3CNQP

Prosubtilisin substrate complex of subtilisin subt_bacam
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
71
structure length
71
Chain Sequence
EKKYIVGFKQGFKSCAKKEDVISEKGGKLQKCFKYVDAASATLNEKAVEELKKDPSVAYVEEDKLYRALSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering substrate preference in subtilisin: structural and kinetic analysis of a specificity mutant.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
molecule keywords Subtilisin BPN'
total genus 17
structure length 71
sequence length 71
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2008-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3cnqP00
2E1PA 2W2PP 3WIVA 1SCJB 4YN3B 3A3NB 3A3OB 3CO0P 2Z2ZA 3SQOP 1R6VA 4NMXA 1SPBP 3T41A 3QFHA 3AFGA 3H42A 3BPSP 3A3PB 2XTJP 2Z56B 3BGOP 3VHQA 3WIUA 2W2QP 2W2NP 3CNQP 2ZWOA 3WHIA 4NE9C 4K8RA 2QTWA 1V5IB 3P5BP 4OV6A 3VV2B 2PMWA 2Z2YB 2W2OP 3GCWP 1ITPA 4JP8A 2W2MP 3GCXP 2ZWPA 2Z57B 2Z30B 2Z58B
chains in the Genus database with same CATH superfamily
2L9WA 2G0CA 2HRTA 1EP4A 2V50A 3CGIA 1JK9B 2HG4A 4C2MA 3VVUA 2VQFF 3VCDA 2JEGA 3ETOA 4DG1A 2DY1A 2ZM6F 1FK9B 4NLXA 1HQUB 3HMJG 3SQOP 1D09B 4V19X 3JSBA 2HQFA 3CO9A 4RW7B 1IKWB 3UI3A 5A8WB 3PEHA 1IBKJ 5HQLA 1LWFA 2YVSA 4M95A 2G9OA 2OHDA 3CJ4A 1FDAA 2HVZA 4DHVA 1QTMA 4P10A 1BQXA 3KJQB 3WZ0A 2UP1A 2MKJA 1KVKA 1MWQA 2DRBA 3FKBA 1T7PA 4K8RA 2YNIA 3KJVB 2GVDA 4Q0BB 5J2NA 8AT1B 2L48A 1PAEX 2Q43A 4O44A 1FKOB 4FYVB 5F9LA 1NJZA 1S0OA 3BSNA 1K47A 3NRBA 2CPZA 1B99A 3FCHA 1N34F 1AXQA 3PM9A 4ED7A 3EGVA 5MLCV 1RAIB 2HHVA 2A10A 2IC3A 1YBTA 4PAAA 2DNLA 4KGXB 3UDLA 4HR2A 1N5QA 1NK6A 1WDDA 1FCAA 2QLXA 1CC8A 1RWXB 4MH8A 2D3ZA 4OZJA 5B0DA 4U7UD 3QBCA 5A6WA 2XTJP 2APOA 1IM6A 3BV8A 5GADU 3TUJC 5B09A 4C11B 1ZS6A 3P49B 2FHOB 4OHYA 1MMLA 3PJ9A 4QIVA 3QPIA 2YQ1A 3NAIA 4LFAJ 2VA2A 2XS2A 4NLVA 4UOFA 2AZ1A 1SKUB 5LOQA 2ZOGA 2KXHA 1BQNB 2BJ3A 2W2OP 2FLPA 2GVDB 4OJ1A 3TJ9A 4DMZA 1JLFA 2BM1A 3IS9B 1P6TA 3DRRA 1FJGF 2MDAA 4QR1A 5HQMA 4DV1F 4X64F 2HVDA 3FC9A 4KO0A 3KLVA 2WSFC 4M5MA 3D1OA 2MQQA 5IV4A 2FVSA 3CCES 2FQQB 2ZJRQ 3LWMA 1OJ4A 1Q8IA 1SPBP 1YWXA 1X9WA 3QAUA 1NLKL 2XY7A 4I2PB 1YIJS 4KTQA 4Y00A 2J9CA 2CJXB 2YNHA 1RGVA 3K57A 1Q5VA 2ZHOA 2KRBA 4KQZA 3ZTSA 2RMLA 4W90B 3HT0A 3EZ5A 2DO4A 2O1PA 4DOZA 1OQ3A 2DPIA 1T3OA 4ZVTB 4PUOA 5GVQA 1IKYA 1RWNB 2AJ0A 3PV8A 2Z0GA 5L1KA 3NBPA 5IXUA 4DL4A 1QY7A 1VI7A 2F8HA 2VG5B 1CG2A 4IR9A 4B3TJ 4L76A 3HKWA 2R8KA 1XR7A 1S1VB 3DU5A 3DYAB 2BQRA 1RWOB 2B51A 4FYYB 2P6SA 4PG8A 4CIOA 5L1IA 4EYIB 4NLPA 2QX0A 3RR8A 4Z37A 3TA2A 2ZOFA 2H65B 5CYQB 4F2SA 1Q4RA 4DV4J 4DR5F 3ITHB 2OEJA 4O3PA 5L46A 1JLAB 1UETA 3NGSA 3AJ2A 3CJSA 2C2NA 3GE9A 3T5LA 3W8GA 2DVIA 3QNWB 4J9KA 4TN2A 2L9DA 4CLUA 1RADB 1WOOA 2FPHX 2WCXA 4NLRA 1JJHA 4GO5X 4CZCA 1RABB 2IJFA 2YKMA 1OWXA 4X64J 5CA5A 4NA3A 5E0OA 1NSAA 1UWBA 4DSJA 2A2CA 1E6VA 3K59A 1M5SA 1R27B 3CJ8A 4PWDB 2CQBA 2GJIA 1UA1A 1MU2A 2MEWA 2GJFA 4USIA 2OFGX 4DDFA 2BDPA 3KHGA 3VGSA 1NUEA 4UW2A 2AV5A 3KJNB 4P73A 3KHRA 5H9EK 1DQ8A 1PYSB 2CAJA 2XWYA 3UFCX 1YRXA 4KV8A 2LEAA 5K9FA 5KFTA 2PFFB 2J5AA 3JAMY 3QO9A 3R8YA 1FXDA 5LMNF 2RS2A 1ROFA 1VRTB 3KJVA 1RCOB 2HNDB 4H4KA 3MHYA 4YQWA 3VAFA 3GFXA 3IGVA 2RAQA 4DBQA 3ZNJ1 2DHGA 2P9CA 3TP2A 3KLIA 5LM7E 4JI3J 4KYZA 4ZHRA 5C7PA 2WTFA 3PW2A 2KU7A 3WC0A 2W8LA 3FZBA 3CUNA 3ZZPA 1JLGA 3OT9A 2V8DA 1IKVB 4ZMMA 4WFXA 4ED3A 3QRPA 9RUBA 3BBFA 2AHOB 5G0RA 4B3OB 3RW6A 4RW6A 1P9QC 1FEEA 1MLAA 2QN6B 1EQMA 2ADBA 1CEZA 4PEOA 4OZLA 5EDWA 2RQKA 4NLTA 4CH1A 1ZAXA 1HD1A 2HQCA 2RUGA 2Y0BB 3ZZZA 4CP5A 2HGNA 3KK3A 1R8HA 4Q8EA 3RAQA 3A3PB 2HFZA 1R8AA 2YNFA 3DLKA 1ZYQA 3H40A 2H3EB 3OTOJ 1DTQA 3PW7A 1JLFB 3PRVA 3IN5A 4HYKA 4LF6J 2XZTB 4MK8A 1TKDA 4HTIA 2CQ3A 2EK6A 1VS3A 3P5BP 4DN9A 4LF4F 3D0HE 3QT8A 4MKVA 5HANA 5HQ8A 3UD3P 5C25B 2QMXA 2RKIA 2KG1A 1FRXA 1I1GA 3RBEA 2IA6A 3FQLA 3J81j 1Y9OA 4GVLA 3MCSA 4RNNA 1U6FA 5AJ3J 4DU8A 4EEYA 4KY3A 5LSLA 5HROA 2PEBA 2V6AA 4PG6A 3M2UA 1UKUA 4DL0C 4YP3A 3HVRA 2J0QD 2R8JA 1TAQA 1UFKA 4J9MA 3ISNC 2H4YB 5KFPA 5K14A 3BO3A 2JVRA 4JV2A 3G87A 4B3SF 2V4QA 1DLOA 3N01A 4FYXB 3V4MA 3DXBA 1HQUA 5IWAF 1C0TA 1T9WA 3EDRB 1HQEB 3IP0A 4YDXA 4AQYF 4ECYA 3H2VE 4CLYA 4ECSA 3OTBA 2IM1A 3PKMA 5DQGA 2H54B 4USVA 2B4VA 3W2WB 5LSRA 2ADCA 4U6PA 1AA1B 2BJ1A 5CD4A 2V4RA 4F3OA 1FJGJ 3MAHA 1SL2A 3EZUA 4YFUA 2VJVA 1S5ZA 1FESA 2AD9A 1T94A 1FT8A 4ANCA 2W8KA 2MZRA 1XR5A 3WDOA 4K4YA 2VKRA 5K8NA 5DDPC 4J9VA 4R0JA 1A7GE 2AZ3A 2Y1IA 2VA3A 1HBNB 2Y0SD 2WSCC 4OI6A 2RILA 1IKYB 2DNOA 3A3OB 2DBBA 3Q8SB 3RGIA 2C2DA 3NS5A 1EQ0A 1LW0B 4ZVGA 1AZSB 2IM3A 5GADI 1G7CB 3PO4A 4U96A 1GNKA 3A4TA 1HPZA 3GFYA 3I9ZA 4P71A 3T41A 1N0UA 3MEDB 5B0BA 4KJIA 4J9OA 1DHMA 3CTRA 1DQ9A 2GGPA 4OX6A 4DV6F 1DLOB 3BN4A 4ZPBA 3AQPA 3EVMA 3QT7A 3CD6S 5LSOA 2IVYA 4DR7J 2CWKA 3IO1A 5FIIA 2ZBRA 3OR1B 1RAEB 3TQEA 1D0EA 2DTJA 3G2XA 3UN2A 1FFSB 1K0TA 5AXLA 1DTTA 2G2ZA 1VFJA 5D0GA 3SDEB 1QSYA 4PYDA 4PWUA 1X5OA 5MAOA 3QRQA 2F40A 1RHKB 2VL1A 2ZBCA 3KUEA 2JSXA 2DH7A 3CEDA 2N82B 5GAEI 5FJ4A 1S1XA 2HFNA 3DRSA 5KFEA 4K0KF 4LQ9A 2B7CB 3IC1A 5M2RA 1U8SA 3IGNA 2CADA 3MURP 4JI1J 1N5SA 1VRQC 3D4JA 2BW7A 1JXLA 2CQCA 1ZBTA 3QGHA 1UCNA 1NAQA 1NCLA 4K2XA 5D4OA 2Z56B 3CPWR 4RW6B 1R0AA 1EP4B 1TMMA 2BUNA 1MG7A 2W1BA 3I0RB 3U02A 2QTWA 4DS5A 1RA6A 3J81U 3OD2A 4R25A 5J2PA 3UDEA 5J2QA 3C6UA 4MKYA 3NMAA 2ZBIA 2V2KA 1JWWA 3SZ2A 1X4EA 1Q53A 1XWLA 2DXFA 4O0NA 1OO0B 2CPYA 5G4DA 4QWCA 4DR1F 2AJQA 3EXYA 2YNFB 1JLGB 3DLKB 4JI6F 4ZA1A 5CCLA 4Q5VA 1ZTWA 4B3RJ 1FD2A 3QT5A 4Z2XA 1N5YB 5KAKA 3OFFA 2B56A 4B9NA 3MMBB 3KUGA 4F67A 3RU0A 3ETMA 1WWHA 2FZKB 4OLOA 1Y11A 1RYRA 3AY0A 4B9TA 3ZNUA 4XK8C 5BXIA 5EHHA 1NJWA 3J7AN 3EXCX 2EFOA 2FTRA 2VUGA 3HDSA 3PFOA 4RUAA 2QEXS 2VF3A 4LF9F 1YZ6A 2NZ4A 4N8OA 3X1LB 4I68A 1LOUA 2J8SA 2J0SD 1HBMA 3G82A 4LVNP 1SL1A 3C3LA 1S97A 3KDOA 2PIIA 4I67A 1R6YA 2W9CA 5KFLA 2K7JA 2J6SA 4HL9A 2WVEA 4LIRA 4DUZJ 5HLFA 3MECA 5IQQA 1NO8A 2CDRB 3BKUA 3L4BC 1JNZB 4M5DB 3BR9A 5KFNA 1FRLA 1Q7LB 2QMWA 4TQRA 3HHLC 2RHSB 3N28A 5ETSA 5KFIA 3IM8A 2IDLA 2VDIA 5AE1A 5F8LA 1H38A 1UFLA 4WTYA 2R7WA 3NG8A 2VQEF 1VRTA 3HULA 2IJRA 3IRWP 4A8SA 2W01A 2IRYA 2QGFB 3BQ1A 1D9DA 4NYPA 4DSIA 3R5DA 1SUQA 4AD6A 3HKZD 2F8MA 2R2SA 4ED2A 2CJ9A 2I9SA 4ID5A 1WDTA 2XCAA 1F2GA 3HSGA 3FSIA 3KHHA 3OTCA 3R5CA 1SL0A 2OH2A 1D3WA 1NKCA 2LU1A 1S12A 3H5XA 4DL5A 4KFBB 4KB7A 2PMZD 2KN4A 5KFGA 3MM6A 3LAMA 2DD8S 3G6XA 4DQSA 1N36J 3ICLA 4ZP6A 4R8UB 3C19A 2W9CB 3PYEA 1URRA 2F3JA 1VYAA 3EM1A 3MECB 1TK8A 4USUA 5LMNJ 2WW4A 1SJ4P 1VQSA 3J7YU 1OMSA 1M90T 2VDHA 3IMQJ 1L3KA 2Y3YA 1MWYA 3NP5A 1JJ2R 3K8VA 3UCGA 5KFJA 2IIHA 1N5VA 1IWAA 1RT5A 2KG0A 4B9VA 1T8EA 1QDUB 5HMWA 3DU6A 2ASJA 2KVQE 3WHIA 4LF1A 5KFSA 3FVYA 2GQCA 1U02A 5JVGQ 3OSPA 1PBAA 2Z8QA 4OJ3A 1FE0A 5I3PA 1OY6A 3MOZA 4W92B 1IBCB 1PAUB 2XWXA 3GCWP 3H5SA 1YLXA 2O5DA 4X4NA 1JLCB 3B8HA 4AT1B 2OSQA 3DLGB 1F9HA 2YX7A 3DOMB 4GMKA 4IQXA 4JI4J 3MEGB 3FK4A 5A6PA 4H54A 4WFBQ 4M8LA 2MMYA 3H4DA 2AGPA 2X1FA 3Q2TC 4QWDA 3D3CJ 1CJVA 3PY8A 4NLSA 3KG1A 4JI5J 4NCBA 4P9SA 1UEKA 2DIUA 1XMBA 2KYZA 1KTQA 4FP9A 4F04B 4K4TA 1G6BA 1TR0A 3PXGa 1HFEL 4GKJJ 1LFPA 2CIMA 4CTAA 3BR8A 2IRXA 4NEYA 1TV6B 3TZWA 1S57A 4LR8A 1WEXA 4DV3F 1KC8T 1A9NB 3X3UA 2PI4A 1WHVA 3D66A 2X3GA 2CYYA 1V5IB 5IV3A 1U1NA 2HHWA 1DZ5A 2C22A 2BVZA 5HP1B 3PYFA 4LF4J 2RQMA 5DJBA 2BX6A 1TQLA 3TW0A 2YNGA 2UV8G 2BE2A 3E3XA 4IFVB 3OV7A 4J5OA 2WZ1A 3M1VB 4MIBA 2P6TA 2BE9B 1NDPA 2AYMA 4FN5A 5IC4B 2VBZA 2PI5A 4EZ9A 3HZGA 3AA8A 4OI2A 4F0KA 3CDWA 4RW9B 2OEKA 4X4TA 3QIPB 2JLGA 1PYTA 5DGAA 4KHRA 4ZP8A 1F0XA 3T6JA 1N8RT 2E66A 3AQOA 5F41A 1HWKA 4DV7J 3FEXB 3T1HF 1YJ9S 3JSMA 3KOAA 3PACA 3OBIA 4LF9J 1WD6A 3HCXA 3LF0A 3HXMA 1ZM3A 3CCSS 3ENVA 4CTAB 4X65J 4DR3J 2G2OA 2ZD1A 4KPCA 2V63A 4LR7A 4LT6A 4NOHA 5GAGU 3C15B 2ZBQA 2KB2A 2YXLA 2V8PA 3BQ2A 4PKDB 3WX8A 3IWNC 4KIAA 1O0PA 1XMQF 2HNYA 4CO5A 2V69A 3G86A 2V5HG 4ECQA 2UUTA 2Z30B 1LFWA 2CQ2A 5HP1A 3DOLA 3HHLB 3MI7X 2KYXA 2WVCA 2QJ3A 4MT1A 2XNQA 4TLQA 3G6YA 1FJ7A 1KFSA 4ZLNA 2BE2B 2PT0A 2VZ9A 2UZAA 4E2FB 1S9EB 1T03A 4B3TF 4K4SA 3Q2SC 1IM4A 3L9ZA 2QL9B 3T1AA 3UVJB 1SXLA 2CZ4A 3W62A 5DDOC 3Q22A 3W66A 4WIQA 2EBGA 3MM9B 3V6JA 2FUG9 4M5DA 2C2ZB 3DFEA 1TUVA 4JYAF 5K8MA 2YQ3A 3DMJA 2ZM6J 1JJ4A 2DH8A 5D0EA 1SKSA 2JH3A 1HKAA 4KPYA 2VFTA 4ZCKA 4KKOB 2B9EA 3DLEB 3WX4A 1R0CB 4DR2J 2VG7B 5DZ6A 4C3MA 1UL3A 2KVIA 1Q8LA 2E5LF 2CPFA 4NYZA 4DG1B 5E3PA 1RDRA 4KHPJ 1ZM2A 4I7FB 1SJ1A 1UTAA 3I87A 1N56A 1FE4A 2AJ4A 3GYNA 2LMIA 1N48A 3L09A 2G2YA 2LP4A 1BE4A 3H8YA 3CJ3A 3KJFB 1TL5A 2BQ3A 4M5KA 4WE1A 4F4YA 3VAMA 1XNRF 4IOCQ 1WSVA 2BOAA 4A8OA 2UXCF 2ASDA 2C2MB 1XMQJ 1KRPA 4PPDA 3OXGA 1Q86T 1X5SA 2PMHA 1N5YA 4K0KJ 1B64A 2D3OR 2RS8A 3F41A 2CXEA 1VMBA 3QSIA 1DY3A 4HLBA 2BZ2A 4I6AA 1SJQA 5F3TA 1QVGR 2UXBJ 1V6HA 3D7SB 1DQAA 2J76E 4JI8J 4G65A 4DLGA 4KT0C 4C11A 4DPXA 4UY8T 2KT3A 5B08A 5JMNA 3N5BA 3M2UB 4HI1A 3G8TA 2VH7A 3A1YG 2HK2A 2RHQB 3FQKA 2MPUA 1RKJA 1VHIA 2GMLA 3VAKA 1QM9A 2ERRA 4Y6IA 4K4VA 1FA0A 2OPRB 2ACMA 1R0BG 4Y2AA 1FHTA 2WSEC 3DLGA 3RRKA 3IR7B 1URNA 1NZAA 2ZE2A 2M4MA 4RX6A 5DO2A 3KLHA 5FLXY 2D3O1 4OI3A 2DGTA 3DGPA 1EJ7L 1LKZA 5F8HA 4M5NA 5J1PA 3OLAA 5RUBA 3SSSA 2V4JB 3THPA 3Q86A 2N4DA 2R3VA 4BWMA 3O2IA 2HYIB 2B9XA 5A2QY 3GJQB 1FVSA 2GIFA 3PR4A 2MXYA 2FLOA 2QT7A 3R5GA 5GAHU 3FJ2A 3GILA 4J9QA 4YS2A 4ITSA 1HBOA 2B5JB 2UUWA 3NXZA 5A8KB 3KDNA 4RUBA 3VAJA 2DB1A 2HNZB 1FNOA 1S99A 1D9AA 2QSFA 2RU9A 4F25A 1HI1A 2MKCA 3BBBA 4WPAA 3W1YC 3JSRA 3JXOA 2F4VF 4TQSA 1BQNA 1EB0A 3T1YF 1K1QA 2IM2A 4IQMA 3PEJA 4RPFA 2ZD1B 3DRXA 2VFRA 3FSYA 3OFGA 4ZP7A 1WHYA 2X1BA 5E3CA 4JI8F 3AXMA 4WU3A 1Z2LA 3BEGB 5J2PB 3TOQA 1MROA 1VBYA 1YVFA 4FS1A 1X4CA 4A48A 1WF0A 4BBYA 1S0VA 1UP1A 1RWUA 2MHNA 3A12A 4I2PA 4NLQA 5A76A 4DV4F 2CJKA 1JQGA 2ZH5A 2EVZA 5HVGA 3SYZA 4DX5A 1XEZA 3I55S 3RG6A 4WYLA 1LNQA 2CPIA 1AFIA 1P27B 2G13A 4PWDA 2JOQA 2QO3A 2HHSA 2OLWA 2LQ9A 1F9FA 2AQ4A 2GAGC 1N36F 1HYSA 3QGIA 4NLWA 3DNCA 4CO1A 5AXNA 3P4UB 3C6TA 3EVWA 4ZPDA 1XIQA 2M70A 3RAXA 2B3TB 1R0AB 1NK9A 2AW0A 3MUTP 3M6WA 1YRTA 1WNEA 3R9LA 2HVHA 2MYFA 3NLCA 1Y3KA 3MAQA 1S7HA 4JYAJ 2RE1A 1S6QB 3OJSA 2JJ4D 4B02A 4V1Ak 1R43A 3NKYA 4A8WA 1FTRA 4LSLA 2JL9A 5F0UA 1RHQB 4J90A 1N5TA 1HARA 4RWXA 3AOBA 1CJKA 