3CNQP

Prosubtilisin substrate complex of subtilisin subt_bacam
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
71
structure length
71
Chain Sequence
EKKYIVGFKQGFKSCAKKEDVISEKGGKLQKCFKYVDAASATLNEKAVEELKKDPSVAYVEEDKLYRALSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Subtilisin BPN'
publication title Engineering substrate preference in subtilisin: structural and kinetic analysis of a specificity mutant.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 17
structure length 71
sequence length 71
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2008-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3cnqP00
1SPBP 1R6VA 3AFGA 3SQOP 4K8RA 1V5IB 4YN3B 3BPSP 3P5BP 3QFHA 1SCJB 2ZWOA 3GCXP 2E1PA 2Z2ZA 3A3PB 2XTJP 2Z2YB 2Z57B 3GCWP 2W2OP 2PMWA 4NMXA 3CO0P 2W2NP 1ITPA 2Z30B 3A3OB 3BGOP 3WHIA 2ZWPA 3VHQA 4NE9C 2Z56B 4OV6A 3VV2B 3WIUA 3WIVA 2W2PP 4JP8A 3A3NB 2W2QP 3H42A 3CNQP 3T41A 2QTWA 2W2MP 2Z58B
chains in the Genus database with same CATH superfamily
1HMVB 1XERA 2PA3A 2CWXA 3MM8A 5J2PA 1XEZA 2Z57B 3G86A 4X64F 2JC1A 4NE9C 4EK2A 5GMDA 1ELOA 3HDSA 1TL3A 4KH1B 3FQLA 1FXRA 1PBUA 3B54A 2CADA 2VG7B 1IBLF 4JV0A 1AB8A 1KHWA 1YLXA 5D6GA 1LWFB 2A0FB 1RAFB 1YBUA 3PJXA 4M5KA 4NXMF 3PIOQ 4RW4B 1WACA 2KRRA 5AE2A 4LF4F 3VAFA 4BC9A 4CLSA 3K0JA 1FX2A 5DETA 3O1LA 2ZNZA 1VQPS 3LA0A 1RI7A 2HS0A 2GGPA 4BBYA 4DR5F 3L7UA 4QWEA 4X4SA 4ZA1A 2W9AA 1R6YA 4F3OA 2CVIA 3HHLD 4ZLLA 2IM2A 4ZJLA 4FYVB 1V9OA 3MMCB 1UJ4A 1S9GA 4V19X 2CA9A 1QD1A 2KB2A 2VG5B 1M5OC 2QLXA 1IM6A 5C24B 4DUYJ 1YTYA 2D3O1 2KL8A 4CLWA 4HHJA 4BC7A 2HNDA 4WU2A 4GKJF 1RT5B 2KFZA 3CCSS 4U7UK 1H7WA 1RWVB 4CYUB 3EUNA 5D0HA 2HHUA 2H4YB 2LA4A 4PXDA 1H2TZ 5EWGA 4JI4F 5CQGA 2HLUA 2B5JA 3R9LA 4ID5B 4NLGA 4OYIA 4KHMA 2H54B 2XEXA 5H9FK 3CDWA 1U2RA 5MLCV 3DRRA 4ZJQA 3TEGA 4ZVRB 2D3OR 1I94J 1RAJA 4ZVSB 1DQ8A 2D1CA 5L1IA 5C25A 3V4IA 4C0HA 1L3SA 5K14B 3PKMA 5LXYA 3QIPA 1RT4A 4CM0A 3RR7A 3M9OB 3S6EA 1M5VC 1W7WA 3BB5A 5HLFB 4C6AA 5H9EJ 4U96A 2ATCB 2ZUGA 6FDRA 1BXNA 3FSIA 3RAMA 1NDPA 3UCZP 5F3ZA 4OV1A 3HFZB 2V5HG 1JLCA 2JEJA 1X4CA 3N9UC 2R7XA 4NRTA 4RW8B 1NKCA 1XMBA 1YVFA 2LEBA 4JI0F 3KHHA 1RADB 2DIUA 4CNYA 1N52B 3IO1A 4RU2A 1CQMA 2P2CB 1YJNS 7FD1A 4OZ5A 2CQBA 4MKYA 2UXBJ 1WEYA 1HYSB 3VVTA 3MEDB 4M5DB 4KO0B 1SJ3P 3M2VA 5ADZA 2OFGX 4UTGA 4WIQA 5KFKA 2DT9A 1CJVB 1N0VC 2AYBA 3A1YG 4LVOP 2OSQA 5KG5A 1U47A 3QO9A 3CC2S 1WKJA 3BBFA 2VFUA 3CPWR 4RBUA 3DYAA 4QR0A 3GJSB 1S0NA 3EM1A 2Y1LB 3J81U 2IRUA 2HBQB 2AMCB 4HHHA 3J7Z5 3QFHA 1FKPB 5KT2A 1XMQF 4UQGA 7FDRA 1OPIA 3FBEA 2ILYA 3FDSA 1O6XA 2AKWB 2DNPA 2XWYA 3KYLA 8ATCB 1YKWA 3I4PA 3LP1A 2QG9B 4UQTA 4KIAA 2EK6A 1WC3A 4ZVQB 2BE2B 1TL7A 4KV8B 4CNZA 2BX6A 4JV5J 1KDNA 1Y0HA 2CG4A 3W61A 2CZVC 1RYSA 1XTZA 4U95A 4NXNJ 2Z4PA 2B43A 1VRUB 3PNIA 3OFFA 1WG5A 1FF2A 4R5PB 5E3QA 4FF3A 1N88A 3D1HA 1S1TB 1HBUA 1WG1A 2XMUA 3R8YA 3PIPQ 5CH7B 2E1CA 3M7VA 1QLNA 2M52A 4JI6F 5H1SV 3HLUA 2IM0A 2P6SA 4NA2A 5D77A 3TAQA 1FJGJ 3MAQA 5B08A 1S6PA 3EGZA 1Y00A 5HROB 5HMWA 2XNRA 3VAHA 5IWAF 4OZ3A 3KLGB 1KKHA 4EU0A 4ECYA 4NLYA 5KG2A 4XDDA 2AGPA 3V6DA 5KFHA 1CEZA 3LALA 3UR3C 5A8KB 1HQ2A 1Q8KA 3L7PA 3B78A 4JI2J 3I0SA 1AROP 1DLOA 1Z2ZA 4CH1A 3MMJA 4DQRA 3ZTRA 1RGVA 1EQ0A 1YGYA 1X31C 4CIOA 2E66A 2JLEA 4PWDA 4QJVA 2ZH8A 1RWWB 4J9PA 5F3TA 2NUHA 1TUVA 3H90A 1BQMB 2PDAA 1NHUA 1S5ZA 2XSJB 3ILOA 5E3CA 2GC8A 1LFPA 5L46A 3BO3A 2NREA 2GCFA 3QPIA 1L3UA 4JI3F 1H7XA 5G0RA 1R89A 2B4OA 1JLQA 1UL3A 3HFKA 2HRYA 5KFXA 3M9NB 4OI3A 2ERRA 2OPSA 2MGZA 2W8LA 5LMUF 4DL2A 1REVB 3PM9A 3GCXP 2ZM6J 2BA9A 1NO8A 3FCHA 3A8EA 4ECWA 2V4JA 2C42A 4TYBA 4M5MA 1PYSB 5K8PA 3SYZA 2EG1A 3CTRA 1YJTA 3IM9A 4OJ3A 2OH2A 2LQJA 1GMWD 4RNOA 2WVCA 3DXSX 4WP3A 3TANA 1EARA 2W2NP 4F8RA 3MECA 4H4KC 3MHYA 2ACYA 1GMUA 4DU8A 3C6UA 4ZVUB 3SZ2A 2EK1A 1HBMA 4LSLB 2APOA 4MK8A 4LIWA 1U24A 1UPMB 1FWKA 2D3UA 1S0VA 5EWFA 3CJRA 2CYYA 2FY1A 5HQ8A 1WDDA 2K8GA 4DOZA 2EKNA 2WVDA 3H4DA 4DUTA 4P73A 1UA1A 3ZNJ1 4A8SA 3AJ2A 5FLXY 3M8QB 2OMLA 2B51A 1KBRA 3BKUA 1Y5NB 4KBIA 4ECVA 4NX9A 1CJUB 2AYEA 3C14A 4FVCA 3QGHA 4RUHA 2VQFF 5CD4A 2EW9A 3QAUA 3MURP 2IA0A 3OSPA 1FNOA 3GE9A 4QWCA 3FBFA 4WP9A 3BSAA 2BACA 2OLWA 4ED6A 1FHTA 4WFAQ 3DCAA 2CQCA 3N01A 3JXOA 1TP7A 1GTEA 2R7RA 2DPIA 3TR5A 4GVLA 1RHJB 1XMOJ 5AE1A 4DR1F 2XBPA 2KN4A 1B70B 4ZPBA 3MPVA 1J5EJ 4ZPWR 2YKNB 2KU7A 1RTJB 5CD4H 5A8WB 4ELVA 2HAIA 1P8GA 2RF2B 1TKTB 3MPUB 2M0GB 1VFJA 5IQ6A 3HF5A 1TL5A 1LEOA 3BV8A 3PYGA 3J81j 3GLJA 7AT1B 2VFTA 1WG4A 3CJQA 5DG8A 4X62J 3PHTA 2UUBF 2R7SA 1A6LA 2RU9A 2XI3A 3SCKE 3B4MA 2QTWA 3PEHA 3ET6A 3S8SA 2CWKA 2OHDA 2KVQE 1DQAA 4OJGA 3HHKA 4F02A 1HI1A 4DF8A 2I9SA 1RBOB 3VGVA 2V4QA 3BM7A 4DS5A 4LREA 2UVWA 4DG1A 8RUCA 5EN1A 3G82B 2MZRA 1WEZA 3QIDA 3CDEA 3HHLC 5L1KA 1U4BA 4LF9J 4DN9A 3A13A 3CJ2A 2A2CA 1RHMB 1VRTA 2ZH3A 2XCAA 1EETA 2CJAA 4JI7J 3W5YA 2P6TA 3CDUA 4F25A 2VBYA 2VIHA 1FKOB 2HBRB 2KG1A 4PG6A 1C0TA 4WFXA 4RNNA 4O44B 4PKDB 5F9LA 3CT9A 5M2RA 1FNXH 4DV7F 4L6V3 3JQMA 2W4CA 2CIMA 3DRPA 3VGUA 3KG4A 2RKIA 1O51A 3DLLQ 1PC5A 2U2FA 2F4VF 1T03A 1SI9A 2BOAA 2X7IA 2YWKA 5L8RC 3G6ES 2YNFB 4CLKA 4U7CA 3CIMA 4WZQA 4LT6A 4Y2MA 4E0DA 3SFUA 1WOPA 2IC3B 3CSKA 1NEEA 4KGMA 5DM7Q 3OLBA 2ASDA 3NNHA 4FXVA 1RAOA 4WYWA 3M32A 2Z2MA 4J9NA 1N32J 1Q82T 1ZH5A 2UVRA 2L9DA 4LBHA 1TAUA 2XMVA 3R6GB 4AQYJ 1JJCB 3PACA 1B4SA 1RWPB 5F8NA 1TKZB 1Q81T 4B3OA 1E6YB 2I2YA 1K0TA 1S4EA 2VOPA 2E1PA 3K2YA 1AFJA 4DWIA 2LXIA 3FJ2A 3BDEA 3IS9B 4R8UA 4ZHRA 3M6VA 1GK8A 2D9OA 3Q2SC 1TUGB 3TAPA 4ZPAA 3KK1B 3BH7B 3AOBA 4XIUA 2CQ1A 2VL1A 1S72S 5HI7A 4EFAC 4NLUA 2W1BA 2PGCA 3LP0A 3BO2A 3W66A 2VC1A 1OO0B 2GMHA 1TK5A 1FCAA 4B9LA 2G2OA 2OD6A 1YITS 2KHCA 4TQSA 1VBZA 3WC2A 3OXGA 3OR2B 5L38A 1N56A 2ALZA 4N47A 3DRSA 4M1KA 5IT9Y 4MK9A 4OLPA 3PDNA 3N79A 1IR2A 2MKKA 1SJRA 3NGRA 2FD2A 3VVUA 3AHPA 2XCPA 3WIUA 1M1GA 2DCUB 4X84A 3NAHA 3OXLA 4NCGA 3EMTA 2VONA 1CJTA 3MCOA 3G9CA 3GB0A 4P75A 4AL6A 2BJEA 4AXJA 2AD9A 4C8YA 2HFSA 5I3PA 2CRLA 3KLHA 2B8QA 2HVIA 4PUOA 3K8WA 3CO0P 1JLFB 1RWNB 4HVZA 4JV2A 3DLKA 2HVDA 2R8JA 2YX7A 1D8YA 2CXEA 2ZVIA 2OAUA 3THTA 1WHWA 1UWAA 1X5TA 4LQ3A 3ZXWA 4TY9A 1SC6A 4J9SA 2QIFA 1N0UA 4OFZA 5ETVA 5HBMA 3GV7B 1YJ7A 1E6VB 4XTTA 2BR0A 2KRBA 2J8AA 1Q7LB 3X3UA 2F8HA 3KUHA 1DHMA 4X65J 2K1RA 2MTLA 1RT1B 3M30A 2MQQA 5B0EA 4RWWA 2MXYA 1RCOB 3BGLA 4ECZA 3NGUA 2JNJA 5E3AA 2KM8C 2DYAA 3CF5Q 5E2QA 1NAQA 1HD0A 2YWGA 2HAFA 5GAHU 5KOWA 1VQ7S 2FPHX 5GADU 3WX4A 3ZO7A 1UA0A 4DR7J 3CGIA 2HNYB 3QSYB 3CULA 2Y0SD 3HSDA 3ZNUA 3T19A 4DN0A 3A3PB 1DTQA 2C1EB 1TK8A 2RUGA 3MCSA 2Y0BB 1B3TA 4ZMMA 4KC5A 4DUZF 1U1MA 4B9TA 4Q5VA 3T1HJ 3KJQB 4ES1A 5CYMA 1YJVA 3PX6A 4NLDA 1S1VB 2XLIA 3Q8YA 1Q5VA 1AUSL 3GCWP 4YB7A 4KFBB 4OYAA 3QT6A 2HQ3A 2VC0A 1Y11A 2HMIB 3VF0B 5HQMA 4L74A 5F0UA 3KG0A 3T5LA 3SSSA 5IC4B 5GAEU 4LSNA 3MM8B 5J2PB 3GONA 5B7WA 2E7VA 3GSDA 4DL4A 4LFBF 1T02A 4Z7YA 2JEFA 3DLJA 1QAJA 1Q5YA 2MLXA 2HK3A 1TL3B 2ZDPA 4RWXA 4F4ZA 2E5JA 2F4FA 4PCQA 1VQ4S 2P9CA 2CNNB 2F40A 3H2LA 4IFYA 4ETXA 1VQMS 1TL4A 2B9XA 1NDLA 4I6AA 1FXLA 1UP1A 2B56A 4RR5A 2YKMA 4AL5A 1N36J 1LWEA 1P6TA 1D0EA 1SQFA 2CNLB 4DX7A 2AEMA 2BABA 2Q3PA 4IH7A 3UR0A 1S7HA 3BREA 2JLFA 1IKXA 1V5IB 3T6BA 2XHCA 3M8YA 1T3OA 3FNNA 2HRTA 1GXUA 1RTZA 2FGCA 4OZLA 1UVIA 2KXNB 5DGAA 4GVBB 1X7VA 1AFIA 2FYXA 1S9GB 3D3BJ 4DR3F 2NYIA 1MSWD 3ONQA 2MJNA 2XNQA 4WE1A 4KY3A 1ZM2A 3IG1A 1PYTA 2F9DA 4M5LA 1W25A 2DJWA 3QSIA 1QVFR 2QL9B 5G4DA 4WFZA 1JJHA 5T7LA 4IH6A 3CCQS 3QGGA 3D7SB 1KTVA 1J2VA 2F7VA 2L48A 4HTIA 5J2QA 5KAKA 4K0KJ 1Y3KA 4DPYA 2DNZA 4ZCKA 4WXWA 1XN9A 4PEOA 2B5JB 1TELA 1M1HA 1HNIB 1MWQA 3EGVA 5BR8F 4B02A 2E1MC 2NXCA 1U09A 2NQPA 3VALA 3DRRB 3RBEA 3GWCA 2GIRA 4IOAQ 1VQ8S 5ETTA 3PJ9A 1TTHB 2IVMA 1VGYA 4FN5A 4CRJA 3F41A 1IBKJ 2YQ1A 1Q79A 3RBDA 2NR0A 2YY3A 5C25B 4ZVTB 2GX8A 3JYTA 3LGHA 3V4IB 3W62A 3UN5A 5AXNA 3DI6A 3HT0A 5CABA 3ZTSA 3QIPB 1RT4B 2B3TB 2DR8A 1OYEA 5F8JA 4F0KA 5CZXA 5D0GA 1QVGR 3D6MB 5HSPA 3K5NA 1HMVA 3QT5A 4LFAJ 1KONA 3UD4P 1JLCB 2FVRA 2WB1D 2ZKUA 4CP5A 1K47A 3AQOA 4Q44A 3KLFA 1X4HA 2XMMA 2HVZA 4ED5A 4OI4A 2EEYA 2YNGA 3KJFB 4QIVA 1HBOA 1IUJA 4DQIA 4F7VA 1J5EF 4V1Ak 3M2VB 4WIIA 1XR6A 4RW4A 4ELUA 1KHVA 1K1QA 2KFNA 4DR2J 2DY9A 3C8YA 4NLWA 4Y28C 4I7FA 2PMWA 3QO9B 1BC6A 2VOOA 2QL5B 2J7KA 5KFPA 4CQ1A 3VWSA 4F26A 4LRCA 3DYAB 2WSFC 3SMZA 5IV4A 2XTJP 2UP1A 4DX5A 2O67A 4DPWA 1RWUA 2BM1A 2HFNA 2AJ1A 3NL0A 1QUVA 1BWEA 3BSOA 1GH8A 1S77D 1NSKL 3H40A 2MHNA 4LRAA 2BVZA 3TUZC 2ASJA 3HHNB 3THVA 4O3SA 4K50A 1WF1A 1URRA 3NAIA 2PFFB 3LP1B 3CEDA 3TVYA 1RTDA 3WX8A 4JI8J 3A8KA 5E5NA 1RCXB 4LF8F 1TL7B 4RO0A 1RJJA 2W9BA 4P2MA 2LQ5A 2HGMA 3R3TA 4URGA 4Y65A 3VGSA 1S1XA 4B3RF 4PG5A 4DF4A 3MF5A 3UI3A 1VI7A 3R5BA 2DH8A 4DV6J 2AX0A 1RB0A 2AJ0A 3H7HB 1WTBA 2J7UA 3OD2A 5J2NB 3L3CA 4WJBA 1R8CA 1UVKA 4MAKA 3KHGA 3CCLS 4KRWA 2QYGA 1OS5A 2ZH9A 2AP6A 4LF5F 3ELHA 2BOPA 4PXBA 3AQPA 4CDIA 1S6PB 2A10A 3DNCA 1FJEB 1UJ5A 1ACMB 4F36A 3O2IA 4W4MA 4OYOA 3TYTA 2YX4A 2QSFA 4YN3B 3U7JA 3V6DB 3ITHA 1ZS6A 2YWEA 5F8LA 5K8NA 4I64A 4MMOA 1CC8A 2GS8A 3I0SB 2Q79A 2BE7D 1X4FA 4ZVGA 4HKQA 1NB2A 3HJFA 4FPRA 5M2UA 1S6UA 1CC7A 3RU0A 3PX4A 1XK8A 3OVAA 3ULHA 2OJ3A 3HX9A 1WC5A 3Q0AA 5ETPA 4Y00A 4PWDB 5L9NA 2XS5A 2EG2A 2ZFHA 4QR1A 1X5OA 2HHHJ 3J81Y 5CCMA 4N41A 4WWSA 4OZNA 1G1XA 4AQYF 5G0RB 4HT5A 1HNWJ 1U0HA 1RTIA 3KK3A 3MXHP 1FWLA 2WVEA 2O5DA 2OPSB 2HG4A 2MGZB 1TUWA 3VAIA 4LFCJ 4HACB 2R3VA 4B3MF 1U8SA 5D4OA 2V4JB 3IA0A 2RE1A 3BDPA 1HW8A 1JB0C 1EP4B 3Q2TC 2QN6B 1WHVA 1G7CB 4N7TA 1RT3A 5EHHA 2X1FA 2BQUA 4YQWA 2DTJA 2E5LF 2G2ZA 1X5SA 3CJSA 1X8DA 3MECB 2XC9A 1EX8A 2VDIA 1J5OA 4NLQA 3K8VA 1LOUA 3IN5A 1TMJA 3C6UB 3UDEA 1SJ1A 2QRRA 2BE2A 1HBMB 3C66A 2AHOB 1ZM4A 1NSQA 2GFFA 2ROPA 1NKBA 4OHWA 4OYMA 2Y1RI 1A0OB 3Q8SB 1SXLA 2D41A 4FYDA 1VRUA 3PO4A 4O3RA 4AT1B 1YWXA 2ZHAA 1J27A 4F4XA 2MZ1A 1U1QA 1H74A 2XULA 3P8BB 4AE5A 2DNMA 2V8HA 3IBCB 4HLBA 3SEOA 5HROA 2VF3A 3QATA 3D1QA 4QU7A 3D67A 1FRXA 4QIFA 2OKQA 5A8KA 3W5ZA 1RHRB 4X64J 4TKTA 2VBXA 1QUPA 1TZ0A 4OI0A 2EBGA 3Q8UA 1MU2A 2BJ7A 4KAIA 3GG0A 1U1KA 1XWLA 1UVJA 3EXYA 1SVDA 2DD8S 1IBLJ 3MFIA 2FHMA 2XY6A 1NPKA 3RRHA 3IM8A 3BGUA 2XY5A 2XSJA 3WQPA 4U8VA 1HNXF 4NXMJ 3MM9B 4KT0C 5U47A 2A18A 4LF4J 2XG8A 2FJVA 2H48B 2B7CB 