4C4WA

Structure of a rare, non-standard sequence k-turn bound by l7ae protein
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
96
structure length
96
Chain Sequence
b'TRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
publication title Structure of a Rare, Non-Standard Sequence K-Turn Bound by L7Ae Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 26
structure length 96
sequence length 96
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4c4wA00
3VAMA 2RRBA 2MXYA 2CPJA 1PO6A 4V19X 2G0CA 1U6BA 2DB1A 4OZ0A 5DM6Q 2RS2A 1B7FA 2GO9A 1R8PA 2NZ4A 1N52B 4BS2A 2CQBA 1PGZA 3NS6A 3CCMS 2MKSA 1VC6A 2JVRA 3VAJA 1SXLA 2KXHA 1N54B 3UD4P 2RUGA 1OIAA 2AYMA 4LIRA 3IWNC 4YOEA 3MD1A 1SJQA 2N3OA 2YH1A 2MGZA 4C4WA 1HD1A 1W2BR 2FPHX 2RNEA 2M70A 2M4MA 2KM8C 1JJHA 2DITA 1VQMS 2EVZA 1Q7YT 3VALA 4ERDA 2LCWA 1YTYA 5GAGU 2KH9A 2MZTA 3B4MA 1WF1A 2DNPA 2DHXA 5BJRA 5D77A 4UQTA 2MSSA 2MZJA 3MURP 2OSQA 2WBRA 1JMTA 3R1LA 4TLQA 1U1KA 1WEYA 3CMAS 3G96A 5DDOC 3CC4S 2HYIB 5IQQA 1IQTA 3P49B 1YWXA 2DNQA 3VAFA 5GMKa 2MB0B 2BOPA 3S01A 2QFJA 2M52A 1U1MA 5IM0A 2PEHA 2JRSA 2MPUA 1SJFA 2DO4A 1H2UX 3TYTA 4ED5A 1FHTA 3EGZA 1OPIA 4QPTA 1WHYA 2G4BA 5JVHQ 2AYEA 2MZRA 2KI2A 2XB2D 1YHQS 1RKJA 1NU4A 4TU9A 4QU7A 3HI9A 1DBDA 2MZQA 4WFNQ 1F9FA 2DGXA 4WIIA 5ITHA 2MKKA 2FC8A 4FXWA 4Y00A 2J0SD 3R27A 2EK6A 5EN1A 2CQ1A 2XNRA 2KN4A 3THTA 2ERRA 1WTBA 2LEAA 1VC5A 1Q86T 1HA1A 4IOAQ 3G8SA 2O3DA 1X4EA 1VQNS 2YKAA 4CIOA 1H2VZ 3FEYB 1FJEB 3NS5A 3L3CA 1KOOA 1WEZA 2MQLA 1FT8A 2OTLS 2RU3A 1S79A 3P3DA 2DHGA 2HZCA 3CC7S 3BEGB 1X4GA 1VQPS 3DLLQ 2CPHA 3K0JA 1BY9A 2CQGA 3US5A 2DGSA 2XS5A 1D8ZA 2KHCA 2MQPA 2DH8A 1Q82T 3U1MA 2D9OA 1WI6A 2M8HA 3VAIA 2AD9A 1M90T 4WF9Q 2LA4A 1X4AA 5GADU 3OW2R 2D9PA 2MY8A 1N88A 3I55S 3S7RA 1VQ8S 2DNOA 1KOHA 1ZZNA 3RW6A 2F9JA 2MJUA 4UY8T 1VQ5S 3CF5Q 3MD3A 2OIHA 5GAEU 1YITS 1X0FA 3CTRA 2CPIA 2RVJA 1K73T 1VQ9S 2DO0A 2CQ2A 3LPYA 4TU8A 1U1OA 1DRZA 4W92B 1M1KT 2QEXS 5D78A 3N9UC 3RW7A 3Q2TC 2YH0A 4M5DB 1OO0B 2MYFA 2KXNB 4IOCQ 5CXTA 5H1SV 5LJ5Y 2OJ3A 4PRFA 2MQMA 2F3JA 2XSFA 1X4DA 2PE8A 3VAKA 2M0GB 2LMIA 2DK2A 3V4MA 2M7SA 2DNGA 1YJWS 1R8HA 2HGMA 4ZKAA 3CD6S 3HHNB 1Q81T 3BO4A 1UFWA 2LYVA 2JWNA 3VAGA 3D2WA 1K9MT 3I56S 1FO1A 2MZ1A 3CPWR 3BO3A 2DHAA 1UAWA 2CQ3A 3UCUP 2LEBA 2DHSA 3NNCA 2CJKA 3J7YU 1M5VC 1X5OA 1QVGR 2K8GA 2I38A 1JJ4A 2G1DA 1VC0A 1KC8T 2DGQA 2KU7A 5DDQC 3CCJS 2KT5A 2N3LA 1KQSR 1U1PA 1UW4A 3CC2S 3CCSS 5JVGQ 3SXLA 4YUDA 2DGOA 2JVOA 2ADBA 2XS2A 3MI7X 3UE2A 2MQNA 4IO9Q 2L08A 4WCEQ 4U67Q 2ZJPQ 3TP2A 1X4HA 2CPEA 2JX2A 3CCUS 2KYXA 4CH0S 1M5KC 2LA6A 2MGZB 2BZ2A 1ZH5A 3FEXB 1OWXA 2Q79A 2RS8A 1DZ5A 1FJ7A 2KRBA 1X4FA 3CCRS 2SXLA 2X1BA 3CCES 2LXIA 4CH1A 3G9CA 3PIOQ 3BO2A 2DNZA 1K8AT 3CCVS 3SDEA 1WI8A 2CQHA 4PR6A 2DGWA 2YWKA 1HL6A 3G8TA 1P1TA 1H6KX 2CPFA 3R1HA 2CQ4A 3ULHA 1A9NB 2J76E 3UCGA 3CXCR 1X5SA 2N82B 5IM0B 1M5PC 3ZZYA 3BS9A 1A7GE 5DM7Q 4F25A 2U2FA 3MUMP 1P27B 2MKIA 4A8XA 3G4SS 2CPXA 1WELA 3NNHA 1FXLA 2CQIA 1VBZA 2DH7A 4TU7A 2EK1A 1CVJA 1KD1T 1VQLS 1N8RT 1QVFR 4EGLA 1YIJS 4Z2XA 2HGLA 2DIUA 2KRRA 2MQOA 3H2UB 2HGNA 2F9DA 3B4DA 5CA5A 2M2BA 4RU2A 3CUNA 4J5OA 2LXUA 1U2FA 3PIPQ 2K3KA 2MJNA 3NNAA 3CCQS 2LKZA 2N7CA 3LQVA 2DISA 1VQ7S 1VQ6S 5LJ3Y 3MUVP 3S6EA 1VQKS 2KG0A 2DNHA 4OZ1A 2MKHA 3MDFA 3JB9k 1AUDA 3NMRA 2DNKA 3SDEB 3CMES 3Q2SC 1VQOS 2X1FA 2KM8B 2DNYA 3H2VE 2GHPA 4F26A 1JJ2R 1X4CA 1U1RA 5HL7Q 2FHOB 3IRWP 1URNA 2E44A 4LMZA 2L9WA 2J0QD 3EGNA 3UCZP 2DGUA 2X1GA 3ZZZA 2FY1A 2RRAA 1WHVA 2E5JA 4C0OC 2U1AA 3UWTA 2CPYA 2KFYA 4IUFA 1D9AA 5LSLA 2OTJS 2B0GA 4WFBQ 4W90B 1FJCA 2X1AA 1X4BA 2E5IA 1WWHA 1X5TA 4QU6A 2VOOA 4FXVA 2ZJRQ 3MOJB 1QM9A 2MKCA 1NJIT 2KXFA 3DXBA 3EX7B 5DDRC 1WG4A 1L3KA 2CQDA 1G2EA 3G71S 3G6ES 1HD0A 2I2YA 2RT3A 2FC9A 2HVZA 3P5TL 1WEXA 2E5GA 5DETA 2CPDA 4LJMA 2DH9A 2XNQA 2XS7A 2DGTA 2VOPA 1FNXH 4Y0FA 2CQPA 2CQCA 2MY7A 1H2TZ 4YB1P 3U1LA 2AYGA 1RK8A 4CQ1A 5LSOA 2M9KA 3CCLS 5GAHU 3MXHP 2KG1A 1XN9A 3CULA 2L41A 5CYJA 3THPA 1YI2S 2OSRA 2A3JA 5IFMA 2DNNA 1S72S 1SJ3P 1WG5A 2DNLA 2V94A 2MQQA 2MZSA 3SMZA 5HO4A 1U1LA 1SJRA 2MMYA 1UP1A 5LXYA 3VAHA 4F02A 2D3OR 2QA4S 4P6QA 2DNMA 2J8AA 1WG1A 1WHXA 1O0PA 3VF0B 1DHMA 4C7QA 4WKRA 2DIVA 2KVIA 1WF0A 2LQ5A 2RQCA 2RQ4A 2DGVA 3UD3P 1YJ9S 1WF2A 1U6FA 1X5PA 2VODA 1SJ4P 1M5OC 2M8DB 1U1QA 1VBYA 1NO8A 2ZJQQ 3J7ZT 2MKJA 2LECA 3MUTP 5GVQA 4WFAQ 2AYBA 3P6YC 1YJNS 2MHNA 2UP1A 5FJ4A 5DDPC 2NLWA 2E5HA 4PKDB 1WHWA 2ADCA 1VBXA 2CPZA 2CQ0A 5LXRA 1U1NA 1ZZFA 4QQBA 2DNRA 2MSTA 3S8SA 5MLCV 2VONA 2YTCA 3TO8A 1VQ4S 2M88A
chains in the Genus database with same CATH superfamily
