE5A 2G4BA 3BF4A 5EWGA 1APSA 5ETTA 1IUJA 2X7IA 4C48A 3NMRA 4DXLA 5B09A 4MKYA 3CCZA 3FMWA 5LXRA 4LIWA 4HHHA 4X66F 2IRYA 2APOA 4TU9A 4EO8A 4JYAJ 4IQMA 4N5SA 2E66A 3HM9A 2EEYA 3MEEB 1CJVA 3MFIA 3CJSA 2IY5B 3VGUA 3UD4P 4KO0A 2I5JA 4HTIA 1Q86T 4DV1J 2XG8A 2BKOA 1NK0A 4ZVOB 1S7HA 3W2WA 5CHCB 2HFVA 1IQTA 3UCUP 4K2JA 1S4FA 1WTFA 5KFBA 1N33F 2ZE2A 2VG5A 2HMIA 2FVCA 4RNFA 5KT6A 1JKHA 3PNIA 3EZOA 1GTHA 1L5UA 1S97A 3VGVA 1G7CB 2FDNA 4FNIA 3JYTB 3ENWA 2D1CA 1XR6A 2Z58B 1JXEA 4DBQA 4USMA 2M3DA 4H4MA 2KXFA 2MJUA 1JXLA 1HQEB 2ZWPA 2LXFA 4F3MA 1VS3A 2C2MB 3OTCA 4OL8A 4NLYA 4A4JA 1MU2B 3KHHA 3JAMY 4NA3A 4IUFA 2HBYB 3FEXB 5DQHA 1RHMB 2K8GA 1JLBB 4TLQA 2QE5A 3BZQA 3OFEA 5A8WA 3HCXA 3EWGA 2JFKA 4LVNP 3LPEA 1OSCA 4ANCA 3FKBA 1QDUB 4PUOA 5E33A 2J7WA 1SI9A 4DZ6A 2B9EA 4Y3CA 2RS2A 4DR7J 4PWWA 1T03A 3K2YA 2AEJA 4ZK7M 3DCAA 4DR4F 5DJBA 4IDKA 3TR5A 2GW8A 4QZVB 5CA5A 2FHJA 1VQ9S 3M8YA 3JQJA 1VQOS 1X5PA 5JVHQ 4ZN3A 5EUHA 1RQ0A 1M1KT 1HMVB 4RWXA 2K1RA 2EPIA 1KBRA 5HMXA 1U0HB 2CQHA 4BDPA 1M90T 4YDDB 4IG3A 4X84A 1EP4A 2FZKB 5JJBA 2Y1LB 2EC2A 4CRJA 2QX0A 2YPZA 4QIGA 4DR5J 3CDEA 2W9BB 4B3MF 5DZ6A 4ES1A 5HVHA 4RUBA 3I5AA 2K7JA 2Y8YA 2CPIA 3O5TB 4A8XA 1NJZA 4C11A 4TY9A 1BQMA 5SUHA 5THWA 5DLGA 4FF2A 2QZ8A 4R25A 3SFUA 4J9UE 2AYGA 1REVB 1FRIA 3LP0B 3OR2A 1T0TV 5B0GA 2DHAA 2ZH2A 4DWIA 1PAEX 2EKNA 2MKYA 2QEXS 4EBEA 1DRZA 4O3SA 2CQ4A 1SKUB 1X4GA 2C22A 2E1CA 2GNKA 4LSNB 4WWSA 3MR5A 3GILA 3MEEA 3KK1B 2JVOA 2V0NA 3W1YC 2HLTA 1YI2S 1HHQA 5GADI 4F4ZA 4ELTA 2YKNB 4X62J 2Q6CA 3PO5A 3SSSA 3UFCX 4KPCA 2C3MA 2KT2A 4DPUA 2NXUA 4HHUA 3HHNB 5CABA 1XEZA 2BJ8A 2HFOA 2ZH8A 3UDVA 5J2NA 3FCHA 2W8LA 2V5HG 5IM0B 4NI2B 3CIZA 4RNNA 3GWCA 4UQGA 3KNGA 2EVZA 2HAIA 4G1PA 2C2DA 4ZVGA 2OTLS 3TJ9A 4EK2A 4O3PA 1JLAB 3JYTA 1BC6A 3R2DJ 1RTJB 4RU2A 3AHPA 5A76A 1HQEA 5BR8J 2RSQA 3CDWA 3NWRA 3SIPB 1UEKA 2DY9A 2DGXA 5F3ZA 1MU2A 4DX5A 3GYXB 5HI7A 4PWDB 5K20B 3UN5A 2H4YB 1HWLA 2V2VA 3AD9C 1IKVB 4I1TA 3CDAA 3Q8VA 3PO4A 2CPJA 1N0VC 2MKCA 1NXIA 5GAGI 3OPKA 1FX4A 1DURA 3B54A 2VG7B 2CJYB 4WYLA 2WHOA 3VQTA 4U96A 2BABA 4C4WA 4QYRA 2M4MA 3BR9A 3I4HX 3DU5A 2FHJD 3NEKA 5DGAA 2MKJA 4UOCA 3MPUB 4NCGB 3PYDA 3W3SA 2J6UA 4UZBA 4GKJF 4ED5A 1WOOA 1TQLA 1UL3A 5H1SV 3D9BA 1TMJA 1ZPVA 2W01A 1W7WA 2ZOMA 5F8JA 1TTHB 3JTNA 5F3TA 3H25A 3PACA 3SDEB 1HMVA 4FPRA 4AQYJ 3V6KA 2P8IA 5B0BA 3SEOA 4CO0A 1J5EJ 2GIFA 1OMSA 3UD5A 1K0TA 1U0HA 