4C4WA

Structure of a rare, non-standard sequence k-turn bound by l7ae protein
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
96
structure length
96
Chain Sequence
TRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
publication title Structure of a Rare, Non-Standard Sequence K-Turn Bound by L7Ae Protein
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 96
sequence length 96
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4c4wA00
3VAKA 2ZJQQ 1N88A 2MQNA 3BO3A 3G71S 1W2BR 1FJCA 2LEAA 1OO0B 2MSTA 3UCUP 4WFBQ 3H2UB 1Q7YT 2QFJA 5DM7Q 2CPIA 3UE2A 2M7SA 3CMES 3THTA 3CCMS 3P3DA 4WFNQ 3P49B 1N8RT 2L41A 3BO4A 3CCVS 2DH8A 2DNYA 2DO4A 2OTJS 3V4MA 2HGLA 1OPIA 2GHPA 4LIRA 2MGZB 3CCES 2G4BA 4WF9Q 4QU7A 1RKJA 3CCSS 3CD6S 1ZH5A 2ZJRQ 3NMRA 3CC7S 5HL7Q 2EK1A 2K3KA 1QM9A 4PR6A 2MZSA 2OTLS 2MJNA 1VQOS 3IRWP 3ZZZA 2KN4A 1VC0A 4ZKAA 1X5TA 2DNPA 1FJ7A 1S72S 5DDRC 3CPWR 5EN1A 1D8ZA 2DK2A 2G0CA 3MD1A 2DGOA 2NLWA 3Q2TC 3RW7A 4C7QA 2KG0A 3SDEB 3LQVA 2YTCA 2BZ2A 2KI2A 2KRBA 2AYGA 2PEHA 2NZ4A 3P5TL 2MQQA 3CULA 5FJ4A 4V19X 1YJ9S 5MLCV 1X4CA 5BJRA 2XB2D 2A3JA 1WF1A 2D3OR 2VOOA 4Y0FA 1YJWS 1YHQS 2DGVA 1WF2A 2MKHA 2MZTA 2EVZA 2MKIA 3TO8A 1P27B 2KXHA 2LYVA 2M9KA 5LJ3Y 1YIJS 1U1RA 4FXVA 2MMYA 4QPTA 1WG5A 1U1MA 2DISA 3VAMA 5DDOC 1X4FA 1A9NB 1WHWA 2MHNA 4CH0S 2MKKA 3CCUS 3CC4S 5LSLA 2JVRA 1WELA 3UWTA 2BOPA 2DNRA 3VAFA 5CA5A 3MD3A 5LXYA 1RK8A 2LEBA 5HO4A 4Y00A 3CC2S 2MXYA 1UFWA 1WG4A 5LSOA 2HGNA 2CQ1A 1G2EA 2KM8B 5GAEU 2LMIA 5DETA 1DHMA 5ITHA 1B7FA 2AYMA 5JVGQ 5IFMA 3R1HA 3HHNB 1KD1T 2MPUA 1WG1A 1K9MT 2LXIA 3EGNA 2KT5A 2YH1A 2E44A 2M0GB 3SXLA 1AUDA 1OIAA 1VQKS 2MQMA 2DITA 1M1KT 2MZRA 2LA4A 2X1GA 3CCQS 1SJQA 2DNHA 2GO9A 3D2WA 2DGXA 2V94A 3G8TA 4EGLA 3CMAS 1VQ6S 1H2VZ 2CQ3A 2FY1A 1U6FA 3B4MA 4CQ1A 1FO1A 2MZQA 5GVQA 2MY8A 1JJHA 4LJMA 3R1LA 1CVJA 5IM0B 1X4DA 2MZ1A 2L9WA 3CCRS 2DO0A 1Q86T 1QVGR 1VQ9S 2RRAA 1F9FA 2HZCA 5D77A 1R8HA 1YTYA 2XS5A 1N54B 2CPYA 2DHGA 2J8AA 3VAGA 1VC6A 2LQ5A 3P6YC 5LJ5Y 3NNCA 2OSQA 4UY8T 2VONA 2OSRA 5DDQC 4J5OA 2CQ2A 1VQ8S 2QEXS 2RRBA 3R27A 1S79A 1YJNS 1R8PA 1DRZA 2HYIB 1WI8A 2JVOA 2MGZA 2CQ4A 2LECA 1BY9A 1HA1A 1P1TA 3VAIA 1PO6A 1VQ4S 1DBDA 1U1NA 2CQBA 2MJUA 4F02A 3NNAA 4PKDB 1SJRA 1XN9A 3VF0B 3S01A 1H2TZ 1X4HA 3TYTA 1FHTA 3MUTP 3J7ZT 3U1MA 1VQ5S 3DXBA 2KM8C 2DHAA 3TP2A 3I55S 2E5IA 2DNOA 2CPXA 2DIVA 3L3CA 3UD4P 1M5VC 2K8GA 1WHYA 2DNMA 1VQNS 2CQIA 5GADU 1SJFA 2F9JA 2M52A 3MUVP 1O0PA 2JRSA 2CPDA 4WIIA 3DLLQ 2DGTA 4TU9A 2M4MA 2FHOB 2M2BA 3BEGB 3BS9A 3UD3P 3SDEA 1M5OC 2CQHA 1KOOA 3RW6A 3PIOQ 3MOJB 3NS5A 2DGWA 4YUDA 1UAWA 4TLQA 2D9PA 3S6EA 3VAJA 2CQDA 2U1AA 3VAHA 2KHCA 2SXLA 4F25A 4QQBA 1Q81T 1SXLA 1Q82T 4WKRA 2MZJA 3CTRA 3EGZA 2CQ0A 3US5A 1NJIT 3G9CA 4IUFA 3I56S 1JMTA 2DNNA 1U1LA 2XS7A 2ADBA 1WHXA 4ERDA 2M88A 2MYFA 4Z2XA 3CXCR 2HVZA 2RS8A 3CCJS 5H1SV 2J0QD 4W92B 2CPJA 3MI7X 3ZZYA 5LXRA 1WTBA 1KQSR 4RU2A 1IQTA 1KOHA 2KU7A 2PE8A 4A8XA 4YB1P 4ED5A 4FXWA 2YH0A 4TU7A 1K8AT 2LKZA 2MSSA 3MURP 1UW4A 1VC5A 2AYEA 4CIOA 1VBXA 2B0GA 2KRRA 2DGUA 2X1AA 3CF5Q 2CQGA 1M5PC 3IWNC 4C0OC 2MQLA 2FC9A 4TU8A 3PIPQ 2JX2A 2D9OA 3SMZA 1NU4A 3S7RA 2CQCA 4W90B 1X4EA 5GAHU 3G96A 1WI6A 2RS2A 2MY7A 1H6KX 1JJ4A 2KXNB 2MB0B 5IQQA 3G6ES 2XNRA 2DHSA 3NNHA 3Q2SC 5CYJA 1U1OA 3BO2A 4UQTA 2DNKA 2FC8A 2DNGA 2DNQA 5JVHQ 2U2FA 1D9AA 2XS2A 2XSFA 1X4BA 4YOEA 1WEYA 1VQ7S 1FT8A 5IM0A 4IO9Q 4IOCQ 2I38A 1HL6A 2RQCA 3CCLS 1WEXA 4PRFA 2DGSA 2DNLA 2DGQA 2MQPA 2KH9A 2E5HA 2RQ4A 2RU3A 2QA4S 2G1DA 2MQOA 2MKJA 4M5DB 1VQPS 2YKAA 1YI2S 2OIHA 4P6QA 1VBYA 2DNZA 2CPHA 2VOPA 3OW2R 2N7CA 2E5JA 1YITS 2N3LA 1WEZA 2OJ3A 3U1LA 2ZJPQ 1X0FA 3CUNA 2RUGA 3VALA 1HD0A 3NS6A 2KFYA 1WHVA 2DH7A 2X1BA 2KXFA 1DZ5A 3MDFA 4WFAQ 1L3KA 1A7GE 5D78A 4OZ1A 1NO8A 1M5KC 3ULHA 2MKSA 4U67Q 1H2UX 3UCGA 3FEXB 2N82B 1UP1A 2RT3A 1SJ3P 1X5OA 1QVFR 2ADCA 2KYXA 3FEYB 2LCWA 1PGZA 2VODA 2FPHX 2LXUA 5GMKa 1WF0A 1U1PA 4BS2A 2EK6A 2WBRA 3J7YU 1YWXA 2X1FA 4OZ0A 2F3JA 1URNA 5CXTA 3JB9k 2KG1A 2HGMA 3EX7B 2M70A 2JWNA 3H2VE 2ERRA 2L08A 3UCZP 1SJ4P 2YWKA 2F9DA 2CPFA 1VBZA 2M8HA 2N3OA 3MUMP 2KVIA 1X4AA 5DM6Q 1KC8T 3G4SS 2RNEA 2AYBA 2M8DB 1HD1A 5GAGU 1X5PA 1X4GA 1U1QA 3B4DA 3HI9A 3MXHP 2XNQA 2MKCA 2DB1A 3K0JA 2DIUA 1ZZNA 2CJKA 2RVJA 1WWHA 1U6BA 2CPZA 1OWXA 2DH9A 1ZZFA 3LPYA 1N52B 4CH1A 1FJEB 3N9UC 1X5SA 4IOAQ 1FNXH 4C4WA 2O3DA 5DDPC 1K73T 2Q79A 1U1KA 1M90T 2I2YA 2CPEA 3G8SA 4WCEQ 2UP1A 4QU6A 1VQLS 4LMZA 1U2FA 2J76E 3THPA 2CQPA 1VQMS 4F26A 2DHXA 2AD9A 2E5GA 1FXLA 3S8SA 2LA6A 1JJ2R 2J0SD
chains in the Genus database with same CATH superfamily
