4C4WA

Structure of a rare, non-standard sequence k-turn bound by l7ae protein
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
96
structure length
96
Chain Sequence
TRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
publication title Structure of a Rare, Non-Standard Sequence K-Turn Bound by L7Ae Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 26
structure length 96
sequence length 96
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4c4wA00
3LQVA 1O0PA 2B0GA 2CPJA 1X4BA 4C0OC 2SXLA 1JJHA 2RVJA 4QU6A 2QEXS 2XSFA 2N82B 3MUVP 1SXLA 3UWTA 3EX7B 3DLLQ 3U1LA 2QFJA 1VQ8S 4LIRA 1U2FA 4M5DB 1YITS 4WFNQ 5ITHA 2YKAA 1M5PC 3BO4A 2RRBA 4Y0FA 3VAJA 2AD9A 3CUNA 2M52A 2MYFA 2DO4A 2G0CA 2ADBA 1Q81T 2DNPA 2DNYA 3EGNA 2M0GB 2MZRA 1FJCA 1XN9A 1WEXA 3HHNB 2D3OR 2J0SD 1FJEB 5IM0A 2M9KA 3FEYB 3SDEA 3V4MA 4YUDA 4QQBA 1FXLA 1WI8A 5LSLA 1WELA 1HA1A 2U2FA 1G2EA 2CPHA 5CA5A 5GVQA 5D77A 1YIJS 2JWNA 2L41A 1VQ4S 3P6YC 1DZ5A 3CD6S 4TU7A 1K8AT 3IWNC 2CPYA 4C7QA 2MPUA 3VAKA 2M88A 1FJ7A 2CPEA 2MQPA 2CQ0A 4TU8A 1KD1T 2M4MA 2DHGA 2OIHA 1N54B 1U1MA 4LMZA 1QVGR 2KFYA 1UFWA 1HD1A 1YHQS 3IRWP 3EGZA 3THTA 4BS2A 2RRAA 1U1PA 2DNOA 2CQ2A 2D9PA 1KOHA 1H6KX 2DGOA 3UCGA 4W92B 4QU7A 3CTRA 2DGTA 3U1MA 2MKIA 3CCVS 2DNZA 2HGMA 1JJ2R 1FNXH 1WWHA 1YJ9S 2UP1A 2RNEA 4TU9A 2KI2A 2LEAA 2RS8A 2Q79A 5GAGU 2AYBA 3ULHA 3RW6A 2X1AA 4A8XA 4V19X 5DDPC 4RU2A 1VQ5S 3MUTP 2LMIA 2LKZA 4QPTA 1VBZA 3CC4S 2MQNA 5LXYA 3N9UC 1KQSR 1SJFA 2F9DA 3CCLS 3MD1A 1X4FA 2RT3A 3R27A 2I38A 2U1AA 2X1GA 2HVZA 5DDRC 3P49B 3VAMA 1M5KC 2KU7A 5IFMA 2EVZA 1N8RT 2VOPA 2MGZB 5JVHQ 4CH1A 3CULA 3G9CA 3NS6A 1U6FA 3P3DA 1X5SA 2MHNA 1SJRA 3H2UB 2MQOA 1U1KA 5BJRA 4IUFA 2L9WA 2D9OA 2FC9A 1VC6A 5GADU 4FXWA 5MLCV 3OW2R 2CQIA 2BOPA 1Q86T 1U1NA 3MI7X 1RKJA 3UD4P 2MSSA 3CCES 2MKHA 1M90T 2E5HA 2CQ3A 2DGUA 5EN1A 1VQKS 1A7GE 2KXNB 1X5PA 2DITA 3MDFA 5GAHU 2DNKA 2KRRA 2O3DA 2OJ3A 2DH7A 3PIOQ 2MZQA 3ZZZA 2MZ1A 4OZ0A 2KT5A 1W2BR 3NMRA 2MKKA 2ERRA 2RQCA 3G8TA 2M8DB 4PRFA 2DIVA 1F9FA 2JVOA 2MQLA 1NJIT 2HGNA 1KOOA 2DIUA 2YH0A 2MXYA 2MSTA 2LXUA 2E5GA 1A9NB 5H1SV 1VBYA 1M5VC 2EK1A 2M70A 2MZTA 1FHTA 4UY8T 1UP1A 1HL6A 2MZJA 1YJNS 3G8SA 5LJ3Y 2KYXA 1QVFR 1ZZFA 2DNGA 1U1OA 1R8PA 2KXFA 1SJ3P 2NZ4A 2OTLS 2CQ1A 2JVRA 2DGXA 3H2VE 1WG5A 2MJUA 3Q2TC 3J7YU 1N52B 3VAGA 3L3CA 1H2UX 2DHAA 2DHSA 1X0FA 2DNRA 1WF2A 1X4CA 4FXVA 2FY1A 2LYVA 5DM7Q 2XS5A 3CPWR 1FT8A 4U67Q 2XS2A 2JRSA 1KC8T 3MURP 2DGWA 1VQLS 2MY8A 2CPFA 4IO9Q 1CVJA 2KH9A 2A3JA 2VONA 5IQQA 3MD3A 1X4DA 1WG4A 3NS5A 5LXRA 1SJQA 2RS2A 2MMYA 3CCQS 3SMZA 3BEGB 2BZ2A 2LEBA 3ZZYA 1ZZNA 1NU4A 2G1DA 3TO8A 2F9JA 3CMAS 1YTYA 4IOAQ 1NO8A 4P6QA 2E5JA 4UQTA 4CH0S 1VQMS 1DBDA 1X4EA 2CPDA 3VAFA 1VBXA 2KRBA 2KHCA 5IM0B 2V94A 3UE2A 3JB9k 2DO0A 1WI6A 1FO1A 1YWXA 3SDEB 4CQ1A 1U6BA 2OTJS 1HD0A 3CCSS 1QM9A 1BY9A 2VOOA 2J76E 5LJ5Y 2CQGA 3MOJB 2ZJPQ 3MXHP 2L08A 2CPIA 1OWXA 2FHOB 2XNQA 1X4AA 4Y00A 3VALA 2CPXA 5JVGQ 4WFBQ 1WHVA 5HO4A 2DGVA 2DNLA 3G4SS 1VQ6S 2M2BA 3G6ES 2DGQA 3VAHA 2M7SA 2MB0B 3R1HA 2DNQA 2OSQA 3VF0B 2DH8A 2MKJA 2N3OA 3CXCR 1YJWS 1VQ9S 2YWKA 2MKSA 4Z2XA 2N7CA 1URNA 5DM6Q 1M5OC 2ZJRQ 2M8HA 1WF1A 5CYJA 1WF0A 1WG1A 3D2WA 4PR6A 4CIOA 2KM8C 1X4GA 3I56S 1X4HA 1WEYA 3SXLA 2CJKA 4ERDA 1WHYA 3J7ZT 3P5TL 4F02A 2ADCA 2AYGA 2YH1A 1WTBA 1K9MT 5DDQC 4YB1P 3BO3A 2XB2D 3HI9A 4WCEQ 2DK2A 3UCZP 2E5IA 5DDOC 3UD3P 2DGSA 3LPYA 4ED5A 2KG1A 3FEXB 2HZCA 4C4WA 2K3KA 2HYIB 3S8SA 2LECA 2WBRA 4WKRA 4WF9Q 1VQNS 2QA4S 3G71S 1U1QA 2LA4A 4F26A 1P27B 3THPA 1VC0A 3NNCA 2X1BA 3CC7S 2I2YA 3US5A 1D9AA 1OO0B 1UAWA 3CC2S 1N88A 1P1TA 2N3LA 3BS9A 3BO2A 2J8AA 1IQTA 1VQPS 3K0JA 5DETA 2YTCA 3TYTA 3TP2A 2HGLA 2CQBA 2GO9A 3S01A 3Q2SC 2FPHX 2DHXA 2F3JA 3CMES 3CCJS 1PGZA 2MZSA 2MGZA 3MUMP 2MJNA 2CQCA 3NNHA 1OPIA 4EGLA 2EK6A 3CCRS 1YI2S 1VQ7S 1DRZA 2AYMA 1AUDA 3RW7A 1M1KT 2G4BA 1B7FA 2KVIA 2KN4A 2NLWA 3R1LA 1RK8A 2VODA 4F25A 2PEHA 3G96A 3VAIA 2LQ5A 2RQ4A 2MKCA 1JMTA 1X5OA 1H2TZ 1Q7YT 5D78A 2KM8B 2CQPA 4WIIA 2K8GA 5CXTA 3CF5Q 2AYEA 2CPZA 3CCMS 1UW4A 2DH9A 1R8HA 2MQMA 4WFAQ 2ZJQQ 1WHWA 2DISA 1VC5A 1X5TA 2OSRA 4ZKAA 2KG0A 1VQOS 2MQQA 1WEZA 2KXHA 1SJ4P 1L3KA 2JX2A 2LXIA 3CCUS 2LCWA 1Q82T 1U1RA 1S72S 1D8ZA 1S79A 2FC8A 3S7RA 1PO6A 4YOEA 1ZH5A 4W90B 2DB1A 2DNNA 4IOCQ 3UCUP 1OIAA 1WHXA 1JJ4A 3NNAA 4LJMA 2DNMA 5FJ4A 2XNRA 2XS7A 4OZ1A 5GAEU 3PIPQ 2PE8A 2CQHA 2J0QD 2CQ4A 1H2VZ 3B4DA 3I55S 4J5OA 2GHPA 2X1FA 2RUGA 2DNHA 1U1LA 2RU3A 1DHMA 3B4MA 2MY7A 2CQDA 4TLQA 4PKDB 3S6EA 5LSOA 5HL7Q 1K73T 5GMKa 2LA6A 2E44A 3DXBA
chains in the Genus database with same CATH superfamily