2AHOB 3GR1A 2HNZB 3FK4A 1Q8LA 5F8LA 5I3UA 2OHDA 2OKQA 3SSRA 4DUTA 4NEYA 2CJBA 4OX6A 1U1MA 1NDKA 2H5EA 2RRAA 2DRBA 2J6TA 4F4AA 5HL7Q 2RT3A 3GMGA 2E7XA 3TI0A 3D1QA 4RW9A 1REVA 2V4JB 3R7BB 4DZDA 1UW4A 1YQHA 1UJ6A 2PN6A 2V9WA 1XNRF 3DRXA 5G0RA 2ABYA 4LF4J 3FSXA 2XLIA 1V5VA 4DR6J 4OI0A 5E3AA 4TU7A 2RILA 4LSNA 1M5VC 2CDQA 4HT5A 2DBBA 1MMDA 3H0PA 1K47A 2JFDA 2XTJP 1SQFA 4ED2A 5KFSA 4CLKA 4AUKA 1TVRA 4IOBA 2B7CB 2F1FA 5D4PA 3CUNA 3BN7A 4EYHB 2YKNA 4DDFA 4FYVB 4ILMA 2OELA 2KRBA 4A8OA 4JI7F 5J1PA 1C0TA 2AKWB 3U7JA 1RB0A 1E6YB 2HURA 2FJVA 2F7VA 1KP6A 4TXSA 1B4SA 1HNWF 1IBMF 1VC5A 2AJ4A 4JI1J 2FLPA 1EQ0A 3MXHP 5IM0A 3MCNA 2HKEA 3NNCA 2YNIB 3IGVA 3PW4A 2WVFA 3D54A 4NI2A 1HNVA 5KG3A 3EJMA 3L95X 1NK5A 3NKYA 3FCWA 1VBYA 3PEHA 4WXWA 3IAS9 3UO0A 5D6GA 3KG4A 4WTOB 3W5ZA 1JLAA 2LEBA 4JV5J 4USHA 3KMSA 4ZPVR 1F5AA 1Y5NB 5K8OA 3RAQA 2XNRA 1H72C 1WG4A 1RTJA 3HVTB 1CJUB 4I6YA 5A0YB 3J7A1 2H9ZA 3EYZA 3QZ7A 4WE1B 1RAIB 2BACA 2LA4A 3H90A 4LF9F 2Z2LA 2EFGA 4Y2MA 4PWDA 1HBMB 2K7KA 3T1AA 5FIIA 4FBUA 2FY8A 1B99A 1T8EA 2EKYA 2OFHX 2Z4PA 1MN9A 3FQKA 1RHKB 3A4TA 5KFAA 3NXZA 1WHWA 1CC8A 2O1PA 1SC1B 1N36J 3LGHA 3ET6A 1Q95G 1S1TB 3MF5A 3W7BA 4ZP9A 3PRDA 2WSFC 4NCGA 3KLGB 1WHVA 1H3DA 3EXYA 3T41A 2OGUA 1GMWA 1RUSA 2XI3A 2Y8WA 4LRDA 4A8YA 4Y00A 4NLSA 5GAGU 2V8HA 3LANA 4EO6A 5KAKA 2KHCA 1S6UA 1IWAA 2HG4A 1WEYA 4JYAF 2ATCB 3ZC4A 3SBMA 3F0NA 1FE0A 2XMJA 1KLMB 2E1PA 2HNZA 3ELHA 3EX7B 4DHVA 1D9FA 3DMJB 3K5NA 1WTBA 2Y3YA 4J7CA 4V1Ak 1U1PA 2Q1LA 1FWPA 4F02A 2ZC3A 3NGKA 2N7YA 2EG2A 3BH7B 5J1EB 2ZH6A 3KK2B 1CJTB 4FKYA 4ZVSB 2GVZB 2YNFB 1OS5A 2Z56B 4WZQA 2ZKTA 1SKWA 1PBAA 1X4BA 1H7WA 2DXFA 3CO9A 5AE2A 4DPYA 1FRHA 2ATLA 5LT5A 4O3NA 1RAFB 4DV6F 3NY0A 4RX6A 1RSCA 3M9OB 1CG2A 2B4PA 2C3UA 5LMNJ 1TL5A 2KJWA 3P3DA 2J9CA 3CCLS 3UDEA 2C3PA 3QQCD 4ILRA 3MM5B 4KIAA 3UQSA 2CG4A 2HIQA 2OFGX 3IBFB 1DTTA 4OMFG 4PABA 3PYEA 1VISA 3RGIA 1U47A 4IG0B 1D9DA 4B3OB 1NAQA 3CJ4A 3UR0A 2FYXA 1GFWB 2IYIA 4Y28C 3PZPA 1GK8A 1WKKA 4OLOA 4ED3A 2W2PP 3MMCB 1X60A 2ZWOA 2R7SA 4FVCA 1E6YA 3E01A 1LWFB 2KI2A 4RLEA 2CWKA 3THVA 4YDXA 1HPZA 4X4RA 4OZNA 5T7LA 3E8OA 4WP9A 3PJXA 2YNIA 4HL9A 3BN4A 1FNMA 4WIQA 2CQGA 3ISZA 4PXCA 3V81B 1FK9B 2HWHA 3OSNA 3JTPA 1EX8A 2OH2A 3G9CA 4QYZK 1JLGB 2ZOGA 5L9XA 3L4BC 4HH0A 2CUYA 1VI7A 5SZTA 1UPPA 4M94A 2NXEA 1ICEB 3BBBA 1TKTB 2MQLA 4WE1A 3RAXA 3IA0A 5B0DA 2YQ3A 2AEFA 1U26A 4WKRA 3VAKA 