1SIZA

Crystal structure of the [fe3s4]-ferredoxin from the hyperthermophilic archaeon pyrococcus furiosus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
66
structure length
66
Chain Sequence
AWKVSVDQDTCIGDAICASLCPDVFEMNDEGKAQPKVEVIEDEELYNCAKEAMEACPVSAITIEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Ferredoxin
publication title The 1.5 A Resolution Crystal Structure of [Fe3S4]-Ferredoxin from the Hyperthermophilic Archaeon Pyrococcus furiosus
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 16
structure length 66
sequence length 66
chains with identical sequence C
ec nomenclature
pdb deposition date 2004-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13370 Fer4_13 4Fe-4S single cluster domain of Ferredoxin I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sizA00
1AXQA 1B0TA 2V2KA 3C8YA 4L6V3 4XDCA 3OR2B 4AYBD 1Y5IB 1Y5NB 2FJBB 3GYXB 2UZAA 1Y5LB 3MM7A 3MMBA 4Y28C 3MMCB 3MM8A 3EUNA 3EGWB 3MMBB 5BYQA 1D3WA 1F5BA 1H7WA 2O01C 7FD1A 1XERA 3MM6B 1GAOA 3HKZD 1KQFB 1FERA 1PC4A 2C3MA 4YDDB 1FRLA 2PDAA 4OV1A 1FRJA 1GTEA 1BWEA 1C4AA 2VKRA 2C3UA 1DURA 2C3PA 1B0VA 1IR0A 1A6LA 1H98A 1KQGB 1B0PA 2FGOA 1FDNA 1SIWB 3MM7B 1ROFA 1VJWA 1H0HB 3MM8B 2WSEC 3MM9A 5FD1A 4CI0B 1FTCA 1FF2A 5BYSA 2FJAB 1FDBA 2V4JA 3IR5B 3OR1A 2XSJA 5L8RC 3OR1B 1RGVA 4DHVA 2WSCC 4OMFG 1FRKA 1F5CA 3PNIA 4XDDA 5E7OB 1BC6A 3LW5C 1JB0C 1IQZA 1FCAA 1FXRA 1DAXA 5BYRA 5CH7B 1JNRB 2C42A 1F2GA 2WSFC 2VPWB 1PC5A 1BLUA 2FJDB 4XK8C 2FJEB 7FDRA 2GMJA 1FXDA 1GT8A 2PA8D 1JNZB 3MM5A 2PMZD 3IR7B 1FD2A 2WB1D 1FRIA 3MM5B 4KT0C 1R27B 3MM9B 3MMAA 2IVFB 2WAQD 2V4JB 2XSJB 4ID8A 1HFEL 1GTHA 3OR2A 2C3YA 2C3OA 1FEHA 1Q16B 1SIZA 1G6BA 2GMHA 1C4CA 2VPXB 3MMCA 3EXYA 1KEKA 6FDRA 1DFDA 2FDNA 1BD6A 1FRXA 5CHCB 1FDDA 1FRMA 1FRHA 1SJ1A 3IR6B 4RKUC 3MM6A 1Y4ZB 1WTFA 1BQXA 2FD2A 1CLFA 2VPZB 1FDAA 1K0TA 1G3OA 2VPYB 2ZVSA 1H7XA 3MMAB 2Y0SD 2Z8QA 6FD1A
chains in the Genus database with same CATH superfamily
2R7TA 4HT7A 4RW9B 2A1BA 3S6EA 4C9DA 2GJ2A 2RF2B 7FD1A 3CC2S 1A7GE 4HHUA 4NEYA 3TA2A 4XAKA 4ZIVA 2OSRA 4F26A 1YZ6A 5A76A 3SDEA 3VAHA 1GNKA 4DR5J 1O51A 2Z0GA 4CLKA 2W9CB 2KG0A 4FYDA 5FJ4A 4ED7A 4K5SA 3OTCA 3UD3P 1B7FA 1QLNA 1SPBP 1VRUA 1TV6B 3PFOA 2E5JA 4HT5A 4YHHF 1NHKL 2B43A 4B08A 3G71S 1S49A 2CPDA 3K5PA 2V4QA 1FKPB 4LFAF 2XWXA 2MY7A 4ZVRB 3V6HA 2VBWA 3D5MA 2DIVA 2OMLA 2HIQA 2OEJA 3DDNA 2KXHA 3BO4A 3V6DB 3S01A 1ICEB 1Q81T 1NDLA 4ECSA 2LQ9A 2O01C 3ZTOA 2HRTA 4X4RA 1RSCA 3R5DA 4AQYF 1OY6A 1YIJS 4WFNQ 1S1XB 2IC3B 5M2RA 4F0KA 2NUUG 3DRSB 3SYZA 2OSQA 3IWNC 1XK8A 2N7YA 4ANEA 1QJHA 1BC6A 2V63A 2HHPA 3GONA 2UXBJ 3I55S 4F50A 1O8BA 2GMJA 2D3ZA 3EGVA 3R5AA 1BMQB 2MSTA 4KH1B 4ALZA 2P6TA 3FZ2A 2XO7A 2CVEA 2H54B 2M3DA 4RW8A 2ZDOA 3KJVA 3BB5A 5AJ3J 2HAIA 5GVQA 4RNNA 5C42B 2PFFB 3I96A 3D6HB 5KFUA 1AZSA 4NE9C 3EX7B 4ZPAA 1RT7A 4UOFA 3QRPA 1XR7A 2GCFA 3TAMA 1VC5A 2Q1LA 5BJRA 1NCLA 1T9YA 5KFAA 1XN9A 1NB2A 8RUCA 2R7XA 3HT0A 1YRXA 1WORA 3WC0A 4ERDA 3Q86A 4TYAA 2CNKB 1FRLA 2DGUA 3P4UB 2PSZA 1S77D 4USUA 4QWEA 1RWXB 1LFPA 3MM8B 2X7IA 1W2IA 2COLA 1ACMB 5FDLB 1IQTA 3PEHA 4HH1A 4IO1A 1QY7A 3H5SA 4GVLA 2RMLA 2VFSA 3HLUA 4CO1A 3RJMB 2BX6A 3UVJA 2DPJA 2DTJA 4RBUA 2YPZA 3L09A 1RHQB 1JJHA 2FGCA 4IYQA 2RIJA 4LF8F 2CPYA 2MZ1A 3T1YF 3TVZA 5IT9U 1HD0A 4ZPCA 4C3KA 5EWGA 4Y3CA 2V2ZA 2Z4PA 4DI6A 4OFZA 5J1NA 2VG7B 3M1VA 2F9JA 2G0JA 3MDFA 4QU7A 5EWFA 4LFCJ 3C6UA 3IAS9 3FFIB 4PAAA 3NLCA 4DR3F 2Z2LA 3OR2B 1NJYA 2BJ9A 3GFYA 4RX6A 3AJDA 4WF9Q 3HHLD 4RNFA 2WOMA 2GHWA 3E01A 2FVSA 2OFGX 1U2CA 2HYIB 4ZJOA 3UR3C 1VI7A 3DMJB 1DURA 2WVFA 2HLTA 2JX2A 3MM7B 1FFWB 2WSEC 4B9MA 3GWCA 2ZZTA 3CCRS 3TX8A 5A2QU 1UVNA 3VAJA 4YOEA 1RWVB 3EWGA 3DRRA 4DEZA 4O44B 1WSVA 3TRGA 4WFAQ 5G4DA 5DETA 2FVCA 3MF5A 2QLBB 5LSOA 5CZXA 3KK2A 3L9ZA 3M8ZA 5HL7Q 1KHWA 5CYMB 3ETMA 2C2EA 2HLUA 1TL1A 1FEHA 1FXLA 3L4BC 1YDLA 3AA9A 4LBHA 1EKSA 3QRRA 2AYGA 1RHKB 1X4GA 3DLHA 1KTQA 1FDAA 1S1TA 2OPQB 5ETLA 3DOKA 3OXFA 3D1OA 2VL1A 1H2VZ 2G1DA 3NXZA 4ED5A 3NAIA 3CJ2A 3IO1A 3ICLA 3KFWX 3B4MA 1OQ3A 1RA7A 4QZVB 3M9MB 2BRLA 2MGZA 2QSFA 1YSJA 5L39A 5BR8F 4QWAA 1N4LA 2ATCB 2BJ8A 4C0BA 2B3TB 3G86A 2RH3A 4CM0A 2DNHA 2QA2A 3TZXA 4ZP8A 4B9TA 2E1AA 2QLFB 1U7LA 1K44A 2DD8S 3PHTA 1N33J 2HQFA 1VMBA 1NK4A 4GKJJ 2I6WA 4DFMA 4DXLA 2CQGA 2HFZA 2XLJA 4LF5F 4ZCLA 1MN7A 4EI2A 1FRXA 2CA9A 4I2PB 2AZ3A 4IUFA 1Q8LA 4J90A 2LEPA 1IM6A 5HBMA 3OFHA 4F36A 3W2WA 3MMBB 4KHPF 5D3GB 3C16B 3GG1A 3ZC4A 5LMNF 3LP1A 3CD6S 1BWVA 2VBZA 2OO4A 2RQKA 2RJZA 1O0PA 4ILMA 3DGVA 3QZ8A 4M5KA 2B9EA 2N3LA 2VD3A 4EYHB 2MDAA 5HK4A 4Y2KA 4DPUA 4B3SJ 3O1LA 4USIA 4YP3A 4OI0A 3PW7A 1VC6A 3AAWB 2W8LA 1VFJA 2R42A 4DPXA 3OBIA 3A8KA 1N34F 3QGPA 2R3VA 1XIQA 1HNVA 2FZKB 4USHA 5KG3A 4KKOA 4USKA 2W8KA 1NK6A 1LW2B 3K0JA 2CVIA 3SMZA 3QWUA 2B4PA 2BKPA 4FF2A 3IS9A 1SBRA 4J9SA 4NXNJ 3N01A 1KLNA 1UETA 1NB7A 3J81U 2E1MC 5KG1A 1NK9A 1PAUB 4KJIA 3WIVA 4O4GA 3CC7S 3L7PA 2XLIA 2GQ2A 1WC4A 4YFUA 2QYCA 4DSJA 2WVDA 1BWEA 1U2RA 3QIPB 5B0BA 1UEVA 2YX1A 3ZTRA 1RT6A 2QMUB 4NXMJ 4OI4A 1LW0B 4Q2MA 4CH0S 5MLCV 3N28A 4YEAA 5C2GA 2HAFA 1N36F 4QYZJ 4A8SA 4JI1F 3N9UC 4FXVA 2IM0A 1F9HA 1F1BB 2RUSA 