3CNQP

Prosubtilisin substrate complex of subtilisin subt_bacam
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
71
structure length
71
Chain Sequence
EKKYIVGFKQGFKSCAKKEDVISEKGGKLQKCFKYVDAASATLNEKAVEELKKDPSVAYVEEDKLYRALSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering substrate preference in subtilisin: structural and kinetic analysis of a specificity mutant.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
molecule keywords Subtilisin BPN'
total genus 17
structure length 71
sequence length 71
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2008-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3cnqP00
1SCJB 2W2PP 2Z2ZA 3CO0P 2W2NP 1R6VA 4NMXA 2W2QP 4OV6A 2XTJP 1SPBP 2Z2YB 2E1PA 4JP8A 4YN3B 2ZWOA 2W2MP 3A3OB 2ZWPA 3SQOP 2PMWA 3AFGA 1ITPA 3H42A 2QTWA 2Z57B 3QFHA 3P5BP 3VV2B 3CNQP 3GCWP 4NE9C 1V5IB 3VHQA 2Z58B 3A3NB 3BGOP 2Z56B 3BPSP 3T41A 3WHIA 3GCXP 3WIVA 3A3PB 2Z30B 2W2OP 4K8RA 3WIUA
chains in the Genus database with same CATH superfamily
1LW0A 3PG9A 4C0BA 3V4IB 3TA0A 4Q7AA 1HWIA 4H4MA 1XIQA 3SCLE 1Q5VA 3MEDB 2OH2A 4LBHA 2CQ1A 4B3MJ 2EG1A 4U7UD 1VHIA 2EXUA 2MMYA 1RAEB 4OHVA 4F0HA 1U0SA 4GVBA 4OYPA 3IM9A 1ZPVA 2VFVA 1FA0A 4QIEA 4RL1A 2XZTB 1TL1A 3QAEA 5BYRA 5SUHA 3THPA 3IG1A 4O3RA 1Q86T 4OI6A 3MAQA 2VG7B 2FJWA 3S1TA 3O1LA 4C8OA 1DARA 4RO0A 1LFPA 3HKZD 4MIBA 3DOLA 4Y65A 4ZPVR 2QTWA 3POTA 4DBQA 4X4TA 3FK4A 3VGVA 2Z2MA 3D6HB 1EQ0A 1UFWA 2NYIA 3CNQP 5B0EA 1C4CA 1PC4A 2RUSA 2HAIA 3RBZA 3QRRA 1BGXT 1PYSB 3HVRA 1HD1A 4MH8A 1N5YA 3WIVA 4WZQA 4U7UK 1HI8A 1RWXB 2DGQA 1ZOTA 4JB8B 2OPPB 4AQYJ 1UZDA 2RS2A 2EI5A 2ZH3A 3M6WA 1UEVA 5A6WA 1KNZA 2QRRA 4FN5A 2VBWA 3HHLA 3DFEA 4IDKA 4P73A 4X65F 3HJFA 2CQHA 1KVJA 2KL8A 4QOTA 1MROA 2XNQA 1Q1KA 4R8UA 2ILZA 2BJ7A 3MEGB 4QYRA 3V6KA 3TEHB 4RBUA 2VQFF 3RBDA 2C2KB 3NL0A 2XM3A 1U1LA 3OVAA 5THWA 3PKMA 2V69A 3WC2A 1WNEA 3BF4A 5B0CA 4FYDA 1RWPB 4UT4A 1RHQB 2ZBCA 2OPRA 3HVTB 2Z56B 3RJMB 2XMWA 1VLOA 3HHLD 1T05B 1VIOA 4P71A 1WHWA 5L8RC 2IJNA 1FEHA 2GW8A 1M5KC 3R5AA 3RW7A 4ZN1A 3PW4A 2DGTA 1SB6A 4KO0B 3ETMA 2MB0B 5FDLA 3RRKA 2B9YA 1YJ9S 2V8VA 1UTAA 3OFEA 3MM9B 3OTOF 3BSCA 5F0WA 4Y28C 1SJRA 4LRAA 2YKNA 3E01B 1REGX 2Y3YA 3D2WA 5DDOC 3TI0A 2F63A 1OS5A 1S9EB 1SC1B 1UCNA 4UUXA 3W2WA 4F4XA 1N36F 4B02A 3L95X 1U8SA 5LM7E 3CSKA 2WZ1A 4DG1B 3TX8A 5K8PA 3OXGA 1SQEA 3HJVA 1HL6A 2UUBF 3R3TA 4D3HA 3Q8PB 3BPSP 1SBRA 2HZCA 2CIMA 4BHQA 1CBKA 2WBRA 3QWUA 1FK9B 2MKKA 1VC5A 1IN0A 1HMVB 4DF4A 1RKJA 1TK8A 1FO1A 4KV8B 4LVNP 3UWTA 4B3TJ 1MWYA 2X1AA 3IP0A 4L3NA 3D3CJ 3G6VA 4NXNJ 2M2BA 4RWWA 3R7SB 3FDSA 3G86A 2HS0A 1I51B 2LQJA 1TV6B 3PKYA 1SL0A 1EP4B 3OD2A 4PG7A 5B0FA 4YP3A 2KT2A 1K1SA 3UO0A 3T1YJ 2KFYA 1U2FA 4DQIA 3M8QA 3BQ1A 1ZM2A 1LOUA 1NZ8A 4LT6A 4DPOA 1AA1B 1YJNS 1VCTA 1Q16B 1AUSL 1HBMB 1LW2B 2WVCA 2HQCA 1LWEA 2KJWA 2PC6A 3K8WA 4KC5A 4CLWA 2WRMA 1RTHA 2XGQA 3KLEA 3DC2A 1NCLA 5DRKA 4EBCA 2PGCA 2XS2A 1T9VA 4MK8A 3SCIE 2FTRA 2C2DA 3WDOA 4DPUA 1Q7YT 4K50A 1WG5A 2L9WA 1YJUA 3C16B 1R0CB 4KYZA 4TNOA 4F25A 2ZH6A 2Z2ZA 4DL2A 4OZ5A 1HNXJ 1RWNB 1TQLA 2BX6A 3GJTB 4WP8A 1QJHA 3POTB 2NZ4A 2XYGB 2H4YB 5D0RA 1MG7A 3OT9A 2VB6A 4R25A 2NREA 4DR7F 3K8VA 3LAMA 1IBKJ 5T7LB 4DV4F 1IBLF 1NHVA 2ALYB 4RKUC 5CAAA 1XMOF 5HMXA 3KUHA 4PKDB 7FD1A 5HO4A 4F4ZA 3Q24A 2IHR1 2IJFA 3W60A 3FNNA 3FBFA 3UW1A 3HMJG 2CNOB 5BR8J 3CCRS 1QAJA 2CA9A 3KTQA 2LECA 4B3OA 4B9TA 3CPWR 5KG0A 1YZ7A 2OSRA 2V34A 4L74A 1IQZA 4ZLJA 5HJXA 2QE5A 3GPAA 1YLXA 3R6GB 2FJVA 5JJBA 1ZAXA 4TYAA 5EWEA 4WK3A 2QZ8A 4IFVB 2XS7A 3UNYA 1CPZA 4EK2A 4HHUA 2JSXA 2Q79A 4KE5A 3W63A 1FRIA 2XYPB 5KFDA 3V81A 2G2ZA 4ALZA 2P9GA 1HHQA 1NK0A 3QRPA 4J9QA 3CMQA 3TWZA 1IR0A 1IVZA 3W8GA 2FLOA 2G0CA 3HHEA 4I68A 2AYMA 3MPUB 3FVYA 3N5BA 3MMAA 1KQGB 4KY3A 3U1MA 3QJPA 4ZN3A 3SYZA 3B78A 2WB1D 2XMUA 1G3OA 1VLYA 1WG4A 2EC2A 2GMHA 2I8EA 2FIUA 2W4PA 3DRRB 3PRDA 4P75A 1T9TA 4J90A 5EHHA 3PXGa 5E3RA 3PFEA 2UUAJ 2QJ3A 2J8AA 2AIRB 3MM6B 1S59A 3M8PA 1NHUA 1RABB 4HVZA 3ULHA 4OMFG 5D6GA 4LF8J 3OQ2A 1N56A 1JMTA 1GMWA 2HIYA 1PKUA 4QR0A 4UOFA 1QSSA 4A8WA 2X1FA 1N33J 2KXNB 4LRFA 5ETRA 1H74A 2ILYA 2VZ9A 2G2YA 2HNDA 2XHWA 4E98A 4CCHA 1OIAA 1VBYA 2LXUA 1HNIB 4B3RJ 4ZVFA 1V3SA 3CULA 5CYMB 1LWFA 1BWVA 1R43A 2AJ4A 1HW8A 1H3DA 3IFEA 4NLWA 1U26A 3NGSA 4ID5B 1TL5A 3M2RA 5IOLA 1BMQB 3QLHA 3CB4A 3C6TA 3JYTB 2RKIB 2XI2A 2M52A 4F4KA 4AFFA 4ANDA 2BE2B 3KK1A 2L48A 3GZ7A 4HH1A 5IFMA 2O5DA 4JUZA 4UZBA 3QZ8A 1RT4A 1VI7A 2K06A 1G4CA 2RQ4A 4DL0C 5KFMA 2QN6B 3CMAS 2DHSA 1VQPS 1R6YA 4RR5A 3M8YA 4USJC 2UU9J 3RTVA 2VBYA 4KPCA 3HHNB 3MPWA 2RD5C 3OW2R 2CXEA 2HKEA 1JLGB 3GSIA 5J2PA 4I6WA 2ADCA 1TL7B 2FUG9 2JHEA 4W90B 1HBUB 3PIPQ 2WB4A 1IWAA 4KKOA 3DHWC 1UW4A 2RILA 3I0SB 4B9NA 2FY1A 2ZH4A 2DRDA 3PEHA 4J9NA 1B0PA 3H90A 3L9ZA 4M1KA 5KFTA 2YWEA 1LWEB 3AY0A 3B4DA 2XSJB 4DV4J 2GCFA 3IWNC 2EFQA 3W65A 3DOMB 2M4MA 5KG6A 2CG8A 2YWWA 3ZNUA 1X4AA 3BH7B 1PJ6A 2IMOA 2BR0A 4P72A 3ONQA 1F6TA 1REVA 2PMWA 2QMWA 4Q2MA 5IQQA 1WTFA 2VQEF 2R7RA 4RNHA 2NSBA 3M9MB 4DLGA 2BKPA 2C1EB 3GTYX 3MM5A 3AJ2A 3N79A 2W9CB 2HVIA 2VFRA 3OUYB 4ECWA 1S79A 2UVUA 2OFGX 4KIAA 1HWJA 2AX0A 4LVOP 1NJXA 4B9MA 1JQGA 1TELA 4WE1A 3CCJS 3QT7A 4RUHA 2R2RA 2B9XA 3DRPA 1K0VA 1LK7A 4PXCA 5ADZA 2JEIA 4DR6J 1CEZA 2YBVA 4ZVOB 4NLVA 5KG3A 3HM9A 1VJQA 2D1CA 2DT9A 4OV6A 3TA2A 4DUTA 3HF5A 2ZOMA 3SV3A 4ED8A 2XS5A 4DHVA 3AOAA 2BW2A 3WX4A 1YZ6A 3HFVA 4OZJA 2MZ1A 4YDDB 1UKUA 2W24A 3QATA 3LPYA 2KT3A 2QL9B 2CQ2A 1WKKA 2XG8A 5ITHA 3TR5A 4ZOSA 1HKAA 3FSIA 4LF7J 3TP2A 2J6TA 2OTJS 3KMSA 2YX7A 1TR0A 3LGMA 3MFIA 3M1VB 5FLXU 3BSAA 3D54A 4I2QA 4P6QA 2MJUA 1LWCA 3H2VE 1JLCB 1VJWA 2VL1A 4RW8B 1IKYB 4C6AA 2BZ2A 1QVGR 1X4HA 4F0KA 3PR5B 1CJKA 2XLJA 1SUQA 3NOGA 1SCJB 3ZZRA 4AQYF 2A10A 4O3NA 1XEZA 4USMA 3TARA 1N8RT 3KG4A 4RBTA 1O0PA 3B4MA 4M94A 2PE8A 1F9HA 4FXDA 3H2UB 3W61A 3MURP 4M5DB 1WF0A 1VK8A 1RWUA 2V9KA 2ZNZA 4NL5A 4KO0A 3OL8A 3C15A 4ZP6A 3NNCA 5AXKA 2QFJA 3FUYA 4Q8EA 3CJKA 2QYCA 4NA3A 4HKQA 4LR7A 2VH7A 4O4RA 5JVHQ 3DU6A 2VBXA 3GCXP 4DQPA 2HGLA 1Y9OA 3ZTQA 2OD4A 5KFSA 3OVSA 4N56A 3IBFB 2ZKUA 3QYYA 4CDIA 3BSOA 1VRTA 4KR0B 1RACB 3FFIA 4TYBA 3DLKB 3GU0A 2IYIA 3A8EA 5KT2A 3CD6S 2EPIA 2HFOA 4V1Ak 2OMOA 3HT0A 3T9NA 2DH9A 5KFIA 2DRAA 5F8IA 5E3PA 3LPEA 4CLFA 5F8MA 4J9RA 2MPUA 5IZHA 4KV8A 1NSKL 4KGZB 2ROGA 3SEOA 1DQ8A 4C2MA 4OL8A 1FWLA 4BWMA 3QSIA 2E9TA 3LP1B 2R7SA 1R0BG 1HHSA 2J9DA 1RT1A 2OPSB 4MFBB 4RNNA 2LQ8A 1H2VZ 1IR2A 1BQXA 5DO2A 5AE1A 1W2BR 1L3UA 4QWBA 1BQNA 4DFKA 3F0NA 1HPZA 4KT0C 4K0KF 1SKUB 1M0SA 2D3ZA 2E5GA 2X3GA 3BV8A 4M5HA 4WFXA 5D0GA 4KGKA 5A8WB 1NB7A 1HI0P 4NI2A 4KAIA 3TO8A 1S0NA 4Y2MA 4ZCKA 2KRRA 1S6QB 3BEGB 4ECTA 5KT3A 1VBZA 4G6VB 2FHMA 2E66A 2Y0SD 4NZ0A 3WBZA 1RUSA 4OYAA 2MQMA 2KG1A 1GQEA 3CUNA 1RI7A 3E51A 2IC3B 2ZE2B 3TJ8A 4ETXA 4PUOB 3GR1A 3Q23A 1JX4A 4JV5J 3NGDA 2VHGA 2F7VA 4I64A 3KKFA 2N7YA 4WK1A 4RUBA 5K8MA 1L5UA 2A1BA 4L75A 4UF4A 3K5OA 3TZWA 3R8YA 2HQFA 4WTYA 5HLFA 4EUVA 2R7VA 2WSFC 2VASA 1N0VC 3MOJB 2P9EA 4Y2IA 5K14A 3KJVA 4PWUA 4DX8H 2WK4A 2U2FA 1NPPA 1SI9A 3NG8A 3GSDA 3Q8RB 2VODA 3RGIA 3N6MA 3PYFA 3W66A 3Q86A 3EZUA 1ZM9A 1X9SA 1T95A 1HR0J 1SH0A 1R6VA 2X7IA 3S7RA 1YJVA 1JLFA 3UI3A 3Q8QB 4URGA 2XLKA 3PX6A 1KC8T 3SCKE 2CYYA 1FVQA 2EBEA 3BM7A 5KFKA 1G2EA 2QC3A 1WC0A 3ELHA 3NBPB 2J7KA 2YNGA 4JBCA 3GQCA 2FVCA 2D3O1 3DRSB 1H38A 4X4VA 1HQUB 1B70B 1Y00A 2E1RA 4HTJA 5G4DA 2IMWP 4QWAA 2QA4G 2QGFB 1AB8A 3GV5B 3DDIA 2GMJA 3ISZA 4CT8A 2WSCC 3BQ0A 3EICA 3NY0A 1R0AB 1SJ4P 2RHSB 4X65J 5H9EK 1W7WA 1RA7A 3KXDA 2KHDA 1TFYA 1D9FA 2FD2A 2W4DA 3KLFB 1VQMS 1XQIA 3CJ8A 1M5HA 1R89A 1A7GE 2IYGA 1FNMA 2IIHA 2V8PA 2X1BA 3NP5A 3CO0P 1NDPA 3OFGA 2MY7A 4JI2J 4J9KA 3MEDA 1C1CA 5C42A 3CJRA 1F60B 1MMLA 3L7PA 3LWLA 2MYFA 3WX8A 1JIHA 2J0SD 2MHNA 3GILA 1KFSA 3MMCA 4F4YA 3OHAA 2VDHA 4MKBA 5HBMA 3CJ3A 4K4TA 4J37A 5DGBA 4DQRA 1NK8A 1V5VA 2BVZA 3AA8A 4DV6F 4GC7A 3VAIA 4C8YA 1BQMB 1C2PA 5AXMA 1SC6A 1S77D 1Y3JA 1T03A 3NRBA 4U9RA 4WPAA 4F4WA 3MPYA 2MKYA 5KT4A 2BEFA 2Z2LA 5GAGI 5HVGA 3P4UB 2GJIA 3Q2SC 5BJRA 5KFHA 4DSLA 1UETA 1JLEA 4ED0A 4G1QB 1RT4B 2E5JA 3CJ0A 1FDBA 1RT3A 2IRYA 5IM0B 1X9WA 2AJFE 3M30A 4LSLA 2UUCF 2WOMB 4WKRA 4B3RF 1X5OA 3JSBA 2D9OA 2G9OA 5JUMA 1BD6A 1WF1A 4RZRA 2W9AA 1LXJA 2BRLA 1YTYA 4BS2A 2ZZMA 2D74B 2DGSA 2IBOA 2LLZA 3VAMA 1FRJA 3A13A 4ZKAA 3MUMP 1R8CA 3NGTA 3PEJA 4UY85 3VWSA 1S6QA 3AXMA 1B7FA 4M5KA 3R5GA 4PXEA 4M95A 4UTGA 5EX3A 1OSDA 3NGUA 1T9UA 4BCAA 2DNNA 4DDFA 1O6XA 2AKWB 4ES3A 1I1GA 2LDYA 3IRXB 5L9NA 2IJRA 1RJJA 3MR6A 4X66F 4DUZF 2UXDJ 4FVCA 5IC4B 1S7IA 2YH0A 4LF9F 1HFEL 1UP1A 2DH8A 5LJ5Y 2DNMA 5D78A 2NSCA 2IY5B 4L6V3 5LJ3Y 4YN3B 4ILLA 4W98A 3DLBA 3C3LA 2E9RX 1GMUA 3SCJE 1CQMA 3ETOA 3JAMY 3EDRB 3BO4A 1K73T 2KM8C 4I1TA 2ZC4A 8AT1B 1XNRF 1S9EA 2YTCA 1RCXB 2GV1A 3R5JB 3US5A 2LEPA 4LIRA 1S1WA 4KFBA 3RBXA 3MMJA 4N76A 2R2SA 2XLIA 7FDRA 1F0XA 2WONB 2WVEA 2DKOB 3DI6B 4KHRA 4PYDA 3Q2TC 1EB0A 2MEWA 4YFUA 4HDHA 4IFVA 1KLNA 1HNWJ 4PXBA 2HFVA 2DNQA 2HNZA 1TKXB 2BW7A 2C2ZB 3MUTP 3TANA 4KB7A 2MZRA 2ZUGA 3QT5A 1ZH5A 4RU2A 3Q8YA 4AL7A 1CJTA 2MQ8A 4ECVA 5EWFA 3MAAB 1XMQF 3W3SA 2K1RA 4MIWA 5IT9Y 4ZPDA 1E6YB 3IAS9 3AB2B 1LV5A 4B9SA 3IWLA 1D9AA 1CS4B 4ZITA 1U0HB 2CAJA 3CVKA 3JSMA 3MCSA 3OTBA 5GAGU 4E0DA 1MU2A 2OJ3A 2CPIA 4DR4J 5AT1B 1IBLJ 5DG7A 3C19A 4USIA 2Z8QA 2DXFA 4PXDA 1FCAA 4WU2A 1T9WA 3TVZA 2DEIA 2GAHC 4P7TA 3BYPA 4ITSA 5HQMA 5J1PA 3WIUA 2NLWA 2ASJA 2MKCA 3ZZPA 4UOCA 3VAJA 1I94J 1YSJA 5DQIA 1VIXA 2YY3A 4LUBA 3CCZA 4OZ3A 2I6WA 3FBEA 4ZS6A 4N5SA 2CVEA 1ZYQA 4NYPA 1CJUB 4DV3J 1S0VA 5DZ7A 3KJFB 4KGVB 2MXYA 3W2VA 4MAKA 5A8RA 3CCSS 2VIHA 2OKQA 1RTJA 5MAOA 1S4EA 1YVFA 1X4BA 4PZVA 4WBFA 4B3MF 3O5TB 2F9DA 2LXIA 1SV5A 4RW6A 3EGWB 3NKYA 1X4FA 1WC3A 4GRSA 1RXOB 3HZEA 3OXLA 3W64A 5LXYA 3A3NB 4DR5J 4PQAA 2KI2A 4M5IA 4N41A 2PA8D 3ZNJ1 3KHRA 4IR9A 1A0OB 5IWAF 1YHQS 5DM6Q 1RTDB 5KFUA 4Y00A 1MN7A 5EUHA 4NYOA 1Q95G 2ACMA 2HG4A 1CJVB 1CLFA 5EGYA 2UU9F 1RTIA 5B0DA 3OLBA 3OTCA 3W5XA 1YK9A 2HHPA 2QLFB 1XTZA 3P3DA 3PYEA 5DG8A 1XC9A 4PWDB 2NYHA 1RK8A 3IWXA 4HACB 2V68A 1QE1B 4DV2F 1IKVA 1Q53A 3PTWA 3GIKA 3MEEA 1WOPA 2JEJA 9ATCB 1EETB 3P5BP 1YX2A 2UZAA 2CFXA 2ZJQQ 2Z0GA 4NLUA 3M6UA 3D0GE 3SQGA 1FKOB 5KFVA 3VVTA 1WHYA 4LBIA 3SMZA 