4C4WA

Structure of a rare, non-standard sequence k-turn bound by l7ae protein
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
96
structure length
96
Chain Sequence
TRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Rare, Non-Standard Sequence K-Turn Bound by L7Ae Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
total genus 26
structure length 96
sequence length 96
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4c4wA00
4TU9A 2LYVA 2J0SD 2PEHA 3N9UC 1K8AT 1VC6A 4F25A 1X0FA 1N8RT 2FPHX 2KG0A 1AUDA 1HD1A 2OJ3A 2KXNB 2MQQA 3Q2TC 3VAMA 1QM9A 1WF1A 2DISA 1YHQS 5BJRA 3VAHA 1KOOA 1N54B 3BS9A 3R1HA 5DM7Q 2DNQA 4PRFA 1U1LA 1Q7YT 2MQOA 5LJ5Y 3MUMP 2MZRA 3J7ZT 1JJ2R 1WG4A 4W90B 3UCZP 2G1DA 2I38A 2YH0A 1DHMA 1UFWA 2CPZA 2DO4A 3MI7X 2FC8A 2J76E 2KT5A 3UCUP 2CQ4A 2FC9A 2CPYA 1X4BA 2DO0A 3VALA 4CH1A 2ZJPQ 2DNHA 4YOEA 1X4AA 2MZTA 2U2FA 2DNZA 3VAFA 3CPWR 4WKRA 2N82B 1YJ9S 3B4DA 4BS2A 4IOAQ 2F9DA 5DDRC 3UCGA 2KU7A 2YH1A 3B4MA 2DNGA 3H2VE 2CQCA 1SJ4P 4YB1P 2MB0B 2CQ2A 2KH9A 3BO3A 5HL7Q 1K73T 3MUVP 4Z2XA 3U1MA 1WG1A 2MQLA 2LA6A 5GVQA 2MY7A 1U6BA 3S8SA 2KXHA 4LIRA 3NS5A 5D78A 1PO6A 2KRBA 2VOPA 4QU7A 2CPXA 3MXHP 2J0QD 2CQ1A 1U1QA 3G71S 3R27A 2LCWA 5LSOA 1SJRA 2CQIA 2N3OA 3ULHA 2KN4A 1DBDA 3CCES 3EGZA 2DNNA 4V19X 1RK8A 2VODA 2X1GA 5ITHA 2E5JA 3TP2A 2A3JA 3S7RA 2DB1A 2EVZA 2M70A 2DH8A 3PIPQ 4UQTA 1VC5A 3CCJS 1R8PA 2KVIA 4C0OC 2MKHA 2M9KA 1X4DA 2KRRA 1VQ9S 1VBXA 1W2BR 3D2WA 1OO0B 1WWHA 2Q79A 1M90T 3S01A 2XS5A 2DNPA 1URNA 2CQ0A 3SDEB 2XB2D 2HGLA 3P49B 2U1AA 3K0JA 2DHXA 4F02A 1KC8T 2I2YA 2XS2A 1VQPS 2MJNA 3NS6A 4TU7A 2MKJA 4WIIA 1WF2A 1QVFR 2RQ4A 1H2VZ 4CQ1A 4IUFA 4WCEQ 1X5PA 2OSRA 1H6KX 1X4GA 1VQ4S 2KG1A 3NNCA 2VOOA 1WEZA 2K8GA 4M5DB 2DGUA 2KFYA 2DNYA 3ZZZA 2GHPA 3CC7S 2M2BA 4WFBQ 2VONA 3G8SA 5DM6Q 2RRAA 1X4CA 1WHYA 2CPDA 2DGVA 2F9JA 2MZ1A 3P3DA 1ZZFA 3FEXB 4ERDA 2RU3A 3DLLQ 4W92B 3MURP 1VQ5S 3I55S 1WF0A 1U1KA 3NMRA 2DGWA 2RUGA 4P6QA 4PKDB 3EX7B 1N52B 4TLQA 2AYBA 3VF0B 1FJCA 3IWNC 5IM0B 4C4WA 2DGTA 4F26A 2JWNA 1VQ6S 3VAGA 1DZ5A 5IM0A 2DIVA 2X1FA 3TO8A 1DRZA 2MHNA 1OIAA 4WFNQ 1SJFA 2LXIA 4LJMA 2MZJA 1UP1A 3CC4S 2CQPA 5GAHU 1K9MT 2MY8A 3UD3P 5LSLA 5DDQC 2D9OA 1WTBA 1JJ4A 1U2FA 2XNRA 2JRSA 3P5TL 2DNKA 2JVOA 2E44A 2X1BA 3CCQS 4IOCQ 2LXUA 5FJ4A 1WHWA 3UE2A 2MZSA 2V94A 3CCSS 2RT3A 4RU2A 3Q2SC 2LEAA 2M7SA 1IQTA 2MQMA 1Q81T 1JMTA 3VAIA 2CPFA 1SJ3P 1P1TA 2MJUA 2CQGA 3CMES 2DNLA 4CH0S 3LPYA 2FY1A 3NNAA 4WF9Q 2HZCA 2G4BA 2L08A 4OZ0A 1A9NB 2MGZB 3BO4A 4A8XA 1U1RA 2MYFA 3S6EA 3CC2S 2MGZA 2LMIA 2AYGA 1F9FA 1X4EA 2DNOA 2E5IA 4QU6A 1FXLA 4QPTA 3US5A 2N7CA 1VQLS 2AYEA 3U1LA 4J5OA 2L41A 2DGSA 2LEBA 2B0GA 2WBRA 1JJHA 1WI8A 5LXRA 3CCMS 2KI2A 1KOHA 2KXFA 5JVHQ 2N3LA 1M5OC 2HGMA 2HYIB 5DETA 2LA4A 4PR6A 4C7QA 4IO9Q 1O0PA 1YIJS 4FXVA 2CQ3A 3CCLS 3MOJB 4EGLA 2CJKA 1X5TA 4Y00A 2OTJS 2EK1A 5MLCV 2BZ2A 2CQDA 2RS8A 1PGZA 2F3JA 2MSTA 2CPHA 2MQNA 3JB9k 1WEYA 5IQQA 2M8DB 3P6YC 2E5HA 3THTA 3HI9A 1UW4A 2JX2A 1QVGR 3G8TA 2DH9A 2KM8C 3CCVS 1FJEB 2XS7A 3SDEA 2UP1A 2MKCA 1YJNS 2BOPA 2KHCA 2M4MA 1YWXA 3UD4P 4FXWA 1M1KT 3MUTP 3MD1A 3MDFA 2KYXA 3LQVA 2J8AA 2LECA 3HHNB 3NNHA 5CA5A 3PIOQ 2SXLA 2RVJA 1S79A 2DGXA 2RNEA 3ZZYA 4CIOA 1X5SA 4UY8T 3VAJA 4WFAQ 2ADCA 1H2UX 1S72S 1RKJA 1L3KA 2MMYA 2OTLS 1WG5A 1YJWS 5GMKa 2FHOB 2O3DA 2M0GB 2QA4S 2EK6A 2ADBA 1FO1A 3MD3A 1VBZA 5GAEU 3VAKA 2MXYA 1OPIA 1NO8A 2D3OR 1M5VC 1D9AA 1NJIT 1SXLA 3L3CA 2XNQA 3I56S 3EGNA 2MKSA 1KD1T 1ZZNA 2DH7A 3CF5Q 3CD6S 3BEGB 1H2TZ 1HL6A 2KM8B 2DNMA 2DIUA 1FNXH 2ZJRQ 1X5OA 3G96A 2DHGA 2MQPA 2DNRA 3G6ES 1A7GE 4QQBA 3CCRS 1SJQA 2CPEA 2X1AA 2XSFA 3G9CA 2DK2A 2YTCA 2YWKA 5IFMA 3FEYB 2DGOA 2JVRA 3V4MA 5GAGU 2HVZA 3G4SS 2DITA 1P27B 2K3KA 1NU4A 2GO9A 4YUDA 2LKZA 3SMZA 1KQSR 2NLWA 1U1NA 5DDOC 1Q82T 2MKKA 5GADU 1CVJA 5H1SV 1VQ7S 1WHVA 3J7YU 3IRWP 3RW7A 2PE8A 2CPJA 2CQBA 2QEXS 2HGNA 4ED5A 2AD9A 3OW2R 2OIHA 2QFJA 5CYJA 1U6FA 2OSQA 2AYMA 3DXBA 1YTYA 3CULA 2LQ5A 2MZQA 1YI2S 3BO2A 1HD0A 4Y0FA 1VQNS 1Q86T 1VQOS 2NZ4A 1ZH5A 1G2EA 1U1OA 1D8ZA 1VQKS 1WELA 1X4FA 3CCUS 1B7FA 2E5GA 1VQMS 4OZ1A 5CXTA 1XN9A 1U1PA 1UAWA 1N88A 3UWTA 2RS2A 1R8HA 4ZKAA 2DHAA 3CUNA 5JVGQ 2M88A 1WI6A 2DGQA 1BY9A 2MSSA 5EN1A 3RW6A 2RRBA 2ZJQQ 1VQ8S 3R1LA 1FHTA 1M5KC 1HA1A 1FT8A 2CPIA 5LXYA 5DDPC 1FJ7A 2MKIA 3THPA 3CTRA 1X4HA 2M52A 1YITS 2ERRA 3SXLA 5HO4A 1OWXA 1VC0A 3CXCR 2YKAA 2L9WA 3CMAS 1VBYA 4U67Q 3H2UB 3TYTA 5D77A 2D9PA 5LJ3Y 4LMZA 4TU8A 1WEXA 2RQCA 1M5PC 2CQHA 2MPUA 2M8HA 2DHSA 2G0CA 1WHXA 1U1MA
chains in the Genus database with same CATH superfamily