4GC7A 3QJLA 1UEVA 1JNZB 3QAEA 3BKFA 3A8IA 4PAAA 1HNVA 1VR6A 1N5YA 1R0AB 3DOMB 4DR5J 4C8ZA 4IUFA 5HK4A 4C9DA 1RISA 1U6BA 2CJKA 2LLZA 4YR0A 2XM3A 5E3RA 3ET6B 3LOUA 4USWA 2MEWA 4P2XA 1U45A 3PEJA 2CPFA 4H4OA 2CAJA 3LP2A 2NXEA 1RAAB 1YDLA 3LWLA 4GKJJ 2B9WA 4U9RA 4NZ6A 1IBCB 2BKPA 1O0PA 1BQNA 3RRGA 2UZAA 1C2PA 4DHVA 4LSLA 1MW7A 1TU0B 1BLUA 2ZUAA 3A12A 3FSYA 1VRTB 3IRWP 4Y2IA 4EZ9A 1EETB 1B0VA 2MLZA 2JSXA 3CMES 2GHVC 3DLEB 3MMAA 5ETMA 2LECA 4WP8A 2G0JA 3O8WA 1C0TB 4F67A 2IRXA 4P52A 4PQUB 4DQSA 3G6XA 2QA4S 2LA6A 4QCLA 3DRPB 1VOMA 4O0IA 3KNAA 2WSCC 4DSLA 3BGRA 2RKIB 4MIBA 3TRGA 2MPUA 2D69A 2VFVA 5DLGA 1T03B 4FF2A 2IM1A 3UDLA 1IQTA 2HWTA 4EMDA 2XO6A 2Q43A 1RTHA 4Z7CA 3I5CA 1HR0F 3S7RA 5CZVA 3RAQA 2RB7A 3BGFA 5DS7A 4OX8A 2Y9HA 1LV5A 4JI0J 2CPYA 3DC2A 3IR5B 3GYNA 2R8GA 1HPZA 3Q24A 1EHWA 2AEJA 1FRJA 2HFUA 1VHIA 2FZKB 1DBDA 4OX9F 2I0XA 3N5BA 4NLRA 1FDBA 4N8OA 1HFEL 1NK6A 4ED3A 4B3OB 3IWLA 1TK0A 1H38A 2DBBA 4B3SF 4ZHRB 4G6VB 1VRQC 2BW7A 3UVJA 2RRAA 4ED8A 2MKYA 2VZ9A 4CZCA 1U1PA 1Q86T 3NGKA 2IHR1 4Y6IA 1HARA 3IXQA 1U1NA 4ZPDA 5KT3A 2IJNA 2RDDA 3I6PA 1XMQJ 1SL2A 2C3YA 4ED0A 4A8OA 2X1GA 3LP0B 3F0NA 3T1YF 3EXCX 3RB4A 1KLNA 1UCNA 3RB6A 5T41A 3HO1A 1HLWA 2DGXA 2A2DA 3NS7B 2M88A 3DRSB 4DCPB 2KYZA 1SBRA 1QY7A 2JX2A 4M5HA 2PMZD 2RU3A 1WNEA 4ZLNA 1T9TA 2F1FA 2K3IA 4KB7A 1TVRA 5KG4A 2COLA 5E3PA 1MN9A 3W63A 3LH2S 4J7CA 5A6WA 3ZZ0A 4K8RA 2CPIA 4NCGB 5JVGQ 1N6QB 4I56A 2E44A 1CJTB 5K9FA 5I42A 4RZRA 3TOQA 3WHIA 3TJ8A 4NZ0A 3TNVA 2W7PA 3GIJA 2EFOA 2ZEJA 4JI6J 3HSGA 1Y9OA 4K4TA 2EFQA 4K2JA 3MPWA 4OLOA 4PUOB 4FXDA 1UFLA 1FFWB 2DCLA 2V67A 3DLKB 4NYPA 4DSFA 5DLFA 2W2MP 2QJ3A 5IWAJ 1QTMA 5HQLA 3OR1A 1Q78A 4Q2MA 1ZM9A 3P3DA 1U1RA 4FPIA 2YNFA 5L9XA 4KGKA 3A3NB 3GZ7A 4LVNP 3W9IA 1LXJA 3FFIB 2FZCB 2XB2D 2KZZA 3W64A 4P7TA 4F2SA 2KT3A 1NJIT 2CQPA 4TLQA 3QJPA 5HBMB 1VQ9S 2OO4A 4ZN3A 3D6HB 4UOFA 3G96A 1NBEB 1SKSA 2DGQA 4P7VA 3SXLA 3DFEA 5A8RA 4J9MA 1ZAVA 1PJ6A 2M8HA 4EYIB 4JI3J 5I3QA 2K1RB 4Y0FA 3M30B 1HI0P 4NWBA 3OHBA 1NB7A 2ZOGA 4DX8H 4KE5A 2LMIA 2GZOA 3FMBA 1DY3A 1X4DA 3EJMA 3IS9A 1HKAA 2GMLA 2EBEA 4PWWA 2QLWA 5LMUJ 2GQCA 3L9ZA 2PE8A 2KJWA 2XZDB 4C8NA 2L3MA 4CI0B 3PRBA 2CDQA 2G0CA 2KDOA 3Q23A 2LQ9A 1XNRF 1Q8BA 4DFJA 2V9KA 5DQIA 2RVJA 3L7OA 2ROGA 4O4GA 4WFBQ 2EFPA 4USJC 4RBVA 1DTQB 5KFGA 3FZ2A 2VG6A 4HEA9 1I3OB 3K7RA 3OR2A 3FRZA 2DY1A 3UDVA 5KFIA 1NCLA 4EBDA 1YX2A 2MLYA 4P6QA 3D1OA 2ZBCA 2YBVA 3FBCA 2FJXA 2DRBA 3HP6A 2J9CA 2DH9A 2L9NA 4J9UE 5CYMB 3RB0A 3BQ1A 4X4PA 3RZAA 2V63A 4ZCMA 3FUYA 4GRSA 3RR8A 5KG3A 5DDOC 4RX6A 3L4BC 2UXDF 2HHQA 2RUSA 2P9GA 4ETZA 3WC0A 2OMOA 1BQXA 4Y2KA 4Q0BA 2HYIB 2J6SA 4PXCA 2Y3YA 4JOUA 1JXLA 3R6LB 2RAQA 2VDHA 3IRXA 3MM6A 3J7AN 2I38A 2VQFJ 2G2YA 2Q6CA 2RQMA 4DPTA 4CM2A 3EGWB 2LDIA 1DFDA 4A47A 4MIAA 1KFSA 2HZAA 4C3LA 2Y8YA 2C2EA 1OJ4A 3FRYA 5CYQB 5D78A 3PW2A 2W4PA 2GHWA 4J9LA 2ZJPQ 3CCZA 4IFYB 3QMQA 4BDPA 2VB6A 4DSEA 3HCXA 2I1RA 4G65A 1LWEB 4JI5F 4DR1J 1CULB 2X1BA 1F2GA 3IR7B 2V69A 1E6VA 1HWJA 5GVQA 2V2KA 1IKXB 3TQ1A 1V3RA 3TARA 2C28A 4ED4A 5ETSA 2A6MA 2UVVA 5KFWA 4ES2A 3W2VA 1RLCL 1SV5B 2DNGA 2HFOA 1XBWA 2DGUA 4LFCF 3KJVA 4OX6A 4PABA 2RH3A 4OJHA 2NSCA 1JLAB 5AT1B 4WE1B 2IJRA 2ZD1A 1HHQA 3IG1B 1GNKA 1VBYA 4B9SA 1VIXA 3W60A 5IQQA 2CJXB 5T7LB 1EQMA 5KT7A 1R0BG 3GTYX 2YTCA 1ZOTA 2MQOA 3JTOA 3MR5A 2V8VA 3O6QA 1HQEA 4KGVB 4K5SA 1B0PA 1RACB 5J2QB 5BXIA 1H0HB 2F5GA 2YKOA 4I6YA 4A4JA 3T9NA 4LRFA 3E3XA 2KT5A 4NLOA 2G4BA 2H4WB 1M90T 1KQSR 2WSEC 1C1CA 1S1WA 1QM9A 3NBPA 4DSJA 3HSZA 2VA2A 2W9CB 1XQIA 1S10A 4OIXA 1S1VA 2X3GA 4KKOA 3H5XA 2YNHA 3GIRA 3JYTB 1K44A 3CO9A 4J9KA 1L3VA 1Y3JA 3KDNA 3DI6B 2XMAA 3D54A 3UQSA 2HMIA 4X4OA 4YUDA 4RU9A 1YRUA 2LFVA 4OYPA 4F3QA 4NRUA 1KC8T 4C11A 4ES3A 4HH1A 3ZZOA 5KFFA 1EB0A 2XZTB 2XZWA 4DV7J 2UUCF 1OIAA 3VTIA 2RQKA 3GG1A 1CS4A 2F63A 3KLFB 2F4VJ 5MAOA 4F3MA 2OTJS 4R25A 3DN9A 3RB3A 3Q89A 2YNGB 1F3VA 1HBOB 1FK9A 2IAJB 1VC5A 1NK7A 3M8ZA 4FS2A 1S57A 1WI8A 4LF6F 1R8HA 4X2BA 4IRKA 2FLLA 1WUUA 4RW9A 3I56S 1W26A 2YXLA 2QE5A 2QLJB 2FB0A 2ADBA 4I7FB 2XS2A 3WIVA 2RS8A 4EUVA 4ZDNA 4W90B 2FHKA 3Q8VA 1IKWA 4YB5A 1F5BA 4IQXA 1FVSA 2MDAA 2N3OA 3W8GA 3BYPA 2KJVA 1RP5A 4I2QB 1UZHA 1ZBTA 3AAWB 4GVBA 5DGBA 1N5SA 5BYSA 1VYAA 4HYKA 4EI2A 3R2CJ 4OI2A 1DRZA 2UU9F 1VISA 3G8TA 1RWKB 1VC0A 2G1HA 3AXMA 3Q8PB 1XNQF 2FVPA 4JBCA 1T9VA 2ILZA 2E1RA 3P5TL 1RTDB 2AWZA 2QFIA 3S01A 3I87A 4ANCA 2C3PA 3JQJA 3P45B 4CCHA 3K5MA 2VODA 3VHQA 1YZ6A 1JJ2R 2W9BB 3DU6A 5IZHA 4ED1A 1FDNA 3NS6A 2VFSA 5K8OA 1S1XB 1HNIA 4UY85 3ISNC 1FI4A 1SC1B 1D3WA 4MTPA 4YB6A 4DMZA 2PI4A 5I3UA 4KPCA 2O3DA 4PPDA 3N4WA 2D74B 1ZYQA 4O0NA 5FIIA 3JQKA 4IFVB 4ELTA 1QE1A 2DH7A 1WC1A 1LW2A 2DNOA 4IQMA 5C7PA 1NZ8A 3W9JA 2OPPA 4ZPCA 2NCKL 1QAYA 2FLOA 2SXLA 5ETKA 1VQOS 2XLKA 1GQEA 3ITHB 1ZETA 1Y5LB 2RS2A 3NEKA 4NMLA 3PX0A 5HAOA 4ID8A 1WC4A 4NYOA 3AODA 2DXEA 2V94A 4K5RA 4ECRA 2VBZA 3Q86A 3P4UB 4M5IA 4HI2A 3OW2R 5D4PA 1MNEA 2MZTA 2CFXA 4X4QA 3UPFA 3BN7A 3GU0A 5D3GA 4HDGA 1BHNA 2PO4A 2XMJA 2D7SA 3SV4A 1NK0A 2DXDA 2WOMA 3H0PA 2QEXS 1GXTA 1T9UA 2R4FA 4OYXA 4I1TA 4A8FA 4QWAA 2H5IB 4CT8A 5J1PA 2ZBQA 1IQZA 5K5MA 1OSDA 2DNLA 3KOAA 4RL1A 1DARA 2K7KA 1X9SA 1U0HB 1KQGB 5AJ3F 1RTIB 5BJRA 3KK3B 2NXJA 4BLGA 2GIFA 1PJ5A 4KHPJ 1WKKA 3GYGA 5GAGI 1FRIA 3HULA 1U49A 1KOOA 1U2CA 1D8ZA 5D4LA 1X9WA 1ICEB 1FRLA 2VJUA 2DNNA 3K5OA 4O3PA 3ILJA 3C16A 3QRQA 1RT3B 2QA4G 5HVHA 1Q0NA 2OP5A 3ZFVA 2FHJD 1IBMJ 5A2QU 1J5OB 1T05A 3CCVS 3GR1A 1U8WA 2KKHA 3N6MA 2BRKA 3M6WA 3PCOB 4WXOA 1YJWS 3DXBA 3TUIC 4Q43A 1MROA 2B4UA 2V6AA 4IR1A 4X66F 1U1LA 2FHOB 2YKAA 3DMJA 1D09B 1HW9A 4DUZJ 2IMOA 1AZSA 5CXTA 2QMUB 2Q66A 2HZCA 5J2NA 2XHWA 3OTOF 4USUA 1JK9B 2GQQA 1UVLA 2V2ZA 2I5JA 4KH0B 5KG1A 1KOHA 1TQLA 4P2SA 3HVWA 3GV8B 1LK5A 2DNYA 4IRCA 4HT7A 3SQOP 2AJ2A 4WK1A 1OQ3A 4C2MA 2HQCA 2PA8D 2CPJA 1VQSA 4TXSA 4LMZA 1ZZNA 1NXIA 1Q8LA 1XC9A 3NWGA 3A4TA 5HATA 4WKYA 4AD6A 2FJEB 4LFBJ 1V5VA 4UOGA 3NOCA 1QDUB 2E9TA 1KQKA 1R27B 1QSLA 1MU2B 2DHGA 2RT3A 2NPIA 2WK4A 3MOZA 2MB0B 1BWVA 5HO4A 4I6WA 4DSKA 4DR4F 3RJMB 3CJ8A 2MKHA 2DHXA 2CZ9A 4ED2A 3AH6A 4DXLA 3AB2B 4DQQA 4M63A 3EZUA 4WU3A 3I9V9 2HGNA 3D68A 1JIHA 2FZGB 3HFVA 1HNVB 1N5YB 3EVOA 3BO4A 5KFEA 2DR7A 3PFOA 3MPDA 2B6AA 1C0UA 1JXEA 4HACA 2GVZA 3MM5B 4I0WA 3BBCA 4ANDA 4DV4J 2HQFA 4PWUA 4CT9A 2Y1JA 5ETQA 1RAGB 1EP4A 2WONA 2DGWA 4DR3J 3HM9A 5HP1B 3RRKA 4EO8A 4MFBA 1S4FA 2VD3A 5AXKA 4H4OB 3QRRA 2CPEA 2E9RX 4IG3A 4WFYA 2K2PA 3W7BA 3LP2B 5DO2A 1LWCA 3MCMA 1VHFA 1BQNB 2N3LA 2OGUA 4XAKA 4IRDA 5LJ5Y 4ED7A 4NLSA 2ZC4A 2EFNA 3Q83A 1T8EA 1CVJA 2ADCA 4Z2XA 3ILIA 4ZVOB 5KFTA 3EVMA 3QGPA 2V8DA 5BR8J 5LXRA 1WELA 5LT5A 3HVTA 5KT6A 1U25A 2ATLA 3BZQA 2EKYA 1S9EB 1NJWA 4K7QA 1SC4B 3MMAB 4DV2F 2YX1A 4HHUA 3D0HE 5M2PA 4IR9A 2G1DA 1YJ9S 2V9WA 4Y3CA 1JWWA 2BJ8A 2JFKA 3DM2A 3PG9A 3N28A 3BGRB 5LMNF 1FD2A 2NZ4A 2F65A 2DR6A 1Y4ZB 2HURA 3M05A 4FXWA 5EUHA 2HLTA 2JJ4D 1RXOB 3M6XA 3ZZZA 1N5TA 2BV3A 2E5HA 2DPJA 4ZN1A 4OZ2A 4DPXA 4DL6A 2EFVA 4P74A 1FJCA 4N76A 4WTYA 1RTHB 2DNRA 2FC9A 1X4EA 4TVAB 1IR0A 3UE2A 4QIGA 2VKRA 4PPZA 1OYDA 2LXUA 4P71A 2H65B 2ROEA 5JJBA 3DLGA 1HPZB 4IG0A 2JEGA 1WI6A 1DZ5A 4EWTA 4EEYA 1A9NB 5F8IA 2PEHA 9RUBA 1D9AA 1AW0A 1HIYA 2JFDA 1TKXA 2PT0A 2HHXA 3ENWA 1OPZA 3MM9A 4ANEA 2CJYB 2Z2YB 3ISZA 3C19A 2ACMA 2MKJA 3M2UA 2GJFA 2YKPA 4ZP9A 1FRKA 1VDHA 3UVJB 3DOMA 1R0AA 1Z2LA 3IC1A 3AB4B 3JB9k 3VAKA 2RSQA 2AGOA 3DHWC 1CJKA 3G8QA 2ZJRQ 4ECTA 2CQDA 3H5SA 1GFWB 4C97A 3NCPA 3D2WA 4RLEA 2XGQA 3ZTQA 3MWBA 4KSEB 3RBXA 1SH2A 3EPIA 1ZTWA 2RD5C 2CVEA 2NPFA 4UUXA 2OPQA 1X0FA 2HFZA 4ZLPA 1FESA 3S1TA 5JUMA 4LF8J 5GAGU 2HBZB 3U02A 1FXDA 1TVRB 2L41A 3CXCR 4F0MA 4DR6F 3LAMA 5HMYA 5HVGA 3EDQB 2KI2A 4B3RJ 1DURA 5JVHQ 1SL1A 4DFMA 3V81B 5JXSA 1N48A 2WRMA 1SUQA 5I42B 1IKYA 2FJDB 4IOCQ 3DLEA 2YNIA 5L1LA 2R2SA 3F44A 2HNZA 4LF5J 4IYQA 4PRFA 2CQ3A 4X4VA 4USTA 5ETOA 1S59A 4PQUA 2JVOA 3E51A 4NL5A 4OJ1A 5GMKa 5KFQA 2MJUA 4G1PA 1WSRA 3FSXA 2QFJA 3OXFA 3RUBL 3CD7A 4P10A 3AY0A 3OR1B 5F8GA 1PO6A 1U0SA 5I4MA 4PXEA 1QAXA 2NLWA 3QNWB 5FD1A 4QW9A 3PHEA 3R5DA 5ETNA 3TA2A 2MYFA 1U7LA 2D9PA 4ZP7A 3RW6A 2L08A 2XI2A 2GAHC 3CW2C 1K1SA 1SCJB 5L1JA 5A8RB 4C8MA 5LOQA 2R7WA 3B6BA 1S79A 2PI5A 4J9RA 2BANA 2ZKTA 2N7YA 3PRVA 1LXNA 2JVRA 3FKBA 3MD1A 4DJBA 5IT0A 3TVKA 1SQEA 2ZHBA 4OHYA 3BQ0A 5DG9A 2HVHA 1B99A 2K7JA 4B3MJ 1NDKA 1ZM3A 5KFMA 4FF1A 3DGPA 3MEKA 4DV0F 3KLEA 2PMHA 2ZH5A 2BEFA 3CD0A 3ILLA 3I32A 4KGZB 2P5VA 4O4GB 3TAMB 3WZ0A 2IBKA 3QT7A 3OSNA 1WOOA 2VG6B 2E5LJ 1FTCA 4R0EA 2QYCA 1T7PA 2QX0A 2ZITA 3J7ZT 3GPAA 3RYLA 3SDEA 1U26A 4HR2A 5J2MA 1IWAA 2AJQA 2KVIA 1BY9A 1BGXT 3FCVA 2R8HA 4ECSA 3ZTPA 4C8LA 4FP9A 2YVSA 2GV1A 2MKSA 1SIZA 4CH7A 4KJIA 4MIWA 4JUZA 4ZVEA 1N6QA 4L72B 4CO3A 4Q0BB 1JLGA 4DV1F 5IC6B 4NEYA 4WFNQ 3OVBA 2AT1B 2HZVA 4RKUC 4YFUA 1JLBA 1JJ4A 3IRXB 1PJ7A 3MM6B 2Z58B 3MM7B 2YQ0A 4YR2A 2KTQA 3VZHA 1MMNA 4RPFA 3D4JA 3FEZA 2QSWA 3CJ5A 2DITA 1UW4A 1KTQA 1XR5A 2MQNA 4Q7AA 2HS3A 3OPKA 5DDQC 2HSEB 2BJ9A 1RHUB 3OFEA 2OI2A 3FFIA 2BKOA 4L76A 1HD1A 1C1BB 3CC7S 1TMMA 1U6FA 4M8LA 3SV3A 2ZZNA 4WK3A 1FTRA 3MAAA 1F5AA 5KFSA 2CPHA 3I55S 2FHJA 1HNXJ 4O3NA 1D1UA 4LF7F 2J8SA 3W2VB 3NS5A 4XDCA 4C7QA 1KVJA 4CO1A 4F50A 1Z1ZA 1LQ9A 4CTAA 4UW2A 4KHPF 5HMXA 3KJVB 1M5PC 2AW0A 3PR4A 4FKYA 1NK4A 3CVKA 4USIA 1H73A 1RKJA 2C2DA 1RZMA 3O5TB 1SJFA 2QV6A 3CCMS 2ZD1B 1RT2A 3R1LA 4IOBA 5KT5A 4TY8B 2XYHB 2VV5A 2VUGA 2CDRB 3ZZPA 2VICA 3PW0A 2FDNA 1IBMF 2HGLA 4LR8A 1HQEB 2C2NA 3BPSP 2GVDB 1KNZA 3UCGA 4USMA 4C8OA 2PFDA 4OZ0A 4TU9A 1PGZA 5B0FA 2DRAA 3OJSA 4CLLA 1X9MA 3I82A 1N34F 2BKNA 3MMBA 1D9FA 4H4MA 2IFXA 1WTFA 1C1CB 1S1WB 2W2OP 1U48A 3NBPB 5C42A 1B64A 3KNGA 2DNKA 1RAEB 2QC3A 4IO1A 4KKOB 5D0EA 3K89A 3O44A 2YNHB 4LR9A 4B08A 1HL6A 3W1YC 5B0BA 4BS2A 1WF2A 1YBTA 3UFCX 3HPOA 5IOLA 4B3TF 5HL7Q 4QU6A 2BRLA 2H3EB 2RJZA 4C11B 2IRYA 5KTQA 1MN7A 3NP5A 1R8BA 3GIMA 3RBZA 2V68A 3F56A 4OI1A 1F9EB 2YWFA 3WBZA 2RHSB 3CD6S 2WW4A 1MG7A 3AD8C 3LAKA 4AXIA 1CS4B 3LANA 2W2QP 1F6TA 4DL7A 1FKAF 4B17A 3HVAA 2MSTA 1QJHA 3H5UA 3T5HA 2IY5B 1VCTA 2ZH4A 3OL6A 1UW9A 4U7UD 5CYQA 2ZOMA 3IFEA 4FBTA 1FK9B 1EAYC 1HR0J 1U1OA 3IMQJ 2JH3A 5ETRA 4KHRA 2BYCA 2KHDA 3KLIA 3TX8A 2HHPA 3DOLB 1NNDA 3M8WA 4I69A 4QYZJ 2QLFB 4UOCA 3R5JB 