4ED1A 2H51B 2CPJA 3CJ4A 1JJHA 5JMNA 2B4PA 3U1LA 2HS0A 2KKHA 4P2SA 3HHLC 3SFGA 2HIYA 2AD9A 1RWUA 2HKEA 5GAHI 5B09A 3TAPA 4NZ7A 3FUYA 2IM2A 1RT3A 1YZ7A 1FDDA 1ZS6A 4FNIA 2HNZA 3FEYB 4LVOP 3TANA 3RB4A 3T1HJ 1K0TA 2WONB 4OYMA 5D77A 2APOA 4JUZA 2WAQD 1SQFA 3OL9A 3GSDA 3P6YC 1K8AT 4KGXB 3D1QA 3E01B 4TU8A 5IC4B 2DRDA 5AE3A 5F9LA 1HNZF 3IRWP 3HVWA 2IJRA 2AJQA 2FHJD 3R2DJ 2DGTA 1OMSA 5KFOA 4MKVA 1QE1A 2RU9A 4FVMA 1ZPVA 2LFVA 2JEJA 2UP1A 1N32F 5BYQA 1Q4RA 2EI5A 1R8AA 3P4UB 1SC3B 3RW6A 4RU2A 3WQPA 2WVDA 4KT0C 2BE2B 1RT5A 1S6UA 1S12A 1LWFA 3VAMA 1N8RT 4CH1A 1T0TV 4WP9A 1U1KA 1V9OA 3IG1A 3CCZA 4DU8A 3MI7X 3OL8A 3GE9A 3LP2A 1JLAB 1G6BA 2QN6B 4IRDA 2OJ3A 2JL9A 4F7VA 2AZ1A 5KFCA 1N0UA 3RR7A 1REGX 4DG1B 1BE4A 1RGVA 1HL6A 2ZOMA 2HLUA 2FVPA 1WNEA 3C6UB 4YY3J 2IC3B 2R7SA 1HI8A 2FZKB 2HS3A 5K8NA 2JVRA 4FPIA 4DR6F 4FP9A 3R2CJ 2Z2MA 3VWSA 4RO0A 3AHPA 1VI7A 3VGTA 2DHSA 4NX9A 2GW8A 1VRTA 1X4CA 3T5HA 1CQMA 3HXMA 2JRSA 5A8WB 2VFSA 3GB0A 2XEXA 3NAIA 3O3LA 3NS5A 5LXRA 1Q79A 4PUOB 1WC3A 3JTPA 2HVIA 3K5NA 2HRTA 1Q1KA 1J5OA 4ZVSB 3OSPA 1NMEB 3RJMB 1KQKA 4C8LA 1N5VA 2MLYA 4M5DA 4FKXA 2J76E 1FKPB 1NLKL 3OHBA 1HR0F 2Z8QA 1SUQA 3PKMA 1JLFB 1Q53A 3A8KA 3DDIA 2K1RA 2KT2A 1T11A 2DH8A 4XK8C 4O4GA 1SBRA 3KG0A 5I42A 3MZIA 4Z2XA 2FUG9 2YWWA 4MTPA 3M9OB 5L1KA 5B0GA 3GILA 1FDAA 3ZXWA 3QRQA 2CG8A 3OT9A 4JI2F 1XMQF 4NEZA 4DFKA 3HI9A 1D3WA 2DK2A 1BGXT 2V8GA 2FZCB 2HYIB 4DUZF 2RDDA 4WXWA 4QCLA 3GZ7A 2I2YA 2J8SA 1YG0A 2V2KA 4OZJA 3V6JA 2O5DA 4DSEA 5F8IA 5DO2A 1YBAA 2ROPA 3IBWA 1IWGA 4PQUA 2MJNA 3J81Y 1BQNB 2W8LA 3NCQA 1TVRB 2VF3A 4DPTA 5HJYA 4OV1A 1Q7YT 5EWGA 2KM8B 4UY85 4OYAA 1W2IA 2JLEA 5LOQA 2R2RA 1AROP 4IFYA 3PO5A 4RW7B 1RWWB 2IAJB 3HJVA 4EO8A 4DX5A 3OTOJ 3BBFA 1AW0A 2EFGA 1CULB 4DL7A 2AGOA 2DR5A 1ZH5A 1LOUA 1BMQB 4KFBA 2DNMA 1EKSA 1JJCB 1UWAA 2ZC3A 3I0SA 2PE8A 4M5KA 2ROEA 4J5OA 2GHPA 4ECXA 3GFXA 3P5BP 1WACA 3TZWA 5HL7Q 4UTGA 2IJFA 2RUSA 4TN2A 1RKIA 2DXDA 1HW9A 4R0EA 3I4PA 3OTDA 4DI6A 3MEEA 1TU0B 2R7TA 1HI1A 3D4JA 1B0TA 2V4JB 2E9ZA 1E6VA 4NMLA 2DPJA 3KK2B 2VQEJ 3IP0A 3FVYA 3HSZA 4DUYJ 4LUBA 4DPWA 2M9KA 3H5YA 2OH2A 3MM9A 4USKA 3D68A 3DN9A 4A47A 1B64A 3QWPA 2VPYB 3QMQA 3MAHA 1G2EA 2E66A 4B3OB 5CA5A 4ED7A 3BBBA 2JWNA 1U0SA 1F5BA 1U7LA 3MECB 4RNHA 3OL7A 2XY5A 2MPUA 1C0TA 5EGYA 2AZ3A 3NGSA 3M2RA 2C2ZB 1XMOJ 4PWUA 3GYXB 4OZ2A 2QLBB 4R25A 4N7TA 3NBPB 1FRLA 3RU0A 2GJIA 2H5IB 2FYXA 2HGMA 2PSZA 2RD5C 5C24B 3UNGC 1TFYA 1HPZB 5H9FK 3V6KA 2MTLA 4ZVOB 4QPTA 2OPSA 4ZCKA 5SUHA 5FLXU 3M30A 4JI3J 1HNVA 1LNQA 2HNYB 4KYZA 4WYWA 3MOZA 5B0EA 1IBCB 4GVLA 1XWLA 5B7WA 1U47A 2OAUA 1NJZA 3P3DA 1XBWA 4RUAA 4DPXA 3HKZD 3DRRA 2MSSA 2MKHA 1V6HA 1M90T 2OEKA 4UQGA 2FQQB 2F8EX 3GV5B 4C48A 1IKXB 2DH7A 2RAQA 4JI8J 3NEKA 2DEJA 1XR5A 3NGDA 3HM9A 1FRIA 1JK9B 2XWXA 4RWWA 4OI4A 1BWVA 1SC4B 1SL0A 4DJBA 3DU5A 1YJNS 3DRPB 1UVNA 2GGPB 3FSIA 3TJAA 4TY8A 4WTYA 3ZTSA 4C98A 1VCTA 3T5KA 4LR8A 2BANA 3RTVA 2NPIA 4I67A 3M8WA 5IQQA 2VHGA 1IBLJ 1U0HB 5KFEA 2AEFA 1WG4A 2DXFA 2RF2B 2JJ4D 9RUBA 4PWDA 4I6YA 1OPZA 2J9CA 2F9JA 3LGNA 2V63A 3B54A 3OD2A 5AT1B 2H5EA 3KUEA 3QAEA 3GCWP 1WKJA 2FDNA 4Y2AA 2B3TB 4D3GA 3SCIE 4CLYA 2HWIA 4ILRA 1LWCA 3G6YA 2PFDA 2XNQA 3BQ2A 3ET6A 1RYSA 1UVMA 2ZDPA 3H59A 5IS2A 1ELOA 5A2QU 4WP8A 2R42A 3KMSA 3OFEA 3CDEA 3AA9A 5KG4A 1N34J 4DZDA 2E29A 4PG5A 3QRPA 2ZFHA 1TMMA 3EPIA 3UN3A 2KL8A 1YVFA 1LWXA 3AOAA 4J9QA 3KOAA 1CJTB 3IR6B 3FCVA 2HFNA 4QPXA 4ZPAA 2QX0A 3JYTB 3KLGA 4D3HA 3S8SA 4CTAB 4WKRA 1FA0A 1IKWB 3CC7S 5C7PA 4MYTA 1S1UB 3D6FB 4GKJJ 1JB0C 5F3TA 1ZBTA 4AXJA 2GO9A 5CH7B 4DV0J 1HI0P 4KHPJ 4L3KA 4X64F 2E7WA 1RJJA 2QJ3A 1MROA 1Q78A 2PT0A 2VH7A 2HQ3A 4ZLLA 4H4MB 3V4IB 2C42A 1VQ7S 3QFHA 4F0HA 3KDOA 4V1Ak 2VODA 7FDRA 4WU2A 4JI0F 3M8SA 4KE5A 2DH9A 2GMJA 1JX4A 4IOBA 4FNHA 4AQYJ 2DISA 4HT5A 2BJ3A 4QWCA 1X5TA 5DQIA 4M5IA 1GX6A 1RA6A 2VC1A 4G1PA 4RKUC 4NWBA 2JX2A 4HHJA 2OGUA 3ETMA 1C2PA 2EBGA 5A8RB 2DNNA 1R27B 4OZ1A 3OVSA 1S1TB 4ZVTB 3K2YA 4I56A 4QWBA 1KP6A 4YR2A 2J7WA 5IWAF 2MY7A 2H5JB 3Q8YA 4DCPB 2Y9HA 1E6YA 1VLOA 4EI2A 3L95X 1VK3A 1CPZA 4QU6A 2N82B 2FHJA 2DKOB 2P2CB 2IRXA 3HLUA 2ZBRA 2YKAA 3D66A 2XY7A 1I94J 1Q81T 3K57A 1SB6A 2MEWA 2B7BB 2G2ZA 3VGSA 2OO4A 3V4MA 1TL4A 4QQBA 1RADB 5ETQA 2VFVA 5D0HA 1WELA 1K1QA 5F8MA 4EEYA 3DGVA 2WSFC 3BREA 2Z58B 3Q24A 3QSIA 4MT1A 3O5TB 2XBPA 2ZH7A 2QE5A 1HBOB 2W2QP 1GQEA 2HFSA 1B0VA 4DQSA 1RHUB 4DS4A 2RRAA 1PAEX 2CQ2A 3MMCA 2YQ3A 3H90A 3WX4A 2E7XA 5J2MA 4C8OA 3DLGB 2KVQE 4ECWA 1MMDA 3TAMB 1SC6A 2AJFE 1SIWB 4RNMA 2ALYB 1LWEB 2OKQA 1T9VA 1HQUA 4LF2A 4XTTA 3AOCA 2A0FB 1UA1A 1WC1A 1UL3A 2EVZA 2VOPA 4QR2A 5HVHA 3UDEA 2M5YA 1VRUA 3OR2A 1Y3JA 4C11B 1WOPA 1TV6B 3CCES 4J9MA 1VQKS 4RZRA 3BKUA 2DITA 4LFBJ 5GAHU 2DNKA 3M32A 2E1CA 2KRRA 4NYPA 3FZBA 4PEOA 3MCSA 4UOHA 2ERRA 2HGNA 4F50A 1A9NB 1IM4A 4P71A 5K8MA 3QYYA 2M70A 2JEFA 1UPPA 3D0IE 1QVFR 2HQDA 2CJ9A 4H4KC 5MAOA 4FF4A 1FRHA 2V9KA 2HHHF 4NCGB 2DHAA 2CAJA 5L9NA 4C0HA 1KFDA 3TRGA 3DOLB 3V6DA 4Q0BA 3CJKA 2F1FA 4DSJA 2XHCA 2A3JA 1REVA 4DZ6A 4RW4A 3GTYX 3OTCA 2W2NP 4EWTA 2MMYA 3BEGB 1VHFA 2HBYB 3GONA 1VQMS 1DBDA 4WYLA 1F3VA 2GX8A 2CYYA 1QM9A 1BY9A 3KK3B 1RWPB 2ZOFA 1DFDA 5LJ5Y 2ATLA 3MXHP 2L08A 1IBKJ 2V5HG 1VQSA 4ZP7A 3MR5A 1F5CA 2IVFB 1XNRJ 5H9FJ 2D41A 3U27A 3OXFA 5HO4A 3DNCA 3IBFB 4RUBA 3DGPB 4IG0A 3SCJE 2VBZA 1RTIA 1AUSL 3EE3A 3MEDA 4CZCA 3LF0A 2JLFA 4NYZA 1N33F 3K5OA 3EVWA 2UXCJ 3O8WA 2O67A 4NXMF 4X66J 2ABYA 2B5JB 1HMVB 3UQSA 2HZCA 3JTOA 4C4WA 2PFFB 1IBMF 2C2MB 4ZPWR 4YS2A 1RT1B 3TR5A 3VGUA 5K20B 4OI2A 4ZJOA 1N88A 3UPFA 1XIQA 3KMQA 4HH0A 2B4UA 1NK5A 4N76A 2DBBA 1RHJB 1JLBB 2R8GA 2B8PA 4L6V3 3ADAC 1LFWA 3AY0A 3CO9A 5HSPA 