4C4WA

Structure of a rare, non-standard sequence k-turn bound by l7ae protein
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
96
structure length
96
Chain Sequence
TRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
publication title Structure of a Rare, Non-Standard Sequence K-Turn Bound by L7Ae Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 26
structure length 96
sequence length 96
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4c4wA00
1YJNS 2RRBA 2MZSA 3CCRS 1ZZFA 2MKCA 5MLCV 1PGZA 2AYBA 1B7FA 1WF0A 2WBRA 3S7RA 4CH1A 1X4GA 1NO8A 3BO3A 2O3DA 2LKZA 2M2BA 1H2UX 5HO4A 4WCEQ 4QU6A 1WI8A 2F9JA 3MD1A 1U1NA 1X5TA 2K8GA 2DGQA 1HD0A 2HGNA 3L3CA 4IO9Q 2CPJA 2MQQA 3D2WA 2B0GA 1WF1A 2AYMA 5GADU 1X4CA 2D9PA 2KRRA 1U1PA 2MQOA 2RS8A 5JVGQ 2MZJA 1VQMS 2KG0A 4U67Q 4PRFA 1OWXA 2DNNA 2F3JA 2MSSA 2M4MA 3ZZZA 3RW6A 2DGWA 2OTLS 1X0FA 1WWHA 4IOCQ 5DETA 3MUTP 3MD3A 1X4HA 4QQBA 2ZJRQ 1VQ8S 2E44A 2OTJS 4TU8A 2A3JA 1YJ9S 3N9UC 1D8ZA 1N52B 1OPIA 2JRSA 4YUDA 2UP1A 2ZJQQ 3BO2A 1JJHA 5IM0B 3US5A 3G4SS 1WG5A 2CPHA 2N3OA 2PEHA 1WHVA 4CQ1A 2DH7A 2K3KA 2AYEA 3CPWR 1VBZA 1SJQA 1K73T 2M52A 3Q2SC 2M0GB 2QEXS 3V4MA 2U2FA 3VAFA 1YI2S 4LMZA 2LA4A 2DNOA 1U1MA 4W92B 4QU7A 1D9AA 2X1BA 2E5GA 2DNMA 2V94A 2NZ4A 2MY8A 5IQQA 3MURP 3CF5Q 3FEYB 5LJ3Y 2J8AA 2RNEA 1WEZA 5HL7Q 2I38A 2MQNA 3ULHA 2XB2D 5IM0A 4ZKAA 1W2BR 2VODA 4LIRA 2ERRA 2CQDA 2MZTA 2DO4A 1U1OA 4W90B 1M5VC 2LEBA 1H2VZ 4TLQA 5D77A 2G4BA 4LJMA 2DHGA 4PKDB 1YJWS 2LXUA 2MKHA 2MYFA 2NLWA 4TU7A 3DLLQ 3Q2TC 4WFNQ 2CPEA 1HL6A 4Y0FA 1WELA 1VC5A 1KOOA 2N7CA 3CCVS 4V19X 3TP2A 2RU3A 1QVFR 2PE8A 3THTA 4Y00A 1H6KX 2YH0A 2M8HA 5LJ5Y 2YKAA 2DNGA 3S01A 1P1TA 1AUDA 5CXTA 2MMYA 4C4WA 5GAGU 2KXFA 1FJEB 3UD3P 2CPDA 3UCGA 3CCES 2N3LA 2HZCA 2CQGA 2VOOA 5GAHU 1WF2A 1UP1A 1YIJS 4FXWA 3R1LA 2DNKA 2MKKA 3I55S 3G96A 2RS2A 5EN1A 2M9KA 1X4FA 3HHNB 1ZZNA 2XS5A 2SXLA 3CC4S 3SXLA 4TU9A 2LA6A 2MZQA 1N8RT 2MPUA 3VAHA 2AD9A 3VAMA 1A9NB 1FJ7A 2X1FA 4CH0S 3TYTA 2CPZA 1DRZA 2F9DA 3G6ES 2OJ3A 2DNZA 2KFYA 2HYIB 3JB9k 2I2YA 2YWKA 3IRWP 1WTBA 1VQPS 4IUFA 2DNLA 2KH9A 1RKJA 3R1HA 2KG1A 2KM8B 4YB1P 2LCWA 3G9CA 1KOHA 1WG4A 2DNHA 4PR6A 2DGSA 1N88A 1WI6A 2Q79A 2CPXA 1VC6A 2KXNB 2CQ1A 3H2VE 2CPFA 2JWNA 4WFBQ 2CQ4A 1WHXA 2LECA 5IFMA 1M1KT 1F9FA 1FXLA 4J5OA 5LXRA 4CIOA 1DHMA 5LXYA 2DISA 1N54B 3CCSS 1P27B 3CMES 1SJ4P 1WEYA 2G0CA 1VQLS 2L9WA 3OW2R 1SJFA 2OSRA 1VQ9S 3EGZA 1R8HA 1FT8A 1QVGR 2DGUA 3MXHP 3VALA 1WHYA 1U1RA 1WEXA 3CTRA 3LPYA 3ZZYA 2YH1A 2FY1A 2FPHX 2LEAA 1HD1A 2MZ1A 4UQTA 3VAKA 1U6FA 4F25A 2M8DB 3MDFA 2CQ0A 3SMZA 4WF9Q 4IOAQ 2CQPA 3MUVP 1Q7YT 3NNAA 1KD1T 3IWNC 2G1DA 3CD6S 2BOPA 2JX2A 2LXIA 1M5KC 2OSQA 1JMTA 3DXBA 1U1KA 1K9MT 2MXYA 2DO0A 3R27A 2KI2A 5CYJA 1U6BA 3VAIA 1NJIT 2CQ2A 1YWXA 1R8PA 2KVIA 1VQOS 2MZRA 2ADBA 3MOJB 1H2TZ 3J7ZT 2MHNA 2QA4S 1X5PA 3UWTA 3CCQS 2M88A 5DM6Q 5H1SV 2QFJA 2FC8A 2LYVA 2KM8C 3G71S 1UFWA 3CUNA 1FHTA 3CCJS 3CCMS 1DBDA 1VQKS 1VBXA 2KHCA 4YOEA 2MKSA 1VC0A 2HVZA 2CPIA 2DGXA 1SXLA 5DDPC 1X4AA 2DGVA 1OIAA 2LQ5A 1FJCA 1SJ3P 2DNPA 2DHXA 2MKIA 5GVQA 4QPTA 2J0QD 2MGZB 5D78A 2DIVA 1UW4A 2JVOA 2RQCA 2XS2A 1SJRA 1U2FA 2E5IA 3S8SA 3CC7S 3K0JA 2DH9A 1WHWA 2CQ3A 2MQPA 3NS6A 3NNCA 1HA1A 2XNRA 3P5TL 2MJNA 2L41A 5DDRC 1RK8A 4C7QA 2J0SD 2RUGA 3MUMP 4WIIA 2DIUA 2DHSA 1X4EA 5DDOC 4WFAQ 3PIPQ 2MQLA 2MY7A 2VOPA 1UAWA 2AYGA 3CCLS 1M90T 2MGZA 2XSFA 1KQSR 2KN4A 2ZJPQ 1M5OC 5BJRA 4WKRA 3VAGA 4OZ0A 2EK6A 2U1AA 2MSTA 3UD4P 2KXHA 3RW7A 2DGOA 2LMIA 1VQ4S 2DH8A 1S72S 3CMAS 3NMRA 2CJKA 3I56S 4ERDA 1O0PA 2YTCA 1YTYA 1JJ2R 3G8SA 1NU4A 4C0OC 2FC9A 2DNQA 4M5DB 3P6YC 2RRAA 1KC8T 2DGTA 3TO8A 5ITHA 1FNXH 1X5OA 2OIHA 1IQTA 3UCUP 3SDEB 3BO4A 2KYXA 1M5PC 1ZH5A 5FJ4A 2JVRA 3VF0B 3UCZP 4A8XA 2CQIA 5GAEU 3P3DA 4F26A 5CA5A 1YITS 2RT3A 5GMKa 2E5JA 3U1LA 1G2EA 2M70A 2DITA 3CC2S 2DNYA 2MKJA 2DK2A 2HGLA 5DM7Q 1JJ4A 3LQVA 1BY9A 2CQHA 3PIOQ 1PO6A 3BS9A 2CPYA 4ED5A 1QM9A 2RQ4A 1WG1A 2VONA 3B4MA 4Z2XA 1FO1A 5JVHQ 3NS5A 3B4DA 1X4BA 4EGLA 1U1LA 2XNQA 1S79A 4FXVA 3H2UB 1OO0B 4OZ1A 2MQMA 1URNA 3SDEA 1Q81T 2BZ2A 1XN9A 2DHAA 3BEGB 3S6EA 2N82B 3THPA 1VQ5S 1VQ6S 2L08A 2RVJA 2GHPA 2KU7A 3P49B 1L3KA 3VAJA 5LSOA 3NNHA 4F02A 3UE2A 2DB1A 3CXCR 3J7YU 3MI7X 2KT5A 3CCUS 2ADCA 1DZ5A 2D3OR 2M7SA 1X4DA 4BS2A 2CQCA 2D9OA 2EVZA 4RU2A 5LSLA 2HGMA 1X5SA 2KRBA 3U1MA 1K8AT 2XS7A 4UY8T 2X1AA 1YHQS 1VQNS 2J76E 5DDQC 3EGNA 2GO9A 3CULA 2E5HA 3G8TA 4P6QA 1VQ7S 1A7GE 1Q86T 3FEXB 2FHOB 1U1QA 2DNRA 2CQBA 3EX7B 2MJUA 1Q82T 3HI9A 1VBYA 1CVJA 2EK1A 2MB0B 2X1GA
chains in the Genus database with same CATH superfamily
