1SJFA

Crystal structure of the hepatitis delta virus gemonic ribozyme precursor, with c75u mutaion, in cobalt hexammine solution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conformational switch controls hepatitis delta virus ribozyme catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation/rna
molecule keywords Hepatitis Delta virus ribozyme
total genus 23
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sjfA00
5FJ4A 1FJCA 1P1TA 2ZJRQ 1KOOA 4TLQA 3MD3A 4YUDA 1WHXA 2M9KA 2OSQA 2D9OA 2MQNA 4CH0S 2EK1A 5GAGU 2F9JA 2M8HA 5LJ3Y 2CQGA 5GAEU 4RU2A 1R8PA 2F3JA 2LKZA 2DIUA 2DNYA 3MUVP 1VQOS 3CC4S 1KOHA 5DM7Q 5JVGQ 2QA4S 3B4DA 3L3CA 1K73T 3FEYB 3DXBA 3PIOQ 2RT3A 2NZ4A 1URNA 1WTBA 2EVZA 2VONA 3TO8A 1YI2S 2KRBA 1D8ZA 2E5HA 2X1BA 3UD3P 1A9NB 2XS2A 2RUGA 3VAJA 2FC8A 2N3OA 3BO2A 1DZ5A 2CPXA 2DGSA 1NU4A 5LXRA 3I56S 2MQMA 2CPIA 2E5IA 1N88A 2LEBA 3ZZYA 2MQOA 1RKJA 3MUTP 4YB1P 4FXWA 1WEYA 1KD1T 3LPYA 3J7YU 2E5GA 2LXIA 5DDRC 1FJEB 4CIOA 2AYEA 2DB1A 3CMES 1YJNS 3G9CA 2HZCA 1IQTA 2CQBA 2FPHX 1VQ8S 2XSFA 3TYTA 1M5VC 2OSRA 1QVFR 3CMAS 3CCLS 4Z2XA 3VAGA 3N9UC 3UD4P 1ZZNA 1VQ5S 5CA5A 2I38A 1VBXA 2AYGA 2RQ4A 1PO6A 3UCZP 2MY7A 1P27B 2M2BA 1WHVA 4J5OA 1QM9A 2J76E 1U1LA 2CPJA 1K8AT 2MZJA 2MQLA 2MKKA 2KXHA 4UY8T 2Q79A 4WFAQ 3THPA 3SXLA 2DNKA 2B0GA 1WG1A 1X5PA 4FXVA 2RNEA 4A8XA 2E5JA 1YHQS 4ERDA 1VC5A 2CPFA 2MZRA 1JJ4A 3CCQS 2N3LA 1YIJS 5DDOC 2KHCA 4TU8A 3I55S 2V94A 2DHXA 5IM0B 2KYXA 2MSTA 4IOAQ 4F25A 2CQIA 2YH1A 2RQCA 3HI9A 2OTLS 1VQNS 2EK6A 5CXTA 3J7ZT 3VAFA 3CD6S 3D2WA 5DM6Q 2MKIA 1SJ3P 3CF5Q 2XS7A 1N54B 3RW7A 3EGNA 2JWNA 2X1GA 1Q86T 3R27A 1KQSR 1ZZFA 3UWTA 4QU6A 1RK8A 2HYIB 1WELA 2YWKA 1YITS 3TP2A 2DHAA 1VBYA 4EGLA 4WFNQ 1WG5A 2KN4A 2LCWA 2AYMA 2G0CA 2HGLA 3US5A 3CXCR 4QU7A 2DITA 2G4BA 2CQCA 3CUNA 1SJRA 2DNLA 1OPIA 3SDEB 1WF2A 2MJNA 2MKCA 5LJ5Y 2J0SD 5BJRA 2J8AA 2KM8B 2U1AA 2K3KA 4C4WA 2SXLA 3JB9k 3S01A 1HL6A 2CPEA 3DLLQ 2DGXA 2AD9A 4W92B 2DIVA 1FXLA 2YKAA 1M1KT 2MKSA 5ITHA 2ADCA 1H2TZ 2HVZA 1VC0A 2XB2D 1HA1A 2CQ4A 2WBRA 1Q7YT 5LXYA 2M7SA 1VQ4S 1U1PA 1L3KA 2MZQA 3U1LA 1U6BA 3P49B 1VQMS 2VOPA 2OIHA 1U1RA 2MJUA 4LJMA 5GADU 2LQ5A 5D77A 1HD1A 5DDQC 2G1DA 4TU9A 2CQPA 2DH7A 4W90B 1WHWA 2YH0A 1DHMA 5HL7Q 1D9AA 3CC2S 2FC9A 2BZ2A 1FNXH 1SXLA 3BEGB 2HGMA 2MPUA 2KM8C 3MDFA 3G8SA 2CPHA 2DH8A 2DO4A 3UCGA 3S6EA 2CQDA 2ADBA 3UCUP 4CQ1A 2KFYA 2DNRA 2HGNA 1M5KC 1U1KA 2MQPA 3MURP 1X4GA 3NMRA 2CQ0A 2XNRA 1HD0A 2MMYA 1UFWA 2DNQA 2LMIA 2PEHA 3CTRA 2ZJQQ 2KVIA 3H2UB 1AUDA 5GAHU 3G4SS 1UAWA 2GO9A 3FEXB 1W2BR 2DNPA 1CVJA 3VALA 1WI8A 1NO8A 1U1MA 2DGUA 3MD1A 1VC6A 1X5SA 1H2VZ 2CQ1A 5LSLA 3MUMP 4ED5A 1BY9A 3CC7S 2DNNA 3CPWR 4M5DB 3PIPQ 3OW2R 2ZJPQ 4IOCQ 2AYBA 3G6ES 2KG0A 2MZTA 2MGZA 2RRAA 2KI2A 2YTCA 3R1LA 2M52A 1JMTA 1X4DA 1U1OA 2MZSA 2DGWA 3BO4A 2DO0A 3ULHA 2D9PA 2DGTA 3U1MA 2M4MA 4BS2A 3LQVA 4OZ1A 1N8RT 2JRSA 1VQKS 4PR6A 1YJWS 3SMZA 2MHNA 3HHNB 2UP1A 1F9FA 3G71S 2MSSA 5D78A 2L41A 2VODA 4LMZA 4P6QA 2DH9A 2M8DB 1WF0A 3CULA 1DRZA 5GVQA 5H1SV 2E44A 2LA4A 2M88A 4Y00A 2MB0B 1X4BA 1JJ2R 3IRWP 4LIRA 2CQ3A 5GMKa 3VAHA 2CJKA 4OZ0A 4V19X 2DNMA 1JJHA 1DBDA 2DHGA 2N7CA 1ZH5A 3G96A 2NLWA 2MXYA 1H2UX 1WHYA 2M70A 2PE8A 4YOEA 1FHTA 5LSOA 3VAMA 3G8TA 2LECA 3H2VE 3BS9A 2GHPA 2MZ1A 4C0OC 2RVJA 2LEAA 1WF1A 4WCEQ 2RU3A 1FJ7A 1X4AA 3SDEA 2DNOA 2MKHA 1A7GE 4QPTA 3S8SA 3EGZA 2L9WA 3R1HA 1WWHA 2OTJS 1YJ9S 2KRRA 2RRBA 3P6YC 3B4MA 3CCVS 4WIIA 3VAIA 3P5TL 4IO9Q 2QEXS 2J0QD 2LXUA 5IM0A 2DNGA 5DETA 3NNCA 2FHOB 2MGZB 1G2EA 1X4EA 3VAKA 1VQ9S 4F02A 2RS8A 1M90T 1WEZA 4UQTA 3NNHA 3RW6A 2OJ3A 1OIAA 5HO4A 1KC8T 3NS6A 2CQHA 1X4FA 4IUFA 2MY8A 1VQ7S 1OWXA 3CCJS 2JVRA 3V4MA 2JX2A 1Q81T 2U2FA 1X5TA 3CCMS 1M5OC 3CCES 1WI6A 4Y0FA 3UE2A 1X5OA 2DISA 2KH9A 2KT5A 1SJFA 4F26A 3Q2TC 5IFMA 3P3DA 2FY1A 5DDPC 1U6FA 2D3OR 5EN1A 1H6KX 3S7RA 2X1AA 1YTYA 2I2YA 2DGQA 1S72S 1WG4A 2O3DA 1OO0B 2X1FA 1S79A 1UW4A 2DNZA 4WFBQ 2MKJA 5MLCV 1X0FA 1SJ4P 3BO3A 2DGVA 3CCSS 2KG1A 1X4CA 1M5PC 1N52B 3MXHP 3VF0B 2DHSA 4CH1A 3NNAA 2A3JA 3CCUS 4WF9Q 2DNHA 2CPYA 1U2FA 2LA6A 4ZKAA 2RS2A 1X4HA 2KXNB 1YWXA 1UP1A 1VQPS 1U1NA 1NJIT 1K9MT 2CQ2A 3MI7X 1PGZA 4TU7A 2QFJA 3IWNC 1FO1A 2LYVA 4PRFA 3K0JA 2K8GA 2M0GB 2CPZA 2F9DA 2KU7A 2DK2A 5CYJA 1QVGR 1VQLS 3ZZZA 2CPDA 3EX7B 1U1QA 5IQQA 4QQBA 3MOJB 1B7FA 1Q82T 2L08A 1SJQA 2BOPA 2DGOA 2XS5A 2VOOA 3NS5A 2JVOA 1R8HA 4PKDB 2XNQA 1VQ6S 2MYFA 2ERRA 1WEXA 2N82B 1O0PA 2KXFA 2MQQA 3THTA 4WKRA 4U67Q 3Q2SC 1XN9A 4C7QA 1FT8A 1VBZA 5JVHQ 3CCRS
chains in the Genus database with same CATH superfamily