2KM8B 3O3LA 2GO8A 3R5AA 2ZZMA 1ITPA 1FDDA 4CM2A 4WZQA 2O66A 4CLFA 3MM7A 5IT9U 2M88A 1RWWB 2K2PA 1TKTB 3ENAA 3IBWA 1O51A 2N3LA 1KTVA 3MUVP 2MQPA 1WOSA 2DY9A 3CJRA 4J7CA 1U24A 4RNFA 3B4DA 2ASLA 1BWEA 3S8SA 1IR0A 1R8PA 2HURA 4N77A 3F0NA 1SJRA 2FJWA 3TWZA 4ZVFA 4RNMA 1AROP 4KC5A 2PA3A 2QIFA 1YITS 1CQNA 2UXDF 3BPSP 3EZOA 3PFEA 1MMNA 1YJNS 1CJTB 4A8XA 4CLKA 3QLHB 4LVOP 3BO4A 2BEFA 1T9VA 1K9MT 3KLEB 2QRRA 2MKSA 3VQTA 4F0MA 3W3SA 1K73T 5G0RB 1LWCA 1SH0A 4F26A 3TZYA 1SBRA 2VPXB 3ULHA 4EMDA 4LSLB 2NPFA 3HHNB 2XO7A 2MKIA 1U1QA 1YI2S 2K1RA 1VOMA 2DT9A 2RF2A 3M8PB 5I3QA 4Y65A 2IYGA 1AUDA 1WKLA 1Y5NB 4KGVB 5F0WA 3QJLA 4L73A 4CT8A 2DRAA 2YPZA 3A8IA 4WK3A 1XC9A 1TL4A 4ECRA 1F3FA 2XGQA 4C3LA 1OYEA 2BW2A 1BGXT 2X3DA 3UQSA 4L74A 2AF6A 3FBBA 1OQ6A 3NOCA 4JI6J 3AD8C 1HHSA 4HACB 4RWWA 3UPFA 4LBIA 5ETOA 1X4FA 1PIEA 5T7LB 4N47A 3HI9A 3CW2C 3LP0B 4I6YA 4X4PA 2HQIA 3R7BB 3BO2A 3V4IB 3Q8QB 4B3MJ 5C2GA 1U47A 1AYEA 5B0FA 3NS7B 3L3CA 1LWFB 3Q8UA 2GA7A 3RB6A 4QW8A 4MAKA 2XZDB 2Z2YB 1KLMA 1REVA 1CC7A 2BJDA 3E01B 4I6WA 4B17A 4C7QA 4OI4A 2HHHF 1DTQB 2DNRA 2ZWPA 4TYBA 2Z58B 3HK2A 3QJJA 3PTWA 1U0SA 2VG7A 3JS9A 4EYHB 2DXDA 5F8MA 5DETA 5DS7A 5ETPA 1DBDA 4TU8A 3ILOA 4CDIA 2RKIB 2WHOA 3TJ8A 4F0HA 1D1UA 1S76D 4DV7F 1HL6A 2QA2A 4V19J 2LQ8A 4H4OB 4NYOA 3ZC4A 2R7RA 3MPWA 4GKKJ 5ITHA 1W2IA 4ED1A 3QYYA 1AZSA 3GR0A 4PZVA 1LK5A 1TMJA 1JLBA 2GQ2A 2P2CB 4LJMA 3FBFA 2I2YA 2V68A 2JLEA 3EICA 2E7XA 3PIOQ 2FYXA 4NLUA 3GP9A 4GVBB 2B0GA 3HP6A 3F44A 3I56S 2Z4PA 3ZZYA 4HEA9 1N6QA 1H2VZ 1UVIA 4NZ7A 2HVEA 4OV6A 6AT1B 2MZTA 5AXMA 1RLCL 3M8ZA 1HWJA 5E5NA 1RTJB 4I2QB 4ED8A 1SQFA 1U2CA 1UWAA 2LXFA 5LMUF 3H90A 1R3NA 5KOXA 1LW2B 3CJ0A 4CO3A 1S1UB 1X4DA 2HFOA 3D6FB 5CAAA 4TYAA 1HNVA 1QAYA 3MGJA 1NK0A 5DG9A 4PUOB 2RH3A 1JLEB 4RL1A 3UN3A 3HF5A 4CO2A 2ZH2A 2OPRA 3KG0A 1VR6A 4M5JA 3TVZA 4DUYF 1Y5LB 2XS7A 1H0HB 5KG5A 4EO6A 2KXFA 5IS2A 4NLOA 4ZLJA 1IJFB 5CABA 2IAJB 4WFNQ 1RTHA 5KFXA 4CH0S 3MPUB 3AH6A 4F4XA 1BLUA 2UUCJ 5B0CA 1FTCA 3R6LB 2XC9A 4IFVA 5HI7A 1X4HA 2QG9B 1N6QB 2IY5B 1RTZA 3JYTA 3CCTA 4JV0A 4OZNA 2Y1LB 2V2VA 3M8RA 4ED0A 2R42A 2LECA 1S1WA 2DCUB 5CZVA 1AFJA 1I5OB 1WC0A 1UW9A 1M0SA 2D7SA 3LP2B 4IRDA 2OPPB 3V81A 4NMXA 2Y8YA 4H4KC 2B4PA 3PW0A 4F7VA 3J7Z5 3R1HA 2NS1B 5F3ZA 2CNNB 3PRDA 4ZCLA 2Q6CA 4ECWA 4LMZA 1D8YA 4NXNJ 2ZZNA 5CZXA 3DHWC 2PSZA 5KFUA 4ERDA 2EI5A 3DRPB 1H7XA 1Z1ZA 4LF5J 1YQHA 1RHRB 4XAKA 1FNMA 1RHMB 4MK7A 4ANDA 1HD0A 2C2OB 3ISND 3LA0A 4B3SJ 3NL0A 1RWKB 2F4FA 3QLHA 1NMEB 4N41A 4FXVA 3TX0A 4AUKA 2KI2A 2N4CA 1HBMB 3G82B 4O4RA 4ZN1A 2BM0A 2WRMA 1U8WA 4YY3F 1W7WA 2CNOB 2GS8A 2LA4A 3JQJA 1ZM9A 3OFHA 3RBDA 1RA7A 2OMLA 2Y9HA 2VQEJ 1JXVA 3BREA 2UUCF 1DJ0A 3RYLA 2VPYB 3CDAA 2DHXA 4JI0J 3IRXB 1HNWF 2FJBB 4LIWA 2XYGB 4FXWA 3D6TB 1GXTA 1SQGA 4CLTA 4BHQA 2XI2A 4E8UA 5E41A 3DLHA 1C4AA 2M8HA 1IR1A 2KO1A 2NREA 4F02A 4J37A 4KKOA 1HHQA 2ALZA 3EWGA 3PHEA 5L8RC 5F8IA 5KG4A 4P2SA 1SKWA 1H3DA 1X4AA 2CVEA 2GAHC 2KT2A 4I7FA 5FD1A 1N33J 1RT3B 3SI8A 2QA4S 1RT2A 2AJ2A 2C3PA 5KG3A 1EIYB 3BYRA 2DXEA 3DHXA 5T7LA 1FXLA 4U7CA 3MXHP 5HJXA 3G96A 2JRSA 4OMFG 5J1NA 3B4MA 4CNZA 3TR5A 3IBCB 1U1MA 1FWLA 2DRDA 5KG6A 1M5PC 5H9FK 4G1QB 4DV2F 4FF3A 1G4CA 1S6UA 5KFMA 3BN7A 5E3AA 2EEYA 2CPHA 3LP1B 4J9LA 4CT9A 1C0UB 2CQGA 1RU2A 2F1FA 3QSYB 4U95A 2FVQA 4O44B 4ECVA 4C98A 2HPUA 2XCPA 3B78A 3VAGA 2OKQA 3FGVA 1F5BA 4IFYB 1BUXA 1HI8A 3A13A 4FKYA 3W65A 3M8YA 4QWBA 1WF2A 3I0SA 5ETRA 4ZJLA 5KG2A 1VK8A 4DPYA 4DR6F 1NHKL 4JI2J 1WC5A 3GJRB 1VQOS 4NASA 5KFDA 1S48A 3FDSA 4DSFA 1A0OB 4C3KA 2QA4G 3CWJA 4K4XA 2E9ZA 3QGGA 3SIPB 1YJWS 2MZSA 3QWPA 5EWGA 4Y28C 3MD3A 4TKTA 4DXLA 1RKIA 2HZCA 5KG0A 4ZPCA 4WCEQ 2FJVA 2HMIA 1FDNA 1F5AA 2YTCA 5BYRA 2V8VA 4B9UA 1IJEB 1PCAA 2BJ8A 1FWPA 2HFVA 2BACA 3J81Y 1VIXA 4F3MA 3NGDA 2GMJA 4KGZB 4LRAA 1YJ7A 2XMWA 2KDOA 1JLCA 3C66A 4OZ1A 3LO3A 4ILLA 3SCKE 2HS4A 3VALA 2CZ9A 1RT5B 2CFXA 2ZVSA 1CJVB 3SFUA 1KLMB 1REVB 2YWHA 1W26A 2ASYA 3O1LA 2ROPA 4U67Q 2Y8WA 4WP9A 3W5ZA 4DX7A 4G3IA 2RRBA 1V5VA 2OGUA 2OD4A 3DI6A 5B7WA 5LJ5Y 1NDLA 4LF2A 2AEJA 3CF5Q 5D6GA 4OHVA 4RW8B 1R89A 2HLTA 3HLUA 4WFAQ 1AUSL 4ZPTR 4OJHA 2V2ZA 3QIPA 2F4VJ 1VLOA 3PR5B 1SC6A 4USMA 3CJQA 2GFFA 1RU1A 2MB0B 1WC6A 1GAOA 2DNNA 5LXRA 2MLXA 2JZ5A 4DUZF 4WYWA 1WG4A 1H2TZ 1Y0HA 3EMTA 5M2UA 2HIYA 2BJ9A 5CQGA 4Y0FA 2FHJA 3JTOA 3GTYX 4L6V3 4OIXA 4Q7AA 4MKBA 4LREA 3MFIA 4LSZB 3TI0A 1KLNA 1HYSB 1B0TA 3QIDA 1NKEA 1S6PB 4UT4A 4TLRA 3LALA 2DGWA 3KWMA 5CYJA 2MZ1A 4IRKA 3P6YC 1C1BA 1NBEB 1OS5A 2FGCA 2HQGA 3BH7B 1WEZA 3M2VB 3OR1A 5KFQA 2XMUA 2CJQA 3NWRA 3CCLS 3PRBA 4ELVA 5I4MA 3FMWA 1QSLA 2FVPA 1N32J 3GR1A 3SSRA 1HNWJ 4DI6A 2RUSA 2F65A 4OHZA 1WKKA 4EUVA 3JSMB 3ZZ0A 1FJEB 1IBMJ 2ZH1A 5DLGA 3U1MA 3FRYA 4KR0B 1RT2B 4B3RF 1FD8A 2MKKA 2HZVA 3T6BA 4YR0A 1E6YB 3GG0A 4UQGA 3EJMA 2F63A 3H59A 2CNKB 1YDLA 1PBUA 4P2MA 1TVRB 3IG1B 2H9ZA 1TKTA 2IAJA 3FEYB 4Y3CA 2NXCA 4DR5J 2H51B 4JV5F 1WOPA 3MMBA 3NWGA 4PR6A 2FY1A 2M52A 2LLZA 3KMQA 1HLWA 1M1GA 1VCTA 4UZBA 3SEOA 8RUCA 4YHHJ 2XLJA 1F3VA 4OYIA 4DSKA 3OTDA 2HSEB 3CMAS 1X5PA 2F7VA 2RJZA 4IG0A 3THVA 1FJCA 5A0YA 1SJFA 4Z7CA 5EN1A 2M9KA 1G1XA 2QA1A 1VQ7S 5EWEA 2E7VA 1OPIA 1XR6A 1PJ7A 3FMBA 2DGXA 2GZOA 4YMEA 5IM0A 5FLXU 2B7BB 4TU9A 1U48A 2E5JA 1N0VC 4JI4F 1SKRA 4NI2A 5DLFA 1I94J 1DAXA 2V9WA 1RISA 2CG4A 1ZH5A 3BSCA 1P1TA 3GYGA 3C14B 4J9UE 3ZZUA 3SSQA 1PJ6A 1X0FA 2ZNYA 4JI2F 5JJBA 3CC7S 1Z4UA 1Z2ZA 3C16A 4UF4A 5D78A 4DV0F 5C42A 4DQPA 1L3VA 4EWTA 3PIPQ 1I6JA 4C4WA 2W2PP 4ZJQA 4Q2LA 4DCJB 3MFHA 2AJFE 2ZVIA 4WKRA 4O4GA 4L3KA 4OHWA 4UUXA 2KTQA 5ETTA 3DDNA 1WTFA 3GONA 4URQU 4GC6A 2YH0A 4DSLA 1Q5YA 1RT4B 2F9DA 2YQ0A 2A6OA 3NNHA 2DIVA 4NCGA 4IRCA 3MMJA 3POTB 1VQYA 3PX6A 3V4IA 3UO0A 4IUFA 1GX6A 1JMTA 1GXLA 2CZVC 3NAHA 3US5A 3PKYA 1ZA1B 2XHCA 4C6AA 3I96A 2EKNA 2U1AA 3OFEA 4O3NA 2PD1A 3TZZA 4USTA 2EC0A 2DHSA 3E01A 3M6UA 1UJ5A 3J7A1 5K8PA 5KTQA 2VFVA 1F60B 1WORA 1RWMB 3C46A 3D6MB 4OYAA 4UUWA 4ZDNA 2DNPA 2BMBA 2EK1A 3PW5A 3SBMA 2FLLA 4LF7F 4DF4A 3GCXP 1FXRA 3OVSA 1ZOTA 3G6ES 3K58A 1JLEA 2PE8A 2HHPA 4NZ6A 4X4RA 3OLBA 3RRGA 5GMKa 1S1XB 1X8DA 3DRSB 5ETKA 1SVDA 2BJ7A 5IFMA 4FS2A 4NXMJ 2OTJS 4XPEA 2Q66A 4AL5A 5SUHA 3BJYA 3TA1A 2XBPA 1WG1A 2M0GB 1AW0A 1FERA 2E7WA 2CJBA 3GLJA 2W7AA 4JUZA 2RRNA 4DEZA 4DV0J 2FC8A 5D0HA 4A4JA 2WK4A 4GVBA 4LRDA 1GXUA 4KHMA 4F4AA 3J7ZT 1S9GA 1UMJA 2OUGA 2DHAA 4TY8B 2ACYA 4NEZA 1K8AT 1FWKA 1IQZA 1VBKA 2YX4A 3CCVS 4HHJA 3R2CJ 2LVWA 1NU4A 1YTYA 2BANA 5HMXA 1NDCA 1H6KX 1P9YA 4CO0A 4MYTA 2IVMA 5FDLB 3PDNA 2IBKA 2Q3PA 2JFDA 3IR6B 2MTLA 5CD4H 4AQYJ 2FC9A 2LDYA 1U1LA 4O3SA 4C9DA 2DEJA 3UE2A 1VBZA 3NY0A 3MEDA 2EFPA 3MCNA 2MGZA 1N34J 1RJJA 1EKSA 1Q0NA 2BKNA 2LCWA 3P5TL 2ZOMA 3AODA 4ICLB 1T02A 4CCHA 4IG3B 1PYOB 4FF4A 1YX2A 2FIUA 2AYBA 5GMDA 3DOMA 3LWLA 4ECTA 2EBEA 2HBRB 1GT8A 2EW9A 4OYBA 1IKXB 2RRAA 1HMVA 1NK5A 4X66F 1NZ8A 1KVIA 1JKHB 1S4EA 3MAAA 1ACMB 5L9XA 5DG8A 4PG7A 1NK4A 4PXEA 2HMIB 1VQ5S 2KJWA 2VBYA 3GU0A 4TY8A 3M1VA 2U2FA 2FY8A 3WC2A 2H5JB 1LEOA 4AFFA 2W9BA 1NPKA 4LSNB 1Q79A 1RI7A 3OVAA 4NA2A 2HHHJ 1LQ9A 3PZPA 3MM5B 4N5SA 3CSKA 1U4BA 2HLUA 4DCOB 3W63A 4C8KA 4WWSA 4ZN3A 4HHUA 1V3ZA 2WW8A 3MUMP 4BCAA 1VC0A 3GIIA 1DTTB 1RHJB 2JHEA 3H2UB 1UZHA 5K5MA 4DLEA 4P2XA 4LFCF 4MFBB 1FRMA 2L08A 1F9EB 5E2QA 2KFZA 1PKUA 1YJTA 2LFVA 3BKFA 1UEUA 1ZZNA 1WSRA 3MDFA 1HW8A 2IA0A 4DFMA 4W98A 3KLFB 3A8JA 4A8YA 3MZIA 1RT3A 2DO0A 4AXJA 2XULA 1DURA 1MNEA 1NH8A 4Y2MA 2ZWOA 4I64A 2ROEA 1CJTA 2HIQA 3PJXA 4DPTA 2V8HA 4IH7A 1X4GA 3EGZA 1Y3JA 2VASA 2FGOA 3I4HX 4O4GB 3H20A 3VZIA 2PDAA 4FYWB 3G8SA 1RT4A 1Q82T 2QLJB 1EHWA 3AB2B 4PG5A 4MYUA 3CCMS 2EXUA 4UOHA 4LFAF 1J5OA 2JEIA 2ZC3A 2J6UA 2V34A 3ZZTA 4OLPA 1SCJB 3SV4A 4X4SA 3M30A 3C14A 2LA6A 3GQCA 3JB9k 2YPYA 2L3MA 4UQTA 3MMCA 3NBPB 1J5EJ 1FEHA 5LT5A 2E9RX 1R6VA 3GFZA 3IR5B 1ZZFA 2EWHA 1U0HA 1PC5A 4LRFA 3SFGA 3VWSA 4A8KA 3V6KA 1S1VA 2XYHB 1KOOA 3TARA 5L38A 3Q24A 2R2UA 5DM6Q 2I5JA 1IWGA 2LYVA 3I82A 3L7UA 4GO7X 3UD4P 1U1RA 3CCJS 4J9RA 2W2QP 3CXCR 1N88A 4LUBA 2CPEA 4YB5A 1S1TA 3HSZA 3MM8B 4ZVUB 3THTA 4AE5A 3J80Y 4ZJOA 2Q79A 1Y00A 2V8GA 4RO0A 4ZVQB 2N7CA 2W24A 1JLQB 2VKZG 3QGPA 5ETLA 1J27A 1WG5A 2HQDA 4HDGA 5GAHI 4QOTA 3J80U 2XQCA 2E5LJ 3C2PA 1RAOA 3EPGA 2BR0A 2AYEA 2E5HA 1T9UA 5KFCA 4G1QA 2MJNA 1WTBA 4M63A 4QJVA 3QQCD 1TL7A 2HEKA 2MHEA 3NS6A 3I5AA 3JAMU 1AT1B 2VG6B 2NCKL 2CWXA 3QMQA 2UXCJ 5IQ6A 2KRRA 2HKEA 2BQUA 4DR6J 4JI5F 4ID5B 4KAIA 3L7OA 1NJYA 4OX8A 3SV3A 2AWZA 2MQ8A 3CDBA 4MIAA 1K1SA 3BGRA 4FNHA 1QTNB 3ZTPA 3CCRS 4RU2A 5H1SV 2I0XA 1AB8A 5IM0B 2BE7D 5EX3A 4P72A 3O6QA 1N4LA 1VJQA 3DLJA 1VQ4S 1KR4A 3VV2B 4CLWA 3DI6B 3M2RA 1HA1A 1N54B 5CYQA 2CVIA 2PC6A 3RBXA 2GMHA 2FZCB 2J9DE 4C8LA 1T9YA 3R5BA 4RU9A 4X65F 1KVJA 2CDQA 2JC0A 3OL6A 2LQBA 5EX0A 1X31C 2DNHA 2XM3A 4S0MA 2NSCA 5DDQC 5D4NA 5AT1B 2WVDA 4NLDA 1KQKA 1UJ6A 3RR7A 4ZPVR 5KOWA 4RJVA 5L1LA 2I8EA 2YKAA 4CNYA 3B6BA 2EKYA 5T41A 2NXEA 3NMRA 1LK7A 4WXWA 3PHTA 2HW3A 1SV5B 2XSFA 5KFZA 4F36A 3T1HJ 2FLNA 3PO5A 4NE9C 5D4LA 4E98A 3MR6A 1WEYA 2AT1B 2LQ5A 1M1HA 2CJYB 2KHDA 2ZZTA 3BZQA 1TKZA 3NCPA 4HDHA 3GSIA 2G0JA 4ZVEA 4KV8B 5KFYA 2DR5A 4NXMF 3KTQA 3EPIA 3W9HA 5HJYA 2R4FA 4LRCA 1B7YB 1HR0J 2BJEA 3MF5A 4LFCJ 4P7VA 4X4QA 4RNHA 3UVJA 3OTEA 1U09A 5KT2A 3R1LA 4PABA 1M5VC 4QIWD 4WFZA 4ZHRB 3TUPA 5A8KA 2JEFA 2R8GA 2NPIA 2GO9A 2ZUAA 3IXQA 4QIEA 3RJMB 1RBAA 4X4OA 4LF5F 1MN7A 2X7IA 3DM2A 3M8QA 1RTHB 5LJ3Y 4DL3A 2VU5A 3IA0A 4ZCMA 2BYCA 1RCXB 4DUYJ 1RTDB 1VDHA 1W25A 2DGUA 2EC2A 2MZQA 4I1TA 3AOCA 4EFAC 3O44A 5HBMB 3HSDA 1OSDA 2ROGA 2P5VA 2GX8A 4Y2CA 4OZ2A 4QYRA 3H98A 4DU7A 2ILZA 2UVRA 3UN5A 3AD9C 2DNQA 1MW7A 4ID8A 4Q2MA 1NPRA 1ZTTA 1SIWB 1BD6A 4I4BA 1QE1B 3HFVA 2CRLA 2VV5A 5KT3A 4HTJA 4LBPA 4YHHF 2ZEJA 4KRWA 3N5FA 3T5KA 1VQLS 2MGZB 4F4KA 4ILMA 4NI2B 1Y4ZB 1L3TA 1S1TB 3MM8A 4DL2A 4ICLA 3HPOA 3OUYA 3D6HB 4FPRA 4NPOA 1WUUA 1RLDA 2JC1A 3M30B 1B3TA 1IBLJ 2IFXA 4BWJA 2M2BA 1FRJA 5ETQA 2VQFJ 4C0BA 5KFBA 2HHXA 1IKVA 3FEZA 2CUYA 1X9MA 1RYSA 2QFIA 4DUTA 4P75A 1K44A 4CM0A 2XGPA 2B6AB 4OI1A 1Q78A 4IOBA 4ZIVA 5ETNA 1XK8A 3VGUA 3FSXA 2NSBA 4DV5J 1B4SA 4ED4A 3QWUA 4KE5A 1Q8BA 3D3BJ 4OZ3A 4LSNA 4DQIA 2HS0A 4DV2J 1TFYA 4QU7A 3ADAC 3POTA 5J2QB 3H25A 3UCUP 3B82A 8ATCB 4FBTA 1RWVB 3T5JA 4ELUA 3LANA 