2O01C

The structure of a plant photosystem i supercomplex at 3.4 angstrom resolution
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
80
structure length
80
Chain Sequence
SHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title The structure of a plant photosystem I supercomplex at 3.4 A resolution.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 8
structure length 80
sequence length 80
ec nomenclature ec 1.97.1.12: Photosystem I.
pdb deposition date 2006-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF14697 Fer4_21 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2o01C00
3MM8B 2PDAA 1FDDA 6FD1A 2FJEB 1C4CA 1FRIA 1FCAA 1Y5NB 2C42A 1Y5IB 2WSFC 3MMCA 5E7OB 1AXQA 2FJDB 1ROFA 2XSJB 3C8YA 4KT0C 1KQGB 1GTEA 4Y28C 1A6LA 1K0TA 2Z8QA 1FTCA 3IR5B 1IR0A 2V4JB 1R27B 1PC5A 2C3UA 2VPXB 3OR1A 1G3OA 2FJAB 2C3YA 3MM9B 1DAXA 1GT8A 2PA8D 4L6V3 1B0TA 1FRMA 1WTFA 1FD2A 1BWEA 2VPZB 2C3MA 2VPYB 7FDRA 4CI0B 5L8RC 4ID8A 1Y5LB 2WAQD 1PC4A 2WSEC 1H0HB 1JNRB 1DURA 1H7XA 1IQZA 3EGWB 1B0VA 1FXDA 3MM6A 1BC6A 1FRLA 3MMBB 4RKUC 3OR2A 5BYSA 2V2KA 3MM7B 1KEKA 4XK8C 2Y0SD 3MM8A 1RGVA 3MMAB 4XDCA 3EUNA 1FEHA 5BYRA 1H7WA 1BQXA 3MM5B 1D3WA 1SIWB 4OV1A 1C4AA 1FF2A 1FRHA 1HFEL 1Q16B 1FDBA 2XSJA 1BD6A 1BLUA 3MMCB 1SIZA 7FD1A 3IR7B 2C3PA 1GTHA 1F2GA 2C3OA 2GMHA 3LW5C 1G6BA 1B0PA 2WSCC 1JNZB 3IR6B 2V4JA 2IVFB 1H98A 1F5BA 5CH7B 2O01C 1FDAA 1F5CA 3MM9A 1JB0C 3EXYA 2FDNA 2PMZD 3OR1B 1DFDA 2UZAA 2VKRA 4YDDB 4AYBD 6FDRA 2GMJA 4DHVA 4XDDA 5FD1A 5CHCB 1VJWA 1SJ1A 2FD2A 2ZVSA 3GYXB 1FRJA 1FRKA 1FXRA 1GAOA 3HKZD 1Y4ZB 3MMBA 1XERA 1FDNA 1FRXA 2FJBB 1KQFB 2FGOA 3MM7A 3MM6B 5BYQA 2VPWB 3MMAA 3OR2B 3PNIA 4OMFG 1FERA 1CLFA 3MM5A 2WB1D
chains in the Genus database with same CATH superfamily
2DNGA 2NLWA 1SL0A 4ANEA 1RTHA 3MZIA 1S6PB 1FKOB 2MDAA 3J81U 1NXIA 5GAEI 4LRDA 2X1FA 4ZN3A 1GT8A 3ITHB 4CNYA 3GIKA 2QL5B 2ZM6F 2BA9A 1BWEA 4ILLA 2PO4A 2ZBPA 3I0RB 2MB0B 4DF8A 1QSLA 2XZTB 1U7LA 2I1RA 1XR6A 1VYAA 3C14B 2ZOMA 1IR2A 1S1WA 3OW2R 2HHQA 1F9EB 3MM8A 1TFWA 4NLYA 3OL6A 4AQYF 5HAOA 3I0SA 4RWWA 1K47A 5AE3A 2E5JA 4XPEA 1ZAVA 1N34J 4C0HA 1QDUB 2PMZD 4U8YA 4OJ3A 3M4XA 2MMYA 2UVWA 1L3TA 1HNWJ 1SQGA 4GKKJ 2MHNA 2FD2A 5AJ3F 4HHJA 4KKOA 3GSIA 4ID5B 3GWCA 2ERRA 2K3IA 3I4HX 4ED1A 2NUHA 2DNNA 1RDRA 1VMBA 4I2PB 2CQPA 4RW8A 3ZNJ1 4DUZF 2XSJB 1R6YA 1T9TA 1Y3KA 1RJJA 2XLIA 2R8KA 3U1NA 3OFHA 2LQJA 3HFKA 2YKMB 4LF5F 1T02A 2F4FA 1XR5A 4YY3J 4F26A 5LMUF 4DR5J 5KFBA 4NLDA 1S0NA 4DPYA 1WTFA 4JI8J 2W4DA 4DQIA 2HVZA 4FF1A 1JNRB 4IDKA 3GIIA 2CKWA 5KFUA 3OTEA 2GIQA 3BBFA 2YKPA 4PG8A 3CJKA 2W01A 2ZH2A 4X65F 1KHWA 3D28A 2XO7A 1FRHA 4RUBA 2JLEA 3KUEA 1NSQA 2M8DB 2WK4A 3AQPA 4DV1J 3TA2A 5J1EB 1WJ9A 5CYMA 2WVDA 3C19A 3KJQB 2OFHX 5C42B 5I3UB 4M5NA 4X66F 2Y1LB 2I6WA 1F9FA 1N0UA 5EWGA 4M5DA 2R7TA 2Y9HA 5A8KB 4OMFG 4C7QA 2LDYA 3V81B 4Y0FA 1AUSL 2HQDA 1HBUA 4ELTA 4IO9Q 2HHXA 5L38A 5C24B 3LWLA 2W7PA 1YJWS 1UVNA 1FNXH 5DDQC 3J80Y 3ENWA 4LF8F 2I5JA 2MZ1A 3JQJA 2J9DE 1UVJA 2XMAA 4TY8A 3HX9A 1UWBA 3RU0A 2MZQA 3M2UA 3UNYA 3QGPA 1T94A 2W9CB 1YWXA 5H9EK 3G96A 3PM9A 4FS2A 2VUGA 3VGSA 3H25A 5KFZA 4KAIA 5IXUA 5J1NA 1U1OA 3AFGA 2FJXA 3GFZA 3DGPA 3G9CA 1S12A 3NWRA 5EWEA 3O44A 4OYAA 2O66A 1LW2B 2QYGA 2MQNA 3A3NB 4H4OA 2DIUA 4YDXA 4B3MF 2LA6A 4KC5A 5ETQA 4B3TJ 4RNOA 1N6QA 2MQPA 5MLCV 4ZLNA 3CCLS 4ZCKA 3DXBA 4RNHA 4DX8H 5DLGA 1FXLA 2F40A 5K8OA 3M6WA 3MCNA 3W7BA 3HSJA 3AXKA 1RYRA 4CTAA 1CJKA 4QIVA 5CD4A 1NCLA 4N41A 1H73A 5HROA 3DLJA 1RT2B 3ZTRA 3RB4A 1OY8A 2CRLA 1L5UA 1V3SA 2PE8A 1KEKA 2OD4A 1T7PA 2IMWP 4FPRA 3CD7A 2R9LA 2VG7B 4LFCJ 1FNOA 3PYEA 5E5NA 3PG9A 3CC4S 3E01A 3CIZA 3OXLA 4DL6A 4NYOA 4EUVA 1RT3A 2FVSA 2ILYA 3O8WA 2O3DA 5B0CA 3KJVA 2D3UA 2CZ4A 4MKBA 2CPJA 1DBDA 5IT9U 4PG5A 1XEZA 3OJSA 3B4MA 1Q8IA 3LQVA 4UQTA 2J9EA 1YZ7A 1EJ7L 3R5AA 4CYUB 4C8MA 4NYPA 1T9WA 5DM7Q 5H9EJ 1KQFB 2E5LJ 2GV1A 4FN5A 5KT7A 1FDDA 3T1YJ 2J9DA 5C25B 4JI2J 4A8YA 3P4UB 4DQPA 2BRKA 3QIPB 3CD6S 1PJ7A 3M2VB 2CQDA 1JXVA 4DV5F 2BE2B 1IBMF 4YN3B 3RBXA 1TU0B 4ITSA 2QLXA 4IYQA 4USTA 4MK7A 3R6LB 2E9TA 2R7XA 5KG5A 1RXOB 1S1VB 2MKCA 5KFAA 4DR7J 2UV8G 7FD1A 1DHMA 1RT6A 2UUAF 4F25A 4TU8A 2PMHA 3M8SA 1WDDA 3CCSS 1OS5A 2ZEJA 6AT1B 2ZJPQ 2HFZA 3W63A 3JSMB 4FNIA 1LWFA 2EFPA 1Y00A 1SKSA 4NLPA 1LFPA 4ZITA 2H4WB 3M32B 3G87A 4RBUA 3LP0B 1UEUA 3KK1B 2WVCA 3TARA 1T95A 1SPBP 2VG5A 1J5OA 2IJRA 3TQ1A 2KT2A 2DNZA 1FD8A 3C8YA 3CJSA 1W26A 1IBKF 4QYZK 3TJ9A 3B78A 2ZM6J 4K4XA 2HEKA 2GVZA 1SJFA 1B0TA 2C22A 4J9NA 1NSKL 4U6PA 1Y5LB 3PIPQ 4C8KA 1YQHA 4AQYJ 1SV5B 3C15A 2P5VA 2R7UA 1IKXB 3OPKA 1GXLA 5AXKA 3G82B 4X64F 2WW4A 4QWEA 2CJKA 2HMIB 2J5AA 2ZKTA 4TU7A 5IC4B 2ZH6A 2J0WA 3DRSA 3M8QB 5HMZA 1I1GA 3IR6B 4AL6A 1L3VA 2WVFA 1LWCB 1V5IB 2U1AA 2E1MC 2RE1A 2AW0A 2RQKA 2QTWA 5ETPA 3K2YA 4O3QA 1ZOTA 3S6EA 4LRBA 1WHVA 2A6OA 3D66A 1OYDA 3UD4P 2MQQA 1H2VZ 1VS3A 2CAJA 1YRTA 3O5TB 3OFEA 4WFNQ 4U7UK 5ETLA 2KN4A 3QGIA 4ED5A 3WX4A 4LF5J 3NGSA 3BSCA 1KQKA 1ACMB 3EMTA 5LMUJ 4I2QB 1S4EA 2N4CA 2W25A 5IT9Y 4G65A 3DLGA 4ZVFA 1RWVB 4KFBB 2L41A 3MEGA 3QATA 5HBMB 4DG1A 4X65J 3GR0A 3ONQA 4BDPA 3MAHA 4DR4J 2C2KB 4QYZJ 3KLEB 