5FJ4A 3MM5B 1HQUB 3V4IB 1KRPA 1TKZA 2GV1A 2ZJRQ 1KSPA 1Q78A 1KOOA 3MWBA 4Q44A 4ZS6A 3MD3A 4YY3F 3NMAA 2XHWA 1WHXA 4O3NA 1NMEB 2OLWA 4USHA 2X7IA 2KB2A 5HVGA 4DSEA 3RRHA 4GC7A 3F56A 5AE2A 2IVMA 4CH0S 1S9EB 5GAGU 2HNYA 3WIUA 3N4WA 4GVLA 4A46A 5HBMB 4F2SA 2B4VA 4OX9J 4ZVOB 4FF3A 4JI1F 2IBKA 2GVDB 5A6PA 1S6UA 2CQGA 5AE1A 5J2NA 2G1HA 1RE1B 2VBXA 4ICLA 5GAEU 3B82A 1RLCL 4RW9A 1FE4A 1O5JA 3E3XA 3ZZRA 3F73A 3BQ1A 4QYZK 4CM0A 2DNYA 4M5GA 3DHWC 2QLBB 3EUNA 2AQ4A 3CC4S 2JEFA 2ROGA 1S97A 5JJBA 2QO3A 1BE4A 3C6TA 2DRDA 4OX9F 3PY8A 1VGYA 4LFCF 4ZITA 2WW4A 3I5BA 1K73T 4F0MA 5BYSA 2LQ8A 2ZD1B 3DXBA 3OL8A 1WC6A 3PDNA 2O01C 3TO8A 3TUJC 2VONA 1YI2S 1D8ZA 3UD3P 3VVTA 2F8EX 2V50A 3EXYA 3UN5A 4X65J 4YP3A 1HBUA 2C2RA 3BV8A 5D4OA 2NXNA 5A8RB 5E3AA 1N4LA 2C2KB 3BO2A 2GAGC 1NAQA 1U7LA 4WE1A 1S76D 4L72B 3L4BC 2DGSA 1WORA 4RR5A 1BQNB 1HW9A 1NU4A 1RDRA 1V5VA 2B4PA 5D4NA 5IV3A 1U8WA 3ENWA 5EWFA 3KHHA 5H9FK 1DTTB 2AJFE 4WFXA 3TQ1A 4I68A 4Q8EA 4FYXB 3CD5A 3R97A 3TZXA 4X4PA 1SL2A 4Q2LA 2RRNA 2V4JA 1RKJA 4ETZA 1AZSA 3MUTP 4YB1P 3IAS9 3PX4A 1WOOA 4WYWA 3BSAA 2UVUA 3CT9A 3LO3A 4E8UA 1B0TA 2VFRA 5DDRC 1T94A 4ZJLA 1FJEB 4USJC 2WB1D 2AU0A 4CIOA 5ETOA 1N33F 1X9SA 1LW2B 4DL5A 3HD1A 1W25A 2C2OB 3DDNA 1IKWA 2DCUB 4M5LA 2HZCA 1LW0B 2CQBA 2JFKA 2IM1A 2VFSA 1VJWA 3UDVA 2ILZA 4DV2J 1VQ8S 2XI3A 3TYTA 2FIUA 2DR5A 1TUWA 3TJ9A 2AZ3A 2J5AA 3AAWB 3CDUA 4F50A 2V0NA 4WZQA 3HHLC 3PHEA 4BLGA 2CDRB 5GAGI 5B0GA 4WXOA 4Q43A 2AEJA 5HQLA 3I5AA 1DTTA 2BEFA 1SQFA 1SC1B 3J80U 4QCLA 1EETB 4NCBA 1UEUA 1OY6A 2Q1LA 5CA5A 6FD1A 1EKRA 4IDKA 2RQ4A 1S9FA 4J9UE 2OPSB 4J7CA 3UCZP 2M2BA 4NLXA 2BXJA 1A6LA 3WIVA 4YMEA 4G1QA 3KLGB 2MZJA 2MQLA 2KTQA 1Y7PA 2BE2A 2OD4A 2Q79A 2BUNA 3GFXA 4NLSA 4OI2A 1FRHA 4K4XA 4LIWA 3HKWA 4WFAQ 3SI8A 2DNKA 4B08A 1WG1A 1NKBA 5KFPA 3GILA 1ZOTA 2MDAA 1Q79A 3CCTA 4YR0A 4HKQA 4YR2A 4ERDA 4GKKJ 3SCLE 2GC8A 2W9CA 1IR2A 4G1PA 2CPFA 3L7OA 2ZBPA 1JJ4A 4MT1A 4M5NA 4N41A 1YIJS 1K0VA 4OYPA 2VFUA 1FCAA 2GIFA 3C6TB 1JLCB 1PSDA 2FZCB 2DR8A 2E5LF 5DDOC 3QLHA 1R0AA 4UF4A 2HNDA 3DXSX 1VRUB 2DHXA 4WTOB 5IM0B 2E5LJ 2ZE2B 1KFSA 1OSDA 1F3VA 2IMOA 1MN9A 3MAAA 1IBLF 3I96A 3DM2A 4F25A 4PCQA 3PM9A 4NRTA 3IR6B 4QWDA 2ASYA 2HS3A 4KC5A 3T1YJ 4ZVSB 4ZCIA 1VQNS 2EK6A 4LR8A 3W2VA 5CXTA 3J7ZT 4ZPWR 3VVUA 5KT5A 1HYSB 2HQGA 2AIRB 3NWRA 5HMWA 1SH0A 1Q0NA 1IBLJ 1IQZA 4CLFA 3MR7A 4F3QA 3RW7A 1TAUA 4CO5A 2JWNA 2FHJD 2HLTA 3D28A 4KHPJ 3Q8RB 4P9SA 1Q86T 3QFHA 2W7PA 3CDEA 3AJ2A 2C3UA 4LF4J 3HHKA 1KQSR 1ZZFA 2XMVA 4ZHRA 5KG1A 3UWTA 4QU6A 2BRKA 1QAJA 4O3OA 4LRFA 5IC4B 2V6AA 1YITS 4GKJJ 2ZNYA 3T1HF 3IMQJ 1RWUA 4UZCA 3TR5A 1VBYA 1RT7A 2V4JB 3FCHA 4MK8A 4NOHA 3I9V9 2KN4A 4WFNQ 3HHEA 3D6FB 2UZAA 3FCWA 3A8JA 3KUGA 4TXSA 2E1CA 1RLDA 4WIQA 2VPXB 4TKTA 2YNIA 3HSDA 3OXFA 4DV3J 4ZPDA 4XAKA 2NXJA 2QJ3A 2A18A 4B9VA 2YKPA 3BBFA 5AXKA 3CUNA 3JSBA 5KFGA 1ZM9A 3E8OA 3HVTA 4UY85 3SDEB 4DL6A 1JLEB 2MKCA 5LJ5Y 5BJRA 2J9CA 2KM8B 2U1AA 3IBFB 3H5UA 3GV8B 4O4RA 4N5SA 1I94F 2NUHA 4RUAA 3ELHA 2RDJA 1TP7A 4KE5A 1HL6A 1HNIB 2CPEA 4KGXB 4YN3B 1OY9A 3MEDA 2WVFA 2R4FA 2YWHA 3AOAA 3IA0A 1ITPA 5LMNJ 2DIVA 4IFYA 2YVSA 4HT5A 4DXLA 1NKEA 3GONA 1MMDA 2MTLA 5ITHA 1H2TZ 2ADCA 3FKBA 3HO1A 2BW2A 2N4CA 4PQUA 1WSVA 2M7SA 1M5HA 1BGXT 2WVBA 3HSZA 5D0RA 3BGLA 3PW5A 1RABB 4DUZF 1TZ0A 3IN5A 1HI1A 3DMJB 4DV7J 4FBUA 1U6BA 2LU2A 2H51B 2QZ8A 1RAHB 3AOBA 3A12A 1K44A 1Z2LA 1FWLA 1NHVA 1CJUA 2IM2A 1XIQA 2EWHA 1R3NA 1GNKA 1CQMA 4I56A 2G1DA 2LP4A 1WHWA 3W2WB 1DHMA 4GVBA 2XZWA 5HL7Q 1VK8A 4EYIB 2MLYA 3A8EA 4JBCA 4DR2F 3BSCA 2GVZB 2D41A 2MPUA 5L1LA 4L75A 4ZCLA 1SKUB 3TWZA 2H3EB 3BH7B 5T7LB 3G8SA 4NLWA 4OHWA 3ICLA 2DH8A 4KY3A 4X62J 1NK4A 3ZZ0A 4N56A 5KFSA 2DO4A 5DJBA 4ENOA 2ZHOA 2EI5A 5L38A 4M1KA 2IM0A 4M5HA 4P7VA 2PA3A 3OVSA 3LP2A 2L48A 2WONA 3UCUP 4CQ1A 4EI2A 2AZ1A 3Q23A 4NXMF 4DFJA 3OFGA 3GIRA 1U1KA 1BMQB 1C1CA 2CDQA 4UUXA 5CD4A 4GRSA 1WKJA 2B7CB 2CQ0A 1HD0A 1ZBTA 3J7A1 1S12A 4NLQA 4DWIA 3O3LA 3DU5A 2R7XA 4DDFA 2HPUA 3SBMA 1OYEA 2CWXA 4LSZB 4OI4A 3MAHA 2VIHA 5HAOA 2ZJQQ 4X64J 1CJKB 1HBOB 4OFZA 2XLJA 2VG6A 4AL6A 2WOMA 3G4SS 3I0RB 3GJTB 2GO9A 3ITHA 2YY3A 7FD1A 1TL7B 1KKHA 2BJ9A 2HNYB 4OLOA 1K8AT 4Q8FA 1NK5A 2Q3PA 1TQLA 2W01A 4RWXA 5F9LA 2OGUA 4OI3A 5L8RC 1U24A 4CLTA 1XMOF 3BGFA 1NO8A 3GCXP 4IKAA 1TL3B 2HNZA 2FVCA 1QJHA 4C3LA 3OHBA 1U1MA 3MMAA 4C11A 4EZ6A 1KTQA 3IO1A 3MD1A 1FKPB 4JV5F 3FZBA 3GTYX 2B51A 2V2QA 2IDEA 2Z2LA 3RAQA 1FK9B 2FY8A 5CQGA 1CQNA 2AP6A 4QIEA 3NS7B 3D6TB 2HK3A 5KG6A 3VQSA 3D7SB 4C97A 3DLGB 2IA0A 3CPWR 2WSCC 5CH7B 2RMLA 3UI3A 2XMAA 3OW2R 1KQKA 4H54A 2FVSA 1N32F 4JI2F 1Q1KA 3EVOA 2YNHA 1U6ZA 1K47A 3FBFA 3IWXA 3BQ2A 3OJSA 2I9SA 2R7QA 2B56A 5FDLA 5J2QA 3PJXA 1U48A 1HNVA 5CCMA 1JMTA 1X4DA 2KJVA 4DCPB 4WBFA 4FP9A 1YJRA 4NI2B 5CAAA 3M8PB 3ULHA 3NAIA 3TAQA 4TQSA 1PJ5A 4ILRA 2Y1JA 1VMBA 3FK4A 2DGTA 3HSGA 2EPIA 2EFPA 4BS2A 4O4GA 5G0RA 3QGIA 1B0VA 1SJ1A 4ZPCA 1HQ2A 4Y28C 3P8BB 1VR6A 3EXCX 2IVYA 4UOCA 4DL0C 4DN9A 3IM9A 4KT0C 5B0BA 1YJWS 2HW3A 4KHRA 2LXFA 3QPIA 4U7CA 4E0DA 2K1RB 5DG7A 1X8DA 4FNIA 4B9UA 3BSOA 4QIWD 1JNZB 4P6QA 3NBPB 1N36F 1LXNA 1UZDA 2NXUA 1FERA 2VG5B 2M8DB 4H4OA 4ZVFA 1DRZA 1FESA 1MROA 5KFIA 3VGUA 4DSKA 7AT1B 3CULA 1SQEA 4XDCA 2HIQA 3ZTSA 4Y65A 4QWEA 5IT9U 2RE1A 1TVRA 3M8PA 4WWSA 1U0SA 2K2PA 5GAHI 2J6TA 1T11A 3GV7B 1CJTB 4ILMA 2QL5B 4JI6F 5GMKa 2CJKA 2BE9B 1D8YA 5KFUA 2E1PA 4KTQA 3DMJA 3OVAA 3D3CJ 1CC8A 2WVEA 4C98A 5L39A 3KMSA 3CJ2A 1P9YA 1UWAA 4ES3A 2LVWA 2NLWA 2POKA 2MXYA 4YS2A 3OSPA 2HBZB 2N4DA 4DQQA 3GFZA 3NGTA 5K14B 3KJVA 2E9TA 4I7FB 2I0XA 2B4OA 3LP2B 3H2VE 1OY8A 2GHPA 3R5CA 5KFLA 1QAIA 2RVJA 2IPOB 4R8UA 5ADZA 5KFKA 2BDPA 2W2PP 2DRAA 2KFZA 4WCEQ 1FJ7A 