3FEXB

Crystal structure of the cbc-importin alpha complex.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
80
Chain Sequence
LLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation, protein transport
molecule keywords Nuclear cap-binding protein subunit 1
publication title The molecular basis for the regulation of the cap-binding complex by the importins.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 80
sequence length 84
ec nomenclature
pdb deposition date 2008-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3fexB00
2DHGA 2RQ4A 1H2VZ 4WFAQ 2OTLS 2E5IA 1U1PA 2F9JA 1JJHA 4QU6A 2KT5A 4EGLA 2M0GB 3CF5Q 4P6QA 3G96A 2AYMA 2LYVA 1URNA 1VQMS 2OIHA 4ZKAA 3J7YU 1DRZA 2KN4A 3CUNA 3G4SS 1M5VC 1WEZA 1R8PA 3IRWP 1JJ2R 2OJ3A 2MZRA 3SDEB 1X4HA 2HVZA 3OW2R 3ZZYA 3H2UB 2V94A 2M4MA 2U2FA 2KVIA 2MQOA 1X4EA 2MMYA 4TU8A 3MUVP 2D9PA 2QEXS 1D8ZA 2RS8A 3L3CA 2XS5A 1U1KA 2QFJA 1ZZNA 2N7CA 3CC2S 1Q7YT 2XNRA 1M1KT 1BY9A 2MZ1A 1S79A 2MQQA 2E5HA 2L08A 3FEXB 1VQ5S 2LQ5A 4U67Q 2FPHX 1AUDA 2L9WA 4UQTA 3SXLA 1VC0A 2YKAA 1H2UX 3G71S 1YITS 1X5TA 3B4DA 2UP1A 1W2BR 2DIVA 2DK2A 3FEYB 3CXCR 1VC6A 3MXHP 2KXHA 2WBRA 1U1LA 2I38A 5JVHQ 1X4CA 3V4MA 1SJFA 2CPDA 4CQ1A 1U6BA 1Q82T 5CA5A 2DGVA 3MURP 3CCRS 2KYXA 1U2FA 2G0CA 2G1DA 2K3KA 4IOAQ 4TLQA 2A3JA 2DGXA 1WF1A 1WG4A 1U1RA 2HGMA 2DH8A 1K9MT 1X4DA 2PEHA 4IUFA 4Y0FA 2DNZA 2L41A 5JVGQ 2DGQA 3Q2SC 1VBXA 1X5PA 2DHAA 1X4FA 1YHQS 3G9CA 1H2TZ 3NS6A 2LXUA 1HD1A 3BO3A 4QU7A 2D9OA 2MY8A 5IFMA 5ITHA 2M70A 2XB2D 1YI2S 1S72S 4UY8T 3P5TL 1WHYA 1N8RT 3CC7S 2X1GA 2PE8A 2E44A 1WEYA 3G8SA 5HL7Q 2MB0B 1VQNS 1OO0B 5DETA 1K73T 2EK6A 1H6KX 3S6EA 1DHMA 4WFNQ 2AYBA 2DHSA 1L3KA 2X1BA 1VQKS 3H2VE 2J0SD 1U1MA 2LKZA 2ZJPQ 2SXLA 2DNQA 2MZSA 2CQ3A 3CTRA 5IM0B 1WG5A 4Y00A 2KG0A 3EX7B 1QVGR 1A9NB 2MKJA 4TU7A 2FHOB 2DB1A 3NNAA 3PIPQ 4M5DB 2DH9A 2MSSA 4WIIA 3I55S 2BZ2A 3BEGB 2CQ2A 1P27B 3ZZZA 2MKKA 2CQHA 2YH0A 2RS2A 1JJ4A 1NU4A 2MJUA 1WF0A 1NO8A 1UFWA 1OWXA 3MD1A 1WELA 1VQ8S 1RK8A 2CPJA 2E5GA 3MDFA 1N88A 3CCUS 1R8HA 5HO4A 3VALA 3CC4S 2CJKA 5DDQC 2VONA 5DDOC 2DNYA 1SJ4P 2HGLA 3LQVA 2MPUA 2VODA 1VQ6S 3NS5A 3VF0B 3VAGA 2DNHA 1FXLA 2N3OA 2FC9A 2MKSA 3P3DA 2HYIB 2KI2A 3CMES 2D3OR 2MGZA 2DNMA 2DH7A 3VAMA 2M8HA 