4ZIWA 4LF9J 1J5EJ 1RTHB 1G4CA 1RT2B 2V9WA 1B7FA 4OYWA 4CH1A 1RWVB 1H2UX 4WCEQ 2WVCA 2XZWA 4ED8A 1U1NA 1X5TA 5HI7A 3AFGA 2Y8YA 1Y5LB 3V6DA 2W8LA 4I2PB 3KLGA 2OP5A 3ENVA 3AQOA 1Z2ZA 1FF2A 5EX3A 3WIVA 4X4PA 1MU2A 3UFCX 2FZKB 3VZIA 4UOFA 3TAQA 3JSBA 1WC6A 1S0OA 2E5LJ 1RT6B 5IT9U 3OL7A 2IMWP 4LSNA 1HBOA 3HSDA 1S1WA 4DMZA 4DOZA 4EU0A 4W92B 3GR0A 3OBIA 2BX6A 1EARA 3KUGA 5DG9A 2CZVC 2YWHA 2Q66A 2FHJD 3PW7A 5H9EJ 3TAMB 2GMLA 3BJYA 3RBDA 5L46A 2CZ4A 1DQ9A 1UFLA 4RNOA 4A46A 1R0CB 4ZKAA 4ELUA 5A2QY 3FUYA 1UWBA 4Q7AA 3WC2A 4C98A 3LANA 1LW0B 4Y0FA 1QLNA 1UVIA 3M32B 3A8KA 3POTB 2YKAA 1AUDA 2XI3A 2YNIB 3ZNUA 1FJEB 4RW6B 4ZCKA 1UP1A 1YIJS 4ZPDA 3VQTA 3PYGA 1CEZA 3MM9A 4DL4A 1FJ7A 3GFYA 5KFAA 4CH0S 3FBCA 3J7A1 4CLZA 4C48A 2EPIA 2YWKA 4DFJA 1J2VA 2IA6A 4ELTA 2OI2A 3CJ4A 2YKQA 1Q1KA 2PGCA 5I4MA 4DX5A 3R7NB 3FGVA 5F8GA 1I1GA 1YGYA 4P52A 1VYAA 2VJVA 4ID5A 1W2IA 3UNYA 3QIPB 2H54B 3A3PB 3LPYA 1IBMJ 3VAKA 3ETOA 4LF5J 2R3VA 4OFZA 5BR8F 1HPZB 3CD6S 4C11A 2Z2LA 4KSEB 4M5DA 4OYMA 1VRUA 2B9EA 3R6GB 2D7SA 1S7HA 1AFIA 4LVNP 2FZGB 5F9NA 1LW2A 1U6ZA 1N33F 1Q5YA 4L75A 5IS2A 3DLEA 2ZBRA 2CUYA 1F60B 2MKSA 1HWKA 1GMVA 3HZEA 5K14B 1F3FA 2XWXA 4DSFA 4ZCLA 1T9WA 3ITHB 3DU5A 3C19A 3GIKA 2X3GA 2FLOA 2OAUA 3EVOA 3V2UC 1T94A 5GADI 3IMQJ 1QAXA 3NS6A 3O5TB 2XNRA 1N34J 4YFUA 3MTKA 1N56A 4M1KA 2MQLA 4FVMA 1FEEA 3M8RA 4N76A 1EETB 3TA0A 4FF1A 1VQ4S 3MAAB 3NMRA 5AJ3F 2OGUA 3PO5A 4J9SA 1B3TA 1RTHA 3MR7A 1RT2A 4NMLA 1NSQA 5FJ4A 4I7FB 3GCXP 3MPVA 3VGVA 2VBZA 2HQCA 1PBUA 2XGPA 2CVIA 4DSIA 1PBAA 4I2PA 3EE3A 1PCAA 2NYHA 2RQKA 5ETQA 1OMSA 3LPEA 1R7IA 4RBUA 3SBMA 1VMBA 2B9YA 2UUCF 2V5HG 1RT6A 3THPA 2R8IA 4ANDA 2RVJA 3ET6A 4X66J 4ETZA 3UN5A 1MG7A 2F4VJ 2EEYA 2FHMA 1FKPB 2HQFA 3J81Y 4I68A 2BRKA 2XMWA 2F8HA 4B3SJ 3TAMA 1A7GE 2ZH8A 4NMXA 4M63A 4KKOA 3HD1A 4IRKA 1HBNB 3HZGA 2J9DE 3KFWX 3QYYA 1WOSA 1YJNS 3TWZA 4WZQA 4J9KA 2NSCA 5IWAJ 1GX6A 3MMCB 1LW0A 3KXDA 3M32A 4OMFG 3GG0A 3POTA 2W7OA 1WF1A 4UF4A 3HM9A 3W8PA 3H5XA 2GQ2A 1X9MA 2DPIA 1TFYA 3QPIA 1NXIA 4LF6J 2KYZA 2N4DA 3NRBA 2E44A 3KK3A 2HQDA 2RRNA 2RAQA 2HURA 2OH2A 3HVWA 3R7SB 1ZAXA 2OD4A 2KHDA 3PYEA 2VC1A 3N5FA 2CPHA 1D3WA 4USJC 2OEMA 3JQJA 4AXIA 4NLQA 1RABB 3VQSA 1YI2S 3BQ2A 4KGVB 3OL9A 1NEEA 2V94A 1T02A 2PEBA 4MIBA 4JOUA 2A6OA 5LL6d 4KR0B 4AL6A 2HNYB 1RWMB 3DMJA 4PXDA 3OTOJ 3QAUA 1NHUA 2IJFA 2MZTA 1U1OA 1JXEA 1EQ0A 2QLWA 2DHGA 2MYFA 5E3PA 2QTWA 2QX0A 2AMCB 3H98A 3SQGB 2XMVA 3SV4A 1SC3B 1WOPA 3EGVA 3THTA 1CPZA 5IT0A 2WVBA 5DG7A 3OQ2A 2W2NP 2CG8A 1X9SA 2X7IA 5GAGU 3DRRA 3CCES 4P73A 2HZCA 2CQGA 3M1VB 3R1LA 1S1UB 2V67A 4ZLJA 1X4FA 4ECUA 4X64J 3QSIA 1J27A 4P72A 2RHSB 2Y1RI 3JB9k 3K5LA 4EBCA 3BBCA 2AGPA 2XM3A 2IPOB 1RUSA 4OYIA 2DHHA 1NHKL 2F4FA 3OV7A 2B8PA 3WX8A 4CNZA 1FKAF 4H4OB 2HK3A 2IAJB 2OFHX 3LWLA 3CCZA 1RI7A 1EETA 2M8DB 3KDNA 3FJ2A 2ZKUA 2G1DA 3R97A 3ZO7A 3FBEA 2NPFA 2H5EA 1XMQF 4JI3F 2Q1LA 1U6BA 1ULRA 3A8IA 1ZM2A 3KNGA 4I7FA 5EUHA 4LF8J 5H1SV 1IR1A 5B0AA 3C14B 3W2VA 5E7OB 5KFLA 4QWCA 3ZZPA 2C42A 4O0IA 3IG1B 2XLKA 2P8IA 4LFBJ 2XY6A 3R2CJ 3SSRA 3PY8A 2QIFA 4K4ZA 2PN6A 5DGAA 3LTOA 2ZWPA 3CC7S 2E5IA 3S8SA 4P7TA 5K9FA 2DR9A 1KVJA 1FKPA 5I3UB 2RD5C 2JSXA 1D9FA 4C7QA 2PI4A 1SL2A 1YG0A 3QAEA 4DL3A 1RT7B 1UAWA 2AYGA 3QRQA 2MGZA 4I64A 4YR2A 1B99A 3TNVA 1FWKA 1FE4A 5AXNA 1BUXA 2W25A 2DH8A 4RLEA 1LV5A 1N0VC 1OYDA 1RTDB 4OZJA 3MMCA 2HZVA 4JI0J 4B3OA 2RKIB 2ZDPA 1NDPA 3W61A 3MMBB 1PO6A 4I0WA 3AT1B 3B4MA 3RRHA 2H1YA 2MEWA 4EGLA 2HVDA 4FXVA 4J7CA 1EP4B 4OZ1A 3ONQA 1AUSL 2ZWOA 3IS9B 4LR7A 1YBTA 2PI5A 3TJ8A 3KG1A 3MPYA 1FRJA 5IV4A 3Q89A 3BQ0A 3J7YU 4DPOA 3I5BA 3KLEB 3IBWA 2WVDA 2YQ1A 1UVMA 2QLFB 2QT7A 2JL9A 4RU2A 1X5SA 3GSIA 4UY8T 2C2RA 1U47A 3PDNA 3CULA 2E5HA 3N5BA 3AJDA 1X8DA 1Q86T 3ILIA 1MWYA 2PMZD 3D0GE 2HNYA 1VI7A 5B0FA 1WSRA 1ZZFA 4DCOB 2V8HA 4A8WA 5KFMA 1GX5A 5ADZA 3BM7A 5HBMA 3SQGA 2BQUA 4YY3J 4QU6A 5IQ6A 5F8HA 4LBPA 4WP3A 1DLOB 3L3CA 3SFGA 2CPJA 4A8YA 1X4CA 4B02A 4OV6A 2LP4A 3N28A 2CFXA 1FA0A 5ETNA 1HNXJ 1UCNA 3BPDA 3ZZZA 5EWEA 4OLPA 3KYLA 4IOCQ 3BSAA 4C0BA 2OTJS 4DR6F 1YJ7A 1YJ9S 4ZLLA 3N9UC 3C3LA 3I5CA 1UA1A 2JRSA 2ROEA 4C8OA 2D69A 4EI2A 1XNQJ 3FVYA 1S59A 4C9DA 1NDLA 2CNNB 1U8SA 1XR6A 2FIUA 4N41A 1WKJA 2M5YA 2KT3A 5LMNF 2NZ4A 4F2RA 2GMJA 2GQCA 4PPDA 3AA9A 1S97A 2FHJA 3Q8VA 3I5AA 1U0SA 1TZ0A 5HVGA 5F8LA 5CHCB 1JLBB 1EQMA 4W90B 1H2VZ 1JXVA 1SI9A 3MPDA 2FVPA 4LF2A 5D0HA 5ETPA 4HHJA 3VGTA 1FWLA 4IQMA 3OJUA 3E01B 4ECZA 2F63A 1FD8A 4XK8C 5I3PA 3QFHA 5ETTA 1CJTB 2OPSB 5G0RA 5A8KB 2PMWA 1VISA 3UD3P 2CPDA 4D3GA 4A47A 4KJIA 2XTJP 3HHNB 2DXDA 3AHPA 2ASJA 3FRZA 1RHQB 5KG0A 3VAMA 1S99A 3DHXA 4Q8FA 2BKPA 4O23A 3OD2A 3C14A 4ID8A 4U7CA 2R2UA 1RBAA 2LVWA 3D6HB 3IG1A 3GCWP 3W3SA 4JI5J 4DV7J 4RNNA 3PCOB 1AYEA 3PJ9A 1N88A 2C2MB 5C5JA 3DRYA 4OV1A 2CG4A 2Y0SD 4DR4F 4RPFA 4F50A 1WNEA 4CIOA 1N5YB 1DHMA 2R7UA 1NDCA 5I3UA 1P27B 3OPKA 1VQLS 2JOQA 4Q0BB 3MXHP 1TKZB 2QN6B 1NH8A 2FY1A 1HD1A 3EDRB 4WF9Q 3BKTA 4ANEA 4B9MA 4UQGA 2ZVSA 4LR9A 2E1AA 1RTDA 2ZD1B 1NAQA 1OS5A 4BBYA 3MM6B 3UDCA 4ES3A 3VAIA 4DFPA 2KVIA 4JUZA 4O3SA 1M5SA 1DQAA 1RHRB 2QL5B 2M88A 4JI1J 4C8NA 3CCJS 1GMWA 3M30B 4F3QA 2CPIA 3HFKA 4GKJJ 5EHHA 2LQ5A 2XWYA 1EP4A 1VJWA 4P2XA 4OZ2A 2IFXA 2AEMA 4DV5J 2KJWA 2JVOA 4K2XA 4UUXA 4L72B 3PRBA 2L41A 3MEEA 3OXFA 3IAS9 3OR2B 2XMKA 2AIRB 2U1AA 1Y00A 4RUBA 5DZ7A 3G8SA 4KPYA 3CEDA 3P6YC 2HWHA 1S10A 2LDIA 3CJ8A 2UXDJ 4FPRA 1PG5B 1DLOA 2EXUA 3SV3A 3FDSA 3ISND 2R7OA 3K17A 2W8KA 1K1QA 2DTJA 2AJQA 1ZS6A 3CE8A 1U1LA 1S79A 2RDJA 4PQAA 3H2UB 2MQMA 1K0TA 1FDAA 4OYZA 1IUJA 5DS7A 1YRXA 2B51A 3P49B 3NNHA 2DB1A 3CXCR 2K1RB 4J9LA 2Y9HA 5C7PA 4X4QA 3MFIA 4BS2A 3P5BP 