1SJFA

Crystal structure of the hepatitis delta virus gemonic ribozyme precursor, with c75u mutaion, in cobalt hexammine solution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatitis Delta virus ribozyme
publication title A conformational switch controls hepatitis delta virus ribozyme catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation/rna
total genus 23
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sjfA00
3CCQS 2MQMA 3JB9k 1NO8A 1WHWA 2M52A 2DK2A 2PE8A 2CQ2A 2MZSA 3S01A 2MZ1A 1KOOA 3UCZP 5HO4A 3CCLS 1YI2S 1K73T 2KN4A 5DETA 1YIJS 2DH8A 2OSQA 2FC8A 2XB2D 2M0GB 2F9DA 2KRRA 5LSOA 2D9OA 3NNAA 4YB1P 1M5OC 1H2VZ 2HGMA 1X4GA 1X4CA 2M4MA 3UWTA 2LKZA 2HGLA 1WHVA 1H6KX 1U1MA 1VQPS 5GADU 3OW2R 1ZZFA 2DNYA 1BY9A 2G4BA 2XS7A 2X1BA 3J7ZT 2G1DA 4CH0S 2L9WA 3G96A 1JJ2R 2KU7A 3NS6A 2LECA 1SJFA 2DNOA 2LA6A 2DO4A 3R1HA 2QEXS 2CPXA 2MZQA 2DHSA 2CPJA 1VQ4S 2OTJS 2DGTA 2FC9A 2VOOA 1Q81T 1U1KA 5MLCV 4TU7A 1FNXH 1K8AT 2J0SD 1SJ3P 1X5PA 5IM0B 1VC6A 3MDFA 2MXYA 1RKJA 3CULA 2VOPA 1R8PA 3G8SA 2DNGA 1WHXA 1S79A 2DNHA 1NU4A 2DNQA 5D77A 3VAKA 2LQ5A 1M1KT 4CIOA 3SDEB 4F02A 1SJRA 4QU7A 2RUGA 3UD3P 2FY1A 2CQ4A 2CQ1A 1HD0A 1U1RA 1H2TZ 4QQBA 3S7RA 2BZ2A 1YJ9S 3MUMP 3BS9A 2DISA 2Q79A 3CC2S 4FXWA 2CPDA 1FHTA 2K8GA 3VAJA 1FJEB 4PRFA 1OPIA 4C4WA 2RQCA 2CPIA 1OO0B 1UW4A 5LXRA 1URNA 3H2UB 2QA4S 3BO2A 3EGNA 4OZ0A 2JVOA 1X4DA 3B4DA 2N3OA 2KVIA 3EGZA 2CQDA 3CCES 1U1PA 5HL7Q 1VQMS 1DBDA 1JMTA 3MD3A 2MGZA 2DGWA 2E5HA 5LSLA 1WEYA 4LMZA 1VQ8S 2MKIA 1DHMA 1YHQS 3RW6A 4ERDA 2J8AA 3PIPQ 1VQNS 3I55S 2XS2A 4EGLA 4YOEA 4UQTA 2DH9A 3BEGB 3P49B 5FJ4A 4PR6A 2LXUA 2MSTA 1WF1A 5CXTA 2KT5A 1WF2A 2N7CA 2JVRA 2MHNA 2DITA 3EX7B 2EK1A 3G71S 3NNCA 2K3KA 5IQQA 1RK8A 2OIHA 4TU9A 5DDQC 4W90B 3CCRS 1Q82T 2L41A 1VBXA 2I2YA 1R8HA 5CA5A 2M88A 2HVZA 1KD1T 4IUFA 4IOCQ 2MQOA 3HI9A 3MXHP 3R1LA 2X1GA 2LA4A 5DDRC 4YUDA 5ITHA 1SJ4P 4V19X 4WCEQ 2UP1A 1O0PA 3P5TL 1X5TA 2MY7A 1IQTA 2MQQA 1U2FA 2ZJQQ 5DM7Q 2E44A 2RRAA 2KG0A 2MQLA 5H1SV 3U1MA 3UD4P 5LXYA 2KXFA 1YJWS 4OZ1A 1ZZNA 2MYFA 2I38A 1FO1A 2KRBA 5EN1A 4A8XA 2DIUA 1FJCA 4TU8A 1FJ7A 3CF5Q 3ZZYA 3V4MA 1PGZA 3P3DA 4CQ1A 1VQKS 5JVGQ 3R27A 1UP1A 1U6BA 3SXLA 4C0OC 2E5GA 1QM9A 2N3LA 2MB0B 1WG4A 2DNZA 3ZZZA 2AYGA 3MUTP 4WKRA 3NMRA 3TO8A 2DGOA 2HGNA 3UCUP 5GAGU 5LJ5Y 1WTBA 1HL6A 2GHPA 2XS5A 1YITS 1SXLA 2DGSA 2DHAA 3FEXB 3N9UC 2KHCA 1WG1A 5IM0A 2MQPA 5BJRA 3HHNB 3ULHA 2M2BA 3D2WA 2CJKA 2MZRA 2ZJRQ 4WFAQ 1N52B 3Q2SC 2EVZA 1K9MT 2DHGA 5DDPC 1YTYA 1HD1A 1JJHA 1U6FA 2LXIA 2KXNB 2DNLA 4ZKAA 1H2UX 2G0CA 3B4MA 3VALA 4Z2XA 4BS2A 2CQBA 2BOPA 4WF9Q 2CQPA 2MKKA 3CTRA 2X1AA 2AYEA 5CYJA 4W92B 2ZJPQ 3CC7S 3P6YC 2O3DA 2XSFA 5IFMA 1W2BR 5GAEU 1VQOS 2ADCA 1WI6A 1VQ5S 2YH0A 1M5KC 1L3KA 1N88A 3MUVP 1ZH5A 1X4EA 2CPZA 5GVQA 2MSSA 5DM6Q 3S8SA 1KOHA 2MKSA 1A9NB 3THPA 1G2EA 1S72S 1VQ9S 3CCJS 1X4FA 2MGZB 1JJ4A 1QVFR 5GMKa 2CPFA 1M5PC 2FPHX 1Q7YT 2DGQA 2WBRA 1VC0A 4WFNQ 1U1NA 1DRZA 1X4HA 2EK6A 2A3JA 4IO9Q 3FEYB 1X5SA 5LJ3Y 3MOJB 1WHYA 3DLLQ 2CQ0A 3IRWP 3MURP 3VAHA 1P1TA 2MY8A 3SMZA 3BO3A 2NZ4A 3K0JA 2D9PA 2MZTA 2M9KA 2DGVA 3UE2A 2LMIA 2DNRA 4LJMA 3U1LA 2RT3A 1U1OA 1VC5A 4LIRA 3VAIA 3TP2A 2U2FA 2FHOB 2AD9A 4RU2A 2LYVA 1OWXA 5GAHU 2CQIA 4FXVA 3CCVS 1WG5A 3G6ES 2M8DB 2DH7A 1UFWA 2V94A 4QPTA 2YWKA 2F3JA 3G4SS 3LPYA 2B0GA 2J76E 2MQNA 2VONA 1X0FA 3MI7X 1NJIT 2MJUA 3DXBA 4Y00A 2CPYA 1X4AA 4CH1A 3G9CA 2DO0A 2N82B 4WFBQ 2MKCA 1D9AA 3VAFA 1U1LA 3CCUS 4ED5A 1A7GE 2M70A 2YKAA 1Q86T 5JVHQ 2JWNA 2DGUA 3TYTA 3H2VE 2CPHA 1KC8T 2LEAA 2KYXA 1VQ7S 1D8ZA 3IWNC 1M90T 2MMYA 1X5OA 3L3CA 3LQVA 2X1FA 1F9FA 2KM8B 1U1QA 1HA1A 4WIIA 2PEHA 1AUDA 2RQ4A 2D3OR 4C7QA 3CMAS 2E5IA 2KM8C 2YH1A 4P6QA 2RU3A 3PIOQ 1CVJA 2AYBA 2SXLA 1OIAA 2DHXA 2MZJA 3THTA 2KI2A 2QFJA 4IOAQ 1QVGR 2KH9A 2J0QD 1YJNS 1WI8A 3SDEA 2MJNA 3RW7A 2KG1A 2CQGA 1WELA 1N54B 2OTLS 3CC4S 2CPEA 3NS5A 2LCWA 4F26A 2M7SA 1VQ6S 2MPUA 1XN9A 2CQ3A 2DGXA 2U1AA 2JX2A 2F9JA 1WEXA 2VODA 3J7YU 2XNQA 1YWXA 2OSRA 2DNPA 3CD6S 2HZCA 1VQLS 3Q2TC 4J5OA 1N8RT 2DIVA 1KQSR 1VBZA 4QU6A 2DNKA 2CQHA 4M5DB 2RVJA 1DZ5A 2RS8A 2GO9A 2KXHA 1PO6A 3BO4A 3VAMA 1P27B 4TLQA 4PKDB 2NLWA 2DNNA 4F25A 3CPWR 3US5A 2MKJA 2CQCA 1WEZA 1FT8A 4UY8T 2M8HA 2DNMA 2HYIB 5DDOC 1WWHA 4Y0FA 1WF0A 2L08A 3G8TA 3NNHA 3MD1A 3UCGA 2OJ3A 1X4BA 1SJQA 2DB1A 3S6EA 3VF0B 3CXCR 1B7FA 2ADBA 2RS2A 2YTCA 3VAGA 3CCMS 3CUNA 2ERRA 5D78A 2JRSA 2RNEA 4U67Q 2XNRA 2LEBA 2AYMA 2KFYA 1M5VC 3CMES 2RRBA 1VBYA 2MKHA 2E5JA 3CCSS 1FXLA 1UAWA 3I56S
chains in the Genus database with same CATH superfamily
