2O01C

The structure of a plant photosystem i supercomplex at 3.4 angstrom resolution
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
80
structure length
80
Chain Sequence
SHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title The structure of a plant photosystem I supercomplex at 3.4 A resolution.
pubmed doi rcsb
total genus 8
structure length 80
sequence length 80
ec nomenclature ec 1.97.1.12: Photosystem I.
pdb deposition date 2006-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF14697 Fer4_21 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2o01C00
3OR1B 1SIWB 2GMJA 1FRIA 3IR7B 1HFEL 4AYBD 1FRKA 1XERA 1RGVA 3MMBB 1FF2A 2UZAA 3OR2B 1KEKA 3MM5B 1GT8A 3OR1A 1CLFA 4KT0C 1FDBA 1B0TA 2C3YA 5BYQA 1KQFB 1DFDA 2Y0SD 3MMCB 1GTHA 4L6V3 4XDCA 2VPXB 4OV1A 4CI0B 2FJDB 1K0TA 3MMBA 1AXQA 1H98A 2PMZD 4ID8A 2PDAA 3MM5A 1Y4ZB 1BC6A 1H7XA 1IQZA 3MM7B 2O01C 1FCAA 1Y5LB 3MMCA 1FD2A 3C8YA 2C42A 1DURA 1FXRA 1FRXA 2XSJB 2V4JB 3MM7A 1WTFA 3GYXB 1GAOA 5FD1A 2WB1D 3EGWB 1JNRB 1FDAA 2VPWB 1BLUA 2V2KA 3LW5C 3IR6B 3HKZD 1R27B 2PA8D 2WSEC 1Y5NB 2V4JA 2XSJA 1H0HB 1DAXA 1F2GA 1FXDA 2FJEB 1VJWA 2VKRA 3MMAB 4OMFG 5CH7B 1FTCA 2GMHA 1C4CA 1JNZB 1PC4A 6FDRA 3MM6A 1B0PA 1D3WA 1Y5IB 6FD1A 1FRMA 1IR0A 1ROFA 2FDNA 2FGOA 2VPYB 1F5CA 2FJAB 2C3OA 2WSCC 3MMAA 1A6LA 1SJ1A 1FERA 1BQXA 1JB0C 5CHCB 1G6BA 2C3MA 4DHVA 1GTEA 7FD1A 1BD6A 1H7WA 3MM6B 1SIZA 1FRLA 3MM9B 3MM8B 4XDDA 2VPZB 5E7OB 2Z8QA 2FJBB 1G3OA 1FDDA 2FD2A 1Q16B 1C4AA 2IVFB 3EXYA 3EUNA 1FDNA 1FRJA 1FRHA 3MM9A 3MM8A 2WAQD 2ZVSA 2C3PA 2C3UA 1FEHA 1B0VA 1F5BA 3PNIA 5BYSA 4YDDB 2WSFC 4XK8C 3OR2A 1PC5A 4RKUC 7FDRA 5BYRA 1BWEA 4Y28C 3IR5B 5L8RC 1KQGB
chains in the Genus database with same CATH superfamily
3RW6A 2VF3A 2F4FA 3QIPB 2AJ1A 1NJYA 1QTNB 2EXUA 2G2ZA 4DV6J 1YQHA 1QUPA 3I82A 3T1AA 4DS4A 2CQIA 1HLWA 4KYZA 4FYYB 4CLPA 1TKZB 2AZ3A 4FXVA 4JI3J 2PFFB 2JDJA 5DS7A 3QPIA 4DSEA 2W8LA 2KFNA 1P6TA 3F44A 4KV8B 3CDWA 5KT2A 2CWKA 2ZOFA 2XLIA 4K0KJ 4JB8B 2H5IB 5LJ5Y 1ZYQA 2NYIA 4JI2J 4B02A 5CYJA 2OPSA 1SBRA 2WBMA 1ULRA 1XWLA 3TW0A 3BPDA 5B08A 1FJEB 2JOQA 3E2EA 2HW3A 3A8JA 1FRJA 1WOOA 1Z1ZA 4O3PA 5K14B 5RUBA 1BWVA 4NL5A 2H5EA 2CNKB 1UVMA 1TL7A 5KFGA 4U67Q 2YKAA 1ZTTA 3QJJA 2J7UA 4TXSA 4OX9F 4G3IA 2CVEA 4A48A 2EK1A 4EO8A 2Z2YB 3Q8VA 5HVHA 1F9HA 4R5PB 2PA3A 3CDAA 3OBIA 1SPBP 1N33F 3H2LA 4J9UE 1U8SA 3DLGA 1YJUA 3IA0A 3D2WA 4RBVA 2UXDJ 1XMQJ 2OPPB 1DLOA 2VH7A 4ZN3A 4KE5A 3JSMA 5C42A 3JYTA 4G65A 3MR2A 1P9QC 5I3QA 4HH0A 3UQSA 6FDRA 4LSNA 5DLGA 2EG1A 1UVJA 2HRYA 1ZZFA 1DTTB 4AQYF 6AT1B 3D68A 2FHOB 5HP1B 4F3OA 3HULA 3SQGB 3VR1A 4PRFA 3N4WA 1IBLJ 2HMIB 3DRPB 1CS4A 2V2QA 1LWFB 5F9LA 4DL0C 5CA5A 3TVZA 4X4SA 5T7LA 1Q53A 4M5KA 1VS3A 3WIUA 4FYDA 2ASDA 2ZEJA 4FVMA 2OFHX 4M5NA 1DHMA 1RT2B 3UCGA 2HNYA 4K59A 3R6GB 2W1BA 3BKUA 2ZHOA 2LQ5A 2R7WA 2O01C 2WZ1A 4RUHA 2ZJPQ 1VQSA 4DQRA 4ECTA 4H4KC 1V5IB 4FBTA 3JB9k 4GC7A 2IMWP 4IFYA 3EM1A 2DHSA 4CO5A 4USIA 3RRHA 3MR6A 3JSRA 4ZLJA 1X4DA 3W5YA 4X4RA 4MTPA 5F8IA 2BE9B 3E01A 1NAQA 2QJ3A 1GTEA 3P5TL 4KKOA 4NE9C 4DCOB 2UUAJ 5E7OB 1F1BB 2K3KA 1X5TA 1X9WA 3UDEA 2KVIA 1U49A 3MR5A 3FGVA 2AX0A 2DGTA 3KUEA 5DETA 2Z58B 4RUAA 5L39A 3TI0A 3LA0A 1S0VA 4WE1B 1LV5A 1CQNA 1O51A 2B9EA 2BX6A 1JX4A 3LANA 2Y0BB 3KLVA 3CW2C 3SCLE 4RNMA 2FB0A 3V5RA 1WKLA 3H59A 3TAQA 3EPIA 4RW4A 4I2PB 4X2BA 1SUQB 5AT1B 3W5XA 3CD6S 2V4JB 5HMYA 4QWAA 2JLEA 4FPRA 4Q8EA 5GAGI 1X4GA 2HHUA 2YNFA 2XS2A 1Z2ZA 3O8WA 2OPQA 4ZPBA 4IO9Q 3M6VA 3PW2A 3OL9A 3H90A 2MQLA 1N5QA 3KKFA 1FTRA 1NJXA 4UW2A 2XZDB 1SIZA 2IM1A 2VU5A 1JQGA 3KUHA 4HR2A 1KS2A 4UOGA 4ALZA 2BJ3A 1IBCB 5KG2A 4DR7J 1P1LA 3MFHA 1I94F 4FXWA 4LF1A 2K3IA 2R7QA 5GAEU 2QRRA 1PC5A 3DRYA 3BREA 2M88A 2MSSA 3IR5B 4NA1A 4B3OA 2P2CB 2JX2A 3R97A 3M32B 3R3TA 5EWEA 1CJKB 1RTIA 1UWAA 3HDSA 2FJDB 2ROPA 1HNWF 1DZ5A 3UW1A 4F4XA 5GMDA 2K7KA 3HZEA 1MWZA 2CQPA 3J7ZT 4FKYA 4IG0B 4DPOA 1PAEX 1PG5B 3HSJA 3D6FB 1S72S 4KB7A 1P27B 2ACYA 1J5OA 3BGLA 2DR6A 4ZS6A 3KLIB 1TL4A 2E1AA 3D7SB 4DV2F 1RHQB 4DQQA 4WPAA 2YQ0A 3NLCA 1KVKA 3GILA 4NMXA 5KG6A 4QBUA 3TUZC 3MM9A 2WAQD 1SKSA 1BGXT 2R7RA 4AXIA 3PX0A 4CO4A 1D09B 3MCSA 2WVFA 2A18A 3RBZA 4NEZA 3PW5A 4OJGA 1Q7LB 2N4CA 3VCDA 2YPYA 1HBOA 4QR1A 3G6ES 1HNIA 1PYTA 2LA4A 2F40A 3D28A 5DLFA 1RHKB 5BR8F 4B3RJ 3M8PB 1DJ0A 1HHTP 4QW9A 2HQCA 3C6UA 2VIHA 4WP8A 4NI2B 3G96A 3ZZRA 4OZ1A 4RW7A 2JRSA 3AODA 1W25A 1SQGA 1T8EA 3PCOB 2IDLA 4F4KA 4QOTA 1RT7A 4USUA 2EFVA 5IT0A 1O0PA 2UXBJ 4FN5A 4OI1A 3FBEA 4ZCIA 2HAIA 5HBMA 1TZ0A 2DVIA 2POKA 1RT6A 4ZPVR 2AEMA 1X5PA 1FKAF 2NPFA 3I5BA 2IBOA 3VWSA 1RACB 5CYQA 3M05A 4ICLA 4G6VB 2OSRA 2ZD1B 2F1FA 4WU3A 4UY8T 5GAHU 4OZNA 1K0TA 3MTKA 1S6PA 1R8BA 2RKIB 1LW0A 1HBMA 1M5KC 1IWAA 2CUYA 4R0EA 2QT7A 3Q0AA 4L3KA 2VPWB 1UFKA 4LUBA 3L4BC 2MKCA 5KFVA 3S6EA 3FUYA 4F04B 1R8HA 3P3DA 3RBXA 5KG4A 3F0NA 2X7IA 3ISNC 2FHMA 5L38A 3PTWA 3IO1A 1PBUA 1JB0C 1RI7A 1L3KA 2Q43A 3LP1B 2XO6A 5LJ3Y 5L1JA 2EI5A 1IBKF 2ZH6A 4ZVRB 4L73A 3THTA 3HVTB 3EYZA 4OZ5A 2C3PA 3GV5B 2ZH7A 4HVZA 3ZZZA 5BYRA 2EC0A 2YNGA 4QR2A 5CYMB 1YJTA 2HWIA 3HHLD 5FIIA 2DRDA 1RWWB 3GYGA 2UZAA 2EFGA 2N7YA 2F63A 