2GHVC 4DL3A 2LYVA 4Q0BB 3BPSP 1S79A 1BD6A 2HZCA 4C8NA 3I4PA 1HD1A 2ZWPA 1RABB 2L3MA 3DGVA 2O01C 3D9BA 4FXVA 4HACA 4EBDA 4YR0A 1HNZF 5IV4A 2M5YA 1CVJA 1T11A 4RW9A 4ALZA 4DCJB 4UZCA 4KPCA 1Q8LA 4NLOA 4Q5VA 4DLEA 5HLFB 2MXYA 4CDIA 1UAWA 1FESA 3NRBA 1Y5IB 1WEZA 3VAIA 4F3QA 4NASA 4ANCA 3RAXA 2PEHA 1U02A 3QWPA 2GMLA 5GAHU 3GTYX 1S9FA 1QE1A 3NCRA 3Q89A 1T8EA 1WELA 4GC7A 3MGJA 3GPAA 1RAFB 1IKYA 4USMA 3U1LA 3KLGB 4LF8J 2FYXA 2IY5B 2FHMA 1N5YA 2HS4A 1M0SA 3QSIA 3C3LA 3HPOA 2FVRA 1UFLA 3KK3A 4IRCA 2B8QA 3FRZA 3CPWR 3IS9A 3NLCA 3ETOA 4BS2A 1SIZA 4NE9C 4F4ZA 2Y8YA 3S1TA 3CT9A 5KFMA 4B3OB 4I6YA 3QPIA 1RQ0A 3GJQB 3FEXB 4EU0A 1Y0HA 3GCXP 3J7YI 4IR1A 4B3SJ 4J9QA 5I42A 5DJBA 3MM6B 2QO3A 2RS8A 2C1EB 3EDQB 3FNNA 3TQEA 1TQLA 5J2MB 2FY8A 2FLLA 5L1IA 4WYWA 4E0DA 3EXCX 5KG7A 1ROFA 4QU6A 3BBCA 4QIFA 3H40A 1O6XA 1P9YA 4U67Q 4Y2MA 4C0OC 4DU7A 4CM2A 2CA9A 1REGX 1FD2A 4MIBA 2R2SA 4ZVUB 1FE4A 2VBXA 1NSPA 4J91A 5GADI 1YJTA 5FLXU 1K73T 3OL7A 1ZBTA 3SSQA 4DL7A 2DGOA 3SDEB 3LPYA 2XNQA 3BGLA 3ISZA 2AKWB 5HJYA 1H98A 4NLWA 3I5AA 1R0BG 3NWGA 5D15A 2UZAA 3AD7C 3BH7B 2W1BA 1NM2A 5IM0B 4B9NA 4JV5F 4HLBA 1X7VA 2FLNA 3LP2A 2CXEA 4NMXA 2CDQA 2MZTA 4F3OA 1U2CA 4JI5F 1LW0A 1TV6B 3IBWA 2ZOGA 2AD9A 4DV0F 4F4WA 1VHFA 1F2HA 2V4JB 4DV5J 4RPFA 1PC5A 5KT2A 2V68A 2OEJA 4B08A 5A8WA 2DRDA 3CO0P 2HK3A 2J7UA 2WAQD 1U1MA 4K4VA 3RB0A 1UW9A 1FK9A 3G6XA 4RBTA 3HO1A 3N6NA 4OX9J 1URNA 2P9GA 4NI2B 2UUAJ 2UUTA 1KC8T 3HF5A 5GAGU 4DPWA 3PACA 4F0HA 1RBOB 3UD3P 4ZKAA 2IVFB 4Y34A 4DMZA 1VIXA 4ES1A 5HP1A 2AQ4A 4QWCA 4PWWA 3ZZOA 4MYUA 3DXSX 3N6LA 2GS8A 2A1BA 2IDLA 3ENAA 3VAGA 4KHPF 1FDNA 1HHQA 3CD0A 2Q79A 3GG1A 1S6OA 2J6TA 2CPHA 3I6PA 2ZUGA 3DMJA 4OI2A 1IBKJ 2BANB 1F0XA 3BN4A 3OLAA 1FJ7A 2VZ9A 1QAIA 2XWXA 3NGTA 1U2FA 1YBUA 4LUBA 3VQSA 4PKDB 1NDKA 3W8GA 1RAJA 2M88A 2DR5A 2JH3A 1HMVB 2AWZA 3QAUA 1LV5A 3HD2A 1NKBA 1WSRA 3ENVA 1TKTA 3ZZ0A 4CLKA 2ROPA 1F60B 3V5RA 3HM9A 1FFWB 4WFBQ 3A3OB 2HRTA 4CRJA 2FQQB 5KFHA 2G0CA 4KHMA 4W90B 2OD6A 2NCKL 3ETMA 5LSLA 1JMTA 2XS2A 1HBMA 4U7UD 2Q3PA 3KHHA 2FHJD 5CZVA 1U48A 2DR8A 2B0GA 3LA0A 2EWHA 1IBCB 1RWNB 3IFEA 3SSRA 1JJHA 2BW7A 3SCIE 4DF4A 3KNAA 3J7AN 3B82A 2LMIA 3JQMA 3JTPA 3KLIB 4OI0A 5AXMA 3OR2B 3L7PA 1FA0A 2YBVA 4PRFA 3LP1B 3NXZA 1FRIA 1SI9A 1YJRA 4YP3A 1YTYA 2MLYA 4CNZA 2HQFA 3ILOA 4NZ7A 2OSRA 3M2RB 1UFWA 4DR3F 4O3RA 4K4WA 1O5JA 3UNGC 1KS2A 1C2PA 2HHUA 1NB2A 2AYBA 4OFZA 1FXDA 4O44B 2VQFF 4IQMA 5B0EA 2R2RA 3MUVP 1H7WA 4V19J 3D2WA 2ZZMA 4JI6J 3JTOA 2AGOA 4ZVTB 3ZTSA 1R8BA 2JEIA 1C0TB 1HKAA 3PEJA 1Z2LA 3HZGA 3IN5A 2W2MP 3QWUA 1X9WA 4LSZB 3P96A 1YITS 1YBTA 4R8UB 2E9ZA 3PX0A 1EQMA 3NCPA 1RAIB 4BLGA 3HDSA 4FKXA 4F36A 1LK7A 2B6AA 1VQSA 2DCUB 3UE2A 1XMBA 5E3RA 2K1RA 2GCFA 4NLTA 1VQ9S 4IR9A 4KH1B 1D9FA 4DN9A 5DG7A 5K20B 4DV6F 4DFPA 2QEXS 5A2QU 3QJJA 2BACA 3FVYA 3N01A 1BXNA 3QYYA 1AT1B 1DQAA 4WJBA 2K3KA 2R8IA 5HVGA 2POKA 2V63A 5F8LA 1JLGA 3BKTA 2F4VF 3IRWP 5G0RA 1N5TA 2UXCF 3RAQA 3VVTA 3V6DB 4L3KA 5CD4H 1FKPA 3IRXA 3PX6A 4PUOB 2Q6BA 3FCWA 2ZJRQ 4P2FA 1U1LA 5EN1A 4NRUA 3X3UA 2Y1RI 2KFZA 5ETNA 3OR1B 2G2ZA 3GV5B 3KHLA 2AT1B 1KLMA 2OI2A 4U7CA 4X62F 1Y10A 3TZXA 4JI1F 2ZFHA 2MLZA 2OMOA 3GIMA 5F0UA 5ITHA 4OYWA 5KT3A 5E3QA 2BX6A 5T41A 5HMYA 1G2EA 4DL5A 4IFYA 2VC0A 1EIYB 1HQUB 2HHWA 1RTZA 3HCXA 4ZCLA 1YI2S 3PZPA 3GR1A 3ZZYA 3PW2A 1SJRA 3BQ1A 5I3QA 1CJUB 4DUYJ 4Z7YA 1S0VA 1WHXA 1ZZFA 2HVEA 3C16A 5KFRA 2AX1A 4LRAA 1RA6A 5L1JA 3MOZA 1TUVA 3TUPA 2JEJA 3QIDA 3VGVA 2Q66A 1FNMA 2V8VA 4UOFA 2D74B 1FDAA 1JB0C 4OZ1A 1REVA 4JV5J 3R5GA 4KYZA 3I31A 4WFZA 3CO9A 3MWBA 2CPIA 2PGCA 1S7HA 4IH6A 4HEA9 4FS1A 2G2OA 2YPYA 1K9MT 3HKWA 4F4YA 1HW8A 2F3JA 1RA7A 2HW3A 2BQRA 2CPXA 1R0AA 3DYAB 1N88A 3VAFA 3LH2S 1NRKA 3Q8PB 2WONA 2DR6A 4RL1A 1WF1A 5L9NA 2YX1A 1LK5A 2UP1A 4YB7A 2YQ0A 2FTRA 3KLHA 3MD3A 2DITA 2M7SA 5B0AA 4ZP9A 1YHQS 2MEWA 3W8PA 3W5XA 5JMNA 2LKZA 3K5LA 5ETMA 2O67A 1OJ4A 4B02A 1S1XA 3IAM9 3W65A 1N5VA 1NNDA 2N4DA 3C66A 3MAAB 2R42A 1ULRA 4F50A 3D6TB 5A2QY 1XK8A 4P72A 4IFVA 3BV8A 5DGBA 4BHQA 3HT0A 3IA0A 3FMWA 1ZAWA 2XMMA 4KHPJ 1CJTB 3M9NB 1JJ4A 4OIXA 4RX6A 1D9AA 3Q8SB 4R0JA 4CLLA 1VLOA 3BSAA 2B9YA 5DM6Q 4ZN1A 2L9DA 1DJ0A 2OPQA 4P6QA 4X4VA 3KK2B 4WPAA 2XM3A 1T9VA 3CWJA 3G8QA 1XWLA 4LR7A 1ZTWA 3V6JA 3IAS9 4DBQA 2GZOA 1P8GA 3TVZA 3DRRB 2QL7B 3FSYA 2KDOA 5I4MA 3GFYA 2JFDA 4QPTA 1I94F 3HHLA 3EM1A 3UD5A 5EX3A 2QLJB 2YH1A 2ILZA 2G2YA 3BO2A 4B9UA 3I5CA 4R25A 3R1HA 2ZH7A 4QU7A 4OI3A 1VC5A 1VRUA 1BQMA 1PYSB 1YJUA 3DLKB 2ZDOA 4QW9A 5KFGA 4HYKA 1GMWA 4WYLA 1SC3B 3HI9A 1VQYA 1KHVA 5D4LA 3TAPA 2YKNA 5HQMA 2CWKA 1L3UA 2QZ8A 2R7QA 4DQQA 1NKCA 4JI4F 2CPDA 4DPUA 3ULHA 1KONA 1PBUA 3SZ2A 1S48A 1UPMB 1CS4B 3S8SA 1RWWB 2CPFA 3MM5A 1TKXB 5L46A 3HVRA 3IGVA 4KHRA 1HYSB 1WDTA 1AZSB 3NOGA 2HQCA 1MWZA 1ZPWX 5A0YA 4CH7A 4DR3J 5HN0A 3PY8A 2HFNA 4RNFA 4AE5A 2JLGA 5EUHA 3IM8A 3W66A 4A8KA 5BYSA 2Y0SD 1R6VA 5ETTA 4OHYA 4ZLLA 2H54B 5DZ7A 2XGPA 2HGLA 1EZZB 3DM2B 1NK5A 4Q2LA 1LEOA 4J9MA 4P2SA 4LF7J 3M6UA 3C6TB 3DLEA 4O4GB 3EYZA 3SFGA 5E41A 4RW7B 2C28A 2HNDA 5A8RA 2D1CA 2IAJA 3R5BA 3NGUA 3QFHA 1SQFA 2HLUA 2XY5A 4ZPTR 2YNIA 4ZOSA 3HHKA 4FF2A 2HIQA 1OSDA 