3VQSA 9ATCB 1JB0C 3CJ8A 4IH6A 2NPIA 3KLIB 1Q7YT 2J6SA 1DLOB 1PG5B 1CULA 3EGWB 2ALYB 2DH8A 2HQFA 3V4MA 1BXNA 1JLCB 2NS1B 3H98A 3PEHA 2Z2LA 4LIRA 3CCES 3QYYA 3RBZA 3J80U 3LWLA 2UXCJ 4P9SA 4H4OA 2W9BB 1TKTB 1VC0A 2DR5A 4OYAA 4Q0BA 1FJ7A 3CPWR 4RW8A 4A8QA 3OFFA 1YX2A 1APSA 3GSDA 1R8AA 2W01A 5CCMA 2YTCA 5J2QB 1S1UA 1FDBA 4RZRA 2JOQA 5KFTA 1T3OA 2CNOB 2UUBJ 5DQHA 3CULA 1RT2A 2V8DA 5GAEI 3LP0A 1YLXA 2D41A 2KXHA 4JI6J 3CCUS 4X4VA 4DLEA 1PYSB 4LF6F 4CYUA 2JVRA 2K7JA 4USUA 2Z2ZA 4C8YA 2C42A 1UFWA 2DD8S 2VQFF 4CO3A 2WONB 3W65A 5DETA 1NAQA 2W2QP 3BZQA 1LV5A 3V4IB 1N33F 1GTEA 4RWXA 2BANA 1SC1B 3HXMA 4OX6A 5LM7E 2M0GB 3MMBA 5DJBA 2LA4A 4S0MA 1Y5LB 2YQ1A 3HSGA 4KIAA 2ALZA 3R1LA 1QDUB 2HAIA 2WOMA 3N6NA 2I9SA 2HBRB 1UWBB 3RBDA 4BHQA 1T9TA 1N32F 1ZM9A 5B0GA 4UY8T 1HQUB 1GFWB 5DDQC 2FLOA 2RE1A 2FVQA 1VRQC 2RRBA 4Y28C 2VFVA 2OMOA 2CQ4A 1C0UA 3R7SB 3GV5B 1HBNB 3TA2A 2KFZA 1H2TZ 3I5BA 3E2EA 1F2GA 4XDDA 3UD4P 4LQ9A 3PV8A 3CVKA 2B51A 1VQNS 2JH3A 2P8IA 2JRSA 4WIIA 2C1EB 1VHIA 5IQ6A 1M5OC 2Y0SD 2J0XA 3D1HA 5KG4A 4EBCA 2Q3PA 2CQDA 2BJEA 2KHCA 5HLFB 2HHVA 2B4PA 2BX6A 2MZJA 1RT4B 4ECWA 2QRRA 5A8WA 1EETB 3DRYA 4YHHF 1YJTA 3SSQA 2ADBA 1RT1A 2F40A 2G2ZA 1JLEB 1S0MA 2CIMA 1ZAWA 4NLYA 4DN9A 4A8XA 2LQJA 1EP4A 4DPTA 1E6VA 3PRBA 4A8FA 2LKZA 1GXTA 4RBUA 2ZH5A 4ED7A 2AYEA 1WD6A 4NLOA 5DG9A 3Q8RB 2WVBA 4C0OC 1Y5NB 1LFWA 2YWWA 2DHHA 1L3VA 2X3DA 5IV4A 3ZTPA 1GEHA 2AJQA 2LXFA 1TVRB 1OSCA 4DV1J 3G6YA 1NK0A 4EYIB 3FSXA 2NUUG 2FHKA 4QR2A 2KH9A 3QGIA 2CJBA 2MQOA 1RAIB 2RD5C 5B08A 4R0EA 4LBPA 4MYTA 1AZSB 4MT1A 3KYLA 2XULA 3QGPA 3KHHA 3CNQP 2QLJB 3UN2A 1DZ5A 2IA0A 3H0PA 5K14A 4U67Q 3IGNA 1QVFR 2AT1B 1TAQA 2LCWA 2FPHX 1S1XB 2F4FA 3IO1A 4P2FA 1SQGA 3I4PA 3WZ0A 3UCZP 5HP1B 4LR8A 2FYXA 1N5TA 3LWMA 2QL9B 1NB7A 3A8EA 3LF0A 4CZCA 1XR5A 4NOHA 4NRUA 1RWPB 3OT9A 3KKFA 3ILOA 1NB2A 2YX4A 2AF6A 4ZVOB 1U1QA 3BKTA 3T1YJ 4LF7J 3HI9A 2XNQA 2HHUA 4NA2A 3UQSA 1RTHB 2RVJA 4MJKA 2DH9A 4CH1A 3I5CA 5HBMA 4RUCA 2CPEA 2P9GA 1NPRA 4LMZA 1N0VC 3KJVB 3DOMA 2W8LA 3NS7B 4KC5A 2ZWPA 1FXLA 1LW2A 4W4MA 2IPOB 4C0BA 3NOCA 3TJAA 1PBAA 5E5NA 2XSJB 2M7SA 2ASYA 3W62A 4J91A 2QO3A 3FMBA 1R6VA 1P9YA 3KWMA 3MR5A 1UEUA 5HANA 1WTFA 1WDDA 1KNZA 2YKOA 2A1BA 1HR0F 5EN1A 4DV1F 4LF9J 1V3SA 5BYRA 1S59A 3RBXA 2KG0A 3C6TB 2HSEB 3DRSA 1JJCB 2MLXA 4NLXA 2FY8A 2BOAA 1CG2A 2L3MA 1N6QB 4C8OA 3VZIA 1B0VA 2R4FA 2XC9A 2EG2A 1U8WA 3D67A 2AEFA 1FNOA 4HHHA 1YHQS 2DGVA 2HNYA 3TO8A 1NH8A 5LJ3Y 3CJ0A 4FXVA 1U1MA 3OBIA 1N48A 2HHTA 3M32B 4URGA 3R6LB 1XERA 1VDHA 5L1KA 4HT7A 3UWTA 1VK8A 2AIRB 4WE1A 2VA3A 4F4AA 3UDVA 5C2CA 5CQGA 2PFFB 3RAQA 1T9WA 2QT7A 4X66F 3RAXA 2NPFA 4K50A 1RWKB 2FVCA 5LOQA 4F4YA 4DS5A 4IQMA 2KT5A 3M7VA 3KG4A 4PCQA 3BSCA 2JC0A 2DGXA 6AT1B 2F8HA 1S5ZA 2FJXA 5KG5A 1N5VA 1OY6A 3T1YF 4O3SA 1CVJA 1OPZA 3PRDA 4P71A 2CDQA 2H54B 2OPPA 4ZITA 2NUHA 3B6BA 2BBEA 1VRUA 2ZH6A 1GMVA 3BH7B 2OEJA 1YVFA 1I1GA 2IVYA 5C2GA 3ETMA 2ZZTA 3CDUA 3FQLA 4I68A 4G1QA 4PABA 3MPWA 2F5GA 5KFXA 2R7OA 3VGSA 4FPIA 2VU5A 1DRZA 3U7JA 1R6YA 4F02A 5F41A 4LFAJ 1TL5A 1PJ6A 4NMXA 4X65F 2C3UA 2CWXA 4MH8A 4K8RA 1SJFA 2HHQA 1TL1A 3BEGB 4WU3A 2H1YA 4HEA9 4CNZA 5DZ6A 3M8QB 1SKUB 2ZOGA 1TFWA 4IFYA 5DLFA 4IYQA 1Q81T 3LTOA 1SXLA 2HQCA 1HNIB 3RB6A 3US5A 3SCKE 1RACB 1LWCA 1U1LA 1S9GB 3O2IA 5GAHI 5LXRA 5KFGA 3GFYA 5HJYA 1QUVA 1TK5A 4X62J 3MHYA 2YNIA 1U0HB 1YZ7A 1JNZB 4ZVQB 3T6JA 2R7VA 3WHIA 3I5AA 5KFNA 1KONA 1XNQJ 4DU7A 2FC9A 4DHVA 4DX5A 1S1TB 1YGYA 4KPYA 4B3OA 1M1HA 2FC8A 3QRQA 4I6WA 3NEKA 2XSFA 1S1WA 2HG4A 2E1CA 5LT5A 2I38A 4DL0C 1W26A 2DNLA 1JK9B 2MKJA 1QE1B 3IP0A 2PA8D 3OUYB 4HH0A 4HTJA 4LF4F 2AX0A 4RJVA 1FRKA 2BR0A 3L9ZA 3A8JA 3R7BB 3MDFA 1RHUB 1KWMA 4OHYA 1HYSB 1T02A 1G4CA 1KBRA 5F9LA 4KHPJ 3JYTA 3CJ5A 3JB9k 2KG1A 4OYBA 3RB4A 4PG6A 2MKYA 1FFGB 3W2VB 4LFAF 3V6JA 4U8VA 1Y10A 1VBZA 2ZBCA 2N3OA 1WKLA 1ROFA 4P72A 1F9HA 4DZDA 3NGSA 1TUGB 2W9CB 1PJ7A 4NCAA 1MNEA 3HJVA 3PG9A 2COLA 3R2DJ 2E66A 2DYAA 1U6BA 1HBMB 5E3PA 3KK3B 1JLFB 1MMNA 1KVIA 2V2KA 2BW2A 2CQPA 1R0CB 3AJDA 4IFVA 1X9WA 1GT8A 3BGRA 4F2RA 1OO0B 1I5OB 2E9ZA 1JLGB 2QFJA 1FVQA 3DI6A 3SYZA 3KK2B 1CS4B 4X62F 4JI3J 4NA1A 2NSBA 2F4VJ 1XIQA 2HGLA 2MGZB 5DS7A 2VG6B 1RKJA 2FJWA 1XNQF 2GVDA 4M63A 1JKHB 2YKMB 4HYKA 5JJBA 5A8KA 2ACMA 4OLPA 5E3AA 3AXMA 3C15B 2ZDOA 3QJPA 4ED2A 1QD1A 1IKXB 4C7QA 3JSMA 1FRMA 4ED8A 1OQ6A 1SC3B 4AQYF 2R42A 3F73A 3IM9A 1ZA2B 1YRUA 3I31A 4DPXA 3HT3A 3KLFA 4ZP6A 4C97A 1JX4A 3ENAA 2W9AA 4WXWA 1WF2A 4LBHA 1URRA 1Q5VA 1DTTA 2DISA 3VAMA 1NDCA 2RRNA 2P9EA 3I0RB 2V4JB 3R5CA 1GK8A 4ID8A 1J5OB 4Q2MA 4DN0A 3R97A 1U26A 3UDLA 3DLBA 2OHDA 4WP9A 2AYMA 3IA0A 3KTQA 3C66A 4KFBB 1XNRJ 1S1VB 4ETXA 1N34J 2R3VA 2F7VA 1B99A 2HHXA 3EGNA 4O3QA 4ECSA 2H5JB 3CD0A 1Q95G 3CJQA 4LVNP 1F9EB 1C4AA 5EWFA 4IRKA 2DT9A 4JI2J 1C4CA 4B17A 3GJTB 3CMAS 2R7RA 3OFGA 3B4MA 1SPBP 1N5QA 5D0EA 2VHGA 5L46A 3MM7B 4OZ5A 4ZK7M 1W2IA 1TL7A 4F7VA 3N4WA 2HNDB 2OO4A 3ZTQA 3P6YC 4DSJA 5F0WA 3CJTA 1Z2LA 4UT4A 4JUZA 4DV3F 3R27A 1R8PA 3HHLB 1SUQA 3H5YA 1HA1A 3KDOA 5CZXA 2F4VF 1FXDA 3M9OB 1XN9A 3OTEA 2I5JB 2LEPA 4F4WA 3DLHA 2DNMA 4DSKA 3AODA 2HQ3A 2JC1A 2FHOB 2XEXA 4H4KC 5D8HB 3G8QA 2KFNA 3PY8A 5CHCB 3PIOQ 5DG8A 3RJMB 2IM3A 3E8OA 4C11A 2K1RA 4OQJA 4ZN1A 4OYMA 4UF4A 3DYAA 2ZZNA 5AE1A 1VISA 1UTAA 4GKKJ 3DDNA 1XMQF 2HVZA 2HWHA 1S9FA 4LSLB 3NAHA 3DDKA 1MW7A 4FZVA 2NXEA 4TU7A 1VK3A 4C98A 3AJ2A 4DX6A 5K8PA 1TMJA 2B5JA 2FVRA 1WOOA 4WU2A 4J9NA 3DNCA 5I3UB 1AW0A 2IJNA 4UOHA 2L9DA 2XNRA 4OI6A 4OI4A 1R31A 2EFOA 4HDGA 4R8UB 4KHMA 3QATA 5KG7A 2Z56B 1NPPA 1IVZA 1UFKA 1HARA 2CNNB 2CPHA 3J7YI 3C19A 4GO5X 2CXEA 3MZIA 4ZPVR 5EWGA 2RF2B 2IJRA 3E01B 1XR6A 4KPCA 2HMIB 