3CNQP

Prosubtilisin substrate complex of subtilisin subt_bacam
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
71
structure length
71
Chain Sequence
b'EKKYIVGFKQGFKSCAKKEDVISEKGGKLQKCFKYVDAASATLNEKAVEELKKDPSVAYVEEDKLYRALSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Subtilisin BPN'
publication title Engineering substrate preference in subtilisin: structural and kinetic analysis of a specificity mutant.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
total genus 17
structure length 71
sequence length 71
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2008-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3cnqP00
3P5BP 1SPBP 3VHQA 2Z56B 4NMXA 2W2PP 3SQOP 4OV6A 3GCXP 4NE9C 2Z2ZA 3BPSP 4YN3B 2Z2YB 2W2OP 3A3NB 3WIUA 3CNQP 2W2MP 3AFGA 3H42A 2W2QP 3A3PB 2ZWPA 3WIVA 3CO0P 2Z58B 2ZWOA 3GCWP 1V5IB 4JP8A 2QTWA 1ITPA 3T41A 3WHIA 3QFHA 2PMWA 3VV2B 2Z57B 2W2NP 2Z30B 1SCJB 2E1PA 2XTJP 4K8RA 1R6VA 3BGOP 3A3OB
chains in the Genus database with same CATH superfamily
1NSQA 2ILYA 1HNZJ 3CW2C 5T41A 1T11A 3V2UC 2CQ3A 3D6FB 1H98A 3FEXB 1RB0A 1D8YA 1LEOA 1E6YA 1T3OA 4X2BA 1FJ7A 2ASDA 2I9SA 4DHVA 2VBXA 3BN7A 4DR7J 4TVAB 1RWMB 2HAIA 2CDQA 5E3PA 1HWUA 2W9CA 4JOUA 4KB7A 4ZPCA 4H4MA 2VB6A 1RAJA 2VPYB 3I87A 1XWLA 3N01A 1RHQB 1VHFA 2GGPB 2G0JA 4PXDA 2V50A 5CYMB 1CBKA 2YWEA 1VIXA 1X4CA 4URSA 4AFFA 2MGZA 2HFNA 2OSRA 4M63A 3DLBA 4J9RA 4EI2A 2DNMA 4FKXA 4I6AA 2FVSA 2VFVA 2UXDF 3AJDA 4JI7J 4M5NA 4QIGA 2RS8A 2XYHB 1VBKA 2BQRA 3OTCA 4BCAA 1BXNA 4DCJB 1G1XA 4YB6A 4K0KJ 4NASA 3EPIA 2CIMA 1IM4A 4IH6A 4OFZA 5ETNA 3W5ZA 4J9VA 1EQMA 2V2KA 3BDEA 1U7LA 2ZH3A 4LF4J 4PABA 2FDNA 4WXWA 4DX7A 1M5KC 3HSJA 3DOMB 1URRA 3PO4A 1KWMA 4MMOA 3B4DA 3M30A 2MQLA 5L9NA 5JMNA 1FXRA 1HBOB 3QIDA 3VAGA 3ZTQA 3KLEA 4DL0C 2XS7A 2L48A 1U24A 3NCRA 1KQGB 3FSYA 2CAJA 3KK2B 2RDDA 3GWCA 4P7VA 5I3UA 4DPXA 1BQNB 4DG1B 2VBYA 5B0BA 3EJMA 5HQMA 3M2RA 4DV4F 4FPIA 5CA5A 3Q86A 4P7TA 4ECZA 1EETB 2FLLA 3NGDA 1LKZA 3W8PA 1KONA 3R5JB 3B8HA 4Q2LA 4A8YA 5BR8F 4CP5A 2DNZA 1JIHA 1TFWA 4WFYA 3POTA 5KFRA 1VRTA 2YH0A 1FK9A 4UQTA 4U7UD 3TJ8A 1IBCB 4R8UB 2VDHA 1JXEA 2JFKA 2QYCA 1KVKA 3F0NA 3QMQA 2NQPA 5EWFA 4JI6J 2UUBF 3HVWA 2KN4A 1SUQA 3TVKA 2R7SA 2RIJA 3GV7B 2ZZNA 1WC1A 4RKUC 3N0VA 4PRFA 2EC2A 5KFEA 2J8AA 4DV1J 3MM5A 1XC9A 4JV5F 3I5CA 4ID5A 1S6QA 2WOMB 9RUBA 3F41A 3KTQA 1JKHB 5CQGA 3JS9A 1KR4A 3G2XA 2DR8A 4K59A 1JK9B 1IKVB 5ETMA 3CJ4A 4HLBA 1AT1B 3DRSA 1L3UA 3CDEA 3AXKA 1EP4B 4JV0A 1ZTTA 2KG0A 5DQIA 1S49A 2XZDB 3IR6B 1U1OA 3BYRA 3D0GE 4QU6A 3ITHA 3WC2A 5CABA 4AT1B 2ZKTA 1RT7A 2GZOA 2KRRA 1Q5VA 1RISA 2ZVSA 3W7BA 1BUXA 3DLLQ 3J7A1 4YHHF 3M8QB 3MEEA 1GQEA 1R43A 1HHSA 3OL6A 1LW2B 3PW5A 5LJ5Y 2M8DB 3CD0A 2V4QA 2ZNYA 3UNYA 6FDRA 4F7VA 2KRBA 3I9ZA 3ZZPA 2B43A 4QWDA 1AROP 3KYLA 5JVGQ 3I31A 5A8RB 5K9FA 4GRSA 2ZJPQ 3D9BA 1FTCA 5F0UA 2I5JB 4TLRA 3K5PA 2XLJA 4DFMA 4C0HA 4OX7A 3NNHA 1CJUB 4OHYA 1KVIA 2FPHX 4OI3A 2GJIA 5HLFA 4Q43A 4XK8C 3H5SA 2J7WA 1XR7A 3G9CA 3FSXA 2HHUA 4D3HA 1FDAA 1FA0A 4IH7A 3SZ2A 2ZHOA 3JTNA 1KVJA 2CNLB 1UZHA 1BE4A 2IJRA 1VGYA 5CCLA 2E29A 1IXKA 2HQDA 4X64F 1Q8LA 2OD6A 4NLOA 3SQGB 4FNHA 2WB4A 3NRBA 2CPHA 3TW0A 4LF8F 2VJVA 2QL7B 1RWVB 2QX0A 3VTIA 1FJCA 2LXIA 4CO2A 2XMWA 3QO9A 1KOHA 5J2PA 3HFVA 4LF9J 2SXLA 5D78A 3CDUA 2DISA 4GO5X 5F41A 5J2NB 1RBAA 3MAAA 1UVNA 3KG0A 4QWCA 1S4FA 3R2CJ 2XMMA 3OL7A 1GMWD 4B9NA 4ID8A 4HR2A 2Z2LA 4GC6A 3R5GA 2XO7A 2NZCA 4FKYA 2OPPA 4FBUA 3BJYA 1TP7A 3NGKA 2QE5A 4P74A 1S1WA 2BZ2A 2KVIA 4DUZJ 1HMVB 2OP5A 2F8HA 1JB0C 2I0XA 3MOJB 2C2RA 3IAS9 1FE4A 2DHXA 2YQ3A 3OD2A 5LJ3Y 2J0SD 2HHTA 3OXFA 2G0CA 1U1LA 1HFEL 3M8YA 3DOKA 4ZVPB 4L3NA 4C8ZA 2LCWA 2WAQD 1IWAA 1IM6A 1DTQB 1YWXA 4EBDA 1TL7B 2FVPA 1LWEA 1C0UA 4NLYA 2ACYA 3J81Y 1VBYA 3E01B 1RT4A 2DCLA 2VKRA 5KFGA 2GNKA 2AJ0A 3DRRB 1X9SA 1MMLA 5DM6Q 4MKYA 5F9NA 1FCAA 2OEMA 1U6FA 1HBMB 4YR0A 3CDWA 3WX4A 3OPKA 2QO3A 2MTLA 3KLGB 3GZ7A 3CDAA 4USKA 1RAOA 2BBEA 1MLAA 3BBFA 4Y0FA 4WTOB 1UVMA 4ES3A 2BE7D 1O51A 3QBCA 4ZLJA 5J1EB 5AJ3J 3MUVP 4ILRA 4WJBA 3T9NA 2MMYA 2HHPA 1MROA 1IKXB 3UI3A 5F3TA 2E1AA 3IA0A 2DXDA 1XMOJ 2AYEA 1F2GA 1U47A 1R8PA 2C2NA 1FRJA 1RQ0A 2HS4A 2RQKA 1JLBB 1R27B 2ZKUA 3OVBA 2OMOA 4QU7A 4IG0A 3MMAB 2HZCA 1C1CA 3T6BA 4NLTA 2CJBA 4MIWA 2OPSB 4WCEQ 1LWFB 1V5IB 4OZ1A 2CZ9A 4EZ6A 5KFAA 3AOBA 2FLNA 4ECRA 2VKZG 4B9MA 3H5YA 2N4CA 4DSIA 2HZVA 3LQVA 2ZD1A 5HO4A 2HVIA 5F8NA 5B0CA 2YNFB 1C4AA 1N5YA 2XMJA 2R8KA 3M9MB 5LMNJ 2QGFB 1QUVA 4KGZB 2G2YA 1MN9A 4W98A 2DRAA 2LFVA 3KK1B 3FMWA 2V4RA 2EVZA 1N32J 2AW0A 2CPIA 3SYZA 4DCOB 3NGRA 4ELUA 2LKZA 1RTHA 5D4PA 5HMXA 2R2UA 4CLUA 3CO0P 4DR5J 3MCNA 2HBYB 4DSJA 1RT6A 4F50A 2BMBA 4FS2A 2JFDA 2BKNA 3MM7A 4DX8H 4QYZK 4EGLA 2FC9A 2JSXA 1AW0A 4CLFA 3C6TB 3R7BB 1OYDA 4KFBB 3HI9A 1X4AA 2HVEA 3A8EA 1HBNA 3J7YU 2E5IA 4URQU 2VICA 2W2QP 2IJFA 1BGXT 4ZCKA 5ETTA 1D9AA 5IWAF 1RTZA 3ZNUA 4TKTA 3VGSA 1SQGA 3HHKA 1CULB 2MQOA 2A10A 4JI2F 2KHCA 4X4OA 3MMCA 1DQAA 3OL8A 4RNFA 1R3NA 1PG5B 2RT3A 1WORA 1TK0A 5DDQC 1AXQA 4B3RF 4YDXA 3B82A 4DR4J 4DUYJ 1X4GA 2HHHF 5J1PA 3QT8A 4CIOA 1Q86T 1TUVA 4I68A 1X0FA 4RW9B 1WHVA 2EFGA 3DHXA 1V3SA 5BYSA 2J9DA 1D3WA 3A12A 1PSDA 4ZK7M 3LA0A 2W4DA 3EDRB 1CJKB 2BE2A 3CMAS 2L9WA 2LQBA 3V81B 5IC4B 2Q79A 1JXLA 3MD1A 2J7KA 5K8PA 2DNLA 4DR6J 4G1PA 5F3ZA 2OPRA 4P10A 1JLFA 2H4WB 2HFSA 3BYPA 4QW8A 1QVFR 1BQMA 4IFVB 4Z7CA 1NKBA 1TMMA 4L74A 4ZVFA 5HP1A 3NNAA 3MMBA 1XEZA 1JJ4A 4H4OB 2UXCJ 4OZJA 4BWJA 3Q8UA 1N48A 2BKOA 1PC5A 4UOFA 1YJWS 1WC6A 4NCGA 3BO4A 3CGIA 2R9LA 4LSLA 1D8ZA 3IFEA 4DN0A 5KFDA 1Y7PA 2Y1IA 3CMQA 2C1EB 2VC0A 4NLXA 2C3OA 1FEHA 4N8OA 2IA0A 4A8XA 2CPXA 4NXMJ 4HVZA 4ZN3A 2DNYA 2YH1A 3Q8QB 4ECUA 3LPEA 5A0YB 1PBAA 4USIA 1VYAA 5CXTA 3G87A 5C25B 2LVWA 4FS1A 5D3GB 3MURP 3OVSA 2ADCA 2RKIA 2QFIA 3JQMA 3N5FA 1YSJA 4WP9A 2XCAA 4QW9A 5I42B 1XK8A 4LSZB 2QTWA 1TKXA 3P8BB 4PWWA 3OL9A 4C8LA 3IWXA 3W2VB 3ETMA 2GJ2A 3C66A 1YI2S 3DI6B 5GAHI 1JXVA 1YIJS 3T9ZA 5HBMB 2UZAA 1YTYA 4Q0BB 1CJTB 3F56A 3S1TA 3T19A 1P27B 4LF2A 3HT3A 3CCLS 3M1VA 4LR8A 3M8PA 4ICLB 3Q8YA 4J9QA 2UV8A 1FNMA 4Y6IA 4NPOA 1S99A 3W64A 1YBAA 4M5JA 1NH8A 2J76E 2EXUA 3ILJA 2AF6A 5HSPA 4ZN1A 3P5BP 4KO0B 2I1RA 3D6MB 4KYZA 2HNYA 4USMA 4C2MA 1RHMB 2BXJA 3DDIA 4N47A 3QSYB 1KHWA 1TKDA 4DQIA 1Q53A 4P9SA 4DL4A 4KGMA 4ZCMA 4U8YA 2EBGA 4KE5A 4PYAA 1YKWA 1R89A 2IM1A 4HHUA 2HHVA 3J7ZT 4ECSA 4KV8A 3D5MA 2AKWB 2LDYA 1FDBA 2DGQA 3IN5A 3GCWP 4JP8A 4PCQA 1VQOS 3PEHA 1GH8A 2U2FA 1SJ1A 4O3PA 1NCLA 3HHEA 5D4LA 4LF7F 3C6UA 2DNRA 2HLTA 3MTKA 2QEXS 4TY9A 2PE8A 3CB4A 2J0QD 4RW8A 2C2KB 1X5SA 1RWPB 3K8VA 2XMAA 3W1YC 3EVWA 3SFUA 1C2PA 1PYOB 4U7UK 1VI7A 3SFGA 2FGOA 2W9AA 3FCWA 4RNHA 3BBCA 4KPYA 1S6PB 2HQ3A 1J27A 4F36A 3R6GB 3K5LA 1I94F 3CMES 1JLGA 2H1YA 3MEGA 1DQ9A 3JQKA 5GAGU 3CD6S 1REVB 3CXCR 1M1KT 3P3DA 2QT7A 1ZPWX 2KO1A 2F65A 2X1BA 4QJVA 3L7OA 1NDPA 4YR2A 2DIVA 4USHA 2X3DA 1RT1B 1N6QA 4DV3J 4R5PB 5A8WA 3QZ8A 2A6OA 3V6KA 2OHDA 1Q82T 1M5OC 2VFRA 4B02A 1FVSA 4Q45A 2OJ3A 4YY3F 2GS8A 2B9EA 4LR7A 3PIOQ 3E8OA 3ZZTA 4PWDB 4LVNP 4CQ1A 4DV0F 3PHEA 2IRUA 1OS5A 4NLPA 5A2QU 1YZ7A 1YQHA 1KBRA 4CLKA 1UVIA 1A6LA 1JJCB 4CH0S 2DR7A 4NLQA 3RAMA 3VGTA 4WK1A 3HHLD 3T41A 3FGVA 4ZP7A 3NS5A 3W65A 4DL6A 3UO0A 2ZBIA 1FD2A 2XY5A 4OZ2A 3V4MA 3EVMA 3IP0A 3CC2S 1F2HA 2O3DA 2ZDPA 1BQXA 4TYBA 2GGPA 1GK8A 4UTGA 5A76A 3N6LA 3CCVS 1PBUA 1EJ7L 1XERA 1F3FA 3J7Z5 5CYMA 1L5UA 3LAMA 4IO9Q 4QQBA 3U27A 5KFJA 1O6XA 3AY0A 5L1KA 1T9YA 2BW2A 2VL1A 4UF4A 2ZZMA 2CQBA 1JLCB 2IMOA 4F2SA 3BN4A 1U26A 1YLXA 3A3PB 4FP9A 3FBFA 2MLXA 3SDEB 3AXMA 1VRUB 2P9EA 3CJ0A 2CJ9A 1PO6A 5KFPA 2QA4S 4RL1A 2HRUA 3M6XA 1NKCA 5F8JA 1OMSA 3ZTRA 3MEDA 2JEJA 3E2EA 3DOMA 3CCJS 5IXUA 2UU9F 3LGNA 4IG3B 2P9GA 1HBOA 1XR6A 2LDIA 4IO1A 4N56A 5EDWA 3P5TL 4OJGA 2RHQB 3UN3A 2R4FA 1TL4A 1WSVA 4ZVHA 2Z56B 4ZOSA 5H9EJ 1BQNA 2B6AB 4DG1A 3C3LA 2PIIA 2VV5A 3FCVA 4RO0A 2V8GA 1JX4A 2EK6A 5HK4A 4JI8F 3OLAA 3BQ1A 4TQSA 3QRQA 3TAQA 4KBIA 3U1NA 3NCQA 1EETA 4J9MA 4X65J 2CQDA 4U7CA 3TANA 4I1TA 2JRSA 4A8QA 2H5JB 2ZDOA 3A1YG 1IQTA 1FO1A 1M5PC 2MQPA 1LQ9A 2D9OA 2HFZA 5IQQA 2A1BA 4R8UA 4C7QA 3T5LA 2HKEA 2C2EA 4ETXA 4K4ZA 2BOPA 1WEXA 5FLXY 5CYQB 1XR5A 4EK2A 4Y3CA 1TL1A 2D9PA 1RABB 1FRKA 1WG1A 3GIRA 2EFQA 1JLAB 1SIZA 2XULA 2M3DA 4C97A 3BREA 3AA9A 2W7AA 1B0PA 3T1YF 3PJ9A 1M5HA 1XNRF 1NKEA 4C98A 2BRKA 2EFOA 4IH5A 3G82A 2UVUA 5EWEA 4YOEA 2WOMA 5KFCA 3IG1A 1P1LA 4NZ7A 3NWRA 3H90A 5AE2A 2Z8QA 1JKHA 1MMDA 2W4PA 5E3QA 2PO4A 1VQYA 1IKVA 2UUWA 4LRDA 2KDOA 3GU0A 3MM6B 3CJTA 1EP4A 3V4IB 2NUHA 4I2QB 2OO4A 4JUZA 2YKNB 4OX8A 1EKSA 2J9DE 5E33A 5H9EK 1R8HA 4Q8EA 4WKYA 2DXFA 4J5OA 3KHHA 3EGNA 4DQQA 5AXKA 3TUZC 2HEKA 2JJ4D 4C8OA 1NHVA 3OTBA 1NK4A 2BRLA 3MGJA 2EC0A 1JNRB 3DM2B 3M8QA 1LXNA 2FJBB 2OD4A 3DDNA 1LW2A 2YTCA 3PEJA 1RE1B 2BX6A 3RBEA 4X66J 4ED8A 2MKIA 3NY0A 3SV4A 2E5LJ 1NJYA 4C0OC 2M4MA 3FFIB 4KT0C 5A8RA 4X62J 1Q8IA 3LO3A 4B08A 4YQWA 4DU8A 4MK7A 4K4XA 3N5BA 2I5JA 2NXJA 1V3ZA 1CJUA 3MTJA 3F73A 1NO8A 1T9XA 5H1SV 2ZH6A 2E9ZA 2BANB 5EX3A 2K7KA 3Q23A 2Z57B 2GHWA 3GYNA 4ANCA 2DH7A 4IR9A 3OR1B 2N3LA 2KKHA 4K4YA 4I69A 4DV6F 4OJHA 2W24A 2WVDA 2UXBF 4ZPTR 2QL9B 3SQGA 1MWYA 2IHR1 5IT9U 4G3IA 4PYDA 3G8TA 2MEWA 2ZHBA 2CJXB 5IQ6A 2R7VA 1O5JA 2QSWA 4ERDA 2RQCA 1G3OA 4PXBA 5J2NA 3T5KA 4FVMA 4ECQA 1H2TZ 1RP5A 1F9HA 1JLEB 4QYRA 2FVCA 1AB8A 1KTVA 3KLFB 2VOOA 4EWTA 4ZVTB 1HMVA 3H20A 3EZUA 3VAFA 2F7VA 1U1KA 2BABA 1X31C 5KG0A 2AU0A 4HT5A 2NPIA 4RBUA 2AJ4A 2JWNA 4EFAC 4P71A 3TQ1A 4DUTA 1QAYA 2BJEA 3HHNB 3IWNC 1DTQA 2PGCA 4LQ3A 1TL7A 1S9GB 1S0MA 4X4RA 2WW4A 1URNA 2X7IA 3E01A 1S7IA 2ACMA 1FKPB 4O3SA 3C46A 3BS9A 2FTRA 3DRRA 3NAIA 2NREA 1HBMA 1TU0B 2ZM6F 4F4YA 3KLGA 5C7PA 1IR1A 1VRTB 1FK9B 4HACB 4LIWA 3K58A 1O8BA 1UJ4A 1X60A 4G65A 2OI2A 2BYCA 4ITSA 1TK8A 1GNKA 1ZZNA 1SIWB 2AZ3A 5J1EA 1WI8A 2UXDJ 1IJFB 4X4QA 1IKXA 4AL6A 3PO5A 3TUJC 1R0CB 1RT5B 3JTOA 5HJYA 2CA9A 3AA8A 5AE3A 2CKWA 4Y2IA 1B3TA 4K7QA 1YRXA 1JLBA 3OSPA 4P2SA 2FJVA 1UKUA 4DU7A 1Q4RA 5KFLA 1WHWA 3MMAA 4DF4A 1S10A 3VWSA 4NA1A 2BV3A 3A3OB 2OPSA 8RUCA 5FD1A 3CC7S 1SH3A 3BPSP 2XI2A 2JX2A 1LWFA 2DGWA 5DJBA 1Z1ZA 1DFDA 1CQMA 3MCSA 3SCJE 2HZAA 2HMIB 1RYRA 3T3FA 5EHHA 1PGZA 2RU9A 4TNOA 2P5VA 1W2IA 4QIFA 3HHLB 3SXLA 4DR1F 