4DF8A 1F2GA 1B7YB 4JI1F 2CPFA 1Q4RA 2HGNA 5KFNA 2IAJB 4QU6A 1GXLA 2PT0A 4PQUA 3N5FA 2A18A 3ITHB 4IH7A 1FJEB 2FJBB 4LRDA 1VK3A 2HVZA 1GFWB 3D1OA 2FC8A 3FCVA 3KLGB 4DSKA 4P10A 3RB0A 4JI4J 3QLHB 1XJWB 1RAHB 2E29A 4RWXA 3RW6A 3DLJA 1ZAVA 1XN9A 2EVZA 2LYVA 2CJQA 3ZZOA 1Y11A 1NZAA 1FEEA 3DMJB 3VGSA 8ATCB 2EEYA 3H42A 5D4PA 1PGZA 5CCMA 4HYKA 2C2RA 3NCQA 1S1VA 3IR5B 3RRGA 1RCOB 2C42A 3G4SS 2YNHA 1WORA 3HD2A 2OPRB 4NASA 3KG1A 3T41A 2RJZA 2W7OA 3CJ4A 2BOAA 3PO5A 2DNPA 5GADI 1FNOA 3CJ5A 1TU0B 2AWZA 1BHNA 3IGNA 3OPKA 1I94F 3DN9A 2GO8A 2HQ3A 4DR2J 3H8YA 4TY8B 1JNRB 2FZGB 4CP5A 2ZD1A 1YJTA 2YXLA 3OV7A 1R0AA 2ROEA 2Y1RI 3J7AN 2QG9B 3SFUA 5CH7B 2RNEA 2UVVA 3DOMA 4IH6A 4KHPJ 4ZLPA 1MSWD 1UEUA 5HK4A 1N34F 1KBRA 4N47A 3TOQA 4ZMMA 2DR7A 2CPZA 4WIQA 1MWQA 1NKBA 4I6AA 4B08A 3W8PA 3X3UA 1NKEA 2IM1A 4DSFA 4B9UA 4KH1B 2QV6A 5JXSA 3OR2A 2NCKL 4JI0J 4MKAA 3UE2A 3MMCB 1EX8A 1SXLA 4OX9F 4ZLLA 2PMHA 1D09B 3BKFA 7AT1B 1K9MT 4LF5J 1MNEA 4JI5F 3CCWA 2W2OP 4MYTA 5F0UA 3C46A 4PRFA 2XMTA 4NRTA 3HI9A 3ET6A 1YDLA 1U09A 3DLLQ 2F40A 4BBYA 4NEYA 2RF2A 2YH1A 1J27A 1I3OB 1VRUA 1RT2A 5KOXA 4EZ9A 4JI3J 3THTA 3ZZUA 3M9NB 1LXNA 3G8SA 3KJNB 1HBNB 2JRSA 1SKWA 1JLEB 4X2BA 4ELUA 1YBTA 3DRYA 3MUVP 2HS4A 2AEFA 1VQNS 1RB0A 5G0RB 4Y34A 1HNVA 2B6AB 1SC4B 1DRZA 4BLGA 2VQEJ 2FVSA 1IBKF 4RW9B 2K7JA 1VS3A 1RTIB 2XWYA 3H4BA 4IQXA 2F65A 1TAUA 4OYOA 3KLEB 4DCOB 1IR1A 3CF5Q 4FZVA 1UJ4A 4BWJA 3AT1B 3DM2A 1ZS6A 4WYLA 3AOBA 4O3OA 3ZZTA 2NR0A 1QE1A 4WWSA 5T41A 2MLXA 2ZFHA 4ZA1A 3T1HF 2HHQA 3W5ZA 1LFWA 2DNHA 2AEJA 3TNVA 4OI0A 3CDAA 2FZKB 4GC6A 2H5EA 9RUBA 4ZVTB 2M3DA 3LAKA 1JLBA 1ZM4A 2CKWA 3R27A 4NWBA 2RUGA 3V4MA 3KHHA 2DR9A 1KONA 4KHMA 2IAJA 4OZNA 4CLYA 3EM1A 4D3GA 3K5LA 2FVPA 4FYXB 2AMCB 1QAXA 1EQMA 1T7PA 1RT6A 1H7XA 2OSQA 4EYHB 2V2ZA 2ZH1A 3KNGA 4F7VA 3DOKB 1OO0B 1G6BA 1FKPA 3ADAC 3HX9A 3ENVA 4KGXB 4NX9A 1CC7A 2RRBA 1LWXA 2DCUB 1LQ9A 1ZA1B 2ZBRA 3MD1A 3EPGA 4JI6J 5H9FK 4L72B 2LQ9A 4X84A 1U6FA 4NLDA 2M7SA 4I4BA 2B3TB 1WF2A 3HHLB 5KFAA 3R1HA 4W4MA 2BJ3A 1I5OB 3CDWA 1RISA 4YB6A 2HEKA 4LF6J 1IJEB 3HHDA 3N28A 4YHHF 1FRKA 1NK5A 2M5YA 2JDJA 1N32F 3SSSA 4CLSA 5A8KB 2YWFA 1OY8A 1J5EJ 2AJ2A 2GVDB 3N01A 4U95A 2RU9A 4OJHA 4CH7A 4K4WA 3ISND 4K59A 3IRWP 2XHCA 2H4WB 3IS9B 2DH7A 1T0TV 2LMIA 4QIVA 2FLLA 3R5BA 1JNZB 5B0GA 3G6ES 4GKKF 2A0FB 3MWBA 1T05A 1TL3B 4KBIA 1HYSA 2JOQA 1CS4A 1D9DA 3T5LA 2V8DA 5H9EJ 1HNWF 1RYSA 4ZPWR 4C11A 5KFOA 2ZDOA 4C48A 3Q22A 1XMQJ 2FHKA 3CWJA 3RZAA 2E1CA 1FE4A 1HNIA 1WACA 4HR2A 5HQLA 1WWHA 4CI0B 4UQGA 5I3UA 2FJXA 3CT9A 2XTJP 5BYQA 4OZ0A 3CCLS 4YB7A 3M2RB 1BC6A 4OLPA 4A4JA 5C2GA 2XCAA 1KTQA 4BC9A 1X0FA 3M8WA 4NCBA 1X8DA 1TVRB 2RSQA 3HO1A 3OJUA 1PJ5A 1BE4A 1ITPA 2DIUA 4USVA 4N7TA 3TYTA 2LXFA 2KH9A 1FKAF 3W62A 3SV4A 3HDSA 1SIWB 2HIQA 3DLGA 2N7CA 1KOHA 2FLPA 4I67A 2Z58B 1NDCA 4Z37A 1JLGA 5J2PB 1FTCA 4QR2A 1YIJS 2D69A 1C1BB 4AXJA 2B4UA 2RE1A 4LRCA 4USWA 3K2YA 2ZHBA 5C2CA 4V19J 4AL5A 4MTPA 2NXJA 1SV5B 4RW6B 2VJVA 1DJ0A 2OFHX 2N82B 5FJ4A 5L1JA 3T5KA 2VF3A 3OSNA 4EZ6A 4TQRA 3FSYA 4F04B 2DHXA 2YKMA 2XSJA 2IBKA 2ZBPA 2HMIB 4PG6A 1P6TA 3PJXA 4H4KC 4UOHA 4DL7A 2Q3PA 3C14A 3GLJA 3NBPA 5E0OA 4C3MA 2RT3A 2YKAA 1REVB 1M5OC 4NXNF 3Q8VA 3UFCX 3M9OB 1U2CA 3TW0A 3ZZZA 4TU8A 3HXMA 4PEOA 1EHWA 1NU4A 2DK2A 1V3RA 2DNRA 4N77A 3VTIA 4YY3J 2EKNA 3BGUA 3BR8A 4LF9J 3SIPB 3CIZA 2YNIB 1JLAB 1PBAA 1B0TA 3LF0A 4C0OC 3NXZA 4F26A 4R5PB 3VZHA 3EGZA 1KDNA 4DN9A 4FNHA 2KFZA 4RPFA 5J2NA 3JQMA 5KFJA 4ZJOA 5FLXY 5T7LA 2E44A 1FKOA 2DPJA 1R8HA 1F1BB 2MZJA 2ZH7A 1VR6A 4YHHJ 2GVZB 5F8GA 2F4VJ 2EK6A 2L9NA 5M2RA 1L3VA 3GFZA 3K5PA 5LSLA 5A76A 5JMNA 2QT7A 4HLBA 1KKHA 1GX6A 5KFGA 2RQCA 1VQKS 1U8WA 1XMBA 2G0JA 3CD5A 4NLXA 4AXIA 1F2HA 2QMXA 3C2PA 1S6OA 1IKWB 2CVIA 2KXFA 2MQPA 2ZJRQ 2MQNA 3AXKA 2MKJA 2QIFA 1S76D 4K4ZA 4U8YA 1UWAA 2CG4A 1T94A 5DLGA 1AXQA 4PG4A 4JI1J 2PDAA 3HSJA 1NPKA 1KVIA 3I6PA 4TN2A 1X4DA 1S6PA 2B0GA 2BKOA 3MF5A 2GJ2A 2UVRA 2QSWA 1YG0A 4HHHA 5D4NA 4M5DA 5HMYA 4J7CA 2G1DA 1NDKA 3UR3C 2E5HA 1FFSB 1TKZB 2M70A 1OQ6A 4WIIA 1OYEA 1UL3A 2CJAA 3J7ZT 1W2IA 3FRZA 3OTEA 1ZBTA 2ZD1B 4DS4A 5DQGA 1C0UA 2BDPA 1FFWB 3L7OA 1RYRA 2CPXA 4K4VA 4H4KA 4HTIA 5H9FJ 4OYWA 3KDOA 3TQ1A 3M6VA 2J6SA 2MQQA 5E7OB 3UPFA 1N4LA 2DB1A 3EUNA 3RR7A 4GO7X 2HHWA 1UA0A 4JOUA 4CM0A 4WKYA 3S01A 3UN3A 3ZO7A 4CO5A 2KZZA 5A6PA 4OYIA 3I0RB 5CZXA 3GB0A 3ILJA 5GAEI 1Q5YA 4LF4F 3OFFA 2UVWA 1NBEB 3BKTA 1CULA 3A3OB 3MM8A 3PDNA 3IMQJ 5F8NA 4Q0BB 1YI2S 3EVWA 2H48B 2MQOA 1KLMB 4PG8A 3PM9A 4IG0B 2Z57B 3RBEA 1VQ8S 4FVMA 2YNFA 3KUEA 4H4OA 1IKXA 2VA3A 1VRUB 2AP6A 1WEZA 2NUUG 4IG3A 1TL7A 2F8HA 3BGRB 4R8UB 4NLRA 2WSEC 3P5TL 3E2EA 2WVBA 1DLOB 1Q8BA 3LO3A 3R9LA 5IXUA 2E7XA 5H1SV 4JV0A 4O0IA 2XY6A 1AFJA 1U24A 4ETZA 2RDIA 2OO4A 1XR7A 3IR7B 1CJTB 2Y9HA 5HVHA 2BJDA 4UZCA 2V4JA 2K1RB 3MHYA 1IUJA 1RAOA 3RB3A 3K89A 2V2KA 1BLUA 5DDPC 2C22A 2B5JA 4DV7F 2HK3A 4MK7A 4DV1F 1MN9A 2ZC3A 3D6FB 3B54A 3BGLA 4FDFA 2EBGA 1RU2A 4I56A 1NEEA 3HPOA 3ZFVA 1UFKA 4RUAA 3I56S 1Y10A 3KNAA 2DEJA 2IM0A 4FYYB 3PIOQ 3K5MA 5J2QB 4P2MA 3EX7B 4CO1A 5L1IA 1CVJA 4O44B 2HK2A 2MZQA 2NUHA 4DLEA 3OL9A 1NDLA 3HFZB 1HNZF 4IRKA 4ANEA 3E8OA 2LFVA 1KFDA 3BYRA 1N52B 1F3VA 5IT0A 1BUXA 2DNYA 2EFPA 2UUWA 4WTOB 1TUWA 4X62F 5ETKA 4K4XA 1GXTA 5DLFA 4CO4A 2GQCA 3EWGA 1PO6A 2C3UA 2O3DA 5C24B 1Q8KA 2LA4A 2HW3A 2RRAA 1B64A 4X64F 2X51A 2BQRA 4G1PA 4A8QA 3OXFA 1RWVB 5KOWA 2VG5A 2RQMA 5I3QA 4C8NA 2W8LA 3BBFA 4RNOA 2WAQD 3SXLA 3T6BA 3K57A 4CH1A 3QFHA 1M5SA 3EXCX 3JQKA 1URRA 4A8OA 1S1VB 4J9OA 4FS1A 1Y7PA 2DO4A 2A2CA 3LW5C 3CDEA 3DCAA 1ICEB 4DV6J 1TKZA 3H98A 4CLKA 3GMGA 3MGJA 1VYAA 3QIPA 4K4UA 1L3KA 2UXCF 3CO9A 3I5AA 4A8XA 5D4LA 5AE2A 4YR3A 2CWXA 3M4XA 2J5AA 4EO6A 1RTHB 2ADBA 5DETA 2E5IA 2RS8A 1WSRA 1X5TA 4H54A 1WI6A 1KHWA 1YKWA 2Q43A 4OZ1A 4DR3J 4F8RA 2M8HA 3G82B 2IPOB 2ATLA 3I9ZA 3EZ5A 4ECSA 4OV1A 2KB2A 2UUCJ 5DQHA 1Y5IB 2LU1A 3DLEA 2CPHA 4ZPBA 2PIIA 2VFUA 3I82A 4EEYA 3P49B 4C4WA 1RU1A 1FRMA 2LQ5A 4NE9C 2DIVA 3M6XA 4TU7A 3QGHA 1U1OA 5J1NA 5SZTA 1PAEX 3L09A 4OIXA 2WCXA 2V8GA 4Q8FA 4GKKJ 2DR8A 3EPIA 1RHUB 2CQIA 3M2UA 4A8MP 1RT5A 4CO3A 3W9IA 3DGPA 2AJ1A 1S1UA 4FP9A 4XAKA 1O5JA 4YB5A 3SDEA 1YITS 3FZ2A 1NMEB 2YNFB 2C3OA 1NK7A 3PW0A 3PY8A 4IG3B 3VZIA 2VFSA 1WHXA 1ELOA 4DV7J 1A9NB 4DPWA 2HHVA 3CGIA 4OX9J 1PG5B 4K2XA 1R27B 3CMES 4O4GB 3CIMA 4AL6A 2DNLA 3NGKA 2RIJA 1DTQA 4H4MB 4YUDA 1GNKA 4PG5A 3FMWA 3OFHA 3MR5A 5E33A 1V5IB 2EKYA 2FJDB 4NLOA 2MZSA 3NGRA 4KGMA 4GVBB 4JI3F 2DNGA 5B7WA 2RB7A 1KD1T 1WD6A 1X0PA 4R0JA 4BDPA 1XNRJ 1WEYA 3DM2B 5K5MA 2DGWA 1SKRA 6AT1B 4TQSA 1VBKA 4P2XA 3MCNA 4PYAA 3OL6A 1U6ZA 1SJ1A 2C3YA 4LF2A 4EI2A 5DDRC 1BY9A 3NCRA 3SFGA 3VQTA 4DUYJ 3UD3P 1QTMA 3CC2S 4CWBA 2Z2YB 3KDNA 3I31A 4LREA 5KFXA 3QQCD 3HVTA 1QVFR 1FX2A 4LIWA 5BXIA 4XPCA 3RUBL 3GE9A 2OTLS 2H51B 3UNGC 4CTAB 4E8UA 3FEXB 3T1AA 3EMTA 2DXDA 4GKJF 1YJRA 4HL9A 1ZZFA 3MMBB 3GIIA 1M5VC 2J9CA 4EGLA 4DN0A 4WFNQ 2UV8G 3QNWB 3G9CA 3K0JA 5J2NB 3VCDA 2LEBA 2BXJA 2H5JB 3AAWB 3HD1A 5K14B 4J9VA 4CQ1A 1SC3B 3MR3A 3KJVB 5I42A 5HROA 3HHLC 4YY3F 4IR1A 1XNQJ 1TKTA 4NMLA 4FYVB 4PCQA 4FF4A 2C2MB 3JTPA 3LANA 4JI7J 2QL5B 4USKA 3W7BA 1CC8A 1D8ZA 3PJ9A 5CQGA 5E5NA 3OJSA 3H5YA 2V9WA 1NSQA 5HMWA 2Y8WA 1VQ7S 2C3MA 3H5UA 1RT7B 1UWBB 3SBMA 2HQGA 4M5GA 5J2MA 2HURA 2HZAA 2OP5A 1RAFB 2VKRA 4P2FA 5ETLA 3LH2S 4DG1A 4EO8A 3OBIA 2G13A 4IO1A 3VQSA 1OSCA 1GXUA 6FDRA 4KJIA 2VOPA 2RHQB 2JVOA 1S1XA 3R6LB 1H2TZ 2RMLA 3KK2A 4TXSA 3CCTA 1HBUA 1X31C 2JVRA 5KT7A 5EN1A 1S49A 2F8MA 3KLHA 4KKOB 4I6YA 5B0AA 3NCPA 4FNIA 5HSPA 3RG6A 1N36J 4ECZA 3RR8A 1S10A 1PCAA 3UDEA 1HWKA 1RWMB 1FFGB 1GT8A 1K47A 1S7HA 2MGZA 3VHQA 1RAJA 2KHCA 3MM9A 3B8HA 5CABA 3X1LB 4F4AA 3I4PA 2UUBJ 3OL7A 4XDDA 1WTBA 4KTQA 1HYSB 2V0NA 1WKLA 4NXMF 4OYMA 3UCUP 3C66A 1FESA 1PIEA 2I0XA 1KQFB 2J7UA 4GMKA 3UQSA 5HP1A 1N32J 2F1FA 4CIOA 1ULRA 3LP0A 2HZVA 1D8YA 2D41A 1G1XA 1KQSR 3NLCA 2VV5A 5KG2A 3OUYA 3MXHP 1FRXA 2IRUA 4A8KA 2ERRA 1PAUB 3T1YF 2CQ0A 3BO2A 2JFKA 3D1QA 3R5DA 3W2VB 2AV5A 1MMNA 3TUZC 1VMBA 5KT6A 1WELA 4FF1A 4ZCMA 1Q7LB 1N6QB 3IR6B 2IA0A 4RJVA 4A8FA 2G2OA 3CE8A 4K4YA 2Y1JA 3M7VA 1FF2A 5KG1A 3D5MA 2IVYA 4Y2AA 4G3IA 1Y4ZB 3OVBA 4ELVA 3MR7A 1K1QA 2HNYB 4EBDA 3THVA 4LQ3A 2DO0A 1RT6B 3G71S 2HGMA 2ZH8A 1AW0A 1WSVA 4FKYA 3ZZYA 5KFQA 1VQ6S 1C1BA 2VU5A 3G87A 4G1QA 1U1MA 2HAFA 4O4GA 2DBBA 3AA9A 3M30B 2U1AA 3J7Z5 4NCAA 1VQYA 3ICLA 4K2JA 5DDQC 4DUYF 4NMXA 5I4MA 1B3TA 1IKXB 1N54B 1RLDA 2CUYA 2EG2A 5HVFA 2DGUA 4IKAA 3KFWX 1U1NA 3AJ1A 2RU3A 4ZHRA 4ZVPB 3UVJB 4PWDA 1VQ9S 3N4WA 1XMOJ 2A6MA 4ECUA 4QJVA 3R97A 1VQLS 1LW0B 1TUGB 1UFLA 2DYAA 3PW2A 2D3OR 3KOAA 2R8GA 4ERDA 1TMJA 3MPVA 4FKXA 3IXQA 3MEEB 4M5JA 4C3LA 3EZOA 1OMSA 2QL7B 3OTDA 4QPXA 2BKNA 2YQ3A 2ZM6F 2JC0A 1EKSA 2CJXB 4MMOA 5ETSA 2LP4A 3BGOP 5B0BA 5J1EB 1NLKL 3QO9A 4JI7F 1WOOA 2EC0A 1HQEA 5A2QY 3GFYA 4WF9Q 3P45B 1QD1A 2R42A 1RAIB 3SSRA 3DOLB 4B3OB 2AT1B 1H0HB 3MM6A 3N6NA 3S6EA 3NS5A 1FRLA 5I3UB 1NM2A 2C28A 2ZUAA 2R7XA 2B9WA 3LALA 4O44A 4FXWA 5F3ZA 5HROB 2YKPA 3V2UC 1K8AT 5KG7A 4NLGA 4OYZA 2J6UA 2CPDA 4ECYA 2VPYB 2ZEJA 2GIRA 3AQPA 3GYGA 3FQLA 2BV3A 2XI3A 3I32A 3UDCA 2DR6A 2QLXA 5CYMA 1S5ZA 1LWFB 2UUAF 4KPYA 1RHJB 2VOOA 4ES1A 3VR1A 1VOMA 2YNHB 1WG1A 2JX2A 2CJKA 1S1XB 2HQIA 3MEGA 1P27B 1UJ6A 1TKXA 1NSAA 2VG5B 4Q44A 2DNZA 2R7QA 1DTTB 2CJ9A 2B7BB 1Q8IA 2M0GB 4P2SA 4IRDA 1R8AA 4C9DA 5CYQA 5DS7A 1N5SA 3LGHA 2XCPA 2R7WA 1Q0NA 2QMUB 2R9LA 4Q45A 1UZHA 3M8PB 3AD7C 1GK8A 1HD0A 3T19A 3VAHA 4QYZK 2DITA 2HRTA 1HPZB 3OR1A 5CHCB 4CLTA 2YQ0A 3RYLA 2HMIA 4JV5F 2PSZA 2VFTA 1U0HA 3DDKA 2R3VA 1GTHA 4OJ3A 3UDLA 3MDFA 4DU7A 2VQFJ 4LR8A 3ENWA 2ALZA 2FDNA 3LP0B 2ZH5A 2HQDA 2QA2A 4ZIVA 1FXLA 1SKSA 4DZ6A 1T02A 3QT8A 5DZ6A 2NS1B 2EFOA 3IC1A 3VV2B 4F67A 1IWGA 2ZE2A 1S9GA 5C7PA 3J81Y 1TK0A 3DLHA 3MTKA 4PABA 2VUGA 4L73A 1NO8A 2AX1A 4RUCA 2AHOB 1J5OA 2YKNB 3E01A 3DDNA 3JYTA 2AEMA 2DVIA 3KUGA 2Z30B 3D67A 1U4BA 1KR4A 2ZVIA 3N9UC 3KWMA 4NYZA 4WFYA 5HATA 1N6QA 1FX4A 2CJYB 2A3JA 3CTRA 3L4BC 1JJ2R 4E2FB 2W9CA 2B8QA 2DRBA 1P9QC 4ZJQA 1WKJA 2O66A 5CD4A 3I0RA 1X7VA 2KT5A 2I2YA 3LQVA 3MD3A 3C6UA 4CLLA 3ZXWA 1VC0A 2DD8S 2NQPA 2DGOA 2BUNA 4MT1A 1GX5A 3WC0A 2B9EA 2K8GA 2GQ2A 3F56A 1SVDA 2KYXA 3HLUA 4RW4B 1WUUA 2K3KA 1TKDA 2R8JA 