3V2UC 1V3ZA 3FFIA 2ZE2B 4PZVA 1RTJA 3CCRS 2DPIA 3W1YC 4IDKB 1RT6A 5F9NA 4ZP6A 3OJUA 4TXSA 2WOMB 4JB8B 2GHVC 4DCOB 4QIEA 1WKKA 2RQ4A 3OL6A 2VV5A 2BJEA 1KSPA 1WHWA 4ZCIA 2WCXA 2I9SA 1VS3A 3OR1A 2A2DA 4DR1J 2R2TA 2I6WA 4A46A 4K4WA 4QWAA 4Q5VA 2CXEA 1S1XB 3GR0A 2WZ1A 2CQDA 2GIFA 1FRXA 3M7VA 3D28A 2E1PA 3EX7B 3CWJA 1RZMA 1WC6A 2ZD1A 4WFNQ 4QIVA 1VHIA 3DDKA 3HDSA 2K7JA 1PYTA 5DQGA 9ATCB 3BKTA 3DKDA 3R8YA 5KG7A 4ZOSA 3HHEA 4KGVB 3AQOA 1SJ1A 3HHLA 4DL4A 3GJRB 3AAWB 4USJC 3QGPA 1FXLA 4HACB 2VDHA 2B4VA 4WJBA 4H4OA 3BN7A 5G0RB 1K0VA 3M1VA 4HH1A 4TU7A 4IFVB 2ZM6J 3W9IA 2P9GA 2WW4A 1U1MA 1O6XA 1QAXA 2V69A 2ZEJA 3MAAB 1JLCB 4MJKA 5BR8J 4LSNA 3VQTA 4LF5F 2RQMA 4OZ5A 4NLYA 3CDAA 1FTRA 2P5VA 1UJ4A 1YJ9S 3DLEA 2CJAA 2HEKA 2RQKA 4Y28C 5HBMB 3UDCA 2CG4A 4NA3A 5DDPC 2GHWA 2PI5A 1S6PB 2D3ZA 3OQ2A 4IRCA 3N9UC 3T9ZA 2XI2A 3CCLS 1NSPA 2Q43A 2UVRA 1UMJA 1UVLA 4DF4A 3NS6A 3QIPA 3ZNUA 3FEZA 2VQFF 3AJDA 4JI1F 4U96A 2JNJA 3QJPA 4F2RA 1T05A 4CO3A 4QBUA 3JSMA 5E3AA 3O44A 3UD4P 1DY3A 2DGUA 1UA0A 2EPIA 1X5PA 5GADI 2I5JB 3ZZZA 1L5UA 2VG7B 2VG5B 3KJVB 2JVOA 2MQLA 3GJTB 5C42B 4DWIA 1IR2A 3NG8A 3TQEA 2KJWA 3NS7B 3R3TA 4TKTA 1Y9OA 5J1NA 5T14A 2CQ1A 1KHWA 4O3RA 1TL7A 2MJUA 1XK8A 1NK0A 4NI2A 5D0EA 4Y2MA 4P10A 1T9TA 4U67Q 1PC4A 3N28A 3KLFA 3QT6A 2BUNA 1FK9A 4L74A 2B6AA 3RRKA 5KFTA 2Y8WA 2R2SA 5ETSA 1VYAA 1DQ8A 3HKWA 2KT3A 3FKBA 1BQMA 4FPRA 3NP5A 1X31C 4EMDA 1BUXA 2NZCA 3A1YG 1F9HA 2WSEC 4DPYA 4NLXA 4JI7F 4LQ9A 4WBFA 3H4BA 2HZAA 3DHXA 3HVTB 4ZPTR 3W7BA 4ED4A 2FHOB 2EW9A 4J9OA 2WVFA 4RW6B 1Y0HA 1HNWJ 3AD7C 2CKWA 3B8HA 2DNLA 2DNQA 3CXCR 5HK4A 2BJ7A 1URNA 4LBHA 3DLKB 4NE9C 1WG1A 3KJQB 2XSJB 5HVFA 4RX6A 4KJIA 5DG7A 2XMMA 3DI6A 3Q8SB 1D1UA 3SCLE 5HJXA 1WTBA 5K8OA 3HK2A 4USTA 4MKBA 3KLEB 1KWMA 3LP0A 1NKCA 1R89A 5ETMA 4OZLA 2LDYA 2HQGA 4LF4J 3I0RA 2LA4A 4R0JA 2UUCF 5J2QA 3HFKA 2V9WA 4DUTA 4OX9F 5CYMA 4EU0A 3T6JA 1T8EA 1P1TA 4WKYA 3EXCX 3U7JA 2FJDB 2IDEA 4KO0B 4PQAA 2CQBA 5I3UA 4KHMA 3EMTA 5DLFA 2DHXA 3EZ5A 4RNOA 3BPDA 3W5YA 8RUCA 3PW2A 4EGLA 3CDUA 3PZPA 1M1KT 3W61A 1HWJA 4RW9A 4DV4J 1X5OA 4JV0A 2HZVA 1HYSB 5E3CA 1PC5A 3MM6A 3OFFA 4HL9A 5D3GB 2ZITA 3HJFA 1UTAA 2YNFA 3RBZA 4QR1A 2PA3A 5L9XA 5ADZA 4HTIA 1D8ZA 2JLGA 4NEYA 2DR8A 1UVIA 4JV5J 3PR5B 1G3OA 4A48A 5BYRA 4GC7A 3RBXA 3DDNA 5JUMA 1CJUA 2CZ4A 4Q8EA 3KUGA 1QDUB 2BRKA 2GO8A 2JC0A 2CQHA 2YKPA 2RUGA 3O1LA 1GK8A 1DHMA 2EFOA 3PRDA 3OV7A 1SXLA 3UWTA 4LIRA 4ID5B 3HULA 6AT1B 2XO6A 1XNQF 2RRBA 5DG9A 1MW7A 3O6QA 3M05A 5B0AA 3BV8A 3TUIC 1WEXA 4OMFG 2UZAA 1KQGB 4NLWA 3LALA 4LSLA 1YX2A 2HG4A 1RUSA 4Y34A 1QSLA 3OUYB 4ELUA 2L41A 3IRXA 1KLMA 1OJ4A 1KVJA 2B9EA 2H54B 4R5PB 3ILJA 1VLYA 3D3BJ 2DHGA 1N54B 1QVGR 4FF1A 5ETOA 2WBMA 1TAQA 1RE1B 3BGOP 1RCOB 4PPZA 2HQFA 2C2OB 5J2PB 4CLTA 4I6WA 4NRUA 4ZHRB 1S1VA 2AJ0A 2W9AA 2RS8A 1GFWB 2ZZTA 2EC0A 2KFNA 4DFPA 4MIBA 1GT8A 1FFWB 2MQNA 1T95A 3GPAA 3PG9A 3BKFA 4RR5A 3WIVA 1AT1B 2RT3A 2OMOA 5CZVA 4AYBD 3MTJA 2E7VA 4DXLA 4LSZB 4OI1A 4DV2F 5IFMA 2A1BA 3C6TA 4YB5A 5FDLA 5KAKA 3H2UB 2BKNA 3NWGA 1U2RA 1ZAVA 1J5EF 4OZ3A 2EWHA 4YB6A 2V0NA 2AQ4A 1U4BA 3SV4A 1NHUA 2UXDJ 1CEZA 1GH8A 2MZQA 1NSQA 3NMRA 4YR3A 2R7XA 1R0AA 2YWHA 3DU6A 1QAYA 4DR7J 5J1EA 2FJXA 1I51B 4O3QA 3AT1B 1LW0B 3T1HF 4ZCMA 1DLOA 5C25A 1X0FA 4F04B 1MWYA 2ZH5A 4ZVEA 4CLLA 1YRXA 3FDSA 2OMLA 3HFZB 5BXIA 3CCQS 2XGQA 3NRBA 5F8GA 2RB7A 2ZKUA 2IM3A 2CVIA 1WOSA 3QAUA 4R8UB 2KHCA 2C2KB 2NYIA 3B78A 3OVBA 4F8RA 2OTJS 2W8KA 1Y7PA 1VIXA 4ZJQA 1SQEA 2AWZA 2DRBA 3OFHA 2QGFB 3VALA 2CPXA 3GIJA 3FMWA 4RUHA 4C9DA 2HAFA 3VVUA 4LF1A 4QIGA 4BWJA 2R8JA 3TUPA 4K4XA 4P2FA 3GLJA 5CABA 5ETRA 2WONA 3KLHB 3C15A 4YEAA 3CT9A 1XR7A 3E01A 4O3OA 3SXLA 5LSRA 1Q95G 1R3NA 2ADCA 3NKYA 5ETVA 1OY6A 3CDBA 2KG1A 4KH1B 3VR1A 4F26A 1R6YA 7AT1B 4K4YA 4RBVA 1UJ6A 1ZETA 4LRDA 5HP1B 1Z2LA 5DETA 2F8MA 5DGAA 4LRAA 5G4DA 3KWMA 5IQ6A 4WP3A 1ZM4A 1T9UA 3LOUA 2C2NA 1Q8LA 6FDRA 5DQHA 3EZOA 3KHHA 4J7CA 3UN2A 5T7LB 1U48A 5JJBA 4DLGA 3UNYA 4WU3A 4OX6A 4M1KA 1S49A 3D5MA 5EUHA 3CF5Q 1JLQB 1TKTB 3AOBA 3THVA 4WFAQ 2J5AA 1RHRB 4K2JA 2AU0A 3M8PA 5KG3A 3LO3A 4IKAA 2MLZA 2XCPA 2QSWA 3JSRA 1WSRA 3BR9A 2Z57B 1OIAA 4DG1A 1IKVB 1U8WA 4B9NA 2AEMA 3C6UA 2IC3A 3PIPQ 3PX6A 1RHKB 5D4PA 3GJQB 2DCLA 1V3SA 3GR1A 4NLPA 4PKDB 3TUZC 4Q2LA 2J6UA 4ZVGA 4C8YA 3A12A 5KT5A 2RVJA 5A8WA 1VISA 5AXNA 2QFJA 1U2FA 2FJWA 2LEPA 3BO4A 3W2VB 2YXLA 2VA3A 3BPSP 3S1TA 2Z56B 4KIAA 4USWA 4DR2J 1LQ9A 4PXEA 3GQCA 2F63A 4C6AA 1I3OB 5D8HB 3AD8C 4NCBA 4ATNA 4AT1B 3B6BA 3QSYB 1JLFA 4GO7X 3IWNC 2HNDB 2W2PP 2CPYA 5A76A 3VAKA 4LF8J 3J7Z5 2XZWA 1HNZJ 3GIRA 2JZ5A 2YWFA 2IFXA 3THTA 4C0BA 1NDCA 4BS2A 2X3DA 4MYUA 3ILIA 1GX5A 1U2CA 4TYAA 2QLWA 2KB2A 1S10A 2ACYA 2YQ1A 4LF6J 2GVZB 4TU9A 1R8CA 4OX8A 4PG8A 2AF6A 4XDDA 3OTOF 4CH7A 3DFEA 3CE8A 3IXQA 2U1AA 5KFSA 4O3NA 3TX8A 1LV5A 2FLPA 3DMJB 2MGZB 1R6VA 1L3UA 4ELVA 2NSBA 5KT7A 4Q8FA 1KRPA 2UU9J 4AFFA 2ACMA 3PXGa 3SSQA 3HX9A 1MMLA 2PMHA 1TTHB 2BE7D 4OFZA 5AXKA 4ECVA 3R5AA 1R31A 4KHRA 2RILA 1YRTA 1BQNA 3I5AA 4OZ0A 3EPGA 3I82A 1G7CB 1WJ9A 3KG1A 3QLHB 2VQEF 6FD1A 3VV2B 1QSYA 4UY8T 4O4GB 3G8SA 2YKMB 4LVNP 1EX8A 4DR6J 1PCAA 