2GV1A 4CYUA 4DV5F 4CLFA 1HLWA 3MAQA 1N52B 4PQAA 1ELOA 4ES1A 4TQRA 4MFBA 3SCJE 2FPHX 2BANB 2DITA 1VQMS 1QUVA 4KHMA 1WDTA 4B08A 3VALA 2OGUA 5KFKA 3ET6A 4I64A 1NSQA 2XMWA 1HNWJ 1U1KA 1R31A 2QMXA 3HSGA 3W1YC 3F41A 5BYQA 1X0PA 3IMQJ 3HHLC 2MLXA 1PJ5A 1K1QA 5L38A 1V3SA 5D8HB 1QSSA 1H2UX 3JSMA 4C11B 4F4AA 5T7LA 1HYSA 3GPAA 4ZHRA 4WBFA 5KFTA 1M5HA 5F3TA 3W2VB 1AYEA 3H4BA 3D68A 3OFFA 4FKYA 1UJ6A 1UJ5A 4USTA 5A8KB 2FJAB 3G8SA 3IWXA 4WIQA 1YBAA 4DQRA 3IBCB 2VFVA 3PY8A 1S79A 4FYXB 3WDOA 3US5A 5DGAA 2XS5A 4WU2A 4H4MB 3T5LA 2AD9A 4QW8A 3OXGA 4WF9Q 3GIKA 1BQMA 1EP4B 4LF8F 1SIWB 2GAGC 3CB4A 4P72A 2F9JA 1KBRA 4ZCLA 1ZM3A 2EFGA 4JP8A 2D69A 5K14B 2HW3A 1U1OA 4JI2F 3DNCA 5KG0A 5DLFA 3G2XA 4OHVA 3F73A 3PKMA 2NSCA 2WB1D 2RB7A 3ISND 3KHGA 3TR5A 3G6XA 1FRHA 1RTZA 4C6AA 1C1CA 2R7WA 4QWBA 3U1NA 1KHWA 3A8JA 4TY9A 2CJKA 1M5VC 2BE2A 4Z7YA 2IYIA 3EZUA 2V5HG 2KU7A 4IFVA 4M5LA 1D3WA 4HHUA 4ZVEA 4JI4J 4WP9A 2ADBA 5IQ6A 3MGJA 1EZZB 3N6LA 5HI7A 4X4NA 5HMXA 1RE1B 3OUYB 1JLCA 4OI0A 4K4SA 3KDOA 5F9NA 4F2RA 4PXCA 2UXDJ 4URSA 1YJRA 2XMUA 2OPQB 2HSEB 2BANA 2AT1B 3GG1A 4XDDA 2HRYA 2HNDA 2UVWA 2WVFA 4EMDA 2VG6B 4Y6IA 1N5YA 3G4SS 2CPXA 1VQLS 1JB0C 1EB0A 1YIJS 5LT5A 1U8WA 2XZWA 2VB6A 1NJXA 4Y2KA 3PKYA 2HHSA 1RHJB 2CUYA 3JB9k 2ALZA 1ZM4A 4URGA 4EUVA 5ETTA 3SDEB 3AQPA 1Y0HA 5B0BA 1NK9A 2UUAF 2J0WA 3HFZB 2DYAA 2JFDA 2WSCC 3OR1B 1D9DA 3K8WA 3ILIA 5A8KA 1D9AA 5EWEA 5LSLA 2CKWA 4LUBA 5A8WB 1X4BA 5C2GA 2HKEA 1NK8A 4QZVB 2AZ3A 1V6HA 2PI5A 4MH8A 5EWFA 4H4MA 2DH9A 2XS7A 3W7BA 3VGVA 4OX6A 2DR5A 5A2QY 5LSOA 1EP4A 2P8IA 3VCDA 2V50A 3CW2C 3HVTB 1H0HB 3JSRA 2DNNA 4A8OA 2J7KA 2V94A 3CDAA 5K14A 1B3TA 4CTAB 3TOQA 3SEOA 4FBUA 2PT0A 4HDGA 3OL9A 4DI6A 2HBQB 2C3YA 2QG9B 4USIA 2PD1A 4K50A 3PW7A 4I2PB 4J9RA 4RO0A 4C97A 4LT6A 2E7XA 3N79A 1LXJA 1KQFB 3GMGA 2BJ7A 4DV2J 4N5SA 5K20B 2V69A 1EQ0A 3K7RA 4YR0A 3I5BA 3MAHA 1TL7B 1RB0A 2KXHA 1C1BB 1MLAA 4LIRA 3W60A 2YH1A 1HD1A 4I6AA 1WNEA 2YNHB 2QX0A 1FKPB 2W4PA 2FLNA 3OUYA 2JEFA 1UETA 5BJRA 2MSSA 1WSRA 2IM1A 1T7PA 2Y1JA 3CMAS 2ZWPA 1HNIB 2KDOA 2UU9J 1LV5A 4ED7A 3VAFA 2MB0B 4PAAA 1ZYQA 2HS4A 1CLFA 2PEHA 2DY1A 1FVSA 2VG6A 1J5EF 2KT3A 2ATLA 2ZH1A 4OJ1A 4B3SF 4PYDA 3R5CA 1KSPA 1RKJA 2R8HA 1GH8A 4WIIA 4LREA 1S0MA 1RYRA 5AXLA 4FF4A 2ZHBA 1IVZA 3CVKA 3ILOA 4X62J 1Q86T 4OYWA 4RW9B 1VRQC 2I8EA 4DR3J 2QN6B 3H5XA 2CPHA 2CQGA 1PYSB 1EIYB 2KHCA 2QLBB 2VA3A 3RR7A 4DUTA 1JXEA 3FZ2A 1M90T 5A8WA 1RHMB 2A2CA 2Z2MA 3ZZRA 4BWJA 4A8MP 5EUHA 3K57A 1T3NA 1ZZNA 1HW9A 3BBCA 2XI2A 3HZEA 3NMAA 1R43A 4DFPA 2DR9A 4JB8B 3JTOA 4BHQA 2WTFA 1HI0P 4I67A 2H48B 3QFWA 3D3BJ 2JLFA 3ICLA 4WKYA 2HPUA 3VZHA 4NLPA 5CXTA 2R7UA 2HMIA 3DRPB 5IV4A 1FA0A 1FVQA 5I42B 1GMWD 1OY8A 1JQGA 3ZTPA 3GYNA 4ZKAA 1PJ7A 4X4PA 1ZAVA 2R7TA 1UAWA 3NCRA 3THVA 2OFHX 3CCTA 4K5SA 4TXSA 3ZZTA 4USJC 2G1DA 1FKOB 2GIRA 3OSNA 1UEUA 2VPXB 2H65B 3TQEA 2GVDA 2RUSA 4OHWA 2MLZA 2W1BA 1T03B 2DGOA 4I2PA 5B0DA 4HKQA 2IAJA 2RS8A 1ULRA 3EDQB 2BQ3A 1G1XA 2EFOA 1V3ZA 2VJUA 1T05B 2E1PA 4CH1A 1PG5B 1TL7A 2DNZA 1C1BA 3V6JA 3GIIA 5KFWA 1WI8A 1IBLJ 1AB8A 3C6UB 4K4VA 4RBTA 2YNHA 1PYOB 2HBRB 1FKPA 3AB4B 4RW6B 1U45A 4DV5J 1VDHA 3QBCA 5KG4A 3BQ2A 4EBCA 4LRBA 4NRUA 2MKIA 1NCLA 1V5VA 1YSJA 1K47A 2X7IA 4RUCA 3NP5A 1HNIA 4L73A 2BEFA 2GCFA 3C15A 4DR2F 3KG4A 4ZN3A 2A6OA 5BXIA 2IA6A 1X7VA 3QZ8A 3S6EA 1T02A 1FESA 4A46A 1BC6A 4ZPVR 4N47A 4ETXA 3DI6B 3DGVA 4FDFA 3DGPB 3EWGA 3GSIA 4GC6A 1WKJA 1RWPB 2RMLA 1X4CA 1U1RA 4Z37A 3DRSA 3HZGA 2RRAA 1SC3B 3R6GB 4IUFA 3JS9A 2H54B 4RW9A 2C2MB 3SFGA 2BW2A 4CO2A 2Q43A 4KO0B 4D3HA 2GMJA 1FWPA 3VGTA 5ETRA 3W63A 3OL8A 3H2LA 4H4KC 1HNZF 1XIQA 3W5YA 1R6YA 2ZWOA 4UZCA 2AYGA 3EZOA 3QGHA 2NR0A 3OTBA 3TZWA 2OSRA 1S72S 2OLWA 4WTOB 4WE1B 2BJ8A 2MQQA 4OZNA 2VIHA 3M9MB 2R7SA 4CLKA 1SC6A 4QIEA 2XCAA 3BH7B 4O4RA 1LK5A 4OZ5A 4LF8J 2ZZMA 3TZZA 5E2QA 3DRPA 4KRWA 5I42A 2LQ5A 4DLEA 3DLEB 1X5PA 4ZPBA 3PFEA 2DRBA 4PCQA 3J7ZT 1Q1KA 4WXWA 2HLUA 2LECA 1XJWB 2BE9B 2OO4A 2RILA 3S8SA 4DQSA 1FKOA 4WYLA 3D0GE 3LP0B 5KFMA 2JVRA 1T03A 1IN0A 1VBKA 1ZPWX 5KT5A 3RBEA 1AT1B 3E01B 1TAQA 4UUWA 5HP1B 1K1SA 2FJVA 2AJ2A 3AJ2A 2EVZA 5E3QA 1IBMF 5ETQA 1C4CA 1DQAA 1UZDA 4C8NA 1T05A 2KH9A 2MZTA 3LGHA 5B0GA 2OSQA 3CJKB 2I6WA 1YBUA 3J7Z5 2WW4A 4TLQA 3L4BC 5KT7A 5HBMB 3ETOA 3V4IA 1IQTA 3GYXB 1RU2A 2WVEA 5HQ8A 1N6QB 4RW6A 1AUSL 5HQMA 2V9WA 2IMWP 1C2PA 2WSEC 3AJ1A 4ED5A 3N5FA 1RT7B 5IWAF 2AYEA 5KG1A 4TU9A 3VQSA 5J1PA 3QJJA 4I4BA 1F9FA 2JLEA 3NS7B 2LQJA 2CQ1A 2PC6A 1XTZA 3D28A 4F7VA 4CIOA 1D1UA 3DI6A 1TL4A 3DGPA 2IM0A 3FBCA 3UR0A 2V8HA 2D9OA 1UPMB 5K8MA 4ED2A 2OUGA 3L09A 5IT4A 3SQGA 1S6PB 2Z4PA 2VICA 5F8GA 4KO0A 3MD3A 2E29A 1NHUA 4NLOA 2UUAJ 2CPIA 4KV8B 3TEHB 3MZIA 2H1YA 4I56A 3LPYA 4QYZJ 4HTIA 3FSYA 3J80Y 1UWAA 3BR9A 1G6BA 3NGTA 2OJ3A 2EI5A 5BYRA 3MMBB 1X4DA 3A8IA 4ECVA 2BKPA 2ZBCA 3MMAB 4ZVOB 1U7LA 2MHEA 3L7PA 2ZH6A 1VC0A 3LAMA 5CHCB 3DLEA 2KT5A 2IRUA 4DU7A 4S0MA 2MQ8A 3F56A 1Q78A 4NYPA 3DU6A 1RWUA 5C7PA 4OIXA 3OV7A 1HNVA 4CLYA 2OI2A 2CNLB 3LP0A 3GJTB 5H9EK 4P71A 3BO2A 1X9WA 3VWSA 2QSFA 1M5SA 4QIGA 1S1UB 1IKYB 3NGRA 2CPFA 1P1TA 3FMWA 4U6PA 2XMAA 5M2RA 3BPSP 4IKAA 1A7GE 4LVOP 3CJKA 3OL7A 3BSOA 3POTA 4QR2A 3SBMA 2KT2A 2UUTA 5BYSA 3W3SA 2YQ3A 1WKKA 1S10A 3RBDA 3H59A 3NNAA 4NCBA 4K59A 1RT7A 2QYGA 2YKMB 3KUHA 4O4GB 5B09A 5GAEI 4P7VA 3LUYA 1S4EA 2V2QA 4O23A 3IRWP 4LMZA 1NLKL 4N76A 1J5EJ 1QAYA 5SZTA 1TK8A 4OHYA 1S0OA 3M2UB 4M5NA 3M1VA 4FXVA 5DRKA 4HI1A 1R8CA 4DU8A 2K7JA 3SV3A 2VFTA 1OJ4A 3EJMA 3HHLB 2W4DA 1NK0A 3UI3A 3G6YA 1S1WB 3J7YI 4F36A 1TKDA 2QT7A 3CJ0A 4C8MA 2EBEA 3KMSA 1GQEA 3CDBA 1UPPA 3UN5A 1S6PA 3WIUA 1FEEA 1TL3B 3ENWA 4KV8A 1SJRA 5C42B 2VKZG 