2WOMB 3SDEA 4PABA 4Y2AA 1ZM2A 1M0SA 2Y9HA 2D3ZA 2V68A 2OPSA 4V1Ak 1GTEA 3WC0A 3FSIA 4DR5F 4DLGA 3PYDA 2GVZA 4ZIWA 3R1HA 1YJ9S 2H5JB 1I6JA 2KRRA 4PQAA 2RRBA 3P6YC 2FJAB 1HWIA 3N6LA 2D74B 4F67A 5B0CA 1DURA 3TX0A 1RT4A 4AYBD 3DOLB 1ZAWA 2OFGX 3NWGA 1X9WA 3PKMA 3D1HA 2WCXA 2OPRB 3IS9A 3Q83A 4IO9Q 3RG6A 5D3GA 1FXDA 2W7AA 2BJDA 8AT1B 2PDAA 2RILA 3HHDA 4O3RA 1NJWA 4H4OB 2HBRB 1V9OA 4F36A 3JXOA 4F3MA 1G2EA 5HJYA 2UXBJ 1F3FA 2VC0A 1JLGA 4ZVTB 4DV0F 1R8CA 4HDGA 2QL9B 1T9WA 1VQ9S 2HVHA 1UL3A 2WSFC 5KFTA 4B3MJ 1M90T 4F02A 5KFZA 1VQYA 2PA8D 5HN0A 2OPRA 3IS9B 4XIUA 5KFWA 3RW6A 2GHWA 2HVDA 2GIRA 2W2QP 3N79A 2PN6A 2V8PA 2R7UA 3MMCB 2XCPA 5HBMA 4FS2A 5C24B 2UVRA 3UN3A 1KC8T 2JEGA 3W2VB 2QMXA 4AE5A 1IBCB 1X4FA 1UWBB 2PMWA 3BREA 4MFBA 4IUFA 3FGVA 3HX9A 4K4VA 1BQNA 1Y11A 1C0TB 2RB7A 4P52A 1TKDA 3KNGA 1IXKA 2W9BA 1HHQA 4ES1A 3CCMS 3ADAC 2ASDA 2HKEA 1M5OC 4LSLB 4K0KJ 4DPXA 4DPWA 2BKPA 3MCNA 4Y0FA 1L5UA 4ZA1A 2W7OA 1DQ9A 4CO4A 4R8UB 4LFBJ 4F26A 2R8JA 4BCAA 3BSNA 2PFFB 3P3DA 4ID5B 4ZVEA 1AUSL 1U6FA 2C3OA 1TMJA 4FKXA 1FRMA 3BYPA 1FRJA 4C2MA 2BKOA 3AB4B 5BYQA 4ZN1A 4ZMMA 1LWEA 1RTDB 3MAQA 4ZJOA 4YB6A 1H6KX 2GJIA 4H4MA 1MWQA 4WFYA 2HSEB 1NB2A 1XC9A 2EFQA 1OO0B 2H65B 1JXEA 4QZVB 4BC7A 4LF1A 1MLAA 1PC5A 1RADB 1S5ZA 2B43A 3LGMA 2QA1A 3QT7A 2NZCA 4MKAA 1RAIB 3MTKA 2WBMA 1HBOA 4ICLB 1YRXA 1FXRA 5J2MA 1OPZA 1YJVA 1R89A 2CJ9A 5C25A 1F6TA 3C14B 2DGVA 2HFUA 3FSXA 1X4CA 3QNWB 3M9OB 3FQLA 4O4GB 5T41A 1M5PC 3H8YA 2HQIA 4CP5A 1CSJA 2HQ3A 2HRTA 1IKYA 2YX7A 4C3MA 3M2RA 5KG2A 4RNMA 1CS4B 4I2PA 2CZ4A 2HLUA 2K1RA 4ER8A 1SUQA 3POTA 1FNMA 2QL7B 1IN0A 1FKOA 3BQ0A 4DR6J 2YQ0A 2UXDJ 2HHWA 4PG4A 4N8OA 3GFHA 3LTOA 1SIZA 4DG1A 3MM5A 3HVAA 2IBOA 1YWXA 1IKWB 2CIMA 1IQTA 4AT1B 2AHOB 1UVNA 1RACB 2CWKA 1PGZA 2LDYA 4QIGA 3RZAA 1FK9A 2XLKA 3LAKA 3KK2B 1S4EA 1ZPWX 1FO1A 4HI2A 3KK1A 1NPKA 4ZLLA 1QD1A 2OI2A 1BUXA 2LYVA 3AD7C 2AGQA 3TARA 4U7UD 3MM7A 5D0EA 5EUHA 3PX6A 3K0JA 3DYAB 2M0GB 1ZTWA 5J2QB 2ZWPA 3VZIA 1HIYA 2FHKA 2K7JA 3D0IE 4O3SA 4NZ0A 1UFKA 3GJQB 1ZAVA 5L1IA 1SC6A 1UFLA 4NA1A 1NNDA 2ASLA 3H59A 3W8GA 3WDOA 1KVJA 3M2UA 3AQPA 3AY0A 3D6HB 4DX5A 1B7FA 1SJQA 2QA2A 3AD8C 3SFGA 1F2GA 3KJFB 1V3RA 1FTCA 4KFBB 3UQSA 2BBEA 3QLHB 1R0AB 2EXUA 1FWPA 4DR7F 5E3PA 4OZLA 4X4UA 2IVFB 2ZWOA 3UNGC 2OMOA 2R9LA 3R2DJ 1S6QB 2ERRA 4ZP6A 3U7JA 3N28A 2IJNA 1JIHA 3KKFA 1CC7A 5GMDA 2FGCA 1C2PA 3W1YC 1LNQA 5J1EB 5I4MA 1F0XA 2VKZG 2MQQA 3BJYA 3Q22A 2DPJA 1XNQF 1FDNA 4WKRA 4C7QA 3Q8PB 3ENAA 4ZCMA 3OSNA 1VBZA 4NPOA 4DLEA 2GQQA 3TZYA 3CCRS 4K4SA 4LQ3A 4ZVGA 1RWKB 2EKYA 1FJCA 2KVQE 5F0WA 1LWXA 4DX7A 4A48A 3M4XA 2GS8A 1LK7A 2OO4A 4C48A 4CDIA 5H9EJ 4YUDA 4G65A 4QWBA 1HR0F 3BDPA 4HL9A 3QGPA 1HBMA 4M5JA 4OJ1A 5ETQA 5B7WA 1T05A 1RAFB 4ANDA 2CKWA 2OSQA 3UVJB 2RF2B 2H5EA 4P2MA 2ZH1A 2HEKA 2ZKTA 5ETSA 3Q89A 4NCGA 3BN7A 3VCDA 5A8WA 3H4BA 3NOGA 4WKYA 4DV6J 3MMCA 2HMIB 4LF9F 3RU0A 4JB8B 1WJ9A 1N6QB 2A6OA 2J7KA 5LJ3Y 4CO3A 4B9MA 3BR8A 3FMBA 4FVMA 3TAMB 5EHHA 1D9FA 3VR1A 3DU6A 2F3JA 2R8HA 2Z2YB 2ZH3A 4P75A 2LKZA 3MM9B 3VTIA 4W98A 4Y2MA 3MUVP 3KLEA 2X3DA 1HHTP 3TUIC 4KH1B 4J9RA 1HWKA 4CNYA 2YQ1A 1KEKA 1S1UB 2Y0SD 1G7CB 4DPTA 2HHVA 1XR5A 3EWGA 2R8KA 4KPCA 4URQU 4DV2F 4L74A 5KG0A 2HS0A 3H40A 1L3UA 1JB0C 4LF2A 1WTBA 3H4DA 5F8NA 4DUTA 3MEEB 3KNAA 2E5HA 2ZZTA 5HQMA 2UXCF 5SZTA 2ALZA 3OTBA 3CEDA 2XS2A 4TY8A 2RUGA 1DQ8A 2YWFA 3FZ2A 3VAJA 4DUYJ 5HANA 2IM3A 2FC8A 5GAEI 3MMBA 4M5MA 2XQCA 4DR3F 1DZ5A 2CPXA 2VUGA 3ZTQA 2UUCJ 1QTNB 2IYGA 5B09A 1LOUA 4RKUC 1RT2B 4PUOA 1TELA 2Z2MA 1IM4A 2MQMA 2YNGB 3GLJA 3MPYA 2E5IA 1UMJA 3AD9C 4K8RA 1N88A 3IGNA 3SSQA 4F4YA 2LEBA 3CO0P 3OR2B 3ZZYA 2MQOA 2R2RA 4XTTA 4FXWA 2XCAA 1WEYA 4NLYA 3LPYA 2UVWA 4HH1A 4B3SF 2LXIA 1UA0A 1RWVB 2VASA 2NCKL 1GXLA 2Y8YA 4F4WA 3K89A 4QJVA 4CLSA 3FFIA 3CCWA 3R7SB 1OMSA 2BE2B 3PCOB 2FPHX 3JQJA 3WHIA 4DSIA 4JV5J 2KZZA 4DF8A 4RZRA 1Q16B 2NSBA 5IT0A 4DL3A 4DFMA 2DRBA 4RW7B 1RBAA 2A1BA 5HK4A 5F8GA 1U4BA 4Z2XA 2W4DA 2ZH8A 1QAXA 2HAIA 3THVA 1B7YB 2OP5A 5BYRA 4X4VA 2I38A 3DHXA 3FNNA 2QN6B 1PO6A 1W2IA 4DR4J 1EHWA 1U25A 3M9MB 5J2MB 4J5OA 4LSNA 1MW7A 3T41A 2J76E 4W4MA 2CPJA 5D0GA 5B08A 4DOZA 1FF2A 2MKKA 1FDBA 2FD2A 4UY8T 2HRYA 5CYMB 2GA7A 2QC3A 3SXLA 3K8WA 5HLFB 2F8MA 3EJMA 2KL8A 1F5CA 1NUEA 2PI4A 1X5PA 3T6BA 4L73A 2W24A 4FXVA 3DOMB 2RNEA 5HATA 2LEPA 2E5JA 5DS7A 4A8XA 1T95A 3NAHA 1YHQS 1HI8A 1FI4A 1XR7A 1KLMA 2AKWB 4RUBA 3GMGA 1GX5A 4RW7A 3CJ3A 2YKNA 3W5YA 4F0HA 1VC5A 2HBQB 1S0NA 1PCAA 3HD2A 3HVRA 2ZHBA 3C66A 1Y5IB 3HFKA 1YZ7A 4PWWA 4JYAF 1JLBA 2KHCA 4I6WA 3I55S 2V94A 2IC3A 4LQ9A 2KYXA 2ZBCA 3ETOA 3GU0A 5GMEA 4EWTA 1TV6A 2ZKUA 2OH2A 2ABYA 2DT9A 2CJXB 1KQGB 2IDLA 2NXEA 2EC2A 1RU2A 3MHYA 3PRBA 4RW6B 5CZVA 4DPUA 2UU9F 2YH1A 2P2CB 1WTFA 4ELTA 2XB2D 4RNFA 3RBZA 4OV1A 4NCAA 3CD6S 2QYCA 2VBWA 5LMUF 2XMUA 1H7WA 4TNOA 2MHEA 3R3TA 1S1VB 4LBIA 2R3VA 1SJ3P 1LV5A 4BDPA 1R7IA 1TL1A 5K5MA 1LWCB 4ZPVR 4HHJA 1N54B 2IMWP 2UU9J 2XS7A 3M7VA 3O8WA 1WOPA 1JX4A 1RA6A 2N7YA 2X1GA 3PRDA 4J9KA 3B8HA 4J9LA 1Y3JA 3IGVA 1JLGB 1HQEA 1TKTB 4OHVA 3U27A 2AJ1A 1J5OA 3D6MB 1SIWB 2ROPA 1PIEA 2V2VA 3CMQA 4LRBA 3DLKB 3OVBA 