3HVTA 4HVZA 3I32A 1NO8A 3IGVA 3FEXB 2KJWA 1HWUA 2QTWA 3CO0P 1CJKA 5CABA 1S0VA 3R5AA 1C1CA 5M2UA 4IO1A 4RU9A 5F8IA 4YB6A 1JLQB 2V0NA 2HGMA 1SJ4P 4C0HA 2FUG9 4ZCIA 2YKNB 1BWEA 1RAHB 3CWJA 2ILZA 1VBKA 3JQJA 3AJ1A 3ICLA 2ZM6F 1X4AA 4DU8A 4DPOA 2RNEA 3JSYA 1RI7A 3MCNA 4A47A 5GAGU 4EK2A 3AAWB 3TAMA 2HFNA 3HULA 5H9EK 3PYDA 3K17A 5KG0A 1WC4A 2YQ3A 4K2XA 5C42A 1U1KA 2MQ8A 2VFTA 2JHEA 3OD2A 2GIFA 4IKAA 1U2RA 4NYZA 5ETRA 4RW4A 2RHQB 2RQMA 4ZCKA 4LF1A 3BF4A 5F8NA 1GX6A 4HDHA 1NZAA 3NWRA 4NASA 3G71S 3WIUA 1D09B 1NJXA 3OHBA 4DCOB 1GMWA 5IZHA 1N8RT 3Q22A 3DMJA 2X51A 4NLUA 4WK3A 2OTJS 3HZEA 1GAOA 3MM9B 4E2FB 1FWKA 4DPUA 2Z4PA 1YK9A 2B56A 1X5TA 5DDRC 3M1VB 3MD1A 4HI2A 4DFJA 4NLDA 2YWHA 2GHWA 4UOGA 2XMAA 2NZCA 4M5KA 3K59A 4V19X 3EPIA 1T9VA 1WC1A 3D68A 3OVSA 4EU0A 1SV5B 1RT5A 9RUBA 2VL1A 4Y0FA 1GQEA 4XO0A 5HQLA 1YIJS 4JI4J 1VOMA 3KFWX 3ZZPA 4PWWA 1A0OB 3HSDA 2MKKA 2MHNA 5K5MA 1RYRA 3SI8A 1RLDA 5I3QA 3RYLA 3VAFA 1X31C 5AJ3J 1OQ3A 1WKJA 2Y1LB 4XK8C 4ANCA 2R8KA 3QBCA 2WB1D 1V6HA 2RB7A 3R1HA 4A48A 3MEEA 5D4NA 3ILJA 3W2WB 3MEDA 2YH1A 5J1EB 1OIAA 5I42A 2GX8A 2V63A 3BSOA 2X1GA 2HRTA 3LP2B 5HMZA 4OI0A 1U6FA 4CQ1A 1S9EB 2B4UA 2V69A 3BSAA 8RUCA 1RTZA 3OR1A 1SKSA 4YEAA 1LKZA 1VQYA 1QVGR 3M2VB 2CKWA 2G0IA 4C3KA 2IC3A 4ILRA 1N54B 1HI8A 1FA0A 1JLBB 3FRYA 4I6YA 4ILLA 3NNCA 1SH0A 3LW5C 3MTKA 5HMYA 4B9TA 3T1HJ 2YNHA 1NJZA 1HHQA 2RKIB 3EPGA 2CQ2A 1VQ8S 2G1HA 2FJEB 1XMBA 2HYIB 1IKVA 2IM2A 2KVQE 1XQIA 4ZP7A 5ADZA 1U1NA 1KVJA 3B54A 1KS2A 1H0HB 3NBPA 3ZZRA 1RT6B 3U1MA 3AQPA 4B9MA 4I6AA 2GA7A 4KGKA 4DQPA 4L72B 1NK6A 4CTAA 1S7IA 3H42A 3UPFA 3MR2A 3CGIA 1Z1ZA 2H9ZA 2D7SA 3OR2B 3ENWA 3PJXA 3PX6A 2ILYA 4X4TA 2BJ9A 2SXLA 2V2ZA 2GJFA 4OZJA 1FJGF 4C2MA 4ES1A 3CTRA 3KLGB 2PSZA 2DNNA 2B6AA 4L73A 4M5LA 5A0YA 4RU2A 2XLJA 1RHQB 4JI4F 5F0UA 3EXCX 1NEEA 1R0BG 2BEFA 1E6YA 3LGMA 1GTHA 1V3RA 4USIA 5AJ3F 2DGUA 4ZVUB 1CULB 4RO0A 1FTRA 5C7PA 3Q8VA 4OI3A 4N77A 2OPQA 1OY8A 2MQLA 3TA1A 1NU4A 3HO1A 3S1TA 5KT7A 3L95X 5D15A 1HHSA 5D4PA 1NPKA 3EDRB 1ZTWA 4I56A 1AYEA 5HVHA 3BO2A 4ZVTB 5KFFA 1HBOA 2L9NA 4H4OB 3WX8A 4DV5J 2YY3A 4Q0BB 8ATCB 2XY7A 2ZHOA 5IM0A 2B9EA 4RW8B 4WTYA 3AQOA 4ZPDA 1HW8A 1S1UB 1HHTP 4ALZA 5DG7A 2OJ3A 2DCUB 5B7WA 3H7HB 4FYYB 2R2TA 2GIQA 3LP0B 3A1YG 3QT8A 4AT1B 4ZDNA 2BABA 1FKOA 3U27A 3EUNA 1F2HA 1IXKA 4CYUB 1VLOA 5L39A 2KZMA 3QPIA 4B3MJ 4NCGA 3QSYB 3KG1A 5J2PA 3TW0A 2KYZA 5ETPA 1NZ8A 2O67A 3ILLA 4RW9A 3TJ9A 4N8NA 4CCHA 4RWWA 3DLKA 1CPZA 1GMUA 3IBCB 4CP5A 1UETA 2Z30B 1RU1A 2ROGA 1MU2A 3PFOA 1TTHB 2Z2MA 2F65A 3I0SA 1U24A 1WWHA 3VVUA 4RUAA 2OUGA 3TX0A 1N52B 2WOMB 2V50A 4JI5J 2AQ4A 4QJVA 4I2PA 1VQMS 3TI0A 4O3PA 4ZVHA 2OPSB 3B78A 1R3NA 5KFHA 2VC0A 2E7XA 2ZJQQ 3O1LA 4USKA 3SFGA 1FE4A 3FZ2A 2A6MA 3CMES 4FVMA 3CCMS 3I87A 4OZNA 3PYEA 1PAEX 3ELHA 1SIWB 3CCSS 1C0UB 2HRYA 2ZJRQ 4NXNJ 5HL7Q 5CH7B 1GMWD 2FJVA 1QM9A 1F1BB 2CFXA 4PQUA 4LFCJ 2HHSA 5IS2A 5SZTA 4P10A 4R5PA 5KFIA 4J9UE 1YJ9S 2XCAA 4EEYA 4ELTA 2A3JA 1O6XA 4NPOA 1BQXA 4ECTA 5A8WB 4FS2A 1RT1B 2I6WA 5DDOC 5JUMA 2R9LA 2AJ4A 4WZQA 2HHPA 4KBIA 1EP4B 4O3RA 1E6VB 4Y00A 3GYGA 4OJGA 1CJTA 1TL3A 5GAEU 4MTPA 5C25A 2XCPA 2VDIA 1Q7LB 1LK7A 4DL3A 1FESA 2GO9A 5L9NA 1HNWJ 4WJBA 4IG3A 1UL3A 1VIXA 2DR7A 1RDRA 1HNZJ 3PFEA 1TU0B 2MY8A 4DFMA 3CJ4A 3TZYA 2JFKA 2D3UA 3D6HB 1BQNA 3A3OB 3BBCA 4ANDA 2NXUA 1VQ9S 5A76A 4JI5F 1VHFA 1WORA 3KLHA 1DJ0A 1TUVA 4TLRA 1VC6A 2VH7A 4MKBA 4FYVB 2VONA 5K14B 3TZZA 3GIJA 1L5UA 4F3QA 1UVNA 3UO0A 4IRCA 5M2RA 1Y3KA 3KUGA 2HFZA 2RHSB 4NXNF 4JYAJ 2E5IA 3MAAA 2IDEA 2M4MA 2M2BA 4DX8H 2VICA 4EO8A 3PYGA 3QGGA 3PW7A 4CI0B 4N56A 1LQ9A 5A6WA 5D3GA 4RL1A 3OLAA 4KR0B 2E1RA 2CQ0A 5HBMB 2KTQA 2Q1LA 4JV0A 3HK2A 2YWFA 2M88A 4DV6J 4TYBA 3CCJS 1WTBA 3DOMB 4WWSA 4URSA 1T03A 2FLNA 1LW2B 4MK7A 2VPZB 1S76D 1K8AT 3OFHA 3MURP 1KHVA 2B0GA 2V8VA 2RILA 2GVZA 3OXFA 1RLCL 3AHPA 4DR4F 4HR2A 2XYPB 3FKBA 3HHLC 5A2QU 2A2CA 2CQCA 1VIOA 2W2NP 3D6MB 3WX4A 4CWBA 2GJIA 4OYXA 4LBIA 1XBWA 4UUWA 3CCWA 3LOUA 4UQTA 2P9CA 3C8YA 1SIZA 2DNQA 4ED0A 1D9AA 1Q0NA 4I2QA 2XS2A 4YR0A 3TVZA 4DI6A 2NYIA 3LA0A 3HLUA 1F5AA 1FT8A 4DG1A 3HJFA 2DGSA 3DRSB 4L3KA 4P2MA 3OXLA 2A0FB 2V8PA 3F0NA 2N3LA 4KO0A 4OJ3A 2GC8A 4HACA 1KTQA 4KQZA 4M5GA 1BHNA 2ZH4A 2HNYB 5D78A 1JXEA 3DRXA 3R6GB 1X5OA 2IBKA 4AL5A 1KP6A 2ZNZA 1YRTA 2QL5B 4RNOA 4WE1B 2EEYA 2HNZA 3OL6A 4PG4A 2EXUA 2VKZG 2WVCA 3K5NA 2CPFA 2M8HA 2QC3A 5E0OA 4JYAF 5HROA 2I0XA 1I94J 2M8DB 4TY8A 3MMAA 1EZZB 4HTIA 1ZZFA 2CWKA 4FNHA 2O66A 1FNXH 4C4WA 2IRUA 2ZHBA 1FE0A 4OX9J 3W7BA 2C2DA 2OPPB 5F3ZA 3A4TA 4DV6F 2RDDA 2KZZA 1RBOB 3MPYA 3VR1A 3CIZA 1VRUB 2UVWA 3EE3A 1AFJA 1XMOJ 2ZC3A 4KH1B 4J90A 3IR7B 1HNVA 2C2MB 4G1QB 2OFHX 3K5MA 4NI2A 5JXSA 4F4XA 3UFCX 1KSPA 4ICLA 3C14A 4JI8F 1ZH5A 2RAQA 1T11A 4WYWA 5AXKA 1D8ZA 2PI5A 4QIGA 1TL1B 3A13A 5F8LA 1G6BA 4O3OA 4DOZA 3D54A 1KVKA 5ETKA 5IWAJ 2WCXA 1IJFB 4Q5VA 4ER8A 2PEHA 4CT9A 4IFYB 3OL9A 2HVDA 1QSSA 1PAUB 1A6LA 3R8YA 4F4KA 4OX8A 3TUZC 1LWCB 1XEZA 3M30A 5KT3A 1WG5A 3R5GA 3GJSB 2XO6A 3W8PA 2EWHA 4L75A 4GKJJ 4B9UA 2YNIB 3UDCA 2LMIA 2Z2YB 2ASDA 3OXGA 3KG0A 3HHNB 2LXIA 3EVOA 4RKUC 3N6MA 2DITA 4U7UK 4B3OB 