4OMFG 2YWKA 2IDEA 4OI6A 2YNFA 3FKBA 1RTJA 4C8YA 3N6MA 4KH1B 3OR2B 1SJRA 4RW6B 1I6JA 5BYQA 5HVGA 1N8RT 3RBDA 3KK1A 2WSCC 5BR8J 2OGUA 1FXLA 3B4MA 1IR2A 1PJ5A 1TUGB 1RHUB 1M90T 4U9RA 1NH7A 4G1QB 3MR7A 3WZ0A 2KB2A 3P45B 1NSPA 4F3MA 1U2CA 3M8SA 2C3PA 3GJRB 2ILZA 5HJXA 4GKJJ 5GAEU 1B4SA 3NAHA 2UUBJ 1N33J 3D7SB 2W1BA 2A2DA 1Q8BA 5HLFB 3MAHA 2PI5A 4M95A 3C6TA 4KFBA 1QE1B 4NRUA 2Z58B 3MWBA 4RWXA 2DGUA 4M5DB 4GMKA 2JEIA 1B0VA 1A0OB 4FZVA 2YBVA 1UFKA 2ABYA 3MF5A 2OFHX 1GMVA 1OY9A 3AD8C 3EZ5A 2IA6A 2FUG9 2XLKA 2VF3A 5IC6B 3VGUA 4W90B 1VBXA 3QGPA 1CULA 3DXSX 1WD6A 4BS2A 2GJFA 4ZPDA 1EX8A 5KFYA 3EM1A 1XJWB 1K73T 4BLGA 2MQ8A 2IM0A 1UMJA 4LFCF 4RUHA 2E1PA 4RR5A 3P49B 3OBIA 2VIHA 2W8KA 3GCXP 2AP6A 3HJVA 2CZ4A 1REGX 5KOWA 4YHHJ 3O2IA 3CDBA 4PXCA 4RW9A 4KKOA 5ETLA 4M5KA 3EE3A 1R8AA 1V9OA 1D09B 4DV2J 4IOBA 2DITA 1NDLA 4I6WA 1UA1A 3HHLC 1CJKA 1BMQB 3GE9A 2GIRA 3V81A 4F04B 2BJ3A 3U1LA 1NJIT 4PPZA 3H25A 4KHMA 5KFNA 2GO9A 3Q8RB 3NOCA 4IFVA 3GIJA 2RAQA 4M1KA 3MCMA 1DAXA 2MKYA 4L76A 1ZYQA 3RU0A 5HMZA 4CZCA 1BHNA 3ZC4A 4H4OA 3EGZA 3EXYA 3D28A 1D0EA 4C3KA 3WIUA 2HHSA 2YKPA 4DSLA 5B0GA 3BSOA 4CDIA 4ZITA 4MJKA 4PG7A 4X64J 3Q2TC 4O3OA 2GMJA 4NLRA 1XNQF 4LF8J 4K5RA 2DGXA 3L7PA 3HK2A 2BJ8A 1T9WA 3LP2B 2MZRA 2QV6A 1VK3A 2KL8A 1ELOA 3HSDA 1C0TB 2EG2A 2AJQA 2HIYA 4C0BA 4HI1A 3OHAA 2D3OR 1H73A 2A18A 2OTJS 2KHDA 5A0YA 2CDRB 5C25A 3HMJG 2EG1A 5D3GA 4O3QA 3K5OA 4OLPA 3FBBA 1S7HA 2J5AA 2BM1A 3GJSB 4DR7F 5I42A 1S5ZA 3LGHA 2D3ZA 2YQ1A 2GAHC 2XBPA 3TX8A 1UFLA 2RQMA 4KHPF 3GMGA 4F4KA 4O23A 3DI6A 1VC5A 1TK5A 5HBMA 4NE9C 4NZ0A 4Q0BA 3MHYA 4DSKA 1CJTA 3R1HA 2G0IA 3T6JA 2VOPA 1LK7A 4ICLA 3RRGA 2D3UA 1VQ9S 1RKJA 1N5YB 3OFFA 3T1HJ 1FRIA 5DQGA 1WEZA 3CJRA 3B6BA 3LANA 4FNIA 4IDKB 2LLZA 1VQPS 4KO0A 4JI7F 3VAMA 2HW3A 2M7SA 4DQPA 3TJ9A 1EAYC 1NUEA 2RS2A 5M2UA 4K50A 4K4UA 4AXIA 1RHKB 1HPZB 4HTJA 1ZPVA 3P96A 3K8WA 3WQPA 5LXRA 1FXDA 2KYXA 1YRUA 2H5EA 2ASJA 2UUAF 1U25A 1GFWB 3NP5A 4B9VA 3G71S 1XTZA 3N28A 1RWKB 3IC1A 4N77A 2Y1JA 3LW5C 2FZCB 5E41A 5KFIA 3UQSA 3HSZA 2HNDB 2LU2A 1M0SA 1EQ0A 1V5VA 3GTYX 2R8HA 2BOAA 2R7OA 3OJUA 1S6PA 4P6QA 3HFZB 1ZAVA 1ZETA 3CIZA 2XY7A 2XGQA 5C42B 4F0MA 1H6KX 2ZITA 2DHGA 4CTAB 4USUA 4PQAA 1DTTB 1REVA 3Q83A 3AQOA 4JYAF 4QWBA 3LTOA 4FF2A 1RTDB 2UV8G 4DSEA 1CJVB 1FRHA 2AIRB 4JBCA 3QJLA 3UD3P 3NCPA 3LGMA 2R3VA 2E66A 3HF5A 1X5OA 2KU7A 1UA0A 1Y4ZB 5EUHA 1RT1A 2WCXA 2C2MB 2R7UA 1RDRA 4GKKF 4JI6F 4X4VA 4R5PA 4DPYA 3GJQB 2CYYA 1KQFB 2FQQB 3FQKA 2QMXA 5I3PA 2HLUA 1RJJA 4PWDA 2HFVA 2RRAA 2CNOB 3H42A 3DU5A 3DU6A 3W66A 4XPEA 5T14A 3JSBA 4OV6A 4FYDA 4FXVA 3K7RA 4OZ0A 1C4CA 2ROGA 4CYUB 1XBWA 2J6TA 2WBMA 2ATCB 2PSZA 3OTOF 2G1DA 3TZYA 4CI0B 5IWAJ 4MH8A 2DVIA 1UP1A 2RMLA 2DY9A 1W7WA 2WVCA 2ZC3A 3P6YC 3BF4A 3QAUA 3NOGA 4HHJA 2O67A 2QLWA 2MHEA 4MKBA 4AD6A 2QFJA 1NDCA 2DTJA 2FY8A 3BKTA 1LXJA 2VHGA 2RRNA 3HFKA 5HAOA 2VPWB 2M8HA 1R6YA 1P8GA 3TX0A 5F9LA 4Z37A 4I64A 4B3SF 1JLCA 3Q0AA 2Y0BB 4Y2CA 1WNEA 4HDGA 2FJEB 4P2XA 3SDEA 3FUYA 1VRUA 2EFVA 2HNZA 4ED4A 1RSCA 3MDFA 2Q66A 4QZVB 4DV7F 3BPDA 2JVRA 3CWJA 3PVXA 1FD8A 2OLWA 3O1LA 2AGPA 3OV7A 1X9WA 3MR5A 2GQ2A 2VBZA 1DZ5A 5K14B 4OZLA 2DJWA 5GAHU 1OJ4A 4OYMA 1RYSA 1S48A 5FDLB 1U0SA 1VMBA 1NK0A 5HL7Q 5KFSA 1NJXA 1WC3A 1Z4UA 1O0PA 2B6AA 4RUAA 4YB5A 3RRHA 4FXDA 3SSSA 3VQSA 1IWGA 2LXUA 2DBBA 1NAQA 3BM7A 1VC6A 4O0IA 1UWAA 1CLFA 2KH9A 4FYYB 4I7FB 3OFGA 5CD4H 3AHPA 2J6SA 5KT4A 2Y8YA 2MY8A 2B9XA 4HHHA 2CJAA 2HPUA 2VASA 4EMDA 2W4CA 4DLGA 4NZ6A 2DH8A 4AYBD 4LREA 2XG8A 4DI6A 2GHPA 4DUZF 3QQCD 2MYFA 1WACA 2CQ0A 3LAKA 3FK4A 2DPIA 3GFHA 1SVDA 4P75A 1SC1B 3T5JA 5CYQA 1L3SA 1S79A 3MPYA 4X4PA 3Q8PB 8AT1B 2NSCA 4M5LA 4OYAA 2FIUA 1JLAA 4AQYJ 2I38A 1K0TA 1LFWA 4KGXB 4OZ5A 4BWMA 5LMUF 4KR0B 3QJPA 4ZVUB 4UUXA 2YWGA 4R0JA 4ER8A 2V69A 1Y00A 2VU5A 3CD7A 2C2ZB 1HWKA 3AODA 2EKNA 3M8WA 4LFBJ 4DJBA 4NI2B 2GC8A 4ECTA 1H72C 3PCOB 4GVBB 2I6WA 2HHXA 4JI0J 5IT0A 3MM6A 3Q89A 4I2QA 2YKNA 4ECYA 3NG8A 2W7PA 2ZJQQ 3ELHA 2WK4A 1FRLA 4E2FB 3D3CJ 2NR0A 5AJ3F 1OPIA 4WP8A 1XMQF 3I56S 4TY8B 4EUVA 2HWIA 2Q3PA 2CXEA 1LOUA 4R25A 2X51A 5A2QY 2IYGA 3TAMB 4KH0B 5AXLA 4RNNA 1XMOF 5DDOC 2COLA 4JV2A 4NLWA 3DM2A 4M94A 4FYVB 2J8SA 3D68A 3WIVA 2B4UA 4C8MA 3DLKB 5ADZA 1FFSB 4USVA 4UOHA 3TJAA 1S1VB 3KFWX 2K3IA 1SKSA 1CS4B 3CUNA 4J9UE 2Y3YA 3FFIA 1IBMF 3I0RB 3D6HB 1NSAA 1N34J 1JWWA 4LRBA 5KT5A 3IMQJ 4C11B 4OIXA 2VG7B 2BANA 3RW7A 2WHOA 2MB0B 7FD1A 1ZS6A 1PKUA 3QGHA 2H48B 2IIHA 3V5RA 1SC6A 3OR1A 3CC4S 4MIBA 2V5HG 4ES1A 5E2QA 3D0HE 2J0XA 1LK5A 2QLFB 4ECVA 1WTBA 3NNCA 2LEBA 4C48A 2CWKA 5LMNF 1I94J 2RH3A 2EBEA 2NUUG 1RWOB 3R5DA 4RZRA 4ENOA 1KHVA 3SCIE 1GXTA 1NHUA 3R3TA 3TP2A 1BC6A 2NXEA 4YEAA 3PYEA 4HYKA 2UVVA 2H54B 2YX1A 1JLEA 1S1UB 2JHEA 5HN0A 2VDIA 5HMYA 2YKAA 4ES2A 1GT8A 3I5BA 4WTYA 2ZH2A 1HD0A 2FJAB 2KYZA 1P9YA 2RF2B 3QFHA 3OLBA 3KLFA 1JLQB 5HMWA 4K8RA 1W26A 4DR3F 3MEDB 4OYOA 1T03B 2ZOGA 4DV0J 4ANDA 2YY3A 1YJUA 1DJ0A 5D0GA 4N76A 3Q22A 1AZSB 4OX9J 4K4WA 2RUSA 2KJVA 2OAUA 3HULA 3CJ5A 4MYUA 1YRTA 3ICLA 4EU0A 3IBWA 2IVMA 4EEYA 1TVRB 1S9GA 2JLFA 1NK9A 3OW2R 1QAIA 1XN9A 2XYPB 4AL7A 2GMLA 3ENQA 1FKPA 3M6WA 1VQ6S 4ZS6A 1NK7A 5B0FA 1RWUA 4O44B 3VZHA 3PX0A 2D1CA 3SIPB 4EYIB 1SH0A 4HACA 2AEJA 3PYDA 1S72S 4DN9A 2K3KA 3GYGA 2Y1LB 3CE8A 1HR0F 1TFYA 4FN5A 2V2QA 1TL1B 1HWIA 3LP1B 1RT5A 3K5NA 4WYWA 4WPAA 2QLXA 4AUKA 3DC2A 3MFHA 4DR6F 1RK8A 1EIYB 5CZVA 4JI5F 2QZ8A 2IBOA 3TRGA 1TQLA 1XMBA 3G82B 1P6TA 3TAPA 3IG1B 2UXCF 4MK8A 4LQ9A 1HHQA 2UU9J 3UW1A 3M7VA 2BJ7A 2ASLA 2HMIA 3RB6A 1TKZB 1YK9A 3TZXA 1SV5B 1S0OA 3MI7X 2VA2A 1X4BA 1CEZA 2WVEA 1YITS 5DLFA 3HHLA 4MKAA 1HWLA 1IBLJ 4Y28C 3GFXA 1YJVA 4KC5A 2LQ9A 1VHIA 3HSGA 3R5BA 3EVOA 3OR2A 4RW6A 2FHJD 4NX9A 4DEZA 3UDLA 2E1RA 3BR9A 2E1CA 2XEXA 4KHRA 1WG5A 3PZPA 1HNXJ 1Q95G 2IPOB 2CPJA 2FHKA 2LQ8A 5GAEI 3U02A 4ZJOA 4UUWA 3KNAA 4G1QA 4ED2A 2HHWA 1U6ZA 1YGYA 4AL5A 4Y2AA 2ROPA 5GMDA 4ZIVA 2KJWA 1CC7A 4TQRA 4I2PB 3QIPB 1DRZA 4JI4F 4UQGA 3CJSA 2AJFE 1UFWA 4V1Ak 1QTMA 1WC0A 2YKOA 3AT1B 1WKJA 2J9EA 3QGGA 3HX9A 2DR6A 2HK2A 3R5AA 3RRKA 4B3OB 4F0HA 1QE1A 2YNHB 2LA6A 3RAQA 4DL2A 4ED5A 2UUTA 1GX6A 4M5DA 3GB0A 2HVDA 3P4UB 1VQSA 2ZH4A 3K0JA 5CH7B 1XNRJ 1ZM2A 2ZUAA 1K1QA 4HKQA 2HBRB 3RB4A 3H4BA 1RXOB 3DHWC 5KT2A 4K2XA 3US5A 4QIVA 4ZPBA 2NYHA 1L3TA 2V8PA 2ZBCA 2XC9A 2B0GA 3R1LA 2WB1D 5KFUA 3ZZYA 2FGCA 1VOMA 5IFMA 1S1XB 1FRMA 1P1TA 3GJTB 1W2BR 2BJDA 3TOQA 2A0FB 4C6AA 1UWBB 5KFHA 2JL9A 2D69A 4KSEB 4RBTA 1VQ5S 5ETPA 1VRQC 2QA2A 4PKDB 1F9EB 1H2VZ 3KKFA 2RB7A 2DO4A 4HDHA 1S97A 4NYZA 1HNIB 1PYSB 3H2UB 3MOZA 3H5XA 3UVJB 1F1BB 1F0XA 3KDNA 1QAXA 2X1FA 2EI5A 2LEAA 4ZPVR 3B54A 1KTQA 3VALA 3PG9A 3VGVA 2GQCA 3VR1A 1ICEB 5AT1B 4CM0A 5IT4A 4F02A 2FVRA 1WDDA 1B70B 1OY6A 4BDPA 3CF5Q 2XHWA 1EHWA 3LP0B 4A8SA 2YWHA 5HI7A 2X1GA 4LIRA 3DLGA 2G13A 2AX0A 3PRBA 1RA7A 3HZEA 2OSQA 3NEKA 3JB9k 3HHDA 2W25A 2F3JA 2XI3A 3BGOP 1RKIA 4DV6J 1TZ0A 3GV8B 2A3JA 4LT6A 3L3CA 3KLVA 3LALA 4WYLA 5IV4A 5LM7E 7AT1B 5D77A 1M1GA 3ENVA 3D67A 3IM8A 1DHMA 3LP2A 1HI0P 3PR5B 4PZVA 4J37A 4ZP9A 1C0TA 4MT1A 4QYZJ 4N7TA 1NRKA 5H9FK 2FHMA 1FNXH 4WIQA 4OYIA 3BV8A 1IQZA 1VQLS 1RU1A 4USWA 4Y65A 4RUCA 2R2RA 2AJ2A 3D2WA 1WJ9A 4XIUA 3KXDA 5DG7A 2YVSA 2VQFF 4B3MF 3GFYA 2DIUA 2FHOB 2XZTB 2ZBQA 3W5YA 2WW8A 1OQ3A 4HH1A 4J7CA 1IBKJ 1T9VA 4LVOP 2XGPA 4P52A 2P6SA 1NBEB 2PMWA 4NL5A 1WC4A 4P2FA 4G6VB 3MEKA 4UZCA 2JOQA 1CVJA 5KFTA 5E3RA 1B7YB 1YX2A 1FX2A 3M2UB 2V9WA 1SJQA 3IXQA 4G1IA 5IOLA 4D3GA 1L3VA 4H4KC 3LWLA 1TELA 4FYXB 1RTJB 3AD9C 2BDPA 1S6OA 3QAEA 4IDKA 1HIYA 2CFXA 1UVJA 1RLDA 2L9DA 3SSRA 1HYSB 2ZM6J 4OLOA 1GAOA 4ZKAA 2AQ4A 1MWZA 4ZJLA 4UY8T 4QR2A 4LBPA 4OX6A 2V94A 3ISND 2XSJB 3FCHA 2PA8D 1NJZA 5J2MB 1HPZA 2R8GA 2VH7A 1DARA 3EXCX 4IQXA 1UW4A 4LJMA 2NXNA 4WFNQ 3L95X 4LRCA 1FVQA 1NSKL 5DZ7A 3ZZRA 4CWBA 1VJQA 3I32A 2MZJA 3S6EA 2CNNB 3R27A 3QNWB 3MUTP 1T95A 4RNOA 2HNDA 2P9CA 1QSSA 1U2RA 2HS3A 4X4UA 5FJ4A 2Z2MA 1SB6A 1FJGF 1G4CA 3A8KA 5KFBA 4CLWA 2YQ0A 1BY9A 1FDNA 1IN0A 3HM9A 5F8IA 3MPDA 5C2GA 4DFKA 4NCBA 1N0UA 3DYAB 4Q2MA 2GQQA 3ILOA 2HG4A 4O4GB 4IYQA 2R8IA 1T0TV 2V0NA 5C42A 3JYTB 1APSA 3ET6B 3VAJA 4CTAA 2EPIA 3MM9B 1DTTA 5LL6d 2MLZA 4F4AA 4HH0A 3SCLE 4OHZA 2KTQA 5HVHA 4OJ1A 1ACMB 1RTDA 1QLNA 4B3TF 3QFWA 1CJVA 5SZTA 1N5VA 1TV6B 3PACA 3CULA 1X4DA 4RW4B 3BGRB 2IRXA 1SQFA 5L38A 2V68A 5EX0A 4X4NA 3HPOA 2YPZA 2P2CB 5T7LB 3BEGB 4ZVGA 1HQ2A 3K5MA 2UUCJ 3FRYA 4KKOB 2VPXB 4B17A 2GIFA 1BLUA 1MWQA 3PYFA 1HQEB 2O5DA 2VQEF 4BC9A 1I1GA 1FEEA 1T02A 3NBPA 2E9RX 4C4WA 4TU7A 1D9FA 1S59A 4JI1F 2PC6A 1X5TA 2R2TA 1Q0NA 3E51A 3BB5A 3BSAA 2HFUA 2YWFA 3DDKA 4DX6A 2CVIA 2L41A 3CJ8A 2HVHA 3MR2A 1ZOTA 2QLJB 4DZDA 1H0HB 3ZZZA 4CYUA 1WWHA 1Y5NB 5GADU 3UNGC 1J5EJ 4PQUB 3AAWB 2ZC4A 1T8EA 4UY85 3V6JA 1K44A 2H51B 3DGVA 5L8RC 1UAWA 3MZIA 4TU9A 1BWVA 2XZWA 1E6VB 1B99A 1LFPA 4J91A 3GLJA 3W8GA 1WOPA 1YG0A 3HJFA 1D9DA 2HVZA 1TMJA 3MR3A 2J9CA 5KG4A 2HRYA 5DO2A 4DS4A 3KG1A 4LFCJ 1NPRA 1Q5YA 4ZMMA 2CZVC 4QWAA 2E5LF 2K7JA 4GO7X 5J2QB 5C24B 2LP4A 2JLGA 2Z2ZA 4WFZA 3M6UA 1ZZFA 4PG5A 2KXNB 2GCFA 2VUGA 1ZBTA 4EBCA 1V3RA 2O66A 3N9UC 2CPDA 2K1RA 3NS6A 1HA1A 3CCTA 3K2YA 3JSMA 5K14A 4HTIA 5FDLA 5A8KB 4YS2A 4NLUA 4O0NA 1OO0B 2NYIA 1DLOB 3DLHA 2R2SA 2A6MA 1TR0A 2O01C 3ZFVA 1Q7LB 3HVAA 4FPRA 2DNHA 2RJZA 2B9WA 4WZMA 1MG7A 5L1JA 1XNQJ 4I7FA 4ILLA 5KFVA 1TTHB 2IJNA 2MPUA 4KIAA 4NLVA 4NXNJ 3HVTB 3TA0A 1H7XA 3FDSA 1QY7A 2POKA 4A4JA 2XYGB 4CLPA 1VIOA 2V8HA 2Q1LA 1RWNB 1M5VC 4U96A 4TLQA 3C8YA 3OVAA 5D0RA 3PKMA 4DBQA 3TQEA 1F9FA 4WP3A 3ZTOA 4X84A 5EN1A 3T1AA 4DL5A 1H74A 4CT9A 2DGOA 1RCXB 2JVOA 1Z2LA 4F4XA 1X4EA 2C28A 5K5MA 2IDLA 4KHPJ 4ZVEA 1VLYA 4I56A 4OHXA 3WHIA 5LXYA 5F8HA 4CM2A 4NI2A 3C19A 3NGSA 2R7XA 2LEPA 3BKUA 4C3MA 3DOLB 4GVBA 4YB1P 4RU9A 2BR0A 1UZDA 1PAUB 1AFIA 2MJUA 2VJUA 2XSFA 3O6QA 2PEHA 4KQZA 3M32B 2HSEB 5K8NA 3H4DA 3ZZOA 4L73A 5A6WA 3SBMA 4TY8A 1S9EB 5B0AA 3TAMA 5D4OA 3G6ES 2ZNZA 4I4BA 2R7RA 3RBZA 2MQQA 5ETOA 3PX6A 2MKKA 2F8EX 3PHTA 3DLKA 3V6DA 3GP9A 4CLTA 3THPA 4Y34A 1UETA 5AXNA 1S1VA 1RWXB 1CS4A 2YKMB 2UUAJ 3L09A 1MN7A 3BQ0A 4CNYA 4ZHRB 2JEGA 3A8JA 4WF9Q 3I0RA 3O5TB 1ZAWA 1KP6A 4IUFA 2BACA 4C11A 4QBUA 3PFOA 3D3BJ 2VG7A 3IGNA 3RBXA 5GMKa 2ZH9A 1N56A 2DHHA 3TNVA 1EKRA 2IAJA 4F3QA 