3ZO7A 4Q0BB 2LU1A 4JI3F 4D3HA 3NGUA 1M1GA 2MLZA 4ZP9A 3RGIA 1YKWA 3TP2A 2O5DA 4FKYA 1E6YA 3GSDA 4BC9A 1RTJB 2ILYA 1TUVA 2GVDA 3DN9A 4WFZA 3IR5B 1C0UA 4I4BA 2LCWA 3MTJA 3QSYB 3PEJA 2KHDA 4B3TF 3NGRA 2PEBA 2AYMA 1YLXA 2G0CA 1AA1B 2HGLA 3AJ1A 4EU0A 4XPEA 4FYDA 2IRXA 2LFVA 4QU7A 1Q8IA 3Q8UA 4DFPA 4JI5J 3D0HE 3BGUA 3SEOA 2G4BA 1BXNA 4Y6IA 5IWAJ 2CQCA 1YRTA 3K5NA 3MECB 2XLIA 1SJRA 1KDNA 1OPIA 4U8VA 3KLVA 5CYQB 1NEEA 1WF2A 2CNOB 2J0SD 2GIQA 2J8AA 3MCOA 1OSCA 1DTQA 1UEVA 3H2LA 2UXBF 2K3KA 4K4UA 2BJEA 3A3OB 2AJQA 2ZZNA 3DLLQ 1B3TA 4G1IA 2B9YA 4GVBB 3GIJA 3M32B 3D9BA 2MKSA 4NI2A 5K14A 1IVZA 4L3KA 1RHQB 2WBRA 2EFGA 3Q24A 2APOA 1NJXA 2DVIA 3M6UA 5JUMA 2Z2ZA 1L3KA 3DRRB 3M30B 1NCLA 1TU0B 4IH5A 1IKXA 3RB6A 1H3DA 2HHQA 3EZUA 3L7PA 4OYIA 1HQEB 1TKTA 1VHIA 5E0OA 2VOPA 1U1RA 2MJUA 2NPFA 2NUUG 2VBYA 1YGYA 1RHKB 5GADU 2LQ5A 3M6XA 5D77A 2BJ1A 5DDQC 1UVLA 1FJGF 2BQRA 1F1BB 4OIXA 3DOMA 4OYOA 4P72A 2UVVA 4LF5F 3RBEA 1JLFA 1VISA 3E01A 4P74A 4Z7CA 4LF5J 3J7Z5 1HW8A 3J81j 1ZPVA 3CIZA 3MF5A 3PJWA 2VPZB 1C1BA 3MDFA 4U96A 2XMKA 1YG0A 4LSNB 3PV8A 3SZ2A 1HQUA 3V4IA 3HJVA 3CJ8A 4EMDA 4DCJB 4URGA 4ZVRB 3O2IA 4KSEB 4NCGB 6FDRA 4TQRA 3QRRA 3UCGA 3H98A 2P5VA 3S6EA 4X66J 1OS5A 4OLPA 5DZ7A 3KTQA 4NZ7A 3PVXA 4LFAJ 3M8QA 3KDOA 4B02A 2KFYA 4DV1F 1AFJA 1YJUA 4LFAF 3ISND 2OHDA 2YKNB 4XK8C 3OTOF 4FF2A 3CSKA 1M5KC 3OV7A 5KFYA 3SCKE 3C15B 1X4GA 3ILIA 2NQPA 3NMRA 2XNRA 3ENQA 4OZNA 1RJJA 2RHSB 3M6VA 2MMYA 4C8ZA 1UFWA 2A2DA 2DNQA 2BJ7A 2PEHA 3FRZA 4Q7AA 2OD6A 1MMLA 4M95A 3FBBA 2KVIA 2OEKA 3GJRB 3H2UB 4USKA 4U95A 3C19A 1FX4A 2R7RA 1QSSA 2QYGA 2DNPA 4IDKB 1P6TA 4NEZA 1E6VA 4IRKA 1CS4A 4USTA 4Z7YA 2B9EA 2V34A 5F9NA 5EX0A 4MK9A 1CVJA 4J90A 2JNJA 3MZIA 1UVIA 4KFBA 3IP0A 4DR7J 2EC0A 1HMVB 4YDDB 2FZGB 2MEWA 2ASJA 4HLBA 1VC6A 1RP5A 4K4TA 1RCXB 4ITSA 4CYUB 5LSLA 4HI1A 2BM0A 3FQKA 3ETMA 3KJQB 4M63A 4KH0B 5C7PA 2YNFA 1BY9A 4OJ3A 1NK0A 1R0BG 4CCHA 4M5DB 3Q8QB 1QE1B 3W8PA 3GZ7A 1N36J 3E2EA 1FEHA 1TTHB 1WC1A 2B6AB 2DXEA 2OEJA 5AXLA 2MGZA 2KG0A 2RRAA 4OL8A 1EQMA 1RA7A 3P96A 1UCNA 3DFEA 3GFYA 3QAEA 2MZSA 1BQMB 3AOCA 3M32A 3PFOA 3PO4A 3DI6A 5HROB 1EKSA 1TUGB 2D9PA 3R6GB 3C3LA 4K5SA 1S1XB 3TZWA 1S6PB 3DOKB 5C24A 5SUHA 1KNZA 2VD3A 1XJWB 1F2HA 1VRTA 2JRSA 5E3QA 4B3OA 1GMVA 3TAMA 3QIPB 2B8QA 1Z1ZA 4DG1B 2XZDB 3IWLA 3OUYA 3WC2A 3PYGA 1FNOA 4TY8B 2QG9B 1F9FA 4QW8A 3X3UA 4DZDA 5D78A 2L41A 2VODA 3PNIA 1LWFB 1R43A 1IM6A 2IJRA 1PYTA 3BPSP 4CLUA 3MM8A 3ISNC 2B9XA 4DV7F 2JL9A 4JV2A 4ELUA 1NBEB 3BGRA 3Q8YA 4ZVHA 1IBKF 4Z37A 3LP1B 4JI3J 1B70B 1KLMB 1ROFA 1V6HA 1WKKA 4Y00A 1JJ2R 2DEIA 3FBCA 4P7TA 4E2FB 1S48A 2QMUB 3U02A 2YXLA 3OTCA 3W60A 1NKCA 1HNZJ 2XYPB 4X64F 4AL5A 1JLAA 2AEMA 4N47A 1VHFA 2ATLA 1JJHA 2QFIA 3AH6A 2DHGA 5ETLA 2E1MC 3AJDA 5ETVA 1Q5YA 1RWPB 4DL2A 1YZ6A 1GXTA 2CAJA 4WYLA 1WHYA 4C9DA 1RAAB 1SKRA 1H98A 4R0JA 3G8TA 4F0KA 4IRCA 2QSWA 2BV3A 5D8HB 1IWGA 2RQMA 4ID5A 1NZAA 3ZNUA 5KFEA 2MZ1A 4F3OA 4C0OC 1RYRA 4DV0J 3H5XA 3SQGA 2DY1A 1UW9A 1HBNA 2LEAA 4LFBF 5D15A 2B3TB 2YBVA 1FFGB 3DM2B 4I7FA 2HIYA 3LANA 4IG3B 1YJ7A 5I3UB 4DS4A 2QLXA 4IO1A 1TL5A 4TYBA 4C0HA 2V4RA 1NM2A 3S8SA 4USUA 2GO8A 3I87A 2XBPA 1WWHA 1MU2B 3HSJA 2NREA 2OTJS 2DXDA 2RD5C 4PG8A 3C2PA 3K5LA 1LFPA 3NG8A 3SQGB 1PILA 4HT7A 4MKYA 3M8SA 1J27A 3HFVA 3OHAA 3RB0A 1FWKA 3KYLA 4NA2A 2J0QD 1WDTA 1XTZA 2LXUA 1JJCB 2YKQA 1IR1A 3OD2A 4B9NA 1CG2A 5DQHA 1WD6A 1PYSB 1VLOA 4RNHA 3NNCA 2FHOB 2I5JA 4P71A 4IG0B 5ETNA 2R2UA 2JEIA 1H38A 3BH6B 1QE1A 1GMUA 3RAXA 4B17A 1T02A 2AV5A 2WZ1A 2DEJA 3IRXA 2GMHA 5DQIA 2BM1A 3OTOJ 1WEZA 5F3TA 4DR1J 4N8NA 1VBKA 3PTWA 3UD5A 4RBVA 3ZTOA 4OV6A 3RJMB 3AA8A 1SVDA 4LR7A 4ECTA 3BYRA 1YVFA 3GG1A 5G4DA 1U0HA 3QQCD 5C42A 2C22A 1OIAA 1PJ7A 4DI6A 4DX8H 3NS6A 4ALZA 2AJ0A 1N5VA 3PO5A 4RPFA 4IYQA 4WU3A 5HMXA 5KT4A 2MY8A 1H72C 2W2NP 1S49A 2YWWA 3Q86A 2ZUGA 2PT0A 3DKDA 2H5IB 1KWMA 2P8IA 4YY3J 2JVRA 2PO4A 1Q81T 2U2FA 3MEGB 2OKQA 3KK1B 5DLGA 1JXVA 3P4UB 1WI6A 1BWEA 4HACA 1JK9B 2ZHAA 1X5OA 2EFVA 2H4WB 1UVKA 1GTHA 4DU8A 3Q2TC 3B78A 4MYUA 2YKMA 4IFVA 1EP4A 3EGWB 5RUBA 5KG5A 2D3OR 1N5TA 4OJHA 5EN1A 1MWYA 1UVMA 3WX4A 1RBLA 5AE3A 1HNVB 2C2MB 6AT1B 4A8OA 1YTYA 2I2YA 4DEZA 2JC0A 1HWLA 3DGPB 5F3ZA 3T3FA 2QTWA 2X1FA 4AQYJ 3CW2C 3T5HA 1S79A 3ZNJ1 4ECWA 3MR6A 3PW4A 4FVCA 3PG9A 4LT6A 4ZPAA 3I9ZA 1ACMB 3MXHP 1JKHB 4MH8A 3FCVA 4PXBA 4XPCA 5DQGA 2XC9A 3DRPA 2XM3A 1U0HB 3LW5C 5M2UA 2KZMA 2CPYA 2ZD1A 1O6XA 2K06A 5JXSA 2LA6A 5KFJA 1CPZA 2VV5A 4NX9A 2AJ4A 4ECSA 2RS2A 2LDIA 1X4HA 1Y9OA 1IUJA 4P2SA 2WONB 4Q5VA 2NYHA 3PYFA 3KLHB 1T05B 3N5FA 1RT1B 4RWWA 5LSRA 1UP1A 5FLXY 1JLAB 1GFWB 1R8AA 2XSJB 4NLOA 1U1NA 1SCJB 4J9OA 1K9MT 1HI0P 1RTHB 4CLWA 3LGHA 2DYAA 2L9NA 3R7BB 2J9DE 4LSLA 1LEOA 2QLWA 2HFNA 1C1CB 4QPXA 4TU7A 5J2NB 5D3GB 1J5EF 2IHR1 4B3TJ 3IWNC 4DSJA 1SC4B 3HZGA 3AB2B 2V63A 5KFXA 2K8GA 2WVCA 4QIVA 4LVNP 3GIMA 2F9DA 2KU7A 5MAOA 2C2EA 3UFCX 2E29A 3KG0A 4ECXA 2VFVA 3MM9A 2CPDA 1U45A 1U1QA 3R7NB 3OUYB 2P9GA 2QT7A 2XGQA 4PZVA 3VHQA 1I3OB 3O1LA 2FLLA 3MOJB 1C1BB 1NDKA 3MMAB 2Y0BB 3P45B 2DGOA 5E5NA 4C11B 2XS5A 2VOOA 2V8VA 3GYNA 4X2BA 5F0UA 4CT9A 2BX6A 2W8KA 1U02A 