3LO3A 5I3PA 2VIHA 3OLBA 4Y2KA 2AZ1A 4I0WA 3M9MB 2HVIA 2DGUA 4ER8A 5CXTA 2F4VJ 2XMKA 2KO1A 2UXCJ 1KTVA 1TR0A 4M5KA 4AXIA 3HSGA 2RF2A 3WX8A 3A13A 3GFHA 1LWEB 1GX5A 5J2PB 3THPA 2JFKA 2D7SA 3IR7B 2AU0A 4PYAA 3KLFA 3B8HA 3DOMA 3L4BC 2DBBA 2ADCA 1YJVA 2DY1A 4X62J 5KFWA 1UVLA 3PV8A 1K1SA 3MAQA 3Q8VA 3IMQJ 3HHEA 2QE5A 3TO8A 3ZTQA 2DHSA 3LAKA 2CQ3A 2P2CB 2O5DA 2EBEA 2KVQE 4I64A 2FJWA 4J7CA 2FIUA 3U7JA 3AOBA 5DQIA 4KT0C 1NPKA 3NOCA 1FEEA 4K50A 3MECB 2BKOA 1G3OA 4ZVEA 2F9DA 4RW4B 2ZKUA 1XMQF 2YNGA 1VK3A 4FDFA 1HQ2A 1VBYA 1UETA 2GA7A 3K58A 2KYZA 1JLQA 4A8WA 3DU5A 4WFYA 2MSTA 2EG1A 3W60A 2BVZA 3PRVA 4I56A 1WD6A 3LW5C 1S77D 1SH2A 1G6BA 5K8PA 3UO0A 5J2NA 3BPDA 2KB2A 2F1FA 2OEKA 4MIWA 3OVSA 3BDEA 3MPWA 3F56A 4J9OA 1LKZA 4KV8A 2XMUA 3IG1A 2XWYA 1QJHA 1AUDA 4YB6A 4E8UA 2BJEA 2HZVA 3NGRA 2MQ8A 1IJEB 2X1AA 3SFUA 3DN9A 5HMWA 2PDAA 4NEYA 4L72B 1JQGA 2RIJA 4F04B 4V19X 3T6BA 3DDNA 3SV4A 1J5EF 1TUGB 1EX8A 5KG1A 3PHTA 4Y2AA 2CQ2A 4B3RF 9ATCB 1KBRA 2RQCA 3DOKA 5KFSA 1XMOF 4GO5X 2VPYB 3K0JA 2YVSA 2DYAA 3I56S 1PJ5A 1U25A 1RKJA 4USKA 2DIVA 2XY6A 1M5OC 1CULB 1FWKA 2OFGX 1CPZA 2X1GA 1SIWB 1IN0A 1EKSA 3A12A 2O1PA 2BJ1A 1JX4A 1WI6A 1AYEA 1QAJA 4G3IA 4MJKA 4KPYA 4F3MA 4LVNP 1WNEA 1SC6A 4KBIA 1J2VA 3JAMU 3HKZD 1R0CB 3WIUA 5LSRA 2D69A 5DDPC 3SCLE 4DX7A 2VD3A 3EGNA 3MFHA 3QNWB 2PD1A 2RU9A 4ECTA 1C4CA 4NZ0A 3CD5A 3SBMA 5J2QB 2UU9J 1DTTA 4K4TA 4I4BA 3D4JA 3W5ZA 2GJIA 4S0MA 1I94J 2FJVA 4IRKA 4BCAA 3GYNA 2A2DA 4ILRA 4RU9A 1RHKB 3AJ2A 4ED7A 1UPPA 3ISND 4JI0F 1VLYA 3CTRA 1KD1T 1OY6A 4XK8C 1RU2A 4B9SA 2UXDF 2R8JA 4EO6A 2YNHB 4DFKA 3LUYA 5CCLA 4WXWA 1VQKS 2V2VA 2J9CA 4Q8EA 1YVFA 1SL1A 3NMRA 5D3GA 1SJQA 3CW2C 4ZHRA 4WE1B 1VQOS 2AHOB 3EPIA 3GJRB 3JQKA 1F1BB 1KVIA 2E7VA 3W9JA 1XERA 4LSLA 5GMEA 3CVKA 3HK2A 5E33A 3PNIA 2N82B 4C0BA 3AOAA 2YQ3A 2A2CA 4KGKA 4USHA 2G0JA 2AV5A 2DXDA 2W8LA 2MKJA 4ZIVA 4ZVSB 3BGRA 2E1AA 3PW7A 4KIAA 4J9KA 3UCUP 3GJTB 3KJFB 1T9UA 1WEYA 2LXIA 4JV1A 1H6KX 4NA1A 3FBEA 1ZM3A 5FIIA 5G4DA 3GE9A 2KVIA 1ZM9A 2IFXA 2DNRA 1WKLA 1AFJA 3C6UB 3PKMA 1HL6A 1RTDA 1HI8A 2CJ9A 3FBBA 2VL1A 4ICLA 4NCGB 2B4OA 4OV6A 2F8MA 1RAOA 3M1VA 4MKYA 2BV3A 1JLFB 2HNZB 5DS7A 4B9VA 3GLJA 2SXLA 4J5OA 4PWDB 3WQPA 4DR2F 1D09B 1JKHA 1YG0A 2ZNZA 3O6QA 2E5IA 3EVWA 3GG0A 3TJAA 3GYXB 3A8EA 2GC8A 5KFNA 1H38A 3MM7A 3D54A 4RZRA 4OZNA 3UWTA 3QZ8A 1T05B 1N36F 2V0NA 1B4SA 4GVBA 1TUWA 1DTQA 1K44A 4DFMA 2IC3B 1DLOB 2IA0A 5LSOA 2RS2A 1UTAA 4X4QA 4KRWA 5KFQA 3CJ0A 5D4NA 3CJ5A 2AJ0A 5BJRA 4ILMA 1DAXA 4FYVB 1WOSA 3KJNB 4AL7A 4H4KC 1S1UB 3QZ7A 2DPJA 1KNZA 4CI0B 2GJ2A 2XY7A 1U0HB 4GC6A 3W1YC 3CCRS 3E2EA 1X4EA 2FC9A 4DV7F 1RU1A 4KE5A 3W5YA 2LQ9A 2VHGA 1AROP 2BJ3A 1X4DA 4Y3CA 4ZA1A 3T5HA 2W8KA 2LLZA 2VA3A 1A7GE 3QQCD 2IM2A 1FJCA 2WOMA 1U1PA 2JSXA 2VG6A 2FUG9 2ZD1B 2LP4A 4NA2A 2QX0A 3MMBA 5CYQA 3NAHA 1KOOA 1HR0F 1XNRF 1NLKL 1S1TA 5GAHI 2ZZTA 2YKAA 4CLYA 2C42A 1VI7A 1LWXA 4C8LA 3AOCA 1VHIA 3MEEB 2H5EA 3KWMA 4Y28C 3P49B 3VAMA 2BM1A 1S9EA 3V4MA 1V3RA 1Q82T 1FT8A 4OHZA 2FZKB 7FDRA 2BKPA 2MYFA 2ZH8A 4WF9Q 2OPRA 3THVA 3QT6A 4WK3A 1NMEB 2ZJQQ 1HPZB 2FLOA 3HULA 4H4MB 2V4RA 1NAQA 1IKWA 5BYRA 2LEPA 3QO9B 1KDNA 3QMQA 1C0UB 2F8HA 5K5MA 3L95X 3BS9A 2EW9A 2GGPB 2PN6A 2RH3A 4DPTA 1Q81T 4C11B 3POTA 3SQOP 4I7FA 4UOCA 1RWPB 3K89A 4DX6A 1AA1B 1DARA 2V50A 3FQLA 2EC2A 3NGKA 2ZOFA 3K59A 2Z30B 2P9EA 3I55S 4DN0A 2H3EB 3H5YA 2NQPA 3DI6A 1FWPA 1ZTTA 1XJWB 1TELA 4K2JA 3LF0A 2DH8A 2HBYB 4DV2F 3KLVA 3BYRA 4NX9A 3TP2A 1TL1B 1U47A 4L6V3 4MFBA 2OPPA 1HWIA 5HVFA 5AXNA 4LF6F 3FEZA 3R7NB 2OPSA 3T6JA 2WSEC 2M3DA 1EETB 5HQ8A 1SJ4P 2RMLA 5M2RA 1HD0A 3NMAA 2GAHC 1KKHA 2AEJA 1O0PA 3B4DA 4MKAA 1NH8A 2CDRB 3DRYA 2MQOA 1FF2A 4PYDA 1B3TA 3PO4A 2JDJA 2L08A 5LJ5Y 2KZZA 2UUCF 2JEFA 1SH0A 3CJRA 3CJTA 3CMES 4KR0B 1HI0P 4XTTA 2NXEA 3ZFVA 5KOXA 1VC0A 1RT4A 2ABYA 3R6GB 2MY8A 5GMKa 4Q44A 4PABA 3PO5A 4ZPDA 2ZBRA 4JV0A 2EXUA 1WC4A 2J76E 2NXJA 1FERA 1Z2ZA 4WU3A 3PCOB 3FFIA 2I9SA 4PCQA 3MMCA 3NG8A 4F2SA 1HBOA 1A6LA 1D8YA 3NBPB 1MROA 4IUFA 5KG2A 1E6YB 1JLCA 1BHNA 2C3YA 1Q4RA 4OHVA 1ZA1B 1UVIA 3O1LA 4JI0J 1JLAB 4J90A 4J9UE 4KO0A 1UL3A 2E5GA 3P8BB 1S97A 3I87A 3RW7A 5GAGI 2GW8A 4RUHA 2IIHA 3IM9A 4DPOA 2AF6A 2LEAA 4DSJA 4NMLA 2CJQA 4P74A 3MFIA 2W9BB 2C2MB 1WSVA 4ETXA 2BOPA 3R1LA 4K4SA 4X4TA 3CC2S 1GEHA 1LNQA 1HNIB 2XYGB 2M0GB 1RYSA 5T7LB 4DXLA 1G1XA 3BGUA 2NYIA 1W25A 2QT7A 4QWDA 3V4IA 2F65A 1N33F 3GJSB 4FZVA 2B5JB 2CFXA 2HHHF 1H3DA 1RT7B 2DHHA 2UVVA 1QVFR 1LFWA 2BW2A 5K14B 1IM6A 2QA4S 1L3SA 1PCAA 2ZHBA 2JOQA 2B9EA 2M2BA 2XEXA 4KGVB 4JYAF 1FCAA 1JLBA 1ZAXA 1G7CB 2A6MA 3QT7A 3UVJA 1VRTA 3CULA 4UUWA 1QSYA 2Y0BB 4TXSA 3OUYB 4C8ZA 1L3KA 1ZM2A 4ZP6A 3JYTB 3AB4B 2QSWA 5MAOA 3U02A 1PSDA 2YNFB 4PG7A 2J6UA 5M2UA 2V69A 2EFQA 3PXGa 5KG0A 5KT5A 1ZYQA 2IM0A 2XMTA 1WUUA 2MKSA 2WTFA 4ANDA 3DOLB 2QJ3A 4N8OA 5KFVA 4EBCA 3H5XA 1EP4A 2HZAA 3L7OA 4RW6A 4C48A 3TYTA 3QGHA 3W2WB 4P71A 1LXNA 1Y4ZB 1N36J 1RT1A 1V5VA 2IRXA 4LSNB 4ZVPB 3DLLQ 1SKRA 4HR2A 3JXOA 5H9FK 3HFVA 2LXFA 3NY0A 4IG3B 2X3GA 3PW4A 2BQ3A 1FTCA 3HVTA 4LJMA 1RTJA 4M5MA 3T1HF 1WACA 3TRGA 2NZ4A 3KMSA 1U1RA 2G13A 4FYWB 2KH9A 4FVCA 4DV7J 4TY9A 2KXHA 3PYFA 