2ZOGA 3RB4A 3WHIA 3C6TB 4B3RF 2ZVIA 1U0SA 1ZPVA 3KLEA 1X31C 2O66A 3CEDA 2RQCA 2GMHA 4M5HA 1GTHA 1F5BA 2B6AA 1M5OC 2YBVA 4NZ7A 1NUEA 3MMAA 3FK4A 3QIPB 4WZMA 3PG9A 2E5HA 1KVKA 3R2DJ 1U1NA 1HWJA 2V4QA 3GILA 1MG7A 2FLLA 1VQ4S 1O51A 4DL4A 2OMOA 4BDPA 2OEJA 3AD9C 4NOHA 2Y1RI 5EX3A 1Q95G 2ZE2B 1N33F 2OPPB 5KFEA 1SUQA 4MK7A 4DR5F 4M95A 1JJHA 2CXEA 1U8SA 5HLFB 5L9XA 5D77A 4IH5A 1TFWA 3SV4A 1S76D 1SC1B 1U48A 3W5ZA 4KPYA 3OVBA 1F2GA 3Q8QB 2VA2A 3IFEA 2P9CA 3PRBA 2W2QP 1FEHA 3GFZA 5KFDA 2LU2A 2B8PA 2JDJA 1Y4ZB 4M5JA 1SH0A 1UTAA 2QA1A 2JL9A 1BWVA 2BACA 4K7QA 2R7XA 1I6JA 4H54A 1NZ8A 4N41A 3MECA 1VC5A 1T0TV 1L3UA 4ZS6A 2YKMA 5IS2A 1NPPA 2AF6A 1H72C 2RKIB 4LSNB 1OYEA 2Q6BA 4CO1A 4GMKA 1VQPS 1B0TA 2I5JA 3MFHA 1KR4A 2B8QA 1FDAA 2K3IA 2EXUA 4DLGA 3M2UA 1HBMB 5KFNA 4G65A 4LFAF 5GAEU 3HHLA 3SSQA 2NXEA 4DX6A 1YRUA 2YWHA 4B3OB 1S1WA 1I3OB 3CMQA 3W66A 1F6TA 2VFUA 2GZOA 2KVQE 2Z30B 1DRZA 5CQGA 4ZP9A 1VOMA 4X4TA 1VJQA 2BJ9A 5J2PB 1FX4A 5KFRA 3V4MA 1NKBA 2FJWA 2WCXA 5ETNA 1YJWS 1TL3A 3Q0AA 2K1RB 5C2CA 1HNZJ 2JWNA 1J5OA 3O5TB 2BKNA 3BGLA 3C6TA 2AEFA 3Q83A 2KHDA 3BGFA 3J7YU 5GAGI 1VI7A 2L9NA 5KG5A 2FGCA 1JXVA 2ATCB 4LSZB 1RLDA 4CM2A 3QIPA 2XHWA 2CPEA 1QE1B 1RWKB 1KRPA 5EDWA 5HVHA 1F60B 4CT9A 3CJ2A 1HPZB 3MMCB 3DHXA 5A6WA 1FFGB 2ZE2A 4YR3A 2NQPA 2XC9A 2XMTA 1YDLA 2QV6A 4X65F 3QQCD 2YWKA 4DPYA 1HL6A 4LRDA 3R1HA 3D66A 4E2FB 1F3VA 3DDNA 4EO8A 2HK3A 3PJWA 1QAXA 2J8SA 4A8XA 2HQFA 2RJZA 1FXLA 4FXDA 1T9WA 2VBYA 2PO4A 1IBMJ 3I9V9 3LW5C 1O6XA 2LP4A 2OAUA 1WC6A 5E3RA 4LFCF 5KFHA 4AQYF 1SB6A 4DV4F 4P2XA 2CZ9A 4ECWA 3ZTRA 4RW7B 4DV3F 2DR8A 3TA2A 3QMQA 2A0FB 1VQOS 4ZMMA 2MTLA 2YNFB 4ELVA 4L72B 2L9WA 1Y11A 4K0KF 5H9FK 3IRXA 2CPYA 5IWAJ 1KLMB 4J9NA 1N56A 1HQUA 3I0SB 1PBAA 1WWHA 1X5TA 4KY3A 5J2QB 2RKIA 3U02A 4LSNA 1XK8A 2FHKA 2JC1A 2GGPA 2FJEB 3N01A 2B9YA 5B0CA 4M5KA 1SKRA 9ATCB 3GB0A 3DLBA 1WOPA 3L7OA 3OTEA 4RNOA 2FVQA 4G1QA 3MCSA 5CYJA 1YI2S 5K8PA 2HFZA 4ID5B 3JXOA 2VG7B 1NSPA 1U1LA 4B3OA 1UP1A 2W2OP 1W2IA 2DNMA 3O6QA 4KHRA 1U26A 1IKWB 2DHHA 4WKRA 1IJFB 1EQMA 2PMZD 4F4WA 1G3OA 3A3NB 2LQBA 2K1RA 5F0WA 5HQLA 4C0BA 4JI1F 4ZLNA 1WHWA 2ADCA 4RBVA 2J5AA 2CQ0A 2MSTA 2E1MC 3GR1A 1EETB 1DLOB 2M88A 2W2NP 3M6XA 4BS2A 5HMZA 3CCMS 2H9ZA 4B9LA 1SXLA 4MYUA 1LK7A 1OIAA 2AYMA 4ZP6A 4CO4A 1FDDA 4ZIWA 4X4UA 4ZPAA 2RNEA 3ETMA 1Q7YT 4DSIA 4QPXA 1OYDA 1RAOA 1YTYA 5GAGU 2WBMA 1HPZA 2Z0GA 3MMCA 4KFBB 1AA1B 4RU9A 3KLIB 3HSJA 4V19J 4TN2A 2HNYA 2VPYB 3L95X 1F5AA 1RHRB 2G2OA 4NWBA 5FD1A 2W25A 3O2IA 1U4BA 2OPRA 2HK2A 3RU0A 5CD4A 5U47A 4KSEB 3LF0A 1TKTB 4YHHF 4DMZA 4NI2B 1LW2A 1S12A 2BA9A 4UF4A 3BM7A 2CDQA 4F4KA 4ZPDA 4WFNQ 3T6BA 2HLTA 2DXEA 4Y00A 1YBTA 1CEZA 5JUMA 1R27B 4JI8F 2LXFA 2N4DA 4ICLB 2ZH3A 1QLNA 1H98A 5J1EB 1VCTA 1VQNS 1YZ7A 1RT6B 4D3GA 4RW7A 1NDCA 3ISNC 1XEZA 1CJUB 2W8LA 3DLLQ 2WK4A 4OV1A 2V0NA 1D8ZA 1HBOB 1KLMA 1U2RA 5GADU 3I0SA 3N5BA 1KVJA 1W7WA 1VQSA 1HMVB 2RVJA 4UOCA 1K73T 2IHR1 3ADAC 2VD3A 4NLRA 1I94F 5JMNA 3QT8A 5A0YB 1AROP 1YVFA 5HJXA 2QEXS 3RW7A 1EARA 5LJ5Y 3VAKA 2PE8A 2M0GB 4YS2A 4QR1A 1NJZA 2VG7A 2ZH8A 1E6YB 2H5JB 3W8PA 3H40A 1FNMA 4JUZA 1LXNA 1RT1A 2IRXA 1U2CA 1IKWA 1B0VA 4IO1A 4LFBJ 4J9KA 4DUYF 5KAKA 3Q8SB 5I4MA 4DN9A 1VIOA 4KGXB 3M4XA 2O5DA 4B3RJ 3FEXB 3M2VB 1EETA 1DLOA 3KK2B 2KRBA 3E3XA 1WOSA 4J7CA 4NYOA 5DS7A 2AWZA 5L39A 4ZCKA 4ANDA 2LDIA 4ED0A 5DJBA 2B5JB 5FDLA 4NL5A 1TQLA 4DSKA 1JLBB 4ZLLA 2Z57B 1PCAA 1XR6A 3UDVA 1MN9A 3FVYA 3AB2B 5MAOA 1ZAWA 1M5PC 4KFBA 5KFVA 2AP6A 1PJ6A 4XPCA 4HHJA 1N33J 1N0VC 4I0WA 2V34A 3G87A 1CVJA 4DR5J 4U7UK 4B9SA 1QVFR 4EGLA 1JLAA 2RQKA 2WZ1A 3SCLE 2RDJA 2XMKA 1NKCA 4USVA 2V2VA 2LKZA 4NI2A 3QT6A 1VQ6S 3KFWX 1CBKA 3KYLA 1UA0A 2PMHA 1SL0A 4AXIA 4FS2A 2BMBA 2X1FA 3GV7B 3PR5B 3MPUB 4A4JA 3VR1A 5HL7Q 3PW0A 2XYPB 2Q1LA 1IKXB 4ICLA 1NSKL 4PG4A 1WHVA 1RWOB 5F8HA 1MWYA 2V8PA 4LR8A 3V6KA 5J1EA 5DQHA 4FZVA 4EBDA 4OI6A 1RT6A 4ED4A 2ZJRQ 4J37A 2R7OA 1B4SA 1CJUA 2J6TA 2XMVA 1HD0A 1NMEB 2QMWA 1N5VA 2ASJA 1FNXH 1TP7A 3OFEA 2CQCA 4X4RA 2PMWA 2K2PA 4ILLA 4DQIA 4KT0C 2A3JA 3M6VA 3PW5A 3A1YG 4ECYA 2MZSA 1NB2A 4ZN1A 1ZOTA 2YNIB 5A0YA 1Q8LA 2UVVA 4J9VA 4LFAJ 4X4OA 2AX1A 2B9WA 2KVIA 2J9EA 3SSSA 2B56A 2KJWA 4JI5J 3M7VA 2VBXA 2AMCB 4LIWA 5KFGA 1VRUB 1W25A 4MYTA 5DDPC 1FJGF 3M8RA 3PV8A 1LWEB 2XY6A 4I6YA 4IDKB 1TK5A 4ER8A 1B7FA 3CE8A 3HP6A 2ZH2A 3OSPA 1OS5A 1Y7PA 4AT1B 2FY8A 2QYCA 1RJJA 3ZC4A 1VLOA 4U8VA 5CYMB 1QSYA 2R2RA 2ZHOA 3I87A 3M2VA 3CIMA 3NGUA 3KK2A 2FGOA 1N32J 4IH7A 5KG6A 3RUBL 1JKHA 4WU3A 3DOLB 2DNPA 4QWEA 5AJ3F 2JNJA 2V2ZA 2YX1A 1WEYA 1QJHA 2B5JA 3CD7A 3K5MA 3VZIA 2IMOA 1JLFB 3MM8B 2IJRA 3H5UA 3NOGA 1IR2A 4FYYB 1HWIA 3B78A 3FBFA 3EGZA 3JTNA 1SL2A 4RKUC 3RBXA 3QGGA 5H9EJ 2HG4A 4X65J 4QIVA 3KLGB 1WOOA 2YNGB 1ZA1B 2O01C 4IOAQ 2JJ4D 4RX6A 5KFYA 1X4EA 3FC9A 3RB6A 5LMUF 3PR4A 2ZH7A 1OSDA 3KJVB 4AYBD 1TTHB 3JQJA 4N8NA 2R8GA 1FCAA 4HHHA 4LFCJ 3VAIA 4AQYJ 1RHUB 2WVBA 1XNRF 3LTOA 4QW9A 2RSQA 4DV4J 1YRXA 2HZAA 4R0JA 3VVTA 2ZH4A 2QIFA 2DBBA 4DV3J 1DURA 4LBHA 1VQ5S 1DQ8A 1S6UA 4K0KJ 2EFPA 4GKJF 1B70B 5EWGA 1I5OB 5C5JA 5CCMA 4M5GA 3W65A 1RTDB 4OYBA 4DX5A 3MOZA 1UFWA 1YKWA 