2B3TB 3LO3A 2PN6A 3G82B 4O3RA 3IGVA 5D4LA 1FTCA 3UDEA 2VU5A 3M8PA 4K59A 4IFYA 1U6ZA 2O5DA 5J1PA 2UXDF 4ZPCA 1P1LA 1T3NA 2B7BB 1M5OC 4GMKA 5EX3A 2WSFC 3GIRA 5F3ZA 3ELHA 3TQEA 1CEZA 1WHVA 3GFYA 2X7IA 2HNZA 2DNYA 2QTWA 2ROEA 4DV4J 5K14A 4QW8A 3N4WA 4RL1A 5KG3A 4JI7J 2DO4A 4DFMA 2WCXA 1PAEX 3D1OA 3KDOA 3RB0A 4OHXA 4ILLA 5KG7A 4KPYA 4U7CA 2ZE2B 3MMJA 2ZZMA 2ASYA 4NLYA 3O6QA 4F67A 4WK1A 4YEAA 2ZUGA 3PV8A 1SJRA 4AL5A 3UD3P 2GHVC 2CQ4A 2QLFB 1U1RA 1FJGJ 1M1HA 1NPRA 4XO0A 2L48A 3R6LB 2ABYA 3KJFB 3VAJA 4PRFA 2RQCA 4DL6A 3N28A 2N3OA 2CQDA 3G86A 1X0PA 1KP6A 3MD3A 3M2RA 4E8UA 1NEEA 4U95A 3SFGA 2JEIA 4C8MA 2QRRA 2J8AA 1DQ8A 3PIPQ 2YNFB 2Z4PA 4KE5A 5DLFA 4DPXA 5L1JA 2LXUA 2HIYA 3TAQA 4UT4A 3EX7B 5LMUF 4OX8A 1Q95G 3K5MA 1TL3B 1H73A 1MW7A 1DY3A 2CZ4A 4PWDA 2QJ3A 1RT4B 4NASA 4ZIWA 3ISNC 2R7WA 4FS2A 4EZ6A 5HI7A 3V6KA 5ITHA 2R7RA 3AY0A 2MY7A 4AFFA 2KL8A 3MCOA 1SVDA 2AX1A 3T6JA 3HD2A 3FQKA 3U1MA 3DOKB 1XMQJ 3MFHA 4AUKA 5JJBA 3K59A 2QLBB 2UU9J 1U2CA 2OPSB 4FF4A 2VC1A 5L39A 4XPCA 3Q89A 3BDPA 1FXRA 3BH6B 5LOQA 2AYGA 1S5ZA 3TO8A 1SJ1A 1KQGB 2FJBB 2XS5A 3WZ0A 2OPQB 2I5JB 3N6MA 1BMQB 2XO6A 3LGMA 3QZ7A 4DSIA 1GMVA 4R0JA 1NB7A 4MK9A 1U6FA 2MTLA 4ZVOB 1VR6A 4X4OA 4BS2A 2R7SA 1YJ7A 2CQBA 2HRYA 4KGVB 4CLUA 3LAKA 4LR7A 2UVWA 1ZTTA 5E5NA 5IT0A 1FRJA 1OSDA 1N88A 5CD4A 4P2XA 1R6YA 2ZWOA 4RWWA 4PG7A 3IAM9 3THPA 1G2EA 4CLWA 1JJ4A 1JLFA 2RDDA 2NPIA 2ZH9A 4RBVA 2W9AA 2V4JA 2QIFA 4KRWA 4OYZA 1RE1B 1R43A 2HURA 3CJ0A 2CKWA 1NM2A 4DUZF 1P1TA 3DRSB 2IYIA 3HULA 4F4ZA 2DGVA 1WKKA 2BBEA 3MEGB 2R3VA 3EVWA 2NXEA 2RKIB 2NXJA 2XULA 5AXNA 2CPYA 3GONA 4NZ0A 5H9EK 1R0AA 3LANA 2EXUA 2A10A 3MFIA 1SKSA 3MPVA 4L72B 2ACYA 1N36F 4ED5A 1EX8A 2JLEA 3WHIA 2XZDB 1HQUB 5ETLA 2GIFA 4DF8A 3WC2A 4M5HA 4C7QA 4DN0A 4JB8B 3W63A 1DURA 4P6QA 5HMXA 1VHFA 3THTA 1ZM2A 2HWIA 3CC4S 2FHKA 4Y6IA 2H5JB 2U1AA 3Q86A 3KXDA 1F0XA 1FK9A 1UVMA 4LBHA 4F0MA 4QU6A 5F0WA 3D54A 3O8WA 1UMJA 4OI0A 1CJTB 2P8IA 3CPWR 3GR0A 3MF5A 2HLTA 5IT9Y 2C22A 5G0RB 1D1UA 1RT2B 5KFGA 2J7UA 4DU8A 3Q8QB 5CYMB 2IDEA 1S9EA 3LA0A 5THWA 2YTCA 5A76A 4FVCA 1VDHA 1T02A 3CCSS 1N56A 2GJIA 3GFHA 1CC8A 1R6VA 3MECB 3W62A 4KSEB 2QLWA 3JB9k 3PO4A 3W61A 3G6VA 3L7PA 3T5LA 3MOZA 4ZA1A 4F4YA 3KK3A 1A6LA 3NGKA 1UCNA 3GSDA 4DL2A 3PYGA 3ZC4A 1I1GA 1NKCA 1H38A 3ZTRA 2ZNZA 3PW7A 1SQEA 2R4FA 2IRUA 3L09A 2BM1A 2L9WA 1FVSA 1ELOA 1FRXA 4GVLA 4CO5A 1T03A 1SH2A 2FDNA 4DV2F 2AGOA 1Q81T 3JYTB 4WP9A 4WIQA 4NOHA 4ITSA 3K5OA 1T9TA 4OYOA 4JP8A 3BJYA 2FGCA 4RW4B 4A8SA 3SDEB 5LT5A 6FDRA 2IBKA 4YY3J 1FA0A 4WZQA 3SZ2A 4DL4A 4PYDA 4KH1B 4ELVA 2I0XA 2JVOA 2XBPA 4N8NA 2HS3A 2GCFA 2R2UA 3CCES 1IM4A 5KFIA 4JI2J 4O4RA 1O5JA 1UTAA 1WEYA 3HDSA 4YDXA 3A4TA 3SSRA 3KHGA 3W8PA 2ZM6F 4URSA 3I55S 3DI6A 2XS2A 1S6UA 4UQTA 2OPPB 4P71A 1PJ6A 4ZPWR 3DLKB 1WJ9A 4PG8A 2FIUA 1LWCB 1HNZF 4EBDA 1CPZA 3ILLA 1IBKJ 1FCAA 1MMLA 4XK8C 4X66F 1HWUA 4IUFA 2K7JA 5ETNA 1SI9A 2COLA 2Z56B 1V6HA 4R25A 3NP5A 4DUZJ 1MWYA 3M8PB 4NZ6A 4IFYB 3JS9A 1NPKA 3N5FA 4OZ1A 5LMNJ 3GFZA 1ZZNA 2MYFA 4A46A 3MTJA 4WP3A 2HNZB 1EJ7L 3U02A 1D3WA 3IAS9 5K14B 3OLBA 5ETPA 5HQMA 3DRPA 1PG5B 5K5MA 3BBFA 2EFQA 3T5JA 1IBLJ 5F9NA 1HHTP 2CJXB 2DGSA 1FDNA 5JXSA 3I9V9 1LW2A 1HFEL 4RX6A 5JUMA 2ZH2A 4WFAQ 2WTFA 3JTOA 2AZ3A 5IV3A 3OVBA 2G0CA 4YHHF 3MEKA 4NE9C 3CTRA 4LREA 2NREA 1KVJA 2AEJA 2I9SA 3ZZOA 2XSFA 5IFMA 3NOCA 4WU2A 5KFLA 2UVRA 1VQ5S 4ILRA 3RR7A 2BOAA 3RB4A 1UW9A 1HBOA 2DYAA 4M5IA 4LF8F 5MAOA 5KFQA 5AJ3J 2GFFA 2YX1A 1S49A 3V81A 3AB4B 2FLNA 2HQCA 5J2QA 1M5PC 4V19J 5A2QY 4USJC 2UXBF 4B3SJ 3PHTA 3LTOA 1TUWA 4I6AA 2V8VA 4KHMA 2LQ8A 5KFEA 1CS4A 4I2PA 5D0GA 1KRPA 3WC0A 2K2PA 4P52A 4A47A 3PRBA 2RD5C 1RAJA 1X60A 4FBUA 4ECVA 2VPXB 2DNRA 2QYGA 2LU2A 1U02A 4PWDB 1N5YA 4JYAF 4HHJA 4UOFA 2C2NA 4PUOA 3PVXA 1FWLA 3C46A 4MMOA 3TYTA 1PILA 2PD1A 1JLAA 3LQVA 2OEJA 3OVAA 3HVAA 4IH6A 2RQ4A 5IT4A 3CMAS 3AFGA 4FKXA 3G8QA 4JOUA 1QVGR 3ILOA 4DPTA 2EFGA 1LWXA 2XWXA 4K4SA 4IRDA 1ZAWA 2B4VA 3M9OB 4M5MA 2BYCA 2CQ3A 2O1PA 4J9NA 4DFJA 1VBZA 5L9NA 2CQHA 2RVJA 2A2CA 1S76D 4JI5J 3JSMA 3BGFA 3F41A 4HTIA 3S6EA 2IIHA 4O23A 2ASLA 5HATA 1XERA 1JLFB 2RNEA 2XNRA 1RDRA 1Y9OA 4ECQA 5CCMA 2V4JB 2NSBA 4LF1A 4NLWA 1QY7A 2AX0A 1RWVB 2JEFA 2PE8A 1IM6A 2YKOA 4B17A 4QW9A 4ZN3A 2ZM6J 1R89A 3CW2C 4BBYA 3GV7B 3M8YA 2QMWA 2ZHOA 1RTIB 5LSOA 2D9OA 2IDLA 1R0AB 3EZOA 2Q43A 2HGLA 1HLWA 4P2SA 3FBEA 5E41A 5DRKA 2BJ8A 2LP4A 2X1BA 1S7HA 3GPAA 2DNOA 3R1HA 1SV5A 3UN3A 1NJYA 5C2CA 1IR1A 3BN7A 1K8AT 1P9YA 3FSYA 3OTEA 5F8MA 3CJRA 1XR5A 4OX7A 2CYYA 1IBMJ 2BZ2A 1YJRA 2FYXA 4E2FB 1FK9B 4ID8A 2ATLA 3EDQB 5D0RA 3OBIA 1WSRA 1CJUA 2DGWA 3I32A 1RYRA 2J8SA 1N33J 2WB4A 3N6NA 1R3NA 3CDAA 1Q4RA 1QAYA 1M1GA 1S9EB 3ZZPA 4I67A 2BDPA 3R5DA 3IN5A 2VBWA 5DDQC 4DFKA 5KFWA 3CCRS 1RTHA 1T8EA 4HT5A 3KK3B 2UXBJ 2KJWA 3FUYA 1DTQB 4LRFA 1O0PA 3FZBA 2OD6A 2UXCF 2J5AA 4DZDA 2HBYB 1UJ4A 3MEDA 3PM9A 4C0OC 4QR0A 4JYAJ 1BQXA 4RWXA 1UEKA 3Q24A 2MB0B 2XCAA 7FD1A 4NLXA 4ED2A 1T03B 4L6V3 2BKNA 3CMQA 5HBMA 1HL6A 3G6XA 2GHPA 1TELA 2J7WA 2C2EA 1JKHA 3J81j 4C11A 2DHGA 3KK1A 2KZMA 4J9PA 2KXNB 4DFPA 3DN9A 4WF9Q 4B9NA 2X1AA 2AYEA 2HKEA 2VPZB 2YKNA 2E1AA 4X4VA 3MM5A 1M5KC 4ED1A 1T11A 2FB0A 2Y1JA 2YY3A 2VBYA 4J7CA 1HNWF 4OZ5A 1B7YB 1KEKA 1TU0B 1NCLA 3AODA 2ZBIA 4HVZA 4OYXA 3TVKA 3MM6A 1NKBA 5EGYA 2WRMA 5KFUA 1DQAA 3DI6B 1OS5A 3OUYA 3QAEA 3TA0A 4F0KA 2IAJA 3NGRA 4DR2F 2BKPA 1F9EB 1RHUB 2LYVA 1YSJA 5DGAA 3BZQA 1WG5A 3IRXA 1NHUA 3KNGA 1M0SA 2CUYA 2VPYB 1Y5IB 1NJWA 2F3JA 2WOMA 4DL3A 2QE5A 4NLOA 4P10A 4GC7A 2YWGA 3PO5A 2HIQA 4QJVA 2DGUA 2YQ3A 4B3TF 3F56A 3C19A 1VQ7S 3M6VA 3Q8PB 3RZAA 1WTFA 4ECXA 3PTWA 2VFUA 1WDDA 3NGSA 3IBFB 2BQUA 2JDJA 3DRPB 3Q0AA 4KR0B 1EB0A 