4O0NA 4RLEA 1WKLA 3M2RA 3C15B 3DFEA 4F25A 4OLOA 3MCSA 4DS4A 3TAMB 3M30B 4DSEA 1F5AA 1RUSA 3ILJA 1Z2ZA 3M2RB 4NI2A 1HYSB 4RNFA 4OLPA 2ROPA 3M30A 1HYSA 3OL8A 3L09A 5FD1A 3SIPB 1Q8KA 1YHQS 2DCUB 2PEBA 4FPRA 2GJ2A 4CLSA 2RQMA 2YWFA 1JXEA 4KAIA 2IFXA 4HHJA 1KOOA 3BS9A 2HS4A 2DNQA 4DI6A 3NEKA 3GV5B 3CJSA 2F8HA 1N0UA 2GCFA 2IRXA 2RB7A 2VV5A 3AOBA 4J91A 4KGXB 2GX8A 4RBUA 4X66J 1IWGA 3PX0A 1KP6A 3J7ZT 1WG4A 3NGSA 3JAMY 1LW0B 1UEKA 1UPMB 2OKQA 5D15A 4DSFA 2EBGA 2YH0A 1PC4A 1QTNB 1LXJA 1C0UA 2DO4A 2JEIA 4B3MJ 5F9NA 1LK5A 3H59A 2FC8A 3PW4A 3OTOJ 1IBCB 3JSMB 3E8OA 3O2IA 3DRRA 3OD2A 4G1IA 1NPKA 1OY8A 2CQ4A 2ZE2A 3LGMA 4X64F 4Y3CA 2R7WA 2ACMA 3CDBA 2ZJPQ 2GV1A 4LF8J 1SH0A 5C24A 1EIYB 4WU3A 1JLBA 3N6LA 1E6YB 1UPPA 1WTFA 3KLHB 2W8KA 2U2FA 3PR5B 3FGVA 5C25A 2YQ3A 3GE9A 1E6YA 3OV7A 2FVQA 5K8NA 2FVRA 4BS2A 3JAMU 3NLCA 4ZCLA 3HHEA 1F3VA 3W64A 1YLXA 4X62J 4QR2A 5E0OA 1IKYB 3OT9A 5D8HB 2DNGA 3H2VE 3K89A 4FYWB 3TX0A 4YB1P 3OL7A 3JTOA 2C28A 2CQ2A 2E66A 1Y00A 1K73T 4Z2XA 3TOQA 1WSVA 2IM2A 2HLTA 2BUNA 4MT1A 2LA6A 1U48A 1TMJA 2MY7A 2BE7D 5F0WA 3KLEA 1TK5A 3TEHB 3FRYA 3GZ7A 2VQEJ 4ED0A 3NS5A 1FNMA 2HNDB 3QYYA 4LIRA 5KT2A 2XY7A 1N5TA 3CJ2A 1GX5A 1REGX 4PG6A 4UOCA 4QWCA 2VG5A 4FVCA 4OHWA 5HVFA 4JI4J 2IJRA 1RT7B 2VOPA 2ZOMA 5HMXA 2P5VA 3DRYA 2IM3A 4P2FA 2KYZA 4LSNB 2J0QD 1QUPA 4JI2J 5HQ8A 2V8PA 3J80Y 1CJKA 4NLWA 3GYXB 2LCWA 3VGTA 4O4RA 2XYPB 4ECWA 4BLGA 5KT4A 1DBDA 3CCES 3P45B 2AP6A 2QYGA 3EZUA 3PO4A 1S9GB 3AQOA 4CZCA 2WVCA 2I9SA 2ZFHA 4GKJJ 1IBLF 4DJBA 2W2NP 3GFZA 2RE1A 3DOLB 4NYZA 2BJ3A 4O3SA 4USJC 2A0FB 4UQTA 3BR9A 3DOLA 4DR5J 1J5OB 5ETPA 4P2XA 1IWAA 4HLBA 1T03A 2F4VJ 4WZQA 3C14B 1X4DA 1VQ9S 1JLEB 1HHSA 1PJ6A 2HNYB 1VBXA 1T03B 4WKYA 2C2NA 1NH7A 2C2KB 2Q79A 2XM3A 1YG0A 1NK9A 1X60A 4AL5A 4ES1A 1HNVA 5C5JA 2Z2ZA 1QE1B 2CUYA 1HBNA 1E6VA 3I31A 2HGLA 1FTRA 3SDEB 5EX3A 3UD5A 3DRPB 2KKHA 2BANB 3ENVA 2FZKB 3NS7B 4IH5A 4PZVA 5A6WA 4KHRA 4EZ6A 2U1AA 3K0JA 1RWXB 1CULB 1F6TA 2KT3A 3I0RB 2DHXA 4LSLB 3IAS9 5E3CA 2ZH6A 4F02A 2YWWA 3MFIA 1ZA1B 5I3UB 2BV3A 1VQPS 2MJNA 4WYWA 3R7BB 4F4KA 4JI4F 4ZVRB 2A2CA 4P75A 1B0TA 4WIIA 2BM1A 1WF2A 1M1HA 2AF6A 3R2CJ 3O8WA 2UXDJ 2ILYA 3AT1B 1JB0C 1S0NA 4IUFA 2BYCA 3BYRA 5G0RB 4DEZA 1R0BG 2C3OA 4Y34A 5K20B 2ZH9A 1T8EA 4F3OA 4DSIA 1X5PA 4JI0F 3K59A 1H0HB 5A6PA 2LFVA 4ZLPA 1KLMA 2KJWA 3LAKA 3MOZA 4QPXA 5LMUJ 4A8OA 2GGPB 1WEZA 3Q8PB 3W61A 1FKOA 4LQ9A 2NXUA 2QE5A 2CXEA 3TA0A 2ASLA 1RU1A 2GGPA 3GYNA 4B9UA 4KHPJ 3DU5A 1OSCA 4RPFA 3FSXA 1FRLA 2GHPA 3HDSA 4MYUA 3GG0A 2DPIA 1BQMA 1T7PA 1UVMA 4Z7CA 2NYIA 4KHMA 4ECYA 5KFGA 4P71A 5KFNA 4ANCA 5KT5A 2MZ1A 3P3DA 3MR7A 4JYAJ 4LF6J 3SQOP 3KHRA 5K8OA 4ERDA 2RU3A 5K14A 2DXFA 4J9RA 1TUGB 1VQ5S 5L1IA 1N6QB 4C9DA 2IAJB 4JOUA 1N32F 4UUXA 2HNZB 4A46A 4DPXA 3IWXA 2RUGA 4PKDB 1RA6A 4PWUA 3DMJA 5GMDA 4MYTA 1O51A 1NK4A 2EKYA 3HFZB 3VF0B 2R8KA 4B3SJ 4F26A 1HWIA 4PPDA 3C15A 2CVIA 4NPOA 5B0CA 2I6WA 4YFUA 3VAGA 4L3KA 1N5YB 2XBPA 2YX4A 1OIAA 2VJVA 1RCXB 4NLSA 2ZBQA 1R27B 1RDRA 2LXIA 4QIGA 4USIA 3HVTA 4IR9A 4NCBA 5KFOA 4DUYJ 2QLBB 3CC4S 2CQPA 3SFUA 3HVTB 4AXIA 2EC0A 3DM2A 3KMQA 2XLKA 2MY8A 3HSDA 3UD3P 4K4YA 1EQMA 1NZ8A 5EUHA 4UQGA 1WTBA 2DY1A 4NLXA 2XCAA 2F40A 2EI5A 4NLTA 5BXIA 3IC1A 2AW0A 1H7WA 3SCIE 2F4VF 2BJ9A 5ETNA 2LXUA 4BHQA 1RT6A 3M4XA 5CCMA 2V94A 5F9LA 2HYIB 2HK2A 2W9BB 1FX4A 3Q2SC 4XTTA 1CPZA 1RT6B 2VKZG 2M7SA 2ZHBA 4H4MA 1JKHB 3PKMA 4QWDA 3FEZA 2B56A 4H4MB 2CPFA 5LMUF 4JV2A 3MMCA 4NOHA 3M1VB 1I1GA 3MR3A 1MWYA 3QNWB 3NOCA 1SJ3P 1SKRA 3WZ0A 2CQGA 2XI2A 2DNLA 4HH0A 4HHHA 4YY3J 1HR0F 2H4YB 3LPYA 2HZCA 5DG8A 2G4BA 1SI9A 3MPUB 5HQLA 5KOXA 3HHKA 1S4EA 3HO1A 4B3OA 3NBPB 1HLWA 1Q5VA 2Q1LA 4P72A 2V2KA 3BO4A 2F65A 1LWFB 4A8XA 4F50A 4ZP8A 5HLFB 1S9EA 1U1RA 3A8EA 2D41A 1MW7A 1ULRA 2IDEA 1LWFA 2AYGA 3CE8A 4DR1J 2M5YA 1IKVA 3PFOA 1EB0A 1FXLA 2KZMA 2UUWA 5F41A 4HACA 1AA1B 3OHAA 5FDLB 1WC3A 1P8GA 2AQ4A 1RISA 1UW9A 2A2DA 5E3PA 2YX1A 3US5A 1RT3A 4B3RJ 4EWTA 5FDLA 4DPOA 3VR1A 3GV8B 4RNOA 3MAQA 4RUHA 2L41A 4NCGA 1FFWB 3ENAA 3CJ0A 2B0GA 2CG4A 1RKIA 4WP8A 5IQ6A 2LEBA 1WC4A 3Q89A 4LIWA 4LVNP 4CO0A 5E41A 1V5IB 2V4QA 4L74A 3IXQA 3W7BA 5JVHQ 2N3LA 3UN5A 2NXJA 4DV4J 3PDNA 2EC2A 5EHHA 2ZH8A 2HVEA 4X2BA 1RT7A 2WB4A 4PR6A 1AROP 2HQCA 2WOMB 2ZDPA 3MEGA 2QA1A 5BR8F 1ZETA 4RW9A 3ETMA 1B7YB 4EZ9A 1YIJS 1J2VA 2IVFB 3TZZA 3M9OB 4X64J 3X1LB 2XMAA 3CNQP 1KDNA 1KN6A 3MOJB 3PCOB 3QSIA 3MMBA 4J9MA 3BV8A 2XCPA 3KOAA 2BRLA 4Y00A 3CD7A 2BJ8A 3W8GA 1LNQA 1VCTA 3J81Y 1TR0A 4LVOP 2K7JA 1K47A 5HJYA 3TAPA 1D9FA 3BN7A 3IFEA 3DLBA 4X4VA 1QAXA 2QC3A 4X4SA 4ZN3A 4X4TA 4ZCIA 4YR0A 1EAYC 5THWA 2F3JA 1OSDA 2MQNA 3RU0A 3VZHA 2AGOA 2QMUB 4OX9F 1RTHA 2AJ2A 2NPIA 3SZ2A 1NHKL 2R2RA 1RSCA 3THTA 2RUSA 3CO9A 3ZZOA 1ZAVA 2IBKA 1UW4A 4WXOA 5RUBA 2JX2A 1Q8LA 2OPRA 5IS2A 3RB0A 2Y9HA 2KM8C 3E2EA 3CCVS 4IG0B 4NXMF 5D0EA 2IM1A 4L6V3 4NLVA 2VF3A 3DGVA 4Z37A 3FVYA 1YJNS 3J81U 2H9ZA 3MCMA 1ITPA 3DDKA 4C97A 4DPUA 1BHNA 4F0KA 4DOZA 2K1RA 3IG1A 4U6PA 2AJQA 3PHTA 4G3IA 1HI8A 3I4HX 4R8UB 1HNWF 3MDFA 2HHUA 3C16B 4RWXA 2VICA 1EETA 1H98A 2VBWA 3BQ1A 3GIIA 3BPDA 1RB0A 2QV6A 4NEZA 5J1PA 1H72C 2XZTB 5D4LA 3NNHA 2QLJB 2ZC3A 4QWBA 2B4VA 3ZZUA 3QQCD 2FB0A 3OLAA 1UCNA 4DBQA 1FI4A 2CADA 4KQZA 4NXNF 4Y2AA 4OYIA 1UA1A 1R8CA 3OHBA 3O5TB 2A1BA 3EYZA 3Q8UA 3M2VA 2VA3A 2DHHA 1URRA 1RLDA 1RKJA 4NLUA 4NXNJ 2PA3A 3N5FA 1WUUA 1WC1A 1XTZA 1HHTP 2E7XA 1B70B 1FKOB 1KVIA 2QL5B 2FHOB 1IKXB 4KH0B 3TW0A 1VMBA 3PG9A 2XQCA 5T7LB 1FWLA 2ZBCA 3TQEA 1CC7A 1H74A 1SIWB 3VQSA 1S1WA 1HBUB 3G82A 4CLWA 3KG1A 4ILMA 2HVDA 1LW0A 4QYZK 2GHWA 3MHYA 2Q6BA 3UDCA 2B4UA 3MD3A 1N56A 3QRRA 5DG9A 4DR2J 3A4TA 2MXYA 2RSQA 1JXLA 4ED1A 4KHPF 