4C4WA

Structure of a rare, non-standard sequence k-turn bound by l7ae protein
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
96
structure length
96
Chain Sequence
TRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Rare, Non-Standard Sequence K-Turn Bound by L7Ae Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
total genus 26
structure length 96
sequence length 96
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4c4wA00
2XS2A 4YB1P 2YH1A 3MD3A 3TYTA 4TU9A 4IUFA 2DNQA 2FPHX 1X4BA 1U6FA 2DITA 4QQBA 3EX7B 5CXTA 2YH0A 3G4SS 3DXBA 3UD3P 3BO3A 4W90B 1WG5A 2CQCA 2CPIA 4WIIA 5D77A 3MURP 4FXWA 2D9PA 3ULHA 3CD6S 2XNRA 2BZ2A 2JVOA 5LSLA 3TP2A 2DH9A 3S8SA 2MYFA 5H1SV 1S79A 1M1KT 4QU6A 5DDOC 2DNGA 4WFNQ 2LMIA 5ITHA 1U1OA 1N88A 2F9DA 3BO4A 3UCGA 2OIHA 2K8GA 4QU7A 2MKIA 3P6YC 1HD1A 4LIRA 2DHXA 3PIPQ 1YJWS 4UQTA 2DNLA 1K9MT 1XN9A 1FNXH 3B4MA 5FJ4A 2CQ1A 2MZQA 5LSOA 2DH8A 1VC5A 3CTRA 2MB0B 1NU4A 3Q2SC 4OZ0A 3D2WA 4C7QA 2SXLA 2LA4A 5DDRC 2LEBA 4TLQA 2ZJRQ 1YTYA 1M5KC 2E5JA 5DDPC 2KVIA 2CQ2A 3UE2A 2DIVA 2MXYA 2KM8C 1NO8A 5LJ5Y 2O3DA 3NS6A 5IQQA 3THTA 4LMZA 1VBXA 2CQBA 5JVHQ 1SJQA 2CPDA 1X4FA 2LKZA 2XB2D 3G9CA 1FHTA 5HO4A 1N54B 5D78A 4FXVA 2Q79A 2G1DA 2CQ4A 2RQCA 1U1PA 2CQGA 1KOOA 3CCJS 3I55S 1WELA 2XS5A 5EN1A 1UFWA 4CH0S 3BO2A 1H2VZ 2J8AA 3G8SA 2ZJQQ 2F9JA 5IM0B 3MOJB 1U1QA 2FC8A 2DNHA 2E44A 2YWKA 2WBRA 1FJ7A 2M0GB 1X4CA 1WWHA 1A7GE 2KM8B 4C4WA 3VAKA 3CCVS 5GADU 3CC4S 1WEZA 3LPYA 1U6BA 3G71S 3R1LA 4IO9Q 1VQNS 2DO4A 5LXRA 1SJ3P 2MKJA 1VC0A 3IRWP 1WG1A 2CQ3A 3UD4P 1VQ9S 5CA5A 2CQ0A 2RS2A 1M90T 1KQSR 5DM6Q 2AYMA 5DETA 3CF5Q 1L3KA 2RQ4A 4QPTA 1YJNS 2RRBA 2LCWA 1WHWA 3THPA 4CIOA 2CJKA 1ZZFA 4V19X 2J76E 2M8HA 3UWTA 2MQNA 3ZZYA 1OO0B 2N7CA 3CCUS 1RK8A 1JMTA 1X5SA 2VODA 2MZJA 3EGNA 4P6QA 2EK6A 4IOCQ 1VQ8S 3TO8A 2MQMA 1SJRA 4ERDA 2MMYA 2D3OR 3BEGB 2CQDA 3NMRA 1M5OC 1CVJA 2ERRA 2G4BA 2MQOA 1FJCA 3UCZP 5CYJA 2MZSA 1BY9A 5JVGQ 1VQ6S 5GAHU 3PIOQ 1X0FA 4WFAQ 1WHYA 2EK1A 1U1RA 2M70A 1G2EA 2DHSA 1WF1A 3MD1A 1URNA 2KI2A 3G8TA 3CXCR 2MSSA 2DHAA 4UY8T 3SDEA 2XNQA 2RT3A 5HL7Q 2ZJPQ 3EGZA 1JJHA 3CCMS 1D9AA 4Y00A 2M52A 2RU3A 1U1MA 2M2BA 2DNMA 2MKSA 1VQKS 1U1KA 1N8RT 2KG0A 2DGXA 2KH9A 1FO1A 1AUDA 2G0CA 3DLLQ 2OTLS 2LEAA 2FHOB 3S7RA 1X5PA 2AYEA 2I2YA 3IWNC 1X4GA 1FT8A 4EGLA 4PR6A 3MDFA 2J0QD 3FEXB 5IM0A 1OIAA 2M9KA 2AD9A 1R8HA 2KRRA 3Q2TC 1B7FA 2DNZA 1WHXA 3VAFA 2KXFA 2OJ3A 2DNNA 2NLWA 3CULA 2NZ4A 4ED5A 1RKJA 1X5OA 1F9FA 5GAEU 4OZ1A 2JWNA 2M7SA 3NNHA 1VQ4S 1U2FA 2MJNA 1PO6A 2DGWA 1VQOS 4TU7A 3R1HA 1WF0A 2LQ5A 2JX2A 1OPIA 2KU7A 1KC8T 1ZH5A 2DNPA 4TU8A 2LXIA 3U1LA 3NNAA 4W92B 3B4DA 3ZZZA 1SXLA 4PRFA 3CCLS 2CQHA 4IOAQ 3H2UB 1Q82T 3U1MA 1SJ4P 5BJRA 4Y0FA 2DNRA 1VQPS 2DGVA 2E5IA 3RW7A 3S01A 3CCRS 4CQ1A 2QFJA 1YIJS 3SDEB 2K3KA 2MGZB 1KOHA 1P27B 4Z2XA 2V94A 2PE8A 2RVJA 5LXYA 4YUDA 2CPHA 1VQ7S 5LJ3Y 4PKDB 3I56S 2A3JA 1Q81T 3JB9k 3CMES 1UAWA 1Q7YT 2OSQA 4LJMA 3VAJA 2DGSA 2I38A 2X1AA 3P5TL 3UCUP 3FEYB 5DDQC 1K8AT 2HYIB 2MQPA 1WEXA 2OTJS 1QM9A 1U1LA 3CC2S 1JJ4A 2KN4A 2KXHA 1UP1A 3MUMP 1QVGR 2M88A 2KRBA 3V4MA 2CPJA 1H2TZ 2MKHA 3RW6A 2AYBA 1Q86T 3NNCA 2MQLA 1X4DA 3CCES 5IFMA 4U67Q 3K0JA 2AYGA 2FC9A 3N9UC 2RNEA 2GO9A 4A8XA 4WF9Q 4F02A 2B0GA 1W2BR 2HVZA 2KYXA 2U2FA 5MLCV 2CPEA 2U1AA 2MY8A 2QEXS 2RUGA 4RU2A 4ZKAA 4WCEQ 2DISA 2RRAA 2HZCA 2DGQA 3VF0B 2MZ1A 3HHNB 2E5GA 2N82B 4J5OA 1YI2S 2DGTA 2CPXA 1HA1A 2KHCA 2KXNB 3VALA 4M5DB 1H6KX 3R27A 3CMAS 1WG4A 2LYVA 1X4HA 3CPWR 1DRZA 1P1TA 2VONA 2JRSA 1IQTA 2OSRA 4F25A 2X1FA 2QA4S 2J0SD 1WHVA 1M5VC 2ADBA 3H2VE 2XS7A 1WI6A 4F26A 1YJ9S 3OW2R 5DM7Q 1YWXA 2HGLA 1H2UX 1DZ5A 2F3JA 2M8DB 3BS9A 2DNOA 2DGUA 2CQIA 2YKAA 2VOPA 2LXUA 4CH1A 1O0PA 3CCQS 2ADCA 3LQVA 3VAGA 2UP1A 1VBZA 2MZTA 1D8ZA 3HI9A 4WKRA 2XSFA 2HGMA 1HD0A 1NJIT 1YITS 3MUTP 2LECA 1ZZNA 2M4MA 1WTBA 2N3LA 3G96A 2EVZA 2PEHA 2FY1A 2MSTA 2MHNA 1JJ2R 2BOPA 3SMZA 1X5TA 1WI8A 2D9OA 2DNKA 1R8PA 3MUVP 1VC6A 2KFYA 2KT5A 1OWXA 2VOOA 4C0OC 2E5HA 2DNYA 2MZRA 1A9NB 2N3OA 1HL6A 2DGOA 2CPFA 2DO0A 1M5PC 2JVRA 2X1BA 4BS2A 3J7ZT 2X1GA 1WF2A 1FJEB 3J7YU 5GMKa 1DHMA 2YTCA 3VAMA 1X4EA 1WEYA 2DK2A 1X4AA 3NS5A 1UW4A 3G6ES 3S6EA 3MXHP 5GVQA 1FXLA 2CPYA 4YOEA 3CC7S 1VBYA 3L3CA 1QVFR 4WFBQ 3VAHA 3VAIA 1VQ5S 3SXLA 2MGZA 2DIUA 2MPUA 3CUNA 3P49B 2MKCA 2HGNA 2LA6A 1VQMS 2CPZA 1YHQS 3P3DA 2GHPA 2KG1A 1DBDA 2DHGA 1S72S 2DB1A 1KD1T 1VQLS 1N52B 1SJFA 2DH7A 2CQPA 1K73T 1PGZA 3US5A 2L08A 5GAGU 3CCSS 3MI7X 2RS8A 1U1NA 2MJUA 2MY7A 2L9WA 2L41A 2MQQA 2MKKA
chains in the Genus database with same CATH superfamily