3X3UA 3P45B 1FA0A 3R5GA 4ID8A 2MHNA 1KKHA 2JEGA 1VK3A 4RWWA 2E5HA 2DNRA 1S1XB 3WBZA 1RBAA 5HO4A 3ZZPA 2GVDA 1VR6A 2L9WA 2HSEB 2N3LA 4K4YA 3H98A 4MAKA 3W61A 5KT3A 3WC0A 2BA9A 2MQMA 2AX1A 2B0GA 3SFUA 3L7UA 2VHGA 5D4LA 1HKAA 1EX8A 1RE1B 4FBUA 1PJ7A 4DS5A 3HM9A 4DR2J 5F8NA 1IKWA 5LSRA 4PXCA 4N77A 3SCJE 1LK5A 3PRVA 2H1YA 5KG5A 5IM0B 4U8YA 1K0VA 1MU2B 1P9YA 5DRKA 3Q24A 4PG6A 2ZM6F 3AFGA 1YITS 3I32A 2W2MP 3GG0A 3L3CA 1XR6A 5IOLA 2QSFA 3JQKA 1HW9A 5BXIA 2RAQA 1M0SA 5C2CA 3J7YU 1LWEA 4MKVA 2DJWA 1A7GE 5J2MB 3V2UC 1IBMF 4HACB 1IR0A 2NXCA 2QA1A 2NUUG 1AFJA 1RU1A 3G8TA 4LFAF 4ZVEA 1XNQJ 3OL8A 2DR8A 3K57A 1RLCL 3VAGA 2BDPA 4WIQA 1S49A 1FRHA 4B08A 4ELTA 1MN7A 4QJVA 3J80Y 2HQIA 3GE9A 3OTDA 2LXUA 1KHVA 2UV8A 3M2RB 1U1QA 4OYMA 3K89A 5LSLA 4ZVFA 1FVQA 2MPUA 3CDUA 2B4OA 4GVLA 3MCOA 2MHEA 3FQLA 1B0TA 2QG9B 5LMNF 2F3JA 1X7VA 2JLGA 2IJRA 3A3NB 3NY0A 1NEEA 3PV8A 3SSQA 2B5JA 2OMLA 5B0FA 2RRBA 3ZTQA 4CDIA 2IM2A 3F41A 3LAKA 1VRUA 1VCTA 2HGLA 1RSCA 1U6BA 3CCES 2H4YB 3JTPA 2RE1A 3EX7B 2XSJA 4KGXB 2E1CA 2FYXA 4TQSA 3DYAA 1N5TA 1HBNA 4Y2CA 2DGVA 4K7QA 3K5LA 5D0HA 3J7A1 3MMAA 4ZJLA 4UOCA 3DOMB 5D6GA 2ZH8A 3HP6A 2PD1A 3PR5B 2DH7A 3MAAA 4N56A 1D9FA 1YJ7A 3EUNA 2B9XA 3CEDA 2QMWA 1NDLA 3OFGA 5B0EA 3L09A 2JNJA 1M1GA 2LCWA 4KHMA 4NLVA 4CZCA 5AE1A 3OL6A 2ILZA 3PVXA 2GAGC 2HBQB 5I42B 3BGFA 4YHHF 2HHSA 3CCMS 5KT6A 3SSRA 3GG1A 4ILMA 3BDEA 2O66A 4EO6A 4M5DA 2I9SA 5A0YA 1XC9A 2CQ2A 3TUJC 4C6AA 1DURA 4OYAA 2GIRA 3T1HJ 2WRMA 2W2PP 2DNYA 3MOZA 2KB2A 2BJ9A 4DL6A 1VQ8S 4I67A 3M7VA 2AIRB 1FHTA 4I1TA 1S57A 3TNVA 1HL6A 1D9DA 1B0PA 3ZNUA 2KH9A 3P8BB 2OPSB 2V0NA 4IKAA 4FVCA 2LU1A 4JI8F 4L75A 1SH0A 3IC1A 2R4FA 2MLXA 7AT1B 3QGPA 4ZOSA 2AMCB 3GZ7A 3M9MB 1NK5A 2KI2A 1FDDA 4NASA 4UZBA 3THPA 1TL7B 2UUBJ 2F8HA 3MEKA 2HHHJ 1Q79A 3H5SA 3HVAA 4FXDA 4NRTA 5AXNA 3TQ1A 1TVRA 3FKBA 3Q8YA 4DV4J 4EBCA 1NRKA 3OR2B 3BBBA 1S0OA 3UD3P 3EZOA 2C2KB 1T9VA 4TU9A 3DLGB 4U6PA 4DLEA 1LNQA 1DLOB 1GH8A 5AJ3J 2IHR1 3JSMB 5C42B 3JYTB 2KT2A 3R7BB 4LFCJ 3NMAA 2LEPA 1RYSA 1XNRJ 5EWGA 4LSNB 4PEOA 3R5DA 1VJWA 3MR7A 1N0VC 3OHBA 2BACA 5DZ7A 2BVZA 3PACA 1P1TA 3I4HX 4TVAB 3ILIA 4NLGA 1GX5A 3TYTA 1X5OA 2YWFA 5A8WA 1IN0A 2HVEA 2HURA 2QTWA 2W9BA 4RU2A 3CJ4A 4MJKA 1CS4B 1M90T 1LW2A 1RJJA 4X4TA 4OL8A 1CPZA 4FF2A 4RUCA 1X31C 2QLWA 3QIDA 5T7LB 3BN4A 4YB7A 1FKPA 1CVJA 3KYLA 5KAKA 1UKUA 3IS9A 1N88A 4QYZJ 4JBCA 2HNYB 1TUWA 5F8MA 3PO5A 4O3SA 4X4VA 5BYQA 2PI5A 1URNA 4DV6F 2OPRA 3PKMA 4LRAA 3CCQS 4USHA 4IFYB 2VL1A 2CAJA 2HHPA 1FD8A 2KZMA 2CPIA 3JQMA 3WC2A 1TTHB 4JI3F 4Y2AA 2VG5A 2CQBA 3FSYA 2J5AA 3R1LA 4C8ZA 3E01B 4KKOB 5CZXA 1UZDA 2VBZA 3JSYA 1DTQA 5J1EA 2E5IA 5F8HA 5L1KA 4ED4A 2W25A 4ZDNA 4WXOA 5IT9U 4K0KF 2P5VA 2D3ZA 4V19X 2D69A 4LVNP 4JP8A 1AT1B 1CJUA 2WB4A 1UEKA 4JI2F 4NOHA 4ZPWR 5CD4A 1KC8T 1C0UA 1HQEA 4X4OA 5KG0A 1YRTA 3GIRA 3AH6A 1J27A 4TU8A 3T5JA 3HSZA 1ELOA 2HFVA 3ENWA 4V1Ak 5E5NA 4PPDA 4ES2A 3MEDA 1NHUA 2VODA 3W62A 5KOWA 4ZPCA 1V3ZA 5DZ6A 4LFBJ 4RW4B 4OI4A 1EJ7L 4B3MJ 5M2UA 2QLXA 1WSVA 3M6UA 2AT1B 4O0NA 1UVKA 1BC6A 1VIXA 2WVCA 4ANEA 4NLUA 3L7PA 2HGMA 2LU2A 4IOAQ 4PQUA 3IP0A 2YNFB 1C0TB 3FBFA 3AD8C 3V4IA 1A9NB 2LQJA 4KGMA 1W26A 2GV1A 2UXDF 4ZP8A 5KFCA 1XMQF 5IFMA 1NJIT 4TY9A 3B4DA 1Y5NB 3DLEA 2FJEB 2FHJD 4CO2A 2FLPA 3C14A 2QEXS 5LL6d 6FD1A 1ROFA 4O3OA 2XY6A 1NLKL 2XB2D 3RJMB 2HWHA 2LDYA 5C2GA 4R8UA 5IV3A 2ZOGA 5G4DA 2XHCA 2OD6A 3DGPA 2OAUA 4DCPB 1TMJA 2NR0A 4DX6A 3PRDA 2BKPA 5KFFA 5D77A 3LP2A 4F2SA 3H2UB 4OLPA 4HHHA 4B3OB 1RWNB 2CJQA 2YKPA 1IBLF 2PN6A 3KTQA 3K5NA 3V6JA 4KGZB 4ZVSB 2DNLA 1RTIB 2MB0B 3BZQA 1T03A 4RNOA 1S99A 2G2YA 1U47A 3HF5A 5E3QA 3EGVA 2HGNA 4LF4J 2R8JA 2J7WA 3H42A 3SSSA 2ZJQQ 4U96A 3I56S 4ZLLA 2Z57B 2BJDA 2AKWB 2RHQB 4ENOA 1MROA 3FZ2A 1J5OB 1F0XA 1KTVA 3M9NB 4TQRA 2ZBCA 1KQKA 3EVMA 1FXDA 1QE1B 2CIMA 1WC3A 1U8WA 1IXKA 3KOAA 3SZ2A 2DGWA 3I0SB 4CLSA 2KKHA 4M5GA 3NKYA 1W2BR 3MM9B 4C3LA 2UVRA 3LPYA 1G3OA 2UUAF 3TX8A 1U7LA 1JJCB 4B9TA 4Q0BA 4ECWA 3VZIA 5T41A 2NZCA 3HHNB 1HBOB 3RBEA 4LQ3A 3TZXA 3NGSA 4K4WA 2CPEA 2CWXA 3WHIA 3KHHA 1S9GA 2RDJA 1WI6A 8AT1B 3C6UB 3GFYA 2XMTA 3DRSA 3H5XA 3A3PB 2ZC3A 1AXQA 1CC8A 1NBEB 1RTZA 2C2MB 1S7IA 2RF2A 1U2RA 2DITA 4RW7B 3MMCA 4M5JA 1KVJA 1KHWA 4Y2MA 4LMZA 4OHXA 5HI7A 1I5OB 1RAGB 1RT7B 3WQPA 4ZMMA 4DUZJ 3UN2A 2UVWA 5ETQA 4NLOA 3PYEA 3SCKE 2KT5A 5HBMB 2YNIA 5C24A 1QSLA 1BQXA 1RT6B 3DLLQ 4ED3A 3K8WA 3VVUA 3T3FA 3LO3A 4DR5J 2QYCA 3OSPA 3NS5A 4M63A 1H2UX 3V6KA 2PE8A 4EZ6A 3QLHA 1ZM4A 5CYQB 3QSYB 1B7FA 1AZSA 3R5AA 2C2ZB 2BQRA 3UI3A 3BQ1A 4ICLB 3KDOA 1DY3A 1IKYA 2GX8A 5IXUA 5B0GA 4K8RA 1UL3A 1S6PB 2QLBB 1LW0B 1HBMB 3NBPA 3BS9A 2N4DA 1NCLA 3HLUA 3NGKA 1N52B 3D0IE 1U45A 4M95A 5DGAA 4ZLPA 2B4PA 4YEAA 3DLKA 2XMMA 4YR0A 1JMTA 3SXLA 2JH3A 2OKQA 2HYIB 1YVFA 2DBBA 4NLYA 3SV3A 3D3CJ 1W2IA 2V2ZA 1LWXA 4JI6J 3MPWA 4ECRA 1CC7A 2XY5A 3IWNC 3C3LA 2V8GA 5E3PA 3UFCX 5JVGQ 3R7NB 4PAAA 1WF1A 5HMWA 1AUSL 4NLPA 1TV6A 3JAMU 5J1PA 1R8AA 2Y1JA 1B99A 2BM0A 4P6QA 1U1OA 1HPZA 2WVEA 4BC7A 5K8NA 2WVDA 2HQ3A 1FKOA 2YNGB 4ZITA 2ADCA 2QC3A 2V4RA 3BYPA 4OZLA 1N5SA 3HJVA 4MK9A 1RT5A 4A46A 1FRIA 1AB8A 1QVFR 4IUFA 1TKZA 2B6AB 3UO0A 