2EPIA 1DJ0A 3CJ4A 3UCUP 2LEBA 4NMXA 1FXRA 2KFNA 2K8GA 3C16A 2ZHAA 1U1PA 3CCSS 4RZRA 4C8OA 1RT4B 4R0EA 3OVAA 3KLFA 4IR1A 1FX2A 3CCUS 4CH0S 1NK4A 2D7SA 2Q79A 1NHKL 1FJ7A 2RAQA 4BC9A 5D0GA 4IDKA 3HX9A 4LSLB 4CT8A 3G9CA 2ABYA 4B3MF 2XMJA 4JI1J 2FUG9 5CYMA 1J2VA 1C0UA 3H90A 3HHLD 1X5SA 3GJSB 2IJNA 3DOLA 3V6DB 4ENOA 3HCXA 3MEGB 2GW8A 2P5VA 4GRSA 4LBPA 3DMJB 1QAJA 2HGLA 2DIUA 3LWLA 5L46A 3AA8A 1JLFA 3MM8A 2W9BB 4RU2A 2MJNA 4O3OA 1Z2LA 4OJHA 5B0AA 4MIBA 2V9KA 1ICEB 1Y00A 2F4VF 4ILRA 2VFSA 2E66A 2Z2ZA 3KLGA 3P96A 1S5ZA 5K8NA 3JQMA 2AEMA 7FDRA 2HRUA 4YHHJ 2E5JA 2XZTB 2OTJS 3HULA 2YQ1A 1PSDA 3R7NB 1QM9A 1NJIT 3G6ES 3T9ZA 4Q43A 3KJVA 4DL0C 2HVZA 1SC4B 3IR5B 1OMSA 3BBBA 4F50A 1H38A 2ZBPA 4F67A 1RK8A 2BRKA 1U6ZA 2BQUA 1K0VA 2L41A 1TK0A 5LL6d 3LO3A 3Q8YA 5KFSA 3SCIE 3FCWA 4ECUA 4NX9A 1WG1A 3I4HX 1SQFA 1RWNB 1GXTA 1RTDA 2QRRA 2BV3A 2RQ4A 3HKZD 2KFZA 1VBYA 5DZ6A 1V9OA 1FD8A 3SSRA 4W98A 3D1QA 1I94J 2BOAA 3P6YC 1YJNS 4GVLA 1B7YB 2CPZA 4QQBA 3EXYA 2JLGA 2VONA 4DCJB 3DLHA 5KG3A 4DPTA 5F8JA 5B0EA 2L48A 4RBUA 3UD4P 2GAHC 7FD1A 1FKAF 5DO2A 1JJCB 2M4MA 2XLKA 4Q5VA 4PG5A 3BN4A 3E2EA 3B4MA 4PPDA 3DFEA 3IA0A 5E5NA 4ED3A 3R1LA 1FF2A 2ZBQA 2F4FA 4F3OA 3G96A 3MM6B 1YJTA 3I0RB 4OYMA 3TA0A 2UXBF 1GNKA 2CJQA 3CJ3A 5J2MB 1U0HB 3HVWA 2CWKA 3PHTA 2CWXA 4A8WA 4UZBA 3V6DA 1FHTA 2CDRB 4CYUB 1T9YA 3AJDA 1FD2A 3KJFB 2W8KA 1TKXA 2PA3A 3MCOA 2W9BA 2Z8QA 2GFFA 4MFBB 4MIWA 1QTMA 3IGNA 3R27A 5HATA 2XWXA 3BV8A 4EYIB 3E8OA 5GAHI 3THTA 4BBYA 4JI7F 1HA1A 5IT9U 2B4OA 2AEJA 4C3MA 3BF4A 2MDAA 4Y34A 5HJYA 2MQPA 2DH8A 1RLCL 5AXMA 2HWHA 2NREA 2Q6CA 2AIRB 2XTJP 4TVAB 2D9PA 3AD7C 3S7RA 2XM3A 3TEGA 3NGKA 3M8WA 2V4JB 2OIHA 5LM7E 3Q23A 4ZVUB 5RUBA 1VK8A 2BQRA 2IJFA 1TZ0A 1QDUB 4DL3A 1MMNA 2NS1B 2W2MP 3Q2TC 5H9FJ 1OQ3A 4K4UA 1ZTTA 1GMUA 4WFZA 2BX6A 4OX9F 2LYVA 1I1GA 4ZDNA 2YKQA 3KK3B 3PW4A 3MHYA 4PABA 1N5SA 2AGOA 3AHPA 2FB0A 2OHDA 1CG2A 2DR7A 4DX7A 2H51B 2GQ2A 3UE2A 1AXQA 2CJ9A 3HJVA 3R5AA 1N36F 1WJ9A 1NDKA 3QRQA 1DZ5A 3MMJA 3I6PA 1RDRA 3RRKA 4X66F 3PX0A 3CJQA 1BQNA 2PN6A 3VHQA 3FMBA 5HSPA 4ED6A 3CCVS 1VGYA 3G8QA 2PGCA 3IO1A 4NYZA 3WC2A 3QIDA 2IDLA 1HARA 1SIZA 4V1Ak 1BXNA 1E6VA 3NBPB 4F2SA 4IFVB 4WJBA 2CNOB 4ZP7A 3JSBA 4RL1A 1KD1T 2D1CA 3I0RA 3KWMA 2KRRA 4FVMA 2IBOA 2ZH5A 5J2MA 1U0HA 1H7WA 4YEAA 1LWFB 1WACA 1QAIA 3I4PA 4MK9A 1TFYA 5AJ3J 1JLCB 3RAXA 3NY0A 2F8MA 1VQ7S 3DOMB 2QO3A 3KXDA 5IT0A 2PIIA 1HW8A 4AD6A 3KLVA 1AUDA 2E9ZA 2DNKA 4JBCA 2V6AA 1IUJA 1YG0A 3EGWB 1NK6A 5KFUA 2E7WA 5T14A 2HNDB 2A10A 2C2ZB 4WFBQ 1FJCA 3OT9A 2X1AA 3HSZA 1N5YB 5D3GB 1Y10A 2VOOA 4LVNP 2GMLA 3BH6B 3EX7B 1HI1A 1XQIA 3PHEA 1LFWA 1CJTA 2VOPA 5M2PA 3C3LA 2AX0A 3ZZOA 2XGQA 5LMUJ 3MTKA 5GAHU 2KG1A 2OP5A 3GU0A 2V4JA 3KMQA 1DARA 1HQ2A 2DNLA 5LXYA 2W24A 1YZ6A 1XNRJ 3HPOA 5DG7A 3N4WA 3BGRB 2W9CA 2FZGB 4DR4F 5B08A 2DGVA 2M3DA 2DTJA 3HXMA 1ZS6A 1TMMA 1Y5NB 1M0SA 2FJDB 4WFAQ 4GKJJ 2FVRA 2UP1A 4JI6F 1BD6A 2H3EB 3KK3A 2ZEJA 1U47A 2MXYA 5DM6Q 3MEKA 4MKBA 4AE5A 3ITHB 3MM7B 5KFFA 4DQQA 4YOEA 2N3OA 2P2CB 1VIXA 3IWLA 3C19A 5FLXU 1VISA 3Q86A 4IQXA 1VYAA 1RTJB 4UQTA 3PFOA 3Q22A 1JMTA 3DKDA 4DL7A 4ZJLA 3BYPA 3FZBA 3NAHA 5E3PA 1KQKA 4NLQA 1EAYC 3X1LB 1SKWA 4P9SA 3NBPA 6FDRA 2JHEA 3M6WA 4A47A 1OPIA 4QPTA 4A8KA 2XULA 2R2SA 1DBDA 3ENQA 1LWFA 5A2QU 1L3SA 3DOMA 3NCQA 3I31A 1PAUB 4YB5A 3R3TA 1T3OA 3JSYA 5DGBA 2DHGA 2NUHA 2HZCA 2I0XA 1T94A 3MM9B 2DGSA 2KL8A 4RW4B 3TUIC 1Q82T 1NZAA 3PACA 1FFWB 3HHEA 1S1XA 4NLXA 1HNXF 3TWZA 2GHWA 2GHVC 5D3GA 2F4VJ 1N88A 1RTIA 3DLJA 4RW8A 2BUNA 3T1HF 1IJEB 4OLOA 2BE7D 1JLEB 3LA0A 2B9XA 4RUBA 1R0CB 1SH2A 4OZLA 5D78A 2YH0A 1Y5IB 3R2CJ 1LWXA 2FZKB 1L3TA 3MEEA 3RZAA 4I69A 1HQEB 3GFYA 4ELTA 4NLGA 1Q5VA 1K9MT 5I3UA 2BBEA 1NJYA 3K58A 4G6VB 4CWBA 3GV5B 3WX4A 3TAMB 3BGRA 3JAMY 3H20A 1KC8T 3TX0A 3RAQA 3CCJS 3QO9B 4P2SA 4OYZA 4DS5A 5EHHA 4DG1B 5JVGQ 2QL5B 1U24A 2L08A 4WCEQ 2ZJPQ 1S9GB 3TP2A 2HBZB 5L8RC 1X9SA 5C25B 2LA6A 1JWWA 3F0NA 1OWXA 1UA1A 1RT5B 5ETPA 2X1BA 2HMIB 3TNVA 5A76A 4BCAA 4DPXA 3ITHA 3MM7A 4K4YA 4WWSA 4EZ9A 2PI4A 1JLQB 4OLPA 4U8YA 3HO1A 3NKYA 3UCGA 4WP3A 3ZZYA 3PYDA 4Q0BB 1RTJA 5DM7Q 4Q2LA 4O3PA 4OJ3A 3M8ZA 1JIHA 2GVDB 4CDIA 2DH7A 4MIAA 3AXKA 4ECRA 2BJ1A 5F8LA 2C2RA 3EXCX 2IAJB 3CDEA 1N34F 4HR2A 1U2FA 2OEKA 1Y3JA 3FFIA 3D3CJ 3OR2A 3KKFA 2GA7A 3MUVP 1WTFA 1KLNA 3BJYA 4A8SA 1UVIA 4GVBA 1TL1B 2E44A 4DPUA 2FY1A 2WSFC 2ZUAA 2ZVSA 4QU6A 1RHQB 5D0EA 3EMTA 3O3LA 1RZMA 5SUHA 1WG4A 2CQDA 1JLGB 3GCWP 2FC9A 3MM9A 1HNWF 4RW4A 3C15B 1FFSB 2XNQA 5B7WA 1RAHB 2MY7A 3MR3A 4JI7J 4WPAA 1NRKA 3DRRB 3LOUA 1IKVA 3CWJA 4EK2A 3G82B 4KIAA 1SJ3P 2PDAA 1P6TA 1JLEA 5G0RA 4NLUA 4F02A 3DRSB 3D9BA 4JV1A 2COLA 3EM1A 4UW2A 2AV5A 2IVYA 3CDWA 2H5EA 4JI0F 1HQEA 2R42A 2BABA 1RBAA 2GIFA 1KQGB 4CRJA 2RIJA 2HS0A 3BSAA 4DR6F 1NAQA 5GMEA 5FJ4A 4FYVB 1FTRA 1ZA2B 1ZZFA 2AU0A 2JFKA 3O44A 3TAMA 2ZH9A 3QO9A 4IG3B 1UEKA 4OX9J 4DG1A 4KBIA 1VC6A 1MU2B 1CSJA 1HFEL 3VTIA 1S9GA 5C25A 4ID8A 1Z4UA 2WOMB 1RT5A 4ERDA 2FTRA 4B02A 2MZJA 3GWCA 1UZHA 2XHCA 5D4LA 1SCJB 1ZETA 1N36J 4YY3J 1JLQA 4IR9A 1YWXA 2HRTA 1T9VA 3W8GA 2AJFE 1WUUA 5AE3A 4Q0BA 4HH1A 4X66J 3K8VA 8ATCB 