3LTOA 4RW9B 1CULA 4WPAA 3CWJA 1JMTA 1AYEA 2GW8A 2DGVA 1M5HA 4OX9J 5DG7A 3KK2A 1N4LA 1SV5A 2IYIA 2VH7A 1IKWB 3AD9C 2MQPA 1S1UA 3GIIA 3ENVA 5D8HB 4DV4F 3NXZA 2DEJA 2JZ5A 2F8MA 5IT4A 3LF0A 2LYVA 4B3SJ 1JLAA 1TL1A 3VCDA 3PYEA 1U02A 2MZSA 2J9EA 3TA0A 4DLEA 2JDJA 1M1KT 2JRSA 2V34A 5CA5A 3MZIA 3T1YJ 5C2GA 2H5JB 1SKUB 3HZEA 3E2EA 3P49B 1H2UX 3SQGB 3H59A 2WAQD 5IM0A 2CJBA 2IM3A 2VJVA 5KG0A 1L3KA 4LBPA 4DV5F 4FVMA 2DO4A 3TZWA 2MSSA 5I3UB 1RT7B 3JSMB 4HL9A 2IMWP 2KFYA 2W9CA 2FVQA 2ZWOA 2VQEJ 4BWJA 3V6HA 4DDFA 1B7YB 4ZP8A 1FEEA 5F0WA 1HWLA 4DZ6A 1K73T 3AA8A 2N7CA 4CLUA 4NI2A 3K5PA 4ZIWA 1QE1B 1ZA1B 5CAAA 2R9LA 4F4AA 1UFWA 1LW2B 2QGFB 2HQDA 2GHPA 2OPPB 4K4VA 1LW0A 3QJJA 2CQ2A 4QIWD 1PSDA 4RW7A 2UV8G 3MR6A 4ATNA 3D3CJ 4PZVA 3D0GE 2NS1B 3MPYA 2Z30B 4CH0S 1U2FA 1F0XA 2BQ3A 4DZDA 2IAJA 1HWKA 3MEEA 3AOAA 4NYZA 3UD3P 1HNZF 4TU7A 5D3GB 3PYDA 2YWHA 2AJ4A 2WOMB 5KFZA 3RG6A 2GO9A 1ROFA 2FVSA 4UT4A 3NNCA 1S48A 3HSJA 5KT4A 2JWNA 3I0RA 2BUNA 1MWYA 5JMNA 2GIQA 2HQIA 2EPIA 3LQVA 4C3KA 4M5JA 2J76E 3QYYA 2FUG9 3LGNA 3C15A 4J91A 2Z8QA 3KUEA 2HHVA 4AFFA 4TU8A 4DEZA 3ZZRA 3C2PA 3OTEA 3AFGA 1RA6A 2R8KA 1K8AT 4I2QA 4UUWA 1SC3B 3TI0A 4NCAA 3VV2B 3C16B 1N5QA 2FTRA 2OEKA 4J9QA 4N56A 3BF4A 3BS9A 3NGDA 3P96A 3H2VE 3PJWA 2XMKA 5KFDA 5T14A 1T05B 4OV6A 2UUAF 2BW2A 2CPXA 1XNRJ 4X4UA 3FC9A 2C3UA 2AEFA 1C4CA 3HK2A 2NSBA 1MROB 3Q22A 1SH0A 3QWUA 2RQ4A 4ZVPB 1QAIA 3DMJB 1GX6A 1AZSB 3UW1A 4LUBA 1HHSA 2IBOA 3NGTA 3CDBA 2R2UA 2IDEA 4LSZB 3EVWA 4ZOSA 3IGVA 2I5JB 4ENOA 3DLBA 1YG0A 2JEIA 2UXDJ 3GP9A 2R7QA 4USKA 4IFVA 1HQUA 1K9MT 1S7IA 1KRPA 3E8OA 4GO7X 1NDCA 4C3MA 4QQBA 2B4VA 2W24A 2V8GA 3M4XA 2R2RA 4ZCLA 3BR8A 3W5XA 2HKEA 3DDNA 4LRDA 4D3HA 4U6PA 1NRKA 4NOHA 3M8SA 3J7YI 3POTB 4F4KA 4FBUA 4OYBA 4K2XA 5A76A 4H4KA 2VKZG 1FD8A 2HWHA 1T0TV 5EDWA 5BYQA 2HIQA 4QPXA 2RRNA 1NSPA 2V8PA 4JYAF 4QBUA 1XR7A 4KGXB 3GILA 3TQEA 2G13A 1S6QA 5B0AA 3DOKA 4GKKF 2EC0A 4FF4A 4YHHF 4JI5J 2UVUA 4DCOB 5GAHI 3TZYA 4KR0B 1NKEA 4FNIA 5GADI 2ZHOA 4K4UA 5KFBA 5HJXA 1S0OA 2B6AB 5A2QY 1C0UB 1YQHA 2CQ4A 2GVZB 5LJ3Y 1GTHA 2ZDOA 5A6PA 4OZJA 2CNOB 2NYHA 2AYMA 2WCXA 4JP8A 3PR5B 2GJIA 2WONB 3A8JA 2XMTA 4MFBB 2LP4A 4RUCA 1RWXB 2N4CA 4NA1A 2AU0A 1NSAA 1YRXA 3NKYA 2RRBA 1T94A 4GMKA 4IG3B 1Q4RA 1O5JA 3FVYA 1YJRA 3IAS9 3HHEA 3UNGC 2PEBA 1LWCB 2OPRB 4I68A 2J6UA 2ZBIA 3RW7A 4DV3F 3JS9A 1FFGB 3CJ0A 4ZK7M 1Y7PA 3GV5B 3HJVA 3D66A 2ZH1A 2DGSA 2J7WA 2C2KB 2YH1A 3V6JA 2DXFA 1BMQB 5IFMA 2QL7B 4PYAA 1QSSA 1RK8A 3ZZTA 1H72C 3HVTB 4PYDA 3D6FB 1NLKL 1IWGA 4TLRA 3C6TA 3HD1A 5GAEI 2UXCF 4FS1A 1ZAWA 1IKVA 2FC8A 2HVEA 3CC4S 3KG1A 2GQ2A 1JXVA 2NXUA 2XMWA 2LQ8A 4EGLA 2DGOA 1NK8A 1Y10A 2X51A 5B0GA 9ATCB 3DM2B 5H9EK 2RIJA 1RWOB 4X4NA 2FJBB 4AL7A 3OFHA 2W7OA 5E0OA 2DB1A 2V2VA 2DHHA 3MTJA 1ITPA 3W65A 3JAMU 4FDFA 1T3NA 2UUCJ 1OSCA 1LFWA 1AA1B 3AXKA 3LUYA 3CB4A 2M9KA 3R27A 3SSQA 5K8MA 3EPGA 3AT1B 2E7WA 4LIRA 2LXFA 1KEKA 3QLHA 2J6TA 3DLGB 4N77A 4EZ6A 3ADAC 4LJMA 3CJKA 4IG0B 1K0VA 2XY7A 2CQIA 3M8RA 4C48A 1L5UA 4LF6J 3DDKA 3N0VA 3HHLA 5GMEA 1SKRA 4KPYA 1TKXB 4J5OA 2E29A 4FYWB 2QLBB 2UUWA 1N33J 1M5SA 4XPCA 4A46A 2P9EA 1U6ZA 4A8XA 2MQLA 4LF1A 4DPOA 3C46A 1MMDA 3M2UB 3BH6B 5AXMA 3LO3A 4C4WA 2DHSA 3MM5A 3NRBA 4E2FB 1CJKB 2AIRB 2B4PA 4BWMA 1S9FA 3AJ1A 5HP1A 1Q16B 3GFZA 2ZWPA 3DKDA 2UU9J 3TX0A 1KD1T 1T95A 1FWPA 1HWIA 3D0IE 2AYGA 1SPBP 5KFCA 3PKYA 4QR2A 4DUYF 1XNQJ 4D3GA 1GXLA 2C2RA 3CCJS 2LKZA 2OPQB 4TN2A 3H5YA 3RAXA 2LEPA 2AX1A 4Y34A 2AQ4A 4CWBA 4ALZA 4P9SA 1FJ7A 1X5PA 1PBAA 3AD7C 4ER8A 1RSCA 4V19J 1Q95G 4FZVA 3GQCA 3R2DJ 2LEAA 5KFNA 3TUJC 3PO5A 2MZJA 2HWIA 2YKQA 3PRDA 4YEAA 4ICLA 2D3ZA 1SUQB 3I5AA 3PFEA 1IKYB 1RYRA 1S9EA 3H20A 2YNIB 3M1VA 4N8NA 4MH8A 1YHQS 1I94F 3TA1A 3NOGA 2HNZB 4PQAA 2FVCA 2JOQA 4CLPA 1Q7YT 4WYLA 4F04B 3OLAA 3TWZA 2A1BA 4QWBA 4NA3A 1RAHB 3MEGA 4BCAA 1KLMA 2J0QD 1AT1B 3CCUS 1SJQA 3N5FA 1FX4A 4DL0C 2P8IA 3TEHB 1JKHA 2OFHX 3IAM9 1KR4A 3DU5A 3HMJG 3V6KA 4ZP6A 3W2WB 2W2PP 3VQSA 3J80Y 3U1LA 5EWEA 1YRTA 2NXNA 5A0YB 1NK9A 1F9HA 1PAUB 1N54B 3FMWA 2UXBF 4IDKA 1PAEX 2C2OB 2BANB 3QZ7A 5J1EA 4ZVFA 4OQJA 4NLTA 2WB4A 1JNRB 2W25A 3J7YU 5F41A 5AXLA 4CLZA 2H9ZA 3A3OB 5AJ3J 2GAGC 1S76D 4CLFA 1HHTP 2ZE2A 5DJBA 2O01C 4Q45A 3KFWX 2ZZMA 1WF0A 2VFRA 1SIWB 2MY7A 2HHWA 3CJ3A 1IR1A 3IP0A 3QT8A 5DRKA 3BSNA 4A48A 3LW5C 3D6TB 4F2RA 2CJQA 3DGPB 4LQ9A 2HW3A 3KLEB 1JQGA 3GFHA 3X1LB 5D15A 1KFDA 2XWXA 1URNA 2VPXB 3KKFA 3LPEA 2BDPA 3JTNA 5F8HA 1KN6A 4NLXA 2EC2A 4G1QA 2FQQB 3VAJA 3R5CA 4FYYB 2BBEA 5SUHA 2Q6BA 4JV1A 1VQNS 1RU2A 3SDEB 1X4BA 1OY9A 4UF4A 5J2MB 3BKTA 4U67Q 4J9VA 2MY8A 4JV5F 5EX3A 1DTTA 4X66J 2VQEF 2F8EX 2ASLA 4WCEQ 3SI8A 1KSPA 3I96A 3V81A 4NXNF 2XGPA 2POKA 4MYTA 2E7XA 1JLGB 4KYZA 3TVZA 3OTOJ 4U8YA 3OJUA 4NPOA 5H9FJ 3TUPA 1JLBB 3H42A 1WSVA 2DIVA 1TV6A 3IBFB 1ZAXA 1NJZA 3EE3A 3NWRA 1KVIA 2YH0A 2ZNYA 3B82A 2X1AA 4J37A 1FJGF 1WKLA 2FIUA 3FCWA 4K4SA 1NHKL 4DFPA 4B9NA 1G2EA 2OD4A 2M8DB 2ZBRA 1JLEA 3EICA 4I2PB 4MKVA 4OZ1A 3ZC4A 4AYBD 5DDPC 3PVXA 3NY0A 1KP6A 1VJWA 4DU7A 1RT6A 1NH8A 4PG8A 2U1AA 1UEKA 4JI2F 4M95A 4KTQA 3BYRA 2CNKB 3DRYA 3DRXA 2MQ8A 3H98A 1FDAA 1CSJA 1WHYA 4E98A 2VA3A 2PD1A 4MT1A 3BJYA 3MAAB 4DR4J 5DQHA 2E5IA 4C98A 2VU5A 3I31A 4XK8C 4NASA 1GX5A 4DLGA 2DGTA 3MAHA 4ZITA 3H4BA 3KTQA 1NUEA 2VPZB 4UZBA 2VPYB 3HT3A 4CTAB 3SCIE 1H2VZ 3KMQA 6AT1B 3PTWA 1ZZFA 1GMWA 3W8PA 4CLYA 4G1IA 4DPUA 5L39A 1EIYB 4ECQA 4RW6A 4WTOB 3N6LA 5KOXA 4DSIA 3M8PA 2Q1LA 1RT2B 2OEJA 2RDIA 2ZH6A 1N8RT 2GGPB 4A8WA 2XYGB 4M5GA 5FDLA 3PW5A 1RA7A 3SIPB 2HBYB 2XYPB 2ZM6F 4C0BA 1Y5IB 5KFAA 4XPEA 3E01A 5CCLA 4PR6A 5B0CA 3PY8A 2BZ2A 3R97A 4YY3J 2N82B 5D4NA 3RGIA 3TAMA 4F4YA 2LVWA 2C2MB 3PXGa 2HFVA 2WBRA 3OUYA 2GMJA 2HNDB 3J7A1 5KFLA 1F5CA 3MMBB 3D9BA 3UD5A 2M2BA 4H4MB 3T5KA 1EZZB 4NZ7A 1QSYA 3G87A 5C42B 3CDAA 1UWBA 3TJ9A 4I4BA 1CBKA 4X4RA 2A3JA 3BBBA 1BE4A 1RLDA 3QFWA 2VPWB 2WW8A 3M2RA 3SSRA 2W7AA 5C5JA 3R7SB 1XJWB 4DV2J 1HBNA 2K06A 2AZ3A 2EXUA 2V50A 1FA0A 3MI7X 6FD1A 4F0HA 4DFKA 2EVZA 3HKWA 4L75A 3MM7A 1BUXA 1HI8A 5LMNJ 2M3DA 1VC6A 2E9ZA 1NMEB 3JTPA 4J90A 3JSRA 2WZ1A 2IDLA 2R7OA 3FGVA 2XQCA 4K4ZA 2KZMA 5KFOA 1UVMA 2HS4A 2XSFA 1FVQA 3KLIB 2PIIA 3K57A 1C1BA 1XMOF 3KUGA 5E33A 1SJ4P 4YR3A 1PC4A 2VG7A 1I6JA 1TAQA 2GJ2A 1LWFA 4LR7A 1VQLS 2ZVSA 3KK2B 4RUBA 2J9DE 1M0SA 4CO0A 1S1UB 1P9YA 4WZMA 2GNKA 2GO8A 3QWPA 4MKAA 1SB6A 1NPPA 1SQGA 1TL1B 1NZAA 4E8UA 4Y2AA 4OX7A 5E41A 3CNQP 3R7NB 1PYOB 4TY8A 4DS4A 1O8BA 2YQ3A 3T6JA 2PSZA 4X62F 1UAWA 4HDHA 4YDXA 3BN4A 1T9YA 4PG7A 3MMCA 1RHKB 1YBAA 4ILRA 1KVKA 4B9VA 2ABYA 2VG5A 1TFYA 2GVDA 2WTFA 2J0WA 5C24A 5CYJA 2BE9B 5IM0B 4F4WA 2FY8A 4DI6A 4L73A 3CCWA 2QO3A 2NUUG 5E7OB 3OTBA 4P2FA 1RT5A 2IJFA 1X0PA 2ALYB 2JHEA 4ILMA 1NJXA 4CYUA 1VQKS 2HHSA 1V6HA 4DR6J 2BJ1A 2X3DA 4OYZA 4LF9F 2DRDA 3AJDA 3MR2A 4ID5A 2AF6A 1AUDA 4NI2B 1MWZA 4JI1J 4QW8A 1UEUA 2HRUA 4JI7F 3R5GA 1V3SA 4NMXA 4Y2CA 2BXJA 1LW0B 3KWMA 1HBUB 3NCRA 4YB1P 2LU1A 3R7BB 2ZC3A 4RW7B 3MFHA 2ZBPA 2JC0A 2CUYA 3VQTA 1FERA 1UKUA 2QZ8A 4CO5A 4URQU 3VAMA 3MDFA 2V0NA 1REGX 1RBAA 5K14A 5F9NA 4ZVHA 2RMLA 4QWDA 1IJFB 3IGNA 2VHGA 5HLFA 5KFUA 2IPOB 1H98A 2O66A 2M5YA 1F3FA 3HI9A 3T1AA 1LWXA 1UVNA 3MEEB 3OT9A 3T5JA 1GEHA 1DLOB 4DL3A 1CLFA 4QIEA 4RW8A 4HH0A 4O4RA 5C2CA 3DOLA 3MOJB 4USVA 3I0RB 4DX6A 3QRPA 5DDRC 4A8KA 1N33F 3QBCA 5DQGA 1R43A 2M70A 3M9MB 3G4SS 1YZ7A 4C8KA 3B4DA 2J0XA 3CUNA 1EKRA 3AA9A 2OIHA 1HYSA 2CKWA 3C15B 5EX0A 1N32F 3MEDA 1XIQA 4G3IA 4M5DA 4KO0A 5KFVA 4GO5X 4LRBA 1DJ0A 3U27A 3GJRB 1RHQB 1FE0A 4ITSA 5IXUA 2RDJA 1CJVA 2R8IA 4IH5A 3SBMA 3FEXB 1JLQB 4K4XA 4UZCA 5HVFA 2YPZA 4TQRA 2DKOB 1I5OB 5B09A 4CO4A 3TJAA 1RE1B 1WDTA 1A7GE 3PW7A 2V4RA 5F8MA 4DV0J 1AXQA 2R7VA 2IYGA 1UPPA 1FKPA 4FYXB 5HJYA 5DM6Q 3WDOA 2F3JA 4K4WA 3EZ5A 2ZH2A 3W3SA 3IR6B 1RKIA 1I51B 3L09A 3SQGA 1KWMA 4L3KA 3OHAA 2M7SA 3MUVP 3EYZA 4P72A 5EGYA 3HKZD 2M4MA 2C2ZB 1H6KX 2EWHA 2DR5A 4RUAA 3BPDA 1RT7A 4KV8A 3JSMA 4RNFA 1LKZA 2KXHA 2CPDA 4EBCA 1ZPWX 1VIOA 3G8SA 2LU2A 3MUMP 3GFYA 1HQUB 3NMRA 3GR0A 4QPTA 4DV1J 3Q8QB 4R5PA 1S49A 3OL7A 1WC6A 2DHAA 2MHEA 3AOCA 1S1TA 5SZTA 1UFKA 2H51B 3FK4A 2MKCA 4AUKA 3VZIA 2HHTA 3C14B 1R3NA 3VR1A 4DQPA 2ZZTA 3GYXB 1YI2S 2FJWA 3MR7A 3KLGA 4K59A 3NCQA 2JL9A 2PC6A 4HI1A 2ZH7A 1SL0A 2Y8WA 4QYZK 1S0MA 5FLXU 3CCRS 4ZS6A 4O3OA 1NHVA 2J0SD 2BM0A 3C3LA 3KLVA 4DL5A 1S6QB 3DOKB 4CO2A 5AE3A 2KXFA 4K4YA 4OHVA 5DZ6A 2C3OA 2FLPA 1L3TA 3ZZYA 1FT8A 1BD6A 1RWMB 1WC0A 3T41A 1GMVA 4OHZA 2V2QA 3MGJA 1PKUA 4LF7J 4IKAA 1BQMA 3GSIA 4A8QA 1IVZA 3NGSA 2CPZA 4WBFA 4A8MP 3JSBA 4X65F 2IVFB 3OVSA 3TP2A 3T9ZA 2B0GA 1M5KC 4NEZA 2WVFA 1CPZA 3PZPA 3I4HX 3D5MA 3EGNA 3EDRB 5KG6A 1REVA 1X4GA 4O23A 2RNEA 2B7BB 4DR7F 2MMYA 1YK9A 1FRHA 2CQ0A 2OELA 4MK7A 1HWUA 3ENAA 4YOEA 5KFJA 5ITHA 1FE4A 5B0DA 2HK2A 4JB8B 1TFWA 1N34J 5HMZA 3MTKA 1Q1KA 5KG7A 2HIYA 2OTLS 1NH7A 3UNYA 4ILLA 4HTJA 2IIHA 4DG1B 3C6TB 3T1HF 1IJEB 4J9OA 1IKVB 4JI4J 2MKIA 1VK3A 4RJVA 2AZ1A 3ICLA 1RUSA 4B9MA 3OBIA 1JX4A 3HVRA 1G3OA 1QTNB 2PN6A 2WHOA 3KHLA 1FRMA 2BJDA 4B3TJ 3D28A 2E1AA 3EZOA 3G6YA 1TR0A 2KO1A 4USHA 2BMBA 3H2UB 2XO7A 2VBWA 3M8QA 1VQ5S 3BR9A 4ZLJA 2Z2LA 1CQNA 1R8AA 5IV3A 3MUTP 1CJUA 3ZTOA 2FGOA 2QT7A 4URSA 4NLPA 2ASYA 2KYXA 3POTA 1RU1A 1WD6A 2E5GA 4I67A 3QLHB 4NLVA 1LK7A 3CCES 1MLAA 1LNQA 3FEYB 1VBXA 3UDCA 2Y1IA 4RNHA 3CJKB 3CD5A 3MR3A 5THWA 3K59A 2CQGA 3H8YA 3QQCD 3HHLB 1FNMA 2C22A 4UOHA 5IS2A 1N36F 3CE8A 4GC6A 4ZKAA 1MMLA 1H3DA 2A6OA 3M32B 4H54A 3PW4A 1PG5B 3CMQA 4L3NA 1KS2A 2R42A 2YKNA 3ENQA 8AT1B 2HPUA 3VAGA 1RTJA 3CJ4A 4A8YA 5A8WA 1EKSA 2RF2A 1TKTA 3TO8A 4MJKA 2DVIA 3OTDA 1F1BB 3OL8A 2G0IA 2UUTA 1IM4A 3HXMA 4EYHB 3NG8A 4EO6A 1N5VA 4R8UB 3K17A 2FJAB 4YY3F 3ISND 1VLOA 5FJ4A 2XS7A 1VJQA 2Z2ZA 2B8PA 2KG0A 2YWWA 2HEKA 3FBBA 2OPRA 3T3FA 3DLHA 1UETA 3R5AA 4OYWA 3U1NA 2QA1A 4FKXA 1NPRA 4ERDA 4K0KF 1GT8A 2C3MA 3CIZA 2OEMA 1FEHA 1S12A 3I9ZA 4ICLB 4DV5J 3BSCA 3P6YC 2VASA 3F73A 2AV5A 3G82A 1UJ6A 2YPYA 2DO0A 3M1VB 3JAMY 4OL8A 2JLGA 4ZJOA 1G4CA 3KDOA 1IBKF 5RUBA 4S0MA 5ETLA 2J9DA 3K5LA 4YDDB 4OI6A 4DCJB 1W2BR 2R7UA 3MEGB 2OUGA 4CLTA 1OQ6A 1OY6A 3IBWA 3QZ8A 5IT9U 2LDYA 2I6WA 3ZZUA 1FDDA 1KLMB 1WORA 3KMSA 1FKOA 3OQ2A 2KT2A 1RAIB 4ZPVR 4O44A 1JKHB 3KLHB 1IXKA 1S99A 5D0RA 4QYRA 1Q53A 