5KFCA 3SCJE 2GC8A 3QRRA 2MJNA 1N54B 3IWXA 2ZH8A 2CPEA 4U96A 2W2OP 5EDWA 2PDAA 4HACA 2KDOA 3GSIA 1S6OA 4NYOA 1N5VA 4LF6J 3HHLD 4NCAA 1K1QA 1RLDA 2ZITA 4B9SA 4ZITA 3I82A 1H72C 5E7OB 1G6BA 4UF4A 4KKOA 1PO6A 4AXIA 4AYBD 2L08A 4DDFA 3VF0B 1RAEB 4O44A 2KZZA 1TL5A 4Y2MA 3GP9A 1KVIA 4OX9F 2LEBA 4QR1A 3QJJA 4O3QA 4Y2KA 1CS4B 4I2PB 4GKJF 4OI6A 4JV1A 5K8NA 1U24A 1Z1ZA 4LBPA 2CQ2A 3J81U 3NGUA 5D15A 4KGMA 4LQ3A 1HQ2A 1NK5A 3JSRA 2IMWP 2RHSB 1D09B 2FC8A 3K7RA 4ZCIA 2KRRA 1N5YB 3FCVA 3KUEA 1WDTA 1H2VZ 3TI0A 4Q8FA 2LKZA 5KG6A 4PUOB 1SIZA 1AXQA 2HRTA 4CH0S 1WKLA 3B6BA 3D0IE 4EYIB 5CZXA 3H5XA 1U45A 4QR2A 4KHPJ 1Y0HA 3PZPA 2DHSA 2BQ3A 2KT2A 2JJ4D 1FNXH 1Q79A 3FNNA 4CT8A 2X3GA 1Q8IA 1YZ6A 4OHVA 3CULA 3E01A 5D77A 3VAKA 4NYPA 1YQHA 4F02A 2FY1A 4BWMA 2VQEF 2XO7A 5D8HB 3PFEA 1FF2A 3ZZTA 4OJ3A 4EBCA 4ALZA 2Y8WA 4DQQA 1UW4A 3T41A 2YNHA 1RWNB 2KVIA 3FKBA 4LF2A 2PMHA 3AH6A 2W2QP 2IRXA 3JSMB 1XK8A 3K17A 3RW6A 2HAFA 2JEGA 1FESA 3AQPA 4CWBA 1WF1A 1LK7A 7FDRA 2MHNA 5CZVA 3D68A 1RT5A 4J9SA 4ZVPB 3QLHA 3Q8UA 4ECZA 4W90B 1ICEB 4UOHA 3UDVA 1ZAXA 4LF9J 2DCUB 1GTHA 2OUGA 2VBXA 1N32F 1VRTA 3P5TL 4L75A 4UQGA 1IQTA 4N56A 2L9DA 2WVBA 5KFBA 2N4CA 3HF5A 4L3KA 4ZP9A 1SQGA 3OR1B 4NI2B 5HLFA 3V4MA 1FWKA 1MN9A 1V3SA 2Y0SD 3FJ2A 3M8QA 1WG4A 1SV5B 2HGNA 4H4OA 4C6AA 2FD2A 2B6AA 3FFIA 2B7CB 4YN3B 1XQIA 1SL0A 5IM0A 4KC5A 1RACB 1RTJA 3DRRA 3N01A 3HHNB 4ECSA 3ULHA 4CLLA 4CRJA 2M2BA 2HAIA 2QLJB 1IJEB 5DDPC 3I31A 1X7VA 1RT1A 2IM3A 4ZKAA 3PY8A 4DZ6A 2HZVA 1VRUA 4A4JA 2HHVA 3J80U 4LT6A 2YKMA 2XCPA 1KOHA 1RHKB 4XAKA 4RZRA 3MM9B 1YX2A 4J9VA 4DI6A 2L3MA 4DCPB 1U1NA 4URGA 5KFSA 4U8VA 4N76A 3FEYB 3IRWP 3ITHA 1T9XA 3QO9B 3BH7B 2CZ9A 4EFAC 2W2MP 3TP2A 3Q8VA 4G65A 3QRQA 2AD9A 1CJVA 4RU2A 5GAHU 2M8DB 4NXMF 1RTHB 2CG8A 4CLSA 2Y3YA 4TN2A 5IS2A 5D4OA 3GLJA 1NSPA 2DO0A 2VUGA 1D9AA 4GKJJ 3F44A 4CM0A 1KNZA 4LVNP 1NDLA 2OEMA 1G3OA 2CNLB 2E9ZA 2KYXA 2XMVA 3L3CA 2IYGA 3MEDB 1MU2A 4X84A 1HA1A 2H5EA 2Z57B 1VLYA 3PIOQ 4R5PA 1OIAA 5HBMB 1QAIA 3ETMA 2J0QD 1OY6A 3X1LB 3HFKA 4PXCA 1B4SA 1JKHB 1Q8BA 3B54A 2LCWA 4F26A 2YWEA 2MPUA 3MR7A 2Y1RI 4IQMA 1XN9A 1APSA 1B0TA 3HT3A 2XNQA 3W2VA 2ZZTA 3KK1B 1FXDA 1L3TA 2BACA 4MIWA 4M5DB 2GO9A 2J9CA 4TNOA 3IP0A 3T19A 3RTVA 1ZM9A 2XEXA 3MM5B 4WP8A 3L7UA 2H5IB 4RUHA 5BR8F 1N34J 2F65A 1TL4A 2ADBA 3T1HF 1Y5NB 1R0CB 1RT3B 3CCMS 4WXOA 1NSAA 4HLBA 4YFUA 2DXDA 3RGIA 3LP2A 3OUYB 2MQMA 2IAJB 3GIIA 3R7SB 3TAMA 3W9HA 5HO4A 4HL9A 3TA1A 5ETRA 1OSCA 3W1YC 3IRXB 1RT6A 1TP7A 2WOMB 1VCTA 3GYNA 2VHGA 4YB6A 3RRGA 1QTNB 1Z2ZA 5KFTA 1ZZFA 4R0EA 2FVQA 2HHHF 2BE2A 1Q0NA 2ASDA 1OQ6A 2AGQA 2GA7A 2LA6A 5A8WA 2XI3A 3VHQA 1C1BB 1U1KA 5MLCV 3P4UB 3KK2A 1RHRB 3MDFA 4Y2CA 1N6QA 2ZHBA 2QLXA 4KTQA 3ILIA 2HNYA 3CJ5A 3VGTA 4X62F 2MKYA 4DV5F 4HACB 3H42A 4DR6F 3HHLA 2ASJA 4IFVA 5DO2A 3W2WA 1A0OB 2NXCA 4BCAA 1FHTA 2F4VJ 3AA8A 1KN6A 2B8PA 5T7LA 3NOGA 3B4DA 1S48A 4KKOB 3KJVA 4O3NA 1VQMS 1S9GA 3UR0A 4DV7J 4P74A 1Q16B 1C4AA 1DJ0A 1FDAA 1YHQS 4ES1A 3NMAA 5D3GB 4O44B 2FVSA 4PR6A 1N5SA 3MEEA 5K9FA 3J7YI 3G2XA 4DR5J 2CJQA 4F3QA 3T9NA 3PXGa 4WK3A 4FNHA 4M94A 1NDKA 1XMBA 2PT0A 1Y3JA 3MR6A 1VIOA 4CO1A 4YUDA 3GR1A 1NJZA 4LQ9A 2V50A 2EEYA 2ZJQQ 2VICA 4OL8A 4K4WA 2BA9A 2EG1A 4NXMJ 2FJXA 1SC3B 4CQ1A 1TUGB 1JJCB 2A18A 3S1TA 2F7VA 2D3UA 3BSCA 4OI1A 5L46A 1WTBA 2V68A 2GGPA 3D6FB 1R7IA 4DOZA 1YITS 1SXLA 2BW2A 1HI1A 2HVHA 1UKUA 3NS7B 1S1TA 1EQ0A 3MCSA 1RWOB 5A6WA 2AQ4A 1RU1A 3E01B 1M5SA 1FKAF 3R2CJ 4IRKA 3QT7A 2XC9A 3M4XA 2C2ZB 5KT7A 2Z2LA 4Z2XA 1VFJA 4Q2LA 2KVQE 1VQOS 5HQLA 3HVWA 2YNHB 4TLRA 2PA8D 5C24B 3TEHB 1VQ9S 3HK2A 3LOUA 3M30A 3J7AN 4H4KC 2XMUA 2C2DA 1HHSA 3H5SA 3EVMA 2CQ0A 2AW0A 3TJAA 2EFPA 3RR8A 4B02A 2NZ4A 2UUCJ 3DYAA 2R7XA 4Q44A 2RT3A 3DDKA 1RT5B 4ZP7A 5AT1B 2V8DA 1BE4A 4PABA 2DH7A 2HHWA 4YP3A 5KT4A 2B0GA 3R5GA 4Z7YA 1VRTB 1SKUB 3P8BB 1UA1A 4LFAF 4KV8A 1ZBTA 1FERA 2M70A 1SPBP 2FLPA 3MM8A 3GE9A 4FP9A 1RBAA 2MMYA 4EMDA 5HLFB 3SBMA 3OL8A 3OTBA 1KFDA 3M8QB 1NJXA 3JSYA 4H4OB 4IOAQ 2KH9A 2B6AB 3FK4A 1B3TA 1HWJA 1WELA 3FFIB 3KLVA 3DRRB 1XNQJ 5B0CA 1F5CA 3EGWB 4DV6F 1YWXA 5AE2A 3CD6S 1V3RA 2IJNA 3OVSA 2Z2YB 3DFEA 4WPAA 1RT1B 2E1MC 4RBTA 1NLKL 1VRUB 4KGZB 1P27B 4OFZA 2XLIA 4MYUA 1FT8A 3PNIA 2YKMB 1WWHA 3MZIA 2FTRA 4DX6A 1NK9A 4NLRA 3NNHA 4B3MJ 3TANA 2ZKUA 5KFFA 2DCLA 3QT8A 1HW8A 4A8QA 4LRCA 1QUPA 4NEYA 3GQCA 3TUZC 3W65A 2RSQA 3CCQS 3ITHB 4OQJA 5HMZA 5AXMA 4YQWA 1UFLA 4RNMA 3AOCA 1S0OA 3VQSA 2YXLA 3UCZP 2RHQB 4P73A 1S1WB 1K73T 1G4CA 1CJVB 2XB2D 2M0GB 2F9DA 4JI1F 3T1YJ 2RU9A 4JI6F 2YWWA 2XG8A 1U1MA 3RRKA 4C2MA 2F8EX 2UUTA 1S99A 2KU7A 1VBKA 1GXTA 2CPXA 3OTOF 3R6GB 3OTCA 2DGTA 1KBRA 1MU2B 4TY8A 1F5AA 4RU9A 4DR7J 3OJUA 3OFFA 1X5PA 3CIMA 3UN5A 2W2NP 2VA3A 1S79A 4ZJOA 2CNKB 1KKHA 4QU7A 2CQ1A 2NQPA 2ALZA 3PDNA 5KFOA 3BS9A 5ETQA 4G3IA 2DISA 1F6TA 3W2VB 1OPIA 1OO0B 4IOBA 1NDCA 3EGZA 3EGVA 2KT3A 2LDIA 2PSZA 2VKRA 3DHWC 3OPKA 4EU0A 3D0HE 7AT1B 4DXLA 4X65F 2E5LJ 1VRQC 2WBMA 2N7CA 2RDIA 3PKYA 1UWBA 3OXGA 2HHUA 4K4UA 3D4JA 1QE1B 4DV3J 1RK8A 3ET6A 3LP2B 4TQSA 1ZOTA 2RIJA 3G82A 2L41A 2V8HA 4QYZJ 2EWHA 3TAMB 1V5IB 2G9OA 2BE9B 3R7NB 5E33A 4V19X 