4HTIA

Crystallographic structure of the membrane-proximal ectodomain of the human receptor-type protein-tyrosine phosphatase phogrin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
88
structure length
88
Chain Sequence
b'ARGYIVTDRDPLRPEEGRRLVEDVARLLQVPSSAFADVEVLGPAVTFKVSANVQNVTTEDVEKATVDNKDKLEETSGLKILQTGVGSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Receptor-type tyrosine-protein phosphatase N2
publication title X-ray structure of the mature ectodomain of phogrin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 21
structure length 88
sequence length 88
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2012-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11548 Receptor_IA-2 Protein-tyrosine phosphatase receptor IA-2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4htiA00
2QT7A 3NP5A 3N01A 4HTJA 4HTIA 3N4WA 3NG8A
chains in the Genus database with same CATH superfamily
3C6UA 3CJQA 4CLPA 2HWHA 2IDEA 2EFOA 2B51A 1I51B 1WHVA 1WSVA 4O3RA 4ZOSA 2WW4A 2F8HA 4DWIA 3D9BA 1OYEA 2FPHX 5BYSA 2RKIB 4Y6IA 1RAJA 4FBTA 4C3KA 2UV8G 2MEWA 1S59A 2KG0A 1LQ9A 2DR7A 3MM8B 2OEJA 5HMZA 1C0TB 3N6LA 3I5BA 3GIIA 1WI6A 3DLJA 4P2FA 1S77D 2AWZA 5D4NA 2LYVA 3L09A 3PG9A 2G0JA 3HVAA 5LM7E 3SFUA 4C7QA 2HHUA 5E3PA 1J5OB 3T41A 1S76D 4K5SA 4ECYA 5EX0A 2CNOB 3F44A 1UMJA 2Z2ZA 1OY9A 1IKYA 2M9KA 1GX5A 4I2QB 2BANB 1TAUA 1V5VA 2VA2A 3DYAA 4HL9A 4RKUC 4P7VA 4J9RA 4PQUA 1F1BB 4H4MB 4G1PA 3KJVB 3H4BA 3PVXA 1M5KC 1JJ4A 2LU2A 1I1GA 3ISZA 2XS2A 3NOCA 3K5PA 5LOQA 4IFVB 3CUNA 5D4LA 5LMNF 1WSRA 2AX0A 2B3TB 3HP6A 4FPIA 2X1GA 2WBRA 2F3JA 1NHUA 2EW9A 3M2VB 3NEKA 4ED5A 1TUGB 3G8QA 1RACB 2KI2A 1FK9A 2APOA 4BC9A 4Y65A 2ABYA 2UXDJ 5LJ3Y 1HBNB 3LP2B 2ZKUA 2HNYA 3CJ4A 4OYMA 3EVMA 1VQYA 3DXBA 1Q1KA 2YH0A 5JJBA 3Q89A 3NGUA 5C25B 1OMSA 3ZC4A 3LTOA 3HJVA 4DL6A 3SI8A 2V94A 2N4DA 3MAHA 4TKTA 3Q22A 2XLKA 2B6AA 2NZ4A 2PMHA 2PGCA 2VF3A 3DGPB 4J37A 2AGQA 2WSEC 1WF1A 2RS2A 4FYXB 4NMXA 2YQ3A 4NXMF 4EZ6A 2WONB 4XDDA 1Z2LA 2CWKA 3QGPA 5KG4A 1WG4A 2V8DA 2G9OA 3V5RA 2RD5C 5M2RA 5ETSA 2CJQA 1N34J 1NMEB 3TOQA 2CADA 3CCVS 1TL7A 1IKXA 2GZOA 1YG0A 3PX0A 5LMUJ 2Y8WA 4NRTA 3V81B 4I6WA 2CA9A 3BB5A 4OHVA 1O0PA 1F5BA 2W8KA 3OTEA 4F26A 4B9NA 4USTA 1CJTA 2ZVIA 1G4CA 5HROA 2AKWB 2DB1A 3EZUA 2KRBA 1GMVA 4Q43A 1NDKA 4EYIB 3C8YA 2CJAA 2HWIA 2MKKA 1RI7A 2Z0GA 1PYTA 2HHXA 1PG5B 1T05B 4HLBA 2UVRA 2W2OP 3RB6A 2GHVC 4F67A 2G2YA 2MKIA 5LXRA 2MKJA 3GILA 4OI0A 3MXHP 2CG4A 4IOCQ 3VGUA 1X9WA 2FY8A 3PX4A 2K8GA 2Z58B 5AE2A 2MZ1A 4DUYF 4ZP8A 5B08A 2E9TA 3T9NA 4A48A 1R89A 1H98A 3L3CA 1CC8A 1Y5LB 4MKYA 4DXLA 2IJFA 2K3KA 1HQUA 1T11A 4QWBA 4CO2A 1SXLA 3LH2S 3MD3A 3H7HB 2FHOB 4DQRA 1ZS6A 1RISA 2XY6A 2XNQA 3A12A 2GIFA 4LFBF 4Q2MA 4GMKA 4AYBD 1S1UA 3CD0A 1WELA 1K8AT 1FO1A 4BCAA 2YWGA 1QE1A 1TKDA 5DETA 1DZ5A 1YBAA 3WBZA 2N3OA 3B4DA 1YZ7A 1VQOS 4D3GA 3MR7A 2HRUA 2BW2A 3AA9A 4MK8A 2IPOB 1ZAVA 4J9NA 3DFEA 3S6EA 3Q2SC 3CMAS 4J90A 2F4FA 4QU7A 4B02A 4LT6A 3M8QA 2AZ3A 3FEYB 4QPTA 4OI2A 1QJHA 5HBMA 4MYTA 5DDQC 3ENAA 3TX0A 4H4OA 4U7UD 3CDWA 5M2PA 2KZZA 4M5IA 3HVTB 4ZVQB 1AT1B 5FLXY 2KZMA 4TU8A 3G6VA 3AOBA 4GVBB 1HNXF 4DBQA 5A8WB 2DNQA 4Q44A 3DHWC 3RUBL 4DX8H 4EBDA 4IG3B 1UW4A 1KRPA 1A9NB 4I67A 1CEZA 2OTLS 5K14B 4B9VA 2HS4A 5IXUA 1FTCA 3IBWA 2HQFA 2JWNA 3K2YA 3Q8PB 4ZCKA 2BJ7A 1FESA 2ZITA 1EAYC 3V4MA 1T03B 2DBBA 2FY1A 3VGVA 2H4WB 5EDWA 4B3MF 1S1WB 3GJRB 2ACYA 3UR3C 1U25A 2MJNA 3ENQA 3K8WA 1Q81T 4OYZA 3TUPA 4R8UB 5KFSA 2D69A 2LXFA 2XEXA 4DOZA 3G82B 4P52A 3M6VA 4M5GA 1HI1A 2RUGA 4OX7A 2AMCB 3KUHA 2R2UA 4QR0A 3AOAA 1VDHA 3PJWA 5KG6A 3KK1A 3R5DA 3GPAA 4IYQA 3EUNA 2FQQB 1TL5A 1S9GB 1X4FA 2OP5A 3D54A 2BXJA 2Q1LA 4ID5A 3W63A 1IN0A 1SH3A 3TUIC 4EI2A 2QG9B 3VQTA 3D1OA 4F4WA 2YQ0A 5KFQA 3NCRA 4DCOB 4Q0BB 5CD4H 5C2GA 2CVEA 2LA4A 4IDKA 4ICLA 1U47A 3DOMA 4OZJA 1VIXA 4QIFA 2RQMA 1XNRF 1S6PA 2OGUA 2J8AA 3CD6S 1RT4A 1N0VC 4ANCA 3M2UA 2VG6B 5HO4A 1LWFA 4WKRA 4RNMA 2DISA 3TEHB 1HPZA 1VQPS 4OHXA 1X7VA 2R4FA 4IH5A 2D9OA 3M30A 3CDBA 4NLWA 2E1PA 4FKYA 1F5CA 4CO3A 4DR4F 1RAHB 4ZVTB 4NX9A 2C2ZB 4DQQA 3OR1B 2PFFB 4RBTA 3ZTRA 5I3QA 3G86A 3VAKA 4ECVA 1C2PA 3IC1A 2FHJA 1N36J 2HFSA 1QAXA 2D9PA 1J2VA 2QX0A 1PYOB 2B9WA 2KHDA 4QYZJ 4LSNA 1NPPA 2DR6A 1SPBP 2QMWA 2AQ4A 2G1DA 3MHYA 3F41A 3GCWP 2N4CA 4QPXA 1WJ9A 3PW4A 4Y2AA 1RAOA 4TVAB 4J9PA 4X2BA 4QIWD 3BH6B 5IOLA 2XM3A 5HMWA 3BKTA 4PWDB 1CULB 2HG4A 3D5MA 4IKAA 4A8WA 3FZBA 3QFHA 4NCGB 4N7TA 1QD1A 1WWHA 2W4CA 2CPXA 1HHTP 1MWZA 2ROEA 4L72B 1U48A 2I1RA 2XULA 1Y3JA 2ZHAA 5DGBA 2G13A 2MXYA 4TY8B 2QV6A 3BQ2A 1WG1A 2CDRB 4KFBA 3ZO7A 1N8RT 4DUZJ 4NEZA 4CP5A 3GIMA 5GAHU 3CNQP 3TA0A 3KLVA 4RU9A 3QIPA 4JBCA 4CH1A 5HMYA 4URSA 2DNMA 3IG1B 3FCHA 3CGIA 3BBCA 2DGOA 1RYSA 3PR5B 3KK3B 3KOAA 2DR9A 1GK8A 4JI1J 4DR5J 3MEEB 2PMZD 1N5YA 2RSQA 1JLEA 4DF4A 3RRHA 1N6QA 2GS8A 4DV0F 4DHVA 3G2XA 3GLJA 2DO4A 4ZA1A 2PEBA 2K2PA 1MROA 5L1KA 1FF2A 5IQQA 4X4NA 1YLXA 3G87A 3UN3A 1FXRA 5GMEA 1FHTA 3CEDA 3HKZD 3BKFA 5SUHA 3AD8C 2FIUA 4J5OA 5A8KA 2P2CB 3N01A 3EVOA 4K4VA 2VC0A 4YN3B 3QRQA 3C6TB 2W2NP 1QTNB 3GJTB 4F3QA 3E3XA 1SH2A 5IS2A 3BYRA 2GAHC 3QRRA 2YPYA 2VA3A 4KYZA 4X4QA 2VOOA 1B3TA 5B0DA 