4WXWA 5GAEI 4LR9A 1ZA1B 5ETPA 1MMDA 4ZCKA 2GVDB 3FEZA 3R5JB 1JNRB 1H6KX 3UCZP 2BABA 2MZSA 1JNZB 2GZOA 2HLTA 3GSDA 4ID5A 4F25A 3KK3A 1M5OC 1G2EA 4HEA9 3LALA 2UXBF 1IKWB 5K14A 2MQNA 3MEGA 1HQUA 5DG9A 1YLXA 2AZ1A 5J2PB 3G8SA 2YTCA 3EGZA 1L3VA 1N48A 2FHKA 2UVVA 4O3NA 3OJSA 2M70A 2CG8A 4PCQA 4XK8C 2GJIA 1XR7A 2EFPA 4PZVA 1R31A 2HK3A 4R5PA 4J9SA 3G71S 3QGHA 2LXIA 1IM4A 3HKWA 3DHXA 1XBWA 4AUKA 1RU2A 1UP1A 4ERDA 2G13A 4KY3A 2AYEA 5KT7A 2OPPA 4ZCLA 3TVKA 1SJFA 2CNNB 1N8RT 2HIYA 2E1PA 4I64A 4ETZA 4LBPA 3VGTA 2XTJP 1G1XA 3NGUA 2MQOA 3TA1A 2NLWA 2YX1A 3G2XA 1IKXA 1KBRA 4UF4A 4ZIVA 1VBYA 1D1UA 1MWQA 3NNHA 1X9SA 1RHJB 3P4UB 1WHWA 4JI0J 1HR0J 1DQ8A 2YKOA 3GFHA 1VMBA 4ECVA 4Q2MA 3EXYA 3QQCD 2YQ1A 1CJTA 1RWKB 3OTBA 4FPIA 3FZBA 1FVSA 3US5A 3NOCA 3WX4A 4J37A 4NZ7A 1SL0A 4LREA 3PIPQ 2AYGA 2ZC4A 4QYZK 2J6UA 3LTOA 1Q8BA 2BOPA 5KFIA 3OD2A 1VYAA 2B5JB 2NPIA 1LKZA 2C2DA 4L6V3 4XDCA 3CB4A 4ILLA 1S79A 2KRRA 1RAEB 2EG2A 2GGPA 5KT5A 1YDLA 4J9PA 2B43A 2XSJB 4KIAA 3KHLA 1SJ4P 4N47A 2VG7A 4FYWB 1HBNB 3T5LA 2Q6CA 2X1GA 2DPJA 5GAHI 1VQPS 3CJ8A 1F2GA 2HHTA 3MMAB 2DR7A 4ZHRA 4NLWA 3RAXA 2HEKA 3GR0A 3MAAB 1GQEA 2EC2A 3O2IA 3HZGA 2Z8QA 2EWHA 1RTJB 3P96A 3PY8A 2ZJRQ 4ECUA 2B56A 3CWJA 2DR9A 4DR2F 1TAQA 2ZH9A 4Z2XA 1FE0A 2AEFA 2BKNA 5KTQA 1N32J 2HVHA 3U27A 3QZ7A 4MKYA 3B54A 5K20B 5DDQC 2FVQA 3E51A 5E3CA 4M5DB 3BPSP 4QPTA 2RQ4A 2ZBRA 4MKBA 5A0YB 3G8QA 4AL6A 3LPEA 4R0JA 2MDAA 2AJ2A 2XBPA 1YTYA 1T9YA 3A8IA 4IG3A 2W9CB 1LEOA 1R7IA 3BSOA 2CKWA 4MH8A 3KG0A 3M2UB 5G0RA 3SI8A 3FEYB 4V19J 4DUYF 3VHQA 4PXEA 2CG4A 4ETXA 4DQIA 1OO0B 4B9LA 2X51A 3FC9A 3K5OA 3NGDA 4ES1A 2PMHA 1WEXA 4XDDA 4JYAJ 1XNQF 3SBMA 2VICA 2V8PA 1S1WA 1FEHA 4K4XA 1TVRB 3PO4A 4FNIA 4C8YA 2AU0A 3IAS9 5L9NA 4GKKJ 1XERA 2XMWA 2ADBA 1FF2A 2IM3A 1F9FA 4C4WA 5EN1A 3WX8A 1XIQA 3VAIA 2NREA 4IG0A 2E5GA 4YS2A 1VI7A 3A1YG 4F0KA 3KHRA 4HT5A 1XN9A 1AA1B 1IBKJ 1AROP 5FLXU 5A8WB 1TU0B 3CCJS 2DNZA 3J7YI 4DQPA 2C22A 2V69A 2W9BB 3EDRB 2DGOA 1KRPA 3K17A 5ETNA 1VK8A 1LW2B 2DNMA 3NRBA 4NLRA 3OT9A 2GS8A 3KG1A 1VQOS 1FKPB 3U1NA 4GO7X 2PEBA 1PIEA 4X4UA 4WK1A 1DQ9A 4F3MA 3M30A 3IS9B 3J80U 1CEZA 2L08A 4TYAA 4MYUA 3M8PA 3QNWB 4LR7A 4PYAA 2P8IA 4P7TA 2OPRB 1NDCA 4P75A 3BSCA 4HHUA 4TN2A 3QGGA 3QMQA 3H0PA 4DLGA 3BKFA 3D6HB 3C15B 1S9FA 1R0AA 1HIYA 2B7BB 2AW0A 2E7VA 2D1CA 4JI1J 2DHAA 3T1HF 2I5JA 5KFQA 3UVJA 4K5SA 1DTQB 5J1EB 1WC5A 3I9V9 3M4XA 3I5CA 4P2MA 4GMKA 2V6AA 1FRMA 1CJUB 5DQGA 4GVBA 2HVZA 4DSKA 4IO1A 3QO9A 3DDIA 1C0UB 9RUBA 4CTAA 1HQEB 4NRUA 2SXLA 4EUVA 3QATA 3MFIA 1IR2A 3QWPA 2VBXA 2UUBF 2X1FA 3EVWA 1FWLA 2J0QD 2RNEA 5LOQA 4Z7YA 3MEDB 2VZ9A 2FLNA 2PC6A 2ZD1A 2HHHF 4P2FA 2I8EA 5L8RC 1NSKL 5B0CA 2NXUA 2F4VJ 3OPKA 5EX3A 4KT0C 1KQFB 4DV4F 2AGOA 4PQUB 3LWLA 3V4IB 1X4HA 4KJIA 1UVLA 1XMBA 4Q45A 3OFFA 5AJ3F 2DRBA 3DLEB 2F65A 1PO6A 2JFDA 4YDXA 1S48A 3C14B 1S0MA 3NCQA 4LFCF 3ZTPA 2UVUA 1XNRF 3VAFA 1ZOTA 2KZZA 2QA2A 4R8UB 3AY0A 3LP1A 2XS7A 3DGPB 1X0PA 2AQ4A 4DCJB 3TZZA 3TQEA 1T3OA 1HI0P 1SH2A 4C0HA 4DV1F 3BBCA 5KFOA 3RBDA 1BHNA 3NCPA 3FBBA 4M5LA 2LLZA 2FIUA 3H25A 2RD5C 1UA1A 1Y3JA 3NAHA 4OJHA 4WU2A 2GNKA 1ZTWA 5GMKa 4PG5A 3N6MA 3I5AA 3KXDA 1T3NA 4IYQA 1GTHA 3CO0P 4X4NA 5HMXA 5HATA 2OO4A 5A76A 1WOPA 3AQOA 1MROB 5C25A 4DX8H 3BM7A 1H2VZ 4RU9A 4NZ0A 1N5YA 4ITSA 4PPZA 4QW8A 4DEZA 4E2FB 1EKSA 5KFSA 5FJ4A 1U0SA 4QZVB 4YUDA 5D4PA 4A8KA 1YRXA 1FX2A 3OTOJ 2FJAB 2DGXA 3CC7S 2N82B 4C9DA 3TUPA 3ZZOA 3KMSA 4QIEA 3W60A 4U9RA 4DR4J 4ED8A 4PABA 3HHDA 3W2WA 1YJWS 2R8KA 1UZHA 2HWTA 4GC6A 2BQUA 2JLFA 1QSSA 3HCXA 1XR5A 2DH9A 4L76A 2MY7A 4ZVOB 3DRSB 1H3DA 2BE7D 1YJ9S 2ZZMA 4WFNQ 3QRPA 1C1BA 2GVZB 2RF2B 1LQ9A 2B9YA 3MMCB 1TELA 1HHSA 1VOMA 4LFBF 3SCIE 2UV8G 4B3MF 2R8GA 4RJVA 4ZIWA 4WF9Q 2BKOA 3W8GA 1Y11A 2EBGA 1GXTA 4A8MP 4HACA 4A47A 2A3JA 4HI2A 4ZP9A 5C24B 2P9EA 1YBTA 3ZFVA 4DF8A 4CH1A 1NH8A 1A6LA 3OLAA 3HO1A 1NUEA 2ZWPA 4QIVA 4NLSA 1KTQA 3PJXA 2AF6A 2RRNA 3QLHB 4UQTA 2IVFB 4IOCQ 3KDNA 1AZSB 4OI2A 2VB6A 4OZJA 3MEEA 5JVHQ 1IKYB 2IRYA 1GMVA 1U1PA 5HROA 1U0HA 2VFVA 3C16A 3VAJA 3NBPB 4WKYA 2MJUA 3FMWA 3MCMA 1FRKA 2XG8A 4OX8A 1H72C 5KOXA 3EMTA 2C2NA 4I6YA 1JKHA 3IBFB 5KFKA 1H74A 4CLTA 4DU7A 4O0IA 5H9EJ 2ASJA 1WC0A 1ZPWX 3K8VA 4B9SA 3D9BA 4LF4F 2DNPA 1Q86T 3CCWA 4HT7A 1WTFA 3B4MA 4A8QA 4IFVA 3DMJB 2RS8A 2IJNA 4WP3A 2CQ1A 1N6QA 2DXFA 4RO0A 1QM9A 4KO0B 1QSYA 3S1TA 4J7CA 4DR3J 4RUBA 1SVDA 3HMJG 1TV6B 1JXLA 3ENAA 2W8KA 2XYHB 1HPZB 3CCLS 3T5KA 1FKOB 2P6TA 5F0UA 3JXOA 4ELUA 2D3O1 2CPYA 1NK6A 2IFXA 4EZ9A 1KSPA 1HMVB 2D9OA 2XMKA 3TJ9A 1B0VA 1KONA 5I42A 1RT5B 4CQ1A 2DISA 4EMDA 2I2YA 2YKMA 3TZWA 2KFZA 4U8VA 3ZNJ1 3GJTB 3PW0A 3CJ2A 4OJ1A 2O3DA 2P9CA 3BQ0A 1X0FA 1KLMA 4TU7A 1WHXA 1OJ4A 2OFGX 4LQ9A 3TA0A 3C8YA 2DEJA 4Y3CA 4OZ3A 4C8LA 5FD1A 4CH7A 2K7JA 2CDRB 4ID5B 2W9AA 3KK3B 5KFXA 2IVMA 4N7TA 4DUZF 2N7CA 2CRLA 3LUYA 3AJDA 5LMUJ 4DWIA 3MEGB 2C3OA 1HQUB 1UW9A 5D3GA 4AFFA 2XS5A 2ZZTA 1B3TA 4K4VA 2DNOA 2DB1A 1SJRA 4O3QA 3IXQA 1FESA 3H20A 2CJKA 2R8HA 4DR5F 5BYSA 1VISA 5A2QY 3IN5A 3OR2A 3BBFA 2W7AA 1P8GA 2OEJA 2HRUA 5IWAF 2RIJA 1FO1A 1TMMA 1BMQB 1QVGR 1U1KA 2BANB 5J2NA 4PXDA 3CMES 3CD5A 1RABB 3CIZA 4WFXA 2HNDA 