1VOMA 3KXDA 4HH0A 3MTKA 3WDOA 2JZ5A 1NJWA 4U8VA 1HBNA 4BBYA 2CQ1A 4CIOA 3SMZA 3PIOQ 3NP5A 1CC8A 5LT5A 4EI2A 2Q43A 1U1QA 3FKBA 3KOAA 3VAHA 4F4AA 1S6QB 2VODA 3MM9A 4EEYA 1DFDA 1H2TZ 3T1AA 1JLEB 3R2DJ 3W9IA 1HNVA 4W92B 1CJVB 4PQUA 4LVOP 2Z58B 2DXEA 3L9ZA 1M5HA 1VBXA 1TL7B 3AJDA 3QJLA 2HSEB 2N7YA 3FDSA 3MPUB 2VBYA 4PXBA 3BQ0A 4M1KA 4G1QA 3H0PA 1Q53A 3HJFA 2VDIA 1TMMA 4LF4F 2CQCA 1Z1ZA 2J6SA 1RTIA 5C7PA 3EWGA 2R4FA 2KKHA 2KHDA 3T19A 3CJ2A 4QIWD 1RLDA 2MZRA 2GIRA 1IKVA 3M30B 1ZM4A 1NB7A 4YQWA 3K5NA 2BM0A 1E6VA 2H5IB 2Z0GA 4IO1A 3NKYA 4WIIA 1F5BA 3BN7A 4ED2A 5DG9A 5GMDA 1GH8A 3US5A 2HWIA 3FBCA 2OSQA 1TK8A 5CHCB 2GVDA 3GP9A 4OX6A 4NL5A 4Y2CA 3FJ2A 3ISNC 1N0VC 3HFZB 5KFKA 1C1BB 3SYZA 3M8PB 2Q1LA 1ELOA 3H5UA 1R89A 3MEDB 4ZLPA 1U24A 5B08A 5IT4A 4HKQA 4K59A 1VQPS 4WK1A 4DSIA 2KT3A 2C3UA 1SH3A 2BKNA 4WKRA 4LF6J 2CVIA 2NR0A 1IBLF 1JXLA 5DQHA 3NAIA 1IWGA 4IG0A 4FBUA 1TKZA 3CMAS 1U6BA 1OIAA 2G0IA 4A8QA 1U8SA 3MMAB 4CLPA 2QLBB 3S01A 1C1CB 4RLEA 3DHXA 1RTHB 1U09A 2UUCJ 3ZNUA 4FF3A 4GRSA 1X4GA 3H2UB 4PXEA 3WZ0A 3QLHA 2DNLA 1FTRA 1S1WB 3A1YG 3Q2SC 2XG8A 3MM8B 3D0IE 4DQSA 3D6HB 4LF9F 3I0SB 1VQ4S 2ZE2A 5EGYA 1YJ7A 2H48B 2HNYA 2XNRA 2CPEA 1EAYC 2XS5A 1YJNS 4WXOA 1RBAA 3LGMA 2JJ4D 1KN6A 1NJIT 1RUSA 2R2UA 3N28A 3BKFA 4KKOB 3TAMA 1H0HB 1HQEA 1ITPA 4NLSA 3PR4A 4OI6A 5ETRA 1X0FA 4RW8B 1Q5VA 2EPIA 1BQNA 3JSRA 2EI5A 4XIUA 5HI7A 1YLXA 4NA3A 2RNEA 4CO4A 1YKWA 2YKQA 3LGNA 4USWA 1N33J 3BBBA 1NDCA 2X7IA 2HHHJ 4ED4A 3HP6A 1RAEB 4ED8A 1BE4A 2L9NA 4C6AA 4LIRA 2CJBA 5FDLA 4MH8A 3SQGA 1YZ6A 5DLFA 3ZZZA 2PI4A 4IDKB 1GQEA 3PJWA 4JYAJ 2XBPA 4LFAF 1Q7YT 7AT1B 4OLOA 4ZVGA 3BR9A 3M8WA 2VC1A 3CJKB 3ET6A 3FBFA 3UDEA 2G9OA 1U45A 2P6TA 5HMXA 1IJFB 2F7VA 4L3NA 4CQ1A 1BUXA 3MPYA 4O0NA 3QRPA 3AHPA 1T03A 3SV3A 4LMZA 1U1NA 1S76D 5CYMB 3TEGA 4EZ9A 3T5KA 3VGUA 1B64A 2HAFA 3PW0A 3D6MB 2E1PA 1DURA 2RDJA 4DUTA 4M5DB 4OYXA 2JLFA 3UN5A 3MHYA 4A8MP 2YWKA 1OPIA 3AA9A 2A0FB 3D5MA 2OP5A 1HBUB 3SCKE 1MMDA 2WSCC 3UDCA 1Y3JA 2D9OA 4QR0A 2MGZA 1Q5YA 2I8EA 4ERDA 2IVMA 2KM8C 2AZ3A 1TVRA 2I5JB 3HHLD 4DSKA 4ZPAA 2V94A 3MXHP 4TY8B 3GILA 1UWBB 1CLFA 2NXNA 3DU6A 4C3KA 4CH1A 3M2UB 5IFMA 2EFGA 1V6HA 2ALYB 2WZ1A 5D4OA 3T1HJ 4CZCA 1JK9B 5KG6A 2AYMA 2VICA 3WBZA 5LJ3Y 4GMKA 1R43A 1RT5A 2Z2YB 2QLFB 1GMWD 5LXYA 3MPVA 2YX4A 3QFWA 3DGPB 4H4OB 4ZJLA 3D7SB 1F3VA 5AJ3J 4HHHA 4DV3F 2AP6A 4DSFA 1N6QB 2Y8WA 2HS0A 4UT4A 4N5SA 1MU2A 3H8YA 2RVJA 1BLUA 4K4UA 4O3SA 1K8AT 1VBKA 3W2VA 5GVQA 3LGHA 4DUZJ 3ADAC 3HHDA 1HARA 5DDRC 4LFBF 4CTAB 1CJKB 4C97A 4A8FA 2HRYA 5HROB 4X4PA 4ENOA 4X4OA 2XZWA 1N52B 1SUQA 4FPIA 3R8YA 3JS9A 4M5LA 3CCVS 2HHSA 2RAQA 2DTJA 2DGVA 1VISA 3E01B 1TTHB 3FC9A 3IP0A 4LBHA 1KOHA 3D1QA 1RT3B 1M1GA 1HNWF 2M9KA 2Z8QA 3KJVB 2LQ5A 4HDHA 4ATNA 4LF4J 1EQ0A 2D41A 1U0SA 2QMWA 5KT6A 1NSAA 2VJVA 1PO6A 2JL9A 1TAUA 4YR3A 1R3NA 2Y3YA 1X60A 4LRCA 3SCJE 4X66J 3IXQA 1S9GA 3R7BB 3I9V9 5EX0A 1GTHA 2RKIA 2NSCA 1N5QA 1IVZA 4NYZA 4JI8F 2N3LA 2E5HA 1WORA 3L09A 2CQ0A 4I69A 3D0HE 1TFYA 6FDRA 4K4ZA 4XDDA 2BE9B 4CLFA 3CJ8A 2DRBA 2P8IA 2X51A 2A10A 2B51A 5HATA 3GU0A 4R5PA 2GO9A 2HBQB 1NZAA 4DV1F 3DRPA 3A4TA 1UMJA 1TL4A 2WSFC 3BGOP 3CNQP 4ZVHA 1TL3A 2XCPA 1PYOB 3HXMA 1GTEA 1VQNS 1RT6B 1RWXB 1IBLJ 3D1OA 1IUJA 4FP9A 3OHBA 2H1YA 5F8HA 1FRMA 2BDPA 5CAAA 2VPZB 4AT1B 4KGMA 1GK8A 4K7QA 2ASJA 3CF5Q 1LWFB 1XC9A 1IQZA 5J1PA 2AGPA 2XMVA 4UZBA 1M5SA 4DR1F 3IWLA 4OYOA 1AFIA 2VG5B 1J5OB 3EZOA 1S6PA 1FKOA 4B3MJ 2C3PA 5ETVA 2DJWA 3AAWB 2E29A 3JB9k 2RDIA 2CQHA 1OQ3A 2Z56B 3ITHA 2GVZB 2QG9B 2DCLA 3I0RA 4IH5A 2VOOA 3C14A 3EVMA 5DRKA 3G4SS 3CMQA 2J8AA 4TU9A 4LF9J 2IMOA 5ETKA 3C15B 4EMDA 1S49A 2CQIA 3TZYA 2YX7A 4AFFA 2DNOA 3DRSB 5HSPA 2GAGC 4WZMA 4Q2MA 2DGWA 2AJQA 3R27A 2H4YB 4PXDA 5KTQA 1T3NA 4B3TF 4L73A 1WI8A 4ID5A 2FHOB 1GXUA 4J9VA 1PBAA 5ETSA 4UF4A 2ZHOA 4F0KA 2AEFA 1RGVA 2FVQA 4I2PA 2IM1A 5EDWA 3UN2A 1UP1A 2XSJA 3I96A 1D0EA 4X84A 5CABA 3ILLA 1F2GA 5AT1B 4RUAA 2CZ9A 2QL9B 2YKMA 4ECUA 2APOA 4N76A 1F9HA 2JC0A 2DHGA 2KHCA 3DLGB 3KG1A 5RUBA 3BDPA 4ZVQB 2J8SA 4LFCF 3MEGB 4DG1B 1JJ2R 4F2RA 1IBMJ 2RSQA 4EBEA 4Z7CA 1H72C 3D3BJ 3NNAA 1ZZNA 3KDOA 1OQ6A 1X9MA 4GVLA 3VTIA 2PA3A 3UCGA 2XHWA 2BYCA 2B4UA 3OSNA 3H4BA 3BZQA 5J1EA 3V6HA 4M5GA 1NJZA 1VBZA 2ROEA 5C42A 4HACB 1RB0A 5I3UA 3FZ2A 3R2CJ 4NWBA 3T9ZA 2W4CA 3CCQS 4ZJQA 4RW9B 4A4JA 4EWTA 3T1YF 2RB7A 1UVMA 4QW8A 2NREA 2HYIB 5A8KA 5KFCA 4JI2F 1P1TA 3V81A 5F3ZA 2OJ3A 2VASA 5KFTA 1RKIA 2XSFA 1UEKA 4DV4F 1U6FA 3OTCA 1W7WA 4F4XA 3TNVA 2CNLB 3M8ZA 3Q2TC 3RRKA 4MK9A 3W9HA 5E0OA 5C24A 4FKYA 1QE1B 2V5HG 3QJPA 3EXYA 1XIQA 1MW7A 1Q8BA 4K5RA 1IKYB 2XMWA 2KTQA 1N5YB 3MR5A 2RJZA 2WHOA 5FJ4A 3KK3B 3LOUA 2ZH1A 4OZ5A 1MSWD 3NEKA 3H42A 2DK2A 1K0VA 3IS9B 2W9CA 1KR4A 3FCVA 1VK8A 2WBMA 3AD8C 4OX7A 4X64J 5F8GA 2ZVIA 1MLAA 2EKYA 4QR1A 4LR9A 2J0XA 4J9SA 1XQIA 4RWXA 2OKQA 2HIYA 1LW2A 4DV3J 1BC6A 5I42B 4U9RA 3OHAA 2EFOA 3THTA 4J9PA 2OELA 3BR8A 2E1RA 2KRBA 3OT9A 2YY3A 2MQMA 4LF2A 3TZWA 2VFSA 3AY0A 2W2PP 4H54A 4A8XA 4LFBJ 4K2XA 4M5IA 4YDDB 3H2LA 4DHVA 2F9JA 1NBEB 3TUZC 5IZHA 4YMEA 1RT2A 3GQCA 1NU4A 2DXFA 4EO8A 2E7XA 2OTLS 2CYYA 2FB0A 4TYBA 4LF1A 2VG7A 5F8IA 1CQNA 