4LFAF 2BJ3A 3MD3A 1PCAA 3NMAA 4DBQA 2QA2A 3PV8A 1UMJA 4OMFG 2O1PA 4LBIA 2K3KA 3GMGA 1HNZJ 3FQKA 1VS3A 3SCJE 1WJ9A 1UZDA 3DDIA 4IDKB 3NLCA 3CCTA 2MZQA 1D9DA 3LPYA 4O3QA 2IC3A 2AJFE 2CZ4A 5J1EB 4EBEA 1RBLA 1RABB 3OV7A 2DEIA 3K58A 3J80U 4DR2F 1OY8A 1HA1A 2ZE2B 5HANA 1R6VA 1VK8A 1EJ7L 1ZPVA 3TW0A 3OL9A 3OFGA 2I8EA 1TKZA 3GJTB 1E6YA 3CJTA 5BYRA 4W92B 3B8HA 3GJQB 4QZVB 2DISA 4ZIVA 3U1MA 3LGMA 1P1LA 4YP3A 3O3LA 1R0CB 3EX7B 3KK1A 1B0TA 3G6VA 4G1QB 4Q8EA 1NK5A 4WKRA 1P27B 3HHDA 1C4AA 2UV8A 2UUAJ 3QGIA 3ETOA 1PILA 1YJUA 5LL6d 5KFRA 4WF9Q 1ZA2B 4JI8F 4KQZA 3SCLE 1VQ6S 3HZGA 3V4MA 1I1GA 2EFGA 1IN0A 3BEGB 1DTTB 2NZCA 2DNHA 5LM7E 4BHQA 1GAOA 2W8KA 4FNHA 2CQHA 4JI1F 3DHXA 4DV6F 4MYUA 1TKDA 3UN3A 1WEXA 2Z0GA 1ZTTA 4M94A 1T9WA 2RHQB 4W98A 3R1HA 1TV6B 3KHRA 1FFSB 1X60A 2L9WA 2LQBA 3FZBA 1WOSA 2DNQA 2DR9A 2KM8B 4ZPTR 4UY8T 2AGQA 4B9UA 2XLJA 4Q2LA 2MQMA 1OMSA 1T9XA 5LSOA 2IVYA 3TZZA 1JLEB 3GIKA 3KJNB 2WBMA 4XO0A 2CG8A 2W4DA 4QOTA 2Z56B 3SFGA 3I5BA 1SKWA 4YMEA 4X4TA 2GA7A 4LSNB 3LWMA 3CMAS 1RT6B 5J1NA 1DAXA 1B7FA 1JLFA 3NNAA 2ZOFA 1S6OA 3W2WA 1VLYA 3GFXA 1WHXA 1R8PA 1RDRA 3ETMA 3DGVA 5A0YA 2ZJQQ 4JYAJ 3HD2A 4PG4A 1W2IA 2IA6A 4YS2A 5HN0A 3JSYA 4GKKJ 2HHHF 2J5AA 4YHHJ 1NM2A 2YKMB 5CHCB 3RTVA 3V2UC 4ECXA 2R2TA 1YSJA 3THPA 1P1TA 4MKBA 1HNWF 3W9HA 1RQ0A 1Q8IA 4RW6B 4TNOA 3TZXA 3M8PB 1DQ9A 1KQFB 1VBKA 2LCWA 3EWGA 5FDLB 5DZ7A 1RT1A 2QMXA 2WVBA 3Q8RB 4OHXA 4C0OC 3E01B 3PYFA 4IO9Q 2KH9A 4NCBA 2F9JA 3H25A 4N5SA 1PIEA 5LSRA 4R0JA 3M6UA 2UUBJ 3P5BP 3OUYB 1ULRA 4LF2A 1FO1A 1NU4A 2N4DA 4DV3J 4TYAA 2HQGA 3N6NA 1R7IA 2BQRA 2HNYA 1WWHA 5KFYA 2FLNA 2DK2A 2B9YA 1P9QC 3L95X 4Z37A 4Q8FA 3KXDA 3UO0A 1VQYA 2H5EA 3G2XA 4ZCIA 1UWBB 2EI5A 3IWXA 3BGOP 1CG2A 3UCUP 2QMWA 1OWXA 2H1YA 1F60B 2G9OA 2CJ9A 3M2RB 3BQ2A 2UXCJ 1V3ZA 3UWTA 1F2HA 1X4AA 1VMBA 3V5RA 1HBNB 1UTAA 1T11A 1Z4UA 4RBTA 2RILA 3MCNA 3OTCA 1R31A 3US5A 2OSRA 1G6BA 4ECUA 1SH3A 2R7TA 3IWNC 4KFBA 1NJYA 2B9EA 5LSLA 3VGTA 1APSA 1S97A 4I2PA 3UN2A 5K20B 1F9FA 2W01A 2RQCA 1YIJS 4RNMA 4M5NA 3G71S
chains in the Genus database with same CATH topology
1SPBP 1R6VA 3AFGA 3SQOP 4K8RA 1V5IB 4YN3B 3BPSP 3P5BP 3QFHA 1SCJB 2ZWOA 3GCXP 2E1PA 2Z2ZA 3A3PB 2XTJP 2Z2YB 2Z57B 3GCWP 2W2OP 2PMWA 4NMXA 3CO0P 2W2NP 1ITPA 2Z30B 3A3OB 3BGOP 3WHIA 2ZWPA 3VHQA 4NE9C 2Z56B 4OV6A 3VV2B 3WIUA 3WIVA 2W2PP 4JP8A 3A3NB 2W2QP 3H42A 3CNQP 3T41A 2QTWA 2W2MP 2Z58B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SPB P;  1R6V A;  3AFG A;  3SQO P;  4K8R A;  1V5I B;  4YN3 B;  3BPS P;  3P5B P;  3QFH A;  1SCJ B;  2ZWO A;  3GCX P;  2E1P A;  2Z2Z A;  3A3P B;  2XTJ P;  2Z2Y B;  2Z57 B;  3GCW P;  2W2O P;  2PMW A;  4NMX A;  3CO0 P;  2W2N P;  1ITP A;  2Z30 B;  3A3O B;  3BGO P;  3WHI A;  2ZWP A;  3VHQ A;  4NE9 C;  2Z56 B;  4OV6 A;  3VV2 B;  3WIU A;  3WIV A;  2W2P P;  4JP8 A;  3A3N B;  2W2Q P;  3H42 A;  3CNQ P;  3T41 A;  2QTW A;  2W2M P;  2Z58 B; 
#chains in the Genus database with same CATH topology
 1HMV B;  1XER A;  2PA3 A;  2CWX A;  3MM8 A;  5J2P A;  1XEZ A;  2Z57 B;  3G86 A;  4X64 F;  2JC1 A;  4NE9 C;  4EK2 A;  5GMD A;  1ELO A;  3HDS A;  1TL3 A;  4KH1 B;  3FQL A;  1FXR A;  1PBU A;  3B54 A;  2CAD A;  2VG7 B;  1IBL F;  4JV0 A;  1AB8 A;  1KHW A;  1YLX A;  5D6G A;  1LWF B;  2A0F B;  1RAF B;  1YBU A;  3PJX A;  4M5K A;  4NXM F;  3PIO Q;  4RW4 B;  1WAC A;  2KRR A;  5AE2 A;  4LF4 F;  3VAF A;  4BC9 A;  4CLS A;  3K0J A;  1FX2 A;  5DET A;  3O1L A;  2ZNZ A;  1VQP S;  3LA0 A;  1RI7 A;  2HS0 A;  2GGP A;  4BBY A;  4DR5 F;  3L7U A;  4QWE A;  4X4S A;  4ZA1 A;  2W9A A;  1R6Y A;  4F3O A;  2CVI A;  3HHL D;  4ZLL A;  2IM2 A;  4ZJL A;  4FYV B;  1V9O A;  3MMC B;  1UJ4 A;  1S9G A;  4V19 X;  2CA9 A;  1QD1 A;  2KB2 A;  2VG5 B;  1M5O C;  2QLX A;  1IM6 A;  5C24 B;  4DUY J;  1YTY A;  2D3O 1;  2KL8 A;  4CLW A;  4HHJ A;  4BC7 A;  2HND A;  4WU2 A;  4GKJ F;  1RT5 B;  2KFZ A;  3CCS S;  4U7U K;  1H7W A;  1RWV B;  4CYU B;  3EUN A;  5D0H A;  2HHU A;  2H4Y B;  2LA4 A;  4PXD A;  1H2T Z;  5EWG A;  4JI4 F;  5CQG A;  2HLU A;  2B5J A;  3R9L A;  4ID5 B;  4NLG A;  4OYI A;  4KHM A;  2H54 B;  2XEX A;  5H9F K;  3CDW A;  1U2R A;  5MLC V;  3DRR A;  4ZJQ A;  3TEG A;  4ZVR B;  2D3O R;  1I94 J;  1RAJ A;  4ZVS B;  1DQ8 A;  2D1C A;  5L1I A;  5C25 A;  3V4I A;  4C0H A;  1L3S A;  5K14 B;  3PKM A;  5LXY A;  3QIP A;  1RT4 A;  4CM0 A;  3RR7 A;  3M9O B;  3S6E A;  1M5V C;  1W7W A;  3BB5 A;  5HLF B;  4C6A A;  5H9E J;  4U96 A;  2ATC B;  2ZUG A;  6FDR A;  1BXN A;  3FSI A;  3RAM A;  1NDP A;  3UCZ P;  5F3Z A;  4OV1 A;  3HFZ B;  2V5H G;  1JLC A;  2JEJ A;  1X4C A;  3N9U C;  2R7X A;  4NRT A;  4RW8 B;  1NKC A;  1XMB A;  1YVF A;  2LEB A;  4JI0 F;  3KHH A;  1RAD B;  2DIU A;  4CNY A;  1N52 B;  3IO1 A;  4RU2 A;  1CQM A;  2P2C B;  1YJN S;  7FD1 A;  4OZ5 A;  2CQB A;  4MKY A;  2UXB J;  1WEY A;  1HYS B;  3VVT A;  3MED B;  4M5D B;  4KO0 B;  1SJ3 P;  3M2V A;  5ADZ A;  2OFG X;  4UTG A;  4WIQ A;  5KFK A;  2DT9 A;  1CJV B;  1N0V C;  2AYB A;  3A1Y G;  4LVO P;  2OSQ A;  5KG5 A;  1U47 A;  3QO9 A;  3CC2 S;  1WKJ A;  3BBF A;  2VFU A;  3CPW R;  4RBU A;  3DYA A;  4QR0 A;  3GJS B;  1S0N A;  3EM1 A;  2Y1L B;  3J81 U;  2IRU A;  2HBQ B;  2AMC B;  4HHH A;  3J7Z 5;  3QFH A;  1FKP B;  5KT2 A;  1XMQ F;  4UQG A;  7FDR A;  1OPI A;  3FBE A;  2ILY A;  3FDS A;  1O6X A;  2AKW B;  2DNP A;  2XWY A;  3KYL A;  8ATC B;  1YKW A;  3I4P A;  3LP1 A;  2QG9 B;  4UQT A;  4KIA A;  2EK6 A;  1WC3 A;  4ZVQ B;  2BE2 B;  1TL7 A;  4KV8 B;  4CNZ A;  2BX6 A;  4JV5 J;  1KDN A;  1Y0H A;  2CG4 A;  3W61 A;  2CZV C;  1RYS A;  1XTZ A;  4U95 A;  4NXN J;  2Z4P A;  2B43 A;  1VRU B;  3PNI A;  3OFF A;  1WG5 A;  1FF2 A;  4R5P B;  5E3Q A;  4FF3 A;  1N88 A;  3D1H A;  1S1T B;  1HBU A;  1WG1 A;  2XMU A;  3R8Y A;  3PIP Q;  5CH7 B;  2E1C A;  3M7V A;  1QLN A;  2M52 A;  4JI6 F;  5H1S V;  3HLU A;  2IM0 A;  2P6S A;  4NA2 A;  5D77 A;  3TAQ A;  1FJG J;  3MAQ A;  5B08 A;  1S6P A;  3EGZ A;  1Y00 A;  5HRO B;  5HMW A;  2XNR A;  3VAH A;  5IWA F;  4OZ3 A;  3KLG B;  1KKH A;  4EU0 A;  4ECY A;  4NLY A;  5KG2 A;  4XDD A;  2AGP A;  3V6D A;  5KFH A;  1CEZ A;  3LAL A;  3UR3 C;  5A8K B;  1HQ2 A;  1Q8K A;  3L7P A;  3B78 A;  4JI2 J;  3I0S A;  1ARO P;  1DLO A;  1Z2Z A;  4CH1 A;  3MMJ A;  4DQR A;  3ZTR A;  1RGV A;  1EQ0 A;  1YGY A;  1X31 C;  4CIO A;  2E66 A;  2JLE A;  4PWD A;  4QJV A;  2ZH8 A;  1RWW B;  4J9P A;  5F3T A;  2NUH A;  1TUV A;  3H90 A;  1BQM B;  2PDA A;  1NHU A;  1S5Z A;  2XSJ B;  3ILO A;  5E3C A;  2GC8 A;  1LFP A;  5L46 A;  3BO3 A;  2NRE A;  2GCF A;  3QPI A;  1L3U A;  4JI3 F;  1H7X A;  5G0R A;  1R89 A;  2B4O A;  1JLQ A;  1UL3 A;  3HFK A;  2HRY A;  5KFX A;  3M9N B;  4OI3 A;  2ERR A;  2OPS A;  2MGZ A;  2W8L A;  5LMU F;  4DL2 A;  1REV B;  3PM9 A;  3GCX P;  2ZM6 J;  2BA9 A;  1NO8 A;  3FCH A;  3A8E A;  4ECW A;  2V4J A;  2C42 A;  4TYB A;  4M5M A;  1PYS B;  5K8P A;  3SYZ A;  2EG1 A;  3CTR A;  1YJT A;  3IM9 A;  4OJ3 A;  2OH2 A;  2LQJ A;  1GMW D;  4RNO A;  2WVC A;  3DXS X;  4WP3 A;  3TAN A;  1EAR A;  2W2N P;  4F8R A;  3MEC A;  4H4K C;  3MHY A;  2ACY A;  1GMU A;  4DU8 A;  3C6U A;  4ZVU B;  3SZ2 A;  2EK1 A;  1HBM A;  4LSL B;  2APO A;  4MK8 A;  4LIW A;  1U24 A;  1UPM B;  1FWK A;  2D3U A;  1S0V A;  5EWF A;  3CJR A;  2CYY A;  2FY1 A;  5HQ8 A;  1WDD A;  2K8G A;  4DOZ A;  2EKN A;  2WVD A;  3H4D A;  4DUT A;  4P73 A;  1UA1 A;  3ZNJ 1;  4A8S A;  3AJ2 A;  5FLX Y;  3M8Q B;  2OML A;  2B51 A;  1KBR A;  3BKU A;  1Y5N B;  4KBI A;  4ECV A;  4NX9 A;  1CJU B;  2AYE A;  3C14 A;  4FVC A;  3QGH A;  4RUH A;  2VQF F;  5CD4 A;  2EW9 A;  3QAU A;  3MUR P;  2IA0 A;  3OSP A;  1FNO A;  3GE9 A;  4QWC A;  3FBF A;  4WP9 A;  3BSA A;  2BAC A;  2OLW A;  4ED6 A;  1FHT A;  4WFA Q;  3DCA A;  2CQC A;  3N01 A;  3JXO A;  1TP7 A;  1GTE A;  2R7R A;  2DPI A;  3TR5 A;  4GVL A;  1RHJ B;  1XMO J;  5AE1 A;  4DR1 F;  2XBP A;  2KN4 A;  1B70 B;  4ZPB A;  3MPV A;  1J5E J;  4ZPW R;  2YKN B;  2KU7 A;  1RTJ B;  5CD4 H;  5A8W B;  4ELV A;  2HAI A;  1P8G A;  2RF2 B;  1TKT B;  3MPU B;  2M0G B;  1VFJ A;  5IQ6 A;  3HF5 A;  1TL5 A;  1LEO A;  3BV8 A;  3PYG A;  3J81 j;  3GLJ A;  7AT1 B;  2VFT A;  1WG4 A;  3CJQ A;  5DG8 A;  4X62 J;  3PHT A;  2UUB F;  2R7S A;  1A6L A;  2RU9 A;  2XI3 A;  3SCK E;  3B4M A;  2QTW A;  3PEH A;  3ET6 A;  3S8S A;  2CWK A;  2OHD A;  2KVQ E;  1DQA A;  4OJG A;  3HHK A;  4F02 A;  1HI1 A;  4DF8 A;  2I9S A;  1RBO B;  3VGV A;  2V4Q A;  3BM7 A;  4DS5 A;  4LRE A;  2UVW A;  4DG1 A;  8RUC A;  5EN1 A;  3G82 B;  2MZR A;  1WEZ A;  3QID A;  3CDE A;  3HHL C;  5L1K A;  1U4B A;  4LF9 J;  4DN9 A;  3A13 A;  3CJ2 A;  2A2C A;  1RHM B;  1VRT A;  2ZH3 A;  2XCA A;  1EET A;  2CJA A;  4JI7 J;  3W5Y A;  2P6T A;  3CDU A;  4F25 A;  2VBY A;  2VIH A;  1FKO B;  2HBR B;  2KG1 A;  4PG6 A;  1C0T A;  4WFX A;  4RNN A;  4O44 B;  4PKD B;  5F9L A;  3CT9 A;  5M2R A;  1FNX H;  4DV7 F;  4L6V 3;  3JQM A;  2W4C A;  2CIM A;  3DRP A;  3VGU A;  3KG4 A;  2RKI A;  1O51 A;  3DLL Q;  1PC5 A;  2U2F A;  2F4V F;  1T03 A;  1SI9 A;  2BOA A;  2X7I A;  2YWK A;  5L8R C;  3G6E S;  2YNF B;  4CLK A;  4U7C A;  3CIM A;  4WZQ A;  4LT6 A;  4Y2M A;  4E0D A;  3SFU A;  1WOP A;  2IC3 B;  3CSK A;  1NEE A;  4KGM A;  5DM7 Q;  3OLB A;  2ASD A;  3NNH A;  4FXV A;  1RAO A;  4WYW A;  3M32 A;  2Z2M A;  4J9N A;  1N32 J;  1Q82 T;  1ZH5 A;  2UVR A;  2L9D A;  4LBH A;  1TAU A;  2XMV A;  3R6G B;  4AQY J;  1JJC B;  3PAC A;  1B4S A;  1RWP B;  5F8N A;  1TKZ B;  1Q81 T;  4B3O A;  1E6Y B;  2I2Y A;  1K0T A;  1S4E A;  2VOP A;  2E1P A;  3K2Y A;  1AFJ A;  4DWI A;  2LXI A;  3FJ2 A;  3BDE A;  3IS9 B;  4R8U A;  4ZHR A;  3M6V A;  1GK8 A;  2D9O A;  3Q2S C;  1TUG B;  3TAP A;  4ZPA A;  3KK1 B;  3BH7 B;  3AOB A;  4XIU A;  2CQ1 A;  2VL1 A;  1S72 S;  5HI7 A;  4EFA C;  4NLU A;  2W1B A;  2PGC A;  3LP0 A;  3BO2 A;  3W66 A;  2VC1 A;  1OO0 B;  2GMH A;  1TK5 A;  1FCA A;  4B9L A;  2G2O A;  2OD6 A;  1YIT S;  2KHC A;  4TQS A;  1VBZ A;  3WC2 A;  3OXG A;  3OR2 B;  5L38 A;  1N56 A;  2ALZ A;  4N47 A;  3DRS A;  4M1K A;  5IT9 Y;  4MK9 A;  4OLP A;  3PDN A;  3N79 A;  1IR2 A;  2MKK A;  1SJR A;  3NGR A;  2FD2 A;  3VVU A;  3AHP A;  2XCP A;  3WIU A;  1M1G A;  