5KG1A 3RB0A 4JV5J 3DOLB 3HHLA 3HHEA 3W2WA 1FX2A 3LPYA 1S49A 2IRUA 3I6PA 3QJPA 1RT6B 2OIHA 3H0PA 3MEEB 2BABA 1EARA 2LXIA 2FJXA 2EFNA 3ZFVA 3DLEA 4XDCA 2P9GA 3DKDA 4ES2A 4FYDA 1H98A 4ZP9A 3CC2S 2EFGA 3D0GE 3OUYB 2BKOA 3GIMA 3QFWA 5LMUJ 2MLZA 5HATA 4QW9A 1NSQA 2K3KA 1HBNA 4OYXA 5HN0A 5KFWA 3IRXA 1FVQA 3GIJA 4DWIA 3UCZP 4RZRA 4ECUA 3HJFA 3LAKA 4MK9A 4QYZJ 2B6AA 4L72B 3EYZA 3FBCA 4U8YA 5HAOA 1GH8A 3A3NB 2CA9A 4HACA 2YBVA 2MKYA 3LP1A 4K7QA 1P1LA 2HAFA 2IMOA 2MSTA 5I42B 1RQ0A 3Q8YA 4EGLA 2YKOA 4NZ0A 2WB1D 4QBUA 2OPQB 1MROB 3HJVA 3TRGA 2IMWP 3HO1A 3CD5A 2XMVA 1WHXA 3DRYA 1Y10A 2CNLB 2AP6A 2KH9A 4DZDA 1MWZA 4U8VA 4DSEA 1S6OA 2GQQA 1NJIT 3KK2B 2ZH9A 5D77A 2VPWB 2X1AA 2J8AA 4Q8FA 2WOMB 3HVTB 5I3UA 1RB0A 3N0VA 1BXNA 1OY8A 1G3OA 2D9OA 1NSKL 4F50A 2VOOA 3DN9A 6FDRA 2WB4A 1SV5A 4CRJA 4YY3J 1FF2A 1TKXA 3CD0A 3EGWB 2CQDA 3BDPA 4NMLA 3UWTA 3JQKA 3MTKA 4M5HA 3MMAA 4DQQA 2YKQA 1HNXJ 1TKZB 4JI7J 2MJUA 1S79A 1RT7B 4PXBA 1WACA 2ZHBA 3NEKA 2DR7A 1YBUA 4O3QA 1RAFB 2HWIA 2DNMA 2RQCA 5HBMA 3CMQA 4JI1F 4JOUA 1TK0A 3V2UC 2KJVA 2XS5A 2HAIA 4PG4A 1IUJA 2OMOA 3PX0A 1IKWA 2ZE2B 4CLSA 4FVCA 2DR9A 1YK9A 3HVAA 5E7OB 1T95A 2KKHA 2MQNA 1GTEA 2PO4A 3CJTA 2HGMA 2CPJA 3O5TB 3O8WA 4PQAA 3R7NB 4F4ZA 2VG5A 1Q81T 1S1UA 2MY8A 2A0FB 4N76A 1BQMA 2V4JA 2ZKUA 5I3UB 2BOPA 1DFDA 2Z57B 1IR2A 2AU0A 3AJ1A 2O01C 3TX8A 4MTPA 2C3UA 3RTVA 5E3RA 4PPZA 2YWFA 4RW8A 2NXUA 3MTJA 1L3SA 3IFEA 2HNZA 3BYPA 2B9WA 3GG1A 3MEGA 3R3TA 3UDCA 5KG7A 3PNIA 2XLKA 1CJUA 1WI8A 4I2QA 4OQJA 3LGNA 1RT7A 2C3MA 2NLWA 3MM6B 4FZVA 3TO8A 2HRYA 4BC7A 4GC7A 1J5EF 2OTLS 2HHTA 1U7LA 4WZMA 2J7KA 1JJCB 3D5MA 3LUYA 1S59A 4X2BA 2ZITA 4ZLLA 1HNIB 4DFJA 1TFWA 4XTTA 4ZCIA 3C6UB 1RT1B 1X60A 4Q43A 3OL7A 5HLFB 1KQGB 1KP6A 1MU2B 1JLAA 4WIIA 2IVFB 5AE3A 4ILRA 4M5IA 4NWBA 4WBFA 3M9NB 1LXNA 2NXJA 2MSSA 3MPYA 4ZPWR 1BHNA 1T11A 1P8GA 2C1EB 4K5RA 1FFWB 1BQMB 4ALZA 2YKMB 4MJKA 2OSRA 4MKAA 2E1AA 5C24B 4G1PA 4KBIA 3BS9A 2AMCB 1Q95G 1YJUA 2XSJA 1VQ6S 4OYPA 1E6VB 3N6NA 1WC3A 2DGSA 2H1YA 3KLFA 5LL6d 3VTIA 1H73A 1VQ9S 2HWHA 3PJWA 3D1HA 1IBKF 3TAMA 4OYMA 2F9JA 1IQTA 1S6PA 2JNJA 3FFIB 4URGA 1X9SA 2BXJA 4LF8F 2YWKA 1CBKA 1RP5A 2DKOB 1S1WB 2UXBF 1CS4B 1FRKA 4QZVB 1PGZA 5HVHA 2C3YA 4P74A 1FFGB 5HL7Q 1TTHB 2DR6A 3QO9B 5IC6B 2YNHB 1NPPA 3CIZA 4ELTA 2B43A 4NXNF 3MEEA 5KFRA 4DL6A 4OJGA 4GKKF 4X4VA 4IO1A 1J5OB 3P96A 2PMWA 3V5RA 2XY6A 1EKRA 4K4UA 3EGNA 3IWLA 4DS4A 3TEGA 4RW7A 1XN9A 2K3IA 1B0PA 5L1JA 2GC8A 1NKBA 3C16B 2XMTA 2HNYB 3VF0B 3OR2A 1UVKA 1IVZA 2DJWA 2MQMA 5KFHA 5HMZA 5KT5A 4I56A 1VQNS 3W61A 1JLBB 4R0EA 4TNOA 4NRUA 4C0OC 4PQUB 3ELHA 4XIUA 1LWCB 1HWIA 3KNAA 3Q8PB 4OHXA 4LRBA 3Q8RB 2AGOA 1FNXH 2LDIA 1FK9A 1RUSA 4O0IA 3N9UC 2CKWA 2F5GA 3BGOP 2QMUB 3CJKA 2WBRA 4ZS6A 2DNGA 4N56A 3N6LA 1JIHA 4F8RA 3M05A 2W7OA 2YWWA 2O3DA 2XMKA 4OZ5A 1U25A 2VOPA 4W4MA 2DH9A 1X7VA 3ZTQA 4DL7A 5HVFA 3H4BA 3KLEA 3K89A 2C2RA 4FXDA 3GV8B 4FF2A 1D9FA 3TAPA 5AXKA 2GVZA 3WBZA 5IT4A 2CPXA 5F9NA 2YNIB 4ZKAA 1TK5A 3CJ5A 1T3NA 1UA0A 2CQ0A 2ZUGA 4FDFA 1PG5B 4NCGB 2JLFA 3CO0P 2RF2B 1C0TB 5J2NB 3GIKA 2AYGA 1IBMF 4RW4B 3N6MA 1GMUA 6FD1A 3ZTRA 4F2RA 2ZDPA 2OFHX 1MN9A 3AD7C 3I4PA 3M9OB 4CI0B 2HFUA 5JUMA 1U49A 5F8JA 3I0SB 4WE1B 1JXEA 4DR7F 2VFUA 4DR3F 3UD5A 2DR8A 4JI3F 1GX5A 1RT6A 2IPOB 4H4MA 4I69A 3NCQA 4Q44A 2E29A 4QQBA 4DV3J 2QLWA 5B0GA 3T9ZA 2W2NP 3CT9A 4WK1A 5LXYA 1KEKA 3TZXA 3KNGA 3G4SS 1HHTP 3BGLA 3CIMA 4FBUA 4UY85 2UU9J 1HQEA 2AJ1A 2QZ8A 3E8OA 1XMOJ 2PEHA 2PFDA 5F8NA 2COLA 4HI2A 3SQGA 7FD1A 2OEMA 1FKPB 1ICEB 5CHCB 1QAIA 4PWWA 2VB6A 4MMOA 3Q8VA 2BRLA 2NR0A 3WIVA 2R7UA 1Y7PA 1SH3A 4B3OA 4ZVOB 5KFFA 3KMSA 2ZHAA 1FO1A 3D1QA 4Y34A 1XERA 2XLIA 4P2FA 2FJEB 1S9FA 3FCWA 1QUVA 1S9GB 3IBFB 4OX9J 2B8QA 3AXKA 4ENOA 1XNRJ 3UW1A 2VC1A 3UDVA 3BB5A 3EDQB 3K17A 2EG1A 2RU3A 2C2EA 1RXOB 5ETMA 3KK3B 1VQPS 2QLFB 1UJ4A 3CB4A 5H9FJ 4QWAA 4J9SA 2VJUA 4EO8A 2M8DB 4GKJF 1QE1A 1PILA 5GAGI 4NCAA 1TU0B 4HHHA 1IXKA 5D3GB 3HD2A 2KHCA 3OXFA 1XNQJ 5BR8F 3EX7B 2H4WB 5C25A 3R97A 2DHHA 1KBRA 3CCWA 1OY9A 4A8FA 2RQ4A 1GMVA 4KHPF 2GIQA 3BSAA 4O3OA 2ABYA 5HROB 1RE1B 1WJ9A 2QC3A 3UR3C 1LW2A 3CDUA 3U1LA 3K5NA 3MAAB 1LV5A 3CC4S 1ZA2B 4R5PA 3AFGA 1YSJA 3GFHA 3GV5B 2D69A 1N52B 3A8KA 1PO6A 2AEFA 4Q45A 3G71S 2HGLA 4WJBA 2GW8A 2YX1A 5J1EA 1X0PA 2W4CA 1WELA 2GHVC 1CULB 3CE8A 3W7BA 5A2QU 3BKTA 3M32B 3FFIA 1T05A 1WHWA 4OX9F 4ETXA 1HMVB 1UZDA 3BM7A 5KFVA 3TNVA 4KGMA 3R2DJ 3LP2A 4F4WA 2J7UA 3M8WA 1UVNA 4PQUA 2E5IA 1NHVA 2VICA 2GJ2A 4OV1A 1M5HA 2N3OA 3DXSX 1TAUA 2AEMA 4EI2A 2Z2ZA 3KLIB 4NL5A 1O5JA 3VAHA 3IM9A 5A8RB 1H74A 5IT0A 4DV6J 3G6VA 1N32F 4K59A 1VLYA 3QFHA 1EAYC 3H42A 3DMJB 1W2BR 1M5KC 3D54A 3KHLA 1WC1A 3GPAA 1CJUB 3A8EA 3M2VA 4YDDB 4YR3A 4QCLA 2FVRA 4OX7A 4RUHA 1VJWA 2B4UA 4Y2KA 2QYCA 3BH6B 2I6WA 2EG2A 1VRUB 1IBLF 2ALYB 4QU6A 4FF1A 3TQ1A 1D8ZA 2WVFA 3E51A 1CLFA 2YY3A 3EUNA 4NA1A 4FPIA 3M6VA 3GSDA 1XQIA 1V3RA 2BA9A 1FI4A 1SIZA 2QV6A 3CJ2A 4GRSA 3ZZRA 4EK2A 5K20B 3KLHB 2UVUA 1H72C 2CJAA 3QATA 2O67A 2BKPA 1KQSR 2DGVA 1MMDA 1Q16B 3HFZB 3ILJA 3LH2S 1UPPA 1T0TV 2I5JB 2JFKA 3D9BA 1WI6A 1ULRA 2RDIA 3MR7A 3RB3A 2E1CA 1UVMA 2KFNA 1C2PA 1FKPA 2E5GA 2V94A 2EFVA 5C2CA 3MMCB 4LF6F 2ZH6A 4C8ZA 4TU7A 5KFOA 2WVBA 4ATNA 2HZAA 2AX0A 3I31A 3I0RA 3LGHA 4ZVRB 4ANEA 4WTOB 2KZZA 5IT9Y 1TL7B 1HW9A 2JWNA 3EVOA 1B7FA 3K5LA 1C0UA 2MY7A 1SQEA 3CD7A 3KKFA 3M2RB 4QIFA 2DCLA 3S1TA 3TUIC 3CCUS 5J2MA 3OJUA 2DGQA 4K4WA 3LW5C 1KNZA 4CLLA 1JLQA 3HZEA 1BC6A 2DNZA 3JSYA 2W9AA 4C97A 1T9XA 1RK8A 1M1KT 3W9JA 2A18A 3RZAA 2H5IB 2XI3A 4WP8A 4ES3A 3KK2A 5KT4A 4RLEA 4IH6A 1EETA 5K14B 2I1RA 4ED5A 2OPSA 4AL6A 4ZVPB 1YJVA 3JTPA 2FDNA 4CLPA 2LU2A 3ILIA 1RBOB 4CYUA 2E1MC 3P8BB 3I9V9 3LP0A 1RAJA 1QJHA 2XY5A 2RT3A 1FRHA 5ADZA 1C1BB 4P7TA 3GB0A 1HPZB 3U27A 2KT5A 1ZPWX 1QD1A 3FRZA 5CH7B 3MR3A 2E1PA 5IOLA 1RZMA 3D68A 3W9IA 3R6GB 2GGPB 5SZTA 2CQ1A 3HSJA 2KZMA 4N8NA 2L41A 2HFSA 2H5EA 4J9PA 2UXDJ 4QPTA 2P8IA 1VGYA 1GMWD 2VPZB 3TA0A 5T14A 3NGTA 4HVZA 2JEJA 1TV6A 3D67A 2IJNA 4C48A 2R7VA 4WXOA 4G6VB 1SC1B 1VBXA 2ZC4A 1S72S 1F2HA 4ZIWA 1LW0A 9ATCB 1QUPA 3DDIA 4H4MB 4OI0A 2OPSB 1NEEA 2J9EA 3N4WA 1U45A 2QL5B 1KD1T 3GJTB 4X62J 3SCIE 2KM8C 4URSA 3SXLA 3V6DA 2HBQB 1TZ0A 1R8BA 4QPXA 1KWMA 3M32A 1T05B 5FDLA 3G8QA 3KLGB 4YEAA 3VGVA 1VQKS 3ENWA 3NNAA 1IN0A 3W60A 3T3FA 3ET6B 4KH0B 3HT3A 4QWEA 5DM7Q 4WP3A 3H7HB 4R8UA 1YGYA 3CULA 2QYGA 2PA8D 3TJAA 2W9BB 4UTGA 4ECXA 3P3DA 5D15A 1RTDA 1B0VA 3Q89A 1XTZA 2ZDOA 3T1YJ 3SMZA 1KS2A 3AOAA 4RW9A 4DN0A 4UOGA 2M7SA 1CJKB 3DLBA 3M8PA 1GMWA 3K8WA 2FJDB 1YRUA 4YUDA 1TL1A 3HHLD 5C42B 1EX8A 2XNRA 3BQ0A 4X62F 2A3JA 3MM7B 4YB1P 1CPZA 2D41A 4ER8A 5C24A 1JKHA 4TVAB 4B3MF 3D0IE 1XMOF 1B70B 3L7PA 3M7VA 1VK3A 2CQIA 2DISA 4DJBA 3MCOA 2WBMA 4ZLPA 2YKNB 3VGTA 2DYAA 3UNGC 2R2RA 4WU2A 2XEXA 3DGVA 1CVJA 2MZJA 5EUHA 3TAMB 3ZZOA 1YJRA 3CJKB 5CCMA 4DR2F 1DRZA 2OI2A 4M5GA 3AJDA 4BS2A 2DNKA 3B54A 3P45B 4XDDA 3TVYA 1FX4A 2LXUA 2QE5A 2SXLA 2D9PA 2DNYA 3AHPA 4QIGA 4L3NA 1XBWA 3RAMA 5HMYA 3SCLE 3KK1B 4C8MA 1ZETA 1F1BB 1LWXA 3HM9A 1NHUA 4FNIA 5DRKA 3UR0A 2UUAF 3MOJB 3WIUA 5CYMB 1S9EA 2GVZB 2LEBA 1T03B 3OVBA 4LF8J 3ILLA 1I51B 3OSNA 3OQ2A 1L5UA 2D1CA 2FHKA 3FCVA 3HHKA 4IYQA 3W5YA 3RRHA 1YHQS 1SC4B 4AYBD 2UUBF 1APSA 3DRPA 1QLNA 3U7JA 4KSEB 4OYZA 3VQSA 4OL8A 4C8YA 4ES1A 3D28A 3AT1B 4YB6A 4IR1A 4CH7A 1HNXF 1N33F 2XZWA 1EETB 2YH1A 4B9MA 1KONA 2GIRA 2HNDA 3I5BA 1TL3A 2OELA 2WONB 5JXSA 1GK8A 1NB7A 1QAJA 5DGBA 1LWEB 2V67A 2ZKTA 2VBWA 5DZ7A 4CYUB 3K5OA 2XMMA 3MD1A 1VC5A 2QSWA 1YG0A 3M6XA 2J0XA 4B9SA 5F8GA 3GV7B 3BF4A 3MPDA 2RB7A 2NUUG 1U1PA 2BANB 3QZ8A 2UVWA 2C42A 3LQVA 2HS3A 4DV5F 1SB6A 1U0HB 3UNYA 5BR8J 3FZ2A 4LR9A 1RACB 2PN6A 1TUGB 1ZPVA 4QR2A 3VVTA 5M2PA 4AL7A 3TANA 1I3OB 4A46A 1RSCA 1HBUB 5KT6A 3EE3A 1C1CA 4KGKA 2M5YA 4DR4J 2WAQD 1RAAB 4U9RA 2ATLA 3CCQS 1U26A 4IH5A 1G2EA 3JTNA 1FDBA 4G1IA 3V6HA 1LXJA 1NM2A 4HT7A 5H9EJ 3DGPB 2D74B 1NH7A 3QAEA 2HWTA 2ILYA 1V3SA 2D3UA 1HIYA 4KFBA 2EPIA 2XMAA 4XPCA 4XO0A 5D3GA 2FVCA 4HH0A 3GIRA 5KFAA 5C5JA 3DOKB 3ENQA 2WOMA 3HVTA 4TY9A 2VG6A 4BLGA 3NNCA 1UVLA 4X66J 1TELA 2IDEA 2K8GA 3JYTB 3OHAA 2MQOA 3RB4A 1HBOB 2B5JA 1WF1A 1RTIB 4EU0A 5JVHQ 1OYDA 2NUHA 1M5OC 4ZVHA 1NSPA 2Y1RI 3KUHA 3NGUA 3GWCA 2HHUA 2ATCB 1NNDA 2KXNB 3M8SA 2R9LA 2CPDA 2FHMA 2UU9F 2CG8A 1V9OA 3FBEA 2AIRB 4YN3B 3K5MA 1HBUA 1HNZF 3LGMA 3HHDA 2W25A 7FDRA 3G9CA 1FKOA 2FD2A 3NOGA 1O6XA 3LTOA 3S6EA 5AE2A 1HWUA 4YB7A 1RAGB 2ZH4A 2HQ3A 4K50A 2YWGA 3L95X 3LOUA 2QFJA 2X1GA 1CQMA 1JB0C 3KFWX 2J7WA 3MMAB 4KH1B 4B9LA 3C8YA 1F6TA 2ZBPA 2NQPA 3KLGA 2I38A 1U6BA 3H2LA 4O23A 2W4DA 4RUCA 4K4ZA 3Q0AA 3HVWA 1SI9A 2JDJA 2VD3A 4LBHA 3TUZC 1YZ7A 4ZITA 1U2FA 3DOKA 2VBXA 4YR2A 2IYIA 2A1BA 3ONQA 2AKWB 4WKYA 1WKJA 2P9EA 2W4PA 4IG3A 4DX6A 4IO9Q 1S0MA 1KKHA 1Q1KA 4USWA 5BJRA 1UW4A 1YKWA 2DEIA 4WFYA 1EZZB 3TVKA 5DDRC 2HHQA 1YBAA 3MWBA 4IFYA 4PXDA 3U1NA 1TL1B 5ETVA 4DV1J 1HR0F 4J9NA 4O3RA 1KOHA 1XJWB 2B4OA 2OP5A 3SDEA 1QAXA 3N79A 4EBCA 1HI0P 4R5PB 2G1HA 1RAHB 3W64A 2R2TA 2RIJA 2VHGA 5DG7A 2Z2MA 4IDKB 4LFBJ 4E0DA 2YNGB 4M5LA 4JI0F 3GJSB 1NK8A 3DRRB 2R7SA 3C15A 2J6TA 1FRIA 3QT6A 2FZGB 2KL8A 2XYPB 3W2VB 4B08A 2XO6A 2C28A 3T9NA 2UUAJ 1OIAA 2CQ4A 4RBTA 4RR5A 4UZCA 1HNZJ 4NX9A 3QRRA 3WQPA 4LQ3A 2HRUA 4OYWA 2MLYA 4NLYA 5HO4A 4MFBA 2ZFHA 5D8HB 2AGQA 3MCMA 3DM2B 2OAUA 3M8QB 4JP8A 5CXTA 3VHQA 1S6QA 4DPUA 2UV8A 4BC9A 2IBOA 4DZ6A 3ZO7A 3JQMA 2HBYB 4BDPA 1KHWA 3PW4A 4JI7F 3MM5A 3F56A 7AT1B 4RBVA 1U6ZA 2F8EX 2OJ3A 2RD5C 2CQHA 2H48B 5A8WA 3V6DB 3PG9A 2G4BA 5GAEU 4JBCA 3Q23A 1ELOA 1VQ8S 2Z2LA 5HSPA 2RSQA 1REGX 1DARA 3ET6A 1X4BA 3OPKA 2XMJA 2GHWA 4IDKA 4ZK7M 2NZCA 3I32A 1WC4A 1HQ2A 2GV1A 3MR5A 3TEHB 1H7WA 5AJ3F 2RVJA 4EBEA 1C4CA 1NJXA 4RBUA 3HFKA 2PGCA 4DF8A 2VONA 4ECZA 1X5TA 2VIHA 5GMEA 4JV1A 1QVFR 2W2MP 1S77D 4HKQA 4LFBF 4X4UA 1UPMB 4OYOA 3R27A 1VISA 3KXDA 1OPZA 2IC3B 4FKXA 3RUBL 2R8IA 1VQMS 1U1KA 4CQ1A 4HH1A 4PXCA 1CSJA 5DQIA 3BDEA 2ZH7A 3K7RA 5E33A 5KFKA 4TXSA 3OL9A 4OFZA 2A6MA 2BRKA 4RW4A 4ZPAA 1VHFA 3AB4B 4IG0B 4PCQA 1Y5IB 3OR2B 2BBEA 2Q6BA 5EWFA 3QZ7A 4EZ6A 3BSOA 4RKUC 1PSDA 3FNNA 3IAM9 3OHBA 1Q8KA 4ETZA 1F5CA 3I5CA 2GNKA 2M3DA 4NLGA 5CYMA 4QYZK 3M4XA 4QR0A 5E3QA 1SUQB 3T19A 5BYSA 5J2MB 2DK2A 2IM0A 1JNRB 4UOCA 