3M8QB 1NO8A 1VQYA 3C6UB 4OJ1A 3D67A 3BBBA 4P7TA 5F3TA 4CTAA 4DCPB 3C2PA 1NHUA 1ZPWX 3TA2A 3ZZTA 5J2QA 3KDNA 1XMOF 2FJEB 1XBWA 3DLKB 3MEDB 2AX0A 5ETKA 4F4AA 2W9AA 4GRSA 2R7VA 4IH7A 5L1KA 4MIWA 3GMGA 4F3QA 2QMWA 3I82A 2R8HA 2BDPA 4DR7J 2C2ZB 2DH7A 4NYOA 5FIIA 2F63A 3KK3B 2KFZA 4IYQA 4DQQA 2KM8B 1NJYA 3TI0A 2HZVA 3AQPA 3OXGA 5KFQA 1DTTA 3LAMA 2FTRA 3G96A 3PW0A 2GFFA 3LANA 4DG1B 3EDRB 1NKCA 4FF4A 1A7GE 3A3NB 4NWBA 3AOCA 3ZNUA 2XTJP 3CCRS 5I42A 3HJFA 3FSYA 1Q79A 5BYRA 3P4UB 3FEYB 1TL3B 2JVRA 3MWBA 5IWAJ 4RW6B 3V4MA 3CD5A 5A76A 2BRKA 5AE1A 3BQ0A 1YJUA 1ZAWA 1P9QC 4QW8A 2B4OA 1XQIA 3OFGA 1S6PA 2D3ZA 2VZ9A 4OYBA 5KFAA 2DXEA 3SMZA 3ZZPA 4ALZA 4YUDA 2C2EA 1AT1B 2ZH7A 5B0FA 2NLWA 1ZM2A 4HDGA 2V50A 4ZVSB 2W9CA 1U1NA 1JKHA 1NDLA 4BWMA 5KG5A 3HPOA 1Q82T 4P74A 2KZZA 2DR7A 5H1SV 3KLVA 2QL7B 1R89A 3DHXA 3WHIA 2YKMB 2C2OB 2Y1JA 1DARA 5C42A 2C3MA 2HMIA 1G4CA 1MSWD 3U1NA 1PIEA 4GVBB 4DR7F 4ZJOA 4ZVUB 3H4BA 3Q8VA 4ED5A 4G1PA 3HP6A 3BGRB 4QZVB 4ZVGA 2AD9A 5EDWA 4K4XA 5I3QA 4DL5A 3IR6B 2V68A 3DXBA 5CYMB 3DYAB 4KFBB 1MWZA 2L3MA 4CWBA 4CLTA 4CLFA 5CAAA 1P6TA 4OI2A 4ELTA 4GKKF 4Y0FA 3UVJA 3SBMA 3ENWA 3W2WB 1CSJA 3AH6A 2C3YA 3RRHA 4ZVFA 1JQGA 4L72B 2NS1B 3QLHB 3PXGa 5KFYA 3UVJB 1SC3B 3BSNA 3K58A 4CLKA 1ZH5A 3BPSP 1RT3B 5BYSA 1F2HA 3D66A 1M0SA 2ABYA 4CLLA 2JLEA 1QE1A 3WDOA 4OYZA 1KSPA 3QGPA 3LP0A 1FXDA 5BYQA 1VQKS 1FJGF 3IBWA 3KUEA 3KFWX 4JYAF 1VOMA 1FKAF 4GC7A 2VUGA 1CS4A 4YQWA 4Y2MA 4QOTA 4YDXA 2J8SA 2A6MA 1VQMS 3FFIB 1RT4A 2Y1RI 4N47A 3SSSA 1AFJA 1RT4B 1N33F 3N01A 1UKUA 3CIMA 4UZBA 2BW7A 4X65F 1T9TA 5CXTA 3QRQA 2RS2A 2QJ3A 3Q86A 5J2MA 4E0DA 3N6MA 1Q1KA 3UR0A 2B6AB 2ALYB 2WW4A 3MM6A 5G0RA 3SQGB 1X7VA 3D28A 4OJ3A 4O3RA 5H9FJ 2B6AA 2MSSA 2DGQA 5AXMA 3SQGA 3H40A 1KFSA 3DCAA 2YNIB 1RT2A 4K8RA 2COLA 4NZ6A 5EN1A 3R5BA 3R1LA 2N7YA 4HH1A 2AX1A 3V6DA 1R7IA 3MPDA 1I5OB 3FZ2A 4C8LA 1O6XA 5L46A 5LXYA 3HVAA 4TLRA 3BREA 2W2OP 3KHHA 3I5CA 3TEGA 3CTRA 4MIBA 3THPA 1X9WA 1NDPA 4M63A 2BE9B 2OPQA 2JDJA 4G1QA 3UI3A 4DV6J 5KFMA 1X4HA 2M52A 1RTHB 2ERRA 1LQ9A 5T41A 4K0KF 3GYGA 3UDEA 3UPFA 2W7PA 3N28A 3NAIA 2W4CA 4A4JA 3SXLA 1RT5A 3V5RA 1LFPA 5F8GA 4L75A 3MMAB 2VJUA 1DJ0A 1OWXA 1BE4A 3CXCR 2KVQE 1NKEA 1C4AA 2POKA 2ZZMA 4ECQA 1HQUA 2HWTA 2VFSA 3K5OA 2I5JA 4KBIA 2R2SA 1B64A 3IS9A 4LR8A 1S6QA 2WTFA 3H2UB 1N6QA 2K1RB 1KWMA 1C1CA 2R9LA 5LJ3Y 2ZHAA 1U09A 2ZVSA 4R0EA 4FBTA 4M94A 5HI7A 1YDLA 2QG9B 1NJWA 1EETB 3HFKA 4LR7A 2CVEA 2RQCA 1MROA 2CQHA 2M8HA 1RT1A 1AXQA 4PXBA 5KFUA 4RW4B 1WHXA 4ZLNA 1B0VA 4TU9A 1SKSA 2PEHA 3N9UC 2J0SD 1JK9B 3JTPA 1EX8A 4NA3A 1VC6A 2HFNA 5HATA 4MFBA 5C7PA 2YNGA 3ILIA 5E5NA 2AEFA 4TVAB 1JLAA 5DGAA 3SSRA 3FC9A 4YN3B 1JLAB 5GADI 2VPZB 1TK8A 2J7KA 3QT6A 1OQ3A 2BQ3A 4PRFA 1SL1A 2NZCA 2OJ3A 4FKYA 4GVLA 1YQHA 5KAKA 3VAMA 4X4NA 2UVRA 5BJRA 1JLFB 2EFQA 4CDIA 3J7Z5 3VCDA 2VBXA 4DL4A 2J9DA 5DM7Q 2CJBA 4FP9A 3O6QA 4LFCJ 1R43A 5T7LA 3NAHA 3PRVA 4F0HA 4NYPA 2YPZA 5KG0A 4C3LA 2W2PP 1Q4RA 2XHWA 3DLGB 4ANEA 4ZHRA 3CIZA 3HFVA 2R42A 1LV5A 2J6SA 1FESA 2HG4A 3HKZD 4USVA 2UVWA 1PJ7A 1AZSA 3POTB 3I0SB 3MI7X 2OEMA 3RR7A 3U7JA 2NXCA 2HSEB 2XGPA 3MFHA 2FJXA 4P73A 3CJ8A 2FC9A 6FDRA 1X4BA 4M5IA 3JSMA 4DV0F 1FEHA 2AJ1A 5HMYA 4FF2A 2AHOB 3EXYA 3BGOP 4CH1A 2UV8A 3R8YA 4Y2IA 5B0BA 2DNHA 2EFGA 4JI3J 2MZTA 3RB4A 2O67A 3HD2A 2P9CA 3THVA 1NJZA 3CPWR 1GMUA 1RADB 2HHHF 2N82B 1YJ9S 2UUAF 4U7UD 4WKRA 1A6LA 2F9DA 1LK7A 4G6VB 5B7WA 5IT4A 3D54A 3UCGA 2KU7A 3AAWB 4M1KA 2IHR1 3Q8SB 3NP5A 2MQ8A 3QJPA 2CQCA 1SJ4P 3CDEA 3W65A 4B9MA 3AD8C 2Q43A 4OJGA 4USHA 3V4IA 3PR4A 3K5PA 3OSNA 4LRBA 5J2PA 3KMSA 4F8RA 1WG1A 2MQLA 4LFAJ 2XWXA 4ENOA 2HS0A 4YP3A 3NGDA 1U6BA 1RWWB 4QYRA 1KTQA 3R5CA 2G2OA 3KKFA 2CG8A 1YBTA 2KXHA 2ZHOA 4FPIA 3N4WA 3PYFA 4KGVB 1EKSA 1RWNB 4BC9A 5I3PA 4TQRA 2JLGA 4J9KA 1BWEA 1Q95G 4JI1F 2VPYB 3FJ2A 2EFOA 1CJUA 2D7SA 2OO4A 1ZPVA 3RB6A 4OX6A 3FBBA 3F41A 4P52A 4QIVA 4DV0J 1U2CA 3IBCB 2OP5A 1S1XB 2CQ1A 5IOLA 2QO3A 5LSOA 2XLJA 2XWYA 3HULA 1UETA 1HIYA 3OFEA 4Q0BB 3ULHA 2J9EA 4JV1A 1U0SA 4M5GA 1JIHA 3ISZA 3EGZA 3K17A 3VVTA 3RG6A 4V19X 3NY0A 2OH2A 2F8EX 2VODA 2IA6A 3LGNA 4ECVA 4YEAA 5CYQB 1S0OA 2E5JA 1U47A 1U8WA 3CJ5A 3EVMA 2GQQA 5ETRA 3TR5A 3AD7C 3M9MB 3PW5A 4KTQA 4B3TJ 5CYMA 2DH8A 3B78A 1OS5A 3MM7A 2XYGB 4TXSA 2OPPA 1KRPA 2FUG9 2KVIA 4C0OC 2XY5A 3PW2A 4F4YA 1ROFA 3HHLA 2JC0A 3MCNA 3D2WA 1VLOA 3UW1A 5KTQA 1M90T 2XS5A 1VQSA 4FDFA 1TELA 2DNPA 1S48A 3GJQB 1URNA 2V8GA 3U27A 1FK9B 3AJDA 1XNQF 3P49B 2D3O1 2X3DA 4WTOB 3AOAA 3TZXA 2WCXA 1TL5A 3GR0A 3Q8QB 2CNLB 1VRQC 1Y5IB 4MK8A 1ZAXA 3GIJA 4DR3F 2I2YA 4JI5J 1CULA 3FSIA 1FRXA 2FVPA 4NZ0A 1PCAA 1F5BA 1YJTA 3OVBA 2NUHA 4USKA 4WXWA 4IRDA 1YJRA 2ZE2B 1QVFR 2GMHA 4TY8B 2E7VA 2XMWA 3GWCA 1XMQJ 3Q83A 4CQ1A 3MM6B 2J9CA 3EJMA 2PSZA 4TY8A 1FA0A 2BQUA 4OI1A 1QAYA 3IRXA 2MTLA 4MKVA 3OR1A 4QJVA 1RT2B 1QUVA 2LDIA 3CDWA 2FLOA 2KFNA 4DL7A 2W7AA 1PAUB 1TL1A 3BGUA 1JWWA 3QIPB 1C0TB 4UY85 1R0CB 1TAUA 1JNZB 1KLNA 1N48A 4WFYA 5HMWA 3ONQA 3T1AA 2BBEA 2BE2A 3FZBA 2EFNA 2RDDA 1X4GA 4I2QB 1KNZA 1EQ0A 4I68A 2UV8G 2ZKUA 3G6XA 2VOOA 2HRUA 3NNCA 2H5IB 4I2QA 4DS5A 1I6JA 4M5DB 1FTCA 1RAGB 