3J7A1 1FVSA 2JLEA 3FBCA 1OY9A 2MSTA 3UD4P 1FXRA 2POKA 1HNVB 2W01A 1SJ3P 2CZVC 1TV6A 2HWTA 2BQ3A 2RVJA 4RW9A 2HPUA 5EDWA 3GIJA 3M32B 2EK1A 3GR0A 3PR4A 2WTFA 3DXSX 1F9EB 3PJWA 1EIYB 4B9VA 4KQZA 1OWXA 2VKZG 3M05A 4ECRA 1GAOA 2YNGB 3PW5A 4JYAJ 3AHPA 1RHKB 4O3SA 1HA1A 1HQUA 4ED7A 2W25A 2V5HG 2EW9A 2YWKA 3D0IE 4QIWD 4QWCA 1NJWA 1X4EA 1LW2A 3MM5B 3HSDA 4ZVSB 5A0YA 5AJ3J 2EFVA 3FJ2A 4KSEB 1AUDA 3AJDA 4LRBA 4M5NA 4ZDNA 3D7SB 2MSSA 1XBWA 3BR9A 1AT1B 1RADB 1YRTA 2B5JB 1HQEB 3PRBA 4R0EA 2MDAA 3DGVA 2VJUA 3K7RA 2M9KA 2CZ9A 3Q8UA 5KTQA 2KM8B 3F44A 3V6DA 1AFIA 2YX1A 2ZOFA 1C0UB 1VHFA 1S4FA 2CQ4A 2L3MA 5KG5A 2L41A 2KRBA 2PI5A 2WVFA 4OQJA 2BYCA 2GGPB 2OGUA 1FKPB 3D28A 4DEZA 3I87A 2E5LF 4K8RA 3FEZA 3MMBA 1HLWA 4WXWA 4PQUB 1S48A 2AZ3A 3KLIA 1FJ7A 3BJYA 5EX0A 1OY6A 1D0EA 1TK5A 3DU5A 4CRJA 3FCWA 1ZETA 4I2QB 4RU9A 1CQNA 1T03B 1ZM3A 5F8HA 3G96A 4IRCA 2QFIA 4USUA 1XWLA 3CCES 3VAGA 2GHWA 3MM8B 4FS2A 2BRKA 2B56A 2VPZB 2GQQA 2XZWA 4NLTA 3TEGA 3FFIB 5J2MB 3EGVA 2J76E 3JXOA 3QBCA 5CYQB 4DPYA 5GAHU 1KTVA 2BMBA 3SZ2A 4OX8A 4N8NA 2F5GA 2QLBB 3ZZ0A 2HVDA 4AT1B 1SJQA 4J9LA 4IFYB 3GIMA 3V6HA 2VD3A 1KEKA 2R7UA 4P52A 1DLOA 1S99A 3BDPA 1KWMA 3K5NA 1P1LA 2E7WA 2F8EX 1H7WA 1RT1B 3C15B 3I9V9 1W26A 2KTQA 1WJ9A 1UPMB 2MGZB 5KFWA 1WDDA 3NAIA 3O3LA 4DPXA 2I5JB 1H72C 1AZSB 1GEHA 3FC9A 4JV2A 2DISA 5C5JA 2W2MP 4Q2LA 3AQOA 1TL1B 4USTA 2VBZA 2E9ZA 4RNFA 1SIZA 5D3GB 1OPIA 2G0IA 4XPEA 5HL7Q 3OHBA 5M2PA 1U6BA 3LWMA 2Z4PA 4RLEA 5KFYA 1PILA 3PACA 3KHGA 4AUKA 3DLGB 4CH0S 1Y0HA 4LR9A 2ZH2A 1IBMJ 2CJBA 2K3IA 2KVQE 4JYAF 4FYWB 3ZC4A 3AB4B 1P1TA 2FGOA 4K7QA 2VDIA 3M2UB 2XSFA 5HI7A 3JAMU 4ED6A 4DR3F 1N34J 3M2VA 3IN5A 5HLFB 5D8HB 3B6BA 1YBAA 2OPSA 2X3DA 4MFBA 3QGGA 1SJFA 3U1NA 2BOPA 1BQNB 1RBOB 2CQBA 2YKMB 2YQ1A 3MCOA 4ZVEA 4LFCF 4JI0F 1HBNA 1FE0A 1VC6A 2O1PA 4K4SA 3BBBA 4NLSA 4F36A 2V94A 4LSZB 4LF5F 2GX8A 2KJVA 3QFWA 2J0XA 1DTQB 1VBXA 1O8BA 5ETVA 5AXNA 4OI2A 3V6JA 1RGVA 3DHXA 1NXIA 2GNKA 3WQPA 2JJ4D 4U7CA 3OTOJ 1UVKA 1S1TB 1FT8A 5RUBA 3VGTA 3D6TB 2J9DE 2CWKA 3HSZA 2DY9A 4DQSA 3PZPA 1Z2LA 2CNLB 2DNOA 1URNA 5AE3A 4QR1A 1UAWA 5MLCV 4UY8T 2KU7A 3M8RA 2XMKA 3V6DB 1RWOB 1XR5A 2XMMA 1TTHB 2QLJB 5D0EA 4DL3A 1BWEA 2CPEA 4MIAA 2ZJPQ 4X4OA 2WHOA 3QO9B 5K8OA 2VC0A 1VQOS 2ZZNA 3NMAA 5GAHI 3DNCA 2XEXA 1SL1A 4DOZA 3DRPB 5E3AA 3PFOA 3G82A 3UN5A 1NJIT 1XR6A 1GH8A 3MR2A 2QYGA 1OQ3A 4DI6A 1H6KX 2W1BA 3D66A 4LSNB 4I2PB 3LP2A 1DZ5A 2HBYB 3LTOA 4LFAJ 5I42B 3W5YA 2ZM6J 4DL4A 2K2PA 2W9BA 1LKZA 2LA6A 2PFDA 2L9DA 4DR7J 2A2DA 4USHA 1FDNA 5HAOA 5L1KA 3T9ZA 4TLRA 5F9LA 3G8TA 3BKUA 3DRSA 3QJJA 3TUIC 4NZ7A 2W2PP 1Q78A 3NEKA 1MWZA 3DGPB 3H7HB 5F8LA 2HBQB 2OHDA 3G6XA 3M1VA 2ZITA 3J81U 3AD8C 4ELTA 1RA6A 2YVSA 2E1PA 3O6QA 3R1LA 3A8IA 5LMUJ 3QT6A 4LF8F 3TZXA 2O67A 3UR0A 2LVWA 3W9JA 1HWLA 4Z2XA 3QMQA 2HHHF 5A8KA 5EWGA 1PJ7A 1RT3B 2KVIA 5IM0A 4WFBQ 2OPQA 3B82A 4P74A 1H73A 3TAMB 1NH8A 1E6VB 3L3CA 2R8KA 4LF7F 3MZIA 3RB4A 2D7SA 5HQ8A 5AXLA 2IA6A 1FWPA 2CPJA 2R7OA 5KFFA 4LJMA 4QYZJ 2JLGA 1TL3A 4U96A 3KLVA 5LT5A 4DL6A 1R7IA 3A12A 3H5SA 1EKRA 3D1HA 1RAAB 1N5VA 5K9FA 3VF0B 5B09A 3T5HA 3PW7A 1BXNA 2RQKA 3J7YU 4LF6F 1NSPA 2J7WA 3CJTA 4HACA 4QQBA 2R2TA 3NWRA 3KK3A 1J5EF 4WJBA 2RAQA 2C3PA 2ZNYA 1JK9B 3MOZA 3MM7A 1BQMA 3BN4A 2R8HA 2AQ4A 1EETA 1SPBP 4ED2A 4M5MA 1L3SA 2HLUA 2R2UA 1HARA 2RDDA 1CG2A 4NPOA 3RU0A 4XO0A 4ES2A 3D6MB 4AD6A 4NXMJ 1RWWB 1X5SA 3EVMA 1Y3KA 4NLPA 4CYUA 1VRTB 2BQUA 3M2VB 4IQMA 3TUJC 2A6OA 3R2CJ 1JJHA 2BE9B 4B3SJ 1ZZNA 2CQGA 2V63A 2O01C 3HULA 3EGNA 4N8OA 2QA1A 4CLZA 3KLGA 1RAGB 4XDCA 2N3LA 3QGPA 2DHHA 3IBWA 3WHIA 1IQTA 1U45A 2GA7A 4DV1J 3Q89A 2QO3A 3AH6A 2APOA 4CNYA 4PPDA 3LGNA 4DUZJ 4XIUA 2UXDF 2LCWA 3F73A 3LP1A 1UVLA 2JLFA 1UW9A 5IQ6A 3H25A 5E3CA 3R5CA 4YB1P 3R7BB 1IM6A 3BPDA 3BZQA 2W8KA 4DX6A 4JP8A 3EXYA 1MROB 3BGFA 2P9CA 3RAQA 5M2UA 3QPIA 2IM3A 3M8ZA 1QAIA 1N88A 3KJQB 4QIFA 2F9JA 2B8PA 1W25A 3ENAA 3DRRA 1EAYC 3SQOP 1JXEA 4X62J 3J81j 4DSEA 4S0MA 3N0VA 4TY8A 3N6LA 3BS9A 2COLA 3MAAA 4ZCIA 5C25A 4Y2CA 1NPRA 2IC3A 4QW8A 1QDUB 3E3XA 2ABYA 1G7CB 1R3NA 4X4SA 1UVJA 5I3PA 1O51A 4X4RA 4ILRA 5LL6d 2GAGC 3GV8B 4OI4A 2GJFA 4DV5J 4B9LA 4WZMA 4Z7CA 2DGXA 4O23A 2YPYA 2EFGA 3CDUA 2P2CB 5FDLB 2QA4S 2AU0A 1N5QA 4AE5A 2N3OA 2JZ5A 4I2PA 1S6UA 1UMJA 3OR2B 4ANCA 3A8KA 5LMUF 1DQ9A 2OUGA 1KVKA 5C24A 1JWWA 3IGVA 3CJQA 2ZKTA 3Q83A 2GVZA 1V6HA 2GGPA 2E7VA 4DMZA 2ROPA 2HHHJ 2V2VA 4C8ZA 3AD9C 4OFZA 1NAQA 2BE2A 3KK1B 1NRKA 5IT4A 2KZMA 2M88A 3KLIB 4ZCLA 4X4QA 2NXEA 2MQLA 1YJWS 1DY3A 5ETOA 4X4UA 4FBTA 2OD6A 2NPIA 2HNYA 4DR4F 2CPYA 2Y0BB 3ENQA 4PAAA 1NK9A 3GG1A 2ASDA 3GFXA 3O44A 1XERA 2UUTA 1DTTA 4HEA9 3TX0A 5A8RB 2Q66A 4DV0F 4JI8J 4F02A 3TAMA 1JKHA 4NCGA 4ZLNA 1MU2B 5GADU 4TU9A 1IM4A 2V67A 4WXOA 3RB6A 4LMZA 5L1LA 1EP4A 3RRHA 4J9SA 1S72S 4LFCJ 4OHZA 4ZHRB 3UVJA 5A2QU 2D9PA 1NHKL 1ZTTA 1TP7A 4EU0A 3KLFA 3BN7A 2WW8A 4ECXA 4OLOA 5D4OA 3KYLA 4L76A 3EE3A 4OHYA 3KK3B 4B3SF 1L3TA 2WVDA 2AYBA 1UVMA 2XB2D 2BJ1A 1X60A 1AZSA 3AODA 3BSNA 1T11A 3GJQB 5KT5A 4ZPAA 1JXLA 2CQCA 3FMBA 5IWAJ 2XULA 3J80Y 3H40A 2YX4A 5LMNF 2LQBA 2FZCB 1R31A 4CYUB 3ZTOA 2GIFA 1F3FA 4F50A 3IAM9 3HVAA 4EWTA 2NZCA 3EJMA 3FQKA 3KHLA 3QSYB 4WE1B 4WYWA 1QAYA 2UXBF 3JB9k 2OAUA 4HHJA 4ED5A 2XZDB 2DXEA 2MKHA 3A4TA 3BQ2A 2B43A 5KFPA 1SH3A 1HBOA 4ED1A 1QSLA 2MZTA 1V3ZA 3H2LA 2K7KA 3ZTPA 2PO4A 1U7LA 4ZIWA 2F3JA 2XO7A 1FTRA 4URQU 4FXVA 1DQAA 4LSLB 2WOMA 1KOOA 1V9OA 2UP1A 3PYGA 1WC6A 2IVMA 3VGUA 3M32A 4DX7A 3BGRA 2BJEA 3LOUA 2D3UA 3MEKA 1IBMF 4U8VA 5ETPA 2DPIA 4G1IA 4LF4J 4IO9Q 3ILOA 1ROFA 4ZP8A 2DTJA 3BB5A 3V81B 3QIDA 3V4IA 1VDHA 1ZPWX 1Q81T 1IKVB 1FJGF 4V19X 3H20A 4PWWA 1VFJA 2IFXA 2W2QP 1Z1ZA 1U25A 2JNJA 3IS9A 3LUYA 4XK8C 2CQPA 3QZ7A 2XY7A 2PD1A 2HFSA 1FWKA 3JSYA 2JC1A 3I4HX 2QSFA 3OR1B 4J9UE 4JI4F 5CXTA 2VONA 5HANA 2PN6A 2CDRB 3IO1A 4ECQA 1R8PA 2ZOGA 1FD8A 1JJCB 3IRXA 2VA2A 4IUFA 4QCLA 2FJAB 3VVUA 2GS8A 2HRUA 1JXVA 4CNZA 1WC5A 4WP9A 4ILMA 4FPRA 2NXCA 1S57A 1AROP 1NK4A 1HIYA 3Q8SB 1S9GB 4QPTA 3S8SA 1F5BA 3TVYA 1HQ2A 1RWKB 3ZTSA 1J5OB 1TL4A 4OJGA 5CYJA 4ATNA 4GO5X 4P9SA 4DJBA 3K59A 2GIQA 4DV0J 2GO9A 1FDDA 2CQDA 4DQQA 3PCOB 4UW2A 4Y0FA 1S1WB 4KFBB 2AYGA 4IOAQ 4LSNA 4HH0A 4URSA 2PEBA 3I96A 4I7FB 4KHPF 1F5AA 3ZTRA 2W9BB 2Q1LA 3C6TB 2RKIA 3KK2B 3KMQA 2Q6BA 1QUVA 1M5PC 3RAMA 1RTZA 4Y6IA 3KLHB 1KRPA 2XMVA 2E5LJ 4YMEA 3HSGA 5D0HA 1IBCB 2R7TA 4IOCQ 2YKOA 4K5SA 4M63A 4OZLA 3MTJA 2ACYA 1JKHB 4WU3A 5DJBA 4ZVRB 3EYZA 3PV8A 2DR5A 1UVNA 1S12A 2FC9A 2KO1A 2BANA 2AZ1A 4LFAF 2V8HA 1QM9A 4A8YA 3CJSA 2W7AA 2ZHOA 5A8WA 3JSRA 5GMEA 2B4VA 3C14B 2AD9A 4EFAC 1QUPA 3I0SA 1HHTP 2QEXS 5HP1B 2VPXB 4JI5J 2HHUA 2J9EA 2NXNA 2BM0A 5HJYA 1QTNB 2B6AA 2OMLA 2W2NP 4Q5VA 1Q8LA 4Q43A 3CCQS 1GMWD 2HHTA 4DZDA 2VC1A 2I5JA 2Y1LB 5ETNA 1FXDA 2CZ4A 4MK9A 4P7VA 1U1QA 2ZWOA 4CO0A 2JWNA 2I9SA 1B4SA 5D3GA 4LQ9A 4QBUA 4F2RA 1NH7A 2C2OB 4J91A 3W2WB 4DL5A 1JLQA 3WZ0A 2P5VA 4YR2A 3PVXA 4DX5A 4R5PA 1CSJA 3ET6B 2N4DA 5DM7Q 4J9PA 1CJUA 4NLQA 3CEDA 2RF2B 1WOSA 1P9YA 2HS3A 4HT7A 1D1UA 2JEFA 2ZZTA 4DS5A 1Z2ZA 4RW7B 2MLZA 2MLYA 3CC4S 2CQ3A 5GVQA 3NNAA 4NA2A 1Y5LB 2OPPA 3GG0A 1JB0C 1RT5B 3T6JA 2MKSA 4ZK7M 2GC8A 2P8IA 4DPTA 2BJ9A 3PX0A 4OYBA 2MKIA 3CC7S 5KFZA 1JLFB 5IT9U 5KFRA 2HHXA 4YOEA 3FKBA 2GHPA 4G65A 1DHMA 1T3NA 4CLPA 2ZHAA 4DV3F 2GFFA 2MHEA 5E3QA 6FD1A 2BACA 5KFBA 2PMZD 1LNQA 1YGYA 3M8QB 1KQKA 5KG4A 3V5RA 1RTDA 3MFHA 4CT9A 2SXLA 4W92B 3M8SA 3TZYA 3ILIA 2GHVC 4OJ1A 1S97A 1S9FA 1H98A 1KN6A 2FGCA 1RKIA 2P6TA 2QX0A 4MYUA 1Y5NB 5CZVA 4I0WA 1WEXA 4ZPCA 2C2EA 2FHJA 1S0MA 4RW8A 5J1EA 4DR5F 4DSJA 4RX6A 2CNNB 2H9ZA 3D4JA 1T9XA 3CW2C 1YWXA 3CD0A 3GWCA 1VRQC 1JLBB 1VQ4S 2HVEA 2YPZA 3H59A 2DJWA 3NOCA 3PNIA 4JI6F 1U49A 5C25B 3I55S 4F3QA 3TZZA 4U6PA 1C1CB 5C42B 4OI1A 1P8GA 2V4RA 2GMLA 4A8SA 4CLUA 3UCGA 2UXCJ 3FSXA 4B3TF 2FHJD 3T3FA 4NEZA 4C11B 5HBMB 1HI1A 3I5BA 4YR0A 3QRQA 3AFGA 3HVWA 2CDQA 2KDOA 4DV2J 2FLNA 2B51A 3ITHA 4ZP9A 2LEAA 4MKYA 3BREA 1M1HA 4X4NA 3LP2B 2B4PA 4NLYA 2AGOA 5T14A 1HWUA 4I7FA 3CCMS 2RDJA 1TKTB 3HZGA 3GIRA 2V4QA 1APSA 1FRHA 4DFJA 4LF1A 2FYXA 2B4OA 1HMVA 1FDAA 1SQGA 1TVRA 3IM8A 3PHTA 3U1LA 1N0UA 4ED3A 3DMJA 4F3OA 2GVDA 2OELA 2OEJA 2YWGA 5BR8F 4IYQA 5LSOA 3GV7B 3AOCA 4IG0A 3W9HA 2R8IA 1YBUA 1OJ4A 2H65B 3G2XA 3FCHA 4H4OB 1UJ5A 4F0MA 1T3OA 4C0HA 2BANB 4WFZA 2FJEB 3CCVS 3P6YC 2LKZA 4LFBJ 1X9MA 2AGPA 4ED4A 2ASLA 2BM1A 3MECB 5IS2A 1EARA 1HNXF 1U1RA 2FPHX 3DYAA 3D68A 2H5IB 2HRYA 4ZP7A 4QU7A 2DNKA 2IDLA 3P8BB 1PYOB 2V4JB 3OLAA 4EYIB 4EBEA 1S1TA 1HNZJ 3HFKA 4NRUA 4UUWA 2XNRA 4ZVHA 2B7CB 1PC5A 3MAHA 4DCPB 3Q0AA 3ISNC 1VISA 5K8NA 4HT5A 2VG7A 3BO3A 3PX4A 4OI3A 2VICA 1JLQB 2WBMA 2XGPA 5JVGQ 1I6JA 2CNKB 5KAKA 4JI8F 1YRUA 4WCEQ 5DG9A 4ID5A 5J2QA 3H4DA 2AF6A 4PUOA 2JFDA 1XNQF 1FERA 3P96A 4YS2A 1IXKA 1WDTA 1JLAA 1YRXA 2QLWA 4Y2KA 4K0KJ 4Z7YA 1IJFB 5FD1A 4TLQA 4FF2A 1KP6A 1N33F 2W7PA 2M8DB 1MMDA 2NXUA 3GYXB 2J0WA 2GZOA 4WP3A 5AJ3F 4BC7A 4QWEA 1KHVA 4NZ6A 2LDIA 5L46A 2HBZB 1QY7A 4IDKB 5HN0A 2WONA 3DI6A 2V2QA 1C0TB 2KFNA 2UV8A 1NB2A 1HW9A 3PYDA 3J80U 4F2SA 4DR1F 3PO4A 1B0VA 1MW7A 4ZVGA 2HNZB 4I69A 4ZVQB 2KG0A 5D15A 2FB0A 3G8QA 4O0NA 5G0RA 4ENOA 4HDGA 3VAFA 2N4CA 1XK8A 2BJ8A 2L08A 4ID8A 1PSDA 1IKWA 2H1YA 3TJ9A 2UXBJ 1DAXA 1E6YA 3HCXA 5FIIA 3MMAB 2XY5A 3FRYA 2OI2A 2AGQA 2AJQA 2P6SA 1OPZA 2XBPA 1FHTA 2XMJA 4QZVB 3TJAA 5GMDA 4DU8A 3JSMB 1U02A 1T9YA 1N5TA 1YJ7A 5D77A 1ZA2B 3D0HE 3I5CA 4JV1A 2HSEB 1RP5A 2MJNA 2OPQB 1U48A 1NNDA 1HR0F 2FY8A 4U67Q 2OEMA 2PFFB 1K0TA 2NPFA 2KN4A 2X1GA 1K44A 4J9MA 1KS2A 4M8LA 3CDBA 1FNXH 5ETMA 3MPDA 4UQTA 2DCLA 1J2VA 1EJ7L 2G1HA 4YQWA 3U27A 1UA1A 4OX6A 4GVLA 4OHWA 1LEOA 3DLEB 4KRWA 1F5CA 3MM7B 5KFLA 4ER8A 2H3EB 5LXRA 4C3KA 3T1HJ 5F8JA 3G6YA 1Z4UA 3UN2A 4C97A 4QWDA 1SL2A 2F4VF 3DOKA 3JTOA 2AW0A 1Q79A 2HWIA 3UDVA 1NUEA 2VPWB 5E2QA 1FK9A 2AYEA 2ZBQA 3TA1A 2J0QD 3SSQA 1KSPA 4C7QA 4DV5F 1JJ4A 5CD4H 3RAXA 4O3PA 2OEKA 4O3QA 4JI2F 4A46A 4DR6F 3SDEB 3GJSB 4ICLA 1S6PB 3A1YG 1YQHA 1LWCB 1UEKA 1JLCA 3NAHA 2DGVA 4RBVA 4CZCA 4QW9A 4YDXA 4HI2A 4A48A 3SI8A 1IKYA 1NJYA 3HK2A 1TAQA 3D3BJ 3GONA 3TRGA 3NNHA 4IFYA 3T5JA 3MECA 3HP6A 3QJLA 3FGVA 1WC4A 3PHEA 4WFAQ 2DHGA 3CD7A 3FBBA 2HWHA 4CM2A 2PA3A 1M1KT 3DYAB 4NCGB 1VQ5S 1OYDA 2HFUA 2VG6A 