1S77D 4YB1P 3M4XA 2RAQA 2ZH3A 2VJUA 3NGTA 3TYTA 4WJBA 3X3UA 5IXUA 2UXBJ 1IN0A 2PMZD 4MK9A 2PC6A 1LWCB 1U6FA 3QAEA 4QQBA 4N47A 1WNEA 2XYGB 1FF2A 1LV5A 2YH0A 5EX0A 3WDOA 5GMEA 3DXBA 1TL1B 4PWDA 4U8YA 5KFKA 2QSFA 4C8OA 3PEJA 2CPIA 3OHBA 1NDCA 3T6JA 2CJBA 2Y0SD 2YNHA 2QT7A 4M5GA 4C8NA 3CD6S 1R89A 5B7WA 2IJRA 4KPYA 3AA8A 4QR0A 2GHWA 5LSLA 3DLEA 1XERA 1RCOB 1DQ9A 1ZM9A 4QYZK 4A48A 1BGXT 3FNNA 1RTIB 2MYFA 4J90A 1V3SA 5CCMA 2HS3A 4QU6A 1Y3KA 2DEIA 2QL7B 3CW2C 3FMWA 1GXUA 1IJFB 3R9LA 5IQ6A 1KNZA 2KFZA 4JYAJ 1VRUA 4U7UK 1FX4A 1RTHB 4JI7F 2EWHA 4XK8C 4AXJA 1N88A 3FSIA 2DCLA 3TAPA 2OH2A 3RZAA 3UCGA 2K8GA 2P2CB 5KFOA 3MR2A 2BMBA 4JI2J 2XGPA 4LIRA 1NZ8A 3EVWA 2DNLA 2BRLA 1VGYA 1VRTA 2YKMA 1OSCA 3N01A 1VQSA 3QGHA 1NKBA 1C4AA 1K9MT 3MR5A 1DLOB 3W62A 2W2QP 2IBKA 3MCSA 5DRKA 1B99A 1TKTB 2CQ1A 2HFNA 4GC6A 5FJ4A 4OLPA 4NLDA 3QWPA 1VC5A 3JQKA 1Y11A 4LQ3A 1RJJA 3CIZA 2YX1A 3AT1B 5J2QA 1JKHA 1U4BA 3Q2SC 4RUHA 3D2WA 1NK7A 1V9OA 2IMWP 1X31C 5GMDA 1FRLA 4F4AA 1TL7A 3EZ5A 4ECQA 4DR3J 4L3KA 4JI1F 3QRQA 4TLQA 3KMQA 1HWLA 3ENWA 4B3RF 3MTKA 1MU2A 4F2SA 3LP0B 1RAOA 1ULRA 4NRUA 4UQGA 3OJUA 2HHUA 4X64J 2DIVA 2M3DA 5A8WB 2KM8C 3T5JA 4DV7F 1FRMA 4DJBA 2OPQB 5LJ5Y 2GQCA 5IQQA 2DRAA 3PJXA 3THTA 1X9MA 1VBXA 3DRXA 2EFOA 4PXEA 4DEZA 2WONA 1FE4A 3PRVA 4DPOA 1SJQA 4K59A 1XR7A 3TEGA 1IR1A 1H0HB 2BXJA 2WHOA 2WVBA 1Q7LB 4KGZB 2D41A 1EETA 3FZBA 1GEHA 4Q2MA 2PSZA 3LALA 4LSNA 3TA0A 3FBCA 1FRXA 3DRSA 2CQ4A 2J6SA 2RQCA 4ZHRB 3M8YA 1G4CA 1KOOA 1RWKB 3R8YA 3RGIA 4DF4A 1WELA 1Q8BA 1ZM3A 3RBXA 1WDTA 2BM1A 2J8SA 5KFYA 1UEKA 3MM7B 2Y1RI 2K7KA 5MAOA 3NNCA 3KMSA 1LEOA 4J9KA 2VFTA 2F9JA 2J9EA 2QC3A 3G6VA 2FVSA 5E3PA 3MOJB 1U1QA 1GAOA 3O3LA 2DNHA 2UXCF 7FD1A 1FJ7A 1K0TA 3AD7C 5E3AA 2M0GB 4KRWA 1GX5A 2HPUA 1D3WA 4ZPCA 2OFGX 4LFCJ 3W65A 3HHLA 3W1YC 5D3GB 1C1CB 2UUBJ 4C4WA 2YX4A 3CC4S 4ICLB 2OD6A 1KTVA 5CYQB 4HL9A 1V3ZA 1L3UA 1RT2B 1RTHA 2AKWB 1U6BA 3DOKB 3PHTA 3ADAC 4GKKF 1HMVB 3ITHB 1PC4A 1IBLJ 3BSAA 1FD2A 2DO4A 1HBMA 1SJ3P 4X2BA 2VJVA 1VC0A 1R3NA 3KK2A 1WG1A 3D1QA 2CQ3A 3UD4P 2I5JA 2HHWA 1IKXA 2YBVA 1PJ7A 1IBKJ 3IG1B 3MPYA 3H5XA 5CA5A 1UVNA 1V3RA 4TYAA 3PM9A 3U27A 5D0GA 4AXIA 2AYMA 5DM6Q 3FBEA 5CYMB 3SYZA 2N7YA 5EWFA 1XMOF 1U47A 4LBHA 4ZLPA 4FF3A 4OV6A 1VK3A 1QTNB 1RWUA 3SV4A 2IVMA 5C24B 1CPZA 4NLRA 3OL8A 1WHWA 1TVRB 3HT0A 5K14B 3HVTB 2HNDB 4DV6J 3THPA 1UVIA 1EJ7L 3AJ2A 3K5OA 4LF2A 3GR1A 1SV5A 2C3YA 2QLJB 2VC1A 4M63A 5E41A 2CYYA 2VPWB 2W4CA 1JB0C 3F0NA 3TNVA 4V19X 2C42A 2V9WA 2MQNA 3IAM9 2BJDA 4H4MA 4HLBA 2PI4A 1BWEA 4ES3A 2WBMA 4FYWB 3OFGA 4DUYF 1R8CA 1QSLA 3W5ZA 4I2QB 4RW9A 3CCUS 1X5SA 3R6LB 2MZJA 3EGNA 4OJGA 4P6QA 1JLCA 2EG1A 2ZKTA 3AODA 4C3LA 3GE9A 2BW2A 3UDVA 2XGQA 1P9QC 3JXOA 2MMYA 4TY8A 2D69A 3CJQA 3KYLA 3KWMA 3T1AA 2P6TA 3M32B 2H9ZA 2AJ2A 2C2DA 1TFWA 4ZCIA 1FJCA 4YB7A 5A6WA 4ZLLA 3TRGA 1RISA 2G2YA 1XMQJ 3CJ4A 2VG7B 2OP5A 2C3MA 1UEUA 3ICLA 4FVCA 3I31A 2BUNA 3CE8A 4HH0A 4NA2A 3FDSA 4RWWA 2ZEJA 1S6PB 3MR7A 4L74A 4NCGB 3PIOQ 2GVDB 4CLTA 5L1KA 1HWUA 4DV2J 4C8KA 2R7TA 3F41A 2DD8S 3TJ8A 3OFHA 2W24A 4FPIA 2HHXA 1G2EA 1VHIA 1NK6A 4DR3F 2DRBA 5KG1A 3CXCR 2DHAA 2GV1A 2MKYA 4TY9A 1S7HA 3W5XA 4TNOA 3OTEA 1HQUB 2ZE2A 4Y2MA 1JLQB 4Y00A 2RU3A 1T03B 3HO1A 1U1MA 3RRKA 2HHHF 1U1KA 1LOUA 2HAIA 3WZ0A 2J0WA 2BE2A 3NGSA 1CLFA 3H2LA 2KH9A 3W8GA 1CJUA 3U7JA 3Q23A 2HBRB 3TW0A 1E6VA 2V69A 1WOOA 3CJTA 3Q8UA 4MFBB 1S4EA 2J0XA 3IR5B 1S1UB 2IDEA 4DZDA 2I2YA 4FKYA 3W9HA 1FD8A 2DKOB 3VZIA 1B3TA 4NCAA 2R42A 2D1CA 1S9EA 4K0KF 3AQOA 3R2DJ 2QX0A 3UNGC 2FLPA 4E98A 2HHPA 4ELUA 1AUSL 2P5VA 4I1TA 4QIVA 4YN3B 1RT5A 3T1HF 3Q2TC 4JI0J 3ILOA 3QIPB 2WVCA 4WTOB 5F3TA 2R7VA 2GA7A 2K1RB 2I1RA 1WHXA 2WSEC 1E6YA 1Z2LA 5KFTA 2IRUA 4R8UA 1T05B 1TV6B 4ZMMA 2OJ3A 2YNFB 3KJFB 1RA6A 2RHSB 4DV4J 2HG4A 1FKAF 2BR0A 3C2PA 1X5OA 4OQJA 1F9FA 5GAEU 4K4UA 1RT6B 4LUBA 2CAJA 2QJ3A 4DLGA 3MCNA 1C0TB 4IFVA 1MMLA 2OPQA 1NMEB 1VQOS 3R1HA 1ZPWX 2BE7D 2E1PA 4OFZA 1WF0A 2LQ5A 2BRKA 3I5AA 4ZVGA 4ZVRB 5J2PB 4J9OA 2R8JA 1Q8IA 2R9LA 2RF2A 1TKZB 4OYMA 1ZH5A 1EX8A 4DZ6A 2LXIA 1RTJA 3B4DA 3H7HB 3RBZA 1RXOB 4DR5J 3H42A 4A8WA 1SXLA 3O6QA 4MIAA 4DR6F 2H5EA 3AOAA 2FHMA 1KVJA 3WBZA 4IOAQ 5KFLA 3M1VB 4LR9A 3HSDA 2HFOA 1OS5A 1WUUA 1NAQA 2HZAA 3CJKA 3HPOA 2NREA 5DO2A 4KJIA 2IIHA 4MFBA 3DRRA 5AE3A 1AFJA 1O6XA 4ZLJA 1TUVA 2XSJA 1F5BA 2XO6A 3BGLA 1RTDB 4RUAA 4MKVA 2XHWA 2E5IA 2NS1B 4N7TA 5CQGA 3HHEA 3S01A 1U8WA 3Q8QB 4O3RA 1LFWA 1NHKL 2CDQA 2B4VA 1S6UA 4E2FB 5EWGA 2V4JA 2V8GA 2QFJA 4DV3J 1HFEL 1R43A 3T9NA 3T3FA 1YIJS 2V8DA 2EBGA 4ELTA 4Y2AA 1FVSA 2H54B 4M5JA 3GFZA 5DG8A 1WC4A 3OR2B 1WOSA 5GAHI 1RE1B 1S6PA 2H5JB 1SJ1A 4GMKA 4PEOA 1NH7A 4C6AA 4EBEA 2MEWA 5EDWA 4KGMA 4CLKA 3E8OA 4OV1A 4J91A 1HQUA 1VOMA 1T03A 1C1BB 3GJQB 4P2FA 2FJBB 3ZTOA 3J80Y 4LFBF 2HWHA 2GX8A 5A2QY 4O0NA 3JB9k 4EO8A 3W9IA 3CMES 3KK1B 2HBQB 1XBWA 2B6AA 1Q7YT 2OSQA 3T41A 1UWAA 3E51A 1IKWA 1B0PA 4I69A 3VAJA 3KOAA 1Z1ZA 1RT1A 3MEDB 3H25A 3JYTA 4R25A 2YNHB 2JNJA 3GB0A 1WTFA 1RWVB 3QSYB 5LM7E 1CULB 3K89A 2UUAJ 1UVLA 1WEXA 3BQ0A 4FF2A 4G1IA 2W9CB 2R2TA 4NLSA 3VWSA 4IDKA 2KHDA 1ZBTA 3BJYA 3C8YA 4QZVB 2QLBB 4P52A 3T5KA 1G7CB 4J9NA 3KLGA 1H38A 2YXLA 3PZPA 3ILJA 1H2TZ 2MKHA 5A8RA 3OQ2A 1SV5B 2N4CA 4DQRA 3RW6A 1VMBA 2MQLA 3CCES 1CS4B 4DR7F 3KLIB 2EFQA 2C2OB 2G1HA 2GO9A 1P8GA 3D0GE 4A8XA 4WF9Q 3NAIA 1J27A 2HVZA 2U2FA 3TQ1A 5H9FK 2CPEA 4RW4A 4UW2A 3D6MB 3V6JA 1AFIA 1HWKA 2BW7A 2D3ZA 2U1AA 3PYEA 4RW8A 2RUGA 1QUVA 2DY9A 3M8WA 4XAKA 3PO5A 3AJDA 2RRAA 1BC6A 2HSEB 2HZCA 4NLYA 2YWWA 4JI3J 3GLJA 1RU1A 3QBCA 3AOCA 2AHOB 1D8YA 5THWA 1RWXB 5EHHA 1YRUA 4ENOA 3SCIE 5H9EK 4FBTA 1Q0NA 2AWZA 2FZGB 3FCHA 4ZVHA 4C2MA 2VICA 4DL3A 