3L4BC 3S8SA 3TNVA 1Q8LA 3MTJA 2VC1A 2PI5A 2CDQA 5HL7Q 3C16A 5A0YA 2HQDA 6AT1B 1RA6A 3PKMA 1RU1A 2YNIB 4CH7A 2RNEA 2CNNB 3MECB 2PT0A 1OY6A 3A8JA 1LWCA 1PC4A 4HTIA 3CVKA 3JXOA 5ETLA 2ALZA 1BQMB 3CDAA 2D41A 3QMQA 5JVHQ 4K0KF 2OSRA 5G4DA 5CYQB 1I3OB 2PD1A 3FCWA 4PG7A 4NZ6A 1ZPVA 4MKVA 1IBKF 2ZE2A 2GVZA 3K5LA 3B54A 1ZOTA 4L73A 3D6TB 3AAWB 3S1TA 3TP2A 2C42A 3J81U 1FTRA 3QWUA 1IKVB 1NBEB 2YXLA 2ZVSA 1M90T 5D0GA 2ADCA 3A3NB 4X66J 3GG0A 3W8PA 3DGVA 1SKSA 2IC3A 2ZH7A 3KLFB 2XWXA 1C1BB 4C8YA 5AJ3J 5ETPA 1VC6A 2MY8A 3PO4A 2WBMA 1WKLA 3N6MA 2F9JA 3BS9A 1SV5A 2F40A 3FMBA 4KE5A 4IRDA 3MPWA 4K59A 4UT4A 1IJEB 2FHKA 5K8NA 1LWXA 1AYEA 2UXCJ 1LWEA 1TR0A 3EXCX 5IC6B 2FHMA 2YBVA 3RR7A 1FXDA 1HHQA 1RZMA 1U1NA 2XS7A 1SC1B 1FRJA 2GJIA 3SZ2A 4DSLA 3I0SA 1CS4A 3A8IA 3B6BA 3TVKA 1T9UA 3W9HA 2CQDA 3CIMA 2ATCB 3KLHA 3EPGA 2E7WA 4AL7A 1A7GE 2QA4G 3QRPA 2DNLA 3ISND 1RHMB 3B8HA 5A8RA 1SH0A 2CNKB 2DKOB 4FF3A 1YI2S 4P71A 1L3VA 3ET6B 2X3DA 1U1OA 2R7UA 2R42A 1M0SA 2QLFB 2AHOB 1WDDA 2XB2D 4QCLA 4X64J 4LBPA 1D9FA 3AHPA 1XQIA 4QYRA 5BR8J 3HSDA 4KR0B 3SBMA 3CJ8A 1URNA 1X5PA 1UEVA 4RUHA 1S48A 4ENOA 4ED7A 2D74B 3JYTA 1FVSA 4CLUA 4PXEA 1M5OC 5KFRA 2YKOA 1FDNA 5KFYA 3UNYA 4LFAF 1RAEB 1T94A 1NJYA 2VQFJ 5KFCA 4LBIA 4DSKA 3N79A 1TKXA 3PM9A 3QGGA 4C8MA 4LRDA 1EJ7L 2MQ8A 2GX8A 5KG3A 3G8SA 2AX1A 1HR0J 1SC6A 4LMZA 4M5KA 3I31A 1R8AA 2W9CA 3UDEA 5T7LA 4I2PA 4FF4A 4C8OA 1G6BA 4F2RA 2BE2B 4NA2A 4EBEA 2UU9J 2W7AA 3EGNA 1BMQB 3DRSA 4NLXA 1KSPA 4DG1B 1NDLA 1T3OA 2H4YB 2V68A 2ILYA 2VG5B 4G1IA 1VMBA 4ZVPB 2E44A 3DMJA 3H25A 3US5A 4ECTA 3DLEB 2MTLA 1ICEB 1UTAA 3RBDA 5A76A 1Q78A 4ETZA 3DC2A 4IFYA 1UWBB 3CB4A 3PW0A 4DL5A 1YX2A 2HNDA 4CIOA 5DS7A 2KU7A 1OO0B 2RDIA 2EFVA 4OYOA 1U26A 2R7SA 4DFJA 4B3TJ 2GO9A 4LBHA 3M6UA 4Q7AA 1RE1B 3IBFB 2JC0A 2YNHB 4KPCA 3RTVA 1U7LA 2DNOA 1TFWA 4H4KC 4ZVFA 4L3KA 1SJ4P 2MKYA 1X4CA 4KIAA 2V4JA 4KHPJ 1O8BA 4LRBA 1HQEB 1YJRA 2R7TA 4OZ3A 5F8LA 3GQCA 3Q8SB 2BACA 1ITPA 5KFIA 4B9TA 1Y00A 2Z8QA 2PIIA 1PO6A 2M2BA 1FWKA 2POKA 1L3UA 5KG0A 1CJKA 2R7XA 5DQIA 1RT2A 2FJEB 4F4AA 3QT5A 2HKEA 2OPRB 1DURA 3T6JA 4B3OA 2NSBA 3LP0B 3M1VA 4ETXA 3MFIA 3H2LA 1B70B 1HHSA 2HVIA 2MJUA 4PR6A 3GSIA 4QW8A 1TL1A 3TAMB 3M8SA 1S6OA 3DLBA 5C24B 1CBKA 2WVDA 3IWXA 3IR5B 4PPDA 1YIJS 3VALA 5L1LA 1NCLA 3OFHA 4CO4A 1VRUB 4HDGA 2J7KA 2M70A 4Z7CA 2LECA 4DEZA 2ZNZA 3H5XA 2NSCA 1LK7A 3OXLA 4MT1A 2DRBA 4RZRA 4ECSA 4KTQA 1HWKA 3PCOB 4KT0C 3MM9B 5J2MA 3WZ0A 4OLOA 2CQ2A 3MR2A 4ZHRA 4NLDA 4MK9A 1VBXA 5RUBA 1RCXB 3GYNA 1X0PA 1REGX 2ZJQQ 1VBKA 4NXNF 1JLFB 4OIXA 5LSLA 4P73A 4EWTA 2R2TA 3GSDA 2V4QA 1U45A 1VK3A 4RNNA 3OL8A 2GIQA 4U67Q 3NG8A 4KO0A 2RVJA 5K20B 1BHNA 4ZVSB 5L1IA 2D1CA 1FWPA 1WKJA 2BABA 2I5JA 2B4PA 5H9FK 4JI7F 3IS9B 1DBDA 1FDBA 1F60B 1P1TA 1FKOB 3ITHA 1JX4A 3SDEA 4GKJF 1MLAA 2BZ2A 4B3RJ 3QZ7A 2E5GA 4WFYA 4PWUA 1X9SA 1RTHB 1FRMA 3BBFA 5EWEA 1BQNA 4LSLA 3ZNUA 3Q8RB 1R8PA 1Q86T 4FYYB 2DY1A 1DY3A 2VD3A 3VWSA 1T8EA 2ZOGA 3MM8A 3BR9A 1LW0B 4N47A 3RB4A 2RQCA 5FLXU 3TEGA 3POTB 3FBBA 2NZCA 2BV3A 3ENWA 2J0XA 3QAEA 4ER8A 1QSLA 3CCMS 2UUAJ 1UVKA 3MUTP 2UVVA 3FMWA 5J2QA 1DQ9A 1S1XB 3BGRB 4NI2B 1J27A 4M5JA 2DHSA 3A13A 1U6BA 3ZTOA 4WFZA 1KVKA 4XDCA 4I2QA 2I0XA 1VQLS 2AJQA 3TQEA 1S5ZA 2HGMA 4DFMA 1VCTA 1R0BG 3X1LB 4O3NA 3C14B 3L7OA 9RUBA 2NPFA 2VG7A 4OHYA 4B3RF 2ZOMA 3EWGA 3NCPA 3GFYA 1IQTA 1NU4A 2BDPA 2EK1A 1DQAA 4JI5J 2FVRA 3W8GA 3KK2A 4NMLA 4PKDB 4KGXB 4NYPA 3FZ2A 4ED0A 1JLQB 2UVWA 2EI5A 5GAEU 1VQ6S 1B0PA 5ETNA 2DK2A 1S72S 4N76A 3BGFA 4NLOA 3OJUA 4F4YA 2OMOA 3I87A 2VBXA 3HT0A 4DV5J 2OSQA 3QBCA 2PDAA 3F0NA 4ZN1A 4FN5A 1X9MA 4RW9A 3E51A 2ZZMA 4FS2A 2VFUA 1W2IA 2IHR1 3W65A 4KRWA 5HLFA 3MPYA 1UWAA 2LQBA 3V6HA 3HXMA 2IM2A 3BF4A 3FFIA 3DDKA 4W4MA 2HIYA 2OPQA 4RX6A 5ITHA 3H5SA 3DOLB 2QSWA 3OVSA 4EK2A 1QTMA 2M52A 2QIFA 3HVRA 3KNAA 3DGPA 4ED2A 5ETVA 3NAHA 2GCFA 4CZCA 3BQ0A 4ZCMA 1FERA 5HQMA 3J81j 3AJ2A 5KFMA 5E3CA 1XIQA 3WIUA 5D3GA 3TWZA 3LP1A 3W5YA 4FXVA 4OX9F 1REVA 1TL3A 3NXZA 2ZM6J 2VKZG 4YB1P 2HBYB 3SIPB 4OLPA 3KJFB 3QLHA 1XNQF 2YNGB 4P10A 4NCBA 4DL4A 2ACMA 5AE1A 2UUCF 3UN5A 3CF5Q 5CH7B 3TA1A 4DR6F 1JXLA 6FDRA 2DH7A 3DDNA 2V6AA 3RRGA 4OX6A 4R5PB 1VQNS 3HK2A 4JV2A 1N33J 2NUHA 5IT9U 1JKHA 2MZQA 5L1JA 1CLFA 2KTQA 5HMXA 2EEYA 2YKQA 1KBRA 3D0GE 1OSDA 4HDHA 1DJ0A 5KG1A 2BKOA 2OPPA 1OYDA 2W7OA 1HNZF 4I7FA 3MAQA 5F41A 2K7KA 1RT6B 2CPYA 2J0SD 1HNIB 3MFHA 5CD4A 1DTTB 2KYZA 4UY85 2F5GA 4JI4J 1YVFA 4B9MA 2R8HA 3C19A 3GYXB 4I6AA 4UF4A 1AZSB 1PILA 3ADAC 3GFXA 3THTA 4WE1A 1HW9A 5D0RA 2VL1A 4P2MA 4U8YA 3KYLA 2O01C 3FRZA 4K4SA 1S49A 3JSMA 2LDIA 3NAIA 1HIYA 1CJUB 2IVYA 2BJ9A 4WBFA 7FDRA 4O3PA 3IR6B 2OH2A 4B9SA 4JV5J 1J5EF 2MQMA 2F9DA 2NR0A 3R2CJ 5K5MA 3I56S 5I42B 4NLRA 1S9EB 2IRXA 1X4AA 1C1CB 2IM0A 3PRVA 4YB7A 3F56A 2R7RA 5A8WA 2GV1A 2NXEA 4DR1J 1RT7A 1M5HA 3OUYA 1Q95G 5BXIA 2OD4A 4K7QA 4CM0A 1S9FA 1NH7A 2WK4A 5J2PA 2HHHJ 1SBRA 3MAAA 3OFEA 4YDXA 1RT5A 3MEDB 3CXCR 2XCPA 2YWKA 2YNFB 5B0AA 2DNPA 4XO0A 4B3SJ 4KH1B 4CLYA 4YDDB 1N5SA 1NB7A 2AJ1A 2CRLA 3P49B 5L8RC 1HBOB 2GA7A 2ZDPA 2HNZA 4R8UA 4UUXA 4USUA 1JMTA 5JUMA 4G1QA 3PTWA 4HTJA 2ZHOA 3GR0A 3E01B 4ERDA 5E3AA 4JI6F 4A8MP 1ELOA 3KDNA 3DRRB 