1AYEA 3C15B 5E3AA 2UVRA 2WRMA 2IRYA 2G1HA 5M2PA 3WC0A 4LFAF 3M9OB 2ZHAA 2Z30B 2CG8A 3OXGA 2EK1A 2NSBA 4E8UA 4DWIA 1RAFB 1VQKS 2XY6A 1FWLA 3DRPB 3SI8A 3SV3A 5G0RB 1L3KA 3H2LA 2ZFHA 2FVQA 2F4VJ 3G6XA 3FRZA 2YNIB 4NA2A 4JYAJ 3DFEA 1U02A 5KG2A 1HW9A 4LF5J 2BVZA 7FDRA 4GC7A 3NLCA 1HI1A 2V2ZA 4A47A 2XMUA 4JI3F 1GEHA 5D15A 2H3EB 2DO0A 1JJ2R 3GV5B 1SQEA 4GKKJ 4FF1A 2HNZB 3I9V9 4GKJF 3ENAA 5J1NA 1S1UA 4O4RA 2Y0SD 1N33F 1X4FA 2F63A 2FB0A 3KLIB 4MFBB 3UD5A 2RF2A 1JLQA 2H65B 1IKWB 2ZJRQ 5KG5A 1T03A 3DN9A 3OT9A 5KFQA 4HI2A 3W60A 1ZM9A 2B8PA 2KFYA 4NOHA 1QUPA 1AZSA 1CQNA 3C14B 3CD5A 2XWYA 3HO1A 2CJYB 5DG8A 4DS5A 4L75A 1OWXA 2YX7A 2AHOB 1HNVB 4BC7A 4NYOA 2CUYA 1TVRA 2L3MA 3OFEA 2M2BA 3OTOJ 2VG5B 2ZH8A 1FKOA 2CPZA 1VBZA 1WKLA 4O44A 2ZOMA 3G8SA 3HD1A 3H98A 2MY7A 2CADA 3KUHA 1IUJA 3GR0A 1RTIB 2DNKA 5FIIA 3THVA 1SL0A 2DRBA 1ULRA 4YB7A 1CC8A 3RW6A 3DLJA 2B9YA 1J2VA 1NM2A 2QL5B 3H8YA 5E0OA 2G2OA 3H0PA 3D0IE 4K5SA 4B3SJ 4DV2F 4A8FA 3LP1A 2C3YA 3HXMA 2OPQB 3RZAA 3FZ2A 2ZE2B 1GTHA 3PJXA 3UE2A 4DV7J 5CAAA 2Y1RI 1ZM4A 3D54A 5B08A 3HKWA 4WIIA 5B7WA 1FKAF 3VVUA 3CJQA 2CQPA 1PILA 5CYJA 1JMTA 2AD9A 3X3UA 4C8KA 1SL2A 1UEKA 3QPIA 2PFDA 4RNMA 1RAEB 1BD6A 3KJVB 3IRXB 2EKYA 5KT3A 4Z7YA 4OYPA 3L9ZA 3TR5A 2XCPA 2HQFA 1TKZA 1OQ6A 4QIEA 1SV5A 2B3TB 3M8RA 4JB8B 3CCZA 3DKDA 2P6TA 1FNOA 3ISNC 4XDDA 3M4XA 4CO3A 4WFBQ 4OL8A 2KT2A 3N79A 1KQSR 3D66A 4ED6A 5BJRA 3M8ZA 3EDQB 2C3UA 2XNQA 1SC4B 4WXOA 3MFIA 1VDHA 1P9QC 1YJ9S 1LV5A 1M5SA 2MSSA 3D1HA 4TN2A 1OIAA 5I4MA 4S0MA 1YBUA 1LWCA 4DL7A 1VQ4S 4I2PA 3QIPA 2DR9A 1IKYB 2Z4PA 4CH1A 2B4VA 3AH6A 5DGAA 3O44A 2XQCA 1VQMS 3DMJB 3W61A 2OEJA 2XMKA 4B3OA 5LMUJ 3KUGA 3JAMU 2YNHA 3CO9A 3BO3A 2CQ1A 3O8WA 4ZDNA 2CNKB 3LH2S 5L9XA 4F2RA 3WDOA 4LSNB 2QRRA 3QWUA 5LSOA 3T1HF 1UVLA 2UP1A 3WX8A 1SJFA 3F44A 2RSQA 1U1QA 2CQHA 1HBUB 4ZLLA 2E5HA 1UEUA 4ELVA 1VQ7S 3C16B 2ATLA 1HQUA 3JSRA 1OSDA 1MU2B 1UPPA 1S76D 1TAQA 2OFGX 1VISA 1S1XA 3H5UA 3HCXA 2RDIA 1HNWJ 3ILLA 3IR5B 4AE5A 1SL1A 1SH2A 4IRCA 1XMQJ 2L9NA 1UWBA 4DOZA 2HS0A 2XNRA 2K06A 1B7FA 4M8LA 3IR7B 2LYVA 4RPFA 2X3GA 1GXUA 3KK3B 4RW7B 2QYGA 5KT7A 4DR2F 4N8NA 2DNGA 3IGVA 2LQ5A 4H4KA 1NK8A 3IBCB 1K1SA 3PX4A 3JQJA 4ELTA 2BUNA 1HNIA 2ZZTA 3PY8A 2QA4G 3UVJA 1SKWA 2LQJA 1LW0B 1N4LA 3MUMP 2V67A 1IBMJ 2GMHA 1OSCA 5THWA 3UCGA 3VF0B 1KC8T 1YJRA 1HD1A 1Y10A 3G4SS 3A13A 5ETSA 2CQGA 1RUSA 3EX7B 1SBRA 3C2PA 3UN5A 3DRYA 1KFDA 4K4SA 4F25A 3W3SA 4IRDA 3LP0A 2HBZB 4OJ3A 5IZHA 3KWMA 4YUDA 4F67A 4CH7A 3UD4P 2FLPA 1QSYA 1YHQS 2BM0A 1MMNA 3UWTA 1Q81T 3MXHP 2C3MA 1QJHA 1X7VA 4UZBA 1N52B 5DM7Q 3RB0A 4CO1A 4O3NA 2V8DA 2PD1A 3I0SB 1IR0A 4LF6F 4ZIWA 1NK6A 2XMVA 3UR0A 5KFOA 5B0DA 1FF2A 4OI0A 2IM2A 2B51A 5DS7A 2PMZD 2W9BB 1B64A 5A6PA 4OYXA 1KFSA 2CQCA 5DETA 1YBTA 1U09A 4DR3J 1U1MA 1WF0A 3W2WB 2V4JB 1U0HB 3EYZA 1I51B 3VHQA 4IFYB 2HWHA 5L46A 4F4ZA 1HW8A 5E7OB 1SJ3P 3N6NA 1WSRA 1YJ7A 4OYBA 2BQ3A 4XTTA 4PPDA 1XIQA 1Y5IB 2HFOA 1K8AT 2IVYA 3M2UA 4YN3B 1HKAA 4B9SA 2G2ZA 1F60B 2OMLA 3D1QA 2HK3A 1IVZA 4DV4J 3THTA 1YJTA 2AV5A 1B0TA 3H7HB 4ZA1A 5KFXA 2FJXA 2R8JA 1HYSA 3I5AA 3PW0A 4W4MA 4FYWB 2H9ZA 2V63A 3KJQB 3W9IA 2RUGA 4RUBA 2MKHA 2XSJA 3EGVA 3PKYA 5J2MA 4J9NA 3KG4A 3D1OA 4PWUA 4IOAQ 4M5IA 1Q79A 1HR0J 2VFSA 1ZH5A 1VK8A 3FQLA 2RVJA 1N5SA 2BKPA 3W9JA 1TL5A 1U8SA 1Z2ZA 3OJSA 1EB0A 2KVQE 1ITPA 4JI5J 5DLGA 2DR5A 3TEHB 4YFUA 1RT3B 2LXFA 3CCRS 2ZEJA 1F6TA 4JV5J 4Q44A 1C1BA 3AQPA 3CCMS 3M2VB 4TU8A 3K17A 4WWSA 4ECWA 1Y3JA 3DRXA 2DEJA 3AFGA 3DYAA 2VA3A 3VQTA 4KGVB 1Q8KA 2MZTA 4CLZA 2CQ4A 2E7WA 4O4GA 3JYTA 2QMUB 3R7SB 1A7GE 3ET6A 4NMXA 3MM9A 1S0VA 5BXIA 2AT1B 1N36F 1NB7A 1S6UA 2PEBA 2VG6B 2B5JB 3LPYA 1VFJA 2E5GA 5HATA 1TV6A 3S7RA 1YVFA 1VC0A 4MTPA 4U67Q 4RW4A 2A2CA 3TWZA 3BGRA 1WKKA 2IC3B 3M6VA 2ERRA 2YNGB 1Y3KA 4NMLA 3QT6A 4L3KA 5T7LA 3GQCA 1GXLA 3EZOA 5L1IA 5CCMA 4DX5A 1WC5A 4AQYF 1SXLA 3SSQA 4DZ6A 1HQEA 3KHRA 2GA7A 3ISZA 1FHTA 3D4JA 1X8DA 2AYMA 4DV5F 1AUDA 3E3XA 2W2PP 1PJ6A 3I82A 4Y2MA 1A9NB 1RT2B 4JI4J 2JNJA 3EICA 1TKTB 1UW9A 4LFBF 5L1LA 4UW2A 5KFFA 1NNDA 5GADI 3OTDA 4YP3A 1X0PA 1WOSA 1KLMB 3BGLA 3DLGB 4A8WA 2ALYB 2OIHA 3BH7B 4JI0F 2C42A 1ZM3A 1H7WA 6AT1B 4R0EA 4UT4A 2N82B 3UR3C 4PQUA 3PM9A 4HL9A 4URGA 3AB4B 2XS5A 4NLSA 1E6VA 2WONB 1G2EA 1H3DA 4J9PA 2X1AA 2W01A 1TUWA 3FEZA 5ETRA 2FY1A 3QRPA 1R0AA 3KLHA 3KDOA 2NS1B 2DK2A 3UN2A 1F5AA 1U2FA 2HGMA 2E5JA 1HNZF 2NCKL 2DB1A 4EYHB 5J2QA 1QM9A 3DLEB 5C24A 2DYAA 4PG4A 2HQCA 4Y2KA 1N34F 2MKSA 3MAQA 1SC3B 3QLHB 3S01A 3JTPA 2EW9A 1RAIB 3QRRA 2FHJA 3VZIA 2PDAA 1NJWA 3NMAA 1WEYA 3GIKA 3RB3A 2B7BB 1PIEA 4OI1A 2CVEA 4WE1B 1N0VC 4F26A 2CJKA 1PJ7A 4DPUA 1ZAXA 2CRLA 5KFKA 3M05A 4WU2A 1F5BA 5MAOA 3QT7A 5A8KA 2PFFB 1NB2A 4USTA 3J7AN 1DLOA 1SKRA 1QSLA 3EWGA 1M1HA 5U47A 2QMWA 5IV3A 1NU4A 3FC9A 3CCQS 1QVGR 1WG4A 4ETZA 2CQ2A 4K0KF 2KM8B 3IS9A 2DKOB 4ECXA 4Y00A 1MW7A 1SI9A 2MQMA 2I8EA 1ROFA 4FBTA 4M5GA 1S12A 3TA1A 1KNZA 4CO5A 2ADBA 3ZNJ1 2HAFA 4OQJA 3HVTA 4I0WA 4LF4F 1N5TA 4CLSA 4Z2XA 2BQUA 1RWWB 2GVDB 1CSJA 1QTNB 3NWGA 2YWWA 2ZUGA 3GIMA 1R8BA 4EBEA 4Q7AA 5HROB 2B8QA 1EZZB 3RG6A 1KKHA 1V6HA 2LU1A 4NLDA 1NPPA 3J80U 3R9LA 3RTVA 2E7VA 4OX9F 1I5OB 5AE1A 2B56A 3MM8B 1FFGB 3MECB 2QA1A 4QR1A 2IM3A 2VQFJ 3ULHA 4B3MJ 3GG1A 5ITHA 4F0KA 2Q43A 2CQIA 2E7XA 1WHXA 2UVWA 1N5QA 5K8MA 5E5NA 4NYPA 1UEVA 2V2VA 2DH9A 5MLCV 4EO8A 3KHLA 3HD2A 1S77D 4IRKA 1DY3A 3OTEA 3DOLA 5LT5A 2JEFA 4ZVQB 1RA6A 2F8MA 3M32A 2V34A 3CJ3A 4TXSA 2DNOA 3R5CA 2Z2YB 3NGTA 1S9EA 2IY5B 3TUPA 1U6BA 5KG6A 3PRVA 1T7PA 2HYIB 4YMEA 1T05B 3ZTSA 4WFAQ 1VLOA 5E3CA 4EO6A 4Q5VA 2GIQA 3ILIA 3OHBA 4DLEA 4F3OA 5KAKA 4DV1F 5IS2A 1Y0HA 2Y8WA 3L4BC 3NBPB 3K59A 2YKMA 4M5HA 3CCES 4PUOB 3S8SA 1ZA1B 3G6VA 2KFZA 2IMWP 4ZHRA 1Q78A 1JQGA 3QYYA 1OYEA 3IM9A 1TAUA 1R0BG 3UDEA 2KM8C 1R31A 3DGPB 3B78A 2KT5A 3Q24A 3X1LB 4NEZA 6FD1A 3LF0A 1Q16B 1FJGJ 3C15A 3KK2A 1RADB 3AJ2A 3QSIA 5LSLA 5F8GA 4IR1A 4OHVA 1IBLF 3NKYA 4J9LA 1HI8A 2RU3A 4JI2J 3DRPA 1HARA 5G0RA 2U1AA 2YNIA 3UDVA 2MQNA 2VC1A 4B3TJ 1S57A 4MAKA 3M9NB 1HNXF 1FJEB 2G4BA 4U6PA 4B3RJ 3MR6A 2KG1A 4IOCQ 4F8RA 2QG9B 2V6AA 4FDFA 2WSEC 3OUYB 2HHHJ 2DT9A 2YXLA 4OYWA 1D1UA 3KLIA 4MFBA 2K1RB 2J0WA 4NLGA 1FRXA 5CHCB 1IKWA 2ZBPA 2HGNA 2VQEJ 1FT8A 3JSMB 2RE1A 3KUEA 1WHYA 2GVZB 4Q8FA 3DXBA 2XTJP 3VAKA 2E1MC 2WTFA 4JI1J 5DDPC 5B09A 3C14A 3ENWA 5KT6A 3J81j 3HP6A 3UPFA 2M0GB 2AWZA 1HNVA 4U95A 1EARA 4NWBA 3VVTA 3ADAC 2BW7A 2JZ5A 4RX6A 4LF9F 2AEFA 2ZBRA 5KOXA 2VG5A 2C2OB 2MDAA 3IO1A 3MPVA 4L6V3 1TL3B 1T9UA 2O1PA 2E44A 2M88A 2ZH7A 2AGOA 1MSWD 4MKVA 2HQIA 3RYLA 1RTIA 2OH2A 2XWXA 2ASYA 3O3LA 1S1TB 1QDUB 2W2NP 1J5OB 2HRTA 3PIPQ 1ZA2B 5IM0B 2LMIA 3I4PA 3CJKB 5HQLA 3A3NB 3W62A 2DHAA 3NGUA 4NEYA 2N3OA 1F3VA 3A4TA 2GFFA 1WUUA 4C9DA 3NL0A 1E6YB 5DGBA 2OPQA 1G7CB 3W9HA 2ZE2A 2OTLS 4RBVA 2R42A 2QC3A 3QATA 4K2JA 3PNIA 3G6YA 1U1PA 1KDNA 1RAHB 2W9CB 3VAHA 4ZLNA 1YDLA 4H4MB 2XB2D 5I3QA 4C8NA 2F5GA 3FVYA 4MYTA 4QOTA 2EEYA 1RBOB 2IVFB 4PR6A 2OKQA 2GHVC 3EPGA 4WZQA 3KJVA 3IRXA 2D74B 3R7NB 3PTWA 2DEIA 3ZTPA 5DG9A 1T3NA 1R6VA 2WBRA 2JC0A 3CT9A 3I96A 4LRFA 2MGZB 2B4OA 3Q2SC 3G86A 2V9KA 1UTAA 2W2MP 1KLNA 2FD2A 2FZKB 3CIMA 5JVHQ 4JV1A 4X4TA 5L39A 1GMUA 2H5IB 4DSFA 5KFZA 4KY3A 3V6DB 2AX1A 2HIQA 4LBIA 2G9OA 4QPTA 4L72B 4O3RA 3RR8A 4UOGA 4YDDB 3FBEA 5DRKA 2GW8A 3ZZ0A 3BZQA 1IBKF 1PYTA 4LF7J 3BH6B 3M30B 4K4VA 2LA4A 1IKYA 5M2RA 3KLEB 4DXLA 4U8VA 2GAGC 3DMJA 2IAJB 2MSTA 5I3UB 1HHTP 4LF1A 2CG4A 1PAEX 3EGWB 2FZGB 4V19X 4ZVRB 2H4YB 2K8GA 4LSNA 3M2RB 2QIFA 3GSDA 2MJNA 2VFTA 2GX8A 4I6YA 3IRWP 5ETVA 1ZTWA 1HBUA 4CO4A 2NXCA 1GTEA 3PW2A 3C16A 4ZVSB 4ATNA 1N32F 1MU2A 4DPWA 3POTB 3Q8SB 3J81U 4CT8A 1FX4A 4OYZA 4DQRA 2MZ1A 1SKUB 5K8OA 3ZZUA 2KXFA 1LNQA 1KEKA 2CPYA 3SMZA 2BEFA 1NLKL 4DR5F 2Q6BA 2F9JA 1SUQB 1WI6A 2CJQA 2DHSA 2ZWPA 3KK3A 1QD1A 4RW7A 2BA9A 4YY3J 2RDJA 2DGSA 4ZP6A 1UJ5A 1YJNS 2AZ1A 4CNZA 5G4DA 3FNNA 3MM5B 3RAXA 4ZPWR 3RJMB 8ATCB 5KG7A 1LW0A 2YKQA 2JH3A 3H59A 4ID5B 1S6QB 5JXSA 2LECA 4KPCA 4ED1A 2ZH5A 1U8WA 1WF1A 4ZCLA 3BR8A 1I3OB 3DRSB 1RBLA 2PT0A 2WZ1A 1U4BA 1FKOB 4PG6A 3H40A 2PMHA 3LWMA 3UCUP 3ITHB 4LFAJ 2XHCA 3QGIA 1RT7B 4DR4F 4DUYF 2NLWA 2NPFA 3R6LB 1PC4A 2KT3A 3MEEB 4A8OA 1KOOA 4USJC 2UUCF 1FESA 4KJIA 1FE0A 2AMCB 3Q8VA 3I0SA 4JI3J 4V19J 4F4WA 4J9OA 1T94A 1FERA 4FF3A 4DF8A 4WK3A 3UFCX 3PXGa 1T9TA 2RRBA 5SUHA 3J7YI 1NEEA 4LUBA 2DRDA 1NZAA 2W9BA 3G8QA 4J9SA 4KGKA 2XMTA 3AOAA 1K0VA 1FTRA 3VAIA 3V6HA 2W8LA 3W2WA 2V4JA 1U0HA 5AXMA 3VCDA 4DFJA 3FMBA 4A8KA 4IFYA 4ED3A 3R8YA 2VODA 4PAAA 4N41A 1J5EF 4WFXA 1JJHA 3IAM9 3HLUA 3GPAA 2KZMA 4RLEA 2XO6A 4CO0A 2VBWA 4PXEA 3IWLA 2OEKA 2JLEA 3QO9B 2FLOA 4JI8J 3CTRA 4HEA9 3NMRA 5J2PB 1KS2A 4LBHA 5EWGA 3NXZA 4EZ9A 4NXMF 3MAAB 3BSNA 1SCJB 2F9DA 2GV1A 2R7TA 3BBBA 4MIAA 4ZP8A 1U1NA 2OPPB 3CEDA 2DY1A 3BO2A 2XLIA 3RUBL 1S1WB 4I67A 1XQIA 2IBKA 3JAMY 3PFEA 2W7OA 5D4NA 5JUMA 2WVFA 4XPCA 2MZSA 2K2PA 4ANEA 3SCKE 4X4SA 3U1MA 1LWCB 3FZBA 3OXLA 4XDCA 4ZJQA 3PW7A 3DOKB 5DQHA 2EFPA 2CWXA 1RZMA 5IT9Y 3TO8A 1N88A 2DNQA 1LWEB 1C0UB 1VCTA 3T1YJ 3OQ2A 3TVYA 3PR4A 1H38A 2PN6A 1RT3A 4YR3A 1RT4B 2WSFC 9ATCB 1FWKA 1U49A 3TVZA 4ZVOB 4ED0A 3M2VA 2BE9B 5LSRA 4ILMA 3R97A 3PW4A 3KOAA 4BHQA 1HQUB 4CLYA 1NXIA 4KTQA 2RQ4A 5B0EA 5BYRA 3GSIA 5H9FJ 2MZQA 2B7CB 2APOA 3HZGA 5CZXA 3NS7B 2VG6A 2HBQB 2B5JA 4NXNF 2JC1A 1MROB 4IKAA 4DMZA 2ZH1A 2IC3A 3W63A 2FYXA 1FWPA 1F5CA 3GR1A 2YNGA 2F40A 2YX4A 3PDNA 1N54B 2FJWA 1OPZA 5CD4A 4QR0A 2Q6CA 2DXEA 3MD3A 1G6BA 1SPBP 4IG0B 3KMQA 1MNEA 1C1CB 3TEGA 1RACB 2VD3A 2ZVIA 4OZNA 4P2MA 3BGFA 4HT7A 3KJFB 3W2VA 3I55S 1WELA 3AD7C 1RT2A 3QZ7A 4OHWA 1TKTA 5K20B 1SJ4P 4NRTA 4WKRA 2F1FA 3GONA 4LRAA 3TUIC 1KLMA 3A8IA 1NZ8A 2ZD1B 3TZZA 3L7UA 1K9MT 2AJ1A 1KN6A 4B9LA 4RJVA 5RUBA 4IQMA 3BGUA 3KNGA 2W2OP 5F0WA 1NHKL 2UXBJ 3TA2A 2RILA 4P72A 1BWEA 2MHNA 4PG8A 2C22A 1UPMB 4DV3F 2WONA 4A48A 4QIWD 2DPJA 1CPZA 1FI4A 2M70A 1UCNA 2HURA 1HL6A 3JSYA 4A46A 3AB2B 2N4DA 3FEYB 1RTHB 2ZWOA 5HVFA 4LMZA 2XM3A 1WDTA 5JJBA 1KRPA 1K47A 3SQOP 2HWTA 1NPKA 5C5JA 1RT6B 3MPWA 2Z0GA 3TARA 3DLEA 4MK9A 3MM7B 5HQ8A 3TYTA 4OZ3A 2L08A 3LOUA 3N4WA 4DR2J 3QLHA 1RHRB 2QSFA 4E0DA 1HBNB 3CSKA 5LOQA 1GMWA 4ZCIA 5KFWA 5D0HA 2Y9HA 3GG0A 2YPYA 4WE1A 1DURA 2M9KA 2PA3A 3PYGA 5GAGI 2D41A 