2FJAB 3ZTQA 2WSEC 2DHHA 1HBMA 2CQCA 2ZM6F 4CYUB 2YWKA 3M6VA 4DR1J 1H7XA 3W8PA 1SV5A 2VFRA 1WELA 1QUVA 5LXYA 1S1VA 4ZLPA 2AJ0A 3J7Z5 4RO0A 4PG6A 2AWZA 1K1QA 3QNWB 1H6KX 2MZTA 4DR5F 5A6WA 3CSKA 1S1TA 4QU7A 2HEKA 3H4DA 4CLPA 1RCOB 3D2WA 1S6QB 1SJFA 3V4MA 3KLGA 3BV8A 4QW9A 1KS2A 2DGOA 1KVKA 1VJWA 4C3MA 4IRCA 3M8ZA 3B8HA 3LOUA 4EI2A 4DQIA 1GMUA 3W9HA 1T9TA 3BYRA 3PVXA 1S1UB 1S1XB 2KVIA 1Y3JA 1M1GA 3MMAA 3BM7A 1NK7A 3IMQJ 3RG6A 3BSCA 4F50A 3CCQS 1UFKA 3R27A 4F2RA 1VQ4S 3U1MA 5A6PA 2R8KA 4YB1P 2HVEA 3GIMA 1KLMA 1PJ6A 2E1AA 3C15B 2VKZG 3KG0A 4NZ0A 2PT0A 4OHWA 1IBCB 3CTRA 3F41A 2EFPA 4CIOA 3DNCA 4X2BA 2DH8A 4NXMJ 2QO3A 4X62F 2PFDA 1J5OB 2HQDA 4LIRA 3P49B 4OYPA 1N5TA 1NHUA 2KL8A 3Q8YA 3DDIA 2W4CA 3QT7A 1UTAA 2YNFA 3DGVA 4BS2A 5KFIA 1LK7A 1R7IA 1YSJA 3I0RB 1WWHA 3CB4A 3NCPA 1YJWS 3DXBA 3WQPA 2PI5A 2E1MC 3FZ2A 4ZVQB 3TEHB 2JH3A 5I3QA 1HBOA 4OYIA 3ZZYA 1YTYA 4OI1A 5IV4A 5DDRC 1G1XA 2H3EB 5J1NA 4OX8A 2JWNA 4OQJA 2QYCA 3DRPA 3BB5A 2MTLA 1VRQC 1KQFB 1JLQB 2FLLA 2L9DA 1HHSA 3GIRA 2KO1A 4MFBB 2CA9A 2B3TB 2YXLA 1L3TA 4CP5A 1F2GA 2VPWB 5BR8F 3MOJB 2DGWA 3QAUA 2BE7D 4B3OA 2X1AA 1FNOA 2EBGA 2HWTA 4PPZA 3OTDA 1R8AA 4PXEA 1FXLA 1FRJA 3R5CA 1SIZA 1IBKF 5AE3A 3BBCA 2DNGA 3QZ8A 4K4UA 4JI5F 1R27B 1LWFA 3W9JA 3NP5A 3K5LA 1VC6A 4ANEA 3IRXA 2QL9B 2XMUA 4DX7A 1WF1A 3M7VA 4LF2A 4IFVA 4BLGA 1Y9OA 2YWEA 1RAGB 2VUGA 3V81A 3GJSB 4WPAA 1YZ6A 2XS7A 2R8IA 2HHUA 1LWEA 4G3IA 4QIWD 4G65A 4O4GB 4PRFA 3CJ0A 1OYEA 5B0CA 1JLGA 3VAJA 3VWSA 2XI2A 1ZM4A 4DR3J 3HHEA 1S77D 2JRSA 3PFOA 1TKTA 1JNRB 2CPFA 4MK9A 2WRMA 1CULB 2FJBB 1CLFA 1O51A 1NHVA 3E2EA 3TX0A 4CH0S 3EXCX 4WZMA 5LSLA 1JJ2R 4CYUA 2RS8A 2HAFA 1J5EF 1HW8A 2ACMA 4C3KA 6AT1B 2B4VA 5HK4A 3PFEA 3HSDA 2IJFA 1RISA 2LEAA 4RW6B 4PG5A 4EWTA 4ZPWR 4P72A 1F5BA 2GHWA 4D3GA 2PEHA 5E3PA 4G1QB 5HMWA 1H2VZ 5HJXA 4F0KA 1VDHA 2X3DA 2BRLA 4EU0A 1G6BA 4NYZA 1FRLA 5ETKA 3VQSA 4NCBA 3I31A 4LT6A 4LRFA 2ACYA 5CAAA 1T3OA 1S1XA 1RA7A 4DQQA 1N34J 3OXGA 4OV1A 1F3VA 3FEZA 4E0DA 4DR6F 3C8YA 3M6XA 3OV7A 4B3RJ 3KLVA 2UV8G 2VPXB 4DPOA 3GG1A 3BQ2A 4WBFA 2F40A 4C3LA 2DEIA 1X5TA 1S10A 1O0PA 4USWA 2CXEA 4IOAQ 3C15A 2R7WA 2HZVA 2HBZB 1IR1A 1AA1B 3G6XA 4ER8A 2WVBA 1I1GA 3Q8SB 4WFAQ 4LRBA 4YY3J 2JLGA 4K59A 2UUBF 1VK3A 1VHIA 1E6VA 5AE1A 4ZMMA 1U45A 4YUDA 4B3TF 1LXJA 3LF0A 2OJ3A 2VBZA 4L74A 5AXNA 4ES2A 4J90A 1Z1ZA 1CJKB 2HK3A 4DS4A 2MGZA 3ILIA 1S1WB 4Q8FA 2D7SA 