1PCAA 3CULA 2DKOB 2Z2ZA 4PXBA 3FK4A 2DH8A 1PSDA 1RA7A 1OY6A 2V34A 3MPDA 4P10A 1WDTA 2FVRA 4DPWA 2WTFA 4NXMJ 2J9DA 1B4SA 1IKXB 1WI8A 3Q22A 2P6SA 1VQ7S 2B3TB 3K7RA 3ZZUA 5HN0A 4JI6F 2FGOA 1HNXJ 1Q78A 3BF4A 4CRJA 3JQJA 1CJTB 2MZQA 1OMSA 4ZCMA 3U02A 1ZAXA 2VC0A 1NM2A 3HHLB 1NK4A 2MJNA 4XIUA 4YB6A 2W24A 3CTRA 1RWMB 2RRAA 1VQLS 4DX7A 1EIYB 1X4BA 3Q8RB 1TKDA 3W9HA 4PG7A 4DZDA 2BW7A 1GMWA 4I69A 3D1HA 1OYDA 2VA2A 4UOHA 2MZTA 3NG8A 4RBTA 2GGPB 4OYZA 3QRRA 3N5BA 4H4OA 1RWPB 2IPOB 2YY3A 2VG7B 2YQ3A 4P7VA 2JHEA 4Y0FA 4ZHRB 5DM7Q 2RUSA 2ZOMA 4OMFG 4P52A 3HVRA 5M2RA 2CFXA 3D3BJ 1L3TA 3HK2A 1T11A 2FGCA 5KFWA 2C1EB 3BGUA 4O3RA 2APOA 1APSA 3PG9A 2QX0A 4MMOA 1N54B 3JSBA 3QJLA 3V6DA 4CLFA 1ZM9A 1T9WA 3KJFB 3CC4S 1FWPA 3DXSX 1FK9B 2KYXA 4AD6A 3GR1A 2GMJA 3W7BA 3Q83A 3ENQA 4PWDA 2V2VA 1KEKA 4IG3B 1UEVA 3V4MA 3VF0B 4I56A 1C0TA 1YI2S 4MFBB 1NH7A 5HK4A 2MZJA 5G0RB 2GMLA 3AXMA 2G0JA 3KUGA 3AB2B 4NCAA 5L1LA 2UU9J 2V67A 2H4WB 3JAMY 2MKIA 4ECZA 1GEHA 2AWZA 2HQDA 4C3MA 5B7WA 1YIJS 2LVWA 4QIWD 2DRAA 5DQHA 2BE2A 2AJ0A 4QWDA 3N6NA 4WWSA 1CBKA 4I2QB 4DR6J 1N34J 2D3OR 1H7WA 2QV6A 1FT8A 1S1WB 2J0WA 4JI0F 1RT1A 4CLLA 4NWBA 1HR0F 3PYGA 1HW8A 1RT3A 4X66J 2XYGB 3MM8A 2CQ3A 1NO8A 1PILA 4OHYA 2CQDA 3OXFA 2DHXA 1WELA 3K0JA 5H1SV 7FDRA 1BWEA 3ZTOA 5IV4A 1S6UA 3M8YA 1W7WA 1WC6A 1K9MT 2H65B 3VZHA 1TUVA 1EP4B 2J0SD 4OX6A 4CI0B 1M1HA 4OI6A 1SI9A 2FC9A 3MMJA 3CJ5A 1PGZA 2FLLA 3FFIA 2A2CA 1RKJA 1XQIA 1QE1A 2RH3A 4CO1A 2HLUA 2DHGA 2ZNZA 3PM9A 3THVA 3I0SA 3HKZD 2WOMA 1K73T 2IIHA 3I96A 3FRYA 3HSDA 3G82A 2KG1A 2H5JB 1UFWA 5I3UA 3QBCA 4DJBA 3W3SA 2E5JA 2WW8A 3TARA 2XWXA 1E6VA 3BYRA 3M30B 4RPFA 4ECYA 4PR6A 3AOAA 2YBVA 4QIGA 1XTZA 5ETLA 2LQ8A 4WIIA 1N32F 3PEJA 4OYIA 2DCLA 3EZ5A 4ED7A 5CCLA 2VQEJ 2XNRA 2MKJA 4DXLA 1OQ3A 2ROGA 1NU4A 2J6TA 3MMBA 3ZTSA 2R7TA 1R0AB 4LF6J 4FDFA 1VQ9S 2XULA 3NS7B 2I5JB 2J76E 3GQCA 3UVJB 4KPCA 2KFYA 4P73A 2RQKA 3DRRA 2JFKA 3TR5A 3RTVA 4C8MA 1KFSA 4FF1A 4GVBB 1UA0A 3QO9B 2YNHA 3EVOA 4I7FA 4CTAB 3TEHB 2ZKUA 4X65J 5KFLA 2QL5B 1WOSA 4XPEA 1C4AA 5D15A 2G9OA 2F8MA 4JYAF 4DF4A 1MMNA 4B17A 3CMAS 2E44A 1RTDA 4DL3A 2ROEA 2R7OA 4KPYA 3DHWC 4LVOP 3R1HA 4CLZA 1XEZA 4C2MA 1HNZJ 5F0WA 3Q86A 4GKKF 1UJ4A 2IY5B 5H9EK 4GKJJ 4TY8B 2ZH5A 5DDPC 2LQ9A 2IVYA 1B64A 3TAMA 3AQPA 1REGX 3N0VA 2VASA 3MDFA 4N41A 4LBIA 3MTJA 1HNVB 3NMRA 3LW5C 4ED5A 3IBCB 2DO0A 1JLCA 1S9EA 4QPXA 3EGNA 1TKTB 1Q8IA 1PC4A 4OHZA 4TLRA 1TK5A 4XTTA 1N36J 2DIVA 1R6YA 4J91A 3VAKA 1UFLA 1FNXH 5AE3A 1X4AA 2VPZB 5HVGA 1Q0NA 3BSAA 2HBYB 1VLYA 4RNNA 3QRQA 3QT6A 3MHYA 4OV6A 3FEXB 3QZ8A 2B6AA 3D1QA 2BBEA 1Q82T 3UDCA 3PHEA 1K1SA 3CXCR 2CXEA 2V94A 4P72A 3R9LA 2HFNA 2B7CB 3M6WA 2W2OP 3U1MA 2PDAA 5C25B 2PSZA 1Q7YT 1YG0A 4FZVA 2BV3A 3SDEA 3ET6A 2BZ2A 4KR0B 1N5YB 2DR5A 2R7SA 1TQLA 4YB5A 3DKDA 4USMA 1C1CA 2B4VA 4JV1A 1ICEB 3K58A 5H9FJ 2PA8D 4WBFA 4JI1F 3LWMA 4B9NA 3WZ0A 1WWHA 3P5BP 2XCPA 5J2QA 1TFWA 2DYAA 2DHHA 1F3VA 2DT9A 1FEEA 2DCUB 4ECSA 5J2PA 3N79A 2BOAA 2GQ2A 1AW0A 1TP7A 3W2WB 3RB6A 5CXTA 2XMUA 2R7VA 1RDRA 1T05A 2XZWA 4KGKA 5HJXA 4U7UK 3AOCA 3GJQB 4IH5A 1EETA 1S4EA 1NK7A 1V3RA 4C0OC 1C1BB 5EUHA 3O5TB 4OI0A 1V5VA 1FNOA 4F4YA 1HFEL 1ZM3A 3A4TA 1PJ5A 4DUYJ 4HH1A 2F4VF 5FLXY 2Y0SD 1BE4A 4QQBA 1OPIA 2MYFA 1NZ8A 2PMZD 5D4OA 3ZZTA 2AD9A 3CSKA 3CUNA 2CQ4A 2V68A 1IKVA 2XWYA 1HARA 4A8OA 1VHFA 3GIJA 3R2DJ 1TL5A 2KDOA 3VTIA 2CNOB 4G1PA 5I4MA 5LSOA 1UTAA 2UUTA 1YZ7A 1WF0A 3MWBA 3IBWA 3LP0A 1HI8A 1IVZA 4EFAC 8ATCB 5F41A 4LIRA 4JV0A 4HI1A 1NK0A 3TOQA 2YH0A 3UDLA 2MZRA 4I0WA 2HKEA 3A8EA 3MEEB 1MNEA 1BQNB 3DU5A 4W4MA 1VRQC 1Y9OA 4J9KA 1HYSA 5HROB 3R5BA 4QCLA 1X8DA 4CLUA 2QFJA 5JUMA 3J81j 1U0HB 1T0TV 2H54B 2YKNA 3C16B 2KXNB 3OLBA 4RKUC 2ZHBA 4Q5VA 5ETVA 1SQFA 1JKHB 2JVRA 2LEBA 4QWCA 3GU0A 1TR0A 2NYHA 2MKSA 4UQGA 2OSQA 4F0HA 2RS2A 1S6QA 3IG1A 1RHUB 3QAUA 1S4FA 3SQOP 3MGJA 3SEOA 4LBHA 4ED1A 1VC0A 4IFVB 4WZQA 4NX9A 1N6QB 1Y0HA 2RSQA 2W4CA 4P9SA 4ELVA 2C2EA 1R27B 4DN9A 1VBZA 4A8YA 1XMOJ 2KXHA 1FTCA 3CIMA 2HQFA 1U24A 3T9ZA 4K50A 1J2VA 3W64A 2FVPA 4DZ6A 1RTJA 3OTOF 1SKRA 3W8PA 2ACMA 3I0RA 1M5VC 2M9KA 4RW9A 1CULA 1V9OA 1NHKL 1U6FA 1ZAVA 1HWUA 3EZUA 4S0MA 4DR4F 2E7XA 2YKMB 1N0UA 3LGMA 1KR4A 2XC9A 2J0XA 3CJRA 1WNEA 4X4PA 4DX5A 2Y1RI 4J9VA 5ETSA 2KJWA 3IMQJ 3IM8A 3PDNA 2OP5A 2W9CA 4P74A 1U1LA 1KLMB 5CZVA 2BYCA 3M2UA 4ED0A 4EWTA 5U47A 4DL2A 3AT1B 3MM5A 4NA3A 3NWRA 2W01A 3TEGA 5KFJA 4KBIA 5HAOA 4CT9A 2KM8B 5DG8A 4ZKAA 3J7AN 3M8RA 4OZ0A 1JJ2R 1NPPA 2ZHAA 5HQ8A 1JLQA 1S1UB 4EBEA 4LF2A 1VDHA 1Y5IB 5D3GB 1HI1A 5B09A 2WSCC 1S5ZA 3DU6A 2RT3A 2C3MA 4HTIA 2JSXA 1SL1A 1DQAA 4IQXA 1H2TZ 2F5GA 1DBDA 4X84A 2HFSA 2BJ7A 4I6WA 4BCAA 4MIAA 2MZ1A 4XPCA 4H4MA 4YN3B 5J2NB 5DM6Q 2VG6B 2HNDB 1GNKA 1UVIA 4DV7J 3AB4B 3RU0A 3CCTA 3TZYA 4ZA1A 3KFWX 1V6HA 2COLA 3I87A 1MN9A 1KLNA 3NNCA 3GLJA 5DG7A 2NS1B 3DDNA 5F3TA 3G86A 2ZH2A 1LFWA 4URSA 4GO5X 4CP5A 3IFEA 4DV1J 1SKUB 2GHVC 3GIMA 1WEYA 3PJ9A 2MMYA 3ILOA 4OHWA 5F9NA 3UD4P 2FDNA 1FFWB 4DR3F 2ATCB 2JL9A 1U26A 7FD1A 1ZAWA 4WK3A 1NJWA 1OPZA 4F7VA 1NB2A 1JLAA 3AJ2A 4ZJQA 4RW8A 5KFAA 3OUYA 4K2JA 2LFVA 1GXLA 4ZJOA 2HVDA 1MWYA 3IM9A 5KFPA 3ENVA 4Q8FA 