1FRMA 2BANA 2AHOB 1RT6B 3D6HB 2HK2A 4ZVHA 5J1EA 2P6TA 5KFXA 3CF5Q 3ZZYA 1FNMA 1UP1A 2BE2B 4DV1J 4JI0J 2WVEA 5AE3A 3DGPA 4Q45A 1HQEA 1M5HA 5A8WB 4ELTA 3NMRA 1R8AA 2JZ5A 3TQ1A 4S0MA 3W5ZA 3N0VA 3ZTOA 4QIEA 3DM2A 2ATCB 1NXIA 3GYGA 3SIPB 3KK2B 1N6QB 2MZRA 1SL2A 3MMAA 4Y3CA 1VQSA 4C48A 2HNYB 4M5GA 3QRPA 2BOPA 3QAUA 2MKKA 3HHLB 1X9MA 3QSIA 4IFVB 3W2WB 2QN6B 1HNXJ 4X64F 5ETKA 5T7LB 1X4EA 2CA9A 4CLYA 2XMJA 3KJVB 3THVA 2E29A 4EK2A 1S9GB 2E66A 1DLOB 4KGKA 2VFVA 1VC0A 4LRAA 4MAKA 1J5OA 2GMHA 3B82A 1F9HA 4IDKA 5DJBA 2E7VA 3DOMA 3MEEB 4ED4A 1B99A 3LP1A 4USUA 1EHWA 4N8OA 4IR1A 3MR5A 2WVDA 4ZP8A 1J5EF 4K7QA 5D4NA 4BC7A 1PYOB 3QMQA 4B9VA 2J76E 2VONA 1NJIT 4WZMA 3EICA 4DLEA 2N82B 1XNRF 2F8HA 2ZH6A 2YPZA 2LVWA 3BDEA 1EARA 3NWGA 3W5XA 4DBQA 5M2UA 3D1HA 5D0EA 2GAGC 2GMJA 4JI8F 4NLVA 2LXFA 1Q5YA 3M6WA 3JQMA 3NGDA 3RYLA 4JI6J 2W4DA 2GGPB 1K0VA 2H51B 4M63A 2CQGA 1S1TB 3D3CJ 3SSSA 1RAHB 1QUVA 4MKVA 2WVCA 5IXUA 2B4PA 2AEMA 2GAHC 4DR4F 1NZ8A 3AOBA 4C8ZA 1HKAA 1OYDA 2Y8YA 4K5RA 4JI3F 3H4BA 2AF6A 2AMCB 4K4XA 1RT7B 3K5NA 2KJVA 3BO4A 2AV5A 1WACA 4AQYJ 1E6VA 4FXDA 2D69A 4U6PA 2CFXA 2JLGA 1HR0F 1JLBB 5I42A 1H98A 1EP4A 2P9GA 2OJ3A 2ALYB 3M30B 4NMXA 2HBQB 4YR0A 4PZVA 2HQ3A 3HHDA 3DRSA 1ZM3A 2W25A 3K89A 3LUYA 3PFOA 4K4TA 3IC1A 3DYAB 1H0HB 4X65J 2JEJA 2F40A 3PW0A 4DV4F 3K8WA 1RAAB 4JI7F 4MH8A 4PG6A 3K5LA 2HSEB 4ED3A 1Q5VA 4IG3A 4NLUA 1L5UA 4KV8B 2G1DA 4B3OA 3MM8B 3QFHA 3KFWX 4QYZK 2ZFHA 4GO5X 4PXDA 4DR1J 5B09A 1NB2A 2CPJA 4TU7A 1FJGF 3MWBA 1VC6A 2VOPA 3OT9A 5CCLA 4CIOA 4AD6A 2RUGA 4URQU 2DY1A 3RBZA 5KT3A 2OI2A 4K4ZA 1Z4UA 4RUAA 4PG5A 1Y11A 5IC4B 3NL0A 1Y7PA 1X4DA 1S1XA 3AB2B 1DBDA 1VS3A 3ENAA 2DVIA 1T94A 1S6PA 3NKYA 1RT2A 5HROA 3CCWA 1TK8A 5KFAA 4QIFA 4CTAA 4EGLA 3AA9A 1U8WA 2GVZA 2AJFE 2KT5A 3OL7A 2DRAA 5C2GA 4F36A 4M5JA 1TMJA 2HEKA 1RCOB 4EYHB 2D1CA 2CJAA 1XMQF 4X4PA 4IOCQ 3HXMA 3QWPA 4F4AA 4L74A 5DDRC 2UU9F 4NXNJ 2BE7D 3D3BJ 3NWRA 2HHSA 1JLEA 2UUAJ 5C7PA 2WSEC 2Z0GA 4ZVTB 1YJWS 5DGBA 2WB1D 2OFHX 4W4MA 4TU8A 1S4FA 4QYRA 3P3DA 3PYDA 3TVYA 4ZVEA 1EAYC 3TJ8A 1QJHA 4K0KJ 1FE4A 3UCUP 3QBCA 4EUVA 2R42A 1WOSA 4TY8B 1LFPA 1WG1A 3NLCA 1W2IA 2Q1LA 2XLJA 2R7TA 1SKRA 1ZA1B 4DCJB 1S77D 2V2VA 2BVZA 5EWEA 3B8HA 2YKQA 3QSYB 2IVFB 3RUBL 2ZJPQ 1WNEA 4ED7A 1FX4A 4I6YA 1S4EA 1WC6A 1YVFA 1JLQB 3WIVA 2MKSA 1JLCA 5B0DA 2R2SA 1RBOB 1TKTA 2FPHX 5EWGA 3SCKE 4TQRA 1X4HA 5BYSA 1D9FA 1UVKA 4F8RA 1HBMA 2IHR1 1X9WA 5KFHA 1TAQA 1B0VA 3U1LA 2VKZG 1K44A 3ET6B 1AFIA 1N0VC 3CCVS 2FVPA 3K2YA 2MJUA 4Y00A 3ADAC 3KMSA 4DEZA 2V8GA 2HFNA 2BANB 1JNZB 4I56A 1R31A 3CCUS 1UEUA 5J1EB 3H2VE 3DNCA 4GO7X 1WOOA 1U47A 1FRHA 1TZ0A 3DGPB 1HQEB 3HP6A 3MCMA 4F0HA 1NDPA 5GAHI 4WFYA 2QFJA 2V9KA 3K57A 2OTLS 3K5PA 3VVUA 4EO8A 2H48B 4MK8A 3DM2B 3KG4A 3DLHA 3MMAB 1DARA 1C0TA 1F3VA 1DZ5A 1Q78A 3ILJA 2DNNA 4F25A 5IV4A 1WEZA 2IM0A 1KONA 2R8JA 2FQQB 2G0JA 5FD1A 2VIHA 1VJQA 5L1IA 2QX0A 2GX8A 4U67Q 2HS4A 2JRSA 2CIMA 1RU2A 2OP5A 3H7HB 1J5OB 2QSFA 3RRHA 1GAOA 5KFPA 4IDKB 2HVEA 3DOMB 4RR5A 1NO8A 1D0EA 3IMQJ 2H3EB 3LP1B 3S01A 1KOOA 1AZSA 3E3XA 3LALA 4RNOA 2WSCC 5DETA 3V4IA 3VQTA 4ANCA 2QYCA 3MMCA 2OELA 4MFBB 4HR2A 2D41A 4QIWD 2AT1B 2R2RA 4GRSA 2W2PP 3DLEA 1FI4A 1Q1KA 4PXEA 1PIEA 2DT9A 4I68A 3IBCB 4QWEA 3NCPA 4IQXA 4K2JA 1AROP 3VGVA 2QA1A 5KFDA 2VOOA 2B5JA 2ZOMA 4O0NA 3PYFA 4YY3F 3PJWA 4CLKA 2AEFA 1Q53A 3KWMA 4JV5F 2Z2ZA 1LFWA 4QZVB 2I8EA 3Q8SB 3HZEA 2KHDA 1LWFA 2OPRA 2HHPA 2WW4A 4CNYA 4DS5A 4JI2F 1YJ9S 2GS8A 4MT1A 4C4WA 3SV3A 3IM9A 5A6PA 3C16B 3H2UB 4LF5J 3PCOB 2CNOB 1S7IA 4NLGA 3V6HA 5HL7Q 1E6VB 1XC9A 4DQSA 5F8JA 5I42B 1RXOB 4ICLA 2KFNA 1IBKF 1EP4B 3QIDA 1WC1A 2R7VA 1V9OA 4F4XA 4FVMA 5LSRA 2G0IA 1I94J 4NLQA 2OIHA 4HH0A 2I2YA 2HVZA 5LMNF 3BGLA 3HI9A 3R1LA 2IY5B 2LA4A 1NMEB 2R8IA 1RTIA 1U2FA 4F4KA 3OHAA 3P45B 2NCKL 2AJ0A 1IBLF 3SV4A 9RUBA 1FEHA 4UUXA 2GHWA 4IG3B 3SYZA 3RB6A 4DL0C 4ED6A 1U6BA 4B3OB 2N3LA 4WXWA 2ILYA 5CQGA 2FZKB 5EWFA 1AYEA 3PW2A 1RTDA 4LFCJ 2FHMA 2YKPA 4PEOA 1BHNA 4HYKA 3PR5B 4ED0A 1HBNB 3D0GE 2MLXA 3NCQA 2V34A 3I87A 1GT8A 2LXIA 4ECUA 4I64A 2YVSA 5AJ3F 3TEGA 5IZHA 3UN2A 3C2PA 3QT6A 1OPZA 1W2BR 1AUSL 1MNEA 3GIJA 2HHXA 1UJ5A 3ENWA 4B3SF 1LWEB 1SUQA 5F8GA 4OHZA 1HPZA 4CM2A 2RJZA 1S1XB 2NPFA 4XPEA 4DF4A 1CQNA 5IT9U 1IVZA 1X4FA 4I4BA 1S6PB 5HROB 2DR8A 2XYHB 3CJSA 2B9XA 1FRLA 2GIRA 3QWUA 4CTAB 3DLLQ 2XZWA 5FIIA 3AJDA 2GVZB 2MZTA 5HN0A 4CO3A 2JC0A 3DXSX 1FX2A 1MROA 2LMIA 2OMOA 4ZCMA 4LJMA 2DEJA 2HK3A 2NYIA 1MG7A 3VAIA 5IC6B 2CQIA 2UVUA 3A8EA 3BV8A 3TOQA 1DTQA 4QBUA 4Q5VA 2AJ1A 2MKCA 1N5TA 1JLEB 2YKAA 2H54B 3ZTQA 4F7VA 5EX0A 5K8PA 3BREA 1RWUA 4KFBA 1BWVA 4HHUA 3A13A 2BXJA 4WIIA 3BR9A 1FD8A 3EXCX 2RU3A 1KWMA 2RQMA 3AT1B 4YB7A 2BM0A 3WX4A 1RADB 3FMBA 3QGGA 5HANA 1JXLA 4ZCKA 3GJRB 2VODA 1CULA 3J7YU 4CNZA 4JI5F 2BRLA 1JXEA 1VISA 3GG1A 4J5OA 1RKIA 1RUSA 1XR6A 4RUCA 3SFUA 2RS8A 3NBPB 1QAXA 1YJTA 1YLXA 4JV5J 4U8YA 2B4UA 3VZIA 2FZGB 2VH7A 1JLCB 2QA4G 4J9MA 1FNOA 2RRNA 3AQOA 3CUNA 1TKTB 3I4PA 2AYMA 3CGIA 1H74A 2RRBA 5HAOA 2KKHA 2ZH1A 3KLGA 1HI0P 4TKTA 1B64A 1HBMB 2DK2A 2UUWA 3AHPA 3MPDA 3O44A 5E3QA 3IA0A 1HNVA 2R7QA 1YG0A 3TR5A 