4GVLA 2KZZA 4DFPA 4W92B 4RWWA 4QWEA 5KTQA 1VR6A 3AOCA 3ONQA 3GFZA 1R7IA 2AEMA 2JDJA 3MMCB 2QN6B 4ZPAA 4DCPB 2F4VF 1OY8A 1X5PA 1NK5A 5DZ6A 4LF5F 1Q7YT 3LUYA 5KG3A 3DNCA 2MKJA 3CCSS 3HDSA 2WVBA 4B9TA 3GILA 2ZOFA 4TYAA 3I4HX 4ED7A 2DNNA 4QPXA 1GX5A 3MPUB 1WOOA 2RD5C 3HVRA 1RCOB 4PEOA 4QCLA 2FJDB 5KG1A 2VFUA 4DPOA 2PI4A 5EGYA 2M5YA 4B9UA 1VQ8S 2GVDA 3MMJA 2DGTA 3AJ1A 4LF6J 1LWXA 4CLLA 3BQ2A 3TI0A 2BE2B 5HROA 1IJEB 1VJWA 2R7QA 5C2CA 1YZ6A 1H2UX 1Q1KA 4FF4A 3FBCA 2OPRB 1JLFB 1BQMB 3MM8A 4XAKA 3MECA 3JXOA 1U1RA 1AA1B 5HP1B 2AGQA 3MMBB 1C1BB 2IFXA 2DD8S 1Y5LB 1CG2A 1Y11A 4A8MP 1S9FA 1NDKA 3I6PA 2MXYA 4K4TA 4XO0A 1RGVA 4OI4A 5HANA 4NCGB 4J9KA 4LSLB 4X65F 2KFNA 2DCUB 5D0EA 3WBZA 2GO8A 4DPTA 3K89A 3BKFA 2VONA 4DR1J 1QAJA 4CRJA 3PRDA 3QWPA 3PJWA 1W25A 2V8VA 2BJ1A 5D8HB 3U7JA 5F8LA 2NZ4A 3W5XA 1VQNS 5D6GA 1KSPA 1T05A 1U45A 3T5HA 1Y9OA 2RKIB 2IYIA 2ALZA 4C3LA 3RGIA 3ETOA 1AFJA 3G96A 1TKXB 2VPZB 2B4PA 2OUGA 3KJNB 4AXJA 4PUOA 4FVCA 2MLYA 1X4HA 3ZXWA 4OI2A 2J6UA 5F8MA 1UVKA 4DL3A 3PV8A 4N5SA 3CCWA 1VS3A 4IG3A 3KHGA 1U48A 2KXHA 2CPFA 3M1VB 3OSNA 1UJ6A 2E9TA 3M8PB 3DGPA 5KFMA 5DDRC 3R2DJ 5GVQA 1PCAA 3CVKA 3BDPA 2MKCA 4DQSA 5GMEA 3GIIA 5ETKA 3FSIA 3D6TB 2HNYB 4BBYA 4WBFA 2AYBA 3HT0A 3CPWR 2HGLA 3OFHA 1R0AB 3KLHB 1N36J 3ZO7A 4CCHA 3RR7A 1S4EA 2C2DA 5ETQA 1FDDA 4X66F 2D7SA 1RAGB 4KV8B 3CCUS 4RU2A 3H2VE 3VV2B 1RU2A 4X62F 3FJ2A 3OUYA 3MCOA 1R8CA 2NXUA 3C6UB 3UDCA 4M5MA 4E98A 1DBDA 4J90A 4RW8B 3HKZD 1RI7A 1KQKA 1FFWB 2RNEA 3SEOA 2DGVA 3GYXB 3QJJA 1WF2A 2CPEA 3EUNA 4FXWA 2D3O1 4KRWA 2ROEA 4ALZA 2GVZA 3K57A 1KD1T 5FLXU 4DV5J 1HWJA 3UCZP 4NCAA 2HQGA 3IBFB 2P8IA 1WTFA 1S0NA 2N7CA 1X9MA 2BJ9A 1RLCL 1JLGB 4H54A 3MEGB 2HHQA 1DQ8A 2KI2A 2FC8A 4OV1A 4UOCA 2M52A 1NMEB 4WU3A 4P73A 2F4FA 4DDFA 1HLWA 4NA3A 3DCAA 2AYGA 2DNPA 3V4IA 1HNWF 4LR9A 4ZLPA 2QJ3A 3IS9B 1N6QB 1TL3A 2OELA 3EMTA 4KAIA 2N7YA 2I2YA 5A8WB 1RAAB 1JNZB 2J7UA 3CJ2A 2RHSB 1AUSL 3J80Y 3QT5A 2R7WA 2QLBB 2EFNA 3BSCA 3CNQP 1UL3A 1S1TA 3KMSA 2VZ9A 1J5OA 2XS2A 3TZWA 1RHJB 5IM0A 2EWHA 3CJKA
chains in the Genus database with same CATH topology
3P5BP 1SPBP 3VHQA 2Z56B 4NMXA 2W2PP 3SQOP 4OV6A 3GCXP 4NE9C 2Z2ZA 3BPSP 4YN3B 2Z2YB 2W2OP 3A3NB 3WIUA 3CNQP 2W2MP 3AFGA 3H42A 2W2QP 3A3PB 2ZWPA 3WIVA 3CO0P 2Z58B 2ZWOA 3GCWP 1V5IB 4JP8A 2QTWA 1ITPA 3T41A 3WHIA 3QFHA 2PMWA 3VV2B 2Z57B 2W2NP 2Z30B 1SCJB 2E1PA 2XTJP 4K8RA 1R6VA 3BGOP 3A3OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P5B P;  1SPB P;  3VHQ A;  2Z56 B;  4NMX A;  2W2P P;  3SQO P;  4OV6 A;  3GCX P;  4NE9 C;  2Z2Z A;  3BPS P;  4YN3 B;  2Z2Y B;  2W2O P;  3A3N B;  3WIU A;  3CNQ P;  2W2M P;  3AFG A;  3H42 A;  2W2Q P;  3A3P B;  2ZWP A;  3WIV A;  3CO0 P;  2Z58 B;  2ZWO A;  3GCW P;  1V5I B;  4JP8 A;  2QTW A;  1ITP A;  3T41 A;  3WHI A;  3QFH A;  2PMW A;  3VV2 B;  2Z57 B;  2W2N P;  2Z30 B;  1SCJ B;  2E1P A;  2XTJ P;  4K8R A;  1R6V A;  3BGO P;  3A3O B; 
#chains in the Genus database with same CATH topology
 1NSQ A;  2ILY A;  1HNZ J;  3CW2 C;  5T41 A;  1T11 A;  3V2U C;  2CQ3 A;  3D6F B;  1H98 A;  3FEX B;  1RB0 A;  1D8Y A;  1LEO A;  1E6Y A;  1T3O A;  4X2B A;  1FJ7 A;  2ASD A;  2I9S A;  4DHV A;  2VBX A;  3BN7 A;  4DR7 J;  4TVA B;  1RWM B;  2HAI A;  2CDQ A;  5E3P A;  1HWU A;  2W9C A;  4JOU A;  4KB7 A;  4ZPC A;  4H4M A;  2VB6 A;  1RAJ A;  2VPY B;  3I87 A;  1XWL A;  3N01 A;  1RHQ B;  1VHF A;  2GGP B;  2G0J A;  4PXD A;  2V50 A;  5CYM B;  1CBK A;  2YWE A;  1VIX A;  1X4C A;  4URS A;  4AFF A;  2MGZ A;  2HFN A;  2OSR A;  4M63 A;  3DLB A;  4J9R A;  4EI2 A;  2DNM A;  4FKX A;  4I6A A;  2FVS A;  2VFV A;  2UXD F;  3AJD A;  4JI7 J;  4M5N A;  4QIG A;  2RS8 A;  2XYH B;  1VBK A;  2BQR A;  3OTC A;  4BCA A;  1BXN A;  4DCJ B;  1G1X A;  4YB6 A;  4K0K J;  4NAS A;  3EPI A;  2CIM A;  1IM4 A;  4IH6 A;  4OFZ A;  5ETN A;  3W5Z A;  4J9V A;  1EQM A;  2V2K A;  3BDE A;  1U7L A;  2ZH3 A;  4LF4 J;  4PAB A;  2FDN A;  4WXW A;  4DX7 A;  1M5K C;  3HSJ A;  3DOM B;  1URR A;  3PO4 A;  1KWM A;  4MMO A;  3B4D A;  3M30 A;  2MQL A;  5L9N A;  5JMN A;  1FXR A;  1HBO B;  3QID A;  3VAG A;  3ZTQ A;  3KLE A;  4DL0 C;  2XS7 A;  2L48 A;  1U24 A;  3NCR A;  1KQG B;  3FSY A;  2CAJ A;  3KK2 B;  2RDD A;  3GWC A;  4P7V A;  5I3U A;  4DPX A;  1BQN B;  4DG1 B;  2VBY A;  5B0B A;  3EJM A;  5HQM A;  3M2R A;  4DV4 F;  4FPI A;  5CA5 A;  3Q86 A;  4P7T A;  4ECZ A;  1EET B;  2FLL A;  3NGD A;  1LKZ A;  3W8P A;  1KON A;  3R5J B;  3B8H A;  4Q2L A;  4A8Y A;  5BR8 F;  4CP5 A;  2DNZ A;  1JIH A;  1TFW A;  4WFY A;  3POT A;  5KFR A;  1VRT A;  2YH0 A;  1FK9 A;  4UQT A;  4U7U D;  3TJ8 A;  1IBC B;  4R8U B;  2VDH A;  1JXE A;  2JFK A;  2QYC A;  1KVK A;  3F0N A;  3QMQ A;  2NQP A;  5EWF A;  4JI6 J;  2UUB F;  3HVW A;  2KN4 A;  1SUQ A;  3TVK A;  2R7S A;  2RIJ A;  3GV7 B;  2ZZN A;  1WC1 A;  4RKU C;  3N0V A;  4PRF A;  2EC2 A;  5KFE A;  2J8A A;  4DV1 J;  3MM5 A;  1XC9 A;  4JV5 F;  3I5C A;  4ID5 A;  1S6Q A;  2WOM B;  9RUB A;  3F41 A;  3KTQ A;  1JKH B;  5CQG A;  3JS9 A;  1KR4 A;  3G2X A;  2DR8 A;  4K59 A;  1JK9 B;  1IKV B;  5ETM A;  3CJ4 A;  4HLB A;  1AT1 B;  3DRS A;  1L3U A;  3CDE A;  3AXK A;  1EP4 B;  4JV0 A;  1ZTT A;  2KG0 A;  5DQI A;  1S49 A;  2XZD B;  3IR6 B;  1U1O A;  3BYR A;  3D0G E;  4QU6 A;  3ITH A;  3WC2 A;  5CAB A;  4AT1 B;  2ZKT A;  1RT7 A;  2GZO A;  2KRR A;  1Q5V A;  1RIS A;  2ZVS A;  3W7B A;  1BUX A;  3DLL Q;  3J7A 1;  4YHH F;  3M8Q B;  3MEE A;  1GQE A;  1R43 A;  1HHS A;  3OL6 A;  1LW2 B;  3PW5 A;  5LJ5 Y;  2M8D B;  3CD0 A;  2V4Q A;  2ZNY A;  3UNY A;  6FDR A;  4F7V A;  2KRB A;  3I9Z A;  3ZZP A;  2B43 A;  4QWD A;  1ARO P;  3KYL A;  5JVG Q;  3I31 A;  5A8R B;  5K9F A;  4GRS A;  2ZJP Q;  3D9B A;  1FTC A;  5F0U A;  2I5J B;  4TLR A;  3K5P A;  2XLJ A;  4DFM A;  4C0H A;  4OX7 A;  3NNH A;  1CJU B;  4OHY A;  1KVI A;  2FPH X;  4OI3 A;  2GJI A;  5HLF A;  4Q43 A;  4XK8 C;  3H5S A;  2J7W A;  1XR7 A;  3G9C A;  3FSX A;  2HHU A;  4D3H A;  1FDA A;  1FA0 A;  4IH7 A;  3SZ2 A;  2ZHO A;  3JTN A;  1KVJ A;  2CNL B;  1UZH A;  1BE4 A;  2IJR A;  1VGY A;  5CCL A;  2E29 A;  1IXK A;  2HQD A;  4X64 F;  1Q8L A;  2OD6 A;  4NLO A;  3SQG B;  4FNH A;  2WB4 A;  3NRB A;  2CPH A;  3TW0 A;  4LF8 F;  2VJV A;  2QL7 B;  1RWV B;  2QX0 A;  3VTI A;  1FJC A;  2LXI A;  4CO2 A;  2XMW A;  3QO9 A;  1KOH A;  5J2P A;  3HFV A;  4LF9 J;  2SXL A;  5D78 A;  3CDU A;  2DIS A;  4GO5 X;  5F41 A;  5J2N B;  1RBA A;  3MAA A;  1UVN A;  3KG0 A;  4QWC A;  1S4F A;  3R2C J;  2XMM A;  3OL7 A;  1GMW D;  4B9N A;  4ID8 A;  4HR2 A;  2Z2L A;  4GC6 A;  3R5G A;  2XO7 A;  2NZC A;  4FKY A;  2OPP A;  4FBU A;  3BJY A;  1TP7 A;  3NGK A;  2QE5 A;  4P74 A;  1S1W A;  2BZ2 A;  2KVI A;  4DUZ J;  1HMV B;  2OP5 A;  2F8H A;  1JB0 C;  2I0X A;  3MOJ B;  2C2R A;  3IAS 9;  1FE4 A;  2DHX A;  2YQ3 A;  3OD2 A;  5LJ3 Y;  2J0S D;  2HHT A;  3OXF A;  2G0C A;  1U1L A;  1HFE L;  3M8Y A;  3DOK A;  4ZVP B;  4L3N A;  4C8Z A;  2LCW A;  2WAQ D;  1IWA A;  1IM6 A;  1DTQ B;  1YWX A;  4EBD A;  1TL7 B;  2FVP A;  1LWE A;  1C0U A;  4NLY A;  2ACY A;  3J81 Y;  1VBY A;  3E01 B;  1RT4 A;  2DCL A;  2VKR A;  5KFG A;  2GNK A;  2AJ0 A;  3DRR B;  1X9S A;  1MML A;  5DM6 Q;  4MKY A;  5F9N A;  1FCA A;  2OEM A;  1U6F A;  1HBM B;  4YR0 A;  3CDW A;  3WX4 A;  3OPK A;  2QO3 A;  2MTL A;  3KLG B;  3GZ7 A;  3CDA A;  4USK A;  1RAO A;  2BBE A;  1MLA A;  3BBF A;  4Y0F A;  4WTO B;  1UVM A;  4ES3 A;  2BE7 D;  1O51 A;  3QBC A;  4ZLJ A;  5J1E B;  5AJ3 J;  3MUV P;  4ILR A;  4WJB A;  3T9N A;  2MMY A;  2HHP A;  1MRO A;  1IKX B;  3UI3 A;  5F3T A;  2E1A A;  3IA0 A;  2DXD A;  1XMO J;  2AYE A;  1F2G A;  1U47 A;  1R8P A;  2C2N A;  1FRJ A;  1RQ0 A;  2HS4 A;  2RQK A;  1JLB B;  1R27 B;  2ZKU A;  3OVB A;  2OMO A;  4QU7 A;  4IG0 A;  3MMA B;  2HZC A;  1C1C A;  3T6B A;  4NLT A;  2CJB A;  4MIW A;  2OPS B;  4WCE Q;  1LWF B;  1V5I B;  4OZ1 A;  2CZ9 A;  4EZ6 A;  5KFA A;  3AOB A;  2FLN A;  4ECR A;  2VKZ G;  4B9M A;  3H5Y A;  2N4C A;  4DSI A;  2HZV A;  3LQV A;  2ZD1 A;  5HO4 A;  2HVI A;  5F8N A;  5B0C A;  2YNF B;  1C4A A;  1N5Y A;  2XMJ A;  2R8K A;  3M9M B;  5LMN J;  2QGF B;  1QUV A;  4KGZ B;  2G2Y A;  1MN9 A;  4W98 A;  2DRA A;  2LFV A;  3KK1 B;  3FMW A;  2V4R A;  2EVZ A;  1N32 J;  2AW0 A;  2CPI A;  3SYZ A;  4DCO B;  3NGR A;  4ELU A;  2LKZ A;  1RTH A;  5D4P A;  5HMX A;  2R2U A;  4CLU A;  3CO0 P;  4DR5 J;  3MCN A;  2HBY B;  4DSJ A;  1RT6 A;  4F50 A;  2BMB A;  4FS2 A;  2JFD A;  2BKN A;  3MM7 A;  4DX8 H;  4QYZ K;  4EGL A;  2FC9 A;  2JSX A;  1AW0 A;  4CLF A;  3C6T B;  3R7B B;  1OYD A;  4KFB B;  3HI9 A;  1X4A A;  2HVE A;  3A8E A;  1HBN A;  3J7Y U;  2E5I A;  4URQ U;  2VIC A;  2W2Q P;  2IJF A;  1BGX T;  4ZCK A;  5ETT A;  1D9A A;  5IWA F;  1RTZ A;  3ZNU A;  4TKT A;  3VGS A;  1SQG A;  3HHK A;  1CUL B;  2MQO A;  2A10 A;  4JI2 F;  2KHC A;  4X4O A;  3MMC A;  1DQA A;  3OL8 A;  4RNF A;  1R3N A;  1PG5 B;  2RT3 A;  1WOR A;  1TK0 A;  5DDQ C;  1AXQ A;  4B3R F;  4YDX A;  3B82 A;  4DR4 J;  4DUY J;  1X4G A;  2HHH F;  5J1P A;  3QT8 A;  4CIO A;  1Q86 T;  1TUV A;  4I68 A;  1X0F A;  4RW9 B;  1WHV A;  2EFG A;  3DHX A;  1V3S A;  5BYS A;  2J9D A;  1D3W A;  3A12 A;  1PSD A;  4ZK7 M;  3LA0 A;  2W4D A;  3EDR B;  1CJK B;  2BE2 A;  3CMA S;  2L9W A;  2LQB A;  3V81 B;  5IC4 B;  2Q79 A;  1JXL A;  3MD1 A;  2J7K A;  5K8P A;  2DNL A;  4DR6 J;  4G1P A;  5F3Z A;  2OPR A;  4P10 A;  1JLF A;  2H4W B;  2HFS A;  3BYP A;  4QW8 A;  1QVF R;  1BQM A;  4IFV B;  4Z7C A;  1NKB A;  1TMM A;  4L74 A;  4ZVF A;  5HP1 A;  3NNA A;  3MMB A;  1XEZ A;  1JJ4 A;  4H4O B;  2UXC J;  4OZJ A;  4BWJ A;  3Q8U A;  1N48 A;  2BKO A;  1PC5 A;  4UOF A;  1YJW S;  1WC6 A;  4NCG A;  3BO4 A;  3CGI A;  2R9L A;  4LSL A;  1D8Z A;  3IFE A;  4DN0 A;  5KFD A;  1Y7P A;  2Y1I A;  3CMQ A;  2C1E B;  2VC0 A;  4NLX A;  2C3O A;  1FEH A;  4N8O A;  2IA0 A;  4A8X A;  2CPX A;  4NXM J;  4HVZ A;  4ZN3 A;  2DNY A;  2YH1 A;  3Q8Q B;  4ECU A;  3LPE A;  5A0Y B;  1PBA A;  4USI A;  1VYA A;  5CXT A;  3G87 A;  5C25 B;  2LVW A;  4FS1 A;  5D3G B;  3MUR P;  3OVS A;  2ADC A;  2RKI A;  2QFI A;  3JQM A;  3N5F A;  1YSJ A;  4WP9 A;  2XCA A;  4QW9 A;  5I42 B;  1XK8 A;  4LSZ B;  2QTW A;  