2FLOA 3Q8VA 3EPIA 1XBWA 4N8OA 2G4BA 4MKAA 2XZDB 2MZRA 2KI2A 4JYAJ 4NASA 4CO3A 3TZYA 5ADZA 5ITHA 4YMEA 3PX6A 3N6NA 1S0NA 2NXCA 2M5YA 2XNRA 4WFXA 3W5XA 1MWQA 4C9DA 3BSCA 2HURA 2CJBA 3MCMA 1WEZA 2MQLA 4K8RA 5KOWA 3FQKA 3IR6B 1UJ4A 3BEGB 3V4IB 1TL1A 2R7RA 4DSEA 1Y5LB 3EVMA 4YN3B 1HKAA 2RHQB 3PCOB 1B64A 1Q8IA 3AXMA 1PKUA 2MY8A 4HDHA 3D5MA 2F7VA 4UY8T 1JLGA 3BKTA 4KE5A 4X4QA 3W2WB 2V63A 4U9RA 1M1GA 1VHIA 2CQ2A 3DRRA 4NLSA 2DEIA 4DR7F 4EZ6A 3TAPA 1TL5A 3G82A 1SPBP 2M7SA 4KGMA 3LPEA 4LF9F 4U95A 2DXFA 1DTQA 3D2WA 1HR0F 2V8VA 3RB3A 4N56A 4ZJQA 5D0HA 3OL6A 2C3UA 4OHXA 2CQ3A 5LMNF 3SQGB 4B9VA 2BYCA 2NSBA 2NXNA 3PO4A 1UFKA 5DDQC 2D74B 3T41A 4FPIA 4UY85 3TA1A 4TNOA 1LOUA 4P74A 4YUDA 1PYTA 2B51A 3GIRA 3MI7X 4GKKF 2MQNA 4DUZF 3N28A 2MGZB 4ZJOA 2BZ2A 2FHJA 3C66A 4WK1A 2HHTA 4DR4J 4KR0B 2E9RX 2SXLA 1UVLA 1MROB 1W26A 1YK9A 4IG3A 2ZBIA 4F4XA 3H8YA 4P2FA 4UTGA 1S1TB 1MU2A 4JI6J 4NEYA 3QJPA 4PR6A 4ES2A 3B82A 2B4UA 2WOMA 3G8TA 4UOFA 5D4OA 3LALA 3OVSA 5KFCA 8RUCA 1REGX 1FTCA 3P45B 3W9HA 3V81B 2JEGA 4RUHA 2VU5A 1FRXA 1QY7A 4WP8A 4JI2J 2Y0SD 2DY9A 3RJMB 1HNVB 1F9HA 4I7FB 3TVKA 2ACYA 4CLZA 2DISA 5ETLA 4KAIA 4I2QB 1RACB 2HIQA 2GX8A 2MKHA 1L3VA 4ECSA 2VC1A 1NB7A 2GVZA 3KDNA 1RABB 3CMES 2ZFHA 4EO6A 2J0QD 3EGNA 3ZZZA 2U1AA 3J81j 1FE0A 2YX4A 3PYFA 2XGPA 4F0KA 3POTB 3G71S 2I2YA 2J0XA 2RT3A 3HFKA 5K8OA 2CA9A 2IM3A 2VV5A 1IBCB 1TUWA 3PW2A 3W61A 1H2TZ 1HI8A 3ZFVA 3CCLS 1U02A 1EHWA 1F1BB 3W2WA 2WVDA 3SMZA 2HHHF 4K4XA 3M30B 1HNXJ 3NEKA 4OYPA 2YKOA 4QWDA 4C7QA 2RDDA 2EKYA 1XC9A 3NGDA 4AXJA 1LNQA 4KC5A 5KG2A 3T1HJ 1Q8KA 3M1VB 3CCWA 1WF2A 4CLPA 2WRMA 4ZA1A 4X62F 1TUGB 5IZHA 4CNZA 1SL1A 3GZ7A 3MUTP 2YWFA 2AYBA 2BRLA 4DR3F 2QLXA 4WFYA 3DN9A 5LXRA 3UPFA 1J27A 2VG5B 4KJIA 1DQ9A 2G0CA 2DB1A 2GO9A 2NZ4A 2CQBA 1G7CB 4DL2A 1O5JA 2MGZA 4TKTA 5A8RA 2DD8S 5F0UA 3DHWC 1MROA 3IG1B 3KLEB 2QMUB 3M05A 4IH6A 3R5BA 3IM9A 5D4NA 2B6AB 2KYZA 4NRTA 2HVIA 1S1TA 3PJXA 4KKOA 2PEBA 2HYIB 2DNQA 4RNNA 3RTVA 3M2RA 4NLVA 2BOPA 3S01A 1VHFA 3MM5A 3AA9A 3KHLA 1RKIA 7AT1B 4PQUB 3V81A 4DR1F 1WHYA 5KFJA 1TUVA 2NCKL 2HWIA 3ILLA 1D8YA 3CDUA 3FNNA 1SUQB 3HM9A 2MZQA 1NHVA 2MKKA 2FC8A 2J0SD 4N77A 4PXEA 4I7FA 2E5LF 3TRGA 3P5BP 4I2QA 1DTTB 4P2MA 1T11A 3BBFA 4DV7F 3AAWB 1BHNA 4DOZA 2J7UA 2OTLS 3T6JA 3Q24A 4MK8A 3A8EA 4KYZA 3RG6A 4QOTA 4FS1A 3ZTSA 4NZ6A 2VDIA 1KVIA 2W7OA 1IBLF 2LA4A 2EWHA 1GEHA 1BGXT 1VS3A 2UUBF 3CJ8A 2IY5B 5AE2A 2P9GA 3VV2B 4WZQA 1X0FA 3CTRA 2JEIA 3WX8A 5KFXA 3AOBA 4W92B 4B3TF 4N7TA 1TV6B 1OO0B 3MECB 5KTQA 1REVB 4Q7AA 2J9DA 5E41A 4OI2A 1NKEA 2CIMA 2IBKA 3CD6S 4LQ9A 1HBNA 2HVHA 2I5JB 2EC2A 2MZ1A 3M30A 3BO3A 4DWIA 1A0OB 1LEOA 4F04B 3CJSA 4C8ZA 4B3SJ 1HWLA 3ELHA 2O1PA 3SXLA 4NCGA 4FN5A 3IR7B 2C2KB 5F8IA 3K5OA 3FGVA 1UWBA 2VG5A 4JI0J 3CJRA 1NJWA 3V6HA 2ZDPA 3QRRA 4MT1A 2E7VA 2NYIA 2IA0A 2BJ3A 2MLYA 3TJAA 4DR6J 3UQSA 4A8YA 2QLJB 1J5OB 1S59A 4K2JA 2NXJA 4USUA 2DGWA 1JNRB 3ULHA 1FWLA 3OHAA 2N82B 3BKFA 4NMLA 3IG1A 1RA7A 4FP9A 3L7UA 3MR6A 2XO6A 1ZAXA 2Z56B 1JNZB 5LSRA 3C14B 1C0TB 4RJVA 4TU7A 2EK1A 3PJ9A 4Z2XA 5HVFA 1XMOF 2HFNA 2LDYA 2HGNA 3OXLA 2M2BA 3V5RA 3K17A 1MWZA 2ILZA 4TLRA 3MEDA 2AKWB 4PQUA 2XYHB 2QLFB 3QYYA 3Q2SC 4LRFA 5E33A 4KH0B 1MMDA 3H2VE 2GHPA 1S49A 2Y1IA 3AFGA 3AD8C 4DSLA 5HN0A 1ACMB 2YKNB 1DTTA 2HHVA 3V2UC 2V68A 1OSCA 2FVCA 3A3OB 3MOJB 3QZ7A 3JQKA 2B3TB 3LP1B 2UUWA 4O44A 1F3FA 4QYRA 4F4YA 3QJLA 5HMWA 5IFMA 4MMOA 1WG5A 3PDNA 4RWWA 2XG8A 2R7VA 2VJVA 4P52A 4P6QA 1UVKA 3CD5A 3IRXB 1TV6A 5KT2A 1K44A 5A6PA 1HQUB 1REVA 3DRYA 3CNQP 2ZBRA 2ZJQQ 2IRYA 4DR2J 3FJ2A 1KS2A 4NLYA 2GGPB 5GVQA 3NWGA 2RU9A 4CO0A 4DR7J 2DNRA 4ECZA 3A8KA 5FLXY 4G1QB 1U6BA 2EG2A 4LF9J 1R8PA 4C11A 1RWWB 3ISZA 1HR0J 5E3CA 5AT1B 4LF7F 2DRDA 4DS4A 4KH1B 3N6MA 1GMVA 3W2VA 1C4AA 3DLGB 2OMLA 5LMNJ 2KM8C 1RCOB 1O8BA 2CJXB 3Q8RB 1Q7LB 4JV5F 2FHMA 5L1LA 2J6UA 2WBRA 2BM1A 4E0DA 4GKKJ 1HIYA 4DUZJ 5DDOC 1TAUA 5IQQA 2LQ9A 4PWWA 3K2YA 1NPRA 4GO5X 5GMKa 2DVIA 2EFQA 2QFJA 2M52A 4DV1F 4IRCA 2Y3YA 2DO4A 3DCAA 2CADA 2EFVA 2HS3A 3C14A 3MR5A 1C0TA 3RR8A 2Y1LB 1PBUA 1XERA 1SI9A 2CNKB 4J9QA 3K5NA 3K5PA 3TANA 2C3PA 2LEAA 1OQ6A 1H2VZ 4DN0A 4C0HA 2HVEA 1RP5A 3P3DA 3AY0A 3I5CA 2HNYB 2MEWA 1RA6A 2YX7A 4M1KA 5HROB 3UFCX 3U1MA 2OPRB 3HHKA 3DOKB 3IM8A 1R89A 2YKNA 1X4AA 2HQDA 1LW2B 1RWXB 1PILA 4CLWA 5KFPA 3I55S 3N0VA 4ZCMA 3I96A 2W9AA 2MJUA 5HANA 3LWMA 3PNIA 3LP1A 4J9UE 3H5SA 1Q53A 2DO0A 5GADI 1VQYA 4ES3A 3QSIA 2PSZA 5L1JA 4M5DB 2LFVA 3GG0A 2DK2A 2HFVA 1YJVA 4AFFA 5K5MA 1HHSA 2EG1A 3NRBA 1UW9A 2GC8A 4RNMA 2OPQA 2PA8D 1P9YA 3CIZA 2AHOB 3I5AA 2JOQA 2EBGA 2HHXA 3KUEA 2JH3A 1WC0A 4RNFA 6FD1A 3LH2S 4LRCA 1KQSR 2IC3B 1UW4A 2UVUA 2HHHJ 2EFNA 3TQ1A 1P8GA 2XS2A 1Z2ZA 9RUBA 3PVXA 4NLWA 1LFPA 1RISA 3CCRS 5CD4H 3RRHA 2WVCA 2F5GA 3RAMA 3DYAB 5B0FA 3CT9A 3QGIA 2P6TA 2X3GA 3SDEA 4ZLPA 1S99A 1FI4A 3WZ0A 3DLGA 2AJ4A 1VRTB 1RT1B 4NPOA 3OR1A 3ZTOA 1AFJA 4TYBA 5IM0B 4U7CA 2LQ8A 4FNHA 4F25A 1X9MA 4Z7CA 4DL6A 3H2UB 2F9DA 2UUCF 3GTYX 4J5OA 2HQIA 2C3OA 1MW7A 1RAFB 4Q44A 4L3KA 2F65A 5L9NA 2D3UA 2I1RA 1VQKS 1WORA 4OZ1A 3GE9A 4Y28C 3MDFA 3HVTA 2HNZB 2C2DA 5FDLB 3SI8A 1BLUA 4F26A 1S6OA 