1S1WB 2VL1A 4RW7A 1WC5A 2CFXA 2IAJA 4I4BA 2XULA 3SIPB 4ZS6A 4ED2A 1H2UX 1CULA 4CT9A 4K4VA 4H4KA 2G1HA 3PYGA 3EM1A 1HIYA 2ZHAA 1WSVA 3KJNB 2E5LF 1XMOF 1B99A 3F41A 4ANCA 1SL2A 3TUJC 3PX0A 2BXJA 1RWVB 3MMBB 2G1DA 4O0NA 2W01A 1W26A 1VBXA 1WI6A 1FO1A 2W25A 1U6BA 1ZOTA 1HR0J 2Y1RI 3EYZA 4DSKA 1RAHB 3CMQA 2V4JA 3BSOA 4PQUB 3KK2A 3M9MB 2EC2A 2DGVA 4MIWA 3FCHA 3M8RA 3G6ES 4ED8A 1YJWS 2YNIB 1XERA 1V5IB 4U7UK 3QBCA 1DTTB 1UWBB 1WF0A 2GIQA 3GU0A 4OJHA 4I6AA 4ELTA 3L4BC 4CIOA 3I56S 1RDRA 4K4UA 1S0VA 2ZH1A 4JI8F 4DR5F 4HEA9 1B4SA 1RWMB 3U02A 4AUKA 2XB2D 2AV5A 4DUZJ 1NHKL 1Y10A 2LECA 4DV1F 2EFPA 1VC0A 1HFEL 5C24A 1X7VA 2MHEA 2PIIA 2XQCA 1HPZA 1XC9A 4PYDA 3AB2B 3PYFA 5HI7A 4IO1A 1F6TA 1UVJA 2FPHX 2HNYA 2MZSA 2FIUA 1OY8A 3MUMP 1T3OA 1IBLF 2O1PA 4KKOB 2G4BA 3I4HX 1H98A 5KTQA 1H74A 2PEHA 3G96A 4A8KA 3HZGA 2GFFA 4CYUB 1BLUA 2K8GA 1LKZA 2RMLA 1Q5YA 1R8HA 1RT4B 2MQMA 3JAMY 1VC5A 1IKXA 4ETXA 4X4SA 4S0MA 1L3KA 1XEZA 5KG2A 1PO6A 1YLXA 1C0TB 1HQEA 2CWKA 4LT6A 2HLTA 4Y65A 3UCUP 2FZGB 5FJ4A 3DRPA 3R6LB 2KYZA 1JLEB 4ZLNA 4FZVA 2GGPA 2JOQA 5KFQA 1N34F 1NSAA 4B3MJ 1ICEB 4ES1A 1S7IA 4MK7A 4I2PB 3FK4A 1X4BA 3GJSB 2JDJA 3DLLQ 1S97A 4V19J 1IKYB 4K0KF 2KTQA 5I3QA 1YKWA 2RF2A 2E9TA 2G0CA 1EB0A 2DNYA 1VQYA 3SI8A 1FJCA 3VTIA 4K4TA 3MM8A 4W4MA 2IRUA 3SCKE 2RHSB 1LK5A 2NPFA 4TNOA 4GKJF 3H5XA 1YBTA 1KLNA 2HWTA 2CPHA 5GVQA 4DV0F 2H4WB 1VQ4S 2HMIB 4KHPF 2C22A 1JXEA 2M88A 1GMVA 2R4FA 2CQ0A 4UZCA 3H5UA 2L3MA 2W1BA 4KQZA 4NLSA 2MKIA 3CCVS 2QV6A 4O3SA 4AQYF 1FNXH 1WWHA 3I6PA 4WE1B 4N41A 2RNEA 1XR6A 2F40A 3U1NA 1RISA 4ANEA 2QYCA 2BANB 2DY9A 2RKIB 3JYTA 2X1GA 2H1YA 4B3RJ 1FXRA 4PXDA 1IKWA 4KGKA 2BM0A 3LP1B 3UN5A 4PWDB 2UUAJ 1C4AA 1S1UA 1RI7A 5I4MA 4DLEA 2D9OA 2FC9A 1JNRB 1VC6A 5MLCV 3H4DA 1AFJA 1FESA 1U1NA 3CJSA 3QZ7A 1RTZA 3FZ2A 3AFGA 2UUBF 3GIMA 4H4MA 3UVJB 4HR2A 3PIOQ 2LLZA 2DR7A 1N0VC 1KOOA 1N5SA 2JHEA 3PJWA 2IJNA 4KRWA 2MZTA 3MPUB 1A6LA 1HNIB 2B9WA 1YJRA 1AB8A 1MLAA 3EZUA 1WD6A 5CHCB 4JV1A 1YRUA 1KDNA 2RH3A 3POTB 2C2RA 3C46A 4CI0B 3R5JB 2Q6BA 2VG6A 5HMXA 3DYAB 3VHQA 3MCOA 4Z7CA 5A8RA 3RAXA 5SZTA 5U47A 1JLGB 1FT8A 1HWKA 3FMBA 1S1TA 5KOWA 2H9ZA 4ZPVR 3QWUA 4NA2A 1OSDA 1CQNA 3PCOB 3RB0A 5JXSA 3ETOA 3DRSB 2RJZA 2RHQB 5KFHA 4DR4F 2HVHA 3UW1A 3DCAA 3RGIA 5IXUA 3ZZUA 1TK5A 2ZZMA 1UJ5A 3TJ8A 5LL6d 3SFUA 2M2BA 2OSQA 2YKNB 2JFKA 3VF0B 5E41A 2EFNA 2MKSA 4JI6J 2N7CA 5DM6Q 4ZK7M 3MPDA 2D74B 2PN6A 2G2OA 3KJFB 1KEKA 5GAEI 5AJ3J 1X9MA 4LFBF 4M5NA 1X4HA 1HBOA 1Z1ZA 3BYPA 1NK8A 3EDQB 2QL7B 1AYEA 5DDQC 5KT6A 2EG1A 3GFHA 4WCEQ 2ASYA 2E5IA 3LPYA 2R7VA 4KBIA 3DLGA 3ZFVA 5D0GA 3TAMA 1HHSA 4I7FB 1VFJA 4EBDA 2ASLA 1IQTA 4NOHA 4ZN1A 1VQPS 4USHA 4N8OA 3TX0A 1LWEA 4O3PA 2IIHA 4CLKA 3CCJS 3PJXA 4RNNA 2N4DA 4RUCA 5D0RA 2CQCA 4BDPA 4OHYA 4YDXA 3M6UA 2GQQA 4DV7J 2LQ5A 4OX7A 4FF3A 4C11A 1TV6A 1PAUB 4YQWA 3PYEA 3IA0A 4JYAJ 2IPOB 4M63A 4UUWA 3TI0A 4DPUA 1GMUA 2LCWA 4DL2A 2V50A 2XG8A 1IBKF 4X4VA 2FC8A 2ZDOA 4F4XA 4KV8B 1XNRF 2AX1A 5GAGI 4RJVA 3GV7B 2XNRA 2VZ9A 3MFIA 2WVEA 5J1PA 1S99A 2NUUG 2OUGA 5J2MB 3UI3A 1D0EA 1JKHB 3WBZA 4E98A 3B4MA 1NJXA 4NCGA 2V2VA 3WC0A 4X4PA 1JIHA 3DOLA 4J9KA 1O0PA 2B0GA 4J37A 2KFZA 1AA1B 1S9EB 4DN0A 4QW9A 1HQUB 1X9SA 3A8IA 1G1XA 4GKKJ 4DMZA 4X2BA 2D3O1 3GFYA 1SV5B 5KOXA 3UR0A 4E8UA 1NK9A 3N5FA 1ZA2B 4ZVRB 3MMAB 4NPOA 3HZEA 2D3OR 1NXIA 3BDEA 2L48A 2A10A 3KK3A 2ZWPA 4KY3A 3FBCA 3M8QB 4OHVA 3BQ1A 1FRMA 4FYYB 2KZMA 2PC6A 2M4MA 1CBKA 4CNYA 4LMZA 3DGPA 1LEOA 4XAKA 1DTQA 3PNIA 2QA4G 2DNOA 1SKRA 2YX7A 2CNOB 2D9PA 1TL1B 2ZH2A 3TNVA 2IMWP 4NLTA 3CO0P 2NR0A 3IFEA 1MG7A 1NZAA 4RNFA 5HN0A 2IYGA 5KFRA 2B5JA 3PM9A 1HMVA 3CVKA 3R27A 1REVB 4C3MA 4J9NA 2OPRB 2B9YA 4MK8A 5DDRC 3H42A 1VOMA 3BBCA 3Q8RB 3R97A 4IH7A 1W7WA 2I1RA 1JWWA 3J80Y 3JS9A 5HVGA 4ALZA 4B3SJ 2HWHA 2BOPA 1JLBA 3P96A 2R8KA 1N5TA 2DCUB 3GSIA 3KHGA 2X3GA 2H65B 2ZE2A 5C5JA 4YHHJ 3UFCX 3HT0A 4IDKA 2M8DB 2WOMA 1RT2B 4NA1A 2AJ1A 1HHTP 2DIUA 3Q0AA 1HWUA 2CJYB 2LQ8A 1S5ZA 2QC3A 1GMWA 2VD3A 3QGGA 2DNGA 2P6SA 4URSA 1VR6A 2BACA 3Q8VA 2OTLS 2J0WA 2AMCB 8AT1B 1UEUA 5D4OA 3D9BA 4ZMMA 3GP9A 1R43A 3MTKA 2RDIA 4TY9A 4FXVA 1NJYA 4XIUA 1TL3B 1KVIA 2KH9A 1NDPA 2XMKA 3CSKA 4NASA 1KHVA 1EKRA 5BR8F 2W4PA 3SMZA 2BJDA 1S1XA 4OL8A 3QFWA 4I69A 3CMAS 3AH6A 2BYCA 4CM0A 3NOGA 2FHMA 1TAUA 2K7KA 3W8GA 3KK1B 1NCLA 1IXKA 2DO0A 2R7QA 4LRCA 3SDEB 1HD0A 3BDPA 5M2PA 2E9RX 4JP8A 2FVQA 5L46A 4WFYA 5JVGQ 1RTJB 2HURA 5KFWA 5KFAA 4A8YA 1EZZB 1RT6B 5HROB 2B51A 1ROFA 3W8PA 1TKZB 2ZBQA 5FIIA 3ZTRA 4IG3A 3HSJA 3D2WA 3A3OB 2GVDA 4IFVA 5RUBA 1N33J 2YNGB 2CJKA 2XGPA 4NXMJ 1FFGB 1T03A 4NRTA 3MAAA 1JLCA 1RT7B 3OR1B 3AXKA 1IBMJ 3JSBA 1NPKA 2XLKA 1QAIA 4Q43A 1EJ7L 3CCTA 1U1QA 3A3NB 2FJBB 4G3IA 5BYSA 5HBMA 3BO2A 5KFGA 4K5SA 4CCHA 4MKAA 1RAAB 5KFVA 1H0HB 1S6QB 1LXNA 2GNKA 2F7VA 1S76D 1DQAA 4OJ3A 4DV5F 4F4KA 3SZ2A 2WHOA 2EFVA 2EK6A 4O44B 2AYMA 1B7FA 2QTWA 3TVKA 3R1LA 2BX6A 1CJKB 1L3TA 4OI6A 1HW8A 4B9MA 1MNEA 4AL6A 3IS9B 2XYPB 2H4YB 4X62J 4UOFA 2I5JA 3EDRB 4HHHA 2MQQA 2VG7A 2VG5A 3KJVA 3QQCD 1CC7A 3OHAA 3X1LB 5C42A 3BB5A 4GO5X 2HFOA 2DB1A 2LQ9A 1M5SA 1O51A 3EXYA 3HHLD 3KKFA 3NNAA 3ISND 4M94A 