3UCUP 2WBRA 4H4OB 2HVIA 3IWXA 3SIPB 4XO0A 3C15A 1VBKA 1KNZA 1NK9A 2CQCA 3TRGA 4DFKA 1GFWB 1WTBA 2LP4A 1K44A 4KGVB 2IA6A 1H38A 5KFNA 4RWXA 3GSIA 2QN6B 2FQQB 5EX0A 1WKKA 3DLJA 3C2PA 3N6LA 1WJ9A 1JLBA 2YVSA 2IMOA 2YXLA 1NPKA 2CZVC 5K8OA 4J9QA 4C98A 5LMUF 1SJ1A 3BH7B 1VQMS 1KOHA 5THWA 5I3PA 3V6DB 4DR1J 1VQ6S 3U7JA 2K1RA 4BWMA 2EVZA 2DK2A 4F4AA 2MLYA 1FJGJ 1EQ0A 2G2OA 4JI7J 3KLHA 4PWDB 2JEIA 2NSBA 1I1GA 2RU9A 4NCBA 3JTOA 3VQSA 2AYBA 1NKEA 4F02A 4F0MA 1R89A 5EDWA 2QZ8A 5E2QA 4OYPA 2IJFA 2RQMA 1BY9A 2U1AA 3EJMA 3DFEA 2HG4A 1D0EA 3LAMA 4UZCA 1VLOA 2EW9A 5KFMA 2NXNA 2VKZG 1YBAA 4JI4J 1IQTA 1U25A 2ASYA 3MUTP 4PYDA 4PG4A 5EWFA 1RHRB 2BE2B 4BBYA 4NXMF 2XQCA 3D0HE 2E7WA 1DAXA 2FY8A 4Q44A 4A8WA 3V81A 2VKRA 2M8DB 1RWOB 2BQ3A 2MKYA 3TWZA 4EI2A 4JV2A 2OHDA 1T95A 1RT1B 1HNXF 1X5SA 1RCXB 2R2UA 1RT3B 1WACA 2Q6BA 3MM8B 3F73A 5IT4A 5KG7A 1ITPA 4E98A 4G1QA 4ANCA 2E29A 2A6OA 2CADA 1OQ6A 2HNZA 2XO7A 4NEYA 3NNAA 3NL0A 5A2QU 3GB0A 2XMJA 1TK8A 3PKYA 4TLQA 4W90B 1Q95G 1JXVA 1T94A 3MECB 2CPZA 3R2CJ 2CJBA 2E9ZA 1DFDA 4CT8A 1U48A 2AYMA 2M4MA 4CO0A 1ZPVA 3FFIB 3OFEA 4WTOB 3Q8SB 2W2NP 1OSCA 1X4EA 2BXJA 3EDQB 3K59A 1RBLA 3V6HA 3BO4A 2LQBA 1NHVA 2WOMB 5H9FK 2M2BA 1QTMA 3R5CA 5KFDA 5LM7E 4WYWA 1B70B 3NS6A 2BW2A 3OQ2A 2MGZA 1BQMA 4F26A 3G82B 2B8PA 2HHQA 3M8WA 3CCUS 2F9JA 3Q8QB 3QFHA 3DOKA 1PBAA 2YWKA 5I3UB 2V9WA 2OD4A 2DNHA 4EBDA 2ZUGA 2CQHA 1RAOA 3MM6B 1MMLA 1E6VB 1S1VA 2A2DA 3T6BA 3TA2A 4DOZA 1QAIA 3PHTA 3K5MA 3VGVA 3CD7A 1KN6A 2XZTB 1SC1B 1KD1T 3VAHA 3UR3C 1S0NA 1RBOB 1R6VA 1ZZNA 2GVZA 3OFHA 1NDKA 4OX7A 4DG1A 1YX2A 2CVIA 2DNGA 3MMBB 4LRFA 1L3UA 4PWWA 1UJ5A 3TJAA 4BS2A 3OW2R 2FUG9 2PMWA 2PIIA 3H5YA 4LSLB 2J9CA 1H7XA 1TL1B 2HFUA 1NSPA 3DRRB 1VC5A 4UOFA 2UU9F 3UWTA 2ZE2A 4L3NA 3WDOA 3ETOA 3BQ2A 2YNHB 3DXBA 5L1IA 4I7FB 4MK7A 1F9EB 3RR8A 2E9TA 1UAWA 3BO2A 3C6TA 3M8SA 1RAJA 3GJSB 4BLGA 1FERA 2KHCA 5IWAJ 4TKTA 4DR6F 1N34F 4WZMA 3QT7A 1UEUA 1RTDB 4NLXA 3J81Y 4IH7A 4ED2A 4LF9F 3I55S 2Z0GA 4X66F 1TKXA 4DL7A 1JWWA 1IR1A 2HZAA 2K06A 2CZ9A 3NOGA 5KFYA 2PEHA 3TAPA 1R3NA 3IR7B 3MZIA 4Q7AA 3BR9A 3DLHA 4Q2LA 2EFNA 1RWVB 2UP1A 1S1TB 4N8OA 2W2QP 2VPXB 4OV1A 3TAMB 2J9EA 3NCRA 3AD7C 4WCEQ 1S10A 5KT4A 3BO3A 3DMJA 4HYKA 4RX6A 4IOBA 1CG2A 1LXJA 3FNNA 1GX6A 5GMEA 1JLCB 1S9EB 4DSFA 4KO0A 3W1YC 4LRCA 2PT0A 2QYGA 1UPMB 1S59A 1J5EJ 2X1BA 2F7VA 2FZGB 4IQMA 1NNDA 1YJRA 3QGIA 2VPYB 2XGPA 2KM8C 3T1YJ 4RNHA 1Q5VA 2I38A 4BDPA 2LYVA 4FF4A 4CNZA 2GJ2A 1HMVA 2IA0A 2QO3A 1DRZA 2BJ8A 2O1PA 1FDNA 4A8FA 3H8YA 4CLKA 4U7UD 3RZAA 4LF7J 4ZK7M 2ZFHA 3HD1A 3T41A 4DPYA 3MR3A 2ZNYA 4M1KA 1MSWD 1VQ5S 2LXFA 2EBEA 1JLGA 5L9XA 2VQEF 3SDEB 4KH0B 3ET6B 3MOJB 4KHPJ 3OL7A 2CYYA 3CMQA 1RA6A 3T6JA 1NZAA 2DD8S 1VQNS 1C1CB 4LF6F 2MQ8A 2KXFA 4F4WA 1FRXA 1EHWA 3MM7A 3HFKA 5D78A 5J2QB 1TAUA 2Q66A 2BMBA 3VQTA 3TANA 2HBRB 5LT5A 5KG3A 3ELHA 2KHDA 2ATLA 3FCWA 2JEJA 4ZVGA 1QLNA 4HL9A 2BEFA 4K4ZA 2E1MC 3M6XA 1HWJA 2VONA 2VBWA 2KRBA 1T05B 4IR9A 4CM2A 3KHGA 5KFBA 4EEYA 4DV5J 4O4GA 4X65F 2OEKA 1EETB 3ZZ0A 3DRXA 4G1IA 1VC6A 3BSNA 2Y1IA 4W92B 2Z2LA 2J8AA 4O23A 2ALYB 1RB0A 2UXCJ 4EK2A 2AGQA 2BANA 1LWCA 4NXNJ 2DNQA 2HS4A 1XJWB 4HLBA 1TL3A 2WW4A 5LXYA 2OEMA 4DPTA 3CC2S 3M8QA 1GT8A 1HNZF 5HJYA 2IM0A 4YY3J 3ZTRA 4GKJF 4ZVQB 2OTLS 4C8OA 5CQGA 1IKVB 3P6YC 5HLFA 2YKQA 3OVBA 4A8XA 4J9NA 4GRSA 2QA4S 5FDLA 3M1VA 1NDPA 3LP0B 1FI4A 4FF3A 5A6WA 3ETMA 4RR5A 1WSRA 3LF0A 2L9NA 2W7OA 4OI3A 4YR3A 1PYOB 1Z4UA 4OZ2A 2D41A 1D3WA 3C66A 3RAMA 3HHLA 4LRBA 2WONA 4IRKA 2XMVA 4NZ6A 1N36F 1HYSB 4MYTA 2YKNB 1S77D 2HS3A 1HWKA 4ZVUB 3GFXA 3RB0A 2MSTA 3MPYA 1E6YA 2WCXA 5A6PA 2E5LJ 5JXSA 2JC0A 1RHMB 3Q8PB 2YX4A 2NCKL 3N01A 2RVJA 3L9ZA 2VJUA 2A10A 3CJTA 3PFOA 1S6QB 3IG1B 2FY1A 2DTJA 1RTHA 2A0FB 4ZVHA 3FCVA 3CNQP 3RRGA 4ANDA 4CLYA 2B8QA 4ZPTR 3KNGA 1IWGA 2DNKA 3S7RA 2VOPA 2XYPB 4LF5J 3ISZA 1HQ2A 5HANA 2ILYA 2DY1A 3Q8UA 1JLFB 3BGRA 3NGRA 3RB4A 4CYUA 1JLEA 2LA6A 2OH2A 1FXLA 5KFRA 3I0RB 4USJC 4N5SA 4X64J 3KK1A 4OYBA 4RW9B 1CULB 2IAJA 1SV5A 5IC6B 2M52A 5LXRA 4OIXA 3OSNA 5ITHA 3KJVB 1EKRA 1HBUA 5AXMA 3N9UC 1Y7PA 1FK9A 4K4SA 4OFZA 1F5BA 2OMOA 4B9UA 1YZ6A 3IRXA 4LSZB 2LMIA 4Y28C 1QUVA 1KQGB 3MF5A 4MFBA 1S76D 1RXOB 2HAFA 1AYEA 4WFZA 3MM5B 3PW7A 4H54A 1OIAA 1FDBA 3O1LA 3KLEA 2PI4A 5AXLA 2O67A 4EGLA 2BJ1A 5SZTA 2ZH4A 2M7SA 3CCZA 1FXRA 1I51B 5ETKA 1VQ4S 2HPUA 1JLQB 1WORA 3L7OA 5DQIA 1H73A 2ZH1A 5MLCV 1LK7A 4I2QA 4AT1B 3CE8A 4OQJA 3ITHA 4DMZA 4NMLA 2QL7B 1VQYA 1Y00A 3ICLA 4C11A 4DDFA 1SC4B 5D0EA 2D9PA 3UN3A 3UR0A 2V4QA 1RT4A 2HHXA 4EYIB 4WTYA 3POTA 2FD2A 1SH3A 4H4MB 2XCAA 2D74B 1OSDA 1EP4A 4KH1B 4L74A 2XEXA 1OS5A 3GWCA 2E66A 4FS2A 1QJHA 1F3FA 2IYIA 2R8IA 3HXMA 2DO4A 5CCMA 4MIBA 2R2SA 2GW8A 2G1HA 2RMLA 3RR7A 4LRDA 2HIQA 2KU7A 3ZXWA 4YFUA 4W98A 4FYVB 1RP5A 5DO2A 1RWXB 2QLJB 1IUJA 2ASLA 2ABYA 3T19A 3GP9A 4X62J 5ETTA 3GTYX 1WUUA 3M2VA 1H0HB 3QJPA 2BRLA 3AHPA 5K9FA 1XMOF 2VQFJ 3SV4A 2DGSA 1F5CA 1REVA 5IQ6A 2GO8A 1JLAB 1TK0A 4USKA 2M3DA 4P71A 1M5SA 4RW8B 1PKUA 4LT6A 2VFRA 3OUYB 2VBYA 5DGBA 4O44A 1NJZA 2HHWA 4UUXA 4RW6A 3SMZA 3FSIA 3LOUA 3PNIA 1NB7A 2C2OB 5L46A 2HK2A 4AL7A 2BRKA 2QLFB 3DC2A 4Y2IA 1T7PA 