2XNRA 1AUSL 2COLA 2DCUB 4I0WA 4F0KA 3MI7X 4ZLPA 4IQXA 3M32B 4RU2A 2O67A 3VF0B 1NJIT 2YWWA 2FJWA 1QSSA 1GT8A 3CW2C 4FVMA 5F8NA 1EETA 2C3OA 2NS1B 3R5BA 2V8PA 3V6DA 2GFFA 2DXEA 3QGHA 1LKZA 2P6SA 4DV7F 4K4UA 2RU3A 3SSSA 1EARA 4NCAA 4LREA 3H42A 8AT1B 2RRBA 4JI2F 4ECUA 1ZYQA 1TKTB 2IY5B 4C8LA 2HHHF 2RHSB 4PG4A 1MMNA 4CH0S 4NLYA 4P72A 2KHCA 2QSFA 4LF5F 1HNVA 5JVGQ 1FJGJ 3LGHA 3CCTA 3BZQA 3M2RA 4XPEA 3VQSA 2PMWA 3QYYA 1JQGA 1VIOA 3EDRB 2HK3A 3QQCD 3P96A 3OQ2A 1F0XA 4XK8C 4EBCA 1FNXH 2LQJA 3DI6A 2AT1B 3ZTPA 3S01A 5A6WA 2IBKA 1RDRA 2B7BB 2LA6A 2O66A 2D7SA 4ZJQA 3C15A 4LFCF 1ZM9A 2MZJA 3P5TL 5KG5A 4A4JA 1N4LA 3G6ES 2BM0A 3T1YJ 3KDOA 3IN5A 4FKXA 2RIJA 4O44B 4YY3F 3CCUS 1IBCB 3GE9A 1P8GA 1HW8A 2YX7A 1WOSA 4PG5A 5DQHA 2HHPA 4F04B 1UP1A 2H54B 1IWAA 2N82B 3I82A 2Y8YA 3QSIA 3EGWB 4JI3J 2FTRA 2DEIA 3J7A1 3LA0A 1IBLJ 2JVOA 3C2PA 4ZP9A 1RT3B 1QY7A 4GVLA 4U7CA 2IMWP 3VR1A 4QR1A 2VFRA 1WC6A 3W2VB 1V3SA 3P3DA 2EK6A 3ZTSA 3CULA 4BS2A 3T1HF 2RRNA 2QMUB 3NS6A 4DSEA 3RB0A 4P74A 2ZH6A 5DLFA 3L7PA 2B9EA 4YS2A 2XO6A 3I9ZA 2K1RB 1SKWA 4C3LA 1DTQB 2H9ZA 4X4OA 2WOMA 3TYTA 1KWMA 3TVYA 1NPRA 4IUFA 2DRAA 2LLZA 3MR3A 2XZDB 1U2CA 1S0MA 2YKMA 1BGXT 2HS0A 4WFBQ 5FDLA 3JS9A 1A0OB 2I9SA 4R0JA 3AB2B 2D3ZA 1JB0C 1WC5A 5KFLA 3OTDA 2YKNB 4AD6A 4RW7A 2R2SA 2VJUA 1TP7A 3UR0A 3PNIA 2DTJA 3OR2B 3VHQA 2AYEA 3R1LA 3PY8A 4RW8B 4YR2A 2ZZNA 4O3OA 2R2RA 2E1CA 1G3OA 1BQMA 3CJ2A 3HF5A 1U1LA 2MMYA 3TJ8A 1WEYA 1Y9OA 4FYVB 2OLWA 1B7YB 3EZOA 5CYQA 4X65J 4J9MA 2J9DE 2K06A 1N56A 2C2KB 1VRTA 2B9XA 3AXMA 1JNRB 4ECXA 1KEKA 4PYDA 3ETMA 3MCNA 2MDAA 3DOKA 1IXKA 2OO4A 3U1NA 4UZCA 4HACB 3OD2A 1TKZB 1WC3A 4ZP7A 5D0EA 1OQ6A 1MMDA 4F25A 3FQLA 3PO5A 2NQPA 2CG8A 4ZPWR 3FQKA 1KHWA 3R5AA 3V6JA 2EKYA 3IRXA 4OI3A 2R9LA 1KN6A 4FXWA 4I64A 5J1EA 2OPSB 2BMBA 4LF6F 5IM0A 3P45B 4TYBA 2HFNA 2OEKA 5KFJA 5KFGA 1KQSR 2MZRA 2KT3A 1S1TA 2OFGX 3UFCX 5J1PA 5F0WA 1HWLA 3VAGA 3MZIA 2V8GA 2ATLA 1FT8A 1KD1T 2VV5A 3FC9A 3TJ9A 3V2UC 3OXGA 1RGVA 2HHTA 1GTHA 1GXTA 3BN4A 2O1PA 2UUBF 4UZBA 4M95A 4EO6A 5KT6A 3MMBB 1W2BR 3GONA 1TUVA 1QVGR 5F8GA 3KNGA 2RT3A 3GV8B 1NAQA 3H20A 4P6QA 2OIHA 2KM8C 2FYXA 4A47A 3O8WA 1ZH5A 2HHWA 2LU1A 3OT9A 3I6PA 1RKJA 2HZCA 5C42B 1RBOB 4CLZA 3R27A 1OJ4A 3AXKA 1KQKA 4AQYF 4ZIVA 1YJTA 3VAJA 4LF1A 3UDLA 1FWLA 4DFKA 1NHVA 2HIQA 4ZCLA 3CJKA 3HHNB 3ET6A 2B5JA 1KOOA 1VR6A 1U6ZA 3DYAB 2Y1IA 3UPFA 4PQUB 4GC6A 4WCEQ 3F73A 2QZ8A 4EZ9A 2HVZA 3PJ9A 3AB4B 1KP6A 3IXQA 2AGPA 2YX1A 4C48A 4TN2A 3LOUA 4PXBA 2DXDA 1ZZNA 3T5KA 3KLIB 2Z56B 1IR0A 4LF8J 3EGVA 2IDLA 5AT1B 3ZZ0A 4J7CA 3BDEA 3NWRA 4J9KA 3LANA 1TVRB 3GWCA 4DL7A 1FK9B 2EC0A 1HBMA 3D1HA 3HKWA 3LUYA 4ZLJA 4OJ1A 1HA1A 1IVZA 4WTOB 2AYGA 2HNYB 4DV3J 1C4AA 2K7JA 4WK3A 3Q0AA 5D78A 4Q8EA 1V5IB 3IAS9 1TK5A 3TVZA 3GJQB 2C3YA 1GFWB 4DV6J 3RBXA 4ZS6A 1S7IA 1YITS 3PW2A 4TQRA 3QWPA 2VZ9A 1UVJA 1VLYA 2F1FA 1TFYA 1CC7A 3KHHA 4C8ZA 3IAM9 3QJJA 3UCUP 1D3WA 2JX2A 4U6PA 1OY8A 2ZFHA 1D8YA 5HAOA 2BJEA 3DLEA 3M8RA 3LPEA 1QVFR 3PYFA 2X1BA 3CJTA 3QT6A 1FFWB 2P5VA 5GADI 1S0NA 1YRUA 2JOQA 1TL7B 1IKXB 3I5CA 2WZ1A 3RGIA 5CHCB 2CPJA 2NPIA 4YUDA 2E66A 1PSDA 5CCLA 4M8LA 3IMQJ 4UQTA 4ANDA 4IG0A 5A2QU 1HBUA 1JJCB 4PYAA 2DYAA 1CJTB 5HROB 3W2WA 2YNHA 2GAGC 1RWVB 2W7PA 2HHVA 3JSRA 3SMZA 4JP8A 3N0VA 2OI2A 5KFFA 3MDFA 2CQ3A 3HFZB 5GADU 1WNEA 4E8UA 2E1AA 4RWXA 5H9EK 4DR2J 5KT3A 1YKWA 1WTFA 4DR7J 4IRCA 2EWHA 1XC9A 5F8MA 1VISA 3RAQA 2R8KA 1HQUB 3GV7B 1FE4A 1QM9A 4O0NA 2L3MA 3SCIE 2EBEA 4M5NA 2V4RA 2DNYA 1GAOA 2CPHA 4E2FB 4DPWA 2HRYA 4U96A 5AE3A 2W8LA 2OPRA 3P6YC 2R7WA 1S1UB 4TYAA 2RF2A 4CI0B 4F4KA 4C11A 5M2UA 2KXNB 4DR3J 4DQIA 1HMVA 3I32A 2UUTA 1KKHA 1QE1B 1RXOB 3TI0A 3MMJA 4MMOA 3FSIA 4LF9J 2J6SA 2E9ZA 1YSJA 3MMAA 2A6MA 5KFTA 1FNMA 3HVWA 2BJDA 2RE1A 2E7VA 4M5DA 3X3UA 1EKRA 5DG7A 1T9XA 4A46A 2NYHA 3OL7A 3HPOA 2Q6CA 3DRPA 2Z30B 2KFNA 5HBMB 3ZZRA 2MGZB 1CQNA 4AUKA 4H4OB 3HULA 1VQSA 4FF2A 4K4TA 2OUGA 4FYDA 2GHPA 1D0EA 1NK4A 1MU2A 5HSPA 2XSJA 3GCXP 5HQLA 2FLLA 4OYPA 1JLGA 4DV4J 4KKOA 2QLWA 5JMNA 5L39A 1EHWA 2ERRA 3NMRA 4RW6A 1W7WA 2MLYA 4DV2J 2I2YA 2BQ3A 1VJWA 5B0FA 3GTYX 2H65B 3SQOP 1I6JA 1H72C 1U0HB 3ENVA 4CNYA 1FKPA 3OLAA 2B43A 3IFEA 1ZAWA 3T6BA 4LR8A 2XO7A 3KXDA 4UOGA 1UEKA 2CPFA 2AEJA 1F9HA 1NK8A 1UZDA 3MM6A 2G0IA 4CTAA 2A3JA 5CCMA 3IS9A 3H5UA 1HYSA 2CXEA 2KM8B 3JAMY 4G3IA 2OTJS 3KK1B 1MNEA 1Y3KA 2YWFA 4JUZA 1JJHA 1PYSB 1DLOA 2FLOA 2UXBJ 4RL1A 3I5AA 1JLAA 1S7HA 1KDNA 2NXNA 4ID5B 1SJ1A 2XHWA 3N9UC 4CT9A 2BE7D 4X4UA 3BYPA 2C28A 5HVFA 2MQQA 2HMIB 1GX6A 3MM5A 1UEUA 3GJSB 2PI4A 3O44A 2J5AA 4CLWA 3NWGA 3OSNA 4ICLB 4Q5VA 3EPIA 3DOMB 3FBCA 2FZKB 2ZWPA 1S6PB 1R6YA 5KOXA 2GJFA 1N32J 3RAMA 3M2UB 5KFUA 1S1VA 4J9VA 3TRGA 1R8CA 4PXCA 1HPZB 4NI2A 5G0RB 3M30B 4HHUA 5IV4A 5DLGA 2XG8A 3A1YG 2GMLA 2WVEA 3EVWA 4XIUA 2RILA 1KTVA 1XEZA 2QFJA 3KLEA 1TU0B 2VASA 3FCVA 4CYUA 1FRLA 3GIJA 5DG9A 2IFXA 3DLKB 1PCAA 2W9BB 2RH3A 4C9DA 2YX4A 3DKDA 4AFFA 2C3UA 2UXDF 1K0TA 3PIPQ 5HJXA 2XI3A 4GKKJ 3OPKA 5KFNA 4DSFA 4CRJA 4ZMMA 8RUCA 1NZAA 3OV7A 2XMTA 2F8EX 3HD2A 2KN4A 1B4SA 1U8SA 3TW0A 3ZXWA 3DRYA 5KAKA 2EKNA 3OLBA 4EU0A 3LALA 1WI8A 1RLCL 1G1XA 3M8YA 2ASYA 5J2NA 2F65A 2ZWOA 3LAKA 2BBEA 2VPXB 4L74A 