1IM6A 4WWSA 1NKEA 2XTJP 1UVKA 2CADA 2J0QD 4DPOA 3IR5B 1ZM9A 3MHYA 5D4NA 1NSKL 3R7BB 3W66A 2GV1A 2FGCA 4FKYA 2W9CB 3G6VA 5B0DA 2VFRA 4JBCA 4JI4J 2V6AA 4B9LA 3BSNA 5E2QA 1RWKB 1TUWA 2Q3PA 2V2ZA 2Y0BB 3KLVA 2DNPA 4LF4F 5E3PA 3EGNA 1IUJA 2EEYA 1MSWD 2WK4A 4A8MP 2J0SD 1FJEB 4PG4A 4YUDA 5KFIA 3JSMB 4DDFA 4BWMA 3HVTA 1K44A 3GFZA 4QOTA 4Y2IA 2FTRA 4G6VB 3CD5A 4RW6A 2D3UA 2Y1LB 3A8JA 1OYEA 1KD1T 4L75A 2KFYA 2IHR1 1FRKA 2R8HA 4DV4F 4QU7A 3DLKA 3EVOA 5F8HA 4F2SA 1MU2B 2XSJA 2RDJA 1HNXF 2BKPA 1HHQA 3MM5B 4A8WA 3ZZ0A 3ITHB 2YX1A 4A8XA 3IGNA 4M5HA 3KLEA 4WFXA 2OFHX 5A6WA 4NL5A 2BV3A 2CJXB 2P8IA 4JV5F 1X4FA 1ZM2A 2F4VF 3G8QA 1K1SA 1M0SA 4QR0A 3DRXA 4JI1J 1X8DA 2WTFA 1FX2A 2V68A 1V5VA 4DL3A 5EX3A 3DOMB 4NLRA 1ZTTA 3HFVA 3TA2A 2R7RA 4C8ZA 5LMNF 5KFPA 2ZVIA 1S9FA 5DRKA 2ZHBA 2HHQA 4ICLA 4DL0C 1FEHA 5IZHA 3DM2B 2MZ1A 2F5GA 1KONA 2RQCA 1OSCA 1NJIT 3OLAA 2WRMA 1EARA 3KFWX 4CO4A 1NAQA 3IM8A 1C1BB 3LA0A 3UD5A 3K89A 1HYSA 1FD8A 1XJWB 1NM2A 1R8PA 2NXNA 1M1HA 2HBQB 3MM7B 2FY8A 4BLGA 1WOOA 2ZH3A 2DNRA 2PO4A 5DM7Q 2XS5A 5CYQB 1U25A 1S4EA 1CVJA 3GG1A 2CVEA 3MR6A 1RAFB 1M5HA 3CJ2A 3IM9A 4DX6A 2ZZNA 1DAXA 3AXMA 5E5NA 3ZZYA 1QUPA 3I0RB 2HHSA 4UQTA 5HMZA 4JI7J 2M3DA 5IM0B 2KRBA 1PSDA 1YWXA 2QFIA 1ZYQA 4ID5A 3NGTA 3EUNA 4ZIWA 1C1CB 4DR3J 1H7XA 1UEVA 4IH6A 2J0XA 1N48A 1X4AA 1KTQA 1WHVA 3W65A 2W7OA 2OD6A 2MB0B 1SKSA 4F4ZA 2C1EB 3PKYA 4RW9B 3CW2C 3OUYA 3FCWA 4K59A 2V8VA 3PY8A 3FNNA 3CIZA 1WEYA 1AZSA 4X4OA 4R5PA 2PMWA 2UXDF 4OYZA 4USUA 3M2VB 2QA1A 4CP5A 2C3MA 1UW9A 3W3SA 4M5MA 4ES2A 2WBRA 1NH8A 2UUCJ 4GVBB 3R7NB 4DR7F 3G71S 5J2PA 2J9EA 3AD9C 4OX9J 4ZHRA 1RTHB 3I32A 3BS9A 2QIFA 3W60A 2NXCA 4K2XA 2BEFA 4QJVA 2V4QA 1ITPA 1SPBP 2F3JA 3Q23A 5DLGA 5LMUJ 4RWXA 1PGZA 4LF9J 2DXEA 2MQ8A 1QY7A 2CNLB 4PXBA 2J9DE 2XWYA 1PBAA 2CJQA 3VVTA 3L09A 4F25A 3SYZA 1JQGA 2KJVA 4LFCF 5I3PA 1S0MA 2GAHC 2CQPA 4CO2A 1L3VA 2OD4A 3E3XA 3MMJA 3DC2A 2UXBJ 4Y2CA 5H9EK 4GC6A 1RBLA 3BH6B 3NLCA 2V8PA 2R7UA 1U1RA 3BGFA 2XMJA 1MN7A 4W90B 1TR0A 1JJ4A 5GAEU 3BGUA 3AJ2A 1Y4ZB 2X1FA 4CNZA 2DNHA 1LW0A 3ZZTA 5KT3A 2G9OA 1U8SA 2VDIA 1TQLA 3CJQA 1X0PA 3DXBA 1VJQA 2BW2A 5B0BA 1DARA 3K5LA 1XNQJ 2CIMA 4DCJB 1S57A 5FLXY 5T41A 3LANA 4NXNJ 2MYFA 2DO4A 2BJ9A 5FDLB 2MZRA 2BVZA 1RABB 4NLQA 4R8UA 2IBOA 1EAYC 4HYKA 5DZ6A 2EXUA 5LSLA 3N6MA 4B9SA 3N4WA 4ETZA 5KFNA 1SI9A 4LBPA 3T41A 5CD4H 4FBTA 4ZVPB 4P7VA 3NY0A 2CDQA 2W2OP 1UCNA 4NZ0A 1KN6A 1OY9A 3KLHA 2ATCB 3CTRA 2XI3A 3BR8A 3TW0A 3FRYA 5GAGU 3BM7A 2MKYA 2NXUA 2VPWB 2HQIA 4DV6F 4XO0A 1VBZA 4DX8H 2ZBPA 2IMOA 3CCWA 4B3TJ 3H7HB 3MD1A 2Y3YA 3ZTPA 2HVZA 1RAIB 3TA0A 1IJEB 3DOKB 1FTCA 5BJRA 3OTBA 1RCXB 5HP1A 1RTDA 5DGBA 3G82B 4L3NA 3C19A 2AKWB 2YKOA 2B7CB 4J91A 3MDFA 4N47A 1KQFB 2O3DA 3R5GA 3NL0A 5DG8A 2HS4A 5T7LA 3ISNC 4YMEA 1W2BR 2MKKA 2MLXA 3TEHB 2OPPB 2E1RA 2E5GA 4DR2F 1M5VC 2ZVSA 5E0OA 5A2QY 3GV8B 1JLQA 1TKTA 4DSIA 2F4FA 2C2DA 4M5GA 3OXGA 4P52A 1WKLA 3C15B 2NYHA 1T3NA 2XYGB 4P2MA 2RRNA 2VJUA 4LF8F 2BJ8A 3KLIB 3A13A 1IKVA 2DGWA 1LK7A 2HAIA 5CCMA 2JC1A 4NCAA 4OYOA 3LAKA 1SJQA 1APSA 2DR9A 2LEBA 2W7AA 5L1IA 2QLJB 2J9DA 4IOAQ 1O5JA 4CDIA 2Q66A 4CH0S 4LF6F 3HVAA 3G6XA 1YJ7A 1N6QB 2IM1A 3UE2A 3B82A 5A8KB 1CJVB 3J7A1 2DVIA 3HT3A 4EFAC 3GWCA 2HHXA 3W2VA 1FNOA 3MFHA 2A2CA 3CJ8A 3EGWB 3KG4A 4M95A 3R5BA 2KZZA 2UU9F 3Q8PB 1VRQC 1VQ9S 2YWKA 2VUGA 2B8QA 4CLSA 2R7WA 3C2PA 3FC9A 3PRVA 1M5OC 1RB0A 3V5RA 3ENVA 1RHQB 4QYZK 2ZNZA 2HNDA 1X4GA 3M8PB 3F44A 3UR3C 4JV2A 1IN0A 1WHYA 3J7ZT 1YDLA 4DL6A 2B9XA 4ANDA 3BO3A 7FD1A 3UCZP 3PHEA 1AXQA 2C3UA 3VZIA 4WF9Q 1P27B 2X1BA 2YPYA 1NPPA 1P9YA 2GVZA 3US5A 1S0NA 1UAWA 3CC2S 1R8BA 3IGVA 3M8ZA 4UOGA 3RBEA 1N36F 3TYTA 1GNKA 1RXOB 2HFZA 2DT9A 1BC6A 4YP3A 2ZH4A 3NCRA 1HBNB 4TQSA 3DMJA 2MGZA 3HSDA 1OPIA 5KFDA 1DRZA 1ZAWA 3QATA 3VCDA 2YQ0A 3Q22A 5J2NB 3ZC4A 3UO0A 2XO7A 4WZMA 3I5BA 2P9EA 1X60A 2NS1B 1UW4A 3M6VA 1MN9A 3Q83A 4OQJA 1VQOS 4RBTA 4ZPBA 3BGRA 2G0JA 3CCUS 1IWAA 3O2IA 3S7RA 3QLHA 2XS7A 2YKMA 1S1WA 1IR1A 1VBKA 1CSJA 2PI4A 2RU3A 4UF4A 1HQ2A 5LSOA 3TQ1A 3C14B 2LQBA 1RLCL 2QL9B 3QGIA 3G87A 5IOLA 1PJ7A 3MMBA 4P74A 4DQRA 2OPQB 3CB4A 4AXIA 1WC0A 1NB7A 1X9WA 3C16B 2AX0A 3MEGA 4O23A 2BQRA 3T9NA 4NLDA 3T19A 3VGVA 1HA1A 2U2FA 4ECZA 2W7PA 4N8NA 4RLEA 4NZ6A 2UUWA 3CD6S 3HO1A 4G1QB 2ILYA 2ZBIA 1DJ0A 2CPEA 3OSNA 1HBUB 1WDTA 2YNIA 1Q5VA 4ZCLA 3DXSX 1KOHA 1B3TA 1DTTA 4CLPA 1UWBA 4OHZA 4AL5A 2ZHOA 5KG5A 2JSXA 4J90A 2GJFA 1HLWA 3MPVA 3UDLA 2BQUA 2UVVA 5K14B 4I68A 5LXYA 2EKNA 5H9EJ 5AE1A 4RW8B 3OVAA 3SQGB 5F0WA 1RP5A 1CG2A 2V34A 3CULA 2YVSA 3M2UB 3N01A 2XLJA 2B43A 3GIKA 4IUFA 1FF2A 2HHVA 4DBQA 1Y11A 4B3MF 1I6JA 2QRRA 2Z4PA 3W2WB 2Y8YA 5HLFB 2HVEA 2W24A 4C8MA 1A7GE 1KS2A 1VJWA 4DFJA 5CD4A 4OHXA 4KKOA 4DV3F 3NMAA 2YNHB 5IT0A 1FERA 2CWXA 4CYUA 3K59A 1FHTA 4X84A 1UP1A 4YDDB 1RT4A 2IM0A 3MCMA 4WIQA 1LW2B 2GAGC 2GC8A 3PHTA 1L3SA 8ATCB 4HHUA 1ZA1B 1N52B 3VAGA 1GXLA 2N7YA 1RYRA 2ASDA 1WF2A 3E8OA 2FY1A 3CPWR 2C2EA 2E5LJ 2XS2A 2J6SA 4LR7A 2VICA 3Q8QB 1JLEA 1PJ5A 4HDGA 5KFLA 3IMQJ 2UV8G 1EP4B 3ZZOA 1NU4A 1UZDA 4P6QA 3MCNA 4J9PA 2AP6A 3CD7A 4I2PA 2LQJA 3T1YJ 4K4SA 4CQ1A 1P9QC 2YX4A 