2AEJA 1DY3A 1MROA 4DUZF 4NRTA 3WBZA 1S1WB 2MZQA 4B9NA 3ZTRA 3UNGC 4DFKA 2FQQB 2XG8A 1LWFB 5BYQA 1DAXA 2J7WA 3QIPB 4QW8A 2BM1A 3RR7A 4ZS6A 4DV2J 1S57A 1R8HA 4WFXA 5C24B 1T3NA 3DLGB 2UXBJ 4OX9F 5LJ5Y 2R7XA 4V19J 3BM7A 4IDKA 1Z4UA 4KB7A 4DLGA 1XMOF 1RJJA 3MEGA 3THVA 4OZLA 3DRPA 2LECA 2HHHF 1SJRA 3VF0B 1YJUA 3JYTB 2V68A 3MUTP 2DXFA 2KDOA 4RW6A 3H25A 3TR5A 1D9DA 1U48A 2JZ5A 5DRKA 4TXSA 2F9JA 4NYPA 5AT1B 4J9RA 3I4HX 5GAGI 2FGOA 1KR4A 2GAHC 1KN6A 4QQBA 5IWAF 1Q82T 1SH3A 4CLPA 1F5CA 3EGZA 3D0HE 1SJ1A 1WHXA 5ETNA 4OZ2A 2PT0A 1S6OA 2J0QD 3MI7X 2F1FA 3B8HA 2ZVIA 1VGYA 3AY0A 3DOLA 3V81A 1RTDA 3TAPA 2R7QA 4FXWA 3M8ZA 1RWOB 2EG1A 3BGRB 3G6VA 1SKRA 1UVMA 3DI6B 4GKJF 3CO9A 4P75A 1RHMB 2HK3A 3AA9A 4TU8A 4ELUA 1NK7A 2JX2A 1BQMA 5GAHU 1IBLJ 2GVDB 4PWDB 4O4RA 1ZTTA 1JJ4A 4LT6A 1FRXA 5A8KB 2W4CA 3OSPA 2R2RA 4KTQA 2DNKA 4DSLA 2DBBA 1HL6A 3JSRA 3D9BA 1CQNA 3JSMB 1XR7A 4DR1J 5DQIA 1VRTA 2GGPA 4IG0A 2GNKA 3GQCA 2CVEA 3KLFB 2XY5A 3HF5A 3IBFB 4P2XA 1Y11A 1WHVA 2ACYA 1NSAA 4OZ1A 2AGOA 5L38A 1ZYQA 2VV5A 2Z8QA 1H2UX 4WIQA 5KOXA 1DTTB 3NGUA 4WPAA 2N82B 3K2YA 2RT3A 1SJ3P 1NDLA 5H9EJ 3IWLA 1RABB 4OZ0A 1URNA 3EZ5A 3QLHB 3H2VE 1TP7A 1Q1KA 1P1LA 4L3NA 2QGFB 2F9DA 3RR8A 4K4SA 4TY9A 3MUMP 2OEMA 3POTA 2DTJA 1TKDA 5KOWA 1ZA1B 1JLAA 1OWXA 2DEJA 4IOAQ 1PCAA 4K7QA 1CBKA 3FBBA 3QRPA 3BGUA 3HHEA 3H20A 1FFSB 3VGVA 4MK8A 3DFEA 3TEHB 3NG8A 2WB4A 4ZHRA 5E41A 2UU9F 2MQNA 2LEAA 1R8BA 4C8ZA 2KB2A 4CLSA 3CCVS 4P2SA 3MGJA 2AP6A 5U47A 1SUQB 1RHRB 2GAGC 2FVSA 2G4BA 3MR7A 3DOKA 1AA1B 4Q43A 4Y2MA 2FD2A 1I51B 2C28A 3UR3C 1IBLF 3I96A 2MJNA 2KN4A 3M4XA 2QFIA 1S72S 3Q8UA 4Z37A 5FDLA 2NXJA 4V1Ak 4U8YA 4DFPA 3C6UA 2VG7A 4FBUA 3LP1A 1TR0A 2J7KA 4HHJA 4C11B 2K1RB 3PM9A 5BJRA 1U6ZA 4DV4J 1WF1A 2D3OR 5AXNA 3U02A 4GRSA 3OL8A 1UZDA 1YZ6A 2MZTA 3PO4A 4AYBD 4DR2F 3TJ8A 3DCAA 4EBEA 3DGPA 4A8OA 3T5LA 1UA0A 4IR1A 4LF5F 3PHEA 3CC2S 3T9NA 2OELA 3BQ0A 4N5SA 3TX8A 3NL0A 4B9VA 2D3ZA 1B7FA 2B5JB 4NXMJ 1KD1T 4B3SF 4RW7A 4B3TF 4MYUA 2N7YA 1NDPA 2MZRA 2FLLA 4C3LA 3D2WA 2ZE2A 4CH7A 4YN3B 3M6VA 2FJBB 5GVQA 3AH6A 1Y0HA 4UOFA 3MAHA 3MF5A 4EFAC 1KEKA 4AE5A 2QA2A 2AW0A 2EI5A 3A8IA 3CJ2A 3Q0AA 4ZIWA 3R7NB 2DXDA 5KFAA 3GLJA 3MPDA 1HW9A 3N5BA 3P4UB 3EZUA 4PXBA 1FRLA 4M5MA 1Q78A 5CD4A 3QT6A 3IFEA 5D0RA 4BC9A 1WI8A 4J9VA 1CJKB 2YX7A 2QE5A 1K44A 4P7TA 2IDLA 1C1CB 3JAMU 2C2ZB 1PIEA 1IBMF 2IY5B 5KFZA 4D3GA 3HM9A 4LF6J 4IR9A 3DGVA 2V2QA 2HHWA 1RAEB 1M0SA 2P6TA 1UEVA 4PYDA 4NZ7A 2VQFJ 3DDIA 5LMUJ 3QAEA 2V34A 5RUBA 4Q44A 1RHJB 1S1XA 3TAMB 3CSKA 1QSLA 2VFRA 3KUEA 3CW2C 4QZVB 3GP9A 3SEOA 3R5BA 1JMTA 1NH7A 5HP1A 4A8WA 4DV4F 1DTQA 2MDAA 3ZNJ1 2I1RA 4RW4B 4W92B 3BBBA 5T7LA 2E1AA 4PXEA 1SB6A 4F50A 3GFXA 5HMWA 1U02A 2EFGA 2B7CB 2E7VA 2FDNA 1XTZA 1H7WA 3FFIA 2HIYA 2EFVA 3U1NA 3DMJB 5CCLA 2LFVA 1FWLA 1N32J 1O51A 3C2PA 3DC2A 2HEKA 2Q6CA 2NREA 5I4MA 1S6QA 2UUAJ 4X4PA 2BXJA 3AB4B 5JVHQ 5ETLA 4NMLA 3VZHA 3KLEA 3CCLS 1NNDA 1WDTA 2Q43A 4NZ6A 2E5HA 4RNMA 2W8KA 3PX0A 2OIHA 3RBEA 2VOPA 4X64F 3DRRA 3B82A 1IWAA 3CUNA 1U49A 5E7OB 4X4UA 1RT5B 3CDEA 4LRBA 5ETVA 1KRPA 2BJ3A 3VHQA 4FF1A 3PR5B 3BGLA 2WVDA 3FCWA 3RRKA 3W66A 3J7YU 4YHHJ 2UVRA 3GE9A 5CXTA 2VASA 2PMWA 2ZHAA 5J2NA 3MEEB 5KAKA 4NE9C 2R8HA 5SUHA 3MEDB 3O44A 3QAUA 1VJQA 1S12A 3GONA 4J9SA 5I42B 3O5TB 2WSEC 4TQRA 4I7FA 3B4DA 5CYQA 4JI0F 2DIUA 2CG4A 3AOBA 5LMUF 4Y2CA 3Q8SB 2R8GA 4X4OA 2FHJA 1FJEB 1D0EA 3NGKA 3Q24A 2P5VA 5DDPC 3OR1B 3G2XA 3HT0A 3G8SA 5CAAA 3WC0A 7AT1B 1YBTA 5H9FK 3ZZOA 1B0PA 2IC3B 2D69A 4QBUA 5EDWA 1H38A 3OTOF 2MSTA 2KL8A 2YNHB 5A2QY 1CJUA 4C8LA 2A6OA 2L41A 4AUKA 2C2EA 4HKQA 5D6GA 2APOA 4K5RA 3SCIE 1IKVB 2BJ1A 2B9WA 4JV5J 5JMNA 3NBPB 5KFLA 4ILMA 2K3KA 1Q8KA 2AJ2A 4PR6A 1TKZA 3FBEA 3KJFB 2UUAF 5AE2A 3NXZA 1NCLA 2G0CA 1RE1B 3HD1A 3BDEA 4QIVA 2WTFA 2AYGA 3W8GA 4HLBA 2ZH1A 4ZPAA 2E9TA 2CADA 4N41A 4F67A 4IOBA 2B6AB 3PTWA 3VGTA 3GILA 5A0YB 1X4FA 3CC4S 3RTVA 1T7PA 1EQMA 4M95A 1RK8A 4J9OA 3D5MA 1E6YB 3PXGa 5IOLA 2DPIA 2QIFA 5KFYA 4XDCA 4G1PA 4GC7A 2OPQB 2MPUA 4UTGA 2B4OA 2MLZA 1VQKS 2DY1A 4RX6A 4DF8A 3GR0A 4C8KA 2YPYA 2X3GA 2XYHB 4EGLA 4RNFA 5MAOA 1HBOB 2FY1A 2D1CA 3LALA 5IM0B 2QYCA 3GJRB 2GMLA 3GIRA 3OHAA 2HZCA 3CB4A 2XHCA 2CPYA 1HR0J 1IQZA 3GJQB 4HH1A 3KXDA 5FLXU 1PC4A 5KFMA 1S6PA 2GV1A 1JNRB 1FKOB 4QR0A 1AT1B 1YJVA 1KQFB 2JVOA 1AROP 1Y00A 1DBDA 2VD3A 4NCGB 3N5FA 2I8EA 3FMWA 1FHTA 5J2PB 2ZUGA 3J7ZT 1QAIA 1VQ5S 3L09A 4JV5F 3PCOB 4RW9B 3SV3A 3NMAA 3KMSA 2W7AA 3DLKB 1FEHA 1WHYA 1RB0A 2CPDA 4DZ6A 1MU2B 3ILIA 3GMGA 2IVFB 1ZM2A 4X66J 4B02A 3I0SB 1ITPA 1RBAA 3SCJE 1NJIT 2W4PA 1LXJA 3MM5A 4N76A 3GSIA 3CXCR 4LF8F 1RTIA 2AZ3A 4I2PB 4RNNA 3FJ2A 1FX4A 1Q16B 3PJWA 3SZ2A 3M8RA 1VBXA 1PBUA 1NSPA 3JTOA 3SIPB 1NLKL 2X1AA 3BPSP 2JLFA 2Y8YA 4CO2A 1HNXF 1P6TA 2PD1A 4J9KA 2VUGA 2J5AA 4J7CA 2MB0B 4EYHB 4F3MA 2HWTA 3MM8A 3W64A 4IO9Q 4PQUB 1CS4A 4Q7AA 2XBPA 3M2RA 4XIUA 3DU5A 4PEOA 4KGMA 4X65J 4ID5A 3D3BJ 1REVA 4R5PB 3MM6A 3FBCA 4M94A 2BYCA 4AXJA 1RHKB 3HFZB 2CJAA 5IV3A 2CJQA 2R8JA 1IKXA 3FEYB 1C0TA 2C2NA 4XTTA 1WF0A 1S7HA 4NLQA 4KV8A 2DY9A 3KDNA 2W24A 5B0CA 2VBXA 1NHKL 1PSDA 5KFDA 1TL3B 1N5YA 2NR0A 2FZKB 