2AJ4A 3KLIA 4NA1A 2LDYA 3M6UA 4RW7A 4ZP6A 4ES2A 1UZHA 2Q6CA 2KFYA 4XO0A 2DNYA 4AD6A 2HNDA 4WFBQ 2HAIA 1Q8IA 3CC7S 4IRKA 4OYOA 2R3VA 2RHSB 2QFIA 4PYAA 2VONA 1CBKA 3P96A 4LRDA 1GMVA 2QMXA 5DM6Q 1RWPB 1V9OA 2H48B 5H9EK 3DC2A 4IKAA 1TKZB 4RU9A 3HHDA 4Q2LA 2P6SA 3J7A1 5HP1A 3ZZRA 2JSXA 2FLNA 3CJTA 4PEOA 1S1TA 1WC6A 1ZOTA 1WF0A 1DAXA 5BR8J 1YRXA 1U1KA 1ZYQA 4P6QA 4DV5J 1RAJA 4TLQA 4NXMJ 4OV1A 3KK2A 1BQXA 1W7WA 3QMQA 5HK4A 4F2SA 1RT1B 3MPVA 4F4XA 1FJCA 3DMJB 1MMLA 1UWBA 3IGVA 1U0HA 1UJ5A 2DGTA 2V8DA 1QAIA 3PO5A 4BDPA 4M95A 2JWNA 3H5YA 4RW8A 3Q24A 1H38A 1UWBB 4Q44A 2DIVA 1U0HB 3TO8A 2VD3A 1DRZA 2X1FA 1S6UA 4CP5A 1RTDB 2QT7A 4LR9A 4NRTA 1RWKB 3LALA 4WFNQ 1J5OA 4LJMA 2ZWPA 2MZJA 4XAKA 1RTDA 1UP1A 2GO8A 1RAIB 1S1UA 4JI3F 1AYEA 2XMVA 3C46A 4QR1A 3QSYB 5B08A 2A6OA 3RYLA 3VGSA 4P7VA 4O3PA 1LOUA 2DT9A 1TV6A 1JLFA 1VQ6S 1G6BA 2HHPA 2VL1A 2D9OA 3CDUA 3L95X 3CDAA 5J1NA 3A12A 1IBMF 3EDQB 2WK4A 4Q2MA 2HVIA 1SL0A 1M1GA 3P5TL 2JVOA 4PXDA 3W5ZA 3OTEA 4LRCA 2X1BA 3CCQS 3PJ9A 2AMCB 2MZSA 3DLGA 2HQDA 4O44A 4ZHRB 4RU2A 1O5JA 3MECA 3R5AA 3ILOA 2H5EA 4I6WA 2BX6A 3KK1B 4F3MA 2HHXA 1IQTA 1AZSB 4LRFA 4HYKA 4RJVA 3UO0A 3MR2A 3KK1A 2YKMA 1TK0A 1F5CA 5EX0A 1RACB 5KFRA 4DR4J 5C42B 2FDNA 5DQIA 2PD1A 1P1TA 3QFHA 4R5PA 4ZPTR 2H51B 1WACA 2YKNB 4CH0S 4DN0A 2W8LA 3CMES 1VK3A 2KHDA 4WF9Q 5ADZA 1MWQA 2Z8QA 2XMMA 1A9NB 1L3VA 5FLXU 3RAQA 3CC2S 2AKWB 3HHLC 4Y2KA 3ZTRA 2E5LJ 4FF1A 2JFKA 4ZN1A 4TY9A 3DLHA 3SFGA 5LOQA 5LM7E 4PQUA 4B3MF 3ELHA 1N34J 1LWCB 2RMLA 3JXOA 1BUXA 3JS9A 4QPTA 3RBZA 3V4IB 2C2MB 4OYMA 2AYEA 1RAEB 5A8RA 4EO8A 1F1BB 5U47A 5LXRA 4DU7A 1AFIA 1Z4UA 3GIKA 3KDOA 2KXFA 4OYWA 1YRTA 4JV5F 4IQMA 1M5OC 2RF2A 4DV1F 5DETA 2GVZA 4NX9A 4RUBA 5KFKA 1RU2A 5K14B 5KFZA 4U7CA 4JV5J 1CQNA 2XMJA 4YB5A 2ZOFA 2Z30B 1RWUA 2QX0A 3RBXA 1N33J 4IO9Q 5SZTA 3W9HA 1O0PA 4FXVA 1QDUB 5E33A 2HVHA 1REVB 4MAKA 3NXZA 3FKBA 2DYAA 4RNHA 4CNYA 3NMAA 4EGLA 2VU5A 2HBYB 4ZPCA 1YVFA 6FD1A 2OTJS 2EK1A 3MMBB 3R7SB 1CC8A 2CKWA 3MZIA 3H20A 5CYQA 5F0UA 3AODA 1N5YA 2V5HG 1S77D 2WB1D 4DUYF 5DZ6A 2BZ2A 2R8JA 2CFXA 1QSYA 3GJSB 3V2UC 3LOUA 3QT8A 5LMNJ 2XMUA 2RS8A 1PGZA 3ZFVA 2MSTA 4ZK7M 3PYDA 3O3LA 1WEYA 5IQQA 2M8DB 4B9SA 3KLGB 4DPWA 3KLEB 2E5HA 2OAUA 3RUBL 4NLQA 1KQKA 4MKYA 2V9KA 2OELA 4F36A 1QVGR 4N77A 3T3FA 3G8TA 4CCHA 1FJEB 2XS7A 1SUQB 2G9OA 5K8MA 3PKYA 2UP1A 2MKCA 3OW2R 4IG0A 3KHGA 2GS8A 4KSEB 4CI0B 2I5JB 2Z0GA 4K7QA 2IIHA 5KFSA 4DFJA 3R97A 4DF8A 3UD4P 5CD4H 2DXDA 4RNNA 3D4JA 1M1KT 4QIWD 2FHKA 3HVRA 2W25A 3M1VA 3BJYA 4C8ZA 2KYXA 1Q16B 2J8AA 2ZC4A 4I6YA 4UUWA 4DQRA 1S9GA 1ZTWA 1UJ4A 1KFDA 2DEJA 1YZ6A 3MPWA 4DWIA 3HHNB 4QYZJ 4RW4A 1C4CA 5IT0A 4ZVOB 2RVJA 2OGUA 3H2LA 1S79A 2DGXA 2RNEA 3I5AA 3ZZYA 4PG4A 1X5SA 2FHJA 1S9EB 5EWFA 1FWKA 2W2QP 3T19A 1XERA 1H2UX 2HLUA 5C25B 4CO2A 1H3DA 4C0HA 4JI6J 3W66A 2X3GA 3RB3A 5AE3A 7AT1B 1J27A 4AXJA 3GLJA 1L3KA 3EE3A 3ISNC 3L7OA 4K4ZA 2V8VA 4PXCA 4RR5A 3TJAA 1GTHA 4X4OA 5GMKa 4HR2A 2O3DA 3L7UA 5LMNF 1JJCB 3PJXA 2FLLA 4TYBA 2HPUA 2EG2A 2QN6B 2V67A 2EK6A 2QA4S 4NL5A 2ADBA 3FCHA 1FO1A 1T02A 3I9ZA 4M5NA 2L9NA 5JMNA 1ELOA 1N34F 3BKTA 2UUBJ 1SH2A 2ROEA 2ZH4A 4DFPA 1NK8A 4DQIA 3IA0A 3K8WA 4RW9B 1EP4A 1OPIA 4ZLJA 2RDJA 2HBZB 2WW8A 2X51A 3V6HA 3F73A 3H25A 1NJIT 3C6UA 1IR1A 1SVDA 5K8PA 2YWEA 1UVLA 2XNQA 2FJBB 1SB6A 4ECTA 5D3GB 1RJJA 3EGNA 3R7NB 4B9VA 3KJFB 2Y8WA 1HMVA 5J1EB 1IBLJ 4TKTA 3CD6S 3MR6A 3CCTA 5DG7A 1KLMB 2IY5B 3BEGB 1TKXB 1H2TZ 4PABA 1R8BA 5A8KB 1QTMA 3RJMB 4LF4J 2R7XA 1FNXH 2OEJA 4DV2F 2CA9A 4MIAA 2MQPA 4ED6A 2BA9A 4A8YA 2ZNYA 4DV3J 4DV7F 2LQ8A 1NRKA 4JI6F 4CLYA 1KTVA 2ZDOA 1NNDA 4A8QA 1PILA 4CYUA 2DR6A 2ZUGA 4C0BA 2YTCA 5IV3A 1XNQJ 2DGOA 5CZVA 2YQ1A 4OI4A 1B3TA 1Y9OA 2ZITA 2AZ1A 3VGVA 5KFCA 2HQFA 1CJUB 1S12A 2HBRB 3H90A 3IG1B 2Z2LA 5DO2A 3M8WA 4BWJA 5B0DA 3ZXWA 2FVSA 1RTIA 1T9WA 1S1XA 3RR8A 3AXKA 2IDLA 3PACA 2VFTA 3M6WA 4DUTA 1FE4A 1WHVA 1YZ7A 3GFXA 2JZ5A 1TL7A 2PGCA 2CQBA 1HNIA 2HGNA 2JL9A 2ROGA 3MTJA 3PM9A 5DJBA 5B0AA 2VIHA 4LFCF 2ZZNA 1RWOB 2QSWA 1TL7B 3G6YA 4B3RF 5C2CA 2OIHA 3FBEA 3NGRA 2AV5A 1U6FA 2AYMA 3QGHA 4USWA 3A8KA 1HWUA 1RXOB 4NI2B 5CQGA 5ETTA 5AT1B 2R8IA 2FLPA 5L38A 2D74B 2BM0A 1VQNS 4K5RA 4E98A 4ED4A 2UVVA 1Q86T 1FX2A 3M9NB 3AY0A 1VQOS 1SC1B 4HI2A 1LWCA 4WP9A 2NZ4A 4XDDA 4N41A 5KFVA 3QLHA 1RYSA 3MM8A 1TAQA 3EWGA 3K5NA 1NK5A 1PAEX 5F8HA 1X4FA 3SV4A 5F8IA 1FD2A 2AEJA 3HMJG 4C8OA 4KY3A 3TVYA 3OR2A 3PYGA 2E5GA 2CZVC 4J9UE 2YXLA 4JP8A 3IN5A 4OHYA 4NEYA 1Y10A 3SCLE 3OTBA 2IC3A 4WK3A 4OZ1A 1TUVA 1K0VA 2WSEC 1Q78A 2Y0BB 3OLBA 4ZP7A 2FJAB 2WSFC 3UQSA 4YHHF 4IRCA 2OPSB 3DLEB 2RJZA 3F44A 5L39A 1WSRA 2WONB 1RHUB 1NKBA 1REVA 1SH3A 5LL6d 4B3OB 1NMEB 3B82A 2HKEA 4CLZA 1JX4A 5IXUA 4JI7J 1FJGJ 1FE0A 5HLFA 4U95A 1DLOB 2HS3A 5IC6B 1VQ8S 1F0XA 2YKQA 2Y1IA 2P9EA 1NK0A 4I67A 2V0NA 4QBUA 1FVSA 1FHTA 1HA1A 1U25A 2BKNA 5ETQA 1FT8A 2V2VA 1KQFB 3J81j 5GAGI 1QSLA 1NSKL 4FBUA 5KFWA 2X7IA 1S1VB 3BKUA 3HD1A 1Y4ZB 5B0GA 4OX8A 4NCGB 1YITS 2M3DA 4M5LA 1S1VA 4QIEA 2YY3A 3EMTA 2N4CA 3MEKA 2K3IA 3DM2B 4RW6A 2CAJA 1X8DA 4DV2J 5HO4A 4Q8FA 5IT9U 1SUQA 4CO5A 1RT5B 2B8PA 5I4MA 1D8YA 3QO9A 4C6AA 