4ZHRB 5J2QA 3WIVA 2GJFA 2MQOA 3RRGA 1JLQA 4M5HA 2HS0A 4MFBA 4F25A 1RHUB 4DPXA 4BCAA 2WVCA 3UNGC 1QSSA 2CQIA 4KV8A 2HRYA 2V63A 4QU6A 3PX0A 2CVEA 1N54B 5ETMA 2A6MA 4MIAA 3JXOA 2YVSA 4NMXA 2FB0A 2QSFA 2RKIB 4Y0FA 4K2XA 1D3WA 4ERDA 5K8MA 2M5YA 4Y2AA 1FFSB 4H4KA 3KJNB 1WC3A 1PJ7A 4N77A 2YTCA 4UUXA 4ES3A 3B82A 2ZJQQ 3DM2B 5ETNA 4F4KA 2P9EA 2MQPA 1XN9A 1S48A 4IFYB 2H51B 5CZXA 5FLXY 2OLWA 2FGOA 3BKUA 5KFUA 3MTKA 2DH7A 2QT7A 1Y10A 4B9LA 3TUPA 4Q44A 4K4VA 4O4GA 4B08A 4OX9F 1F2HA 2LQBA 8AT1B 1KQGB 3A12A 3L7OA 1SBRA 2J0WA 4WF9Q 4OYZA 2G1DA 1Q7LB 1RYRA 1FWKA 3VF0B 2MKKA 4RL1A 4I64A 2EK1A 1DZ5A 1AFJA 4YQWA 3Q2TC 1YRXA 1Q82T 1R8BA 1GNKA 2LQ5A 2YQ0A 4E8UA 2VC1A 1W2BR 3DOLB 4HEA9 1K44A 1NNDA 3SZ2A 4DPWA 3LP1B 2QA1A 4RW6A 1RT5A 1M0SA 4CO4A 4C8YA 4ZP8A 5IT4A 2XMVA 1RBLA 1XERA 2L9WA 3LAMA 2WW8A 4G1QA 5AXMA 2E5JA 2OMLA 4X4QA 3TEGA 2AYEA 4LBHA 4QOTA 2JC0A 3CCRS 2VFSA 1I94J 1UA0A 4FXWA 3D0HE 2DGUA 3DOMB 2ZH3A 1FEEA 3T1HJ 4BC7A 2XQCA 1H2TZ 4QWEA 1FRKA 1CPZA 5LMNF 2OP5A 1YITS 2V2QA 1NPKA 1TK5A 3VAHA 2OPSA 3GJQB 3D3CJ 1KQKA 5C2GA 4WU2A 3UD3P 3KG1A 1X9MA 2AU0A 3RUBL 4B9NA 4LFAJ 3VTIA 2AW0A 3R5JB 3R5AA 4B3SF 3AQPA 3CJQA 3HT0A 4OYXA 1R43A 5KFRA 4FXDA 1FVSA 3VZIA 3FBBA 3EDRB 4B9VA 1YWXA 3MAQA 1YVFA 4LF6J 4YR3A 3NS7B 2HFNA 3KMQA 1CVJA 3R3TA 2PA3A 4R0JA 2GCFA 4I67A 2XBPA 1WNEA 5LMUJ 1KVIA 3M05A 2NUUG 1S1WA 2DR7A 2ZKUA 1RWXB 1F3FA 4RNMA 3K89A 2LA6A 3K8VA 4ETZA 2F3JA 4URQU 3BO3A 2RRBA 1QAJA 3QFWA 3WC0A 1U2CA 3GYGA 3OLAA 3UW1A 5HLFB 2LYVA 4M5LA 3SMZA 5KFQA 4HKQA 4KFBB 1F1BB 4J9RA 2MDAA 2R3VA 3LGMA 1HNZJ 4DR1F 4AL5A 3I5CA 1VGYA 4JI4J 4DSFA 4NE9C 3C6UB 4P2SA 3OLBA 3THPA 3I87A 3DM2A 4OI2A 2Q6BA 1S0NA 2PC6A 3T9NA 4IFYA 3P8BB 2IJRA 1F6TA 1NDLA 2AZ3A 3W61A 1UW9A 5LSRA 1WF0A 2ZHBA 2GC8A 1WEXA 4GMKA 4HACB 4NLVA 4RKUC 1B3TA 4XPCA 2HNDB 4DOZA 3DOKB 3RZAA 1MSWD 2F4VJ 4QWDA 2VHGA 3IAM9 4OZ1A 4JI8F 2DD8S 3B6BA 2UXDJ 3AAWB 3RW6A 1Q78A 5U47A 4FP9A 2VD3A 1LK5A 3TNVA 4X66J 3DRSA 2YWGA 1G4CA 1XNQF 5CD4A 4NLWA 3GV5B 4QQBA 2YNHA 5JMNA 3AOBA 3NWGA 3US5A 3F73A 5DM7Q 3DOLA 3HHDA 2GIQA 4EEYA 4KJIA 3LP1A 1KHVA 3C3LA 2E9TA 1R8PA 5L46A 1P6TA 1SH2A 5CH7B 3W62A 3SCKE 2BJEA 1JLCB 2VZ9A 2GS8A 3PY8A 1I3OB 3RB6A 2HK2A 1B0TA 2OSRA 1I51B 4DFKA 3CCSS 1S9EA 4XIUA 3KTQA 2ALZA 2UXCJ 5D4NA 1D9AA 2R2SA 1KDNA 4NOHA 1XC9A 1SH3A 1TV6A 3GTYX 3G86A 2YKPA 2IC3B 5DDQC 1KHWA 1R0BG 4J9LA 2BE2B 2MZ1A 1NK4A 1P27B 