2HGMA 3GB0A 2KRBA 2L48A 1XERA 3BGRB 3OTCA 4B9SA 4G65A 1OYEA 1T9UA 2W2MP 1NPPA 2HLUA 4QIEA 3FEXB 1U1QA 5HAOA 1MLAA 2FZCB 1JLBA 4EK2A 1CVJA 2X1GA 4HI2A 3ZC4A 1C0TA 4F7VA 3KHHA 1N36J 2BE7D 2LU1A 3CSKA 3NGTA 4DR3J 4C2MA 3EDQB 1WI8A 2K8GA 1CJTA 2W9AA 3KUHA 1S6QB 2ZUGA 2BJ9A 3BGOP 2RS8A 4LFAJ 4NX9A 4PRFA 2DNNA 1F5CA 2UVUA 4JI6J 3OFHA 3QO9B 5DETA 2ZHOA 1F2GA 2ZJRQ 5C25B 1SBRA 3T5HA 2AV5A 1Q0NA 1YQHA 2A2DA 3HFZB 4P71A 1U4BA 1RP5A 5B7WA 3US5A 4FF2A 4X4SA 3DU6A 5AXLA 2BJEA 1IWAA 1HNZJ 3M4XA 4F4XA 4BDPA 2H5JB 1NK8A 4TXSA 1X0PA 2VUGA 1RBLA 1Y7PA 3IGNA 2DCUB 4K4YA 4QU7A 1B70B 2CDRB 4A4JA 1N5YA 2WHOA 1BLUA 4DI6A 4HACB 4JP8A 2ATLA 4F4YA 2XB2D 5IM0A 1HWJA 3GJRB 4KRWA 4LIRA 4Q0BA 1TKZA 3P4UB 4CO3A 2E9TA 3GONA 1PKUA 2X3DA 4UT4A 3CNQP 1VQYA 3F44A 4ZVFA 3NBPB 5C24A 4FYDA 4DEZA 2ZD1A 2IM1A 1IR0A 5FIIA 3LO3A 5CXTA 5KFRA 4C4WA 3MM6A 2KXFA 2QFIA 2VOOA 4NEYA 3QJLA 2YNGA 5KFCA 2DR5A 4OHZA 5JXSA 2HWIA 2BJ1A 2VU5A 3TYTA 1FE0A 5IC6B 2BV3A 1FJGF 1RA6A 2P6TA 4USTA 4OJGA 2XCAA 1LWXA 4PR6A 1RWPB 5DQGA 4RZRA 3CJ0A 3D0HE 4PUOB 4KY3A 2E29A 3VZHA 3UN2A 5IT9Y 3H5SA 3D0IE 2FLNA 2VBWA 2IJRA 3BSCA 2GW8A 4F0HA 1R8HA 1FT8A 4YP3A 5E5NA 2XLIA 4RW9B 5FLXU 2VQEF 2LEAA 3I0RB 3G2XA 4TQSA 2FTRA 1D9DA 2QE5A 2ROGA 2UZAA 3F56A 3IWNC 4ZP8A 2VG6A 4HR2A 1JMTA 4USMA 3CJ3A 4EBEA 3K8VA 4JBCA 1Q78A 1I3OB 2IDLA 4EZ6A 4Q43A 3I4HX 5H9FJ 2XMTA 2J7KA 3BGLA 2CADA 3FNNA 2ZFHA 4QW9A 1RWKB 5GMEA 1X5PA 4IDKB 3CW2C 3CUNA 3DLJA 3MCNA 3G82B 3CCMS 5A2QU 2RF2B 2ZE2B 2YPYA 3IA0A 3RYLA 4GKKJ 4JI7J 4CLYA 1JIHA 2HHPA 3MCMA 4R0EA 2DHXA 2H5IB 1VFJA 3LAMA 4EO8A 2FLPA 2ZITA 2WONB 5D78A 2GMHA 1RTIA 2RQCA 1SC6A 2K1RA 2JDJA 3I4PA 4WFYA 5CZXA 2RIJA 4QR2A 3C46A 2JEFA 1VQSA 1F5BA 4Y2AA 3CDAA 3GFHA 3HHKA 4F3MA 3BGRA 1HW8A 2ZOFA 3W1YC 1Q4RA 4NLOA 2MKYA 4GO7X 2XYHB 1S6PB 2KN4A 4NRTA 3Q0AA 2EK6A 2DRAA 2YKMB 1HWLA 5I3QA 2L9DA 4IH7A 3MR5A 3HHLD 1CQMA 3JQKA 4JV1A 1T9XA 4C0OC 2DNQA 1DFDA 4DV0F 1RYSA 4QPXA 4ECXA 1IQTA 4FF3A 5CYMB 5H9FK 1XR7A 2HFVA 1CJKB 3HF5A 3OFFA 1SKRA 3NGDA 1ZAWA 4B3RJ 3LQVA 1TMJA 4LRBA 3QO9A 2VONA 2AF6A 4DR1F 4ZPVR 4DX7A 5C25A 4I6AA 1G1XA 1V9OA 3X3UA 4X4RA 2B4OA 1HR0J 3VTIA 1L3KA 1YZ7A 5A6PA 1PJ7A 1U0HB 2YWFA 4RNHA 3WC0A 2AEFA 3SQOP 4RW8A 5LSLA 3ENAA 4DUZJ 4E0DA 3NLCA 4CO0A 1QE1A 4C3KA 2ZH3A 1E6VB 4HEA9 4HACA 3BR9A 4F8RA 4DL5A 2NS1B 4F4ZA 4ZA1A 3DGPB 3CCRS 5AE3A 1NK7A 4AQYF 2AYBA 5AE2A 4GRSA 1KDNA 5K8OA 3BO3A 1NBEB 1P9YA 2DGQA 3PR4A 3NBPA 4NXMJ 4DL6A 3N0VA 3DLGB 2QL9B 5GADU 3D6TB 1UVKA 5CQGA 5B0EA 3LW5C 3SSQA 4ZN1A 1S9GA 5B0GA 3M6UA 4OZNA 4FNHA 4B3TF 2JC1A 3RG6A 4R5PA 2OKQA 2OO4A 1O5JA 4OX6A 3PTWA 1RWXB 1ELOA 3DOLB 1GEHA 1KS2A 4YUDA 2OPPB 3T1HJ 1DY3A 1TKDA 1H38A 3D1HA 4XPCA 1WHVA 4OX9F 5D6GA 5B08A 2YXLA 2ZZTA 2M0GB 2DR6A 5E2QA 1FK9B 4JYAJ 1D9AA 3HVTB 1K44A 3DRPB 2FVCA 1CULB 4A8SA 2HIYA 2HG4A 2DVIA 4IKAA 4OL8A 3ULHA 2GGPA 1UMJA 1C4CA 1DARA 4HH0A 1FDBA 1YJWS 3I0RA 3CCWA 3ZXWA 5GAHI 1TL1B 2GX8A 4NA2A 5AXMA 3I9V9 3Q8RB 1QVFR 3LUYA 2LXFA 4O44B 1ROFA 2YH0A 1KHWA 2E7XA 5ETVA 1U48A 3IWLA 2MMYA 3C8YA 4P9SA 3EVWA 3HJVA 4X65J 3GP9A 4U9RA 1RWOB 2QRRA 2N3LA 3QGGA 4WXOA 1TK5A 4A8QA 1LWFB 4IDKA 1IBKJ 4PQUB 4Q5VA 2VG7A 4B3RF 4R8UB 3G82A 2DNZA 2ZE2A 4ICLB 4C0HA 3M8WA 5HQ8A 2BACA 4NOHA 2Z58B 1S0VA 2DNLA 3GIJA 3HK2A 5HJXA 4YB1P 4M5GA 3DDKA 4Z37A 2WONA 4ED2A 2CQ1A 1HR0F 2G1HA 3EZUA 4DQPA 4DPXA 1LXJA 1FXLA 1R0BG 1N0UA 4DV3F 3JTNA 1SJ4P 4NLWA 2KTQA 4M5KA 3CTRA 1S6PA 2YH1A 4ZHRA 2A1BA 2YKMA 2BDPA 5HATA 1SC4B 2XGQA 5KT3A 1HARA 4ECQA 3MAHA 3WDOA 4U6PA 2YX4A 2BOPA 2IRUA 1K9MT 1RDRA 5F41A 1O6XA 4AFFA 3MOJB 3FZBA 4ES1A 3NGUA 5KFXA 2QFJA 1F1BB 3G71S 2FVRA 2QA4G 1DAXA 1HNWJ 2E7VA 1RLCL 1R43A 1NPRA 2Y1LB 5GVQA 4X4OA 3FZ2A 4DCJB 4MAKA 1U8WA 4OI6A 4RWXA 1ZTWA 2HWTA 1QDUB 1U0HA 5DQIA 3K5OA 3T19A 1X4EA 3N6NA 5IC4B 1FDDA 2VDHA 1E6VA 3DI6B 2DJWA 4MFBA 3D66A 1M5OC 2MSTA 3PX4A 5HP1B 4AYBD 4AL5A 5EDWA 5F9LA 3K8WA 3DGPA 3JSMA 3C66A 4ERDA 5D0EA 2WSCC 3J7Z5 2CJBA 2F5GA 1NU4A 2RHQB 2V2VA 2PSZA 1FRIA 2UUAF 3S1TA 5ITHA 1SQGA 4U7UK 3QWUA 1HIYA 4EYHB 3PW0A 3QZ8A 3ZTOA 3DLGA 3W7BA 4CO4A 1G2EA 2Y1IA 4ZPBA 1TAQA 1NLKL 1SIZA 4UOCA 2BOAA 2DXEA 5JVHQ 1PC4A 2HRYA 3DLHA 4AL7A 1JK9B 4WFXA 3PNIA 3MPUB 4C3MA 2L08A 1LOUA 2OPPA 1H3DA 4ZVQB 2DBBA 3IR7B 1HHQA 2BANB 3HVAA 1D09B 1LFWA 3HVTA 1K8AT 5D0GA 1IJEB 2XBPA 5HROA 2EC0A 4NLUA 2GAHC 1CULA 4WE1B 3BV8A 1DTQB 4H4KA 4JI8J 2ZM6J 1NK6A 3NL0A 5CCLA 1TVRA 2W2OP 3HHLB 1AB8A 4JV0A 3BSOA 1PGZA 3IM8A 4RU9A 5DLGA 3H20A 2O3DA 3SCKE 3ZZUA 1DTTB 3PEJA 1TL1A 4CWBA 2CDQA 4G1QB 5J1NA 1CJVB 4LVOP 1OPZA 3MM5A 1AROP 1U1PA 2MQOA 5B0CA 4CTAB 2MSSA 3VCDA 2HHTA 1X0FA 1WWHA 2VG5A 3ZTPA 5D4OA 5L8RC 4NLXA 4F3OA 4IRDA 2UXCJ 4C97A 4PQUA 3QT6A 4Q2MA 3UO0A 1W7WA 2Y8WA 1TELA 1C1BA 2POKA 3BO2A 1QSSA 4G3IA 3V81B 3OL8A 4WYLA 2N3OA 2VHGA 1FKOB 2Y3YA 2QEXS 3VAFA 2NXJA 3RB4A 5KFSA 3CIMA 2LDYA 2CIMA 4YMEA 2BKNA 3PO4A 2G9OA 1H0HB 2D3UA 1V6HA 3LALA 3MM7B 4N47A 3SZ2A 3MR6A 4RW7A 4YDDB 3MEDB 4LF7J 1UW9A 2K2PA 1HWUA 2ZBQA 2IHR1 4FF4A 3QGIA 3QSYB 4X84A 4QYZJ 1FWPA 4Q45A 4V19X 2UVVA 2FJBB 1HQUB 4NLSA 1J5OA 1GK8A 2BE9B 1RT5B 1KWMA 2R7RA 3DLBA 1UZHA 3AY0A 