1TKX A;  3P8B B;  4PWW A;  3OL9 A;  4C8L A;  3IWX A;  3W2V B;  3ETM A;  2GJ2 A;  3C66 A;  1YI2 S;  3DI6 B;  5GAH I;  1JXV A;  1YIJ S;  3T9Z A;  5HBM B;  2UZA A;  1YTY A;  4Q0B B;  1CJT B;  3F56 A;  3S1T A;  3T19 A;  1P27 B;  4LF2 A;  3HT3 A;  3CCL S;  3M1V A;  4LR8 A;  3M8P A;  4ICL B;  3Q8Y A;  4J9Q A;  2UV8 A;  1FNM A;  4Y6I A;  4NPO A;  1S99 A;  3W64 A;  1YBA A;  4M5J A;  1NH8 A;  2J76 E;  2EXU A;  3ILJ A;  2AF6 A;  5HSP A;  4ZN1 A;  3P5B P;  4KO0 B;  2I1R A;  3D6M B;  4KYZ A;  2HNY A;  4USM A;  4C2M A;  1RHM B;  2BXJ A;  3DDI A;  4N47 A;  3QSY B;  1KHW A;  1TKD A;  4DQI A;  1Q53 A;  4P9S A;  4DL4 A;  4KGM A;  4ZCM A;  4U8Y A;  2EBG A;  4KE5 A;  4PYA A;  1YKW A;  1R89 A;  2IM1 A;  4HHU A;  2HHV A;  3J7Z T;  4ECS A;  4KV8 A;  3D5M A;  2AKW B;  2LDY A;  1FDB A;  2DGQ A;  3IN5 A;  3GCW P;  4JP8 A;  4PCQ A;  1VQO S;  3PEH A;  1GH8 A;  2U2F A;  1SJ1 A;  4O3P A;  1NCL A;  3HHE A;  5D4L A;  4LF7 F;  3C6U A;  2DNR A;  2HLT A;  3MTK A;  2QEX S;  4TY9 A;  2PE8 A;  3CB4 A;  2J0Q D;  4RW8 A;  2C2K B;  1X5S A;  1RWP B;  3K8V A;  2XMA A;  3W1Y C;  3EVW A;  3SFU A;  1C2P A;  1PYO B;  4U7U K;  1VI7 A;  3SFG A;  2FGO A;  2W9A A;  3FCW A;  4RNH A;  3BBC A;  4KPY A;  1S6P B;  2HQ3 A;  1J27 A;  4F36 A;  3R6G B;  3K5L A;  1I94 F;  3CME S;  1JLG A;  2H1Y A;  3MEG A;  1DQ9 A;  3JQK A;  5GAG U;  3CD6 S;  1REV B;  3CXC R;  1M1K T;  3P3D A;  2QT7 A;  1ZPW X;  2KO1 A;  2F65 A;  2X1B A;  4QJV A;  3L7O A;  1NDP A;  4YR2 A;  2DIV A;  4USH A;  2X3D A;  1RT1 B;  1N6Q A;  4DV3 J;  4R5P B;  5A8W A;  3QZ8 A;  2A6O A;  3V6K A;  2OHD A;  1Q82 T;  1M5O C;  2VFR A;  4B02 A;  1FVS A;  4Q45 A;  2OJ3 A;  4YY3 F;  2GS8 A;  2B9E A;  4LR7 A;  3PIO Q;  3E8O A;  3ZZT A;  4PWD B;  4LVN P;  4CQ1 A;  4DV0 F;  3PHE A;  2IRU A;  1OS5 A;  4NLP A;  5A2Q U;  1YZ7 A;  1YQH A;  1KBR A;  4CLK A;  1UVI A;  1A6L A;  1JJC B;  4CH0 S;  2DR7 A;  4NLQ A;  3RAM A;  3VGT A;  4WK1 A;  3HHL D;  3T41 A;  3FGV A;  4ZP7 A;  3NS5 A;  3W65 A;  4DL6 A;  3UO0 A;  2ZBI A;  1FD2 A;  2XY5 A;  4OZ2 A;  3V4M A;  3EVM A;  3IP0 A;  3CC2 S;  1F2H A;  2O3D A;  2ZDP A;  1BQX A;  4TYB A;  2GGP A;  1GK8 A;  4UTG A;  5A76 A;  3N6L A;  3CCV S;  1PBU A;  1EJ7 L;  1XER A;  1F3F A;  3J7Z 5;  5CYM A;  1L5U A;  3LAM A;  4IO9 Q;  4QQB A;  3U27 A;  5KFJ A;  1O6X A;  3AY0 A;  5L1K A;  1T9Y A;  2BW2 A;  2VL1 A;  4UF4 A;  2ZZM A;  2CQB A;  1JLC B;  2IMO A;  4F2S A;  3BN4 A;  1U26 A;  1YLX A;  3A3P B;  4FP9 A;  3FBF A;  2MLX A;  3SDE B;  3AXM A;  1VRU B;  2P9E A;  3CJ0 A;  2CJ9 A;  1PO6 A;  5KFP A;  2QA4 S;  4RL1 A;  2HRU A;  3M6X A;  1NKC A;  5F8J A;  1OMS A;  3ZTR A;  3MED A;  2JEJ A;  3E2E A;  3DOM A;  3CCJ S;  5IXU A;  2UU9 F;  3LGN A;  4IG3 B;  2P9G A;  1HBO A;  1XR6 A;  2LDI A;  4IO1 A;  4N56 A;  5EDW A;  3P5T L;  4OJG A;  2RHQ B;  3UN3 A;  2R4F A;  1TL4 A;  1WSV A;  4ZVH A;  2Z56 B;  4ZOS A;  5H9E J;  1BQN A;  2B6A B;  4DG1 A;  3C3L A;  2PII A;  2VV5 A;  3FCV A;  4RO0 A;  2V8G A;  1JX4 A;  2EK6 A;  5HK4 A;  4JI8 F;  3OLA A;  3BQ1 A;  4TQS A;  3QRQ A;  3TAQ A;  4KBI A;  3U1N A;  3NCQ A;  1EET A;  4J9M A;  4X65 J;  2CQD A;  4U7C A;  3TAN A;  4I1T A;  2JRS A;  4A8Q A;  2H5J B;  2ZDO A;  3A1Y G;  1IQT A;  1FO1 A;  1M5P C;  2MQP A;  1LQ9 A;  2D9O A;  2HFZ A;  5IQQ A;  2A1B A;  4R8U A;  4C7Q A;  3T5L A;  2HKE A;  2C2E A;  4ETX A;  4K4Z A;  2BOP A;  1WEX A;  5FLX Y;  5CYQ B;  1XR5 A;  4EK2 A;  4Y3C A;  1TL1 A;  2D9P A;  1RAB B;  1FRK A;  1WG1 A;  3GIR A;  2EFQ A;  1JLA B;  1SIZ A;  2XUL A;  2M3D A;  4C97 A;  3BRE A;  3AA9 A;  2W7A A;  1B0P A;  3T1Y F;  3PJ9 A;  1M5H A;  1XNR F;  1NKE A;  4C98 A;  2BRK A;  2EFO A;  4IH5 A;  3G82 A;  2UVU A;  5EWE A;  4YOE A;  2WOM A;  5KFC A;  3IG1 A;  1P1L A;  4NZ7 A;  3NWR A;  3H90 A;  5AE2 A;  2Z8Q A;  1JKH A;  1MMD A;  2W4P A;  5E3Q A;  2PO4 A;  1VQY A;  1IKV A;  2UUW A;  4LRD A;  2KDO A;  3GU0 A;  3MM6 B;  3CJT A;  1EP4 A;  3V4I B;  2NUH A;  4I2Q B;  2OO4 A;  4JUZ A;  2YKN B;  4OX8 A;  1EKS A;  2J9D E;  5E33 A;  5H9E K;  1R8H A;  4Q8E A;  4WKY A;  2DXF A;  4J5O A;  3KHH A;  3EGN A;  4DQQ A;  5AXK A;  3TUZ C;  2HEK A;  2JJ4 D;  4C8O A;  1NHV A;  3OTB A;  1NK4 A;  2BRL A;  3MGJ A;  2EC0 A;  1JNR B;  3DM2 B;  3M8Q A;  1LXN A;  2FJB B;  2OD4 A;  3DDN A;  1LW2 A;  2YTC A;  3PEJ A;  1RE1 B;  2BX6 A;  3RBE A;  4X66 J;  4ED8 A;  2MKI A;  3NY0 A;  3SV4 A;  2E5L J;  1NJY A;  4C0O C;  2M4M A;  3FFI B;  4KT0 C;  5A8R A;  4X62 J;  1Q8I A;  3LO3 A;  4B08 A;  4YQW A;  4DU8 A;  4MK7 A;  4K4X A;  3N5B A;  2I5J A;  2NXJ A;  1V3Z A;  1CJU A;  3MTJ A;  3F73 A;  1NO8 A;  1T9X A;  5H1S V;  2ZH6 A;  2E9Z A;  2BAN B;  5EX3 A;  2K7K A;  3Q23 A;  2Z57 B;  2GHW A;  3GYN A;  4ANC A;  2DH7 A;  4IR9 A;  3OR1 B;  2N3L A;  2KKH A;  4K4Y A;  4I69 A;  4DV6 F;  4OJH A;  2W24 A;  2WVD A;  2UXB F;  4ZPT R;  2QL9 B;  3SQG A;  1MWY A;  2IHR 1;  5IT9 U;  4G3I A;  4PYD A;  3G8T A;  2MEW A;  2ZHB A;  2CJX B;  5IQ6 A;  2R7V A;  1O5J A;  2QSW A;  4ERD A;  2RQC A;  1G3O A;  4PXB A;  5J2N A;  3T5K A;  4FVM A;  4ECQ A;  1H2T Z;  1RP5 A;  1F9H A;  1JLE B;  4QYR A;  2FVC A;  1AB8 A;  1KTV A;  3KLF B;  2VOO A;  4EWT A;  4ZVT B;  1HMV A;  3H20 A;  3EZU A;  3VAF A;  2F7V A;  1U1K A;  2BAB A;  1X31 C;  5KG0 A;  2AU0 A;  4HT5 A;  2NPI A;  4RBU A;  2AJ4 A;  2JWN A;  4EFA C;  4P71 A;  3TQ1 A;  4DUT A;  1QAY A;  2BJE A;  3HHN B;  3IWN C;  1DTQ A;  2PGC A;  4LQ3 A;  1TL7 A;  1S9G B;  1S0M A;  4X4R A;  2WW4 A;  1URN A;  2X7I A;  3E01 A;  1S7I A;  2ACM A;  1FKP B;  4O3S A;  3C46 A;  3BS9 A;  2FTR A;  3DRR A;  3NAI A;  2NRE A;  1HBM A;  1TU0 B;  2ZM6 F;  4F4Y A;  3KLG A;  5C7P A;  1IR1 A;  1VRT B;  1FK9 B;  4HAC B;  4LIW A;  3K58 A;  1O8B A;  1UJ4 A;  1X60 A;  4G65 A;  2OI2 A;  2BYC A;  4ITS A;  1TK8 A;  1GNK A;  1ZZN A;  1SIW B;  2AZ3 A;  5J1E A;  1WI8 A;  2UXD J;  1IJF B;  4X4Q A;  1IKX A;  4AL6 A;  3PO5 A;  3TUJ C;  1R0C B;  1RT5 B;  3JTO A;  5HJY A;  2CA9 A;  3AA8 A;  5AE3 A;  2CKW A;  4Y2I A;  1B3T A;  4K7Q A;  1YRX A;  1JLB A;  3OSP A;  4P2S A;  2FJV A;  1UKU A;  4DU7 A;  1Q4R A;  5KFL A;  1WHW A;  3MMA A;  4DF4 A;  1S10 A;  3VWS A;  4NA1 A;  2BV3 A;  3A3O B;  2OPS A;  8RUC A;  5FD1 A;  3CC7 S;  1SH3 A;  3BPS P;  2XI2 A;  2JX2 A;  1LWF A;  2DGW A;  5DJB A;  1Z1Z A;  1DFD A;  1CQM A;  3MCS A;  3SCJ E;  2HZA A;  2HMI B;  1RYR A;  3T3F A;  5EHH A;  1PGZ A;  2RU9 A;  4TNO A;  2P5V A;  1W2I A;  4QIF A;  3HHL B;  3SXL A;  4DR1 F;  4OMF G;  2YWK A;  2IDE A;  4OI6 A;  2YNF A;  3FKB A;  1RTJ A;  4C8Y A;  3N6M A;  4KH1 B;  3OR2 B;  1SJR A;  4RW6 B;  1I6J A;  5BYQ A;  5HVG A;  1N8R T;  3RBD A;  3KK1 A;  2WSC C;  5BR8 J;  2OGU A;  1FXL A;  3B4M A;  1IR2 A;  1PJ5 A;  1TUG B;  1RHU B;  1M90 T;  4U9R A;  1NH7 A;  4G1Q B;  3MR7 A;  3WZ0 A;  2KB2 A;  3P45 B;  1NSP A;  4F3M A;  1U2C A;  3M8S A;  2C3P A;  3GJR B;  2ILZ A;  5HJX A;  4GKJ J;  5GAE U;  1B4S A;  3NAH A;  2UUB J;  1N33 J;  3D7S B;  2W1B A;  2A2D A;  1Q8B A;  5HLF B;  3MAH A;  2PI5 A;  4M95 A;  3C6T A;  4KFB A;  1QE1 B;  4NRU A;  2Z58 B;  3MWB A;  4RWX A;  2DGU A;  4M5D B;  4GMK A;  2JEI A;  1B0V A;  1A0O B;  4FZV A;  2YBV A;  1UFK A;  2ABY A;  3MF5 A;  2OFH X;  1GMV A;  1OY9 A;  3AD8 C;  3EZ5 A;  2IA6 A;  2FUG 9;  2XLK A;  2VF3 A;  5IC6 B;  3VGU A;  4W90 B;  1VBX A;  3QGP A;  1CUL A;  3DXS X;  1WD6 A;  4BS2 A;  2GJF A;  4ZPD A;  1EX8 A;  5KFY A;  3EM1 A;  1XJW B;  1K73 T;  4BLG A;  2MQ8 A;  2IM0 A;  1UMJ A;  4LFC F;  4RUH A;  2E1P A;  4RR5 A;  3P49 B;  3OBI A;  2VIH A;  2W8K A;  3GCX P;  2AP6 A;  3HJV A;  2CZ4 A;  1REG X;  5KOW A;  4YHH J;  3O2I A;  3CDB A;  4PXC A;  4RW9 A;  4KKO A;  5ETL A;  4M5K A;  3EE3 A;  1R8A A;  1V9O A;  1D09 B;  4DV2 J;  4IOB A;  2DIT A;  1NDL A;  4I6W A;  1UA1 A;  3HHL C;  1CJK A;  1BMQ B;  3GE9 A;  2GIR A;  3V81 A;  4F04 B;  2BJ3 A;  3U1L A;  1NJI T;  4PPZ A;  3H25 A;  4KHM A;  5KFN A;  2GO9 A;  3Q8R B;  3NOC A;  4IFV A;  3GIJ A;  2RAQ A;  4M1K A;  3MCM A;  1DAX A;  2MKY A;  4L76 A;  1ZYQ A;  3RU0 A;  5HMZ A;  4CZC A;  1BHN A;  3ZC4 A;  4H4O A;  3EGZ A;  3EXY A;  3D28 A;  1D0E A;  4C3K A;  3WIU A;  2HHS A;  2YKP A;  4DSL A;  5B0G A;  3BSO A;  4CDI A;  4ZIT A;  4MJK A;  4PG7 A;  4X64 J;  3Q2T C;  4O3O A;  2GMJ A;  4NLR A;  1XNQ F;  4LF8 J;  4K5R A;  2DGX A;  3L7P A;  3HK2 A;  2BJ8 A;  1T9W A;  3LP2 B;  2MZR A;  2QV6 A;  1VK3 A;  2KL8 A;  1ELO A;  3HSD A;  1C0T B;  2EG2 A;  2AJQ A;  2HIY A;  4C0B A;  4HI1 A;  3OHA A;  2D3O R;  1H73 A;  2A18 A;  2OTJ S;  2KHD A;  5A0Y A;  2CDR B;  5C25 A;  3HMJ G;  2EG1 A;  5D3G A;  4O3Q A;  3K5O A;  4OLP A;  3FBB A;  1S7H A;  2J5A A;  2BM1 A;  3GJS B;  4DR7 F;  5I42 A;  1S5Z A;  3LGH A;  2D3Z A;  2YQ1 A;  2GAH C;  2XBP A;  3TX8 A;  1UFL A;  2RQM A;  4KHP F;  3GMG A;  4F4K A;  4O23 A;  3DI6 A;  1VC5 A;  1TK5 A;  5HBM A;  4NE9 C;  4NZ0 A;  4Q0B A;  3MHY A;  4DSK A;  1CJT A;  3R1H A;  2G0I A;  3T6J A;  2VOP A;  1LK7 A;  4ICL A;  3RRG A;  2D3U A;  1VQ9 S;  1RKJ A;  1N5Y B;  3OFF A;  3T1H J;  1FRI A;  5DQG A;  1WEZ A;  3CJR A;  3B6B A;  3LAN A;  4FNI A;  4IDK B;  2LLZ A;  1VQP S;  4KO0 A;  4JI7 F;  3VAM A;  2HW3 A;  2M7S A;  4DQP A;  3TJ9 A;  1EAY C;  1NUE A;  2RS2 A;  5M2U A;  4K50 A;  4K4U A;  4AXI A;  1RHK B;  1HPZ B;  4HTJ A;  1ZPV A;  3P96 A;  3K8W A;  3WQP A;  5LXR A;  1FXD A;  2KYX A;  1YRU A;  2H5E A;  2ASJ A;  2UUA F;  1U25 A;  1GFW B;  3NP5 A;  4B9V A;  3G71 S;  1XTZ A;  3N28 A;  1RWK B;  3IC1 A;  4N77 A;  2Y1J A;  3LW5 C;  2FZC B;  5E41 A;  5KFI A;  3UQS A;  3HSZ A;  2HND B;  2LU2 A;  1M0S A;  1EQ0 A;  1V5V A;  3GTY X;  2R8H A;  2BOA A;  2R7O A;  3OJU A;  1S6P A;  4P6Q A;  3HFZ B;  1ZAV A;  1ZET A;  3CIZ A;  2XY7 A;  2XGQ A;  5C42 B;  4F0M A;  1H6K X;  2ZIT A;  2DHG A;  4CTA B;  4USU A;  4PQA A;  1DTT B;  1REV A;  3Q83 A;  3AQO A;  4JYA F;  4QWB A;  3LTO A;  4FF2 A;  1RTD B;  2UV8 G;  4DSE A;  1CJV B;  1FRH A;  2AIR B;  4JBC A;  3QJL A;  3UD3 P;  3NCP A;  3LGM A;  2R3V A;  2E66 A;  3HF5 A;  1X5O A;  2KU7 A;  1UA0 A;  1Y4Z B;  5EUH A;  1RT1 A;  2WCX A;  2C2M B;  2R7U A;  1RDR A;  4GKK F;  4JI6 F;  4X4V