4NLDA 1VQPS 3BM7A 1VMBA 4ECYA 3LPEA 2QEXS 4DL7A 1YBAA 4X2BA 2A0FB 2FJDB 1VQ4S 1FKOB 2N4DA 3MR2A 3TZWA 3OSPA 3H59A 4H4MA 1IBMF 2G2ZA 3TUJC 4EI2A 5F8LA 1SJ3P 1RKJA 3OL6A 1JNRB 2DNQA 2E9TA 3VV2B 2LQ5A 1M1KT 1KHVA 2V6AA 3LW5C 2RDJA 1GX6A 3JTPA 3LH2S 1RWWB 1T3OA 1AA1B 1ZPVA 2C42A 2NZCA 1TVRA 1N33F 1YBTA 4FXWA 4F04B 1C0TB 2VV5A 4KAIA 5KT6A 3IWLA 3PEJA 2IFXA 2VFTA 5KFMA 2J6SA 4OYBA 1F5BA 1SC1B 3BBCA 1IKYA 4EZ9A 3QGIA 2D3ZA 2BW7A 5E3CA 2LFVA 4YOEA 1WC0A 5C5JA 2ZVIA 5FJ4A 5ETVA 4UUWA 1UVJA 5A2QU 3KLIA 3NEKA 2JVRA 1GFWB 3C6TB 3KKFA 1FRKA 5KFZA 3PJXA 2MEWA 2FJWA 5L38A 3R8YA 4JBCA 1Q82T 2XYPB 1PJ5A 3WBZA 3M6UA 1AZSB 3V6DA 5F8HA 2XMKA 3V4IB 4OV6A 2HWHA 5HMWA 4DR3J 5DM7Q 2E44A 3O5TB 2KG0A 1EETA 5H1SV 1CC7A 3MMCB 5LXYA 5T41A 2Y1LB 1Q7LB 4UOGA 1X9SA 3HHEA 3POTA 3SEOA 1VQKS 2APOA 3DLEB 5JVGQ 1GXUA 2OH2A 1LW0A 2QT7A 1FEEA 2B5JB 4CLPA 5BJRA 1LK5A 1N0UA 4UOCA 1U0SA 2V9WA 3BSAA 5ETSA 3R2DJ 4GKKJ 2FVRA 1HARA 1IKVA 1LWFB 3HVRA 5F0UA 2OPRB 2VBZA 2R9LA 3MMBA 2ZVSA 4OZ2A 4OJHA 4C97A 1RLCL 3EMTA 2CPZA 2VG5A 2EG2A 4DUYJ 1TUVA 1FDBA 1S72S 2GNKA 3CCJS 5E3AA 2QSWA 2WHOA 2J0WA 1WUUA 1R27B 3F73A 4WFNQ 4ICLB 1Y5LB 5DS7A 1YRXA 3FBCA 3HD1A 1S1VA 4FPRA 2XMTA 4YR3A 2DR9A 2WW8A 2Y9HA 4ZMMA 3UE2A 3KG1A 1S10A 2XMAA 1I3OB 2YQ1A 2RF2A 4RKUC 3TW0A 3R97A 4QPTA 2V4QA 4OZ3A 4LF4F 4CYUB 3M1VB 2H1YA 3CCTA 2V67A 1EKSA 1YK9A 3EDRB 4FF3A 4J9UE 4ECWA 3OR1A 4ZN1A 4JV0A 1KFSA 4USKA 3V2UC 5HP1A 2RH3A 4NI2A 1AFJA 4WFXA 4ID5A 4B9LA 4PQUA 3NGTA 2FLOA 1U1QA 1DTTB 1RSCA 2PEHA 1IWGA 1C1CA 5J2NA 4MKBA 1J27A 4LF6F 2VASA 3PW4A 2K7KA 4LFBJ 3H5YA 2KI2A 1YJNS 4NWBA 1RTDB 2POKA 4MK7A 3JQJA 2F9JA 1XIQA 3ENVA 3CJQA 4E0DA 3C66A 1DFDA 3OXFA 4PWUA 1SH0A 4WE1A 4USMA 3QGPA 4MIBA 2ZBQA 2E7WA 2DEIA 1SUQB 3FZ2A 4NL5A 1HPZB 5AE1A 3MM9A 2HBRB 4ZDNA 1HIYA 1QSLA 2XHWA 2V4RA 2DRDA 3Q8RB 4KY3A 3QATA 2ERRA 1VBYA 2MKHA 3D28A 1CQMA 2V2ZA 2VDIA 2XHCA 2VQFF 1VLOA 2V2KA 3QO9A 1S12A 4OLOA 5E0OA 1MROB 3JTNA 4Z7CA 3AJ2A 1XMOJ 2YWFA 3CJ2A 1MMNA 4N77A 2C2KB 3KG0A 4OYWA 4KHPF 1X4CA 3UWTA 3PYEA 5CABA 2DR7A 4PPZA 4BHQA 2XS7A 4ZPAA 3ZFVA 3NAHA 4AXJA 3RAXA 4OIXA 5FLXY 4WU3A 4KFBB 3CB4A 2FJVA 2KYZA 3ENQA 1OY9A 3HKZD 4ZCLA 1SB6A 3BB5A 5JMNA 4OI4A 3SQOP 1SC4B 3QQCD 2XY5A 4C0BA 5KOWA 2LQBA 4G1IA 4U7UD 3IM8A 3BSNA 1WORA 2CDQA 4B3RJ 2LLZA 1CULB 3D67A 2K8GA 4M5DA 3DRXA 1REGX 3BO2A 3IS9A 4MKYA 4TVAB 4DWIA 2YPYA 4ZIVA 4B9MA 5CAAA 3GJQB 4XTTA 5KFVA 4ZLLA 5KFRA 4FF1A 5AXKA 4OYIA 1RT3A 2DRBA 4LF9F 3P49B 2CNNB 3M2UA 1HHQA 3CSKA 3GV8B 4J37A 3LP0B 3KLGB 3LWLA 2M88A 1GTEA 1LXJA 4X4NA 2X1GA 3UQSA 2MQQA 4QWAA 3HSJA 3EZ5A 2RRAA 1HNVB 1T95A 1KHWA 2KTQA 4G6VB 4OZNA 2DIUA 5E2QA 1NH7A 3M2VB 6FD1A 1Q8KA 4ZVSB 1IKWA 4RBUA 1FKPA 4LF4J 1C1BA 4C8NA 4G1PA 4LF7J 1WKJA 4NCBA 3H4DA 2Z58B 1S59A 3D7SB 1TL1A 5M2RA 3FEXB 1KLNA 2KHCA 4H4MB 4USTA 5J2PA 1LV5A 4F2RA 1K1SA 5DQGA 1LNQA 4C8YA 2JH3A 4L76A 4UY85 3M9MB 5L8RC 5GADI 2CJYB 1SL1A 2C3OA 2A6OA 4CLZA 2QV6A 1TVRB 3HHLC 4RUBA 2FGOA 3VR1A 3S8SA 3GCXP 1QAJA 1IKYB 2VFRA 1PBUA 4Y65A 1VGYA 3AXMA 3IXQA 2VFSA 4ES2A 4DSEA 3I0RA 1PCAA 5D3GA 3PHEA 4JI4J 2XLKA 1Y00A 1TKDA 3MM7A 5DG7A 3RG6A 1GX5A 3K0JA 2D9PA 3KLIB 4RLEA 3ISND 4CO0A 2EFOA 5CHCB 1VC5A 2O67A 4MJKA 4ELUA 2FUG9 1N48A 2XZTB 1UFWA 4YMEA 4IYQA 2HNDA 2Y0BB 4QWBA 3V6DB 4CH1A 4C0HA 1NHVA 5IWAJ 2ZD1B 2VQFJ 2J7KA 2CZVC 2ZBCA 3IFEA 1EETB 3FSXA 3PRDA 4ZPDA 2MQ8A 4RW7A 4A8WA 4FF2A 3IWNC 2PFFB 1PYTA 4PAAA 3POTB 2KM8B 4DU7A 1RYSA 5B0AA 4QOTA 1N4LA 1LW0B 2YH1A 1HYSA 1U8SA 1O8BA 4DQIA 3H0PA 1CG2A 5I3PA 1FRIA 1OJ4A 1NK8A 1RB0A 3FRZA 2WVFA 2ZH3A 3M7VA 4NZ7A 2W1BA 1XBWA 4CO2A 1UJ6A 2V63A 1UVIA 3MCNA 1KQSR 1IKVB 4ECRA 2IM2A 2ZEJA 1N34F 3VAMA 4FYDA 1BC6A 3MMBB 2C3UA 3DU6A 2M8HA 2YQ0A 5C24A 2GQ2A 1URRA 1HWKA 2VG5B 2WK4A 2DB1A 2I1RA 1VYAA 2HBZB 3GTYX 4DCOB 3VGSA 5ETTA 3GWCA 5B0BA 1RWMB 4LRBA 3UR3C 1S1VB 1NAQA 1FVQA 1E6YB 1WHWA 2EC2A 3IR5B 5GAEI 5A0YA 1R0BG 2RF2B 3FBFA 3UNYA 2FHJD 2F8MA 2VJVA 2YWHA 3O2IA 2J0XA 1IQZA 4ATNA 2GJFA 4TYBA 3QIPA 2GMLA 2UXDJ 3IG1A 4F4WA 5HP1B 1XEZA 2GZOA 2BQRA 2MZQA 4ID5B 4PQUB 5CYQA 3EUNA 1C1CB 4NLSA 3I5CA 5J2NB 3R5JB 2FLLA 2F4VF 2HRUA 3TUIC 2OKQA 4NRTA 3A8IA 3L7OA 3S7RA 6AT1B 4DV7F 1S57A 2Q79A 1S9FA 1RAIB 2ZWPA 5L1LA 4YB5A 3EGNA 4OZ0A 3R7BB 4WE1B 4V1Ak 1QSYA 2C3PA 3FC9A 4DR5F 3EWGA 2Z2MA 1T9WA 2DH9A 3MPUB 5T14A 2FJEB 4Q8EA 3JSBA 4B9TA 4X4RA 4O4GA 4C3KA 3BGOP 1S1WA 3MXHP 3DOLA 1T0TV 1UWAA 5LMUJ 3M05A 3CNQP 3OSNA 3R5BA 2B9YA 5KFJA 3OQ2A 4DSJA 3T6BA 3UD5A 4FBTA 1TKXB 4A8XA 1FJCA 2JLFA 2N7YA 3A8KA 1PGZA 1RQ0A 3SXLA 4NLTA 1C0UA 1UPMB 3OLAA 1U4BA 3C14A 5C25A 4WKRA 4I6WA 3KDNA 2FJAB 5KFYA 1UEVA 2HFSA 3H98A 3M32A 5F8NA 1U7LA 4K2XA 2MQPA 5HVHA 4Y34A 2JSXA 1HD1A 4ZVUB 1Z2LA 3ETOA 2DNLA 4DSFA 4WTOB 2CQPA 1ZS6A 4CT9A 1IR2A 3CC7S 3CDUA 2H4YB 3OL9A 2C28A 2PEBA 3IS9B 1NUEA 3WDOA 4P2FA 2UUCF 1NHKL 1UFKA 2OAUA 2DGQA 1JXVA 2HFUA 2A3JA 2ZHAA 2KB2A 3MOJB 4MYTA 5ETOA 1YKWA 5KG4A 3BO3A 4LSNA 2NXUA 3M2UB 2M9KA 1KSPA 1QE1A 2OO4A 2OMLA 1U1OA 2ZNYA 1NK7A 4FXVA 3G6ES 3FVYA 4DX5A 5D0HA 5HSPA 4KO0A 3N6LA 2DY9A 4MIAA 4OHYA 4C8LA 2EFNA 2V8PA 2AIRB 2C2RA 3VAFA 5D4PA 1U1LA 4C9DA 1A7GE 