4M94A 2BQRA 3OLBA 3ZTSA 4Y2KA 1JLQB 4J9QA 4J9MA 2ZZNA 1MW7A 2BMBA 3H8YA 2IRXA 1FFGB 2XZTB 2H48B 1FX4A 3PFOA 4B9VA 1T3NA 2ALZA 1MROA 3U1NA 2NYIA 2WBMA 1FTCA 3MF5A 1VC6A 4JI4F 2FJAB 3PV8A 2EBEA 1HFEL 3MMAA 2JLEA 3KJFB 3K5PA 3CMES 2ZNYA 2VB6A 3JSRA 2WSEC 3M8QA 3EGZA 4PG6A 3DI6A 4KV8B 2HQIA 4FNIA 4UQTA 3TVZA 1NSAA 5HP1A 3W5XA 1JLEB 4QYZK 4QZVB 1WKKA 3AAWB 1OY9A 3DXBA 1U1KA 3C6TB 2V4JB 2ABYA 3FRYA 1TL3B 1SKUB 4UOGA 1KONA 4NLGA 3ISZA 2AKWB 5ETLA 4DQIA 4ZCIA 2MHNA 5KG4A 1F3VA 3QIDA 5D0RA 2FC8A 2G2ZA 2BJDA 3RRGA 1RHUB 3OFEA 2KZZA 1N32F 2HVZA 2CZ9A 4DQSA 4MYTA 1IKYA 2I1RA 4ZJQA 2QSWA 2ASDA 1RCOB 4HHHA 1RADB 3EZ5A 2GIFA 1TMMA 2R9LA 2AJ0A 2I9SA 3BDPA 1S49A 1YKWA 4Z7YA 1S7IA 3PW4A 4X62F 1JLAB 3TUIC 5C2GA 2BANA 5DDRC 2RMLA 1NB2A 1GTEA 4RUAA 3PJWA 3GR1A 4WBFA 2XSJB 1DTQA 4RW4B 4ZVEA 1FESA 1RWNB 4TNOA 5IOLA 1JLCA 3RW7A 1RGVA 1KTVA 4B9NA 3HHLA 2YTCA 1MN9A 2CA9A 1XK8A 3GV8B 3BKUA 2VKRA 4DL2A 3RR7A 4DR7F 1DTTA 1JWWA 2QO3A 1FNXH 4G1QA 1C1CB 3R8YA 3DC2A 1CJVA 2JVRA 4WU3A 5KT4A 2G0IA 2DRDA 3A8EA 2DK2A 3M2UB 4KGXB 4CTAA 4KH0B 3LWMA 3W9JA 4OI0A 2XZDB 3H0PA 3T1YJ 2RH3A 4B9TA 1Q81T 3KK1B 4J37A 2GZOA 3UN3A 2GHPA 5DG8A 3TX8A 5K8MA 1F9EB 1HW9A 1NM2A 2KT5A 4QR1A 3FMWA 3AOAA 1M1HA 2ZC4A 2R8KA 2WAQD 3GJTB 3EGNA 2GO9A 2VZ9A 3UR0A 1YBUA 2DNRA 3TANA 3MM7A 4P2FA 3R3TA 3ENWA 3Q8YA 3MEDA 2RSQA 2P9CA 2HVEA 3WQPA 4GC7A 3HHEA 3LOUA 2F9JA 4C6AA 1Z1ZA 4YR0A 2MQQA 1QD1A 1RT5A 4LSNB 3AJ1A 4I69A 5EGYA 3IBFB 4J9OA 5JJBA 4ZP7A 1NSKL 4FKYA 1KTQA 3CO0P 1RHMB 1X4HA 3M6XA 3P45B 4DUTA 4Q2LA 4QIVA 4FDFA 1EKSA 4TU8A 1FRHA 1IWGA 2AQ4A 3JS9A 2QA1A 3OHAA 3HSJA 2A2CA 3FFIB 4MIAA 2FY8A 4HL9A 3TZXA 4YB7A 2NREA 2DH7A 2DXFA 3U27A 4O3OA 3Q2SC 3V4MA 4LIWA 4EEYA 4LMZA 5L1JA 1UETA 1RU1A 1SPBP 3M2RB 2MY8A 2XY5A 2MDAA 2HRUA 1PAEX 4PXEA 2RU9A 4NCGB 2IVMA 2IYGA 2IYIA 3MEKA 5HL7Q 4K0KF 1U02A 2VODA 5J2QB 4BWJA 5IV3A 2IVYA 1UEKA 2CJQA 4WTYA 3H4BA 3W2WB 5F8NA 4FPIA 1NUEA 2HMIB 1VJQA 3DLLQ 2KVQE 1GH8A 1U25A 3SCIE 1R8AA 1VC5A 2DY1A 5C42B 3TP2A 2ACMA 2C3YA 2R2TA 1UZDA 1SC1B 1ZOTA 4A8OA 3C6TA 3DN9A 3UD5A 1TL3A 5I42A 4CRJA 5U47A 2PT0A 7FD1A 3G96A 2M9KA 1HLWA 1SL1A 4N77A 1N8RT 3GV5B 3NMAA 3EJMA 2KFYA 2HYIB 1VQPS 5SUHA 3PVXA 4IR1A 2ZKTA 2DCLA 4P74A 1NZ8A 1DQ8A 1IQZA 3QNWB 2LCWA 3I9ZA 4Q8EA 4ZVOB 1PC5A 3E3XA 4NASA 2P5VA 5G4DA 5LXYA 1JLAA 2HHUA 3ELHA 4C11B 3OW2R 2AGQA 4KHRA 4DV6F 1U1RA 2XSJA 3L7UA 3PX0A 3QQCD 4RW4A 2FPHX 4DXLA 1IBLF 2GIQA 4ECRA 5B09A 3Q24A 1FDNA 1N5SA 3R5GA 4LSLB 1LQ9A 1KD1T 2W4PA 4H4MB 3FQLA 1NKEA 2CQ2A 1HNVB 3BREA 2QA4S 4N5SA 3CCQS 3EPGA 4K4VA 5J2NA 1DBDA 1L3TA 3KMQA 1FVQA 4UOHA 4C8YA 3TA1A 3IN5A 3KK1A 2JNJA 2NQPA 1Y3JA 2NUHA 3SEOA 4KGZB 2W2PP 5BR8J 3QT8A 5HMZA 1S0MA 2EFGA 3ZZRA 4P7VA 1M0SA 1FRMA 2DH9A 1JQGA 2ROPA 4URSA 2V6AA 2QG9B 5KAKA 5EWGA 5HJYA 2IY5B 2FGOA 2RUGA 5DDOC 2MY7A 5EWFA 3HD2A 2NXNA 3A3NB 3K2YA 4DSKA 1N33J 1RTJA 3VAGA 4DN0A 1D8YA 4EBDA 4KYZA 3GJQB 4NLTA 3Q8UA 3H5UA 2AU0A 1MNEA 2WW8A 5FLXY 4JV5F 4MTPA 2UUWA 2CYYA 2KT2A 5LMUF 4NXNF 3ET6B 2CNLB 1NH7A 3FSYA 3CC2S 2R8JA 1R31A 2H65B 1YJTA 3QT5A 4LQ3A 4ZJOA 1ZAVA 3O8WA 4KGKA 3SDEA 1XMBA 2YKNA 3S6EA 3SI8A 1CJUB 3FFIA 1KVIA 5DLFA 2KU7A 4KKOB 4NCAA 1NJZA 4IFYA 5AJ3J 1TTHB 4DUYF 3DOKB 2QMUB 4LRAA 2AWZA 1WC5A 4BC7A 3M2RA 5DDQC 3G8TA 3M9OB 4NCGA 2UUBF 3A13A 1OY6A 4IG3B 3FSIA 5J2QA 2HFOA 3EM1A 1D1UA 3RZAA 2XMAA 2EFOA 3GYNA 1WSVA 4CCHA 5MLCV 2UU9F 2WB1D 3W2WA 2HMIA 2XMUA 1UJ4A 5IZHA 3TAPA 2UUCJ 5C42A 5ETRA 3KK3B 3PYDA 2HGNA 3HKWA 1S5ZA 4RJVA 4EO6A 4WJBA 1PIEA 3H4DA 2I5JB 3LP2A 4IG0B 1RAAB 4WK1A 4N7TA 1KQFB 5A6WA 2W4DA 1RKIA 3MD3A 4K5SA 5A8RB 2A3JA 2IA0A 4USWA 2QMXA 3A4TA 1AT1B 4P10A 1T03A 3BN4A 5H9EK 3AOBA 4Y28C 3OXLA 3DMJB 3ZTRA 1XMOF 5E3QA 4A48A 2YPZA 3SSSA 1U1MA 3CT9A 5THWA 3TQEA 2VQFF 4TVAB 4TYBA 3CF5Q 4NI2B 4CLKA 3OUYA 1NK5A 2RNEA 4B08A 4B17A 4GVBB 1RT3B 5JMNA 2E9RX 4EUVA 2FJXA 3PRVA 1N5TA 1RU2A 3AA8A 3DRRB 4TLQA 5D77A 4JI2F 5T41A 1V5VA 5GAGI 4DCPB 4CNYA 1VLYA 2MTLA 1HL6A 4LSLA 4Y2MA 1UTAA 2E1RA 3JYTB 1KOOA 3L95X 1GMWD 1R0AB 2HNZB 2ZBCA 3A1YG 4LUBA 2M8HA 4H4MA 4DR2F 5E0OA 3PXGa 3H2LA 4LSZB 2RJZA 4CO5A 1HNVA 2AX1A 2NSBA 3CGIA 2X1FA 5KFFA 3K5MA 3LP0B 2XEXA 3KLFB 1TK0A 2KH9A 1RKJA 2OLWA 2KM8B 3I96A 3DXSX 4QYRA 2DNHA 2HHHF 3ILOA 3GFXA 1XWLA 4CI0B 3D6MB 2PD1A 2XYGB 2OFGX 2L9WA 4YB6A 1NNDA 3W64A 3NCRA 4UW2A 4LBHA 2HNDA 1U6FA 3SMZA 1Q7YT 3HP6A 4U8VA 4I1TA 3AD8C 3W2VB 4LFCF 1WC4A 4ZK7M 1JLFA 4RNMA 3JTOA 1FD2A 2MXYA 2DO0A 4J9VA 5CYJA 1QSYA 2VD3A 2MZRA 4BLGA 3J7ZT 1JNRB 1WC0A 5F8JA 1N5VA 4HVZA 1OQ6A 2KM8C 3QATA 2Y1JA 1VC0A 3TR5A 1BD6A 3FCWA 3PKMA 1O8BA 2V9KA 5DO2A 1X4AA 1OIAA 1M5HA 1CJUA 2MGZB 1P6TA 8AT1B 4PEOA 2O01C 1VHFA 3DOKA 1YSJA 4WPAA 1U7LA 1HA1A 2MJNA 1RAJA 2BQ3A 3BQ1A 1PAUB 2DIUA 4CM2A 1XMQJ 1IKVB 4JI3J 3KOAA 2XSFA 2PA3A 3NXZA 4WKRA 4B3OB 4O4GB 3JQMA 4IG3A 2KXHA 2LMIA 2JEJA 1S72S 2OHDA 2HPUA 3I56S 1WDDA 1S1XB 1JLGB 2QLBB 2HKEA 2V68A 5KG1A 2V8VA 5KFWA 1S6OA 3GIMA 3L09A 2VFUA 2I5JA 4IG0A 5ETOA 3PIOQ 3V4IA 4PAAA 4FYWB 1ITPA 2RQ4A 2VH7A 3NS5A 3ZZOA 3SFUA 2N4CA 3H25A 3TI0A 5A8RA 2ZDOA 3CD7A 2G13A 1XN9A 4TQRA 4FBUA 2IRYA 4HT5A 2R8GA 4TYAA 1T9TA 