1JXLA 1S1WB 3I5CA 1X5SA 2YX7A 5IWAF 1TL7A 5H9FJ 4ZN1A 2E7XA 5KT4A 4WWSA 4RU2A 4CNZA 4KH0B 4DV6J 2BXJA 1WF0A 2R7OA 3PKYA 1LWEB 1AW0A 1RU2A 3US5A 2YKNA 2G4BA 1VBXA 2JRSA 5DZ7A 1IXKA 1RAJA 4PPDA 1EQMA 4TY9A 2DGXA 1U0HB 1FT8A 4CYUB 1T8EA 1HHSA 3UDVA 2Q43A 3DLKA 5A6WA 1ZAVA 5FLXY 3IWXA 1T7PA 2MZSA 2PO4A 5F8NA 1MROA 3HZEA 3M4XA 3NCPA 3G6ES 2JLFA 2HBZB 3R6GB 3K5NA 3TW0A 1NK0A 4MTPA 3OTOF 3JSYA 4X84A 2FVQA 2MKJA 4QWDA 5KFZA 4R0EA 3KLEB 2YWHA 4UY8T 3BBCA 2KZZA 1NNDA 3ULHA 2WVCA 4OYMA 3IRWP 3TP2A 4P72A 1WF2A 1HIYA 2VA3A 1JJ4A 3EGZA 1IKVB 4NMXA 2XS2A 5K14A 2EFVA 1CS4B 3FVYA 1RWWB 2JVOA 2VPXB 1C4CA 3OFEA 4WP8A 2XNQA 2DBBA 3L3CA 1CULA 4PEOA 1XNRJ 5E33A 4OHZA 4OQJA 4RW6B 3EXCX 2HKEA 1SH3A 2ROPA 3KLIB 5ETNA 1MMLA 3ILOA 4PG5A 2YKMB 3QLHB 1R6YA 3V4IB 1JXEA 3GIJA 4M5DB 2PEHA 1HD1A 5CZVA 1VQSA 3NNAA 1RYSA 5KT6A 4J7CA 5KT3A 3T5KA 4NYOA 3I9ZA 1DQAA 1FCAA 4JBCA 3K7RA 3KK1B 1TKXB 4PUOB 3T9ZA 5D4LA 3LP0B 4EWTA 5DO2A 2DNOA 4DQRA 2PEBA 1Q53A 1LNQA 1M5KC 3MMAA 3H2LA 4P2FA 2CDQA 4I6AA 4F7VA 4A8WA 2MMYA 4CCHA 3PEJA 3M9NB 2JL9A 1WTBA 4Z7YA 3FMBA 1VK8A 2B5JA 4HL9A 2QA4S 4Q8FA 2DIUA 5B7WA 2VONA 4KV8A 4HKQA 1BHNA 2C28A 5E5NA 2DB1A 3BQ2A 1MU2B 1N54B 4DR7J 3W61A 5HQ8A 2GO9A 4M63A 5IXUA 2N4CA 1QE1B 2IVMA 3CD7A 4N41A 3CJTA 1U02A 3B82A 4DUZF 2RD5C 1ZS6A 4ED6A 5F0WA 3KJNB 4JI8J 2E9ZA 2MZRA 1VHFA 2YNFB 4NLDA 1VS3A 2ADBA 3CW2C 5E0OA 1WHWA 4DX8H 1SJQA 2R8HA 2W1BA 3QJLA 4P74A 3K8WA 3D3BJ 4O4RA 2CUYA 5L8RC 1WELA 2HHUA 2BJDA 3I87A 2M8HA 4E8UA 2J9DE 2PE8A 2VQFF 3O3LA 2YNGB 2C42A 4J9LA 4U9RA 3NMRA 4ZCMA 2UXDJ 1GX5A 3CDEA 1N5YA 2BE9B 4DCOB 1XMOF 1UEKA 2ZH3A 3DU6A 2A6MA 3M9OB 2XMJA 4I56A 2I1RA 3RRKA 2ZUAA 2BQ3A 2NQPA 2JOQA 4DL3A 3MCMA 4ATNA 3RAXA 4DUYF 5D0GA 4ECYA 1EJ7L 4O3PA 1SQEA 1WOOA 3H59A 1JLEA 4F67A 3AJ2A 3GMGA 2RKIA 3QSYB 3KUGA 3IBCB 1IBLF 1JLFB 1HNIA 1BQNB 1NEEA 3MEGB 2VICA 2GX8A 3KLFB 1PJ5A 3V6JA 4IH6A 2JEJA 2X3DA 2VFUA 5EDWA 5JMNA 1WKLA 2MB0B 1KTVA 1FKOB 3MPUB 3U1NA 4RU9A 3EZUA 2XCAA 5DGAA 3D6TB 1FXRA 3U1MA 4DZDA 2KI2A 1YRUA 3PM9A 1QTNB 5KFVA 3DYAB 3M6UA 1REVB 5KFSA 4RLEA 4EGLA 3CD0A 2YQ3A 2VU5A 4LRBA 2C22A 1QAJA 1LWFB 2DXFA 3J7AN 1KLMB 1TUWA 1AXQA 3FSYA 3W3SA 4F4ZA 3N79A 2MJUA 4GC6A 3ZO7A 3G8SA 2ZC4A 1PC4A 4JI4F 1FNMA 3TA0A 3VV2B 2KDOA 1PILA 3Q8UA 5LOQA 2ZKTA 4RUBA 2XTJP 3BBFA 3ZTPA 4IFVA 3FEZA 3R6LB 1AUDA 2HMIA 1IM4A 2ZITA 2HGNA 3TWZA 1TKTA 5KOWA 2VC1A 2P9GA 3HHEA 5I42B 3ADAC 5IV3A 1QUPA 4USWA 2LQ8A 4DX6A 2Z2MA 2GVDB 3BGUA 1FO1A 1XEZA 3QQCD 3CCVS 2XS7A 3D6MB 3WHIA 4UOHA 2YNIA 1MW7A 4OIXA 2ZHAA 2JC0A 3VGVA 3IM8A 1ZA1B 3N6NA 3SIPB 4RW4A 3VAKA 2NXNA 2ZHOA 3MHYA 3OVBA 1Y00A 2LQ5A 4O3OA 3JYTA 2PMHA 2EPIA 5KFFA 1RI7A 3CJKA 2CG8A 4X66J 5KG5A 2ZH4A 4GC7A 2HZCA 2MKSA 3CIMA 5HJXA 2HNYB 4YDDB 3QT7A 2PDAA 1D0EA 1HR0F 2XCPA 1YKWA 2W4PA 2JFKA 4ED1A 3UNGC 4YQWA 2D3UA 2ZBIA 5U47A 1NDPA 2NXJA 2K3IA 2CPEA 1ZTWA 4FNHA 1F5CA 4MFBA 2HFNA 2V6AA 3FMWA 2NXCA 3VCDA 4JYAJ 1E6VB 3GP9A 1UW9A 2IM3A 3DLGB 2W7AA 4DG1A 4QU6A 2R7UA 2UXCF 3MZIA 4ANCA 4F4YA 2UUCF 3V4MA 1VRUB 3QO9B 1UWBA 1LKZA 3FBFA 3GCWP 3MR2A 4PZVA 4DX7A 2WONA 2VKZG 3CWJA 2AV5A 5FLXU 1BQMA 3BBBA 1BXNA 3NWGA 3I82A 2YY3A 2B51A 4Q5VA 3DOMA 2KKHA 1CG2A 1OSCA 1IVZA 2F63A 2KT3A 3RRGA 1NDKA 2BR0A 2QT7A 2GIQA 1NSQA 3OUYA 1JNRB 2XSFA 4M8LA 1E6YA 2FJXA 2VDIA 1VQ6S 3UCGA 3TUZC 2ZNZA 2IBKA 4KSEB 4J9RA 2C2RA 4FS1A 4YN3B 1YJWS 3ZFVA 1WDTA 4CLWA 1FRHA 1YBUA 4LF4J 5HMYA 3V81B 5T7LA 4WE1B 1VQPS 1RAGB 1AUSL 5F8JA 4B9LA 2QLJB 4OJ1A 2ALZA 5HO4A 5CXTA 4RW8B 5GADU 4H54A 4C2MA 3BO2A 3MECA 5K8OA 3TZWA 1NXIA 2YTCA 1FTRA 1R31A 1XJWB 1X4FA 2GAHC 3NAHA 1SI9A 5K5MA 1LOUA 2CPHA 1HNWJ 3RAQA 4LSNA 3I0RA 1PKUA 3P96A 2VG5A 5GAGU 3AJ1A 1AZSB 3D2WA 1RT7B 1SCJB 3QPIA 1HQUB 2C3UA 3TAMB 2HHVA 1FVQA 3IA0A 1VBKA 1HKAA 3D0HE 4TNOA 5DLGA 1RWOB 4UQTA 4M5HA 3IAM9 2DNQA 3H20A 4P71A 1HHTP 2VPWB 4C11A 5DRKA 1HW9A 1FE0A 1OPZA 3PJ9A 3BV8A 2IIHA 4CO3A 1CJUA 3FQKA 3HJFA 1B4SA 4EYIB 4LF6J 1N0VC 5DS7A 2IVYA 5C24A 4C98A 1KKHA 5THWA 1D1UA 3VVTA 3OFFA 3GB0A 2AYEA 2DR8A 3UVJB 4X62J 3MEDA 3QSIA 5HQMA 1V5VA 2DVIA 3VZHA 2EFQA 3ELHA 5H9EJ 1GXTA 2K1RA 1PSDA 1RE1B 4N76A 1RQ0A 4IOCQ 2BANA 4JI5F 4JI7J 3PFEA 1Z2ZA 2B9WA 4LRCA 1Q4RA 2ZM6F 4LUBA 4C8OA 4LF2A 5KFRA 4DOZA 4TU9A 2A10A 3C6UB 1U8WA 1M5VC 1UVKA 4IOAQ 1MSWD 1T3NA 1NRKA 1URNA 4N5SA 1FF2A 4JI2J 2WOMB 1R8AA 4UT4A 4WZQA 1TUVA 1S6PB 2DEJA 1SKRA 3E01B 1VGYA 2D74B 8ATCB 2J0XA 3UCUP 4NA1A 3R5BA 4ZITA 1WKKA 3R3TA 2AWZA 1HW8A 2AJ2A 1S9EB 4DR2J 2P5VA 4KHMA 3W9HA 2HHHJ 3LP2A 2GJFA 2UU9J 2FHKA 2IM2A 4KGXB 3G6VA 2ABYA 5HMZA 4DV2J 4K0KF 3O2IA 4IRCA 4C8LA 3VALA 3ET6A 2QZ8A 2KB2A 4ER8A 3RBDA 3KK2B 2RQ4A 2VG6A 3D0IE 2Y1RI 3I5AA 3NMAA 1U25A 1SH2A 3PO4A 1S7IA 1U1KA 2IRXA 1TL1B 5ETSA 3HT3A 2LKZA 3CXCR 4DV7F 1UZDA 2EC0A 3JQKA 4KC5A 2Q66A 2L9NA 1ZM2A 5AE2A 2DH7A 4CTAA 2WW4A 4HEA9 4XPEA 3W9IA 3TZZA 4ZP9A 3DC2A 1N52B 4GMKA 3DOKB 1L3VA 4WK3A 1KN6A 3H8YA 2HBQB 2V94A 1KVIA 5HMWA 3J80Y 3CT9A 2L48A 2V34A 4U7CA 2GA7A 4OLPA 2ZBCA 3BPDA 5E3CA 1N0UA 4PWUA 4LT6A 3PX0A 2FHJA 5KT2A 4HH0A 3BO3A 2E1CA 2OPRA 1PIEA 2ASDA 2QTWA 2PI4A 3FNNA 2D9PA 4Z37A 2ILYA 1U4BA 3R27A 1F3VA 2OJ3A 4IDKA 2LXFA 1XR6A 2E5IA 4JI0J 4N47A 1Q78A 