4CTAA 4RNHA 4O3QA 3TJ8A 3UCZP 4Y2MA 4BC7A 4DR1J 4QWAA 2EW9A 5ETMA 3UNYA 2FHJD 2MKCA 3J7AN 2FYXA 1JLAB 5HROA 4C2MA 2E5LJ 2E1RA 1WEXA 5DETA 3FBEA 4ZPWR 3DOKA 3J81U 2XMMA 4O3RA 4YB1P 4DV7J 4PG8A 3GFXA 2N4CA 2M9KA 2N7YA 1HWKA 2C42A 4USWA 3OLAA 1ZM2A 3TARA 4NXNF 4P7TA 3QT7A 2GO8A 4L74A 2ROGA 1VFJA 4K2XA 4LF6F 2P9EA 1T8EA 2D3OR 4P75A 2R2TA 2MKYA 4M5DA 2VKRA 3MFIA 2UUBJ 3O1LA 4K4TA 4IG0B 2Y8WA 3DU5A 4YB7A 4ECXA 2X3DA 3TZXA 2LVWA 2VODA 2B4PA 4CLSA 4UUXA 2MKJA 1RGVA 3I32A 4IFYB 4B3TJ 4DBQA 1PC5A 2FJBB 1XR5A 2HAFA 4DFKA 2ROEA 4DEZA 4NXMF 2R8JA 4E8UA 4P73A 4V19X 4OZ0A 2IC3A 4F3QA 1KDNA 4U96A 5GMDA 2XY7A 3KOAA 4RWXA 3D0IE 4DPWA 2M70A 4L76A 1Y9OA 2IVMA 2Q3PA 1RTHB 1WD6A 4ANEA 1EKSA 2ACMA 2B9EA 4WK3A 3DYAA 2E1CA 1TR0A 2O67A 2G2YA 4C3KA 4OYAA 3OJUA 4USKA 4FVCA 5HVGA 3MF5A 2HFUA 2YVSA 1VRTA 3JTPA 4F0MA 4K4ZA 3P8BB 2VL1A 3AH6A 5IM0A 2JRSA 4B9TA 4KGVB 1NK5A 1SJFA 4XTTA 2R8IA 5F9LA 2HFSA 4HACB 2K06A 2KJVA 3H4DA 4ZLJA 3UDCA 2HEKA 1NU4A 4QU7A 3HVAA 5KFQA 2HAIA 4HT5A 4FXWA 1HHQA 1RT3B 3G86A 2KN4A 2ERRA 1WTBA 4QWCA 1JKHB 3OTOF 3W9IA 2DRAA 4ZVQB 2JC0A 2HNZA 2DPJA 1XNQF 4PUOB 1FJEB 4ZVSB 3L3CA 1XMOJ 1KP6A 4PZVA 3CC7S 4ZVRB 4DL5A 3OLBA 3GSDA 4OYXA 2L9DA 4PG6A 1FWKA 1BY9A 1N0UA 5AE1A 2DXDA 1WI6A 4X4SA 2VQFF 5K9FA 3NGSA 1FERA 5IC6B 1GXUA 4DQPA 1UEVA 1KTVA 3RW6A 4WYWA 3H0PA 4EYHB 3CF5Q 1YITS 1T9TA 2Y0BB 3WIVA 1LWCB 2VC0A 1VQ9S 4M94A 2ZZNA 2ZNZA 4NEZA 4LR7A 2YQ0A 2LMIA 3ILJA 4DX8H 2OH2A 3RGIA 3FDSA 1APSA 5E0OA 4Q45A 3VAGA 4M5MA 1F0XA 2GIQA 3VGUA 3C6UA 3BB5A 4TY8B 1S77D 1X5OA 4IG0A 2I38A 1LKZA 3DRXA 2N3LA 3RBZA 2RH3A 3B6BA 3PXGa 2JVOA 4IFYA 2AW0A 2VASA 4IO9Q 1KKHA 1X4HA 3KLHB 2KYXA 1NPKA 5D4PA 5T41A 1X4FA 4HT7A 3W9JA 4J9PA 4FBTA 2NPFA 1GFWB 2E9TA 3OFHA 4CLTA 2UZAA 1TKZB 2XEXA 3UW1A 2KZZA 3OHBA 4UOHA 1RAAB 3MPYA 1RTHA 2HQGA 3ZZ0A 3C16B 3UVJB 2W4CA 4Y65A 4Y2AA 4R8UB 3FSIA 2B4VA 4J9MA 4LF7J 3GONA 4PWDB 3NNHA 2NYHA 4EWTA 4MAKA 3KLFB 1VJWA 4UOGA 3B4DA 4YP3A 2OFGX 2LXUA 2NUUG 3PEHA 2K3KA 4DDFA 4JV5J 2IYGA 1KONA 3O8WA 4HACA 3BYRA 1DAXA 2DNHA 4NZ0A 4C8KA 4H4KA 4WE1A 1WC4A 3FUYA 1FK9B 2DNYA 1URNA 4DV1J 1C0UB 1RT3A 1RQ0A 3D1HA 1G4CA 2KFYA 5EX0A 2YPZA 4W90B 1PIEA 4DJBA 2BDPA 4PUOA 3PM9A 2ZOFA 3BDEA 2J6SA 1R3NA 1G2EA 2RDIA 4I68A 1H7XA 2E5GA 2CPDA 4YFUA 3DXSX 2CQPA 3HT3A 1TELA 4WXOA 3I9ZA 3DLKB 3MXHP 3GFHA 5ETKA 2PFFB 3KHHA 1T9XA 1LWCA 2MMYA 3E01A 3MCNA 1QD1A 5HP1A 2NXUA 2WONB 2UV8G 2RD5C 3HF5A 2J8AA 4CCHA 1MN7A 4ZITA 1DHMA 2AJ0A 2A6MA 3NXZA 4IYQA 4PXDA 4KQZA 4H4OB 4OYOA 1YJ9S 2M8DB 1NO8A 3QWPA 3TI0A 2C1EB 3D6HB 5HBMA 1XMBA 2CRLA 2VFRA 1N6QA 4TY8A 3FKBA 5MLCV 2YTCA 1RT2B 3IAM9 2CPJA 4TQSA 2RS2A 1PGZA 5KFZA 2Z58B 3NS6A 1N4LA 1CQNA 1CULB 3D4JA 4J91A 4XO0A 3KLHA 3GIMA 4GO7X 4LF4F 2AZ1A 3HD1A 4ZVHA 2GJIA 4K5RA 1RSCA 1S4FA 2DHXA 3BKUA 4XK8C 1H3DA 1GAOA 4HEA9 2R2UA 5KOXA 2B43A 1TKZA 2OKQA 1PC4A 2BVZA 2H4WB 3UVJA 2D3ZA 4J9LA 2CAJA 4R8UA 3TYTA 3X3UA 3MAAB 1RXOB 4PWDA 1GXLA 2RHSB 3G6VA 4LF1A 2AJ1A 4LFBF 4IRKA 2XB2D 2G2ZA 2XBPA 5HK4A 1UMJA 3M9NB 5KT3A 4X2BA 2EK6A 5EN1A 5G4DA 1ROFA 5CYQB 4FYDA 2YKAA 1K0TA 3MMBA 1RUSA 3BR8A 3RRGA 2UUCJ 2XI3A 1R0BG 1N48A 1FK9A 1NBEB 1X4GA 2ALYB 4BWMA 4PEOA 1NH7A 2M8HA 2CVEA 4B9NA 2XWYA 5DQIA 1KNZA 1TKXB 1VQ8S 1KOHA 5EGYA 4ZPTR 5HAOA 1S7IA 4A8FA 4Y2IA 4F4ZA 1GX6A 3UDEA 3HJFA 4PYAA 3KJNB 3OQ2A 1N5QA 4RUAA 2DJWA 3T5KA 2FLPA 2FZCB 2VBWA 3OBIA 4QR0A 1ZBTA 5IXUA 2ZUGA 3DLKA 5H1SV 4J9OA 1S97A 3E51A 1P1LA 2XSFA 2XCPA 3PX4A 3CGIA 1RHKB 2DNGA 1WC3A 1R7IA 2VBZA 2HGMA 3K59A 3MR7A 5L1KA 1Q81T 1S1UA 4ILMA 4QBUA 1IKYA 1Q16B 3FCVA 2WONA 2BW7A 2DHAA 2V2KA 2G1HA 3ZNJ1 1BMQB 2APOA 2E1AA 4NXNJ 4H4OA 2R9LA 3T3FA 4CI0B 5E3AA 1D0EA 3MWBA 3CCZA 4LF6J 1F9EB 3ONQA 3IBWA 1U49A 4G1PA 1IWGA 4JI8J 1MNEA 2GJFA 3QATA 3FSXA 3D0HE 2OD6A 1WC5A 1YX2A 5AXKA 2FVPA 1RT2A 2DCLA 2CFXA 3CCES 3HK2A 4O4GA 1CULA 4OMFG 1Q8BA 4NA2A 3NL0A 1MSWD 4NXMJ 2LLZA 2V8GA 2ZZTA 3M8YA 1YGYA 2POKA 3PYEA 1WELA 3VQTA 2CQIA 1VBZA 2V4RA 1TVRB 2MQOA 3NOCA 4JI5F 3EYZA 4EBEA 4HYKA 3QNWB 4L6V3 5C24B 2N7CA 3MAAA 2F8HA 2OELA 1L5UA 2H4YB 2CYYA 3FEZA 5DZ7A 3GYGA 1BQNB 1VLYA 4LQ3A 2KM8B 5C42A 3NCPA 4Q2MA 1XWLA 1TMJA 1E6VB 1RCXB 2X1GA 1NK7A 1B0PA 1KEKA 1T95A 4DUYJ 5CYQA 4OYIA 1OPZA 5DLGA 1U09A 4HLBA 2CZ4A 2E5IA 3D1OA 1N32F 1JXLA 1HWUA 2F40A 4EEYA 1L3KA 2XSJB 4JI3F 2RE1A 2DR6A 3AQOA 3P5TL 1P9QC 5IOLA 2DGTA 4ZVGA 3T1AA 3OTOJ 3U1LA 4MJKA 2FQQB 1XNQJ 3OJSA 1UCNA 2AJQA 1XN9A 3CULA 1FDBA 3KJQB 2OPPA 1AW0A 2VQFJ 2ASYA 2OPSB 2QA4S 1Y3KA 5HLFA 1QTNB 3T5JA 2C3MA 4CZCA 2A2DA 3UNGC 1U6FA 4RR5A 1MMLA 3EVOA 3MPDA 1IR1A 4L3NA 3NG8A 3GP9A 1CJTB 4W4MA 2BKOA 1Q0NA 3MPWA 2NLWA 4E98A 2V67A 4QJVA 2ASLA 2ILYA 4DPOA 3UDLA 3WC0A 4LRAA 4QIFA 3R5DA 1N54B 3MD1A 1SJQA 4C4WA 3ENAA 3GV8B 1D09B 3HT0A 2VF3A 3KG0A 1IXKA 4G1IA 4FF2A 2W9CB 4JOUA 4CLUA 1SQGA 1F5CA 2DEJA 4ECTA 3CC4S 3PEJA 4ETZA 4YDDB 4ITSA 4KPCA 2ZM6F 4F8RA 1U1MA 3KNGA 1CJVB 4DF4A 1FRIA 3IAS9 4FF1A 1HBMA 2ZD1B 5JVHQ 2F8EX 3M8PB 1TVRA 3M9OB 2ZC3A 2QA4G 3QGPA 2DGXA 1EX8A 2R7QA 2J9DE 2IPOB 5C24A 5J2PA 3FEYB 3NS5A 1FJGJ 3SCKE 4K4WA 4X4VA 3R7BB 4DXLA 2A1BA 4AL7A 2CVIA 1RAJA 2D3O1 1SV5B 1CJKB 