5D4PA 4RBTA 3TJAA 2YQ0A 3MI7X 5T14A 1Q16B 5A0YA 1KVKA 1LWEB 3BGUA 2ZH1A 2K06A 4ZVSB 1MWZA 3UVJA 1NCLA 4NLRA 2UVWA 3U1MA 1SH0A 5HBMB 4ZN3A 1TFWA 3PACA 4I6YA 4NI2A 2CJAA 4GVBA 3BDEA 1RT3A 2D3ZA 1LWCB 2MB0B 1CC8A 4ZP6A 1YJVA 4CT8A 1NO8A 2NXCA 1TL7B 5HO4A 3M8YA 3JYTA 2H3EB 4GC6A 1KLNA 1R0AA 2HNZA 1VLOA 4DR5J 3HHDA 3TZZA 2V69A 2LQ8A 2KRRA 2FYXA 4GO5X 4TY9A 1KFSA 1E6YB 4U67Q 3D7SB 1QJHA 2JZ5A 3U7JA 4MKVA 5K20B 1SVDA 4WFZA 3O6QA 2VDIA 3MPWA 3LP0A 4CLWA 3KLFA 1Q8BA 1PSDA 3EGWB 3BGFA 3RB3A 1JJHA 3SCLE 4CQ1A 4DLGA 4ZJLA 2AYEA 1ZM9A 3C16B 4PYAA 2Q3PA 2DNMA 4PABA 5IQQA 1UJ6A 6AT1B 4KE5A 4KHPF 1WEZA 1MSWD 4MJKA 5G0RB 2YBVA 4F04B 5CYQA 3VGUA 2DO4A 1B7YB 4HYKA 5J2MB 1RHJB 1YBAA 1TR0A 3EPIA 4DR6J 2HHVA 3KTQA 1TV6B 1Q95G 3W62A 2OMOA 1B4SA 3S01A 1P1TA 4I2QA 2R7SA 2P9EA 4OZ5A 4DV1F 1CG2A 1B0PA 2B56A 1MMNA 4FXWA 3QGPA 5EN1A 2RS2A 3A8JA 5LMNJ 2LA6A 1H72C 2C3OA 3R5CA 1A9NB 5FDLB 2GS8A 3ICLA 2ZH4A 1ICEB 2BM1A 4M5MA 1LK7A 3FCVA 2R7VA 4X4TA 3H2VE 2CPFA 4WFBQ 4L73A 3M7VA 1KR4A 2K7KA 1WORA 1RT4B 2H51B 1BHNA 3CCSS 4LRFA 1KN6A 1VCTA 1IKVA 4DDFA 5MAOA 2BW2A 4G6VB 2W7AA 1T95A 2HS4A 4O4GA 4WKYA 2JFDA 2JH3A 3NEKA 1S1XA 1B0VA 1JLGA 4L3NA 4KPCA 3GIRA 3PKYA 1CSJA 2QGFB 1GNKA 5KFOA 5KT7A 4DR4J 4DR5F 4DSLA 1JB0C 4ZS6A 1WD6A 2ZH9A 2VBYA 3A3OB 4L74A 4NLPA 2B5JA 1QUVA 4YOEA 3MOZA 1PJ6A 4CM0A 3DOMA 2DGXA 3CDWA 5KOXA 4F4WA 3MEEB 4TKTA 4D3HA 1I94F 1IJFB 2UXBF 2MKIA 2EFNA 3MEGB 3M2VB 1Q8KA 1H7WA 2D1CA 3DGVA 4PG5A 1DJ0A 5AE1A 2MQPA 2DR7A 1LWEA 1R89A 3KWMA 3TEHB 4KAIA 4FN5A 2J6SA 2DRBA 4ZITA 2X51A 2V8PA 3GU0A 3D1OA 1JX4A 1KQSR 2EFQA 4YS2A 5LT5A 2HQ3A 2VPWB 1LWCA 1P8GA 1KNZA 2EFVA 4DFKA 3LAKA 1ZYQA 4NRUA 4AUKA 1TL7A 3BBFA 3KK2A 5B0DA 1OSCA 3UCUP 1AFJA 4W4MA 1ZH5A 3UCZP 2C1EB 5GAEU 4F26A 3PFEA 2E5JA 2IC3B 2DITA 1CS4A 1E6YA 2B7CB 2CQHA 4J9RA 3D67A 3FQKA 3L9ZA 4PYDA 1CQNA 2HQGA 4O3NA 3R5BA 5KG3A 3QMQA 1I51B 1GAOA 2AJ1A 1X31C 1RLDA 2XYPB 2BZ2A 1QY7A 3T5KA 3CWJA 5KFEA 2E7WA 4QWBA 2GAGC 2ZC3A 3NP5A 3C16A 1C0TB 3T3FA 3H5YA 4NLYA 1T11A 3D68A 2VV5A 4KH1B 4OJHA 5KFDA 4WIQA 3BF4A 2GJIA 1RHKB 2XULA 1HQEB 2OUGA 3F73A 1URRA 2DKOB 2MJUA 5KT5A 4WTOB 3LGMA 5J2MA 4OHYA 2E1PA 3FSXA 3OR1B 3R6LB 1X4GA 1VBKA 2M2BA 2J6TA 4XTTA 2MLZA 3UNGC 1TV6A 3P96A 4IH6A 4M5JA 3TUJC 2ZUAA 3LGHA 1TU0B 4U8YA 4TY8B 3BZQA 5KFGA 3HT0A 1VQMS 2PA8D 2VFTA 3IO1A 5J2PB 4QQBA 4YR3A 5ETSA 5FDLA 4DS5A 4HDHA 4MK9A 5CD4H 1FRXA 1D8ZA 2AP6A 2I6WA 2UP1A 5IM0B 2UV8A 2PEHA 4Q44A 2IJNA 4NZ6A 3IWXA 2XO6A 3ZZ0A 3R5AA 4USIA 2WSFC 4ALZA 3TUZC 5BXIA 1RT4A 3MURP 5C24B 4MKBA 4F2SA 4K4UA 4KB7A 5M2UA 2UUTA 1NJXA 3DM2A 3FBFA 2O66A 3E2EA 3TUPA 2LEBA 1QUPA 3CDBA 3H7HB 2YNGB 3C6UB 4N56A 3CCVS 2PDAA 3HXMA 4EWTA 2KFNA 3AB4B 8RUCA 4MKAA 5LJ5Y 5LM7E 2Z0GA 2APOA 2BBEA 2ILZA 1UEUA 3W9HA 3I55S 2SXLA 4I67A 2RDDA 2EWHA 3TOQA 1PILA 2CPZA 3GV7B 2F9DA 4CLTA 2F8EX 1F9HA 4IUFA 2GIRA 3G8QA 2AJFE 1GXUA 2C2KB 2ZVIA 3MEGA 3M2VA 2EFPA 2HS3A 2XC9A 3OTBA 2LECA 4WYWA 1F9FA 1R8BA 5KFQA 4Y2CA 5LXRA 4DV2F 4CO1A 2OEKA 4K2JA 3GJSB 1SKSA 4PWDA 1XNRF 9RUBA 2R2SA 1IBCB 2G0CA 3L7PA 4OYAA 1Y9OA 2VG6B 2J6UA 3O3LA 3LP1B 5T7LA 3HDSA 2W24A 3BBBA 3MDFA 3NG8A 4YHHF 3MUVP 2LQJA 2XHWA 4OYPA 1FRKA 1FJGJ 3SCJE 3T41A 2CWXA 2VKZG 4M5IA 4DPWA 1JXLA 4IR9A 3AODA 1BWEA 2ZHAA 1WOOA 2KI2A 1YWXA 1YRUA 3HCXA 4FBTA 1EIYB 3N6LA 2IC3A 1RTIB 5SZTA 2LYVA 2ASYA 4FVCA 2XI2A 1UVLA 2C2OB 2HSEB 2JJ4D 4LF4F 1ZTTA 1B64A 4USKA 3IXQA 2V8DA 2VQEJ 1NPKA 1QTMA 4ZLPA 1SJRA 3CVKA 3I82A 4TLRA 3MUMP 5KG6A 4DU8A 1VR6A 2VOPA 3CCLS 4DV4F 3RU0A 2C3MA 2CJYB 4J90A 1HQEA 4OZ0A 1YX2A 2DGOA 4KT0C 2A18A 1O0PA 1YLXA 1TP7A 1S9EB 3OR1A 2DGTA 4KFBB 4B3MF 2WZ1A 1X5OA 1Y11A 3T1AA 3GMGA 3HULA 4A8XA 1S77D 4PG8A 2C2EA 3U1LA 4TY8A 1I6JA 2XG8A 5DM7Q 7AT1B 4LF9F 1RAGB 1J5EF 3GILA 4EFAC 5J2PA 2BW7A 1FO1A 3CJQA 4RW8B 3B4DA 1X4BA 2NZCA 1V3SA 3CIZA 3O1LA 4RUHA 1QE1B 3BEGB 2HHXA 5L1LA 3KHGA 1TUWA 3RJMB 1RXOB 3CCUS 2D3OR 3CJSA 4AXJA 4DFMA 3EMTA 4O0NA 1S48A 5DQHA 4DV0J 1HYSB 2X1AA 1YHQS 3RBZA 4IOBA 4ES2A 4XAKA 4OI1A 3N4WA 2E5LF 1VQ7S 3F41A 2FHOB 2CQBA 3THVA 2HBZB 1HBUA 2W9CB 2MZSA 5HLFB 1S9GB 4BHQA 3JTPA 1Y3KA 4DR1J 1IKWB 4CLFA 4G1PA 3C6UA 4R5PB 2HRTA 2VFVA 3D2WA 3AQPA 4IQXA 1JKHB 3JAMU 1UPPA 2KG0A 1EJ7L 2F3JA 3RW6A 5HANA 1X9WA 2IM2A 1SH3A 2BA9A 4OX7A 3KHLA 5LSRA 1RBOB 4K50A 1OPIA 1QAIA 3HT3A 5D3GB 2GGPB 3G4SS 1ZETA 3G87A 1V3ZA 2WCXA 3DHWC 4AQYJ 1ZA2B 3TVKA 2OPQB 4MH8A 1SIWB 3UDEA 1BQMB 1RE1B 2K3IA 3Q8PB 4LR8A 1VRTB 3LP1A 1NK4A 4MT1A 1U49A 5K5MA 3K5NA 4J9PA 4B3TJ 4PKDB 2VA3A 2NLWA 2VIHA 1XC9A 4HTIA 2CPEA 4KTQA 3J80U 2VG7B 2F1FA 1D0EA 4ZPCA 2JEGA 1A0OB 3NKYA 4M5NA 4OX9J 1T0TV 4ZVHA 3GE9A 1ACMB 4QIWD 3HSZA 2R7TA 1ZBTA 1IBMF 3KJVB 1WJ9A 3CC4S 4LF5F 1GQEA 1QTNB 1R27B 2LEPA 4DU7A 4CLSA 1DRZA 2LFVA 1FFWB 3MR3A 2O67A 2WVFA 3QFWA 1WTBA 2YNIA 3NCQA 3AD7C 2KG1A 3B82A 1Q8IA 3NGKA 1WG4A 1NK9A 4RW6A 1U45A 1RA7A 4ZHRB 1WHXA 1RWUA 3HO1A 4M8LA 4K4SA 1KHVA 3RTVA 3TVYA 2VPXB 4ECTA 4BWMA 3MWBA 5DJBA 1L3SA 2JFKA 4DQRA 2R2RA 3W66A 4U96A 1T8EA 5HMWA 3NNAA 1V5IB 3RBXA 1S9EA 3AH6A 3EICA 3DCAA 3QIPA 1N34F 4CZCA 1U09A 4KFBA 4CT9A 5D15A 1TKTB 1S9FA 2AJ4A 2Z8QA 2CAJA 