2QMWA 4YY3F 2ACYA 3AY0A 2MGZB 2LECA 2DITA 3R7BB 4B02A 5KAKA 4MMOA 5JXSA 5L1IA 4ES2A 1MWZA 1YTYA 2IJFA 1UWAA 1G4CA 2OTJS 4K4YA 5CHCB 3UCZP 4QIVA 3UD5A 2C2DA 3BZQA 1EP4A 4CIOA 2YKAA 2PC6A 5IT0A 6FD1A 3PIPQ 5LSRA 2M8DB 4PYDA 3EDRB 3WC2A 2CXEA 3CPWR 2FHMA 2L3MA 2FQQB 3T5JA 1LQ9A 1RXOB 4H4MB 2VIHA 4EFAC 4JV5F 2A18A 3P49B 3CMAS 3LGHA 2YX4A 3ISND 1X4BA 2YWKA 4NLSA 3T3FA 4FF4A 4J9OA 2QRRA 1NZ8A 1TMJA 3CVKA 3LP1B 2Y1LB 1KVKA 4DR4J 4NRTA 4M1KA 1BLUA 4I2QB 3CUNA 3V6KA 4NCAA 2KJWA 2WB1D 1S99A 1RT5B 3PW0A 1R27B 3RYLA 2B56A 1CC8A 3CC4S 3M8QA 2FZGB 1F9EB 3VAIA 3W8GA 3L7UA 3TUIC 2AQ4A 4ZLJA 3HHLC 1IBMJ 1OMSA 4OYWA 5F8MA 4J37A 2X1GA 1Q7YT 4OZ0A 4UUXA 3E2EA 1HNVB 2CJAA 4KKOB 4CM2A 3KLVA 4LRDA 5CQGA 1PAEX 2A2CA 5M2PA 3GZ7A 3CCJS 3OTBA 4H4KA 2WZ1A 3C14A 4PXBA 5A8RA 4RW7A 3M2VA 1EKRA 2V4RA 1RWUA 3LF0A 2DNRA 1FESA 2H51B 1OY9A 4O4GB 4CI0B 2X1BA 4TLQA 4W4MA 4ZHRA 2NYIA 1F6TA 2M88A 1FRKA 4J9UE 3OXLA 4LMZA 2B4VA 2CQ4A 1R0AA 4ZVEA 2O67A 2Q3PA 1FNXH 4AL7A 1W25A 1FD2A 3HSZA 3MPDA 3AHPA 2B4OA 4X4QA 1Y3JA 3DLLQ 2E44A 3EJMA 3CGIA 4HDHA 1SJ4P 3KLHA 2J8AA 2DXEA 3HPOA 2LQBA 2NUHA 2V2VA 3I4HX 2YXLA 4AXJA 2E9TA 1K47A 4ELVA 1MG7A 1YLXA 3N5BA 4EZ9A 1X4DA 3PXGa 1TL7B 3CDBA 4I6YA 4WKYA 3GV5B 2NSCA 4OYPA 1N8RT 3HKZD 2YKNB 4S0MA 2B0GA 1ZOTA 3TYTA 1WG1A 4LRAA 2E29A 4F4WA 3NY0A 4ZPDA 2PN6A 1A6LA 4DV5F 3DLKB 5D78A 3PZPA 2FJAB 4ECWA 3DKDA 1I1GA 4MIWA 3V5RA 2WBMA 2ZFHA 1IWAA 1T05B 3B8HA 2HHWA 5B0CA 2KXFA 2IMWP 1GT8A 1HNXF 3R9LA 1FNOA 1RA6A 3FEXB 2W7PA 4C7QA 2DRDA 3NS5A 4M5IA 2IRUA 4DL7A 2GV1A 2FVRA 1KQKA 5DLFA 3PJXA 5KG6A 2K2PA 3M6VA 5K14B 1C0TA 2CQ3A 4AFFA 4KY3A 3EUNA 5DQIA 1UZHA 4OLOA 4WK1A 1X4CA 2IHR1 4PKDB 3OJUA 4BC9A 1CULB 4PPZA 5LXRA 2AX1A 2XBPA 3NBPA 1TKZA 1GMUA 4WIIA 4B3RF 1OYDA 4CH1A 3PRBA 3A4TA 5D0RA 3C6TA 4WFZA 1S12A 4USJC 2UUTA 4AT1B 4ECXA 1HPZA 4LF9F 3BGOP 5A8WA 4RBTA 3PACA 2W25A 3EGNA 3KWMA 5LMNJ 4LQ9A 2DO0A 4P73A 4ECTA 4DV4J 2YQ0A 1ZETA 2KM8B 1HBMA 3CO9A 1FWKA 2ILZA 1WTFA 3OW2R 2RS8A 4FYYB 3MMAB 4KTQA 2MSSA 4DSEA 4QJVA 4Q45A 3R1LA 1VQ7S 4ZP6A 4F8RA 1A9NB 2RRNA 2AD9A 3GLJA 2VQEF 1WSRA 2B5JB 2JH3A 1G1XA 3IGNA 2YKQA 1YJUA 3A1YG 1UFWA 2HQGA 3O44A 5KFTA 2QG9B 3FDSA 4ZJLA 4WXWA 1JKHA 2VB6A 3DGPB 4LQ3A 1VRTB 3KK3A 3A12A 3A8EA 3HHLA 1NLKL 1Y11A 2KFZA 1PC5A 3FCWA 1ZH5A 1SC6A 1Q1KA 1R43A 2EG2A 1KRPA 1AROP 2BE7D 2LFVA 4IR9A 3LGNA 2PFDA 1TKDA 3BQ1A 2FB0A 4WXOA 3NNHA 3ZNJ1 4NZ6A 1HNZF 4CO5A 2OD6A 1U09A 3VWSA 2K7JA 2RNEA 3T1HJ 4JI1J 5HVGA 4DSKA 1N5YB 2GNKA 4ZVTB 3CSKA 3I0SA 3HK2A 2FJWA 2EFGA 2FJBB 2M9KA 4USTA 3CCQS 2B8QA 2R8KA 1TL3B 4MYTA 2BJ7A 1JIHA 4DR5F 2VF3A 2GQQA 4DPOA 1Q95G 4DCJB 1P6TA 3AOCA 4FF3A 4OV6A 2ZEJA 5HAOA 4DX5A 5DG7A 4AD6A 4PWDA 4IFYA 1G7CB 4ZVSB 3PR5B 3J80U 1N5TA 3VGSA 3J7A1 5T41A 1D8ZA 4Y00A 1OYEA 2Y8YA 2R7RA 4N7TA 3HM9A 2FLNA 1WOSA 3IR7B 2OTLS 1UP1A 1LK7A 4ID5A 4ID8A 3EVWA 2RDJA 3TQEA 3M2RA 3OTOJ 1XR5A 1YJTA 3LGMA 2VOPA 1FDDA 5GAEU 3E51A 3MM6A 2K06A 2J0QD 2C1EB 3SZ2A 3MEEA 5K20B 2HVIA 1X9WA 4FYXB 2C2ZB 4Y65A 1RT4A 1FWPA 4NLPA 2YBVA 4KBIA 4J9QA 1EIYB 3Q8YA 2R4FA 3BPSP 2J9EA 1F2HA 2RE1A 3HSJA 2CJYB 3W2VA 3VVUA 4J9NA 2FHOB 4OYIA 3CDUA 2NLWA 2CQCA 1HI8A 2XMTA 5F0UA 2UXBF 2B8PA 5L1KA 2XZTB 4M5MA 1F5AA 1WC1A 4DLEA 3OR1A 2JSXA 4KO0A 1RGVA 4DQQA 4RWXA 2HG4A 1DAXA 2Y0BB 1VC0A 4YR3A 2PI5A 4CLYA 4DR1F 1EETA 1NK8A 4JI3J 2KVQE 4MKAA 5AJ3F 2HMIB 3GJRB 1IKXA 1TMMA 4RUCA 1HBOA 4NZ7A 1TKTB 5ETPA 5HJYA 1QSYA 6FDRA 2VZ9A 1Q8IA 3IR6B 4HACA 1PBAA 5I4MA 5KFWA 1VCTA 3UR0A 5KFGA 2ZJQQ 1S7HA 4I6WA 5B0GA 3CJ8A 2W01A 3KNAA 4L74A 3GU0A 1XBWA 1RTIB 3JS9A 2M4MA 2YNIB 2LA6A 4LVNP 1UA1A 4UZCA 3MD1A 1DARA 4FBTA 1IJEB 1T02A 4K7QA 1P1LA 1SUQB 1B0VA 1KQGB 3JYTB 5HN0A 2UUAJ 2XHWA 1ULRA 1HMVB 2J7KA 4U7UK 1ZYQA 3VAMA 3BH6B 3GPAA 2BRKA 3QBCA 2OI2A 1YJNS 3QZ7A 1YQHA 4KPCA 1S72S 3HF5A 1U6FA 2CZ4A 4NRUA 3DLEB 2KZMA 3H2VE 1KR4A 3SSRA 4LFCF 5I3PA 2R7WA 4FPIA 4DR6J 2MKKA 1DTTA 2AF6A 1HLWA 1Q86T 1FRMA 3M32B 2WB4A 1RHUB 4DSFA 2MQPA 4XO0A 2OH2A 3PYDA 3J7ZT 2CQHA 2W2QP 4C3MA 3T1AA 3QFHA 2PA3A 4GO5X 2AEFA 2ZWOA 4DG1B 4YUDA 1X60A 4A8KA 2ZD1A 4X4VA 3MCOA 5L9XA 2V50A 4BLGA 5KFQA 3DOLA 1UVLA 4NLXA 1UWBB 3U1LA 2XGPA 2LU1A 1UA0A 4X64F 4DBQA 2WONB 4KR0B 2HWHA 1PYTA 4OX9J 5E3QA 2XMAA 1BQMB 1S6OA 3I9V9 1K0VA 5F9NA 2OIHA 1PCAA 2E5HA 1VQLS 1IBKJ 2CQ2A 2H9ZA 4ZN3A 1F0XA 4QYRA 1TV6A 4O3RA 3OVAA 5LSLA 5B0AA 1RKJA 4MYUA 3BN7A 4PXDA 3BGLA 1M1KT 1UVJA 1RBAA 4ZPWR 3OUYB 1R7IA 4FXDA 3M6WA 3CF5Q 1X0FA 1FKPA 4EMDA 2EK1A 4NASA 1WC0A 4QR1A 4A8OA 2ZOGA 3K57A 2Z2YB 3OFGA 1XQIA 1SQGA 3LOUA 2LA4A 4NEZA 1EX8A 2PIIA 1T11A 3AB2B 2XC9A 2AGQA 1FEEA 4OYXA 5A6PA 1U1PA 1S1XA 3GE9A 3VGUA 4OV1A 2MKYA 3W66A 1M1HA 2OMOA 2EFOA 1CJVB 4ENOA 3UFCX 1HA1A 1ROFA 3GSDA 4P2SA 3GFHA 5A0YA 1N33F 4WYLA 4NWBA 4LSNB 3I0RB 1ELOA 2VG5B 4GKJF 1J5OB 3HHKA 4X4SA 3KTQA 3MEKA 2UUBJ 3RB6A 2DRBA 3AT1B 1PG5B 3W65A 2CAJA 4U8YA 4HI1A 1SL2A 1GTHA 2VBYA 2C3OA 3Q24A 3X1LB 1S0VA 4RJVA 5GAGI 5D0EA 4FKXA 5C42A 2CWXA 2Z2ZA 1J27A 3O8WA 1VQ4S 2F1FA 1T9TA 2K7KA 4RZRA 1CJUB 4ZS6A 1M5SA 3EDQB 3MR6A 2MXYA 3BSCA 4JB8B 2QO3A 2N7CA 3VGTA 4JV2A 2B4UA 1C0UB 5LJ3Y 1Q82T 5C24B 2DR6A 1FA0A 1PJ6A 1KQFB 3IG1B 4OI3A 1P9QC 2C3MA 