2DCU B;  4X84 A;  3NAH A;  3OXL A;  4NCG A;  3EMT A;  2VON A;  1CJT A;  3MCO A;  3G9C A;  3GB0 A;  4P75 A;  4AL6 A;  2BJE A;  4AXJ A;  2AD9 A;  4C8Y A;  2HFS A;  5I3P A;  2CRL A;  3KLH A;  2B8Q A;  2HVI A;  4PUO A;  3K8W A;  3CO0 P;  1JLF B;  1RWN B;  4HVZ A;  4JV2 A;  3DLK A;  2HVD A;  2R8J A;  2YX7 A;  1D8Y A;  2CXE A;  2ZVI A;  2OAU A;  3THT A;  1WHW A;  1UWA A;  1X5T A;  4LQ3 A;  3ZXW A;  4TY9 A;  1SC6 A;  4J9S A;  2QIF A;  1N0U A;  4OFZ A;  5ETV A;  5HBM A;  3GV7 B;  1YJ7 A;  1E6V B;  4XTT A;  2BR0 A;  2KRB A;  2J8A A;  1Q7L B;  3X3U A;  2F8H A;  3KUH A;  1DHM A;  4X65 J;  2K1R A;  2MTL A;  1RT1 B;  3M30 A;  2MQQ A;  5B0E A;  4RWW A;  2MXY A;  1RCO B;  3BGL A;  4ECZ A;  3NGU A;  2JNJ A;  5E3A A;  2KM8 C;  2DYA A;  3CF5 Q;  5E2Q A;  1NAQ A;  1HD0 A;  2YWG A;  2HAF A;  5GAH U;  5KOW A;  1VQ7 S;  2FPH X;  5GAD U;  3WX4 A;  3ZO7 A;  1UA0 A;  4DR7 J;  3CGI A;  2HNY B;  3QSY B;  3CUL A;  2Y0S D;  3HSD A;  3ZNU A;  3T19 A;  4DN0 A;  3A3P B;  1DTQ A;  2C1E B;  1TK8 A;  2RUG A;  3MCS A;  2Y0B B;  1B3T A;  4ZMM A;  4KC5 A;  4DUZ F;  1U1M A;  4B9T A;  4Q5V A;  3T1H J;  3KJQ B;  4ES1 A;  5CYM A;  1YJV A;  3PX6 A;  4NLD A;  1S1V B;  2XLI A;  3Q8Y A;  1Q5V A;  1AUS L;  3GCW P;  4YB7 A;  4KFB B;  4OYA A;  3QT6 A;  2HQ3 A;  2VC0 A;  1Y11 A;  2HMI B;  3VF0 B;  5HQM A;  4L74 A;  5F0U A;  3KG0 A;  3T5L A;  3SSS A;  5IC4 B;  5GAE U;  4LSN A;  3MM8 B;  5J2P B;  3GON A;  5B7W A;  2E7V A;  3GSD A;  4DL4 A;  4LFB F;  1T02 A;  4Z7Y A;  2JEF A;  3DLJ A;  1QAJ A;  1Q5Y A;  2MLX A;  2HK3 A;  1TL3 B;  2ZDP A;  4RWX A;  4F4Z A;  2E5J A;  2F4F A;  4PCQ A;  1VQ4 S;  2P9C A;  2CNN B;  2F40 A;  3H2L A;  4IFY A;  4ETX A;  1VQM S;  1TL4 A;  2B9X A;  1NDL A;  4I6A A;  1FXL A;  1UP1 A;  2B56 A;  4RR5 A;  2YKM A;  4AL5 A;  1N36 J;  1LWE A;  1P6T A;  1D0E A;  1SQF A;  2CNL B;  4DX7 A;  2AEM A;  2BAB A;  2Q3P A;  4IH7 A;  3UR0 A;  1S7H A;  3BRE A;  2JLF A;  1IKX A;  1V5I B;  3T6B A;  2XHC A;  3M8Y A;  1T3O A;  3FNN A;  2HRT A;  1GXU A;  1RTZ A;  2FGC A;  4OZL A;  1UVI A;  2KXN B;  5DGA A;  4GVB B;  1X7V A;  1AFI A;  2FYX A;  1S9G B;  3D3B J;  4DR3 F;  2NYI A;  1MSW D;  3ONQ A;  2MJN A;  2XNQ A;  4WE1 A;  4KY3 A;  1ZM2 A;  3IG1 A;  1PYT A;  2F9D A;  4M5L A;  1W25 A;  2DJW A;  3QSI A;  1QVF R;  2QL9 B;  5G4D A;  4WFZ A;  1JJH A;  5T7L A;  4IH6 A;  3CCQ S;  3QGG A;  3D7S B;  1KTV A;  1J2V A;  2F7V A;  2L48 A;  4HTI A;  5J2Q A;  5KAK A;  4K0K J;  1Y3K A;  4DPY A;  2DNZ A;  4ZCK A;  4WXW A;  1XN9 A;  4PEO A;  2B5J B;  1TEL A;  1M1H A;  1HNI B;  1MWQ A;  3EGV A;  5BR8 F;  4B02 A;  2E1M C;  2NXC A;  1U09 A;  2NQP A;  3VAL A;  3DRR B;  3RBE A;  3GWC A;  2GIR A;  4IOA Q;  1VQ8 S;  5ETT A;  3PJ9 A;  1TTH B;  2IVM A;  1VGY A;  4FN5 A;  4CRJ A;  3F41 A;  1IBK J;  2YQ1 A;  1Q79 A;  3RBD A;  2NR0 A;  2YY3 A;  5C25 B;  4ZVT B;  2GX8 A;  3JYT A;  3LGH A;  3V4I B;  3W62 A;  3UN5 A;  5AXN A;  3DI6 A;  3HT0 A;  5CAB A;  3ZTS A;  3QIP B;  1RT4 B;  2B3T B;  2DR8 A;  1OYE A;  5F8J A;  4F0K A;  5CZX A;  5D0G A;  1QVG R;  3D6M B;  5HSP A;  3K5N A;  1HMV A;  3QT5 A;  4LFA J;  1KON A;  3UD4 P;  1JLC B;  2FVR A;  2WB1 D;  2ZKU A;  4CP5 A;  1K47 A;  3AQO A;  4Q44 A;  3KLF A;  1X4H A;  2XMM A;  2HVZ A;  4ED5 A;  4OI4 A;  2EEY A;  2YNG A;  3KJF B;  4QIV A;  1HBO A;  1IUJ A;  4DQI A;  4F7V A;  1J5E F;  4V1A k;  3M2V B;  4WII A;  1XR6 A;  4RW4 A;  4ELU A;  1KHV A;  1K1Q A;  2KFN A;  4DR2 J;  2DY9 A;  3C8Y A;  4NLW A;  4Y28 C;  4I7F A;  2PMW A;  3QO9 B;  1BC6 A;  2VOO A;  2QL5 B;  2J7K A;  5KFP A;  4CQ1 A;  3VWS A;  4F26 A;  4LRC A;  3DYA B;  2WSF C;  3SMZ A;  5IV4 A;  2XTJ P;  2UP1 A;  4DX5 A;  2O67 A;  4DPW A;  1RWU A;  2BM1 A;  2HFN A;  2AJ1 A;  3NL0 A;  1QUV A;  1BWE A;  3BSO A;  1GH8 A;  1S77 D;  1NSK L;  3H40 A;  2MHN A;  4LRA A;  2BVZ A;  3TUZ C;  2ASJ A;  3HHN B;  3THV A;  4O3S A;  4K50 A;  1WF1 A;  1URR A;  3NAI A;  2PFF B;  3LP1 B;  3CED A;  3TVY A;  1RTD A;  3WX8 A;  4JI8 J;  3A8K A;  5E5N A;  1RCX B;  4LF8 F;  1TL7 B;  4RO0 A;  1RJJ A;  2W9B A;  4P2M A;  2LQ5 A;  2HGM A;  3R3T A;  4URG A;  4Y65 A;  3VGS A;  1S1X A;  4B3R F;  4PG5 A;  4DF4 A;  3MF5 A;  3UI3 A;  1VI7 A;  3R5B A;  2DH8 A;  4DV6 J;  2AX0 A;  1RB0 A;  2AJ0 A;  3H7H B;  1WTB A;  2J7U A;  3OD2 A;  5J2N B;  3L3C A;  4WJB A;  1R8C A;  1UVK A;  4MAK A;  3KHG A;  3CCL S;  4KRW A;  2QYG A;  1OS5 A;  2ZH9 A;  2AP6 A;  4LF5 F;  3ELH A;  2BOP A;  4PXB A;  3AQP A;  4CDI A;  1S6P B;  2A10 A;  3DNC A;  1FJE B;  1UJ5 A;  1ACM B;  4F36 A;  3O2I A;  4W4M A;  4OYO A;  3TYT A;  2YX4 A;  2QSF A;  4YN3 B;  3U7J A;  3V6D B;  3ITH A;  1ZS6 A;  2YWE A;  5F8L A;  5K8N A;  4I64 A;  4MMO A;  1CC8 A;  2GS8 A;  3I0S B;  2Q79 A;  2BE7 D;  1X4F A;  4ZVG A;  4HKQ A;  1NB2 A;  3HJF A;  4FPR A;  5M2U A;  1S6U A;  1CC7 A;  3RU0 A;  3PX4 A;  1XK8 A;  3OVA A;  3ULH A;  2OJ3 A;  3HX9 A;  1WC5 A;  3Q0A A;  5ETP A;  4Y00 A;  4PWD B;  5L9N A;  2XS5 A;  2EG2 A;  2ZFH A;  4QR1 A;  1X5O A;  2HHH J;  3J81 Y;  5CCM A;  4N41 A;  4WWS A;  4OZN A;  1G1X A;  4AQY F;  5G0R B;  4HT5 A;  1HNW J;  1U0H A;  1RTI A;  3KK3 A;  3MXH P;  1FWL A;  2WVE A;  2O5D A;  2OPS B;  2HG4 A;  2MGZ B;  1TUW A;  3VAI A;  4LFC J;  4HAC B;  2R3V A;  4B3M F;  1U8S A;  5D4O A;  2V4J B;  3IA0 A;  2RE1 A;  3BDP A;  1HW8 A;  1JB0 C;  1EP4 B;  3Q2T C;  2QN6 B;  1WHV A;  1G7C B;  4N7T A;  1RT3 A;  5EHH A;  2X1F A;  2BQU A;  4YQW A;  2DTJ A;  2E5L F;  2G2Z A;  1X5S A;  3CJS A;  1X8D A;  3MEC B;  2XC9 A;  1EX8 A;  2VDI A;  1J5O A;  4NLQ A;  3K8V A;  1LOU A;  3IN5 A;  1TMJ A;  3C6U B;  3UDE A;  1SJ1 A;  2QRR A;  2BE2 A;  1HBM B;  3C66 A;  2AHO B;  1ZM4 A;  1NSQ A;  2GFF A;  2ROP A;  1NKB A;  4OHW A;  4OYM A;  2Y1R I;  1A0O B;  3Q8S B;  1SXL A;  2D41 A;  4FYD A;  1VRU A;  3PO4 A;  4O3R A;  4AT1 B;  1YWX A;  2ZHA A;  1J27 A;  4F4X A;  2MZ1 A;  1U1Q A;  1H74 A;  2XUL A;  3P8B B;  4AE5 A;  2DNM A;  2V8H A;  3IBC B;  4HLB A;  3SEO A;  5HRO A;  2VF3 A;  3QAT A;  3D1Q A;  4QU7 A;  3D67 A;  1FRX A;  4QIF A;  2OKQ A;  5A8K A;  3W5Z A;  1RHR B;  4X64 J;  4TKT A;  2VBX A;  1QUP A;  1TZ0 A;  4OI0 A;  2EBG A;  3Q8U A;  1MU2 A;  2BJ7 A;  4KAI A;  3GG0 A;  1U1K A;  1XWL A;  1UVJ A;  3EXY A;  1SVD A;  2DD8 S;  1IBL J;  3MFI A;  2FHM A;  2XY6 A;  1NPK A;  3RRH A;  3IM8 A;  3BGU A;  2XY5 A;  2XSJ A;  3WQP A;  4U8V A;  1HNX F;  4NXM J;  3MM9 B;  4KT0 C;  5U47 A;  2A18 A;  4LF4 J;  2XG8 A;  2FJV A;  2H48 B;  2B7C B;  4GC7 A;  3QJL A;  1UEV A;  1JNZ B;  3QAE A;  3BKF A;  3A8I A;  4PAA A;  1HNV A;  1VR6 A;  1N5Y A;  1R0A B;  3DOM B;  4DR5 J;  4C8Z A;  4IUF A;  5HK4 A;  4C9D A;  1RIS A;  1U6B A;  2CJK A;  2LLZ A;  4YR0 A;  2XM3 A;  5E3R A;  3ET6 B;  3LOU A;  4USW A;  2MEW A;  4P2X A;  1U45 A;  3PEJ A;  2CPF A;  4H4O A;  2CAJ A;  3LP2 A;  2NXE A;  1RAA B;  1YDL A;  3LWL A;  4GKJ J;  2B9W A;  4U9R A;  4NZ6 A;  1IBC B;  2BKP A;  1O0P A;  1BQN A;  3RRG A;  2UZA A;  1C2P A;  4DHV A;  4LSL A;  1MW7 A;  1TU0 B;  1BLU A;  2ZUA A;  3A12 A;  3FSY A;  1VRT B;  3IRW P;  4Y2I A;  4EZ9 A;  1EET B;  1B0V A;  2MLZ A;  2JSX A;  3CME S;  2GHV C;  3DLE B;  3MMA A;  5ETM A;  2LEC A;  4WP8 A;  2G0J A;  3O8W A;  1C0T B;  4F67 A;  2IRX A;  4P52 A;  4PQU B;  4DQS A;  3G6X A;  2QA4 S;  2LA6 A;  4QCL A;  3DRP B;  1VOM A;  4O0I A;  3KNA A;  2WSC C;  4DSL A;  3BGR A;  2RKI B;  4MIB A;  3TRG A;  2MPU A;  2D69 A;  2VFV A;  5DLG A;  1T03 B;  4FF2 A;  2IM1 A;  3UDL A;  1IQT A;  2HWT A;  4EMD A;  2XO6 A;  2Q43 A;  1RTH A;  4Z7C A;  3I5C A;  1HR0 F;  3S7R A;  5CZV A;  3RAQ A;  2RB7 A;  3BGF A;  5DS7 A;  4OX8 A;  2Y9H A;  1LV5 A;  4JI0 J;  2CPY A;  3DC2 A;  3IR5 B;  3GYN A;  2R8G A;  1HPZ A;  3Q24 A;  1EHW A;  2AEJ A;  1FRJ A;  2HFU A;  1VHI A;  2FZK B;  1DBD A;  4OX9 F;  2I0X A;  3N5B A;  4NLR A;  1FDB A;  4N8O A;  1HFE L;  1NK6 A;  4ED3 A;  4B3O B;  3IWL A;  1TK0 A;  1H38 A;  2DBB A;  4B3S F;  4ZHR B;  4G6V B;  1VRQ C;  2BW7 A;  3UVJ A;  2RRA A;  4ED8 A;  2MKY A;  2VZ9 A;  4CZC A;  1U1P A;  1Q86 T;  3NGK A;  2IHR 1;  4Y6I A;  1HAR A;  3IXQ A;  1U1N A;  4ZPD A;  5KT3 A;  2IJN A;  2RDD A;  3I6P A;  1XMQ J;  1SL2 A;  2C3Y A;  4ED0 A;  4A8O A;  2X1G A;  3LP0 B;  3F0N A;  3T1Y F;  3EXC X;  3RB4 A;  1KLN A;  1UCN A;  3RB6 A;  5T41 A;  3HO1 A;  1HLW A;  2DGX A;  2A2D A;  3NS7 B;  2M88 A;  3DRS B;  4DCP B;  2KYZ A;  1SBR A;  1QY7 A;  2JX2 A;  4M5H A;  2PMZ D;  2RU3 A;  1WNE A;  4ZLN A;  1T9T A;  2F1F A;  2K3I A;  4KB7 A;  1TVR A;  5KG4 A;  2COL A;  5E3P A;  1MN9 A;  3W63 A;  3LH2 S;  4J7C A;  5A6W A;  3ZZ0 A;  4K8R A;  2CPI A;  4NCG B;  5JVG Q;  1N6Q B;  4I56 A;  2E44 A;  1CJT B;  5K9F A;  5I42 A;  4RZR A;  3TOQ A;  3WHI A;  3TJ8 A;  4NZ0 A;  3TNV A;  2W7P A;  3GIJ A;  2EFO A;  2ZEJ A;  4JI6 J;  3HSG A;  1Y9O A;  4K4T A;  2EFQ A;  4K2J A;  3MPW A;  4OLO A;  4PUO B;  4FXD A;  1UFL A;  1FFW B;  2DCL A;  2V67 A;  3DLK B;  4NYP A;  4DSF A;  5DLF A;  2W2M P;  2QJ3 A;  5IWA J;  1QTM A;  5HQL A;  3OR1 A;  1Q78 A;  4Q2M A;  1ZM9 A;  3P3D A;  1U1R A;  4FPI A;  2YNF A;  5L9X A;  4KGK A;  3A3N B;  3GZ7 A;  4LVN P;  3W9I A;  1LXJ A;  3FFI B;  2FZC B;  2XB2 D;  2KZZ A;  3W64 A;  4P7T A;  4F2S A;  2KT3 A;  1NJI T;  2CQP A;  4TLQ A;  3QJP A;  5HBM B;  1VQ9 S;  2OO4 A;  4ZN3 A;  3D6H B;  4UOF A;  3G96 A;  1NBE B;  1SKS A;  2DGQ A;  4P7V A;  3SXL A;  3DFE A;  5A8R A;  4J9M A;  1ZAV A;  1PJ6 A;  2M8H A;  4EYI B;  4JI3 J;  5I3Q A;  2K1R B;  4Y0F A;  3M30 B;  1HI0 P;  4NWB A;  3OHB A;  1NB7 A;  2ZOG A;  4DX8 H;  4KE5 A;  2LMI A;  2GZO A;  3FMB A;  1DY3 A;  1X4D A;  3EJM A;  3IS9 A;  1HKA A;  2GML A;  2EBE A;  4PWW A;  2QLW A;  5LMU J;  2GQC A;  3L9Z A;  2PE8 A;  2KJW A;  2XZD B;  4C8N A;  2L3M A;  4CI0 B;  3PRB A;  2CDQ A;  2G0C A;  2KDO A;  3Q23 A;  2LQ9 A;  1XNR F;  1Q8B A;  4DFJ A;  2V9K A;  5DQI A;  2RVJ A;  3L7O A;  2ROG A;  4O4G A;  4WFB Q;  2EFP A;  4USJ C;  4RBV A;  1DTQ B;  5KFG A;  3FZ2 A;  2VG6 A;  4HEA 9;  1I3O B;  3K7R A;  3OR2 A;  3FRZ A;  2DY1 A;  3UDV A;  5KFI A;  1NCL A;  4EBD A;  1YX2 A;  2MLY A;  4P6Q A;  3D1O A;  2ZBC A;  2YBV A;  3FBC