4ID8A 4X65F 1IKYA 4NYOA 3FSYA 4OI3A 1SCJB 2VFTA 2UV8A 2HHTA 2ZUGA 2QMUB 4B9TA 1PBUA 4Y00A 4B3RF 2HHUA 5C2CA 1S0OA 2P9CA 3R1HA 2UUAF 4YN3B 3RUBL 2DTJA 4KGZB 3IAM9 2Z2LA 3QT5A 3W9JA 4P7TA 4QWDA 5GMEA 1FJGJ 2HMIA 4LFAF 5EHHA 4WK3A 1RA7A 4DR5J 3DLJA 3P5TL 4OV6A 3D67A 2CA9A 2CRLA 4I2QB 5EWEA 1HQEB 4B08A 4QW8A 2BA9A 5DDOC 3KDNA 1P1LA 4DV1J 4CLFA 2K3KA 2N4CA 4A4JA 1VQNS 3BJYA 1SIZA 4J9SA 1D9AA 4WE1A 3PVXA 4OJGA 1FKOB 2N3LA 2XMAA 3QPIA 2HGLA 2DYAA 1FVSA 2HSEB 5F41A 4MFBB 2RKIA 2W9BB 1NZ8A 4W98A 3LP1A 3K8VA 4TQRA 3H25A 3PO4A 3N0VA 2JFDA 1NHVA 4ES3A 1Y5IB 2KVIA 4DSFA 1BD6A 4LF7F 3MM8B 3RAQA 1FDNA 3J7AN 2GJ2A 5KT4A 2VJVA 1I5OB 3GYGA 4K8RA 3UVJA 2I0XA 1N5YA 3KTQA 2LXIA 1Q82T 2K3IA 3QO9B 4YOEA 1HNIA 1U45A 4LJMA 1HKAA 2UUTA 2VKRA 3NXZA 4JI6F 3POTA 3B4DA 3CNQP 3I9ZA 5DJBA 1CS4B 3DYAA 2Y1JA 3L7OA 1K73T 4FS1A 3D1OA 5AJ3F 2KDOA 2E44A 2AHOB 1WTFA 1JLGA 2XHWA 4K0KJ 1VQ8S 5DZ7A 3BSCA 1YITS 4QYZJ 3NGUA 3VAJA 1H3DA 3CUNA 2ADBA 3DRSA 3H2LA 4I0WA 3D6HB 3HHNB 3MAQA 1Z2ZA 4UOCA 5FD1A 5K5MA 1DZ5A 1HBMA 4KSEB 2WVCA 2BM1A 4FN5A 2R8IA 3V81A 2YKNA 4MAKA 5LM7E 1GXUA 3J7YI 1HD1A 3TAQA 1QTNB 1RACB 4DV7F 2XZDB 1NNDA 5KFUA 2XY6A 1Q8KA 1KVKA 4JYAF 1RWOB 4EYIB 2DHHA 1TELA 4C2MA 2LEAA 2VG6B 1QSSA 3ULHA 4HLBA 1S77D 2X1AA 4V19X 3SQOP 2PD1A 1VQ5S 3RR8A 3CC4S 1KQSR 5IC6B 1ZTWA 2AGPA 2QSFA 1FNMA 4P72A 2KU7A 4JI5J 1RAEB 4I7FA 1Y5NB 2CNKB 1SJRA 2ZWOA 1S7HA 2L9WA 3TARA 4KGMA 5A0YB 5EN1A 1FX4A 1TKXB 1TKDA 2UUBJ 1EETB 4G1IA 1FD2A 4ZITA 1RQ0A 3DHWC 3RB6A 2C28A 4GKKF 2FHKA 2QA2A 2DIVA 1F9FA 2D1CA 2YH0A 2BR0A 2MSTA 1TL5A 3AQPA 4DEZA 1C0UB 4A8FA 3QZ8A 4YY3F 1WG5A 1S9GB 3D6TB 4CRJA 3KHRA 2ALZA 1J2VA 4TLRA 1PIEA 2DR6A 4LR9A 4KV8A 2FVSA 2BE2A 1BXNA 5KG6A 3E51A 2PMZD 1I1GA 1R7IA 3Q89A 3QNWB 1F0XA 1BQXA 2RS2A 1JKHA 5ETLA 3VQSA 4DR4J 2BJ1A 2E5JA 1U6ZA 3BGLA 1TMJA 3ZNJ1 2DEIA 1RT3B 3KHLA 5LT5A 2HNZB 4NLUA 1S9EA 2WSCC 1JLAA 3MOJB 3ILLA 1SV5A 1LFPA 1HWIA 2LU1A 4K4ZA 3MMAA 2DGQA 1QTMA 2WW8A 2N3OA 2YWEA 2J7UA 3M6XA 2JH3A 4B3SF 1QLNA 2M8HA 4C3KA 3F0NA 3M8QA 1QE1B 2ZUAA 4PR6A 2KM8C 4YR0A 4YHHF 3ZZPA 3QT7A 2FB0A 3VZHA 3NOCA 1FEEA 1CLFA 3EICA 2GQCA 1RT5B 3UD3P 2UVUA 3W9HA 1TL1A 3FEXB 4OHWA 4PUOA 1LWFB 3ZTOA 3ICLA 4USIA 2WB1D 2OEJA 3J81j 5M2RA 5L8RC 2YTCA 1B70B 3IG1B 1JXVA 1FKPA 3LP2B 2DD8S 2HIQA 2OPRA 2QL5B 1GEHA 4UUXA 3LWMA 3IO1A 2D69A 4Q7AA 1RK8A 3MR3A 1JMTA 4CM2A 4X4TA 1WUUA 5KFFA 2L9DA 5CXTA 1MMNA 4QWEA 3CJTA 2OELA 2POKA 2KG0A 2AIRB 1WEZA 1IQZA 2RSQA 1N32J 4ZDNA 1CC8A 1RT2A 4Y3CA 4DSLA 3K8WA 5E3RA 1NPRA 1VRTB 3TVZA 3DLHA 1FRJA 1D09B 1DTQB 5L38A 1RLDA 4F3MA 4ILMA 3I55S 4AE5A 4GRSA 4LRBA 1B0PA 4DQPA 1OYDA 2LA6A 3HF5A 1J5OB 3LQVA 3TWZA 4AD6A 1TL3A 1M1GA 3R5DA 2SXLA 1S4FA 1TUVA 1SKWA 4PABA 4M5DB 1A0OB 1M5PC 4X4NA 1SUQB 3IAS9 5IV3A 1TVRA 2M52A 3KUHA 4F3QA 1F2HA 3PEJA 4TYBA 3WHIA 2K1RB 4Y2KA 3KK1A 2CJBA 3K58A 2QO3A 4DUYF 3SDEA 5I42B 3FQKA 4OIXA 4E2FB 1T02A 2IRYA 5ETNA 1IR0A 4B17A 2EKYA 4C7QA 4M5JA 2JEGA 1FJ7A 4J9LA 1F5AA 1VK8A 5HROA 1YHQS 4BC9A 3OPKA 1SVDA 2QYGA 1TKZA 3UCGA 3PFEA 3M6WA 4ZPDA 4X62F 1JJ2R 3T1AA 1FE0A 1RHMB 2YNGA 4XPEA 3H40A 2AYBA 2IVMA 1VIOA 3MEKA 3MUTP 1RT7A 1GTEA 1GMWD 4HDHA 4UT4A 4DOZA 4F0KA 2X51A 3N6NA 4JI3F 2HFVA 1PG5B 5JVHQ 3GMGA 4Q2MA 3QJLA 1U6FA 4IYQA 2MHNA 1PKUA 3MPYA 2PGCA 1EIYB 1S6QA 1OS5A 5GADU 1DQ9A 1RKJA 1Q7LB 4N5SA 2E1MC 3GYNA 4I1TA 2E5HA 4B3OA 1RU2A 3K5MA 2KXNB 4IFYB 2YWGA 1H72C 4JI4F 3MECA 1KKHA 4JI2J 5F8JA 4O44A 4KTQA 3ONQA 1XMQJ 2ZBCA 3A4TA 4DL5A 1LXJA 3EVMA 1CJKA 1VDHA 3NBPA 4N56A 1VBYA 3BF4A 4KFBB 2XCAA 3IS9A 2XMTA 2KYXA 5AXMA 3I0SB 1U1OA 4XDCA 1KR4A 1URRA 1SJ3P 2CZ9A 4ED0A 4NLVA 4ECSA 1YJVA 1N5QA 4IG3B 2Q1LA 2GVDB 3M4XA 4KH0B 2VPZB 2LYVA 2IVYA 1T03B 1FDBA 1QAJA 3MEEB 5F8NA 3LW5C 2BZ2A 1E6VB 3N5BA 2HW3A 2W9CA 1XTZA 4B9VA 2V94A 5F3ZA 3MM9B 4OJ1A 3CCSS 2FVRA 5IV4A 2ZJPQ 4WFBQ 1TFWA 1RWNB 3G4SS 1VQ6S 5K9FA 3M2RB 2MKJA 3GCXP 3HD1A 4E0DA 2A18A 3L7PA 3PW0A 1NK6A 5C2GA 2OFGX 3I9V9 1WF1A 2F65A 3SBMA 4X4RA 3N79A 2NQPA 3T3FA 3E2EA 1HARA 2QT7A 4F02A 2AYGA 4P73A 2BABA 4RU9A 1WORA 2OPSB 1U0HA 3HHDA 2LVWA 3BZQA 3RRHA 3M30B 4PYAA 1HNVB 3OJSA 3H0PA 3TA1A 1MU2A 1VGYA 2W2MP 2AEJA 3TEGA 3MM5A 3ITHA 3HVRA 3D0HE 3TP2A 4UZBA 4DV5J 1D8YA 3DRRB 3SSSA 4QZVB 5AXLA 4ECRA 2VASA 3CGIA 4P9SA 3BN4A 1RAOA 1AUDA 4EBEA 3NCPA 4B02A 2HK2A 4HT7A 5HATA 2V67A 3FQLA 3DOMA 4ZP9A 1NEEA 4C8KA 2B56A 3H5SA 2K2PA 4TY8B 1P6TA 3HSGA 2F8HA 1FWLA 3DM2A 2KXHA 3MR2A 4DR3F 2HRUA 4ZPCA 4LBIA 2R9LA 1CJTA 1C1BA 3N6LA 3IN5A 2EBEA 3V6HA 5HMWA 3ZTQA 2HHPA 2QG9B 4EO6A 3TOQA 4CTAA 3C3LA 2NXJA 2OP5A 2LDIA 1YJTA 3MM7A 1S6OA 4HI2A 1Q8BA 5E3QA 2ILZA 3FRZA 1SH3A 5GMKa 5CYQA 1EQMA 2QZ8A 2WVBA 1R0BG 4M8LA 3BH7B 2Z30B 4K50A 5ITHA 3V4IA 3QIDA 2ZH6A 4Y0FA 1LWCB 2OI2A 1I94F 1PJ6A 3ET6B 2HQCA 1OQ6A 2BKOA 5IM0A 1TZ0A 4G65A 1WI8A 2PA8D 1C1CA 2VB6A 3K5PA 5LMUF 2QMXA 4ENOA 4OYBA 3W64A 4ICLB 5IT9U 4LF9F 4WK1A 2GMHA 2XM3A 2OIHA 2H48B 2K06A 2VKZG 4GMKA 2IBKA 1U1PA 2KHDA 2VC0A 5F0UA 1NKBA 2RIJA 3KLGB 1HNXJ 4CO0A 2UXBF 4WTOB 4ZVFA 2IA0A 2KI2A 3QT8A 3M2VA 2ZOGA 4EUVA 1WDDA 2F4VJ 4OLOA 2CZVC 4WXOA 3T6BA 2I38A 4GVBA 5L1LA 3TJ9A 3P49B 1MROB 1M5KC 