1ZS6A 3DNCA 1APSA 2NSBA 2FVCA 2OI2A 3KJQB 4C48A 2ZVIA 1AW0A 3AJ1A 2QIFA 4C2MA 4L3NA 3D5MA 1SQEA 2D9PA 4CLPA 4KV8B 1PYOB 3T6JA 1DTQB 2W24A 1BWVA 4TU8A 2PMHA 1WEXA 2JOQA 3UN3A 4DL3A 1M5PC 3VWSA 3QGIA 1QLNA 4NLYA 2G0CA 5KFFA 3LO3A 3UNYA 3TA1A 1ZM4A 2CNKB 3IM9A 5IT9Y 4DSKA 2W2MP 4OYPA 4URQU 3RRGA 3DYAA 1X0FA 5EWGA 1N8RT 3NBPA 2VG7B 3WC0A 4C11B 4DSJA 2FPHX 2KG0A 3GCXP 3IGNA 3ZNJ1 1AUDA 4CT9A 2V2QA 4U7UK 3PY8A 1H73A 2KXNB 4CO4A 2MQQA 1QM9A 1WF1A 2BJ1A 1OPZA 4X65J 3M2UA 1SC4B 3OPKA 3O1LA 3VAHA 1N54B 3R1HA 3QJLA 2IVYA 1KR4A 2YNHB 5HQMA 4Q7AA 1U1LA 4J9OA 4M5KA 1IJFB 1ZM3A 2MQOA 3R2DJ 3A3PB 3CMQA 1N5SA 3FMWA 4HTJA 4LREA 5LJ5Y 2MZRA 4Q5VA 4LF5J 3GSIA 4KB7A 1JLQA 2I1RA 5AXKA 4KGMA 4HI1A 3HF5A 3RAMA 2ZH3A 2CPZA 1RQ0A 1UFWA 3I0RA 3T1HF 1N36J 2R7TA 1FFSB 5B0EA 1S4FA 2OD6A 4K59A 1LWEA 1IN0A 2I8EA 2K2PA 4FYXB 3SSQA 4J9PA 1VDHA 4A8WA 2J0XA 2R7RA 2DO0A 4JI2F 3VALA 1GXLA 2NUUG 2ZH5A 4YOEA 1X4AA 2F8MA 5DLFA 1RLCL 1RP5A 4EYHB 1SIZA 2HFVA 3DRSA 1NDCA 3HX9A 1TQLA 3B4DA 1IJEB 1NXIA 3I5BA 2H54B 1RA7A 2H5JB 2E1CA 5DDRC 1HNXF 1TKXA 2RIJA 1WC0A 5AJ3J 3ILLA 3ZZ0A 3J80U 5ETMA 4AYBD 3OFFA 4IFYB 2MB0B 1GT8A 2AT1B 3BO3A 4HT7A 5HL7Q 4FN5A 3MUVP 2R2UA 3T9NA 4KE5A 4OI3A 4OYAA 2G2ZA 3VVUA 3S8SA 4B08A 6AT1B 4EBEA 1FVQA 1FRHA 4ZA1A 4I69A 2HHHJ 5D78A 3F56A 1JLGB 2HHVA 1MMNA 1PO6A 2KRBA 1YRUA 2YX7A 2CPXA 3B54A 3HM9A 3MXHP 4CTAB 4QU7A 1JLGA 4CT8A 1QD1A 4J9VA 4EBCA 3CB4A 5J2QB 1RTIB 1S6OA 2RHQB 2BACA 5KG3A 3R27A 1U1QA 1LEOA 2UXCJ 3DRXA 3LWMA 2PT0A 2V63A 4USTA 4Q0BA 1MMDA 4DQSA 4I56A 4N8OA 2V4RA 3OUYB 2B9EA 3EXCX 4DR5F 4F0MA 5ITHA 3TP2A 1UVIA 3S7RA 3CJQA 2ZZTA 2DB1A 2EVZA 2JFDA 3A8JA 2UUCF 5CZXA 2OHDA 4NLDA 5GMEA 4F7VA 3PV8A 1AB8A 4DFMA 5HROA 1VC5A 1T05B 4FF3A 1R8PA 3VZIA 2G0JA 3BKFA 3I32A 7FD1A 2HQ3A 5KG4A 4N5SA 4IQXA 3ZTQA 2E1RA 2OFHX 2L9DA 2IBOA 3LTOA 1MU2A 4ANDA 1UL3A 2H1YA 3P8BB 4PG7A 2I0XA 3BR8A 1U24A 1D0EA 4ELVA 2WVEA 1MU2B 4PWDA 7FDRA 2CQ0A 3LP2A 4NLOA 4LF6F 1S6PB 2LQJA 2O1PA 1WDTA 3GPAA 4OI6A 2FGCA 5CHCB 5KG7A 3LP2B 3NCQA 1XMOJ 3H5XA 2C2DA 1FCAA 2GMLA 1XIQA 4DX8H 3VGUA 1MNEA 1Q7LB 3EPIA 4LT6A 4Y6IA 4OIXA 3POTA 4AE5A 2WHOA 2NPFA 3W9JA 3CVKA 4PG5A 4LBPA 2XS2A 2VFRA 4U9RA 4BC7A 3L4BC 5HBMA 3KNGA 3W5YA 3QJJA 5MAOA 3OBIA 4GVBA 4PWWA 4OMFG 4PQAA 5FLXY 3OSPA 2RQ4A 4C3MA 1PBAA 4FNHA 4OZ2A 1LFWA 2KL8A 5CCLA 1KVJA 4DR4F 2DTJA 2WZ1A 5KG2A 1KKHA 2CNOB 3EGVA 4Y2CA 4YMEA 4WCEQ 4A8KA 4KFBA 3W8PA 2ZKTA 3MM9A 4K2XA 1CJTB 4KR0B 4RUAA 3PFEA 4OX7A 1HBMA 2GNKA 2OSRA 4AT1B 1H6KX 3MM9B 1BXNA 3TUJC 4YB6A 4E2FB 3A13A 4EI2A 4GKJF 3EICA 2E29A 2PIIA 1VQ4S 2KG1A 2DR5A 3DOMB 4DR2F 3NGKA 2XMTA 2PFDA 5M2PA 2GJIA 4N76A 4KKOB 2ZEJA 3IAM9 1PG5B 1Y3KA 5GAEI 4KKOA 3QRPA 3PRBA 2DRAA 1G7CB 1TUWA 4BBYA 2PDAA 4RO0A 1S5ZA 1X4CA 2DGVA 3B6BA 2RRAA 3I9V9 1ZZFA 4I2PB 3QO9B 3FEXB 3MEEA 1FDAA 3GILA 1K1QA 4L73A 1R6VA 2WVFA 4USUA 4WPAA 1EHWA 1UWAA 4ETXA 3MURP 4W92B 1MN7A 4BCAA 3NMRA 5SUHA 2DGWA 1PJ5A 2XI3A 2VBYA 3AHPA 2IJFA 5CABA 1Y7PA 4ED7A 2GVDB 3HSZA 1NH8A 2LQ9A 3IWNC 1PC5A 1UEUA 4RBTA 4C4WA 2J7WA 2VKRA 4K4WA 4X62F 3TUIC 4NASA 1YGYA 5KFBA 2MHNA 3A1YG 5CD4A 3HK2A 2IPOB 4ZJLA 4PCQA 4G1QB 1HQEA 4LBIA 2ZM6J 2B5JA 3C14A 4HHUA 2N4DA 1XMBA 3HXMA 2B5JB 2BABA 3DI6A 1VR6A 2C3UA 5KG1A 1EARA 3WQPA 4DZ6A 1XEZA 3CW2C 2XULA 4IH6A 1HWKA 1TV6B 2DNKA 4FNIA 2BEFA 2LLZA 4Y28C 2OD4A 5E3AA 4EUVA 3AA8A 4MJKA 8ATCB 3LP0B 3X3UA 1WOSA 4IFVB 4LUBA 1S9FA 3KG4A 2RT3A 4FZVA 4LSLA 3T5KA 5F8NA 4HKQA 1D09B 1Q81T 4LF9F 1F3FA 3D6TB 3BDEA 5IZHA 1LKZA 2MEWA 5A8WA 2EKNA 4WJBA 4P2SA 3NNAA 2CJXB 3FMBA 3UFCX 4B17A 5D0HA 2L08A 1Q8BA 4ED8A 1FDDA 3BBCA 2Z57B 4OZ0A 4ICLB 1TL1B 2MGZB 1RCOB 4CRJA 2G13A 3S6EA 1HI0P 5KFXA 4PUOB 3R5JB 2D1CA 4DL6A 1YK9A 3KUHA 1F9FA 1JLCB 5ETLA 4S0MA 5J2NB 4QWEA 1RHQB 3JYTA 3OXLA 4QU6A 1BLUA 4IDKB 3GTYX 4EMDA 1RHMB 2HRTA 8RUCA 4LFAF 4IDKA 4A47A 1VQLS 3KYLA 3U1LA 1IKXA 2DGSA 2RKIB 3NRBA 4ZPVR 2WBRA 5KFIA 1WI8A 3G6VA 3CCMS 2F1FA 4OZLA 3OTDA 1C1BA 1KOHA 2RKIA 3OR2B 4NLRA 4K4TA 4EK2A 2C42A 4AFFA 3EM1A 3I0SA 1HD1A 4CM2A 1IKWA 2HGMA 1VFJA 4L76A 2IC3B 4FYVB 4C8MA 2E9TA 1KHVA 2R7QA 1T95A 4C7QA 4A8MP 1S6QB 4EU0A 5D0GA 3BF4A 1FRIA 1C1CB 2WONA 3N6NA 2AZ3A 3CCLS 4X4PA 2HIQA 2FZGB 2E1PA 2FGOA 4M5MA 2XO6A 3I6PA 4A8FA 4ZDNA 2CJKA 1J5EF 1FFGB 2UU9F 4JBCA 3N5BA 3HVWA 4DR1F 2KTQA 4W4MA 2UXCF 5MLCV 3KJVA 4ECRA 1U7LA 3AFGA 1UZDA 4JI1J 2LEPA 5KT6A 1WD6A 2BXJA 3WIUA 2J9DE 4MK7A 2CPHA 3T1YF 3BDPA 3QAUA 2CJQA 1HFEL 4DFKA 3VQTA 5D4NA 3HI9A 2RILA 1MN9A 3TJ9A 2VBZA 3M05A 4CO3A 1M5HA 2CWXA 2DH9A 3M8YA 1HNXJ 3TARA 4OFZA 4C98A 4IG3A 1GQEA 2IVMA 3EVOA 1XR5A 1UVNA 4H4OB 2C22A 1V3ZA 2KHCA 2OEKA 1VBKA 1NEEA 2PO4A 3IR5B 3ZC4A 3MECB 2HHQA 2M4MA 5K5MA 4JI5F 2D69A 3Q22A 3BH7B 4FXWA 4YR2A 2XYHB 2W9CB 3MF5A 2LQBA 4HL9A 4O4GB 2HBQB 5ETOA 4PAAA 2DD8S 2OFGX 1U45A 1HARA 3UDLA 4GC6A 5L9XA 2LECA 4DLEA 3RTVA 2GA7A 4NLGA 5K9FA 2GIFA 3AJ2A 4ZS6A 5CA5A 3PIOQ 1K1SA 3TVZA 2YWGA 2ASJA 1RHKB 3ZTSA 4CIOA 3UDVA 4UY8T 1M5SA 1NPRA 2EEYA 3MM7B 3BSOA 4ID5A 3VAJA 5DQGA 4WFAQ 4J9LA 1VYAA 1OJ4A 1V5VA 3D6MB 2VFUA 1TU0B 1CJVA 1V6HA 2VG6A 2YVSA 3C66A 3TWZA 3FQKA 3GCWP 4Y65A 1WG5A 4F4ZA 