3KG4A 3PYGA 1VIOA 1ZAVA 1KSPA 3DC2A 3SQGB 2R8HA 2E9TA 4IOAQ 1ZAWA 4USKA 3DDKA 1RTIA 2HK3A 2JVOA 4CLZA 2ZJPQ 2HVIA 3IG1A 4F3QA 3OXLA 4C8OA 4P52A 3CMES 4USHA 5BYQA 5L9NA 1NK7A 4USJC 1UFWA 3RW7A 1RWPB 2FB0A 2CQPA 1NDKA 2K06A 1TP7A 3R5JB 1BMQB 1GEHA 1BWVA 5U47A 2DITA 2QLBB 5B0AA 2KFYA 4DQRA 3PVXA 3R7SB 5A0YB 3HD1A 3NCRA 2HBZB 1VC6A 2V0NA 1NRKA 2E1RA 2L9NA 2B8PA 3BGRB 3IAS9 4M1KA 4P6QA 2GHPA 3D2WA 1U1OA 2C2KB 2ZJQQ 5IWAJ 3DYAA 4ZVSB 1KQFB 2NYIA 3BGUA 3HX9A 4AXIA 1R31A 2GCFA 2B9YA 3LPEA 1BY9A 3S01A 3AAWB 4CO4A 4DFPA 4OZ0A 2V9KA 2ZH8A 3BGFA 1HWLA 1FKAF 1ZM4A 3CCZA 2IHR1 1KN6A 2VFSA 3IWXA 1C1CB 3CDEA 1KHVA 2N7YA 1TUWA 2BV3A 1E6YA 2X51A 2JX2A 5L39A 1S10A 2XHWA 2G0IA 1RHUB 3NGRA 3PYDA 5K8OA 2Y1JA 3PX4A 3J7YI 2R7OA 4N7TA 1I94F 1TVRA 2RDJA 2RNEA 2V2QA 1SH2A 1HNVB 2AX1A 2FHJD 3ZXWA 4Y2IA 1UWBB 3MR2A 3F73A 2XB2D 3CNQP 2DPJA 3K0JA 1GFWB 3BPDA 4I0WA 1A6LA 4KO0B 2FJAB 2OD6A 1R7IA 1S0NA 1JX4A 4PRFA 1KDNA 2E44A 5KT7A 4RNOA 2ZNZA 3C6TB 5THWA 4M94A 3NGKA 5HK4A 1UEVA 3OL8A 1NXIA 4DR4F 2C3OA 2OPPA 1PJ5A 3V81B 3DLLQ 4C8NA 2A2DA 3BBCA 5D4PA 1HNIA 4X84A 4C0HA 2YKPA 3KYLA 1K0VA 2RDDA 2R7QA 1RT1A 1UAWA 3IS9A 4YOEA 4DPWA 3SCJE 1KFDA 1S7IA 2DGOA 4J91A 4H4OA 4D3GA 4JB8B 5J1EB 2OO4A 1U2RA 4A8MP 3OTOF 3TAQA 1S4FA 1R8CA 3CVKA 3Q83A 3S7RA 3AA9A 3OW2R 1IKXA 3W5XA 4HT5A 2R7XA 2ZH3A 4LF7J 2R7TA 1H2UX 2Q1LA 3E2EA 2XSJB 3T5HA 2EFQA 3MPVA 3FUYA 1TL3B 2WONA 4L75A 4MIWA 4A8QA 1O8BA 2YKNA 3VAIA 1MSWD 1T9TA 1LWEA 3M9MB 1RBLA 2NXNA 2LEPA 3ISZA 3ITHA 4NRTA 3ZTOA 4D3HA 5I42A 4DFKA 1QSSA 3VZHA 3H5YA 1CULA 3MM9A 1RTJA 2J0WA 4DPOA 5IZHA 2LKZA 3RBZA 1UVJA 1PC4A 2OPQA 4U7UK 4WF9Q 2POKA 1J2VA 3TYTA 2W7PA 2UVVA 2VODA 2UUBJ 2QL7B 3KK1A 1Q7YT 4K5SA 4Z7YA 2J9DA 3VR1A 3PCOB 3MEKA 1GTHA 4IKAA 1SJ3P 1GQEA 3GYXB 2G1DA 2YWEA 4CWBA 1VRUA 1OSCA 1SC3B 4EBDA 4Q0BA 2K1RB 3DCAA 2XG8A 3W2VA 5B0EA 2MKHA 2MQLA 5A8RA 4DCPB 5DQHA 4DR1J 2VC0A 3K2YA 3W8PA 3GZ7A 3GMGA 3H5UA 4FVMA 1L3UA 3K5PA 1TKXB 4ZOSA 4A47A 1XNQF 2K7KA 1NB2A 2LQJA 2NYHA 5EGYA 1CS4A 4ED6A 4DX8H 4PYAA 4K2JA 5D0RA
chains in the Genus database with same CATH topology
2E1PA 2W2PP 3WIVA 1SCJB 4YN3B 3A3NB 3A3OB 3CO0P 2Z2ZA 3SQOP 1R6VA 4NMXA 1SPBP 3T41A 3QFHA 3AFGA 3H42A 3BPSP 3A3PB 2XTJP 2Z56B 3BGOP 3VHQA 3WIUA 2W2QP 2W2NP 3CNQP 2ZWOA 3WHIA 4NE9C 4K8RA 2QTWA 1V5IB 3P5BP 4OV6A 3VV2B 2PMWA 2Z2YB 2W2OP 3GCWP 1ITPA 4JP8A 2W2MP 3GCXP 2ZWPA 2Z57B 2Z30B 2Z58B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1P A;  2W2P P;  3WIV A;  1SCJ B;  4YN3 B;  3A3N B;  3A3O B;  3CO0 P;  2Z2Z A;  3SQO P;  1R6V A;  4NMX A;  1SPB P;  3T41 A;  3QFH A;  3AFG A;  3H42 A;  3BPS P;  3A3P B;  2XTJ P;  2Z56 B;  3BGO P;  3VHQ A;  3WIU A;  2W2Q P;  2W2N P;  3CNQ P;  2ZWO A;  3WHI A;  4NE9 C;  4K8R A;  2QTW A;  1V5I B;  3P5B P;  4OV6 A;  3VV2 B;  2PMW A;  2Z2Y B;  2W2O P;  3GCW P;  1ITP A;  4JP8 A;  2W2M P;  3GCX P;  2ZWP A;  2Z57 B;  2Z30 B;  2Z58 B; 
#chains in the Genus database with same CATH topology
 2L9W A;  2G0C A;  2HRT A;  1EP4 A;  2V50 A;  3CGI A;  1JK9 B;  2HG4 A;  4C2M A;  3VVU A;  2VQF F;  3VCD A;  2JEG A;  3ETO A;  4DG1 A;  2DY1 A;  2ZM6 F;  1FK9 B;  4NLX A;  1HQU B;  3HMJ G;  3SQO P;  1D09 B;  4V19 X;  3JSB A;  2HQF A;  3CO9 A;  4RW7 B;  1IKW B;  3UI3 A;  5A8W B;  3PEH A;  1IBK J;  5HQL A;  1LWF A;  2YVS A;  4M95 A;  2G9O A;  2OHD A;  3CJ4 A;  1FDA A;  2HVZ A;  4DHV A;  1QTM A;  4P10 A;  1BQX A;  3KJQ B;  3WZ0 A;  2UP1 A;  2MKJ A;  1KVK A;  1MWQ A;  2DRB A;  3FKB A;  1T7P A;  4K8R A;  2YNI A;  3KJV B;  2GVD A;  4Q0B B;  5J2N A;  8AT1 B;  2L48 A;  1PAE X;  2Q43 A;  4O44 A;  1FKO B;  4FYV B;  5F9L A;  1NJZ A;  1S0O A;  3BSN A;  1K47 A;  3NRB A;  2CPZ A;  1B99 A;  3FCH A;  1N34 F;  1AXQ A;  3PM9 A;  4ED7 A;  3EGV A;  5MLC V;  1RAI B;  2HHV A;  2A10 A;  2IC3 A;  1YBT A;  4PAA A;  2DNL A;  4KGX B;  3UDL A;  4HR2 A;  1N5Q A;  1NK6 A;  1WDD A;  1FCA A;  2QLX A;  1CC8 A;  1RWX B;  4MH8 A;  2D3Z A;  4OZJ A;  5B0D A;  4U7U D;  3QBC A;  5A6W A;  2XTJ P;  2APO A;  1IM6 A;  3BV8 A;  5GAD U;  3TUJ C;  5B09 A;  4C11 B;  1ZS6 A;  3P49 B;  2FHO B;  4OHY A;  1MML A;  3PJ9 A;  4QIV A;  3QPI A;  2YQ1 A;  3NAI A;  4LFA J;  2VA2 A;  2XS2 A;  4NLV A;  4UOF A;  2AZ1 A;  1SKU B;  5LOQ A;  2ZOG A;  2KXH A;  1BQN B;  2BJ3 A;  2W2O P;  2FLP A;  2GVD B;  4OJ1 A;  3TJ9 A;  4DMZ A;  1JLF A;  2BM1 A;  3IS9 B;  1P6T A;  3DRR A;  1FJG F;  2MDA A;  4QR1 A;  5HQM A;  4DV1 F;  4X64 F;  2HVD A;  3FC9 A;  4KO0 A;  3KLV A;  2WSF C;  4M5M A;  3D1O A;  2MQQ A;  5IV4 A;  2FVS A;  3CCE S;  2FQQ B;  2ZJR Q;  3LWM A;  1OJ4 A;  1Q8I A;  1SPB P;  1YWX A;  1X9W A;  3QAU A;  1NLK L;  2XY7 A;  4I2P B;  1YIJ S;  4KTQ A;  4Y00 A;  2J9C A;  2CJX B;  2YNH A;  1RGV A;  3K57 A;  1Q5V A;  2ZHO A;  2KRB A;  4KQZ A;  3ZTS A;  2RML A;  4W90 B;  3HT0 A;  3EZ5 A;  2DO4 A;  2O1P A;  4DOZ A;  1OQ3 A;  2DPI A;  1T3O A;  4ZVT B;  4PUO A;  5GVQ A;  1IKY A;  1RWN B;  2AJ0 A;  3PV8 A;  2Z0G A;  5L1K A;  3NBP A;  5IXU A;  4DL4 A;  1QY7 A;  1VI7 A;  2F8H A;  2VG5 B;  1CG2 A;  4IR9 A;  4B3T J;  4L76 A;  3HKW A;  2R8K A;  1XR7 A;  1S1V B;  3DU5 A;  3DYA B;  2BQR A;  1RWO B;  2B51 A;  4FYY B;  2P6S A;  4PG8 A;  4CIO A;  5L1I A;  4EYI B;  4NLP A;  2QX0 A;  3RR8 A;  4Z37 A;  3TA2 A;  2ZOF A;  2H65 B;  5CYQ B;  4F2S A;  1Q4R A;  4DV4 J;  4DR5 F;  3ITH B;  2OEJ A;  4O3P A;  5L46 A;  1JLA B;  1UET A;  3NGS A;  3AJ2 A;  3CJS A;  2C2N A;  3GE9 A;  3T5L A;  3W8G A;  2DVI A;  3QNW B;  4J9K A;  4TN2 A;  2L9D A;  4CLU A;  1RAD B;  1WOO A;  2FPH X;  2WCX A;  4NLR A;  1JJH A;  4GO5 X;  4CZC A;  1RAB B;  2IJF A;  2YKM A;  1OWX A;  4X64 J;  5CA5 A;  4NA3 A;  5E0O A;  1NSA A;  1UWB A;  4DSJ A;  2A2C A;  1E6V A;  3K59 A;  1M5S A;  1R27 B;  3CJ8 A;  4PWD B;  2CQB A;  2GJI A;  1UA1 A;  1MU2 A;  2MEW A;  2GJF A;  4USI A;  2OFG X;  4DDF A;  2BDP A;  3KHG A;  3VGS A;  1NUE A;  4UW2 A;  2AV5 A;  3KJN B;  4P73 A;  3KHR A;  5H9E K;  1DQ8 A;  1PYS B;  2CAJ A;  2XWY A;  3UFC X;  1YRX A;  4KV8 A;  2LEA A;  5K9F A;  5KFT A;  2PFF B;  2J5A A;  3JAM Y;  3QO9 A;  3R8Y A;  1FXD A;  5LMN F;  2RS2 A;  1ROF A;  1VRT B;  3KJV A;  1RCO B;  2HND B;  4H4K A;  3MHY A;  4YQW A;  3VAF A;  3GFX A;  3IGV A;  2RAQ A;  4DBQ A;  3ZNJ 1;  2DHG A;  2P9C A;  3TP2 A;  3KLI A;  5LM7 E;  4JI3 J;  4KYZ A;  4ZHR A;  5C7P A;  2WTF A;  3PW2 A;  2KU7 A;  3WC0 A;  2W8L A;  3FZB A;  3CUN A;  3ZZP A;  1JLG A;  3OT9 A;  2V8D A;  1IKV B;  4ZMM A;  4WFX A;  4ED3 A;  3QRP A;  9RUB A;  3BBF A;  2AHO B;  5G0R A;  4B3O B;  3RW6 A;  4RW6 A;  1P9Q C;  1FEE A;  1MLA A;  2QN6 B;  1EQM A;  2ADB A;  1CEZ A;  4PEO A;  4OZL A;  5EDW A;  2RQK A;  4NLT A;  4CH1 A;  1ZAX A;  1HD1 A;  2HQC A;  2RUG A;  2Y0B B;  3ZZZ A;  4CP5 A;  2HGN A;  3KK3 A;  1R8H A;  4Q8E A;  3RAQ A;  3A3P B;  2HFZ A;  1R8A A;  2YNF A;  3DLK A;  1ZYQ A;  3H40 A;  2H3E B;  3OTO J;  1DTQ A;  3PW7 A;  1JLF B;  3PRV A;  3IN5 A;  4HYK A;  4LF6 J;  2XZT B;  4MK8 A;  1TKD A;  4HTI A;  2CQ3 A;  2EK6 A;  1VS3 A;  3P5B P;  4DN9 A;  4LF4 F;  3D0H E;  3QT8 A;  4MKV A;  5HAN A;  5HQ8 A;  3UD3 P;  5C25 B;  2QMX A;  2RKI A;  2KG1 A;  1FRX A;  1I1G A;  3RBE A;  2IA6 A;  3FQL A;  3J81 j;  1Y9O A;  4GVL A;  3MCS A;  4RNN A;  1U6F A;  5AJ3 J;  4DU8 A;  4EEY A;  4KY3 A;  5LSL A;  5HRO A;  2PEB A;  2V6A A;  4PG6 A;  3M2U A;  1UKU A;  4DL0 C;  4YP3 A;  3HVR A;  2J0Q D;  2R8J A;  1TAQ A;  1UFK A;  4J9M A;  3ISN C;  2H4Y B;  5KFP A;  5K14 A;  3BO3 A;  2JVR A;  4JV2 A;  3G87 A;  4B3S F;  2V4Q A;  1DLO A;  3N01 A;  4FYX B;  3V4M A;  3DXB A;  1HQU A;  5IWA F;  1C0T A;  1T9W A;  3EDR B;  1HQE B;  3IP0 A;  4YDX A;  4AQY F;  4ECY A;  3H2V E;  4CLY A;  4ECS A;  3OTB A;  2IM1 A;  3PKM A;  5DQG A;  2H54 B;  4USV A;  2B4V A;  3W2W B;  5LSR A;  2ADC A;  4U6P A;  1AA1 B;  2BJ1 A;  5CD4 A;  2V4R A;  4F3O A;  1FJG J;  3MAH A;  1SL2 A;  3EZU A;  4YFU A;  2VJV A;  1S5Z A;  1FES A;  2AD9 A;  1T94 A;  1FT8 A;  4ANC A;  2W8K A;  2MZR A;  1XR5 A;  3WDO A;  4K4Y A;  2VKR A;  5K8N A;  5DDP C;  4J9V A;  4R0J A;  1A7G E;  2AZ3 A;  2Y1I A;  2VA3 A;  1HBN B;  2Y0S D;  2WSC C;  4OI6 A;  2RIL A;  1IKY B;  2DNO A;  3A3O B;  2DBB A;  3Q8S B;  3RGI A;  2C2D A;  3NS5 A;  1EQ0 A;  1LW0 B;  4ZVG A;  1AZS B;  2IM3 A;  5GAD I;  1G7C B;  3PO4 A;  4U96 A;  1GNK A;  3A4T A;  1HPZ A;  3GFY A;  3I9Z A;  4P71 A;  3T41 A;  1N0U A;  3MED B;  5B0B A;  4KJI A;  4J9O A;  1DHM A;  3CTR A;  1DQ9 A;  2GGP A;  4OX6 A;  4DV6 F;  1DLO B;  3BN4 A;  4ZPB A;  3AQP A;  3EVM A;  3QT7 A;  3CD6 S;  5LSO A;  2IVY A;  4DR7 J;  2CWK A;  3IO1 A;  5FII A;  2ZBR A;  3OR1 B;  1RAE B;  3TQE A;  1D0E A;  2DTJ A;  3G2X A;  3UN2 A;  1FFS B;  1K0T A;  5AXL A;  1DTT A;  2G2Z A;  1VFJ A;  5D0G A;  3SDE B;  1QSY A;  4PYD A;  4PWU A;  1X5O A;  5MAO A;  3QRQ A;  2F40 A;  1RHK B;  2VL1 A;  2ZBC A;  3KUE A;  2JSX A;  2DH7 A;  3CED A;  2N82 B;  5GAE I;  5FJ4 A;  1S1X A;  2HFN A;  3DRS A;  5KFE A;  4K0K F;  4LQ9 A;  2B7C B;  3IC1 A;  5M2R A;  1U8S A;  3IGN A;  2CAD A;  3MUR P;  4JI1 J;  1N5S A;  1VRQ C;  3D4J A;  2BW7 A;  1JXL A;  2CQC A;  1ZBT A;  3QGH A;  1UCN A;  1NAQ A;  1NCL A;  4K2X A;  5D4O A;  2Z56 B;  3CPW R;  4RW6 B;  1R0A A;  1EP4 B;  1TMM A;  2BUN A;  1MG7 A;  2W1B A;  3I0R B;  3U02 A;  2QTW A;  4DS5 A;  1RA6 A;  3J81 U;  3OD2 A;  4R25 A;  5J2P A;  3UDE A;  5J2Q A;  3C6U A;  4MKY A;  3NMA A;  2ZBI A;  2V2K A;  1JWW A;  3SZ2 A;  1X4E A;  1Q53 A;  1XWL A;  2DXF A;  4O0N A;  1OO0 B;  2CPY A;  5G4D A;  4QWC A;  4DR1 F;  2AJQ A;  3EXY A;  2YNF B;  1JLG B;  3DLK B;  4JI6 F;  4ZA1 A;  5CCL A;  4Q5V A;  1ZTW A;  4B3R J;  1FD2 A;  3QT5 A;  4Z2X A;  1N5Y B;  5KAK A;  3OFF A;  2B56 A;  4B9N A;  3MMB B;  3KUG A;  4F67 A;  3RU0 A;  3ETM A;  1WWH A;  2FZK B;  4OLO A;  1Y11 A;  1RYR A;  3AY0 A;  4B9T A;  3ZNU A;  4XK8 C;  5BXI A;  5EHH A;  1NJW A;  3J7A N;  3EXC X;  2EFO A;  2FTR A;  2VUG A;  3HDS A;  3PFO A;  4RUA A;  2QEX S;  2VF3 A;  4LF9 F;  1YZ6 A;  2NZ4 A;  4N8O A;  3X1L B;  4I68 A;  1LOU A;  2J8S A;  2J0S D;  1HBM A;  3G82 A;  4LVN P;  1SL1 A;  3C3L A;  1S97 A;  3KDO A;  2PII A;  4I67 A;  1R6Y A;  2W9C