A;  2FJX A;  2DRB A;  3HP6 A;  2J9C A;  2DH9 A;  2L9N A;  4J9U E;  5CYM B;  3RB0 A;  3BQ1 A;  4X4P A;  3RZA A;  2V63 A;  4ZCM A;  3FUY A;  4GRS A;  3RR8 A;  5KG3 A;  5DDO C;  4RX6 A;  3L4B C;  2UXD F;  2HHQ A;  2RUS A;  2P9G A;  4ETZ A;  3WC0 A;  2OMO A;  1BQX A;  4Y2K A;  4Q0B A;  2HYI B;  2J6S A;  4PXC A;  2Y3Y A;  4JOU A;  1JXL A;  3R6L B;  2RAQ A;  2VDH A;  3IRX A;  3MM6 A;  3J7A N;  2I38 A;  2VQF J;  2G2Y A;  2Q6C A;  2RQM A;  4DPT A;  4CM2 A;  3EGW B;  2LDI A;  1DFD A;  4A47 A;  4MIA A;  1KFS A;  2HZA A;  4C3L A;  2Y8Y A;  2C2E A;  1OJ4 A;  3FRY A;  5CYQ B;  5D78 A;  3PW2 A;  2W4P A;  2GHW A;  4J9L A;  2ZJP Q;  3CCZ A;  4IFY B;  3QMQ A;  4BDP A;  2VB6 A;  4DSE A;  3HCX A;  2I1R A;  4G65 A;  1LWE B;  4JI5 F;  4DR1 J;  1CUL B;  2X1B A;  1F2G A;  3IR7 B;  2V69 A;  1E6V A;  1HWJ A;  5GVQ A;  2V2K A;  1IKX B;  3TQ1 A;  1V3R A;  3TAR A;  2C28 A;  4ED4 A;  5ETS A;  2A6M A;  2UVV A;  5KFW A;  4ES2 A;  3W2V A;  1RLC L;  1SV5 B;  2DNG A;  2HFO A;  1XBW A;  2DGU A;  4LFC F;  3KJV A;  4OX6 A;  4PAB A;  2RH3 A;  4OJH A;  2NSC A;  1JLA B;  5AT1 B;  4WE1 B;  2IJR A;  2ZD1 A;  1HHQ A;  3IG1 B;  1GNK A;  1VBY A;  4B9S A;  1VIX A;  3W60 A;  5IQQ A;  2CJX B;  5T7L B;  1EQM A;  5KT7 A;  1R0B G;  3GTY X;  2YTC A;  1ZOT A;  2MQO A;  3JTO A;  3MR5 A;  2V8V A;  3O6Q A;  1HQE A;  4KGV B;  4K5S A;  1B0P A;  1RAC B;  5J2Q B;  5BXI A;  1H0H B;  2F5G A;  2YKO A;  4I6Y A;  4A4J A;  3T9N A;  4LRF A;  3E3X A;  2KT5 A;  4NLO A;  2G4B A;  2H4W B;  1M90 T;  1KQS R;  2WSE C;  1C1C A;  1S1W A;  1QM9 A;  3NBP A;  4DSJ A;  3HSZ A;  2VA2 A;  2W9C B;  1XQI A;  1S10 A;  4OIX A;  1S1V A;  2X3G A;  4KKO A;  3H5X A;  2YNH A;  3GIR A;  3JYT B;  1K44 A;  3CO9 A;  4J9K A;  1L3V A;  1Y3J A;  3KDN A;  3DI6 B;  2XMA A;  3D54 A;  3UQS A;  2HMI A;  4X4O A;  4YUD A;  4RU9 A;  1YRU A;  2LFV A;  4OYP A;  4F3Q A;  4NRU A;  1KC8 T;  4C11 A;  4ES3 A;  4HH1 A;  3ZZO A;  5KFF A;  1EB0 A;  2XZT B;  2XZW A;  4DV7 J;  2UUC F;  1OIA A;  3VTI A;  2RQK A;  3GG1 A;  1CS4 A;  2F63 A;  3KLF B;  2F4V J;  5MAO A;  4F3M A;  2OTJ S;  4R25 A;  3DN9 A;  3RB3 A;  3Q89 A;  2YNG B;  1F3V A;  1HBO B;  1FK9 A;  2IAJ B;  1VC5 A;  1NK7 A;  3M8Z A;  4FS2 A;  1S57 A;  1WI8 A;  4LF6 F;  1R8H A;  4X2B A;  4IRK A;  2FLL A;  1WUU A;  4RW9 A;  3I56 S;  1W26 A;  2YXL A;  2QE5 A;  2QLJ B;  2FB0 A;  2ADB A;  4I7F B;  2XS2 A;  3WIV A;  2RS8 A;  4EUV A;  4ZDN A;  4W90 B;  2FHK A;  3Q8V A;  1IKW A;  4YB5 A;  1F5B A;  4IQX A;  1FVS A;  2MDA A;  2N3O A;  3W8G A;  3BYP A;  2KJV A;  1RP5 A;  4I2Q B;  1UZH A;  1ZBT A;  3AAW B;  4GVB A;  5DGB A;  1N5S A;  5BYS A;  1VYA A;  4HYK A;  4EI2 A;  3R2C J;  4OI2 A;  1DRZ A;  2UU9 F;  1VIS A;  3G8T A;  1RWK B;  1VC0 A;  2G1H A;  3AXM A;  3Q8P B;  1XNQ F;  2FVP A;  4JBC A;  1T9V A;  2ILZ A;  2E1R A;  3P5T L;  1RTD B;  2AWZ A;  2QFI A;  3S01 A;  3I87 A;  4ANC A;  2C3P A;  3JQJ A;  3P45 B;  4CCH A;  3K5M A;  2VOD A;  3VHQ A;  1YZ6 A;  1JJ2 R;  2W9B B;  3DU6 A;  5IZH A;  4ED1 A;  1FDN A;  3NS6 A;  2VFS A;  5K8O A;  1S1X B;  1HNI A;  4UY8 5;  3ISN C;  1FI4 A;  1SC1 B;  1D3W A;  4MTP A;  4YB6 A;  4DMZ A;  2PI4 A;  5I3U A;  4KPC A;  2O3D A;  4PPD A;  3N4W A;  2D74 B;  1ZYQ A;  4O0N A;  5FII A;  3JQK A;  4IFV B;  4ELT A;  1QE1 A;  2DH7 A;  1WC1 A;  1LW2 A;  2DNO A;  4IQM A;  5C7P A;  1NZ8 A;  3W9J A;  2OPP A;  4ZPC A;  2NCK L;  1QAY A;  2FLO A;  2SXL A;  5ETK A;  1VQO S;  2XLK A;  1GQE A;  3ITH B;  1ZET A;  1Y5L B;  2RS2 A;  3NEK A;  4NML A;  3PX0 A;  5HAO A;  4ID8 A;  1WC4 A;  4NYO A;  3AOD A;  2DXE A;  2V94 A;  4K5R A;  4ECR A;  2VBZ A;  3Q86 A;  3P4U B;  4M5I A;  4HI2 A;  3OW2 R;  5D4P A;  1MNE A;  2MZT A;  2CFX A;  4X4Q A;  3UPF A;  3BN7 A;  3GU0 A;  5D3G A;  4HDG A;  1BHN A;  2PO4 A;  2XMJ A;  2D7S A;  3SV4 A;  1NK0 A;  2DXD A;  2WOM A;  3H0P A;  2QEX S;  1GXT A;  1T9U A;  2R4F A;  4OYX A;  4I1T A;  4A8F A;  4QWA A;  2H5I B;  4CT8 A;  5J1P A;  2ZBQ A;  1IQZ A;  5K5M A;  1OSD A;  2DNL A;  3KOA A;  4RL1 A;  1DAR A;  2K7K A;  1X9S A;  1U0H B;  1KQG B;  5AJ3 F;  1RTI B;  5BJR A;  3KK3 B;  2NXJ A;  4BLG A;  2GIF A;  1PJ5 A;  4KHP J;  1WKK A;  3GYG A;  5GAG I;  1FRI A;  3HUL A;  1U49 A;  1KOO A;  1U2C A;  1D8Z A;  5D4L A;  1X9W A;  1ICE B;  1FRL A;  2VJU A;  2DNN A;  3K5O A;  4O3P A;  3ILJ A;  3C16 A;  3QRQ A;  1RT3 B;  2QA4 G;  5HVH A;  1Q0N A;  2OP5 A;  3ZFV A;  2FHJ D;  1IBM J;  5A2Q U;  1J5O B;  1T05 A;  3CCV S;  3GR1 A;  1U8W A;  2KKH A;  3N6M A;  2BRK A;  3M6W A;  3PCO B;  4WXO A;  1YJW S;  3DXB A;  3TUI C;  4Q43 A;  1MRO A;  2B4U A;  2V6A A;  4IR1 A;  4X66 F;  1U1L A;  2FHO B;  2YKA A;  3DMJ A;  1D09 B;  1HW9 A;  4DUZ J;  2IMO A;  1AZS A;  5CXT A;  2QMU B;  2Q66 A;  2HZC A;  5J2N A;  2XHW A;  3OTO F;  4USU A;  1JK9 B;  2GQQ A;  1UVL A;  2V2Z A;  2I5J A;  4KH0 B;  5KG1 A;  1KOH A;  1TQL A;  4P2S A;  3HVW A;  3GV8 B;  1LK5 A;  2DNY A;  4IRC A;  4HT7 A;  3SQO P;  2AJ2 A;  4WK1 A;  1OQ3 A;  4C2M A;  2HQC A;  2PA8 D;  2CPJ A;  1VQS A;  4TXS A;  4LMZ A;  1ZZN A;  1NXI A;  1Q8L A;  1XC9 A;  3NWG A;  3A4T A;  5HAT A;  4WKY A;  4AD6 A;  2FJE B;  4LFB J;  1V5V A;  4UOG A;  3NOC A;  1QDU B;  2E9T A;  1KQK A;  1R27 B;  1QSL A;  1MU2 B;  2DHG A;  2RT3 A;  2NPI A;  2WK4 A;  3MOZ A;  2MB0 B;  1BWV A;  5HO4 A;  4I6W A;  4DSK A;  4DR4 F;  3RJM B;  3CJ8 A;  2MKH A;  2DHX A;  2CZ9 A;  4ED2 A;  3AH6 A;  4DXL A;  3AB2 B;  4DQQ A;  4M63 A;  3EZU A;  4WU3 A;  3I9V 9;  2HGN A;  3D68 A;  1JIH A;  2FZG B;  3HFV A;  1HNV B;  1N5Y B;  3EVO A;  3BO4 A;  5KFE A;  2DR7 A;  3PFO A;  3MPD A;  2B6A A;  1C0U A;  1JXE A;  4HAC A;  2GVZ A;  3MM5 B;  4I0W A;  3BBC A;  4AND A;  4DV4 J;  2HQF A;  4PWU A;  4CT9 A;  2Y1J A;  5ETQ A;  1RAG B;  1EP4 A;  2WON A;  2DGW A;  4DR3 J;  3HM9 A;  5HP1 B;  3RRK A;  4EO8 A;  4MFB A;  1S4F A;  2VD3 A;  5AXK A;  4H4O B;  3QRR A;  2CPE A;  2E9R X;  4IG3 A;  4WFY A;  2K2P A;  3W7B A;  3LP2 B;  5DO2 A;  1LWC A;  3MCM A;  1VHF A;  1BQN B;  2N3L A;  2OGU A;  4XAK A;  4IRD A;  5LJ5 Y;  4ED7 A;  4NLS A;  2ZC4 A;  2EFN A;  3Q83 A;  1T8E A;  1CVJ A;  2ADC A;  4Z2X A;  3ILI A;  4ZVO B;  5KFT A;  3EVM A;  3QGP A;  2V8D A;  5BR8 J;  5LXR A;  1WEL A;  5LT5 A;  3HVT A;  5KT6 A;  1U25 A;  2ATL A;  3BZQ A;  2EKY A;  1S9E B;  1NJW A;  4K7Q A;  1SC4 B;  3MMA B;  4DV2 F;  2YX1 A;  4HHU A;  3D0H E;  5M2P A;  4IR9 A;  2G1D A;  1YJ9 S;  2V9W A;  4Y3C A;  1JWW A;  2BJ8 A;  2JFK A;  3DM2 A;  3PG9 A;  3N28 A;  3BGR B;  5LMN F;  1FD2 A;  2NZ4 A;  2F65 A;  2DR6 A;  1Y4Z B;  2HUR A;  3M05 A;  4FXW A;  5EUH A;  2HLT A;  2JJ4 D;  1RXO B;  3M6X A;  3ZZZ A;  1N5T A;  2BV3 A;  2E5H A;  2DPJ A;  4ZN1 A;  4OZ2 A;  4DPX A;  4DL6 A;  2EFV A;  4P74 A;  1FJC A;  4N76 A;  4WTY A;  1RTH B;  2DNR A;  2FC9 A;  1X4E A;  4TVA B;  1IR0 A;  3UE2 A;  4QIG A;  2VKR A;  4PPZ A;  1OYD A;  2LXU A;  4P71 A;  2H65 B;  2ROE A;  5JJB A;  3DLG A;  1HPZ B;  4IG0 A;  2JEG A;  1WI6 A;  1DZ5 A;  4EWT A;  4EEY A;  1A9N B;  5F8I A;  2PEH A;  9RUB A;  1D9A A;  1AW0 A;  1HIY A;  2JFD A;  1TKX A;  2PT0 A;  2HHX A;  3ENW A;  1OPZ A;  3MM9 A;  4ANE A;  2CJY B;  2Z2Y B;  3ISZ A;  3C19 A;  2ACM A;  2MKJ A;  3M2U A;  2GJF A;  2YKP A;  4ZP9 A;  1FRK A;  1VDH A;  3UVJ B;  3DOM A;  1R0A A;  1Z2L A;  3IC1 A;  3AB4 B;  3JB9 k;  3VAK A;  2RSQ A;  2AGO A;  3DHW C;  1CJK A;  3G8Q A;  2ZJR Q;  4ECT A;  2CQD A;  3H5S A;  1GFW B;  4C97 A;  3NCP A;  3D2W A;  4RLE A;  2XGQ A;  3ZTQ A;  3MWB A;  4KSE B;  3RBX A;  1SH2 A;  3EPI A;  1ZTW A;  2RD5 C;  2CVE A;  2NPF A;  4UUX A;  2OPQ A;  1X0F A;  2HFZ A;  4ZLP A;  1FES A;  3S1T A;  5JUM A;  4LF8 J;  5GAG U;  2HBZ B;  3U02 A;  1FXD A;  1TVR B;  2L41 A;  3CXC R;  4F0M A;  4DR6 F;  3LAM A;  5HMY A;  5HVG A;  3EDQ B;  2KI2 A;  4B3R J;  1DUR A;  5JVH Q;  1SL1 A;  4DFM A;  3V81 B;  5JXS A;  1N48 A;  2WRM A;  1SUQ A;  5I42 B;  1IKY A;  2FJD B;  4IOC Q;  3DLE A;  2YNI A;  5L1L A;  2R2S A;  3F44 A;  2HNZ A;  4LF5 J;  4IYQ A;  4PRF A;  2CQ3 A;  4X4V A;  4UST A;  5ETO A;  1S59 A;  4PQU A;  2JVO A;  3E51 A;  4NL5 A;  4OJ1 A;  5GMK a;  5KFQ A;  2MJU A;  4G1P A;  1WSR A;  3FSX A;  2QFJ A;  3OXF A;  3RUB L;  3CD7 A;  4P10 A;  3AY0 A;  3OR1 B;  5F8G A;  1PO6 A;  1U0S A;  5I4M A;  4PXE A;  1QAX A;  2NLW A;  3QNW B;  5FD1 A;  4QW9 A;  3PHE A;  3R5D A;  5ETN A;  3TA2 A;  2MYF A;  1U7L A;  2D9P A;  4ZP7 A;  3RW6 A;  2L08 A;  2XI2 A;  2GAH C;  3CW2 C;  1K1S A;  1SCJ B;  5L1J A;  5A8R B;  4C8M A;  5LOQ A;  2R7W A;  3B6B A;  1S79 A;  2PI5 A;  4J9R A;  2BAN A;  2ZKT A;  2N7Y A;  3PRV A;  1LXN A;  2JVR A;  3FKB A;  3MD1 A;  4DJB A;  5IT0 A;  3TVK A;  1SQE A;  2ZHB A;  4OHY A;  3BQ0 A;  5DG9 A;  2HVH A;  1B99 A;  2K7J A;  4B3M J;  1NDK A;  1ZM3 A;  5KFM A;  4FF1 A;  3DGP A;  3MEK A;  4DV0 F;  3KLE A;  2PMH A;  2ZH5 A;  2BEF A;  3CD0 A;  3ILL A;  3I32 A;  4KGZ B;  2P5V A;  4O4G B;  3TAM B;  3WZ0 A;  2IBK A;  3QT7 A;  3OSN A;  1WOO A;  2VG6 B;  2E5L J;  1FTC A;  4R0E A;  2QYC A;  1T7P A;  2QX0 A;  2ZIT A;  3J7Z T;  3GPA A;  3RYL A;  3SDE A;  1U26 A;  4HR2 A;  5J2M A;  1IWA A;  2AJQ A;  2KVI A;  1BY9 A;  1BGX T;  3FCV A;  2R8H A;  4ECS A;  3ZTP A;  4C8L A;  4FP9 A;  2YVS A;  2GV1 A;  2MKS A;  1SIZ A;  4CH7 A;  4KJI A;  4MIW A;  4JUZ A;  4ZVE A;  1N6Q A;  4L72 B;  4CO3 A;  4Q0B B;  1JLG A;  4DV1 F;  5IC6 B;  4NEY A;  4WFN Q;  3OVB A;  2AT1 B;  2HZV A;  4RKU C;  4YFU A;  1JLB A;  1JJ4 A;  3IRX B;  1PJ7 A;  3MM6 B;  2Z58 B;  3MM7 B;  2YQ0 A;  4YR2 A;  2KTQ A;  3VZH A;  1MMN A;  4RPF A;  3D4J A;  3FEZ A;  2QSW A;  3CJ5 A;  2DIT A;  1UW4 A;  1KTQ A;  1XR5 A;  2MQN A;  4Q7A A;  2HS3 A;  3OPK A;  5DDQ C;  2HSE B;  2BJ9 A;  1RHU B;  3OFE A;  2OI2 A;  3FFI A;  2BKO A;  4L76 A;  1HD1 A;  1C1B B;  3CC7 S;  1TMM A;  1U6F A;  4M8L A;  3SV3 A;  2ZZN A;  4WK3 A;  1FTR A;  3MAA A;  1F5A A;  5KFS A;  2CPH A;  3I55 S;  2FHJ A;  1HNX J;  4O3N A;  1D1U A;  4LF7 F;  2J8S A;  3W2V B;  3NS5 A;  4XDC A;  4C7Q A;  1KVJ A;  4CO1 A;  4F50 A;  1Z1Z A;  1LQ9 A;  4CTA A;  4UW2 A;  4KHP F;  5HMX A;  3KJV B;  1M5P C;  2AW0 A;  3PR4 A;  4FKY A;  1NK4 A;  