5KFVA 5C25B 1RAJA 4F36A 2XGQA 3ZTSA 2OMLA 2XZTB 1HIYA 4H54A 2V4JA 3M2UA 4ETZA 2HQGA 1J5EJ 4RUBA 2B3TB 2Q79A 1M90T 2I2YA 3HFKA 2J9CA 1VQLS 3OTCA 3EWGA 1S1VA 1BQNB 3FUYA 2CA9A 1NRKA 3S8SA 3KLHB 3H4DA 2PA3A 4DS4A 4J37A 1IR1A 1NJWA 3W5XA 3THTA 3NRBA 2ZH7A 1UJ5A 4LF4J 3J7Z5 3BO4A 2C2OB 3HP6A 4QR1A 2DO4A 1B7YB 1OPIA 2ZOFA 4ED3A 2ATCB 1HQEA 2UV8G 3NMRA 2BA9A 3ZZZA 2KJVA 2W7OA 2VPWB 1EHWA 3MAAB 2QG9B 2LU2A 4QCLA 3HHLA 4IH5A 3A8KA 3P5TL 1X4CA 3M8YA 2UV8A 5D3GB 2HFSA 3KOAA 4USTA 4NLRA 2N4DA 4QPTA 2K06A 3MCOA 3R9LA 1D9FA 1SVDA 1RWXB 4RLEA 4OX7A 2GFFA 2GVZB 3GIIA 3N6LA 3NY0A 3SXLA 4JOUA 3M9NB 1RU2A 4LF2A 3G8TA 2M5YA 3LGHA 5IT0A 7FD1A 1HFEL 4I2QB 1MSWD 4H4MA 1JIHA 2PMHA 3TOQA 2KKHA 1N36F 3AT1B 4BCAA 4DG1B 1J5EF 2PC6A 3Q23A 4KO0B 2J8AA 5DO2A 3RGIA 4HACB 5L1IA 2KHDA 2E5LF 4AQYJ 1ZPVA 4QWEA 1LOUA 4J9LA 2IMWP 1S99A 1G1XA 4O3NA 1UMJA 1TKXA 3IRXB 1VQ4S 4GVLA 2CDRB 4ZVRB 1UZHA 2G13A 2XY6A 2C2KB 2HNZB 4JV1A 3K8WA 4PAAA 2CPXA 5G4DA 2CQIA 2GQCA 2LVWA 2Z57B 4FVCA 3QGHA 3V6DA 5HROB 3UD3P 3C46A 1B3TA 2CQHA 3KUHA 1KOOA 2V9WA 3RW6A 4TLQA 4TY8B 3MMAB 3AD8C 1LWXA 2CYYA 4C8MA 1D3WA 2OPRA 2GHVC 2UUTA 2J9DA 3W3SA 1V9OA 2QX0A 4M5NA 2W25A 1Y9OA 4NX9A 1SH2A 2VZ9A 2V5HG 2BE2A 4USJC 4X84A 5F8GA 2F8MA 2MSSA 3IG1A 4FYDA 3QNWB 4YQWA 4KYZA 1WSRA 1HNVB 3WIVA 1REGX 3GG1A 5E3QA 1OSDA 2RH3A 4NI2B 1GX5A 3DN9A 2QZ8A 3EJMA 4KSEB 2F63A 4ICLB 4U9RA 5GMDA 3C14B 1X4EA 1SBRA 2KXNB 3T5JA 3O6QA 4HHUA 1ZS6A 1F3VA 4RUHA 3Q2SC 5CYJA 4DV3J 1HI1A 3ZTOA 1X4BA 3K8VA 3GV7B 4K59A 1WEXA 4BWJA 5KT2A 1YBUA 4LSZB 3UN5A 2NQPA 4EZ9A 1WEZA 4FNIA 1UJ4A 2KO1A 3LO3A 1FVSA 3OQ2A 1NM2A 2AJFE 5BXIA 5A8RA 2X1BA 5BR8F 1VCTA 2J0WA 3M30B 2MKSA 3JAMY 3FVYA 3BBFA 2KYXA 4JP8A 3OSNA 1HKAA 4ZVPB 1U1PA 3T1AA 4ZLJA 3UVJA 2X1FA 2VKRA 3WQPA 1XMQJ 2XMVA 3EX7B 1CC7A 2XZDB 3V5RA 4ECRA 1SV5A 5KFQA 4YY3F 3IR6B 3M8SA 1MWQA 1UVKA 2MLYA 5IT4A 5EHHA 2BQRA 4DF4A 4OFZA 3NCQA 2VF3A 2NXNA 3R5JB 4B3RF 4C6AA 3V2UC 2CPZA 1MROB 4I1TA 5AXLA 4M5HA 1L3UA 3P96A 1RCXB 2J76E 4ECYA 1YKWA 1U47A 2AD9A 2UUWA 2YVSA 1FTCA 3VAKA 4WYLA 3PYFA 4WFBQ 4CLUA 4IDKB 2BDPA 4DL4A 1S9EA 3FC9A 2IM0A 2VA2A 1PYTA 1U2CA 2PDAA 2IFXA 3MEGB 3DRPB 3AOAA 2Y3YA 2WVFA 5KT6A 4UOCA 3QT5A 4ZJOA 5ETTA 3D28A 3ZXWA 4RW6B 4A8YA 2OTLS 3KK1A 4OLOA 3J80Y 5D4OA 4M5DA 3TA0A 3BDPA 3MECB 2QYGA 4LRFA 5L8RC 2B7BB 2ZM6J 1OYDA 1KHWA 2MKIA 3NCPA 2XI2A 1F0XA 3AOCA 3PW4A 1B70B 3TUJC 5IT9U 2BKPA 3NOGA 3QFHA 2JEJA 3DOLB 3V81B 1RTDB 3W60A 3MD3A 4TYAA 3VTIA 1NUEA 4GMKA 3V6HA 1G2EA 1U09A 2KM8B 2ZBRA 3KLGA 2FVPA 4LFBF 2UXDJ 2E44A 1D1UA 3ETOA 4KGXB 2FIUA 1BQMB 2XM3A 4CM2A 1M1KT 2YNFA 1RAAB 2QA1A 2V94A 1X9MA 1RYSA 2ZZMA 1FRJA 2HVIA 2CAJA 3PRVA 1X4DA 1FD8A 4KE5A 2L9WA 3CCRS 2CUYA 1QJHA 3BV8A 2RRAA 2UUCJ 4J9PA 1VRTB 2GGPB 1SL0A 4IG0B 2XS5A 1S77D 1RWVB 4UQGA 2GJ2A 1U8SA 3ISNC 1TK0A 4Q8FA 3SV4A 3LGNA 2VPYB 5HK4A 1CLFA 4J5OA 2E1PA 2QEXS 3M6UA 4NLPA 1YJNS 4QYZK 2G2YA 2N4CA 3PNIA 4NLTA 2YKPA 1S4FA 3K57A 3MPUB 2DNOA 2FJDB 2K8GA 4NLSA 2HVHA 2M52A 4F0KA 4F3OA 2VJVA 3QO9B 4FF3A 2RQKA 3POTB 2CRLA 3W9HA 2R7TA 4WXOA 4LREA 3PEJA 1AUSL 4UUXA 2BRKA 1CJVB 1JLAB 2FZCB 1FF2A 2JJ4D 3J7AN 5K8MA 4ERDA 4TNOA 2RS8A 3BSNA 4Q8EA 1RA7A 2H4YB 5KFCA 2PE8A 2UZAA 4ZHRB 1H72C 3H5XA 4CLYA 1VC5A 2O5DA 2VFSA 2VIHA 2Z0GA 2ZH9A 4NA3A 4LRAA 1TZ0A 5F3TA 3S7RA 1YQHA 3DOKB 2OPSA 1SI9A 2DRBA 2UXDF 3CDBA 3GCXP 4OV6A 1EX8A 2HIQA 5FDLB 2IBOA 2JLEA 3C6UB 2VG7B 5FLXY 3LP1B 1VBYA 3ISZA 2N7CA 3FCVA 2IMOA 3L4BC 5KFUA 3X1LB 1WNEA 1WOPA 2BV3A 2RSQA 2UUCF 1HD0A 3GU0A 5FIIA 1L3KA 4ELVA 2UXCF 5AE3A 4DV7J 1KDNA 3UCGA 1FJGJ 4Y3CA 2V6AA 5HQMA 3W9JA 1OS5A 3DM2A 4BS2A 3DGPB 1S6UA 3EVWA 1RTJA 3LH2S 4LR9A 2HAFA 3UNYA 4FP9A 5H9FJ 2UUBF 3CDAA 3ENQA 4RW7B 4BDPA 2OFGX 2EKYA 1RZMA 2XLKA 2GMHA 1VQSA 2ZE2B 3KMQA 4JI6F 5L1LA 4X2BA 1EB0A 2HZAA 3TEGA 3HHKA 1R0AA 2ZC4A 4YFUA 1HMVA 2O3DA 3CCTA 4C48A 4ECZA 4QWBA 3HVAA 3GFZA 3OVAA 4CT8A 1UA1A 3EGVA 4NEYA 5LMNJ 1FDDA 4LSNB 1U45A 1ZPWX 2VBZA 1V5VA 2IAJA 5KFJA 4XAKA 3HD2A 3MMCA 5DM7Q 4WFNQ 4DJBA 4AL7A 2IYIA 2YWGA 2DNYA 2QLWA 4BC7A 4ECXA 3SQGA 2QMXA 4CO1A 1KQKA 2GO8A 5KT4A 4KGVB 2CJ9A 3DXSX 1BWVA 1H73A 3NKYA 4CLKA 3IRWP 1S10A 4PG8A 4QIEA 2DK2A 4U96A 4DX7A 2DGOA 2NLWA 1RP5A 3RW7A 2DRDA 3VQTA 3LQVA 4LIWA 5EX3A 4K4WA 1UJ6A 1QAXA 4DR3J 2FZGB 5FJ4A 3W61A 2VOOA 1HQ2A 2ZH8A 2B9YA 2EVZA 4J9MA 1DTQB 4ED6A 5T7LB 1WELA 4DV7F 2BOPA 4TVAB 1IR0A 2LQ8A 1G3OA 2XGPA 5E3RA 3IMQJ 4QWAA 3UD5A 3FFIB 1HWLA 2QA4G 5JVGQ 3EXYA 4DXLA 3H90A 4KKOA 4A8KA 4QYRA 4UY85 2MQMA 2RUSA 1TUWA 1PKUA 1SJQA 3IBWA 4BLGA 1S6QB 3CD5A 3HHDA 3NGDA 2F8EX 2H5IB 5CZVA 4PUOA 1H2VZ 3QWUA 2AU0A 2HLTA 1X0PA 1RT3A 4LJMA 3KLEB 4FBTA 3UR0A 4R0JA 1W25A 4DBQA 1K1SA 3DRRB 1F9FA 2B9XA 1YTYA 3PVXA 3QRRA 1XK8A 3VAGA 4OYOA 5LMNF 2XMMA 2OSQA 2D74B 3HVWA 1LW0A 5HN0A 3C3LA 2DJWA 2HURA 5BYSA 1IBKJ 3T41A 3R5DA 3RG6A 3MAQA 2ZITA 3QFWA 2AEMA 2FTRA 3VAIA 4ZPBA 2CQBA 3MR3A 1SL2A 1FEEA 1RT2B 1YJ7A 2DPJA 4P74A 1X4HA 2GQQA 2XYGB 3PX4A 5J2NB 2AJ1A 1L3TA 1J2VA 2ASJA 3CT9A 5ETQA 3PR4A 1C2PA 4I7FB 3NS5A 5EUHA 1HBUA 1ZETA 5CYQB 4QOTA 1MN7A 2C2RA 1RBLA 5C5JA 3HKWA 1XWLA 3M8PA 4DR3F 3I56S 1C1BA 5G0RA 