A;  5KFL A;  2K7J A;  2J6S A;  4HL9 A;  2WVE A;  4LIR A;  4DUZ J;  5HLF A;  3MEC A;  5IQQ A;  1NO8 A;  2CDR B;  3BKU A;  3L4B C;  1JNZ B;  4M5D B;  3BR9 A;  5KFN A;  1FRL A;  1Q7L B;  2QMW A;  4TQR A;  3HHL C;  2RHS B;  3N28 A;  5ETS A;  5KFI A;  3IM8 A;  2IDL A;  2VDI A;  5AE1 A;  5F8L A;  1H38 A;  1UFL A;  4WTY A;  2R7W A;  3NG8 A;  2VQE F;  1VRT A;  3HUL A;  2IJR A;  3IRW P;  4A8S A;  2W01 A;  2IRY A;  2QGF B;  3BQ1 A;  1D9D A;  4NYP A;  4DSI A;  3R5D A;  1SUQ A;  4AD6 A;  3HKZ D;  2F8M A;  2R2S A;  4ED2 A;  2CJ9 A;  2I9S A;  4ID5 A;  1WDT A;  2XCA A;  1F2G A;  3HSG A;  3FSI A;  3KHH A;  3OTC A;  3R5C A;  1SL0 A;  2OH2 A;  1D3W A;  1NKC A;  2LU1 A;  1S12 A;  3H5X A;  4DL5 A;  4KFB B;  4KB7 A;  2PMZ D;  2KN4 A;  5KFG A;  3MM6 A;  3LAM A;  2DD8 S;  3G6X A;  4DQS A;  1N36 J;  3ICL A;  4ZP6 A;  4R8U B;  3C19 A;  2W9C B;  3PYE A;  1URR A;  2F3J A;  1VYA A;  3EM1 A;  3MEC B;  1TK8 A;  4USU A;  5LMN J;  2WW4 A;  1SJ4 P;  1VQS A;  3J7Y U;  1OMS A;  1M90 T;  2VDH A;  3IMQ J;  1L3K A;  2Y3Y A;  1MWY A;  3NP5 A;  1JJ2 R;  3K8V A;  3UCG A;  5KFJ A;  2IIH A;  1N5V A;  1IWA A;  1RT5 A;  2KG0 A;  4B9V A;  1T8E A;  1QDU B;  5HMW A;  3DU6 A;  2ASJ A;  2KVQ E;  3WHI A;  4LF1 A;  5KFS A;  3FVY A;  2GQC A;  1U02 A;  5JVG Q;  3OSP A;  1PBA A;  2Z8Q A;  4OJ3 A;  1FE0 A;  5I3P A;  1OY6 A;  3MOZ A;  4W92 B;  1IBC B;  1PAU B;  2XWX A;  3GCW P;  3H5S A;  1YLX A;  2O5D A;  4X4N A;  1JLC B;  3B8H A;  4AT1 B;  2OSQ A;  3DLG B;  1F9H A;  2YX7 A;  3DOM B;  4GMK A;  4IQX A;  4JI4 J;  3MEG B;  3FK4 A;  5A6P A;  4H54 A;  4WFB Q;  4M8L A;  2MMY A;  3H4D A;  2AGP A;  2X1F A;  3Q2T C;  4QWD A;  3D3C J;  1CJV A;  3PY8 A;  4NLS A;  3KG1 A;  4JI5 J;  4NCB A;  4P9S A;  1UEK A;  2DIU A;  1XMB A;  2KYZ A;  1KTQ A;  4FP9 A;  4F04 B;  4K4T A;  1G6B A;  1TR0 A;  3PXG a;  1HFE L;  4GKJ J;  1LFP A;  2CIM A;  4CTA A;  3BR8 A;  2IRX A;  4NEY A;  1TV6 B;  3TZW A;  1S57 A;  4LR8 A;  1WEX A;  4DV3 F;  1KC8 T;  1A9N B;  3X3U A;  2PI4 A;  1WHV A;  3D66 A;  2X3G A;  2CYY A;  1V5I B;  5IV3 A;  1U1N A;  2HHW A;  1DZ5 A;  2C22 A;  2BVZ A;  5HP1 B;  3PYF A;  4LF4 J;  2RQM A;  5DJB A;  2BX6 A;  1TQL A;  3TW0 A;  2YNG A;  2UV8 G;  2BE2 A;  3E3X A;  4IFV B;  3OV7 A;  4J5O A;  2WZ1 A;  3M1V B;  4MIB A;  2P6T A;  2BE9 B;  1NDP A;  2AYM A;  4FN5 A;  5IC4 B;  2VBZ A;  2PI5 A;  4EZ9 A;  3HZG A;  3AA8 A;  4OI2 A;  4F0K A;  3CDW A;  4RW9 B;  2OEK A;  4X4T A;  3QIP B;  2JLG A;  1PYT A;  5DGA A;  4KHR A;  4ZP8 A;  1F0X A;  3T6J A;  1N8R T;  2E66 A;  3AQO A;  5F41 A;  1HWK A;  4DV7 J;  3FEX B;  3T1H F;  1YJ9 S;  3JSM A;  3KOA A;  3PAC A;  3OBI A;  4LF9 J;  1WD6 A;  3HCX A;  3LF0 A;  3HXM A;  1ZM3 A;  3CCS S;  3ENV A;  4CTA B;  4X65 J;  4DR3 J;  2G2O A;  2ZD1 A;  4KPC A;  2V63 A;  4LR7 A;  4LT6 A;  4NOH A;  5GAG U;  3C15 B;  2ZBQ A;  2KB2 A;  2YXL A;  2V8P A;  3BQ2 A;  4PKD B;  3WX8 A;  3IWN C;  4KIA A;  1O0P A;  1XMQ F;  2HNY A;  4CO5 A;  2V69 A;  3G86 A;  2V5H G;  4ECQ A;  2UUT A;  2Z30 B;  1LFW A;  2CQ2 A;  5HP1 A;  3DOL A;  3HHL B;  3MI7 X;  2KYX A;  2WVC A;  2QJ3 A;  4MT1 A;  2XNQ A;  4TLQ A;  3G6Y A;  1FJ7 A;  1KFS A;  4ZLN A;  2BE2 B;  2PT0 A;  2VZ9 A;  2UZA A;  4E2F B;  1S9E B;  1T03 A;  4B3T F;  4K4S A;  3Q2S C;  1IM4 A;  3L9Z A;  2QL9 B;  3T1A A;  3UVJ B;  1SXL A;  2CZ4 A;  3W62 A;  5DDO C;  3Q22 A;  3W66 A;  4WIQ A;  2EBG A;  3MM9 B;  3V6J A;  2FUG 9;  4M5D A;  2C2Z B;  3DFE A;  1TUV A;  4JYA F;  5K8M A;  2YQ3 A;  3DMJ A;  2ZM6 J;  1JJ4 A;  2DH8 A;  5D0E A;  1SKS A;  2JH3 A;  1HKA A;  4KPY A;  2VFT A;  4ZCK A;  4KKO B;  2B9E A;  3DLE B;  3WX4 A;  1R0C B;  4DR2 J;  2VG7 B;  5DZ6 A;  4C3M A;  1UL3 A;  2KVI A;  1Q8L A;  2E5L F;  2CPF A;  4NYZ A;  4DG1 B;  5E3P A;  1RDR A;  4KHP J;  1ZM2 A;  4I7F B;  1SJ1 A;  1UTA A;  3I87 A;  1N56 A;  1FE4 A;  2AJ4 A;  3GYN A;  2LMI A;  1N48 A;  3L09 A;  2G2Y A;  2LP4 A;  1BE4 A;  3H8Y A;  3CJ3 A;  3KJF B;  1TL5 A;  2BQ3 A;  4M5K A;  4WE1 A;  4F4Y A;  3VAM A;  1XNR F;  4IOC Q;  1WSV A;  2BOA A;  4A8O A;  2UXC F;  2ASD A;  2C2M B;  1XMQ J;  1KRP A;  4PPD A;  3OXG A;  1Q86 T;  1X5S A;  2PMH A;  1N5Y A;  4K0K J;  1B64 A;  2D3O R;  2RS8 A;  3F41 A;  2CXE A;  1VMB A;  3QSI A;  1DY3 A;  4HLB A;  2BZ2 A;  4I6A A;  1SJQ A;  5F3T A;  1QVG R;  2UXB J;  1V6H A;  3D7S B;  1DQA A;  2J76 E;  4JI8 J;  4G65 A;  4DLG A;  4KT0 C;  4C11 A;  4DPX A;  4UY8 T;  2KT3 A;  5B08 A;  5JMN A;  3N5B A;  3M2U B;  4HI1 A;  3G8T A;  2VH7 A;  3A1Y G;  2HK2 A;  2RHQ B;  3FQK A;  2MPU A;  1RKJ A;  1VHI A;  2GML A;  3VAK A;  1QM9 A;  2ERR A;  4Y6I A;  4K4V A;  1FA0 A;  2OPR B;  2ACM A;  1R0B G;  4Y2A A;  1FHT A;  2WSE C;  3DLG A;  3RRK A;  3IR7 B;  1URN A;  1NZA A;  2ZE2 A;  2M4M A;  4RX6 A;  5DO2 A;  3KLH A;  5FLX Y;  2D3O 1;  4OI3 A;  2DGT A;  3DGP A;  1EJ7 L;  1LKZ A;  5F8H A;  4M5N A;  5J1P A;  3OLA A;  5RUB A;  3SSS A;  2V4J B;  3THP A;  3Q86 A;  2N4D A;  2R3V A;  4BWM A;  3O2I A;  2HYI B;  2B9X A;  5A2Q Y;  3GJQ B;  1FVS A;  2GIF A;  3PR4 A;  2MXY A;  2FLO A;  2QT7 A;  3R5G A;  5GAH U;  3FJ2 A;  3GIL A;  4J9Q A;  4YS2 A;  4ITS A;  1HBO A;  2B5J B;  2UUW A;  3NXZ A;  5A8K B;  3KDN A;  4RUB A;  3VAJ A;  2DB1 A;  2HNZ B;  1FNO A;  1S99 A;  1D9A A;  2QSF A;  2RU9 A;  4F25 A;  1HI1 A;  2MKC A;  3BBB A;  4WPA A;  3W1Y C;  3JSR A;  3JXO A;  2F4V F;  4TQS A;  1BQN A;  1EB0 A;  3T1Y F;  1K1Q A;  2IM2 A;  4IQM A;  3PEJ A;  4RPF A;  2ZD1 B;  3DRX A;  2VFR A;  3FSY A;  3OFG A;  4ZP7 A;  1WHY A;  2X1B A;  5E3C A;  4JI8 F;  3AXM A;  4WU3 A;  1Z2L A;  3BEG B;  5J2P B;  3TOQ A;  1MRO A;  1VBY A;  1YVF A;  4FS1 A;  1X4C A;  4A48 A;  1WF0 A;  4BBY A;  1S0V A;  1UP1 A;  1RWU A;  2MHN A;  3A12 A;  4I2P A;  4NLQ A;  5A76 A;  4DV4 F;  2CJK A;  1JQG A;  2ZH5 A;  2EVZ A;  5HVG A;  3SYZ A;  4DX5 A;  1XEZ A;  3I55 S;  3RG6 A;  4WYL A;  1LNQ A;  2CPI A;  1AFI A;  1P27 B;  2G13 A;  4PWD A;  2JOQ A;  2QO3 A;  2HHS A;  2OLW A;  2LQ9 A;  1F9F A;  2AQ4 A;  2GAG C;  1N36 F;  1HYS A;  3QGI A;  4NLW A;  3DNC A;  4CO1 A;  5AXN A;  3P4U B;  3C6T A;  3EVW A;  4ZPD A;  1XIQ A;  2M70 A;  3RAX A;  2B3T B;  1R0A B;  1NK9 A;  2AW0 A;  3MUT P;  3M6W A;  1YRT A;  1WNE A;  3R9L A;  2HVH A;  2MYF A;  3NLC A;  1Y3K A;  3MAQ A;  1S7H A;  4JYA J;  2RE1 A;  1S6Q B;  3OJS A;  2JJ4 D;  4B02 A;  4V1A k;  1R43 A;  3NKY A;  4A8W A;  1FTR A;  4LSL A;  2JL9 A;  5F0U A;  1RHQ B;  4J90 A;  1N5T A;  1HAR A;  4RWX A;  3AOB A;  1CJK A;  2KM8 B;  3O3L A;  2GO8 A;  3R5A A;  2ZZM A;  1ITP A;  1FDD A;  4CM2 A;  4WZQ A;  2O66 A;  4CLF A;  3MM7 A;  5IT9 U;  2M88 A;  1RWW B;  2K2P A;  1TKT B;  3ENA A;  3IBW A;  1O51 A;  2N3L A;  1KTV A;  3MUV P;  2MQP A;  1WOS A;  2DY9 A;  3CJR A;  4J7C A;  1U24 A;  4RNF A;  3B4D A;  2ASL A;  1BWE A;  3S8S A;  1IR0 A;  1R8P A;  2HUR A;  4N77 A;  3F0N A;  1SJR A;  2FJW A;  3TWZ A;  4ZVF A;  4RNM A;  1ARO P;  4KC5 A;  2PA3 A;  2QIF A;  1YIT S;  1CQN A;  2UXD F;  3BPS P;  3EZO A;  3PFE A;  1MMN A;  1YJN S;  1CJT B;  4A8X A;  4CLK A;  3QLH B;  4LVO P;  3BO4 A;  2BEF A;  1T9V A;  1K9M T;  3KLE B;  2QRR A;  2MKS A;  3VQT A;  4F0M A;  3W3S A;  1K73 T;  5G0R B;  1LWC A;  1SH0 A;  4F26 A;  3TZY A;  1SBR A;  2VPX B;  3ULH A;  4EMD A;  4LSL B;  2NPF A;  3HHN B;  2XO7 A;  2MKI A;  1U1Q A;  1YI2 S;  2K1R A;  1VOM A;  2DT9 A;  2RF2 A;  3M8P B;  5I3Q A;  4Y65 A;  2IYG A;  1AUD A;  1WKL A;  1Y5N B;  4KGV B;  5F0W A;  3QJL A;  4L73 A;  4CT8 A;  2DRA A;  2YPZ A;  3A8I A;  4WK3 A;  1XC9 A;  1TL4 A;  4ECR A;  1F3F A;  2XGQ A;  4C3L A;  1OYE A;  2BW2 A;  1BGX T;  2X3D A;  3UQS A;  4L74 A;  2AF6 A;  3FBB A;  1OQ6 A;  3NOC A;  4JI6 J;  3AD8 C;  1HHS A;  4HAC B;  4RWW A;  3UPF A;  4LBI A;  5ETO A;  1X4F A;  1PIE A;  5T7L B;  4N47 A;  3HI9 A;  3CW2 C;  3LP0 B;  4I6Y A;  4X4P A;  2HQI A;  3R7B B;  3BO2 A;  3V4I B;  3Q8Q B;  4B3M J;  5C2G A;  1U47 A;  1AYE A;  5B0F A;  3NS7 B;  3L3C A;  1LWF B;  3Q8U A;  2GA7 A;  3RB6 A;  4QW8 A;  4MAK A;  2XZD B;  2Z2Y B;  1KLM A;  1REV A;  1CC7 A;  2BJD A;  3E01 B;  4I6W A;  4B17 A;  4C7Q A;  4OI4 A;  2HHH F;  1DTQ B;  2DNR A;  2ZWP A;  4TYB A;  2Z58 B;  3HK2 A;  3QJJ A;  3PTW A;  1U0S A;  2VG7 A;  3JS9 A;  4EYH B;  2DXD A;  5F8M A;  5DET A;  5DS7 A;  5ETP A;  1DBD A;  4TU8 A;  3ILO A;  4CDI A;  2RKI B;  2WHO A;  3TJ8 A;  4F0H A;  1D1U A;  1S76 D;  4DV7 F;  1HL6 A;  2QA2 A;  4V19 J;  2LQ8 A;  4H4O B;  4NYO A;  3ZC4 A;  2R7R A;  3MPW A;  4GKK J;  5ITH A;  1W2I A;  4ED1 A;  3QYY A;  1AZS A;  3GR0 A;  4PZV A;  1LK5 A;  1TMJ A;  1JLB A;  2GQ2 A;  2P2C B;  4LJM A;  3FBF A;  2I2Y A;  2V68 A;  2JLE A;  3EIC A;  2E7X A;  3PIO Q;  2FYX A;  4NLU A;  3GP9 A;  4GVB B;  2B0G A;  3HP6 A;  3F44 A;  3I56 S;  2Z4P A;  3ZZY A;  4HEA 9;  1N6Q A;  1H2V Z;  1UVI A;  4NZ7 A;  2HVE A;  4OV6 A;  6AT1 B;  2MZT A;  5AXM A;  1RLC L;  3M8Z A;  1HWJ A;  5E5N A;  1RTJ B;  4I2Q B;  4ED8 A;  1SQF A;  1U2C A;  1UWA A;  2LXF A;  5LMU F;  3H90 A;  1R3N A;  5KOX A;  1LW2 B;  3CJ0 A;  4CO3 A;  1S1U B;  1X4D A;  2HFO A;  3D6F B;  5CAA A;  4TYA A;  1HNV A;  1QAY A;  3MGJ A;  1NK0 A;  5DG9 A;  4PUO B;  2RH3 A;  1JLE B;  4RL1 A;  3UN3 A;  3HF5 A;  4CO2 A;  2ZH2 A;  2OPR A;  3KG0 A;  1VR6 A;  4M5J A;  3TVZ A;  4DUY F;  1Y5L B;  2XS7 A;  1H0H B;  5KG5 A;  4EO6 A;  2KXF A;  5IS2 A;  4NLO A;  4ZLJ A;  1IJF B;  5CAB A;  2IAJ B;  4WFN Q;  1RTH A;  5KFX A;  4CH0 S;  3MPU B;  3AH6 A;  4F4X A;  1BLU A;  2UUC J;  5B0C A;  1FTC A;  3R6L B;  2XC9 A;  4IFV A;  5HI7 A;  1X4H A;  2QG9 B;  1N6Q B;  2IY5 B;  1RTZ A;  3JYT A;  3CCT A;  4JV0 A;  4OZN A;  2Y1L B;  2V2V A;  3M8R A;  4ED0 A;  2R42 A;  2LEC A;  1S1W A;  2DCU B;  5CZV A;  1AFJ A;  1I5O B;  1WC0 A;  1UW9 A;  1M0S A;  2D7S A;  3LP2 B;  4IRD A;  2OPP B;  3V81 A;  4NMX A;  2Y8Y A;  4H4K C;  2B4P A;  3PW0 A;  4F7V A;  3J7Z 5;  3R1H A;  2NS1 B;  5F3Z A;  2CNN B;  3PRD A;  4ZCL A;  2Q6C A;  4ECW A;  4LMZ A;  1D8Y A;  4NXN J;  2ZZN A;  5CZX A;  3DHW C;  2PSZ A;  5KFU A;  4ERD A;  2EI5 A;  3DRP B;  1H7X A;  1Z1Z A;  4LF5 J;  1YQH A;  1RHR B;  4XAK A;  1FNM A;  1RHM B;  4MK7 A;  4AND A;  