4X4UA 4B3SF 1RAFB 5D77A 2DGVA 3OL8A 5E41A 4PWWA 2EVZA 4I4BA 3SXLA 1WI8A 2K1RB 5DDPC 5LMUF 3K5OA 4DN0A 3PTWA 3HFVA 5J2PA 2BVZA 2BA9A 4W90B 2O3DA 4R5PA 3MAAB 2F8HA 2RHQB 1FX4A 4MT1A 3R5JB 1I6JA 2ZBPA 1SQFA 1KOOA 1HR0J 3UI3A 5HVFA 4C8ZA 5D8HB 3DRPB 1TP7A 5B0EA 2DGWA 4CO4A 4NXNF 5AXMA 3DLBA 5K8NA 3OD2A 2FDNA 5F3TA 3HCXA 4PRFA 2VG7A 3DDKA 1M5OC 4CT8A 5HP1A 4ZLLA 2BQRA 3NL0A 4A8FA 1BQXA 3SI8A 2W4CA 2ZH8A 2L08A 3T5HA 5LL6d 1V3ZA 3LP2B 2Y0SD 3FFIA 4B9VA 2V2KA 3CEDA 3SSSA 4DZ6A 2L9WA 1VIXA 2ASLA 2CPIA 1TFYA 1RT2A 4DPTA 9RUBA 2VG6B 5KG4A 3AB4B 3PVXA 3SCJE 3PRVA 1TK5A 2I0XA 3W63A 1VIOA 1N48A 4NA2A 2KVIA 3QGGA 2JFDA 4ANDA 1U48A 3W8PA 3D54A 4CTAB 5DG8A 2Y3YA 3VHQA 2ZC3A 4QWBA 2HS0A 1TVRA 5IZHA 2CPFA 2WTFA 3S8SA 4X2BA 2DCLA 4TY8A 1NPPA 2CWKA 5DG9A 4DV6F 5CYMA 1VQKS 2JEGA 2V67A 2WAQD 4URQU 2QL5B 4C0HA 4IQXA 5L1JA 1KVJA 1RCXB 4I0WA 3UWTA 2P9CA 2LEBA 1DTQB 3BF4A 3KLGB 4MK7A 2POKA 4NLUA 4IDKB 1FJEB 1VDHA 2Y1JA 3H5YA 1V9OA 2CQDA 1ZA2B 2OPQA 1RWPB 1ZZNA 4OHXA 2AJQA 4F3QA 5CABA 2JZ5A 1NK5A 4KAIA 1Y5IB 2Z30B 3G2XA 3RW6A 1AA1B 2OPPB 3DM2A 5HSPA 2UVUA 5HLFA 3THTA 3L95X 1EP4B 4LSLB 3P6YC 1NPRA 3RBZA 1C4AA 2IMOA 2BJEA 3BGRB 1TFWA 2MTLA 1RB0A 4TQSA 1CJKA 2JJ4D 4ICLA 2IJNA 4F02A 3DRXA 2F4VF 3LW5C 1YBTA 3M2UA 3D0GE 3QFWA 1U45A 1VQOS 2OLWA 5E3AA 3H25A 2DNKA 1VLYA 1RTZA 4ETXA 2I5JA 1H2TZ 3EVMA 2PGCA 2HS4A 3CTRA 4WTYA 4PQUA 2YQ1A 1U1RA 2CIMA 1IWGA 2YKPA 3EZOA 2R7VA 4ED2A 3LALA 4YB5A 4RBVA 4CNYA 1L5UA 3C8YA 1OIAA 4AYBD 2F8EX 3MMBA 4DF8A 5IQQA 2HK2A 2VUGA 1HQEA 4FS2A 1U1QA 1H38A 3I56S 2G9OA 3CCTA 4ZCKA 1S48A 3LTOA 2UV8A 2GVZA 2ZKUA 1GEHA 3GJTB 4ZKAA 5BYSA 1HYSA 3DHWC 1K1SA 4U8VA 4B9NA 3M8WA 3BN4A 2ALYB 2DISA 4ZLNA 3RGIA 5A8RB 4JI5J 1S9FA 3PX4A 2HFVA 3M2VB 1HWKA 4K5RA 1SL0A 4PG8A 5K8PA 2O66A 4ZHRB 2UUWA 2HK3A 1KD1T 2J6SA 1LW2A 3EXYA 4DR7F 2VJUA 4Q0BA 1R0AB 4ES3A 3AD7C 1YI2S 4D3GA 1RTHA 2ZH7A 2EFPA 3KYLA 2ZVSA 1FFGB 3AODA 2XI2A 3T19A 5D0HA 2G13A 3HZGA 4JI8F 2HQIA 4JUZA 2D41A 1TL5A 4OZ1A 3KLHB 4FDFA 3X3UA 4OZ3A 5KFBA 3U7JA 3G9CA 4K4WA 3CDAA 4P2XA 1GFWB 3RB0A 1TQLA 2EFNA 2HVEA 4XPCA 3LA0A 2XMKA 1HARA 3HHNB 1M5PC 1DZ5A 3D3CJ 3ITHA 2UP1A 4NLVA 2V4JA 4JI6J 3PNIA 1OY8A 2UXDF 2XI3A 4NCGB 1S0OA 2Q79A 2GHVC 1B70B 2M7SA 3QATA 1S5ZA 4HYKA 3ENQA 4CO0A 2MZQA 2WW8A 4DL4A 5DM6Q 1XNQJ 2KM8C 3NGUA 2FIUA 1F60B 4WFBQ 4QOTA 3MR7A 5HROA 2XZWA 4IOBA 1WJ9A 1DRZA 1S1UA 2R2SA 3UD4P 3Q8QB 2NREA 1M0SA 3QGHA 1SB6A 4CYUA 1XMQJ 2FZCB 2X1AA 1HL6A 1U1LA 4J91A 3FSIA 2IAJA 1KFDA 2J7WA 2HBYB 1PO6A 5J1EA 2ZOFA 4ZIWA 4ED3A 4CLZA 3K89A 1IR2A 2H5EA 2BM0A 2XM3A 2V9KA 1N56A 5ETQA 1C0TB 2HZVA 3VF0B 2QLWA 5D15A 3GILA 4IR1A 3K17A 3KLEA 1DY3A 4DN9A 4LIWA 5I3QA 4ED4A 4MIBA 1RHJB 2F40A 3TVKA 4YB7A 2R9LA 3NBPB 2C2OB 1NH8A 2Z56B 1EQ0A 2VA2A 3G82B 1IKVA 5ADZA 4B9SA 1N5SA 4KPYA 2DCUB 2EBGA 1BD6A 3KXDA 4A48A 3MPYA 1HPZB 2DHXA 3A3OB 2ZH5A 1Y4ZB 1RT3A 3CJ0A 1UJ4A 1PBUA 5JJBA 1KFSA 1DJ0A 2VPYB 2XB2D 4WPAA 1CSJA 4ZJQA 3HVTA 3EGWB 1HBNA 3KLIA 3W60A 1Y9OA 2YKMA 2E5LJ 2EK6A 3QLHA 2GAGC 4M5JA 3CCZA 1HWLA 3NRBA 2C3PA 2J6TA 3CJ5A 1FI4A 3GIRA 3VR1A 3AOAA 1U24A 4ILLA 2B9YA 3KNGA 2DNYA 4NPOA 5E2QA 3HD1A 3ZZPA 1JMTA 2G0CA 3T9NA 3KDNA 2QFIA 4PUOA 2DHAA 1Y3KA 3GFXA 3C3LA 2G0IA 4EUVA 2KRBA 1BUXA 3R2CJ 1IN0A 2IA0A 1JKHB 1GMWD 3RUBL 1SIZA 4YB1P 2BABA 4TU8A 1X5PA 3HHLB 3TVYA 4DCPB 4O3SA 1NJIT 1P8GA 4ZVQB 2C2MB 4OI1A 1CQNA 2XMWA 4X66F 1EHWA 3OSNA 1Z1ZA 2HNDB 1D8YA 2BE2B 4UZBA 4BWJA 1T03A 4MJKA 4WFYA 4QIFA 4RWWA 3TUPA 3FBCA 2MKCA 4P75A 4Y34A 2YNFA 1YGYA 4L75A 3J81j 3G4SS 3CJQA 3I0SB 1SV5A 2Q6CA 3RAMA 3G8TA 3QJJA 1S57A 2O5DA 3OQ2A 5F8IA 4C8KA 4JYAF 4DFPA 5C2CA 2DNZA 2GIFA 1S76D 4PWDB 5DDOC 3ZZZA 4IFYB 2PMZD 1AFIA 1T3OA 2JLGA 2CYYA 2V8VA 2XY7A 2AYBA 2KN4A 4BBYA 4R8UA 3RW7A 3E3XA 1J5EJ 2J9CA 4FP9A 3RTVA 3MFIA 2IDEA 3H2UB 3ZZ0A 3D9BA 4C97A 1U1MA 4IH7A 4ID5B 4EO6A 1YJ9S 2D3OR 2H48B 5AE3A 1NAQA 5KFOA 3D1QA 1R89A 3MM6B 1JLFA 3MEGA 2RDDA 3HO1A 3K8VA 2QGFB 4F4KA 4Y2AA 2E7WA 2BUNA 2V8HA 4LF7F 1VHIA 4G1QA 4A47A 1RT4B 4O23A 1C1CA 3EPIA 4K59A 2YWGA 2CNLB 4X65J 3GR0A 3PCOB 4PG7A 1S4FA 2KFYA 2AEMA 5GAEI 3NG8A 3W2VB 3Q23A 3TAQA 1WF1A 4B3MJ 1U49A 3F0NA 1FHTA 2CFXA 4FXWA 2AEJA 3W9JA 4LF4F 5L9NA 3MR3A 3BS9A 1YJRA 1YK9A 4KO0B 1W26A 1WEZA 4ZDNA 1FWLA 4U6PA 3U27A 1KDNA 3DI6A 2G2ZA 4Z7CA 3PV8A 1EETB 2LEAA 3Q8VA 1H3DA 1F9FA 1JLQA 1MMNA 5L46A 4LF1A 2VPZB 2J0WA 1G3OA 3IM9A 2MQNA 4C48A 1IKXB 1HBOB 3KMSA 4OZNA 4WU2A 4F3MA 3J7YI 1GXLA 2MZJA 3D68A 5T14A 1ZM4A 2YVSA 3FC9A 1IJFB 2YNHA 2EC2A 1URRA 4B3OA 1O5JA 4DS5A 2I8EA 3ZZTA 3TEHB 1QSLA 3JSRA 3QGIA 4BHQA 4FBUA 5KFLA 2KYXA 5B0DA 2N3OA 3K2YA 2W4DA 3W7BA 4B17A 3W64A 2WSCC 1GXUA 4XDDA 1L3UA 3HFKA 3WQPA 2QL9B 4C8NA 1U6ZA 5I42A 1QSSA 2NXUA 3LUYA 2GVDA 2F7VA 4ZK7M 4EO8A 3DU5A 3MM5B 4KB7A 4DPWA 2IVFB 4ZLPA 4X62F 2OD4A 1LFWA 4DV3J 4DV0J 4Y6IA 3PW5A 2G2OA 1VQ5S 3PG9A 2Z58B 4UOGA 1Q5YA 1EB0A 2I2YA 1NSPA 4JI7F 2AJ1A 4YDXA 2CPZA 2OHDA 2DR5A 3BSOA 4B9UA 1RT1A 2FYXA 4DV1J 2DGSA 4U95A 2HNYA 4WYWA 3EPGA 2R7QA 3KUHA 1AT1B 5L1LA 4M5GA 1HNZJ 4Q44A 4F0MA 2APOA 4OHYA 4QYZK 2ZD1B 1VOMA 2CJ9A 1UFKA 2F3JA 4YB6A 2XSJA 3B54A 5D4PA 5K9FA 2AGOA 3DOLB 2LXIA 4DR2F 4IRDA 4JP8A 3Q2SC 