2AJQA 2ZBIA 4TYBA 2VA3A 4K4TA 4LF8J 2QL9B 1D9AA 4U95A 1FFSB 5MAOA 2V8DA 1VJQA 3O6QA 1KVIA 1F60B 2ALZA 3OVAA 1FCAA 2D3UA 3NP5A 5K8MA 2K2PA 3CCVS 2LDIA 2YWHA 3KJNB 1UCNA 1UWBA 1BUXA 3BJYA 4Y00A 4F8RA 5GADU 4YR2A 2D7SA 2FLOA 2ZDOA 4DV3J 1NXIA 1JLBB 5J1NA 1K1QA 1RYRA 4KSEB 1GK8A 4CH0S 2XSFA 5DDRC 5DJBA 4MIWA 2OJ3A 4YB1P 2WK4A 3Q23A 4B3TJ 5HL7Q 1RAIB 2IC3A 3R6LB 2K1RB 1SC3B 4UTGA 3Q89A 2W4PA 1YRUA 4JUZA 4PKDB 2CQGA 2MKKA 1U6ZA 3LH2S 4DV0J 4C8NA 3RW7A 3KLHB 3OV7A 1JJ4A 3KK2A 2B4UA 4A8SA 1FE4A 3D67A 4KRWA 4TY8A 3HHEA 2W4DA 1WD6A 1NSQA 1ZA2B 5KFHA 2WHOA 4DV7F 4CNYA 3D0GE 3CJ0A 4H4KA 4YQWA 2CNLB 4AL5A 1YWXA 3BDPA 4F2RA 3CDBA 1HNVA 3Q2TC 2HRTA 4HDGA 2C28A 2M0GB 5BJRA 4ECQA 1TKTA 1GAOA 2L41A 3V81B 4DN0A 4UT4A 4AXJA 2UUCJ 4F67A 4JI5J 3NWGA 4FNHA 2WSEC 3HPOA 1YHQS 1WG1A 2VV5A 3EXCX 2VDIA 3W5ZA 1O8BA 1OYEA 3CJKA 4OYOA 2OPQB 5D0RA 3X1LB 1SJQA 4DHVA 3HFZB 1T02A 4G1QB 2FJXA 5KFEA 2MKHA 2DXDA 4HHJA 1K47A 1Q16B 2HNZB 2DPIA 5A8KA 2QMUB 3MXHP 4B9VA 3N5FA 4NCGA 3ILJA 2N3OA 1ZH5A 5HQMA 1YBUA 4OLOA 4K5RA 2XNQA 5IZHA 4OJ3A 4ZPAA 1SB6A 4KFBA 3OTEA 4KTQA 4AYBD 3PW4A 2F9DA 4DSIA 1CQMA 2ZVIA 4DSJA 4NYPA 5B0BA 3MURP 1VGYA 3BH6B 4CO3A 3KWMA 1RZMA 2MGZB 1BQMB 2WB1D 2ZBPA 4DUTA 3IR6B 5E33A 3DOKB 3MAQA 2K8GA 1CJVA 2HFZA 3CT9A 3GIKA 1EQMA 4B3SJ 4JV5J 1S1VB 1URRA 3W65A 3HI9A 1RLDA 4Q43A 4K4UA 3GONA 3ILLA 3FJ2A 1HWLA 2OTJS 4J9MA 1T9XA 3IWLA 1SC6A 2V5HG 3B6BA 4DR1F 3GJRB 3MD3A 3BR8A 3TUIC 3DI6A 3S01A 2M8HA 4DSLA 2Z30B 1FJGF 4DG1B 2E9RX 2MQPA 2YX7A 1JXEA 4JI7F 2MEWA 3H4BA 2FHJA 4Y65A 4RL1A 3H40A 4EYHB 3OR1A 3DM2A 1VHIA 4IDKA 3GIIA 4F4ZA 2EKYA 1HD1A 3TX0A 2KT3A 1HNIB 3DLBA 3VVTA 2ZE2B 3TVYA 1RWUA 5HQLA 5F8GA 2CPHA 2A1BA 1RK8A 2JWNA 1U1MA 4ED6A 5K5MA 4ZLNA 4JI4F 2GCFA 3C6TB 2NQPA 1IJEB 4URQU 2FJVA 4Z7CA 2O5DA 4NA2A 4DQSA 5C7PA 4PUOA 2W7PA 2CJAA 5A8RA 1BQNA 2GA7A 3TJ8A 3QT5A 3JTNA 4IRCA 2R2RA 2G1DA 3I9ZA 1X4CA 1X60A 1WC4A 1TKXB 3SFGA 3HJFA 4J9OA 2L48A 2AJ4A 2IRXA 4PWUA 3G87A 2EK6A 2C3UA 2QSWA 2RILA 3KLFA 3AXKA 2J8SA 3PYDA 4OX9J 2FJWA 1KQSR 3D6MB 3KLGA 3AA9A 4USTA 3ISND 1VRTA 2ZH3A 1LOUA 5HMZA 4HTJA 2A6MA 4DR7F 1RADB 1N33J 1QAJA 3DOLA 5IS2A 1MG7A 3K5PA 2E1RA 4LIWA 3NXZA 1I6JA 2WVBA 4LJMA 1WHYA 5HSPA 1U2CA 3F56A 3W2VA 1FDAA 2MQQA 1SL2A 1MLAA 3O3LA 1HHQA 1NKBA 4DPUA 1IJFB 4USVA 2DEIA 3UN5A 2OI2A 2GIFA 3PYFA 2JJ4D 2YWWA 4WFBQ 2MTLA 3SYZA 4AQYJ 1U09A 1G6BA 2XHWA 2ERRA 3HHKA 3QAEA 3D4JA 1VBXA 1SJ3P 2KN4A 4M5IA 2VFTA 1IM6A 5F3ZA 2GQQA 2NXEA 3B8HA 4ZVTB 2HS0A 1JLGB 4Y6IA 1KFDA 2CJYB 4M8LA 3TP2A 4DFJA 1VFJA 4PQAA 3GV8B 3KNAA 5GAGU 1WG4A 2C3YA 3QIPA 1UW4A 1Q5YA 4OYWA 2CA9A 4YOEA 3DDKA 4B9MA 3L95X 3MM7B 3BN7A 2IBKA 2MXYA 4A4JA 4AE5A 4ZP7A 5B0AA 2RQCA 4K2XA 1LFPA 3LGNA 4E8UA 3HT3A 1S1UA 3I31A 2RHSB 2CPDA 1Q8LA 4R25A 2AV5A 2VFUA 3A12A 2VOOA 4B3RF 1F5AA 2CJXB 1T9TA 1GMWD 2IRUA 1D8YA 4KV8A 2FVSA 3N28A 4DL5A 2L9DA 4O4GB 4C0BA 3M9OB 2JEFA 2VJVA 2LECA 2RB7A 1SCJB 2DY9A 2XM3A 2ZUAA 4DL4A 1G7CB 2I6WA 1LWCB 2R7UA 2DGUA 2VG6A 3ULHA 4QU7A 2AP6A 4YDDB 2WSFC 4URGA 1TL3B 2R42A 3W63A 4F3QA 4DPXA 3BV8A 3UNGC 4C8KA 3M8QB 4MK8A 4I68A 2LEAA 1X9MA 3PR4A 5HLFB 2RJZA 3QSIA 3PJWA 2ZZNA 1Y4ZB 5FDLB 1LXNA 3M1VB 1IQZA 2GIQA 3VAMA 4QU6A 4WJBA 3MI7X 3FQKA 1RAAB 4WP9A 2GHWA 1BLUA 3EE3A 1QAXA 3RG6A 2L3MA 2X3DA 5E0OA 2GMHA 1J5EF 4JOUA 2WONB 4WKRA 3DGVA 2RUGA 2FTRA 1LWEB 1ZS6A 3PXGa 4C7QA 2IDEA 3T1YF 3FMBA 1S12A 1WDDA 2GC8A 3MCNA 1E6YB 2FJBB 1G4CA 1WG5A 2H51B 3GV7B 1VQKS 1I94J 1DTTA 3GMGA 1RCOB 2ZVSA 5HP1A 3SQGA 3HX9A 3OHAA 3J81U 2B51A 5E3RA 2R9LA 4F50A 1RTHB 4NPOA 4ZVPB 1HWIA 3H7HB 8RUCA 4LF7F 3R27A 4KAIA 2HMIA 3DRPA 1U02A 1LWFA 3CO9A 2BUNA 4RBUA 2XY7A 4CLWA 1HNWJ 2OLWA 5ETRA 9ATCB 3J7Z5 5F8JA 4FKXA 4M5HA 5B0DA 2XGQA 2ZWOA 4KHPF 1C2PA 3CJQA 3FRZA 2P9GA 1O5JA 2V50A 1RT2A 2VDHA 2C42A 4J5OA 3BGRB 5DDOC 4CYUB 1JLEB 3ZZYA 3S8SA 3RB3A 1UVNA 1VRUB 2HZVA 3KK1B 2IAJB 1SV5B 3UPFA 1VIOA 2RDIA 3JS9A 2KG0A 3DYAB 4DV2J 2KJVA 3ZO7A 1HBUB 1WF2A 4RNFA 4CCHA 3D6TB 4FP9A 1RAFB 1FRLA 1YGYA 2R3VA 1YSJA 3BEGB 4DV5F 3O44A 5CAAA 3IRXB 2H48B 2Y8WA 2F8EX 1U2FA 2C2RA 5F8LA 1HA1A 4UUWA 2EEYA 1N4LA 1S6OA 2MLZA 4KQZA 1AUDA 2HHVA 4U7CA 2UXCF 1U4BA 1TFYA 4NLTA 5EHHA 1OY8A 1RAHB 2G4BA 4NXNF 3OTCA 2EFOA 3GCXP 3KLEB 3RAQA 4IH6A 1L3SA 1SQEA 3E3XA 4WE1A 3EPGA 5BR8J 2HQGA 1NPRA 2QA4G 1NMEB 3D1OA 4YY3F 2YWEA 1YJVA 2VUGA 3KMQA 4I4BA 4NYOA 1RQ0A 1CSJA 2DGQA 1TUGB 3ITHB 4I2PA 3PIOQ 1SUQA 2V4JA 4C11B 5CH7B 3MD1A 1MW7A 4LF9J 1KWMA 3FCHA 3IGVA 3PFEA 3VGUA 4KC5A 1Q4RA 1RT4B 1WEZA 3U1LA 4M94A 3POTB 5JJBA 2DNNA 5CHCB 2PGCA 3TO8A 3KJQB 3CPWR 1EB0A 3GFZA 4CM0A 4M5MA 5CD4H 3CVKA 4RZRA 2Y8YA 1PAUB 4J90A 1QY7A 2V9KA 4L72B 4QWBA 1SKWA 1K8AT 1Y3KA 2XMAA 3GCWP 2CPFA 4NLQA 3MECA 3VALA 1HD0A 2E5LF 5JMNA 2QIFA 3UD5A 5D8HB 4UY85 3AA8A 4C48A 4WYLA 5C5JA 1N5VA 1B7YB 4Z37A 1RKIA 4Y34A 3RUBL 4RLEA 2DXEA 3MUMP 3M32A 2FPHX 1CJKA 1FD2A 2U2FA 1FX4A 3M2VB 1EAYC 3DCAA 3AOBA 2GFFA 3A8KA 1YJNS 3FBCA 4LF5F 3QT8A 2V2KA 4C97A 1REVB 1Z2LA 1C4CA 2RU3A 3MM6A 3FVYA 3IGNA 4N8NA 2XI2A 3DNCA 4BWJA 3OXLA 5D4NA 4QYRA 3HT0A 5E41A 4X64F 4O44B 5GVQA 2ZDPA 3VV2B 1WHVA 1FFGB 3CDEA 3C46A 4RW6B 2BR0A 3KLIA 2NXJA 