4TY9A 3U02A 1HBMA 3TVKA 1CJVA 3VALA 4L3KA 2MTLA 1U1PA 2CADA 4TVAB 3EDQB 4DSIA 3EVOA 3HHKA 1RHRB 4HI1A 1R8BA 1FJCA 5B08A 2Q6CA 4KH0B 3CCUS 4GKJJ 5A0YB 3JS9A 1TMMA 1RZMA 5IV4A 3C16A 5ETTA 4DWIA 5F9NA 1U47A 3VAKA 2DHAA 1TFWA 3TAQA 5LSRA 3F41A 3L7UA 3H0PA 2LU2A 2HBRB 4FBUA 2ZDPA 3J7YI 4UOGA 2HHSA 3GJRB 2BE7D 2FHOB 3SQGB 4DR1J 3NS7B 1EZZB 3IG1B 1RHMB 1UPPA 1CULB 2HFNA 2PEHA 1DURA 4LBPA 3IBCB 4CTAA 1A6LA 3CXCR 2E1AA 2ZVSA 1NK6A 4Q0BA 1C4AA 4C98A 1VQSA 1KLMA 4FF3A 1VGYA 4A47A 5CA5A 4YEAA 5IC6B 5K20B 3QAUA 3TQEA 5L39A 1DFDA 3C6UB 4RW7A 4Y3CA 1C0TA 1HBOB 4DCJB 1N5YB 2IRXA 3CJ2A 3DKDA 3O8WA 5E41A 1PBUA 5GMKa 2JL9A 5LMNJ 4RW4A 2XWXA 4DR2F 3NS6A 3BDEA 1GMVA 1RE1B 3NWGA 4MKVA 3FEYB 5F3TA 1LK5A 1Q82T 4X66J 1RT7A 1UWBA 2AJ0A 5HMZA 2E1MC 2V6AA 2IVFB 4C8KA 1RDRA 2RH3A 3K58A 1WC1A 2KYZA 3W1YC 2HFZA 2Y1IA 1TUVA 4OHXA 2ZBIA 4NOHA 2DY1A 2ASYA 2WW4A 4IH5A 1QSYA 5KFCA 1NJZA 1RBAA 1CJKB 1SUQB 4EMDA 5ETQA 5F41A 4FPIA 3R7NB 5U47A 3TAPA 4J5OA 4XTTA 2BBEA 3UCZP 1M90T 2FVRA 1X4GA 2J8SA 3MI7X 3C8YA 3GP9A 4X64J 5LOQA 4TKTA 2BA9A 2XYHB 2KXHA 2YNIA 3FZBA 4OYXA 2ZWPA 1GTEA 1ACMB 5L9XA 2EWHA 3QWPA 2ZH9A 1H2UX 1PYTA 2F4FA 2HNDB 1MLAA 1X5PA 2W4CA 1FI4A 3BH6B 2ATCB 4M5LA 4QIGA 5L38A 1U2RA 1X4CA 3U7JA 5BYSA 1DBDA 2MY8A 3GFHA 5CCLA 2IM2A 3OSPA 3CJKB 1T8EA 1FJGJ 3GCWP 1UVIA 1QLNA 4OX7A 3HT3A 2Y8YA 3MCMA 2JH3A 4DXLA 4IOBA 2IDEA 3QGIA 1B99A 5DGAA 1WHVA 1RQ0A 3A8JA 3LA0A 4ZVUB 2FVQA 4DFMA 2HVHA 3A3PB 1N48A 1SQFA 4OZ2A 3JTNA 2XC9A 3TUPA 2I1RA 2OLWA 2BABA 2H54B 4DFPA 3H5XA 5GAEU 1S0OA 4X4PA 5IV3A 4ZJLA 1D3WA 1RLCL 4C8MA 3DLKA 5KFEA 2KKHA 2XO6A 1NKCA 3DXBA 2EFNA 4ICLB 2XQCA 1F9FA 1RBLA 1ZAWA 1RT2B 4AYBD 4C8LA 1FD2A 1AYEA 2YWHA 3O2IA 3UD5A 4F3MA 2R4FA 2G4BA 1TZ0A 3KG0A 1WI8A 2CRLA 1RTJB 3NMRA 2HYIB 3PRVA 2C2NA 2I38A 2XMAA 3R2DJ 2OIHA 2HLTA 8RUCA 1S1UB 2RRNA 4PPZA 3BBCA 4LFBF 3JQJA 3QIPB 1E6VA 2PI4A 4RNMA 2VG6B 3GYNA 2YKQA 4MJKA 3K17A 4PR6A 3DRXA 2FQQB 4ZPTR 1U1KA 4K5RA 1M1GA 2V50A 4NA1A 1ZTWA 2JEGA 3IA0A 1RSCA 3HKWA 3D9BA 4CO2A 4B17A 4NI2B 3ILLA 1SH2A
chains in the Genus database with same CATH topology
1SCJB 2W2PP 2Z2ZA 3CO0P 2W2NP 1R6VA 4NMXA 2W2QP 4OV6A 2XTJP 1SPBP 2Z2YB 2E1PA 4JP8A 4YN3B 2ZWOA 2W2MP 3A3OB 2ZWPA 3SQOP 2PMWA 3AFGA 1ITPA 3H42A 2QTWA 2Z57B 3QFHA 3P5BP 3VV2B 3CNQP 3GCWP 4NE9C 1V5IB 3VHQA 2Z58B 3A3NB 3BGOP 2Z56B 3BPSP 3T41A 3WHIA 3GCXP 3WIVA 3A3PB 2Z30B 2W2OP 4K8RA 3WIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SCJ B;  2W2P P;  2Z2Z A;  3CO0 P;  2W2N P;  1R6V A;  4NMX A;  2W2Q P;  4OV6 A;  2XTJ P;  1SPB P;  2Z2Y B;  2E1P A;  4JP8 A;  4YN3 B;  2ZWO A;  2W2M P;  3A3O B;  2ZWP A;  3SQO P;  2PMW A;  3AFG A;  1ITP A;  3H42 A;  2QTW A;  2Z57 B;  3QFH A;  3P5B P;  3VV2 B;  3CNQ P;  3GCW P;  4NE9 C;  1V5I B;  3VHQ A;  2Z58 B;  3A3N B;  3BGO P;  2Z56 B;  3BPS P;  3T41 A;  3WHI A;  3GCX P;  3WIV A;  3A3P B;  2Z30 B;  2W2O P;  4K8R A;  3WIU A; 
#chains in the Genus database with same CATH topology
 1LW0 A;  3PG9 A;  4C0B A;  3V4I B;  3TA0 A;  4Q7A A;  1HWI A;  4H4M A;  1XIQ A;  3SCL E;  1Q5V A;  3MED B;  2OH2 A;  4LBH A;  2CQ1 A;  4B3M J;  2EG1 A;  4U7U D;  1VHI A;  2EXU A;  2MMY A;  1RAE B;  4OHV A;  4F0H A;  1U0S A;  4GVB A;  4OYP A;  3IM9 A;  1ZPV A;  2VFV A;  1FA0 A;  4QIE A;  4RL1 A;  2XZT B;  1TL1 A;  3QAE A;  5BYR A;  5SUH A;  3THP A;  3IG1 A;  4O3R A;  1Q86 T;  4OI6 A;  3MAQ A;  2VG7 B;  2FJW A;  3S1T A;  3O1L A;  4C8O A;  1DAR A;  4RO0 A;  1LFP A;  3HKZ D;  4MIB A;  3DOL A;  4Y65 A;  4ZPV R;  2QTW A;  3POT A;  4DBQ A;  4X4T A;  3FK4 A;  3VGV A;  2Z2M A;  3D6H B;  1EQ0 A;  1UFW A;  2NYI A;  3CNQ P;  5B0E A;  1C4C A;  1PC4 A;  2RUS A;  2HAI A;  3RBZ A;  3QRR A;  1BGX T;  1PYS B;  3HVR A;  1HD1 A;  4MH8 A;  1N5Y A;  3WIV A;  4WZQ A;  4U7U K;  1HI8 A;  1RWX B;  2DGQ A;  1ZOT A;  4JB8 B;  2OPP B;  4AQY J;  1UZD A;  2RS2 A;  2EI5 A;  2ZH3 A;  3M6W A;  1UEV A;  5A6W A;  1KNZ A;  2QRR A;  4FN5 A;  2VBW A;  3HHL A;  3DFE A;  4IDK A;  4P73 A;  4X65 F;  3HJF A;  2CQH A;  1KVJ A;  2KL8 A;  4QOT A;  1MRO A;  2XNQ A;  1Q1K A;  4R8U A;  2ILZ A;  2BJ7 A;  3MEG B;  4QYR A;  3V6K A;  3TEH B;  4RBU A;  2VQF F;  3RBD A;  2C2K B;  3NL0 A;  2XM3 A;  1U1L A;  3OVA A;  5THW A;  3PKM A;  2V69 A;  3WC2 A;  1WNE A;  3BF4 A;  5B0C A;  4FYD A;  1RWP B;  4UT4 A;  1RHQ B;  2ZBC A;  2OPR A;  3HVT B;  2Z56 B;  3RJM B;  2XMW A;  1VLO A;  3HHL D;  1T05 B;  1VIO A;  4P71 A;  1WHW A;  5L8R C;  2IJN A;  1FEH A;  2GW8 A;  1M5K C;  3R5A A;  3RW7 A;  4ZN1 A;  3PW4 A;  2DGT A;  1SB6 A;  4KO0 B;  3ETM A;  2MB0 B;  5FDL A;  3RRK A;  2B9Y A;  1YJ9 S;  2V8V A;  1UTA A;  3OFE A;  3MM9 B;  3OTO F;  3BSC A;  5F0W A;  4Y28 C;  1SJR A;  4LRA A;  2YKN A;  3E01 B;  1REG X;  2Y3Y A;  3D2W A;  5DDO C;  3TI0 A;  2F63 A;  1OS5 A;  1S9E B;  1SC1 B;  1UCN A;  4UUX A;  3W2W A;  4F4X A;  1N36 F;  4B02 A;  3L95 X;  1U8S A;  5LM7 E;  3CSK A;  2WZ1 A;  4DG1 B;  3TX8 A;  5K8P A;  3OXG A;  1SQE A;  3HJV A;  1HL6 A;  2UUB F;  3R3T A;  4D3H A;  3Q8P B;  3BPS P;  1SBR A;  2HZC A;  2CIM A;  4BHQ A;  1CBK A;  2WBR A;  3QWU A;  1FK9 B;  2MKK A;  1VC5 A;  1IN0 A;  1HMV B;  4DF4 A;  1RKJ A;  1TK8 A;  1FO1 A;  4KV8 B;  4LVN P;  3UWT A;  4B3T J;  1MWY A;  2X1A A;  3IP0 A;  4L3N A;  3D3C J;  3G6V A;  4NXN J;  2M2B A;  4RWW A;  3R7S B;  3FDS A;  3G86 A;  2HS0 A;  1I51 B;  2LQJ A;  1TV6 B;  3PKY A;  1SL0 A;  1EP4 B;  3OD2 A;  4PG7 A;  5B0F A;  4YP3 A;  2KT2 A;  1K1S A;  3UO0 A;  3T1Y J;  2KFY A;  1U2F A;  4DQI A;  3M8Q A;  3BQ1 A;  1ZM2 A;  1LOU A;  1NZ8 A;  4LT6 A;  4DPO A;  1AA1 B;  1YJN S;  1VCT A;  1Q16 B;  1AUS L;  1HBM B;  1LW2 B;  2WVC A;  2HQC A;  1LWE A;  2KJW A;  2PC6 A;  3K8W A;  4KC5 A;  4CLW A;  2WRM A;  1RTH A;  2XGQ A;  3KLE A;  3DC2 A;  1NCL A;  5DRK A;  4EBC A;  2PGC A;  2XS2 A;  1T9V A;  4MK8 A;  3SCI E;  2FTR A;  2C2D A;  3WDO A;  4DPU A;  1Q7Y T;  4K50 A;  1WG5 A;  2L9W A;  1YJU A;  3C16 B;  1R0C B;  4KYZ A;  4TNO A;  4F25 A;  2ZH6 A;  2Z2Z A;  4DL2 A;  4OZ5 A;  1HNX J;  1RWN B;  1TQL A;  2BX6 A;  3GJT B;  4WP8 A;  1QJH A;  3POT B;  2NZ4 A;  2XYG B;  2H4Y B;  5D0R A;  1MG7 A;  3OT9 A;  2VB6 A;  4R25 A;  2NRE A;  4DR7 F;  3K8V A;  3LAM A;  1IBK J;  5T7L B;  4DV4 F;  1IBL F;  1NHV A;  2ALY B;  4RKU C;  5CAA A;  1XMO F;  5HMX A;  3KUH A;  4PKD B;  7FD1 A;  5HO4 A;  4F4Z A;  3Q24 A;  2IHR 1;  2IJF A;  3W60 A;  3FNN A;  3FBF A;  3UW1 A;  3HMJ G;  2CNO B;  5BR8 J;  3CCR S;  1QAJ A;  2CA9 A;  3KTQ A;  2LEC A;  4B3O A;  4B9T A;  3CPW R;  5KG0 A;  1YZ7 A;  2OSR A;  2V34 A;  4L74 A;  1IQZ A;  4ZLJ A;  5HJX A;  2QE5 A;  3GPA A;  1YLX A;  3R6G B;  2FJV A;  5JJB A;  1ZAX A;  4TYA A;  5EWE A;  4WK3 A;  2QZ8 A;  4IFV B;  2XS7 A;  3UNY A;  1CPZ A;  4EK2 A;  4HHU A;  2JSX A;  2Q79 A;  4KE5 A;  3W63 A;  1FRI A;  2XYP B;  5KFD A;  3V81 A;  2G2Z A;  4ALZ A;  2P9G A;  1HHQ A;  1NK0 A;  3QRP A;  4J9Q A;  3CMQ A;  3TWZ A;  1IR0 A;  1IVZ A;  3W8G A;  2FLO A;  2G0C A;  3HHE A;  4I68 A;  2AYM A;  3MPU B;  3FVY A;  3N5B A;  3MMA A;  1KQG B;  4KY3 A;  3U1M A;  3QJP A;  4ZN3 A;  3SYZ A;  3B78 A;  2WB1 D;  2XMU A;  1G3O A;  1VLY A;  1WG4 A;  2EC2 A;  2GMH A;  2I8E A;  2FIU A;  2W4P A;  3DRR B;  3PRD A;  4P75 A;  1T9T A;  4J90 A;  5EHH A;  3PXG a;  5E3R A;  3PFE A;  2UUA J;  2QJ3 A;  2J8A A;  2AIR B;  3MM6 B;  1S59 A;  3M8P A;  1NHU A;  1RAB B;  4HVZ A;  3ULH A;  4OMF G;  5D6G A;  4LF8 J;  3OQ2 A;  1N56 A;  1JMT A;  1GMW A;  2HIY A;  1PKU A;  4QR0 A;  4UOF A;  1QSS A;  4A8W A;  2X1F A;  1N33 J;  2KXN B;  4LRF A;  5ETR A;  1H74 A;  2ILY A;  2VZ9 A;  2G2Y A;  2HND A;  2XHW A;  4E98 A;  4CCH A;  1OIA A;  1VBY A;  2LXU A;  1HNI B;  4B3R J;  4ZVF A;  1V3S A;  3CUL A;  5CYM B;  1LWF A;  1BWV A;  1R43 A;  2AJ4 A;  1HW8 A;  1H3D A;  3IFE A;  4NLW A;  1U26 A;  3NGS A;  4ID5 B;  1TL5 A;  3M2R A;  5IOL A;  1BMQ B;  3QLH A;  3CB4 A;  3C6T A;  3JYT B;  2RKI B;  2XI2 A;  2M52 A;  4F4K A;  4AFF A;  4AND A;  2BE2 B;  3KK1 A;  2L48 A;  3GZ7 A;  4HH1 A;  5IFM A;  2O5D A;  4JUZ A;  4UZB A;  3QZ8 A;  1RT4 A;  1VI7 A;  2K06 A;  1G4C A;  2RQ4 A;  4DL0 C;  5KFM A;  2QN6 B;  3CMA S;  2DHS A;  1VQP S;  1R6Y A;  4RR5 A;  3M8Y A;  4USJ C;  2UU9 J;  3RTV A;  2VBY A;  4KPC A;  3HHN B;  3MPW A;  2RD5 C;  3OW2 R;  2CXE A;  2HKE A;  1JLG B;  3GSI A;  5J2P A;  4I6W A;  2ADC A;  1TL7 B;  2FUG 9;  2JHE A;  4W90 B;  1HBU B;  3PIP Q;  2WB4 A;  1IWA A;  4KKO A;  3DHW C;  1UW4 A;  2RIL A;  3I0S B;  4B9N A;  2FY1 A;  2ZH4 A;  2DRD A;  3PEH A;  4J9N A;  1B0P A;  3H90 A;  3L9Z A;  4M1K A;  5KFT A;  2YWE A;  1LWE B;  3AY0 A;  3B4D A;  2XSJ B;  4DV4 J;  2GCF A;  3IWN C;  2EFQ A;  3W65 A;  3DOM B;  2M4M A;  5KG6 A;  2CG8 A;  2YWW A;  3ZNU A;  1X4A A;  3BH7 B;  1PJ6 A;  2IMO A;  2BR0 A;  4P72 A;  3ONQ A;  1F6T A;  1REV A;  2PMW A;  2QMW A;  4Q2M A;  5IQQ A;  1WTF A;  2VQE F;  2R7R A;  4RNH A;  2NSB A;  3M9M B;  4DLG A;  2BKP A;  2C1E B;  3GTY X;  3MM5 A;  3AJ2 A;  3N79 A;  2W9C B;  2HVI A;  2VFR A;  3OUY B;  4ECW A;  1S79 A;  2UVU A;  2OFG X;  4KIA A;  1HWJ A;  2AX0 A;  4LVO P;  1NJX A;  4B9M A;  1JQG A;  1TEL A;  4WE1 A;  3CCJ S;  3QT7 A;  4RUH A;  2R2R A;  2B9X A;  3DRP A;  1K0V A;  1LK7 A;  4PXC A;  5ADZ A;  2JEI A;  4DR6 J;  1CEZ A;  2YBV A;  4ZVO B;  4NLV A;  5KG3 A;  3HM9 A;  1VJQ A;  2D1C A;  2DT9 A;  4OV6 A;  3TA2 A;  4DUT A;  3HF5 A;  2ZOM A;  3SV3 A;  4ED8 A;  2XS5 A;  4DHV A;  3AOA A;  2BW2 A;  3WX4 A;  1YZ6 A;  3HFV A;  4OZJ A;  2MZ1 A;  4YDD B;  1UKU A;  2W24 A;  3QAT A;  3LPY A;  2KT3 A;  2QL9 B;  2CQ2 A;  1WKK A;  2XG8 A;  5ITH A;  3TR5 A;  4ZOS A;  1HKA A;  3FSI A;  4LF7 J;  3TP2 A;  2J6T A;  2OTJ S;  3KMS A;  2YX7 A;  1TR0 A;  3LGM A;  3MFI A;  3M1V B;  5FLX U;  3BSA A;  3D54 A;  4I2Q A;  4P6Q A;  2MJU A;  1LWC A;  3H2V E;  1JLC B;  1VJW A;  2VL1 A;  4RW8 B;  1IKY B;  4C6A A;  2BZ2 A;  1QVG R;  1X4H A;  4F0K A;  3PR5 B;  1CJK A;  2XLJ A;  1SUQ A;  3NOG A;  1SCJ B;  3ZZR A;  4AQY F;  2A10 A;  4O3N A;  1XEZ A;  4USM A;  3TAR A;  1N8R T;  3KG4 A;  4RBT A;  1O0P A;  3B4M A;  4M94 A;  2PE8 A;  1F9H A;  4FXD A;  3H2U B;  3W61 A;  3MUR P;  4M5D