2HHHF 2QX0A 3KG0A 5CA5A 2UU9F 5H9FK 1KP6A 4DV2F 1N5QA 4IH5A 1E6VA 2M52A 3BYRA 1B7YB 1IKWA 2BOAA 1RAIB 4UQGA 2NZCA 4ZPBA 4J9MA 1FK9A 3HHDA 2HBRB 3DLGA 2OEMA 3PIOQ 4NI2A 4G3IA 1YZ7A 5F8GA 3WZ0A 3MMCA 2HHXA 1ZPVA 3QO9A 1WWHA 2RRBA 3POTA 2IY5B 2ERRA 2D9OA 1M5HA 3O6QA 4CO2A 4K4XA 4QWCA 4NOHA 4QW9A 3M8YA 3HULA 4UW2A 4UTGA 2K8GA 2CKWA 4I64A 3PY8A 4PABA 2BW7A 3D1HA 3Q8PB 2QN6B 1VQ9S 3OV7A 1HWUA 4ED8A 1TK8A 3TI0A 2MKIA 4K8RA 3VAFA 3ENVA 4OZ5A 4FPRA 2H3EB 4JI0F 4AL5A 5J1PA 1VJQA 3CULA 3P8BB 4R25A 1PJ7A 1KC8T 2IJRA 2DNPA 4LFBJ 1ZZFA 2LCWA 4W98A 4IKAA 3A3NB 1H2UX 3GQCA 1M1GA 4DLGA 4WP9A 3HXMA 2XMVA 3M8PA 5A0YB 1XMBA 1Q79A 1UMJA 1WHXA 2D1CA 4V19J 3V81A 1FJ7A 4GKKJ 1LWXA 4WE1A 1UPMB 1N6QA 2GW8A 4I68A 5DZ6A 1VYAA 3AD8C 4DR1J 1FD8A 3JTNA 1HHQA 2K3KA 4LIRA 1YVFA 2M70A 1WACA 4OX7A 1YJ7A 5AXLA 3KKFA 2BJ3A 2KHCA 4IG0A 1HQUA 1RUSA 4M5LA 3NCQA 3SDEB 4DR4F 2VFRA 2AJ4A 4CLUA 2V5HG 3AXKA 2UVWA 3GIIA 3J7Z5 2FY1A 2ZDPA 5A8KA 3OLBA 3W5ZA 5ITHA 3WBZA 4OZ2A 1IBMF 5J2PB 1WG4A 1RP5A 3N6MA 4CDIA 4R5PB 4KFBA 2HQCA 3NKYA 4OZJA 5KT7A 2HRUA 3MMJA 4OI2A 4DUTA 2HVZA 2H5IB 3ENWA 2NXEA 4NLQA 2PMWA 4PCQA 1N32J 5F8LA 4TVAB 1RISA 3GG0A 1OSDA 3GYXB 2YH1A 5KFDA 4K50A 2EWHA 2DO4A 1OPIA 2DXDA 4DQSA 2WK4A 5HP1B 3IBWA 3BKFA 3Q89A 4GVBA 1FVSA 3U02A 2A6OA 2XHCA 2KHDA 1HBUA 4B3TJ 5GMEA 1Y10A 3PYEA 2ZE2A 2HS3A 2VASA 3TJAA 1FDNA 3AD9C 2VFTA 2ROEA 1RT2B 1S6PA 4Y2CA 2DYAA 4C0OC 2KRRA 1BY9A 3H7HB 4PXCA 1S9EA 3DXSX 1IBCB 4WCEQ 1TAQA 4X64J 1RADB 5I3UA 4F4XA 2C2KB 5KG0A 3R5GA 2C3YA 4UOCA 3TZYA 1FJGJ 2VHGA 4MKYA 2ZH6A 5DQGA 3DRYA 3KJVB 5KG2A 1TVRB 4AL6A 1VK3A 4NL5A 4FF1A 4TY8B 4LBPA 1RAEB 4MKVA 3AOBA 2QL7B 2WRMA 4MK9A 2KT5A 3ILLA 5IV4A 2MLXA 3MPWA 4HLBA 1S0NA 2UZAA 3BEGB 1NO8A 3EYZA 3UPFA 1D9DA 2F9DA 4ECZA 1VQ8S 1S97A 3KJQB 2OKQA 4H4KC 5J2NA 4HTIA 5GMKa 3AXMA 4ETZA 2RRAA 3DM2B 2DY9A 1OJ4A 4OYZA 5HLFB 3MFHA 5CYQA 4K4ZA 2IM1A 4WBFA 2FJEB 4ZVGA 5CYJA 2NPFA 3O5TB 1I94F 4J9KA 1CJKB 4ICLB 4V1Ak 3M2UB 1UVMA 4P9SA 3UDLA 3QMQA 1RBOB 3NOGA 2I5JB 3BSNA 3M1VB 2CJBA 4F25A 5J2QA 4DSIA 4K4TA 1TZ0A 3TJ9A 1H6KX 4PQUB 1VQNS 1NPKA 1DLOA 2LMIA 3FZBA 2N4DA 5BYQA 3G6YA 4H4MA 4OHVA 2MLZA 1R6VA 2BACA 4BWMA 1JJ2R 3BM7A 2QA1A 2ZZNA 1QDUB 3M30A 2MKHA 4ECVA 2MHNA 4RUHA 2W9AA 3AQPA 3DNCA 2AT1B 4DQPA 1IQZA 1RKIA 3DRRB 1HQEB 2DPIA 4PQAA 2BBEA 3ZTQA 4I2QA 3MUMP 4HR2A 3MTKA 2FJDB 2GGPA 3LH2S 4DV4F 3CD5A 3S7RA 2QMXA 2MYFA 1RT5A 2GVZB 1FRIA 4FVCA 4HDGA 2XLKA 3TO8A 3TR5A 1HYSB 1OS5A 5LMUJ 3C46A 3GIKA 3HJVA 4YHHJ 1RLDA 1B3TA 3UO0A 2MQ8A 1S1TB 7AT1B 3QWPA 2LDYA 2DH8A 4LFAJ 4G1IA 2ZNYA 3I5BA 2XNRA 2V2QA 1QAIA 1CJTA 4Q0BB 3CJRA 2XS5A 1RTHB 5D4OA 4NX9A 4CLLA 4HTJA 3MUTP 1T9XA 2GJIA 1HQ2A 2L41A 3FCVA 2GO8A 2V9WA 2HVHA 4UUWA 3DCAA 4AQYJ 1I51B 2UVRA 4ZVUB 4ELUA 4USMA 2DHSA 4QBUA 3RB4A 4I69A 2R8IA 1AFJA 4XK8C 4DF4A 3ISZA 3ITHB 4ZA1A 1VISA 2V4JB 4F3OA 1TELA 5JVHQ 2U2FA 3T1HF 3CCUS 1Q16B 4A8QA 2GMHA 4YMEA 4ZVPB 3DHXA 2J8SA 3BH7B 1XC9A 2CADA 2HRYA 2HGMA 1TL4A 5B09A 3PHEA 1RACB 3FQLA 3OJSA 1C1BA 3MTJA 1L3KA 4ED0A 4G65A 5C7PA 1RYRA 5HROB 5HBMB 4ILRA 3QIDA 3GJQB 5IC4B 2RDIA 3MCSA 3W2WB 1GQEA 2M5YA 1UTAA 2YWFA 1S1UB 2CJKA 2RQCA 3ZXWA 4F2RA 4L3KA 4YS2A 1NM2A 1SC4B 2D7SA 5C25A 1H98A 4FZVA 2AX0A 2IAJB 2MLYA 3MR5A 4OJHA 3MUVP 3W5XA 1FTCA 1OO0B 5J1EB 3MAHA 3D7SB 3TJ8A 1T05A 4X4TA 2B7CB 2HEKA 3R7NB 1JWWA 3IFEA 2VFVA 2KTQA 1K9MT 4Q8EA 1NKEA 3HP6A 4KT0C 2BZ2A 1S9GA 1MMDA 1R8CA 4OYOA 3RR8A 1S4EA 5KFIA 2R7SA 1WHYA 3N6LA 1D9AA 2XG8A 3CJ3A 3BGFA 4LF8J 2AMCB 1O6XA 2F4VJ 2ADCA 3T1YJ 3D28A 3PKMA 3HSDA 3IS9B 1NHUA 4KRWA 2JEFA 1UL3A 4EK2A 2DK2A 3C15A 3ZZUA 4XIUA 3GV8B 1FJCA 5H1SV 1MWYA 4WIQA 4OJGA 4OL8A 2EI5A 1IR1A 4AE5A 3OSPA 1SKSA 1EARA 5ETTA 2DKOB 1FE4A 4DR3J 1RT3B 4ZVFA 2VKRA 1QD1A 1RTDA 3KDOA 2ASYA 3HVTB 2BEFA 1NJXA 1HBNB 1RT6B 1X4HA 4JI3F 5F3ZA 3RRHA 5E7OB 4M95A 5BYRA 4MK8A 5CH7B 3VAGA 3SCLE 1WD6A 3THVA 3FGVA 2JEIA 1T0TV 4CWBA 2KFNA 3DN9A 3PR4A 2HFUA 5CD4A 1P9YA 3NOCA 1N88A 4NLYA 4ECQA 2J6UA 2DNNA 3P5BP 3EE3A 1DFDA 4DFJA 5H9EK 4OHWA 5HQLA 3UDCA 4O0IA 2CQ0A 1WC3A 3AH6A 1CLFA 4NLTA 3NGTA 3ONQA 5IS2A 4WFXA 2Z8QA 3UNYA 3VQSA 5GMDA 3P45B 1U2FA 3UE2A 2RSQA 2ZWPA 5G0RA 2GS8A 4K4SA 2UUAF 2XO6A 1NMEB 3RB3A 1MROB 5KFJA 2JDJA 4L76A 3UN5A 3WIUA 3B4DA 4P6QA 3H4BA 2AKWB 4QIWD 1T03B 4R0JA 3DGPA 4QCLA 1VRTA 5KFYA 3LWMA 3BR9A 1VQYA 3G6XA 3NGDA 2NSBA 2Y9HA 1L3SA 2FLPA 5J2MA 2ATLA 3GR1A 2HNZA 1SV5B 5BR8J 1NBEB 1JNZB 4DR6F 3UN2A 1H72C 3D66A 3W5YA 2HHSA 3EICA 3GSIA 1U1NA 2W24A 4FYWB 1M90T 4A8YA 2W7OA 2OPSA 4W92B 4KYZA 3GJSB 2W9BA 2OFHX 3QYYA 4LF5J 2B6AA 4G1PA 3LANA 4CLFA 4DMZA 4R8UB 1Y5NB 3CE8A 1JLAA 3KG4A 3WX8A 4P10A 3SEOA 1TL3A 2NS1B 2CQ1A 1VBYA 4OX9F 4I7FA 3THPA 1DQ8A 1S1VA 2J7UA 2HVDA 1FX2A 2XYPB 4KHPJ 2OEKA 1IBKF 4ZPTR 2BJ1A 4CT9A 1Z4UA 3PX6A 3MM9A 2KL8A 5SZTA 3QAUA 2GMLA 1UCNA 5D4NA 5HATA 1NH7A 2RHSB 1UPPA 4G1QB 2H5JB 4X4OA 2HGLA 1C1CB 1JJCB 1JLCA 1RTJA 2PT0A 5ETOA 3UW1A 3P5TL 2QEXS 2CQIA 1N34J 3NCRA 4FN5A 5E3RA 1UJ6A 1RHRB 1RU1A 3M05A 1DHMA 4KV8B 1H7XA 2V8DA 1W7WA 4IG3A 3DI6B 1ZTTA 3QT6A 4ZPVR 3ZZOA 1JLQB 1ZAXA 4Q43A 4QQBA 2DT9A 2GIRA 3N5FA 1GH8A 4UF4A 4E2FB 1IR0A 2AYMA 2KG1A 1T9WA 1SIWB 1IUJA 1MWQA 3Q83A 