A;  4R5P A;  4DPY A;  3GJQ B;  2CYY A;  1KQF B;  2FQQ B;  3FQK A;  2QMX A;  5I3P A;  2HLU A;  1RJJ A;  4PWD A;  2HFV A;  2RRA A;  2CNO B;  3H42 A;  3DU5 A;  3DU6 A;  3W66 A;  4XPE A;  5T14 A;  3JSB A;  4OV6 A;  4FYD A;  4FXV A;  3K7R A;  4OZ0 A;  1C4C A;  2ROG A;  4CYU B;  1XBW A;  2J6T A;  2WBM A;  2ATC B;  2PSZ A;  3OTO F;  2G1D A;  3TZY A;  4CI0 B;  5IWA J;  4MH8 A;  2DVI A;  1UP1 A;  2RML A;  2DY9 A;  1W7W A;  2WVC A;  2ZC3 A;  3P6Y C;  3BF4 A;  3QAU A;  3NOG A;  4HHJ A;  2O67 A;  2QLW A;  2MHE A;  4MKB A;  4AD6 A;  2QFJ A;  1NDC A;  2DTJ A;  2FY8 A;  3BKT A;  1LXJ A;  2VHG A;  2RRN A;  3HFK A;  5HAO A;  2VPW B;  2M8H A;  1R6Y A;  1P8G A;  3TX0 A;  5F9L A;  4Z37 A;  4I64 A;  4B3S F;  1JLC A;  3Q0A A;  2Y0B B;  4Y2C A;  1WNE A;  4HDG A;  2FJE B;  4P2X A;  3SDE A;  3FUY A;  1VRU A;  2EFV A;  2HNZ A;  4ED4 A;  1RSC A;  3MDF A;  2Q66 A;  4QZV B;  4DV7 F;  3BPD A;  2JVR A;  3CWJ A;  3PVX A;  1FD8 A;  2OLW A;  3O1L A;  2AGP A;  3OV7 A;  1X9W A;  3MR5 A;  2GQ2 A;  2VBZ A;  1DZ5 A;  5K14 B;  4OZL A;  2DJW A;  5GAH U;  1OJ4 A;  4OYM A;  1RYS A;  1S48 A;  5FDL B;  1U0S A;  1VMB A;  1NK0 A;  5HL7 Q;  5KFS A;  1NJX A;  1WC3 A;  1Z4U A;  1O0P A;  2B6A A;  4RUA A;  4YB5 A;  3RRH A;  4FXD A;  3SSS A;  3VQS A;  1IWG A;  2LXU A;  2DBB A;  1NAQ A;  3BM7 A;  1VC6 A;  4O0I A;  1UWA A;  1CLF A;  2KH9 A;  4FYY B;  4I7F B;  3OFG A;  5CD4 H;  3AHP A;  2J6S A;  5KT4 A;  2Y8Y A;  2MY8 A;  2B9X A;  4HHH A;  2CJA A;  2HPU A;  2VAS A;  4EMD A;  2W4C A;  4DLG A;  4NZ6 A;  2DH8 A;  4AYB D;  4LRE A;  2XG8 A;  4DI6 A;  2GHP A;  4DUZ F;  3QQC D;  2MYF A;  1WAC A;  2CQ0 A;  3LAK A;  3FK4 A;  2DPI A;  3GFH A;  1SVD A;  4P75 A;  1SC1 B;  3T5J A;  5CYQ A;  1L3S A;  1S79 A;  3MPY A;  4X4P A;  3Q8P B;  8AT1 B;  2NSC A;  4M5L A;  4OYA A;  2FIU A;  1JLA A;  4AQY J;  2I38 A;  1K0T A;  1LFW A;  4KGX B;  4OZ5 A;  4BWM A;  5LMU F;  4KR0 B;  3QJP A;  4ZVU B;  4UUX A;  2YWG A;  4R0J A;  4ER8 A;  2V69 A;  1Y00 A;  2VU5 A;  3CD7 A;  2C2Z B;  1HWK A;  3AOD A;  2EKN A;  3M8W A;  4LFB J;  4DJB A;  4NI2 B;  2GC8 A;  4ECT A;  1H72 C;  3PCO B;  4GVB B;  2I6W A;  2HHX A;  4JI0 J;  5IT0 A;  3MM6 A;  3Q89 A;  4I2Q A;  2YKN A;  4ECY A;  3NG8 A;  2W7P A;  2ZJQ Q;  3ELH A;  2WK4 A;  1FRL A;  4E2F B;  3D3C J;  2NR0 A;  5AJ3 F;  1OPI A;  4WP8 A;  1XMQ F;  3I56 S;  4TY8 B;  4EUV A;  2HWI A;  2Q3P A;  2CXE A;  1LOU A;  4R25 A;  2X51 A;  5A2Q Y;  2IYG A;  3TAM B;  4KH0 B;  5AXL A;  4RNN A;  1XMO F;  5DDO C;  2COL A;  4JV2 A;  4NLW A;  3DM2 A;  4M94 A;  4FYV B;  2J8S A;  3D68 A;  3WIV A;  2B4U A;  4C8M A;  3DLK B;  5ADZ A;  1FFS B;  4USV A;  4UOH A;  3TJA A;  1S1V B;  3KFW X;  2K3I A;  1SKS A;  1CS4 B;  3CUN A;  4J9U E;  2Y3Y A;  3FFI A;  1IBM F;  3I0R B;  3D6H B;  1NSA A;  1N34 J;  1JWW A;  4LRB A;  5KT5 A;  3IMQ J;  4C11 B;  4OIX A;  2VG7 B;  2BAN A;  3RW7 A;  2WHO A;  2MB0 B;  7FD1 A;  1ZS6 A;  1PKU A;  3QGH A;  2H48 B;  2IIH A;  3V5R A;  1SC6 A;  3OR1 A;  3CC4 S;  4MIB A;  2V5H G;  4ES1 A;  5E2Q A;  3D0H E;  2J0X A;  1LK5 A;  2QLF B;  4ECV A;  1WTB A;  3NNC A;  2LEB A;  4C48 A;  2CWK A;  5LMN F;  1I94 J;  2RH3 A;  2EBE A;  2NUU G;  1RWO B;  3R5D A;  4RZR A;  4ENO A;  1KHV A;  3SCI E;  1GXT A;  1NHU A;  3R3T A;  3TP2 A;  1BC6 A;  2NXE A;  4YEA A;  3PYE A;  4HYK A;  2UVV A;  2H54 B;  2YX1 A;  1JLE A;  1S1U B;  2JHE A;  5HN0 A;  2VDI A;  5HMY A;  2YKA A;  4ES2 A;  1GT8 A;  3I5B A;  4WTY A;  2ZH2 A;  1HD0 A;  2FJA B;  2KYZ A;  1P9Y A;  2RF2 B;  3QFH A;  3OLB A;  3KLF A;  1JLQ B;  5HMW A;  4K8R A;  1W26 A;  4DR3 F;  3MED B;  4OYO A;  1T03 B;  2ZOG A;  4DV0 J;  4AND A;  2YY3 A;  1YJU A;  1DJ0 A;  5D0G A;  4N76 A;  3Q22 A;  1AZS B;  4OX9 J;  4K4W A;  2RUS A;  2KJV A;  2OAU A;  3HUL A;  3CJ5 A;  4MYU A;  1YRT A;  3ICL A;  4EU0 A;  3IBW A;  2IVM A;  4EEY A;  1TVR B;  1S9G A;  2JLF A;  1NK9 A;  3OW2 R;  1QAI A;  1XN9 A;  2XYP B;  4AL7 A;  2GML A;  3ENQ A;  1FKP A;  3M6W A;  1VQ6 S;  4ZS6 A;  1NK7 A;  5B0F A;  1RWU A;  4O44 B;  3VZH A;  3PX0 A;  2D1C A;  3SIP B;  4EYI B;  1SH0 A;  4HAC A;  2AEJ A;  3PYD A;  1S72 S;  4DN9 A;  2K3K A;  3GYG A;  2Y1L B;  3CE8 A;  1HR0 F;  1TFY A;  4FN5 A;  2V2Q A;  1TL1 B;  1HWI A;  3LP1 B;  1RT5 A;  3K5N A;  4WYW A;  4WPA A;  2QLX A;  4AUK A;  3DC2 A;  3MFH A;  4DR6 F;  1RK8 A;  1EIY B;  5CZV A;  4JI5 F;  2QZ8 A;  2IBO A;  3TRG A;  1TQL A;  1XMB A;  3G82 B;  1P6T A;  3TAP A;  3IG1 B;  2UXC F;  4MK8 A;  4LQ9 A;  1HHQ A;  2UU9 J;  3UW1 A;  3M7V A;  2BJ7 A;  2ASL A;  2HMI A;  3RB6 A;  1TKZ B;  1YK9 A;  3TZX A;  1SV5 B;  1S0O A;  3MI7 X;  2VA2 A;  1X4B A;  1CEZ A;  2WVE A;  1YIT S;  5DLF A;  3HHL A;  4MKA A;  1HWL A;  1IBL J;  4Y28 C;  3GFX A;  1YJV A;  4KC5 A;  2LQ9 A;  1VHI A;  3HSG A;  3R5B A;  3EVO A;  3OR2 A;  4RW6 A;  2FHJ D;  4NX9 A;  4DEZ A;  3UDL A;  2E1R A;  3BR9 A;  2E1C A;  2XEX A;  4KHR A;  1WG5 A;  3PZP A;  1HNX J;  1Q95 G;  2IPO B;  2CPJ A;  2FHK A;  2LQ8 A;  5GAE I;  3U02 A;  4ZJO A;  4UUW A;  3KNA A;  4G1Q A;  4ED2 A;  2HHW A;  1U6Z A;  1YGY A;  4AL5 A;  4Y2A A;  2ROP A;  5GMD A;  4ZIV A;  2KJW A;  1CC7 A;  4TQR A;  4I2P B;  3QIP B;  1DRZ A;  4JI4 F;  4UQG A;  3CJS A;  2AJF E;  1UFW A;  4V1A k;  1QTM A;  1WC0 A;  2YKO A;  3AT1 B;  1WKJ A;  2J9E A;  3QGG A;  3HX9 A;  2DR6 A;  2HK2 A;  3R5A A;  3RRK A;  4B3O B;  4F0H A;  1QE1 A;  2YNH B;  2LA6 A;  3RAQ A;  4DL2 A;  4ED5 A;  2UUT A;  1GX6 A;  4M5D A;  3GB0 A;  2HVD A;  3P4U B;  1VQS A;  2ZH4 A;  3K0J A;  5CH7 B;  1XNR J;  1ZM2 A;  2ZUA A;  1K1Q A;  4HKQ A;  2HBR B;  3RB4 A;  3H4B A;  1RXO B;  3DHW C;  5KT2 A;  4K2X A;  3US5 A;  4QIV A;  4ZPB A;  2NYH A;  1L3T A;  2V8P A;  2ZBC A;  2XC9 A;  2B0G A;  3R1L A;  2WB1 D;  5KFU A;  3ZZY A;  2FGC A;  1VOM A;  5IFM A;  1S1X B;  1FRM A;  1P1T A;  3GJT B;  1W2B R;  2BJD A;  3TOQ A;  2A0F B;  4C6A A;  1UWB B;  5KFH A;  2JL9 A;  2D69 A;  4KSE B;  4RBT A;  1VQ5 S;  5ETP A;  1VRQ C;  2QA2 A;  4PKD B;  1F9E B;  1H2V Z;  3KKF A;  2RB7 A;  2DO4 A;  4HDH A;  1S97 A;  4NYZ A;  1HNI B;  1PYS B;  3H2U B;  3MOZ A;  3H5X A;  3UVJ B;  1F1B B;  1F0X A;  3KDN A;  1QAX A;  2X1F A;  2EI5 A;  2LEA A;  4ZPV R;  3B54 A;  1KTQ A;  3VAL A;  3PG9 A;  3VGV A;  2GQC A;  3VR1 A;  1ICE B;  5AT1 B;  4CM0 A;  5IT4 A;  4F02 A;  2FVR A;  1WDD A;  1B70 B;  1OY6 A;  4BDP A;  3CF5 Q;  2XHW A;  1EHW A;  3LP0 B;  4A8S A;  2YWH A;  5HI7 A;  2X1G A;  4LIR A;  3DLG A;  2G13 A;  2AX0 A;  3PRB A;  1RA7 A;  3HZE A;  2OSQ A;  3NEK A;  3JB9 k;  3HHD A;  2W25 A;  2F3J A;  2XI3 A;  3BGO P;  1RKI A;  4DV6 J;  1TZ0 A;  3GV8 B;  2A3J A;  4LT6 A;  3L3C A;  3KLV A;  3LAL A;  4WYL A;  5IV4 A;  5LM7 E;  7AT1 B;  5D77 A;  1M1G A;  3ENV A;  3D67 A;  3IM8 A;  1DHM A;  3LP2 A;  1HI0 P;  3PR5 B;  4PZV A;  4J37 A;  4ZP9 A;  1C0T A;  4MT1 A;  4QYZ J;  4N7T A;  1NRK A;  5H9F K;  2FHM A;  1FNX H;  4WIQ A;  4OYI A;  3BV8 A;  1IQZ A;  1VQL S;  1RU1 A;  4USW A;  4Y65 A;  4RUC A;  2R2R A;  2AJ2 A;  3D2W A;  1WJ9 A;  4XIU A;  3KXD A;  5DG7 A;  2YVS A;  2VQF F;  4B3M F;  3GFY A;  2DIU A;  2FHO B;  2XZT B;  2ZBQ A;  3W5Y A;  2WW8 A;  1OQ3 A;  4HH1 A;  4J7C A;  1IBK J;  1T9V A;  4LVO P;  2XGP A;  4P52 A;  2P6S A;  1NBE B;  2PMW A;  4NL5 A;  1WC4 A;  4P2F A;  4G6V B;  3MEK A;  4UZC A;  2JOQ A;  1CVJ A;  5KFT A;  5E3R A;  1B7Y B;  1YX2 A;  1FX2 A;  3M2U B;  2V9W A;  1SJQ A;  3IXQ A;  4G1I A;  5IOL A;  4D3G A;  1L3V A;  4H4K C;  3LWL A;  1TEL A;  4FYX B;  1RTJ B;  3AD9 C;  2BDP A;  1S6O A;  3QAE A;  4IDK A;  1HIY A;  2CFX A;  1UVJ A;  1RLD A;  2L9D A;  3SSR A;  1HYS B;  2ZM6 J;  4OLO A;  1GAO A;  4ZKA A;  2AQ4 A;  1MWZ A;  4ZJL A;  4UY8 T;  4QR2 A;  4LBP A;  4OX6 A;  2V94 A;  3ISN D;  2XSJ B;  3FCH A;  2PA8 D;  1NJZ A;  5J2M B;  1HPZ A;  2R8G A;  2VH7 A;  1DAR A;  3EXC X;  4IQX A;  1UW4 A;  4LJM A;  2NXN A;  4WFN Q;  3L95 X;  4LRC A;  1FVQ A;  1NSK L;  5DZ7 A;  3ZZR A;  4CWB A;  1VJQ A;  3I32 A;  2MZJ A;  3S6E A;  2CNN B;  3R27 A;  3QNW B;  3MUT P;  1T95 A;  4RNO A;  2HND A;  2P9C A;  1QSS A;  1U2R A;  2HS3 A;  4X4U A;  5FJ4 A;  2Z2M A;  1SB6 A;  1FJG F;  1G4C A;  3A8K A;  5KFB A;  4CLW A;  2YQ0 A;  1BY9 A;  1FDN A;  1IN0 A;  3HM9 A;  5F8I A;  3MPD A;  5C2G A;  4DFK A;  4NCB A;  1N0U A;  3DYA B;  4Q2M A;  2GQQ A;  3ILO A;  2HG4 A;  4O4G B;  4IYQ A;  2R8I A;  1T0T V;  2V0N A;  5C42 A;  3JYT B;  1APS A;  3ET6 B;  3VAJ A;  4CTA A;  2EPI A;  3MM9 B;  1DTT A;  5LL6 d;  2MLZ A;  4F4A A;  4HH0 A;  3SCL E;  4OHZ A;  2KTQ A;  5HVH A;  4OJ1 A;  1ACM B;  1RTD A;  1QLN A;  4B3T F;  3QFW A;  1CJV A;  5SZT A;  1N5V A;  1TV6 B;  3PAC A;  3CUL A;  1X4D A;  4RW4 B;  3BGR B;  2IRX A;  1SQF A;  5L38 A;  2V68 A;  5EX0 A;  4X4N A;  3HPO A;  2YPZ A;  2P2C B;  5T7L B;  3BEG B;  4ZVG A;  1HQ2 A;  3K5M A;  2UUC J;  3FRY A;  4KKO B;  2VPX B;  4B17 A;  2GIF A;  1BLU A;  1MWQ A;  3PYF A;  1HQE B;  2O5D A;  2VQE F;  4BC9 A;  1I1G A;  1FEE A;  1T02 A;  3NBP A;  2E9R X;  4C4W A;  4TU7 A;  1D9F A;  1S59 A;  4JI1 F;  2PC6 A;  1X5T A;  2R2T A;  1Q0N A;  3E51 A;  3BB5 A;  3BSA A;  2HFU A;  2YWF A;  3DDK A;  4DX6 A;  2CVI A;  2L41 A;  3CJ8 A;  2HVH A;  3MR2 A;  1ZOT A;  2QLJ B;  4DZD A;  1H0H B;  3ZZZ A;  4CYU A;  1WWH A;  1Y5N B;  5GAD U;  3UNG C;  1J5E J;  4PQU B;  3AAW B;  2ZC4 A;  1T8E A;  4UY8 5;  3V6J A;  1K44 A;  2H51 B;  3DGV A;  5L8R C;  1UAW A;  3MZI A;  4TU9 A;  1BWV A;  2XZW A;  1E6V B;  1B99 A;  1LFP A;  4J91 A;  3GLJ A;  3W8G A;  1WOP A;  1YG0 A;  3HJF A;  1D9D A;  2HVZ A;  1TMJ A;  3MR3 A;  2J9C A;  5KG4 A;  2HRY A;  5DO2 A;  4DS4 A;  3KG1 A;  4LFC J;  1NPR A;  1Q5Y A;  4ZMM A;  2CZV C;  4QWA A;  2E5L F;  2K7J A;  4GO7 X;  5J2Q B;  5C24 B;  2LP4 A;  2JLG A;  2Z2Z A;  4WFZ A;  3M6U A;  1ZZF A;  4PG5 A;  2KXN B;  2GCF A;  2VUG A;  1ZBT A;  4EBC A;  1V3R A;  2O66 A;  3N9U C;  2CPD A;  2K1R A;  3NS6 A;  1HA1 A;  3CCT A;  3K2Y A;  3JSM A;  5K14 A;  4HTI A;  5FDL A;  5A8K B;  4YS2 A;  4NLU A;  4O0N A;  1OO0 B;  2NYI A;  1DLO B;  3DLH A;  2R2S A;  2A6M A;  1TR0 A;  2O01 C;  3ZFV A;  1Q7L B;  3HVA A;  4FPR A;  2DNH A;  2RJZ A;  2B9W A;  4WZM