1QSYA 4KHPJ 4OJHA 3NOCA 4USKA 2BDPA 4B9MA 2FJAB 3OXLA 3N6NA 2HIQA 1VFJA 1YJTA 4DN0A 3DNCA 1N6QB 1Q5YA 1RTDA 2XMVA 1KONA 1VS3A 2JC0A 3QZ7A 2UXBF 1WG4A 2QSWA 3CPWR 4B9UA 2W8LA 2HEKA 3FEZA 2GZOA 3FQLA 3H8YA 1R6YA 5C42B 1PKUA 4DV6F 1BQMA 4DSFA 3GG0A 3LGMA 5KFEA 2V2KA 4QWDA 4Y65A 2QA4S 2F8MA 3H20A 4OZ5A 5B0EA 1M5VC 4UOCA 2JEJA 3JSBA 2J0SD 5KFMA 3PACA 3MAHA 1PSDA 4TQRA 3W7BA 3ISND 5IT4A 4ZLNA 2X51A 3DRRB 3FCWA 4LFAF 1YJ9S 4EBCA 1JK9B 2FVQA 3SBMA 4FYDA 2N4DA 2NSCA 3TZWA 3CVKA 4USIA 4I6AA 4U95A 1TK5A 1DZ5A 4EFAC 3BS9A 1PAUB 1RGVA 2RH3A 3IBWA 5HATA 4KBIA 3KHLA 3QIDA 2DGUA 4AUKA 1FWPA 4BLGA 1IVZA 2VOPA 2CNKB 2DXFA 3KLIA 5HMWA 3AY0A 4IQXA 1JLFA 1F5AA 4A8MP 3FFIA 1RB0A 4NLQA 5F0UA 1NPPA 1I5OB 4XPCA 3OL6A 3AOBA 5HJXA 4CLSA 3CDUA 3HK2A 2I9SA 4NEYA 4QIGA 2B9XA 2W2PP 1MG7A 4V1Ak 1HWJA 4EMDA 3P4UB 2GVZA 4MKBA 2CUYA 1N36J 1EETB 1XNRF 4QR1A 5D0RA 2HQGA 1RHRB 3G96A 3BB5A 3R97A 4ID5A 1IM4A 1SB6A 1FNMA 4QWCA 4HACB 3DM2A 3HT3A 2IY5B 1JLBB 2C2NA 5BYRA 3SMZA 2MQ8A 2JH3A 3NCQA 3M9MB 1UZHA 2A0FB 3OFFA 3W5YA 1D1UA 2DNKA 4NZ7A 2B6AB 3L9ZA 3NLCA 3PEHA 4JI6F 3SQGB 2YQ1A 3MPVA 5FD1A 1FRIA 4DCJB 5C7PA 2G0IA 2Z2YB 1ZA2B 3T1YJ 3HVRA 1DTTB 1OY6A 2OO4A 2DR9A 1EHWA 3W9JA 4NLOA 4ZPVR 3TEHB 3QFWA 4NYPA 1IXKA 2E7WA 4JP8A 2COLA 2JVRA 2LQJA 1A0OB 2X1BA 3TUJC 1QY7A 1M5PC 3OLBA 3PW0A 3JTPA 4OZ3A 2KT2A 4OJ1A 4DQPA 2OPRB 4C8YA 1T8EA 4OZNA 4U96A 5L9XA 3TR5A 3NS5A 4FBUA 1UW4A 1W7WA 2EBEA 3S6EA 1N5YB 1WC5A 4YP3A 3I5BA 3KLVA 3HFKA 5KFFA 3VQSA 5KFVA 4ATNA 3KHGA 3VAIA 2FIUA 1T9XA 1XR5A 2MPUA 3DHWC 4J7CA 1YJ7A 5HQ8A 3MEGA 1TKDA 2V63A 3TX8A 2HGNA 1R8AA 2FZKB 3N4WA 4OI4A 3W66A 3WX8A 1VQMS 2UXDJ 4LR8A 2ZDPA 3OD2A 4FKXA 1B4SA 4OYXA 2K06A 2HLTA 1JNZB 4WFXA 3F73A 2BBEA 1YHQS 1HNWF 1WACA 2OAUA 3MOZA 5D4PA 3VTIA 4X66F 3IMQJ 1QJHA 5F8IA 4K4YA 1MN9A 3C6UB 2F7VA 1VQLS 4QW9A 4I2PA 2KO1A 2VFSA 2BYCA 4ZVTB 2DH7A 4ETXA 2ZHBA 3PFOA 4HACA 5LOQA 1AA1B 2ZC4A 2QO3A 4P74A 3I4HX 1KLMB 1KKHA 1L3SA 2L08A 3CCSS 3MI7X 1U1NA 4C11A 1ZYQA 3DLJA 4PWDB 4O4GA 3TZXA 4N41A 2HAFA 2MQQA 2WVDA 2VF3A 3G2XA 5FDLA 3RJMB 4O0IA 4G3IA 3QQCD 2MHEA 2ZBRA 3EGVA 1X7VA 2K2PA 3HKWA 3MD3A 3VQTA 4TY8B 3DLGB 3OL9A 1SKSA 3EICA 4IUFA 1MWYA 2DNQA 1Q1KA 2HMIB 1X4BA 4OL8A 4WK1A 2LQ9A 1XTZA 1R0CB 1GTEA 3A13A 4CWBA 5FLXY 3EX7B 4DSIA 2XWYA 3AHPA 2KVQE 2QA2A 4DPTA 4X4VA 3CJ8A 1CJKB 4WK3A 3BO3A 1CC7A 1Q5VA 1EB0A 4C3MA 4J9PA 1YJNS 2X3GA 1S0OA 2JSXA 2YWEA 3IRXA 4ER8A 2I6WA 1XJWB 1FTRA 5D77A 3MURP 4NLWA 3HD2A 3ZXWA 3WIUA 3TWZA 4D3GA 5KFNA 3DOMA 5CZVA 5KFZA 2WOMA 1TL5A 1R6VA 3NY0A 3B54A 3TP2A 2YNGA 4KTQA 1S57A 3CD0A 1N0UA 1PILA 3FRYA 3M8PA 3PDNA 3QLHB 3IAS9 5C25B 5DG9A 3MFHA 4ECXA 2EEYA 2PMWA 3U1NA 4CO0A 3C19A 2B8PA 2PA8D 3K17A 3TUZC 1FJGF 4B3SJ 1HWIA 2YVSA 4ES1A 4RO0A 5KFAA 5I4MA 4A4JA 2DXDA 2DTJA 1VI7A 1NK5A 2F9DA 4MK7A 2GVZB 3BO4A 2CNLB 2I8EA 2PO4A 4QU7A 4LT6A 1E6VB 3BSCA 4URSA 2CFXA 3PIPQ 4BWMA 1QTMA 1SH0A 3I0RA 3HHLD 4EYHB 3BSNA 1RI7A 2RF2B 4N76A 1AB8A 2GMHA 1FDBA 2MZQA 2ROEA 2KYZA 2RQMA 1Y4ZB 2WW8A 2Z57B 3LPEA 2GVDA 4TYBA 2DH8A 1FFWB 3D1HA 3PKMA 3MMAB 5JVGQ 2MB0B 1NU4A 4LF9J 5IC4B 5IWAJ 1A6LA 1IQZA 4OZ0A 3CJKB 4RNFA 4F4ZA 2ZVIA 1XMBA 1EP4B 4GO5X 2LA4A 4FPRA 2E5LJ 1RT4A 3N6MA 4UZCA 3B8HA 4NYZA 5DGBA 2OFHX 1RAEB 2RSQA 1FE0A 4XDDA 1AROP 1FKOA 2P6SA 1HBMB 5HMYA 5K8NA 1YTYA 1M5KC 4CZCA 2BANA 3V6HA 4ED7A 3CWJA 3D3BJ 5KT7A 2ZH9A 1GXLA 2P9EA 5DDPC 2KVIA 5HLFB 4FN5A 5I42B 2MXYA 2A10A 3HULA 3QATA 4OJ3A 1U6ZA 2F5GA 2O3DA 3NS6A 5G4DA 2OKQA 1K1QA 4IFVB 3GSDA 2LDYA 1JLEA 2CVIA 3CD7A 2VQEJ 1D9FA 1MMNA 4DSJA 2XB2D 1BXNA 4ZJOA 2CPDA 1X4FA 3DOMB 3FVYA 3KHHA 4FYVB 1VLYA 4O4GB 3CJSA 2QFIA 4LRAA 1RTZA 2Q79A 4FXVA 2G1DA 2V8VA 2ZOMA 3I9ZA 4EYIB 2APOA 4CRJA 1U1PA 1MWZA 3DC2A 2XMTA 1BMQB 3I55S 4PXBA 5CYMA 4AL5A 2PIIA 4WYLA 3F44A 1SIWB 5KG6A 3W60A 1RT1B 3MEDA 5EN1A 2ZH1A 1NK4A 2ZZNA 3QZ8A 4FNIA 1XR6A 3BO2A 4C3KA 2VFUA 1SVDA 4K5RA 1H2VZ 4LREA 4QIEA 3KK1A 1B7YB 1WSRA 3M2UA 4NASA 5L39A 2I0XA 1T9YA 2D3UA 5DQHA 5KFJA 3KLGB 4Y34A 1HHTP 1U26A 5KFDA 1RUSA 2LDIA 4EK2A 1SIZA 2FC8A 5T14A 2W9AA 4ALZA 2YWKA 5SZTA 5BR8F 1HMVA 3ITHA 3EGWB 2DXEA 3ET6A 4OZJA 5HJYA 1X9SA 2ZUGA 2HFVA 2GHVC 4KY3A 1O51A 3OUYB 3CCVS 1CEZA 3J7AN 2Q6BA 1HYSB 3GJSB 2ZH6A 1T02A 3M6UA 3D3CJ 1VRQC 2HBYB 3IRXB 1FVQA 1WEZA 1HARA 4LBIA 2IJFA 2LFVA 2CA9A 1LW2A 2MLZA 2B9YA 2J7KA 2NUHA 2YKOA 3D7SB 3V5RA 4IO9Q 1SC4B 2CWXA 5LXRA 2RB7A 3KLHB 2FYXA 4USTA 3IRWP 1BQXA 4DFKA 2XZWA 3ZZ0A 4RW8B 1XK8A 1H3DA 4RZRA 1JX4A 4KV8B 4ELVA 4DR6J 1I6JA 3BF4A 1TKXA 1UPPA 2CQ0A 1VJQA 2H4YB 3O44A 2WAQD 2RS2A 1SKWA 3ENAA 2RDIA 3NBPA 1KVIA 2XLKA 2KJWA 3M8QA 2RQ4A 4P2SA 4WE1A 5AT1B 3SFGA 2C3PA 2IM1A 2RRBA 4I6YA 2LCWA 4DOZA 1SC1B 5I3UA 1HBNB 3MEEB 2EC2A 3UFCX 9RUBA 3V81A 2EPIA 3ENQA 4LF6F 4ILMA 1FXDA 3CJRA 5JUMA 1VHFA 4NX9A 4PWUA 1HQEB 4DI6A 2PN6A 4NXMJ 3OXFA 4FXDA 2J76E 3L09A 3MMBA 4DPXA 1GTHA 4GVBB 4MAKA 5G0RB 4BDPA 1YRXA 2QMUB 3CNQP 3M8ZA 5J1PA 2XZDB 1N34J 1HNVB 3HFVA 2QTWA 1RYRA 4NLGA 3ZZYA 1OO0B 4C48A 3HLUA 4U8VA 4ZITA 4DR2F 3L7OA 2VODA 2BJ8A 2HLUA 4IH7A 2EK6A 1ZM4A 4IOCQ 1UJ5A 3A8KA 1IR0A 2MQMA 2OPPA 1UETA 1SPBP 3DLKB 4ECYA 3JS9A 