3HLUA 4N56A 1LW2B 3HVAA 4ED7A 3HFZB 5DG8A 4B9UA 5C5JA 1KQSR 1JJHA 5IQ6A 5GAEI 5L9NA 4DCPB 4NYPA 1X0PA 5HSPA 3DFEA 4EYIB 3GB0A 3GFZA 1B0PA 2WVDA 8ATCB 5F8HA 2KT3A 2CG8A 1FKPB 3GIKA 5IOLA 1FRXA 4AXJA 1S59A 4DR4J 1FTCA 2ZBPA 5E3CA 2MY7A 1P1TA 3TX8A 3QRPA 3FVYA 2HGMA 1Z4UA 4P6QA 2Z2YB 2FGCA 2WK4A 1K1SA 1ACMB 1H38A 4MMOA 3OTEA 2B9XA 3SI8A 1SUQA 4J37A 4EMDA 1HD0A 2GQQA 2X1BA 2Y1IA 1RWUA 5HLFA 5JUMA 2KM8C 3MHYA 2R4FA 1PC5A 1N48A 4KFBA 1BUXA 3AY0A 1ZAWA 2G0JA 2HHQA 3VVUA 2HSEB 4U7CA 2KTQA 5DS7A 2BYCA 4A8QA 2PDAA 3DDKA 2H65B 1QSYA 1IJFB 3C6UA 3V6DB 2AYMA 3WX8A 3V6JA 2XB2D 1CBKA 3ISND 1GEHA 2HS3A 2YKMA 3UNYA 3HZEA 1L3VA 4B3MJ 2XO6A 5DG9A 1PO6A 4Q2MA 2YX7A 2K2PA 2GMHA 1RT2B 4C8LA 1FO1A 3HD2A 4HACA 2CAJA 2VB6A 4IO1A 2KKHA 1BQNB 2HNDA 4MIBA
chains in the Genus database with same CATH topology
3CMAS 2IYGA 2DRBA 2V2KA 3JSYA 3DOKA 2J6TA 1QVGR 3SCJE 4B02A 4K4WA 1QUPA 4U6PA 2FC8A 1NK9A 4PG4A 5HQ8A 5HL7Q 3OFFA 1QE1B 2NYIA 2RT3A 3GMGA 4NLUA 2E7XA 3UWTA 4CI0B 4CNYA 3TI0A 2GFFA 2QLWA 4PG8A 4DFMA 1UJ4A 3D1QA 3MCSA 3K59A 1Q16B 4RW9A 1REVA 2DRAA 2V4JB 3K5MA 4ETXA 1U6BA 1UW4A 1YQHA 2A10A 1S0VA 2ZD1B 1N34F 2DPIA 2XS2A 1UJ6A 2C2RA 2W7PA 4ECTA 2AD9A 2EBEA 2PN6A 2V9WA 1XNRF 3MZIA 2LECA 3P96A 1PILA 2DJWA 1ZTTA 4FF3A 3DRXA 3DI6A 4KHRA 5HROB 3GG0A 4ELUA 5G0RA 2ABYA 4TY8B 2R8HA 3FSXA 4I56A 3ULHA 5J2NB 2WOMB 2XLIA 1RI7A 1U7LA 3KNAA 3DMJA 2Y1RI 3M30B 1HI1A 1U24A 4CO5A 1S9EB 2XWXA 3HXMA 4OI0A 2CPHA 4YEAA 5E3AA 2AGQA 4I68A 4TU7A 2RILA 4DL5A 4LSNA 3EGZA 1M5VC 2CPYA 1OQ6A 2CDQA 2LVWA 1ZYQA 2VBXA 5HO4A 1TV6B 4TKTA 5EDWA 4F3OA 4HT5A 3KLEB 5J1EA 1YHQS 2DBBA 4HH1A 1MMDA 3RB3A 3HI9A 1VQ8S 1FJ7A 3KK2A 1OO0B 1KVJA 1RKIA 1SC6A 2JFDA 3HDSA 3FMBA 4ED2A 2XCAA 5KFSA 4TQRA 2IMWP 5LL6d 3QPIA 3M8SA 2DVIA 2HHHF 4AUKA 1TVRA 4K4YA 4IOBA 4DLEA 2B7CB 2CIMA 2F1FA 2ERRA 3KJVB 5D4PA 2NUHA 4WXOA 3CUNA 1WI6A 2RH3A 3NAIA 2BW2A 3NS6A 2B56A 3BN7A 4EYHB 3K58A 4YY3F 2YKNA 4CT8A 4DDFA 4ILMA 2E7WA 2KRBA 3QO9B 4A8OA 4JI7F 4DG1A 2HHPA 2UVRA 2U2FA 1X0FA 5J1PA 1C0TA 1FJEB 2BOPA 1S6PB 3BSNA 3U7JA 4A8WA 3ZZTA 1E6YB 4J9QA 3BJYA 2FJVA 2F7VA 2DHXA 2G0CA 4RUAA 3DC2A 4TXSA 3UR3C 1HNWF 1IBMF 4KAIA 4LFCF 2MKSA 1VC5A 4ECVA 2N4CA 1R8CA 1FNXH 4XDCA 5KFKA 3DRRA 3MR6A 4ICLB 2AJ4A 1F5CA 1DHMA 1YG0A 2XSJA 1O5JA 4J9SA 1FA0A 3KHLA 2FLPA 3MEKA 2W9CA 1ZAXA 2YH1A 2XMTA 5CYJA 1EETB 3MXHP 3MM5A 1OQ3A 5IM0A 3MURP 4M95A 3H5YA 1BWEA 