1FJEB 1KFDA 3CCMS 3BSNA 2JX2A 3MTJA 4C9DA 4QWAA 4AL5A 1V3ZA 2YQ1A 1Q78A 4TLQA 1WG4A 1IR0A 4W98A 4PG6A 2G4BA 2VF3A 3OVBA 2DGXA 4CYUA 3Q24A 4G1IA 4ED0A 3BYPA 1HNZJ 4O0IA 3LP2B 1XNQF 4OHWA 3PW5A 1KVJA 3RZAA 1U8WA 5C25A 1U6ZA 2VQEF 1LW0B 2GNKA 1QD1A 2CQ4A 4QBUA 5IS2A 4C2MA 3QIPA 2H65B 1F5CA 3M2VA 3G71S 5E3AA 5JUMA 3PYDA 3CSKA 1TK0A 2BE2A 1ZS6A 4DR4F 2PFDA 2QC3A 2B4VA 5A8WB 3EZ5A 2GHWA 2KL8A 1N32F 3L7UA 4NPOA 3F0NA 1FK9B 3WHIA 2VA2A 4A48A 3CCWA 2JVRA 1S1VA 3PTWA 3GSDA 1RISA 4CO1A 2R7OA 2HK2A 1KVKA 1WF2A 1CG2A 2XMJA 2OUGA 2PI5A 5D8HB 5HP1B 5KFIA 2LQBA 1ZPVA 1RADB 3JSMA 3K8VA 5IT0A 2VJUA 4FNHA 2IM3A 3M32A 5HK4A 4DR1J 3LP0A 3G86A 3KK1A 2QMUB 3MMJA 1R8CA 4ZVRB 1KFSA 3VR1A 3BKUA 1RZMA 2KJVA 3DMJB 4YR2A 1RHMB 3OVAA 4QIEA 4Q7AA 3UDLA 5CA5A 3MR7A 3OJUA 3CDUA 4DSEA 4L75A 3QSYB 5DG8A 2QFIA 3D3CJ 2EK1A 5D4PA 4RJVA 2OHDA 3D0GE 2W2NP 1FRJA 3JSYA 3HVAA 1SQEA 1O51A 1Z4UA 4CLTA 1SV5A 1TKTB 3PJXA 4L74A 3J81Y 5B0DA 4YEAA 1IKXA 4RO0A 3QT5A 3G82A 4NLQA 2DPIA 1URRA 4HT7A 2HMIA 3M8QA 2GFFA 5E7OB 4I1TA 1HWUA 2FGCA 1X31C 1OSCA 1VRQC 2N3OA 1TKDA 1LWCA 1GMVA 5JXSA 1P9QC 2P6SA 1HBMB 4B3SF 4Z37A 2V2QA 3AH6A 4OLPA 3TWZA 2KFNA 1UKUA 3BEGB 2JWNA 2VDHA 1UZHA 4O3OA 4EYHB 3HHLC 2HQ3A 2CPZA 3VHQA 2V9KA 1DQ8A 3P6YC 1FVQA 1NDLA 2CUYA 1KTQA 5KFYA 3KMQA 2DO4A 2QGFB 4I2QA 3K8WA 5F3TA 2X3DA 4JI5J 2MQLA 2MKYA 4DV0J 1X5TA 2CNKB 4BWJA 1SJ1A 2ZVSA 4KFBA 1RSCA 5HBMA 4HTIA 4DSLA 4WTYA 3TR5A 4RBVA 4ZLJA 1FRXA 3KLEA 1ZETA 4Q0BA 2RHSB 4FBTA 2VB6A 2HKEA 1Y5NB 1FFGB 3KFWX 3M8YA 2FVCA 2ZBIA 1N48A 1K0TA 2Z4PA 4N7TA 4NXMF 4QOTA 2PA8D 2K06A 3M7VA 5JJBA 2XTJP 3OTOF 5F8NA 2V6AA 4JV2A 2J7WA 3PR5B 2H9ZA 1WOPA 5D0HA 1K1QA 4F67A 3K5MA 4DV4J 5HLFA 3BSOA 3PHEA 2B6AB 1FEHA 3MPDA 1V9OA 2K1RB 2JC1A 3RGIA 1VQ6S 1BWVA 3R5CA 2YWHA 4EYIB 4XO0A 2DR9A 1WC0A 1R31A 2QN6B 3A8IA 4Y65A 3KLGA 2HVDA 1MMNA 2RQ4A 4ECQA 5KFOA 2IA6A 3IWXA 3RB3A 3CDBA 4OX9F 5AXLA 1JLGB 4K4YA 1A0OB 5G0RB 1VFJA 1UEVA 3FCHA 5K9FA 4C3LA 4YHHF 1FKPB 3IRXB 4TNOA 5HQLA 3LTOA 4B3OA 1R8AA 2DNHA 1YRXA 5EWFA 2W2OP 2RQMA 2WB4A 2KFYA 2CVEA 2C3MA 4P10A 1W2IA 1KLMB 3GV8B 2AJ2A 1HWJA 4LQ9A 3MM6A 4JB8B 5LM7E 3HHNB 1S5ZA 2GJFA 1CEZA 2DGSA 1MMLA 5J2MA 2UVRA 2L48A 3TVYA 4MK8A 3N5FA 4NLGA 3H59A 1W2BR 1S4FA 4IFYB 5IWAF 3IWNC 4YOEA 4CLUA 4DCOB 1SL2A 4MKVA 5DO2A 5HJXA 2V34A 3Q23A 4P75A 4F02A 3U27A 3RBZA 2EVZA 1F6TA 2QMXA 3BO4A 4KTQA 3UFCX 1OY9A 4F4KA 1MN7A 3C16B 4M94A 4LRFA 2LEBA 3TW0A 4UY85 2FJEB 2MKHA 2VQFJ 2FJDB 1X4BA 2WVEA 3H2VE 3SDEA 3AT1B 2KZMA 2OGUA 2LFVA 3Q8UA 3TUIC 3KNGA 1SCJB 5AE1A 3M05A 1REVB 3ZZTA 1R7IA 2JRSA 5IM0A 2BABA 4UUXA 1QM9A 4USVA 1XNQJ 4CH0S 3EICA 4PR6A 1UW4A 2HS3A 2VQEJ 2ZUAA 3EUNA 1PILA 1WG5A 3G6VA 1TV6A 1OO0B 4C8YA 3ICLA 1R0AB 3PDNA 3UN3A 4Q8FA 4RNMA 2V4JA 2HLTA 2WONB 2CWXA 3K17A 4HI1A 2VFTA 2ZDPA 4J37A 2D9PA 4JUZA 2D3O1 1GMUA 2KYXA 2Y1JA 3KLHB 2DISA 4DV6J 1N32J 2XGQA 2KXNB 1YGYA 1WWHA 2FY1A 5K8NA 5HANA 3OFGA 2ZITA 3Q8QB 1SVDA 4JI6F 4K5SA 1YK9A 3Q8RB 2MTLA 3HLUA 4NI2A 1HWKA 4KGXB 3EPGA 3GMGA 1S1XB 1I5OB 4OJ1A 4I67A 1SXLA 2IYIA 2RU3A 2EC0A 4IFVB 3LANA 2EFVA 1BGXT 2BJ9A 2XLJA 3CJ3A 2DKOB 4OI4A 3M9OB 2YWGA 2NXCA 8ATCB 4C98A 1FX4A 2A18A 1B7YB 1Y9OA 2OPQB 2LDIA 4JI1J 2AMCB 1U26A 2BANA 2IRYA 1RWUA 2V8HA 4CT9A 1RWOB 1B0PA 1NUEA 2AGQA 2EFNA 3P45B 1RCXB 1M5KC 2IYGA 1PKUA 4WP9A 1HMVA 2Z2LA 3HHLB 4CO5A 3NNCA 3KYLA 1QTNB 1NK4A 3P5BP 4XAKA 2AYGA 2N7CA 3V2UC 1RK8A 3BO3A 3NGDA 4LQ3A 2R7RA 5CCMA 5E3PA 1TP7A 1T3OA 2FC8A 2B8PA 1HHSA 1VRUB 1BQMB 5DZ6A 5LL6d 4ZK7M 1MNEA 3KG4A 2YTCA 3H98A 3J7Z5 1NO8A 2YKNB 4HHUA 4P7TA 2LXUA 4ZP7A 4MYTA 4PPZA 3H4DA 3GIJA 1GNKA 1NK7A 4KB7A 4IOCQ 3KLIA 2WRMA 3OR2A 3LP1A 1WC5A 1PAUB 2NUUG 3MM5B 2UV8A 2PFFB 3ZO7A 4DUYF 5A0YB 1U49A 3M2RA 1QLNA 2MPUA 4OZ0A 4O3PA 1P6TA 2G1HA 1S7IA 5BR8F 1NKEA 1Y7PA 1QAXA 1FI4A 5CZXA 4OYBA 2V8GA 4O44A 2G1DA 2BZ2A 5F41A 2B3TB 1NHUA 2LQ8A 3VAJA 4ZVOB 4EFAC 4NXMJ 2UUBF 4X2BA 3DC2A 2HRUA 4F0MA 3X1LB 1C0TA 4WP3A 2PEBA 1NZ8A 3OTOJ 5DDOC 4C8OA 4J9RA 2ZZNA 1CQMA 2MLXA 3GZ7A 2BJ7A 3DLEB 3TOQA 4R8UA 3TX8A 2B4PA 4YB5A 2XHCA 2HNDB 5A8RB 2IAJB 3QRRA 1I6JA 2ZC3A 2AJFE 3DLBA 2OO4A 4O23A 3DDKA 2DH7A 1M1HA 2PC6A 4YFUA 1VQ8S 2LA4A 2VKZG 3BM7A 4ECWA 4ZIWA 1UA1A 5KAKA 2YNIB 3BREA 4JI3F 3R3TA 1X5PA 1FJGF 4P2XA 4EK2A 3VVUA 3TEHB 4M95A 3UDVA 3RYLA 1T0TV 3TX0A 3D68A 2VOPA 3RB6A 5A6PA 1J27A 2V8PA 4IOBA 4PPDA 4RUCA 1QUPA 2OEMA 1PGZA 4IRDA 2RF2B 2NSBA 3UCZP 1VGYA 4YHHJ 5B0BA 3V6DA 3SXLA 3G2XA 2GQCA 4PUOA 3K5OA 2UUWA 3M6XA 4Y2IA 4ZPWR 3W61A 3BB5A 1F3FA 4LBIA 4WU2A 5BXIA 1M5PC 3KLFB 2XI2A 4N77A 3EJMA 3DOMB 2JHEA 1R27B 4OYZA 3OR1A 2ZHAA 2HFOA 3MD1A 3AXMA 5F9LA 1KQSR 5SZTA 3RTVA 3S7RA 4O3NA 2QFJA 4JI4J 4G6VB 3CGIA 3H7HB 4FYXB 5IWAJ 2K8GA 1X5OA 4PXCA 2GMHA 1HQUA 4USIA 3ZZRA 3OQ2A 4ECVA 5HVHA 3OL8A 2NPFA 2VFRA 1TAQA 4DFJA 2W9AA 1I3OB 1JXEA 1CJUA 3A8KA 2MJNA 4Q45A 4UQGA 1JIHA 4K8RA 1RLCL 2YNGB 3OXFA 2J0QD 3EVOA 3OTBA 4CLSA 5LOQA 1JLQB 1HA1A 4MTPA 4DX5A 1H2UX 3WC0A 1AXQA 3CB4A 4WZQA 2OIHA 4HH1A 1DY3A 2HQIA 2VBWA 3K5PA 3R9LA 3IR5B 3I32A 5J2NB 3ZTPA 2UXBF 3WC2A 2PT0A 4KV8B 2YWFA 3Q86A 5GAEU 3ZZPA 3IG1B 5C5JA 5FLXY 1U4BA 1UVKA 5LXRA 3E8OA 2HURA 