1RWKB 4PWWA 3P8BB 2BQRA 4KFBB 3DNCA 5CZVA 3NKYA 2LQ5A 1N34F 3QIPB 3C3LA 3KHLA 5ETRA 3NNCA 1M1GA 4LSZB 5LMUF 1UVIA 3TR5A 3J80Y 2J76E 4M94A 2XTJP 1N5YB 4YHHJ 3CJRA 1JLEB 3QFWA 1PJ7A 2RMLA 1K73T 4Q45A 2N3LA 1N6QB 4HT5A 5DZ7A 3MUMP 4TU7A 4F4XA 1U49A 3VVUA 3I0RB 2BJ1A 4K4WA 3NY0A 1FFSB 2F7VA 4CNZA 3KG1A 3CDUA 2IRYA 5A8KB 1WF0A 3O2IA 2MQNA 2JZ5A 5CYMA 2RUSA 2KYXA 2ZH9A 4ZP6A 3BM7A 5D4PA 1GMWD 2OEMA 2V34A 2VQEJ 5D15A 2C1EB 4M5MA 1ZPWX 2AU0A 3JQMA 3H4DA 1XK8A 4XAKA 4DFPA 1CJVA 1YJ9S 1HWIA 5A0YB 5I3UB 4RBUA 4R5PA 2ZBPA 3J7YU 4DX5A 1RUSA 2YPZA 1XWLA 2HS3A 3Q8YA 2WCXA 4GO5X 1LWCB 3MF5A 3D67A 3DN9A 4CDIA 1EQMA 2IYGA 2CPDA 3EM1A 3PIOQ 3CC2S 3HMJG 3OSPA 1M5PC 1I94J 4X4VA 1TK8A 2RDJA 4EGLA 3BKUA 2V67A 1VQ7S 1RTIA 3ZFVA 3PKYA 5HK4A 2GVZB 4NA3A 3DLGA 2UP1A 4EMDA 1L5UA 4WYWA 1SC4B 5GAGU 3Q86A 2M7SA 1PBAA 2HGNA 2ZD1A 5CA5A 3PFEA 1AZSA 3GFZA 1QUVA 4I4BA 3TZXA 1Q82T 2CUYA 4NLTA 1V3RA 1RBLA 5KFEA 2Z4PA 4K4XA 4ZVRB 2G2ZA 5K8PA 5HP1A 2CZVC 3CMQA 3V4IA 3V6KA 1UZHA 1RB0A 1RT1A 2YWHA 1UKUA 2M88A 3QIDA 3U7JA 2XZWA 3M8PA 4ZPCA 2P8IA 1SV5B 4NZ0A 3KG0A 2CJBA 2KFYA 4FDFA 1HWUA 1X5SA 3CC7S 4LJMA 2GO8A 1LWEB 1T9YA 1S9EA 1JK9B 5F8HA 2GJ2A 3HSJA 1Y11A 3R6LB 2ZEJA 4NLSA 3I0SB 1CS4B 2ROPA 2PA8D 3H0PA 2RQ4A 2RS8A 3PYDA 4X62J 3JQKA 1E6VA 3KLHB 1YJUA 3P5BP 5H9EJ 2QA2A 2RJZA 1TTHB 3IWLA 3DHXA 2DXFA 2VONA 5KFZA 2HURA 2NXJA 4PUOA 3BBBA 1H2TZ 2ZNYA 3OTOJ 2HHSA 4RWWA 3ETOA 4MH8A 5GAHI 3MEKA 4RNHA 1QSYA 2K3IA 3HSGA 4YEAA 1NO8A 1RWPB 3QNWB 1VQ4S 2O5DA 1LXNA 3NP5A 1GXLA 2FZGB 1EP4B 2VUGA 2E1MC 1X60A 3PJXA 4H54A 2HQCA 4JYAJ 4WXOA 4FNIA 3UD3P 1FJCA 2BKPA 3B78A 3LGNA 1VGYA 1R0AB 3DRRA 3JYTB 5FD1A 3QJLA 1S97A 1RHRB 2XYPB 2A2DA 2CPIA 2IM3A 1TKXB 3CPWR 2J9EA 1M1HA 1GH8A 4NLPA 4WIIA 4LVOP 1E6YA 4HKQA 1Y10A 1NJWA 5KT5A 2E1RA 4WFNQ 1FDDA 2W9CB 3QATA 5T7LB 1DRZA 2FVSA 4I2PB 2DR5A 4DF8A 1HI0P 2JJ4D 1KC8T 2UVUA 3FJ2A 2VICA 3NBPA 1IKWA 4ZJLA 2FB0A 3N28A 5KG7A 3ONQA 5IWAJ 1XMOJ 1N36F 1IBMJ 1HD0A 3W64A 4WYLA 3DRSB 3WC0A 4LRCA 2R8JA 1Q5YA 4U9RA 3D6FB 4K2JA 1S4FA 1NNDA 5KFPA 2Y0BB 1UPMB 1Q8KA 4DV1J 4ZPBA 4P75A 3EICA 3TUZC 2IAJA 1WKKA 4F8RA 3Q24A 1F5AA 3KFWX 2DNKA 3BSAA 3JTPA 3LWMA 4A8YA 2CQ1A 4BWMA 2DJWA 4MYUA 2FJAB 1Y4ZB 3BGLA 4L76A 2CJYB 4CLTA 3R7NB 2KVQE 3S7RA 1EIYB 4IFYB 4N56A 2GMHA 2CPEA 3FNNA 4DUZF 2GMJA 2HNDB 3MM7A 3PYEA 3Q23A 4QWEA 2AIRB 1HNWJ 1SIWB 1IR2A 3HCXA 3MWBA 1NB2A 4RBVA 4IO1A 4DR5F 4JI1F 4OJHA 1JLBA 4K50A 3HX9A 2YKAA 1U2FA 1R8HA 1UPPA 3BO2A 1NLKL 3UDVA 1RTJB 5FIIA 4NEYA 4X4TA 2IA0A 3K57A 5DZ6A 1SJ3P 1KTQA 3DCAA 3SQGA 2V4JB 5KFDA 2AV5A 1K44A 3B82A 1ZM2A 1VBYA 4CO5A 3M8WA 5F9LA 3FKBA 4B9UA 4G6VB 4E0DA 4QQBA 1SL0A 3J7AN 2KVIA 3VTIA 1CJKB 4LF7J 2ZC3A 4YOEA 1AFIA 4WWSA 3MCSA 1XBWA 4DPXA 3SFGA 4JI8J 2X3GA 3J81Y 1RT2B 1ZAXA 5DM7Q 1FD2A 2NCKL 1B7FA 4B3OB 3CMES 3H2VE 2JVRA 1KS2A 2DHGA 3M1VB 2HVEA 5F3ZA 5FJ4A 1JJ2R 4W92B 2ILZA 1LXJA 3D1QA 2DH8A 2FJBB 4N77A 3GFHA 1TL1B 2HFOA 1YJNS 4KB7A 4RPFA 3MCMA 4RR5A 2Q66A 2XMVA 1JXEA 1WEZA 1SKUB 3H40A 5D6GA 4USMA 4WPAA 2Z57B 2KXFA 3UCZP 1TL4A 3IR7B 3TX8A 5KFWA 2XGQA 5D77A 2NLWA 2YKNA 2FJXA 1EZZB 2B4VA 1H73A 2LQ8A 1XMQJ 4UOFA 2QA1A 3OR2A 3CJ5A 3EE3A 3UVJA 2FD2A 2EG1A 4KHRA 1NK5A 1FXLA 4CCHA 3HD1A 3T19A 3LPYA 1V6HA 3KJQB 4ECWA 3IA0A 5E2QA 1L3SA 5J2MB 2KT2A 2WHOA 3DM2A 4NLQA 4X66F 4WK1A 4FP9A 4ZHRB 3J7ZT 2JC1A 1JLCA 3OJSA 1Q7YT 1WTBA 2XMMA 4ELVA 1NJXA 2BEFA 3G8TA 5AJ3F 1S12A 4WTYA 4Y2MA 4L3NA 3MOJB 4ZVHA 5ETTA 3IWNC 3HHLA 4EYHB 2CQGA 1EX8A 4KO0B 3LAMA 3C66A 4L6V3 1U2RA 1KLNA 3KHGA 2DGTA 5MLCV 2Q6BA 3QSYB 3E8OA 2UXCF 5IFMA 2ZH3A 3VAHA 1C0UB 3R8YA 5AXKA 5ADZA 4OZ1A 3T3FA 2IVFB 4QYZK 1MSWD 3BPDA 3AJDA 4U7UK 1VQ9S 2LFVA 3L7UA 3ITHB 3SDEB 1TV6A 2R7OA 1T0TV 1UVLA 2ZUAA 4R25A 3TANA 4V19X 1OPIA 5LMNJ 2V9WA 2X1FA 5DGAA 4OYWA 1BQNB 4LSLB 4X4SA 4ZPTR 1FRXA 2KJVA 2QYGA 2IMOA 3UDCA 3L9ZA 2DO0A 3MMBA 2QGFB 3K58A 1UA0A 2W2QP 1WD6A 1YTYA 4ZDNA 4GC7A 2MKHA 1ULRA 5HATA 4X64F 3VAIA 1X31C 1GXUA 2ZBQA 5BR8F 3OW2R 1NSAA 3UCGA 5JXSA 2AYMA 4DL0C 5J2QB 2HBQB 2LP4A 5C42A 3MEGB 4A8OA 4OI4A 4OZ5A 4ELUA 4LUBA 3NCQA 4WU2A 3WX4A 1IWGA 1AA1B 1R7IA 2Y1JA 2ZHBA 4GO7X 3ZTQA 2VQFF 3AQPA 4DPYA 1X4BA 4DZDA 5EUHA 4O3QA 1XERA 1Q7LB 1O51A 4Y2IA 4IR1A 2VG7B 1HR0F 4AL6A 2H5EA 2OFHX 4WFXA 4ZLLA 1VLOA 2R8GA 4NXMJ 5U47A 2ASJA 1YZ6A 1UVMA 2KH9A 3D4JA 3JAMU 3KLIA 1MMLA 3KK2B 3CCQS 2AP6A 2UU9F 5IC4B 1S6QA 1M5VC 1IM4A 3R1HA 3SSRA 8ATCB 5HI7A 1Z1ZA 1NDCA 1PAUB 1MWQA 4NOHA 4ILMA 1VQ5S 2JNJA 1TVRA 5CAAA 3ZZZA 4RO0A 3BO4A 3UD5A 3EZ5A 3M6XA 4ED3A 4UUWA 3QT8A 4X4RA 1RSCA 1UCNA 2D3UA 4RW9B 4QWDA 3RG6A 4S0MA 4MFBA 3OFGA 4M1KA 3IGVA 2HFUA 1UJ6A 1AXQA 1T9VA 3KKFA 3ZZTA 5HLFB 3BO3A 3LW5C 4I1TA 2A1BA 3QO9B 3FFIB 1SJQA 1Q8IA 2OPQB 2XBPA 1U0SA 2KJWA 3OVAA 2PFDA 1F3VA 1T95A 1YRXA 4B3TF 5HQ8A 1DARA 2CQBA 4DUYJ 5ETKA 1N88A 3HHLD 1S57A 3I55S 2DH9A 3K5NA 3CSKA 4RLEA 2AD9A 4AXJA 1FX2A 2ZOFA 4PEOA 3D66A 4LRFA 4AE5A 1AB8A 1VQMS 2JSXA 1WDTA 5CYJA 5KFXA 5D3GB 3LP1B 2WB1D 2XGPA 1FEHA 1REVB 1TL3B 4CM2A 2B7CB 3BDPA 4P2XA 2ZH8A 4ZK7M 2BKNA 2HFZA 2RQKA 4LFBJ 1S79A 1XN9A 4LIWA 3QLHB 2H5IB 4KHPF 4DQPA 3KMSA 2YTCA 1RWOB 3PRDA 5HVHA 2U1AA 3THPA 3LO3A 3R97A 3MMCA 2X1AA 4HYKA 3BGUA 