A;  1MG7 A;  5L1J A;  1XNQ J;  4I7F A;  4ILL A;  5KFV A;  1TTH B;  2IJN A;  2MPU A;  4KIA A;  4NLV A;  4NXN J;  3HVT B;  3TA0 A;  1H7X A;  3FDS A;  1QY7 A;  2POK A;  4A4J A;  2XYG B;  4CLP A;  1VIO A;  2V8H A;  2Q1L A;  1RWN B;  1M5V C;  4U96 A;  4TLQ A;  3C8Y A;  3OVA A;  5D0R A;  3PKM A;  4DBQ A;  3TQE A;  1F9F A;  4WP3 A;  3ZTO A;  4X84 A;  5EN1 A;  3T1A A;  4DL5 A;  1H74 A;  4CT9 A;  2DGO A;  1RCX B;  2JVO A;  1Z2L A;  4F4X A;  1X4E A;  2C28 A;  5K5M A;  2IDL A;  4KHP J;  4ZVE A;  1VLY A;  4I56 A;  4OHX A;  3WHI A;  5LXY A;  5F8H A;  4CM2 A;  4NI2 A;  3C19 A;  3NGS A;  2R7X A;  2LEP A;  3BKU A;  4C3M A;  3DOL B;  4GVB A;  4YB1 P;  4RU9 A;  2BR0 A;  1UZD A;  1PAU B;  1AFI A;  2MJU A;  2VJU A;  2XSF A;  3O6Q A;  2PEH A;  4KQZ A;  3M32 B;  2HSE B;  5K8N A;  3H4D A;  3ZZO A;  4L73 A;  5A6W A;  3SBM A;  4TY8 A;  1S9E B;  5B0A A;  3TAM A;  5D4O A;  3G6E S;  2ZNZ A;  4I4B A;  2R7R A;  3RBZ A;  2MQQ A;  5ETO A;  3PX6 A;  2MKK A;  2F8E X;  3PHT A;  3DLK A;  3V6D A;  3GP9 A;  4CLT A;  3THP A;  4Y34 A;  1UET A;  5AXN A;  1S1V A;  1RWX B;  1CS4 A;  2YKM B;  2UUA J;  3L09 A;  1MN7 A;  3BQ0 A;  4CNY A;  4ZHR B;  2JEG A;  3A8J A;  4WF9 Q;  3I0R A;  3O5T B;  1ZAW A;  1KP6 A;  4IUF A;  2BAC A;  4C11 A;  4QBU A;  3PFO A;  3D3B J;  2VG7 A;  3IGN A;  3RBX A;  5GMK a;  2ZH9 A;  1N56 A;  2DHH A;  3TNV A;  1EKR A;  2IAJ A;  4F3Q A;  1AYE A;  3C15 B;  5E3A A;  2UVR A;  2WRM A;  2IRY A;  2G1H A;  5M2P A;  3WC0 A;  4LFA F;  3M9O B;  2ZHA A;  2Z30 B;  2CG8 A;  3OXG A;  2EK1 A;  2NSB A;  4E8U A;  4DWI A;  1RAF B;  1VQK S;  2XY6 A;  1FWL A;  3DRP B;  3SI8 A;  3SV3 A;  5G0R B;  1L3K A;  3H2L A;  2ZFH A;  2FVQ A;  2F4V J;  3G6X A;  3FRZ A;  2YNI B;  4NA2 A;  4JYA J;  3DFE A;  1U02 A;  5KG2 A;  1HW9 A;  4LF5 J;  2BVZ A;  7FDR A;  4GC7 A;  3NLC A;  1HI1 A;  2V2Z A;  4A47 A;  2XMU A;  4JI3 F;  1GEH A;  5D15 A;  2H3E B;  2DO0 A;  1JJ2 R;  3GV5 B;  1SQE A;  4GKK J;  4FF1 A;  2HNZ B;  3I9V 9;  4GKJ F;  3ENA A;  5J1N A;  1S1U A;  4O4R A;  2Y0S D;  1N33 F;  1X4F A;  2F63 A;  2FB0 A;  3KLI B;  4MFB B;  3UD5 A;  2RF2 A;  1JLQ A;  2H65 B;  1IKW B;  2ZJR Q;  5KG5 A;  1T03 A;  3DN9 A;  3OT9 A;  5KFQ A;  4HI2 A;  3W60 A;  1ZM9 A;  2B8P A;  2KFY A;  4NOH A;  1QUP A;  1AZS A;  1CQN A;  3C14 B;  3CD5 A;  2XWY A;  3HO1 A;  2CJY B;  5DG8 A;  4DS5 A;  4L75 A;  1OWX A;  2YX7 A;  2AHO B;  1HNV B;  4BC7 A;  4NYO A;  2CUY A;  1TVR A;  2L3M A;  3OFE A;  2M2B A;  3OTO J;  2VG5 B;  2ZH8 A;  1FKO A;  2CPZ A;  1VBZ A;  1WKL A;  4O44 A;  2ZOM A;  3G8S A;  3HD1 A;  3H98 A;  2MY7 A;  2CAD A;  3KUH A;  1IUJ A;  3GR0 A;  1RTI B;  2DNK A;  5FII A;  3THV A;  1SL0 A;  2DRB A;  1ULR A;  4YB7 A;  1CC8 A;  3RW6 A;  3DLJ A;  2B9Y A;  1J2V A;  1NM2 A;  2QL5 B;  3H8Y A;  5E0O A;  2G2O A;  3H0P A;  3D0I E;  4K5S A;  4B3S J;  4DV2 F;  4A8F A;  3LP1 A;  2C3Y A;  3HXM A;  2OPQ B;  3RZA A;  3FZ2 A;  2ZE2 B;  1GTH A;  3PJX A;  3UE2 A;  4DV7 J;  5CAA A;  2Y1R I;  1ZM4 A;  3D54 A;  5B08 A;  3HKW A;  4WII A;  5B7W A;  1FKA F;  3VVU A;  3CJQ A;  2CQP A;  1PIL A;  5CYJ A;  1JMT A;  2AD9 A;  3X3U A;  4C8K A;  1SL2 A;  1UEK A;  3QPI A;  2PFD A;  4RNM A;  1RAE B;  1BD6 A;  3KJV B;  3IRX B;  2EKY A;  5KT3 A;  4Z7Y A;  4OYP A;  3L9Z A;  3TR5 A;  2XCP A;  2HQF A;  1TKZ A;  1OQ6 A;  4QIE A;  1SV5 A;  2B3T B;  3M8R A;  4JB8 B;  3CCZ A;  3DKD A;  2P6T A;  1FNO A;  3ISN C;  4XDD A;  3M4X A;  4CO3 A;  4WFB Q;  4OL8 A;  2KT2 A;  3N79 A;  1KQS R;  3D66 A;  4ED6 A;  5BJR A;  3M8Z A;  3EDQ B;  2C3U A;  2XNQ A;  1SC4 B;  4WXO A;  3MFI A;  1VDH A;  1P9Q C;  1YJ9 S;  1LV5 A;  1M5S A;  2MSS A;  3D1H A;  4TN2 A;  1OIA A;  5I4M A;  4S0M A;  1YBU A;  1LWC A;  4DL7 A;  1VQ4 S;  4I2P A;  3QIP A;  2DR9 A;  1IKY B;  2Z4P A;  4CH1 A;  2B4V A;  3AH6 A;  5DGA A;  3O44 A;  2XQC A;  1VQM S;  3DMJ B;  3W61 A;  2OEJ A;  2XMK A;  4B3O A;  5LMU J;  3KUG A;  3JAM U;  2YNH A;  3CO9 A;  3BO3 A;  2CQ1 A;  3O8W A;  4ZDN A;  2CNK B;  3LH2 S;  5L9X A;  4F2R A;  3WDO A;  4LSN B;  2QRR A;  3QWU A;  5LSO A;  3T1H F;  1UVL A;  2UP1 A;  3WX8 A;  1SJF A;  3F44 A;  2RSQ A;  1U1Q A;  2CQH A;  1HBU B;  4ZLL A;  2E5H A;  1UEU A;  4ELV A;  1VQ7 S;  3C16 B;  2ATL A;  1HQU A;  3JSR A;  1OSD A;  1MU2 B;  1UPP A;  1S76 D;  1TAQ A;  2OFG X;  1VIS A;  1S1X A;  3H5U A;  3HCX A;  2RDI A;  1HNW J;  3ILL A;  3IR5 B;  4AE5 A;  1SL1 A;  1SH2 A;  4IRC A;  1XMQ J;  2L9N A;  1UWB A;  4DOZ A;  2HS0 A;  2XNR A;  2K06 A;  1B7F A;  4M8L A;  3IR7 B;  2LYV A;  4RPF A;  2X3G A;  1GXU A;  3KK3 B;  4RW7 B;  2QYG A;  5KT7 A;  4DR2 F;  4N8N A;  2DNG A;  3IGV A;  2LQ5 A;  4H4K A;  1NK8 A;  3IBC B;  1K1S A;  3PX4 A;  3JQJ A;  4ELT A;  2BUN A;  1HNI A;  2ZZT A;  3PY8 A;  2QA4 G;  3UVJ A;  1SKW A;  2LQJ A;  1LW0 B;  1N4L A;  3MUM P;  2V67 A;  1IBM J;  2GMH A;  1OSC A;  5THW A;  3UCG A;  3VF0 B;  1KC8 T;  1YJR A;  1HD1 A;  1Y10 A;  3G4S S;  3A13 A;  5ETS A;  2CQG A;  1RUS A;  3EX7 B;  1SBR A;  3C2P A;  3UN5 A;  3DRY A;  1KFD A;  4K4S A;  4F25 A;  3W3S A;  4IRD A;  3LP0 A;  2HBZ B;  4OJ3 A;  5IZH A;  3KWM A;  4YUD A;  4F67 A;  4CH7 A;  3UD4 P;  2FLP A;  1QSY A;  1YHQ S;  2BM0 A;  1MMN A;  3UWT A;  1Q81 T;  3MXH P;  2C3M A;  1QJH A;  1X7V A;  4UZB A;  1N52 B;  5DM7 Q;  3RB0 A;  4CO1 A;  4O3N A;  2V8D A;  2PD1 A;  3I0S B;  1IR0 A;  4LF6 F;  4ZIW A;  1NK6 A;  2XMV A;  3UR0 A;  5KFO A;  5B0D A;  1FF2 A;  4OI0 A;  2IM2 A;  2B51 A;  5DS7 A;  2PMZ D;  2W9B B;  1B64 A;  5A6P A;  4OYX A;  1KFS A;  2CQC A;  5DET A;  1YBT A;  1U09 A;  4DR3 J;  1U1M A;  1WF0 A;  3W2W B;  2V4J B;  1U0H B;  3EYZ A;  1I51 B;  3VHQ A;  4IFY B;  2HWH A;  5L46 A;  4F4Z A;  1HW8 A;  5E7O B;  1SJ3 P;  3N6N A;  1WSR A;  1YJ7 A;  4OYB A;  2BQ3 A;  4XTT A;  4PPD A;  1XIQ A;  1Y5I B;  2HFO A;  1K8A T;  2IVY A;  3M2U A;  4YN3 B;  1HKA A;  4B9S A;  2G2Z A;  1F60 B;  2OML A;  3D1Q A;  2HK3 A;  1IVZ A;  4DV4 J;  3THT A;  1YJT A;  2AV5 A;  1B0T A;  3H7H B;  4ZA1 A;  5KFX A;  2FJX A;  2R8J A;  1HYS A;  3I5A A;  3PW0 A;  4W4M A;  4FYW B;  2H9Z A;  2V63 A;  3KJQ B;  3W9I A;  2RUG A;  4RUB A;  2MKH A;  2XSJ A;  3EGV A;  3PKY A;  5J2M A;  4J9N A;  3KG4 A;  3D1O A;  4PWU A;  4IOA Q;  4M5I A;  1Q79 A;  1HR0 J;  2VFS A;  1ZH5 A;  1VK8 A;  3FQL A;  2RVJ A;  1N5S A;  2BKP A;  3W9J A;  1TL5 A;  1U8S A;  1Z2Z A;  3OJS A;  1EB0 A;  2KVQ E;  1ITP A;  4JI5 J;  5DLG A;  2DR5 A;  3TEH B;  4YFU A;  1RT3 B;  2LXF A;  3CCR S;  2ZEJ A;  1F6T A;  4JV5 J;  4Q44 A;  1C1B A;  3AQP A;  3CCM S;  3M2V B;  4TU8 A;  3K17 A;  4WWS A;  4ECW A;  1Y3J A;  3DRX A;  2DEJ A;  3AFG A;  3DYA A;  2VA3 A;  3VQT A;  4KGV B;  1Q8K A;  2MZT A;  4CLZ A;  2CQ4 A;  2E7W A;  4O4G A;  3JYT A;  2QMU B;  3R7S B;  1A7G E;  3ET6 A;  4NMX A;  3MM9 A;  1S0V A;  5BXI A;  2AT1 B;  1N36 F;  1NB7 A;  1S6U A;  2PEB A;  2VG6 B;  2B5J B;  3LPY A;  1VFJ A;  2E5G A;  5HAT A;  1TV6 A;  3S7R A;  1YVF A;  1VC0 A;  4MTP A;  4U67 Q;  4RW4 A;  2A2C A;  3TWZ A;  3BGR A;  1WKK A;  2IC3 B;  3M6V A;  2ERR A;  2YNG B;  1Y3K A;  4NML A;  3QT6 A;  4L3K A;  5T7L A;  3GQC A;  1GXL A;  3EZO A;  5L1I A;  5CCM A;  4DX5 A;  1WC5 A;  4AQY F;  1SXL A;  3SSQ A;  4DZ6 A;  1HQE A;  3KHR A;  2GA7 A;  3ISZ A;  1FHT A;  3D4J A;  1X8D A;  2AYM A;  4DV5 F;  1AUD A;  3E3X A;  2W2P P;  1PJ6 A;  3I82 A;  4Y2M A;  1A9N B;  1RT2 B;  4JI4 J;  2JNJ A;  3EIC A;  1TKT B;  1UW9 A;  4LFB F;  5L1L A;  4UW2 A;  5KFF A;  1NND A;  5GAD I;  3OTD A;  4YP3 A;  1X0P A;  1WOS A;  1KLM B;  3BGL A;  3DLG B;  4A8W A;  2ALY B;  2OIH A;  3BH7 B;  4JI0 F;  2C42 A;  1ZM3 A;  1H7W A;  6AT1 B;  4R0E A;  4UT4 A;  2N82 B;  3UR3 C;  4PQU A;  3PM9 A;  4HL9 A;  4URG A;  3AB4 B;  2XS5 A;  4NLS A;  1E6V A;  2WON B;  1G2E A;  1H3D A;  4J9P A;  2X1A A;  2W01 A;  1TUW A;  3FEZ A;  5ETR A;  2FY1 A;  3QRP A;  1R0A A;  3KLH A;  3KDO A;  2NS1 B;  2DK2 A;  3UN2 A;  1F5A A;  1U2F A;  2HGM A;  2E5J A;  1HNZ F;  2NCK L;  2DB1 A;  4EYH B;  5J2Q A;  1QM9 A;  3DLE B;  5C24 A;  2DYA A;  4PG4 A;  2HQC A;  4Y2K A;  1N34 F;  2MKS A;  3MAQ A;  1SC3 B;  3QLH B;  3S01 A;  3JTP A;  2EW9 A;  1RAI B;  3QRR A;  2FHJ A;  3VZI A;  2PDA A;  1NJW A;  3NMA A;  1WEY A;  3GIK A;  3RB3 A;  2B7B B;  1PIE A;  4OI1 A;  2CVE A;  4WE1 B;  1N0V C;  4F26 A;  2CJK A;  1PJ7 A;  4DPU A;  1ZAX A;  2CRL A;  5KFK A;  3M05 A;  4WU2 A;  1F5B A;  5MAO A;  3QT7 A;  5A8K A;  2PFF B;  1NB2 A;  4UST A;  3J7A N;  1DLO A;  1SKR A;  1QSL A;  3EWG A;  1M1H A;  5U47 A;  2QMW A;  5IV3 A;  1NU4 A;  3FC9 A;  3CCQ S;  1QVG R;  1WG4 A;  4ETZ A;  2CQ2 A;  4K0K F;  2KM8 B;  3IS9 A;  2DKO B;  4ECX A;  4Y00 A;  1MW7 A;  1SI9 A;  2MQM A;  2I8E A;  1ROF A;  4FBT A;  4M5G A;  1S12 A;  3TA1 A;  1KNZ A;  4CO5 A;  2ADB A;  3ZNJ 1;  2HAF A;  4OQJ A;  3HVT A;  4I0W A;  4LF4 F;  1N5T A;  4CLS A;  4Z2X A;  2BQU A;  1RWW B;  2GVD B;  1CSJ A;  1QTN B;  3NWG A;  2YWW A;  2ZUG A;  3GIM A;  1R8B A;  4EBE A;  4Q7A A;  5HRO B;  2B8Q A;  1EZZ B;  3RG6 A;  1KKH A;  1V6H A;  2LU1 A;  4NLD A;  1NPP A;  3J80 U;  3R9L A;  3RTV A;  2E7V A;  4OX9 F;  1I5O B;  5AE1 A;  2B56 A;  3MM8 B;  1FFG B;  3MEC B;  2QA1 A;  4QR1 A;  2IM3 A;  2VQF J;  3ULH A;  4B3M J;  3GG1 A;  5ITH A;  4F0K A;  2Q43 A;  2CQI A;  2E7X A;  1WHX A;  2UVW A;  1N5Q A;  5K8M A;  5E5N A;  4NYP A;  1UEV A;  2V2V A;  2DH9 A;  5MLC V;  4EO8 A;  3KHL A;  3HD2 A;  1S77 D;  4IRK A;  1DY3 A;  3OTE A;  3DOL A;  5LT5 A;  2JEF A;  4ZVQ B;  1RA6 A;  2F8M A;  3M32 A;  2V34 A;  3CJ3 A;  4TXS A;  2DNO A;  3R5C A;  2Z2Y B;  3NGT A;  1S9E A;  2IY5 B;  3TUP A;  1U6B A;  5KG6 A;  3PRV A;  1T7P A;  2HYI B;  4YME A;  1T05 B;  3ZTS A;  4WFA Q;  1VLO A;  5E3C A;  4EO6 A;  4Q5V A;  2GIQ A;  3ILI A;  3OHB A;  4DLE A;  4F3O A;  5KAK A;  4DV1 F;  5IS2 A;  1Y0H A;  2Y8W A;  3L4B C;  3NBP B;  3K59 A;  2YKM A;  4M5H A;  3CCE S;  4PUO B;  3S8S A;  1ZA1 B;  3G6V A;  2KFZ A;  2IMW P;  4ZHR A;  1Q78 A;  1JQG A;  3QYY A;  1OYE A;  3IM9 A;  1TAU A;  1R0B G;  3UDE A;  2KM8 C;  1R31 A;  3DGP B;  3B78 A;  2KT5 A;  3Q24 A;  3X1L B;  4NEZ A;  6FD1 A;  3LF0 A;  1Q16 B;  1FJG J;  3C15 A;  3KK2 A;  