2DT9A 3ZO7A 3H98A 4FKXA 4DZ6A 4DCPB 2DKOB 2IFXA 2XSJA 4UQGA 3PO5A 4ZIVA 3BN7A 4MKVA 1QE1A 2GJ2A 1M1KT 4DV0F 3EVWA 3N9UC 3SIPB 5I3QA 4OFZA 2MYFA 3D54A 2HIYA 4OV6A 1RWVB 2BM0A 3S1TA 2OPSA 1FO1A 1RAEB 2AGQA 1RAIB 1TU0B 2ZKTA 5ETSA 4JV0A 5THWA 1RBOB 2WAQD 1S1XB 2Z2YB 2Q66A 1JJ4A 1S1VB 2BXJA 3AT1B 1RTIB 1URRA 2GQCA 4RW8B 1RI7A 4OX8A 4IRDA 4M8LA 3CC2S 5J2NB 3EICA 2UVRA 3WBZA 2QJ3A 2FIUA 2JX2A 2F1FA 5JJBA 3H42A 1M5KC 1ZH5A 3PRVA 5CAAA 3Q8UA 2DCUB 4MTPA 4ZK7M 5BR8F 3MEEB 3GJQB 1GK8A 2OEMA 4CNYA 4KTQA 2JEJA 2B7CB 3KK1B 4NLTA 5I3UB 4DV6F 3QSYB 2YNFA 5KT6A 1XR7A 4ZVTB 2CQ4A 2YKPA 3KNAA 4RPFA 3BS9A 4DHVA 1SQEA 3MUMP 4U7UD 5J2QA 3BPDA 3GJRB 3UN3A 3OTDA 4LF4J 2BR0A 5KFIA 1S57A 1D9FA 3GLJA 3PIPQ 2VUGA 5ETVA 1FNOA 1CJVA 2BJDA 2R8KA 3EZ5A 1S0VA 2ZD1A 3PZPA 2AQ4A 4USHA 2C22A 3M8PA 4C3LA 1I51B 4R25A 3VGSA 2QA2A 3TW0A 1NH8A 2XLIA 1ZM9A 4ID5A 2VQEF 2GQQA 1JJ2R 1EJ7L 3OPKA 4ED1A 2L3MA 3QAUA 3SFUA 2X51A 5D0RA 2DGUA 3J81Y 4X64F 3CSKA 3UO0A 2C2NA 2EKNA 1U25A 4EU0A 3DXBA 2KO1A 4Y3CA 1BUXA 3TJ9A 3MR2A 2V8DA 1AFIA 1WSVA 4QIWD 1SV5A 1CJKA 4LJMA 1S48A 1S6QB 3DDIA 1UVNA 3M32B 3FFIB 1NEEA 4CH7A 2KKHA 2YY3A 3OR2B 3C2PA 4KB7A 8AT1B 3JAMU 4B3MJ 4TYAA 4WTYA 1KTQA 3OFGA 3THPA 4GVBB 2UXCF 1YJUA 2Y8YA 3F44A 2WB4A 1WHXA 4YR2A 3U27A 4EI2A 1N5TA 2ZC4A 2W7PA 3UD3P 4FYWB 2ASDA 3KLIA 4O0NA 1SJ4P 4O3SA 3P4UB 1R6VA 4C8LA 3B54A 5KFBA 5KT4A 2YPYA 2MHNA 5DQGA 1S1VA 1IKVB 1TKTA 3VAMA 2RRBA 4X84A 1PO6A 1DFDA 4IQMA 5J2NA 3T1YF 2MKSA 3BSNA 1VR6A 5G0RB 1CC8A 3HD2A 4B9UA 1GTEA 2QSWA 5JXSA 4ED8A 3DC2A 3QLHB 1Z1ZA 4EFAC 1XMQF 5M2UA 1IBKF 4C8YA 2QTWA 3B8HA 1FRJA 3MURP 2W7AA 3KK1A 3TX8A 4LF5F 4HL9A 4NE9C 1ZTWA 4DFMA 3P49B 4ZCIA 4DF8A 1FRLA 1JX4A 2Y9HA 1HBOA 3LANA 5CZVA 1UL3A 3QPIA 4ATNA 1X8DA 5F8NA 1V3RA 3KUGA 3ZXWA 4KHPF 4QCLA 1YHQS 4F0HA 1HMVA 4M5IA 3PYGA 3QAEA 1IM4A 3FCHA 2IM2A 3H25A 2HWTA 1SKUB 3D6MB 3R9LA 4AUKA 1WKLA 2GNKA 2O3DA 3OXFA 1PAEX 3FRYA 2HVDA 1JK9B 1FT8A 2HZVA 1WC1A 3QFHA 1E6YA 1UKUA 2R4FA 4PPZA 3K0JA 3R8YA 2F63A 3QT5A 5IC4B 3UR3C 4Q8EA 1BWEA 3U7JA 3OW2R 4O3NA 2BJEA 1V5IB 2ZITA 3JYTB 1NSAA 2PFDA 1S6QA 3M32A 4Y2CA 4TU8A 4OHZA 1SVDA 3IP0A 4OX7A 2IVFB 4IOCQ 4F3MA 2LEPA 2KZMA 4PRFA 2F3JA 2XQCA 4B9MA 4JI3J 4P10A 2UXBJ 5F3ZA 3HHNB 5LOQA 3BO4A 3J7A1 3SQOP 1LW0B 1JLBA 4ZPCA 3BGOP 2G9OA 2DHSA 4PWUA 3KG1A 4OL8A 3TUZC 1IWAA 3ENVA 2HHPA 4J90A 3TUPA 3IGVA 3NLCA 5I3PA 4DZDA 4FF3A 1LQ9A 1BE4A 2OD4A 4Q8FA 4NA1A 3FBBA 2HHWA 4DCOB 1B99A 3EDRB 3WQPA 4OZ3A 4I1TA 1OY6A 4DSJA 2LXIA 2CG8A 3PIOQ 3ZZPA 4O0IA 1NNDA 2VPWB 1K8AT 3D6FB 3DDKA 3HVRA 1DTQB 1YJ7A 3UN2A 3OD2A 2CQHA 1KWMA 3QLHA 1QUPA 1IKXA 3HDSA 1A9NB 3CXCR 2QC3A 2JSXA 1CC7A 1HBUB 2U2FA 3HLUA 2XYGB 1P27B 1SJ1A 2CNNB 3MPVA 4AL5A 2FJXA 3IXQA 2J7WA 4ANCA 1RADB 2HQCA 5KFLA 2RRNA 1UFLA 4XIUA 4OJGA 3CD0A 3SYZA 3LQVA 3HSDA 2B7BB 5LJ3Y 3HHDA 4YQWA 1UVMA 3I82A 4IOBA 4XPEA 2ZM6J 2YNIA 2FHOB 1QSLA 5KFAA 4HI2A 4NLDA 4OI1A 3A4TA 2IDEA 1SBRA 1FRKA 3KTQA 2UV8A 3TVYA 2KXFA 5ETOA 3M8SA 3OTCA 4ECQA 4LBIA 4RLEA 1VRUA 4B17A 4Y0FA 2CG4A 1LWEA 4CQ1A 3H7HB 5D15A 1M1HA 2EC0A 2GVZB 2RF2B 2R3VA 4MKYA 2D41A 3PTWA 3JYTA 2HQ3A 5HO4A 2G0IA 4JI4F 3VAHA 4XDCA 1H73A 2Z2LA 3R5GA 1KHVA 3R6LB 1O0PA 3C8YA 2CJYB 4L75A 5IV3A 4AL6A 1WF0A 3HKWA 2WHOA 5F41A 5KFOA 4USMA 3LP2B 1S9EB 1NDLA 4OI4A 1FRMA 1RBLA 1R0AB 3M6UA 3QWUA 2UXDF 4HH0A 1LW0A 4DV0J 5L1IA 3IN5A 2P6SA 3K5LA 1CS4B 2CJAA 1FDNA 2ZNYA 3ZTQA 1KFDA 2QLWA 3TO8A 2YWGA 4CO5A 1AZSB 3KHRA 1FXDA 3VAJA 2I9SA 4M63A 2RUGA 3C46A 3IWNC 4KGKA 1W2BR 2YNGA 4R5PB 3QRPA 3R7SB 3M8QB 3CJTA 2LCWA 1WF1A 1YLXA 3EUNA 1IQZA 3MTJA 3IS9B 2LU1A 3LAKA 3TAQA 3RYLA 4NCAA 2RQMA 4J9SA 1BQXA 3IC1A 1FE4A 1R8BA 2EEYA 2NPIA 3UD5A 1T9UA 1GMWA 4HVZA 2IIHA 5BR8J 2MPUA 4CP5A 2W2PP 3A12A 1HBUA 1RU1A 1SKSA 4ZOSA 1X60A 1Q4RA 1S7HA 4DV6J 5F8MA 6AT1B 1IM6A 3BZQA 3HI9A 2KB2A 3LGMA 2C28A 3D7SB 1RYSA 1VMBA 3Q89A 3PRDA 4C98A 5A8RB 3EGVA 2K7KA 2H5IB 1A6LA 4XAKA 2VPZB 3L9ZA 1GT8A 1KFSA 2ROPA 1KOOA 3CJ5A 2HBYB 1CPZA 3BGUA 3LGNA 4I6WA 4KKOB 2RU3A 2C2OB 1H74A 4CM0A 3M2RB 3MM5B 4G3IA 3ZNUA 3D6TB 4URQU 3RB0A 2VQEJ 2DNOA 3BREA 3FQLA 4NA3A 2W01A 1RT4A 4ZP8A 1NDPA 2XLJA 4X64J 1S9FA 1GX5A 4OZJA 2J9CA 1ITPA 4DFJA 3AOAA 2KXNB 1EKRA 3H5YA 3R5JB 3HFVA 2MQMA 2FDNA 2QZ8A 3A3PB 4C48A 5HMYA 4DV2F 2RF2A 4LSLA 4PG7A 1R8HA 3CO9A 2HHUA 1NXIA 3I56S 1Q79A 3CPWR 4DSFA 2WW8A 3DM2B 3GQCA 3BDPA 3J80U 3EPGA 3NNCA 3AODA 1QVGR 4OZ2A 3BQ0A 3T9NA 4CLLA 3NAIA 1IR0A 1KN6A 2DGQA 2NZCA 2YWEA 3MEGA 1YRTA 2UXCJ 3LP2A 1S9EA 1HHTP 5CH7B 2XY5A 1R0AA 1RWMB 3TVZA 3DMJA 2JZ5A 4U67Q 1CS4A 2UU9F 3CO0P 3W64A 4OQJA 3ET6B 1AZSA 4ZVPB 4ELUA 2FD2A 2QGFB 5DG8A 2CZVC 1HBNB 4YB6A 1WDDA 3FRZA 3AOCA 4R5PA 2G13A 1H6KX 1DY3A 3M8QA 2J76E 2QL9B 2QFIA 3T1YJ 4HTJA 2HHQA 3IS9A 1VK3A 3JSMB 5CZXA 2YWWA 4NCGB 5T7LB 1N8RT 1HYSB 4ZHRB 1RAGB 1XMQJ 5KG7A 5CA5A 2ZKUA 1IBKJ 1NM2A 3CUNA 1UWBB 5J1NA 1CQMA 3CCQS 4A8QA 2GS8A 2KTQA 5FIIA 1UVJA 3VVUA 2C2EA 2ZDOA 4LF5J 2KG0A 3NMRA 2AGPA 4QYZK 5DG9A 5D6GA 4KGZB 3GIJA 4ALZA 4FNIA 2YXLA 4C0OC 3UWTA 3K89A 3NWRA 2B0GA 4KHPJ 1BQMB 4LF2A 1OY9A 4UT4A 1SH3A 5DDRC 1R8AA 4OI3A 3T5HA 3HMJG 2HFOA 3GCXP 4ZVFA 4YY3F 3MEDB 3W62A 3EE3A 5IT9Y 2QL7B 5E7OB 3T19A 2VH7A 2A18A 5AXNA 2XO7A 3D67A 4PXBA 3ZZUA 5CABA 1YQHA 4A48A 3BQ1A 3A13A 2QE5A 2G0JA 4JYAF 2VDHA 2VHGA 1C1CB 4BLGA 5CCLA 2FVSA 3GR0A 3VF0B 3R97A 2BE2B 2DIVA 3Q8PB 3IBFB 1U1QA 1Q5YA 2VZ9A 4JV2A 3TUJC 1N34J 2DPIA 4LR9A 3MM6A 4YDXA 2ZOMA 4O44B 3DM2A 4FPRA 4GC7A 4PKDB 1VBXA 1F2HA 3SZ2A