4ZPDA 1RCOB 5H1SV 4CWBA 4USHA 4UY8T 4O4RA 4JB8B 3RYLA 3EGZA 4UOCA 3K7RA 2VHGA 3RJMB 1JKHB 3FBFA 1BD6A 2J0QD 4NASA 2Y3YA 5EWGA 5B0CA 4FYWB 4DL3A 1JWWA 4C97A 2M5YA 4IH6A 2AJ4A 3MR6A 3PHEA 4D3HA 1FRHA 5KTQA 4RW4A 2LEPA 2OPPB 2CVIA 2HFVA 4C0HA 2O3DA 3HFVA 4I7FB 2GHWA 1WOPA 3D3CJ 3LF0A 1HNXJ 4CLLA 3KG4A 3J80U 4UW2A 1SUQA 4M5HA 2V9KA 4PCQA 5C5JA 1HQ2A 3KLGA 5F3TA 5HANA 1NJZA 5F8JA 4B17A 2B8QA 1FD8A 4HHJA 3AA8A 2DIUA 4B3MJ 4WE1B 2MHNA 1F9FA 4P2SA 2CQIA 2HVDA 3JSMB 2W1BA 2DHXA 2PSZA 3HHKA 2VFTA 4ZVGA 2RKIA 3SCKE 2ZBCA 2KFZA 2XS5A 4PG6A 2WVFA 4OV1A 5J1NA 1C0TA 1XR7A 4ELTA 2MGZA 1RU2A 2XWYA 3RR8A 2D3OR 2L9WA 2CWXA 2ZH4A 3ILLA 4YMEA 4X4PA 2E9RX 3CTRA 4USIA 3KWMA 3FEXB 1J5OA 3I4HX 1RT7B 5GAEI 2MQOA 3OUYB 2LEAA 1S99A 1LW2B 2ZH2A 3HZGA 1F2GA 2BANA 7FD1A 5EX3A 5J2PB 5E0OA 2BUNA 3RBZA 1N5VA 1XNRJ 3MAAB 4H4MA 1RT5B 2QLXA 3KJVA 2B0GA 1U02A 4OZLA 4ZVOB 1U0HA 2MYFA 4L75A 4IFVA 3MTKA 2HNZB 4Q8FA 3PW7A 5A6PA 1VFJA 1LEOA 2LDYA 2GVDB 4G1QB 2DNNA 1FRIA 4J9LA 3DRXA 3IGNA 4DR4J 3M2VA 4C98A 3A3PB 3FUYA 3JSBA 2XMWA 2XZTB 1KONA 3NRBA 2UUAF 2ZUGA 3LGMA 4WF9Q 2HRTA 1HBNA 3CT9A 3LP2A 4KV8B 1TK0A 4KPYA 1EETB 2KG1A 3V6DB 1IUJA 3RRKA 1HD1A 2BA9A 2J7WA 2HVHA 2HMIA 2DT9A 2MQPA 2FVQA 4CT8A 1SQFA 5C25A 1KQGB 3D0HE 1K1QA 4M63A 2VPYB 2AYBA 2Q79A 1RTDB 3ICLA 4ITSA 2GQCA 2ZC4A 2BOPA 4ZPVR 5D0HA 2FVCA 3UNGC 1CG2A 1Q53A 4DCPB 4KGKA 1KLMB 1QAYA 4FPRA 2VPWB 1HNVB 2Q43A 2WONA 1CQMA 4C8KA 5G0RA 4JI5F 1FX4A 4MK7A 3M2RB 2CJXB 1RAGB 4QIVA 4TNOA 4DL2A 4Z37A 1HARA 2WVBA 2ADBA 2CJ9A 4MIAA 3V81A 2W2PP 3DI6B 3DLKA 1IR1A 2JEIA 2P9CA 2VDHA 4PPZA 3GMGA 5D4OA 1R6VA 4ZVUB 2W9BA 4DV5F 1KFDA 4ILLA 5CQGA 1RHUB 1A6LA 4FF1A 3UWTA 2FGCA 1FI4A 4DV0J 2GGPB 2ZJPQ 4DS5A 1R3NA 1DQ8A 4DLGA 3C15B 1X0FA 1R31A 1KFSA 1BUXA 1Y5NB 3M9NB 3PEJA 4ED4A 2I6WA 3I4PA 3OTBA 4DJBA 2WB4A 3OVBA 3CCWA 4Y00A 1T05A 2XSFA 4PRFA 2E5LJ 4N5SA 4O4GB 2HSEB 3PW5A 4DCJB 4TU9A 3MUVP 2R8IA 5IT9Y 2DITA 1RQ0A 2JH3A 5AXLA 3EMTA 4UQGA 2DPJA 4LR9A 3W9IA 2DVIA 3CCES 3W9JA 4URGA 4ZJOA 4YQWA 1VHIA 5KFAA 4OJ3A 5HVGA 2ZM6F 2KXHA 1RHKB 3OFFA 4ILRA 2Y1RI 4XPCA 2MSTA 3ILJA 3BV8A 2L08A 4K0KJ 5AXMA 4KY3A 4JI0J 2RB7A 4KBIA 2GQ2A 1JIHA 1IBKJ 3AJ1A 2DGQA 3I0RA 3N4WA 2DPIA 4TLQA 1GEHA 1N33F 1P9QC 5IT4A 2M8DB 1ZA1B 2WOMB 2E5LF 2XY5A 3DLLQ 4EUVA 2XYHB 2YKMB 4C0BA 1ZM4A 3A3OB 4NA1A 2I38A 5FDLB 3HVTA 1S0VA 3PV8A 2ZZTA 2MPUA 1TELA 5ETQA 4AT1B 4GVBA 2C2MB 1NDPA 4ZIWA 4IG3A 5I3UA 4RW7B 3VZHA 5K14A 1BE4A 4ZCIA 4JI4F 1BY9A 1RWNB 5IZHA 4JOUA 3ZZOA 4O23A 3PRBA 3TZYA 3JQJA 1LK5A 2PEHA 5KOWA 3T9ZA 1RWMB 2XMKA 2DNGA 4A8QA 1T03A 1R43A 2AJ2A 2FJDB 3D68A 1U8WA 3ILOA 1S1WA 4JI0F 9ATCB 4FXDA 4WKYA 1H7WA 5AXNA 4N41A 1VK8A 3SCLE 2C2RA 2HYIB 1VRTB 1Q8BA 1YGYA 1B0VA 2OD6A 1LV5A 1RWWB 3Q8VA 3G82A 2JRSA 3H8YA 3DOKB 3G9CA 3KMQA 4Y0FA 3CCZA 2DEJA 1D8ZA 3RW7A 2ZH5A 3SYZA 4OFZA 3UW1A 5F9NA 4DDFA 3HI9A 4JV5F 4ECQA 2W4DA 4J9UE 2HK2A 3D3BJ 3IRXB 4I69A 4Y34A 1S9GA 2BX6A 2FHJD 1VJQA 1PAEX 2VDIA 4IOBA 4NLVA 1UJ4A 5J1EB 3NLCA 5IM0B 3N6NA 2QJ3A 4DR1F 2NYIA 4V19J 4Q0BA 2QMXA 1S1TB 4OI6A 3FSXA 3K89A 5F8IA 1FDAA 4ES1A 2DGVA 2HQ3A 3I96A 5K8OA 3LQVA 3FSYA 1ACMB 2LEBA 4X84A 3ILIA 4B3SF 4OYIA 5CABA 1VRQC 2VG6A 3SXLA 2HBZB 4LFAJ 2XC9A 1GQEA 2XMAA 1YJ7A 4YP3A 5K8MA 3GV5B 3R2DJ 1XMBA 4ZN3A 4OI1A 2IM1A 2XYGB 1NSPA 1MN7A 2RAQA 5L38A 2WSCC 4TQSA 1URRA 1SL2A 4EFAC 2GC8A 2RRAA 5KFVA 4ED6A 5L9NA 4P9SA 3N5FA 3OR1A 2WVCA 2FC9A 3QGIA 3DU5A 3R7BB 3CJKB 5H9FJ 2B5JB 2PO4A 3AH6A 4F0MA 4DX7A 3MCOA 1YDLA 3E2EA 2QA4S 1N52B 3PR4A 2WTFA 1BXNA 3M05A 3PHTA 3R5CA 1EP4A 1UL3A 2L9DA 4HHHA 4Y28C 4PWDA 4TXSA 1CULA 4C2MA 1X8DA 3HHDA 4C8NA 1K9MT 1R0AA 4NCGA 1NHKL 3WIVA 2BR0A 2KKHA 2VU5A 1Y5IB 2BOAA 2J9CA 1TZ0A 1FJGF 2HWTA 2CQ4A 4TY8A 3C46A 3G6YA 1HBMB 2CFXA 4W90B 4OL8A 4A8FA 1RKIA 3IG1A 4O3SA 2VBWA 3KK3A 2XLJA 4GRSA 3W66A 1IQZA 3MEEA 4OMFG 1WF2A 4YFUA 4B9LA 5EWFA 4DMZA 1EB0A 4F3OA 1TMJA 3HT3A 2IJRA 4WP3A 3K59A 3SEOA 3RB3A 5DDOC 3O5TB 3I9V9 4Q2LA 3T1YF 4F3MA 2QYCA 2WW8A 3D7SB 3PEHA 4IO9Q 7AT1B 3KTQA 2ASDA 3C6TA 1F3FA 4R0EA 2CQHA 2IRUA 1D09B 1O5JA 2AW0A 2EFNA 3W61A 4KAIA 4PAAA 4BWJA 3AY0A 2QRRA 3FRYA 1F6TA 4C3MA 1WC0A 4JI3F 3U27A 5BYQA 3CIZA 2QLJB 1IBLF 2YNIA 2VB6A 4IG0B 1HBUB 3MECA 4OYAA 2MZTA 3BR8A 2CQPA 3TARA 3W5ZA 1H6KX 2VOPA 3W2WB 1PKUA 1Z2ZA 4ED1A 3CDEA 2X51A 2DHAA 4ANEA 2KDOA 1RTJA 2BRLA 1NEEA 4OYXA 2HAIA 2ZH1A 1U1KA 2FGOA 3WX8A 1ZTTA 1TQLA 1P1LA 4Z2XA 4MJKA 4C0OC 2EFGA 3K5OA 2MZSA 4CLKA 1NKCA 1HKAA 3MGJA 3CO9A 2J8SA 3IM8A 3BSCA 4I68A 3NGTA 2FUG9 3NGSA 1KHVA 4MIWA 1YJWS 1SI9A 1HL6A 4YB6A 1NSQA 3NOGA 2CZ9A 4F2SA 1IKVA 4RUCA 4Z7YA 5DQGA 2HZAA 4PABA 4MAKA 1BWVA 3KLFA 1C1BA 2RF2B 1U4BA 4C11B 3PFOA 4NXNJ 3DXSX 1HMVB 2KB2A 2V8VA 4DSJA 1RTZA 3C6UB 1HI8A 2QE5A 4NYOA 3SCJE 2M8HA 3MMAB 1B0TA 4QJVA 1RAAB 1L3TA 1EKSA 3ZZUA 3FEZA 2XLIA 2AZ1A 2U2FA 4M5DB 2DNZA 2BYCA 3W60A 4AXIA 1Q79A 4X65F 3BSOA 4JI7J 3CWJA 3NL0A 3DRPB 1GNKA 2DRDA 4USJC 3VV2B 2HBRB 2MLXA 1SIZA 1R8BA 4GKJJ 3TAQA 1RA7A 1M5SA 2B4OA 1H38A 2YWEA 2C2EA 1VQ8S 5CXTA 4LVNP 4ALZA 1MU2B 2BRKA 3VVTA 2XSJB 4IQMA 1JLGB 3EJMA 4USWA 2LKZA 4KKOB 5B0GA 1UFKA 3PZPA 2FZCB 1IKYB 3GP9A 4RW6B 3AOCA 1R0CB 3IP0A 4DZ6A 1BC6A 5T14A 2V69A 4NLGA 