4OYWA 4U7UD 1RTHA 3C8YA 1EQ0A 3FGVA 2W4CA 4MK9A 2C3OA 5LMNJ 3IR7B 3RRGA 2V8DA 3OBIA 4PRFA 2E1AA 2MDAA 2I8EA 4NXNF 2MXYA 2LXUA 3SV3A 4TVAB 2A6OA 1UZHA 4ER8A 4CWBA 1TUGB 2Y0SD 2KXFA 2NZ4A 1Q0NA 5ETKA 2VBYA 3J7YU 4NLOA 3L3CA 1E6YB 1AZSB 1SC1B 2EG2A 4X64J 1KC8T 4FBUA 1VQLS 3KNAA 1FVQA 4PAAA 1S48A 4ZVUB 1FFSB 1D9DA 1RU1A 3AJ1A 1ZZNA 3AODA 2PEBA 3TO8A 4JI0J 1NO8A 3JSYA 4WPAA 1QJHA 2CPDA 4F4AA 4ZA1A 2L9NA 2XMVA 4EYHB 3L9ZA 2VOOA 2NSCA 4C8NA 2FJAB 5CZXA 2ASJA 5KFJA 4B3TF 3K17A 3HMJG 2HBZB 1FCAA 2BRLA 5CQGA 3RBDA 1V3RA 1JNZB 1TP7A 4Z37A 4FVCA 4LQ3A 3WIUA 1U02A 4KC5A 3MMCB 3HD2A 5IWAJ 5B08A 5CYJA 4DFMA 1RBAA 5GMDA 2AJ4A 2NREA 3W63A 5B0FA 3R5CA 4IR1A 3HHKA 4J9RA 4KR0B 1F9EB 1EHWA 2A6MA 3F73A 3JQMA 2UXCF 4JOUA 4X66F 4PG6A 1QD1A 3IC1A 3PJ9A 2QA4S 4ITSA 1U49A 3QJJA 3ELHA 3LAMA 3THPA 3W5XA 4FYXB 4PXCA 4ZLPA 4USMA 1OO0B 3JTNA 5KG1A 3NGRA 3ZO7A 1VRUB 3OR2B 3R9LA 2NXEA 3Q2SC 4DQQA 2XYHB 2HBRB 2LXFA 3CMES 2BW7A 4ZVHA 3AB4B 4BBYA 3M32B 3NNHA 4O0IA 4Q45A 1F3FA 4DF8A 3DOKA 2FVCA 4MKYA 3FBFA 3F56A 3PW4A 1Y5LB 4IH5A 3SEOA 4LFCJ 2KN4A 5KT2A 3HP6A 1R0CB 4F36A 4CO1A 3CJ3A 2CNNB 3M9NB 3IWLA 3G82A 2VPXB 4WIIA 4DN9A 4ZVQB 1PYOB 2CPZA 1UFLA 3LPEA 1QUVA 3AA8A 3I31A 2FD2A 4OYPA 3ISZA 5E33A 4ZKAA 1SJ4P 4B9UA 2JEIA 1S72S 2OPPA 1S79A 5L39A 1N56A 5F8LA 4P2XA 4IQXA 4IOCQ 3V6DB 5CAAA 4Q0BB 3CJKB 2GCFA 1H38A 1RWXB 4DR1F 1K47A 1RT1A 4EZ9A 3R6GB 4RW4B 3TZYA 4RBUA 1PILA 5AE2A 1Z4UA 1NDKA 2GA7A 1KTVA 3KLIA 2BE9B 1FWKA 1RAJA 4C0OC 2AGQA 2QEXS 2XSFA 1MWZA 1OQ3A 2FLNA 1NK4A 3Q86A 4BC7A 3WX8A 2ZH9A 1KBRA 1UEKA 2M0GB 2OHDA 1XN9A 1N6QA 2QMWA 1RTDB 2XMWA 5A8KA 1CJVA 2OEMA 4IG0B 4OLPA 3JAMU 1RTIB 2HHHJ 1YZ6A 4RL1A 3LTOA 5HMYA 3MEDB 3TZXA 3FBEA 2ZM6F 3FBBA 2R3VA 3LWLA 4QIFA 3EGZA 1KFSA 1SKUB 4PPDA 3WDOA 3RZAA 1H6KX 3CJRA 4UW2A 3U1MA 2CDRB 4J9UE 2H3EB 2YPZA 2VIHA 4EBCA 5KFYA 4K7QA 2IA6A 5ETTA 2R7OA 2Q79A 2HHWA 4DV6J 5IT9Y 2ROGA 3LGHA 2LKZA 2AW0A 2C3PA 4FYWB 1SJFA 1N4LA 4FXDA 3ZZRA 2VFUA 5KFKA 3FFIB 1Y3KA 3G9CA 2BOAA 4WFZA 1X5SA 3MF5A 1YSJA 2MQOA 2GZOA 5HQLA 5CCLA 2XZTB 4BHQA 2ZC4A 1W25A 2FGOA 1UFKA 1IVZA 4MH8A 1FKAF 4HACA 2CQ3A 5G0RA 1HBNA 4Y6IA 5EWFA 3G8TA 1YBUA 5J2NA 4I64A 2G13A 5H1SV 3D1HA 2EK1A 5HQ8A 1F2GA 2VU5A 2MZJA 5LJ3Y 1ZZFA 1RAGB 1UPMB 2Y1IA 2DGXA 3H2VE 4EK2A 1ACMB 2Z0GA 2BMBA 3CD0A 1S6PA 1NBEB 2IYIA 4FYDA 2MY8A 2CPFA 4U9RA 2VONA 2AT1B 2ZD1B 1X4DA 1UKUA 3MGJA 4ECUA 2YBVA 2D7SA 5IT4A 1O8BA 2P6TA 4ILLA 3LH2S 4ECQA 3A3PB 5E7OB 1X4EA 1T94A 3PTWA 4L72B 3VAFA 1SH0A 3C14A 3H20A 3HHLB 3NGKA 3M8YA 5L1JA 2Z2YB 1T9WA 4X4QA 4H4OB 4F4WA 3M1VB 2YKQA 2OPQA 5D6GA 3KXDA 2HRYA 3C16A 3TVYA 3PYDA 3T5LA 3VAHA 1HNWF 4Q44A 5B0CA 2KO1A 1BHNA 4WZQA 4LSNB 2FLLA 2ZJRQ 5HAOA 5M2UA 1XMBA 4G1QA 5EDWA 1NUEA 2XMUA 5HQMA 3DLEB 3BGRB 4YB7A 4ERDA 2EFQA 1HBUA 2YH1A 2Q6CA 2O01C 2DGSA 4L73A 1YJUA 1NJWA 3MR7A 4A8QA 2FJVA 1YK9A 4IRKA 3NNCA 4F3OA 3H98A 3QIPB 4HTJA 5THWA 4URGA 2J6TA 3MPWA 1N36J 3K0JA 5K14A 1T05B 2G2YA 2HK3A 2R2UA 4RW8A 5KG0A 3SQGA 4LREA 3RAMA 1TK0A 3D6MB 1T9XA 4MIAA 4NMXA 5KFBA 3M2UA 2FJEB 1UETA 3RW7A 2W4DA 2NLWA 1XQIA 1F1BB 3RB3A 3VAIA 2MKCA 4RPFA 1Q8IA 3MEGB 1H2TZ 4KPCA 4LF5J 3W2WA 5HLFA 3D7SB 2AYEA 3T1YF 4FYVB 3A8EA 2ZKTA 4L76A 4BCAA 4LRFA 3IBCB 1TL7B 4PG7A 2X7IA 2HPUA 3KYLA 3ENQA 3CEDA 4NI2B 4XPCA 2YNHA 1VMBA 3W5ZA 3ILOA 1SH2A 1U09A 4CLWA 3T5JA 3EJMA 3KLFB 1G4CA 1FK9B 2B6AB 4PWWA 3Q8UA 2CUYA 1LW2A 2VQFJ 1RSCA 5DS7A 4DS5A 1ZM3A 1BQMB 1GXTA 3S6EA 1FJGF 1YGYA 3IWXA 4LIWA 3PFOA 4KO0A 1H2VZ 1Y00A 4YFUA 3MUVP 4U7CA 3UDVA 4ED6A 3L7UA 4EZ6A 3NWRA 5A6PA 2DJWA 3D0GE 4KPYA 3PRBA 1EP4A 1Q16B 2YY3A 4O4RA 1SQGA 1H7WA 3OLBA 2C3YA 3BYRA 3I87A 4C3LA 1IJFB 4H54A 5D3GA 1WC4A 3TZZA 4DX7A 4IQMA 2OLWA 1YIJS 4QIWD 1FE4A 3ENWA 2HVDA 1SL1A 1FXDA 4ECYA 3DI6B 2MQPA 3PX4A 3DLBA 3I5CA 2RE1A 1UFWA 1C4CA 3LP0B 3G2XA 3SSRA 4W92B 2DGOA 2NCKL 1ULRA 3LGMA 5D15A 3P8BB 1T9YA 2DNZA 5EX0A 1U26A 2ZNYA 4AL7A 5J2QB 3PW7A 5CYMB 4ECTA 4OYXA 3FJ2A 1NK7A 4I2QA 3CDWA 2LMIA 2VBXA 2HFUA 4HI1A 5I3UB 2DRAA 3CJ5A 3D3CJ 3ENAA 3FSXA 4C97A 2F9DA 4FS2A 1F60B 4CLZA 1YQHA 3WC2A 1FI4A 2FLOA 2DY1A 3JXOA 1FKOA 3BSAA 4ED3A 2BQ3A 3NAHA 4OYIA 2V8HA 4FXWA 3K7RA 4ZJLA 3OW2R 3WZ0A 2CQIA 1Q86T 4KAIA 4MFBA 2W9BA 5K8PA 2J7KA 3MM6B 2XC9A 1P8GA 2COLA 2V2QA 1ZAXA 4DV3J 2YNFB 4FF2A 4F0MA 2KT5A 3PV8A 4HKQA 4U6PA 4CT8A 1JXLA 1B7YB 1AFIA 3OXLA 1CJUB 2GIRA 1T7PA 4PCQA 3RG6A 2QLFB 4OZNA 3Q2TC 3MWBA 4U8VA 4NLGA 3QO9A 3PDNA 2GQ2A 3R7SB 3MURP 4IO9Q 4DQIA 3MD3A 1RBOB 4N77A 2WB4A 2BBEA 3HPOA 3JQJA 3QRRA 1CS4A 2XLIA 3J80U 5HANA 1YTYA 1U24A 4U8YA 4CLUA 3DRYA 3KNGA 3H8YA 4URQU 4J9VA 4LSLB 3JB9k 4X65J 3CJ0A 2CQGA 2QLXA 3GIIA 4ZN3A 2CPIA 4ZIVA 1OWXA 3QGHA 3PR4A 3HCXA 2Z2ZA 1J27A 1GAOA 3IRXB 4QYRA 1GTHA 1KLMB 2LU2A 3LUYA 1DURA 4JI5F 2M7SA 4X4UA 2O66A 2PDAA 2ZH8A 1NB2A 1D9FA 1NH7A 3P45B 3X3UA 2UVWA 4ZLJA 4LFAJ 2V4RA 5D4LA 2IY5B 4CO5A 1ZPWX 3PEHA 4Z7YA 3RYLA 1S1VB 5ETPA 1N5YB 3C66A 3OTEA 3JQKA 1K9MT 2AJ2A 4YB1P 1S59A 4ED5A 3J81U 3PW5A 4F4YA 2GMLA 2NUHA 2IDLA 1NRKA 5KFXA 4K5RA 3EGVA 3C6TB 3D54A 4OI0A 2LP4A 2J8AA 1TK8A 4P75A 4DHVA 4A8SA 1PYSB 2GS8A 4IR9A 1H73A 3S01A 2VBWA 2B4OA 1YI2S 3G86A 3EWGA 3GG0A 4DU7A 1R0AB 4LF7J 1MWQA 4HVZA 5D78A 3BQ0A 4U95A 5A0YA 4MMOA 3CCMS 1TKXA 4A8OA 4KB7A 1EETA 3PACA 2G0IA 5J1EB 2ZJQQ 2OSRA 2VA2A 1KNZA 3W62A 1FWPA 1DLOB 5C25B 3OFGA 1HBMB 4F67A 4USVA 3V81B 1WHXA 3I96A 1HWLA 1C0UA 1BWEA 4DV2J 2CQ4A 4FDFA 3CIMA 1S9GA 4M5LA 1U1LA 2BDPA 4ZP8A 4TLQA 5KFZA 1J5EJ 1NDLA 5KFMA