B;  1WF0 A;  1VK8 A;  1RWU A;  2V9K A;  2ZNZ A;  4NL5 A;  4KO0 A;  3OL8 A;  3C15 A;  4ZP6 A;  3NNC A;  5AXK A;  2QFJ A;  3FUY A;  4Q8E A;  3CJK A;  2QYC A;  4NA3 A;  4HKQ A;  4LR7 A;  2VH7 A;  4O4R A;  5JVH Q;  3DU6 A;  2VBX A;  3GCX P;  4DQP A;  2HGL A;  1Y9O A;  3ZTQ A;  2OD4 A;  5KFS A;  3OVS A;  4N56 A;  3IBF B;  2ZKU A;  3QYY A;  4CDI A;  3BSO A;  1VRT A;  4KR0 B;  1RAC B;  3FFI A;  4TYB A;  3DLK B;  3GU0 A;  2IYI A;  3A8E A;  5KT2 A;  3CD6 S;  2EPI A;  2HFO A;  4V1A k;  2OMO A;  3HT0 A;  3T9N A;  2DH9 A;  5KFI A;  2DRA A;  5F8I A;  5E3P A;  3LPE A;  4CLF A;  5F8M A;  4J9R A;  2MPU A;  5IZH A;  4KV8 A;  1NSK L;  4KGZ B;  2ROG A;  3SEO A;  1DQ8 A;  4C2M A;  4OL8 A;  1FWL A;  4BWM A;  3QSI A;  2E9T A;  3LP1 B;  2R7S A;  1R0B G;  1HHS A;  2J9D A;  1RT1 A;  2OPS B;  4MFB B;  4RNN A;  2LQ8 A;  1H2V Z;  1IR2 A;  1BQX A;  5DO2 A;  5AE1 A;  1W2B R;  1L3U A;  4QWB A;  1BQN A;  4DFK A;  3F0N A;  1HPZ A;  4KT0 C;  4K0K F;  1SKU B;  1M0S A;  2D3Z A;  2E5G A;  2X3G A;  3BV8 A;  4M5H A;  4WFX A;  5D0G A;  4KGK A;  5A8W B;  1NB7 A;  1HI0 P;  4NI2 A;  4KAI A;  3TO8 A;  1S0N A;  4Y2M A;  4ZCK A;  2KRR A;  1S6Q B;  3BEG B;  4ECT A;  5KT3 A;  1VBZ A;  4G6V B;  2FHM A;  2E66 A;  2Y0S D;  4NZ0 A;  3WBZ A;  1RUS A;  4OYA A;  2MQM A;  2KG1 A;  1GQE A;  3CUN A;  1RI7 A;  3E51 A;  2IC3 B;  2ZE2 B;  3TJ8 A;  4ETX A;  4PUO B;  3GR1 A;  3Q23 A;  1JX4 A;  4JV5 J;  3NGD A;  2VHG A;  2F7V A;  4I64 A;  3KKF A;  2N7Y A;  4WK1 A;  4RUB A;  5K8M A;  1L5U A;  2A1B A;  4L75 A;  4UF4 A;  3K5O A;  3TZW A;  3R8Y A;  2HQF A;  4WTY A;  5HLF A;  4EUV A;  2R7V A;  2WSF C;  2VAS A;  1N0V C;  3MOJ B;  2P9E A;  4Y2I A;  5K14 A;  3KJV A;  4PWU A;  4DX8 H;  2WK4 A;  2U2F A;  1NPP A;  1SI9 A;  3NG8 A;  3GSD A;  3Q8R B;  2VOD A;  3RGI A;  3N6M A;  3PYF A;  3W66 A;  3Q86 A;  3EZU A;  1ZM9 A;  1X9S A;  1T95 A;  1HR0 J;  1SH0 A;  1R6V A;  2X7I A;  3S7R A;  1YJV A;  1JLF A;  3UI3 A;  3Q8Q B;  4URG A;  2XLK A;  3PX6 A;  1KC8 T;  3SCK E;  2CYY A;  1FVQ A;  2EBE A;  3BM7 A;  5KFK A;  1G2E A;  2QC3 A;  1WC0 A;  3ELH A;  3NBP B;  2J7K A;  2YNG A;  4JBC A;  3GQC A;  2FVC A;  2D3O 1;  3DRS B;  1H38 A;  4X4V A;  1HQU B;  1B70 B;  1Y00 A;  2E1R A;  4HTJ A;  5G4D A;  2IMW P;  4QWA A;  2QA4 G;  2QGF B;  1AB8 A;  3GV5 B;  3DDI A;  2GMJ A;  3ISZ A;  4CT8 A;  2WSC C;  3BQ0 A;  3EIC A;  3NY0 A;  1R0A B;  1SJ4 P;  2RHS B;  4X65 J;  5H9E K;  1W7W A;  1RA7 A;  3KXD A;  2KHD A;  1TFY A;  1D9F A;  2FD2 A;  2W4D A;  3KLF B;  1VQM S;  1XQI A;  3CJ8 A;  1M5H A;  1R89 A;  1A7G E;  2IYG A;  1FNM A;  2IIH A;  2V8P A;  2X1B A;  3NP5 A;  3CO0 P;  1NDP A;  3OFG A;  2MY7 A;  4JI2 J;  4J9K A;  3MED A;  1C1C A;  5C42 A;  3CJR A;  1F60 B;  1MML A;  3L7P A;  3LWL A;  2MYF A;  3WX8 A;  1JIH A;  2J0S D;  2MHN A;  3GIL A;  1KFS A;  3MMC A;  4F4Y A;  3OHA A;  2VDH A;  4MKB A;  5HBM A;  3CJ3 A;  4K4T A;  4J37 A;  5DGB A;  4DQR A;  1NK8 A;  1V5V A;  2BVZ A;  3AA8 A;  4DV6 F;  4GC7 A;  3VAI A;  4C8Y A;  1BQM B;  1C2P A;  5AXM A;  1SC6 A;  1S77 D;  1Y3J A;  1T03 A;  3NRB A;  4U9R A;  4WPA A;  4F4W A;  3MPY A;  2MKY A;  5KT4 A;  2BEF A;  2Z2L A;  5GAG I;  5HVG A;  3P4U B;  2GJI A;  3Q2S C;  5BJR A;  5KFH A;  4DSL A;  1UET A;  1JLE A;  4ED0 A;  4G1Q B;  1RT4 B;  2E5J A;  3CJ0 A;  1FDB A;  1RT3 A;  2IRY A;  5IM0 B;  1X9W A;  2AJF E;  3M30 A;  4LSL A;  2UUC F;  2WOM B;  4WKR A;  4B3R F;  1X5O A;  3JSB A;  2D9O A;  2G9O A;  5JUM A;  1BD6 A;  1WF1 A;  4RZR A;  2W9A A;  1LXJ A;  2BRL A;  1YTY A;  4BS2 A;  2ZZM A;  2D74 B;  2DGS A;  2IBO A;  2LLZ A;  3VAM A;  1FRJ A;  3A13 A;  4ZKA A;  3MUM P;  1R8C A;  3NGT A;  3PEJ A;  4UY8 5;  3VWS A;  1S6Q A;  3AXM A;  1B7F A;  4M5K A;  3R5G A;  4PXE A;  4M95 A;  4UTG A;  5EX3 A;  1OSD A;  3NGU A;  1T9U A;  4BCA A;  2DNN A;  4DDF A;  1O6X A;  2AKW B;  4ES3 A;  1I1G A;  2LDY A;  3IRX B;  5L9N A;  2IJR A;  1RJJ A;  3MR6 A;  4X66 F;  4DUZ F;  2UXD J;  4FVC A;  5IC4 B;  1S7I A;  2YH0 A;  4LF9 F;  1HFE L;  1UP1 A;  2DH8 A;  5LJ5 Y;  2DNM A;  5D78 A;  2NSC A;  2IY5 B;  4L6V 3;  5LJ3 Y;  4YN3 B;  4ILL A;  4W98 A;  3DLB A;  3C3L A;  2E9R X;  1GMU A;  3SCJ E;  1CQM A;  3ETO A;  3JAM Y;  3EDR B;  3BO4 A;  1K73 T;  2KM8 C;  4I1T A;  2ZC4 A;  8AT1 B;  1XNR F;  1S9E A;  2YTC A;  1RCX B;  2GV1 A;  3R5J B;  3US5 A;  2LEP A;  4LIR A;  1S1W A;  4KFB A;  3RBX A;  3MMJ A;  4N76 A;  2R2S A;  2XLI A;  7FDR A;  1F0X A;  2WON B;  2WVE A;  2DKO B;  3DI6 B;  4KHR A;  4PYD A;  3Q2T C;  1EB0 A;  2MEW A;  4YFU A;  4HDH A;  4IFV A;  1KLN A;  1HNW J;  4PXB A;  2HFV A;  2DNQ A;  2HNZ A;  1TKX B;  2BW7 A;  2C2Z B;  3MUT P;  3TAN A;  4KB7 A;  2MZR A;  2ZUG A;  3QT5 A;  1ZH5 A;  4RU2 A;  3Q8Y A;  4AL7 A;  1CJT A;  2MQ8 A;  4ECV A;  5EWF A;  3MAA B;  1XMQ F;  3W3S A;  2K1R A;  4MIW A;  5IT9 Y;  4ZPD A;  1E6Y B;  3IAS 9;  3AB2 B;  1LV5 A;  4B9S A;  3IWL A;  1D9A A;  1CS4 B;  4ZIT A;  1U0H B;  2CAJ A;  3CVK A;  3JSM A;  3MCS A;  3OTB A;  5GAG U;  4E0D A;  1MU2 A;  2OJ3 A;  2CPI A;  4DR4 J;  5AT1 B;  1IBL J;  5DG7 A;  3C19 A;  4USI A;  2Z8Q A;  2DXF A;  4PXD A;  1FCA A;  4WU2 A;  1T9W A;  3TVZ A;  2DEI A;  2GAH C;  4P7T A;  3BYP A;  4ITS A;  5HQM A;  5J1P A;  3WIU A;  2NLW A;  2ASJ A;  2MKC A;  3ZZP A;  4UOC A;  3VAJ A;  1I94 J;  1YSJ A;  5DQI A;  1VIX A;  2YY3 A;  4LUB A;  3CCZ A;  4OZ3 A;  2I6W A;  3FBE A;  4ZS6 A;  4N5S A;  2CVE A;  1ZYQ A;  4NYP A;  1CJU B;  4DV3 J;  1S0V A;  5DZ7 A;  3KJF B;  4KGV B;  2MXY A;  3W2V A;  4MAK A;  5A8R A;  3CCS S;  2VIH A;  2OKQ A;  1RTJ A;  5MAO A;  1S4E A;  1YVF A;  1X4B A;  4PZV A;  4WBF A;  4B3M F;  3O5T B;  2F9D A;  2LXI A;  1SV5 A;  4RW6 A;  3EGW B;  3NKY A;  1X4F A;  1WC3 A;  4GRS A;  1RXO B;  3HZE A;  3OXL A;  3W64 A;  5LXY A;  3A3N B;  4DR5 J;  4PQA A;  2KI2 A;  4M5I A;  4N41 A;  2PA8 D;  3ZNJ 1;  3KHR A;  4IR9 A;  1A0O B;  5IWA F;  1YHQ S;  5DM6 Q;  1RTD B;  5KFU A;  4Y00 A;  1MN7 A;  5EUH A;  4NYO A;  1Q95 G;  2ACM A;  2HG4 A;  1CJV B;  1CLF A;  5EGY A;  2UU9 F;  1RTI A;  5B0D A;  3OLB A;  3OTC A;  3W5X A;  1YK9 A;  2HHP A;  2QLF B;  1XTZ A;  3P3D A;  3PYE A;  5DG8 A;  1XC9 A;  4PWD B;  2NYH A;  1RK8 A;  3IWX A;  4HAC B;  2V68 A;  1QE1 B;  4DV2 F;  1IKV A;  1Q53 A;  3PTW A;  3GIK A;  3MEE A;  1WOP A;  2JEJ A;  9ATC B;  1EET B;  3P5B P;  1YX2 A;  2UZA A;  2CFX A;  2ZJQ Q;  2Z0G A;  4NLU A;  3M6U A;  3D0G E;  3SQG A;  1FKO B;  5KFV A;  3VVT A;  1WHY A;  4LBI A;  3SMZ A;  4DF8 A;  1F2G A;  1B7Y B;  4JI1 F;  2CPF A;  1Q4R A;  2HGN A;  5KFN A;  2IAJ B;  4QU6 A;  1GXL A;  2PT0 A;  4PQU A;  3N5F A;  2A18 A;  3ITH B;  4IH7 A;  1FJE B;  2FJB B;  4LRD A;  1VK3 A;  2HVZ A;  1GFW B;  3D1O A;  2FC8 A;  3FCV A;  3KLG B;  4DSK A;  4P10 A;  3RB0 A;  4JI4 J;  3QLH B;  1XJW B;  1RAH B;  2E29 A;  4RWX A;  3RW6 A;  3DLJ A;  1ZAV A;  1XN9 A;  2EVZ A;  2LYV A;  2CJQ A;  3ZZO A;  1Y11 A;  1NZA A;  1FEE A;  3DMJ B;  3VGS A;  8ATC B;  2EEY A;  3H42 A;  5D4P A;  1PGZ A;  5CCM A;  4HYK A;  2C2R A;  3NCQ A;  1S1V A;  3IR5 B;  3RRG A;  1RCO B;  2C42 A;  3G4S S;  2YNH A;  1WOR A;  3HD2 A;  2OPR B;  4NAS A;  3KG1 A;  3T41 A;  2RJZ A;  2W7O A;  3CJ4 A;  2BOA A;  3PO5 A;  2DNP A;  5GAD I;  1FNO A;  3CJ5 A;  1TU0 B;  2AWZ A;  1BHN A;  3IGN A;  3OPK A;  1I94 F;  3DN9 A;  2GO8 A;  2HQ3 A;  4DR2 J;  3H8Y A;  4TY8 B;  1JNR B;  2FZG B;  4CP5 A;  2ZD1 A;  1YJT A;  2YXL A;  3OV7 A;  1R0A A;  2ROE A;  2Y1R I;  3J7A N;  2QG9 B;  3SFU A;  5CH7 B;  2RNE A;  2UVV A;  3DOM A;  4IH6 A;  4KHP J;  4ZLP A;  1MSW D;  1UEU A;  5HK4 A;  1N34 F;  1KBR A;  4N47 A;  3TOQ A;  4ZMM A;  2DR7 A;  2CPZ A;  4WIQ A;  1MWQ A;  1NKB A;  4I6A A;  4B08 A;  3W8P A;  3X3U A;  1NKE A;  2IM1 A;  4DSF A;  4B9U A;  4KH1 B;  2QV6 A;  5JXS A;  3OR2 A;  2NCK L;  4JI0 J;  4MKA A;  3UE2 A;  3MMC B;  1EX8 A;  1SXL A;  4OX9 F;  4ZLL A;  2PMH A;  1D09 B;  3BKF A;  7AT1 B;  1K9M T;  4LF5 J;  1MNE A;  4JI5 F;  3CCW A;  2W2O P;  4MYT A;  5F0U A;  3C46 A;  4PRF A;  2XMT A;  4NRT A;  3HI9 A;  3ET6 A;  1YDL A;  1U09 A;  3DLL Q;  2F40 A;  4BBY A;  4NEY A;  2RF2 A;  2YH1 A;  1J27 A;  1I3O B;  1VRU A;  1RT2 A;  5KOX A;  4EZ9 A;  4JI3 J;  3THT A;  3ZZU A;  3M9N B;  1LXN A;  3G8S A;  3KJN B;  1HBN B;  2JRS A;  1SKW A;  1JLE B;  4X2B A;  4ELU A;  1YBT A;  3DRY A;  3MUV P;  2HS4 A;  2AEF A;  1VQN S;  1RB0 A;  5G0R B;  4Y34 A;  1HNV A;  2B6A B;  1SC4 B;  1DRZ A;  4BLG A;  2VQE J;  2FVS A;  1IBK F;  4RW9 B;  2K7J A;  1VS3 A;  1RTI B;  2XWY A;  3H4B A;  4IQX A;  2F65 A;  1TAU A;  4OYO A;  3KLE B;  4DCO B;  1IR1 A;  3CF5 Q;  4FZV A;  1UJ4 A;  4BWJ A;  3AT1 B;  3DM2 A;  1ZS6 A;  4WYL A;  3AOB A;  4O3O A;  3ZZT A;  2NR0 A;  1QE1 A;  4WWS A;  5T41 A;  2MLX A;  2ZFH A;  4ZA1 A;  3T1H F;  2HHQ A;  3W5Z A;  1LFW A;  2DNH A;  2AEJ A;  3TNV A;  4OI0 A;  3CDA A;  2FZK B;  4GC6 A;  2H5E A;  9RUB A;  4ZVT B;  2M3D A;  3LAK A;  1JLB A;  1ZM4 A;  2CKW A;  3R27 A;  4NWB A;  2RUG A;  3V4M A;  3KHH A;  2DR9 A;  1KON A;  4KHM A;  2IAJ A;  4OZN A;  4CLY A;  3EM1 A;  4D3G A;  3K5L A;  2FVP A;  4FYX B;  2AMC B;  1QAX A;  1EQM A;  1T7P A;  1RT6 A;  1H7X A;  2OSQ A;  4EYH B;  2V2Z A;  2ZH1 A;  3KNG A;  4F7V A;  3DOK B;  1OO0 B;  1G6B A;  1FKP A;  3ADA C;  3HX9 A;  3ENV A;  4KGX B;  4NX9 A;  1CC7 A;  2RRB A;  1LWX A;  2DCU B;  1LQ9 A;  1ZA1 B;  2ZBR A;  3MD1 A;  3EPG A;  4JI6 J;  5H9F K;  4L72 B;  2LQ9 A;  4X84 A;  1U6F A;  4NLD A;  2M7S A;  4I4B A;  2B3T B;  1WF2 A;  3HHL B;  5KFA A;  3R1H A;  4W4M A;  2BJ3 A;  1I5O B;  3CDW A;  1RIS A;  4YB6 A;  2HEK A;  4LF6 J;  1IJE B;  3HHD A;  3N28 A;  4YHH F;  1FRK A;  1NK5 A;  2M5Y A;  2JDJ A;  1N32 F;  3SSS A;  4CLS A;  5A8K B;  2YWF A;  1OY8 A;  1J5E J;  2AJ2 A;  2GVD B;  3N01 A;  4U95 A;  2RU9 A;  4OJH A;  4CH7 A;  4K4W A;  3ISN D;  4K59 A;  3IRW P;  2XHC A;  2H4W B;  3IS9 B;  2DH7 A;  1T0T V;  2LMI A;  4QIV A;  2FLL A;  3R5B A;  1JNZ B;  5B0G A;  3G6E S;  4GKK F;  2A0F B;  3MWB A;  1T05 A;  1TL3 B;  4KBI A;  1HYS A;  2JOQ A;  1CS4 A;  1D9D A;  3T5L A;  2V8D A;  5H9E J;  1HNW F;  1RYS A;  4ZPW R;  4C11 A;  5KFO A;  2ZDO A;  