3SV4A 2Y8WA 4OX7A 2ACYA 2CG8A 2XNQA 5ETPA 4NASA 3LWMA 4EYHB 4B9SA 3SCJE 3GCWP 3IXQA 1C0UB 3HHLA 4HTIA 4KV8A 4WK3A 1SL1A 4ILLA 1QY7A 3TRGA 3EMTA 3Q2SC 1MWZA 3SQOP 2C3PA 1Y3KA 5F8LA 2GJ2A 1FT8A 2B6AA 1S57A 2C3YA 3DLEB 5J1PA 5JVHQ 2VJUA 2NR0A 1JWWA 3JTNA 1RT1A 1RAEB 3N5BA 4NLRA 1Y0HA 4PXEA 1CJVA 3T1AA 4FS1A 3HP6A 1F5BA 3KLHA 4JI5F 3L9ZA 2DR9A 4NXMJ 3TW0A 2PSZA 4TLQA 4X4OA 2VG7A 4C6AA 5E3CA 1YX2A 2M9KA 2V8GA 4CO1A 4ETXA 3QRPA 2RUSA 1JXLA 2I1RA 4DPOA 3HULA 1S1WA 3CWJA 3SV3A 2Z30B 2HHPA 2M5YA 2D3UA 1U8SA 1KONA 2W4PA 1ZTTA 3DCAA 3V5RA 3DRYA 1W26A 3K17A 3NKYA 3H0PA 2JH3A 1TKZB 2W8LA 2HZVA 2XO6A 3KHGA 2G2YA 2YKOA 2DIUA 2RKIA 1JLBB 1KOHA 1VQOS 1PBUA 5DM7Q 5JVGQ 1S10A 2R7TA 1RISA 2RH3A 2QA4S 2AW0A 3C15A 5E2QA 5BXIA 3B4DA 5M2RA 1O8BA 3L3CA 2ZEJA 4BWMA 4YHHF 1NSPA 4I64A 5F41A 5FDLB 1URNA 3DRXA 3K5OA 2VQFF 1NRKA 1ZA1B 2FGOA 1CEZA 2HBYB 3CIMA 4DF4A 1N56A 1P8GA 2KRBA 1FRKA 1ULRA 2RKIB 3CB4A 4N7TA 3Q0AA 2VQEF 1NXIA 4M5KA 2V9KA 4KBIA 1N34F 1A9NB 3RB3A 1XK8A 1HWJA 3PW0A 1FKPA 3M9NB 1Y10A 1RAOA 1S7HA 4QWAA 5LXRA 4IR9A 1RSCA 3HMJG 3I56S 1T7PA 4ELVA 4DZ6A 2DPIA 3DRPB 1RBOB 4LF4F 3NXZA 3N01A 4CZCA 4ED6A 4CM2A 2OMLA 4USIA 3A3PB 3TJAA 1PC4A 2E9ZA 4WP8A 1ZETA 4RNOA 3JSRA 3HJFA 3W9IA 1KD1T 1RYSA 2VZ9A 4KO0A 3AXKA 2CFXA 5DRKA 1TV6B 1RT4B 2ZE2A 3RR7A 4KGZB 2HNDB 1FX2A 2Z0GA 1H74A 4F4ZA 2AYEA 2DB1A 1T3NA 3CMES 2YNIB 1RWXB 3BKFA 3FRYA 1U2RA 3I6PA 3K5PA 2WTFA 3BM7A 1FRLA 4KV8B 3G6XA 3V81A 1VIXA 4QOTA 3CMAS 3OR2A 2ACMA 4WP9A 3OLBA 3VAGA 5D4LA 4OZ5A 3CJRA 2E7XA 3UD4P 2CNKB 1ZZNA 4ZHRB 1QSYA 5LM7E 5HP1B 1OQ3A 3ISZA 1VQ5S 1GX6A 1HHSA 2DCLA 2GNKA 2AYGA 3E51A 1QAYA 3PFEA 2ZUAA 2IIHA 3QAUA 4K59A 2MY7A 1P27B 2PD1A 3OFHA 1XBWA 3FSYA 4O44A 5ETTA 4KJIA 3D4JA 2J9EA 5I42A 1U1LA 4F04B 3GR0A 5I3UA 4DL7A 1C0TA 3PW2A 1CJVB 1IR0A 4LRDA 1LW2A 2B7BB 1M1HA 3THPA 3G6VA 4K4ZA 4A8YA 1N5YA 1DAXA 3IAM9 5DG8A 4CTAB 3GWCA 1VDHA 2LLZA 4GO7X 2C3MA 3W64A 3M6WA 1YSJA 3CJ0A 2MZRA 4J9PA 1CJUB 3J81U 3T1HJ 3CE8A 3DOLA 1BQXA 2ZH9A 5FIIA 1EIYB 3TEGA 4R0EA 1WACA 4OYXA 2HG4A 3JSMA 1N5YB 3RYLA 1UJ5A 2Q43A 2E9RX 4TU8A 1Q8BA 2XEXA 2BQUA 2ZDOA 2Z58B 2CJBA 4CLKA 1GMWA 1X9MA 4MKBA 1R31A 1SH2A 4P73A 2MSTA 1T3OA 4TLRA 3PHTA 5I42B 1XNQJ 2XYGB 3KJNB 1VCTA 1VRTB 2RQCA 1V3SA 1SH3A 2A2CA 3HI9A 2OTLS 3F0NA 3L7UA 4FBTA 3TQEA 4BHQA 3VAFA 1OQ6A 1A0OB 2BJ3A 2E7VA 2VH7A 3LF0A 3MR3A 2WK4A 3AQOA 5DM6Q 1IBMJ 3CF5Q 3Q8VA 2FZKB 3SCIE 1IBMF 3QATA 2XMJA 2ZOFA 3EGNA 2Y1RI 4ZVQB 4DU7A 2CJYB 4ZOSA 2EEYA 1FVQA 4OJGA 2V8HA 3EE3A 5A8RA 3K8VA 4ZLJA 4OX6A 5K8OA 5C42B 1FJGJ 1HPZB 3R27A 1EX8A 2CUYA 4L76A 2VHGA 2XSJA 3QT5A 3HVWA 3RR8A 1H0HB 2V5HG 1UKUA 1R6VA 2WB4A 2PMHA 4KO0B 2R7SA 1NH7A 1AT1B 2Y1LB 1NJYA 1HKAA 4EGLA 2F5GA 4QIFA 2FB0A 1WG5A 4KKOB 2EKNA 2O67A 2PGCA 2KDOA 3W61A 1FEEA 1UVJA 2HHHJ 1WDDA 3FBEA 1HNIA 1T03B 4JUZA 3I5CA 4KR0B 4QR2A 5J2PA 2DITA 2XHCA 2YWEA 3BN4A 4DR2J 1EB0A 2ZBQA 3NOCA 2F4VJ 2IY5B 4DPYA 4ZVUB 2UXDF 1RZMA 2L3MA 5BR8F 1RHRB 3CDBA 4DX6A 4ZLNA 1FDDA 2P9EA 5K20B 1MROB 4O3PA 4EZ9A 4C4WA 5KT6A 3JB9k 1VOMA 2IFXA 3NBPA 4RL1A 1NDPA 4ED7A 4DR6F 3H5YA 1UTAA 2DGXA 3G82B 3NL0A 2ZM6F 2R7WA 1FXLA 1M1KT 1N5SA 3D68A 2QA4G 4RW6A 1VC0A 2HVZA 4I0WA 2XI2A 3LALA 1I51B 5LXYA 4L3NA 1VQ4S 1U1PA 4CWBA 4YHHJ 2Z8QA 4X4NA 2R42A 2MZQA 1TAQA 3EGVA 1NB7A 3MMJA 5IOLA 2Z56B 1RT6A 2F8HA 3P49B 4J37A 3C8YA 1P1LA 4USWA 5IWAF 1VQMS 1DY3A 1FDAA 5B0AA 2OIHA 2BVZA 2BANA 4LJMA 5T7LA 2HHTA 4QR0A 2YQ3A 4MMOA 4PPZA 1HD1A 2CQPA 2A6MA 2DH7A 2UUAF 3CCZA 4W90B 1YDLA 1KQFB 1NHKL 4U8YA 3ZFVA 3CC2S 3X1LB 5A76A 2BZ2A 1FNXH 1SXLA 1WC0A 1VIOA 3I4PA 2HGMA 4QYZJ 4MK7A 2KM8C 4UQGA 2OFHX 3PR4A 1VLYA 3M2UB 1RT3A 4V19J 2CPHA 1KBRA 1NH8A 1NSAA 4XO0A 3IG1B 4NRUA 2FLNA 3BPDA 5KT2A 4B9LA 1V5IB 2M3DA 3GB0A 4C8OA 2VL1A 1S9EA 1T03A 1XEZA 3CNQP 4TY9A 3ZZOA 1S1TB 2ADBA 3MR2A 1SPBP 1VYAA 1NK7A 4OMFG 1T8EA 1VRQC 3WBZA 4ZLPA 4UT4A 4X65F 4J9NA 2DNRA 2HS4A 1I5OB 1FVSA 2PIIA 2G0JA 2VC1A 2VG6B 2MQPA 1ZA2B 3KK2A 4HYKA 4DSLA 2EBGA 3QT6A 4BBYA 3CJ5A 4OZ2A 4GO5X 2V67A 3UR3C 3OBIA 2LMIA 1DTQB 1T9XA 3K5MA 3QIDA 2JEJA 3CTRA 1CULA 5T14A 3QBCA 3OR1A 1AUDA 2CRLA 1W2BR 3LP0A 2AX1A 4FN5A 4DV3F 5A8WB 4OYWA 4OYZA 2H4YB 4RO0A 4YR3A 1VFJA 1EETA 3VALA 4DR5J 1SKWA 1WI8A 1X0PA 3HF5A 4FPIA 1SV5B 5KFHA 1HBMB 1LQ9A 4MIAA 2CJQA 3W2WA 5HQ8A 4DV5J 2DGUA 4K2XA 1VK3A 2D69A 4HDHA 2KJWA 4IRDA 4JI7J 1YK9A 3C6UB 5M2PA 4JP8A 1KS2A 3V6KA 3V6JA 2ZJPQ 1KHVA 4AFFA 3G6ES 4ED1A 1H7XA 2I5JB 2MZTA 4F4AA 4RJVA 2FVQA 2HAFA 1MN7A 3N6MA 4KHMA 3M8ZA 4NMXA 3LWLA 5IT9Y 2DXFA 3AODA 4NLDA 1XMBA 1S1UA 4WTYA 3SIPB 3V6DA 3KMQA 2F65A 4CTAA 4NLUA 2H54B 3U1MA 2W9AA 4RBTA 4PWUA 2M4MA 4CO2A 1S0VA 4FXDA 3BKTA 3LQVA 4S0MA 4B3MF 1MU2A 4OZ1A 2HK2A 5KG3A 4LF9J 4O0NA 3HPOA 1VQKS 1KVIA 2V2ZA 4PR6A 4RUHA 4KQZA 1N6QA 4O44B 1HNWF 3PW7A 3HHNB 3G71S 1D0EA 2AF6A 1RHMB 1S1VA 2MSSA 2K7KA 4LMZA 3ILOA 1BC6A 2C42A 3NCRA 5HP1A 3B54A 3GG0A 5H9EK 1N32J 3QJJA 2KT3A 2QSFA 4ED0A 1RQ0A 3LH2S 4ZPBA 1GXUA 3OXLA 5GVQA 4I69A 3VWSA 4NLTA 5H1SV 2LA4A 2M88A 3IR7B 3KJVB 3HM9A 1KHWA 1BLUA 1X4BA 4BWJA 1PKUA 4KPYA 4YB5A 4OZ3A 4LIRA 4DSFA 1QUPA 2CQ3A 5E33A 1RTHA 4LR9A 4WJBA 3G2XA 