1XR7A 5KT2A 4F50A 5JVHQ 3GIMA 2OEKA 5KG5A 2X1FA 1OQ3A 2XWYA 4IH7A 4UZCA 4DQPA 1IKWB 3RJMB 2DR6A 1N36J 1FKPB 2CVIA 1NPPA 1XNQF 3LGNA 2G2OA 3AD8C 3GMGA 5L1KA 1TL1B 4OX6A 4D3GA 5HVFA 1ZM4A 4ANEA 5J2PB 2M7SA 3I96A 3CCZA 3M8SA 2JX2A 3VZHA 3TARA 5DQHA 4FKYA 1VQLS 1JQGA 1N8RT 3RU0A 3TZZA 1T9YA 4B3MF 2DNKA 3Q22A 2NLWA 4QWCA 3US5A 1KR4A 1BWEA 1MWZA 3R5AA 3IR6B 4ZPVR 3M2RB 3GIKA 5DDOC 4PPDA 1DLOA 3O3LA 1GMUA 5D78A 2JL9A 1PC4A 3CMES 3BN4A 3UO0A 1S0NA 3D66A 2E1RA 3I0RB 3EJMA 1HWIA 3MM7B 2F1FA 3T1YF 2DXFA 2ZBRA 1ZAVA 2HQFA 4LBIA 5M2PA 1YI2S 4DSKA 4ES3A 4ILMA 5I3QA 1KS2A 3FSIA 2DPIA 3QJLA 2HNDB 1TKZA 4UZBA 1RAGB 1P9QC 1NSQA 2C3MA 5KOXA 3AOAA 2X3DA 4H54A 5GMEA 2DPJA 4DPOA 4DR7F 1RCXB 1MMDA 1F2HA 4RW7B 1U09A 1LKZA 2DTJA 1V3ZA 1BQNA 1P6TA 3CJKA 4XIUA 1T7PA 2DJWA 3ZZ0A 1VJWA 1HYSB 2IA6A 2J0SD 2PO4A 3G8SA 3OR2A 2MLYA 4DV2J 1U49A 3WIUA 1I5OB 1VOMA 2LU1A 3Q23A 4FYXB 2WONA 1TAUA 2YNIA 4KHRA 1RT7A 4DX7A 5KFKA 2QA4S 3KNAA 2E5LF 2QMXA 2L9NA 2PMWA 4RO0A 1JLBA 1VK8A 5LSLA 4Q0BA 2WAQD 3KYLA 4DV3F 3BF4A 3BKUA 1N5QA 3BEGB 3FCWA 1GMWD 1RGVA 1UVNA 2OHDA 3NNCA 2K3KA 3MGJA 3EYZA 5B0EA 4EEYA 2XI2A 4TU9A 3VCDA 2ZH4A 2HZAA 1VHIA 3MAHA 1KTQA 2D74B 1HMVA 5A0YB 3QT5A 1HNZJ 2FHJA 4JI0F 4DV1F 2E1PA 1YGYA 3W60A 1S6QA 4X66J 3HSDA 1H7XA 4OHWA 1XTZA 4WTYA 1X8DA 4Y28C 2ZC4A 2QL9B 4OI2A 2HVIA 5LM7E 1MWQA 3QIPB 4A8OA 4ZPTR 3U27A 1WC3A 3IG1B 4CLFA 2QL7B 2UVVA 4QIGA 1U26A 3D5MA 5CYQB 2BJDA 4LR9A 2JOQA 1ITPA 2BV3A 1HNXF 3HZGA 2Z30B 1LXNA 3TX8A 2BR0A 1H2UX 1FFSB 3B4MA 1TQLA 4OZLA 1S0MA 4LSZB 2GQQA 4USIA 4ZOSA 4FYYB 2YH0A 2G1HA 3PEHA 3GILA 4N5SA 5DM6Q 1SIWB 3ZZUA 4YHHJ 4CH7A 1UPPA 3P5BP 2W4CA 1QSSA 4C3LA 2VG6A 4IO9Q 4LF8J 1EQMA 5KG1A 3SMZA 3PG9A 4NMLA 1K0TA 1OY8A 3MHYA 5K8MA 4QIVA 3LWMA 4LIRA 3I9ZA 1OWXA 4KIAA 4F3OA 3T9ZA 1F3FA 4O4GB 5EHHA 1UA0A 1R8BA 2YWKA 2NYHA 4YDDB 3DOLB 4P9SA 2HFOA 1F2GA 1BGXT 5KTQA 3D1QA 2BJ1A 1RP5A 2BRKA 4LRDA 5C42A 1BUXA 4PXBA 2R7UA 1JK9B 4BDPA 4LUBA 1C0UB 2Q3PA 4FYVB 3C14B 5C25B 1Y3KA 2DHXA 5CH7B 2IA0A 3NY0A 2VA2A 3Q8YA 1NNDA 1WOPA 3M32B 3TUPA 4AQYF 3AXKA 2DGXA 5DLGA 5H9FJ 1PYSB 2QO3A 2QC3A 3V5RA 5E3RA 2DXEA 4BWJA 3OD2A 1TR0A 1PSDA 3AJ1A 3ZTPA 5HJXA 1WC4A 4DLGA 3GCWP 1MN7A 1TK0A 2MKJA 1G1XA 3A3NB 5GAGI 2HYIB 1JLQA 4K8RA 3UCGA 1UETA 1HI8A 3SCIE 1M5VC 2KFZA 3PX4A 3HM9A 1PAUB 4HDHA 5SZTA 4OYPA 4B9UA 1SC6A 3HCXA 4LSNB 1W26A 3HSZA 2MZSA 1UZDA 4BLGA 3CCLS 3BYPA 2OSQA 4J90A 4DUTA 3JXOA 2P9CA 2AP6A 4KO0B 3IR7B 4DR1F 2HGMA 4DV0F 1X4GA 8AT1B 2ZDOA 2M4MA 3C15A 3PACA 4IO1A 3JQKA 3GJTB 4HH1A 4USVA 3SI8A 2LECA 2AZ1A 3R5CA 2VPWB 2OFGX 2EC0A 4CDIA 1LW2B 1R8PA 4NA3A 2DNHA 1CJKA 2R8HA 5GMDA 2DHHA 4NCGA 3ZO7A 1RA6A 2CWKA 3A3PB 3CD0A 2R7OA 4NLPA 4IG0A 1YJVA 3CC2S 2FY8A 3BPDA 2R8GA 2NXNA 3N5BA 1TL7A 1Y4ZB 1SCJB 1RHQB 1HBOB 3GZ7A 4I7FA 2XGPA 2Q6CA 2MGZA 2E5HA 1RHJB 3V81B 2IVMA 1RAFB 3CJTA 1GNKA 4LMZA 1HBUA 3W64A 5J2QB 4ERDA 1NK4A 1P8GA 1WD6A 1JLGA 1NRKA 4I0WA 4KT0C 1NZAA 2MSTA 5CXTA 3W8GA 4NXNF 2GV1A 3J81Y 5IQQA 1R8CA 1VIXA 2UUAF 1XWLA 1VBXA 2XY7A 1KD1T 2ZBPA 4N41A 2CJ9A 2VDHA 3H8YA 3RBEA 3UVJA 1X5TA 3TAPA 5SUHA 4FPIA 4MFBA 3SQGA 1TKZB 2CAJA 4K0KF 1ACMB 4TY9A 1FJ7A 2W01A 5IOLA 4KGXB 1JLAB 3H25A 1TFYA 4KYZA 2EKYA 2UXCJ 3EZUA 3ZZZA 1VK3A 1IR0A 1BQNB 2MDAA 3CJKB 3VVTA 1JX4A 4ED8A 2QG9B 2V69A 2NR0A 1ROFA 1BQMA 3EM1A 3D2WA 4Z37A 2BMBA 1N52B 3Q2SC 4RJVA 3B78A 5I4MA 5KG2A 4JV2A 1Q8LA 3OR2B 2JC1A 3GG0A 4PYAA 2XY6A 3CIZA 1MLAA 3E8OA 4K4VA 2WONB 3C16A 3X3UA 2YNIB 5DZ6A 2Z8QA 1RA7A 1L3KA 3DDIA 5GVQA 2FZCB 1NSKL 4ZJLA 3H40A 1A9NB 3EE3A 4XDDA 4L3NA 5H9FK 2ROPA 3HHKA 2PI5A 3KJQB 1IWAA 1Q7YT 2J6UA 4Q0BB 3BQ2A 1H7WA 2ZOFA 5FDLA 3MURP 1GMWA 1NKEA 1HNWJ 1DQ9A 9ATCB 2MHEA 4ZLNA 4FZVA 2C2MB 4R8UA 2XMMA 5ADZA 4RW9A 3G4SS 3BSOA 2MQNA 3FBBA 4P7VA 2DKOB 3TA2A 3DXBA 1IN0A 1HMVB 4DR2J 1X4AA 5KG0A 2ZUAA 4WFBQ 2XSJA 1S6QB 4DS4A 4L73A 4WYLA 1RWPB 1WC5A 1M90T 3M8ZA 3VWSA 1AUDA 2J9EA 2D3OR 4CCHA 5G4DA 4DV0J 3EVOA 3BQ0A 4DPWA 4B3TJ 1RZMA 2MZJA 2W4PA 3DGVA 4IKAA 2IPOB 3A1YG 5IQ6A 1VQ6S 1HBNA 4K4YA 2HVDA 2CJBA 3HKWA 3KUGA 4LSLA 3A3OB 3HFVA 2XMWA 2IM1A 3J80Y 1TTHB 4FN5A 1SKWA 1IXKA 2W9CA 1U0HA 3FMWA 1ZYQA 1LWEA 1CJUB 4ZS6A 5A8RA 3PRVA 3M8WA 2HQDA 2B43A 4RNNA 4Y0FA 3N79A 3RBXA 1WF0A 3MD1A 1X4BA 3T5HA 1SJQA 2W9BA 4EBEA 3H20A 5E3PA 4O3SA 2E5JA 2LQJA 1FXLA 2VG6B 2A6MA 5F8IA 3CT9A 4WJBA 2EW9A 4I2QA 2MZ1A 4OX9J 2R2TA 3BYRA 5B08A 4QCLA 4IH5A 2DH8A 1YRUA 2B56A 1D8YA 1RWXB 3P96A 3NNAA 1G7CB 3UDCA 1NH8A 4ZJQA 3KHRA 1H6KX 5GADU 3OW2R 3T3FA 3J7ZT 2YNGA 4HDGA 1NK6A 2W8LA 4KBIA 2NUHA 1NK0A 2GW8A 3CJ4A 5RUBA 1O6XA 5C42B 4KPCA 3KLHA 1QDUB 2P2CB 3A12A 3HO1A 2O01C 3GYXB 4KH0B 1REVA 4C11B 3GV5B 1NU4A 2XM3A 4LF5F 2BJ7A 3W7BA 1RTZA 1HD0A 4CZCA 3ZNUA 3TX0A 1PKUA 4KB7A 5HJYA 4IR9A 2C2OB 2BJEA 1URNA 2YKNB 2IBOA 3NBPA 2HMIA 2HG4A 3MPWA 2VQEJ 3IO1A 1JMTA 3UI3A 1QD1A 1KLMA 1KVKA 2BEFA 1I94F 1DHMA 2A1BA 4NRUA 2O66A 4GVBA 3DRYA 3MM6B 1WF2A 1YDLA 2EK1A 3G71S 4M1KA 1Y10A 5F41A 1IKXA 4ZVFA 3PW5A 5CD4H 3D6TB 3H90A 1RHMB 5KFNA 5A8KA 3KLEA 3L4BC 1ZETA 1RAOA 5DQIA 1CBKA 4UW2A 4M5KA 5B0FA 1T9UA 5I3UA 1FO1A 2ZZNA 3C15B 1N32J 1CLFA 5DG9A 3KUHA 