4C48 A;  3Q22 A;  1XMQ J;  2FHK A;  3CWJ A;  3RZA A;  2E1C A;  1FE4 A;  1HNI A;  1WAC A;  4HR2 A;  5HQL A;  1WWH A;  4CI0 B;  4UQG A;  5I3U A;  2FJX A;  3CT9 A;  2XTJ P;  5BYQ A;  4OZ0 A;  3CCL S;  4YB7 A;  3M2R B;  1BC6 A;  4OLP A;  4A4J A;  5C2G A;  2XCA A;  1KTQ A;  4BC9 A;  1X0F A;  3M8W A;  4NCB A;  1X8D A;  1TVR B;  2RSQ A;  3HO1 A;  3OJU A;  1PJ5 A;  1BE4 A;  1ITP A;  2DIU A;  4USV A;  4N7T A;  3TYT A;  2LXF A;  2KH9 A;  1FKA F;  3W62 A;  3SV4 A;  3HDS A;  1SIW B;  2HIQ A;  3DLG A;  2N7C A;  1KOH A;  2FLP A;  4I67 A;  2Z58 B;  1NDC A;  4Z37 A;  1JLG A;  5J2P B;  1FTC A;  4QR2 A;  1YIJ S;  2D69 A;  1C1B B;  4AXJ A;  2B4U A;  2RE1 A;  4LRC A;  4USW A;  3K2Y A;  2ZHB A;  5C2C A;  4V19 J;  4AL5 A;  4MTP A;  2NXJ A;  1SV5 B;  4RW6 B;  2VJV A;  1DJ0 A;  2OFH X;  2N82 B;  5FJ4 A;  5L1J A;  3T5K A;  2VF3 A;  3OSN A;  4EZ6 A;  4TQR A;  3FSY A;  4F04 B;  2DHX A;  2YKM A;  2XSJ A;  2IBK A;  2ZBP A;  2HMI B;  4PG6 A;  1P6T A;  3PJX A;  4H4K C;  4UOH A;  4DL7 A;  2Q3P A;  3C14 A;  3GLJ A;  3NBP A;  5E0O A;  4C3M A;  2RT3 A;  2YKA A;  1REV B;  1M5O C;  4NXN F;  3Q8V A;  3UFC X;  3M9O B;  1U2C A;  3TW0 A;  3ZZZ A;  4TU8 A;  3HXM A;  4PEO A;  1EHW A;  1NU4 A;  2DK2 A;  1V3R A;  2DNR A;  4N77 A;  3VTI A;  4YY3 J;  2EKN A;  3BGU A;  3BR8 A;  4LF9 J;  3SIP B;  3CIZ A;  2YNI B;  1JLA B;  1PBA A;  1B0T A;  3LF0 A;  4C0O C;  3NXZ A;  4F26 A;  4R5P B;  3VZH A;  3EGZ A;  1KDN A;  4DN9 A;  4FNH A;  2KFZ A;  4RPF A;  5J2N A;  3JQM A;  5KFJ A;  4ZJO A;  5FLX Y;  5T7L A;  2E44 A;  1FKO A;  2DPJ A;  1R8H A;  1F1B B;  2MZJ A;  2ZH7 A;  1VR6 A;  4YHH J;  2GVZ B;  5F8G A;  2F4V J;  2EK6 A;  2L9N A;  5M2R A;  1L3V A;  3GFZ A;  3K5P A;  5LSL A;  5A76 A;  5JMN A;  2QT7 A;  4HLB A;  1KKH A;  1GX6 A;  5KFG A;  2RQC A;  1VQK S;  1U8W A;  1XMB A;  2G0J A;  3CD5 A;  4NLX A;  4AXI A;  1F2H A;  2QMX A;  3C2P A;  1S6O A;  1IKW B;  2CVI A;  2KXF A;  2MQP A;  2ZJR Q;  2MQN A;  3AXK A;  2MKJ A;  2QIF A;  1S76 D;  4K4Z A;  4U8Y A;  1UWA A;  2CG4 A;  1T94 A;  5DLG A;  1AXQ A;  4PG4 A;  4JI1 J;  2PDA A;  3HSJ A;  1NPK A;  1KVI A;  3I6P A;  4TN2 A;  1X4D A;  1S6P A;  2B0G A;  2BKO A;  3MF5 A;  2GJ2 A;  2UVR A;  2QSW A;  1YG0 A;  4HHH A;  5D4N A;  4M5D A;  5HMY A;  4J7C A;  2G1D A;  1NDK A;  3UR3 C;  2E5H A;  1FFS B;  1TKZ B;  2M70 A;  1OQ6 A;  4WII A;  1OYE A;  1UL3 A;  2CJA A;  3J7Z T;  1W2I A;  3FRZ A;  3OTE A;  1ZBT A;  2ZD1 B;  4DS4 A;  5DQG A;  1C0U A;  2BDP A;  1FFW B;  3L7O A;  1RYR A;  2CPX A;  4K4V A;  4H4K A;  4HTI A;  5H9F J;  4OYW A;  3KDO A;  3TQ1 A;  3M6V A;  2J6S A;  2MQQ A;  5E7O B;  3UPF A;  1N4L A;  2DB1 A;  3EUN A;  3RR7 A;  4GO7 X;  2HHW A;  1UA0 A;  4JOU A;  4CM0 A;  4WKY A;  3S01 A;  3UN3 A;  3ZO7 A;  4CO5 A;  2KZZ A;  5A6P A;  4OYI A;  3I0R B;  5CZX A;  3GB0 A;  3ILJ A;  5GAE I;  1Q5Y A;  4LF4 F;  3OFF A;  2UVW A;  1NBE B;  3BKT A;  1CUL A;  3A3O B;  3MM8 A;  3PDN A;  3IMQ J;  5F8N A;  4Q0B B;  1YI2 S;  3EVW A;  2H48 B;  2MQO A;  1KLM B;  4PG8 A;  3PM9 A;  4IG0 B;  2Z57 B;  3RBE A;  1VQ8 S;  4FVM A;  2YNF A;  3KUE A;  4H4O A;  1IKX A;  2VA3 A;  1VRU B;  2AP6 A;  1WEZ A;  2NUU G;  4IG3 A;  1TL7 A;  2F8H A;  3BGR B;  4R8U B;  4NLR A;  2WSE C;  3P5T L;  3E2E A;  2WVB A;  1DLO B;  1Q8B A;  3LO3 A;  3R9L A;  5IXU A;  2E7X A;  5H1S V;  4JV0 A;  4O0I A;  2XY6 A;  1AFJ A;  1U24 A;  4ETZ A;  2RDI A;  2OO4 A;  1XR7 A;  3IR7 B;  1CJT B;  2Y9H A;  5HVH A;  2BJD A;  4UZC A;  2V4J A;  2K1R B;  3MHY A;  1IUJ A;  1RAO A;  3RB3 A;  3K89 A;  2V2K A;  1BLU A;  5DDP C;  2C22 A;  2B5J A;  4DV7 F;  2HK3 A;  4MK7 A;  4DV1 F;  1MN9 A;  2ZC3 A;  3D6F B;  3B54 A;  3BGL A;  4FDF A;  2EBG A;  1RU2 A;  4I56 A;  1NEE A;  3HPO A;  3ZFV A;  1UFK A;  4RUA A;  3I56 S;  1Y10 A;  3KNA A;  2DEJ A;  2IM0 A;  4FYY B;  3PIO Q;  3K5M A;  5J2Q B;  4P2M A;  3EX7 B;  4CO1 A;  5L1I A;  1CVJ A;  4O44 B;  2HK2 A;  2MZQ A;  2NUH A;  4DLE A;  3OL9 A;  1NDL A;  3HFZ B;  1HNZ F;  4IRK A;  4ANE A;  3E8O A;  2LFV A;  1KFD A;  3BYR A;  1N52 B;  1F3V A;  5IT0 A;  1BUX A;  2DNY A;  2EFP A;  2UUW A;  4WTO B;  1TUW A;  4X62 F;  5ETK A;  4K4X A;  1GXT A;  5DLF A;  4CO4 A;  2GQC A;  3EWG A;  1PO6 A;  2C3U A;  2O3D A;  5C24 B;  1Q8K A;  2LA4 A;  2HW3 A;  2RRA A;  1B64 A;  4X64 F;  2X51 A;  2BQR A;  4G1P A;  4A8Q A;  3OXF A;  1RWV B;  5KOW A;  2VG5 A;  2RQM A;  5I3Q A;  4C8N A;  2W8L A;  3BBF A;  4RNO A;  2WAQ D;  3SXL A;  3T6B A;  3K57 A;  4CH1 A;  3QFH A;  1M5S A;  3EXC X;  3JQK A;  1URR A;  4A8O A;  1S1V B;  4J9O A;  4FS1 A;  1Y7P A;  2DO4 A;  2A2C A;  3LW5 C;  3CDE A;  3DCA A;  1ICE B;  4DV6 J;  1TKZ A;  3H98 A;  4CLK A;  3GMG A;  3MGJ A;  1VYA A;  3QIP A;  4K4U A;  1L3K A;  2UXC F;  3CO9 A;  3I5A A;  4A8X A;  5D4L A;  5AE2 A;  4YR3 A;  2CWX A;  3M4X A;  2J5A A;  4EO6 A;  1RTH B;  2ADB A;  5DET A;  2E5I A;  2RS8 A;  1WSR A;  1X5T A;  4H54 A;  1WI6 A;  1KHW A;  1YKW A;  2Q43 A;  4OZ1 A;  4DR3 J;  4F8R A;  2M8H A;  3G82 B;  2IPO B;  2ATL A;  3I9Z A;  3EZ5 A;  4ECS A;  4OV1 A;  2KB2 A;  2UUC J;  5DQH A;  1Y5I B;  2LU1 A;  3DLE A;  2CPH A;  4ZPB A;  2PII A;  2VFU A;  3I82 A;  4EEY A;  3P49 B;  4C4W A;  1RU1 A;  1FRM A;  2LQ5 A;  4NE9 C;  2DIV A;  3M6X A;  4TU7 A;  3QGH A;  1U1O A;  5J1N A;  5SZT A;  1PAE X;  3L09 A;  4OIX A;  2WCX A;  2V8G A;  4Q8F A;  4GKK J;  2DR8 A;  3EPI A;  1RHU B;  2CQI A;  3M2U A;  4A8M P;  1RT5 A;  4CO3 A;  3W9I A;  3DGP A;  2AJ1 A;  1S1U A;  4FP9 A;  4XAK A;  1O5J A;  4YB5 A;  3SDE A;  1YIT S;  3FZ2 A;  1NME B;  2YNF B;  2C3O A;  1NK7 A;  3PW0 A;  3PY8 A;  4IG3 B;  3VZI A;  2VFS A;  1WHX A;  1ELO A;  4DV7 J;  1A9N B;  4DPW A;  2HHV A;  3CGI A;  4OX9 J;  1PG5 B;  4K2X A;  1R27 B;  3CME S;  4O4G B;  3CIM A;  4AL6 A;  2DNL A;  3NGK A;  2RIJ A;  1DTQ A;  4H4M B;  4YUD A;  1GNK A;  4PG5 A;  3FMW A;  3OFH A;  3MR5 A;  5E33 A;  1V5I B;  2EKY A;  2FJD B;  4NLO A;  2MZS A;  3NGR A;  4KGM A;  4GVB B;  4JI3 F;  2DNG A;  5B7W A;  2RB7 A;  1KD1 T;  1WD6 A;  1X0P A;  4R0J A;  4BDP A;  1XNR J;  1WEY A;  3DM2 B;  5K5M A;  2DGW A;  1SKR A;  6AT1 B;  4TQS A;  1VBK A;  4P2X A;  3MCN A;  4PYA A;  3OL6 A;  1U6Z A;  1SJ1 A;  2C3Y A;  4LF2 A;  4EI2 A;  5DDR C;  1BY9 A;  3NCR A;  3SFG A;  3VQT A;  4DUY J;  3UD3 P;  1QTM A;  3CC2 S;  4CWB A;  2Z2Y B;  3KDN A;  3I31 A;  4LRE A;  5KFX A;  3QQC D;  3HVT A;  1QVF R;  1FX2 A;  4LIW A;  5BXI A;  4XPC A;  3RUB L;  3GE9 A;  2OTL S;  2H51 B;  3UNG C;  4CTA B;  4E8U A;  3FEX B;  3T1A A;  3EMT A;  2DXD A;  4GKJ F;  1YJR A;  4HL9 A;  1ZZF A;  3MMB B;  3GII A;  1M5V C;  2J9C A;  4EGL A;  4DN0 A;  4WFN Q;  2UV8 G;  3QNW B;  3G9C A;  3K0J A;  5J2N B;  3VCD A;  2LEB A;  2BXJ A;  2H5J B;  3AAW B;  3HD1 A;  5K14 B;  4J9V A;  4CQ1 A;  1SC3 B;  3MR3 A;  3KJV B;  5I42 A;  5HRO A;  3HHL C;  4YY3 F;  4IR1 A;  1XNQ J;  1TKT A;  4NML A;  4FYV B;  4PCQ A;  4FF4 A;  2C2M B;  3JTP A;  3LAN A;  4JI7 J;  2QL5 B;  4USK A;  3W7B A;  1CC8 A;  1D8Z A;  3PJ9 A;  5CQG A;  5E5N A;  3OJS A;  3H5Y A;  2V9W A;  1NSQ A;  5HMW A;  2Y8W A;  1VQ7 S;  2C3M A;  3H5U A;  1RT7 B;  1UWB B;  3SBM A;  2HQG A;  4M5G A;  5J2M A;  2HUR A;  2HZA A;  2OP5 A;  1RAF B;  2VKR A;  4P2F A;  5ETL A;  3LH2 S;  4DG1 A;  4EO8 A;  3OBI A;  2G13 A;  4IO1 A;  3VQS A;  1OSC A;  1GXU A;  6FDR A;  4KJI A;  2VOP A;  2RHQ B;  2JVO A;  1S1X A;  3R6L B;  1H2T Z;  2RML A;  3KK2 A;  4TXS A;  3CCT A;  1HBU A;  1X31 C;  2JVR A;  5KT7 A;  5EN1 A;  1S49 A;  2F8M A;  3KLH A;  4KKO B;  4I6Y A;  5B0A A;  3NCP A;  4FNI A;  5HSP A;  3RG6 A;  1N36 J;  4ECZ A;  3RR8 A;  1S10 A;  1PCA A;  3UDE A;  1HWK A;  1RWM B;  1FFG B;  1GT8 A;  1K47 A;  1S7H A;  2MGZ A;  3VHQ A;  1RAJ A;  2KHC A;  3MM9 A;  3B8H A;  5CAB A;  3X1L B;  4F4A A;  3I4P A;  2UUB J;  3OL7 A;  4XDD A;  1WTB A;  4KTQ A;  1HYS B;  2V0N A;  1WKL A;  4NXM F;  4OYM A;  3UCU P;  3C66 A;  1FES A;  1PIE A;  2I0X A;  1KQF B;  2J7U A;  4GMK A;  3UQS A;  5HP1 A;  1N32 J;  2F1F A;  4CIO A;  1ULR A;  3LP0 A;  2HZV A;  1D8Y A;  2D41 A;  1G1X A;  1KQS R;  3NLC A;  2VV5 A;  5KG2 A;  3OUY A;  3MXH P;  1FRX A;  2IRU A;  4A8K A;  2ERR A;  1PAU B;  3T1Y F;  2CQ0 A;  3BO2 A;  2JFK A;  3D1Q A;  3R5D A;  3W2V B;  2AV5 A;  1MMN A;  3TUZ C;  1VMB A;  5KT6 A;  1WEL A;  4FF1 A;  4ZCM A;  1Q7L B;  1N6Q B;  3IR6 B;  2IA0 A;  4RJV A;  4A8F A;  2G2O A;  3CE8 A;  4K4Y A;  2Y1J A;  3M7V A;  1FF2 A;  5KG1 A;  3D5M A;  2IVY A;  4Y2A A;  4G3I A;  1Y4Z B;  3OVB A;  4ELV A;  3MR7 A;  1K1Q A;  2HNY B;  4EBD A;  3THV A;  4LQ3 A;  2DO0 A;  1RT6 B;  3G71 S;  2HGM A;  2ZH8 A;  1AW0 A;  1WSV A;  4FKY A;  3ZZY A;  5KFQ A;  1VQ6 S;  1C1B A;  2VU5 A;  3G87 A;  4G1Q A;  1U1M A;  2HAF A;  4O4G A;  2DBB A;  3AA9 A;  3M30 B;  2U1A A;  3J7Z 5;  4NCA A;  1VQY A;  3ICL A;  4K2J A;  5DDQ C;  4DUY F;  4NMX A;  5I4M A;  1B3T A;  1IKX B;  1N54 B;  1RLD A;  2CUY A;  2EG2 A;  5HVF A;  2DGU A;  4IKA A;  3KFW X;  1U1N A;  3AJ1 A;  2RU3 A;  4ZHR A;  4ZVP B;  3UVJ B;  4PWD A;  1VQ9 S;  3N4W A;  1XMO J;  2A6M A;  4ECU A;  4QJV A;  3R97 A;  1VQL S;  1LW0 B;  1TUG B;  1UFL A;  2DYA A;  3PW2 A;  2D3O R;  3KOA A;  2R8G A;  4ERD A;  1TMJ A;  3MPV A;  4FKX A;  3IXQ A;  3MEE B;  4M5J A;  4C3L A;  3EZO A;  1OMS A;  2QL7 B;  3OTD A;  4QPX A;  2BKN A;  2YQ3 A;  2ZM6 F;  2JC0 A;  1EKS A;  2CJX B;  4MMO A;  5ETS A;  2LP4 A;  3BGO P;  5B0B A;  5J1E B;  1NLK L;  3QO9 A;  4JI7 F;  1WOO A;  2EC0 A;  1HQE A;  5A2Q Y;  3GFY A;  4WF9 Q;  3P45 B;  1QD1 A;  2R42 A;  1RAI B;  3SSR A;  3DOL B;  4B3O B;  2AT1 B;  1H0H B;  3MM6 A;  3N6N A;  3S6E A;  3NS5 A;  1FRL A;  5I3U B;  1NM2 A;  2C28 A;  2ZUA A;  2R7X A;  2B9W A;  3LAL A;  4O44 A;  4FXW A;  5F3Z A;  5HRO B;  2YKP A;  3V2U C;  1K8A T;  5KG7 A;  4NLG A;  4OYZ A;  2J6U A;  2CPD A;  4ECY A;  2VPY B;  2ZEJ A;  2GIR A;  3AQP A;  3GYG A;  3FQL A;  2BV3 A;  2XI3 A;  3I32 A;  3UDC A;  2DR6 A;  2QLX A;  5CYM A;  1S5Z A;  1LWF B;  2UUA F;  4KPY A;  1RHJ B;  2VOO A;  4ES1 A;  3VR1 A;  1VOM A;  2YNH B;  1WG1 A;  2JX2 A;  2CJK A;  1S1X B;  2HQI A;  3MEG A;  1P27 B;  1UJ6 A;  1TKX A;  1NSA A;  2VG5 