2E1RA 1UJ4A 3KWMA 3GYXB 2MLXA 3TA2A 4MAKA 4YDXA 5KFAA 1DBDA 3JSMB 3AA9A 2VJVA 4NL5A 3MPUB 2G0IA 1ZH5A 3G96A 1ZAXA 1XNRJ 3ZZUA 1D1UA 4AXJA 1RT7B 2PE8A 1N5QA 2ZOGA 4ECYA 1FHTA 5B0DA 3M2VA 4KB7A 3ZTRA 5HMZA 4DR1F 1L3SA 3W5XA 2ZH2A 3BS9A 3VGSA 3M2RB 3UR0A 2VG5A 4DCOB 4K2JA 2UV8G 5CD4H 3M1VA 5CHCB 4A8WA 1B64A 2BACA 1U2CA 3R9LA 4NYPA 2FVPA 1X4AA 1YBTA 4PG7A 2AX0A 4A8FA 5DGBA 2MKHA 3DNCA 1A7GE 1LXJA 1T0TV 3FMWA 4QPTA 1NHUA 3IRXB 1KP6A 4WP3A 2HQFA 5KAKA 4LF6J 1TK0A 2UXCJ 4RX6A 1HYSA 3DOKA 3IFEA 2QLJB 4EEYA 1QSLA 2D7SA 2GZOA 3NCPA 4H4MB 5HROA 3KG1A 4MJKA 3D1QA 4WIIA 3CCVS 3V81B 3P5TL 3ZZPA 2PI5A 1U49A 1L3VA 1R8BA 1S77D 3K59A 4I1TA 1VRUA 1XQIA 2DNGA 2IC3B 3CJ4A 3DC2A 2YNHB 3FC9A 3M8YA 1MG7A 3GYGA 1FD2A 4KGKA 3J81Y 2MGZB 4DQSA 1X4EA 1SC3B 2A0FB 2BYCA 3NLCA 3L09A 4KGMA 5EWGA 2NS1B 3VAKA 3T5KA 1NZ8A 2C2DA 4CLZA 1EARA 3KUEA 2VDHA 4G1QB 3PJ9A 3KLGA 3MCSA 4ZP7A 2ZZMA 5AXMA 4UQTA 2AJ2A 4UUWA 2JOQA 5K9FA 1CLFA 4JI1J 3NNHA 1SUQB 3POTB 3GSIA 3QGGA 3GIKA 2CYYA 4OYAA 2OJ3A 5ETRA 5HO4A 2CZVC 4UZBA 3OLAA 5K8NA 2CQHA 4UW2A 1IJFB 1RWWB 4DUZJ 3E01B 1E6VB 1PG5B 3EVWA 1VQ7S 2OELA 1S99A 1ZYQA 1NK9A 3I0RA 1RU1A 3RTVA 3MM6A 1IBKJ 2RDIA 3K7RA 3TA0A 3HK2A 3HDSA 1IKVB 4YEAA 4ECZA 1K1QA 1VI7A 4EFAC 5KOXA 3UPFA 3JAMY 4JI4F 4LBPA 2DISA 2HFVA 4M8LA 2KH9A 2YWGA 4F2RA 5U47A 3T5JA 3DRRA 3M30A 4KKOA 4PG5A 4ZCKA 3C6UA 3VGTA 1RKIA 5CCLA 5D6GA 5DDPC 2BQ3A 1RTJA 3R5JB 4DQIA 2IRUA 3BGRB 3G8QA 5H9FJ 4DHVA 3TI0A 2VPYB 1O51A 2YX4A 5KFBA 2X1AA 4A47A 2R2SA 2DGQA 5KT7A 1WG4A 2O3DA 4ATNA 1S72S 3TVKA 1PAEX 4ZK7M 2XY5A 3UDCA 1FFSB 1R27B 2DNZA 2MKJA 3OR1B 2GQCA 3A8KA 5CYQA 2VU5A 5MLCV 1LWCA 4WFBQ 2KFNA 1FRIA 2RJZA 2ZBIA 3BO3A 3CCSS 4WXWA 2K3IA 1T9YA 2RQKA 3EM1A 3VF0B 3GV5B 2AMCB 4LBHA 4CH1A 4C8YA 4OHYA 5HMYA 3NNAA 2HVIA 2ZDPA 3AFGA 3CCUS 2EW9A 4F7VA 2ZH5A 1AB8A 2HFZA 2Q6CA 4LF8J 3J7YI 4WU2A 4WF9Q 3ITHB 4ECUA 2DBBA 4P2FA 4ED2A 1FD8A 4C0BA 4FF4A 1E6YB 1TK8A 1RXOB 4Q0BA 2B4UA 4NWBA 4OHXA 3VV2B 2KYZA 4IH7A 4EBDA 5E3RA 3TVYA 2FY1A 2PMZD 2J6UA 2DHHA 1VQPS 2P6SA 2ZITA 1NJIT 2CQ2A 2BE7D 2FTRA 3MI7X 2JLFA 3CJTA 1RTIA 3EICA 1IKVA 1CJTA 4Y2IA 3K58A 1YBAA 2QFJA 2Z57B 1OYDA 2WVDA 5A6WA 4A4JA 3MM6B 2H9ZA 4X4TA 3G86A 2IYIA 1TL1B 3NGDA 4DR3J 5EWEA 2CPZA 3QMQA 1SB6A 3HHLD 2JJ4D 2DK2A 3FDSA 3EDRB 5DZ6A 1NK8A 4HR2A 2KO1A 4X66F 2V4QA 3EX7B 2KKHA 4PYDA 5THWA 3G87A 4QQBA 2ZM6J 1Q8LA 2P6TA 1D3WA 2ZH6A 2HQDA 1Q82T 2L08A 1WC5A 5CZXA 5HJXA 2BOPA 4IQMA 2Q66A 2HFOA 3V2UC 1RT6B 2DR6A 3NS5A 3SSRA 1R8HA 3VZHA 2CNNB 1LK5A 1RWNB 2C2NA 1FRXA 4DL4A 4C8LA 4CO0A 1VQ6S 4CLPA 1WEXA 2N82B 5JMNA 2BR0A 5K8MA 3TOQA 3NRBA 2KXFA 1FKOB 4F4KA 3KUHA 1DFDA 1KLNA 3MCMA 4I2PB 3TVZA 4RW8A 1FFWB 3PRVA 3T1YF 3RRGA 4JI2J 2Q6BA 5KFMA 3UNYA 2RSQA 4K4WA 3I4HX 1VQSA 3M8RA 3O6QA 3IC1A 5KFOA 1P1TA 3EPIA 1G3OA 3CDAA 5J1EA 3UDLA 5IM0A 2R7VA 2VFTA 1TL3A 2HNZB 3JTOA 3RUBL 1R0CB 1HNWJ 2ATCB 3WQPA 4AQYF 2D9OA 2MQNA 3OT9A 4LUBA 1DARA 2EK1A 4EUVA 3GQCA 3K57A 3SYZA 1BD6A 2F9JA 2QGFB 2VKRA 2M8HA 1G1XA 4FNHA 4JV1A 2HZAA 5C25B 2H1YA 1FKAF 3H25A 4PWDB 2UUTA 3UN2A 3KHRA 2FLPA 1SKSA 4RU2A 1NPRA 1R8PA 1S9GB 2ZC3A 2FYXA 4YB7A 3TEHB 2XY7A 2HQCA 4D3GA 3MOZA 1UJ6A 1IKXB 2VA3A 2CXEA 1VS3A 1TKXA 3D66A 3RBXA 5KFRA 1GK8A 4LVOP 5LMNF 2WHOA 2FJEB 5EX3A 1RHJB 2OPQB 2VBZA 2V8DA 3FEYB 4OYBA 2P9CA 2QMWA 5FLXU 2RT3A 3PIOQ 2JDJA 2NZ4A 2H48B 3CO9A 4X4SA 1HR0J 5HI7A 2EVZA 2UUBF 4K50A 4H4KA 2HHXA 3R5DA 2JC1A 2XGPA 3KLEB 3HT3A 2X1BA 3BZQA 2CVEA 3DRSB 3CJKA 2UUBJ 3W5ZA 1TFYA 2MKYA 1Q4RA 1LKZA 3S01A 4ECRA 2N3OA 1C4CA 4HTJA 1RT5B 3LAMA 2HWIA 3MFIA 4JI7F 2NYIA 2HWHA 4WZMA 3KK3A 3RRKA 3G82A 4ECQA 1AROP 3QZ7A 1HBNB 3M1VB 4MFBB 3BB5A 1RB0A 3PR5B 2CPIA 2HFSA 2AWZA 5KFQA 4ZPTR 4KGVB 1JLQA 5I3QA 3A1YG 4NEYA 2XTJP 2WSEC 2ZBRA 3R8YA 3MFHA 2C28A 3V6DB 1G4CA 1R6YA 3MAAB 3JTPA 1NJZA 3J7YU 1HNZF 2XWXA 4Y34A 2E5GA 4CRJA 3TANA 2JHEA 1QUVA 1KN6A 4RW4B 4R5PA 2GGPB 2YX1A 5J2PB 3EZ5A 1QDUB 3PACA 2FVRA 2OUGA 2BOAA 1YJNS 3G9CA 4F4XA 5L1JA 5A2QY 1Y5LB 2XSFA 4DMZA 4QYRA 3LA0A 2FLOA 4TVAB 4DJBA 4J9SA 1UA1A 1M5VC 1U47A 1ZM3A 2EFNA 2OSRA 3ET6A 3HHLB 3MPWA 4Q2MA 4A8QA 2JLGA 1F60B 2GHVC 1QVFR 3AT1B 3CD7A 3CCLS 4HVZA 3OFFA 1V3ZA 2V2KA 4O3QA 3N9UC 2HHSA 3KLIA 1WOSA 4LFCJ 4USMA 5KFFA 4FZVA 3I32A 1VBXA 2YPYA 4U7UK 2ZVSA 4NE9C 3PKYA 2F1FA 5LMUJ 1WHVA 2VG7B 3DGVA 1QM9A 4ZN3A 4DFKA 1AYEA 2KXHA 2JZ5A 4CLLA 3AXMA 1LFWA 3LPEA 1TL4A 4KAIA 1UWBA 3KLFA 2AGOA 2B0GA 1D9DA 4J9MA 1XWLA 1DLOA 3KLIB 3MEEA 5AXNA 4O23A 2VB6A 1KTVA 1NLKL 3V6HA 2CJAA 3ET6B 4IOBA 4IQXA 4UOGA 3GPAA 2GW8A 4K0KF 2NXCA 1NSQA 1MNEA 4PXDA 2YKMB 4IFVB 5DO2A 5KG7A 1JLQB 2J7UA 2BA9A 2N3LA 1G6BA 2GMJA 1Z4UA 3W9HA 5A2QU 3CCQS 3PX0A 2VA2A 4NXNJ 4HACB 4CT8A 4KYZA 3NY0A 5KFVA 4X4QA 4NXNF 2F40A 2FJDB 4IOAQ 2GX8A 3T6JA 2CQIA 2XZTB 4IFYB 4DQPA 3J7AN 3SSSA 4C3KA 4RLEA 4J9QA 1HMVA 1T9UA 3ILJA 3CJKB 4X62F 1URRA 2E7WA 9ATCB 4C8KA 3KFWX 2AT1B 3EVMA 5KFNA 3D2WA 4RUCA 2MKIA 5LL6d 3HCXA 3MM7B 1RT5A 3C46A 2DR7A 1QLNA 2ZNZA 5IZHA 4X4RA 2B5JB 4A8SA 4JI4J 2BANB 2DKOB 3EZOA 2IA6A 2VDIA 3MR5A 3IBWA 1YQHA 3ONQA 1RK8A 3BBCA 2HYIB 1IJEB 1S9GA 1HWUA 1WELA 2YWKA 2ZC4A 4K5RA 3D3BJ 