4LFCF 3RB3A 4J9QA 4ZP6A 3W66A 1W7WA 2DD8S 2DNZA 4J9LA 1FKOA 1X31C 2DGOA 3GB0A 1JIHA 3I0SA 8RUCA 2H9ZA 2GO8A 2UUBF 4EWTA 3HVTA 2IJFA 3MPYA 1K9MT 1CJKB 4NCGB 2Q66A 3EPGA 1BXNA 2QL5B 4ZHRA 4IG0B 3P6YC 4G1QA 2O3DA 5GAEU 4RPFA 4A48A 1TL7B 2HS0A 3MUVP 2R8KA 1FDDA 4HHHA 2MSSA 3EXYA 4Q2MA 4I7FB 2VG7A 2MGZB 4ANDA 1LQ9A 2CPFA 3SCLE 3RBDA 4DN9A 3HJFA 2WBRA 1HBUB 5B7WA 2VL1A 3ICLA 1DRZA 4ZLJA 5LJ3Y 4GC6A 1JLGB 5HMYA 2BX6A 1S0VA 3C6TA 2PI4A 4HT7A 4ZK7M 2V94A 1DAXA 2PMZD 1RJJA 4C8OA 1FD2A 3LGHA 3LPYA 1X0FA 3KHHA 3G9CA 2IRYA 3UVJB 4ER8A 3BKTA 3OFGA 3MTKA 3SQGB 1Q86T 2JFDA 2JWNA 2V0NA 3MR3A 4LVOP 1UZHA 3CDBA 3DKDA 3DMJA 1F9FA 1F1BB 1U48A 1GH8A 4Q43A 2KM8C 4X4QA 1JB0C 1CSJA 2AYBA 2SXLA 3ZXWA 3G6YA 4MKAA 3T5KA 4D3HA 3TZXA 3PX6A 1T05A 2KG1A 1RISA 2B9EA 1BQMB 2GQCA 4W98A 5DG8A 2LEPA 3PKMA 3OXLA 2OSRA 4WBFA 2QZ8A 2DIVA 1YJUA 2RUSA 4TLQA 4HKQA 3QGHA 1RWKB 4UY8T 1IBCB 2BJ3A 2E1CA 3IGNA 3ONQA 1B7FA 2I6WA 4BC9A 5K8OA 3CVKA 3UFCX 3W5YA 3W9IA 2EKNA 3FGVA 2KFYA 1TV6A 3I4HX 4XDCA 3OJSA 4PCQA 3FQLA 5B0GA 1PC5A 1EKRA 5FDLB 3C8YA 3DLGA 5BR8J 3QLHB 3T1HJ 3D6MB 3CD7A 2CG4A 3AD7C 2ILZA 1ZA2B 4R8UB 2HLUA 4RW9B 2HPUA 2QA2A 1YIJS 2HWTA 2HFVA 2K06A 4CYUA 2HHQA 1WSVA 4YB1P 3ZTSA 3M1VA 4AE5A 2XGQA 5D6GA 5HQ8A 3BKFA 4HI1A 2XSJB 2G4BA 1BD6A 4HI2A 4K50A 4JUZA 2AJ4A 1L3VA 3HX9A 1DTTA 4QPXA 1QTMA 3FEZA 5J1NA 2FC9A 1FE0A 2YX7A 1AT1B 2HHHJ 3HFZB 1XJWB 2HW3A 3DU5A 2QGFB 3BGRA 5IM0B 5LL6d 1RTJB 2MXYA 2DNGA 1WHXA 1HWLA 3QZ8A 3UDLA 2F63A 2GIQA 1H2TZ 4QQBA 3MAQA 2VB6A 4LSLB 2CPDA 4C3MA 1FJEB 4A8FA 2UUBJ 2W9CB 4DG1A 4X62J 4DV5J 1U1PA 1U0HB 4DR6J 2P6SA 2VD3A 4B08A 4RW8A 4QWDA 5A8RB 1VQ8S 2MKIA 2HFZA 1FTRA 1VQNS 2HQGA 2OD4A 1TFWA 1PJ7A 2ZH5A 4HTJA 2W9BB 1ZPWX 4DSLA 1SH3A 3BQ1A 4CLTA 3T1AA 2NUUG 3KMQA 3GJSB 1U25A 4DR3F 3ISZA 2K1RA 4NEZA 3AD9C 2GJ2A 4X4TA 1R8HA 3C6UA 4I2QB 4IRCA 3MAAA 3LF0A 2XYGB 2AU0A 2VF3A 4ECTA 4OLPA 8ATCB 4UTGA 1O51A 4USWA 1RBLA 2DR5A 3D9BA 2MQLA 4Y2AA 1RABB 3UD4P 3HJVA 4P72A 2W8KA 2KRBA 5EN1A 3OFEA 3KTQA 5BXIA 1GK8A 1KQFB 3R27A 4N47A 1GEHA 3JAMY 3JAMU 4RW6A 3PR4A 4M5NA 2YNGB 2P9EA 4EO6A 2UV8G 3MUTP 5HVGA 4GKKF 5LJ5Y 4R5PB 1F60B 2LQ9A 2DHAA 3KLHB 3N9UC 4O3OA 2OGUA 2W7AA 1AB8A 1REVB 1V5VA 2BUNA 2Q6BA 2GVDA 2CJKA 1HNIA 5J2MA 2IC3A 1HW9A 2EVZA 1YTYA 2CRLA 1BLUA 1JJHA 3U7JA 2ZH7A 4DUYF 2XTJP 3BBBA 3I6PA 4W92B 2RE1A 1IUJA 1S1UA 3KLFA 1FWPA 4AT1B 1J2VA 2HMIB 3UPFA 4U7UK 2UV8A 2B9WA 4ENOA 4FS1A 5GMKa 2B51A 1D9DA 1VQYA 1KLMB 2CADA 2OLWA 2NS1B 1X5SA 4GVBB 4NPOA 3QFWA 3VAHA 2EI5A 2IJRA 2MY8A 4TXSA 1GXLA 4J9OA 3L95X 3LP0A 3ZNJ1 2CDRB 1ZTWA 2U2FA 2FHOB 4ZVQB 4M5LA 1IKXB 1NBEB 4DQRA 2D3O1 2AKWB 2BJ9A 4OJGA 3FRYA 5A8KB 1AW0A 5KT5A 3KLEB 1ULRA 2VC0A 4RNFA 4J9KA 5HK4A 2RILA 3PJ9A 2RAQA 3DDNA 1UL3A 2CPHA 1KC8T 4ETZA 5I3UB 4LFBF 1YRTA 1D8ZA 3M2VA 4OJ1A 1X5OA 5KAKA 4FDFA 4RNHA 2ZE2A 4LFAJ 1KTVA 1CVJA 4NA1A 3H5UA 1T9VA 1RI7A 3CDWA 1WI8A 3I0SB 4U9RA 3RAQA 5AXLA 2AWZA 3CO9A 4DL5A 4YS2A 2KO1A 4OI3A 3HVTB 2C1EB 1WEXA 4DPUA 5F9LA 4WYWA 2HZCA 1UVLA 3Q2TC 2AJQA 3CDEA 4KQZA 3OFHA 2QMUB 2PGCA 1K47A 1MSWD 3IBWA 2V5HG 2KXHA 4OYAA 4ZHRB 4G1QB 4F2SA 3I5BA 2ROGA 2VZ9A 4DV6J 2DNMA 2YNFA 3TVZA 3NXZA 4DPYA 4HEA9 2HQIA 4FYWB 4NA2A 2VG7B 3VAGA 3QYYA 4C98A 4LR8A 3R3TA 1EZZB 1UAWA 1KDNA 2JNJA 1TL3A 3K8VA 1XMOF 4O0IA 4MTPA 3HSGA 2M52A 2BABA 1RT4A 1B70B 3DC2A 2CXEA 2RQKA 2KN4A 2B4OA 1YZ7A 5L9XA 4AL7A 3DOKA 3TJ9A 2ZD1A 5EUHA 2EPIA 2P5VA 3R9LA 4ZLPA 3C3LA 1BY9A 2OPSA 1I51B 3CJ8A 3G96A 1JJ2R 4JI1J 3NS6A 3UW1A 3CD5A 1SJFA 3KJNB 4NX9A 3WQPA 3DLBA 4I69A 2IMOA 2OTJS 4PWWA 3DMJB 4A8YA 4E98A 3FDSA 2OPQA 4WKYA 2I5JA 4J91A 3M8RA 4B3RF 2CVEA 4ZVGA 1B0PA 2PFDA 2YBVA 3OTOJ 4OMFG 1T05B 4ZPBA 3LAMA 4P75A 1OYEA 4PQAA 1KQKA 1QLNA 2W24A 2MLZA 3MUMP 1FFGB 2CPIA 5LXRA 2FVCA 4O3PA 4CP5A 1EIYB 4WFZA 2PA3A 3H2LA 3G87A 4H4KA 4USHA 3QPIA 4OYMA 3DLJA 4F3MA 2M3DA 4X4SA 3W9JA 2G13A 3BPSP 1YBUA 3NRBA 2QFIA 2Y1IA 3J7A1 3NG8A 1TV6B 2DITA 1PBAA 3CWJA 3MEGA 2E9RX 1E6YA 3DLGB 4AL6A 2RKIA 5CA5A 3DCAA 3RAMA 4M95A 2MQOA 2M5YA 3GU0A 4DHVA 3E2EA 2ZKTA 1SJ4P 4WCEQ 3J7Z5 2UP1A 2HHTA 2ZC3A 2B8QA 2BKOA 3E51A 3HT0A 2D7SA 2KXFA 3UNGC 1HQUA 3KHLA 4LF7F 2RB7A 2I38A 3TNVA 2H4WB 2W7PA 2ZOGA 2E5GA 1QM9A 2G2YA 1S97A 3OTDA 2EFVA 2JHEA 4Q7AA 2W7OA 5GAGU 3TWZA 4KJIA 3EPIA 1VI7A 1I6JA 4PG4A 3BGRB 3KOAA 3U1NA 3BGUA 3TZYA 2ZJRQ 1GQEA 1SQFA 3HMJG 2JFKA 4FNIA 3VALA 2IVYA 1C2PA 3VGUA 1CJTA 5CYJA 3CE8A 1U2RA 2ADCA 1WI6A 5G0RA 3ZZRA 2EBEA 2DBBA 1ZH5A 3WX8A 3A8JA 4JI4F 4K5SA 2XQCA 4DG1B 5CYMA 3V6JA 4LIWA 2ZDPA 4RW8B 4DJBA 1QVFR 1L3SA 3K58A 4N7TA 4X64J 2X51A 3QJPA 2EK6A 4CO4A 3OHBA 1TK5A 1WHYA 1W25A 3MECA 2LDYA 4M8LA 2PIIA 3DHXA 4YR2A 5U47A 4X4UA 3Q83A 4ZVRB 5IWAF 3OV7A 2VJUA 2NSCA 4DMZA 2K1RB 3I5AA 1TMMA 2YX4A 1IJFB 3C6UB 3CO0P 4P2MA 3AAWB 3QNWB 3MI7X 4DX8H 3MAAB 3SSQA 4WWSA 2E7XA 1LOUA 1J5EJ 5BYRA 1C4CA 5BYQA 1TKXA 2LEAA 3CJ3A 4TYAA 2PC6A 2K3IA 4J9RA 1XNRJ 4C8KA 4OZJA 4NYZA 3JYTA 4RW6B 2F5GA 3F0NA 2E5IA 5FLXU 3L9ZA 3W3SA 3PX0A 4RW4A 5F3TA 2EBGA 2C3YA 3FCHA 4OV1A 3SDEA 3RW7A 4I1TA 3NS5A 4A8MP 2A2DA 4JI8J 3TRGA 1SBRA 1H3DA 4ETXA 2ACMA 5ETMA 2GVDB 1HNIB 4CI0B 5J2MB 2IC3B 2DNPA 2RMLA 3GFXA 1OMSA 4A8KA 3BR8A 3CEDA 2F4FA 5K20B 2J6TA 4PKDB 2AGPA 5DZ7A 3HPOA 3VTIA 1S1UB 2CQCA 2V2QA 1LEOA 3KLFB 2J9DA 2H65B 4DR4J 3O1LA 2WZ1A 3NAIA 2J9DE 3HLUA 3NCRA 3G8TA 4JI3J 1L3UA 3M9NB 2UZAA 1JWWA 3CXCR 2OPPA 3M6XA 2RS2A 4P7TA 3DLKA 5H9EJ 1HR0J 1LWCA 2AJ2A 1FFWB 4Y2IA 2CWXA 1UWBB 3I56S