1RAD B;  3AJ2 A;  3QSI A;  5LSL A;  5F8G A;  4IR1 A;  4OHV A;  1IBL F;  3NKY A;  4J9L A;  1HI8 A;  2RU3 A;  4JI2 J;  3DRP A;  1HAR A;  5G0R A;  2U1A A;  2YNI A;  3UDV A;  2MQN A;  2VC1 A;  4B3T J;  1S57 A;  4MAK A;  3M9N B;  1HNX F;  1FJE B;  2G4B A;  4U6P A;  4B3R J;  3MR6 A;  2KG1 A;  4IOC Q;  4F8R A;  2QG9 B;  2V6A A;  4FDF A;  2WSE C;  3OUY B;  2HHH J;  2DT9 A;  2YXL A;  4OYW A;  1D1U A;  3KLI A;  4MFB A;  2K1R B;  2J0W A;  4NLG A;  1FRX A;  5CHC B;  1IKW A;  2ZBP A;  2HGN A;  2VQE J;  1FT8 A;  3JSM B;  2RE1 A;  3KUE A;  1WHY A;  2GVZ B;  4Q8F A;  3DXB A;  2XTJ P;  3VAK A;  2E1M C;  2WTF A;  4JI1 J;  5DDP C;  5B09 A;  3C14 A;  3ENW A;  5KT6 A;  3J81 j;  3HP6 A;  3UPF A;  2M0G B;  2AWZ A;  1HNV A;  4U95 A;  1EAR A;  4NWB A;  3VVT A;  3ADA C;  2BW7 A;  2JZ5 A;  4RX6 A;  4LF9 F;  2AEF A;  2ZBR A;  5KOX A;  2VG5 A;  2C2O B;  2MDA A;  3IO1 A;  3MPV A;  4L6V 3;  1TL3 B;  1T9U A;  2O1P A;  2E44 A;  2M88 A;  2ZH7 A;  2AGO A;  1MSW D;  4MKV A;  2HQI A;  3RYL A;  1RTI A;  2OH2 A;  2XWX A;  2ASY A;  3O3L A;  1S1T B;  1QDU B;  2W2N P;  1J5O B;  2HRT A;  3PIP Q;  1ZA2 B;  5IM0 B;  2LMI A;  3I4P A;  3CJK B;  5HQL A;  3A3N B;  3W62 A;  2DHA A;  3NGU A;  4NEY A;  2N3O A;  1F3V A;  3A4T A;  2GFF A;  1WUU A;  4C9D A;  3NL0 A;  1E6Y B;  5DGB A;  2OPQ A;  1G7C B;  3W9H A;  2ZE2 A;  2OTL S;  4RBV A;  2R42 A;  2QC3 A;  3QAT A;  4K2J A;  3PNI A;  3G6Y A;  1U1P A;  1KDN A;  1RAH B;  2W9C B;  3VAH A;  4ZLN A;  1YDL A;  4H4M B;  2XB2 D;  5I3Q A;  4C8N A;  2F5G A;  3FVY A;  4MYT A;  4QOT A;  2EEY A;  1RBO B;  2IVF B;  4PR6 A;  2OKQ A;  2GHV C;  3EPG A;  4WZQ A;  3KJV A;  3IRX A;  2D74 B;  3R7N B;  3PTW A;  2DEI A;  3ZTP A;  5DG9 A;  1T3N A;  1R6V A;  2WBR A;  2JC0 A;  3CT9 A;  3I96 A;  4LRF A;  2MGZ B;  2B4O A;  3Q2S C;  3G86 A;  2V9K A;  1UTA A;  2W2M P;  1KLN A;  2FD2 A;  2FZK B;  3CIM A;  5JVH Q;  4JV1 A;  4X4T A;  5L39 A;  1GMU A;  2H5I B;  4DSF A;  5KFZ A;  4KY3 A;  3V6D B;  2AX1 A;  2HIQ A;  4LBI A;  2G9O A;  4QPT A;  4L72 B;  4O3R A;  3RR8 A;  4UOG A;  4YDD B;  3FBE A;  5DRK A;  2GW8 A;  3ZZ0 A;  3BZQ A;  1IBK F;  1PYT A;  4LF7 J;  3BH6 B;  3M30 B;  4K4V A;  2LA4 A;  1IKY A;  5M2R A;  3KLE B;  4DXL A;  4U8V A;  2GAG C;  3DMJ A;  2IAJ B;  2MST A;  5I3U B;  1HHT P;  4LF1 A;  2CG4 A;  1PAE X;  3EGW B;  2FZG B;  4V19 X;  4ZVR B;  2H4Y B;  2K8G A;  4LSN A;  3M2R B;  2QIF A;  3GSD A;  2MJN A;  2VFT A;  2GX8 A;  4I6Y A;  3IRW P;  5ETV A;  1ZTW A;  1HBU A;  4CO4 A;  2NXC A;  1GTE A;  3PW2 A;  3C16 A;  4ZVS B;  4ATN A;  1N32 F;  1MU2 A;  4DPW A;  3POT B;  3Q8S B;  3J81 U;  4CT8 A;  1FX4 A;  4OYZ A;  4DQR A;  2MZ1 A;  1SKU B;  5K8O A;  3ZZU A;  2KXF A;  1LNQ A;  1KEK A;  2CPY A;  3SMZ A;  2BEF A;  1NLK L;  4DR5 F;  2Q6B A;  2F9J A;  1SUQ B;  1WI6 A;  2CJQ A;  2DHS A;  2ZWP A;  3KK3 A;  1QD1 A;  4RW7 A;  2BA9 A;  4YY3 J;  2RDJ A;  2DGS A;  4ZP6 A;  1UJ5 A;  1YJN S;  2AZ1 A;  4CNZ A;  5G4D A;  3FNN A;  3MM5 B;  3RAX A;  4ZPW R;  3RJM B;  8ATC B;  5KG7 A;  1LW0 A;  2YKQ A;  2JH3 A;  3H59 A;  4ID5 B;  1S6Q B;  5JXS A;  2LEC A;  4KPC A;  4ED1 A;  2ZH5 A;  1U8W A;  1WF1 A;  4ZCL A;  3BR8 A;  1I3O B;  3DRS B;  1RBL A;  2PT0 A;  2WZ1 A;  1U4B A;  1FKO B;  4PG6 A;  3H40 A;  2PMH A;  3LWM A;  3UCU P;  3ITH B;  4LFA J;  2XHC A;  3QGI A;  1RT7 B;  4DR4 F;  4DUY F;  2NLW A;  2NPF A;  3R6L B;  1PC4 A;  2KT3 A;  3MEE B;  4A8O A;  1KOO A;  4USJ C;  2UUC F;  1FES A;  4KJI A;  1FE0 A;  2AMC B;  3Q8V A;  3I0S A;  4JI3 J;  4V19 J;  4F4W A;  4J9O A;  1T94 A;  1FER A;  4FF3 A;  4DF8 A;  4WK3 A;  3UFC X;  3PXG a;  1T9T A;  2RRB A;  5SUH A;  3J7Y I;  1NEE A;  4LUB A;  2DRD A;  1NZA A;  2W9B A;  3G8Q A;  4J9S A;  4KGK A;  2XMT A;  3AOA A;  1K0V A;  1FTR A;  3VAI A;  3V6H A;  2W8L A;  3W2W A;  2V4J A;  1U0H A;  5AXM A;  3VCD A;  4DFJ A;  3FMB A;  4A8K A;  4IFY A;  4ED3 A;  3R8Y A;  2VOD A;  4PAA A;  4N41 A;  1J5E F;  4WFX A;  1JJH A;  3IAM 9;  3HLU A;  3GPA A;  2KZM A;  4RLE A;  2XO6 A;  4CO0 A;  2VBW A;  4PXE A;  3IWL A;  2OEK A;  2JLE A;  3QO9 B;  2FLO A;  4JI8 J;  3CTR A;  4HEA 9;  3NMR A;  5J2P B;  1KS2 A;  4LBH A;  5EWG A;  3NXZ A;  4EZ9 A;  4NXM F;  3MAA B;  3BSN A;  1SCJ B;  2F9D A;  2GV1 A;  2R7T A;  3BBB A;  4MIA A;  4ZP8 A;  1U1N A;  2OPP B;  3CED A;  2DY1 A;  3BO2 A;  2XLI A;  3RUB L;  1S1W B;  4I67 A;  1XQI A;  2IBK A;  3JAM Y;  3PFE A;  2W7O A;  5D4N A;  5JUM A;  2WVF A;  4XPC A;  2MZS A;  2K2P A;  4ANE A;  3SCK E;  4X4S A;  3U1M A;  1LWC B;  3FZB A;  3OXL A;  4XDC A;  4ZJQ A;  3PW7 A;  3DOK B;  5DQH A;  2EFP A;  2CWX A;  1RZM A;  5IT9 Y;  3TO8 A;  1N88 A;  2DNQ A;  1LWE B;  1C0U B;  1VCT A;  3T1Y J;  3OQ2 A;  3TVY A;  3PR4 A;  1H38 A;  2PN6 A;  1RT3 A;  4YR3 A;  1RT4 B;  2WSF C;  9ATC B;  1FWK A;  1U49 A;  3TVZ A;  4ZVO B;  4ED0 A;  3M2V A;  2BE9 B;  5LSR A;  4ILM A;  3R97 A;  3PW4 A;  3KOA A;  4BHQ A;  1HQU B;  4CLY A;  1NXI A;  4KTQ A;  2RQ4 A;  5B0E A;  5BYR A;  3GSI A;  5H9F J;  2MZQ A;  2B7C B;  2APO A;  3HZG A;  5CZX A;  3NS7 B;  2VG6 A;  2HBQ B;  2B5J A;  4NXN F;  2JC1 A;  1MRO B;  4IKA A;  4DMZ A;  2ZH1 A;  2IC3 A;  3W63 A;  2FYX A;  1FWP A;  1F5C A;  3GR1 A;  2YNG A;  2F40 A;  2YX4 A;  3PDN A;  1N54 B;  2FJW A;  1OPZ A;  5CD4 A;  4QR0 A;  2Q6C A;  2DXE A;  3MD3 A;  1G6B A;  1SPB P;  4IG0 B;  3KMQ A;  1MNE A;  1C1C B;  3TEG A;  1RAC B;  2VD3 A;  2ZVI A;  4OZN A;  4P2M A;  3BGF A;  4HT7 A;  3KJF B;  3W2V A;  3I55 S;  1WEL A;  3AD7 C;  1RT2 A;  3QZ7 A;  4OHW A;  1TKT A;  5K20 B;  1SJ4 P;  4NRT A;  4WKR A;  2F1F A;  3GON A;  4LRA A;  3TUI C;  1KLM A;  3A8I A;  1NZ8 A;  2ZD1 B;  3TZZ A;  3L7U A;  1K9M T;  2AJ1 A;  1KN6 A;  4B9L A;  4RJV A;  5RUB A;  4IQM A;  3BGU A;  3KNG A;  2W2O P;  5F0W A;  1NHK L;  2UXB J;  3TA2 A;  2RIL A;  4P72 A;  1BWE A;  2MHN A;  4PG8 A;  2C22 A;  1UPM B;  4DV3 F;  2WON A;  4A48 A;  4QIW D;  2DPJ A;  1CPZ A;  1FI4 A;  2M70 A;  1UCN A;  2HUR A;  1HL6 A;  3JSY A;  4A46 A;  3AB2 B;  2N4D A;  3FEY B;  1RTH B;  2ZWO A;  5HVF A;  4LMZ A;  2XM3 A;  1WDT A;  5JJB A;  1KRP A;  1K47 A;  3SQO P;  2HWT A;  1NPK A;  5C5J A;  1RT6 B;  3MPW A;  2Z0G A;  3TAR A;  3DLE A;  4MK9 A;  3MM7 B;  5HQ8 A;  3TYT A;  4OZ3 A;  2L08 A;  3LOU A;  3N4W A;  4DR2 J;  3QLH A;  1RHR B;  2QSF A;  4E0D A;  1HBN B;  3CSK A;  5LOQ A;  1GMW A;  4ZCI A;  5KFW A;  5D0H A;  2Y9H A;  3GG0 A;  2YPY A;  4WE1 A;  1DUR A;  2M9K A;  2PA3 A;  3PYG A;  5GAG I;  2D41 A;  4GVL A;  2KZZ A;  4DFP A;  4W92 B;  4RWW A;  4QWE A;  5KTQ A;  1VR6 A;  3AOC A;  3ONQ A;  3GFZ A;  1R7I A;  2AEM A;  2JDJ A;  3MMC B;  2QN6 B;  4ZPA A;  4DCP B;  2F4V F;  1OY8 A;  1X5P A;  1NK5 A;  5DZ6 A;  4LF5 F;  1Q7Y T;  3LUY A;  5KG3 A;  3DNC A;  2MKJ A;  3CCS S;  3HDS A;  2WVB A;  4B9T A;  3GIL A;  2ZOF A;  4TYA A;  3I4H X;  4ED7 A;  2DNN A;  4QPX A;  1GX5 A;  3MPU B;  1WOO A;  2RD5 C;  3HVR A;  1RCO B;  4PEO A;  4QCL A;  2FJD B;  5KG1 A;  2VFU A;  4DPO A;  2PI4 A;  5EGY A;  2M5Y A;  4B9U A;  1VQ8 S;  2GVD A;  3MMJ A;  2DGT A;  3AJ1 A;  4LF6 J;  1LWX A;  4CLL A;  3BQ2 A;  3TI0 A;  2BE2 B;  5HRO A;  1IJE B;  1VJW A;  2R7Q A;  5C2C A;  1YZ6 A;  1H2U X;  1Q1K A;  4FF4 A;  3FBC A;  2OPR B;  1JLF B;  1BQM B;  3MM8 A;  4XAK A;  3MEC A;  3JXO A;  1U1R A;  1AA1 B;  5HP1 B;  2AGQ A;  3MMB B;  1C1B B;  2IFX A;  2DD8 S;  1Y5L B;  1CG2 A;  1Y11 A;  4A8M P;  1S9F A;  1NDK A;  3I6P A;  2MXY A;  4K4T A;  4XO0 A;  1RGV A;  4OI4 A;  5HAN A;  4NCG B;  4J9K A;  4LSL B;  4X65 F;  2KFN A;  2DCU B;  5D0E A;  3WBZ A;  2GO8 A;  4DPT A;  3K89 A;  3BKF A;  2VON A;  4DR1 J;  1QAJ A;  4CRJ A;  3PRD A;  3QWP A;  3PJW A;  1W25 A;  2V8V A;  2BJ1 A;  5D8H B;  3U7J A;  5F8L A;  2NZ4 A;  3W5X A;  1VQN S;  5D6G A;  1KSP A;  1T05 A;  1U45 A;  3T5H A;  1Y9O A;  2RKI B;  2IYI A;  2ALZ A;  4C3L A;  3RGI A;  3ETO A;  1AFJ A;  3G96 A;  1TKX B;  2VPZ B;  2B4P A;  2OUG A;  3KJN B;  4AXJ A;  4PUO A;  4FVC A;  2MLY A;  1X4H A;  3ZXW A;  4OI2 A;  2J6U A;  5F8M A;  1UVK A;  4DL3 A;  3PV8 A;  4N5S A;  3CCW A;  1VS3 A;  4IG3 A;  3KHG A;  1U48 A;  2KXH A;  2CPF A;  3M1V B;  3OSN A;  1UJ6 A;  2E9T A;  3M8P B;  3DGP A;  5KFM A;  5DDR C;  3R2D J;  5GVQ A;  1PCA A;  3CVK A;  3BDP A;  2MKC A;  4DQS A;  5GME A;  3GII A;  5ETK A;  3FSI A;  3D6T B;  2HNY B;  4BBY A;  4WBF A;  2AYB A;  3HT0 A;  3CPW R;  2HGL A;  3OFH A;  1R0A B;  3KLH B;  1N36 J;  3ZO7 A;  4CCH A;  3RR7 A;  1S4E A;  2C2D A;  5ETQ A;  1FDD A;  4X66 F;  2D7S A;  1RAG B;  4KV8 B;  3CCU S;  4RU2 A;  3H2V E;  3VV2 B;  1RU2 A;  4X62 F;  3FJ2 A;  3OUY A;  3MCO A;  1R8C A;  2NXU A;  3C6U B;  3UDC A;  4M5M A;  4E98 A;  1DBD A;  4J90 A;  4RW8 B;  3HKZ D;  1RI7 A;  1KQK A;  1FFW B;  2RNE A;  3SEO A;  2DGV A;  3GYX B;  3QJJ A;  1WF2 A;  2CPE A;  3EUN A;  4FXW A;  2D3O 1;  4KRW A;  2ROE A;  4ALZ A;  2GVZ A;  3K57 A;  1KD1 T;  5FLX U;  4DV5 J;  1HWJ A;  3UCZ P;  4NCA A;  2HQG A;  3IBF B;  2P8I A;  1WTF A;  1S0N A;  2N7C A;  1X9M A;  2BJ9 A;  1RLC L;  1JLG B;  4H54 A;  3MEG B;  2HHQ A;  1DQ8 A;  2KI2 A;  2FC8 A;  4OV1 A;  4UOC A;  2M52 A;  1NME B;  4WU3 A;  4P73 A;  2F4F A;  4DDF A;  1HLW A;  4NA3 A;  3DCA A;  2AYG A;  2DNP A;  3V4I A;  1HNW F;  4LR9 A;  4ZLP A;  2QJ3 A;  3IS9 B;  1N6Q B;  1TL3 A;  2OEL A;  3EMT A;  4KAI A;  2N7Y A;  2I2Y A;  5A8W B;  1RAA B;  1JNZ B;  2J7U A;  3CJ2 A;  2RHS B;  1AUS L;  3J80 Y;  3QT5 A;  2R7W A;  2QLB B;  2EFN A;  3BSC A;  3CNQ P;  1UL3 A;  1S1T A;  3KMS A;  2VZ9 A;  1J5O A;  2XS2 A;  3TZW A;  1RHJ B;  5IM0 A;  2EWH A;  3CJK A; 
#chains in the Genus database with same CATH homology
 3P5B P;  1SPB P;  3VHQ A;  2Z56 B;  4NMX A;  2W2P P;  3SQO P;  4OV6 A;  3GCX P;  4NE9 C;  2Z2Z A;  3BPS P;  4YN3 B;  2Z2Y B;  2W2O P;  3A3N B;  3WIU A;  3CNQ P;  2W2M P;  3AFG A;  3H42 A;  2W2Q P;  3A3P B;  2ZWP A;  3WIV A;  3CO0 P;  2Z58 B;  2ZWO A;  3GCW P;  1V5I B;  4JP8 A;  2QTW A;  1ITP A;  3T41 A;  3WHI A;  3QFH A;  2PMW A;  3VV2 B;  2Z57 B;  2W2N P;  2Z30 B;  1SCJ B;  2E1P A;  2XTJ P;  4K8R A;  1R6V A;  3BGO P;  3A3O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...