3G86A 4YDXA 5DQGA 2RDDA 2VQFJ 1NK0A 2L9DA 4HH1A 4H4OA 4RWXA 5DQIA 2D3OR 2VHGA 1M5OC 3BDPA 3NGDA 2G4BA 2EKYA 2DT9A 4Y3CA 3H90A 1JLFB 2E1RA 4Y6IA 3M30B 3UO0A 4F0MA 1KFDA 1QAXA 2LU1A 5A6PA 5CYJA 5KFWA 3K58A 2HRUA 2KJVA 1BY9A 3IFEA 5ETTA 1FK9B 2YX7A 2ZOFA 1RT2A 4CO5A 1MROB 2LLZA 3CDWA 5GAHU 2R7UA 1X0FA 4WFAQ 2ZVSA 2EK1A 2KB2A 2XLIA 2WVFA 3NRBA 4XO0A 3KK3A 4IR1A 1HR0J 3TARA 3JAMY 2AZ1A 2R2RA 1WF1A 3MD1A 4HKQA 2KI2A 4OHVA 4GKJJ 1GH8A 2VBYA 2YY3A 1NZAA 2V6AA 2XNQA 4I0WA 2RT3A 3KG1A 4ID8A 1T9TA 4ITSA 5KG0A 4X66J 5HL7Q 1B70B 5I42A 2XMAA 1NHUA 1RBOB 1S1WB 2FHJA 1U0HA 1N5QA 2XZTB 2MKSA 4PUOB 4LFAJ 4AT1B 2NCKL 2XEXA 3I87A 1N8RT 3KUGA 4X65J 4FS2A 2X3DA 1KP6A 5J1NA 4JI4F 1WJ9A 3Q8VA 5KG2A 3GCXP 4RNHA 2OTLS 2PT0A 2LEAA 1CJVB 1T9VA 4ZVFA 4A46A 5KFPA 4DBQA 4DL4A 2IVFB 1FT8A 3M2VB 4EGLA 5F8JA 2B5JA 3MDFA 3TVYA 3GPAA 2GGPB 3BBFA 4QJVA 1RHMB 3FEXB 1OIAA 3W2WB 3RAMA 5IM0A 4Q44A 3E3XA 2AD9A 1R8HA 2KRRA 3TVKA 1B7FA 1S1UA 2UUWA 5KFRA 8RUCA 5L1LA 1RLCL 3NGRA 3I6PA 1V5IB 3IP0A 1UTAA 1YQHA 2RDJA 2KXFA 2BJ7A 4GKJF 4ZIWA 1D0EA 4OX8A 3RB3A 2E5LF 3W61A 3KTQA 4HT7A 4YDDB 1YJVA 2CG4A 2NZ4A 4C0HA 4DL5A 2UUAF 2JWNA 3IA0A 1RT7A 3NNHA 1HHQA 3RB0A 1U2FA 3QIPA 4GVBA 2FLNA 2KZZA 1Q16B 3PRDA 4PXDA 1HNZF 3TANA 4M5IA 3Q8SB 1N32F 4USUA 2DGWA 1K0VA 4ZP9A 3M8RA 1I3OB 1QDUB 1LK5A 1M5HA 2OELA 3TZZA 5ADZA 1KHWA 1HBNA 1YGYA 3D5MA 4BCAA 2ZHOA 4ZPAA 1OPIA 3JQMA 4O3PA 1UVJA 2V50A 4ZCKA 1HR0F 3X1LB 1NH8A 3LGHA 4P71A 3U1LA 2NPIA 4CYUA 2V8HA 2QA4G 2YKMB 5HSPA 4C8ZA 1Y5IB 2VASA 3A3PB 3ZZZA 4PRFA 4UUWA 3CCWA 4J37A 5HQLA 2D3O1 2DPJA 3H2UB 1ZETA 3A8JA 1CJUB 3GYNA 2I5JB 4F3QA 5C2GA 5KFXA 5BJRA 1XWLA 3RRHA 3HJFA 4YS2A 3R5DA 4JV5J 3BH6B 3UR3C 4FYXB 4Y0FA 3QT7A 2J6UA 5M2RA 1K1SA 3LOUA 1PBAA 1T7PA 4DR1J 2DNRA 3RW7A 1FDDA 4NL5A 2WZ1A 4DU7A 1J5OB 4LF5F 1HNVA 2Z2LA 3EXCX 3M1VA 1RAGB 2H65B 4USMA 5BR8J 3N5BA 3TUPA 3SDEB 2MGZB 2HVIA 4ZDNA 1P27B 3KLEB 1EARA 4YMEA 2V8PA 3OUYA 2IRXA 4MYUA 3D67A 4B08A 2ZM6J 4I6WA 2HFSA 2W7OA 2RHQB 3OTBA 4KC5A 2Q3PA 3MM8B 4RNMA 5DG7A 3AD8C 3MZIA 4DF8A 3BBCA 3LUYA 1UA0A 1Q95G 4ZS6A 1Y00A 5A0YA 4RJVA 3VVTA 1GX6A 4KFBA 1Q81T 3LTOA 1UAWA 3N79A 2XCPA 2VQFF 2F40A 2VZ9A 3N5FA 4FP9A 3M9NB 2DGSA 4UOHA 4DMZA 2Y9HA 3M9OB 2YKQA 3DDKA 2C2EA 5IZHA 3AB4B 1K8AT 2ZBQA 3GIRA 2O66A 1WKKA 5J2NB 5F9NA 3KG4A 1QM9A 4B17A 4B3MJ 4QR2A 3HF5A 5HQMA 2CADA 1UP1A 3MUMP 1RT4B 1QVGR 1RADB 2CNNB 2V5HG 5B08A 1R8BA 3I32A 1J5EF 2L48A 3I4PA 3NXZA 5I3PA 1VR6A 3DMJA 1OSDA 3GR0A 2C28A 3BQ2A 1ZAVA 2JEIA 1DURA 3LO3A 4OZ2A 3MPWA 3SCKE 5F8GA 4A8QA 4EEYA 4Y2CA 3SCJE 3FMBA 4IYQA 3VGSA 4RBUA 3VGTA 1S9GA 1VQKS 1SL2A 3CGIA 2RNEA 3HDSA 4MKAA 2NPFA 4ZHRA 1CJVA 1F9EB 3LWMA 1VIXA 2IM3A 1W2BR 2HHSA 2GIFA 4NPOA 4W98A 3VR1A 3GJRB 4Q0BB 1SI9A 5ETQA 2MY8A 1N6QA 2QEXS 3LF0A 4WCEQ 2DISA 1YBAA 3FFIB 5LMNF 3GMGA 1D09B 4ZA1A 3W2WA 5KT2A 4K7QA 5ETMA 4LRCA 5KG4A 3VF0B 4H4KC 3WIVA 2R3VA 1RP5A 3ZTRA 4PG7A 2MZ1A 2Y1JA 4DQIA 2HNZA 1AYEA 2J9DA 2N82B 4KO0A 3OVBA 2ABYA 4J5OA 3NS7B 1BQMB 5GADI 2EC0A 3KFWX 2DGTA 2VFRA 1C1CA 3JQJA 3LAKA 4DV2F 4DL7A 1ITPA 4RR5A 3VALA 1S0VA 3H0PA 4P2MA 2OEKA 5K9FA 4M5DB 3R27A 4HI2A 4QWEA 1DRZA 4CNYA 2E1MC 4F4KA 3MPDA 4L76A 1S1XB 1S76D 1P1TA 4M1KA 2JRSA 2QV6A 3KNAA 3UNYA 3EYZA 1YG0A 2KT3A 2Q66A 3IWLA 2GW8A 4P7VA 1S1WA 8ATCB 1NPRA 2X1FA 4EWTA 4MK8A 4M5LA 3M32A 2NXEA 2JLEA 2ADBA 4FF4A 4NI2A 4ED3A 3TAMA 4EUVA 4F26A 1FKPA 3PY8A 1X9WA 2IYIA 3HVWA 3MEKA 1BWVA 3M8PB 3OW2R 5DM7Q 1YWXA 1NNDA 1S6QB 2HGLA 2IAJB 1H98A 1JLCB 3BGRB 2BJ9A 2BOAA 1AW0A 4CNZA 1J2VA 2B56A 3JTNA 1U0SA 1KQFB 3DGPA 1N48A 1U09A 2E9TA 2VG7A 3I9V9 2W9BB 4PYDA 4LF1A 1O0PA 3PCOB 4LQ9A 5ETPA 2AJFE 5AXKA 4RUBA 1S59A 3DXSX 2ADCA 4URQU 3TVZA 1K44A 4RW4B 1N56A 4B9SA 3QRRA 4WZQA 1GMVA 4HTIA 1HD0A 1RKIA 5A0YB 5E7OB 3KNGA 2JEFA 2FUG9 1BE4A 3MUTP 5AE1A 2DR6A 4WP9A 4USVA 2V4RA 1WTBA 2N3LA 3PX6A 1XMOJ 2W4PA 2GQQA 2IA0A 2NYHA 2MSTA 2MHNA 2R4FA 2AX1A 2QN6B 3VV2B 5D6GA 2R7WA 3PX0A 2CG8A 2AQ4A 3ZNUA 5F8HA 3DMJB 1X5TA 4ZCMA 2Z30B 3BKUA 2PFFB 3PG9A 4IH6A 1Z4UA 2D9OA 3SFUA 3VCDA 3H5SA 4UT4A 4K4ZA 1JLGB 4J9UE 2OPRA 4Q0BA 4BHQA 4DU8A 2Y3YA 4DPUA 3Q24A 3NBPB 2NR0A 3R5AA 4KB7A 2MZRA 2CZVC 3R3TA 3KXDA 4R5PB 2HQDA 2DGOA 3NMAA 4IOBA 1JLEB 2Y0BB 2DO0A 2ZD1A 3FJ2A 2OLWA 5HK4A 4DV7J 1RYSA 3CDBA 2W2NP 4NEZA 3J7ZT 4X4UA 2GJ2A 5F3ZA 1WF2A 3LP1A 2OMLA 4M94A 3J7YU 3T19A 2QG9B 4Q2LA 2OEJA 5GMKa 2YTCA 4J9MA 3NCPA 3HSJA 2W9CA 4Q8FA 3G9CA 1FEHA 1TKTA 4BC9A 3MXHP 4K8RA 2CKWA 4DHVA 2CPYA 1HI8A 2W1BA 5J1EB 4X4PA 1VBYA 3CC7S 1QVFR 1Q79A 1RT3B 4ZK7M 2B7BB 5B0CA 2GMLA 1VQ5S 1TL4A 3SXLA 4E8UA 2DIUA 2MGZA 2MKCA 3JTOA 1NJWA 3MPUB 3IWXA 4QCLA 4WP8A 4K2JA 2YQ3A 4NI2B 4DFMA 3HSZA 3I0SA 2R2UA 2GHPA 1T05A 3M30A 1CJTA 3QSIA 4NCBA 1S72S 4WXOA 1FXRA 3HHLC 5IV3A 2RIJA 1SUQB 1KD1T 1QSSA 1DTQA 1UWBA 1S1XA 1SJFA 4NXNF 2WB1D 1S97A 1MWQA 3WC0A 3DM2B 3RRGA 1S9FA 2GGPA 1K73T 4F0HA 2VBXA 3T5LA 5KFUA 4A47A 3UVJB 3R5JB 1XNQJ 5LL6d 2OPSA 3EDRB 4CTAB 3DRSB 2RS8A 4I64A 3PVXA 3MHYA 3SQGA 2LQ8A 4KGXB 3SIPB 1UMJA 4RBTA 4I68A 4HTJA 5KT5A 1F1BB 4FVMA 2L41A 2UUTA 3M2RB 1AT1B 4NA1A 4OYWA 5KG7A 1EP4A 3EPIA 5J2PA 4KHRA 1REVB 