1HD0 A;  2C2O B;  3ISN D;  3LA0 A;  4B3S J;  3NL0 A;  1RWK B;  2F4F A;  3QLH A;  1NME B;  4N41 A;  4FXV A;  3TX0 A;  4AUK A;  2KI2 A;  2N4C A;  1HBM B;  3G82 B;  4O4R A;  4ZN1 A;  2BM0 A;  2WRM A;  1U8W A;  4YY3 F;  1W7W A;  2CNO B;  2GS8 A;  2LA4 A;  3JQJ A;  1ZM9 A;  3OFH A;  3RBD A;  1RA7 A;  2OML A;  2Y9H A;  2VQE J;  1JXV A;  3BRE A;  2UUC F;  1DJ0 A;  3RYL A;  2VPY B;  3CDA A;  2DHX A;  4JI0 J;  3IRX B;  1HNW F;  2FJB B;  4LIW A;  2XYG B;  4FXW A;  3D6T B;  1GXT A;  1SQG A;  4CLT A;  4BHQ A;  2XI2 A;  4E8U A;  5E41 A;  3DLH A;  1C4A A;  2M8H A;  1IR1 A;  2KO1 A;  2NRE A;  4F02 A;  4J37 A;  4KKO A;  1HHQ A;  2ALZ A;  3EWG A;  3PHE A;  5L8R C;  5F8I A;  5KG4 A;  4P2S A;  1SKW A;  1H3D A;  1X4A A;  2CVE A;  2GAH C;  2KT2 A;  4I7F A;  5FD1 A;  1N33 J;  1RT3 B;  3SI8 A;  2QA4 S;  1RT2 A;  2AJ2 A;  2C3P A;  5KG3 A;  1EIY B;  3BYR A;  2DXE A;  3DHX A;  5T7L A;  1FXL A;  4U7C A;  3MXH P;  5HJX A;  3G96 A;  2JRS A;  4OMF G;  5J1N A;  3B4M A;  4CNZ A;  3TR5 A;  3IBC B;  1U1M A;  1FWL A;  2DRD A;  5KG6 A;  1M5P C;  5H9F K;  4G1Q B;  4DV2 F;  4FF3 A;  1G4C A;  1S6U A;  5KFM A;  3BN7 A;  5E3A A;  2EEY A;  2CPH A;  3LP1 B;  4J9L A;  4CT9 A;  1C0U B;  2CQG A;  1RU2 A;  2F1F A;  3QSY B;  4U95 A;  2FVQ A;  4O44 B;  4ECV A;  4C98 A;  2HPU A;  2XCP A;  3B78 A;  3VAG A;  2OKQ A;  3FGV A;  1F5B A;  4IFY B;  1BUX A;  1HI8 A;  3A13 A;  4FKY A;  3W65 A;  3M8Y A;  4QWB A;  1WF2 A;  3I0S A;  5ETR A;  4ZJL A;  5KG2 A;  1VK8 A;  4DPY A;  4DR6 F;  1NHK L;  4JI2 J;  1WC5 A;  3GJR B;  1VQO S;  4NAS A;  5KFD A;  1S48 A;  3FDS A;  4DSF A;  1A0O B;  4C3K A;  2QA4 G;  3CWJ A;  4K4X A;  2E9Z A;  3QGG A;  3SIP B;  1YJW S;  2MZS A;  3QWP A;  5EWG A;  4Y28 C;  3MD3 A;  4TKT A;  4DXL A;  1RKI A;  2HZC A;  5KG0 A;  4ZPC A;  4WCE Q;  2FJV A;  2HMI A;  1FDN A;  1F5A A;  2YTC A;  5BYR A;  2V8V A;  4B9U A;  1IJE B;  1PCA A;  2BJ8 A;  1FWP A;  2HFV A;  2BAC A;  3J81 Y;  1VIX A;  4F3M A;  3NGD A;  2GMJ A;  4KGZ B;  4LRA A;  1YJ7 A;  2XMW A;  2KDO A;  1JLC A;  3C66 A;  4OZ1 A;  3LO3 A;  4ILL A;  3SCK E;  2HS4 A;  3VAL A;  2CZ9 A;  1RT5 B;  2CFX A;  2ZVS A;  1CJV B;  3SFU A;  1KLM B;  1REV B;  2YWH A;  1W26 A;  2ASY A;  3O1L A;  2ROP A;  4U67 Q;  2Y8W A;  4WP9 A;  3W5Z A;  4DX7 A;  4G3I A;  2RRB A;  1V5V A;  2OGU A;  2OD4 A;  3DI6 A;  5B7W A;  5LJ5 Y;  1NDL A;  4LF2 A;  2AEJ A;  3CF5 Q;  5D6G A;  4OHV A;  4RW8 B;  1R89 A;  2HLT A;  3HLU A;  4WFA Q;  1AUS L;  4ZPT R;  4OJH A;  2V2Z A;  3QIP A;  2F4V J;  1VLO A;  3PR5 B;  1SC6 A;  4USM A;  3CJQ A;  2GFF A;  1RU1 A;  2MB0 B;  1WC6 A;  1GAO A;  2DNN A;  5LXR A;  2MLX A;  2JZ5 A;  4DUZ F;  4WYW A;  1WG4 A;  1H2T Z;  1Y0H A;  3EMT A;  5M2U A;  2HIY A;  2BJ9 A;  5CQG A;  4Y0F A;  2FHJ A;  3JTO A;  3GTY X;  4L6V 3;  4OIX A;  4Q7A A;  4MKB A;  4LRE A;  3MFI A;  4LSZ B;  3TI0 A;  1KLN A;  1HYS B;  1B0T A;  3QID A;  1NKE A;  1S6P B;  4UT4 A;  4TLR A;  3LAL A;  2DGW A;  3KWM A;  5CYJ A;  2MZ1 A;  4IRK A;  3P6Y C;  1C1B A;  1NBE B;  1OS5 A;  2FGC A;  2HQG A;  3BH7 B;  1WEZ A;  3M2V B;  3OR1 A;  5KFQ A;  2XMU A;  2CJQ A;  3NWR A;  3CCL S;  3PRB A;  4ELV A;  5I4M A;  3FMW A;  1QSL A;  2FVP A;  1N32 J;  3GR1 A;  3SSR A;  1HNW J;  4DI6 A;  2RUS A;  2F65 A;  4OHZ A;  1WKK A;  4EUV A;  3JSM B;  3ZZ0 A;  1FJE B;  1IBM J;  2ZH1 A;  5DLG A;  3U1M A;  3FRY A;  4KR0 B;  1RT2 B;  4B3R F;  1FD8 A;  2MKK A;  2HZV A;  3T6B A;  4YR0 A;  1E6Y B;  3GG0 A;  4UQG A;  3EJM A;  2F63 A;  3H59 A;  2CNK B;  1YDL A;  1PBU A;  4P2M A;  1TVR B;  3IG1 B;  2H9Z A;  1TKT A;  2IAJ A;  3FEY B;  4Y3C A;  2NXC A;  4DR5 J;  2H51 B;  4JV5 F;  1WOP A;  3MMB A;  3NWG A;  4PR6 A;  2FY1 A;  2M52 A;  2LLZ A;  3KMQ A;  1HLW A;  1M1G A;  1VCT A;  4UZB A;  3SEO A;  8RUC A;  4YHH J;  2XLJ A;  1F3V A;  4OYI A;  4DSK A;  3OTD A;  2HSE B;  3CMA S;  1X5P A;  2F7V A;  2RJZ A;  4IG0 A;  3THV A;  1FJC A;  5A0Y A;  1SJF A;  4Z7C A;  5EN1 A;  2M9K A;  1G1X A;  2QA1 A;  1VQ7 S;  5EWE A;  2E7V A;  1OPI A;  1XR6 A;  1PJ7 A;  3FMB A;  2DGX A;  2GZO A;  4YME A;  5IM0 A;  5FLX U;  2B7B B;  4TU9 A;  1U48 A;  2E5J A;  1N0V C;  4JI4 F;  1SKR A;  4NI2 A;  5DLF A;  1I94 J;  1DAX A;  2V9W A;  1RIS A;  2CG4 A;  1ZH5 A;  3BSC A;  1P1T A;  3GYG A;  3C14 B;  4J9U E;  3ZZU A;  3SSQ A;  1PJ6 A;  1X0F A;  2ZNY A;  4JI2 F;  5JJB A;  3CC7 S;  1Z4U A;  1Z2Z A;  3C16 A;  4UF4 A;  5D78 A;  4DV0 F;  5C42 A;  4DQP A;  1L3V A;  4EWT A;  3PIP Q;  1I6J A;  4C4W A;  2W2P P;  4ZJQ A;  4Q2L A;  4DCJ B;  3MFH A;  2AJF E;  2ZVI A;  4WKR A;  4O4G A;  4L3K A;  4OHW A;  4UUX A;  2KTQ A;  5ETT A;  3DDN A;  1WTF A;  3GON A;  4URQ U;  4GC6 A;  2YH0 A;  4DSL A;  1Q5Y A;  1RT4 B;  2F9D A;  2YQ0 A;  2A6O A;  3NNH A;  2DIV A;  4NCG A;  4IRC A;  3MMJ A;  3POT B;  1VQY A;  3PX6 A;  3V4I A;  3UO0 A;  4IUF A;  1GX6 A;  1JMT A;  1GXL A;  2CZV C;  3NAH A;  3US5 A;  3PKY A;  1ZA1 B;  2XHC A;  4C6A A;  3I96 A;  2EKN A;  2U1A A;  3OFE A;  4O3N A;  2PD1 A;  3TZZ A;  4UST A;  2EC0 A;  2DHS A;  3E01 A;  3M6U A;  1UJ5 A;  3J7A 1;  5K8P A;  5KTQ A;  2VFV A;  1F60 B;  1WOR A;  1RWM B;  3C46 A;  3D6M B;  4OYA A;  4UUW A;  4ZDN A;  2DNP A;  2BMB A;  2EK1 A;  3PW5 A;  3SBM A;  2FLL A;  4LF7 F;  4DF4 A;  3GCX P;  1FXR A;  3OVS A;  1ZOT A;  3G6E S;  3K58 A;  1JLE A;  2PE8 A;  2HHP A;  4NZ6 A;  4X4R A;  3OLB A;  3RRG A;  5GMK a;  1S1X B;  1X8D A;  3DRS B;  5ETK A;  1SVD A;  2BJ7 A;  5IFM A;  4FS2 A;  4NXM J;  2OTJ S;  4XPE A;  2Q66 A;  4AL5 A;  5SUH A;  3BJY A;  3TA1 A;  2XBP A;  1WG1 A;  2M0G B;  1AW0 A;  1FER A;  2E7W A;  2CJB A;  3GLJ A;  2W7A A;  4JUZ A;  2RRN A;  4DEZ A;  4DV0 J;  2FC8 A;  5D0H A;  4A4J A;  2WK4 A;  4GVB A;  4LRD A;  1GXU A;  4KHM A;  4F4A A;  3J7Z T;  1S9G A;  1UMJ A;  2OUG A;  2DHA A;  4TY8 B;  2ACY A;  4NEZ A;  1K8A T;  1FWK A;  1IQZ A;  1VBK A;  2YX4 A;  3CCV S;  4HHJ A;  3R2C J;  2LVW A;  1NU4 A;  1YTY A;  2BAN A;  5HMX A;  1NDC A;  1H6K X;  1P9Y A;  4CO0 A;  4MYT A;  2IVM A;  5FDL B;  3PDN A;  2IBK A;  2Q3P A;  2JFD A;  3IR6 B;  2MTL A;  5CD4 H;  4AQY J;  2FC9 A;  2LDY A;  1U1L A;  4O3S A;  4C9D A;  2DEJ A;  3UE2 A;  1VBZ A;  3NY0 A;  3MED A;  2EFP A;  3MCN A;  2MGZ A;  1N34 J;  1RJJ A;  1EKS A;  1Q0N A;  2BKN A;  2LCW A;  3P5T L;  2ZOM A;  3AOD A;  4ICL B;  1T02 A;  4CCH A;  4IG3 B;  1PYO B;  4FF4 A;  1YX2 A;  2FIU A;  2AYB A;  5GMD A;  3DOM A;  3LWL A;  4ECT A;  2EBE A;  2HBR B;  1GT8 A;  2EW9 A;  4OYB A;  1IKX B;  2RRA A;  1HMV A;  1NK5 A;  4X66 F;  1NZ8 A;  1KVI A;  1JKH B;  1S4E A;  3MAA A;  1ACM B;  5L9X A;  5DG8 A;  4PG7 A;  1NK4 A;  4PXE A;  2HMI B;  1VQ5 S;  2KJW A;  2VBY A;  3GU0 A;  4TY8 A;  3M1V A;  2U2F A;  2FY8 A;  3WC2 A;  2H5J B;  1LEO A;  4AFF A;  2W9B A;  1NPK A;  4LSN B;  1Q79 A;  1RI7 A;  3OVA A;  4NA2 A;  2HHH J;  1LQ9 A;  3PZP A;  3MM5 B;  4N5S A;  3CSK A;  1U4B A;  2HLU A;  4DCO B;  3W63 A;  4C8K A;  4WWS A;  4ZN3 A;  4HHU A;  1V3Z A;  2WW8 A;  3MUM P;  4BCA A;  1VC0 A;  3GII A;  1DTT B;  1RHJ B;  2JHE A;  3H2U B;  1UZH A;  5K5M A;  4DLE A;  4P2X A;  4LFC F;  4MFB B;  1FRM A;  2L08 A;  1F9E B;  5E2Q A;  2KFZ A;  1PKU A;  1YJT A;  2LFV A;  3BKF A;  1UEU A;  1ZZN A;  1WSR A;  3MDF A;  1HW8 A;  2IA0 A;  4DFM A;  4W98 A;  3KLF B;  3A8J A;  4A8Y A;  3MZI A;  1RT3 A;  2DO0 A;  4AXJ A;  2XUL A;  1DUR A;  1MNE A;  1NH8 A;  4Y2M A;  2ZWO A;  4I64 A;  2ROE A;  1CJT A;  2HIQ A;  3PJX A;  4DPT A;  2V8H A;  4IH7 A;  1X4G A;  3EGZ A;  1Y3J A;  2VAS A;  2FGO A;  3I4H X;  4O4G B;  3H20 A;  3VZI A;  2PDA A;  4FYW B;  3G8S A;  1RT4 A;  1Q82 T;  2QLJ B;  1EHW A;  3AB2 B;  4PG5 A;  4MYU A;  3CCM S;  2EXU A;  4UOH A;  4LFA F;  1J5O A;  2JEI A;  2ZC3 A;  2J6U A;  2V34 A;  3ZZT A;  4OLP A;  1SCJ B;  3SV4 A;  4X4S A;  3M30 A;  3C14 A;  2LA6 A;  3GQC A;  3JB9 k;  2YPY A;  2L3M A;  4UQT A;  3MMC A;  3NBP B;  1J5E J;  1FEH A;  5LT5 A;  2E9R X;  1R6V A;  3GFZ A;  3IR5 B;  1ZZF A;  2EWH A;  1U0H A;  1PC5 A;  4LRF A;  3SFG A;  3VWS A;  4A8K A;  3V6K A;  1S1V A;  2XYH B;  1KOO A;  3TAR A;  5L38 A;  3Q24 A;  2R2U A;  5DM6 Q;  2I5J A;  1IWG A;  2LYV A;  3I82 A;  3L7U A;  4GO7 X;  3UD4 P;  1U1R A;  3CCJ S;  4J9R A;  2W2Q P;  3CXC R;  1N88 A;  4LUB A;  2CPE A;  4YB5 A;  1S1T A;  3HSZ A;  3MM8 B;  4ZVU B;  3THT A;  4AE5 A;  3J80 Y;  4ZJO A;  2Q79 A;  1Y00 A;  2V8G A;  4RO0 A;  4ZVQ B;  2N7C A;  2W24 A;  1JLQ B;  2VKZ G;  3QGP A;  5ETL A;  1J27 A;  1WG5 A;  2HQD A;  4HDG A;  5GAH I;  4QOT A;  3J80 U;  2XQC A;  2E5L J;  3C2P A;  1RAO A;  3EPG A;  2BR0 A;  2AYE A;  2E5H A;  1T9U A;  5KFC A;  4G1Q A;  2MJN A;  1WTB A;  4M63 A;  4QJV A;  3QQC D;  1TL7 A;  2HEK A;  2MHE A;  3NS6 A;  3I5A A;  3JAM U;  1AT1 B;  2VG6 B;  2NCK L;  2CWX A;  3QMQ A;  2UXC J;  5IQ6 A;  2KRR A;  2HKE A;  2BQU A;  4DR6 J;  4JI5 F;  4ID5 B;  4KAI A;  3L7O A;  1NJY A;  4OX8 A;  3SV3 A;  2AWZ A;  2MQ8 A;  3CDB A;  4MIA A;  1K1S A;  3BGR A;  4FNH A;  1QTN B;  3ZTP A;  3CCR S;  4RU2 A;  5H1S V;  2I0X A;  1AB8 A;  5IM0 B;  2BE7 D;  5EX3 A;  4P72 A;  3O6Q A;  1N4L A;  1VJQ A;  3DLJ A;  1VQ4 S;  1KR4 A;  3VV2 B;  4CLW A;  3DI6 B;  3M2R A;  1HA1 A;  1N54 B;  5CYQ A;  2CVI A;  2PC6 A;  3RBX A;  2GMH A;  2FZC B;  2J9D E;  4C8L A;  1T9Y A;  3R5B A;  4RU9 A;  4X65 F;  1KVJ A;  2CDQ A;  2JC0 A;  3OL6 A;  2LQB A;  5EX0 A;  1X31 C;  2DNH A;  2XM3 A;  4S0M A;  2NSC A;  5DDQ C;  5D4N A;  5AT1 B;  2WVD A;  4NLD A;  1KQK A;  1UJ6 A;  3RR7 A;  4ZPV R;  5KOW A;  4RJV A;  5L1L A;  2I8E A;  2YKA A;  4CNY A;  3B6B A;  2EKY A;  5T41 A;  2NXE A;  3NMR A;  1LK7 A;  4WXW A;  3PHT A;  2HW3 A;  1SV5 B;  2XSF A;  5KFZ A;  4F36 A;  3T1H J;  2FLN A;  3PO5 A;  4NE9 C;  5D4L A;  4E98 A;  3MR6 A;  1WEY A;  2AT1 B;  2LQ5 A;  1M1H A;  2CJY B;  2KHD A;  2ZZT A;  3BZQ A;  1TKZ A;  3NCP A;  4HDH A;  3GSI A;  2G0J A;  4ZVE A;  4KV8 B;  5KFY A;  2DR5 A;  4NXM F;  3KTQ A;  3EPI A;  3W9H A;  5HJY A;  2R4F A;  4LRC A;  1B7Y B;  1HR0 J;  2BJE A;  3MF5 A;  4LFC J;  4P7V A;  4X4Q A;  4RNH A;  3UVJ A;  3OTE A;  1U09 A;  5KT2 A;  3R1L A;  4PAB A;  1M5V C;  4QIW D;  4WFZ A;  4ZHR B;  3TUP