2NSCA 2JC1A 4J9RA 5KFZA 2EKNA 3G6XA 3PRBA 1R8PA 2V8HA 1WKJA 5EGYA 2IYGA 3BB5A 4BC9A 4LSLA 3RRKA 1Q8KA 1TL1A 2FZCB 4CIOA 5KFTA 2GO9A 2KVQE 3A13A 1CLFA 3T5HA 4I6AA 1UWBB 5K8PA 4IR1A 1OWXA 4KHRA 2G0CA 3AAWB 3LGHA 1RUSA 3HVWA 3MUVP 1O6XA 1ZBTA 3B82A 1V3SA 4CWBA 3ADAC 3UE2A 2Z4PA 4NI2A 1R8CA 2Q79A 2NZ4A 2ZKTA 2IC3B 1NSAA 3QYYA 2XI3A 4ECXA 2VG5B 2Z2MA 2KO1A 3I4PA 3CCSS 1YK9A 1BD6A 3NGTA 4D3HA 2Y3YA 1M5HA 2VD3A 1EARA 2QGFB 3ONQA 3B78A 3KK2B 2YWGA 3AJ1A 4D3GA 3QFWA 1NK8A 2BJEA 1M1KT 2EPIA 2HFOA 1RISA 2CQ0A 1KDNA 5ETMA 2OUGA 2J6SA 1S1TA 2BM1A 2Z56B 4NLDA 2FVCA 4QIFA 2CPXA 4C3KA 2ZM6J 1RGVA 3EICA 5ETOA 3P49B 3MAHA 1ZM2A 4TNOA 1BXNA 3LQVA 1H98A 1R43A 2CPJA 5AE2A 2X1AA 2Y9HA 2M5YA 1X4FA 3EWGA 4ZN1A 4ILRA 5E3AA 3MPUB 1F2HA 2KTQA 4NYZA 2RKIA 3A3OB 3PEHA 2OELA 3IAM9 4O4RA 4YMEA 3GPAA 3CJKB 4X62F 1IBMJ 4ATNA 4IRDA 3QWUA 3RGIA 2J9DE 3W9IA 3VGSA 1D8ZA 1NKCA 4LFAJ 1YKWA 4DBQA 2VQFF 3G9CA 5AXKA 1PJ6A 2I1RA 1T9UA 2I0XA 2MY8A 4E0DA 5A8KB 1Y10A 2Y1LB 3D66A 4NCGB 2AGPA 2GQCA 1DARA 1JJHA 2Q3PA 4EU0A 4KFBB 3KG4A 1FJCA 2LKZA 1U1NA 3HVTA 2H3EB 2Q1LA 4Y2KA 4X4QA 3LP2B 4ES3A 2GHPA 3H5UA 1EZZB 4WFAQ 2HZCA 5LMNJ 5T14A 3CJ3A 2CZ4A 5CYMA 4LF8F 1F6TA 4ER8A 1T03B 2KL8A 2AJFE 4ZPDA 3IRWP 3CGIA 3W66A 1Y5LB 3MPVA 1JK9B 2YPZA 2B9WA 4DI6A 3EGWB 3T9NA 1CJVB 2ZITA 1I3OB 1L5UA 1S1XA 3OJUA 2XLKA 4HKQA 2GJFA 1FWKA 1S97A 3BGOP 4DV3F 2YH1A 2GAHC 2NUHA 1S7HA 2R7XA 5D0GA 1Q81T 4WFYA 1R0CB 2VC1A 2RDDA 3R7SB 4PG8A 4B3TF 4J9LA 1JIHA 3R8YA 2UUWA 4LR8A 3HHLC 3DI6B 1ACMB 4ZP6A 4DV0F 4MKAA 3ZC4A 2QFIA 2ZBQA 3H4DA 3DN9A 4OHVA 1UJ6A 4Q0BB 4YHHJ 3OR1B 3DM2B 4IDKB 1Q1KA 2H9ZA 5IM0A 2X3GA 2PFDA 3BKTA 3PZPA 1MU2A 3HD2A 3AD9C 3H2VE 2FZKB 1S9GB 4DU8A 4FYXB 5IQQA 3PX4A 2QMXA 3CCRS 3HFVA 2CDQA 4HDHA 3OXGA 3GYXB 3E8OA 1N56A 4DFPA 5KG1A 3OVSA 1UMJA 4PUOB 2UUCF 3CJSA 5A8RB 4JI5F 1KP6A 3M8ZA 1WC1A 4QWEA 1R0BG 4JI8J 2JVOA 2KYZA 1OY9A 3G6YA 3FSXA 5J2MA 5GADI 4P2XA 5IC4B 4N76A 3D5MA 2V63A 3PX6A 4OYXA 2PO4A 1U1RA 2YNIB 5KFUA 2AEJA 5M2PA 3KLFB 2J7KA 2FC8A 3UDVA 1SXLA 3Q2SC 1FJ7A 3KLGB 1VRTB 1SIWB 4FS1A 5HVFA 3RYLA 3M2RA 4USWA 3K2YA 4P2SA 1QDUB 3DOLB 1AFIA 1UETA 5ADZA 1GXUA 3CF5Q 1XK8A 5CABA 3CD0A 4XAKA 3C19A 2AHOB 1UPPA 1FNMA 2OIHA 3W2VB 3UNYA 3GYNA 2OGUA 1JLFA 4YP3A 2JZ5A 4QR0A 2DIUA 2EFQA 1QAYA 1A0OB 2G0IA 3DLKB 2HBZB 5SUHA 3W9JA 5IT9Y 3FDSA 3KJVA 4B3SF 4JV5F 3NAIA 3HSGA 4MT1A 3WIVA 2R2TA 3NEKA 4BHQA 2VFSA 1GMUA 4F36A 3DOMA 3I6PA 4DFMA 1M5PC 2XLJA 3G6VA 1KOOA 2CJ9A 1QD1A 1ZETA 3G4SS 1PYSB 2V8VA 2QE5A 3D54A
chains in the Genus database with same CATH topology
2XEXA 3RW6A 1OS5A 3GWCA 3PEJA 3QIPB 2E66A 1IKYA 2AJ1A 2GX8A 4FS2A 1NJYA 5IXUA 2DCLA 3EZ5A 1QJHA 4ED7A 2IYIA 5B0GA 2R8IA 5CCLA 3HXMA 2DO4A 1UL3A 1S6PB 5CCMA 4MIBA 2R2SA 2MKJA 2XNRA 2GW8A 1LW0B 1HBMB 1YQHA 3BS9A 3NBPA 1OQ3A 2ROGA 1NU4A 2RMLA 2J6TA 2N4DA 3RR7A 3MMBA 1QUPA 3I82A 3HLUA 3T1AA 2HIQA 4DS4A 2CQIA 2R7TA 2KU7A 3NGKA 4YFUA 1R0AB 1N52B 3D0IE 1U45A 1TKZB 4M95A 5DGAA 1VQ9S 2XULA 1RP5A 4ZLPA 4FXVA 2PFFB 5DO2A 2I5JB 2JDJA 2J76E 2B4PA 5DS7A 3GQCA 4YEAA 3DLKA 2KFYA 3QPIA 2XMMA 1IUJA 4DSEA 4YR0A 2ASLA 1JMTA 2W8LA 2ABYA 2KFNA 1P6TA 3SXLA 2JH3A 2OKQA 3T19A 2HYIB 1YVFA 2DBBA 4NLYA 2RQKA 3DRRA 3SV3A 1W2IA 3F44A 4KV8B 3M2VA 3CDWA 2JFKA 3TR5A 1H0HB 5KT2A 3QJPA 3MPWA 3RTVA 4C8MA 4ECRA 1KFSA 1CC7A 4FF1A 2BRLA 2XY5A 3AHPA 3IWNC 5K9FA 2ZOFA 1UA0A 3C3LA 1XMOF 3QO9B 2YNHA 3SV4A 2V8GA 5E3PA 2DGSA 1F5CA 3UFCX 2XLIA 1REVA 4I7FA 5JVGQ 5IQ6A 4CTAB 5LJ5Y 1WF1A 1ZYQA 2GO8A 2NYIA 5HMWA 1JLAB 1TK0A 2ZKUA 2M3DA 4B02A 4NLPA 5CYJA 2OPSA 1TV6A 1M5SA 1SBRA 2WBMA 1R8AA 1ULRA 4RW8B 5J1PA 1XWLA 4LT6A 3TW0A 2VFRA 5KFLA 5B08A 3OUYB 2Y1JA 2VBYA 1FJEB 2JOQA 5DGBA 4XPEA 3E2EA 4O44A 2BM0A 1C4AA 2G9OA 2HW3A 4P6QA 1NJZA 2HHWA 2F8MA 1FRJA 4DF4A 4JYAF 1U1OA 1HPZA 4BC7A 1Z1ZA 1MMNA 4UUXA 5K14B 4O3PA 4B17A 5K8NA 4RW6A 3SMZA 2HQ3A 1FKOA 3FSIA 3LOUA 3CMAS 2YNGB 2E44A 1RTDA 2ADCA 3PNIA 2V4RA 1NB7A 4NL5A 2H5EA 4DL3A 2ROEA 2R7OA 4AL7A 4KPYA 2BRKA 1UVMA 4OZLA 1N5SA 3DHWC 4LVOP 5KFGA 4U67Q 3R1HA 2YKAA 3DC2A 4Y2IA 1ZTTA 4MK9A 1T7PA 3QJJA 2AJQA 1RT5A 2ZBIA 4A46A 1FRIA 1XEZA 2J7UA 4TYBA 4TXSA 2VA3A 4OX9F 4C2MA 4G3IA 1QVFR 2CVEA 5F0WA 4K4TA 4GKKF 4A48A 1UJ4A 2EK1A 4IUFA 4TY8B 1TKZA 1D9AA 4EO8A 2B6AB 2ZH5A 4WXWA 5GAEI 5DDPC 5MAOA 2V8DA 3O6QA 4R5PB 2PA3A 2LQ9A 3CDAA 3OBIA 1F60B 1KVIA 2ALZA 1N33F 2IVYA 3H2LA 3OVAA 1FCAA 1MMDA 2D3UA 3NP5A 4ZCKA 5K8MA 2K2PA 1U8SA 3TAMA 3AQPA 3CCVS 2LDIA 2VASA 3MDFA 3N0VA 1B64A 3DLGA 1YJUA 3IA0A 3FEZA 2YWHA 3D2WA 4N41A 4RBVA 1UWBA 3MTJA 3BJYA 1JNRB 4Y00A 4F8RA 1HNVB 5GADU 2OPPB 4YR2A 1DLOA 2D7SA 2VH7A 3NMRA 4KE5A 3JSMA 1H6KX 2FLOA 2ZDOA 3LW5C 5C42A 3JYTA 3UCZP 4ED5A 3MR2A 1JLBB 2BABA 2DO0A 1JLCA 1K1QA 5J1NA 1RYRA 1S9EA 4QPXA 1P9QC 4KSEB 3EGNA 1TKTB 4HH0A 5I3QA 2MZSA 1Q8IA 1JNZB 2XSFA 4CH0S 1PC4A 3UQSA 5DJBA 6FDRA 4OHZA 5DDRC 2HLTA 4MIWA 4TLRA 3GSDA 4ID5A 4LSNA 4F25A 5DLGA 3KK3A 2OJ3A 4YB1P 2EG1A 2WK4A 3Q23A 1M5OC 1G2EA 1UVJA 4HEA9 5HL7Q 1TK5A 2IC3A 2HRYA 3LALA 2DIVA 1R6YA 2K1RB 2UXBF 1ZZFA 1IKWB 5K14A 3VAKA 2MQNA 1DTTB 2W4PA 4AQYF 1UFLA 3MEGA 1FNXH 1YRUA 5AE3A 1HQUA 1X4AA 2VPZB 4JUZA 4PKDB 