1A0OB 4DSLA 2QV6A 4JV1A 2UUBF 1DQ9A 3EMTA 2WVEA 5IM0A 3TX0A 1R8HA 3HFZB 2YNHB 5KT5A 2M2BA 5LM7E 3DDIA 5GAHI 2B7BB 4RNOA 4B3OB 1EAYC 2RAQA 2DRAA 4ZVHA 2HIYA 3E8OA 4NLOA 1N36J 4JOUA 4U96A 1SJ3P 1HI0P 1CC7A 2DHHA 5HI7A 2FLOA 2JWNA 1T94A 4QPXA 3OVSA 3I32A 5SUHA 3OL9A 2B9XA 2ZH2A 3G87A 5IWAJ 1X4AA 1EZZB 4UY85 1GK8A 3FRZA 1L3TA 5EWEA 5AXKA 1Q8KA 1RTIA 4XDCA 5F41A 1WNEA 1JLEB 5C5JA 1ZM9A 4O0NA 2RKIB 3Q0AA 1S0MA 3SQOP 1HNIB 3OTEA 2DR9A 5EX0A 1SUQA 3CIZA 3MXHP 3OPKA 1YX2A 4EU0A 1HMVA 1RT1B 3WX4A 3SSQA 3CCSS 3FCHA 3MURP 2DJWA 3JTPA 1JB0C 1V6HA 5KFPA 1YJVA 1K73T 4A8MP 2WSFC 2A0FB 4PR6A 2IBOA 4NLGA 4LBIA 2WCXA 2IA6A 1H74A 3B78A 1LWCA 3IBFB 3DLEA 2XSJB 4YR0A 5CAAA 2XEXA 2HQ3A 2KO1A 1G6BA 3JSMA 5ETKA 2ZH1A 4GO7X 3M32A 2R2TA 5KFNA 4EBDA 1IKWB 4NA3A 3K5LA 2AJFE 1FK9B 1VRQC 3CJSA 1JXVA 1VBZA 4NI2B 1TK0A 2FVPA 5B08A 3ZTSA 4CP5A 3MMCB 2EBEA 4XTTA 5B0FA 4X4NA 4NMLA 6AT1B 1XERA 1APSA 3POTB 2ZJPQ 2CZ9A 3J7YU 1UFLA 3NGKA 1NJZA 2GFFA 2VJVA 4IFVB 2CRLA 3B6BA 5ETVA 5KG7A 4DHVA 2MY8A 5KTQA 3UQSA 4ECRA 4K2XA 1I3OB 4WJBA 3IP0A 3SQGA 4RL1A 3EM1A 1NU4A 1REGX 2DEIA 4QPTA 1H73A 4CLPA 3BQ0A 4J5OA 4LF7J 3BSAA 4O3QA 3H40A 4ELTA 2MQOA 1RAOA 4CLTA 4TYBA 2YKOA 3SFGA 3DXBA 4HHJA 1X9SA 1Q7LB 2CZVC 2UVVA 4RW4B 1X5OA 2RT3A 1JLBA 3IRXA 3M8PB 4L6V3 3LWLA 4G6VB 3AFGA 3S1TA 2J5AA 5IOLA 4KIAA 1IKYA 4H4OA 3CJKB 3RR7A 1RWKB 3PW4A 3JB9k 4RR5A 1J2VA 2V0NA 4DFKA 1N6QB 3SV4A 1CJVA 1KONA 2OAUA 3HX9A 5KFCA 3BYPA 2E66A 3I6PA 4DUZJ 3GYNA 2CDRB 1H0HB 5MAOA 1CQMA 3FSXA 1WEXA 3Q22A 1SL1A 1I5OB 2AIRB 2R2UA 4NLRA 2LYVA 1J5OA 4MFBB 3CCES 4IG0B 3F41A 2FTRA 4K2JA 3TQ1A 2V8PA 1FXDA 1K1QA 3H42A 3R97A 1S6QA 1JLGA 2VQFJ 4NZ0A 2EG1A 1QVFR 4RW9A 4LSZB 2R8JA 3PYGA 3T6JA 3KHRA 2I38A 2ZJRQ 3Q8SB 1KEKA 2RF2A 4PG6A 2EKYA 3ZNUA 2CG4A 4C8MA 1XMOJ 1KQSR 5A8KB 3GCXP 1LK5A 2QLXA 3RU0A 4PXEA 1C0UA 3CCLS 2PD1A 3VQTA 3FUYA 5RUBA 4KFBB 4QIEA 1H7WA 4DUYJ 1GMWA 3IG1A 2W9CA 1HWJA 1NJWA 3N0VA 2WVBA 3DOMB 3BJYA 4NYZA 3SFUA 1JQGA 5HVHA 1KWMA 3Q8RB 1SJRA 2LXUA 3OHAA 1IBLJ 3IMQJ 1PYSB 4L73A 4HI2A 1U8SA 1N5VA 2ACMA 1AB8A 1S10A 3CMES 4QIGA 4ZMMA 2H4WB 4BC7A 4C4WA 4GVBB 2J76E 3MAAA 1OWXA 1HBUB 4CH7A 1RDRA 3SV3A 1E6YB 2ZE2B 2J0SD 2JVRA 4K4UA 2C2NA 3DRPA 1HFEL 3KG1A 3SBMA 3GIMA 1RLCL 3V6DA 1WG5A 4BCAA 3BREA 2GZOA 1C2PA 4QW8A 4RPFA 1RAHB 4KHRA 1UW4A 1S79A 1RAAB 3TNVA 2MJNA 5T7LB 2BYCA 2IFXA 3M8RA 2IC3A 3TUJC 3FRYA 2XY6A 3RG6A 5I3UB 4J9PA 3DRSA 4O3NA 2NYHA 1D9FA 2LP4A 1KHVA 3MECB 2L9DA 1WDDA 1D09B 3MCNA 1RJJA 4JI6F 4URGA 3K5MA 4DL6A 2Z57B 2ZUGA 2FGOA 1LXNA 1RCOB 2Q6BA 2ASJA 4JI4J 2BKNA 1PGZA 1XNQF 4F0HA 1QTMA 2X3GA 3HMJG 3HVWA 1SC1B 1TTHB 1UEUA 4C11B 1X7VA 3KJFB 5J2NB 4DPYA 2IRYA 3LQVA 2P6SA 4RNHA 4DDFA 4A4JA 4TLRA 3TOQA 3FBBA 3NNCA 1SH0A 1RZMA 1DTQA 2R8GA 1XMQF 3R2DJ 5CYQB 3KLGA 3UN3A 4QR2A 2I9SA 2MPUA 4RKUC 2RILA 2WHOA 2ZBQA 1UVIA 3MEDB 1S59A 3T5LA 3A8IA 3HVAA 2OPPA 1WHVA 3BKUA 3MM8A 5EUHA 1D3WA 1F5BA 1FKAF 3ILJA 4L3NA 2BANB 2QJ3A 3P3DA 5FDLA 4X4PA 4LSLA 1HWIA 2KT2A 1GTEA 2SXLA 5J2QB 3BGRA 1TR0A 1HI1A 1DLOB 1QM9A 1VJWA 3SCIE 3BDEA 1U6BA 5FD1A 1UJ5A 1UAWA 4N56A 4MAKA 3DLJA 4U7UD 1WEYA 1NSAA 4OX6A 3TARA 4M94A 1X0PA 3LAMA 2XMMA 2MQLA 3M30B 2QA4G 4TKTA 5CCMA 3OR2A 1ITPA 2RUGA 1YWXA 2H1YA 2U1AA 3ET6B 3NP5A 1CEZA 2GGPB 2P2CB 2AU0A 3SCKE 3RBXA 2MEWA 3BR8A 4ZOSA 2R2RA 4NXMF 3DMJA 2E5LF 5LT5A 2UXCJ 1P1TA 3VZIA 2MQQA 3CCWA 2QYGA 4V19X 2UUCJ 3F56A 1RWNB 2CJQA 3MM7A 5KFMA 4ZCIA 2BM1A 3MAQA 2FUG9 1B99A 1TUGB 4C8YA 4O44A 1U1OA 3C19A 4GRSA 4P52A 1NUEA 4LVOP 5KFXA 2LLZA 3HVRA 2ZZMA 1VQMS 4CLSA 3D67A 5IT4A 1WC5A 3BKTA 1NKBA 1P27B 2Y1IA 5EGYA 1ZAWA 1CJTB 2NR0A 5EHHA 4P7TA 2OPRB 1QAYA 5KFHA 2X51A 3AA8A 4HVZA 3DFEA 1CVJA 1NSKL 3K59A 2CPXA 3KHHA 1LV5A 3HI9A 2KXNB 1YRTA 4OX8A 5HMXA 2XULA 4RUAA 5JVGQ 2HW3A 3NGRA 2X1FA 3IC1A 2GQCA 2IYIA 2BDPA 1RABB 2DHGA 4NYPA 1FFSB 4LREA 3PDNA 1WUUA 2XWYA 2OELA 2FJVA 5IC6B 1XWLA 4FYVB 4ECUA 1C1BB 2GHPA 1ZBTA 3IWLA 1V3RA 3GFZA 1TAUA 5DGBA 1LEOA 1BGXT 3H5XA 2EEYA 3OLAA 3QT8A 4OZLA 3LPEA 4NCGA 2ZVIA 2XY5A 5FIIA 2CQBA 2F5GA 4TQRA 1XNRF 4KE5A 3H5UA 3MI7X 1F2GA 3AQOA 4DQIA 2P8IA 5C25B 3R1HA 1MNEA 4I2PA 2CPJA 4OYBA 3M8SA 2RQMA 1J5EF 5EN1A 3RBEA 4URSA 1KNZA 4FNIA 1MN9A 2AW0A 4RO0A 2IDLA 5JUMA 3M8QB 3CB4A 3I31A 4EZ6A 5D3GA 2QE5A 1B64A 3C16A 3MD3A 4I1TA 2FC9A 3FEYB 2CNOB 2D69A 2FD2A 1LXJA 2OGUA 3F73A 2RB7A 1S9GB 3CO0P 3GTYX 2CJXB 3R5CA 1F3FA 1I94J 2HWTA 1GX6A 4X65F 2D3O1 2DGOA 5ETRA 2G2YA 3C14B 2J9DA 3ETOA 3IXQA 4RW7B 5CD4H 4DU7A 3C15B 4CZCA 4A46A 3RZAA 5HANA 2CQPA 4B3MF 2ZM6J 3G96A 4DU8A 1X31C 2FY8A 4OMFG 4DL2A 3A13A 3V2UC 3L7OA 3OXGA 5F8HA 1X9MA 7FDRA 1RTDB 2MZTA 4LR9A 2VOOA 1ZPWX 2W2OP 3G82A 3A8JA 2HQDA 3JTOA 5DDQC 3JAMY 3EVOA 4KGVB 4BDPA 4EBCA 2VODA 3ILIA 4K0KJ 1QAXA 2AJ0A 3W1YC 4OI6A 1DBDA 1SVDA 3QIPA 4ES1A 1U0SA 2IYGA 3OT9A 1R3NA 5DM7Q 3JSBA 2FC8A 4JV0A 2AZ1A 2AHOB 5F9LA 1LW0A 2AP6A 4Q7AA 4L72B 1PYOB 1CPZA 2VBXA 4DV7J 2HFOA 4TN2A 4KGKA 3FJ2A 1S1WA 3HKWA 2HHQA 2E1RA 1OQ6A 2DNMA 1FDBA 5G0RB 5D6GA 5K8MA 2YWWA 3MPVA 1SXLA 2EXUA 4P2MA 4Y2IA 1LWEA 2F8MA 2HSEB 3I4PA 3FKBA 4DV3F 2V68A 1RHMB 4DV0F 1R0BG 3KOAA 1RBLA 1U0HA 4WZMA 2YH0A 1Q0NA 1TU0B 3LO3A 2W2NP 4OYAA 