1V5VA 1CSJA 4NOHA 5J2MB 2XC9A 2FPHX 5KFSA 2BQUA 4PQAA 5LT5A 2DITA 2AGOA 3VZHA 1F0XA 5CXTA 1KBRA 2UU9J 4OI6A 3RR8A 1TUGB 4ED2A 2ASYA 3FUYA 2UVWA 4LVNP 4OX9F 3ZC4A 1WG5A 5LSRA 3UD3P 5L1IA 4W90B 3DGVA 4OHZA 1GXTA 3MM9B 2XTJP 1JLAA 1DAXA 3DLHA 4FXWA 3C16A 3KJVA 1FDNA 3Q8YA 2XNRA 4ZJLA 1LK7A 4OYAA 5CHCB 5G0RA 1KS2A 1LWFB 3KJNB 5K5MA 4CDIA 1GK8A 3S8SA 4JOUA 1S79A 3TJAA 3L4BC 1M1KT 3MM6A 3CSKA 1JQGA 3EXYA 3EVOA 2H5IB 1S6OA 3FBBA 4NWBA 4FZVA 1CC8A 3D4JA 2LMIA 2ASDA 1S10A 1JXEA 4DL6A 5A8KA 2A18A 2HFUA 2OIHA 3K5MA 2MKIA 2QLXA 3P6YC 3KHRA 2HZVA 3DCAA 2DHXA 2IMOA 3UQSA 3A4TA 3LP2A 1XN9A 1DQAA 1DTQB 1F3FA 1UWBB 3CO9A 3GIMA 1FNXH 4KKOA 1U2RA 5EX3A 1FK9A 3MECA 4PG5A 3OSNA 3BQ1A 1NKCA 1J5OA 5CCLA 5HMXA 4AE5A 1PC5A 4CLZA 3PYGA 2FTRA 2F65A 2A6OA 2W4DA 3CTRA 3V4IA 1F2GA 2KFYA 2R7XA 2WVEA 4NMLA 2Y1LB 3K57A 1ZS6A 2Z58B 1YITS 2UVUA 4JI8J 1RAJA 2O1PA 4C7QA 4DCOB 4X62J 4M5NA 5FDLB 4CH7A 3C15A 4DSEA 1UW9A 3HVTA 3MAAB 2ZC3A 4F04B 2AEJA 1R0BG 1RWNB 5U47A 5EGYA 1PAEX 3BYPA 3OXGA 3Q22A 4X4NA 2GCFA 2ZJRQ 3GYGA 1ACMB 4OHXA 4RW6A 3DOLA 4IG0B 3GONA 3IR7B 4WFYA 5B0GA 2ZM6F 4B3OB 2WTFA 2E5JA 1WKLA 4AFFA 2JFDA 2NXNA 2CQ2A 4U7UD 3EE3A 3IG1A 5HN0A 5AJ3F 1K47A 3TX0A 1NO8A 3NKYA 4X65F 4JI8F 1L5UA 2B51A 4NRTA 1Y7PA 4IQMA 3TUIC 4C98A 2BJ1A 5F8MA 5JVHQ 1HBOB 4MKYA 1C4CA 2LKZA 3KG0A 2OHDA 4MIWA 2FJEB 3JSMA 1HW8A 4LSLB 1N54B 5KFCA 5D78A 5JJBA 1TFYA 4LF8F 3D66A 1CQNA 3DFEA 1NCLA 2CQGA 2VG5A 3M6WA 3CCJS 1SH2A 2WB4A 4K4WA 3ZZPA 4DR2J 1HNXF 4B3MF 4ECTA 3OV7A 3PNIA 2AJ4A 2HNYB 1LNQA 3BGFA 4GRSA 5K8MA 1UFWA 4CH0S 3C46A 4ZP8A 1HPZB 3P45B 2Z2ZA 4IH5A 1NHVA 4XPEA 2XO7A 2J8AA 3Q89A 3G8SA 2ZJQQ 3OR1B 2R7RA 2WK4A 2YQ0A 3EWGA 3QT6A 2JEGA 4P2XA 2E44A 1ICEB 1WC0A 3GZ7A 7FDRA 5KG3A 2HHVA 2AJ1A 3MECB 4RBVA 2IFXA 4K5SA 1AZSA 4OYOA 4CLPA 1WWHA 1A7GE 2ALZA 1YZ6A 5AXLA 2DYAA 2KM8B 1PG5B 3VAKA 5CH7B 5A2QU 5GADU 2B4PA 1S12A 3PJWA 5DLGA 4JB8B 3PR4A 4AL7A 4JI3F 3D6FB 4M8LA 2Z0GA 3A12A 5E3QA 5ETLA 3EDQB 3G71S 5DLFA 1VQNS 1LXJA 1S48A 2F4FA 4YB6A 4KH1B 2VBZA 3PV8A 1X0PA 1W25A 1HW9A 1KEKA 4ZP6A 1N34F 5KOXA 2ASJA 4LFCF 1TELA 1W2IA 2BE9B 3QYYA 5A8WA 3LP2B 4UOGA 2X7IA 4L3NA 1URRA 4A8SA 1M90T 1NK8A 1XNRJ 3BM7A 2P9GA 1P9YA 5KT3A 3CF5Q 1N36F 3QJJA 2DY1A 1I1GA 2HW3A 4ED5A 3FGVA 4HI1A 3DRYA 1F60B 3AFGA 5F41A 4HDHA 4LSNB 1RHUB 5KFHA 3SZ2A 4JYAF 4FDFA 3QJPA 3M2UB 3MM6B 1Q8KA 4K4VA 4HHHA 4M5DA 3CCZA 4USWA 4LF4J 4DWIA 3AA9A 1KN6A 1KFSA 1KQGB 2M8HA 2BQRA 1RT6A 2XYPB 3CIMA 1N33F 2JFKA 2JLGA 2KZMA 3T1YF 5D8HB 2F63A 4UOFA 4NZ0A 1HQ2A 1VIOA 2N7CA 4Y28C 1RK8A 3SV3A 1Q53A 2OPSB 1B64A 3OTCA 1VQ8S 4HYKA 3TO8A 2VUGA 2W01A 3C15B 3M7VA 2DJWA 3HJVA 3QGIA 2L3MA 1SJRA 4FYYB 2WONB 4EZ6A 4ERDA 2FY8A 2RE1A 4PCQA 3HCXA 4R0EA 1SCJB 1DY3A 3EJMA 1QLNA 2ERRA 2ILZA 2B4OA 1OQ3A 4X4OA 2R2SA 2CJQA 3UCZP 3C6UA 2W8KA 1JKHB 2JDJA 2MZSA 4E0DA 2QMWA 1CG2A 4OX7A 1FHTA 2R7OA 2UVVA 1RHKB 2AF6A 1Q78A 4KAIA 5CD4A 4DLEA 3NGUA 3PYFA 3P5BP 2CIMA 1TL7B 3AXKA 4TXSA 1HHSA 3HSGA 4LF7F 4WU2A 4O3NA 4U7CA 2XY6A 1LW0A 3BR9A 1KR4A 2DHSA 3IGNA 2WOMB 4LR7A 3ZTQA 2GQ2A 1SL1A 4B3RJ 4OYPA 5FIIA 1T9WA 5IT0A 2XMMA 1URNA 3G8TA 4FNHA 3UDLA 3Q0AA 5ETRA 1HNIB 3QNWB 1JJHA 2RKIA 1QE1A 3CCMS 3M6XA 3GQCA 4A8KA 2M52A 2QL5B 3EMTA 4X84A 3NCRA 2PFDA 2DNMA 2MDAA 4OI0A 1TZ0A 4WE1B 1HPZA 5E2QA 5IOLA 4ZVEA 3UDEA 4CLWA 3A3NB 2LVWA 3GWCA 2RRNA 4DV1J 4YR2A 1HKAA 1AUDA 2IPOB 2G0CA 3I5CA 4OHYA 2KDOA 2VG5B 1RCXB 2FHOB 4KQZA 5D0EA 3S7RA 5HVHA 2NQPA 2VU5A 3IWNC 1I94J 4R5PA 5L8RC 2YPZA 2VA2A 1FEEA 1YSJA 5SUHA 2J0QD 3VVUA 1FERA 2AP6A 4PABA 1RZMA 3OR1A 4TVAB 1TK0A 4DPWA 4WZMA 2OEMA 2ZD1B 1ZPVA 4V19J 2ZDOA 3OR2A 1F6TA 3OTOF 2R8KA 2GIRA 3MMCA 3PHEA 4O44B 1HIYA 3W3SA 2G2ZA 1JXLA 2QYCA 3GFYA 4JI4J 2MTLA 2Z2MA 3PTWA 3KK3B 3VAFA 4AQYF 3K7RA 1TP7A 1Y10A 5J1EA 3CJ0A 4DX6A 4O4RA 4P9SA 5GAGI 3MR3A 4CO1A 4C8LA 3CULA 4YHHJ 2GAHC 2QLWA 3BREA 2BJ3A 2C2KB 3K5NA 1CBKA 2ZOGA 3DN9A 1UVMA 2M7SA 4DL2A 3LP1B 1Y9OA 2VDIA 3AQPA 1NRKA 2B3TB 3W64A 5HMZA 1VQ4S 2ZZMA 1PO6A 2C2RA 4G65A 3CT9A 1MSWD 3O1LA 4TU7A 1WC1A 5D0HA 4N8NA 2H1YA 4JI0F 1FJGJ 2WSFC 3MMJA 1NPKA 4KT0C 3B6BA 4CO2A 5IS2A 5HANA 2KU7A 1KC8T 2HHTA 3OHAA 3QWUA 2RKIB 1PBUA 3DKDA 1OYDA 4M5HA 2UVRA 1R0AA 4W92B 3NNAA 4UY85 3J7Z5 2CWKA 1RWWB 2GO8A 4X4RA 2Z56B 2JOQA 2XM3A 4C8MA 3U1MA 4ED6A 3QJLA 3DDIA 5B0AA 4DUTA 1SJ4P 3HP6A 3TOQA 3A1YG 3GFXA 5C24A 2H3EB 3BKFA 4Q5VA 4JV2A 3MMAA 4IKAA 5ETSA 4EO6A 3DU6A 3J7YI 1ZM2A 4EBDA 2AIRB 1N4LA 3CDEA 2ACYA 3GG1A 3MM5A 2UU9F 1YDLA 5C42A 3TAQA 3GSIA 2CXEA 3CCRS 4MJKA 1FCAA 2J9DE 3EPGA 2Y8YA 4CQ1A 4Z37A 3ETMA 3WHIA 2K3KA 4X4SA 1DARA 1TUWA 2UXDF 4K2XA 1HYSA 4MIBA 4KPCA 4ZPBA 3MM9A 4YUDA 1IKVB 2UUBF 3UN3A 4WXWA 1NEEA 5CABA 5LJ3Y 1S4FA 1JLGA 1SL0A 3OFEA 2Y8WA 4QIFA 5ETOA 3OLAA 3I56S 1XIQA 3PW2A 1HI1A 2IDLA 2XMUA 1NDKA 3IS9B 1WC6A 1TK8A 2UUCJ 4AL6A 1MW7A 1VBKA 4B02A 3R7BB 1VK8A 2P9CA 4LJMA 3TZYA 4EZ9A 4IRDA 2I38A 2X1AA 3P5TL 4ID5B 3FEYB 4DV3F 1RAFB 2EFPA 4H4OB 4YR3A 3K5LA 3MWBA 2OUGA 1X60A 2BEFA 3THVA 1IBKF 4LRDA 2BE2B 3IN5A 1XEZA 3MCMA 4PG6A 1C2PA 3GTYX 3MFIA 3CC2S 2ROPA 4NYOA 2KN4A 2E9RX 1NB2A 3FSXA 4UTGA 2DR5A 4OHWA 2M88A 2KRBA 