4WCEQ 3NNCA 2YNIB 3IGVA 3PW4A 1UJ5A 3MMBB 2W8KA 2NS1B 3D54A 2R7RA 2J0QD 1HNVA 3SCLE 3OJUA 5KG3A 2DHGA 3L95X 5A8KA 2CKWA 1NK5A 5J2MA 3IS9A 4P7TA 2MJNA 2OPRB 3QMQA 3NKYA 4M63A 3EZUA 3UDCA 1ZBTA 2O5DA 2BANA 4ELVA 1VBYA 3PEHA 4WXWA 2WBRA 1MNEA 2FPHX 2WB1D 3IAS9 3F44A 4IG0A 4QW8A 5E0OA 3KG4A 5D6GA 1V3SA 5M2PA 5KFJA 3Q8RB 3H5UA 2XY5A 3D1OA 3T1YF 1JLAA 1VQNS 2VFVA 2LEBA 4USHA 3KMSA 4ZPVR 2GHPA 1F5AA 3BGFA 4I2QB 3H2LA 1Y5NB 4DN9A 5EHHA 5K8OA 3RAQA 1LW2A 2FJDB 4BHQA 4KC5A 1KOOA 2XNRA 2XLKA 1WG4A 1RTJA 3QGHA 3HVTB 3O6QA 4TN2A 3T5LA 3BDPA 3ENQA 4QR1A 3MMCA 1PSDA 2XZWA 1DAXA 2JL9A 4DUYF 4I6YA 2FC9A 2VBYA 5A0YB 1LOUA 4C2MA 3J7A1 2H9ZA 3EYZA 4PR6A 5KG5A 3QZ7A 1FRMA 1TZ0A 2AJ1A 1N88A 3R1LA 3BGLA 3CD5A 2ZH4A 4WE1B 1SJQA 1DBDA 2BACA 2LA4A 1SUQB 4LF9F 2Z2LA 2OPPA 2EFGA 1D8YA 1ZPWX 4Y2MA 2MXYA 4PWDA 1R89A 4FN5A 1HBMB 5KT7A 2K7KA 1N5SA 5K9FA 1R8HA 3T1AA 3C6TB 3DRYA 1KD1T 4NXNF 2RUGA 1PC4A 5FIIA 3TAMB 5KFHA 4FBUA 1DTQA 3LWMA 2IMOA 2E1RA 3RRKA 3CC2S 4IKAA 1T8EA 1ZZFA 2EKYA 4RBTA 4CH1A 1FDNA 4C8NA 2OFHX 1JX4A 2KYXA 2RIJA 2UU9F 2JC1A 2PSZA 2Z4PA 2ZBIA 3FQKA 4I2PA 5CYMA 4QIVA 1Y5LB 1FKPA 1F9FA 2DB1A 4PQAA 2RF2A 1FK9A 1N56A 4AYBD 5KFAA 4DX8H 3HHKA 1WHWA 4PG7A 1CC8A 5KT4A 2O1PA 2FVPA 3DN9A 4ID5B 4P7VA 1ZOTA 2XMWA 4DLGA 4ALZA 1FD2A 4ZVHA 1K0VA 1S1TB 4QWAA 1RT1B 4A8SA 1RTHA 3M2VA 3MF5A 2M2BA 3W7BA 2AYBA 5F9NA 4ZP9A 3KLHB 2YKMB 2DTJA 4QR0A 3ISNC 5KG2A 4DFJA 3PW5A 3PRDA 3BO4A 3OL8A 2E5IA 2GV1A 4NLDA 4NLRA 1DLOA 2CRLA 2WSFC 1HW9A 5I3UB 3OXFA 3OVSA 1T05B 4NCGA 2WCXA 1FXDA 3KLGB 2QSWA 4ZCIA 4YR0A 2R2TA 2CZVC 3H5XA 1WHVA 3O44A 4X4OA 1H3DA 2DNYA 3QWUA 2Z2MA 3UDLA 5GAEU 2B9WA 4Q5VA 1W2IA 5C25B 3JSMB 4JUZA 4HYKA 2KFZA 3EXYA 4OZLA 4RU9A 4H4OA 2ZJPQ 4DQSA 2I1RA 4EBDA 4QIEA 4L72B 1VQ5S 4TU8A 1N52B 2QMWA 2V9KA 3JB9k 3TA2A 2J6SA 2IBOA 2IHR1 1IM4A 1SKRA 3I0SA 1Y7PA 4TNOA 4K50A 2XI3A 3MUVP 3MFHA 3M6UA 2WAQD 2AF6A 4M1KA 4LSLA 4ECRA 1VRUA 4A8YA 1U25A 2R8GA 2P6TA 3HT3A 4Y00A 1R0AA 3G6ES 2JX2A 3DHXA 2M8DB 2CQDA 5HN0A 4BBYA 4Q8EA 5DETA 3GE9A 4NLSA 2GO8A 5GAGU 2V8HA 3LANA 4RW9B 3G8SA 4EO6A 1N8RT 1YJ9S 2UV8A 5KAKA 2KHCA 2DT9A 1S6UA 5F8GA 1Q8IA 2I9SA 2HG4A 4FXVA 1UMJA 1WEYA 1NJIT 5K14B 4JYAF 4RNOA 4ZS6A 5HMYA 2A18A 1FDDA 4NLTA 1TUVA 2ILZA 2D9OA 3ZC4A 1UVJA 1CEZA 4DSLA 3HX9A 2Q66A 4WTYA 4RW4B 3G8TA 3DLKA 3TANA 1FE0A 3GIIA 2XMJA 4LF8F 1KLMB 4TYAA 2HNZA 5KT2A 3EX7B 4KGKA 5G0RB 1S6QA 