3A13A 2XG8A 3DI6B 1NK6A 3MPVA 4E98A 2DHAA 5DG9A 1S0MA 5F8HA 1RGVA 1EP4B 2GMLA 2G9OA 2AEFA 2AGPA 3US5A 2O66A 3CXCR 1MSWD 4A8MP 1Q53A 5HLFA 1GQEA 2WW8A 1HFEL 2GGPA 3HT0A 3FVYA 2R7OA 2YNFB 4X84A 3KXDA 3C14A 3IM8A 1S0OA 2F7VA 2KT2A 1P9QC 2DNLA 4B3RF 2F4VF 4UOFA 3H42A 1UETA 2ZH7A 1S4FA 2MJNA 2RAQA 1VJQA 4P10A 3S1TA 3U1NA 3ZTPA 4EBEA 4B3SJ 3QJLA 2BJ8A 3WX8A 1GEHA 2HHHF 1CBKA 4DQRA 5LT5A 2SXLA 3HFZB 3MGJA 4MIWA 3RB4A 1WC4A 1UZHA 3W65A 4K7QA 2R2TA 2AD9A 3KK3B 1B0PA 4W92B 4AL7A 5FD1A 2YKAA 3W66A 5A8KA 5LOQA 4GKJF 3MPDA 1CJKA 1Y4ZB 1HA1A 2CQ4A 4P2XA 3H90A 2XO7A 1XMQF 4RU9A 4DV1J 3FJ2A 1Q7YT 4J91A 3GE9A 4LREA 5I3PA 4MYTA 2F63A 3SFUA 2BMBA 4DBQA 2A10A 3OL7A 1HNXJ 3L95X 1Q8KA 2W4CA 4LRAA 1PJ6A 3U1LA 4GKKF 1PAUB 1F5AA 1HNXF 4PPDA 1ICEB 5A0YB 5L1KA 2JFDA 3D67A 1ZM4A 3M8WA 3JS9A 3QGHA 3RBDA 1J5EJ 2CG4A 1XMQJ 2R8IA 2GFFA 1AZSB 3ENVA 2BKNA 4TU9A 3UW1A 3BR9A 2YH0A 1QTMA 2EG2A 1D9AA 2CNLB 3OL6A 1TKXB 2XMTA 3MM8B 1UEKA 4I2QA 2FC9A 3UVJA 4KRWA 3GP9A 3C16A 1RCOB 2QE5A 3BEGB 2FHJA 3RAMA 5HSPA 2FJWA 4ZVPB 3F41A 3MMBB 3AHPA 4G3IA 4PWDA 1HBUB 3O44A 2YPZA 3JQMA 5D0HA 4HH0A 5F8JA 4XDDA 2C2ZB 3CD0A 4QW9A 1S1XA 2F4FA 5L9XA 4IH6A 4Y2KA 4QWCA 2VPWB 1EJ7L 2CQDA 4GMKA 5AJ3F 4DV5F 1JNRB 1B99A 1TL7A 2XMWA 3EDQB 3B6BA 4FF1A 2HGNA 2LQJA 2JLEA 2IAJA 2OPPB 3H20A 2W1BA 3OTEA 1S6QA 2RHQB 4L6V3 3T9ZA 4EK2A 5A8KB 1LW0A 5C2GA 3MURP 1RTIB 3MEDB 4NYZA 1AXQA 1S1TA 3DLKA 3GJSB 3TUPA 2E1AA 3EYZA 1J5OB 4LF7F 3PZPA 1UPPA 4CYUA 3LP1A 1Q5VA 1TVRB 2J9DA 1XERA 3VQTA 5GAHU 5DLFA 1UAWA 2JSXA 3FEXB 1YBUA 5E41A 2HMIA 3TX8A 3QO9A 4ED8A 4Y2CA 2W2OP 1WNEA 1F9EB 1BHNA 2RF2A 2XULA 3QSIA 4JV0A 4MIBA 5B0EA 2RU9A 4J9VA 3W7BA 4WE1B 1ZS6A 3JSYA 1X5SA 3QWUA 4C8NA 1H2VZ 3QIPA 2CQ1A 2J0XA 2LQBA 3MUMP 5KT3A 2EBEA 4ED5A 5G0RB 2V69A 1TR0A 1KVKA 4ZP8A 3CC7S 2DNNA 4AD6A 3PIPQ 4O0IA 1S7IA 1S6PA 4IOCQ 2AYBA 1DJ0A 3JQKA 4I2QB 4N77A 2Y1IA 2VICA 1NDLA 4DV4F 2VQEJ 2KI2A 2O1PA 3TZZA 4NA3A 2YTCA 3R1LA 2M52A 3EPGA 1U1OA 4F8RA 1N0VC 1U26A 2OPQA 2QX0A 5C5JA 1GH8A 2DGWA 3QYYA 2DO0A 3M8QB 4FYVB 3CVKA 4JI8F 5KTQA 3BO4A 2FDNA 5C2CA 1AW0A 2UUAJ 4AUKA 1ELOA 1IKYB 3GR1A 2ALYB 2B9WA 1Q7LB 3BBBA 2EG1A 3NCQA 3NGSA 4H4KC 1JKHA 4WPAA 1B4SA 1S6OA 1SBRA 2XWYA 3I0SB 1MMNA 4ES2A 1N8RT 2QV6A 1RUSA 2QRRA 3IBCB 3JYTB 2FJBB 4JI8J 1SL0A 3T19A 3SMZA 1M5SA 5ETMA 2MHNA 2UP1A 1FA0A 3ZC4A 4NLPA 2IJFA 4KIAA 8RUCA 2R8GA 4IG0A 3PYEA 5L46A 4ANEA 2DH9A 1YJTA 1JLFB 1WF0A 2XMMA 1U09A 3W3SA 4JYAJ 4PXCA 2J0WA 3TNVA 5IQ6A 2E44A 1LWEB 1WKLA 4ANCA 4DS5A 3LGNA 4Y3CA 9RUBA 1RTDA 4CI0B 3HVTB 4M94A 2MB0B 1X60A 1Y00A 1L3TA 3IRWP 3NP5A 5ETKA 4I6AA 4IR1A 3VAHA 4OZ0A 4ED4A 2VF3A 1DLOB 3CJQA 1XMOJ 4FYWB 2FJXA 4V19X 2FUG9 3FFIB 5D4PA 2DNMA 1I94J 3I82A 3DGPA 3O5TB 3FUYA 2Z4PA 4OQJA 4M5DA 2N7CA 7FDRA 2B5JA 1J2VA 2ZFHA 4YFUA 1H2UX 1FTRA 5EGYA 2OAUA 4RNNA 3CGIA 2M70A 5KG4A 2G13A 4TN2A 2W9BB 5LSOA 3VAMA 1HARA 2GCFA 4UOHA 2W9CB 2LECA 4NZ6A 5BR8J 3BF4A 4U6PA 2ROEA 3D5MA 3KHLA 2I6WA 3TUZC 1TK5A 1WC3A 4DV4J 1Y5NB 3H7HB 2E66A 3R6LB 3GIIA 4ED3A 1IWAA 4CH7A 4EBCA 3NGKA 1RHUB 2XYHB 4NLVA 3OFEA 3M2VB 1EAYC 1WF1A 5CYMA 5E7OB 2RU3A 2PC6A 2DNOA 5CABA 2HVEA 4HHHA 5F8IA 5KFCA 2ZVIA 3EGZA 5F8MA 2NPIA 1RAGB 1RI7A 3R5BA 1WUUA 2L9WA 2X51A 4QR1A 3UO0A 5IC6B 1PBAA 3BDEA 3N6NA 4JI0F 3R5AA 5L9NA 2CA9A 4I67A 3NEKA 4RW4A 4R5PB 4LF6F 1N0UA 3B4MA 3K2YA 2HURA 4DN0A 3VAIA 4ECVA 3KDNA 4OX8A 1EQ0A 4MTPA 2PFDA 3HKZD 4HHUA 2QEXS 4KHPF 3KG4A 4UTGA 2BW7A 2XY6A 2FQQB 4HEA9 5DETA 4EO8A 3DDKA 2J8SA 3OTDA 3QJPA 1K0TA 1LWFA 3QZ8A 2BRLA 1HPZA 2UUWA 1TMMA 4ZDNA 4K4YA 3HLUA 3PEHA 3QT8A 4PEOA 2RS8A 1GAOA 1W7WA 1PYOB 4NMLA 1TFWA 1C4AA 4JI6J 4Q45A 1FE0A 2D1CA 3J80Y 2CADA 1OJ4A 3F44A 4QBUA 3OPKA 1S1WB 3D1OA 1KFDA 1RAJA 3KLFB 1XR6A 4ZJQA 4OI0A 3QO9B 1OWXA 3CCJS 5GADI 3V4MA 2JX2A 3BKUA 1X5TA 1REVA 4TYAA 4URSA 3JYTA 4IG3A 3CCES 3T9NA 2GJFA 3UDEA 5KOWA 5DGAA 3UE2A 4RBUA 5K8PA 2V9WA 1RTZA 3W63A 1SI9A 2KT5A 1SJFA 2J6SA 4YOEA 3DLEA 1X7VA 2Y3YA 4MKVA 5IFMA 4PYAA 2DD8S 5EDWA 1WSRA 2RDDA 1S59A 3VGVA 1YRUA 4NLGA 4PQUB 4EO6A 2IAJB 2OPPA 5KFDA 3P5BP 4R25A 4DUYF 1AFIA 4M5IA 4CLYA 5AT1B 3S7RA 1I1GA 1SQGA 2W2MP 4FPRA 1NSKL 1Q95G 1RWOB 5HVFA 2UUCF 3QFWA 1K1SA 2IRYA 5B0FA 3A4TA 4OZJA 4OI1A 4LF7J 3H5SA 3LP0B 3DLHA 4N76A 1APSA 3OJUA 1UW4A 1EZZB 3R5GA 4DV6F 1REVB 3DDIA 3N0VA 4FYYB 2NSCA 4ID8A 4AXIA 3OL9A 1CULB 4OI6A 1X0FA 3MECA 2LQ9A 4FDFA 1SJ4P 4B3OB 3M05A 2KG1A 1N52B 3QWPA 2C1EB 2DHSA 3C16B 1H73A 3FEZA 4ZIVA 3QRQA 2A3JA 1T9TA 2X3GA 4PG6A 4OHZA 2HWTA 2EFOA 2W25A 4OYMA 4C8MA 2DNHA 1N33J 3ZXWA 5AJ3J 4YQWA 1U2FA 2G2ZA 4NYOA 3OXGA 2B8PA 3HZEA 2COLA 1NDCA 3CDWA 4ZKAA 1XNRF 2KXNB 1T9VA 5IXUA 3MEKA 5A0YA 5J1NA 3Q8SB 4GC6A 4LRCA 2DTJA 4A8KA 3DRSA 1D09B 2I8EA 2OEMA 1JLCA 2ZH4A 4B9TA 1DQAA 2DY9A 4LF8F 2GAHC 5HVHA 4USVA 2DJWA 1BQMA 3MEGA 4JOUA 3DLJA 3PXGa 3D0GE 1F9HA 2BABA 2VQFJ 4PRFA 1N48A 2YNGA 3I31A 2G2OA 2FHMA 2WAQD 5CYJA 1RT2A 1N34J 2L9DA 4PUOB 2CVIA 3W9JA 5IV4A 3ZZZA 1QVGR 1VQLS 2HHUA 4CNZA 3IG1A 3R2CJ 1RWMB 4RW9B 5IQQA 2J7WA 2UV8A 1JLEA 4WK1A 1KR4A 1RT3B 1GT8A 3TA1A 8ATCB 1HLWA 3TAPA 3I0SA 5IT4A 1GMWD 1REGX 3OQ2A 1UPMB 1SV5A 2JVOA 2QLFB 4I6YA 1NPPA 4RW8B 1BWVA 1JQGA 1X31C 4PKDB 2MYFA 2CZ9A 4DR4F 3DYAA 4B3RJ 2RIJA 3CJSA 5IS2A 1O0PA 3A8IA 3ILLA 2MQ8A 3T5LA 3THTA 3WZ0A 3LUYA 3W62A 3G6YA 3LOUA 3JAMU 4U67Q 2D3O1 4JI0J 4PAAA 2HRUA 1XN9A 3TJ8A 1Z2ZA 3DLBA 4G6VB 2FJVA 2QIFA 2ZOMA 3A3NB 2WRMA 3DLGA 4U9RA 3BGOP 3HXMA 3D54A 3ZZTA 3KOAA 2GQ2A