A;  5A8K A;  2JEF A;  2R8G A;  2NPI A;  2GO9 A;  2ZUA A;  3IXQ A;  4QIE A;  3RJM B;  1RBA A;  4X4O A;  4LF5 F;  1MN7 A;  2X7I A;  3DM2 A;  3M8Q A;  1RTH B;  5LJ3 Y;  4DL3 A;  2VU5 A;  3IA0 A;  4ZCM A;  2BYC A;  1RCX B;  4DUY J;  1RTD B;  1VDH A;  1W25 A;  2DGU A;  2EC2 A;  2MZQ A;  4I1T A;  3AOC A;  4EFA C;  3O44 A;  5HBM B;  3HSD A;  1OSD A;  2ROG A;  2P5V A;  2GX8 A;  4Y2C A;  4OZ2 A;  4QYR A;  3H98 A;  4DU7 A;  2ILZ A;  2UVR A;  3UN5 A;  3AD9 C;  2DNQ A;  1MW7 A;  4ID8 A;  4Q2M A;  1NPR A;  1ZTT A;  1SIW B;  1BD6 A;  4I4B A;  1QE1 B;  3HFV A;  2CRL A;  2VV5 A;  5KT3 A;  4HTJ A;  4LBP A;  4YHH F;  2ZEJ A;  4KRW A;  3N5F A;  3T5K A;  1VQL S;  2MGZ B;  4F4K A;  4ILM A;  4NI2 B;  1Y4Z B;  1L3T A;  1S1T B;  3MM8 A;  4DL2 A;  4ICL A;  3HPO A;  3OUY A;  3D6H B;  4FPR A;  4NPO A;  1WUU A;  1RLD A;  2JC1 A;  3M30 B;  1B3T A;  1IBL J;  2IFX A;  4BWJ A;  2M2B A;  1FRJ A;  5ETQ A;  2VQF J;  4C0B A;  5KFB A;  2HHX A;  1IKV A;  3FEZ A;  2CUY A;  1X9M A;  1RYS A;  2QFI A;  4DUT A;  4P75 A;  1K44 A;  4CM0 A;  2XGP A;  2B6A B;  4OI1 A;  1Q78 A;  4IOB A;  4ZIV A;  5ETN A;  1XK8 A;  3VGU A;  3FSX A;  2NSB A;  4DV5 J;  1B4S A;  4ED4 A;  3QWU A;  4KE5 A;  1Q8B A;  3D3B J;  4OZ3 A;  4LSN A;  4DQI A;  2HS0 A;  4DV2 J;  1TFY A;  4QU7 A;  3ADA C;  3POT A;  5J2Q B;  3H25 A;  3UCU P;  3B82 A;  8ATC B;  4FBT A;  1RWV B;  3T5J A;  4ELU A;  3LAN A;  5KG1 A;  3RB0 A;  4JV5 J;  3DOL B;  3HHL A;  3HHE A;  3W2W A;  1FX2 A;  3LPY A;  1S49 A;  2IRU A;  3I6P A;  3QJP A;  1RT6 B;  2OIH A;  3H0P A;  3MEE B;  2BAB A;  1EAR A;  2LXI A;  2FJX A;  2EFN A;  3ZFV A;  3DLE A;  4XDC A;  2P9G A;  3DKD A;  4ES2 A;  4FYD A;  1H98 A;  4ZP9 A;  3CC2 S;  2EFG A;  3D0G E;  3OUY B;  2BKO A;  3GIM A;  3QFW A;  5LMU J;  2MLZ A;  5HAT A;  4QW9 A;  1NSQ A;  2K3K A;  1HBN A;  4OYX A;  5HN0 A;  5KFW A;  3IRX A;  1FVQ A;  3GIJ A;  4DWI A;  3UCZ P;  4RZR A;  4ECU A;  3HJF A;  3LAK A;  4MK9 A;  4QYZ J;  2B6A A;  4L72 B;  3EYZ A;  3FBC A;  4U8Y A;  5HAO A;  1GH8 A;  3A3N B;  2CA9 A;  4HAC A;  2YBV A;  2MKY A;  3LP1 A;  4K7Q A;  1P1L A;  2HAF A;  2IMO A;  2MST A;  5I42 B;  1RQ0 A;  3Q8Y A;  4EGL A;  2YKO A;  4NZ0 A;  2WB1 D;  4QBU A;  2OPQ B;  1MRO B;  3HJV A;  3TRG A;  2IMW P;  3HO1 A;  3CD5 A;  2XMV A;  1WHX A;  3DRY A;  1Y10 A;  2CNL B;  2AP6 A;  2KH9 A;  4DZD A;  1MWZ A;  4U8V A;  4DSE A;  1S6O A;  2GQQ A;  1NJI T;  3KK2 B;  2ZH9 A;  5D77 A;  2VPW B;  2X1A A;  2J8A A;  4Q8F A;  2WOM B;  3HVT B;  5I3U A;  1RB0 A;  3N0V A;  1BXN A;  1OY8 A;  1G3O A;  2D9O A;  1NSK L;  4F50 A;  2VOO A;  3DN9 A;  6FDR A;  2WB4 A;  1SV5 A;  4CRJ A;  4YY3 J;  1FF2 A;  1TKX A;  3CD0 A;  3EGW B;  2CQD A;  3BDP A;  4NML A;  3UWT A;  3JQK A;  3MTK A;  4M5H A;  3MMA A;  4DQQ A;  2YKQ A;  1HNX J;  1TKZ B;  4JI7 J;  2MJU A;  1S79 A;  1RT7 B;  4PXB A;  1WAC A;  2ZHB A;  3NEK A;  2DR7 A;  1YBU A;  4O3Q A;  1RAF B;  2HWI A;  2DNM A;  2RQC A;  5HBM A;  3CMQ A;  4JI1 F;  4JOU A;  1TK0 A;  3V2U C;  2KJV A;  2XS5 A;  2HAI A;  4PG4 A;  1IUJ A;  2OMO A;  3PX0 A;  1IKW A;  2ZE2 B;  4CLS A;  4FVC A;  2DR9 A;  1YK9 A;  3HVA A;  5E7O B;  1T95 A;  2KKH A;  2MQN A;  1GTE A;  2PO4 A;  3CJT A;  2HGM A;  2CPJ A;  3O5T B;  3O8W A;  4PQA A;  3R7N B;  4F4Z A;  2VG5 A;  1Q81 T;  1S1U A;  2MY8 A;  2A0F B;  4N76 A;  1BQM A;  2V4J A;  2ZKU A;  5I3U B;  2BOP A;  1DFD A;  2Z57 B;  1IR2 A;  2AU0 A;  3AJ1 A;  2O01 C;  3TX8 A;  4MTP A;  2C3U A;  3RTV A;  5E3R A;  4PPZ A;  2YWF A;  4RW8 A;  2NXU A;  3MTJ A;  1L3S A;  3IFE A;  2HNZ A;  3BYP A;  2B9W A;  3GG1 A;  3MEG A;  3R3T A;  3UDC A;  5KG7 A;  3PNI A;  2XLK A;  1CJU A;  1WI8 A;  4I2Q A;  4OQJ A;  3LGN A;  1RT7 A;  2C3M A;  2NLW A;  3MM6 B;  4FZV A;  3TO8 A;  2HRY A;  4BC7 A;  4GC7 A;  1J5E F;  2OTL S;  2HHT A;  1U7L A;  4WZM A;  2J7K A;  1JJC B;  3D5M A;  3LUY A;  1S59 A;  4X2B A;  2ZIT A;  4ZLL A;  1HNI B;  4DFJ A;  1TFW A;  4XTT A;  4ZCI A;  3C6U B;  1RT1 B;  1X60 A;  4Q43 A;  3OL7 A;  5HLF B;  1KQG B;  1KP6 A;  1MU2 B;  1JLA A;  4WII A;  2IVF B;  5AE3 A;  4ILR A;  4M5I A;  4NWB A;  4WBF A;  3M9N B;  1LXN A;  2NXJ A;  2MSS A;  3MPY A;  4ZPW R;  1BHN A;  1T11 A;  1P8G A;  2C1E B;  4K5R A;  1FFW B;  1BQM B;  4ALZ A;  2YKM B;  4MJK A;  2OSR A;  4MKA A;  2E1A A;  5C24 B;  4G1P A;  4KBI A;  3BS9 A;  2AMC B;  1Q95 G;  1YJU A;  2XSJ A;  1VQ6 S;  4OYP A;  1E6V B;  3N6N A;  1WC3 A;  2DGS A;  2H1Y A;  3KLF A;  5LL6 d;  3VTI A;  1H73 A;  1VQ9 S;  2HWH A;  3PJW A;  3D1H A;  1IBK F;  3TAM A;  4OYM A;  2F9J A;  1IQT A;  1S6P A;  2JNJ A;  3FFI B;  4URG A;  1X9S A;  2BXJ A;  4LF8 F;  2YWK A;  1CBK A;  1RP5 A;  2DKO B;  1S1W B;  2UXB F;  1CS4 B;  1FRK A;  4QZV B;  1PGZ A;  5HVH A;  2C3Y A;  4P74 A;  1FFG B;  5HL7 Q;  1TTH B;  2DR6 A;  3QO9 B;  5IC6 B;  2YNH B;  1NPP A;  3CIZ A;  4ELT A;  2B43 A;  4NXN F;  3MEE A;  5KFR A;  4DL6 A;  4OJG A;  4GKK F;  4X4V A;  4IO1 A;  1J5O B;  3P96 A;  2PMW A;  3V5R A;  2XY6 A;  1EKR A;  4K4U A;  3EGN A;  3IWL A;  4DS4 A;  3TEG A;  4RW7 A;  1XN9 A;  2K3I A;  1B0P A;  5L1J A;  2GC8 A;  1NKB A;  3C16 B;  2XMT A;  2HNY B;  3VF0 B;  3OR2 A;  1UVK A;  1IVZ A;  2DJW A;  2MQM A;  5KFH A;  5HMZ A;  5KT5 A;  4I56 A;  1VQN S;  3W61 A;  1JLB B;  4R0E A;  4TNO A;  4NRU A;  4C0O C;  4PQU B;  3ELH A;  4XIU A;  1LWC B;  1HWI A;  3KNA A;  3Q8P B;  4OHX A;  4LRB A;  3Q8R B;  2AGO A;  1FNX H;  2LDI A;  1FK9 A;  1RUS A;  4O0I A;  3N9U C;  2CKW A;  2F5G A;  3BGO P;  2QMU B;  3CJK A;  2WBR A;  4ZS6 A;  2DNG A;  4N56 A;  3N6L A;  1JIH A;  4F8R A;  3M05 A;  2W7O A;  2YWW A;  2O3D A;  2XMK A;  4OZ5 A;  1U25 A;  2VOP A;  4W4M A;  2DH9 A;  1X7V A;  3ZTQ A;  4DL7 A;  5HVF A;  3H4B A;  3KLE A;  3K89 A;  2C2R A;  4FXD A;  3GV8 B;  4FF2 A;  1D9F A;  3TAP A;  5AXK A;  2GVZ A;  3WBZ A;  5IT4 A;  2CPX A;  5F9N A;  2YNI B;  4ZKA A;  1TK5 A;  3CJ5 A;  1T3N A;  1UA0 A;  2CQ0 A;  2ZUG A;  4FDF A;  1PG5 B;  4NCG B;  2JLF A;  3CO0 P;  2RF2 B;  1C0T B;  5J2N B;  3GIK A;  2AYG A;  1IBM F;  4RW4 B;  3N6M A;  1GMU A;  6FD1 A;  3ZTR A;  4F2R A;  2ZDP A;  2OFH X;  1MN9 A;  3AD7 C;  3I4P A;  3M9O B;  4CI0 B;  2HFU A;  5JUM A;  1U49 A;  5F8J A;  3I0S B;  4WE1 B;  1JXE A;  4DR7 F;  2VFU A;  4DR3 F;  3UD5 A;  2DR8 A;  4JI3 F;  1GX5 A;  1RT6 A;  2IPO B;  4H4M A;  4I69 A;  3NCQ A;  4Q44 A;  2E29 A;  4QQB A;  4DV3 J;  2QLW A;  5B0G A;  3T9Z A;  2W2N P;  3CT9 A;  4WK1 A;  5LXY A;  1KEK A;  3TZX A;  3KNG A;  3G4S S;  1HHT P;  3BGL A;  3CIM A;  4FBU A;  4UY8 5;  2UU9 J;  1HQE A;  2AJ1 A;  2QZ8 A;  3E8O A;  1XMO J;  2PEH A;  2PFD A;  5F8N A;  2COL A;  4HI2 A;  3SQG A;  7FD1 A;  2OEM A;  1FKP B;  1ICE B;  5CHC B;  1QAI A;  4PWW A;  2VB6 A;  4MMO A;  3Q8V A;  2BRL A;  2NR0 A;  3WIV A;  2R7U A;  1Y7P A;  1SH3 A;  4B3O A;  4ZVO B;  5KFF A;  3KMS A;  2ZHA A;  1FO1 A;  3D1Q A;  4Y34 A;  1XER A;  2XLI A;  4P2F A;  2FJE B;  1S9F A;  3FCW A;  1QUV A;  1S9G B;  3IBF B;  4OX9 J;  2B8Q A;  3AXK A;  4ENO A;  1XNR J;  3UW1 A;  2VC1 A;  3UDV A;  3BB5 A;  3EDQ B;  3K17 A;  2EG1 A;  2RU3 A;  2C2E A;  1RXO B;  5ETM A;  3KK3 B;  1VQP S;  2QLF B;  1UJ4 A;  3CB4 A;  5H9F J;  4QWA A;  4J9S A;  2VJU A;  4EO8 A;  2M8D B;  4GKJ F;  1QE1 A;  1PIL A;  5GAG I;  4NCA A;  1TU0 B;  4HHH A;  1IXK A;  5D3G B;  3HD2 A;  2KHC A;  3OXF A;  1XNQ J;  5BR8 F;  3EX7 B;  2H4W B;  5C25 A;  3R97 A;  2DHH A;  1KBR A;  3CCW A;  1OY9 A;  4A8F A;  2RQ4 A;  1GMV A;  4KHP F;  2GIQ A;  3BSA A;  4O3O A;  2ABY A;  5HRO B;  1RE1 B;  1WJ9 A;  2QC3 A;  3UR3 C;  1LW2 A;  3CDU A;  3U1L A;  3K5N A;  3MAA B;  1LV5 A;  3CC4 S;  1ZA2 B;  4R5P A;  3AFG A;  1YSJ A;  3GFH A;  3GV5 B;  2D69 A;  1N52 B;  3A8K A;  1PO6 A;  2AEF A;  4Q45 A;  3G71 S;  2HGL A;  4WJB A;  2GW8 A;  2YX1 A;  5J1E A;  1X0P A;  2W4C A;  1WEL A;  2GHV C;  1CUL B;  3CE8 A;  3W7B A;  5A2Q U;  3BKT A;  3M32 B;  3FFI A;  1T05 A;  1WHW A;  4OX9 F;  4ETX A;  1HMV B;  1UZD A;  3BM7 A;  5KFV A;  3TNV A;  4KGM A;  3R2D J;  3LP2 A;  4F4W A;  2J7U A;  3M8W A;  1UVN A;  4PQU A;  2E5I A;  1NHV A;  2VIC A;  2GJ2 A;  4OV1 A;  1M5H A;  2N3O A;  3DXS X;  1TAU A;  2AEM A;  4EI2 A;  2Z2Z A;  3KLI B;  4NL5 A;  1O5J A;  3VAH A;  3IM9 A;  5A8R B;  1H74 A;  5IT0 A;  4DV6 J;  3G6V A;  1N32 F;  4K59 A;  1VLY A;  3QFH A;  1EAY C;  3H42 A;  3DMJ B;  1W2B R;  1M5K C;  3D54 A;  3KHL A;  1WC1 A;  3GPA A;  1CJU B;  3A8E A;  3M2V A;  4YDD B;  4YR3 A;  4QCL A;  2FVR A;  4OX7 A;  4RUH A;  1VJW A;  2B4U A;  4Y2K A;  2QYC A;  3BH6 B;  2I6W A;  2EG2 A;  1VRU B;  1IBL F;  2ALY B;  4QU6 A;  4FF1 A;  3TQ1 A;  1D8Z A;  2WVF A;  3E51 A;  1CLF A;  2YY3 A;  3EUN A;  4NA1 A;  4FPI A;  3M6V A;  3GSD A;  1XQI A;  1V3R A;  2BA9 A;  1FI4 A;  1SIZ A;  2QV6 A;  3CJ2 A;  4GRS A;  3ZZR A;  4EK2 A;  5K20 B;  3KLH B;  2UVU A;  1H72 C;  2CJA A;  3QAT A;  2O67 A;  2BKP A;  1KQS R;  2DGV A;  1MMD A;  1Q16 B;  3HFZ B;  3ILJ A;  3LH2 S;  1UPP A;  1T0T V;  2I5J B;  2JFK A;  3D9B A;  1WI6 A;  1ULR A;  2RDI A;  3MR7 A;  3RB3 A;  2E1C A;  1UVM A;  2KFN A;  1C2P A;  1FKP A;  2E5G A;  2V94 A;  2EFV A;  5C2C A;  3MMC B;  4LF6 F;  2ZH6 A;  4C8Z A;  4TU7 A;  5KFO A;  2WVB A;  4ATN A;  2HZA A;  2AX0 A;  3I31 A;  3I0R A;  3LGH A;  4ZVR B;  4ANE A;  4WTO B;  2KZZ A;  5IT9 Y;  1TL7 B;  1HW9 A;  2JWN A;  3EVO A;  1B7F A;  3K5L A;  1C0U A;  2MY7 A;  1SQE A;  3CD7 A;  3KKF A;  3M2R B;  4QIF A;  2DCL A;  3S1T A;  3TUI C;  3CCU S;  5J2M A;  3OJU A;  2DGQ A;  4K4W A;  3LW5 C;  1KNZ A;  4CLL A;  1JLQ A;  3HZE A;  1BC6 A;  2DNZ A;  3JSY A;  2W9A A;  4C97 A;  1T9X A;  1RK8 A;  1M1K T;  3W9J A;  2A18 A;  3RZA A;  2H5I B;  2XI3 A;  4WP8 A;  4ES3 A;  3KK2 A;  5KT4 A;  4RLE A;  4IH6 A;  1EET A;  5K14 B;  2I1R A;  4ED5 A;  2OPS A;  4AL6 A;  4ZVP B;  1YJV A;  3JTP A;  2FDN A;  4CLP A;  2LU2 A;  3ILI A;  1RBO B;  4CYU A;  2E1M C;  3P8B B;  3I9V 9;  3LP0 A;  1RAJ A;  1QJH A;  2XY5 A;  2RT3 A;  1FRH A;  5ADZ A;  1C1B B;  4P7T A;  3GB0 A;  1HPZ B;  3U27 A;  2KT5 A;  1ZPW X;  1QD1 A;  3FRZ A;  5CH7 B;  3MR3 A;  2E1P A;  5IOL A;  1RZM A;  3D68 A;  3W9I A;  3R6G B;  2GGP B;  5SZT A;  2CQ1 