2BANB 1CC8A 3MPVA 2DVIA 3MMBB 2CPJA 1IWGA 3HVRA 4CRJA 3J81U 1F5BA 1ICEB 1IKYA 2YBVA 3GZ7A 1UW4A 1FWPA 4E8UA 4CIOA 1CJUB 2WK4A 2KRRA 2W7PA 1FK9A 1K47A 4LF7F 3MOZA 3IS9A 2CNKB 2BACA 3GIKA 4HL9A 1G7CB 4PG5A 2NCKL 3SMZA 2CG8A 2RS2A 1WI6A 4MKVA 4IH7A 4RNHA 2DNGA 1TKZB 1MMDA 2BMBA 4MAKA 2H51B 4K5SA 4PPDA 1ZOTA 3RRGA 4URQU 1NKEA 3KHRA 2JL9A 2RU9A 4DSFA 2RU3A 2DR9A 4N8OA 3L7UA 2E5JA 4MIBA 4MMOA 3K58A 3HX9A 4YB5A 3GCWP 2G2OA 3P8BB 1IUJA 3EM1A 2KT3A 3TRGA 2ATLA 3VGUA 2QSFA 1IBKF 1YWXA 4LF9F 4JI1J 2W4DA 3D7SB 2Y1JA 3Q8YA 4ED1A 5HSPA 2E1MC 4DCPB 1S4EA 4C9DA 1AB8A 3TZXA 2ROPA 3WDOA 2NXCA 3TVYA 2KVIA 1FKPA 1KC8T 3CJRA 3G4SS 5J2MA 2JLGA 4Y2IA 4PYAA 1UVLA 1HWKA 2Q6BA 4DR4J 2ZWOA 4LRCA 2EBGA 1FNMA 2XZWA 2V8HA 3Q86A 3NP5A 5DLGA 3IM8A 3FEZA 4I4BA 2XMJA 2IVMA 4O44A 2E9RX 3HDSA 5B0AA 4U6PA 4YR3A 4AFFA 3BO3A 1NKBA 1S6PB 2EC0A 1RADB 3UE2A 3BJYA 3KHGA 4EZ6A 3AD7C 3TZWA 1GNKA 1VJWA 1LWFA 4KGZB 4DCJB 3QIPA 1S0NA 5C24A 3DLGA 3PKYA 5HI7A 2R2SA 2EFQA 2RJZA 4X4SA 6FD1A 2MZSA 5KFWA 2B8PA 2AV5A 4AXIA 2DNPA 3TAQA 5KFSA 3Q2TC 3AD9C 4M5IA 3QT7A 2FLPA 3OVBA 2KI2A 1PILA 1WC0A 1LWEA 3D6TB 3KNGA 4I64A 2BJ7A 4OYZA 1EQ0A 3BR8A 2OP5A 3MM5B 4OL8A 1RQ0A 2MMYA 3CD7A 1RTIB 3J7A1 4DQRA 1QLNA 1FDNA 4RBVA 3ZZ0A 3HZGA 1W7WA 3UN3A 3ET6A 3ITHA 5CA5A 4NEZA 5HO4A 2DXEA 3T3FA 2MXYA 5J1PA 2W2OP 4JI1F 1DHMA 3UW1A 3JTNA 4DV0J 2OKQA 3GPAA 5J1NA 4MFBA 4USHA 2XMWA 2HFUA 1S0OA 2PI4A 5T41A 1N56A 3ISND 1NK9A 2GS8A 2CZ9A 4YS2A 4QW9A 5HJXA 3MM8B 5ETOA 4JI8J 3M2RB 2MZ1A 3P45B 2DO0A 2HW3A 4JB8B 1J27A 4ID5B 3OJUA 5D77A 1K0VA 2CZVC 1REVB 2ZD1A 3JXOA 1PJ5A 3HFVA 4PWDA 4BWMA 3MM6B 2XMTA 2VPXB 4M1KA 3MCSA 1U7LA 5GADI 4DUYJ 4WKYA 2HBZB 1VLYA 4KRWA 1S79A 2QMWA 4ECUA 4UZCA 1C0TB 1PYOB 1DQ8A 3F56A 1PO6A 2ZNYA 3FK4A 4KV8B 3NNAA 5KG1A 3MEKA 1CQMA 1QTNB 1Y4ZB 1KLMA 5F8HA 3DXBA 2KM8C 1N5YB 3ZZTA 3RU0A 5D4LA 1IKWA 4ZLNA 5DQGA 1I3OB 2UVVA 2VDHA 3NCRA 3SDEA 4Y2AA 4GVBA 1Y7PA 2XI3A 4A46A 1NK4A 2XWXA 2D9PA 3M2UB 2U1AA 1B64A 4CLLA 1WACA 2QMUB 5IT9Y 4MKAA 4O4GA 1Y3JA 3QLHA 8AT1B 1I6JA 2ASLA 4EBDA 3A3NB 4KHPF 3H5UA 1SC4B 4DSIA 3PW0A 4PPZA 4DUZJ 2M3DA 2PMZD 5THWA 2O1PA 5D0HA 2BJ8A 1RT7A 2V4RA 2V67A 3H40A 4K4YA 4ZJLA 2EBEA 1RISA 5HVGA 3FSIA 2OH2A 3ENVA 3DLEA 2AGQA 3CF5Q 1Y5IB 3FSYA 1Q8LA 4O0IA 4DV0F 2ROEA 1HQEB 1S49A 5IQQA 3BGFA 1HLWA 2OI2A 5CYMA 2HHHJ 4ZPTR 3W63A 1JXVA 3LAMA 4PRFA 1X8DA 1YI2S 2YNGA 3LPEA 3Q89A 5KFPA 3NLCA 4JI3F 2J9EA 2QLBB 4JV2A 1ELOA 5E2QA 1WUUA 3WC2A 2WSFC 3ZNUA 4OI2A 3PW5A 2ADCA 4DUYF 2CJYB 5GMKa 2YWEA 1NXIA 1FI4A 2HPUA 5K8OA 2VG5A 1UVJA 3MTJA 3T6BA 1X7VA 2M70A 4Y34A 2L08A 1T0TV 3C16A 2W2MP 1NSQA 1RWMB 4JI7J 3CJKA 5AXMA 2HKEA 2YKQA 5HVFA 2K7KA 3KLVA 1X5PA 1U4BA 2KT2A 2MKCA 4ZN3A 2AWZA 1ZZNA 4ZVFA 4H4MB 2BKNA 4HI1A 1U2FA 3G82A 2OEKA 2XHWA 1XNRF 3K5LA 1N34F 3QJLA 3UCUP 1IBCB 3T5HA 2E29A 4JI2F 5HQ8A 2WRMA 3SBMA 4ATNA 1UWAA 1TKXB 4WF9Q 1MMLA 1SC6A 5FD1A 1T05A 3A3PB 4G1IA 4LVOP 2ZBQA 4ZVGA 1VQOS 1BD6A 1ACMB 1M5HA 2L48A 2WVEA 4CDIA 3DKDA 4AL6A 3BPDA 3V6DB 1T95A 3BGOP 4YMEA 3CIMA 1BC6A 3EYZA 1TV6A 2OPRB 2BVZA 4MIWA 3SCLE 3Q8QB 2K3IA 1Q53A 2W2PP 3KHLA 2D3O1 1A9NB 2HRUA 1VI7A 4ZCLA 3J81j 4E98A 4FDFA 2BE2B 3ADAC 2DNRA 2NYHA 3M9MB 4ZLPA 4QPXA 2C3MA 2AHOB 3IG1B 2UU9J 3K7RA 1WG1A 3I6PA 3BH6B 3F41A 3RB3A 1HWIA 4Y65A 2EKNA 3M6WA 4A8MP 4IFVB 4JI7F 5ETSA 4GKKF 1MLAA 1QTMA 1FFWB 1LNQA 1VQ6S 1HPZA 4AD6A 4IQXA 1JJHA 3BREA 4QYZJ 3D0GE 2BE7D 4N7TA 1N0UA 1B0TA 2EW9A 5A8RB 3KLIA 1DLOA 2V9KA 4TN2A 4FKYA 1Q8IA 3T5KA 2ZVSA 3I9ZA 1GXLA 4NYOA 2HQDA 1JLCA 2POKA 5KFBA 3TANA 4I67A 3G87A 1BY9A 1IR2A 3N0VA 2MJUA 3UVJB 3IR5B 3CDWA 4OV1A 1QAYA 4X4RA 4DR2J 2WZ1A 3PJ9A 3TYTA 2FB0A 3JS9A 3NGTA 2ZBIA 4X4NA 1RAGB 2W9BA 3TP2A 1TKTA 3CJ3A 1MWYA 2DIVA 3JSBA 3L3CA 2ZUAA 4LF5J 1O0PA 3BS9A 4K0KJ 5J2QA 2CZ4A 3S6EA 1OYEA 1O5JA 4B3SJ 1RAFB 4B3TJ 2J6UA 3G9CA 4IUFA 4DQQA 3TVKA 3TQEA 2ZFHA 5K9FA 1KQSR 2Y9HA 4IRDA 2KU7A 1WC6A 4TKTA 5KG6A 4YB1P 1RXOB 4U7UD 3N01A 2VJUA 2XO7A 4L6V3 5KTQA 1DQ9A 2WONA 3OLBA 1TK8A 3TUIC 4USMA 1EKRA 2CQGA 3M6XA 3V4IA 1TL7B 2JEGA 4H4KA 4EI2A 2MY7A 1H6KX 1XJWB 3NNHA 1DFDA 1U1OA 4WFZA 2U2FA 3KK1B 2BE9B 2RDJA 1HI0P 1WEYA 1VQ7S 2XQCA 3FBFA 4D3HA 5HATA 1IBMJ 5IXUA 2RQ4A 2ZBPA 2QA4S 4M5DB 1VQPS 3BN4A 1UWBA 4OHWA 2G0JA 2H48B 4W98A 2GQ2A 3NWGA 4YB7A 1HQUA 2OGUA 1L3SA 3OJSA 4DMZA 2E7WA 3F44A 3ONQA 4JBCA 3FRZA 1PGZA 2HLUA 2LXUA 1TQLA 5EWEA 4KHRA 3BYRA 1HBNA 2F3JA 4DR5J 3DYAB 2JWNA 7FDRA 5HAOA 1EAYC 1Q8BA 3Q83A 3E51A 1UEKA 4ITSA 4CO0A 2LU1A 5DM6Q 1Q79A 3OTBA 4G65A 2YNFB 3JQKA 4K4UA 1X4GA 2H5EA 3MXHP 1YG0A 2QLXA 3K0JA 1WC3A 4K0KF 5HLFA 2O01C 2LQBA 1RT4A 1KTVA 1X5SA 2Y1RI 3J81Y 1EETA 2VQEJ 2HBYB 1F60B 1JLEA 5LL6d 2RMLA 1NSKL 2DHXA 1K0TA 2BM0A 2LA6A 1JJ2R 3CMQA 5DGAA 4F04B 1N88A 1IJEB 3FNNA 2WW4A 2WW8A 1R89A 3H2UB 4I0WA 1BMQB 4X64J 3P3DA 2HS4A 4ED4A 3QZ8A 1RCOB 2GHPA 2FHMA 4QU7A 2R7WA 4ZP8A 2UVUA 1V5IB 1KFDA 4E0DA 4ZPWR 1TVRA 2P2CB 3HVTB 4A8SA 2BKOA 2EK1A 4TQSA 1WC5A 2C3OA 1QSYA 2HS0A 2IRXA 1YSJA 1B4SA 3T1HF 4RR5A 2B43A 3D4JA 3V6KA 1AZSA 1YDLA 2CJXB 2EPIA 5MLCV 4LR7A 4DWIA 1YJWS 1ZM3A 2MKHA 5IC4B 5B0BA 2M9KA 1BUXA 5KFEA 4JI0J 1CEZA 