3HT3A 1NJYA 2FHKA 1HWLA 1RHUB 2E9RX 2DNYA 4P52A 1QUVA 2IHR1 3DYAA 2Q6CA 4X4NA 1X8DA 2GHPA 3R5DA 1X4FA 3R7SB 2E1CA 2J0SD 4AXJA 2BR0A 3DOKB 4NOHA 3CDAA 2LCWA 4JBCA 1NH7A 3FEYB 3KHGA 2RRAA 2IJNA 4C3MA 3TZZA 3GFXA 2VBZA 2BBEA 1AW0A 4DOZA 4U96A 5KOWA 4OX8A 1FX2A 3OXGA 5ADZA 1ICEB 4LF7F 3MAAA 1RAAB 2Z57B 3BGFA 4JP8A 2HQGA 1FVSA 5IQ6A 4OZ3A 2RRNA 1CJTA 2DNPA 1VR6A 3NS6A 5B0GA 2AJ1A 2DB1A 5F9NA 1PC4A 5KG4A 5DQGA 4LREA 3HSZA 4CO2A 3HJVA 3AD9C 4KH0B 1TZ0A 1UJ6A 3CUNA 3KK2A 5M2PA 3EZUA 1HFEL 3R5JB 1Q0NA 3OBIA 4DR6F 2K7KA 4UTGA 4ED6A 3RW6A 1DTTB 4OJGA 2AIRB 4ES3A 3GONA 2HPUA 3DRRA 2D3ZA 2W24A 2R8GA 1SJ3P 2E66A 2ZBCA 1B7FA 2QA2A 2CPYA 4A8OA 1SKWA 3DDIA 3DKDA 2QA4G 4DWIA 2K7JA 1GXTA 2P9CA 1XMQJ 4WFAQ 2E44A 1RP5A 2B7CB 3OSPA 3GV7B 1N8RT 3DLKA 4YB1P 2QIFA 4FYYB 4LR8A 4O4RA 9RUBA 5B09A 4NLUA 4CWBA 4UOHA 1UFKA 2ZH4A 5CYJA 5D3GB 1VC6A 3LWMA 3CC7S 3EDRB 2MKKA 4ZHRB 3IBFB 4OYPA 4LSLB 1Q7LB 1CS4A 3I5BA 1TKXA 4XDCA 2BOAA 5IOLA 1X4AA 2HAIA 4TKTA 2QSFA 4B9LA 1HYSA 3KHRA 2BE7D 1AZSA 3DFEA 5D0GA 3BGRB 2HVHA 3N79A 4LBPA 2QLWA 3VQTA 5BR8J 1U2RA 1J5EJ 4TLRA 3KG0A 2QV6A 3H20A 4B3RJ 1MG7A 3O2IA 3TI0A 1SBRA 4NXNF 1CC7A 4K0KF 1XMOJ 2ADBA 4URQU 2UUBJ 2CNNB 1RTDB 2Z2ZA 4FVMA 3OTDA 4ECSA 4ICLB 3ZZUA 3DM2A 3SI8A 4X4UA 3M1VB 3V6KA 3FMBA 4DZDA 2VV5A 2VPXB 2ZBQA 1Y11A 4OQJA 4WP8A 3C6TA 5IV3A 1I51B 1ZA2B 3H90A 1JKHB 1FE0A 5F8MA 4O4GA 2E7WA 4HI2A 4URSA 2C2DA 4RW7A 3UR0A 3MM7B 1Q95G 5L1LA 1NEEA 1C4AA 2IRUA 4JI3J 4GVBB 1OYEA 4DCPB 1DTQB 4KQZA 1NDPA 4ED3A 5LMNF 1GFWB 2HGMA 3M6VA 1FJGJ 2HGNA 4HVZA 1S6UA 4TVAB 4IQXA 4CLZA 2FDNA 3RRHA 5IC6B 1R8PA 1X0PA 4D3GA 2F5GA 1UWAA 4QZVB 4I68A 2MZJA 2R3VA 4OI1A 4UY8T 2ASLA 4Z2XA 2KG1A 2WVBA 2C2NA 2CJYB 2IBKA 5A76A 2CG4A 1LWEA 2YWEA 1Q86T 5J2PA 2B9WA 3G8TA 4DJBA 1N5SA 4IOAQ 4QR2A 2UXDJ 3KDNA 3NNHA 1YJ9S 4ZPVR 1QTMA 1UA0A 3FSXA 4M5JA 1B70B 3PJ9A 4CLWA 2WOMB 1T9XA 1IWAA 1PJ6A 5L1KA 4ID8A 2VG6B 4JI7F 2UU9F 1N54B 3MMBB 1QAYA 5CYQB 3GB0A 4QPXA 2C2ZB 2EKNA 3PYGA 2DEIA 2RT3A 3UQSA 1S1TB 2BJ8A 4DS5A 2HBZB 2W4PA 3EX7B 3MECA 1U1KA 3FZBA 1VQ7S 4PG4A 3PKYA 3OFFA 4FXWA 1JJCB 2C2OB 1S9EB 3MUMP 4RW4A 4DEZA 1YDLA 1MN9A 2GQ2A 3HD1A 2GMJA 3QAEA 2DVIA 2GO8A 5KFFA 2RD5C 4NRTA 2OPRB 4QYRA 2FPHX 2FJBB 2FGOA 4R0EA 3TJ8A 3RAMA 3VAKA 1Q8KA 1IKWB 1S99A 1UCNA 5KFJA 2XZDB 4XPCA 2LU1A 2MZSA 3N4WA 4WIQA 1WC6A 4A8SA 2UXBJ 1FWLA 2KJWA 3POTB 4GKJF 3GIRA 1IXKA 4I7FB 3L3CA 4IH7A 3EGVA 3TVKA 2XYPB 2DEJA 1RE1B 4DR2J 3CCTA 3BJYA 3RBEA 1FRLA 3NS7B 2NPIA 3RG6A 4CO0A 1D1UA 2OH2A 3LAMA 4OYIA 3VWSA 3PFOA 5KFEA 1HHTP 3DI6B 1FKAF 2C2RA 2DNQA 2BMBA 2NZCA 2ZC4A 4PQAA 2HFSA 1WKJA 2K2PA 1RAGB 5HO4A 1VIOA 1X4CA 2VKRA 2FZGB 4AYBD 2R7WA 1MWQA 4MFBB 1VJQA 2OPPB 1FRKA 2OPSB 5L39A 1CULA 2HHTA 3ZC4A 5IQQA 3SIPB 3PRDA 3VZIA 5K8MA 1SB6A 3QGGA 1RCOB 3ELHA 3J7ZT 2CQGA 2DGQA 3CXCR 5DETA 4J9LA 5E2QA 2V67A 3MF5A 3UI3A 4CP5A 1GX6A 5KFXA 4NEZA 3ILIA 2PSZA 4UOGA 2V8DA 4ECZA 1RT4B 1D8ZA 3CCUS 1H7XA 4OZJA 1B0VA 3D1HA 1QVGR 4MMOA 4X4SA 5B0FA 3PVXA 1SC4B 4DPXA 2B56A 4DR6J 2W2QP 2BRLA 2FLPA 3NCQA 2HHVA 5J2QA 3FFIB 2D3OR 1RACB 3MMCB 2IJFA 4GO7X 3VCDA 4ELVA 1HBOB 1HR0J 3A8JA 1XNRJ 2LECA 1S0MA 3FGVA 1MROB 3F41A 5CH7B 4P7VA 1JLCB 2RHQB 2J7KA 2ZH9A 3N0VA 1B99A 3RJMB 5FD1A 3I82A 1VJWA 2R7SA 1MWYA 1A9NB 4KO0B 4B9MA 4ELUA 2CZVC 1IQTA 2KXFA 3QT8A 2WB1D 5DGAA 1NHVA 2YNHA 6FD1A 4KSEB 2HBRB 4CM0A 2ATLA 5H9FJ 2W7AA 2XLKA 3AODA 2RRBA 1KWMA 3RR7A 5F8JA 4OJHA 5E3CA 4WE1A 1UZDA 2ALZA 2EG2A 1APSA 3G6YA 1S0OA 3V4IB 2CQBA 5KFPA 4YUDA 1UJ5A 2DHXA 2V2KA 2CADA 1SC1B 3D6FB 1WG1A 2IDEA 4BWMA 3G6ES 4A46A 1JLBB 3HSDA 3KUGA 3D67A 1WF0A 3UVJB 1VRTB 5B7WA 5L9XA 4TN2A 4ETZA 1QSSA 1YIJS 3RBDA 4QCLA 4NXNJ 1NPRA 1XBWA 5D78A 4K0KJ 2B7BB 4DV2J 1H74A 2BJDA 1N56A 2EK6A 4WKYA 8RUCA 3C6UA 4ES2A 1T9YA 3CCES 3J7YU 3HVWA 4TQSA 2GIFA 3QBCA 4NCGA 2RDDA 3UPFA 2HFVA 2KRRA 3DRXA 1VQ5S 3I9ZA 8AT1B 3Q83A 1JLFA 2HNZA 5ETOA 4PWDA 1HNXF 4KGZB 3J81j 2XC9A 2MY7A 1WC3A 2V2ZA 2YH0A 2YKOA 1VCTA 1EP4B 4RW6B 2XYHB 3JSBA 3GYGA 2XS7A 4RKUC 3W62A 1T05A 1RT1B 4F8RA 1D3WA 5LMNJ 2PIIA 2YWWA 2WCXA 2IC3A 5GADU 1DLOA 3AJ1A 3ILJA 2I38A 3B54A 3T3FA 3HVTB 3CJQA 1RTJB 5JVHQ 1S1UA 4PWUA 3EE3A 4FYDA 1PAEX 1U0HA 2GX8A 4QIGA 4MAKA 2KI2A 1HBNB 4CT8A 4EGLA 4G1PA 1O8BA 2R2TA 1KQGB 4I6AA 2BQUA 5KFLA 2I0XA 3VV2B 4DL2A 4L76A 5EHHA 3MM9B 4OYMA 1Q79A 3U1MA 4JI7J 2ZD1A 4AD6A 5H1SV 3MCSA 4ZP8A 1HNVB 3ZXWA 4PQUB 3VALA 4V1Ak 4AUKA 3P3DA 1XTZA 4NZ6A 3DHWC 3CCJS 3MEEA 4CCHA 2ASYA 4ECRA 3TA1A 2NS1B 4YS2A 4G1QB 1VQMS 1RWKB 1WEXA 2JVOA 3RR8A 4P9SA 1WHWA 3CDEA 1X9SA 3ENQA 1NHKL 4DLGA 1RTIB 2KT5A 4LIWA 1S72S 1HPZA 4B9TA 3QRQA 4H4MA 4ECXA 4KY3A 4UW2A 3JTNA 3QO9A 1IKVB 3DLHA 3FUYA 1C0UA 3VZHA 2JNJA 3MUTP 3FK4A 2GGPA 1E6VB 4IKAA 2NXUA 3CE8A 4E98A 2FHJA 4GKJJ 4F7VA 2RILA 2YPZA 4C11A 3N9UC 2F8EX 2XO6A 3OL9A 5CQGA 3BH6B 5L8RC 2GVDB 3B6BA 5F0WA 4QQBA 2ZWOA 2WBRA 4ZCIA 2HHPA 1NK8A 4DZ6A 1VDHA 1IM4A 4WWSA 4M5HA 2AJ4A 1PG5B 2YXLA 2VFVA 1N4LA 1DZ5A 1DRZA 4PZVA 3T9NA 2DNMA 3DCAA 2AX0A 3FRYA 3T5JA 2M4MA 1JNZB 2V4QA 2QA1A 1TL1A 2ZNYA 5JVGQ 2QRRA 2F63A 2AEMA 1RAHB 3HMJG 1GAOA 3MOJB 1EETA 2ATCB 4TYAA 1NK9A 1PYTA 3BF4A 4IG0B 4U95A 3PFEA 