4DHVA 1D9FA 4MTPA 1X5OA 2EFOA 2V94A 1YIJS 2ZOFA 1YBAA 3DMJB 3PJWA 5IQQA 3K5NA 3M8RA 2JVRA 2BVZA 3IWXA 1AW0A 3ETOA 1WTBA 1SJ1A 5AXLA 1U1PA 1HNIB 4YR2A 1H0HB 1RT2A 2Q1LA 3POTA 4F02A 3N6NA 1D8ZA 2X51A 2ZC3A 3NGKA 4A46A 2N7YA 3RU0A 4UY85 3G71S 5I3PA 4C8OA 2EG2A 1AFIA 5J1EB 1IKXA 3K7RA 2OAUA 2OO4A 2UVVA 2ZH6A 2RD5C 3NCQA 3MECA 3KK2B 1BQNA 2F8MA 3H40A 5ITHA 4Q7AA 3NGDA 2M7SA 3GSDA 1F60B 1TR0A 3LPYA 1S1UA 1FTRA 3HKZD 4CO1A 1TVRB 5BYQA 5AXKA 4NXMF 2QIFA 1Y5IB 2YNFB 5KFOA 4IRKA 1P1LA 3LH2S 4KR0B 3MGJA 2XNQA 1OS5A 4WZQA 2ZKTA 2RQKA 2PI4A 5L1KA 3DLEA 1SKWA 2VFTA 1X4BA 1H7WA 4WFBQ 3N4WA 3CO9A 5AE2A 1FRHA 4XPEA 2ATLA 2DNHA 4DV7F 5LT5A 1C0TB 4O3NA 3MEGB 2YX4A 4IOCQ 5H9FJ 4NA2A 4QWCA 4DV6F 3UCZP 2KFNA 3PIPQ 2E5LF 2CYYA 7FD1A 2XGQA 3LWLA 1FF2A 2N7CA 1GAOA 1HHTP 1KLNA 4CNZA 4RX6A 3M9OB 1CG2A 2B4PA 1XK8A 2C3UA 1HD1A 1TL5A 2C28A 5HROA 1KNZA 2KJWA 3P3DA 3N5BA 4O23A 2J9CA 4TY8A 3CCLS 2HYIB 2XSJB 5KFPA 2VONA 3M30A 2C3PA 2DNQA 2FD2A 4ILRA 3MM5B 2R7VA 4DL3A 3Q0AA 5KFZA 5F8IA 2PMHA 4KIAA 1UVLA 3UQSA 2CG4A 2XC9A 1C1CB 1HNVB 4LFAF 1S0OA 5HMZA 1N32F 3KLEA 2HIQA 5LSOA 2OFGX 2R2RA 2J9DE 1Y4ZB 5J2MB 3N6MA 2YY3A 1J5OA 5F8MA 2VQEF 4J9NA 1DTTA 4OMFG 3BO2A 2KZMA 3Q8QB 3CC7S 4ZKAA 4NLQA 2E29A 1U47A 1OPIA 3EGNA 1DJ0A 4IG0B 1D9DA 3CVKA 3PW0A 4B3OB 1NAQA 1MMNA 3FEYB 5B0FA 3CJ4A 1Q1KA 2PIIA 4NZ7A 3C66A 1VQPS 3UR0A 3KJVA 5KFEA 2YKOA 2RNEA 2MZSA 2IYIA 1HBNA 3MR3A 2LKZA 3DLGB 4Y28C 3PZPA 5CCMA 3I0RA 2HHVA 1XBWA 2K3IA 2NR0A 4JI0F 1C2PA 2RQMA 4LF6F 3QO9A 4HI1A 4OLOA 2IM0A 1A7GE 2M52A 2VH7A 1S9FA 4ED3A 3MMCB 4UW2A 1N5QA 1S6OA 1X4FA 3MM7B 3V4IB 1LKZA 1S6PA 2R7SA 4FVCA 2J8AA 1E6YA 2DNPA 1URRA 1KN6A 5L38A 2ROGA 3E01A 1LWFB 5KFWA 2MB0B 4N41A 2KI2A 2UZAA 4V19X 4RLEA 1YJUA 4C0BA 2KG1A 2BUNA 3I9ZA 3P5TL 4ICLA 4OHZA 4X4NA 1TL4A 2HVZA 1TK0A 4YOEA 3THVA 2NPIA 4YDXA 1FKAF 3N0VA 1HPZA 4X4RA 4OZNA 3FFIB 1GXUA 1EETA 4KB7A 3E8OA 1ZM9A 3HFKA 4NLXA 1IXKA 3D0GE 1DTQB 3PJXA 3GZ7A 1RTIA 2FIUA 2YNIA 4HL9A 3MMBA 4OZ5A 5A8RB 4FVMA 1ZM2A 3BN4A 1MMLA 2ASYA 4PWUA 1OSDA 5IFMA 1FNMA 2LLZA 2CQGA 3Q23A 3J81Y 3CCWA 3ICLA 1V6HA 4I2PB 3ISZA 2ZH7A 1VQ6S 2OPRA 4PXCA 3V81B 3IR7B 4OI3A 1FK9B 1Q7YT 2HWHA 3OSNA 1JLFB 5D77A 2RDJA 4Q0BB 1RT7B 3JTPA 3TA0A 1UETA 2LQ9A 1GTEA 1UFLA 2OH2A 3G9CA 2BQRA 5D8HB 2PE8A 1B64A 4ZP7A 1JLGB 2ZOGA 1JNZB 1RTHB 3LQVA 5L9XA 3GR0A 3M2VB 5BYSA 4I2QA 4HH0A 1YJVA 3ZZUA 3MPVA 1UVKA 1VI7A 