2C3PA 1WHWA 3AFGA 4CH0S 1NMEB 1JQGA 5LXYA 4CO5A 2HGNA 4X4QA 5C42B 5ITHA 3CEDA 4F4ZA 2OD4A 2ZKUA 3OTDA 2OLWA 4DR5F 4Z7YA 3GIMA 3OTOJ 2CVIA 3M05A 3CCQS 2AMCB 3MFHA 2HVEA 4OJ1A 1RTHA 4A4JA 4MKYA 3D1OA 2NSCA 1P9QC 4DL7A 4WBFA 2PGCA 2Z58B 2DEIA 3KJVA 4OYWA 3X3UA 3OPKA 3EICA 2VQEF 1P8GA 3TUPA 4WK1A 4OZ3A 2ZEJA 4OHVA 1FKAF 3GTYX 2XSJA 2WSCC 1XC9A 2Y0BB 4QWDA 4ES3A 4DV5F 1P1TA 3DM2B 3JTPA 1R8CA 3QMQA 3ZFVA 4G3IA 1NHUA 3QQCD 1KFSA 1RTJB 4OMFG 3UDEA 1TELA 1TAUA 4OYPA 2QN6B 3RAMA 1M5VC 4B9LA 1X9SA 2DGTA 1BGXT 1NK5A 3C6TA 1T8EA 3MOJB 1N6QA 4KAIA 2J7UA 3OFEA 4LRDA 4K4VA 2V8GA 4I69A 1R0AB 3PO5A 4FN5A 4YDDB 1HMVB 2A18A 4B3MF 2BJDA 4Z2XA 5K8NA 5H1SV 1MG7A 1GXUA 3DU6A 2PFDA 3M32A 3ZZYA 2EFPA 3VCDA 5CD4H 4LQ3A 1Q4RA 1KOHA 4ZVSB 2IAJB 1T9UA 4ES2A 3ZC4A 4C8NA 3MMCB 1TMMA 4PXDA 2GIRA 4ENOA 3R3TA 1M5PC 3D0IE 1V3ZA 3AXKA 1WJ9A 5F8MA 4UW2A 2DCLA 1UFLA 2D9OA 3SQGB 3TARA 4W90B 3G96A 3BYPA 3EZOA 3T19A 1KQGB 3FQKA 4ZMMA 4N47A 2DHSA 3DHWC 3LANA 4EWTA 4XPEA 3HSJA 1NDKA 2RDIA 1LEOA 3OL7A 1SQFA 3IC1A 3U1LA 4F0HA 2RUGA 2H4WB 3KJNB 3AB2B 2DH7A 2HZVA 3GB0A 4ZA1A 2MEWA 3BKFA 1M5KC 3ULHA 4CTAB 2AX1A 2IA6A 1IM6A 3RZAA 1UP1A 2VODA 2BQ3A 1RA6A 1RWWB 2LLZA 1T9YA 5B0FA 1NJYA 3A12A 2WHOA 3PZPA 4LFCF 3K5PA 4LF8J 4DQSA 2YWKA 3Q8PB 1PC5A 3HKZD 3NAIA 4KKOB 4DEZA 1OMSA 3L7OA 3M8QA 2XMUA 1HD1A 2YPZA 4L76A 4RBTA 2FGCA 2HK2A 4ECQA 4PUOB 1F6TA 2LDIA 2GMJA 1HNIA 3LPYA 1HNXJ 1O8BA 1RT3B 4DR7J 1S9GA 4WP8A 1WKKA 3ZZUA 4U7CA 2H3EB 4Q2LA 2E5GA 2GZOA 3W5ZA 2HS3A 2G9OA 4O0NA 2IYGA 1UKUA 2XTJP 1U0HA 1FJCA 1UVIA 2CPIA 1LW0B 2HQIA 5B09A 1HNWF 1CSJA 2IJFA 3MR6A 2QSWA 1HNZF 2R8IA 1NHVA 4ANEA 2DR6A 2A10A 1S1TA 5E33A 1JXLA 2V4QA 2IHR1 4OHXA 1GH8A 3PDNA 4P73A 4ZKAA 4B08A 4YDXA 2AGPA 1H98A 1YRXA 1QE1A 2C22A 2BZ2A 4Z7CA 3OUYA 3IRXA 1FRIA 4DPYA 3BQ2A 1HBUB 2NZ4A 2VC1A 2MQQA 3D6FB 3BB5A 6FDRA 2XB2D 5DGBA 3P5BP 3M8PB 1C1BB 1EARA 3CJSA 5G0RB 2AZ1A 2QL7B 1HYSA 3FDSA 2C3YA 4KT0C 4ZPCA 2H65B 2YXLA 1IKYB 3GG0A 2LEBA 1WG4A 4LUBA 1SL1A 4YP3A 1LXNA 1IM4A 2XLIA 2PN6A 4CO4A 1N4LA 1FK9B 3W2VA 3IS9B 3RB0A 4K4TA 1TL4A 3TQ1A 2QV6A 3SSSA 3H5SA 2R7SA 2IRYA 3W5YA 1Z2ZA 2W9CA 4F2SA 4FF4A 2DRAA 4GC6A 5D0GA 2CQ3A 1HBMA 3KK3A 1JLFA 5GMEA 1FO1A 2IM1A 3L7PA 3TNVA 1Q86T 4DR7F 2PO4A 3O8WA 1Q5YA 3RRHA 4M5JA 4M8LA 1DQAA 5KT5A 2LQ5A 3BKUA 3VVTA 1JLGA 2LDYA 3KK2A 2OSRA 2ZOMA 2OD6A 3E3XA 1DURA 2IIHA 1VFJA 4PXCA 3O3LA 3FGVA 2MGZA 2VG6A 1VS3A 5E3CA 1JKHA 2YKMA 4PKDB 4WFYA 3C15A 2DHAA 1N5SA 4KH0B 3MUVP 3DLLQ 2FJAB 1FKPB 5J2MB 1NK8A 1MWZA 3RUBL 4YUDA 4NLGA 1IN0A 4ZCMA 3TWZA 3VAJA 1CJTB 3VAHA 1H7XA 4F25A 4DSEA 4WP3A 3PKMA 4ZJQA 2XS7A 3HMJG 2MYFA 2XMKA 2PEBA 3EVMA 4O44B 1IQTA 4QIWD 3I0RA 3MMJA 3IAS9 4ED5A 3MWBA 1N36J 2DR8A 4IG3B 1J5OA 4Y2KA 3QZ7A 5F8JA 4MIAA 2J8SA 4ZVEA 1I94F 1M5SA 4DDFA 3HCXA 4KFBA 4QIFA 3IWNC 5DZ7A 2E5LJ 1ZBTA 4ZIVA 3IWXA 3KJQB 2HFOA 4NCBA 1RSCA 2FHJD 4PG7A 3JQMA 1VR6A 2DKOB 1NBEB 2QLFB 1MN9A 2B4VA 3G6XA 5HMXA 4IOCQ 1JWWA 3PHTA 3MM7A 2DGQA 3DHXA 5I3PA 2DNZA 3OW2R 2HNDA 1LWEB 1YITS 3SFUA 5KFRA 1EKSA 4FXDA 4G6VB 4NL5A 5L1JA 3LAKA 2KFYA 2KXFA 1FDAA 4USWA 3D66A 3BQ1A 1SCJB 3NGRA 5KG3A 2MTLA 4FF2A 3ET6B 3HSZA 1FD2A 2EK6A 3ITHB 2CNLB 3SSRA 4ZP9A 1BE4A 3MECA 4DL2A 1ZAVA 2I5JA 3D1QA 2ERRA 3KNAA 3OV7A 1H3DA 1DARA 3GYXB 4J9QA 4MFBB 4HT5A 1T03B 2AYBA 2EFNA 1YBAA 4DQIA 2DB1A 3N28A 1K1QA 2CJKA 1QUPA 1FXRA 4GO7X 3N9UC 1KKHA 1QAJA 2JFDA 2UP1A 4LSLA 2BRLA 2P6SA 2B8QA 3FZBA 3R2CJ 2ZD1B 1S48A 4NLVA 2J0SD 4DL5A 3GV8B 3VWSA 4OIXA 1M1GA 1W2BR 3DLJA 4USVA 3P49B 1S97A 5KFKA 5EX0A 3D3CJ 4FYWB 2VBWA 5I3UA 3CD6S 1RUSA 3K89A 5BR8J 2JDJA 5IC6B 3CC7S 1AXQA 1KLMB 2EC2A 4DV2F 3UI3A 2HWIA 1LFPA 4R8UA 5ETMA 2UXBF 1IKWB 3SQOP 1SKWA 3GWCA 3SDEB 4FKXA 3BR9A 2JSXA 2Y1IA 2KRBA 2Y8WA 2GW8A 4GVBB 1RGVA 1R7IA 5A6PA 4WTOB 4YY3J 3EMTA 1RAOA 1X60A 2RF2A 3E01A 4FYXB 2HMIA 5KFOA 3W1YC 1LK5A 4O4GB 1P27B 2LYVA 4DPWA 3HPOA 1U1RA 4B3RJ 1WOSA 2MHEA 4ECVA 2VB6A 4BBYA 5LSLA 2ABYA 4RPFA 3QO9A 1UCNA 1RT7B 4PWUA 3CCZA 1U25A 5LSOA 4CNYA 1JLQA 2CQ1A 4OYIA 1CJVA 1VMBA 2HBQB 3DLEB 2AJ0A 4EMDA 5IFMA 5T14A 2YKNA 3PACA 4OJHA 1K9MT 4CLZA 3QSIA 3H2LA 1VYAA 2BUNA 1AUDA 2VBYA 3K5OA 4K4XA 4L74A 2GCFA 4CLWA 2DNHA 4DR6J 2JEIA 1ZM4A 4F0MA 1ULRA 1FRHA 2AKWB 3GFHA 4PZVA 3PW2A 5CYMB 1OY9A 1WSVA 2YNGB 1FX2A 3IAM9 2DHGA 5KG2A 1SQEA 5L9XA 3BN7A 2LQ9A 2WAQD 3N79A 2YQ0A 3I82A 4B9SA 4WZMA 3MM9A 4NLWA 2ZKTA 4FPRA 4CLFA 4NWBA 3VV2B 3S01A 4DR1F 5B0DA 2VG5B 3ZO7A 4UZBA 5B0EA 2R7UA 1BLUA 3C16B 4O23A 3I55S 1T9XA 3M1VA 2JNJA 5GADU 3CJKB 4TU9A 1ZAXA 3G86A 1RWNB 4OHZA 1UPPA 3GYNA 2DGWA 1UAWA 4U95A 3H8YA 4LFBJ 3QJJA 4WKRA 5EGYA 2ZDPA 3IXQA 3W9IA 4ZLLA 4YR2A 4FS1A 4XPCA 2PIIA 1RKIA 4K2JA 3T9ZA 4OI1A 4KJIA 3G82B 4F8RA 4EUVA 3EDQB 4DL6A 1F3FA 2YH0A 1QY7A 1FERA 1OJ4A 3CE8A 1KLNA 3W2WA 5F9NA 1YJRA 3PIPQ 5J1EA 3QWPA 3I9V9 3LP2A 4CLTA 2R2UA 2HFVA 1T05B 4LSNA 3G6ES 4QWCA 4C3MA 4DR6F 4YOEA 1EJ7L 3M8WA 1AFIA 1UPMB 2W1BA 2RQCA 2BQUA 4ZOSA 2RIJA 2MQPA 3M2VA 2A2DA 2G1DA 2YKAA 4P6QA 2BW7A 4PQAA 2ZJPQ 1X0FA 4R25A 4Q45A 3VALA 1JLBA 3NS6A 2K2PA 1TV6B 2RKIA 1D8YA 3LUYA 4WFAQ 1A7GE 5K20B 1H74A 2J9DE 1T94A 4P52A 3H59A 4EO6A 4K4ZA 2VFUA 4P7VA 2WBRA 2V2VA 3H4BA 1RWUA 3AA8A 1TFYA 1RT6A 4DUTA 1N33J 5LSRA 3MCMA 2ZH2A 2LP4A 4NZ0A 1HWJA 3HHLD 2ZH3A 4Y6IA 2Q66A 1NKCA 2X7IA 3OR2A 2J6TA 4CM0A 1UW9A 1FCAA 3GR1A 1HPZB 3FCHA 4MK9A 2QJ3A 3MFIA 2WBMA 1R27B 1K73T 2XWYA 2JEFA 4KY3A 4WCEQ 4QU6A 1U0SA 3THPA 2OAUA 2YX1A 4F26A 3IN5A 1EIYB 5M2PA 4NXMF 1R43A 3QIDA