5E33A 3UI3A 5KT2A 1FKPB 2PC6A 2WRMA 3DU6A 4URQU 4NYZA 2QFIA 1IM6A 1PJ6A 1SQEA 1I5OB 3M7VA 2A2CA 1C0UA 1ZA2B 1VYAA 5F0UA 3J7Z5 3MM6B 2LXUA 3ZNJ1 4CTAB 2WSFC 4OZ2A 1HYSB 2QT7A 3AFGA 4KC5A 3VAFA 4JV1A 2AEFA 1DLOB 3D28A 1JLAB 4USKA 2DNHA 3TJAA 4LQ3A 1HWJA 1C4CA 2MQLA 5IT0A 2BE2A 3Q83A 5KT4A 4OV6A 5HJYA 3FK4A 1T9WA 3MM5B 2A6OA 3NNAA 2DGSA 2HLUA 5C2CA 2YY3A 1QLNA 1RK8A 4KGZB 2A10A 2E29A 1UJ5A 1N48A 3BN7A 1FJ7A 2EG2A 2C3PA 4DN9A 4DG1A 3UQSA 4WP8A 1WG5A 1PJ5A 2B6AB 2VG5A 2MLZA 2V2VA 3NGDA 1VHFA 3PYGA 2CPZA 1S1VB 2EC2A 5K9FA 3QT7A 4LR7A 1K0VA 3RW6A 3MEGA 3TAPA 2EBGA 4ECRA 3TZZA 3D2WA 3CCLS 4UTGA 2EVZA 4YB5A 4LF8F 2OAUA 4PG8A 2UV8A 3U1MA 1RABB 3KLEB 1UWBA 3HO1A 4CYUB 4KSEB 1AFJA 2SXLA 3H2UB 2G4BA 5GVQA 3ISNC 2V8HA 3AQOA 1YBUA 3BGOP 3CCSS 2CQ0A 1FA0A 3H98A 5I3PA 2XMUA 1X4GA 2ZJRQ 1RWXB 5I4MA 4TY9A 2VBYA 1CPZA 4BLGA 4DV3F 2NREA 1SC3B 1SCJB 3AD9C 5A2QY 1ZM3A 1NK0A 1UAWA 4OX9J 2GIRA 3HJFA 1SVDA 1PGZA 1YWXA 3ELHA 3ULHA 3CJ3A 4DV6F 3MR5A 4F02A 2LXIA 2AF6A 1XNQJ 2JEGA 1RHJB 1HQEA 1BWEA 5J2NB 4EO8A 5KG2A 4DS4A 1SKRA 3RU0A 5IV3A 2UZAA 1U1PA 5SZTA 4TLRA 1P27B 2R7QA 5E5NA 2OMLA 2UUCJ 2DR8A 4MTPA 1F2HA 4DR6J 3T5HA 5LT5A 4OHZA 3OHBA 1W25A 3CD5A 5E41A 4DI6A 1LNQA 2RHQB 3MD1A 3IM9A 4XTTA 1GMUA 5LXYA 4DU7A 3QO9A 1NK7A 2H1YA 2W4PA 2AJFE 4ECZA 2DD8S 1T7PA 4OHWA 2RU9A 4KH0B 4F36A 3QJPA 2C3MA 3R6GB 1FJEB 2CYYA 3LP0A 4ID8A 2V0NA 2JEJA 4J91A 3FGVA 1UFWA 3AODA 2H5JB 1WHYA 5IQ6A 3AD7C 3KJNB 1HNZJ 4ZLNA 4I6YA 4OQJA 3TAMA 3JB9k 1R27B 5C24A 1CVJA 2YVSA 5LSOA 5MAOA 4BC7A 3OL6A 4K2XA 2KRRA 1VRUA 4USVA 3M8QB 5CYMB 2HW3A 2Y1LB 2B4UA 1VOMA 1SJFA 4DR2F 4NE9C 4HT7A 4N8NA 4DR7F 4CO1A 2Z2MA 3KUGA 4NWBA 1FCAA 3MM9A 2QL7B 5KFKA 1CJVB 3K8VA 1RBAA 1AROP 3R7SB 4CLSA 3W5XA 3BREA 1ZTWA 1B64A 2VIHA 2HEKA 4YR0A 4QWAA 1WACA 1NZ8A 3R5JB 2Q3PA 2PA3A 1J5EJ 4HH0A 4RNFA 4DR3F 2IJNA 1JLFA 1DFDA 5LSRA 3RAXA 5E3QA 3MOZA 1O6XA 2HQIA 4DPOA 2P6TA 2QEXS 2JEFA 3MPDA 4LF9F 4KJIA 1OQ3A 5BYRA 1RTIB 3KUEA 1X5TA 1S4EA 3M4XA 3DLGB 3VGSA 2EFQA 1U6FA 2E5JA 3QZ8A 3OTCA 2A18A 2HGLA 1RHQB 1KR4A 4N8OA 4ZVEA 2J6TA 2ZD1B 2VH7A 1MWYA 3UE2A 1GMWA 1FKOA 2DHHA 1EQ0A 2J9DA 2FLPA 5EHHA 2BE9B 2CAJA 1RTHA 2CJKA 1G7CB 5HP1B 2OELA 3V4IB 3RZAA 1RT1B 5DO2A 1WEXA 3CJ0A 3MURP 1Y7PA 2D3O1 1OIAA 2CKWA 4DV4F 5B0EA 2C2OB 4Y3CA 3GIRA 3M8PB 4FZVA 4IDKB 3TZWA 4F4ZA 4JI6J 4DV2F 1LW0A 4CLFA 3HHLC 3FBEA 3POTA 4HEA9 3G96A 4FS1A 1NSKL 3M9MB 4ZITA 2J6UA 1AUDA 1RT4B 2FVPA 2KT5A 2JHEA 4NL5A 2Z2YB 1LWFB 2DGUA 2M4MA 1S1XA 3BGRA 2IVMA 2W9AA 1RP5A 3PACA 5GMDA 2NXUA 4KQZA 1E6VB 4F50A 1NM2A 5L46A 4DV7J 1T02A 3SSQA 1ZBTA 1LW2A 1OPZA 2X7IA 1UVNA 4DU8A 4JI2J 1SL1A 2KO1A 4A8KA 1M1KT 2MY7A 4PUOB 4LF2A 3FVYA 3JTOA 3C14A 4IH7A 1WC4A 2RDDA 2UXBF 3D0IE 2PE8A 2A0FB 4WXWA 3W62A 3U1LA 1BLUA 1U1RA 1TUWA 4LF5J 1GTEA 1Q0NA 4LSNB 2LVWA 1N0UA 2IYIA 5E7OB 2FDNA 1SQGA 4O0IA 4OX8A 5DG8A 1N5QA 2GVDA 2F4VJ 2M0GB 2G1HA 1JLQA 3HHEA 5KT7A 1OWXA 1KNZA 3VZIA 1U1QA 2B8PA 4Y2CA 5B0BA 1Z4UA 4WU3A 1XTZA 2P9GA 3K17A 3OBIA 1RADB 4DPTA 2GQQA 3BH7B 3G6XA 3CJSA 4P7TA 2QL9B 1N32F 3P4UB 2BJ8A 4DQSA 2YKPA 2OKQA 4KV8A 4QBUA 1X4HA 3A8EA 1U1MA 3HM9A 3KHRA 3N5BA 3UO0A 4LFCJ 1OS5A 2I8EA 1RTDA 2LMIA 2E7XA 1E6YB 3CE8A 1WOOA 4BHQA 3DOLA 4YY3J 1NPKA 1PBUA 4IOAQ 3OHAA 4C4WA 2VPZB 3TO8A 3HLUA 3MPUB 2E5HA 3NBPB 1IKWB 2NUUG 3NNHA 2QN6B 4RUAA 3SV4A 1KLMA 5LJ5Y 4UOHA 2Z2LA 4GKKF 1MROB 3J7YI 1AW0A 1DHMA 1QAJA 3PDNA 3EYZA 1SB6A 1X4DA 2F4VF 4H4KA 1FEEA 4C6AA 2H48B 4ZPAA 2L41A 3GYGA 3H5YA 2IAJB 3K0JA 5THWA 3VGTA 1DAXA 3M8ZA 3OL9A 1P9YA 4OYBA 2YNGA 3IBCB 4A8XA 3D6MB 3L95X 1NRKA 3GZ7A 3M9OB 2GGPA 3B4MA 3WDOA 1H2UX 2HAFA 3T1HJ 4QR2A 2C22A 3THVA 5DRKA 1Q16B 4NZ7A 3C16B 1WUUA 3MM7B 5KFHA 3DLHA 2XHCA 5GAGI 5LL6d 2MKSA 2AGOA 1LFPA 2MB0B 2HZVA 2VKRA 1XR6A 1K47A 4O4GA 3CCJS 4IRKA 2W2MP 1B99A 4YHHF 4FVCA 3Q2TC 2N7YA 1JLBB 2NXCA 1VQKS 2C2DA 2W24A 4DPUA 2DNRA 1NK6A 2DGWA 1D1UA 5ETMA 2P9EA 2XQCA 4J9OA 1TMMA 5D8HB 1BQXA 3CC4S 4LF4J 2HHQA 1L3KA 1WORA 3M6WA 3JTNA 4ES3A 4AL5A 3SQGB 4DX6A 1RT6A 1OSCA 2B9YA 2ZE2B 1RAFB 1HNIA 3EDQB 3OXFA 3QAUA 1QUPA 2HLTA 2V2KA 2IA6A 4CQ1A 3R3TA 2AJ0A 2Y0SD 1DTTA 1X5OA 2VBZA 1JXVA 2OHDA 3QPIA 2H51B 4KGVB 4WP9A 1NH8A 4F7VA 2AEMA 3O1LA 2V63A 1UW9A 4KGMA 3DDIA 4HR2A 2VQEF 4MKBA 1UA1A 2JFKA 3MPVA 2EFPA 1D9DA 2IC3B 1WHWA 3EXYA 4QOTA 2DCLA 1CJUA 2DGXA 3T5JA 3UN2A 1RAIB 4ATNA 4U95A 4BDPA 4WZMA 3W3SA 4OZNA 2EPIA 1PIEA 2GW8A 2V50A 2BW7A 2BM1A 5I42A 2F8MA 3AT1B 1I94F 3G71S 1ZZFA 3UD4P 3T5LA 1C1CA 3H59A 1KOHA 4LF4F 1S0OA 2FLNA 3BPSP 1U24A 1H7XA 2VODA 4IR9A 4LF6J 1XJWB 2B56A 1YRTA 5T41A 5GMKa 4K4YA 2VFSA 2MSSA 5DJBA 3UVJB 3H90A 1XR5A 1N5TA 2FC8A 2CNLB 5EGYA 5KFBA 3IRWP 3U02A 1QAIA 1VC5A 3DM2B 3MEDA 5A8RB 2BJ3A 2YNFA 3HDSA 3IO1A 4PQAA 5BJRA 4DUTA 1JLCB 2EXUA 5KFOA 4QWCA 3O3LA 4G65A 1ROFA 2UUBJ 3HSZA 3NMAA 2JFDA 1HBOA 4QIGA 3Q8UA 4LIRA 3PX6A 1X4EA 1ZETA 3Q8QB 3TUJC 2FJVA 1VC0A 3NGRA 3HHLB 3E01A 2W25A 5DDPC 3W7BA 2IBOA 1F9EB 1W26A 2E5IA 1LFWA 1FE0A 1NKEA 2PN6A 1MG7A 3D6HB 4AQYJ 4U8VA 2V5HG 3M32A 4JV0A 2C2NA 2QO3A 2DIVA 1S10A 3PXGa 2IIHA 3NS7B 1S6UA 4X62F 2JDJA 4RUBA 3BJYA 1TV6B 3NS5A 2ZDOA 1FKAF 4KHMA 2XCAA 4ED8A 4FBUA 2JLFA 1TKTA 3BSNA 1T9TA 1N54B 