4XTTA 1P1LA 2XI2A 3MMBB 1RHQB 2CJ9A 2LQBA 4EI2A 2NYIA 3BKTA 2ZH8A 2AYBA 4O3QA 3KLHA 3DGPB 1Q86T 3SSRA 2ZFHA 1H72C 1VYAA 1X4DA 2F1FA 4CLFA 1F2HA 5IFMA 4U67Q 2AYGA 2DR8A 3N9UC 3OTDA 3CB4A 3K0JA 3OT9A 3QO9B 3AJ1A 2B0GA 1ELOA 2BJEA 1RA7A 1RQ0A 2HWIA 2KYXA 4OX6A 5E5NA 5KFQA 4RUCA 3BR8A 2V34A 3JSMB 3KDNA 3D9BA 4OYIA 2KG0A 3QMQA 3ZTPA 1RBAA 3OVSA 4A8YA 5DGAA 3R7NB 5F8LA 5RUBA 2HRYA 4FS1A 4GKKJ 1IM6A 3PW5A 1YJRA 2XHCA 1RACB 3RBDA 3HHNB 1REGX 4M95A 3QT5A 3R2CJ 1IKYB 3W8PA 3SQOP 1IWAA 1TKXB 2V68A 1RU2A 2CPXA 1T11A 1KLMA 1LWEB 3ISNC 4L73A 1EKRA 2W9BA 4WIQA 6FDRA 1HA1A 2KHCA 3D6HB 4NLXA 3PJ9A 1HQEA 2LYVA 1X4HA 2ZH5A 5HROA 3CDAA 4I2PB 2B8QA 3BZQA 2GNKA 2VONA 3ZZRA 4TQSA 2DBBA 1JLQA 1NSPA 1T3NA 3HXMA 1ZTWA 1SQGA 1WHVA 1LKZA 1NLKL 2BM0A 3VGUA 4ZPDA 2DRDA 5DZ6A 3RB6A 5AE2A 1UJ6A 2GJFA 3JSRA 3MF5A 4HVZA 2M8DB 2G2OA 2FQQB 4Z7YA 2DNOA 3IS9A 2BANB 4BWJA 2PGCA 4RW6B 4USJC 4WTYA 3EGZA 3PFEA 1B0TA 3UDCA 1YKWA 1S1VA 4CH1A 2E1CA 2F4VJ 2FJWA 2VQEF 3L7PA 1IKVA 4LIWA 5DS7A 5CYQA 3LQVA 4DG1B 1PJ5A 1VBZA 2DVIA 2EI5A 2HMIA 1D8ZA 1VDHA 3HI9A 4ZJQA 3O2IA 3IXQA 4H54A 4X4QA 4KHPF 4JV5F 4NLVA 1GNKA 4ZP7A 4IDKB 4ANEA 1ZAXA 2ZH4A 3M05A 4JI5J 1CJKA 4OI3A 1CULA 1HLWA 3IGVA 4NE9C 3F56A 2LECA 4I2QA 4RW9B 2VD3A 1NUEA 2M4MA 1NSAA 2EVZA 2PEHA 3BN7A 3CJ3A 4M5MA 1JJ2R 3PR5B 4RL1A 3BH7B 2XBPA 3N0VA 4O3SA 4IG3A 2IC3A 3KKFA 2JJ4D 1UJ4A 4ECRA 1TVRA 1WI8A 2XMJA 1VC6A 5K8OA 6AT1B 3MUVP 1NJYA 4F36A 5HVGA 1C0UB 1RHJB 3M2RA 3Q8PB 4DUYJ 1NK9A 1WKJA 4HHUA 4PPZA 4USHA 2YPYA 1FNOA 3R5GA 1N33J 2WW4A 4YR0A 5KOWA 2XCAA 3B78A 1SQEA 4G6VB 1ZOTA 2DNYA 2L9NA 3BGRA 3LANA 2ZHAA 1A9NB 4RW7B 2BX6A 1LWCA 5KFGA 3GV8B 1UVKA 2NXUA 4QOTA 1M1GA 1V6HA 5JMNA 4K4TA 4BS2A 4DCPB 1DJ0A 4B9VA 4DSKA 1OYEA 4IR9A 4RNOA 1FA0A 2CJAA 2E7VA 3IR6B 5HLFA 2IBOA 1RWPB 1DHMA 1QAIA 2NSBA 4I7FA 2CJXB 1U0HB 2PD1A 3BSOA 3VAMA 2ZUAA 3GIJA 2DK2A 4PUOA 1WC3A 1S0MA 3OSPA 2QYGA 4YEAA 2YWGA 3PO4A 2IHR1 2HKEA 3M2VA 4J9RA 1S7IA 3MM7A 2HK2A 2IM0A 1HNIA 4WFBQ 1BD6A 3UW1A 2K7JA 4IO1A 3VAHA 2XI3A 1EAYC 1RAIB 2VBWA 3AH6A 3QO9A 2BQ3A 4ZN3A 2RU9A 1RLDA 3C16B 3KJVB 3MAQA 1LW0B 5L9NA 3R6GB 4NCGA 4RKUC 4OLOA 3UN5A 3LW5C 4N5SA 2FVPA 2UV8G 2B5JB 2W2OP 1GQEA 3UVJA 1OY9A 2D74B 2G9OA 3HD1A 1DBDA 1BQNA 1Q4RA 2XULA 3T6BA 3FBFA 3UPFA 4ECSA 3GJTB 1YX2A 2DB1A 4NXMF 1SKUB 4NLUA 1L3VA 1N52B 2P8IA 3CO0P 4CM0A 5A76A 4A8FA 1NKEA 4UZBA 2FVRA 3PW4A 1IJEB 4LRBA 4ED4A 2PMHA 2RMLA 5J2MA 1UZDA 1FRKA 4F7VA 1PGZA 2GAGC 3I0SB 1YJUA 4WBFA 3RU0A 4G1QA 3OVAA 4JV1A 3J80U 2V4QA 4DR5F 2MY7A 4ZCLA 5KFIA 2K1RA 1C0UA 1QE1B 3D1OA 1UEVA 2VG6A 1VCTA 4HR2A 4N77A 3AB2B 5CAAA 2XS2A 2YH1A 4YFUA 5IV4A 4TU9A 3NEKA 4DG1A 4DN9A 2RQKA 2LU2A 4QYRA 1KHVA 4RW7A 4QWBA 1U45A 5EUHA 2H4WB 1S9EB 1VQ6S 5FLXU 3G4SS 2C3UA 3GFHA 3LP0A 2JC1A 3RB4A 2POKA 4WPAA 5B0BA 3C6TA 2CQCA 3H5UA 2FVCA 4P75A 2DHHA 1EQMA 3LGNA 2W2MP 2EFNA 5D4OA 1TV6A 4I4BA 4WIIA 4DV4F 2VH7A 2AW0A 2D9PA 3ULHA 4ZVUB 4MT1A 2YNIB 3BGUA 3HVAA 2BZ2A 2JVOA 5D4NA 4BBYA 5LMUJ 1UPMB 1XC9A 4IG3B 2DH9A 3QAUA 5BYQA 2KTQA 1G1XA 3MEEA 3V81B 1RT5B 3EVMA 1OJ4A 2EW9A 5H1SV 4KFBB 1CJTB 3R7SB 5DDOC 3M6VA 4CO3A 2DNGA 4Q8EA 4WFNQ 5DZ7A 4DV1F 5ITHA 1U1OA 1LW2B 2J7UA 3FCVA 4ZPWR 1I51B 1UFLA 2CDRB 2FZCB 4X62F 2DR7A 1TAUA 3BBBA 4Z7CA 1HD1A 3BPDA 3D68A 3KLEA 1YJWS 4UQTA 2CRLA 1R0AB 4JI1J 2PDAA 4F8RA 3B4MA 3CD5A 4G1PA 3POTA 1FRJA 3ET6B 5LSOA 3PW7A 5I3UB 1EZZB 1KTQA 3OTOJ 3J81j 1IBMJ 5KTQA 3CJ2A 3IBCB 1U2CA 3W2VA 4L72B 5D3GA 3MEGB 2RUSA 2LP4A 2NXCA 1OPZA 5HBMA 3V6DB 1JWWA 2SXLA 1O8BA 5DDRC 2NZCA 2QMXA 4DFPA 2LEBA 3C3LA 2XMWA 4Y2IA 1BHNA 1F9HA 4OZLA 2FDNA 4MH8A 1JNRB 4C97A 2FJXA 2YWFA 4N8OA 4OYBA 4HDGA 2HQFA 2NXJA 1SQFA 2CNOB 2GMJA 3CJ5A 5HAOA 4YY3F 2O01C 3JSYA 5KT6A 1N5YA 3UE2A 3CMQA 2DCUB 4ECVA 2MLXA 5L38A 4KGVB 2VKRA 4KR0B 3GV7B 2AJ0A 3NGKA 1C0TA 2CQBA 2YKNB 3HKZD 2ATLA 4F0KA 2V2QA 2AU0A 1PYSB 1RSCA 1Y5LB 3QFHA 2QL9B 2ASLA 2HRTA 2XY7A 3DLBA 1YRTA 4YB5A 3DYAA 1BUXA 4G1QB 2Q6CA 1B0VA 3SSSA 4X4TA 2KKHA 4DV0F 1Y5NB 2R8HA 1S6QA 2IAJA 3RR7A 4ZVSB 1HBUA 2FB0A 2XS5A 1ZAWA 3RBEA 2AZ3A 4ZPTR 2EFVA 2J6TA 3HZEA 2AEFA 2V2ZA 1XQIA 3HHLB 3FC9A 5KAKA 1KVKA 2IVYA 1FRHA 2HNDA 3Q86A 2VV5A 3HM9A 5IM0B 1UKUA 2EG2A 2F8EX 3TAMB 2DPIA 4B9LA 4JI7J 2VG6B 2HNZB 1XNQF 1DFDA 4MYTA 4CO4A 2WBRA 2VL1A 2PI5A 4DSLA 1NXIA 1WORA 1X4CA 4NXNJ 2BKPA 3RTVA 3HHDA 5C5JA 3K5PA 3NG8A 2YNIA 1S5ZA 2YWHA 1LXNA 1PJ6A 3H40A 1MROA 4RLEA 4GC7A 2R7QA 4ZVPB 3OL7A 2ZH7A 3LPYA 1NM2A 5KT4A 3GYXB 1RABB 3GP9A 2IYGA 3R1LA 4I7FB 5IWAF 2HFZA 2ZWPA 2B43A 1TR0A 2MKJA 3RG6A 1U48A 3I0RB 2VA3A 5IT9Y 5HROB 5B0DA 4IRKA 1VQ9S 4ICLA 3T5HA 4PQUB 3PXGa 2V2VA 2V9KA 4WKYA 4J9SA 3D54A 4CLYA 1KQSR 2J5AA 4WYWA 3J81U 5DETA 5D4LA 4CCHA 2BKNA 2F8HA 2XWXA 3HHKA 4OIXA 1L3KA 2ZBIA 3I96A 1IKYA 4DX5A 2M5YA 1IR2A 3H4DA 2Y1IA 1R31A 4QPTA 1TL1A 2OD4A 3DI6B 4L6V3 4CI0B 2HS0A 5E33A 5DJBA 4K4XA 2HQIA 3KLFB 2QRRA 2ZE2B 5LMUF 2HHQA 4CIOA 4BC7A 1W26A 4PG8A 2CJKA 1ZZFA 3RAQA 1HBUB 5KG5A 3UWTA 3NAHA 4DX7A 3DLEB 4Q45A 4GVLA 3V6KA 3E01A 4CLUA 1C1BA 2ZITA 1CS4A 1JMTA 1U7LA 4ES2A 2ATCB 1M5SA 4C11B 1S0NA 3P96A 4FF1A 3TI0A 2G0JA 2XG8A 3AAWB 2RJZA 2YKNA 