chains in the Genus database with same CATH topology
2VC0A 2E7XA 2ZJQQ 3O1LA 3QJLA 3VQSA 4DS4A 1JB0C 4J37A 3SFGA 4IH6A 3UCUP 2NPIA 1FE4A 3KLIB 1Q7YT 2J6SA 3T5HA 1NJWA 3FZ2A 1DLOB 3CMES 3THTA 4FVMA 3NRBA 2ZH7A 3CCMS 2E29A 1UJ5A 3EGWB 3J7Z5 4JI2F 3I87A 3BO4A 5HQ8A 2WRMA 2DH8A 3HP6A 4QR1A 4OZNA 2DO4A 3V4MA 1JLCB 2NS1B 4ATNA 3H98A 3PEHA 2Z2LA 1SIWB 1OPIA 1TKXB 4LIRA 3CCES 4WF9Q 2ZOFA 3CCSS 4ED3A 1C0UB 1MMLA 3QYYA 1SC6A 2HRYA 5FD1A 2ZJRQ 1HQEA 2UV8G 3LWLA 1T05A 3NMRA 5HL7Q 5CH7B 4G1IA 4LVOP 2FJVA 1QM9A 4H4OA 4ZVGA 2BA9A 2W9BB 1VQOS 3ZZZA 1TKTB 1BD6A 1VC0A 2DR5A 2KJVA 2W7OA 4Q0BA 1M5HA 1FJ7A 2VPWB 3CPWR 2CFXA 4PQUA 2L48A 4RW8A 4A8QA 3OFFA 2HHSA 1APSA 3GSDA 1R8AA 5IS2A 4AL6A 2LU2A 3V6DB 5CCMA 2YTCA 5J2QB 1S1UA 4QCLA 3HHLA 1FDBA 1T95A 5SZTA 4RZRA 2JOQA 4IH5A 5KFTA 1T3OA 4R5PA 5DQHA 3P5TL 5KFIA 4YMEA 3CULA 1YJ9S 1RT2A 1X4CA 2V8DA 3CIMA 5GAEI 2UV8A 2XCAA 2A3JA 4EEYA 4ELTA 3EYZA 3LP0A 1BC6A 1TV6A 5D3GB 2OPRB 2BVZA 4NPOA 1BQXA 4MIWA 4ECTA 3KOAA 5A8WB 2D41A 4FS2A 3SCLE 2KXHA 4NLRA 1RT1B 3Q8QB 2K3IA 2N4DA 4QPTA 1Q53A 3KHLA 5DDOC 5JUMA 1A9NB 3CCUS 2R9LA 2HRUA 1VI7A 2AJ4A 4DLEA 4X4VA 4LF6F 4ZCLA 4WZQA 4E98A 2HHPA 2JVRA 2K7JA 2BE2B 4KBIA 2DNRA 1EP4B 4O3RA 3M9MB 1E6VB 1D9FA 4C8YA 4ZLPA 2C42A 4Y00A 4QPXA 1UFWA 2C3MA 4RLEA 2DD8S 2VQFF 4CO3A 3IG1B 4OJGA 2WONB 4OX7A 1TL3A 5GAEU 2GFFA 5DETA 1NAQA 3BZQA 4MTPA 5C25A 1LV5A 2XCPA 3K7RA 3V4IB 1WG1A 1GTEA 1N33F 3I6PA 1Q7LB 4RWXA 2BANA 3GIIA 3F41A 3HXMA 3N6LA 4OX6A 3RB3A 2M0GB 3MMBA 5DJBA 3SXLA 1LK7A 1HWIA 4Y65A 4JOUA 2LA4A 3M6WA 1Y5LB 4A8MP 4IFVB 3M9NB 1FESA 4DL3A 4JI7F 4GKKF 2GO9A 1QTMA 5L9NA 3G8TA 2M5YA 4WJBA 5IT0A 4IG3A 1UL3A 1VQ6S 4KIAA 1VIXA 1HPZA 2DR7A 1RDRA 7FD1A 3PFEA 1HFEL 4I2QB 1MSWD 4H4MA 1JIHA 2ALZA 2MY8A 1JJHA 4IQXA 2PMHA 3TOQA 4DFMA 3R1LA 2KKHA 1N36F 2HAIA 4BCAA 3CJ4A 3BREA 2WOMA 4DG1B 4QYZJ 3D0GE 1J5EF 2JFKA 2D3UA 2PC6A 3N6NA 1BQNA 2I9SA 2NXUA 3Q23A 1VQ9S 1UWBB 4JI5F 1N0UA 1VHFA 4KO0B 3KLHA 3RBDA 1DJ0A 2J8AA 5DO2A 1B0TA 1TUVA 4TLRA 4BHQA 1VC6A 5L1IA 2EW9A 1N32F 2KHDA 2E5LF 2VH7A 5A8RB 3KLIA 4MKBA 1ZM9A 5B0GA 4UY8T 2VONA 1HQUB 1ZPVA 4QWEA 1LOUA 1DLOA 2V9KA 5DDQC 4TN2A 4J9LA 2FLOA 5K14B 1Q8IA 2RE1A 2IMWP 3T5KA 1S99A 2ZVSA 2FVQA 1G1XA 2RRBA 4Y28C 3I9ZA 1GXLA 4NYOA 1JLCA 3GIJA 4O3NA 2POKA 5KFBA 3TANA 1L5UA 4I67A 1UMJA 2VFVA 1TKXA 2OMOA 4F3QA 2CQ4A 3IRXB 1BY9A 3N0VA 1C0UA 1VQ4S 3GV5B 2MJUA 1UVNA 3IR5B 3CDWA 1HBNB 4IRCA 5M2RA 3TA2A 2KFZA 4OV1A 1QAYA 1Y3KA 4X4RA 1H2TZ 2G13A 3TYTA 2FB0A 2XY6A 2HNZB 2HFZA 2ZBIA 4X4NA 3I5BA 4JV1A 2W9BA 3TP2A 1TKTA 3K8WA 4NXNF 3CJ3A 2E5IA 3E2EA 1MWYA 1F2GA 2CPXA 2DIVA 3JSBA 4LQ9A 4XDDA 5G4DA 3L3CA 3UD4P 3CVKA 2B51A 3PV8A 1VQNS 2CQIA 2GQCA 2JH3A 2LVWA 1O0PA 2JRSA 4WIIA 4FVCA 2M4MA 2M2BA 3QGHA 4DX8H 3BS9A 5IQ6A 5HROB 3UD3P 3V6DA 3C46A 1M5OC 2CQHA 5J2QA 2Y0SD 4EO8A 2CZ4A 1KOOA 2J0XA 2V9WA 3RW6A 3D1HA 5KG4A 4EBCA 3QGGA 3PW7A 2Q3PA 4TLQA 3S6EA 4CI0B 4TY8B 4N56A 1LQ9A 2BJEA 2CQDA 3MMAB 1O5JA 2KHCA 5HLFB 2CYYA 2HHVA 5A6WA 4C8MA 2B4PA 2J6UA 5D3GA 1D3WA 2OPRA 3OLAA 2MZJA 4KR0B 1RT4B 2GHVC 2UUTA 2J9DA 4ECWA 2E1RA 2CQ0A 2QRRA 5A8WA 3G9CA 4IUFA 5HBMB 4DQQA 1EETB 3DRYA 3TVKA 2KTQA 4YHHF 3W3SA 2Q1LA 1YJTA 1V9OA 3SSQA 2ADBA 1RT1A 2W25A 1Y9OA 2F40A 4JV0A 3HK2A 2YWFA 2M88A 1JLEB 2ZFHA 1SH2A 4NX9A 4TYBA 5K9FA 3CCJS 1S0MA 1WTBA 2CIMA 1KQSR 1ZAWA 4IRDA 4URSA 1T03A 2VZ9A 2KU7A 2BE2A 2V5HG 4NLYA 2FLNA 4TKTA 5KG6A 1LW2B 4DN9A 4A8XA 4YB1P 2LQJA 1EP4A 4USJC 1E6VA 4MK7A 2VPZB 3PRBA 1S76D 4X84A 5F8GA 1K8AT 4A8FA 2LKZA 3N01A 3OFHA 2XO7A 1GXTA 2F8MA 2MSSA 4RBUA 3MURP 1KHVA 3IG1A 4L6V3 5KTQA 1DQ9A 2ZH5A 2WONA 4ED7A 4FYDA 4YQWA 2AYEA 3OLBA 1TK8A 1WD6A 3TUIC 4NLOA 1HNVB 2B0GA 2V8VA 5DG9A 3Q8RB 3GG1A 5E3QA 2CQGA 3M6XA 2RILA 1OSDA 3OXFA 2RH3A 4C0OC 3V4IA 3AHPA 1Y5NB 4DR4F 1LFWA 3HHLC 1GX5A 3DN9A 2JEGA 1L3VA 2QZ8A 4KSEB 2A2CA 4H4KA 4ICLB 4U9RA 2CQCA 1X4EA 1SBRA 2MY7A 1VIOA 3WX4A 1H6KX 2GJIA 2KXNB 3T5JA 2AJQA 3O6QA 2LXFA 1XBWA 1TVRB 1OSCA 4UUWA 3Q2SC 4RUHA 3CCWA 5CYJA 3NNHA 3LOUA 1DFDA 1U1OA 4UQTA 4WFZA 2P9CA 3G6YA 3C8YA 1SIZA 2DNQA 4ED0A 2U2FA 1HI1A 1D9AA 4I2QA 3KK1B 2XS2A 4YR0A 1X4BA 1NK0A 3K8VA 3TVZA 2RDJA 1HI0P 2NYIA 1WEYA 1VQ7S 3HLUA 1F5AA 1FT8A 3GV7B 4K59A 4DG1A 4EYIB 4D3HA 3FSXA 3HJFA 1WEXA 2NUUG 2FHKA 2DGSA 4QR2A 5IXUA 2KH9A 2RQ4A 3QGIA 4BWJA 2CJBA 2MQOA 2QA4S 4M5DB 1VQPS 5KT2A 2RD5C 3DRSB 3BN4A 5B08A 1UWBA 3OXLA 4OHWA 2NQPA 2N3LA 1WEZA 4EZ9A 4FNIA 4KO0A 4OJ3A 4R0EA 1UJ4A 4MYTA 2GC8A 2GQ2A 2KO1A 3KYLA 3LO3A 1FVSA 3OQ2A 2AJFE 3NWGA 2XULA 3QGPA 3KHHA 5A8RA 1KTQA 4KQZA 4YB7A 1HQUA 2X1BA 2ZH4A 5BR8F 1DZ5A 2IA0A 2HNYB 1L3SA 5D78A 2J0WA 5K14A 3M30B 2MKSA 1JXEA 3DRXA 3FVYA 4DMZA 3JAMY 4U67Q 2E7WA 3OJSA 3F44A 3IGNA 1QVFR 1X5OA 2KYXA 3ONQA 2LCWA 1TAQA 4JBCA 3FRZA 1PGZA 2HLUA 2IBKA