chains in the Genus database with same CATH topology
2FGCA 3OV7A 2W9CB 3HF5A 4ED1A 1J5OB 3LQVA 2CPJA 3G6VA 3CJ4A 1TL3A 3R5DA 2SXLA 1JJHA 1S4FA 5B0DA 1TUVA 2VFRA 1SKWA 2B4PA 1SXLA 4JBCA 3UWTA 3U1LA 4B9LA 4LIRA 4M5DB 3BSNA 2HS0A 4ID5B 2KKHA 4P2SA 5E2QA 1XNQF 1M5PC 2RRBA 5DG9A 4X4NA 3HHLC 3SFGA 1SUQB 3IAS9 2AD9A 1TVRA 2Q3PA 1MW7A 2M52A 1RWUA 4F3QA 3O6QA 3M05A 5B09A 5GAHI 3KLVA 3TAPA 2DNPA 5B0AA 4LF4F 5E3PA 3PEJA 3EGNA 4NZ7A 1IUJA 4TYBA 3TUIC 1MSWD 2IM2A 2K1RB 1WEXA 1RT3A 4OMFG 4Y2KA 2WK4A 2UZAA 4A8MP 1FDDA 1KQGB 3LALA 4NLWA 3KK1A 2CJBA 4FNIA 1FJEB 2J0SD 4LSLA 2HNZA 3K58A 2QO3A 3FEYB 2HG4A 4DUYF 4LVOP 4PG4A 3SDEA 5I42B 3TANA 4YUDA 4Y34A 3FQKA 5KFIA 3JSMB 4DDFA 4OIXA 4BWMA 1QSLA 3HVTA 3OUYB 3RB4A 3GFZA 1K0TA 2WONB 5D77A 1T02A 4ELUA 4QOTA 2APOA 2IRYA 4JUZA 4Y2IA 2FTRA 1IR0A 4G6VB 2WAQD 2L41A 3OL9A 3GSDA 4B17A 3CD5A 2EKYA 3IRXA 3P6YC 1KLMA 1K8AT 3D1QA 4RW6A 2D3UA 4C7QA 1KVJA 3E01B 2JEGA 1FJ7A 4R5PB 1VLYA 4J9LA 4TU8A 1KD1T 5AE3A 2DHGA 5F9LA 1F5AA 1VK8A 5HROA 1N54B 1QVGR 1HNZF 2KFYA 4FF1A 1YHQS 3IRWP 2IHR1 4BC9A 3OPKA 1FRKA 2WBMA 3HVWA 1TKZA 1TAQA 2R8HA 4DV4F 3UCGA 4QU7A 2AJQA 3DLKA 2FHJD 2DGTA 3PFEA 5KFOA 4PPZA 5F8HA 1QE1A 2RU9A 4F2SA 1MU2B 2XSJA 3M6WA 4FVMA 2RDJA 5J2PB 1HNXF 4ZPDA 4I6WA 4NRUA 4X62F 1JJ2R 4ZHRB 1ZPVA 1S1VA 3T1AA 2JEJA 1FE0A 2YNGA 4XPEA 3H40A 2AJ0A 2UP1A 4A8WA 3MM5B 2RS8A 2W9AA 1N32F 3ZZ0A 3ITHB 5BYQA 1Q4RA 2EC0A 2EI5A 2YX1A 2AYBA 1R8AA 2KFNA 4DFPA 3RW6A 2IVMA 4A8XA 1VIOA 3IGNA 3MEKA 4RU2A 4MIBA 3KLEA 1GT8A 3MUTP 4WFXA 1RT7A 2OFHX 2MQNA 4KT0C 1T95A 2BE2B 1GTEA 5A6WA 4NL5A 1RT5A 2BV3A 1S6UA 4JV5F 1X4FA 2RT3A 4HDHA 2OMOA 1ZM2A 5CZVA 3MTJA 4AYBD 4DOZA 2F4VF 1LWFA 3G8QA 1K1SA 2HHTA 2X51A 3N6NA 4JI3F 3VAMA 4OI1A 1M0SA 4QR0A 4DV2F 5IFMA 1N8RT 2A1BA 5JVHQ 3GMGA 3C6TA 4Q2MA 4CH1A 4YB5A 3QJLA 1U6FA 3DRXA 4IYQA 5FDLA 1X8DA 5KAKA 2WTFA 2MHNA 3H2UB 3MPYA 1U1KA 2PGCA 3NWGA 1U2RA 4DL3A 1S6QA 1V9OA 1OS5A 1ZAVA 5EX3A 5GADU 3IG1A 3CCZA 1DQ9A 4NLRA 1ZTTA 1J5EF 3MI7X 1RKJA 3OL8A 1Q7LB 4N5SA 3GE9A 2E1MC 3GYNA 4I1TA 3TA2A 2R7RA 2E5HA 3LP2A 4B3OA 3K5MA 2EWHA 4C8ZA 5LMNF 5KFPA 2KXNB 4IFYB 1JLAB 4YB6A 1G6BA 2V0NA 5DRKA 2YWGA 2AQ4A 2ZHBA 1S9FA 4JI4F 3MECA 2HHQA 4ICLA 1U4BA 4IRDA 4DL0C 3SV4A 1NHUA 1FEHA 2OJ3A 5F8JA 4O44A 1CEZA 5IZHA 2JL9A 3DM2B 1GH8A 2MZQA 2MZ1A 4KTQA 3ONQA 3NMRA 2ZBCA 4YR3A 1KONA 2RQCA 1LXJA 4DL5A 2R7XA 1OSCA 1R0AA 1NJIT 3OLAA 2WRMA 5KFCA 3KFWX 1N0UA 4CO4A 3RR7A 1NAQA 2YWHA 1C1BB 3NBPA 3DU6A 4N56A 1VBYA 3BF4A 4KFBB 1QAYA 4DG1B 2XCAA 1HYSA 1RGVA 1HL6A 3IS9A 2ZOMA 2XMTA 2HLUA 2KYXA 2FVPA 3C6UB 1WNEA 2IC3B 1FD8A 5AXMA 3I0SB 1U1OA 4XDCA 1KR4A 5J1EA 2FJXA 2R7SA 1HI8A 1R8PA 1URRA 2HS3A 1SJ3P 5K8NA 2JVRA 4ED0A 4O3QA 4NLVA 4ECSA 4DR6F 1YJVA 4FP9A 1N5QA 1LW0B 3T1HF 3MM7B 2Z2MA 4IG3B 3VWSA 3AHPA 4ZCMA 1DLOA 2Q1LA 1VI7A 5C25A 2DHSA 4NX9A 2GW8A 3M4XA 1X0FA 2ZH3A 2DNRA 1VRTA 2PO4A 1X4CA 3T5HA 2VPZB 2LYVA 5DM7Q 2XS5A 5CYQB 1MWYA 1CQMA 3HXMA 1U25A 2IVYA 2JRSA 5A8WB 2ZH5A 2VFSA 1T03B 1CVJA 3GB0A 2XEXA 4ZVEA 3NAIA 3GG1A 1FDBA 2CVEA 3O3LA 1QAJA 3MEEB 3MR6A 5F8NA 1M5HA 3CJ2A 3LW5C 3NS5A 1YRXA 5LXRA 1Q79A 2OMLA 3FDSA 2ZZNA 3CCQS 1DAXA 4PUOB 2BZ2A 5E5NA 3ZZYA 1QUPA 2XGQA 3NRBA 3I0RB 3JTPA 5F8GA 2HVIA 3K5NA 1E6VB 2HHSA 2RB7A 3N5BA 2HW3A 4UQTA 2ZKUA 2IM3A 2CVIA 5HMZA 1Q1KA 2W9CA 1XTZA 1J5OA 4B9VA 3OSPA 3QAUA 2M3DA 2KRBA 2KHCA 4R8UB 2V94A 1PSDA 5IM0B 5F3ZA 2NYIA 3B78A 3OVBA 1YWXA 3MM9B 1KQKA 4C8LA 4OJ1A 1N5VA 4F8RA 2W8KA 2OTJS 1Y7PA 3CCSS 4M5DA 1ZYQA 4ID5A 1VIXA 2J76E 2FVRA 1SQEA 2AWZA 3EUNA 2ZJPQ 1C1CB 1FKPB 3OHBA 1H7XA 1HR0F 2Z8QA 1SUQA 1UEVA 2DRBA 3PKMA 4IH6A 2J0XA 1N48A 1X4AA 3OFHA 1JLFB 1KTQA 2CPXA 3GIJA 3VALA 4WFBQ 3FMWA 1Q53A 4RUHA 1WHVA 1TFWA 4C9DA 2W7OA 3G4SS 2K1RA 2KT2A 1VQ6S 2OD6A 2MB0B 5K9FA 3M2RB 2DH8A 4QIGA 2MKJA 1SKSA 4BWJA 4XK8C 4F4ZA 2R8JA 4O4GA 1SBRA 3PKYA 3KG0A 5I42A 4E0DA 2A18A 4K4XA 3MZIA 3L7PA 4RW9B 4Z2XA 3PW0A 1NK6A 2FUG9 2OFGX 3OUYA 3I9V9 1WF1A 2WONA 4MTPA 3KLHB 3M9OB 5L1KA 4K59A 5B0GA 2V8VA 3PY8A 3GILA 3FNNA 1FDAA 4YEAA 4X4RA 3N79A 3CIZA 3CT9A 2NQPA 1XR7A 1WEYA 3E01A 4O3OA 3SXLA 3T3FA 4X4OA 4JI2F 4R5PA 3E2EA 1HARA 2UXDF 5LSRA 1R3NA 2QT7A 1XMQF 4F02A 2ADCA 3NKYA 2AYGA 3M2VB 4DFKA 2BABA 2QA1A 4RU9A 3HI9A 2OPSB 2C3MA 1D3WA 2DK2A 3CDBA 3W3SA 3HHDA 1BGXT 2KG1A 2V8GA 2LVWA 3BZQA 3RRHA 3M30B 2HYIB 4DUZF 1HNVB 4ES2A 2WBRA 1NH8A 3VR1A 3OJSA 3TA1A 1MU2A 3G71S 4DR7F 1VGYA 4F26A 5J2PA 2J9EA 1R6YA 4WXWA 4ZHRA 1RTHB 4QCLA 3GZ7A 2I2YA 4K4YA 4RBVA 1UJ6A 3I32A 3MM5A 3ITHA 1YG0A 2QIFA 3BS9A 1ZETA 3HVRA 2V2KA 3D0HE 5HP1B 1Z2LA 4OZJA 5DETA 3V6JA 2F8MA 3TP2A 4K2XA 5DGAA 2O5DA 4QJVA 4DSEA 5F8IA 5G4DA 3KWMA 1D8YA 5IQ6A 3DRRB 3SSSA 4QZVB 2V4QA 1ZM4A 5DO2A 3LOUA 2F3JA 3Q23A 5DLGA 1YBAA 4RWXA 1Q8LA 1PGZA 5AXLA 2ROPA 3IBWA 6FDRA 4PQU<