B;  4Q44 A;  2DNZ A;  2R7Q A;  1DTT B;  2CJ9 A;  2B7B B;  1Q8I A;  2M0G B;  4P2S A;  4IRD A;  1R8A A;  4C9D A;  5CYQ A;  5DS7 A;  1N5S A;  3LGH A;  2XCP A;  2R7W A;  1Q0N A;  2QMU B;  2R9L A;  4Q45 A;  1UZH A;  3M8P B;  3AD7 C;  1GK8 A;  1HD0 A;  3T19 A;  3VAH A;  4QYZ K;  2DIT A;  2HRT A;  1HPZ B;  3OR1 A;  5CHC B;  4CLT A;  2YQ0 A;  3RYL A;  2HMI A;  4JV5 F;  2PSZ A;  2VFT A;  1U0H A;  3DDK A;  2R3V A;  1GTH A;  4OJ3 A;  3UDL A;  3MDF A;  4DU7 A;  2VQF J;  4LR8 A;  3ENW A;  2ALZ A;  2FDN A;  3LP0 B;  2ZH5 A;  2HQD A;  2QA2 A;  4ZIV A;  1FXL A;  1SKS A;  4DZ6 A;  1T02 A;  3QT8 A;  5DZ6 A;  2NS1 B;  2EFO A;  3IC1 A;  3VV2 B;  4F67 A;  1IWG A;  2ZE2 A;  1S9G A;  5C7P A;  3J81 Y;  1TK0 A;  3DLH A;  3MTK A;  4PAB A;  2VUG A;  4L73 A;  1NO8 A;  2AX1 A;  4RUC A;  2AHO B;  1J5O A;  2YKN B;  3E01 A;  3DDN A;  3JYT A;  2AEM A;  2DVI A;  3KUG A;  2Z30 B;  3D67 A;  1U4B A;  1KR4 A;  2ZVI A;  3N9U C;  3KWM A;  4NYZ A;  4WFY A;  5HAT A;  1N6Q A;  1FX4 A;  2CJY B;  2A3J A;  3CTR A;  3L4B C;  1JJ2 R;  4E2F B;  2W9C A;  2B8Q A;  2DRB A;  1P9Q C;  4ZJQ A;  1WKJ A;  2O66 A;  5CD4 A;  3I0R A;  1X7V A;  2KT5 A;  2I2Y A;  3LQV A;  3MD3 A;  3C6U A;  4CLL A;  3ZXW A;  1VC0 A;  2DD8 S;  2NQP A;  2DGO A;  2BUN A;  4MT1 A;  1GX5 A;  3WC0 A;  2B9E A;  2K8G A;  2GQ2 A;  3F56 A;  1SVD A;  2KYX A;  3HLU A;  4RW4 B;  1WUU A;  2K3K A;  1TKD A;  2R8J A;  3J7A 1;  1FVS A;  2JLE A;  3FBC A;  1OY9 A;  2MST A;  3UD4 P;  1FXR A;  2POK A;  1HNV B;  2W01 A;  1SJ3 P;  2CZV C;  1TV6 A;  2HWT A;  2BQ3 A;  2RVJ A;  4RW9 A;  2HPU A;  5EDW A;  3GIJ A;  3M32 B;  2EK1 A;  3GR0 A;  3PR4 A;  2WTF A;  3DXS X;  1F9E B;  3PJW A;  1EIY B;  4B9V A;  4KQZ A;  1OWX A;  2VKZ G;  3M05 A;  4ECR A;  1GAO A;  2YNG B;  3PW5 A;  4JYA J;  3AHP A;  1RHK B;  4O3S A;  1HA1 A;  1HQU A;  4ED7 A;  2W25 A;  2V5H G;  2EW9 A;  2YWK A;  3D0I E;  4QIW D;  4QWC A;  1NJW A;  1X4E A;  1LW2 A;  3MM5 B;  3HSD A;  4ZVS B;  5A0Y A;  5AJ3 J;  2EFV A;  3FJ2 A;  4KSE B;  1AUD A;  3AJD A;  4LRB A;  4M5N A;  4ZDN A;  3D7S B;  2MSS A;  1XBW A;  3BR9 A;  1AT1 B;  1RAD B;  1YRT A;  2B5J B;  1HQE B;  3PRB A;  4R0E A;  2MDA A;  3DGV A;  2VJU A;  3K7R A;  2M9K A;  2CZ9 A;  3Q8U A;  5KTQ A;  2KM8 B;  3F44 A;  3V6D A;  1AFI A;  2YX1 A;  2ZOF A;  1C0U B;  1VHF A;  1S4F A;  2CQ4 A;  2L3M A;  5KG5 A;  2L41 A;  2KRB A;  2PI5 A;  2WVF A;  4OQJ A;  2BYC A;  2GGP B;  2OGU A;  1FKP B;  3D28 A;  4DEZ A;  3I87 A;  2E5L F;  4K8R A;  3FEZ A;  3MMB A;  1HLW A;  4WXW A;  4PQU B;  1S48 A;  2AZ3 A;  3KLI A;  1FJ7 A;  3BJY A;  5EX0 A;  1OY6 A;  1D0E A;  1TK5 A;  3DU5 A;  4CRJ A;  3FCW A;  1ZET A;  4I2Q B;  4RU9 A;  1CQN A;  1T03 B;  1ZM3 A;  5F8H A;  3G96 A;  4IRC A;  2QFI A;  4USU A;  1XWL A;  3CCE S;  3VAG A;  2GHW A;  3MM8 B;  4FS2 A;  2BRK A;  2B56 A;  2VPZ B;  2GQQ A;  2XZW A;  4NLT A;  3TEG A;  3FFI B;  5J2M B;  3EGV A;  2J76 E;  3JXO A;  3QBC A;  5CYQ B;  4DPY A;  5GAH U;  1KTV A;  2BMB A;  3SZ2 A;  4OX8 A;  4N8N A;  2F5G A;  2QLB B;  3ZZ0 A;  2HVD A;  4AT1 B;  1SJQ A;  4J9L A;  4IFY B;  3GIM A;  3V6H A;  2VD3 A;  1KEK A;  2R7U A;  4P52 A;  1DLO A;  1S99 A;  3BDP A;  1KWM A;  3K5N A;  1P1L A;  2E7W A;  2F8E X;  1H7W A;  1RT1 B;  3C15 B;  3I9V 9;  1W26 A;  2KTQ A;  1WJ9 A;  1UPM B;  2MGZ B;  5KFW A;  1WDD A;  3NAI A;  3O3L A;  4DPX A;  2I5J B;  1H72 C;  1AZS B;  1GEH A;  3FC9 A;  4JV2 A;  2DIS A;  5C5J A;  2W2M P;  4Q2L A;  3AQO A;  1TL1 B;  4UST A;  2VBZ A;  2E9Z A;  4RNF A;  1SIZ A;  5D3G B;  1OPI A;  2G0I A;  4XPE A;  5HL7 Q;  3OHB A;  5M2P A;  1U6B A;  3LWM A;  2Z4P A;  4RLE A;  5KFY A;  1PIL A;  3PAC A;  3KHG A;  4AUK A;  3DLG B;  4CH0 S;  1Y0H A;  4LR9 A;  2ZH2 A;  1IBM J;  2CJB A;  2K3I A;  2KVQ E;  4JYA F;  4FYW B;  3ZC4 A;  3AB4 B;  1P1T A;  2FGO A;  4K7Q A;  2VDI A;  3M2U B;  2XSF A;  5HI7 A;  3JAM U;  4ED6 A;  4DR3 F;  1N34 J;  3M2V A;  3IN5 A;  5HLF B;  5D8H B;  3B6B A;  1YBA A;  2OPS A;  2X3D A;  4MFB A;  3QGG A;  1SJF A;  3U1N A;  2BOP A;  1BQN B;  1RBO B;  2CQB A;  2YKM B;  2YQ1 A;  3MCO A;  4ZVE A;  4LFC F;  4JI0 F;  1HBN A;  1FE0 A;  1VC6 A;  2O1P A;  4K4S A;  3BBB A;  4NLS A;  4F36 A;  2V94 A;  4LSZ B;  4LF5 F;  2GX8 A;  2KJV A;  3QFW A;  2J0X A;  1DTQ B;  1VBX A;  1O8B A;  5ETV A;  5AXN A;  4OI2 A;  3V6J A;  1RGV A;  3DHX A;  1NXI A;  2GNK A;  3WQP A;  2JJ4 D;  4U7C A;  3OTO J;  1UVK A;  1S1T B;  1FT8 A;  5RUB A;  3VGT A;  3D6T B;  2J9D E;  2CWK A;  3HSZ A;  2DY9 A;  4DQS A;  3PZP A;  1Z2L A;  2CNL B;  2DNO A;  1URN A;  5AE3 A;  4QR1 A;  1UAW A;  5MLC V;  4UY8 T;  2KU7 A;  3M8R A;  2XMK A;  3V6D B;  1RWO B;  1XR5 A;  2XMM A;  1TTH B;  2QLJ B;  5D0E A;  4DL3 A;  1BWE A;  2CPE A;  4MIA A;  2ZJP Q;  4X4O A;  2WHO A;  3QO9 B;  5K8O A;  2VC0 A;  1VQO S;  2ZZN A;  3NMA A;  5GAH I;  3DNC A;  2XEX A;  1SL1 A;  4DOZ A;  3DRP B;  5E3A A;  3PFO A;  3G82 A;  3UN5 A;  1NJI T;  1XR6 A;  1GH8 A;  3MR2 A;  2QYG A;  1OQ3 A;  4DI6 A;  1H6K X;  2W1B A;  3D66 A;  4LSN B;  4I2P B;  3LP2 A;  1DZ5 A;  2HBY B;  3LTO A;  4LFA J;  5I42 B;  3W5Y A;  2ZM6 J;  4DL4 A;  2K2P A;  2W9B A;  1LKZ A;  2LA6 A;  2PFD A;  2L9D A;  4DR7 J;  2A2D A;  4USH A;  1FDN A;  5HAO A;  5L1K A;  3T9Z A;  4TLR A;  5F9L A;  3G8T A;  3BKU A;  3DRS A;  3QJJ A;  3TUI C;  4NZ7 A;  2W2P P;  1Q78 A;  3NEK A;  1MWZ A;  3DGP B;  3H7H B;  5F8L A;  2HBQ B;  2OHD A;  3G6X A;  3M1V A;  2ZIT A;  3J81 U;  3AD8 C;  4ELT A;  1RA6 A;  2YVS A;  2E1P A;  3O6Q A;  3R1L A;  3A8I A;  5LMU J;  3QT6 A;  4LF8 F;  3TZX A;  2O67 A;  3UR0 A;  2LVW A;  3W9J A;  1HWL A;  4Z2X A;  3QMQ A;  2HHH F;  5A8K A;  5EWG A;  1PJ7 A;  1RT3 B;  2KVI A;  5IM0 A;  4WFB Q;  2OPQ A;  3B82 A;  4P74 A;  1H73 A;  3TAM B;  1NH8 A;  1E6V B;  3L3C A;  2R8K A;  4LF7 F;  3MZI A;  3RB4 A;  2D7S A;  5HQ8 A;  5AXL A;  2IA6 A;  1FWP A;  2CPJ A;  2R7O A;  5KFF A;  4LJM A;  4QYZ J;  2JLG A;  1TL3 A;  4U96 A;  3KLV A;  5LT5 A;  4DL6 A;  1R7I A;  3A12 A;  3H5S A;  1EKR A;  3D1H A;  1RAA B;  1N5V A;  5K9F A;  3VF0 B;  5B09 A;  3T5H A;  3PW7 A;  1BXN A;  2RQK A;  3J7Y U;  4LF6 F;  1NSP A;  2J7W A;  3CJT A;  4HAC A;  4QQB A;  2R2T A;  3NWR A;  3KK3 A;  1J5E F;  4WJB A;  2RAQ A;  2C3P A;  2ZNY A;  1JK9 B;  3MOZ A;  3MM7 A;  1BQM A;  3BN4 A;  2R8H A;  2AQ4 A;  1EET A;  1SPB P;  4ED2 A;  4M5M A;  1L3S A;  2HLU A;  2R2U A;  1HAR A;  2RDD A;  1CG2 A;  4NPO A;  3RU0 A;  4XO0 A;  4ES2 A;  3D6M B;  4AD6 A;  4NXM J;  1RWW B;  1X5S A;  3EVM A;  1Y3K A;  4NLP A;  4CYU A;  1VRT B;  2BQU A;  3M2V B;  4IQM A;  3TUJ C;  2A6O A;  3R2C J;  1JJH A;  2BE9 B;  4B3S J;  1ZZN A;  2CQG A;  2V63 A;  2O01 C;  3HUL A;  3EGN A;  4N8O A;  2QA1 A;  4CLZ A;  3KLG A;  1RAG B;  4XDC A;  2N3L A;  3QGP A;  2DHH A;  3IBW A;  3WHI A;  1IQT A;  1U45 A;  2GA7 A;  4DV1 J;  3Q89 A;  2QO3 A;  3AH6 A;  2APO A;  4CNY A;  4PPD A;  3LGN A;  4DUZ J;  4XIU A;  2UXD F;  2LCW A;  3F73 A;  3LP1 A;  1UVL A;  2JLF A;  1UW9 A;  5IQ6 A;  3H25 A;  5E3C A;  3R5C A;  4YB1 P;  3R7B B;  1IM6 A;  3BPD A;  3BZQ A;  2W8K A;  4DX6 A;  4JP8 A;  3EXY A;  1MRO B;  3BGF A;  2P9C A;  3RAQ A;  5M2U A;  3QPI A;  2IM3 A;  3M8Z A;  1QAI A;  1N88 A;  3KJQ B;  4QIF A;  2F9J A;  2B8P A;  1W25 A;  3ENA A;  3DRR A;  1EAY C;  3SQO P;  1JXE A;  4X62 J;  3J81 j;  4DSE A;  4S0M A;  3N0V A;  4TY8 A;  3N6L A;  3BS9 A;  2COL A;  3MAA A;  4ZCI A;  5C25 A;  4Y2C A;  1NPR A;  2IC3 A;  4QW8 A;  1QDU B;  3E3X A;  2ABY A;  1G7C B;  1R3N A;  4X4S A;  1UVJ A;  5I3P A;  1O51 A;  4X4R A;  4ILR A;  5LL6 d;  2GAG C;  3GV8 B;  4OI4 A;  2GJF A;  4DV5 J;  4B9L A;  4WZM A;  4Z7C A;  2DGX A;  4O23 A;  2YPY A;  2EFG A;  3CDU A;  2P2C B;  5FDL B;  2QA4 S;  2AU0 A;  1N5Q A;  4AE5 A;  2N3O A;  2JZ5 A;  4I2P A;  1S6U A;  1UMJ A;  3OR2 B;  4ANC A;  3A8K A;  5LMU F;  1DQ9 A;  2OUG A;  1KVK A;  5C24 A;  1JWW A;  3IGV A;  3CJQ A;  2ZKT A;  3Q83 A;  2GVZ A;  1V6H A;  2GGP A;  2E7V A;  4DMZ A;  2ROP A;  2HHH J;  2V2V A;  4C8Z A;  3AD9 C;  4OFZ A;  1NAQ A;  2BE2 A;  3KK1 B;  1NRK A;  5IT4 A;  2KZM A;  2M88 A;  3KLI B;  4ZCL A;  4X4Q A;  2NXE A;  2MQL A;  1YJW S;  1DY3 A;  5ETO A;  4X4U A;  4FBT A;  2OD6 A;  2NPI A;  2HNY A;  4DR4 F;  2CPY A;  2Y0B B;  3ENQ A;  4PAA A;  1NK9 A;  3GG1 A;  2ASD A;  3GFX A;  3O44 A;  1XER A;  2UUT A;  1DTT A;  4HEA 9;  3TX0 A;  5A8R B;  2Q66 A;  4DV0 F;  4JI8 J;  4F02 A;  3TAM A;  1JKH A;  4NCG A;  4ZLN A;  1MU2 B;  5GAD U;  4TU9 A;  1IM4 A;  2V67 A;  4WXO A;  3RB6 A;  4LMZ A;  5L1L A;  1EP4 A;  3RRH A;  4J9S A;  1S72 S;  4LFC J;  4OHZ A;  4ZHR B;  3UVJ A;  5A2Q U;  2D9P A;  1NHK L;  1ZTT A;  1TP7 A;  4EU0 A;  3KLF A;  3BN7 A;  2WW8 A;  4ECX A;  4OLO A;  5D4O A;  3KYL A;  4L76 A;  3EE3 A;  4OHY A;  3KK3 B;  4B3S F;  1L3T A;  2WVD A;  2AYB A;  1UVM A;  2XB2 D;  2BJ1 A;  1X60 A;  1AZS A;  3AOD A;  3BSN A;  1T11 A;  3GJQ B;  5KT5 A;  4ZPA A;  1JXL A;  2CQC A;  3FMB A;  5IWA J;  2XUL A;  3J80 Y;  3H40 A;  2YX4 A;  5LMN F;  2LQB A;  2FZC B;  1R31 A;  4CYU B;  3ZTO A;  2GIF A;  1F3F A;  4F50 A;  3IAM 9;  3HVA A;  4EWT A;  2NZC A;  3EJM A;  3FQK A;  3KHL A;  3QSY B;  4WE1 B;  4WYW A;  1QAY A;  2UXB F;  3JB9 k;  2OAU A;  4HHJ A;  4ED5 A;  2XZD B;  2DXE A;  2MKH A;  3A4T A;  3BQ2 A;  2B43 A;  5KFP A;  1SH3 A;  1HBO A;  4ED1 A;  1QSL A;  2MZT A;  1V3Z A;  3H2L A;  2K7K A;  3ZTP A;  2PO4 A;  1U7L A;  4ZIW A;  2F3J A;  2XO7 A;  1FTR A;  4URQ U;  4FXV A;  1DQA A;  4LSL B;  2WOM A;  1KOO A;  1V9O A;  2UP1 A;  3PYG A;  1WC6 A;  2IVM A;  3VGU A;  3M32 A;  4DX7 A;  3BGR A;  2BJE A;  3LOU A;  2D3U A;  3MEK A;  1IBM F;  4U8V A;  5ETP A;  2DPI A;  4G1I A;  4LF4 J;  4IO9 Q;  3ILO A;  1ROF A;  4ZP8 A;  2DTJ A;  3BB5 A;  3V81 B;  3QID A;  3V4I A;  1VDH A;  1ZPW X;  1Q81 T;  1IKV B;  1FJG F;  4V19 X;  3H20 A;  4PWW A;  1VFJ A;  2IFX A;  2W2Q P;  1Z1Z A;  1U25 A;  2JNJ A;  3IS9 A;  3LUY A;  4XK8 C;  2CQP A;  3QZ7 A;  2XY7 A;  2PD1 A;  2HFS A;  1FWK A;  3JSY A;  2JC1 A;  3I4H X;  2QSF A;  3OR1 B;  4J9U E;  4JI4 F;  5CXT A;  2VON A;  5HAN A;  2PN6 A;  2CDR B;  3IO1 A;  4ECQ A;  1R8P A;  2ZOG A;  1FD8 A;  