3PO5A 2HHTA 1NZAA 2W2MP 4YY3J 3D6FB 2ZOMA 3ISNC 3HDSA 5J2MB 2MHEA 2HNZB 2HWIA 3CMQA 4DV1F 3FK4A 3CDWA 2VV5A 2DNLA 2VDHA 2HNDA 2O1PA 2BE2A 1SC3B 2F65A 4LJMA 4F2SA 4USVA 1U26A 2QC3A 4FVMA 4C6AA 2OPSB 3QRQA 2A2DA 3KMQA 2XYHB 2W9BB 3FBEA 2RVJA 2BKOA 3NEKA 3OTDA 2B6AB 3TEGA 4E98A 3T6BA 4ZVOB 1TKZB 2NPIA 1JLAB 2E9RX 5LXYA 2JC1A 3GYGA 1NKCA 4JV5J 1R8PA 4I7FB 2M0GB 1CS4A 1S1VB 4RNMA 3C6TB 5AE1A 3JQMA 3VTIA 1SJFA 3TANA 2JLEA 2RU3A 1T9UA 5A8WB 3F44A 2MQMA 2NZ4A 2KYZA 1QUVA 2WBRA 3MM9B 4IQMA 4DL5A 2QFJA 4RW6A 1NHVA 4DS4A 4DJBA 9ATCB 4ZP7A 1HBMB 1SJ1A 3JXOA 3WDOA 3HD2A 1JLCB 4D3HA 5AXNA 3V4IA 1S6UA 3OHBA 1RTJB 3NS6A 3QNWB 1R0CB 1WKJA 4DL0C 1YITS 4M5DA 4Y2MA 2HFSA 2ZH9A 2ROGA 1RWMB 1Z2LA 3M7VA 4NLWA 4PYAA 2W2PP 3ZZYA 3KHLA 4IO9Q 2E1PA 1GAOA 2LU2A 3PYFA 2XGQA 1FERA 3KK1A 1TKXA 4QR0A 4Q2LA 3BDPA 1FRJA 3MGJA 2XMUA 3LP0A 2XZDB 1CBKA 2DGTA 1JX4A 4IG3B 1K8AT 1WOPA 4LFBF 3IR5B 2Y8WA 2BMBA 1Y7PA 8AT1B 4PG4A 1Q5VA 4AUKA 3C2PA 3A3PB 3QT5A 2XQCA 2F4FA 3KK3B 3KHGA 1WC6A 5LJ5Y 4EBEA 4N8OA 4GKKF 2VH7A 5DJBA 1MU2A 1VR6A 5EX3A 2QSWA 1NDCA 2DR7A 5IM0B 2BOPA 3MOJB 5IT9Y 2A3JA 1QE1A 1NK7A 3MWBA 4DWIA 5M2UA 4N8NA 5AT1B 3KUEA 4TXSA 1XTZA 2YPYA 1R8BA 2V69A 4U67Q 3R7SB 2FPHX 5IQ6A 2XYGB 3H0PA 3QJPA 4Z2XA 3TAPA 4MH8A 1YG0A 5KFEA 1G2EA 1AYEA 4I67A 2P9EA 3H90A 1YHQS 2YNGA 3NS7B 4Y0FA 1U47A 5A2QY 3IN5A 4J9VA 1X4EA 3ENAA 3TA1A 5BXIA 4DV5J 1X5TA 1V3SA 2BW2A 3K58A 1KBRA 3MM5A 1UKUA 1VLOA 1YBAA 2DH9A 5KFKA 3LAKA 2G1HA 5ETMA 1ZM3A 2HURA 2KJVA 4WU3A 1SKWA 1KS2A 1HNXJ 3W62A 4MIAA 3M2RB 1N32F 3CCMS 1V5IB 4MKBA 4E0DA 2RU9A 2HZAA 1BQNA 3UDEA 3KLFA 1K0TA 1LWCB 2FHJD 3MEEB 4LR7A 3R8YA 1B0TA 5KOXA 4Y28C 3JSMB 4B3TF 2LQJA 4EEYA 1FKOA 2VC0A 2NCKL 4LR8A 2H65B 4CRJA 4LRFA 5DDRC 4F04B 4C3LA 3H98A 4P7VA 4WKRA 2KU7A 3DYAA 4F4AA 1REVA 4M5NA 2LVWA 1KSPA 3OR1B 2CNNB 4YR2A 2ZHBA 4B3RJ 2BV3A 2HPUA 2LDIA 2V8GA 3OL7A 3CNQP 3N4WA 1LWFA 1FJGF 2PA8D 3G8QA 1T95A 3CJ4A 1BE4A 5GAHU 1KLMA 3LPYA 1Q8BA 5DQHA 1HNWF 3NWRA 4LF9J 4ITSA 2GC8A 3GV7B 2KH9A 3ZZRA 2JHEA 2FLLA 3HSGA 3SQGB 5CCLA 4HACB 1GMVA 2E7VA 4KGMA 1SKUB 4N77A 3EZ5A 1Y5LB 4HHHA 1Y0HA 3T41A 4BS2A 2EW9A 1W2BR 2YWEA 3D4JA 1JLBB 3IRXB 1JK9B 1B0PA 1QVGR 4LF6F 2VQEJ 2QIFA 1WI6A 4KGZB 1IKYB 4H4OB 4NCBA 2DY1A 2BQUA 3QAEA 4FKYA 1X8DA 2N82B 2OP5A 2H4YB 4A8XA 3PJWA 2UV8G 2AGPA 2E5GA 3PRDA 5IFMA 2DGQA 2ZBRA 3M6XA 3NGSA 4KQZA 3OL6A 2OUGA 3H4DA 1T9VA 4OJ3A 1KOHA 3Q2TC 2JNJA 1RK8A 3JAMU 2RS2A 3MOZA 4TU7A 2DNGA 4CQ1A 1MLAA 1DTTB 4AXIA 2IPOB 4K4VA 5GADI 5E3PA 4IRKA 3C66A 2EKNA 4WP3A 5L38A 1S6QB 3JQJA 3PW2A 1JLGB 4WTOB 4JI2F 3J81Y 3IGVA
chains in the Genus database with same CATH topology
2R7TA 4HT7A 1TL1B 2V8DA 4RW9B 3HT3A 2A1BA 2LKZA 3CXCR 4DV7F 1U1LA 3S6EA 3FSIA 4C9DA 2IAJA 2EC0A 4IG3A 3DI6B 4KC5A 1KFDA 2J7WA 2GJ2A 1PO6A 2Q66A 2L9NA 1ZM2A 2RF2B 5J1EA 7FD1A 5AE2A 2ZOFA 1ZTTA 3CC2S 2DH7A 4ZPVR 4CTAA 1A7GE 4HEA9 4ED3A 3ZZOA 1JLQB 1ZAXA 4Q43A 4QQBA 4XPEA 3TA2A 4ZP9A 3DC2A 2DT9A 4XAKA 2H5EA 2BM0A 2OSRA 2GIRA 1N52B 3N5FA 1GH8A 4F26A 2V9KA 4GMKA 3DOKB 1N56A 4WK3A 1L3VA 1KN6A 3H8YA 1IR0A 2V94A 2AYMA 2KG1A 5HMWA 3J80Y 1KVIA 3SDEA 3CT9A 1C0TB 3VAHA 1GNKA 2L48A 1SIWB 1IUJA 4U7CA 2GA7A 4OLPA 2ZBCA 3VF0B 5E3CA 1N0UA 2QLWA 1O51A 2Z0GA 4PWUA 4LT6A 4DSLA 2QV6A 3GILA 3PX0A 2FHJA 4IR1A 5KT2A 4JV1A 4HH0A 3BO3A 2W9CB 2UUBF 2KG0A 1DQ9A 2E1CA 2OPRA 5IM0A 3KLEA 4DN9A 4FYDA 2ASDA 4LIWA 4ED7A 5FJ4A 2PI4A 5I3QA 4MIBA 3FNNA 4K5SA 2D9PA 1R8HA 3OTCA 2YNHB 5KT5A 2M2BA 2F40A 3TVKA 2ILYA 4Z37A 5GAHI 3UD3P 1U4BA 1B7FA 4YB7A 3R27A 2OJ3A 2B7BB 4IDKA 4RNOA 1QLNA 2R9LA 4B3OB 1VRUA 2LXFA 1XR6A 3NBPB 2E5IA 4N47A 2DRAA 1NH8A 1Q78A 1TV6B 2QMWA 3PFOA 4ZVHA 2E5JA 4YY3F 3E8OA 4NLOA 2ACYA 4JOUA 3AY0A 2VA2A 4HT5A 4YHHF 1IKVA 2B43A 2MGZB 2LECA 2DITA 4B08A 4B02A 5KAKA 4MMOA 1SJ3P 1HI0P 1CC7A 3G71S 5JXSA 5L1IA 4ES2A 1S49A 5ADZA 2CPDA 4B9SA 1MWZA 1N5SA 5HI7A 2FLOA 2JWNA 1T94A 4KPYA 4QPXA 3OVSA 1YTYA 3I32A 2DCUB 2EBGA 2IJFA 3K5PA 5SUHA 1BD6A 3OL9A 4A48A 2OTJS 4K4YA 2V4QA 5CHCB 3MPYA 1HPZB 2DHXA 1FKPB 2ZH5A 2B9XA 1Y4ZB 4LFAF 2ZH2A 3UCZP 2XWXA 2MY7A 1RT3A 1X4AA 4QIVA 3V6HA 2C2DA 2VBWA 3BZQA 1EP4A 1UJ4A 3CJ0A 4CIOA 3D5MA 2YKAA 4UY85 5JJBA 1KFSA 1DJ0A 2VPYB 2DIVA 3FRZA 1L3TA 2XB2D 2PC6A 5AXKA 5EWEA 5IT0A 1CSJA 6FD1A 3PIPQ 1RTIA 4XDCA 5F41A 5LSRA 2OMLA 2HIQA 2M8DB 3DDNA 1WNEA 2KXHA 3HVTA 3BO4A 3V6DB 3WC2A 3EGWB 3S01A 1HBNA 1Q81T 4ECSA 3KLIA 1JLEB 5C5JA 3CPWR 1ZM9A 2FHMA 2LQ9A 2O01C 2L3MA 1Y9OA 2YKMA 2RKIB 4X4RA 2EK6A 3T5JA 3R5DA 3Q0AA 1S0MA 4AQYF 1YIJS 1LQ9A 3QLHA 4H4MB 4WFNQ 1HNIB 3OTEA 1S1XB 2IC3B 4EFAC 5M2RA 2DR9A 3CCZA 1HWLA 4JV5F 2A18A 2NUUG 5EX0A 1SUQA 3CIZA 3P49B 3DRSB 3CMAS 3NRBA 2C3PA 2J6TA 2YX4A 3MXHP 3OPKA 4EU0A 3ISND 3CJ5A 3SYZA 2OSQA 1X4BA 1HMVA 1RT1B 3WX4A 3VR1A 2YWKA 3SSQA 3CCSS 3IWNC 1U24A 3FCHA 4ILLA 3MURP 4NLSA 3T3FA 4FF4A 1XK8A 2B9YA 3KNGA 2DNYA 4NPOA 5E2QA 4J9OA 2DJWA 2N7YA 3JTPA 2QRRA 3CVKA 3ZZPA 1JMTA 2G0CA 1QJHA 3T9NA 1BC6A 1JB0C 1V6HA 4PUOA 2HHPA 3LP1B 5KFPA 1YJVA 1K73T 3I55S 2DHAA 4NRTA 4M1KA 2WSFC 1Y3KA 3GFXA 4A8MP 3C3LA 1BLUA 4F50A 1O8BA 4I2QB 4EUVA 3CUNA 3V6KA 2GMJA 2D3ZA 4PR6A 3R5AA 2KRBA 2IBOA 4NLGA 4NCAA 2MSTA 2KJWA 