2CQGA 2FHOB 5DG9A 5HP1B 2MKKA 1U6ZA 3LH2S 3SQGB 4F3OA 5J2PB 3VR1A 4C8NA 3G8SA 3RW7A 3BSAA 4PRFA 2YTCA 3KLHB 1VLYA 1L3VA 1N48A 3OV7A 3EGZA 4RNNA 1JJ4A 2FHKA 2UVVA 3N4WA 3KK2A 2B4UA 4O3NA 3OJSA 2M70A 3MHYA 4A8SA 2HMIB 3DRPB 4PCQA 4XK8C 1FE4A 3FEXB 2GJIA 3QZ8A 4KRWA 4TY8A 1LWFB 2B6AA 3D1QA 1XR7A 2BBEA 1Q82T 5F9LA 3UDCA 3HHEA 4DL0C 3PHEA 2EFPA 5CA5A 3TVZA 2W4DA 4X4SA 1WD6A 1K1SA 5T7LA 1R31A 1Q53A 4R5PA 4J9SA 3CXCR 1VS3A 3QGHA 2LXIA 1IM4A 2V94A 3G71S 5KFHA 3HKWA 4FYDA 2ASDA 2WHOA 3DHXA 1XBWA 4AUKA 2HFNA 4FVMA 2B7CB 4DV7F 2OFHX 3M6WA 3U1MA 1UP1A 4ERDA 1DHMA 2G13A 4CNYA 3D0GE 3CJ0A 1RT2B 4H4KA 4YQWA 3UCGA 4AL5A 2HNYA 2PDAA 2AYEA 4K59A 5C25B 5KT7A 1YWXA 3BDPA 4F2RA 2PSZA 2ZHOA 3CDBA 1HNVA 2OPPA 1YG0A 1Q7YT 2LQ5A 2R7WA 4ZCLA 3TVKA 2O01C 3Q2TC 1SJFA 4FZVA 4RUHA 2BV3A 3SDEA 2BZ2A 2ZJPQ 1N8RT 1VQSA 4I64A 4ETZA 4HDGA 4KR0B 1N5YB 2DR5A 2R7SA 4DQRA 2C28A 4ECTA 2M0GB 4H4KC 1TQLA 4YB5A 5BJRA 4ECQA 1TKTA 1GAOA 2L41A 3V81B 4FBTA 4DN0A 3JB9k 4GC7A 2IMWP 1G1XA 4IFYA 4AXJA 1C1CA 4F67A 2B4VA 4JV1A 2MQOA 3NWGA 4FNHA 3TA1A 3K58A 5H9FJ 2PA8D 2WSEC 4JI1F 2DHSA 3LWMA 4B9NA 2NLWA 2YX1A 3WZ0A 4CO5A 3HPOA 4USIA 1IKXA 1WWHA 2XCPA 5J2QA 1YHQS 1TFWA 1WG1A 2VV5A 3RRHA 3EXCX 3MR6A 3JSRA 2DT9A 1X4DA 1O8BA 4X4RA 4MTPA 1FEEA 3CJKA 2OPQB 1VBYA 5F8IA 2DCUB 4ECSA 1D1UA 5J2PA 3NNHA 3E01A 1X9SA 1NAQA 1SJQA 3X1LB 4DHVA 1WHWA 1GTEA 3P5TL 3N79A 4KKOA 1DQ8A 1T02A 2GQ2A 2YKOA 4G1QB 3GFHA 1AW0A 1VMBA 5KFEA 1TP7A 2FJXA 3W2WB 4ECVA 3RB6A 2XMUA 5CXTA 2MKHA 5E7OB 2K3KA 4HHJA 1X5TA 1X9WA 2R7VA 1Q16B 4Q2MA 1RDRA 2HNZB 3EXYA 2DPIA 2KVIA 5A8KA 1T05A 2XZWA 1U49A 3MR5A 3OTBA 4KGKA 3FGVA 3MXHP 3FZBA 2AX0A 4B9VA 1FVSA 2DGTA 3N5FA 4NCGA 4U7UK 5DETA 3US5A 4RUAA 3WX4A 4J37A 4NZ7A 2N3OA 1ZH5A 1SL0A 4IH5A 1EETA 5L39A 3TI0A 3PIPQ 4OLOA 2AYGA 4K5RA 2XNQA 2ZC4A 1NK7A 1S0VA 5IZHA 1V3RA 4OJ3A 4WE1B 1LV5A 4ZPAA 1SB6A 4C0OC 1C1BB 2J6UA 1CQNA 4KFBA 1O51A 5EUHA 1Q8BA 3O5TB 4OI0A 3OTEA 1FNOA 4KTQA 4F4YA 1HFEL 4AYBD 1ZM3A 1JX4A 2BOPA 5KFIA 3PW4A 2B5JB 2NPIA 2F9DA 4DSIA 1CQMA 3LANA 1LKZA 2C2DA 4DSJA 4HH1A 2F4VF 5FLXY 2Y0SD 4L6V3 4XDCA 3CB4A 4QQBA 3KLVA 4ILLA 1OPIA 2MYFA 1S79A 3SCLE 4RNMA 2FB0A 4NYPA 3V5RA 5B0BA 3MURP 2PMZD 2KRRA 1VGYA 3H59A 5D4OA 3ZZTA 4CO3A 3TAQA 3EPIA 2AD9A 4RW4A 2EG2A 4I2PB 4X2BA 2GGPA 3CSKA 3CUNA 5KT5A 2CQ4A 1SUQB 1IKVA 4J9PA 3KWMA 2XWYA 1HARA 3CD6S 4A8OA 2XSJB 2B43A 1BQMB 1VHFA 2V4JB 2JLEA 5HMYA 4FPRA 2MGZB 4QWAA 3GIJA 4Q8EA 2WB1D 4KIAA 3KHLA 5GAGI 1TL5A 1X4GA 2KDOA 4N47A 3VTIA 2VG7A 4G1PA 5I4MA 1HBNB 3T5LA 2HHUA 2Q6CA 2X1GA 2UUTA 5LSOA 2DPJA 1WF0A 2YNFA 5GAHI 3IR6B 3MWBA 2XS2A 5E33A 1Z2ZA 3O8WA 2OPQA 1VQPS 3IBWA 3DOKB 3MAQA 1F2GA 2HHTA 4ZPBA 3MMAB 2K8GA 3LP0A 2DR7A 2HFZA 4ZHRA 1HI8A 4IO9Q 3M6VA 4NLWA 3CT9A 3PW2A 3GIKA 4EFAC 3RAXA 3OL9A 5F41A 1S1VB 2MQLA 1N5QA 1URRA 4LIRA 4JV0A 4HI1A 3KKFA 3HI9A 1NK0A 3TOQA 3GR0A 4Q43A 1GQEA 2YH0A 4K4UA 1FTRA 1NJXA 4UW2A 3UDLA 1SIZA 2MZRA 2IM1A 3FJ2A 4I0WA 1HWLA 3O2IA 2OTJS 3A8EA 3HZGA 4J9MA 2Z8QA 3MEEB 1MNEA 1BQNB 3DU5A 2EWHA 3IWLA 1KS2A 1RTJB 3P96A 3PY8A 2ZJRQ 1SC6A 4ALZA 4ECUA 2V5HG 2B56A 5KG2A 3CWJA 4DR1F 1Y9OA 2DR9A 4J9KA 1TAQA 4DR2F 1HYSA 1P1LA 2ZH9A 5HROB 3R5BA 4QCLA 3MD3A 1X8DA 3BR8A 4Z2XA 5JUMA 3MFHA 3TUIC 3DI6A 2QFJA 1I94F 1FE0A 4FXWA 3S01A 2K3IA 2M8HA 2R7QA 2YKNA 5GAEU 5KTQA 4DSLA 2QRRA 2KXNB 2HVHA 3OLBA 4DG1B 1FJGF 1PC5A 4RKUC 2E9RX 2MQPA 3U27A 3DRYA 3BREA 3QZ7A 2ZHBA 4MKYA 2M88A 2MSSA 2YX7A 4Q5VA 3IR5B 1JXEA 4JI7F 4NA1A 4B3OA 5DDQC 3H4BA 2FVQA 3E51A 1JKHB 2JX2A 2JVRA 5E3CA 4M5DB 2LEBA 2FHJA 4QPTA 4Y65A 2RQ4A 4MKBA 3H40A 3M32B 4QWCA 3R3TA 5A0YB 5EWEA 3G8QA 4EYHB 3OR1A 3DM2A 4AL6A 4R0JA 1RTIA 1TR0A 2MDAA 2MKSA 4IDKA 4UQGA 3HDSA 2OSQA 2FJDB 2RS2A 1S6QA 2XBPA 1YTYA 2ROPA 3IG1A 1HNWF 3GIIA 4F4ZA 2EKYA 1HD1A 1DZ5A 3QAUA 3UW1A 2W9CB 2KT3A 4IG3A 4F4XA 1HNIB 1S4FA 3DLBA 2K7KA 1R7IA 3HZEA 3MGJA 3SEOA 2ZE2B 3TVYA 3BSOA 2CKWA 4ED1A 1VC0A 4MH8A 4IFVB 3KG0A 1RWUA 3M2UB 5F8GA 2CPHA 1MWZA 4WZQA 2A1BA 2CQPA 1RK8A 3J7ZT 4NX9A 5G0RA 3SI8A 4IG0B 2JWNA 1U1MA 4ED6A 1N6QB 5K5MA 4DPOA 4JI4F 1Y0HA 2RSQA 2GCFA 2W4CA 3FEYB 4ELVA 2C2EA 1R27B 3C6TB 4V19J 4DN9A 4DUYF 2NQPA 1VBZA 1IJEB 4URQU 4PXEA 2FJVA 4A8YA 2KXHA 2CG4A 1S72S 2O5DA 1FTCA 4KB7A 3CIMA 1P27B 4NA2A 1U24A 2ACYA 1J5OA 4ETXA 4DQIA 4DQSA 1OO0B 4B9LA 3T9ZA 4PUOA 4K50A 3BGLA 2W7PA 1J2VA 2CJAA 2X51A 5A8RA 1BQNA 2FVPA 1RTJA 2GA7A 3OTOF 4ZS6A 1SKRA 3KLIB 3JTNA 3I0RA 3K5OA 3NGDA 1TL4A 4ES1A 4IRCA 2E1AA 2PMHA 1M5VC 4DV2F 2M9KA 2R2RA 1WEXA 2G1DA 3I9ZA 1X4CA 4RW9A 4XDDA 4DQQA 1XNQF 3NLCA 1V9OA 1TKXB 3SFGA 3GILA 3HJFA 1U6FA 5KG6A 1ZAVA 4QBUA 2L48A 4J9OA 2AJ4A 2IRXA 3TUZC 3MM9A 1HWUA 4PWUA 2WAQD 1SKSA 1BGXT 1S1WA 3EZUA 2R7RA 2EK6A 2E7XA 2C3UA 4AXIA 4DR4F 3PX0A 1FEHA 4CO4A 3MCSA 4K4XA 2YKMB 1TVRB 1N0UA 2A18A 2QSWA 2RILA 4FNIA 3PO4A 4C8YA 3LGMA 1KR4A 3KLFA 2XC9A 2AU0A 3PW5A 2J0XA 4OJGA 3IAS9 1Q7LB 2N4CA 3VCDA 1WNEA 4X4PA 5L9NA 2Y1RI 1HBOA 2FJWA 1KQSR 2KJWA 1XERA 2XMWA 4QR1A 3PDNA 2OP5A 3KLGA 2ADBA 1FF2A 3G6ES 3AA9A 2ZH3A 3ISND 1VRTA 2W9CA 2IM3A 1HNIA 1LOUA 2LA4A 1U1LA 1F9FA 5HMZA 4C4WA 4HTJA 1KLMB 4DR7F 2F40A 5CZVA 5EN1A 2BYCA 3D28A