3NGUA 5L8RC 1YJWS 3MAHA 4I0WA 4DUZJ 3FCWA 1SBRA 2HFSA 1RTJA 2WVDA 1PYSB 1KHWA 2XHCA 2ASDA 3IM8A 5J2PB 1FF2A 1X0PA 2MKYA 2IYIA 4FXDA 1XNRF 4J90A 1JLQB 3EGWB 1Y3JA 2H4WB 1BC6A 5JUMA 5HAOA 3I87A 1HPZA 4M5HA 3HSGA 1R3NA 2GJFA 4WK1A 2RU9A 4IR1A 3OVSA 1HPZB 4OZ3A 5DRKA 4JV0A 1KBRA 3J7YI 2OLWA 1HNZJ 2BKOA 3UNGC 1GXTA 2CWKA 4O0IA 1D9AA 1IM4A 2FYXA 1GK8A 1DURA 3TNVA 4WZMA 2VA2A 1FRJA 4OV6A 1B0PA 2HAFA 3IRXB 1B4SA 4I1TA 2E1MC 1RAOA 3BGLA 5HANA 1VIOA 1KD1T 2E9RX 3QIPA 3QT5A 1ZZNA 1FD8A 1LW2B 1HMVB 5J1EA 1QY7A 1WC5A 1KONA 4DV1J 1UA0A 4M5DA 3KLIB 1X5OA 4M8LA 5A8KA 2ZJRQ 2DHGA 3D1QA 2DY9A 2DNRA 2HQIA 5D4OA 5AXNA 3G6ES 3FCVA 3D0IE 1F2GA 2X1AA 3KTQA 2VPXB 3MGJA 1LWXA 4EBDA 1BQMB 2DK2A 2JHEA 2CJ9A 4KH1B 5H9EJ 5IFMA 4PPZA 2XY6A 4LF1A 2W4PA 3KHLA 2HVZA 4KGKA 3MM5A 2ZM6F 4ZCKA 1D1UA 2DITA 1P27B 2VHGA 1NU4A 3C8YA 4GO7X 3IMQJ 4ID8A 3AXMA 5HP1B 2P9GA 4X4UA 2GQ2A 4ETZA 5F8MA 3AB4B 3ITHB 3IS9B 1BQNA 4AL6A 1ACMB 2MKKA 3W63A 3FDSA 3ITHA 2XLIA 2V4JB 4UOFA 2V8HA 1MLAA 2H65B 3KK2B 3IRWP 4WBFA 2QEXS 1NM2A 3D1OA 2CZ4A 4A8SA 3C3LA 4OHZA 3ET6A 1B99A 4RW8B 1HNIB 4KJIA 4ES3A 1Y5NB 2GAHC 2GMJA 3EVWA 4ATNA 1XR6A 3ZTOA 4QW9A 2YNGB 3BQ2A 2OSQA 3TX8A 1N32J 4U8YA 1RZMA 5HROB 1EJ7L 1YTYA 1T05A 3CULA 2MZQA 5DZ7A 2HHSA 1C0TA 4OX9J 1U8SA 2J5AA 2YWHA 1XWLA 2R8GA 2HHWA 2G0IA 1GTEA 2A10A 5L1JA 2NQPA 1JXVA 2EW9A 3IP0A 1G2EA 2VDHA 1U1OA 2Q66A 1XJWB 3BB5A 3E51A 1OY9A 4RW7B 4O23A 4KT0C 1WELA 1WORA 3TVKA 3W1YC 4C8YA 1WJ9A 1S99A 1OYEA 1U6ZA 1GFWB 4LBHA 1B7FA 3FK4A 3TZWA 2O01C 1CEZA 1RABB 3MMCB 2JNJA 3CJRA 4P2MA 3G8QA 4CNZA 4D3HA 1XN9A 1U1PA 2B8QA 4ZP9A 1N88A 1OY6A 2CJYB 2CIMA 4DU8A 4ED3A 1L3SA 2KJVA 1IR0A 3HKWA 5IC4B 2YNFA 1R8HA 3M32A 1S1TB 4ZKAA 4DV4F 2DRBA 2CDQA 2DHAA 2O66A 2OPSA 4P10A 4EO6A 1VRTB 4J7CA 3CUNA 5JVGQ 1L5UA 1JLBB 2JC1A 2RRBA 1Z1ZA 4B9NA 2O5DA 4NE9C 4JUZA 1VRTA 4CH7A 4LF8F 4DMZA 2ILZA 4OYXA 3RRKA 1IBMJ 5GAHI 1SQGA 3G2XA 1WOOA 3GQCA 2UUBF 2CPIA 5DDPC 2RDIA 2JEFA 2JEGA 5L1LA 4HVZA 1FJ7A 4I7FA 2MKIA 2V9WA 1I94F 3W62A 4DG1A 1WOPA 3W60A 4B9LA 5A8RB 5KFDA 2MLXA 3K2YA 1N5VA 4RX6A 3P5BP 2GAGC 2WSCC 3ISND 4B02A 1U26A 3IWLA 3G87A 3HLUA 4F2RA 4C8NA 3WX4A 3DDIA 1Q53A 4XPCA 1RI7A 3N0VA 1VC0A 9ATCB 3EZ5A 1RHJB 3E01A 1HWJA 2YKAA 2EG1A 2L9WA 4DCJB 3TUZC 2NREA 1VBYA 4KPYA 3MEEB 2XZWA 3E01B 3FNNA 1RBLA 4U67Q 3RBDA 3BH6B 1RAFB 3EPGA 1SC6A 4O44B 3A3OB 5D77A 1DY3A 1IQZA 3MAAB 4LRAA 2YKOA 1NSQA 1VISA 1VRUB 1XR7A 4MKAA 1FDNA 3JSYA 4KV8A 2RD5C 3LF0A 3R3TA 3O44A 2IMOA 5KFJA 1L3UA 1U1MA 3BGRA 2LYVA 1J5EJ 3TAMA 1K8AT 4Q8EA 2EPIA 3SCKE 3PYEA 4I6AA 2RAQA 3QGGA 3DLJA 2PA8D 1U02A 4WYLA 1MG7A 3T1HJ 3DN9A 4KC5A 2EWHA 3Q0AA 1C2PA 4NMLA 3OTOF 3FQLA 1IXKA 2IA0A 2DISA 2VC0A 1SPBP 4O3NA 2XGQA 3PVXA 2V6AA 1JLEA 2FHJD 1IM6A 2WVBA 5KFHA 4NA2A 2VFVA 3C6TA 5DQHA 4KPCA 4YHHJ 3MM8B 3M2UB 1BD6A 4DL0C 2HZAA 1Y5LB 4E8UA 1VJQA 3OVAA 1Q7YT 1FERA 2W1BA 3MUMP 1JJ2R 4R25A 4XDCA 2J6UA 2DEIA 3UCZP 1S7IA 2G1DA 2GC8A 1YX2A 2I38A 3FFIA 4ILRA 4K5SA 5D4PA 1XMQF 1K0TA 1DHMA 1TMMA 2ATCB 3GSDA 2UXBJ 4GMKA 2BW2A 1UVKA 2Z58B 2J76E 2KT5A 3UCUP 3QIDA 4H4KA 5EGYA 4NCAA 2VPWB 2CPYA 2FJDB 3DLEA 3ZO7A 3AA9A 1VHIA 2CYYA 1PBUA 4ITSA 3RZAA 3W5XA 1S0MA 2HIYA 3E3XA 1D9DA 3TJ8A 5E2QA 2BJDA 2DNZA 3VAFA 3V6DB 4IOAQ 3GFYA 4KYZA 3T41A 3HT3A 2PI4A 4PUOA 3H4DA 1KVKA 1DQ9A 4ZPWR 1LW2A 2ZNZA 2YH1A 2W4DA 3B4MA 1VS3A 2P6TA 1N5QA 1L3TA 9RUBA 2FZCB 2OPQB 4DF4A 3FRZA 2KH9A 4RWWA 1HI1A 3KXDA 4CO1A 2QA4G 2LXFA 3LW5C 2J0WA 3U1MA 4ECZA 3D6HB 3HHLD 5GVQA 3KLGA 4B9TA 4IO1A 3CWJA 2F4FA 4NRUA 1OMSA 2P2CB 5E7OB 5HVHA 2VG5B 4LFBF 2OPRB 2CJAA 4WFZA 3T6BA 2VDIA 1HQUB 4JI8F 1WNEA 1SV5B 2AIRB 4LSNA 1TKTB 2B9WA 3T1YJ 1HWLA 2DR9A 2Y8YA 1SV5A 1CJKB 3RGIA 1YJ7A 1D3WA 3ZTPA 1HNZF 2VB6A 3DLKA 3MEDA 3GP9A 3G71S 4HTIA 1WDDA 3OTCA 1SJRA 2CQIA 2W7OA 1U49A 2KO1A 4R8UA 1H7XA 2N3OA 2KN4A 1MROB 3KJNB 2KB2A 2R7OA 3H42A 3H5UA 2DNNA 3JSBA 3QWUA 2MLZA 4URGA 1NB7A 3Q23A 5CH7B 5KFLA 4DX7A 1RK8A 3ET6B 3DHWC 3MPYA 4QIFA 2LU1A 4Z7YA 2MLYA 2X1GA 3JQJA 3LUYA 1S57A 1TZ0A 5ETVA 3T5JA 1VI7A 2A3JA 4KO0B 3KJVB 1IVZA 2VG7A 2M70A 3PIPQ 3M6VA 3MTKA 2VQFJ 1S59A 2HNYA 2MHEA 3CCJS 3WIVA 4N7TA 1S76D 4UW2A 2MKHA 5KT3A 2M9KA 3CD0A 1IR2A 2KRRA 2PMWA 4CYUB 3KG0A 3DOKB 4RZRA 2E1AA 5IV4A 3TANA 1W2BR 1OO0B 1HNVB 1X31C 1WWHA 3M8PA 2B51A 3DOKA 3S01A 1CG2A 3DRPA 3K5LA 1I94J 2XB2D 4OJHA 4UTGA 4EEYA 4XK8C 1S1WB 1S49A 1VJWA 2XSJB 3G82B 4UZCA 3SV3A 4LF2A 3M8SA 5I3UA 4MKBA 1IBKJ 3NL0A 1SKWA 5B09A 1KC8T 3J7AN 4RUCA 5H9FK 4TU7A 3NS6A 1G1XA 1NK6A 3M6XA 4LF7J 2MKJA 2B43A 4ZVTB 3GIMA 2IMWP 4RBVA 3W2VB 4UOGA 3GIRA 4R5PB 4RL1A 1H2VZ 3QPIA 1ZTTA 1W2IA 2YNFB 4LQ3A 3V81A 2J6TA 1HHQA 3FBCA 3W2VA 3VTIA 1T0TV 2UXBF 4OL8A 3IBFB 1GMWD 1ICEB 3PEHA 2B7BB 4X66F 5D3GA 1I3OB 3S1TA 1I51B 4K50A 3GJRB 4WIQA 1F60B 3GR1A 1HW8A 4LF5F 4JB8B 3W2WA 4LF9J 3NOGA 4ECUA 3VHQA 1CJTA 4RKUC 2R4FA 1KEKA 4RNMA 3L9ZA 3KK3A 2Y3YA 1NUEA 1T9VA 1OQ6A 2HK3A 2FD2A 3I96A 2HHTA 3EUNA 2GW8A 5KFEA 1S97A 4HACB 4ZPDA 1TVRB 2PN6A 2K8GA 3MCOA 3T9ZA 2EXUA 2UUAJ 2CDRB 2DGUA 3DOMA 3H5SA 5I42B 2DPJA 1UFKA 2MDAA 1VIXA 3MMJA 1CS4B 3Q8YA 3ZZZA 4DL2A 2M2BA 1NSPA 4DDFA 5JJBA 