1VQOS 1SQFA 4O4RA 1SQEA 2PC6A 5F0UA 1HPZA 1UFWA 4DV3J 2GNKA 3PHEA 3RBEA 2ZH5A 2IIHA 5KT2A 3DRSB 2ZEJA 4QPTA 1R3NA 4PWUA 3DKDA 4MFBB 5KFPA 2DIVA 3WIUA 2XS2A 3ZFVA 1U2FA 2B4VA 3K0JA 5KT6A 3W8GA 5E41A 3JSMB 3MCOA 4C8LA 3NNCA 4A8FA 3B78A 1HMVB 5K14A 2J0SD 1ZPWX 3SIPB 1HYSA 1ZM3A 2YX1A 3CDEA 2VF3A 2V34A 3ITHA 1Z4UA 2A0FB 1EZZB 4X66F 3UD4P 3QBCA 4DF4A 4DSJA 3NAHA 2W9CA 4DG1B 2HBQB 2F4VF 5HLFA 1NHVA 3MTJA 2ZBIA 1IKWA 4L3KA 2QL7B 3V6JA 1EHWA 3TO8A 1KKHA 1FNMA 4B3SF 2CQIA 4V1Ak 1F5AA 5CA5A 3H59A 1HI0P 3KG0A 2VL1A 3MAAA 1JKHA 4FS2A 4ZOSA 2GQQA 2FLLA 3BS9A 4U7UD 1GXLA 5IWAF 2HFUA 3UI3A 2D3O1 3RR8A 1YK9A 2V63A 2V0NA 5HROB 1S4FA 5D3GA 4OYOA 2Q6BA 2GO8A 1TVRB 1X4DA 5KFIA 2EVZA 2OPQA 1RB0A 3MCSA 2CXEA 2UUAJ 3D28A 4LF6F 4DJBA 3W5ZA 3X1LB 1WTFA 2J76E 3QJJA 4KC5A 1NK0A 2YVSA 1BQMA 3PM9A 1NRKA 3D1QA 2BYCA 2GC8A 2HIQA 1VGYA 2YNHB 3G6YA 5FD1A 3J7AN 2BKOA 3MM5B 4PXBA 4YDXA 1VRTA 3VGSA 1LEOA 2MKCA 2WBRA 1YDLA 2VG5B 2W01A 4PCQA 1KFDA 3E51A 1NZAA 1HBNA 2YWEA 2E1MC 5F8IA 5L9XA 1N5QA 1C1BB 2FDNA 1VIXA 3OTOF 5HVFA 1F6TA 1NKCA 5KTQA 2FJDB 3OSNA 3EVMA 2DGWA 4IFVB 3KJVA 4WU2A 2XLJA 1R6YA 1K0VA 2B4UA 2OEJA 3DFEA 1REVB 5RUBA 2ZZMA 1C2PA 1W26A 3PG9A 4OHWA 3D5MA 1FTRA 4ER8A 4KIAA 4RW7B 1VBZA 2M52A 4OJ1A 2DNOA 1Y5NB 4NYOA 3M05A 4X64F 1MMLA 1M1GA 2J8AA 1J5OB 2MQNA 3IGVA 4ZIVA 2L9NA 2DY9A 1Q8LA 3BN7A 4Y3CA 3J81j 2J8SA 3LA0A 4LJMA 3Q23A 4QJVA 1CLFA 3CO9A 2HHWA 5F3TA 3QT7A 4MYUA 2HBYB 3PZPA 3RAQA 2ZH2A 4Y00A 3BH6B 3VWSA 1NDKA 2KJVA 3VR1A 1TKTA 1MROB 3D3BJ 1QAYA 2DPJA 3IM9A 5KG2A 3QRPA 2XS5A 3CD0A 4TU9A 2MZQA 4YQWA 3NCPA 1ZA1B 3MMAB 2BE2B 2JC0A 1WUUA 3M8QB 3DRSA 1KOHA 2O1PA 2EG2A 1WI6A 3M1VA 2CPXA 4ZPWR 1S1UA 1VS3A 3OHBA 3R5JB 5IFMA 2EKYA 4LF8F 1RCXB 4YN3B 4E8UA 4OYBA 1SJFA 1HMVA 4UZBA 3CJRA 5BYQA 2V50A 3R9LA 3W63A 1VQ9S 5CCMA 2DGUA 4HLBA 3P8BB 2QSFA 4LFBF 2Z2ZA 1WC3A 2AEJA 2FHKA 2B3TB 2AT1B 2IM0A 4DG1A 4OI3A 4JB8B 3DNCA 4KHMA 4H4OA 2IAJA 4Y6IA 1IKYB 2C3UA 4CYUB 3FMBA 4YB5A 3RB6A 1S1VB 4USVA 1A6LA 4JI4J 2ZBPA 5KFNA 5DM6Q 5HMYA 4RWWA 1VQKS 1B0TA 5KFYA 2GV1A 1EKRA 2R7WA 1SXLA 9ATCB 2QMWA 2CVEA 4WK3A 4JI0F 1DURA 5HSPA 3ILLA 5HN0A 2GJFA 1JLCB 1IKXB 2HHQA 2CNKB 3D3CJ 2XHCA 2GVZB 2R8HA 2CQ3A 1HNIB 2EW9A 2CJ9A 4WIIA 1EX8A 5KFJA 4ECWA 2J7WA 1V3RA 2YNHA 2PIIA 3B6BA 5C2CA 1AZSB 2HLTA 1L3VA 3D4JA 3CJ2A 1N32J 3EWGA 3GPAA 3OT9A 1RT7A 1LFPA 4K4XA 1HWIA 2J0XA 3OVAA 3MAQA 4QCLA 3PR5B 2CNOB 2MKJA 2KFZA 4Y2IA 4X62J 2CPYA 4ED5A 2UVRA 2HAFA 4ECYA 2B6AB 4IFVA 2AZ1A 1WG1A 5M2RA 4H54A 1OO0B 4ELVA 4YY3F 1URNA 3GSDA 4NZ7A 2DHAA 1REVA 2RKIA 3TA2A 4OI2A 2FJEB 4FZVA 3K59A 3VAJA 4ED7A 1JNZB 4CO2A 1YJRA 1FVSA 3MHYA 1IM6A 1R6VA 1C4AA 3MMBA 1HNXF 5E3CA 1PYOB 3NWGA 1P9QC 1N6QB 2XS7A 4DR7J 3CJ5A 3Q86A 2GHVC 3IS9A 4I56A 1GXTA 4P6QA 2BJ7A 2DD8S 1TUVA 1C0UB 3EX7B 4QIGA 1FXRA 4CLPA 3KLEA 1XNQF 2RRBA 5HQLA 2L3MA 2IM3A 1VRQC 3M8SA 1HI1A 3EXCX 5A76A 4OYXA 4IO9Q 2VASA 3PJXA 2B0GA 2JLGA 3D9BA 2D9PA 4HHUA 2J5AA 2B4PA 2GA7A 3U02A 4LREA 3TZYA 3NY0A 1BXNA 4IYQA 5JVGQ 2W9BB 2EG1A 3VVUA 3IC1A 3HX9A 3DRXA 3MUTP 2VFRA 4NYPA 4ILMA 2PO4A 2IBOA 3CJTA 1NMEB 3I32A 2BE2A 2ZJQQ 1UEVA 2DEJA 3RAXA 3Q22A 2IBKA 2E9ZA 3PW5A 2K3KA 2Y0BB 3CPWR 3M8PB 2DYAA 2Z56B 2D41A 2X1BA 4J91A 1T9VA 3WBZA 4QOTA 5HVHA 3MMJA 2AX0A 3FEYB 4DWIA 2VA2A 3UW1A 1VDHA 3GWCA 1W2BR 4JI5F 3EUNA 4DV7F 5I42B 1M5VC 2MLYA 2WB4A 4DX8H 4M5HA 4PG7A 3Q2TC 1XTZA 1VHIA 2FVSA 1WELA 2FUG9 2GVDB 2PE8A 3DDNA 3HPOA 4CYUA 3QZ7A 1S0NA 1S1VA 2IMOA 4BC9A 2HW3A 1MWQA 1WF2A 1OSDA 2COLA 3E01A 3SXLA 4DF8A 3RAMA 3G6ES 4K59A 1HHSA 4K4TA 2OPSA 1XR5A 4K0KJ 5A8KA 3F0NA 1KBRA 3QRRA 1CC7A 3NS7B 2BEFA 5IT4A 3W60A 3GG1A 4ED1A 3K89A 4YEAA 2FD2A 1M1KT 1IKXA 4JI1F 3I0SB 3GQCA 3HVRA 2GVZA 2DISA 3EYZA 1HNIA 2YWGA 4DS4A 2VC0A 4ZPAA 3CJKB 4GKJF 1QVGR 1XEZA 1WHYA 6FDRA 1P1LA 1IXKA 4I6WA 3ZZYA 4DV5F 4B9LA 1AZSA 2CQ0A 4MIWA 2XCPA 4ECSA 1Y4ZB 2HK2A 3FCHA 1MMDA 1EAYC 5J2NB 4QBUA 2HVIA 1WDTA 2FJVA 3HKZD 1VIOA 2ZH7A 2A10A 4HH1A 2V8GA 2A6MA 4RNFA 3TEGA 1H2TZ 5L38A 5BYRA 4A8KA 4X4NA 1WACA 2V4QA 2W7PA 5E33A 1YRTA 2B6AA 4DN9A 1H74A 2P6SA 2GJ2A 2UV8G 4DV6J 4P2SA 2UXDF 3T5JA 1VK3A 2XY7A 3AB2B 1RTJB 1IBLJ 3ZNJ1 1AW0A 1LXNA 1WHWA 3FEZA 3RB0A 3M30A 1GMUA 1N6QA 4K8RA 5DZ6A 3VHQA 2PMHA 3PEHA 2C3PA 5KFHA 4WFAQ 1G3OA 4K4WA 2ZJPQ 1C0UA 4OQJA 4R25A 5KFKA 3Q8QB 5K8PA 1TAUA 3KDOA 2VPYB 4R0JA 5CD4A 5KG7A 4DPYA 3OR2A 1XBWA 3SDEB 3PHTA 3GYXB 2KYXA 2YKNB 4FS1A 1RTZA 1YITS 2M70A 2PFDA 3AJ2A 2HGLA 2KB2A 3BR8A 4IFYB 2W9BA 1JJ4A 1BY9A 3ILJA 1MN7A 3K58A 1N36F 2C22A 2BXJA 2XNQA 4DR3F 1ZM4A 2ILYA 3T5LA 1NB7A 2Z4PA 1VQ6S 4F02A 4NCBA 2ADCA 4LFAF 3M8PA 4ENOA 2W4CA 4Y65A 4JI6F 4CH7A 4MKYA 1VOMA 4W98A 3OXGA 4JV5J 1UKUA 3GZ7A 4U95A 5LMUJ 4WXWA 4NXNJ 2HVHA 3MGJA 2R7XA 1HBMB 1GTHA 4NLVA 2P9GA 1Q82T 2WRMA 2B9XA 1NKBA 3LP2B 1KQKA 2J9EA 1HNZF 4DLEA 4HKQA 1WF0A 3FKBA 3S7RA 2J7UA 4ZP9A 3BB5A 1S6UA 1OY8A 4EZ9A 1KEKA 2GVDA 2WVEA 1AXQA 4NZ0A 1T03B 3KJQB 1WC1A 5A8WB 2CRLA 2MQ8A 3Q8SB 4DUYJ 1TK8A 1OWXA 1RYRA 2RUSA 2OTLS 4IRCA 1VQ8S 2BUNA 3DYAB 2UUBJ 3N79A 2EBGA 3OTEA 3OUYB 1S6QA 2OMLA 4V19J 3OVSA 1Y0HA 3FC9A 2KKHA 1T7PA 3G6VA 3N01A 2RDIA 5KOWA 4HDGA 