1NPPA 3P5TL 5HL7Q 1DQ9A 1TKZB 1D9DA 2ROGA 2AYEA 1S10A 2HG4A 3MI7X 1NJXA 2U2FA 3R97A 3VF0B 3G8SA 1LOUA 3NS5A 1WC1A 4ZCMA 4N47A 2KG0A 1OWXA 4KJIA 1LXJA 4MT1A 3CIMA 4OZ2A 2DR7A 1OMSA 2XQCA 1JWWA 1BMQB 2H5JB 2M70A 3CJ4A 5SUHA 2ACMA 4TQRA 2VFUA 4RU2A 4M63A 4A47A 3A3PB 3Q8YA 1TL5A 4USUA 3LALA 5C2CA 3QLHB 1XN9A 2HWHA 2CJXB 3K7RA 4NLRA 2COLA 4OL8A 2MSSA 1S57A 1Q16B 2BEFA 2C2EA 2ZE2B 3IC1A 3JAMY 1FO1A 2ACYA 3AQOA 3NBPA 2FVPA 1E6YA 1CBKA 2HNYB 5D0EA 2IBOA 4P2MA 2UVUA 1N34F 1FHTA 1M90T 1JLAA 4ZJOA 3CEDA 4GKKF 2DRAA 3TAMB 1HQEB 5THWA 2FZCB 3F73A 5BYQA 2RUGA 2CG8A 1FFSB 2W9BA 3MDFA 2DD8S 3FSIA 1BQNB 2XB2D 4HL9A 3PEHA 1EHWA 1R8HA 2FJAB 1HNIA 3K57A 3UR3C 4WCEQ 5T7LA 3RRGA 1NK0A 1WOOA 5D0RA 4YY3F 1PIEA 4P73A 2BXJA 4DR5F 1KRPA 4I6WA 2B5JA 1RT7A 3IO1A 5FDLB 3N5BA 1UJ4A 3SEOA 3SQGB 3IBCB 5K14A 4ZMMA 3SSSA 1RHJB 1X5SA 2GQQA 2V9WA 1KP6A 3ET6B 4OV1A 5D6GA 1G4CA 3MCMA 1EKRA 4URGA 1HI1A 4CO3A 5T14A 4Y00A 3LPEA 1YRUA 4FF4A 1AB8A 1T03B 4E2FB 3H5SA 3OUYA 3DNCA 4PEOA 1RWMB 2I2YA 3PX4A 2HFUA 4C4WA 3CDWA 3JYTA 4FXDA 4BC7A 4NCAA 1YBAA 2DT9A 2YNFA 3KUHA 2Y1IA 2OTJS 1HIYA 4EZ6A 5KFDA 1KLNA 1HNXJ 4QWBA 4JOUA 2EBGA 4DL4A 4H4KA 5U47A 2XI3A 2MGZB 3W3SA 3DOLA 4X4RA 1RI7A 2VONA 2IVYA 1TVRB 3W2WA 3RUBL 3TANA 2JEGA 4LSNA 3MCOA 2RUSA 5KT4A 4ZS6A 1IR1A 5AE2A 1FDBA 4RR5A 4IG3A 4ECYA 2C3OA 4OZLA 2A3JA 3N6MA 3CCZA 2B43A 2L9WA 1NK6A 3AA8A 4NLXA 5C2GA 3AB2B 1RT5B 1KSPA 3W64A 2VH7A 3UW1A 3MEKA 3C46A 3HZEA 2X1BA 4DL0C 4PAAA 3O3LA 5D77A 4LT6A 1XR7A 1QY7A 2H51B 1OPZA 2OMLA 1F5AA 1RHQB 2R8HA 4NLVA 4D3HA 3PRBA 3WIVA 1MU2B 2CIMA 2ZH5A 3NL0A 4Q43A 2PMWA 3W2VB 4ZPCA 1S6QA 2MJUA 3TAQA 1RBLA 1RHRB 2DH9A 2LVWA 2DY9A 4WFXA 1JLEA 4HDGA 5KG3A 1YX2A 2XCAA 4QJVA 2EEYA 3E3XA 1CJVA 4HT5A 1WKKA 2VU5A 4DS4A 3OV7A 1WHYA 2DGTA 1TL7A 4OHXA 4N56A 3OD2A 3T5LA 1SUQB 1BQXA 3VGTA 4DDFA 1HLWA 1P27B 2CJAA 4LFAJ 4ZDNA 4B17A 1X4HA 2R7VA 3Q0AA 2HWTA 4Y6IA 2BUNA 4HTJA 1TMJA 4USJC 2KU7A 1M1KT 3T41A 2IPOB 2DNKA 2ZH3A 1ZH5A 3GCWP 1CSJA 2Z2MA 2ASDA 3Q22A 3M8RA 2KM8B 2M52A 4RNNA 2WW8A 4NCBA 3M30A 1S9GB 4MIAA 2E5LF 1SKUB 3MURP 2RKIB 4WBFA 2DHAA 2M8HA 4ZPBA 4WTOB 4M8LA 3TUJC 2LU2A 1WTBA 1VQLS 5A6WA 1EB0A 4DU8A 3MR3A 3BQ2A 1Q1KA 3TA0A 3KKFA 2XULA 1HW9A 2CNOB 4R5PB 1C1BA 3EGWB 3F44A 3M8PA 1TK5A 2B9XA 1YSJA 3DRPB 3MEDA 2W7OA 2OLWA 1TL3B 4DR7F 3C2PA 4DI6A 4DQRA 3J7A1 3MR2A 1S59A 4W4MA 2OAUA 3MR6A 2QYCA 3E51A 4BC9A 3J80U 1P1LA 1EARA 3EGZA 1FXRA 3FQKA 1BY9A 2NYHA 4N8NA 2MHEA 2MKIA 2DO0A 3ZTOA 3MMAA 3IGNA 1LQ9A 1C1CA 3KTQA 1M5VC 2VPWB
chains in the Genus database with same CATH topology
1HA1A 3DU6A 2DNGA 4MTPA 1TKXB 2NLWA 4C3KA 4CH1A 1H2UX 3WC0A 1SL0A 3M2UB 1RTHA 5IFMA 2EFGA 3HVRA 1V6HA 1AXQA 3CB4A 3IGVA 3MZIA 1S6PB 1FKOB 4KHRA 1HYSB 4WZQA 5D4OA 2OIHA 2MDAA 4HH1A 4CZCA 2HQIA 2VBWA 3K5PA 1MWZA 1ZPWX 3IR5B 1JK9B 5KG6A 5GAEI 2AYMA 5A0YA 3WBZA 3I32A 4CH7A 5J2NB 5LJ3Y 4GMKA 5HN0A 1R43A 3PY8A 2HFNA 2X1FA 1RT5A 1GT8A 3ITHB 4CNYA 3GIKA 2UXBF 5LXYA 3WC2A 4RNFA 3MPVA 2ZM6F 2BA9A 1BWEA 2YX4A 4ILLA 2PO4A 2PT0A 4KV8B 2YWFA 3I0RB 4AE5A 4DF8A 2MB0B 5GAEU 2JLGA 3ZZPA 3IG1B 5EUHA 5C5JA 5FLXY 1U4BA 1UVKA 1QSLA 1U7LA 2I1RA 5LXRA 1XR6A 3E8OA 2ZOMA 1S1WA 3HT3A 1NJYA 4A8KA 3OW2R 4H4OB 2FHKA 1HWLA 2HHQA 5BYSA 2E9RX 2Y0SD 3MM8A 1TFWA 4NLYA 4DV3F 2AP6A 2DNYA 4OHYA 3OL6A 4AQYF 2XGPA 4DSFA 1N6QB 3I0SA 2HS0A 4RWWA 1QUVA 4N5SA 1MU2A 2HGLA 2IHR1 3H8YA 5AE3A 2RVJA 1BLUA 2E5JA 3DYAA 4K4UA 4O3SA 2Q6CA 1K8AT 4XPEA 4X4NA 1X8DA 2GHPA 3R5DA 3W2VA 1X4FA 3DM2B 1NK5A 5GVQA 1ZAVA 4C0HA 4Q2LA 4J9MA 2E1CA 2J0SD 4P2SA 4AXJA 2PMZD 2BR0A 4OJ3A 3M4XA 2MMYA 3DOKB 3HHDA 2UVWA 1HARA 4NOHA 1L3TA 3CDAA 3M6UA 2LCWA 3C6TB 4JBCA 1NH7A 5DDRC 4LFBF 4CTAB 3DLEA 2MHNA 2FD2A 3FEYB 5AJ3F 4HHJA 3KHGA 4KKOA 4O4GB 2RRAA 2IJNA 3EYZA 4C97A 4A8FA 4C3MA 2HRYA 3SFGA 5E41A 5HROB 4ID5B 4RW7B 3GWCA 2ERRA 4X4PA 2K3IA 2C28A 3I4HX 2HNDA 2VBZA 2BBEA 2D1CA 2IAJA 3GFXA 5A8RA 3R5BA 1AW0A 4X4OA 4ED1A 4DOZA 5KOWA 2NUHA 2XZWA 1N52B 2DNNA 1SUQA 4OX8A 1RDRA 1VMBA 3CCVS 2HHSA 4I2PB 2CQPA 2HLUA 2DTJA 3OXGA 2DGVA 4RW8A 3E01B 5ADZA 4DUZF 2XY5A 2XSJB 4ZPTR 1R6YA 2YNIA 4ZOSA 4LF7F 1Y3KA 1KOHA 3D1QA 3HHKA 1RT3B 4FF2A 1RJJA 2XLIA 2HIQA 1OSDA 2R8KA 1HNWF 2M9KA 3U1NA 3LO3A 3BGFA 2Z8QA 3OFHA 3KJVB 2LQJA 5I3PA 3HFKA 2LQ5A 2YKMB 4HDHA 4LF5F 1FVSA 1T02A 4ATNA 3OLBA 4Y2KA 4I0WA 3M9MB 2HVIA 1XR5A 2D41A 5IQ6A 2DGUA 2QMWA 4F26A 5LMUF 5CXTA 5KFBA 4NLDA 1S0NA 2RRNA 1WTFA 2XMKA 5KT6A 2DNPA 2KO1A 2W4DA 3NS6A 5B0GA 4DQIA 2AJ1A 2DB1A 2HVZA 5F9NA 1PC4A 4FF1A 1PO6A 1KTVA 5KG4A 1TR0A 1JNRB 5DQGA 4IDKA 2JL9A 4AXIA 3GIIA 4CO2A 4YR3A 2RF2A 1TAUA 1R3NA 2CKWA 5KFUA 3OTEA 2GIQA 1TZ0A 1UJ6A 2YKPA 3SCJE 3GFHA 4PG8A 3CJKA 3CUNA 2ZH2A 3KK2A 4X65F 1KHWA 3D28A 5M2PA 3IXQA 3EZUA 1S9GA 1LWEB 2XO7A 1FRHA 1HFEL 1GX5A 2JLEA 5J2PB 3OBIA 3THPA 2JFKA 4DR6F 2D7SA 3I9V9 1GTHA 2RKIA 3IR7B 5EX0A 2AU0A 2K7KA 2NSCA 2WK4A 3AQPA 2M8DB 3KLFA 1N5QA 4ED6A 3B8HA 3RW6A 1DTTB 4NYZA 4OJGA 4JI8F 2N3LA 3DOMA 4ES3A 2E5HA 2DBBA 2HPUA 3TA2A 3DRRA 3L09A 5J1EB 2ADCA 2CQ0A 1YJVA 2D3ZA 5CYMA 4I69A 3D0HE 1TFYA 2W24A 6FDRA 2R8GA 1SJ3P 2OFHX 2E66A 4K4ZA 5KFWA 5C42B 1UVLA 2ZBCA 4XDDA 5I3UB 2DRBA 