1JJC B;  3IRX A;  2VA2 A;  4IUF A;  4QCL A;  2FJA B;  3VVU A;  2GS8 A;  2HRU A;  1JXV A;  4CNZ A;  1WC5 A;  4WP9 A;  4ILM A;  4FPR A;  2NXC A;  1S57 A;  1ARO P;  1NK4 A;  1HIY A;  3Q8S B;  1S9G B;  4QPT A;  3S8S A;  1F5B A;  3TVY A;  1HQ2 A;  1RWK B;  3ZTS A;  1J5O B;  1TL4 A;  4OJG A;  5CYJ A;  4ATN A;  4GO5 X;  4P9S A;  4DJB A;  3K59 A;  2GIQ A;  4DV0 J;  2GO9 A;  1FDD A;  2CQD A;  4DQQ A;  3PCO B;  4UW2 A;  4Y0F A;  1S1W B;  4KFB B;  2AYG A;  4IOA Q;  4LSN A;  4HH0 A;  4URS A;  2PEB A;  3I96 A;  4I7F B;  4KHP F;  1F5A A;  3ZTR A;  2W9B B;  2Q1L A;  3C6T B;  2RKI A;  3KK2 B;  3KMQ A;  2Q6B A;  1QUV A;  1M5P C;  3RAM A;  1RTZ A;  4Y6I A;  3KLH B;  1KRP A;  2XMV A;  2E5L J;  4YME A;  3HSG A;  5D0H A;  1IBC B;  2R7T A;  4IOC Q;  2YKO A;  4K5S A;  4M63 A;  4OZL A;  3MTJ A;  2ACY A;  1JKH B;  4WU3 A;  5DJB A;  4ZVR B;  3EYZ A;  3PV8 A;  2DR5 A;  1UVN A;  1S12 A;  2FC9 A;  2KO1 A;  2BAN A;  2AZ1 A;  4LFA F;  2V8H A;  1QM9 A;  4A8Y A;  3CJS A;  2W7A A;  2ZHO A;  5A8W A;  3JSR A;  5GME A;  2B4V A;  3C14 B;  2AD9 A;  4EFA C;  1QUP A;  3I0S A;  1HHT P;  2QEX S;  5HP1 B;  2VPX B;  4JI5 J;  2HHU A;  2J9E A;  2NXN A;  2BM0 A;  5HJY A;  1QTN B;  2B6A A;  2OML A;  2W2N P;  4Q5V A;  1Q8L A;  4Q43 A;  3CCQ S;  1GMW D;  2HHT A;  4DZD A;  2VC1 A;  2I5J A;  2Y1L B;  5ETN A;  1FXD A;  2CZ4 A;  4MK9 A;  4P7V A;  1U1Q A;  2ZWO A;  4CO0 A;  2JWN A;  2I9S A;  1B4S A;  5D3G A;  4LQ9 A;  4QBU A;  4F2R A;  1NH7 A;  2C2O B;  4J91 A;  3W2W B;  4DL5 A;  1JLQ A;  3WZ0 A;  2P5V A;  4YR2 A;  3PVX A;  4DX5 A;  4R5P A;  1CSJ A;  3ET6 B;  2N4D A;  5DM7 Q;  4J9P A;  1CJU A;  4NLQ A;  3CED A;  2RF2 B;  1WOS A;  1P9Y A;  2HS3 A;  4HT7 A;  1D1U A;  2JEF A;  2ZZT A;  4DS5 A;  1Z2Z A;  4RW7 B;  2MLZ A;  2MLY A;  3CC4 S;  2CQ3 A;  5GVQ A;  3NNA A;  4NA2 A;  1Y5L B;  2OPP A;  3GG0 A;  1JB0 C;  1RT5 B;  3T6J A;  2MKS A;  4ZK7 M;  2GC8 A;  2P8I A;  4DPT A;  2BJ9 A;  3PX0 A;  4OYB A;  2MKI A;  3CC7 S;  5KFZ A;  1JLF B;  5IT9 U;  5KFR A;  2HHX A;  4YOE A;  3FKB A;  2GHP A;  4G65 A;  1DHM A;  1T3N A;  4CLP A;  2ZHA A;  4DV3 F;  2GFF A;  2MHE A;  5E3Q A;  6FD1 A;  2BAC A;  5KFB A;  2PMZ D;  1LNQ A;  1YGY A;  3M8Q B;  1KQK A;  5KG4 A;  3V5R A;  1RTD A;  3MFH A;  4CT9 A;  2SXL A;  4W92 B;  3M8S A;  3TZY A;  3ILI A;  2GHV C;  4OJ1 A;  1S97 A;  1S9F A;  1H98 A;  1KN6 A;  2FGC A;  1RKI A;  2P6T A;  2QX0 A;  4MYU A;  1Y5N B;  5CZV A;  4I0W A;  1WEX A;  4ZPC A;  2C2E A;  2FHJ A;  1S0M A;  4RW8 A;  5J1E A;  4DR5 F;  4DSJ A;  4RX6 A;  2CNN B;  2H9Z A;  3D4J A;  1T9X A;  3CW2 C;  1YWX A;  3CD0 A;  3GWC A;  1VRQ C;  1JLB B;  1VQ4 S;  2HVE A;  2YPZ A;  3H59 A;  2DJW A;  3NOC A;  3PNI A;  4JI6 F;  1U49 A;  5C25 B;  3I55 S;  4F3Q A;  3TZZ A;  4U6P A;  1C1C B;  5C42 B;  4OI1 A;  1P8G A;  2V4R A;  2GML A;  4A8S A;  4CLU A;  3UCG A;  2UXC J;  3FSX A;  4B3T F;  2FHJ D;  3T3F A;  4NEZ A;  4C11 B;  5HBM B;  1HI1 A;  3I5B A;  4YR0 A;  3QRQ A;  3AFG A;  3HVW A;  2CDQ A;  2KDO A;  4DV2 J;  2FLN A;  2B51 A;  3ITH A;  4ZP9 A;  2LEA A;  4MKY A;  3BRE A;  1M1H A;  4X4N A;  3LP2 B;  2B4P A;  4NLY A;  2AGO A;  5T14 A;  1HWU A;  4I7F A;  3CCM S;  2RDJ A;  1TKT B;  3HZG A;  3GIR A;  2V4Q A;  1APS A;  1FRH A;  4DFJ A;  4LF1 A;  2FYX A;  2B4O A;  1HMV A;  1FDA A;  1SQG A;  1TVR A;  3IM8 A;  3PHT A;  3U1L A;  1N0U A;  4ED3 A;  3DMJ A;  4F3O A;  2GVD A;  2OEL A;  2OEJ A;  2YWG A;  5BR8 F;  4IYQ A;  5LSO A;  3GV7 B;  3AOC A;  4IG0 A;  3W9H A;  2R8I A;  1YBU A;  1OJ4 A;  2H65 B;  3G2X A;  3FCH A;  4H4O B;  1UJ5 A;  4F0M A;  1T3O A;  4C0H A;  2BAN B;  4WFZ A;  2FJE B;  3CCV S;  3P6Y C;  2LKZ A;  4LFB J;  1X9M A;  2AGP A;  4ED4 A;  2ASL A;  2BM1 A;  3MEC B;  5IS2 A;  1EAR A;  1HNX F;  1U1R A;  2FPH X;  3DYA A;  3D68 A;  2H5I B;  2HRY A;  4ZP7 A;  4QU7 A;  2DNK A;  2IDL A;  3P8B B;  1PYO B;  2V4J B;  3OLA A;  4EYI B;  4EBE A;  1S1T A;  1HNZ J;  3HFK A;  4NRU A;  4UUW A;  2XNR A;  4ZVH A;  2B7C B;  1PC5 A;  3MAH A;  4DCP B;  3Q0A A;  3ISN C;  1VIS A;  5K8N A;  4HT5 A;  2VG7 A;  3BO3 A;  3PX4 A;  4OI3 A;  2VIC A;  1JLQ B;  2WBM A;  2XGP A;  5JVG Q;  1I6J A;  2CNK B;  5KAK A;  4JI8 F;  1YRU A;  4WCE Q;  5DG9 A;  4ID5 A;  5J2Q A;  3H4D A;  2AF6 A;  4PUO A;  2JFD A;  1XNQ F;  1FER A;  3P96 A;  4YS2 A;  1IXK A;  1WDT A;  1JLA A;  1YRX A;  2QLW A;  4Y2K A;  4K0K J;  4Z7Y A;  1IJF B;  5FD1 A;  4TLQ A;  4FF2 A;  1KP6 A;  1N33 F;  2W7P A;  2M8D B;  1MMD A;  2NXU A;  3GYX B;  2J0W A;  2GZO A;  4WP3 A;  5AJ3 F;  4BC7 A;  4QWE A;  1KHV A;  4NZ6 A;  2LDI A;  5L46 A;  2HBZ B;  1QY7 A;  4IDK B;  5HN0 A;  2WON A;  3DI6 A;  2V2Q A;  1C0T B;  2KFN A;  2UV8 A;  1NB2 A;  1HW9 A;  3PYD A;  3J80 U;  4F2S A;  4DR1 F;  3PO4 A;  1B0V A;  1MW7 A;  4ZVG A;  2HNZ B;  4I69 A;  4ZVQ B;  2KG0 A;  5D15 A;  2FB0 A;  3G8Q A;  4O0N A;  5G0R A;  4ENO A;  4HDG A;  3VAF A;  2N4C A;  1XK8 A;  2BJ8 A;  2L08 A;  4ID8 A;  1PSD A;  1IKW A;  2H1Y A;  3TJ9 A;  2UXB J;  1DAX A;  1E6Y A;  3HCX A;  5FII A;  3MMA B;  2XY5 A;  3FRY A;  2OI2 A;  2AGQ A;  2AJQ A;  2P6S A;  1OPZ A;  2XBP A;  1FHT A;  2XMJ A;  4QZV B;  3TJA A;  5GMD A;  4DU8 A;  3JSM B;  1U02 A;  1T9Y A;  1N5T A;  1YJ7 A;  5D77 A;  1ZA2 B;  3D0H E;  3I5C A;  4JV1 A;  2HSE B;  1RP5 A;  2MJN A;  2OPQ B;  1U48 A;  1NND A;  1HR0 F;  2FY8 A;  4U67 Q;  2OEM A;  2PFF B;  1K0T A;  2NPF A;  2KN4 A;  2X1G A;  1K44 A;  4J9M A;  1KS2 A;  4M8L A;  3CDB A;  1FNX H;  5ETM A;  3MPD A;  4UQT A;  2DCL A;  1J2V A;  1EJ7 L;  2G1H A;  4YQW A;  3U27 A;  1UA1 A;  4OX6 A;  4GVL A;  4OHW A;  1LEO A;  3DLE B;  4KRW A;  1F5C A;  3MM7 B;  5KFL A;  4ER8 A;  2H3E B;  5LXR A;  4C3K A;  3T1H J;  5F8J A;  3G6Y A;  1Z4U A;  3UN2 A;  4C97 A;  4QWD A;  1SL2 A;  2F4V F;  3DOK A;  3JTO A;  2AW0 A;  1Q79 A;  2HWI A;  3UDV A;  1NUE A;  2VPW B;  5E2Q A;  1FK9 A;  2AYE A;  2ZBQ A;  3TA1 A;  2J0Q D;  3SSQ A;  1KSP A;  4C7Q A;  4DV5 F;  1JJ4 A;  5CD4 H;  3RAX A;  4O3P A;  2OEK A;  4O3Q A;  4JI2 F;  4A46 A;  4DR6 F;  3SDE B;  3GJS B;  4ICL A;  1S6P B;  3A1Y G;  1YQH A;  1LWC B;  1UEK A;  1JLC A;  3NAH A;  2DGV A;  4RBV A;  4CZC A;  4QW9 A;  4YDX A;  4HI2 A;  4A48 A;  3SI8 A;  1IKY A;  1NJY A;  3HK2 A;  1TAQ A;  3D3B J;  3GON A;  3TRG A;  3NNH A;  4IFY A;  3T5J A;  3MEC A;  3HP6 A;  3QJL A;  3FGV A;  1WC4 A;  3PHE A;  4WFA Q;  2DHG A;  3CD7 A;  3FBB A;  2HWH A;  4CM2 A;  2PA3 A;  1M1K T;  3DYA B;  4NCG B;  1VQ5 S;  1OYD A;  2HFU A;  2VG6 A;  4TY9 A;  3U02 A;  1HBM A;  3TVK A;  1CJV A;  3VAL A;  4L3K A;  2MTL A;  1U1P A;  2CAD A;  4TVA B;  3EDQ B;  4DSI A;  3EVO A;  3HHK A;  1RHR B;  4HI1 A;  1R8B A;  1FJC A;  5B08 A;  2Q6C A;  4KH0 B;  3CCU S;  4GKJ J;  5A0Y B;  3JS9 A;  1TMM A;  1RZM A;  5IV4 A;  3C16 A;  5ETT A;  4DWI A;  5F9N A;  1U47 A;  3VAK A;  2DHA A;  1TFW A;  3TAQ A;  5LSR A;  3F41 A;  3L7U A;  3H0P A;  2LU2 A;  2HBR B;  4FBU A;  2ZDP A;  3J7Y I;  4UOG A;  2HHS A;  3GJR B;  2BE7 D;  2FHO B;  3SQG B;  4DR1 J;  3NS7 B;  1EZZ B;  3IG1 B;  1RHM B;  1UPP A;  1CUL B;  2HFN A;  2PEH A;  1DUR A;  4LBP A;  3IBC B;  4CTA A;  1A6L A;  3CXC R;  2E1A A;  2ZVS A;  1NK6 A;  4Q0B A;  1C4A A;  4C98 A;  1VQS A;  1KLM A;  4FF3 A;  1VGY A;  4A47 A;  5CA5 A;  4YEA A;  5IC6 B;  5K20 B;  3QAU A;  3TQE A;  5L39 A;  1DFD A;  3C6U B;  4RW7 A;  4Y3C A;  1C0T A;  1HBO B;  4DCJ B;  1N5Y B;  2IRX A;  3CJ2 A;  3DKD A;  3O8W A;  5E41 A;  1PBU A;  5GMK a;  2JL9 A;  5LMN J;  4RW4 A;  2XWX A;  4DR2 F;  3NS6 A;  3BDE A;  1GMV A;  1RE1 B;  3NWG A;  4MKV A;  3FEY B;  5F3T A;  1LK5 A;  1Q82 T;  4X66 J;  1RT7 A;  1UWB A;  2AJ0 A;  5HMZ A;  2E1M C;  2V6A A;  2IVF B;  4C8K A;  1RDR A;  2RH3 A;  3K58 A;  1WC1 A;  2KYZ A;  3W1Y C;  2HFZ A;  2Y1I A;  1TUV A;  4OHX A;  2ZBI A;  4NOH A;  2DY1 A;  2ASY A;  2WW4 A;  4IH5 A;  1QSY A;  5KFC A;  1NJZ A;  1RBA A;  1CJK B;  1SUQ B;  4EMD A;  5ETQ A;  5F41 A;  4FPI A;  3R7N B;  5U47 A;  3TAP A;  4J5O A;  4XTT A;  2BBE A;  3UCZ P;  1M90 T;  2FVR A;  1X4G A;  2J8S A;  3MI7 X;  3C8Y A;  3GP9 A;  4X64 J;  5LOQ A;  4TKT A;  2BA9 A;  2XYH B;  2KXH A;  2YNI A;  3FZB A;  4OYX A;  2ZWP A;  1GTE A;  1ACM B;  5L9X A;  2EWH A;  3QWP A;  2ZH9 A;  1H2U X;  1PYT A;  2F4F A;  2HND B;  1MLA A;  1X5P A;  2W4C A;  1FI4 A;  3BH6 B;  2ATC B;  4M5L A;  4QIG A;  5L38 A;  1U2R A;  1X4C A;  3U7J A;  5BYS A;  1DBD A;  2MY8 A;  3GFH A;  5CCL A;  2IM2 A;  3OSP A;  3CJK B;  1T8E A;  1FJG J;  3GCW P;  1UVI A;  1QLN A;  4OX7 A;  3HT3 A;  2Y8Y A;  3MCM A;  2JH3 A;  4DXL A;  4IOB A;  2IDE A;  3QGI A;  1B99 A;  5DGA A;  1WHV A;  1RQ0 A;  3A8J A;  3LA0 A;  4ZVU B;  2FVQ A;  4DFM A;  2HVH A;  3A3P B;  1N48 A;  1SQF A;  4OZ2 A;  3JTN A;  2XC9 A;  3TUP A;  2I1R A;  2OLW A;  2BAB A;  2H54 B;  4DFP A;  3H5X A;  5GAE U;  1S0O A;  4X4P A;  5IV3 A;  4ZJL A;  1D3W A;  1RLC L;  4C8M A;  3DLK A;  5KFE A;  2KKH A;  2XO6 A;  1NKC A;  3DXB A;  2EFN A;  4ICL B;  2XQC A;  1F9F A;  1RBL A;  1ZAW A;  1RT2 B;  4AYB D;  4C8L A;  1FD2 A;  1AYE A;  2YWH A;  3O2I A;  3UD5 A;  4F3M A;  2R4F A;  2G4B A;  1TZ0 A;  3KG0 A;  1WI8 A;  2CRL A;  1RTJ B;  3NMR A;  2HYI B;  3PRV A;  2C2N A;  2I38 A;  2XMA A;  3R2D J;  2OIH A;  2HLT A;  8RUC A;  1S1U B;  2RRN A;  4PPZ A;  3BBC A;  4LFB F;  3JQJ A;  3QIP B;  1E6V A;  2PI4 A;  4RNM A;  2VG6 B;  3GYN A;  2YKQ A;  4MJK A;  3K17 A;  4PR6 A;  3DRX A;  2FQQ B;  4ZPT R;  1U1K A;  4K5R A;  1M1G A;  2V50 A;  4NA1 A;  1ZTW A;  2JEG A;  3IA0 A;  1RSC A;  3HKW A;  3D9B A;  4CO2 A;  4B17 A;  4NI2 B;  3ILL A;  1SH2 A; 
#chains in the Genus database with same CATH homology
 1SCJ B;  2W2P P;  2Z2Z A;  3CO0 P;  2W2N P;  1R6V A;  4NMX A;  2W2Q P;  4OV6 A;  2XTJ P;  1SPB P;  2Z2Y B;  2E1P A;  4JP8 A;  4YN3 B;  2ZWO A;  2W2M P;  3A3O B;  2ZWP A;  3SQO P;  2PMW A;  3AFG A;  1ITP A;  3H42 A;  2QTW A;  2Z57 B;  3QFH A;  3P5B P;  3VV2 B;  3CNQ P;  3GCW P;  4NE9 C;  1V5I B;  3VHQ A;  2Z58 B;  3A3N B;  3BGO P;  2Z56 B;  3BPS P;  3T41 A;  3WHI A;  3GCX P;  3WIV A;  3A3P B;  2Z30 B;  2W2O P;  4K8R A;  3WIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...