1K73T 1FNOA 3RRKA 2G2YA 3IBCB 2UU9J 4AT1B 4NEZA 3HMJG 2DR8A 5M2PA 1BQXA 3I0SA 1IVZA 2ZOGA 1K1SA 3HLUA 3LF0A 3CJKA 1BWVA 4KBIA 2ERRA 4C8ZA 3M9NB 3LH2S 1U2CA 4WFNQ 1RAIB 2N7CA 2R42A 2RU3A 1KLMB 1XQIA 3MZIA 2P2CB 2DEIA 2FB0A 2HBRB 3N6MA 1H98A 6FD1A 2HEKA 1XMOJ 4RL1A 3UCGA 2LU2A 1ZZNA 2VQFJ 1N4LA 2NR0A 2W1BA 1BQNB 2OJ3A 1QSLA 2RE1A 2H4YB 1RWWB 2NCKL 4N8OA 4F4KA 3JAMY 3R7BB 4NLDA 3R1HA 3MECB 3G9CA 4RUCA 3MM8B 2DGSA 4JI2J 3L7OA 1LNQA 2HNDB 3WX4A 4J5OA 3EXYA 2ACYA 4DR2J 4GKKF 4JI7F 1JLFB 4Y34A 3VALA 1WEXA 2MZ1A 4ZDNA 4PUOA 3HFVA 4DSEA 1RT1B 3OL6A 3WZ0A 2JLFA 3M8ZA 4FYXB 3NGRA 2JX2A 1TKXB 1M5KC 2OSQA 3KNAA 4PG4A 2ZH6A 3C2PA 2QLJB 4DL7A 4RW9A 4TN2A 2ZOMA 2G2OA 3H42A 1NJIT 4CDIA 4ETXA 2HHHJ 1R8PA 2YWWA 5E3RA 1F0XA 2ADBA 1H7XA 3J80Y 3UWTA 4ITSA 1IM4A 4NWBA 3V6HA 2H4WB 3ISNC 3IR6B 3DDIA 2KHCA 1FERA 2QYCA 4NPOA 1S12A 1SH2A 3J81U 2DNPA 2AJ2A 3T6JA 2B8QA 1UW4A 3ENQA 2WOMB 1I5OB 2BM0A 2HHSA 4B9UA 4OLOA 1NJWA 1FXDA 2RF2A 1Q53A 4F4AA 3P5TL 3IRXB 4LFCJ 4RBVA 3R5DA 2CJXB 3PIPQ 3KMSA 1SJ1A 3R2DJ 4WP8A 3PX6A 2QA2A 4H4KC 4F67A 4QW8A 3UPFA 1HBMA 3PRDA 1FI4A 4NA3A 1YVFA 3W9IA 4DX6A 2CJKA 4DZ6A 1JJ2R 1IR2A 2K7JA 4GVLA 1TUGB 3V4IB 2FC9A 1KSPA 1PJ5A 5CH7B 5KFTA 4DUZF 4CP5A 1SV5B 1X7VA 2KDOA 3BO4A 3VF0B 3TZWA 4WWSA 1U24A 5A8WA 1GFWB 3QLHB 2I8EA 3GTYX 4K7QA 3GYGA 3H90A 5A0YB 4C8KA 2JEIA 4Z2XA 3I31A 3UVJB 4ZLNA 1XJWB 5CYMA 5KG5A 2V2QA 3DYAA 1CJKA 4NXMF 1VQ5S 3G86A 2HS0A 1FEHA 5LSOA 1SB6A 4ZVGA 4XDCA 3IAM9 3KJNB 2CQCA 2D9OA 2F8MA 5JUMA 2Z57B 5CZVA 2Z30B 4C8MA 4NYZA 3A12A 5IXUA 2EC2A 1VQNS 3OVBA 3BYRA 1SKWA 3K57A 5KFUA 4I4BA 5F8MA 3T1HF 2B43A 3HI9A 2HFNA 1VBYA 2EK1A 4QIFA 3RUBL 3W65A 2HFSA 2BJ3A 4URQU 2FGCA 4JYAF 2KL8A 2LKZA 3MD1A 1HD0A 2I0XA 1KLMA 2BJ8A 7FDRA 5D4LA 3VVTA 5HMXA 2M4MA 4F36A 5F3ZA 2Q43A 2FQQB 3BH7B 2Q6CA 2H9ZA 1BQNA 4WZMA 5L1IA 3NAIA 4O3PA 1N52B 4UTGA 3TJ9A 4ZCMA 3E8OA 1S1TB 4UZCA 3MECA 2F7VA 4O3RA 1RJJA 1WG5A 4S0MA 3MM8A 4X65F 5CYQB 4IO1A 2LQ9A 2MLXA 2U2FA 2LA4A 1IBKF 4M5LA 1RAHB 4CLLA 3EZOA 5LJ3Y 3DOLA 5BYSA 2I38A 4MK7A 1Z2LA 4I2QB 4QR0A 4ECVA 5L39A 3K7RA 2QJ3A 1FK9A 2YKOA 2MKHA 3IP0A 2YQ3A 2OPRB 1U26A 1RT1A 3DRPA 3JXOA 4P2MA 2WTFA 1UVNA 1BE4A 3GFZA 3T6BA 1CBKA 2CKWA 1TKXA 3JSYA 4IH5A 2J9CA 3DLKB 5D4NA 5ETMA 4NL5A 4QWDA 5GAHU 2DNKA 5HQMA 4G1IA 2RQMA 2MPUA 3BKFA 3VAHA 3CD5A 3TW0A 4O44A 1S76D 4HI1A 4KHPJ 2F65A 2I2YA 2YX7A 4OZ3A 4XPEA 4PPZA 1W25A 4LT6A 2NXUA 2Q79A 2W2QP 4OZLA 2KXNB 2CWKA 2JWNA 2QC3A 4WP9A 1LWFA 2WOMA 1SL0A 4R8UA 2R4FA 5LOQA 4ZVPB 2EI5A 4ICLA 3HJFA 1N54B 1HNWF 3IRXA 2QYGA 1R8CA 3GLJA 1UA0A 4LRDA 3TX0A 1AA1B 4DV1J 1NSPA 4OHVA 1RAFB 2RILA 4KQZA 4DQQA 3UDLA 2N7YA 4ED6A 4IOAQ 2CQPA 5J1EB 2NPIA 2EKNA 1IN0A 3HHLC 3LGNA 2B5JB 2LXIA 4LF1A 3J7YI 3CB4A 2ZHBA 3DOMB 3ZZTA 1SV5A 4J9UE 1REGX 2FJWA 3I6PA 3V5RA 3QLHA 4KO0B 1FHTA 3KUEA 4FXDA 4LBIA 3HSGA 4MMOA 4FKXA 3VV2B 1FJCA 1SJ3P 2M3DA 1UFKA 3KHRA 3AD9C 4EMDA 2J0QD 4OHXA 4F0KA 3T9NA 2GFFA 3BSNA 4XO0A 3IR5B 3TRGA 1QAJA 3Q83A 1PYSB 3NOGA 2VBXA 4QWAA 1T9YA 3KK2B 1UJ5A 1PYTA 1Q5VA 1Y10A 3CMAS 5GAEI 1CS4B 1BGXT 1T05B 1YTYA 2O5DA 2XMMA 4A8MP 8ATCB 1Q7LB 2J0WA 3B54A 2QV6A 1KC8T 1I94J 2UXBJ 1O51A 2R7QA 3CMQA 1M5PC 3NWRA 2VPZB 2WW4A 4JI8F 2ZM6F 4X2BA 5GMKa 2B7BB 3RGIA 3D54A 4LRCA 3OLAA 1JJCB 4L6V3 4EYIB 3M6VA 5ETKA 2N82B 1S1TA 4C3LA 4ED3A 2XMJA 4HT7A 3MR2A 2M7SA 1RQ0A 3BPSP 2GCFA 4XIUA 2UXCF 1RISA 2YNFB 3KLHB 5E3AA 3KLIB 4QWEA 1Y5IB 3FBBA 4FP9A 4AD6A 4URGA 4Z7CA 4UUWA 3UQSA 1YZ6A 2BRLA 2OPRA 4WE1A 2C2NA 2QLXA 3QWPA 3V6KA 2AYMA 3DLKA 1OQ3A 2AZ3A 4F0MA 4LF7F 2MZJA 4ILLA 3OFGA 2YY3A 3CDUA 3QJPA 2NUUG 1H73A 3M9MB 1F2HA 2G0JA 1OJ4A 3O2IA 4UY85 4K5RA 4J9NA 3C15B 2JHEA 3MFHA 5DGBA 1SUQB 3DM2B 1SJQA 1NJYA 3TARA 2BR0A 3TQ1A 2E5GA 1UWAA 5AXKA 1TL5A 1VK8A 1RZMA 1SCJB 3V81A 1RAEB 4PWWA 2CQDA 2C2ZB 1LK5A 1K47A 3G6XA 1FKOA 2KO1A 3QGHA 2G4BA 1X60A 2IDEA 2LXUA 2E66A 2XO7A 4TU7A 1KRPA 5J1EA 3PYFA 2E1CA 4ED0A 4ZVTB 2XQCA 4OIXA 2GHWA 5D8HB 4BCAA 1H6KX 2YKPA 3PW2A 2DNGA 3V6DB 3KLVA 2V2KA 2Z2YB 3KLGB 4ZVRB 2VFSA 5B0BA 3ETMA 2MKKA 2OELA 2RB7A 2ZNZA 1LKZA 1MU2B 4KO0A 3H40A 2AD9A 4RKUC 2PFFB 2QZ8A 1HQUA 1S4EA 4PWDB 3IRWP 1HBOB 1FFSB 1S1WB 1JLQA 2LQBA 3AXKA 4E98A 4ILRA 3M6WA 2V4RA 2F40A 3UR3C 5T7LB 2CQ4A 1RAOA 5J1PA 2AGOA 4MK8A 5EX0A 1WEYA 1HKAA 1KQGB 4USUA 2OSRA 3AXMA 1FCAA 4XDDA 2C2DA 2AHOB 3W5YA 1UWBB 5GMDA 1RACB 2ATCB 4RO0A 4DBQA 4F25A 4L76A 1UL3A 1T05A 4DPTA 1EB0A 4PXCA 4DHVA 4DZDA 3AOCA 1L5UA 4M95A 3GIIA 1GT8A 3R27A 4P75A 2VJUA 4KV8A 1UVJA 2ALYB 1KP6A 4ZVUB 5L1KA 1JLEA 3MM9B 4DV2J 3ZTQA 1UPMB 4FYYB 2VICA 1VBXA 1XNRJ 1Q79A 3OTDA 1G6BA 1TL4A 5HK4A 3OSPA 2V4JA 5DDPC 4ATNA 2DGVA 4LQ9A 4OJ3A 5KFZA 3ADAC 4YHHJ 1TQLA 4AE5A 2ASLA 3D6FB 1WKLA 5KFVA 4PZVA 3L4BC 4ZMMA 5K8NA 1RK8A 4ID5B 1N48A 4NE9C 1BMQB 2DHSA 3T1YF 4JV2A 3KKFA 3UDVA 2YNFA 1XIQA 3O44A 3KLHA 5AT1B 1M90T 3KLIA 5BJRA 4ANCA 4KGMA 5KFBA 2B9WA 3SYZA 4CLUA 4OI4A 3CCTA 2NXEA 4E2FB 1S57A 2AW0A 2MHEA 3BYPA 2Z2MA 1YJUA 4LF4J 1APSA 3IFEA 4M5DB 1FRLA 2RRAA 1VRUB 1U2RA 4USHA 3NGSA 3T9ZA 2OIHA 3KG4A 1RSCA 1LW2B 2C28A 2BVZA 3P3DA 2FVQA 5CABA 2RT3A 4ED4A 1HI8A 2DNYA 4NA1A 3DLEB 5F0WA 4X4VA 4OX8A 4N8NA 2KZMA 1G7CB 4DL0C 1QM9A 1ZPVA 3FK4A 4DPUA 5L9NA 2LLZA 4RX6A 1FX2A 3WHIA 1C1CA 4X4UA 4DV4J 4O3QA 3C15A 2HAIA 2OD6A 4GMKA 3UE2A 3OJSA 2V2ZA 4ZPTR 3M2UA 3B8HA 1HQ2A 1SUQA 1L3UA 2WK4A 1DZ5A 1HBUB 2DT9A 4FYVB 2BABA 5DRKA 1BC6A 2HZAA 4HTJA 1HHTP 4B3MJ 2D74B 5CAAA 2HFZA 3I87A 2J9DA 1T3OA 3NOCA 2IVFB 4RR5A