3CC4S 5SZTA 4LFBF 4ID8A 1Y3KA 4M94A 4PQUB 1BLUA 1UWBB 2MSTA 3O2IA 1F0XA 1D1UA 2HQIA 4U67Q 1NU4A 2G9OA 3N6LA 4U9RA 4F2SA 4DMZA 1TKTB 2MQLA 4WE1A 5K8NA 2RRNA 3O8WA 4OJ3A 2R7QA 3PW7A 3RAXA 3IA0A 5B0DA 2YQ3A 1U26A 2AQ4A 1HYSB 1HNZF 2KH9A 4WKRA 4Q2LA 2FJAB 4H4OB 4RBVA 3VAKA 2WSEC 4DR3F 1HNXF 2BM0A 1HBMA 4NRTA 1Q53A 3HHLB 3EPIA 2CQCA 1QVFR 2ZM6F 2LU1A 2YWKA 3B4DA 4DV5F 3M6VA 3I0SB 1H7XA 4K0KF 4X4TA 2GHVC 5E2QA 4NCAA 1LXNA 1SV5A 2VFRA 3TAMA 2F9JA 4JOUA 2QA4G 4LSLB 1WELA 1U49A 2O67A 2POKA 1R0AB 1QUVA 2W25A 3KLIA 5LXYA 1M5PC 2KG0A 3MMJA 3QJJA 2M0GB 4BWJA 1S1VA 3IBWA 2WTFA 5H9EJ 3VAGA 4ZLPA 2FY1A 2KHDA 3NS5A 2AJ0A 3J7Z5 4WYWA 1LFPA 1LW0B 2HHXA 3CGIA 3TW0A 3D28A 3QYYA 4PG6A 1XR7A 4ECYA 4WU3A 4J9OA 1AUDA 3TUJC 2AWZA 2PGCA 5KTQA 3DYAB 1K1QA 5D4LA 2HNYB 2B51A 4ID5A 6FDRA 1H6KX 3BDEA 3CXCR 2MZTA 3VALA 4DR5F 2ADBA 3NRBA 5A6WA 4DL4A 3CSKA 1S1TA 1L3UA 1RT1A 4HTJA 1QTMA 4C8MA 5DLFA 4QU7A 1VQMS 3Q2SC 1GX5A 2B0GA 3H4DA 4B9SA 1Q79A 2OTJS 3KLHA 5CXTA 4DSKA 2A2CA 3D2WA 2XWYA 1S6QB 2VFUA 5DQIA 3MPYA 2NZ4A 3WZ0A 3TAPA 1OIAA 4FYDA 1SJFA 3V4MA 2CZ4A 3OW2R 1B7FA 3KLGA 2I2YA 3R5DA 2W4DA 3QGPA 3SXLA 4QPXA 4QW9A 2F4VF 2FJXA 3QJLA 1KS2A 3JSMA 5C25A 1XMBA 2DGOA 4FNHA 2YKQA 2UXDF 1R6YA 1IKXB 1DARA 1VJWA 4C3MA 4IRCA 4PPDA 5IT9Y 2RE1A 3TOQA 1IKWB 4UY8T 3QLHB 3B8HA 3M1VB 3LOUA 4DQIA 2DCUB 2J7UA 5EX0A 2PMZD 3PVXA 1S1UB 1S1XB 2KVIA 1YJTA 1Y0HA 2XEXA 2BA9A 3NAHA 3Q24A 1FVQA 4USIA 4YP3A 4BWMA 1Y3JA 3H4BA 3EUNA 2FVSA 3MMAA 2IJNA 3DLEB 3BM7A 3TA1A 1NK7A 3CJ5A 3BSCA 4OZJA 5JVGQ 3T5KA 4F50A 2CQ1A 5DM6Q 2JEGA 1TL3B 1SJRA 2JDJA 2YWHA 3CCQS 2FHMA 1FE4A 3R27A 1UEVA 1U1NA 4RW8B 4F2RA 2RQCA 1VQ4S 5K14A 3SFGA 4ATNA 1IKYA 3U1MA 3VR1A 3IFEA 5A6PA 1T7PA 5DGBA 2R8KA 4RW4A 2XY7A 4QIFA 3NNAA 1I6JA 1X4DA 4J9KA 1X4HA 4YB1P 1BQXA 4R5PB 4LJMA 4RW7A 4X4PA 1KLMA 3GIMA 2BQ3A 1VIOA 1P9QC 2E1AA 3MWBA 3GV8B 2AGOA 3EGWB 2B5JB 1TK8A 4B3RF 4HHJA 1G2EA 1A6LA 2VKZG 4FBTA 3KG0A 1YRUA 1HWIA 4NZ0A 5T7LA 3MM9A 1BY9A 3FDSA 4JI2F 2PT0A 4NMLA 3MEDB 4OHWA 2IAJB 3CTRA 3WC2A 1HNIA 1TKZB 2BRKA 2EFPA 3F41A 4PXDA 1QSLA 4ECUA 5KOXA 3DNCA 4CIOA 2DH8A 4X2BA 4MJKA 2NQPA 2QO3A 2DGVA 4X62F 1FDAA 3FZBA 3CDUA 1TL1A 3LAKA 3PX6A 1J5OB 3BQ1A 3RTVA 4LIRA 3P49B 2GQCA 3UPFA 2ASLA 1DTTB 1N5TA 4C0HA 1NHUA 1TKXA 3BS9A 2L9NA 3MM6B 2CFXA 1ELOA 3TVZA 2W4CA 1U1QA 5K5MA 2CJQA 5KFCA 2D9PA 1L3SA 2P5VA 4CH7A 4DQRA 1VQSA 3KHGA 2MZJA 4N47A