chains in the Genus database with same CATH topology
5FJ4A 3MM5B 1HQUB 3V4IB 1KRPA 1TKZA 2GV1A 2ZJRQ 1KSPA 1Q78A 1KOOA 3MWBA 4Q44A 4ZS6A 3MD3A 4YY3F 3NMAA 2XHWA 1WHXA 4O3NA 2OLWA 4USHA 2KB2A 4DSEA 3RRHA 4GC7A 3F56A 5AE2A 2IVMA 4CH0S 1S9EB 5GAGU 2HNYA 5HBMB 3N4WA 4A46A 2B4VA 4FF3A 4JI1F 2IBKA 5A6PA 1S6UA 2CQGA 5AE1A 5J2NA 2VBXA 4ICLA 5GAEU 3F73A 3B82A 4RW9A 1FE4A 1O5JA 3E3XA 3ZZRA 3BQ1A 2AQ4A 2DNYA 3DHWC 3EUNA 3CC4S 2JEFA 2ROGA 1S97A 5JJBA 2QO3A 3C6TA 4OX9F 3PY8A 4LFCF 1VGYA 1K73T 3I5BA 5BYSA 2ZD1B 3DXBA 3OL8A 3PDNA 2O01C 3TO8A 3TUJC 2VONA 1YI2S 1D8ZA 3UD3P 2F8EX 3EXYA 4YP3A 2C2RA 1HBUA 1N4LA 5D4OA 5A8RB 3BO2A 1NAQA 1U7LA 4WE1A 1S76D 4L72B 2DGSA 1BQNB 1HW9A 1NU4A 1RDRA 2B4PA 5D4NA 3ENWA 5EWFA 3KHHA 1DTTB 2AJFE 4WFXA 3TQ1A 4I68A 4Q8EA 3CD5A 4X4PA 1SL2A 4Q2LA 2RRNA 2V4JA 1RKJA 4ETZA 3MUTP 4YB1P 3IAS9 3PX4A 4WYWA 3BSAA 2UVUA 3CT9A 3LO3A 4E8UA 1B0TA 2VFRA 5DDRC 1T94A 1FJEB 4USJC 2WB1D 4CIOA 1N33F 1X9SA 1LW2B 4DL5A 1W25A 2XCAA 3DDNA 1IKWA 2DCUB 1T05A 2HZCA 1LW0B 2CQBA 2JFKA 2IM1A 2VFSA 1VJWA 1VQ8S 2ILZA 1IQTA 2XI3A 3TYTA 2FIUA 2DR5A 2J5AA 3AAWB 3CDUA 4F50A 2V0NA 4WZQA 3HHLC 3PHEA 5GAGI 5B0GA 4WXOA 4Q43A 3I5AA 1DTTA 4QCLA 1EETB 4NCBA 1UEUA 2Q1LA 5CA5A 1S9FA 6FD1A 4IDKA 2RQ4A 2OPSB 3UCZP 2M2BA 4NLXA 2BXJA 1A6LA 4YMEA 4G1QA 3KLGB 2MZJA 2MQLA 2KTQA 1Y7PA 2BE2A 2OD4A 2Q79A 2BUNA 3GFXA 4NLSA 4OI2A 1FRHA 4K4XA 4LIWA 3HKWA 4WFAQ 3SI8A 2DNKA 4B08A 1WG1A 1NKBA 5KFPA 3GILA 1ZOTA 2MDAA 1Q79A 3CCTA 4YR0A 4HKQA 4YR2A 4ERDA 3SCLE 2GC8A 2W9CA 4G1PA 2CPFA 3L7OA 1JJ4A 4N41A 1YIJS 1K0VA 2VFUA 1FCAA 2DR8A 3C6TB 1JLCB 1PSDA 2E5LF 5DDOC 3QLHA 1R0AA 2HNDA 3DXSX 1VRUB 2DHXA 5IM0B 2ZE2B 1KFSA 1OSDA 2IMOA 1IBLF 3I96A 3DM2A 4F25A 4PCQA 3PM9A 4NRTA 3IR6B 4QWDA 2ASYA 2HS3A 4KC5A 4ZCIA 1VQNS 2EK6A 3W2VA 5CXTA 3J7ZT 4ZPWR 1HYSB 5KT5A 5HMWA 1SH0A 1IQZA 4F3QA 3RW7A 4CO5A 2JWNA 2FHJD 2HLTA 3D28A 3Q8RB 1Q86T 2W7PA 3CDEA 3AJ2A 2C3UA 3HHKA 1KQSR 1ZZFA 2XMVA 4ZHRA 5KG1A 3UWTA 4QU6A 2BRKA 1QAJA 4O3OA 1YITS 2ZNYA 3T1HF 1RWUA 3TR5A 1VBYA 1RT7A 2V4JB 3FCHA 4MK8A 4NOHA 3I9V9 2KN4A 4WFNQ 3HHEA 2UZAA 4TXSA 2E1CA 2VPXB 4TKTA 2YNIA 3OXFA 4ZPDA 4XAKA 4B9VA 2A18A 2YKPA 5AXKA 3CUNA 3JSBA 5KFGA 1ZM9A 3E8OA 3HVTA 4UY85 3SDEB 4DL6A 1JLEB 2MKCA 5LJ5Y 5BJRA 2J9CA 2KM8B 2U1AA 3H5UA 3GV8B 4O4RA 4N5SA 2NUHA 4RUAA 2RDJA 1TP7A 4KE5A 1HL6A 1HNIB 2CPEA 5E3AA 3S01A 3MEDA 4DN9A 2YWHA 2R4FA 1SL0A 3IA0A 2DIVA 4IFYA 2YVSA 4HT5A 1NKEA 1MMDA 5ITHA 2ADCA 1H2TZ 3HO1A 2BW2A 2N4CA 4PQUA 2M7SA 1M5HA 1BGXT 3PW5A 3BGLA 4DUZF 1TZ0A 3IN5A 1HI1A 3DMJB 1U6BA 2LU2A 2QZ8A 1Z2LA 1NHVA 2IM2A 2EWHA 1R3NA 1GNKA 1CQMA 4I56A 2G1DA 3W2WB 1WHWA 1DHMA 5HL7Q 2XZWA 1VK8A 4EYIB 3A8EA 4JBCA 4DR2F 3BSCA 2D41A 2MPUA 5L1LA 4ZCLA 3G8SA 5T7LB 4NLWA 4OHWA 3ICLA 2DH8A 1NK4A 3ZZ0A 4N56A 5KFSA 2DO4A 5DJBA 2ZHOA 2EI5A 5L38A 4M1KA 2IM0A 4P7VA 2PA3A 3OVSA 3LP2A 2L48A 2WONA 3UCUP 4CQ1A 3Q23A 4NXMF 4DFJA 3OFGA 1U1KA 1C1CA 2CDQA 4UUXA 2B7CB 2CQ0A 1HD0A 1ZBTA 3J7A1 4NLQA 4DWIA 3O3LA 3DU5A 2R7XA 4DDFA 2HPUA 4OI4A 3MAHA 2ZJQQ 1HBOB 4OFZA 2XLJA 2VG6A 4AL6A 2WOMA 3G4SS 3I0RB 2GO9A 3ITHA 2YY3A 7FD1A 4Q8FA 2HNYB 4OLOA 1NK5A 2Q3PA 1TQLA 4RWXA 5F9LA 4OI3A 5L8RC 1U24A 1XMOF 3BGFA 1NO8A 4IKAA 1TL3B 2HNZA 2FVCA 1QJHA 4C3LA 3OHBA 1U1MA 3MMAA 4C11A 4EZ6A 1KTQA 3IO1A 3MD1A 1FKPB 4JV5F 3FZBA 2B51A 2Z2LA 3RAQA 1FK9B 5CQGA 1CQNA 2AP6A 4QIEA 5KG6A 3VQSA 4C97A 3DLGB 2IA0A 3CPWR 2WSCC 5CH7B 2RMLA 3UI3A 3OW2R 2FVSA 1KQKA 4H54A 1N32F 4JI2F 1Q1KA 3BQ2A 2YNHA 1U6ZA 3IWXA 5J2QA 1U48A 3OJSA 2I9SA 2R7QA 2B56A 5FDLA 3PJXA 1HNVA 5CCMA 1JMTA 1X4DA 2KJVA 4FP9A 1YJRA 3M8PB 3ULHA 3NAIA 3TAQA 4TQSA 4ILRA 2Y1JA 1VMBA 2DGTA 2EPIA 2EFPA 4BS2A 4O4GA 5G0RA 3QGIA 1B0VA 1SJ1A 4ZPCA 4Y28C 1YJWS 3EXCX 2IVYA 4UOCA 4DL0C 4FBUA 4KT0C 5B0BA 2HW3A 4KHRA 2LXFA 3QPIA 4U7CA 4E0DA 2K1RB 5DG7A 1X8DA 4FNIA 4B9UA 3BSOA 4QIWD 1JNZB 4P6QA 3NBPB 1N36F 1LXNA 2VG5B 2NXUA 1FERA 2M8DB 4DSKA 4H4OA 4ZVFA 1DRZA 1FESA 1MROA 5KFIA 3CULA 1SQEA 4XDCA 2HIQA 4Y65A 4QWEA 2RE1A 1TVRA 3M8PA 2J6TA 2K2PA 5GAHI 3GV7B 4ILMA 4JI6F 5GMKa 2CJKA 1D8YA 5KFUA 4KTQA 3DMJA 3OVAA 1CC8A 4C98A 5L39A 3KMSA 3CJ2A 4ES3A 2LVWA 2NLWA 2POKA 2MXYA 3OSPA 2N4DA 4DQQA 3GFZA 5K14B 3KJVA 2E9TA 4I7FB 2I0XA 2B4OA 3LP2B 3H2VE 2GHPA 3R5CA 5KFLA 1QAIA 2RVJA 4R8UA 5ADZA 5KFKA 2BDPA 2DRAA 2KFZA 4WCEQ 1FJ7A 2WOMB 3SDEA 4Y2AA 1ZM2A 1M0SA 2D3ZA 2OPSA 3WC0A 1GTEA 3FSIA 4DR5F 4DLGA 3R1HA 1YJ9S 1I6JA 2KRRA 4PQAA 2RRBA 3P6YC 2FJAB 1HWIA 3N6LA 2D74B 4F67A 5B0CA 1DURA 1RT4A 4AYBD 3DOLB 1ZAWA 2OFGX 3NWGA 1X9WA 3PKMA 3D1HA 2WCXA 2OPRB 3IS9A 4IO9Q 5D3GA 1FXDA 2W7AA 2BJDA 2PDAA 2RILA 3HHDA 4O3RA 1NJWA 4H4OB 1V9OA 4F3MA 1G2EA 2VC0A 1JLGA 4DV0F 1R8CA 4HDGA 2HVHA 1VQ9S 1UL3A 2WSFC 5KFTA 4F02A 1M90T 5KFZA 1VQYA 2PA8D 5HN0A 2OPRA 3IS9B 4XIUA 5KFWA 3RW6A 2GHWA