1IBKF 3G8SA 2ZD1B 3U02A 4CLUA 3H7HB 2CPDA 1WHYA 2RF2B 3BN4A 2F9JA 3QBCA 1F9EB 2FY8A 2XZDB 1U2RA 3R6LB 4H4KC 2GIRA 4NZ7A 3ADAC 2F7VA 3GJTB 4DV5F 2XO7A 3DLLQ 1UVJA 3W3SA 2HNZA 3TAQA 1WKJA 4LFBJ 4WE1B 3MAAA 3I55S 1GAOA 3LPEA 3R5DA 1T9UA 3EX7B 3PX4A 4C8KA 1N52B 4QCLA 3T5LA 2AYBA 3PZPA 1NCLA 1YKWA 2AGPA 5IM0B 1QSSA 4UOHA 2B4PA 3GONA 1VHFA 1VGYA 1DZ5A 1RWMB 4ZIWA 5IM0A 2KT2A 1TP7A 2HEKA 4ZCMA 5DGBA 4I4BA 1SJFA 4DSLA 1QAJA 3FBFA 3B8HA 1FRKA 2IM0A 1SCJB 5GAHU 1SQFA 1K9MT 2GZOA 2V34A 1FEEA 4U8VA 3CCZA 1A0OB 2NCKL 4ZIVA 5LSLA 2AWZA 5DDQC 3MMAA 4YS2A 3LWLA 4DQPA 4PWDB 1FRMA 1JJ4A 3CJ4A 1UJ6A 1U2FA 3MM5B 2JRSA 2XNRA 2E44A 3HT0A 5HJXA 2W9BA 4IOCQ 5FJ4A 2JJ4D 1WHWA 2Y1LB 3UE2A 3CCSS 4GKKJ 2JEJA 1GH8A 3OL9A 4EYIB 2HFUA 2LEAA 2NR0A 1C0UB 2OMLA 2MQMA 2Q3PA 1DTQA 2Z2MA 3D3CJ 1JMTA 2NXNA 4HDHA 3VAIA 2UUCJ 1Z2LA 3C16A 4D3GA 4WTYA 1RBAA 1W26A 2G2YA 2ASYA 3BZQA 3DRRB 4ZJQA 4FS1A 2MJUA 4TN2A 5KFPA 2R2TA 2QZ8A 4AQYJ 1T3NA 4Q45A 3DGPA 1YBUA 4WU2A 2FY1A 1FWPA 3PHEA 2B9YA 4MFBB 5A8WB 1R8AA 5HMZA 3OL6A 2KDOA 1W25A 1RBOB 2VQFF 1ZA2B 2NYHA 4M5JA 3KWMA 1V3SA 3W9IA 2MYFA 2YNIA 5LT5A 2BJEA 4ICLA 1OYDA 2CRLA 2LMIA 2WRMA 2MGZA 4AL7A 3PJWA 1TTHB 1IKYA 1IUJA 1X4EA 2DNOA 2GIQA 3CT9A 4V1Ak 4N56A 3CGIA 3D6FB 2DKOB 1GX6A 1O8BA 1Q0NA 3DDNA 1T11A 4FS2A 5J2NA 1N36F 1TFWA 4HEA9 4K4VA 2YNHA 2CNNB 2C3PA 2QLFB 1JNRB 2N7CA 4X4QA 2BR0A 4J5OA 2LP4A 3V6KA 2DVIA 1JJHA 4AUKA 2KI2A 4OHXA 1HBUA 4DN9A 4XIUA 3A8IA 2RQKA 3OJSA 1UEVA 2WOMA 2YKPA 2Z2YB 3FUYA 3MEGB 2P8IA 4I2PA 1DQAA 1DQ8A 1LWEB 1NSAA 1TKTA 1RE1B 2LA4A 4ER8A 1IKWB 1FXRA 2ZUAA 4LF7F 2JH3A 2NSCA 3BSCA 2E9ZA 4K0KJ 4FYYB 1HR0J 2HWIA 4K4UA 1F9HA 1NPPA 3WC2A 1FKPB 2CQ3A 4MH8A 3M32B 4DLGA 3SI8A 4ELUA 2PC6A 3Q8RB 1FKPA 2D3UA 4DR3J 3CJKA 4UT4A 4W90B 3EZOA 5HVGA 2E5LF 1X5TA 1CQMA 4J9NA 3H0PA 3QZ7A 2EFPA 4ZOSA 3CJKB 3ENQA 2ZBRA 3BYPA 2AJFE 2H3EB 5AE2A 4I7FB 3NWGA 1Y0HA 3RAXA 4O3OA 5D0RA 4DXLA 4W98A 3KLFA 2CQDA 2NXEA 4QWAA 1S1UB 3D1HA 3TRGA 4C11A 1DTTB 1KQGB 4ZLLA 2Z4PA 3DKDA 3T5HA 4X84A 1PSDA 3JB9k 2JLFA 3P6YC 1NHVA 1EKRA 2GHVC 2CZ9A 4K2JA 3OFHA 3M8ZA 3M8PB 2LU2A 3CO0P 4FVMA 3TUPA 4FYDA 1ZM9A 3NCRA 1T3OA 1TL3A 2HFOA 4UF4A 5L9NA 4B3TF 1HBNB 3SDEA 1S0VA 2C2RA 4IFVA 2BOPA 2BANA 3JTNA 2DJWA 5A2QU 3UR3C 4U96A 4ZVQB 4ED2A 1YWXA 3GV7B 1V3RA 5D6GA 1GNKA 2ZWOA 3PTWA 4TYAA 1N4LA 1HKAA 2BMBA 3D0HE 3MD1A 3MUTP 4HT5A 1TL4A 2RH3A 5HSPA 3LQVA 3ETOA 4O4GA 3C19A 3D0GE 2HQGA 3OJUA 1LXNA 5IWAF 4KIAA 4JI8J 2FJWA 1VLYA 5ETSA 1HW9A 3V81B 2SXLA 3HZEA 3VV2B 1GEHA 4DPYA 3M8RA 4JI7F 3GB0A 5KOWA 3M2VB 4K4SA 2ADCA 2ZBPA 4AQYF 4C3KA 4OI0A 3NCPA 5A2QY 4WFXA 2VQEF 1S72S 1JLCA 3JYTB 3PEJA 4ID5B 2ATLA 1T9XA 3JQKA 4FKXA 4LSZB 2QLXA 4PQUB 2FQQB 2MMYA 1CJVB 2OTLS 4DZDA 3C6TB 1TVRA 1QJHA 3HSJA 3L7PA 3LH2S 2GQCA 2OMOA 5DLGA 5DS7A 2IJNA 2M0GB 4IOBA 1NDKA 3SYZA 2ALZA 1C1BB 3HCXA 1RTJB 2F5GA 4H54A 4MTPA 4N8NA 4ZVEA 3K57A 1U4BA 2QTWA 4ECXA 3MR5A 4DPTA 2GVZB 1T94A 2Z56B 4GO5X 1VBZA 4DR6F 3M8QA 5GAEU 3WBZA 2J7UA 3OXFA 4ZMMA 3VAKA 3ICLA 2ACYA 4WWSA 4OHVA 4YDDB 2AEMA 4DV6F 4OQJA 1GXUA 1YSJA 2D3OR 1M5VC 4MMOA 2IAJA 5EWEA 1SXLA 2APOA 3QFWA 4J9QA 2BQRA 3L3CA 2B7CB 2LVWA 4ZVHA 5G4DA 5C24B 3I56S 1X9SA 3BGFA 2MKSA 2FJVA 1S7HA 3BM7A 3KLHA 1G3OA 2WAQD 1XNRJ 1HBMB 4XPEA 4LF4F 4NLPA 1DLOA 3CF5Q 2AJ0A 2QSFA 4YB7A 1XK8A 3F0NA 2BE2B 3OUYA 3NG8A 1HL6A 1RWVB 3LA0A 4J9SA 1PKUA 1X9MA 4ILLA 2DNMA 3QATA 5F3ZA 2DIUA 2V2ZA 2AGQA 4PYDA 4ZPBA 4URSA 5F8LA 2HRYA 3WX8A 3I4PA 2OPPB 1UFLA 4QQBA 2HFZA 1YJVA 1SJQA 2CPEA 4ZVPB 1VK8A 2XSFA 3QZ8A 2RRNA 4F67A 3G9CA 3HHLB 3PW7A 4NMXA 5E3QA 2XEXA 2YWKA 3NGTA 4DCOB 4IG3B 4DR6J 2V69A 5GAGU 2ZH1A 1TKDA 2IYGA 1NZAA 4H4OA 3G4SS 1T9YA 2UUTA 3IR7B 2K3KA 3R9LA 2GO9A 1FK9A 2LKZA 2UU9J 1HNWJ 2YBVA 1KQSR 4TQSA 3NKYA 2BOAA 1RAHB 5A0YB 1KS2A 2W01A 3CJ3A 2AU0A 4USMA 1ZBTA 2K7KA 5DDOC 5C2GA 4B3SF 2UVUA 5GADU 4TNOA 5A0YA 3D3BJ 1CVJA 4JI0J 3H98A 2UZAA 4OZJA 2HMIB 1VQ7S 3J7YU 4MK9A 3JSRA 3N79A 2GVDA 4PXEA 5HBMB 3RW7A 2PE8A 4YY3F 2V4JA 2BVZA 2CPJA 3GU0A 1R0AA 4DUZF 5KFTA 3GG1A 2IRUA 2DRDA 3DGPB 1R0AB 1RHRB 3G86A 3HJVA 3LP1B 4J37A 4KGZB 5AXLA 5T14A 3M7VA 2DCLA 4KO0A 1R6YA 2K06A 3TZYA 2ZH2A 5CYJA 2QFJA 3LP1A 4OZ5A 3D68A 1WKKA 2FHMA 3D9BA 3OR1B 2ZBIA 1RYRA 1FNOA 1UMJA 2LQ5A 2VG6B 3SCJE 3AD9C 3BO2A 3LGHA 1YI2S 3KNAA 1HD0A 2WBMA 1IKVB 1NBEB 4F4WA 5M2UA 1DFDA 2BJ7A 1HQ2A 3Q2TC 3H8YA 1SJ1A 3QWPA 3V6JA 2IRYA 1NLKL 3IO1A 4DX5A 2XC9A 1P1LA 2EBEA 2QYCA 2Y0SD 1D8ZA 1E6VB 2A18A 1BMQB 4P9SA 4I64A 1S10A 4DV7J 1PYTA 4R0JA 3CCUS 4ECSA 2XSJA 3BSAA 8AT1B 3RBEA 5HN0A 2ZOGA 2DR8A 1FDBA 2OUGA 1EP4B 2VASA 2YPYA 2XMKA 1SL2A 5J2MB 2L48A 1NJXA 1P9YA 1TKZA 1UAWA 2E7WA 4O3QA 2R7SA 5KG6A 3UWTA 1BGXT 2YKNA 3K7RA 5F8JA 4KRWA 3AB2B 4DX6A 4ZITA 2HW3A 4ZPAA 2VH7A 2G1HA 4V19J 3K8VA 5AJ3F 2HWHA 1HBOA 1K44A 2M88A 1WI6A 1BY9A 3D7SB 3BBFA 2QRRA 3RW6A 1SKUB 1GMWA 2ZJQQ 1HBOB 1RGVA 4PG8A 3CEDA 2DBBA 3DRSB 1M5KC 2PFFB 2XG8A 2QL9B 1XC9A 4X4RA 1RAAB 4EFAC 3R6GB 3KUGA 2B3TB 2QLWA 4QR0A 4WP3A 5JXSA 3NWRA 4A48A 3GFHA 3KLFB 4YR3A 1YBAA 3UN2A 4IFYA 1HQEB 2PMZD 1TFYA 1NAQA 1Q5YA 2VC1A 1AUSL 1UTAA 3HZGA 3QT7A 3DI6B 3PX6A 2R7UA 4DHVA 2ZD1A 5E3RA 1N0VC 2EFVA 1NK7A 1Y11A 2QA2A 1NB2A 1R31A 2HURA 3PNIA 5M2RA 3CMAS 4DV3F 3JQMA 3TQ1A 1CLFA 3PRDA 5KT7A 3SEOA 2B9XA 1BQNB 2YQ0A 3CCWA 1RTZA 4G65A 2QGFB 4WE1A 3QAEA 3TYTA 4CM0A 1EZZB 5LSRA 3OQ2A 3DXSX 4F04B 4LMZA 2FIUA 2BKPA 1VRUA 2PI5A 3K5MA 4Q43A 2UXDF 2C1EB 2MPUA 2E5IA 2DHSA 3R5GA 4OZNA 3DU6A 3CSKA