chains in the Genus database with same CATH topology
1CC8A 2RRBA 3CCRS 5AE3A 4ZP6A 1YJVA 1NK7A 2L3MA 1RTHB 4AQYF 2AYBA 2V9WA 1RT2B 5AE2A 1B7FA 5K8OA 4CH1A 4CT8A 1NO8A 3BO3A 2IM3A 3M8SA 1H2UX 5HO4A 1HI1A 4WCEQ 3JYTA 2XZWA 4ED8A 1U1NA 1X5TA 4GC6A 2DGQA 3EXCX 5HI7A 1KLNA 3PR4A 3NBPA 1R0AA 2HNZA 4IO9Q 2VASA 4DL6A 3PJXA 2B0GA 2JLGA 3HHDA 3N0VA 3DLGB 1Y5LB 5GADU 2D9PA 3V6DA 2J5AA 1UVKA 2KRRA 2B4PA 2GA7A 5CQGA 5B0EA 3U02A 2W8LA 1KFSA 4GO5X 4TY9A 4I2PB 3KLGA 3LW5C 3SSQA 1E6YB 4IYQA 5JVGQ 2OP5A 2W9BB 3ENVA 4U67Q 1S9GA 2EG1A 1Z2ZA 1QJHA 3AQOA 5B0GA 1FF2A 3IC1A 3M6UA 4OZNA 5EX3A 4FNHA 3HX9A 4B3TF 2JC1A 2JZ5A 3DRXA 3U7JA 3MUTP 2VFRA 4NYPA 4X4PA 4R5PA 2OKQA 1MU2A 3UFCX 4ILMA 3VZIA 3TAQA 2PO4A 2IBOA 4WFZA 3O6QA 2OO4A 3JSBA 3MPWA 1O5JA 4OX6A 1S0OA 1RT6B 3LP0A 3I32A 3KLFA 1ELOA 1Q8BA 3DOLB 3OL7A 2IMWP 1KS2A 1HBOA 1PSDA 2BE2A 3EGWB 4LSNA 4YUDA 2ZJQQ 1UEVA 3BGFA 2OPPB 3RB3A 3RAXA 1JJHA 1TKDA 1H38A 3D1HA 4XPCA 3Q22A 3SCLE 2IBKA 3PW5A 1S1WA 2E9ZA 1WHVA 4OX9F 2K3KA 4CQ1A 5D6GA 2AYEA 4DMZA 5B08A 4DLGA 3CPWR 1ZM9A 4DOZA 3M8PB 2M0GB 2D41A 5E2QA 4EU0A 4W92B 1FK9B 3GR0A 3OBIA 2Q3PA 1D9AA 2X1BA 3HVTB 2DNMA 5DG9A 2CZVC 3DRPB 3WBZA 4QOTA 3MMJA 5IQQA 2YWHA 2AX0A 1UJ6A 2FVCA 2Q66A 2FHJD 3FEYB 4A8SA 3PW7A 5H9EJ 3TAMB 2GMLA 3BJYA 3RBDA 4KE5A 2VA2A 3UW1A 4DWIA 2CZ4A 4KHPF 2HG4A 1DQ9A 1WEZA 2DVIA 1UFLA 4IKAA 4OL8A 3ULHA 3GWCA 4RNOA 2GGPA 4A46A 4ELUA 4ZKAA 1MSWD 4MJKA 5A2QY 1W2BR 5G0RB 1UMJA 5CYQA 4JI5F 3EUNA 1C4CA 1UWBA 2DO4A 4DV7F 5I42B 1M5VC 1DARA 4HH0A 4HYKA 1FDBA 5J2MB 2WB4A 4Q7AA 3WC2A 1YJWS 4C98A 4DX8H 1YBAA 3LANA 3I0RA 1TR0A 3CCWA 3EPIA 4PG7A 3Q2TC 1XTZA 2FVSA 5GAHI 1LW0B 4Y0FA 2HHVA 1WELA 1QLNA 1TL1B 2GX8A 1UVIA 3M32B 4NA2A 2FUG9 5AXMA 3I9V9 3POTB 3Q8RB 1QVFR 3KTQA 3LUYA 2LXFA 2PE8A 4O44B 1ROFA 1TV6B 2YH0A 1KHWA 2YKAA 2E7XA 3DDNA 2OMOA 1U48A 3HPOA 3IWLA 3S01A 1P1TA 1AUDA 3QZ7A 2XI3A 1S0NA 2MMYA 4I2QA 1S1VA 2R7SA 2YNIB 3C8YA 2P9EA 2IMOA 4OZ5A 4DV1F 4U9RA 4BC9A 1FJEB 1CG2A 1B0PA 2HW3A 2B56A 2QRRA 2N3LA 1WF2A 4RW6B 4ZCKA 1MMNA 1OSDA 1UP1A 4FXWA 4ZPDA 3QGPA 3VQTA 1YIJS 3QGGA 4WXOA 2COLA 2RS2A 5EN1A 1TK5A 1CEZA 4A8QA 3E01A 3MM9A 1LWFB 4IDKA 3SXLA 2LA6A 4DF8A 4PQUB 2C3OA 2VG7A 3RAMA 4Q5VA 4DL4A 3R5CA 1A9NB 4B3RF 1FJ7A 3GFYA 4R8UB 5FDLB 5KFAA 4CH0S 3G6ES 4K59A 1HHSA 2DNZA 3J7A1 2ZE2A 4ICLB 4C0HA 4K4TA 5HQ8A 2BACA 2EPIA 2YWKA 3ICLA 4NOHA 2OPSA 1XR5A 4DFJA 1J2VA 5A8KA 2ZH4A 2DNLA 2IA6A 1S0VA 4ELTA 3GIJA 1CC7A 3HK2A 2BM1A 4YB1P 5IT4A 3DDKA 1LK7A 4Z37A 3CJ4A 3GG1A 4ED1A 2R7VA 2WONA 2YKQA 4X4TA 4ED2A 2CQ1A 3H2VE 1HR0F 2CPFA 5D8HB 4WFBQ 3EZUA 4YEAA 4DQPA 2FD2A 1LXJA 1M1KT 1Q1KA 2PGCA 5I4MA 1IKXA 1FXLA 4JI1F 3I0SB 3GQCA 1KR4A 1N0UA 3HVRA 3FGVA 2K7KA 5F8GA 1I1GA 2DISA 3EYZA 4DV3F 1RT4B 1HNIA 1YGYA 2YWGA 3JTNA 3CCSS 4DS4A 1SJ4P 4NLWA 2VC0A 4ID5A 1W2IA 4ZPAA 1KN6A 3QIPB 3CJKB 4GKJF 1IKVA 1QVGR 2KTQA 1XEZA 4DDFA 5MAOA 1WHYA 6FDRA 2BW2A 3CTRA 1P1LA 4G6VB 1IXKA 1S6PA 2W7AA 3LPYA 4I6WA 1T95A 3ZZYA 2HS4A 2YH1A 4O4GA 4WKYA 4ZHRA 2A1BA 4DV5F 2JFDA 2YKMA 2BDPA 4B9LA 3VAKA 3ETOA 2CQ0A 4MIWA 4OFZA 2JH3A 5BR8F 2XCPA 4ECSA 2XGQA 1Y4ZB 5KT3A 1HARA 3FCHA 4ECQA 1HPZB 3MAHA 1MMDA 3WDOA 4U6PA 3CD6S 1S1XA 2YX4A 1B0VA 2BOPA 1JLGA 5J2NB 4QBUA 4C11A 4L3NA 2HVIA 2Z2LA 4KSEB 3HKZD 1VIOA 4M5DA 3PKYA 2FJVA 2ZH7A 2IRUA 2A10A 1VRUA 1K9MT 1CSJA 4HH1A 2V8GA 1RDRA 2D7SA 1S7HA 5F41A 1AFIA 4LVNP 5F9NA 4RNFA 1LW2A 1U6ZA 1GNKA 4AFFA 3MOJB 1N33F 1H2TZ 3FZBA 5KFOA 5KT7A 4ES1A 5L38A 4DR5F 1JB0C 5BYRA 4DSLA 4A8KA 4X4NA 1WACA 5IS2A 2V4QA 3DLEA 5KFXA 2QFJA 4ZS6A 3G71S 2W7PA 2QA4G 2FVRA 1WD6A 5E33A 2ZH9A 2VBYA 4NLPA 1DAXA 2B5JA 1F60B 1YRTA 1QUVA 4YOEA 2B6AA 2MKSA 3MOZA 1HWKA 3DOMA 2DGXA 4DN9A 3CDWA 1R43A 3HZEA 5KOXA 4F4WA 3MEEB 4TKTA 4D3HA 5K14B 1I94F 2P6SA 2GJ2A 2UV8G 1IJFB 2XWXA 2UXBF 4DSFA 4P2SA 2UXDF 2MKIA 5GVQA 4X4OA 4ZCLA 2EFNA 3T5JA 3FZ2A 3ITHB 3MEGB 4MAKA 3M2VB 4OI6A 4RWXA 1VK3A 1H7WA 2XY7A 3AB2B 1RTJB 2D1CA 3DU5A 1ZTWA 2HWTA 3GIKA 2X3GA 4PG5A 2FLOA 1AW0A 2OAUA 3V2UC 1DJ0A 1LXNA 1T94A 1WHWA 3FEZA 5AE1A 3K5OA 5DQIA 5GADI 3M30A 3RB0A 2MQPA 2DR7A 1QAXA 1LWEA 3NS6A 3O5TB 2XNRA 3T19A 1R89A 3KWMA 1N6QA 4KAIA 4YFUA 4FN5A 3MTKA 1N56A 1X4EA 2PMHA 3N6NA 3PEHA 2DRBA 2J6SA 2C3PA 4M1KA 5KFHA 4WFAQ 2X51A 2MQLA 1G3OA 4K4WA 1FDDA 1E6VA 3DI6B 3D1OA 2DJWA 1JX4A 4FVMA 1KQSR 4MFBA 2ZJPQ 1FEEA 1M5OC 2EFQA 3M8RA 2MSTA 4N76A 1EETB 1C0UA 3PX4A 3TA0A 5HP1B 4AYBD 5LT5A 4FF1A 4AL5A 1VQ4S 2HQ3A 2VPWB 1LWCA 4OQJA 1P8GA 5F9LA 5EDWA 3K8WA 3NMRA 1KNZA 3DGPA 3JSMA 5AJ3F 3C66A 4R25A 3PO5A 4ERDA 5KFKA 2WSCC 2EFVA 3J7Z5 4J9SA 2CJBA 3Q8QB 4DFKA 5K8PA 1TAUA 1RTHA 3LAKA 1RT2A 1NU4A 2PSZA 1ZYQA 1FRIA 2UUAF 2VPYB 4NRUA 4AUKA 4R0JA 3S1TA 3KK2A 5ITHA 5B0DA 1OSCA 4U7UK 5KG7A 3UCUP 3QWUA 4NMLA 3OR2A 1XBWA 3SDEB 4EYHB 1AFJA 3GYX<