chains in the Genus database with same CATH topology
1RT2B 2GV1A 3IAM9 2CPJA 4DV5F 3QO9A 4TQSA 4IG3B 2RS2A 3MAQA 3M6XA 1N52B 4BS2A 4DG1A 4KBIA 1PGZA 5KFZA 5HMZA 3NS6A 1N4LA 3CCMS 1VC6A 4PQAA 2H9ZA 4B9LA 1CQNA 1SXLA 4MYUA 1MU2B 1ELOA 1CSJA 1HFEL 3VTIA 1S9GA 4ES1A 4XO0A 1LK7A 1OIAA 2AYMA 3KLHA 4ZP6A 4TQRA 4CO4A 1FDDA 5C25A 4MFBA 3SCJE 4ID8A 4X4UA 4ZPAA 2FPHX 2BANB 2RNEA 3GIMA 1Z4UA 4GO7X 4LF4F 4ZVHA 2DITA 2WOMB 1VQMS 2GJIA 1QUVA 1Q7YT 4KHMA 4DSIA 4B08A 4QPXA 3VALA 1RT5A 4ERDA 2FTRA 4K5RA 1YTYA 5KFKA 4B02A 5GAGU 2WBMA 1HPZA 2Z0GA 3MMCA 1S4FA 2DHXA 4I64A 4KFBB 2MZJA 3GWCA 2XMWA 4RU9A 4XK8C 3KLIB 1H3DA 1GAOA 1U1KA 4HEA9 1R31A 2QMXA 5D4LA 2R2UA 5KOXA 4V19J 3F41A 4TN2A 2B43A 2HNYA 2VPYB 5BYQA 1ZETA 3L95X 1F5AA 4NWBA 1TKZA 5FD1A 1JLQA 1X0PA 2W25A 4IR9A 1YWXA 2OKQA 3O2IA 1PC4A 1U4BA 3HHLC 2BVZA 2OPRA 3RU0A 2AJFE 1K1QA 5L38A 1V3SA 5AE3A 5U47A 4KSEB 2D3ZA 3LF0A 5D8HB 4J9LA 1TKTB 4HH1A 1QSSA 4Q0BA 4R8UA 1H2UX 3TYTA 3X3UA 1LW2A 3K8VA 4DMZA 4YHHF 2FLOA 2BA9A 3EPIA 4PWDA 1GXLA 1XBWA 4N8OA 2G4BA 3G6VA 4MKAA 3JSMA 4C11B 2MZRA 2AJ1A 2KI2A 3BM7A 5T7LA 2CDQA 4F4KA 4IRKA 2XB2D 4LFBF 1HYSA 2XBPA 4ZHRA 4CO3A 5KFTA 4ZPDA 5ADZA 1UMJA 1M5HA 4WFNQ 5F3TA 3W2VB 3M9NB 5KT3A 3T6BA 3OFFA 5ITHA 3H4BA 4YMEA 3PX6A 1UJ6A 2HLTA 4X2BA 3N6NA 4Y00A 1S0NA 1CEZA 2M5YA 2EK6A 5EN1A 5JUMA 1R27B 5G4DA 4JI8F 2XNRA 2LXFA 2N4DA 4ICLB 1ROFA 4WFXA 1UJ5A 2ZH3A 5CYQB 1QLNA 5A8KB 1H98A 5J1EB 4C9DA 2FJAB 3G8SA 1VQNS 4FYDA 2YKAA 3BSCA 1K0TA 2ZH9A 3MMBA 3IWXA 1RT6B 1YBAA 3BR8A 2CJBA 4RW7A 4D3GA 4DQRA 1WEZA 2MQLA 3ISNC 1XEZA 2VFVA 5KOWA 1S79A 3RRGA 2XI3A 3FQKA 3PY8A 3WDOA 3IR6B 1UJ4A 1N48A 2W8LA 3BEGB 1FK9A 1X4GA 3V4IB 1TL1A 2R7RA 4DSEA 1Y5LB 3DLLQ 2WK4A 4BWMA 3US5A 5DGAA 2XS5A 4OV1A 2V0NA 1D8ZA 4WU2A 1NH7A 4H4MB 2M8HA 3T5LA 1HBOB 2AD9A 4QW8A 1KLMA 2CVEA 1U2RA 3OXGA 4WF9Q 3GIKA 5GADU 1B64A 3I0SA 1Q8IA 4B9NA 1BQMA 1EP4B 4LF8F 1SIWB 2XWYA 2MY8A 3N5BA 5DQIA 4HDHA 1KVJA 1VQSA 1KNZA 1TKXB 1VQ8S 1KOHA 3CB4A 3D5MA 2F9JA 5EGYA 2F7VA 4UY8T 4ZPTR 4ZCLA 1HMVB 1JLGA 1ZM3A 2EFGA 4KE5A 4X4QA 4A8FA 3W2WB 2RVJA 4Y2IA 4F4ZA 1GX6A 3HJFA 4UOCA 4U9RA 2IHR1 1K73T 2VD3A 4NLRA 5K14B 1I94F 3OQ2A 2CQ2A 2HW3A 1N5QA 1U1OA 5A0YB 4JI2F 1AROP 2DJWA 1YVFA 4RUAA 3T5KA 2FLPA 2QEXS 3DRRA 3DNCA 2VBWA 3OBIA 4QR0A 3RW7A 5KG0A 1ZBTA 5IXUA 2ZUGA 5DLFA 3DLKA 4NLSA 4OHVA 5H1SV 5LJ5Y 4DR7F 4J9OA 4EZ6A 3F73A 1S97A 3E51A 1P1LA 2XSFA 3VAKA 2PE8A 2XCPA 2M0GB 3PX4A 3TAPA 1TL5A 3CGIA 3PKMA 4QR1A 2NSCA 2WB1D 2M7SA 2DNGA 4KGMA 1NJZA 2VBZA 1R7IA 2RB7A 2VG7A 2HGMA 3K59A 4LF9F 2ZH8A 1E6YB 3ISND 5L1KA 1Q81T 1S1UA 3KHGA 1DTQA 4ILMA 3TR5A 3D2WA 4QBUA 1HR0F 1IKYA 1Q16B 3G6XA 1FRHA 2V8VA 3RB3A 3H40A 1FNMA 2WONA 4N56A 2DHAA 2V2KA 3OL6A 1C1CA 4JUZA 2C3UA 1LXNA 4OHXA 1RT1A 2R7WA 2CQ3A 4QWBA 1KHWA 2IRXA 3U1NA 4TY9A 2CJKA 5LMNF 1IKWA 2BE2A 1M5VC 2IYIA 2APOA 3SQGB 2E1AA 3EZUA 4B9VA 1B0VA 2BYCA 4IO1A 4H4OA 2R9LA 4J9KA 3T3FA 2V5HG 4CI0B 2NSBA 2KU7A 5E3AA 3PO4A 5DDQC 2D74B 1D0EA 3MWBA 4IFVA 4DUYF 4UY85 5KAKA 3TA1A 4TNOA 1D3WA 3Q8SB 1LOUA 3CCZA 5I4MA 4DN9A 1VIOA 4ZVEA 3ONQA 4YUDA 2B51A 2ADBA 3IBWA 1U49A 4G1PA 5IQ6A 3MGJA 3MI7X 4GKKF 2MQNA 3N6LA 4DUZF 1MNEA 5HI7A 3M4XA 4X4NA 2O5DA 3N28A 3FSXA 3D0HE 2OD6A 2MGZB 2BZ2A 2FHJA 3C66A 3FEXB 3M2VB 4WK1A 5AXKA 5HMXA 2FVPA 1EETA 1DLOA 3KK2B 2HHTA 2KRBA 3E3XA 1RT2A 2DCLA 3OUYB 1JLCA 4OI0A 4K4SA 2CFXA 4KR0B 4NYOA 2SXLA 2E9RX 5DS7A 1MROB 4IG3A 1UVLA 3CCES 2AWZA 3HK2A 5F9NA 2ZBIA 4F2RA 4F4XA 5L39A 3H8YA 4O4GA 4ZCKA 2LDIA 4ED0A 4PXCA 4OMFG 1S1TB 1MU2A 1Q8BA 4URSA 5DJBA 4NA2A 3NL0A 1MSWD 3QJPA 1YJRA 2XMUA 2B5JB 2OPQB 5FDLA 4NL5A 4PR6A 1TQLA 4DSKA 2BANA 4ES2A 1JLBB 3B82A 2B4UA 2WOMA 3G8TA 2LLZA 1XR6A 2V8GA 5D4OA 3GG1A 4XDDA 3LALA 2HRYA 3FVYA 3AB2B 5MAOA 3OVSA 2HNDA 1ZAWA 1M5PC 4KFBA 5KFCA 5KFVA 2UVWA 1FTCA 2AP6A 2VG6B 1YGYA 2POKA 4XPCA 4HHJA 4Y6IA 3V81B 1N5YA 1N0VC 3G4SS 2CPXA 1WELA 4I0WA 2CQIA 3VQTA 1VBZA 2JEGA 2V4RA 4RUHA 1CVJA 1VQLS 4U7UK 4B9SA 1FRXA 1JB0C 4EGLA 1QVFR 1YIJS 1QY7A 1TVRB 1JLAA 2RQKA 2MQOA 3SCLE 2RDJA 4JI5F 5LT5A 2XMKA 2Y0SD 2XZWA 1NKCA 1HNVB 3EYZA 2VB6A 4I7FB 3TVKA 4EBEA 4HYKA 4L6V3 2ACYA 2LKZA 5C24B 2N7CA 1NJXA 2F8HA 4Y2KA 2DISA 1L5UA 1VQ6S 3KFWX 4KAIA 3PKYA 4I2QB 2HHSA 2CYYA 2HIQA 3KYLA 2GX8A 3FEZA 2MKHA 1BQNB 3JB9k 4ECSA 2VC1A 1UA0A 1L3VA 1NB7A 2PMHA 2ALZA 1VLYA 1ZM4A 1SL0A 4AXIA 4URGA 4FS2A 4EUVA 3SDEB 3CMES 2ZFHA 4LQ3A 2X1FA 3AQPA 2KM8B 3GV7B 5C42A 3PR5B 3NCPA 4Q2MA 1Y0HA 5B0BA 1XWLA 4A4JA 4EO6A 3VR1A 5HL7Q 1NK9A 3PW0A 2UUAF 2J0QD 1E6VB 2J0WA 2Q1LA 1IKXB 3EGNA 2JFDA 2WSCC 2X1GA 3OR1B 3ZZZA 4ICLA 1NK7A 1B0PA 1WHVA 3K8WA 4PG4A 1T95A 1KEKA 1D9DA 2U1AA 5F8HA 1MWYA 5CYQA 1FE0A 5A8KA 1OPZA 1D9AA 2YX4A 5J1EA 5LSLA 5DQHA 2CKWA 4LUBA 5DLGA 5EWEA 5A8WB 1U09A 4FZVA 4HLBA 4EBDA 1X4BA