5F9LA 5F0WA 3BEGB 2CQDA 3JYTB 1RAHB 3NMRA 1CVJA 3TJ9A 3KDOA 2UZAA 2MQOA 1G3OA 1EIYB 4LMZA 2UXCJ 2G13A 3FK4A 4GO7X 4KIAA 1EKSA 4LF4F 3LA0A 2EXUA 4DL0C 4U9RA 1RT7B 3BGOP 4NLTA 3ONQA 1GMWD 4ILRA 3DYAB 1UA1A 3BV8A 1LQ9A 1TQLA 5D15A 3ZTSA 3GIKA 1WHYA 4ED1A 4DFJA 1RWOB 3MM8A 1PYTA 3EZOA 1U1RA 2M70A 1TL3A 2QIFA 3NWGA 3UD5A 2CZ9A 4YY3J 5M2UA 1SH3A 5A8RB 3G6XA 4DQSA 1GMUA 2HVDA 2MSSA 2JLFA 4KV8A 4UY8T 2JZ5A 2JHEA 3A8EA 3SDEA 2W7AA 3G6YA 2FGOA 2ZJPQ 5B09A 1IBLF 4RPFA 1NB7A 1ROFA 1D9AA 5K14A 3N6LA 2V67A 1T0TV 1SC3B 3DU5A 4JI6J 1NDLA 2M2BA 1AXQA 3FQKA 4O23A 2BVZA 1T94A 5ETVA 4AYBD 4CM2A 4CTAA 4RNNA 2FHJD 3GU0A 1GT8A 2DGXA 5CD4H 3M8QB 3EM1A 3O5TB 3G82B 4LRFA 4LSZB 4DDFA 1FO1A 4DR1F 2IA6A 1YK9A 4ED0A 1RT3A 1Y0HA 2HURA 1S1TB 2PEBA 3C14B 3DLLQ 4LF7J 3BPSP 3MGJA 1H7WA 1U24A 3TA1A 5JXSA 1NJZA 4PXCA 1X5PA 2HVEA 1SUQA 2AYEA 2FD2A 5K8PA 1MMDA 1X4GA 3SCLE 3RUBL 4WWSA 3LH2S 4ED8A 3IM8A 2AGPA 3H59A 2IRYA 1VJWA 2QLFB 2ALYB 3BYRA 4PR6A 1TMJA 2ROGA 4O3OA 2MLYA 1N32J 3G87A 3LAMA 4P10A 2GIQA 3PKYA 2M9KA 1RTIA 2C22A 2CZ4A 4KE5A 4DQQA 2VC0A 2DNZA 2O5DA 4KH0B 2AX0A 5GAEI 4LF9F 1DTTA 4I67A 4OX9J 4ANCA 2V4JB 2H48B 2GC8A 1NSKL 5A8KB 3K8WA 2DNNA 3DOLB 2NLWA 4IG0A 4KGKA 4PYAA 4WP3A 4D3HA 3HMJG 4RU9A 4F4XA 4PPDA 1NBEB 1YZ7A 1PIEA 1T3OA 1TMMA 4KYZA 4QW8A 4YQWA 1RKJA 2C3OA 4DV5F 4ZVQB 2LEPA 4S0MA 4OZ1A 5T41A 1T95A 1Z2ZA 2HS4A 5L46A 1HNWJ 1SKRA 2MJNA 1S99A 2XQCA 2C1EB 2J9CA 1E6YB 3RYLA 3W63A 1VQYA 3T1HJ 2OGUA 2FLOA 2B9WA 4F3OA 4IFYA 4B3SF 2AJQA 2JX2A 1UCNA 1BQNB 2A2DA 4KKOB 5E3CA 2DNPA 4TU8A 4B9NA 3GILA 2K3IA 2NUUG 4DR7J 2AEMA 2A1BA 6FD1A 5HP1A 4DR4J 3NWRA 2A6MA 2OMOA 3CCLS 4DUZF 3QRPA 5T7LA 1YVFA 2CQHA 5BYSA 1Q82T 3ZFVA 1PCAA 2BKOA 2W7PA 1U02A 1IKXB 4MTPA 2WRMA 4QPXA 1M0SA 4R0JA 4RX6A 3MR6A 2E29A 4F4WA 1KWMA 4JUZA 4ZVOB 1KLNA 5CZXA 1VQPS 2F4VF 2DGVA 1FDAA 1PYOB 2D7SA 2GJIA 4NMXA 2YNGB 3H4BA 2EKNA 3E01B 4NLPA 1CQMA 1GFWB 4M5KA 3R5CA 2IC3B 3NP5A 4WU3A 1KOHA 1SC6A 2V94A 4Z2XA 1BLUA 1LWXA 4J9LA 4LBPA 2PE8A 4DR4F 2FJDB 2RVJA 5LXYA 4B3TF 2CPHA 3ZZUA 1VQ7S 3MCOA 3VHQA 2DEJA 1TTHB 3AD9C 3MM5B 4PKDB 2O67A 4CLLA 4DXLA 5AJ3J 2XLJA 2A3JA 2W25A 4X64F 1OQ6A 5AXNA 3ZNJ1 1HI0P 3DHXA 1TU0B 1VLOA 3V2UC 3WX4A 3Q83A 4JV0A 2B7CB 4PZVA 3QLHA 5C25A 3ISZA 3UCUP 1S1TA 3C14A 2HNYA 8AT1B 4J9QA 4YHHF 2PA3A 5IC6B 2H51B 5DDQC 1LFPA 4EU0A 1D9DA 2HYIB 4B3TJ 4LF8J 4PG4A 1AZSB 2MQPA 2Z8QA 1ZTTA 4HT5A 2OTJS 2HWTA 1RBLA 2XYHB 3ELHA 4MMOA 2ZKUA 4DV0J 4F50A 1U1LA 1JJ4A 4IFYB 1NDPA 2EFGA 2VPXB 2KXHA 1WSVA 2JL9A 3FSYA 4OI2A 5L1JA 4C9DA 3GIIA 4ECUA 3K8VA 2E7XA 2CPJA 4J9VA 3V4MA 3LWLA 1QAJA 1MN7A 4L75A 2XY5A 1WD6A 4NA3A 1MNEA 2BABA 3UR0A 3ENVA 3D0IE 3L95X 2WSCC 3KUHA 3SEOA 4XIUA 3C66A 1FWLA 4K4SA 2QA1A 1S1VB 2FC9A 3OBIA 5BXIA 1P6TA 4AD6A 4B3OA 1RWMB 1JJCB 2J7WA 3S1TA 7AT1B 4K0KJ 4F02A 2YKPA 3M8SA 5M2PA 5MLCV 4P7TA 4WFZA 1YLXA 3FRZA 2ZNZA 4TLRA 2IJNA 4OYZA 3E2EA 4DPYA 1LWEA 1U8SA 4QBUA 4DS5A 1QAYA 4ZKAA 4RU2A 3W2VB 1J5EJ 2VFVA 2DGQA 4QWAA 3RAXA 2B9EA 3D28A 3ILLA 3QGPA 1SBRA 4ANDA 3K59A 1F3VA 4ECZA 2E1AA 2E5GA 2ZWOA 4NZ6A 1FFGB 2R8GA 3ILIA 2HIYA 3PX4A 4W4MA 1KSPA 1X8DA 2VPZB 4K50A 1YI2S 2ZH2A 4DV5J 1IUJA 1FKOB 4H4MB 4F4YA 2RILA 3QPIA 4H4KA 2ZBCA 2Z4PA 1TL3B 3BDEA 4U6PA 1VRTB 3N28A 3MTJA 2KXNB 2ZBPA 3HX9A 4AQYJ 3KK2B 1T9UA 5AXMA 1H6KX 2IM2A 3CMAS 3HFZB 4DS4A 1IKWB 3L7UA 2Q1LA 3TA2A 2AV5A 1NJXA 3TQEA 4CYUB 4KHMA 4IRCA 5B0FA 3C6TB 3DOKA 1IQTA 2OSRA 1M1HA 4F25A 3POTB 5HO4A 3JAMU 2UUCF 3O8WA 1JXVA 4ECWA 5C2CA 1FWKA 3V4IB 1MLAA 1RDRA 3R5BA 4XDCA 4LF6J 4JBCA 5J2NA 3H2VE 1FX2A 2XS7A 1WI6A 3H98A 4CT9A 5F8NA 5ETNA 3DRPB 3VGVA 1S49A 2R7SA 3MAAA 4TKTA 2QE5A 2ACMA 1UFKA 2ZNYA 4OMFG 5E3RA 5HBMB 2HQ3A 3V6DA 3K2YA 2LXFA 1F5CA 1FTCA 1YBUA 1H2UX 3ETOA 1JLAB 2F3JA 2R8IA 5HP1B 2B4UA 2FLLA 1MU2B 4F2RA 2HBZB 2WCXA 3IM9A 4UUXA 2AGQA 4KSEB 1OY8A 5EWEA 2CQIA 1TKZA 2YKAA 4DUZJ 2LXUA 1S9GB 3CCQS 2FGCA 4P73A 1VISA 5H9EJ 2E9ZA 1ZA1B 3CEDA 4QYZJ 4LF5J 2XMKA 2AT1B 3VAGA 3SI8A 1JIHA 2UP1A 1N0VC 2MZTA 4ZN1A 1JLBA 4JI2F 4WKRA 1IWGA 1REVA 2ILYA 2QZ8A 2XSFA 3IO1A 1NSQA 3UN2A 3EZUA 2HGMA 2BACA 5HVFA 3UI3A 2KL8A 4OI1A 3T9ZA 1G6BA 1NJIT 1L3TA 3HZGA 1ZZNA 1GMWA 2V0NA 2RD5C 4TN2A 3ZO7A 2XSJB 1R27B 1U49A 1WOPA 1OMSA 4LFBJ 2FY1A 3Q8RB 3GCWP 2FJVA 4PQUA 4ZOSA 5KFBA 3I82A 2BOPA 4UF4A 5H9FJ 1LWFA 2ZZTA 4F67A 2C2ZB 2VIHA 1QD1A 1FESA 2VKZG 4A8OA 3KLFA 1HNZJ 1H73A 1R8PA 2BA9A 2E66A 3EUNA 5J2QB 3A8IA 4PAAA 2KT5A 3U02A 3DI6A 1TAQA 2CJYB 1OWXA 1RTJB 4I56A 2CVEA 1IBMF 2KFNA 2VOOA 2FHKA 4C0OC 2E5HA 1QUPA 4F3MA 1H74A 2N3OA 1HL6A 2BV3A 2VDHA 2UV8A 4Y2KA 2CPFA 2A2CA 5HI7A 3NOGA 4C0BA 5T7LB 3H5YA 4ILLA 1FFSB 5E0OA 2AMCB 1FKPB 3DRPA 3ZZOA 5IT9U 1N5TA 3B82A 4KO0B 3KUEA 4HHJA 1DQ8A 3PYDA 2X1GA 3ZZTA 1FJEB 1IBCB 4B9TA 3NL0A 1EQ0A 3P8BB 2VB6A 3IBFB 4P72A 1X4EA 1KQKA 1XMQF 1WEYA 4LVOP 2C2MB 1X4AA 1DLOA 2HVHA 1FI4A 3GV5B 3J81Y 1KDNA 2HQCA 3FKBA 3G6ES 5GVQA 1FXLA 2GS8A 4R8UB 5K20B 4YOEA 3D0HE 3QGGA 3L3CA 1HNXJ 3DDNA 3G8QA 3PRBA 5I3QA 4CP5A 2HK3A 3FZ2A 4ZIVA 2OI2A 3QT8A 3WQPA 3CUNA 3J7A1 2OPPB 3DLKA 3P49B 4Q7AA 2LA6A 1R7IA 1VRUB 2CPZA 1UL3A 1RAAB 3A3OB 1APSA 3G82A 2VPYB 3IC1A 4QIWD 3P3DA 1HBOA 3AXMA 3KJQB 3D6TB 2KG1A 1KRPA 2DHGA 3CCTA 1Q8LA 3SSQA 2HHHJ 2Q43A 1N5SA 2QGFB 3MMCB 4O44A 5LMNJ 4URGA 4N56A 4JI5F 2CQPA 3DLGA 5ETKA 4CT8A 3OPKA 1O5JA 1U25A 1Y3JA 9ATCB 4Q43A 1YBTA 2YNFA 3US5A 1I94F 4DX8H 5GAGU 3OJSA 3WC2A 2MJUA 1N5VA 4ETZA 4HEA9 2L9WA 4LSLA 2GFFA 3BN4A 4PWWA 1WDDA 1H7XA 2MKKA