3VCDA 3CCRS 1FFGB 1YQHA 3OTOF 4K4ZA 2CIMA 3BQ1A 2ZKTA 2J7UA 2GNKA 2QLBB 4RNOA 2J0WA 3GG1A 2MHEA 4RJVA 4MKAA 3GR1A 3ZZPA 3DMJB 4JYAF 4PXDA 1U09A 1YBTA 4QW9A 1VBZA 2XI2A 3R5GA 2V2QA 3WHIA 2DY9A 1RLDA 2N7CA 1H0HB 4MIBA 2HPUA 5L9XA 4J9QA 1P6TA 4PZVA 1VS3A 4DSIA 2YQ1A 1YJVA 1CSJA 2HQGA 1VI7A 1V3ZA 3WC2A 4HI1A 1H3DA 1YHQS 4LQ9A 4O44A 4NRUA 1APSA 2ZBRA 2ALYB 3R9LA 2G2OA 3W1YC 1WHXA 5IWAF 1XMOF 2ROGA 4HI2A 3CO0P 4DLEA 1IBMF 5CZXA 1S6QB 3GU0A 1K1SA 3G4SS 4NPOA 2CQCA 4Y2KA 5DDRC 3EX7B 4K5RA 4W98A 2BQUA 2F63A 1NUEA 2YH1A 2ZBIA 3NGKA 3A4TA 3K5MA 4DV1F 1PC5A 3BEGB 2QC3A 2LQ9A 1SJRA 5ETOA 4ZKAA 1Y0HA 1RT3A 5C7PA 2V2ZA 4MFBB 1KVJA 4LRAA 2OJ3A 3RBEA 3TA2A 3JSYA 3W2VA 3O6QA 1NKBA 2H3EB 4ES2A 6FD1A 4WZQA 1JNZB 5EN1A 1FVQA 3WQPA 1HNWF 3T1AA 4NLUA 4QZVB 2K1RA 1DTQA 2L9NA 3A8KA 5B7WA 1T3NA 2G0CA 1H74A 4WFAQ 4I56A 1RJJA 4K8RA 2QTWA 1FRKA 1NXIA 2LCWA 1UETA 3CD7A 4BBYA 1Q4RA 1FNOA 1HLWA 1D9AA 3SV3A 5E3RA 4YR3A 2MKCA 4FNHA 4J9SA 1QDUB 3ZZYA 4OJGA 1KVIA 4F0HA 1HFEL 2QL5B 2WAQD 1KQFB 3HZEA 3MMCB 4B08A 5HN0A 2KL8A 2BVZA 4RW8A 1WC1A 1LOUA 2JLGA 4LF7F 1MN9A 4OZ0A 2XY7A 4DN0A 4A8SA 4M5LA 5DM6Q 4JI8F 1Q5VA 4QIEA 1H2VZ 3GIKA 3TQ1A 4WJBA 2R7VA 2JL9A 1TAQA 3FDSA 2ASLA 1MW7A 3HFKA 2M3DA 4E98A 2Y9HA 5B09A 4RW4B 2R3VA 2L48A 1RWUA 4HACA 1TKZA 4HH1A 4V1Ak 1IJFB 4HVZA 4CO0A 1SUQB 3LWLA 1UFLA 2VJVA 1G2EA 2I5JB 3VAMA 1V9OA 3KLGB 1NK9A 1YK9A 2OPSA 2VFVA 2W01A 2CZ4A 3GB0A 2JLEA 1XMQF 2XMJA 4WIQA 4QU6A 1RYRA 4EEYA 2UUWA
chains in the Genus database with same CATH topology
4RX6A 5ITHA 4YFUA 1RT1A 2YWHA 3C6UA 3H5SA 1UKUA 3DOLB 5EWFA 4B9LA 2QSWA 2HWHA 3OVSA 4DMZA 2EFOA 2B51A 1WHVA 4F3OA 2M88A 1QTMA 3QIDA 4O3RA 2M52A 4ZOSA 3U7JA 2XZWA 3M8PA 4ZPCA 2QIFA 2F8HA 3HVRA 3HT3A 4DWIA 3DGPA 3KNAA 2FPHX 4ED2A 1SV5B 5BYSA 2RKIB 4NZ0A 3KG0A 4Y6IA 1RAJA 2CJBA 3K59A 3NAHA 3SEOA 2GCFA 2KFYA 3RB3A 5DDOC 4C3KA 4FBTA 2UV8G 3O5TB 4CZCA 3I9V9 1HWUA 1X5SA 2KG0A 3CC7S 1LQ9A 4Q2LA 4LJMA 3BQ0A 2GO8A 3T1YF 1LWEB 4ZCMA 2DR7A 1FERA 1S9EA 4F3MA 1JK9B 3AJ2A 3MM8B 5KFMA 5HMZA 2QYCA 2WW8A 5E3CA 1C0TB 5F8HA 2GJ2A 3PEHA 3N6LA 4IO9Q 3I5BA 3GIIA 5D3GA 3LP1A 3KTQA 1WI6A 3DLJA 4FXVA 1S77D 4OX9F 2ASDA 1REVA 1TL3A 2AWZA 3C6TA 4NLSA 3I0SB 4R0EA 2ROPA 2CQHA 5D4NA 2PA8D 2IRUA 2RQ4A 2VKZG 2LYVA 2RS8A 4YB1P 3L09A 4OLPA 3HVAA 1O5JA 2AW0A 1E6VA 2EFNA 3QLHA 2YNGB 3SFUA 1XNQF 3KLHB 4C7QA 1YJUA 5H9EJ 2HHUA 4KAIA 5E3PA 4NCBA 4BWJA 2QA2A 4DL4A 1J5OB 2RJZA 3AY0A 1S76D 2QRRA 4K5SA 5AE1A 3FRYA 3IWLA 4C3MA 2UUCF 4ECYA 5EX0A 3DHXA 4JI3F 3F44A 3CF5Q 5CH7B 2VONA 5KFZA 3TA1A 1UMJA 3U27A 4DR6F 5BYQA 3CIZA 1IKYA 1JXLA 2M9KA 4PUOA 1GX5A 4I2QB 2BANB 1IBLF 1TAUA 6FDRA 2YNIA 2DH7A 2VB6A 1H2TZ 1HBUB 3MECA 4IG0B 2VA2A 2ZNYA 3DYAA 4HL9A 2MZTA 3DDNA 3BR8A 4RKUC 2CQPA 4P7VA 4J9RA 2HHSA 3TARA 3RRGA 4RWWA 4OX6A 4R5PB 1VQNS 4PQUA 3ETOA 1H6KX 3HK2A 2VOPA 4H4MB 4JV2A 3W2WB 4G1PA 4MH8A 5GAHI 2NUHA 3KJVB 3MEKA 3H4BA 3PVXA 1M5KC 1JJ4A 1Z2ZA 4RNHA 4ED1A 3CDEA 2X51A 2K3IA 2DHAA 2LU2A 1QSYA 1I1GA 3ISZA 4YEAA 1NO8A 1JKHA 2XS2A 2MZQA 5L1JA 1CLFA 2KDOA 2KTQA 3K5PA 1VQ4S 1RTJA 5HMXA 4IFVB 2BRLA 3CUNA 5D4LA 1NEEA 5LMNF 2O5DA 1LXNA 3NP5A 1GXLA 2HAIA 1EP4B 2YKQA 2ZH1A 2VUGA 1U1KA 2E1MC 3D0GE 1OSDA 2FGOA 4HDHA 3PJXA 1ZTTA 1TQLA 1DJ0A 1P1LA 5KG1A 4H54A 4Z2XA 4WXOA 4MJKA 4C0OC 4FNIA 2EFGA 3K5OA 2OPPA 3UD3P 2AX0A 2B3TB 3HP6A 3B78A 1FJCA 2MZSA 2W7OA 1NKCA 1HNZF 3LGNA 4I7FA 1VGYA 2X1GA 3MGJA 3MAQA 1R0AB 2WBRA 3DRRA 3CO9A 5F41A 5FD1A 3JYTB 4I68A 3BSCA 2K7KA 1RT6B 2CPYA 3QJLA 2F3JA 1NHUA 2FUG9 1S97A 1KHVA 2EW9A 3M2VB 4MIWA 1HNIB 2J0SD 1YJWS 4ED5A 1SI9A 3MFHA 1HL6A 4YB6A 4F2SA 1IKVA 1DTTB 2A2DA 2KYZA 3G8QA 4UY85 4RUCA 2KI2A 1YVFA 4B9MA 1FK9A 2APOA 2CPIA 4BC9A 2IM3A 2R8HA 1TKXB 4Y65A 3CPWR 2ABYA 3GYXB 2J9EA 4I6AA 5DQGA 5LJ3Y 1GH8A 1HBNB 4NLPA 3LP2B 4MAKA 2ZKUA 4WIIA 2HNYA 3CJ4A 4LVOP 1PILA 3GFXA 3THTA 1VQYA 1E6YA 3DXBA 1Q1KA 4WE1A 3KLFA 2YH0A 1HW9A 4HKQA 1C1BA 2RF2B 1U4BA 2VL1A 1NJWA 4C11B 5KT5A 2E1RA 3PFOA 5JJBA 1FDDA 4WFNQ 3KYLA 5C25B 2W9CB 5T7LB 2O01C 3FRZA 1DRZA 4I2PB 2FVSA 2DR5A 4K4SA 3ZC4A 4DF8A 3DXSX 1HMVB 1S49A 2JJ4D 2KB2A 3JSMA 1KC8T 1HI0P 2V8VA 2UVUA 2LDIA 4DL6A 3SI8A 4DSJA 2V94A 3C6UB 3FJ2A 2N4DA 3NAIA 1HI8A 3MAHA 3NBPA 1IKWA 2FB0A 2QE5A 3N28A 4TKTA 5KG7A 3ONQA 2IVYA 4NYOA 1N36F 3Q22A 3SCJE 2M8HA 3MMAB 1HD0A 1B0TA 4QJVA 2XLKA 7FDRA 2B6AA 2NZ4A 2PMHA 2PGCA 3ZZUA 1L3TA 4WYLA 3DRSB 3WC0A 4J37A 2AGQA 2R8JA 4O3PA 3FEZA 3IR6B 4U9RA 2OH2A 2XLIA 2WSEC 1S4FA 2U2FA 1NNDA 4M5DB 5KFPA 1WF1A 4B9SA 2DNZA 2BYCA 2RS2A 1J5EF 2MQMA 1Q79A 2F9DA 4AXIA 2NR0A 2YQ3A 4ZPBA 5K5MA 4X65F 4NXMF 3BSOA 3TUZC 4EZ6A 3I56S 2IAJA 4F8RA 2WONB 4XDDA 1Z2LA 3QGPA 3CWJA 4NLRA 3DRPB 1WG4A 5KG4A 5I42B 1F5AA 1S9EB 3Q24A 3NL0A 2V8DA 2IRXA 1X4AA 3KFWX 1GNKA 2G9OA 3V5RA 1C1CB 2DNKA 2RD5C 3BSAA 3JTPA 5M2RA 3LWMA 4A8YA 4USJC 2CJQA 2CQ1A 2IM0A 1SIZA 4BWMA 3TOQA 4YB7A 3F56A 2DJWA 2R7RA 4MYUA 2FJAB 1R8BA 1Y4ZB 5A8WA 3CCVS 2GV1A 1IKXA 3TAQA 1RA7A 1YG0A 3PX0A 1M5SA 3BGLA 1RT7A 4NRTA 3V81B 2B4OA 4I6WA 1H38A 1M5HA 2YWEA 3BB5A 4OHVA 1O0PA 3OUYA 2C2EA 1VQ8S 5CXTA 3S7RA 4LVNP 1F5BA 4IFYB 4ALZA 2W8KA 4N56A 1MU2B 2BRKA 2OD4A 2GMHA 3OTEA 2XSJB 2CPEA 4F26A 3FNNA 4B9NA 4IQMA 