2WCXA 4ALZA 2IA6A 2WB1D 2P6TA 1S99A 1RT5B 3PW0A 1IN0A 1R27B 3RYLA 3B78A 3FZ2A 1LWCA 2B56A 2IA0A 3DLEA 2XO7A 1CC8A 2XSJB 4YR0A 1JKHB 2CVEA 2M3DA 3CC4S 4RW8A 2XEXA 3M8QA 2HQ3A 1SIZA 2KO1A 3VAIA 2ZDOA 4YB1P 1G6BA 3KJVA 3BB5A 3JSMA 2ZH1A 2BABA 4TU8A 1X5PA 3TUIC 2HAIA 3HHLB 4GO7X 5GVQA 3TVYA 4RNNA 3M32A 2AQ4A 5C42B 2R2TA 4O3SA 1NJIT 2PFFB 1P8GA 3HHLC 5KFNA 4EBDA 3I96A 5F8MA 1IKWB 4NA3A 4OI1A 1CQNA 2XMWA 4J37A 5KFUA 4X66F 2X1GA 3K5LA 3OSNA 1Z1ZA 2AJFE 3EX7B 1Q7YT 4ZPAA 4OZ0A 2HNDB 4UUXA 1RT7A 1D8YA 2BE2B 1FK9B 3E2EA 1XR7A 1HNVB 1VBZA 2GCFA 3TAMA 1VC5A 2Q1LA 1TK0A 5BJRA 2CJAA 4BWJA 2FVPA 4KKOB 5B08A 1T03A 3KLVA 4MJKA 3MMCB 4WFYA 2EBEA 5KFAA 1XN9A 2R7XA 4QIFA 5CQGA 5B0FA 1YRXA 2A2CA 4NMLA 1XERA 4RWWA 3WC0A 5M2PA 4X4NA 1APSA 4ERDA 3GZ7A 3POTB 2ZJPQ 2MKCA 4TYAA 3CCJS 3J7YU 4Y34A 2YNFA 1YGYA 3OTBA 1FRLA 1UFLA 3NGKA 4H4KA 1NJZA 2DGUA 2PSZA 1S77D 4PXBA 3G4SS 5A8RA 4RW7A 2GFFA 4QWEA 3M2VA 3I0SB 1SV5A 2V4RA 1LFPA 2Q6CA 1RWUA 3MM8B 3LF0A 3RAMA 3G8TA 4IFVB 2DNRA 1FESA 1W2IA 2O5DA 3QJJA 3OQ2A 4O4GB 2CRLA 4CI0B 2X1BA 2COLA 4TLQA 4ZHRA 5F8IA 2NYIA 4C8KA 5KG7A 2M88A 4JYAF 4DHVA 5FDLB 1FRKA 1IQTA 2MY8A 5KTQA 3PEHA 4HH1A 3UQSA 4IO1A 4ECRA 4DFPA 3OXLA 4LMZA 1QY7A 2DNZA 3H5SA 4K2XA 2B4VA 2CQ4A 4WJBA 2RMLA 2VFSA 3HLUA 4CO1A 1R0AA 4ZVEA 2O67A 2Q3PA 1S76D 4PWDB 5DDOC 3SQGA 3ZZZA 4AL7A 1FNXH 2DPJA 4IFYB 2DTJA 4RBUA 1NU4A 2PMZD 1W25A 1AFIA 1FD2A 1T3OA 2JLGA 2CYYA 3L09A 1JJHA 2V8VA 4QPTA 2XY7A 2FGCA 4IYQA 3AHPA 3BQ0A 4J5OA 2RIJA 4LF8F 3BSAA 2KN4A 2B4OA 4O3QA 3H40A 2AYBA 2CPYA 4BBYA 2MZ1A 4X4QA 1Y3JA 3TVZA 3T1YF 4R8UA 3DLLQ 4ELTA 2E44A 1HD0A 4ZPCA 3E3XA 3RW7A 4C3KA 3CGIA 4HDHA 5EWGA 2MQOA 4Y3CA 1SJ4P 2Z4PA 3KLHA 2J8AA 2J9CA 3HPOA 2LQBA 4OFZA 5J1NA 4TYBA 4FP9A 3RTVA 2NUHA 2VG7B 3I4HX 3MFIA 2YKOA 3H2UB 3SFGA 3M1VA 3DXBA 4HHJA 4AXJA 2E9TA 3ZZ0A 1Q7LB 2CZVC 2F9JA 1X9SA 4RW4B 2UVVA 3MDFA 1X5OA 4ELVA 4C97A 4QU7A 5EWFA 2RT3A 1U1MA 1JLBA 3C6UA 3IRXA 3IAS9 3N5BA 3M8PB 4ID5B 4IH7A 4EZ9A 1X4DA 4EO6A 3FFIB 3PXGa 1YJ9S 4L6V3 3NLCA 4DR3F 3LWLA 2D3OR 2Z2LA 3CDBA 3OR2B 4I6YA 4G6VB 4WKYA 3S1TA 5AE3A 2J5AA 1NJYA 1NAQA 3GFYA 4KIAA 1IKYA 4H4OA 4RX6A 3CJKB 4WF9Q 3HHLD 5KFOA 3RR7A 3GV5B 2NSCA 4RNFA 3PW4A 2WOMA 3JB9k 1N8RT 3D1QA 1R89A 3MM6B 1JLFA 1J2VA 2YKNB 3HKZD 2GHWA 2V0NA 3E01A 3MEGA 4DFKA 2FVSA 3HO1A 2OFGX 2HYIB 2B0GA 1ZOTA 3K8VA 3TYTA 1WG1A 3UR3C 1N6QB 2E29A 3SV4A 4Y2AA 4F4KA 4F4WA 1VI7A 2E7WA 2BUNA 3DMJB 2V8HA 4LF7F 4ZPDA 2PN6A 1KONA 1DURA 4G1QA 2OAUA 3HX9A 2HLTA 4A47A 5KFCA 1RT4B 1A6LA 2E66A 4DV5F 4O23A 2JX2A 3I6PA 1C1CA 3DLKB 3EPIA 3GYNA 2YWGA 4K59A 3MM7B 5D78A 3PZPA 1H0HB 5MAOA 1CQMA 2WSEC 4B9MA 3GWCA 3GR0A 3CCRS 3TX8A 2FJAB 3FSXA 4PG7A 1S4FA 4ECWA 1WEXA 3Q22A 3VAJA 1I1GA 2KFYA 1SL1A 1UVNA 4YOEA 2R2UA 4MIWA 5GAEI 3V5RA 3DRRA 2WBMA 4DEZA 4O44B 4NLRA 2LYVA 1J5OA 3NG8A 3W2VB 2ZFHA 4MFBB 3Q23A 3TAQA 3CCES 3TRGA 4WFAQ 1WF1A 4IG0B 5G4DA 3F41A 2FVCA 3MF5A 5DETA 2FTRA 1T05B 3B8HA 1U49A 3TQ1A 1FHTA 5LSOA 2CFXA 5CZXA 2HHWA 3KK2A 5B0CA 2KXFA 1FXDA 2IMWP 1GT8A 5HL7Q 1HNXF 4FXWA 1K1QA 1KHWA 1FNOA 1S6QA 5CYMB 1JLGA 4LF4F 2C2EA 5L9NA 3MR3A 3BS9A 2HLUA 1YJRA 4NZ0A 2EG1A 4KO0B 1TL1A 1QVFR 4RW9A 2R8JA 1RA6A 3FEXB 3T6JA 2W7PA 3KHRA 2I38A 1FEHA 1WEZA 4ZDNA 4C7QA 2ZJRQ 1FXLA 4U6PA 3U27A 3Q8SB 3DI6A 1KEKA 3NS5A 3AA9A 2RF2A 2IRUA 3PV8A 4DL7A 2GV1A 4PG6A 2AYGA 1EETB 2EKYA 2LEAA 1H3DA 2CG4A 4C8MA 1F9FA 1JLQA 1MMNA 1X4GA 3DLHA 1KTQA 1KQSR 2FVRA 1KQKA 5DLFA 5A8KB 2VPZB 1FDAA 1S1TA 2J0WA 1LK5A 3PJXA 2OPQB 1G3OA 5KG6A 2QLXA 2MQNA 3RU0A 1IKXB 2K2PA 3DOKA 3M6VA 3OXFA 1HBOB 4PXEA 5K14B 1C0TA 2CQ3A 3KMSA 1C0UA 4AFFA 4OZNA 3CCLS 4WU2A 4F3MA 3J7YI 2PD1A 1GXLA 2MZJA 3EUNA 3VQTA 5DQIA 3D1OA 5T14A 4OLOA 4KFBB 4QIEA 4WK1A 1H7WA 1ZM4A 2YVSA 3IG1A 2W9CA 2VL1A 1X4CA 2IHR1 1HWJA 4PKDB 1NJWA 1IJFB 1H2VZ 3OJUA 4BC9A 3N0VA 2G1DA 4PPZA 2YNHA 4ED5A 3BJYA 3NAIA 3CJ2A 4NYZA 3SFUA 5LXRA 3Q8RB 3IO1A 1URRA 2AX1A 2XBPA 4B3OA 3ICLA 1SJRA 1O5JA 2LXUA 3NBPA 4DS5A 2I8EA 1TKZA 3KFWX 3B4MA 3ZZTA 3OHAA 1OQ3A 1RA7A 1QSLA 4WIIA 3JSRA 3QGIA 4QZVB 4BHQA 4FBUA 4B3RF 5KFLA 2KYXA 4HI2A 4CH1A 2BRLA 3M9MB 2MGZA 1U8SA 2QSFA 1YSJA 5B0DA 1N5VA 3PRBA 5L39A 2N3OA 3K2YA 2W4DA 1S10A 3W7BA 4B17A 3CMES 5BR8F 4QWAA 2WSCC 1GXUA 4QIGA 4XDDA 4ZMMA 1N4LA 1L3UA 3C6TA 4C0BA 3HFKA 4WFZA 2B3TB 4BC7A 3G86A 4C4WA 2RH3A 2DNHA 2J76E 1U6ZA 2QA2A 4USJC 4C8NA 5I42A 2UUTA 4ZP8A 1OWXA 1QSSA 4B9TA 1HBUB 2E1AA 4CH7A 4ECXA 1HPZA 1RDRA 3SV3A 4LF9F 2NXUA 1E6YB 1U7LA 3LUYA 2ZE2B 2DD8S 5A8WA 4RBTA 3PACA 2W25A 2F7VA 3EGNA 4ZK7M 3KWMA 4EO8A 2J0SD 3DU5A 4LQ9A 1VMBA 2JVRA 2DO0A 1NK4A 3MM5B 4K4UA 4KB7A 4DFMA 2IVFB 4ZLPA 2CQGA 2HFZA 3DRPA 4X62F 1HFEL 3KG1A 3GIMA 2XLJA 4ECTA 2OD4A 4LF5F 1LFWA 4ZCLA 3V6DA 1WG5A 1ZETA 2KM8B 1HBMA 3CO9A 1FRXA 4Y6IA 4BCAA 3BREA 3PW5A 1C2PA 4QW8A 1VQ5S 4KHRA 2ILZA 1UW4A 1S79A 1WTFA 3TNVA 2MJNA 5T7LB 2BYCA 2IFXA 4I2PB 3M8RA 2IC3A 1Q8LA 3TUJC 4IUFA 3FRYA 2XY6A 3OW2R 2LEPA 2I2YA 2RS8A 4JI7F 5I3UB 3MMAB 4J9PA 4KTQA 2MSSA 3DRSA 4O3NA 4DSEA 2AJ1A 4QJVA 4YDXA 5HBMA 4Q45A 3R1LA 3OFHA 1VQ7S 2CPZA 4ZP6A 1D9FA 2DR5A 3BSOA 4B9UA 3W2WA 1RT1A 4F8RA 1KHVA 3MECB 3MMBB 4KHPF 5D3GB 2L9DA 1A9NB 2RRNA 2AD9A 3GG1A