1B7FA 2QA2A 2CPYA 1K1SA 4X66F 2X51A 3PV8A 3MAQA 2A10A 4A8OA 1F9FA 1N0UA 1SKWA 2B51A 4R5PA 2GO9A 3HHEA 1NZAA 5EWGA 2QA4G 4M5DA 2QE5A 4DWIA 2R7TA 3TO8A 2K7JA 1GXTA 2P9CA 2DHSA 3LAKA 2CQ3A 5A8KB 4WFAQ 4OMFG 2E44A 4C7QA 4DV1F 2O5DA 1RP5A 2EBEA 3DRPA 4I64A 2B7CB 3OSPA 2FJWA 2LDYA 3V81B 3GV7B 1N8RT 1UMJA 2FIUA 3DLKA 1TL4A 3U7JA 4YB1P 4Y0FA 2WSFC 2QIFA 1HBUA 4ELTA 4ZVHA 5DQIA 4IO9Q 1TL3A 2XCPA 4KT0C 3HXMA 1GTEA 1FEEA 1VQNS 1RT6B 3MECB 4K50A 4O4RA 2HHXA 3D1OA 5B09A 5L38A 1IUJA 4FP9A 4NLUA 1G3OA 5C24B 3LWLA 2W7PA 3OHBA 2ZH4A 1YJWS 4ZVEA 5F8HA 5CYJA 5D3GB 1VC6A 1UVNA 3LWMA 1FNXH 1FRMA 2F9DA 5DDQC 2BDPA 3CC7S 4RW4B 2VPZB 3J80Y 2MKKA 2ZKUA 4ZHRB 4KGMA 1XMQF 3ENWA 2YNGA 4LF8F 2ASJA 2I5JA 3CF5Q 1LWFB 1XC9A 2MZ1A 1IQZA 5J1PA 1VK3A 2J9DE 1UVJA 1VBYA 2AGPA 4LSLB 1Q7LB 4TY8A 1UETA 2GA7A 2XMVA 3I5BA 3HX9A 3K58A 2KYZA 1JLQA 1UWBA 4A8WA 3RU0A 1TKXA 2MZQA 2MSTA 3DU5A 2EG1A 1M5SA 4WFYA 4XDCA 3IWLA 4DR1F 3M2UA 1AFIA 2BVZA 2VG5B 3QGPA 1T94A 1X4AA 2HAIA 2W9CB 4TKTA 1J5OB 4I56A 1S6PA 2QSFA 4B9LA 1FKOA 1HYSA 3KHRA 1YWXA 2C3PA 1WD6A 3LW5C 1S77D 1SH2A 1G6BA 3DFEA 3G96A 3PM9A 3BGRB 2HVHA 3N79A 4FS2A 5K8PA 2VUGA 2QLWA 3H25A 2DJWA 3AAWB 5KFZA 3VQTA 2E29A 5J2NA 3JB9k 4KAIA 5IXUA 2KB2A 1U2RA 5J1NA 2RDIA 2CQHA 1OQ3A 2F1FA 4MIWA 4TLRA 3ITHA 3OVSA 3BDEA 3MPWA 3KG0A 3F56A 1U1OA 4J9OA 2QV6A 2DCLA 3H20A 1LKZA 4KV8A 3I0RA 4IH5A 2XMUA 2FJXA 3GFZA 3DGPA 3IG1A 3G9CA 2XWYA 3O2IA 1QJHA 3TI0A 1AUDA 2VOOA 4YB6A 1SBRA 4E8UA 5EWEA 4NXNF 3O44A 2O66A 2BJEA 5DRKA 3G4SS 1CC7A 1LW2B 2MQNA 2J8AA 4H4OA 4TU9A 4K0KF 1IJEB 2X1AA 2IMOA 2ADBA 2DIUA 3SFUA 4YDXA 4B3MF 2LA6A 3DN9A 1S49A 2CQIA 4KC5A 5HMWA 4URQU 4RNOA 1N6QA 2PDAA 2MQPA 5MLCV 3CCLS 1RTDB 2YX7A 4L72B 4AFFA 2RIJA 4FVMA 4V19X 3OTDA 4ECSA 2DNOA 3T6BA 3DDNA 4ICLB 4ZCKA 3SV4A 1J5EF 3DRSB 3DXBA 3ZZUA 4RNHA 4DX8H 5DLGA 5KG1A 3DM2A 3SI8A 1FXLA 4X4UA 2F40A 3M1VB 3V6KA 4Y2AA 5K8OA 3FMBA 2CQ2A 2VV5A 4B3RF 3M6WA 2VPXB 4WZMA 2RQCA 3W7BA 4Q2MA 3DOKA 2DGWA 2AJQA 4OQJA 3R27A 5KFSA 3C6TA 1RYRA 4CTAA 4QIVA 4GO5X 1XMOF 2VPYB 1JKHB 1FE0A 4N41A 4PXDA 5F8MA 4O4GA 5KTQA 1T3NA 2E7WA 3K0JA 2YVSA 4HI2A 4B3TF 4URSA 5HROA 2C2DA 1WI8A 4ID5A 4RW7A 2FHOB 3DLJA 1RT2B 3UR0A 3I56S 3RB4A 1GXUA 1U25A 1RKJA 2CRLA 2DIVA 1L5UA 2XY6A 1M5OC 1V3SA 2PE8A 3MM7B 1KEKA 2OD4A 1T7PA 2ZHOA 2IMWP 4FPRA 3CD7A 2OFGX 1RGVA 1CPZA 2FVQA 4I2PA 2R9LA 2VG7B 1FNOA 2X1GA 2IM1A 5E5NA 5L1LA 1SIWB 1NEEA 5EDWA 3CC4S 3E01A 1UP1A 1C4AA 2IRUA 3CIZA 1IN0A 2XSJA 3I96A 3OXLA 1D0EA 4X84A 4DL6A 2O1PA 4NYOA 4EUVA 1DTQB 1RT3A 4KQZA 1F2GA 4RUAA 2FVSA 4ED3A 2ILYA 5LMNF 3O8WA 2O3DA 5B0CA 3KJVA 2HGMA 2D3UA 2YKMA 3M6VA 2CZ4A 2HGNA 4HVZA 4MKBA 1JX4A 4ECUA 2APOA 1WI6A 4N76A 1S6UA 4IQXA 2CPJA 2JC0A 1DBDA 1QAJA 2FDNA 4G3IA 2DHGA 4MJKA 4PG5A 4KPYA 3RRHA 1XEZA 3OJSA 4F3MA 3B4MA 1Q8IA 4LVNP 3LQVA 4UQTA 2KHCA 2J9EA 1R8PA 1X0PA 3DLGB 4D3GA 3KG1A 4QZVB 4I68A 2MZJA 1WNEA 4OI1A 1SC6A 3BDPA 3R5AA 4KBIA 1J2VA 3HKZD 4LFCF 4C8MA 3MEGB 4NYPA 5LSRA 4UY8T 4DG1B 1JJ2R 5DM7Q 4Z2XA 2ASLA 4F2RA 5H9EJ 2KG1A 1KQFB 5DDPC 3SCLE 2RSQA 2VD3A 3EGNA 3MFHA 2IBKA 4EBEA 2GV1A 2CG4A 2PD1A 2RU9A 4FN5A 1LWEA 5KT7A 3NNAA 1ZZNA 1FDDA 2YWEA 4ECTA 1C4CA 4NZ0A 3CD5A 1OQ6A 1Q86T 1X9MA 5J2PA 5J2QB 2B9WA 2J9DA 5C25B 3VTIA 2PA3A 3G8TA 3UCGA 1N5SA 4DJBA 2XHWA 4IOAQ 4A8YA 2BYCA 4QR2A 1DTTA 2B4UA 4DQPA 3OSNA 3H4BA 3BZQA 5J1EA 4K4TA 3NNHA 1YJ9S 3V6HA 4I4BA 2BRKA 2GJIA 1NJZA 4ZPVR 1QTMA 2FJVA 3QIPB 1UA0A 3FSXA 4IRKA 3CD6S 3M2VB 2CQDA 1VBZA 4BCAA 2ROEA 5C42A 3GYNA 4DV5F 5I3UA 3FZ2A 2A2DA 2WOMB 2BE2B 4ILRA 4RU9A 1IBMF 4NWBA 3T9ZA 5L1KA 4ID8A 2VG6B 3AJ2A 4ED7A 2W4CA 3CCQS 4RW9B 4ITSA 4A4JA 3ISND 2QLXA 4EWTA 3T1YF 4JI7F 4IYQA 2RB7A 4JI0F 1VLYA 1UVMA 3CTRA 2UU9F 4MK7A 1KD1T 1N54B 3MMBB 4QW8A 2NREA 1QAYA 5CYQB 2E9TA 3GB0A 5A8KA 4QPXA 4JI2F 5KFCA 2HYIB 4XK8C 5KG5A 2R7XA 1P1TA 3V81A 5F3ZA 2OJ3A 2VASA 1S1VB 4B9SA 5KFTA 2RT3A 2UXDF 1RKIA 2XSFA 4DV4F 2MKCA 1U6FA 3UQSA 2R8JA 4EO6A 1S1TB 2YNHB 3OTCA 5KFAA 4DFKA 4DS5A 3LUYA 5CCLA 4F4XA 3TNVA 2UV8G 2W4PA 4WXWA 3EX7B 7FD1A 3Q2TC 1DHMA 1RT6A 3MECA 1U1KA 3RRKA 3FZBA 4MK9A 1VQ7S 2UUAF 1VQKS 4F25A 4TU8A 2J9CA 5E0OA 4Q8EA 4PG4A 3PKYA 2PMHA 3OFFA 4FXWA 1YVFA 1SL1A 5C24A 1QE1B 2V5HG 3QJPA 3EXYA 3NMRA 1S9EB 5D3GA 3MUMP 3M8SA 1SJQA 3CCSS 1OS5A 1MW7A 4RW4A 1Q8BA 4DEZA 4K5RA 1IKYB 2GQ2A 2GMJA 4ZHRA 3QAEA 2XMWA 4WE1B 2KTQA 2DVIA 1VQOS 2ZJPQ 1N5YB 2HFZA 3EPIA 3JSMB 4FNIA 1LWFA 2GO8A 2EFPA 1Y00A 2RD5C 4NRTA 4NLPA 5KFFA 3MR5A 1SKSA 1KVIA 1LFPA 2RJZA 2OPRB 2WHOA 5FJ4A 3M32B 1XERA 4LSLA 4QYRA 2FPHX 4RBUA 2FJBB 3CVKA 2FGOA 3LP0B 3KK3B 3HK2A 3LOUA 2ZH1A 1UEUA 3KK1B 4R0EA 3VAKA 3RAMA 4OZ5A 5E33A 3TARA 1T95A 3PNIA 1MSWD 2N82B 4C0BA 2YQ3A 1IKWB 2DK2A 2VG5A 1K0VA 1S99A 2A2CA 3IS9B 4KGKA 2W9CA 5KFJA 4USHA 1J5OA 1KR4A 2LU1A 4XPCA 2AV5A 3TQ1A 1VK8A 2KT2A 2MZSA 3N4WA 2DNZA 2W8LA 1FD8A 3C8YA 2WBMA 2MKJA 4A8SA 3BGRA 4OX7A 2E1AA 3PW7A 1IBKF 4KIAA 4J9KA 3UCUP 5F8GA 3B78A 2KJWA 4K4XA 3POTB 1WEYA 4GKJF 1IXKA 2LXIA 2EKYA 4I7FB 1SJFA 4QR1A 3L3CA 4JV1A 1B0TA 1H6KX 4NA1A 2C22A 4J9NA 1ZM3A 4IH7A 2J0XA 5FIIA 3TVKA 4J9SA 4U6PA 4RWXA 2OKQA 5G4DA 1Y5LB 3GE9A 2KVIA 3PIPQ 1ZM9A 1LW2A