1JLGB 4DUZF 2GMJA 2HNDB 1NH7A 3MM7A 1S9FA 2LKZA 2WK4A 5J2PA 4KKOB 3Q23A 5B0GA 4QWEA 5HROA 3PZPA 1SBRA 3OFEA 2DB1A 4YDXA 3EZUA 1IKYB 1RT5A 2KRBA 3MEDB 4RW6B 2XCPA 3CXCR 4Q43A 1SIWB 2YWKA 2YNFB 5B0AA 2DNPA 4EYIB 3MWBA 4XO0A 3C8YA 2CJAA 2HWIA 2MKKA 1RI7A 4RBVA 4IO1A 2Z0GA 4DR5F 4JI1F 1BC6A 2HHXA 5T14A 4NLGA 4YDDB 1T05B 1N5SA 4HLBA 4OJHA 1NB7A 2AJ1A 1JLBA 4K50A 2CRLA 5E33A 3P49B 3HX9A 3UI3A 5L8RC 1HBOB 2YKAA 1U2FA 2GA7A 1R8HA 2UVRA 2ZDPA 2HNZA 4R8UA 4UUXA 5KT2A 1FKPB 3BO2A 2GHVC 4F67A 2PC6A 2WRMA 3RB6A 3DU6A 4URQU 2MKIA 1JMTA 4NYZA 1RTJB 5FIIA 4X4TA 5JUMA 5LXRA 2IA0A 2MKJA 1SQEA 3GILA 4OI0A 3K57A 3MXHP 4G1QA 2CG4A 1SJ3P 4IOCQ 1KTQA 1X9WA 4HTJA 2ZHOA 3GR0A 3PX4A 3E01B 2K8GA 3DCAA 4ERDA 5E3AA 4JI6F 3SQGA 5AE2A 2MZ1A 4DUYF 4ZP8A 5B08A 2A2CA 1C0UA 2E9TA 2V4JB 5KFDA 3T9NA 5F0UA 2AV5A 4A8MP 4A48A 1R89A 1ELOA 1H98A 3L3CA 1CC8A 3J7Z5 3B82A 3MM6B 3DRRB 1Y5LB 2LXUA 4MKYA 4CTAB 2XNRA 1ZM2A 2IJFA 1VBYA 2COLA 2K3KA 4CO5A 2WSFC 5F9LA 1HQUA 2DCUB 4I0WA 4QWBA 3MI7X 4ZLPA 4CO2A 4B9UA 1SXLA 4IQXA 3M32B 4G6VB 3LH2S 4RU2A 1HYSB 2O67A 3VF0B 3MD3A 1NJIT 2FJWA 4E0DA 2QT7A 1QSSA 4KC5A 1GT8A 2FHOB 4DQRA 4QQBA 1SL0A 4FVMA 2KVIA 5F8NA 3VTIA 1RISA 3VAFA 1EETA 2C3OA 2NS1B 4JV1A 3R5BA 3V6DA 2XY6A 2XNQA 1DLOB 2GFFA 3D28A 2ZC3A 4LFBF 4Q2MA 1JLAB 4GMKA 4YOEA 1AFIA 4AYBD 1S1UA 3MCSA 1XBWA 3QGHA 2DNHA 3SFGA 2X3GA 3J81Y 1RT2B 1LKZA 3CD0A 1WELA 2P6SA 4DV7F 4K4UA 2RU3A 4LQ3A 1HWJA 3SSSA 1K8AT 1FO1A 4NCAA 1ZAXA 5DM7Q 1C4CA 4BCAA 2MQLA 2YWGA 1FD2A 5IT0A 2RRBA 2BE2A 5KT4A 1QE1A 4JI2F 1TKDA 4ECUA 1B7FA 1ZYQA 1TKTB 5DETA 3MM5B 3CMES 4B3OB 1DZ5A 3H2VE 2JVRA 4C8LA 2HHHF 1YBAA 3NNAA 2DGSA 1KS2A 2HLUA 2YY3A 2DHGA 1RK8A 1QLNA 3M1VB 3WBZA 2A10A 4PG4A 2N3OA 5F3ZA 2E29A 1UJ5A 1N48A 3BN7A 1JJ2R 3B4DA 1MMNA 4W92B 2EG2A 5FJ4A 2ILZA 1LXJA 1FJ7A 3D1QA 1VQOS 2C3PA 4DN9A 4CH0S 4DG1A 4D3GA 2HRUA 2DH8A 4NLYA 2BW2A 3UQSA 2FJBB 3AA9A 4MK8A 4N77A 1WG5A 2KHCA 1ZAVA 2B6AB 3GFHA 4J9NA 2QSFA 2VG5A 3DFEA 3S6EA 1TL1B 4LF5F 1HNVA 3Q2SC 2HFOA 5JVGQ 1YJNS 3CMAS 4KB7A 3NGDA 1VHFA 3CCTA 4QU7A 3BZQA 4B02A 4LT6A 3M8QA 2Q66A 2CPZA 2XMVA 1S1VB 3FEYB 3M2RA 1JXEA 1WEZA 5K9FA 4QPTA 4OI2A 3H40A 1QJHA 5HBMA 5D6GA 4XPEA 3VQSA 4MYTA 1K0VA 3RW6A 5DDQC 2KXFA 3QYYA 3UCZP 3MEGA 1TL4A 3TAPA 4H4OA 2EBGA 1VIOA 3IR7B 3TX8A 3CDWA 3P96A 5KFWA 3OQ2A 1F0XA 5M2PA 2XGQA 4ECRA 1BWEA 4XK8C 4EBCA 1FNXH 2KZZA 2LQJA 5D77A 3D2WA 3CCLS 3HVTB 2NLWA 2YKNA 2FJXA 2B4VA 3DI6A 2EVZA 4YB5A 4LF8F 5FLXY 2OAUA 2QA1A 2KZMA 4TU8A 4PG8A 2UV8A 3U1MA 3G6VA 1HNXF 3OR2A 3CJ5A 4DBQA 5A8WB 2DNQA 4Q44A 3DHWC 3KLEB 2FD2A 1UWBA 4DX8H 4EBDA 2EG1A 5A6WA 3S01A 4KHRA 1NK5A 1FXLA 4IG3B 1UW4A 1KRPA 4KSEB 2IBKA 3HO1A 1AFJA 4CCHA 3T19A 1A9NB 2SXLA 4I67A 3LPYA 1V6HA 2OTLS 1RDRA 1CEZA 3H2UB 5K14B 4ECWA 2G4BA 4B9VA 5GVQA 2HS4A 5IXUA 3ISNC 2V8HA 3AQOA 3IA0A 5E2QA 1L3SA 2B7BB 1FTCA 3IBWA 5J2MB 2LA6A 2O66A 2D7SA 2KT2A 2CQ0A 1FA0A 2JWNA 2WHOA 3DM2A 3H98A 3K2YA 1ZM9A 2MZJA 1X4GA 2XMUA 4NLQA 4X66F 3Q8PB 4WK1A 4FP9A 2ZJRQ 4ZCKA 1FESA 4ZHRB 5I4MA 3J7ZT 2JC1A 4TY9A 1JLCA 3OJSA 2ZITA 1Q7YT 2VBYA 3P5TL 1CPZA 5KG5A 4A4JA 3V4MA 1WTBA 2XMMA 2DBBA 1T03B 1N4LA 3G6ES 2BM0A 4DV3F 2FY1A 2NREA 4ELVA 5EDWA 4B3MF 1NJXA 3IN5A 1S1WB 2RIJA 2ACYA 4O44B 4YY3F 3G8TA 3CCUS 3UR3C 5AJ3F 1U25A 2MJNA 5A2QY 1ZM3A 1NK0A 1UAWA 3ENQA 3GE9A 1P8GA 1HW8A 4WTYA 3K8WA 4Y2MA 2YX7A 1Q81T 2GIRA 3HJFA 4L3NA 4PG5A 4ZVHA 3MOJB 1PGZA 5DQHA 2HHPA 1YWXA 3ULHA 3CJ3A 4R8UB 3HHLA 2LXFA 5KFSA 3IWNC 4DV6F 2XEXA 3MR5A 4DOZA 4F02A 2LXIA 4EYHB 2CQGA 2AF6A 1UP1A 2JEGA 4KO0B 3LAMA 3M6VA 3C66A 4L6V3 1HQEA 1HI1A 1U2RA 5J2NB 2N82B 3KHGA 1KLNA 2DGTA 5MLCV 2Q6BA 4EO8A 5KG2A 3E8OA 2RUGA 4OX7A 4DS4A 2UXCF 3I82A 1SKRA 5IFMA 3RU0A 2ZH3A 3VAHA 2UZAA 1U1PA 5SZTA 4TLRA 1P27B 2R7QA 3EGWB 5E5NA 1C0UB 2OMLA 2DR8A 2FTRA 2R2UA 5AXKA 4MTPA 4QR0A 3J7A1 3PJWA 5KG6A 3KK1A 3R5DA 3T5HA 5ADZA 4OZ1A 4IYQA 5LT5A 4OHZA 3EUNA 3T3FA 3OHBA 1W25A 3CD5A 5E41A 2JVOA 3C2PA 1TL5A 1S9GB 2IVFB 1MSWD 3MD1A 1X4FA 4U7UK 4ZP9A 1RT3B 1VQ9S 1QY7A 2OP5A 3D54A 5LXYA 2BXJA 3QO9A 2Q1LA 3ITHB 4ID5A 3SDEB 4U7CA 1NK7A 1TV6A 2IMWP 3VR1A 2R7OA 2W4PA 2AJFE 4QR1A 4ECZA 1IN0A 1SH3A 2VFRA 2DD8S 1T7PA 3TUIC 1UVLA 4OHWA 4R25A 2RU9A 3W2VB 1V3SA 3VQTA 3QJPA 3P3DA 2C3MA 3TANA 2EK6A 3D1OA 4V19X 4F4WA 1OPIA 2V9WA 2X1FA 5KFQA 3NCRA 4Q0BB 3CULA 5DGAA 4BS2A 5CD4H 1FJEB 3T1HF 2CYYA 2RRNA 1BQNB 2CVEA 2LA4A 3LP0A 3NS6A 4IDKA 4LSLB 4DSEA 3RB0A 4ICLA 4ID8A 2V0NA 4X4SA 2JEJA 4ZPTR 3FGVA 1UFWA 1U47A 1FRXA 2ZH6A 1WHYA 5IQ6A 2KJVA 3DOMA 4OZJA 5DLFA 1VIXA 3L7PA 4QIFA 2RQMA 1XNRF 1S6PA 4I6YA 3I9ZA 2K1RB 2IMOA 2J8AA 1SKWA 3UDCA 4C3LA 3CD6S 1DTQB 2DO0A 2H9ZA 3MMBA 4OQJA 3TAMA 2WOMA 4X4OA 3JB9k 1RT4A 3TYTA 1R27B 3K58A 1YTYA 5C24A 1WD6A 1UA0A 3TVYA 1N0VC 4ZDNA 4GC7A 2MKHA 1CVJA 4IUFA 3M2UA 1ULRA 2YVSA 2VG6B 4X64F 5HO4A 1LWFA 2DRAA 5LSOA 4WKRA 3VAIA 2LLZA 4RNMA 3MR3A 2DISA 1GXUA 5MAOA 1HPZA 1S0MA 2YKMA 1VQPS 4BC7A 4OHXA 3OL6A 1X7VA 2R4FA 4K2XA 2KRRA 5BR8F 3OW2R 1VRUA 4IH5A 2D9OA 1BGXT 2HS0A 3M8QB 5CYMB 4WFBQ 2HW3A 3M30A 3CDBA 3UCGA 5JXSA 5FDLA 2AYMA 4NLWA 4DL0C 5J2QB 5C42A 2I9SA 4R0JA 3MEGB 4A8OA 4OI4A 4OZ5A 2B4UA 4LUBA 4ELUA 3AB2B 3NCQA 1F5CA 1VOMA 2D3ZA</