chains in the Genus database with same CATH topology
1S77D 4YB1P 3M4XA 2ZH3A 3TYTA 4WJBA 3X3UA 5IXUA 1IN0A 2PMZD 4MK9A 2PC6A 1LWCB 1U6FA 3QAEA 4QQBA 4N47A 1WNEA 1FF2A 1LV5A 2YH0A 5EX0A 3WDOA 3DXBA 1TL1B 4PWDA 5KFKA 2QSFA 4C8OA 3PEJA 2CPIA 3OHBA 3T6JA 2CJBA 2Y0SD 2YNHA 2QT7A 4C8NA 3CD6S 1R89A 4KPYA 3AA8A 4QR0A 2GHWA 5LSLA 3DLEA 1XERA 1ZM9A 1DQ9A 4A48A 1BGXT 3FNNA 1RTIB 2MYFA 5CCMA 1V3SA 2HS3A 4QU6A 1Y3KA 5IQ6A 3FMWA 1KNZA 1GXUA 1IJFB 2KFZA 1VRUA 4U7UK 1RTHB 4JI7F 2EWHA 4XK8C 4AXJA 1N88A 3FSIA 2DCLA 3TAPA 2OH2A 3RZAA 3UCGA 2K8GA 5KFOA 3MR2A 2XGPA 4LIRA 2DNLA 2BRLA 1VGYA 1VRTA 2YKMA 1OSCA 3N01A 1VQSA 3QGHA 1NKBA 1C4AA 1K9MT 3MR5A 1DLOB 2IBKA 3MCSA 5DRKA 1TKTB 4GC6A 2CQ1A 2HFNA 5FJ4A 4OLPA 4NLDA 3QWPA 1VC5A 4LQ3A 1RJJA 3CIZA 2YX1A 5J2QA 1U4BA 1JKHA 3Q2SC 4RUHA 3D2WA 1NK7A 1V9OA 2IMWP 1FRLA 3EZ5A 4ECQA 4JI1F 4TLQA 3KMQA 1HWLA 3ENWA 4B3RF 3MTKA 1MU2A 4F2SA 3LP0B 1ULRA 4NRUA 4UQGA 3OJUA 2HHUA 2DIVA 2M3DA 5A8WB 2KM8C 3T5JA 4DV7F 1FRMA 4DJBA 2OPQB 5LJ5Y 2GQCA 5IQQA 2DRAA 3PJXA 3THTA 1X9MA 1VBXA 3DRXA 2EFOA 4PXEA 4DEZA 2WONA 1FE4A 4DPOA 1SJQA 4K59A 1XR7A 4C8LA 2BXJA 1H0HB 2WHOA 1FHTA 1Q7LB 4Q2MA 2D41A 1EETA 3FZBA 3TA0A 5HO4A 2PSZA 3LALA 4LSNA 1FRXA 3DRSA 2CQ4A 2J6SA 2RQCA 4ZHRB 1KOOA 4DF4A 1WELA 1Q8BA 1ZM3A 2BM1A 5KFYA 3MM7B 2Y1RI 2K7KA 5MAOA 3KMSA 4J9KA 2VFTA 2F9JA 2J9EA 3MOJB 3G6VA 2FVSA 5E3PA 1U1QA 1GAOA 3O3LA 2DNHA 2UXCF 7FD1A 1FJ7A 1K0TA 5E3AA 2M0GB 4KRWA 1GX5A 2HPUA 1D3WA 4ZPCA 2OFGX 3HHLA 1C1CB 4C4WA 2YX4A 3CC4S 4ICLB 2OD6A 1KTVA 5CYQB 4HL9A 1V3ZA 1L3UA 1RT2B 1RTHA 1U6BA 3DOKB 4GKKF 1HMVB 3ITHB 1PC4A 3BSAA 1FD2A 2DO4A 1HBMA 1SJ3P 4X2BA 1VC0A 1R3NA 3KK2A 1WG1A 3D1QA 2CQ3A 3UD4P 2I5JA 2HHWA 1IKXA 3IG1B 3MPYA 3H5XA 5CA5A 1UVNA 1V3RA 4TYAA 3PM9A 3U27A 4AXIA 5DM6Q 2AYMA 5CYMB 3SYZA 2N7YA 5EWFA 1XMOF 1U47A 4ZLPA 4FF3A 1VK3A 1RWUA 3SV4A 2IVMA 5C24B 1CPZA 4NLRA 3OL8A 1WHWA 1TVRB 1UVIA 5K14B 3HVTB 2HNDB 3THPA 3AJ2A 3K5OA 3GR1A 1SV5A 2C3YA 5E41A 2VC1A 4M63A 3PW5A 2CYYA 2VPWB 2W4CA 1JB0C 3TNVA 4V19X 2C42A 2V9WA 2MQNA 3IAM9 2BJDA 4H4MA 4HLBA 2PI4A 1BWEA 4ES3A 2WBMA 3OFGA 4DUYF 1R8CA 1QSLA 4I2QB 4RW9A 3CCUS 1X5SA 4OJGA 2MZJA 3EGNA 4P6QA 1JLCA 2EG1A 2ZKTA 4C3LA 3GE9A 2BW2A 2XGQA 1P9QC 2MMYA 4TY8A 3KYLA 3KWMA 3T1AA 2P6TA 3M32B 2H9ZA 2C2DA 1TFWA 4ZCIA 1FJCA 4YB7A 5A6WA 3TRGA 1RISA 3CJ4A 2VG7B 2OP5A 2C3MA 1UEUA 3ICLA 4FVCA 3I31A 2BUNA 3CE8A 4HH0A 4NA2A 3FDSA 4RWWA 1S6PB 4NCGB 3PIOQ 4C8KA 5L1KA 2R7TA 1HWUA 3F41A 2DD8S 2HHXA 3OFHA 2W24A 1G2EA 1NK6A 2DRBA 5KG1A 3CXCR 2DHAA 2GV1A 4TY9A 1S7HA 4TNOA 3OTEA 1HQUB 2ZE2A 4Y2MA 1JLQB 4Y00A 2RU3A 1T03B 3HO1A 1U1MA 3RRKA 2HHHF 1U1KA 1LOUA 2HAIA 3WZ0A 2J0WA 2BE2A 1CLFA 3H2LA 2KH9A 3U7JA 3Q23A 3TW0A 1E6VA 4MFBB 2J0XA 3IR5B 1S1UB 2I2YA 1FD8A 3VZIA 4NCAA 2D1CA 1S9EA 4K0KF 3AQOA 2FLPA 3UNGC 4E98A 2HHPA 4ELUA 2P5VA 4I1TA 4QIVA 1RT5A 3T1HF 3Q2TC 3QIPB 5F3TA 2R7VA 2GA7A 2K1RB 2I1RA 1WHXA 2WSEC 1E6YA 1Z2LA 5KFTA 2IRUA 4R8UA 1T05B 1TV6B 4ZMMA 2OJ3A 2YNFB 1RA6A 1FKAF 2HG4A 3C2PA 2BR0A 1X5OA 4OQJA 1F9FA 5GAEU 4K4UA 1RT6B 4LUBA 4DLGA 4IFVA 1C0TB 1MMLA 2OPQA 1VQOS 3R1HA 1ZPWX 4OFZA 1WF0A 2LQ5A 2BRKA 3I5AA 4ZVGA 4J9OA 5J2PB 2R8JA 1Q8IA 2R9LA 2RF2A 1TKZB 1ZH5A 2LXIA 1RTJA 3B4DA 4A8WA 1SXLA 3O6QA 4MIAA 4DR6F 2H5EA 1KVJA 2FHMA 3WBZA 4IOAQ 5KFLA 3M1VB 2HFOA 1OS5A 3CJKA 1NAQA 3HPOA 2NREA 5DO2A 4KJIA 4MFBA 3DRRA 5AE3A 1TUVA 2XSJA 1F5BA 1RTDB 3BGLA 4RUAA 2XHWA 2E5IA 2NS1B 5CQGA 3HHEA 3S01A 3Q8QB 4O3RA 1LFWA 2CDQA 2B4VA 1S6UA 5EWGA 3T3FA 2V4JA 2V8GA 2QFJA 1YIJS 1HFEL 1R43A 3T9NA 2V8DA 2EBGA 4ELTA 4Y2AA 1FVSA 5DG8A 3GFZA 3OR2B 5GAHI 1S6PA 4GMKA 1SJ1A 4EBEA 1NH7A 5EDWA 4KGMA 3E8OA 4OV1A 1HQUA 1VOMA 1T03A 1C1BB 4LFBF 2FJBB 3J80Y 2HWHA 2GX8A 5A2QY 3JB9k 4EO8A 3CMES 3KK1B 1XBWA 2B6AA 1Q7YT 2OSQA 3VAJA 3E51A 4I69A 1IKWA 1B0PA 3KOAA 1Z1ZA 1RT1A 3MEDB 3H25A 3JYTA 4R25A 2YNHB 3GB0A 1WTFA 1UVLA 1WEXA 3BQ0A 4FF2A 4G1IA 2W9CB 2R2TA 4NLSA 3VWSA 4IDKA 2KHDA 1ZBTA 3BJYA 3C8YA 4QZVB 3T5KA 1G7CB 4J9NA 3KLGA 1H38A 3PZPA 1H2TZ 2MKHA 5A8RA 3OQ2A 1SV5B 2N4CA 4DQRA 3RW6A 1VMBA 2MQLA 3CCES 4DR7F 3KLIB 2EFQA 2GO9A 3D0GE 1P8GA 4A8XA 4WF9Q 3NAIA 2HVZA 2U2FA 3TQ1A 2CPEA 4RW4A 4UW2A 3V6JA 1AFIA 1HWKA 2U1AA 2D3ZA 4RW8A 4XAKA 2RUGA 1QUVA 3PO5A 2RRAA 1BC6A 2HZCA 4NLYA 1D8YA 5THWA 5EHHA 1YRUA 4FBTA 3SCIE 2AWZA 3FCHA 4ZVHA 4C2MA 4DL3A 1QSYA 4OJHA 2BDPA 4B9MA 2FJAB 3OXLA 3N6NA 2HIQA 1VFJA 1YJTA 4DN0A 3DNCA 1N6QB 1RTDA 2XMVA 1KONA 1VS3A 2JC0A 3QZ7A 2UXBF 1WG4A 2QSWA 3CPWR 2W8LA 3FEZA 3FQLA 3H8YA 5C42B 1R6YA 4DV6F 1BQMA 4DSFA 3GG0A 3LGMA 5KFEA 2V2KA 4QWDA 4Y65A 2QA4S 2F8MA 3H20A 4OZ5A 5B0EA 1M5VC 4UOCA 2JEJA 3JSBA 2J0SD 5KFMA 3PACA 3MAHA 1PSDA 4TQRA 3W7BA 3ISND 5IT4A 4LFAF 2X51A 3DRRB 1YJ9S 4EBCA 1JK9B 2FVQA 4FYDA 2N4DA 2NSCA 3CVKA 4USIA 4I6AA 1TK5A