chains in the Genus database with same CATH topology
4TKTA 1B64A 2B3TB 2MQMA 4LSNB 3LO3A 1HBMB 2PN6A 2DK2A 2IAJB 3GIIA 2MZSA 3TAMA 4O3RA 2UUWA 3AHPA 3IGVA 5HO4A 3CCLS 5D4LA 4HL9A 3TA1A 1FTCA 1OSCA 3M8PA 3O44A 4K59A 5E3QA 2OSQA 3IRXB 3IA0A 4IFYA 1U6ZA 2O5DA 1RT6A 1TP7A 2P9CA 1HNVA 5J1PA 2AP6A 4KO0B 2UXDF 4ZPCA 2WOMB 1P1LA 1T3NA 3IR7B 2B7BB 2R7QA 3GYNA 1M5OC 4GMKA 4DR1F 2HGMA 1YG0A 4DV0F 1X4GA 5EX3A 4YB6A 2WSFC 5F3ZA 2ZDOA 2M4MA 3RRGA 3PACA 1CEZA 3TR5A 1WHVA 1Z2ZA 3GFYA 5KFTA 2HNZA 4NLDA 1VQPS 1ZZFA 2DNYA 4R0EA 2FVQA 4IO1A 3BM7A 2HHHF 2ROEA 5K14A 4QW8A 2BE2A 4HH1A 3N4WA 2ASDA 5KG3A 1OQ6A 1VMBA 2AGQA 2GA7A 3SI8A 4ECYA 2LECA 2LA6A 5A8WA 2DO4A 2QEXS 2XI3A 4DL7A 1C1BB 4DFMA 1YBAA 4X2BA 2WCXA 2FJDB 3D1OA 1VQ4S 1FKOB 3RB0A 4OHXA 4ILLA 3R5CA 5KG7A 4KPYA 2VPWB 1U1KA 2OFGX 2N4DA 2EC0A 3MR2A 4U7CA 5MLCV 2ZE2B 3MMJA 3OSPA 2ZZMA 2ASYA 3H59A 4H4MA 4NLYA 1IBMF 3O6QA 3TUJC 5F8LA 1SJ3P 4F67A 4WK1A 3KK2A 1LW2B 3MDFA 2ZUGA 4Y2CA 4YEAA 1RKJA 3OL6A 2ZHBA 1R8PA 4NA3A 1N6QA 1JNRB 2QLXA 2DNHA 2DNQA 3PV8A 2E9TA 2LQ5A 2R8HA 1M1KT 4KTQA 1KHVA 4NCGA 1SJRA 3LW5C 2HNYA 2RDJA 3UD3P 4AL5A 2GHVC 3CJ5A 1RA6A 2CQ4A 4X62F 4DV5F 1GX6A 1U1RA 3JTPA 3CD0A 3LH2S 2R7OA 4DR6F 3HHLA 1T3OA 4NLPA 2ASJA 1ZPVA 4IFVA 4IG0A 5DO2A 3W2WA 2C42A 4XO0A 1YJVA 2L48A 1TVRA 3CC2S 4BCAA 4FXWA 2ABYA 1N33F 1FHTA 3VAJA 4PRFA 2RQCA 3AA8A 1C0TB 2VV5A 2R8GA 4DL6A 4KAIA 1KN6A 5T7LA 5KT6A 3IWLA 3N5BA 3PEJA 2IFXA 3B4DA 1S48A 2VFTA 3N28A 1Y4ZB 4KKOB 4O3NA 5KFMA 2N3OA 1HBOB 3KJVA 3GZ7A 4I7FA 2XGPA 2J6SA 2CQDA 3G86A 2Q6CA 1VQMS 1F5BA 1X0PA 1S9GA 3UR0A 1IKYA 3MD3A 3M2RA 2E5HA 2MGZA 4EZ9A 3QGIA 4E8UA 3V81B 2IVMA 1NEEA 1Q16B 1C4AA 1GNKA 4LMZA 2D3ZA 1DJ0A 1HBUA 1FDAA 3SFGA 2JEIA 4C8MA 5J2QB 5E3CA 2QRRA 1YHQS 4ERDA 2J8AA 1NK4A 1DQ8A 3PIPQ 2YNFB 4ES1A 3NMAA 1P8GA 4YOEA 1WD6A 2Z4PA 1JLGA 1NRKA 4I0WA 5D3GB 4KT0C 4KE5A 5C5JA 5DLFA 4O44B 2FVSA 5L1JA 4PR6A 5FJ4A 2LXUA 1NZAA 4UUWA 1N5SA 2MSTA 3MEEA 1UVJA 5K9FA 3KLIA 5CXTA 3J7YI 3TAQA 2JVRA 3EX7B 3C6TB 5LMUF 3KKFA 4NXNF 1FRKA 2GV1A 3J81Y 5KFZA 5IQQA 3PJXA 1R8CA 2FJWA 4OX8A 2CJQA 4F3QA 5L38A 3T9NA 1TL3B 4JBCA 3K5MA 1MW7A 1VIXA 2UUAF 1XWLA 1Q82T 3PXGa 1VBXA 2CZ4A 2XY7A 4PWDA 1KD1T 4WK3A 4FNHA 4M94A 1RT4B 3WBZA 3M6UA 1XMBA 2PT0A 3ISNC 2R7WA 4FS2A 1Y3JA 4EZ6A 5HI7A 3MR6A 3V6KA 1VIOA 2CJ9A 3V6DA 5F8HA 4CO1A 3H8YA 4YUDA 5ITHA 3RBEA 3GR1A 1NJZA 4LQ9A 1X5TA 2XMKA 3AY0A 2R7RA 3TAPA 2MY7A 3V4IB 5SUHA 4AFFA 2HWHA 5HMWA 4MFBA 2AX1A 2ZJQQ 5DM7Q 3T6JA 2E44A 3O5TB 2KG0A 1EETA 3SQGA 1CC7A 3FQKA 5H1SV 3U1MA 3MMCB 5LXYA 3DOKB 5T41A 4OL8A 4K4WA 3MFHA 1TKZB 4AUKA 2BA9A 5JJBA 4K0KF 1Q7LB 1X9SA 4TY9A 3K59A 2EG1A 3HHEA 1FJ7A 3POTA 2FJXA 3SEOA 1VQKS 4CQ1A 2APOA 3DLEB 5JVGQ 2OPSB 1JLAB 1GXUA 3H25A 2A18A 2OH2A 4FF4A 2VC1A 1LW0A 3S1TA 5L39A 1TFYA 2F7VA 2EKYA 2D3UA 4XPCA 3BDPA 1FXRA 3BSCA 4OI1A 3EZUA 3ZZZA 2AYGA 1VK3A 3TO8A 1IR0A 1SJ1A 1KQGB 2FJBB 2QT7A 1BQNB 2MDAA 1WTBA 3CJKB 1FEEA 2GGPA 1JX4A 1R7IA 2XS5A 4DOZA 2B5JB 4ED8A 1YITS 1SXLA 2BW2A 3WZ0A 1HI1A 2HVHA 2NR0A 1UKUA 1ROFA 2OPQB 2I5JB 1S1TA 3N6MA 1BQMA 5BJRA 1LK5A 3MCSA 5A6WA 1N0UA 2AQ4A 3LGMA 4UOCA 3QZ7A 3D2WA 4Z37A 4DSIA 3E01B 2V9WA 1N52B 1M5SA 3BSAA 1FKAF 3Q2SC 4R0JA 4IRKA 3B78A 5I4MA 1NB7A 4MK9A 2XC9A 5KG2A 4JV2A 1Q8LA 3M4XA 3OR2B 1U6FA 2JC1A 3GG0A 2FVRA 5KT7A 1HARA 2XY6A 1IKVA 3CIZA 2Z2LA 4Z2XA 1LWFB 4X4OA 3HVRA 1VFJA 4BS2A 2CQBA 2R7SA 5F0UA 2OPRB 4Q2LA 2HRYA 2VBZA 3E8OA 2R9LA 3MMBA 2ZVSA 3LAKA 2WONB 4K4VA 2UVWA 1VQOS 4OJHA 3X3UA 2YNIB 2Z8QA 4C97A 3HVWA 1RA7A 1L3KA 5E5NA 5IT0A 1FRJA 1OSDA 1N88A 1ZTTA 2YNHB 2BR0A 4TLRA 1R6YA 2CPZA 5GVQA 2VG5A 2EG2A 2PA8D 4RWWA 1TUVA 5C24B 4PG7A 3IAM9 3H40A 1A9NB 3THPA 1G2EA 1FDBA 1S72S 1VQ9S 2GNKA 4XDDA 4L3NA 3CCJS 3HK2A 2ROPA 3LOUA 1JJ4A 1JLFA 3M30A 2QSWA 2NPIA 3HHKA 5E3AA 2WHOA 2ZH9A 2PI5A 3OUYB 2J0WA 1R27B 3F73A 1Q7YT 4RBVA 2W9AA 2J6UA 4Q0BB 4H4KC 3BQ2A 4WFNQ 2V4JA 2QIFA 4ICLB 4KRWA 2XMUA 1Y5LB 2C2DA 1H7WA 5DS7A 1HHSA 1R43A 1YRXA 3H5SA 3CJ0A 2ZOFA 5FDLA 2CQ0A 2CKWA 3MURP 2AW0A 1S1VA 2EFPA 4FPRA 1NKEA 3RR8A 2XMTA 1DQ9A 4DUZF 1P1TA 4B02A 3DRSB 4YR3A 2NZ4A 2MHEA 2DR9A 2IYIA 4F4ZA 4FZVA 2WW8A 3DYAA 2DGVA 3UE2A 4ZMMA 3KG1A 2BBEA 2R7XA 1S10A 4Q44A 2RT3A 4R8UA 3DDKA 2XMMA 1RT5B 4ZP7A 2RF2A 5ADZA 3MEGB 2V8DA 4RW9A 4RKUC 2DH7A 3TW0A 2RKIB 4QPTA 2HHWA 4YP3A 2XULA 2V4QA 3G4SS 5KT4A 2B0GA 5AXNA 3BSOA 2MQNA 4P7VA 4LF4F 3TA2A 3DXBA 2CPYA 1IN0A 1HMVB 4NZ0A 1R0AA 1X4AA 1VRTB 5KG0A 3M1VB 4WFBQ 3LANA 2A10A 2XSJA 3CCTA 3MFIA 1SKSA 1UA1A 3MPVA 4FF3A 4L72B 4LFAF 2ACYA 4KV8A 1ZBTA 1FERA 1N36F 4ED5A 1S6QB 2M70A 2JLEA 4DS4A 4ECWA 2FLPA 3MM8A 4WYLA 3OR1A 3GE9A 4JV0A 1KFSA 1HQUB 3V2UC 5HP1A 2RH3A 1AFJA 4FP9A 4WFXA 1M90T 2MMYA 4ID5A 4B9LA 4PQUA 5HLFB 2FLOA 3OL8A 1U1QA 1DTTB 3OTBA 3VWSA 2PEHA 4DF8A 1AUDA 1C1CA 3WC2A