chains in the Genus database with same CATH topology
4RLEA 3M2RA 3DFEA 4F25A 4OLOA 3MCSA 4DS4A 3TAMB 3M30B 4DSEA 1F5AA 3M2RB 1HYSB 1Z2ZA 4RNFA 4OLPA 2ROPA 3M30A 1HYSA 3OL8A 3L09A 5FD1A 1YHQS 2DCUB 4FPRA 2GJ2A 2RQMA 2YWFA 1JXEA 4KAIA 2IFXA 4HHJA 1KOOA 3BS9A 2HS4A 2DNQA 3GV5B 2F8HA 1N0UA 2GCFA 2IRXA 2RB7A 2VV5A 4Y2KA 2ZZMA 2GX8A 4RBUA 3PX0A 3J7ZT 1WG4A 3JAMY 1LW0B 2OKQA 4DSFA 2EBGA 2YH0A 1PC4A 1LXJA 1C0UA 2DO4A 2JEIA 5F9NA 1LK5A 3H59A 2FC8A 3PW4A 3JSMB 3E8OA 3O2IA 3DRRA 4G1IA 2CQ4A 2ZE2A 3LGMA 4X64F 4Y3CA 2R7WA 3CDBA 2ZJPQ 2GV1A 1SH0A 5C24A 4WU3A 1JLBA 3N6LA 1E6YB 2W8KA 1WTFA 3KLHB 2U2FA 3PR5B 3FGVA 5C25A 2YQ3A 3GE9A 1E6YA 2FVQA 2FVRA 5K8NA 4BS2A 3NLCA 4ZCLA 3HHEA 4QR2A 5E0OA 1IKYB 5D8HB 2DNGA 3H2VE 3OL7A 4YB1P 3JTOA 2C28A 2CQ2A 2E66A 1Y00A 1K73T 4Z2XA 3TOQA 2IM2A 2HLTA 2BUNA 1U48A 2LA6A 2MY7A 3KLEA 5F0WA 1TK5A 3FRYA 3GZ7A 4ED0A 3NS5A 1FNMA 2HNDB 3QYYA 4LIRA 5KT2A 2XY7A 1N5TA 3CJ2A 1GX5A 4PG6A 4UOCA 4QWCA 2VG5A 4FVCA 4OHWA 1RT7B 2VOPA 2ZOMA 5HMXA 2P5VA 3DRYA 2IM3A 2KYZA 4LSNB 2J0QD 1QUPA 5HQ8A 3J80Y 4NLWA 3GYXB 2LCWA 4O4RA 4ECWA 5KT4A 1DBDA 3CCES 2AP6A 3EZUA 3PO4A 1S9GB 3AQOA 4CZCA 2I9SA 2ZFHA 1IBLF 4DJBA 3GFZA 2RE1A 3DOLB 4NYZA 4O3SA 4USJC 4UQTA 3BR9A 3DOLA 1J5OB 4WZQA 4HLBA 1T03A 1X4DA 1VQ9S 1JLEB 1HHSA 2HNYB 1VBXA 1T03B 4WKYA 1NH7A 2Q79A 1NK9A 1YG0A 4AL5A 4ES1A 1HNVA 5C5JA 1QE1B 3I31A 1HBNA 1E6VA 3SDEB 2HGLA 1FTRA 5EX3A 3DRPB 2KKHA 2BANB 3ENVA 4IH5A 5A6WA 4KHRA 4EZ6A 2U1AA 3K0JA 5E3CA 2KT3A 3I0RB 2DHXA 4LSLB 3IAS9 2ZH6A 4F02A 3MFIA 5I3UB 2BV3A 1VQPS 2MJNA 4WYWA 4F4KA 4JI4F 2A2CA 1B0TA 4WIIA 2BM1A 1WF2A 2AF6A 3O8WA 2ILYA 1JB0C 1S0NA 4IUFA 2BYCA 5G0RB 4DEZA 2C3OA 4Y34A 2ZH9A 1T8EA 4F3OA 4DSIA 1X5PA 4JI0F 3K59A 1H0HB 5A6PA 4ZLPA 1KLMA 2KJWA 3LAKA 3MOZA 4QPXA 4A8OA 2GGPB 1WEZA 3Q8PB 1FKOA 4LQ9A 2NXUA 2QE5A 3TA0A 2ASLA 2GGPA 3GYNA 4B9UA 3DU5A 1OSCA 3FSXA 1FRLA 2GHPA 3HDSA 4MYUA 3GG0A 2DPIA 1BQMA 1T7PA 1UVMA 2NYIA 4KHMA 4ECYA 5KFGA 5KFNA 2MZ1A 5KT5A 3P3DA 3KHRA 5K8OA 4ERDA 2RU3A 5K14A 4J9RA 1VQ5S 5L1IA 1N6QB 4C9DA 2IAJB 4JOUA 1N32F 4UUXA 2HNZB 4A46A 3IWXA 2RUGA 4PKDB 1RA6A 4PWUA 3DMJA 4MYTA 1O51A 1NK4A 2EKYA 3VF0B 2R8KA 4F26A 1HWIA 4PPDA 4NPOA 2CVIA 5B0CA 3VAGA 4YFUA 1N5YB 2XBPA 2YX4A 1OIAA 4NLSA 1R27B 1RDRA 2LXIA 4QIGA 4USIA 3HVTA 4IR9A 4NCBA 5KFOA 3CC4S 2CQPA 3SFUA 3HVTB 4AXIA 2EC0A 3DM2A 3KMQA 2XLKA 2MY8A 3UD3P 4K4YA 5EUHA 4UQGA 1WTBA 4NLXA 2XCAA 2F40A 2EI5A 4NLTA 2F4VF 3IC1A 2AW0A 1H7WA 3SCIE 4BHQA 2LXUA 1RT6A 3M4XA 5CCMA 2V94A 5F9LA 2W9BB 3Q2SC 1CPZA 1RT6B 2VKZG 2M7SA 2ZHBA 4H4MA 1JKHB 3PKMA 4QWDA 3FEZA 2B56A 4H4MB 2CPFA 5LMUF 4JV2A 3MMCA 4NOHA 3M1VB 1I1GA 3MR3A 1MWYA 1SKRA 1SJ3P 3WZ0A 2CQGA 2XI2A 2DNLA 4HH0A 1HR0F 3LPYA 2HZCA 5DG8A 2G4BA 1SI9A 5KOXA 3HHKA 3HO1A 4B3OA 3NBPB 2Q1LA 2V2KA 3BO4A 4A8XA 1LWFB 4F50A 1U1RA 4ZP8A 5HLFB 1S9EA 3A8EA 2D41A 1MW7A 1ULRA 1LWFA 2AYGA 3CE8A 2M5YA 1IKVA 3PFOA 1FXLA 2KZMA 2UUWA 5F41A 3OHAA 2AQ4A 5FDLB 1P8GA 1RISA 2A2DA 5E3PA 2YX1A 3US5A 1RT3A 4EWTA 5FDLA 4DPOA 3VR1A 3GV8B 4RNOA 3MAQA 4RUHA 2L41A 4NCGA 3CJ0A 2B0GA 2CG4A 1RKIA 5IQ6A 2LEBA 4LVNP 4LIWA 4CO0A 5E41A 2V4QA 3W7BA 3IXQA 5JVHQ 2N3LA 3PDNA 5EHHA 2ZH8A 4X2BA 1RT7A 2WB4A 4PR6A 2WOMB 1AROP 3MEGA 2ZDPA 5BR8F 2QA1A 1ZETA 4RW9A 4EZ9A 1YIJS 1J2VA 2IVFB 3M9OB 3X1LB 1KN6A 3MOJB 4J9MA 3MMBA 2XCPA 3KOAA 2BRLA 4Y00A 3CD7A 3J81Y 1TR0A 4LVOP 2K7JA 3TAPA 4X4VA 1D9FA 3BN7A 3IFEA 3DLBA 1QAXA 4X4SA 4X4TA 4ZCIA 4YR0A 5THWA 2F3JA 1OSDA 2MQNA 3RU0A 3VZHA 2AGOA 4OX9F 1RTHA 3SZ2A 2NPIA 2R2RA 3THTA 3CO9A 3ZZOA 1ZAVA 2IBKA 1UW4A 4WXOA 5IS2A 2JX2A 1Q8LA 2OPRA 3RB0A 3E2EA 2KM8C 3CCVS 4IG0B 4NXMF 2IM1A 4L6V3 4NLVA 4Z37A 3FVYA 1YJNS 2H9ZA 3DDKA 4C97A 4U6PA 4DOZA 2K1RA 3IG1A 2AJQA 4G3IA 1HI8A 3I4HX 4R8UB 1HNWF 3MDFA 4RWXA 1EETA 1H98A 2VBWA 3BQ1A 3GIIA 2QV6A 5J1PA 3NNHA 2ZC3A 4QWBA 2B4VA 3ZZUA 2FB0A 3OLAA 4DBQA 4KQZA 4NXNF 4Y2AA 1UA1A 1R8CA 3OHBA 3O5TB 2A1BA 3EYZA 3M2VA 2VA3A 1URRA 1RKJA 4NLUA 2PA3A 3N5FA 1XTZA 1HHTP 2E7XA 1FKOB 1KVIA 2FHOB 1IKXB 3TW0A 1VMBA 5T7LB 2ZBCA 3VQSA 1CC7A 1SIWB 1S1WA 1HBUB 3KG1A 4ILMA 1LW0A 2GHWA 3MHYA 2Q6BA 3UDCA 2B4UA 3MD3A 1N56A 5DG9A 2MXYA 2RSQA 1JXLA 4ED1A 4KHPF 3M8QB 1NO8A 1VQYA 3C6UB 4P7TA 5F3TA 3C2PA 4CTAA 1NHUA 1ZPWX 3TA2A 5J2QA 1XMOF 2FJEB 1XBWA 3DLKB 3MEDB 2AX0A 2R7VA 2W9AA 4IH7A 5L1KA 4MIWA 3GMGA 4F3QA 2QMWA 3I82A 2R8HA 2BDPA 2DH7A 4NYOA 5FIIA 2KFZA 3KK3B 4IYQA 4DQQA 2KM8B 1NJYA 3TI0A 3AQPA 3OXGA 5KFQA 1DTTA 3LAMA 2FTRA 3G96A 3PW0A 2GFFA 3LANA 4DG1B 1NKCA 4FF4A 1A7GE 4NWBA 3CCRS 5I42A 3HJFA 3FSYA 1Q79A 5BYRA 3FEYB 1TL3B 2JVRA 3MWBA 4RW6B 3V4MA 3CD5A 2BRKA 5AE1A 3BQ0A 1YJUA 1ZAWA 1P9QC 4QW8A 2B4OA 3OFGA 5KFAA 1S6PA 2D3ZA 2VZ9A 3SMZA 4D3GA 4YUDA 3ZZPA 4ALZA 2C2EA 2ZH7A 5B0FA 2NLWA 1ZM2A 4HDGA 2W9CA 1U1NA 1XNQF 2KZZA