A;  3HSJ A;  2KZM A;  4N8N A;  2L41 A;  2HFS A;  2H5E A;  4J9P A;  2UXD J;  4QPT A;  2P8I A;  1VGY A;  1GMW D;  2VPZ B;  3TA0 A;  5T14 A;  3NGT A;  4HVZ A;  2JEJ A;  1TV6 A;  3D67 A;  2IJN A;  4C48 A;  2R7V A;  4WXO A;  4G6V B;  1SC1 B;  1VBX A;  2ZC4 A;  1S72 S;  1F2H A;  4ZIW A;  1LW0 A;  9ATC B;  1QUP A;  3DDI A;  4H4M B;  4OI0 A;  2OPS B;  1NEE A;  2J9E A;  3N4W A;  1U45 A;  2QL5 B;  1KD1 T;  3GJT B;  4X62 J;  3SCI E;  2KM8 C;  4URS A;  3SXL A;  3V6D A;  2HBQ B;  1TZ0 A;  1R8B A;  4QPX A;  1KWM A;  3M32 A;  1T05 B;  5FDL A;  3G8Q A;  3KLG B;  4YEA A;  3VGV A;  1VQK S;  3ENW A;  3NNA A;  1IN0 A;  3W60 A;  3T3F A;  3ET6 B;  4KH0 B;  3HT3 A;  4QWE A;  5DM7 Q;  4WP3 A;  3H7H B;  4R8U A;  1YGY A;  3CUL A;  2QYG A;  2PA8 D;  3TJA A;  2W9B B;  4UTG A;  4ECX A;  3P3D A;  5D15 A;  1RTD A;  1B0V A;  3Q89 A;  1XTZ A;  2ZDO A;  3T1Y J;  3SMZ A;  1KS2 A;  3AOA A;  4RW9 A;  4DN0 A;  4UOG A;  2M7S A;  1CJK B;  3DLB A;  3M8P A;  1GMW A;  3K8W A;  2FJD B;  1YRU A;  4YUD A;  1TL1 A;  3HHL D;  5C42 B;  1EX8 A;  2XNR A;  3BQ0 A;  4X62 F;  2A3J A;  3MM7 B;  4YB1 P;  1CPZ A;  2D41 A;  4ER8 A;  5C24 A;  1JKH A;  4TVA B;  4B3M F;  3D0I E;  1XMO F;  1B70 B;  3L7P A;  3M7V A;  1VK3 A;  2CQI A;  2DIS A;  4DJB A;  3MCO A;  2WBM A;  4ZLP A;  2YKN B;  3VGT A;  2DYA A;  3UNG C;  2R2R A;  4WU2 A;  2XEX A;  3DGV A;  1CVJ A;  2MZJ A;  5EUH A;  3TAM B;  3ZZO A;  1YJR A;  3CJK B;  5CCM A;  4DR2 F;  1DRZ A;  2OI2 A;  4M5G A;  3AJD A;  4BS2 A;  2DNK A;  3B54 A;  3P45 B;  4XDD A;  3TVY A;  1FX4 A;  2LXU A;  2QE5 A;  2SXL A;  2D9P A;  2DNY A;  3AHP A;  4QIG A;  4L3N A;  1XBW A;  3RAM A;  5HMY A;  3SCL E;  3KK1 B;  4C8M A;  1ZET A;  1F1B B;  1LWX A;  3HM9 A;  1NHU A;  4FNI A;  5DRK A;  3UR0 A;  2UUA F;  3MOJ B;  3WIU A;  5CYM B;  1S9E A;  2GVZ B;  2LEB A;  1T03 B;  3OVB A;  4LF8 J;  3ILL A;  1I51 B;  3OSN A;  3OQ2 A;  1L5U A;  2D1C A;  2FHK A;  3FCV A;  3HHK A;  4IYQ A;  3W5Y A;  3RRH A;  1YHQ S;  1SC4 B;  4AYB D;  2UUB F;  1APS A;  3DRP A;  1QLN A;  3U7J A;  4KSE B;  4OYZ A;  3VQS A;  4OL8 A;  4C8Y A;  4ES1 A;  3D28 A;  3AT1 B;  4YB6 A;  4IR1 A;  4CH7 A;  1HNX F;  1N33 F;  2XZW A;  1EET B;  2YH1 A;  4B9M A;  1KON A;  2GIR A;  2HND A;  3I5B A;  1TL3 A;  2OEL A;  2WON B;  5JXS A;  1GK8 A;  1NB7 A;  1QAJ A;  5DGB A;  1LWE B;  2V67 A;  2ZKT A;  2VBW A;  5DZ7 A;  4CYU B;  3K5O A;  2XMM A;  3MD1 A;  1VC5 A;  2QSW A;  1YG0 A;  3M6X A;  2J0X A;  4B9S A;  5F8G A;  3GV7 B;  3BF4 A;  3MPD A;  2RB7 A;  2NUU G;  1U1P A;  2BAN B;  3QZ8 A;  2UVW A;  2C42 A;  3LQV A;  2HS3 A;  4DV5 F;  1SB6 A;  1U0H B;  3UNY A;  5BR8 J;  3FZ2 A;  4LR9 A;  1RAC B;  2PN6 A;  1TUG B;  1ZPV A;  4QR2 A;  3VVT A;  5M2P A;  4AL7 A;  3TAN A;  1I3O B;  4A46 A;  1RSC A;  1HBU B;  5KT6 A;  3EE3 A;  1C1C A;  4KGK A;  2M5Y A;  4DR4 J;  2WAQ D;  1RAA B;  4U9R A;  2ATL A;  3CCQ S;  1U26 A;  4IH5 A;  1G2E A;  3JTN A;  1FDB A;  4G1I A;  3V6H A;  1LXJ A;  1NM2 A;  4HT7 A;  5H9E J;  3DGP B;  2D74 B;  1NH7 A;  3QAE A;  2HWT A;  2ILY A;  1V3S A;  2D3U A;  1HIY A;  4KFB A;  2EPI A;  2XMA A;  4XPC A;  4XO0 A;  5D3G A;  2FVC A;  4HH0 A;  3GIR A;  5KFA A;  5C5J A;  3DOK B;  3ENQ A;  2WOM A;  3HVT A;  4TY9 A;  2VG6 A;  4BLG A;  3NNC A;  1UVL A;  4X66 J;  1TEL A;  2IDE A;  2K8G A;  3JYT B;  3OHA A;  2MQO A;  3RB4 A;  1HBO B;  2B5J A;  1WF1 A;  1RTI B;  4EU0 A;  5JVH Q;  1OYD A;  2NUH A;  1M5O C;  4ZVH A;  1NSP A;  2Y1R I;  3KUH A;  3NGU A;  3GWC A;  2HHU A;  2ATC B;  1NND A;  2KXN B;  3M8S A;  2R9L A;  2CPD A;  2FHM A;  2UU9 F;  2CG8 A;  1V9O A;  3FBE A;  2AIR B;  4YN3 B;  3K5M A;  1HBU A;  1HNZ F;  3LGM A;  3HHD A;  2W25 A;  7FDR A;  3G9C A;  1FKO A;  2FD2 A;  3NOG A;  1O6X A;  3LTO A;  3S6E A;  5AE2 A;  1HWU A;  4YB7 A;  1RAG B;  2ZH4 A;  2HQ3 A;  4K50 A;  2YWG A;  3L95 X;  3LOU A;  2QFJ A;  2X1G A;  1CQM A;  1JB0 C;  3KFW X;  2J7W A;  3MMA B;  4KH1 B;  4B9L A;  3C8Y A;  1F6T A;  2ZBP A;  2NQP A;  3KLG A;  2I38 A;  1U6B A;  3H2L A;  4O23 A;  2W4D A;  4RUC A;  4K4Z A;  3Q0A A;  3HVW A;  1SI9 A;  2JDJ A;  2VD3 A;  4LBH A;  3TUZ C;  1YZ7 A;  4ZIT A;  1U2F A;  3DOK A;  2VBX A;  4YR2 A;  2IYI A;  2A1B A;  3ONQ A;  2AKW B;  4WKY A;  1WKJ A;  2P9E A;  2W4P A;  4IG3 A;  4DX6 A;  4IO9 Q;  1S0M A;  1KKH A;  1Q1K A;  4USW A;  5BJR A;  1UW4 A;  1YKW A;  2DEI A;  4WFY A;  1EZZ B;  3TVK A;  5DDR C;  2HHQ A;  1YBA A;  3MWB A;  4IFY A;  4PXD A;  3U1N A;  1TL1 B;  5ETV A;  4DV1 J;  1HR0 F;  4J9N A;  4O3R A;  1KOH A;  1XJW B;  2B4O A;  2OP5 A;  3SDE A;  1QAX A;  3N79 A;  4EBC A;  1HI0 P;  4R5P B;  2G1H A;  1RAH B;  3W64 A;  2R2T A;  2RIJ A;  2VHG A;  5DG7 A;  2Z2M A;  4IDK B;  4LFB J;  4E0D A;  2YNG B;  4M5L A;  4JI0 F;  3GJS B;  1NK8 A;  3DRR B;  2R7S A;  3C15 A;  2J6T A;  1FRI A;  3QT6 A;  2FZG B;  2KL8 A;  2XYP B;  3W2V B;  4B08 A;  2XO6 A;  2C28 A;  3T9N A;  2UUA J;  1OIA A;  2CQ4 A;  4RBT A;  4RR5 A;  4UZC A;  1HNZ J;  4NX9 A;  3QRR A;  3WQP A;  4LQ3 A;  2HRU A;  4OYW A;  2MLY A;  4NLY A;  5HO4 A;  4MFB A;  2ZFH A;  5D8H B;  2AGQ A;  3MCM A;  3DM2 B;  2OAU A;  3M8Q B;  4JP8 A;  5CXT A;  3VHQ A;  1S6Q A;  4DPU A;  2UV8 A;  4BC9 A;  2IBO A;  4DZ6 A;  3ZO7 A;  3JQM A;  2HBY B;  4BDP A;  1KHW A;  3PW4 A;  4JI7 F;  3MM5 A;  3F56 A;  7AT1 B;  4RBV A;  1U6Z A;  2F8E X;  2OJ3 A;  2RD5 C;  2CQH A;  2H48 B;  5A8W A;  3V6D B;  3PG9 A;  2G4B A;  5GAE U;  4JBC A;  3Q23 A;  1ELO A;  1VQ8 S;  2Z2L A;  5HSP A;  2RSQ A;  1REG X;  1DAR A;  3ET6 A;  1X4B A;  3OPK A;  2XMJ A;  2GHW A;  4IDK A;  4ZK7 M;  2NZC A;  3I32 A;  1WC4 A;  1HQ2 A;  2GV1 A;  3MR5 A;  3TEH B;  1H7W A;  5AJ3 F;  2RVJ A;  4EBE A;  1C4C A;  1NJX A;  4RBU A;  3HFK A;  2PGC A;  4DF8 A;  2VON A;  4ECZ A;  1X5T A;  2VIH A;  5GME A;  4JV1 A;  1QVF R;  2W2M P;  1S77 D;  4HKQ A;  4LFB F;  4X4U A;  1UPM B;  4OYO A;  3R27 A;  1VIS A;  3KXD A;  1OPZ A;  2IC3 B;  4FKX A;  3RUB L;  2R8I A;  1VQM S;  1U1K A;  4CQ1 A;  4HH1 A;  4PXC A;  1CSJ A;  5DQI A;  3BDE A;  2ZH7 A;  3K7R A;  5E33 A;  5KFK A;  4TXS A;  3OL9 A;  4OFZ A;  2A6M A;  2BRK A;  4RW4 A;  4ZPA A;  1VHF A;  3AB4 B;  4IG0 B;  4PCQ A;  1Y5I B;  3OR2 B;  2BBE A;  2Q6B A;  5EWF A;  3QZ7 A;  4EZ6 A;  3BSO A;  4RKU C;  1PSD A;  3FNN A;  3IAM 9;  3OHB A;  1Q8K A;  4ETZ A;  1F5C A;  3I5C A;  2GNK A;  2M3D A;  4NLG A;  5CYM A;  4QYZ K;  3M4X A;  4QR0 A;  5E3Q A;  1SUQ B;  3T19 A;  5BYS A;  5J2M B;  2DK2 A;  2IM0 A;  1JNR B;  4UOC A;  3KG4 A;  3PYG A;  1VIO A;  1ZAV A;  1KSP A;  3DC2 A;  3SQG B;  2R8H A;  2E9T A;  4IOA Q;  1ZAW A;  4USK A;  3DDK A;  1RTI A;  2HK3 A;  2JVO A;  4CLZ A;  2ZJP Q;  2HVI A;  3IG1 A;  4F3Q A;  3OXL A;  4C8O A;  4P52 A;  3CME S;  4USH A;  5BYQ A;  5L9N A;  1NK7 A;  4USJ C;  1UFW A;  3RW7 A;  1RWP B;  2FB0 A;  2CQP A;  1NDK A;  2K06 A;  1TP7 A;  3R5J B;  1BMQ B;  1GEH A;  1BWV A;  5U47 A;  2DIT A;  2QLB B;  5B0A A;  2KFY A;  4DQR A;  3PVX A;  3R7S B;  5A0Y B;  3HD1 A;  3NCR A;  2HBZ B;  1VC6 A;  2V0N A;  1NRK A;  2E1R A;  2L9N A;  2B8P A;  3BGR B;  3IAS 9;  4M1K A;  4P6Q A;  2GHP A;  3D2W A;  1U1O A;  2C2K B;  2ZJQ Q;  5IWA J;  3DYA A;  4ZVS B;  1KQF B;  2NYI A;  3BGU A;  3HX9 A;  4AXI A;  1R31 A;  2GCF A;  2B9Y A;  3LPE A;  1BY9 A;  3S01 A;  3AAW B;  4CO4 A;  4DFP A;  4OZ0 A;  2V9K A;  2ZH8 A;  3BGF A;  1HWL A;  1FKA F;  1ZM4 A;  3CCZ A;  2IHR 1;  1KN6 A;  2VFS A;  3IWX A;  1C1C B;  3CDE A;  1KHV A;  2N7Y A;  1TUW A;  2BV3 A;  1E6Y A;  2X51 A;  2JX2 A;  5L39 A;  1S10 A;  2XHW A;  2G0I A;  1RHU B;  3NGR A;  3PYD A;  5K8O A;  2Y1J A;  3PX4 A;  3J7Y I;  2R7O A;  4N7T A;  1I94 F;  1TVR A;  2RDJ A;  2RNE A;  2V2Q A;  1SH2 A;  1HNV B;  2AX1 A;  2FHJ D;  3ZXW A;  4Y2I A;  1UWB B;  3MR2 A;  3F73 A;  2XB2 D;  3CNQ P;  2DPJ A;  3K0J A;  1GFW B;  3BPD A;  4I0W A;  1A6L A;  4KO0 B;  2FJA B;  2OD6 A;  1R7I A;  1S0N A;  1JX4 A;  4PRF A;  1KDN A;  2E44 A;  5KT7 A;  4RNO A;  2ZNZ A;  3C6T B;  5THW A;  4M94 A;  3NGK A;  5HK4 A;  1UEV A;  3OL8 A;  1NXI A;  4DR4 F;  2C3O A;  2OPP A;  1PJ5 A;  3V81 B;  3DLL Q;  4C8N A;  2A2D A;  3BBC A;  5D4P A;  1HNI A;  4X84 A;  4C0H A;  2YKP A;  3KYL A;  1K0V A;  2RDD A;  2R7Q A;  1RT1 A;  1UAW A;  3IS9 A;  4YOE A;  4DPW A;  3SCJ E;  1KFD A;  1S7I A;  2DGO A;  4J91 A;  4H4O A;  4D3G A;  4JB8 B;  5J1E B;  2OO4 A;  1U2R A;  4A8M P;  3OTO F;  3TAQ A;  1S4F A;  1R8C A;  3CVK A;  3Q83 A;  3S7R A;  3AA9 A;  3OW2 R;  1IKX A;  3W5X A;  4HT5 A;  2R7X A;  2ZH3 A;  4LF7 J;  2R7T A;  1H2U X;  2Q1L A;  3E2E A;  2XSJ B;  3T5H A;  2EFQ A;  3MPV A;  3FUY A;  1TL3 B;  2WON A;  4L75 A;  4MIW A;  4A8Q A;  1O8B A;  2YKN A;  3VAI A;  1MSW D;  1T9T A;  1LWE A;  3M9M B;  1RBL A;  2NXN A;  2LEP A;  3ISZ A;  3ITH A;  4NRT A;  3ZTO A;  4D3H A;  5I42 A;  4DFK A;  1QSS A;  3VZH A;  3H5Y A;  1CUL A;  3MM9 A;  1RTJ A;  2J0W A;  4DPO A;  5IZH A;  2LKZ A;  3RBZ A;  1UVJ A;  1PC4 A;  2OPQ A;  4U7U K;  4WF9 Q;  2POK A;  1J2V A;  3TYT A;  2W7P A;  2UVV A;  2VOD A;  2UUB J;  2QL7 B;  3KK1 A;  1Q7Y T;  4K5S A;  4Z7Y A;  2J9D A;  3VR1 A;  3PCO B;  3MEK A;  1GTH A;  4IKA A;  1SJ3 P;  1GQE A;  3GYX B;  2G1D A;  2YWE A;  4CWB A;  1VRU A;  1OSC A;  1SC3 B;  4EBD A;  4Q0B A;  2K1R B;  3DCA A;  2XG8 A;  3W2V A;  5B0E A;  2MKH A;  2MQL A;  5A8R A;  4DCP B;  5DQH A;  4DR1 J;  2VC0 A;  3K2Y A;  3W8P A;  3GZ7 A;  3GMG A;  3H5U A;  4FVM A;  1L3U A;  3K5P A;  1TKX B;  4ZOS A;  4A47 A;  1XNQ F;  2K7K A;  1NB2 A;  2LQJ A;  2NYH A;  5EGY A;  1CS4 A;  4ED6 A;  4DX8 H;  4PYA A;  4K2J A;  5D0R A; 
#chains in the Genus database with same CATH homology
 2E1P A;  2W2P P;  3WIV A;  1SCJ B;  4YN3 B;  3A3N B;  3A3O B;  3CO0 P;  2Z2Z A;  3SQO P;  1R6V A;  4NMX A;  1SPB P;  3T41 A;  3QFH A;  3AFG A;  3H42 A;  3BPS P;  3A3P B;  2XTJ P;  2Z56 B;  3BGO P;  3VHQ A;  3WIU A;  2W2Q P;  2W2N P;  3CNQ P;  2ZWO A;  3WHI A;  4NE9 C;  4K8R A;  2QTW A;  1V5I B;  3P5B P;  4OV6 A;  3VV2 B;  2PMW A;  2Z2Y B;  2W2O P;  3GCW P;  1ITP A;  4JP8 A;  2W2M P;  3GCX P;  2ZWP A;  2Z57 B;  2Z30 B;  2Z58 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...