3CVK A;  4USI A;  1H73 A;  1RKJ A;  2C2D A;  1RZM A;  3O5T B;  1SJF A;  2QV6 A;  3CCM S;  2ZD1 B;  1RT2 A;  3R1L A;  4IOB A;  5KT5 A;  4TY8 B;  2XYH B;  2VV5 A;  2VUG A;  2CDR B;  3ZZP A;  2VIC A;  3PW0 A;  2FDN A;  1IBM F;  2HGL A;  4LR8 A;  1HQE B;  2C2N A;  3BPS P;  2GVD B;  1KNZ A;  3UCG A;  4USM A;  4C8O A;  2PFD A;  4OZ0 A;  4TU9 A;  1PGZ A;  5B0F A;  2DRA A;  3OJS A;  4CLL A;  1X9M A;  3I82 A;  1N34 F;  2BKN A;  3MMB A;  1D9F A;  4H4M A;  2IFX A;  1WTF A;  1C1C B;  1S1W B;  2W2O P;  1U48 A;  3NBP B;  5C42 A;  1B64 A;  3KNG A;  2DNK A;  1RAE B;  2QC3 A;  4IO1 A;  4KKO B;  5D0E A;  3K89 A;  3O44 A;  2YNH B;  4LR9 A;  4B08 A;  1HL6 A;  3W1Y C;  5B0B A;  4BS2 A;  1WF2 A;  1YBT A;  3UFC X;  3HPO A;  5IOL A;  4B3T F;  5HL7 Q;  4QU6 A;  2BRL A;  2H3E B;  2RJZ A;  4C11 B;  2IRY A;  5KTQ A;  1MN7 A;  3NP5 A;  1R8B A;  3GIM A;  3RBZ A;  2V68 A;  3F56 A;  4OI1 A;  1F9E B;  2YWF A;  3WBZ A;  2RHS B;  3CD6 S;  2WW4 A;  1MG7 A;  3AD8 C;  3LAK A;  4AXI A;  1CS4 B;  3LAN A;  2W2Q P;  1F6T A;  4DL7 A;  1FKA F;  4B17 A;  3HVA A;  2MST A;  1QJH A;  3H5U A;  3T5H A;  2IY5 B;  1VCT A;  2ZH4 A;  3OL6 A;  1UW9 A;  4U7U D;  5CYQ A;  2ZOM A;  3IFE A;  4FBT A;  1FK9 B;  1EAY C;  1HR0 J;  1U1O A;  3IMQ J;  2JH3 A;  5ETR A;  4KHR A;  2BYC A;  2KHD A;  3KLI A;  3TX8 A;  2HHP A;  3DOL B;  1NND A;  3M8W A;  4I69 A;  4QYZ J;  2QLF B;  4UOC A;  3R5J B;  3LTO A;  4RW9 B;  1CUL A;  4WPA A;  3CWJ A;  1JMT A;  1AYE A;  2GW8 A;  2DGV A;  1M5H A;  4OX9 J;  5DG7 A;  3KK2 A;  1N4L A;  1SV5 A;  2IYI A;  2VH7 A;  1IKW B;  3AD9 C;  2MQP A;  1S1U A;  3GII A;  3ENV A;  5D8H B;  4DV4 F;  3NXZ A;  2DEJ A;  2JZ5 A;  2F8M A;  5IT4 A;  3LF0 A;  2LYV A;  4B3S J;  1JLA A;  1TL1 A;  3VCD A;  3PYE A;  1U02 A;  2MZS A;  2J9E A;  3TA0 A;  4DLE A;  2JDJ A;  1M1K T;  2JRS A;  2V34 A;  5CA5 A;  3MZI A;  3T1Y J;  5C2G A;  2H5J B;  1SKU B;  3HZE A;  3E2E A;  3P49 B;  1H2U X;  3SQG B;  3H59 A;  2WAQ D;  5IM0 A;  2CJB A;  2IM3 A;  2VJV A;  5KG0 A;  1L3K A;  4LBP A;  4DV5 F;  4FVM A;  2DO4 A;  3TZW A;  2MSS A;  5I3U B;  1RT7 B;  3JSM B;  4HL9 A;  2IMW P;  2KFY A;  2W9C A;  2FVQ A;  2ZWO A;  2VQE J;  4BWJ A;  3V6H A;  4DDF A;  1B7Y B;  4ZP8 A;  1FEE A;  5F0W A;  1HWL A;  4DZ6 A;  1K73 T;  3AA8 A;  2N7C A;  4CLU A;  4NI2 A;  3K5P A;  4ZIW A;  1QE1 B;  1ZA1 B;  5CAA A;  2R9L A;  4F4A A;  1UFW A;  1LW2 B;  2QGF B;  2HQD A;  2GHP A;  2OPP B;  4K4V A;  1LW0 A;  3QJJ A;  2CQ2 A;  4QIW D;  1PSD A;  4RW7 A;  2UV8 G;  3MR6 A;  4ATN A;  3D3C J;  4PZV A;  3D0G E;  2NS1 B;  3MPY A;  2Z30 B;  4CH0 S;  1U2F A;  1F0X A;  2BQ3 A;  4DZD A;  2IAJ A;  1HWK A;  3MEE A;  3AOA A;  4NYZ A;  3UD3 P;  1HNZ F;  4TU7 A;  5D3G B;  3PYD A;  2YWH A;  2AJ4 A;  2WOM B;  5KFZ A;  3RG6 A;  2GO9 A;  1ROF A;  2FVS A;  4UT4 A;  3NNC A;  1S48 A;  3HSJ A;  5KT4 A;  2JWN A;  3I0R A;  2BUN A;  1MWY A;  5JMN A;  2GIQ A;  2HQI A;  2EPI A;  3LQV A;  4C3K A;  4M5J A;  2J76 E;  3QYY A;  2FUG 9;  3LGN A;  3C15 A;  4J91 A;  2Z8Q A;  3KUE A;  2HHV A;  4AFF A;  4TU8 A;  4DEZ A;  3ZZR A;  3C2P A;  3OTE A;  3AFG A;  1RA6 A;  2R8K A;  1K8A T;  4I2Q A;  4UUW A;  1SC3 B;  3TI0 A;  4NCA A;  3VV2 B;  3C16 B;  1N5Q A;  2FTR A;  2OEK A;  4J9Q A;  4N56 A;  3BF4 A;  3BS9 A;  3NGD A;  3P96 A;  3H2V E;  3PJW A;  2XMK A;  5KFD A;  5T14 A;  1T05 B;  4OV6 A;  2UUA F;  2BW2 A;  2CPX A;  1XNR J;  4X4U A;  3FC9 A;  2C3U A;  2AEF A;  1C4C A;  3HK2 A;  2NSB A;  1MRO B;  3Q22 A;  1SH0 A;  3QWU A;  2RQ4 A;  4ZVP B;  1QAI A;  3DMJ B;  1GX6 A;  1AZS B;  3UW1 A;  4LUB A;  1HHS A;  2IBO A;  3NGT A;  3CDB A;  2R2U A;  2IDE A;  4LSZ B;  3EVW A;  4ZOS A;  3IGV A;  2I5J B;  4ENO A;  3DLB A;  1YG0 A;  2JEI A;  2UXD J;  3GP9 A;  2R7Q A;  4USK A;  4IFV A;  1HQU A;  1K9M T;  1S7I A;  1KRP A;  3E8O A;  4GO7 X;  1NDC A;  4C3M A;  4QQB A;  2B4V A;  2W24 A;  2V8G A;  3M4X A;  2R2R A;  4ZCL A;  3BR8 A;  3W5X A;  2HKE A;  3DDN A;  4LRD A;  4D3H A;  4U6P A;  1NRK A;  4NOH A;  3M8S A;  3J7Y I;  3POT B;  4F4K A;  4FBU A;  4OYB A;  4K2X A;  5A76 A;  4H4K A;  2VKZ G;  1FD8 A;  2HWH A;  1T0T V;  5EDW A;  5BYQ A;  2HIQ A;  4QPX A;  2RRN A;  1NSP A;  2V8P A;  4JYA F;  4QBU A;  1XR7 A;  4KGX B;  3GIL A;  3TQE A;  2G13 A;  1S6Q A;  5B0A A;  3DOK A;  4GKK F;  2EC0 A;  4FF4 A;  4YHH F;  4JI5 J;  2UVU A;  4DCO B;  5GAH I;  3TZY A;  4KR0 B;  1NKE A;  4FNI A;  5GAD I;  2ZHO A;  4K4U A;  5KFB A;  5HJX A;  1S0O A;  2B6A B;  5A2Q Y;  1C0U B;  1YQH A;  2CQ4 A;  2GVZ B;  5LJ3 Y;  1GTH A;  2ZDO A;  5A6P A;  4OZJ A;  2CNO B;  2NYH A;  2AYM A;  2WCX A;  4JP8 A;  3PR5 B;  2GJI A;  2WON B;  3A8J A;  2XMT A;  4MFB B;  2LP4 A;  4RUC A;  1RWX B;  2N4C A;  4NA1 A;  2AU0 A;  1NSA A;  1YRX A;  3NKY A;  2RRB A;  1T94 A;  4GMK A;  4IG3 B;  1Q4R A;  1O5J A;  3FVY A;  1YJR A;  3IAS 9;  3HHE A;  3UNG C;  2PEB A;  1LWC B;  2OPR B;  4I68 A;  2J6U A;  2ZBI A;  3RW7 A;  4DV3 F;  3JS9 A;  1FFG B;  3CJ0 A;  4ZK7 M;  1Y7P A;  3GV5 B;  3HJV A;  3D66 A;  2ZH1 A;  2DGS A;  2J7W A;  2C2K B;  2YH1 A;  3V6J A;  2DXF A;  1BMQ B;  5IFM A;  2QL7 B;  4PYA A;  1QSS A;  1RK8 A;  3ZZT A;  1H72 C;  3HVT B;  4PYD A;  3D6F B;  1NLK L;  1IWG A;  4TLR A;  3C6T A;  3HD1 A;  5GAE I;  2UXC F;  4FS1 A;  1ZAW A;  1IKV A;  2FC8 A;  2HVE A;  3CC4 S;  3KG1 A;  2GQ2 A;  1JXV A;  2NXU A;  2XMW A;  2LQ8 A;  4EGL A;  2DGO A;  1NK8 A;  1Y10 A;  2X51 A;  5B0G A;  9ATC B;  3DM2 B;  5H9E K;  2RIJ A;  1RWO B;  4X4N A;  2FJB B;  4AL7 A;  3OFH A;  2W7O A;  5E0O A;  2DB1 A;  2V2V A;  2DHH A;  3MTJ A;  1ITP A;  3W65 A;  3JAM U;  4FDF A;  1T3N A;  2UUC J;  1OSC A;  1LFW A;  1AA1 B;  3AXK A;  3LUY A;  3CB4 A;  2M9K A;  3R27 A;  3SSQ A;  5K8M A;  3EPG A;  3AT1 B;  2E7W A;  4LIR A;  2LXF A;  1KEK A;  3QLH A;  2J6T A;  3DLG B;  4N77 A;  4EZ6 A;  3ADA C;  4LJM A;  3CJK A;  4IG0 B;  1K0V A;  2XY7 A;  2CQI A;  3M8R A;  4C48 A;  1L5U A;  4LF6 J;  3DDK A;  3N0V A;  3HHL A;  5GME A;  1SKR A;  4KPY A;  1TKX B;  4J5O A;  2E29 A;  4FYW B;  2QLB B;  2UUW A;  1N33 J;  1M5S A;  4XPC A;  4A46 A;  2P9E A;  1U6Z A;  4A8X A;  2MQL A;  4LF1 A;  4DPO A;  3C46 A;  1MMD A;  3M2U B;  3BH6 B;  5AXM A;  3LO3 A;  4C4W A;  2DHS A;  3MM5 A;  3NRB A;  4E2F B;  1CJK B;  2AIR B;  2B4P A;  4BWM A;  1S9F A;  3AJ1 A;  5HP1 A;  1Q16 B;  3GFZ A;  2ZWP A;  3DKD A;  2UU9 J;  3TX0 A;  1KD1 T;  1T95 A;  1FWP A;  1HWI A;  3D0I E;  2AYG A;  1SPB P;  5KFC A;  3PKY A;  4QR2 A;  4DUY F;  1XNQ J;  4D3G A;  1GXL A;  2C2R A;  3CCJ S;  2LKZ A;  2OPQ B;  4TN2 A;  3H5Y A;  3RAX A;  2LEP A;  2AX1 A;  4Y34 A;  2AQ4 A;  4CWB A;  4ALZ A;  4P9S A;  1FJ7 A;  1X5P A;  1PBA A;  3AD7 C;  4ER8 A;  1RSC A;  4V19 J;  1Q95 G;  4FZV A;  3GQC A;  3R2D J;  2LEA A;  5KFN A;  3TUJ C;  3PO5 A;  2MZJ A;  2HWI A;  2YKQ A;  3PRD A;  4YEA A;  4ICL A;  2D3Z A;  1SUQ B;  3I5A A;  3PFE A;  1IKY B;  1RYR A;  1S9E A;  3H20 A;  2YNI B;  3M1V A;  4N8N A;  4MH8 A;  1YHQ S;  1I94 F;  3TA1 A;  3NOG A;  2HNZ B;  4PQA A;  2FVC A;  2JOQ A;  4CLP A;  1Q7Y T;  4WYL A;  4F04 B;  3OLA A;  3TWZ A;  2A1B A;  4QWB A;  4NA3 A;  1RAH B;  3MEG A;  4BCA A;  1KLM A;  2J0Q D;  1AT1 B;  3CCU S;  1SJQ A;  3N5F A;  1FX4 A;  4DL0 C;  2P8I A;  3TEH B;  1JKH A;  2OFH X;  3IAM 9;  1KR4 A;  3DU5 A;  3HMJ G;  3V6K A;  4ZP6 A;  3W2W B;  2W2P P;  3VQS A;  3J80 Y;  3U1L A;  5EWE A;  1YRT A;  2NXN A;  5A0Y B;  1NK9 A;  1F9H A;  1PAU B;  1N54 B;  3FMW A;  2UXB F;  4IDK A;  1PAE X;  2C2O B;  2BAN B;  3QZ7 A;  5J1E A;  4ZVF A;  4OQJ A;  4NLT A;  2WB4 A;  1JNR B;  2W25 A;  3J7Y U;  5F41 A;  5AXL A;  4CLZ A;  2H9Z A;  3A3O B;  5AJ3 J;  2GAG C;  1S76 D;  4CLF A;  1HHT P;  2ZE2 A;  5DJB A;  2O01 C;  4Q45 A;  3KFW X;  2ZZM A;  1WF0 A;  2VFR A;  1SIW B;  2MY7 A;  2HHW A;  3CJ3 A;  1IR1 A;  3IP0 A;  3QT8 A;  5DRK A;  3BSN A;  4A48 A;  3LW5 C;  3D6T B;  4F2R A;  2CJQ A;  3DGP B;  4LQ9 A;  2HW3 A;  3KLE B;  1JQG A;  3GFH A;  3X1L B;  5D15 A;  1KFD A;  2XWX A;  1URN A;  2VPX B;  3KKF A;  3LPE A;  2BDP A;  3JTN A;  5F8H A;  1KN6 A;  4NLX A;  2EC2 A;  4G1Q A;  2FQQ B;  3VAJ A;  3R5C A;  4FYY B;  2BBE A;  5SUH A;  2Q6B A;  4JV1 A;  1VQN S;  1RU2 A;  3SDE B;  1X4B A;  1OY9 A;  4UF4 A;  5J2M B;  3BKT A;  4U67 Q;  4J9V A;  2MY8 A;  4JV5 F;  5EX3 A;  1DTT A;  4X66 J;  2VQE F;  2F8E X;  2ASL A;  4WCE Q;  3SI8 A;  1KSP A;  3I96 A;  3V81 A;  4NXN F;  2XGP A;  2POK A;  4MYT A;  2E7X A;  1JLG B;  4KYZ A;  3TVZ A;  3OTO J;  4U8Y A;  3OJU A;  4NPO A;  5H9F J;  3TUP A;  1JLB B;  3H42 A;  1WSV A;  2DIV A;  1TV6 A;  3IBF B;  1ZAX A;  1NJZ A;  3EE3 A;  3NWR A;  1KVI A;  2YH0 A;  2ZNY A;  3B82 A;  2X1A A;  4J37 A;  1FJG F;  1WKL A;  2FIU A;  3FCW A;  4K4S A;  1NHK L;  4DFP A;  4B9N A;  1G2E A;  2OD4 A;  2M8D B;  2ZBR A;  1JLE A;  3EIC A;  4I2P B;  4MKV A;  4OZ1 A;  3ZC4 A;  4AYB D;  5DDP C;  3PVX A;  3NY0 A;  1KP6 A;  1VJW A;  4DU7 A;  1RT6 A;  1NH8 A;  4PG8 A;  2U1A A;  1UEK A;  4JI2 F;  4M95 A;  4KTQ A;  3BYR A;  2CNK B;  3DRY A;  3DRX A;  2MQ8 A;  3H98 A;  1FDA A;  1CSJ A;  1WHY A;  4E98 A;  2VA3 A;  2PD1 A;  4MT1 A;  3BJY A;  3MAA B;  4DR4 J;  5DQH A;  2E5I A;  4C98 A;  2VU5 A;  3I31 A;  4XK8 C;  4NAS A;  1GX5 A;  4DLG A;  2DGT A;  3MAH A;  4ZIT A;  3H4B A;  3KTQ A;  1NUE A;  2VPZ B;  4UZB A;  2VPY B;  3HT3 A;  4CTA B;  3SCI E;  1H2V Z;  3KMQ A;  6AT1 B;  3PTW A;  1ZZF A;  1GMW A;  3W8P A;  4CLY A;  4G1I A;  4DPU A;  5L39 A;  1EIY B;  4ECQ A;  4RW6 A;  4WTO B;  3N6L A;  5KOX A;  4DSI A;  3M8P A;  2Q1L A;  1RT2 B;  2OEJ A;  2RDI A;  2ZH6 A;  1N8R T;  2GGP B;  4A8W A;  2XYG B;  4M5G A;  5FDL A;  3PW5 A;  1RA7 A;  3SIP B;  2HBY B;  2XYP B;  2ZM6 F;  4C0B A;  1Y5I B;  5KFA A;  4XPE A;  3E01 A;  5CCL A;  4PR6 A;  5B0C A;  3PY8 A;  2BZ2 A;  3R97 A;  4YY3 J;  2N82 B;  5D4N A;  3RGI A;  3TAM A;  4F4Y A;  2LVW A;  2C2M B;  3PXG a;  2HFV A;  2WBR A;  3OUY A;  2GMJ A;  2HND B;  3J7A 1;  5KFL A;  1F5C A;  3MMB B;  3D9B A;  3UD5 A;  2M2B A;  4H4M B;  3T5K A;  1EZZ B;  4NZ7 A;  1QSY A;  3G87 A;  5C42 B;  3CDA A;  1UWB A;  3TJ9 A;  4I4B A;  1CBK A;  4X4R A;  2A3J A;  3BBB A;  1BE4 A;  1RLD A;  3QFW A;  2VPW B;  2WW8 A;  3M2R A;  3SSR A;  2W7A A;  5C5J A;  3R7S B;  1XJW B;  4DV2 J;  1HBN A;  2K06 A;  2AZ3 A;  2EXU A;  2V50 A;  1FA0 A;  3MI7 X;  6FD1 A;  4F0H A;  4DFK A;  2EVZ A;  3HKW A;  4L75 A;  3MM7 A;  1BUX A;  1HI8 A;  5LMN J;  2M3D A;  1VC6 A;  2E9Z A;  1NME B;  3JTP A;  4J90 A;  3JSR A;  2WZ1 A;  2IDL A;  2R7O A;  3FGV A;  2XQC A;  4K4Z A;  2KZM A;  5KFO A;  1UVM A;  2HS4 A;  2XSF A;  1FVQ A;  3KLI B;  2PII A;  3K57 A;  1C1B A;  1XMO F;  3KUG A;  5E33 A;  1SJ4 P;  4YR3 A;  1PC4 A;  2VG7 A;  1I6J A;  1TAQ A;  2GJ2 A;  1LWF A;  4LR7 A;  1VQL S;  2ZVS A;  3KK2 B;  4RUB A;  2J9D E;  1M0S A;  4CO0 A;  1S1U B;  1P9Y A;  4WZM A;  2GNK A;  2GO8 A;  3QWP A;  4MKA A;  1SB6 A;  1NPP A;  1SQG A;  1TL1 B;  1NZA A;  4E8U A;  4Y2A A;  4OX7 A;  5E41 A;  3CNQ P;  3R7N B;  1PYO B;  4TY8 A;  4DS4 A;  1O8B A;  2YQ3 A;  3T6J A;  2PSZ A;  4X62 F;  1UAW A;  4HDH A;  4YDX A;  3BN4 A;  1T9Y A;  4PG7 A;  3MMC A;  1RHK B;  1YBA A;  4ILR A;  1KVK A;  4B9V A;  2ABY A;  2VG5 A;  1TFY A;  2GVD A;  2WTF A;  2J0W A;  5C24 A;  5CYJ A;  2BE9 B;  5IM0 B;  4F4W A;  2FY8 A;  4DI6 A;  4L73 A;  3CCW A;  2QO3 A;  2NUU G;  5E7O B;  3OTB A;  4P2F A;  1RT5 A;  2IJF A;  1X0P A;  2ALY B;  2JHE A;  4ILM A;  1NJX A;  4CYU A;  1VQK S;  2HHS A;  1V6H A;  4DR6 J;  2BJ1 A;  2X3D A;  4OYZ A;  4LF9 F;  2DRD A;  3AJD A;  3MR2 A;  4ID5 A;  2AF6 A;  1AUD A;  4NI2 B;  1MWZ A;  4JI1 J;  4QW8 A;  1UEU A;  2HRU A;  4JI7 F;  3R5G A;  1V3S A;  4NMX A;  4Y2C A;  2BXJ A;  1LW0 B;  3KWM A;  1HBU B;  3NCR A;  4YB1 P;  2LU1 A;  3R7B B;  2ZC3 A;  4RW7 B;  3MFH A;  2ZBP A;  2JC0 A;  2CUY A;  3VQT A;  1FER A;  1UKU A;  2QZ8 A;  4CO5 A;  4URQ U;  3VAM A;  3MDF A;  2V0N A;  1REG X;  1RBA A;  5K14 A;  5F9N A;  4ZVH A;  2RML A;  4QWD A;  1IJF B;  3IGN A;  2VHG A;  5HLF A;  5KFU A;  2IPO B;  1H98 A;  2O66 A;  2M5Y A;  1F3F A;  3HI9 A;  3T1A A;  1LWX A;  1UVN A;  3MEE B;  3OT9 A;  3T5J A;  1GEH A;  1DLO B;  4DL3 A;  1CLF A;  4QIE A;  4RW8 A;  4HH0 A;  4O4R A;  5C2C A;  3DOL A;  3MOJ B;  4USV A;  3I0R B;  4DX6 A;  3QRP A;  5DDR C;  4A8K A;  1N33 F;  3QBC A;  5DQG A;  1R43 A;  2M70 A;  3M9M B;  3G4S S;  1YZ7 A;  4C8K A;  3B4D A;  2J0X A;  3CUN A;  1EKR A;  3AA9 A;  2OIH A;  1HYS A;  2CKW A;  3C15 B;  5EX0 A;  1N32 F;  3MED A;  1XIQ A;  4G3I A;  4M5D A;  4KO0 A;  5KFV A;  4GO5 X;  4LRB A;  1DJ0 A;  3U27 A;  3GJR B;  1RHQ B;  1FE0 A;  4ITS A;  5IXU A;  2RDJ A;  1CJV A;  2R8I A;  4IH5 A;  3SBM A;  3FEX B;  1JLQ B;  4K4X A;  4UZC A;  5HVF A;  2YPZ A;  4TQR A;  2DKO B;  1I5O B;  5B09 A;  4CO4 A;  3TJA A;  1RE1 B;  1WDT A;  1A7G E;  3PW7 A;  2V4R A;  5F8M A;  4DV0 J;  1AXQ A;  2R7V A;  2IYG A;  1UPP A;  1FKP A;  4FYX B;  5HJY A;  5DM6 Q;  3WDO A;  2F3J A;  4K4W A;  3EZ5 A;  2ZH2 A;  3W3S A;  3IR6 B;  1RKI A;  1I51 B;  3L09 A;  3SQG A;  1KWM A;  4L3K A;  3OHA A;  2M7S A;  3MUV P;  3EYZ A;  4P72 A;  5EGY A;  3HKZ D;  2M4M A;  2C2Z B;  1H6K X;  2EWH A;  2DR5 A;  4RUA A;  3BPD A;  1RT7 A;  4KV8 A;  3JSM A;  4RNF A;  1LKZ A;  2KXH A;  2CPD A;  4EBC A;  1ZPW X;  1VIO A;  3G8S A;  2LU2 A;  3MUM P;  3GFY A;  1HQU B;  3NMR A;  3GR0 A;  4QPT A;  4DV1 J;  3Q8Q B;  4R5P A;  1S49 A;  3OL7 A;  1WC6 A;  2DHA A;  2MHE A;  3AOC A;  1S1T A;  5SZT A;  1UFK A;  2H51 B;  3FK4 A;  2MKC A;  4AUK A;  3VZI A;  2HHT A;  3C14 B;  1R3N A;  3VR1 A;  4DQP A;  2ZZT A;  3GYX B;  1YI2 S;  2FJW A;  3MR7 A;  3KLG A;  4K59 A;  3NCQ A;  2JL9 A;  2PC6 A;  4HI1 A;  2ZH7 A;  1SL0 A;  2Y8W A;  4QYZ K;  1S0M A;  5FLX U;  3CCR S;  4ZS6 A;  4O3O A;  1NHV A;  2J0S D;  2BM0 A;  3C3L A;  3KLV A;  4DL5 A;  1S6Q B;  3DOK B;  4CO2 A;  5AE3 A;  2KXF A;  4K4Y A;  4OHV A;  5DZ6 A;  2C3O A;  2FLP A;  1L3T A;  3ZZY A;  1FT8 A;  1BD6 A;  1RWM B;  1WC0 A;  3T41 A;  1GMV A;  4OHZ A;  2V2Q A;  3MGJ A;  1PKU A;  4LF7 J;  4IKA A;  1BQM A;  3GSI A;  4A8Q A;  1IVZ A;  3NGS A;  2CPZ A;  4WBF A;  4A8M P;  3JSB A;  4X65 F;  2IVF B;  3OVS A;  3TP2 A;  3T9Z A;  2B0G A;  1M5K C;  4NEZ A;  2WVF A;  1CPZ A;  3PZP A;  3I4H X;  3D5M A;  3EGN A;  3EDR B;  5KG6 A;  1REV A;  1X4G A;  4O23 A;  2RNE A;  2B7B B;  4DR7 F;  2MMY A;  1YK9 A;  1FRH A;  2CQ0 A;  2OEL A;  4MK7 A;  1HWU A;  3ENA A;  4YOE A;  5KFJ A;  5ITH A;  1FE4 A;  5B0D A;  2HK2 A;  4JB8 B;  1TFW A;  1N34 J;  5HMZ A;  3MTK A;  1Q1K A;  5KG7 A;  2HIY A;  2OTL S;  1NH7 A;  3UNY A;  4ILL A;  4HTJ A;  2IIH A;  4DG1 B;  3C6T B;  3T1H F;  1IJE B;  4J9O A;  1IKV B;  4JI4 J;  2MKI A;  1VK3 A;  4RJV A;  2AZ1 A;  3ICL A;  1RUS A;  4B9M A;  3OBI A;  1JX4 A;  3HVR A;  1G3O A;  1QTN B;  2PN6 A;  2WHO A;  3KHL A;  1FRM A;  2BJD A;  4B3T J;  3D28 A;  2E1A A;  3EZO A;  3G6Y A;  1TR0 A;  2KO1 A;  4USH A;  2BMB A;  3H2U B;  2XO7 A;  2VBW A;  3M8Q A;  1VQ5 S;  3BR9 A;  4ZLJ A;  2Z2L A;  1CQN A;  1R8A A;  5IV3 A;  3MUT P;  1CJU A;  3ZTO A;  2FGO A;  2QT7 A;  4URS A;  4NLP A;  2ASY A;  2KYX A;  3POT A;  1RU1 A;  1WD6 A;  2E5G A;  4I67 A;  3QLH B;  4NLV A;  1LK7 A;  3CCE S;  1MLA A;  1LNQ A;  3FEY B;  1VBX A;  3UDC A;  2Y1I A;  4RNH A;  3CJK B;  3CD5 A;  3MR3 A;  5THW A;  3K59 A;  2CQG A;  3H8Y A;  3QQC D;  3HHL B;  1FNM A;  2C22 A;  4UOH A;  5IS2 A;  1N36 F;  3CE8 A;  4GC6 A;  4ZKA A;  1MML A;  1H3D A;  2A6O A;  3M32 B;  4H54 A;  3PW4 A;  1PG5 B;  3CMQ A;  4L3N A;  1KS2 A;  2R42 A;  2YKN A;  3ENQ A;  8AT1 B;  2HPU A;  3VAG A;  1RTJ A;  3CJ4 A;  4A8Y A;  5A8W A;  1EKS A;  2RF2 A;  1TKT A;  3TO8 A;  4MJK A;  2DVI A;  3OTD A;  1F1B B;  3OL8 A;  2G0I A;  2UUT A;  1IM4 A;  3HXM A;  4EYH B;  3NG8 A;  4EO6 A;  1N5V A;  4R8U B;  3K17 A;  2FJA B;  4YY3 F;  3ISN D;  1VLO A;  5FJ4 A;  2XS7 A;  1VJQ A;  2Z2Z A;  2B8P A;  2KG0 A;  2YWW A;  2HEK A;  3FBB A;  2OPR A;  3T3F A;  3DLH A;  1UET A;  3R5A A;  4OYW A;  3U1N A;  2QA1 A;  4FKX A;  1NPR A;  4ERD A;  4K0K F;  1GT8 A;  2C3M A;  3CIZ A;  2OEM A;  1FEH A;  1S12 A;  3I9Z A;  4ICL B;  4DV5 J;  3BSC A;  3P6Y C;  2VAS A;  3F73 A;  2AV5 A;  3G82 A;  1UJ6 A;  2YPY A;  2DO0 A;  3M1V B;  3JAM Y;  4OL8 A;  2JLG A;  4ZJO A;  1G4C A;  3KDO A;  1IBK F;  5RUB A;  4S0M A;  5ETL A;  2J9D A;  3K5L A;  4YDD B;  4OI6 A;  4DCJ B;  1W2B R;  2R7U A;  3MEG B;  2OUG A;  4CLT A;  1OQ6 A;  1OY6 A;  3IBW A;  3QZ8 A;  5IT9 U;  2LDY A;  2I6W A;  3ZZU A;  1FDD A;  1KLM B;  1WOR A;  3KMS A;  1FKO A;  3OQ2 A;  2KT2 A;  1RAI B;  4ZPV R;  4O44 A;  1JKH B;  3KLH B;  1IXK A;  1S99 A;  5D0R A;  4QYR A;  1Q53 A;  4LFA F;  2BJ3 A;  3MD3 A;  1PCA A;  3NMA A;  4DBQ A;  2QA2 A;  3PV8 A;  1UMJ A;  4OMF G;  2O1P A;  4LBI A;  2K3K A;  3GMG A;  1HNZ J;  3FQK A;  1VS3 A;  3SCJ E;  1WJ9 A;  1UZD A;  3DDI A;  4IDK B;  3NLC A;  3CCT A;  2MZQ A;  1D9D A;  3LPY A;  4O3Q A;  2IC3 A;  2AJF E;  2CZ4 A;  5J1E B;  4EBE A;  1RBL A;  1RAB B;  3OV7 A;  2DEI A;  3K58 A;  3J80 U;  4DR2 F;  1OY8 A;  1HA1 A;  2ZE2 B;  5HAN A;  1R6V A;  1VK8 A;  1EJ7 L;  1ZPV A;  3TW0 A;  3OL9 A;  3OFG A;  2I8E A;  1TKZ A;  3GJT B;  1E6Y A;  3CJT A;  5BYR A;  4W92 B;  3B8H A;  3GJQ B;  4QZV B;  2DIS A;  4ZIV A;  3U1M A;  3LGM A;  1P1L A;  4YP3 A;  3O3L A;  1R0C B;  3EX7 B;  3KK1 A;  1B0T A;  3G6V A;  4G1Q B;  4Q8E A;  1NK5 A;  4WKR A;  1P27 B;  3HHD A;  1C4A A;  2UV8 A;  2UUA J;  3QGI A;  3ETO A;  1PIL A;  1YJU A;  5LL6 d;  5KFR A;  4WF9 Q;  1ZA2 B;  4JI8 F;  4KQZ A;  3SCL E;  1VQ6 S;  3HZG A;  3V4M A;  1I1G A;  2EFG A;  1IN0 A;  3BEG B;  1DTT B;  2NZC A;  2DNH A;  5LM7 E;  4BHQ A;  1GAO A;  2W8K A;  4FNH A;  2CQH A;  4JI1 F;  3DHX A;  4DV6 F;  4MYU A;  1TKD A;  3UN3 A;  1WEX A;  2Z0G A;  1ZTT A;  4M94 A;  1T9W A;  2RHQ B;  4W98 A;  3R1H A;  1TV6 B;  3KHR A;  1FFS B;  1X60 A;  2L9W A;  2LQB A;  3FZB A;  1WOS A;  2DNQ A;  2DR9 A;  2KM8 B;  4ZPT R;  4UY8 T;  2AGQ A;  4B9U A;  2XLJ A;  4Q2L A;  2MQM A;  1OMS A;  1T9X A;  5LSO A;  2IVY A;  3TZZ A;  1JLE B;  3GIK A;  3KJN B;  2WBM A;  4XO0 A;  2CG8 A;  2W4D A;  4QOT A;  2Z56 B;  3SFG A;  3I5B A;  1SKW A;  4YME A;  4X4T A;  2GA7 A;  4LSN B;  3LWM A;  3CMA S;  1RT6 B;  5J1N A;  1DAX A;  1B7F A;  1JLF A;  3NNA A;  2ZOF A;  1S6O A;  3W2W A;  1VLY A;  3GFX A;  1WHX A;  1R8P A;  1RDR A;  3ETM A;  3DGV A;  5A0Y A;  2ZJQ Q;  4JYA J;  3HD2 A;  4PG4 A;  1W2I A;  2IA6 A;  4YS2 A;  5HN0 A;  3JSY A;  4GKK J;  2HHH F;  2J5A A;  4YHH J;  1NM2 A;  2YKM B;  5CHC B;  3RTV A;  3V2U C;  4ECX A;  2R2T A;  1YSJ A;  3THP A;  1P1T A;  4MKB A;  1HNW F;  3W9H A;  1RQ0 A;  1Q8I A;  4RW6 B;  4TNO A;  3TZX A;  3M8P B;  1DQ9 A;  1KQF B;  1VBK A;  2LCW A;  3EWG A;  5FDL B;  5DZ7 A;  1RT1 A;  2QMX A;  2WVB A;  3Q8R B;  4OHX A;  4C0O C;  3E01 B;  3PYF A;  4IO9 Q;  2KH9 A;  4NCB A;  2F9J A;  3H25 A;  4N5S A;  1PIE A;  5LSR A;  4R0J A;  3M6U A;  2UUB J;  3P5B P;  3OUY B;  1ULR A;  4LF2 A;  1FO1 A;  1NU4 A;  2N4D A;  4DV3 J;  4TYA A;  2HQG A;  3N6N A;  1R7I A;  2BQR A;  2HNY A;  1WWH A;  5KFY A;  2FLN A;  2DK2 A;  2B9Y A;  1P9Q C;  3L95 X;  4Z37 A;  4Q8F A;  3KXD A;  3UO0 A;  1VQY A;  2H5E A;  3G2X A;  4ZCI A;  1UWB B;  2EI5 A;  3IWX A;  3BGO P;  1CG2 A;  3UCU P;  2QMW A;  1OWX A;  2H1Y A;  1F60 B;  2G9O A;  2CJ9 A;  3M2R B;  3BQ2 A;  2UXC J;  1V3Z A;  3UWT A;  1F2H A;  1X4A A;  1VMB A;  3V5R A;  1HBN B;  1UTA A;  1T11 A;  1Z4U A;  4RBT A;  2RIL A;  3MCN A;  3OTC A;  1R31 A;  3US5 A;  2OSR A;  1G6B A;  4ECU A;  1SH3 A;  2R7T A;  3IWN C;  4KFB A;  1NJY A;  2B9E A;  5LSL A;  3VGT A;  1APS A;  1S97 A;  4I2P A;  3UN2 A;  5K20 B;  1F9F A;  2W01 A;  2RQC A;  1YIJ S;  4RNM A;  4M5N A;  3G71 S; 
#chains in the Genus database with same CATH homology
 1SPB P;  1R6V A;  3AFG A;  3SQO P;  4K8R A;  1V5I B;  4YN3 B;  3BPS P;  3P5B P;  3QFH A;  1SCJ B;  2ZWO A;  3GCX P;  2E1P A;  2Z2Z A;  3A3P B;  2XTJ P;  2Z2Y B;  2Z57 B;  3GCW P;  2W2O P;  2PMW A;  4NMX A;  3CO0 P;  2W2N P;  1ITP A;  2Z30 B;  3A3O B;  3BGO P;  3WHI A;  2ZWP A;  3VHQ A;  4NE9 C;  2Z56 B;  4OV6 A;  3VV2 B;  3WIU A;  3WIV A;  2W2P P;  4JP8 A;  3A3N B;  2W2Q P;  3H42 A;  3CNQ P;  3T41 A;  2QTW A;  2W2M P;  2Z58 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...