2KHCA 2OSRA 5CYJA 1X4BA 3R27A 3B4MA 1X5SA 1VQLS 2MQMA 2MQLA 2ZJQQ 1HD0A 2CPFA 2CQPA 1B7FA 2DIUA 2RNEA 2MHNA 2X1FA 2MSTA 2DGSA 1DZ5A 2LXIA 3PIOQ 1IQTA 5DDRC 1U1QA 2DGWA 2DNLA 1WF2A 1KOHA 2DNNA 2J76E 3SMZA 2HZCA 5GAGU 3S8SA 2LEBA 2M88A 2MZQA 1N54B 4LIRA 1WHWA 2KM8C 3ULHA 2MZTA 5LSLA 3I56S 2FY1A 3CCVS 5LJ5Y 2DO0A 2MQPA 2DNOA 1KQSR 3RW6A 3LPYA 4YOEA 1YJWS 2GO9A 4WKRA 4F26A 1DBDA 3N9UC 4CIOA 2MXYA 1VQ4S 2KXNB 2JX2A 3P49B 1RKJA 1SJRA 1FO1A 5MLCV 2RRBA 2DISA 2MQNA 2YWKA 2M7SA 1U1NA 4BS2A 2RVJA 5DM6Q 1M5KC 1UP1A 3CULA 5DDPC 4PR6A 3UD3P 4LJMA 1QM9A 2KU7A 5H1SV 3TO8A 2J0QD 1M5OC 1WEXA 1NJIT 1N52B 4A8XA 2OTJS 1P1TA 2M52A 3VAIA 3CCSS 2MKHA 4WFBQ 3UCUP 2EK1A 2O3DA 2Q79A 1FNXH 2N82B 2CQBA 2CQ1A 5GVQA 2CQ0A 2ADBA 1WTBA 1SJ3P 4CH1A 5GAEU 4YB1P 4J5OA 2ERRA 2XS2A 1O0PA 2VOOA 3MUTP 1OIAA 2GHPA 1ZH5A 5IQQA 3VAFA 1X4GA 4F02A 3DLLQ 2KG1A 2CQCA 3CCJS 5GAHU 3CPWR 2U1AA 3THPA 3R1HA 3CCLS 4QQBA 1UAWA 2DHXA 1KD1T 3SDEA 2LMIA 4FXWA 1FJEB 1VQOS 2CQ4A 1XN9A 1WI8A 3S01A 2RQCA 1YJNS 3D2WA 1D9AA 4WF9Q 4F25A 3HHNB 2CPZA 1FJ7A 2CPHA 2M2BA 3UCZP 5GMKa 1JMTA 2MJNA 2AD9A 1YJ9S 1VC5A 2F9DA 2I2YA 3EGNA 2DNRA 2RU3A 3K0JA 1A7GE 3U1MA 2ZJRQ 2LECA 1F9FA 2XNQA 3UE2A 2DNKA 3DXBA 4ERDA 5GADU 1QVFR 4CH0S 1FHTA 3UCGA 4ED5A 1KC8T 3U1LA 4W92B 3CCMS 2KFYA 2MY7A 4TU9A 2RRAA 5D78A 2CQIA 3NMRA 4V19X 3P6YC 2LA4A 4WCEQ 2KH9A 1OPIA 1KOOA 1WHXA 2CPEA 2G4BA 2AYGA 2XS7A 5LJ3Y 5LSOA 2MGZB 1YTYA 2OSQA 5LXRA 2CPYA 2XSFA 2BOPA 2KRBA 1WI6A 3R1LA 3UD4P 4C4WA 1FT8A 2DNPA 3MUMP 1X5OA 5D77A 2AYEA 2LEAA 4Z2XA 5DM7Q 3EGZA 2LA6A 2YTCA 3CCES 2DGTA 3S7RA 2E5JA 2DNGA 1WG1A 2DGOA 1VQ7S 4C7QA 3CD6S 4PRFA 1ZZFA 2NZ4A 2RT3A 2JWNA 2JVOA 4LMZA 1U1OA 1SXLA 4YUDA 3HI9A 2NLWA 3MD3A 5LXYA 5CXTA 2KXFA 2YH1A 5FJ4A 2M8DB 1Q86T 2DO4A 2RUGA 3BO4A 3G8TA 1U6FA 2VOPA 2DITA 3VAKA 2B0GA 3TP2A 3VAHA 3CMAS 1UW4A 1K8AT 3BO2A 1X4AA 4W90B 3J7ZT 2X1AA 5IM0A 1VQ9S 1WHVA 2MKIA 2CPIA 3CCQS 1PGZA 1PO6A 5BJRA 2ADCA 3TYTA 2CQGA 3VAJA 3G6ES 3BS9A 2QA4S 2M9KA 1WWHA 4FXVA 1X0FA 1CVJA 4QPTA 2HGNA 2JVRA 3NNHA 2FC8A 2EVZA 3NNCA 2CPXA 1VQPS 2MKCA 1M90T 1YIJS 2LCWA 4PKDB 2N3LA 1HA1A 4OZ0A 4IO9Q 1HL6A 2KM8B 4RU2A 1FJCA 3US5A 2F3JA 1YWXA 3IWNC 2J8AA 3RW7A 2MYFA 2MZJA 2K8GA 3THTA 1SJQA 3JB9k 3Q2TC 3MI7X 4OZ1A 3MOJB 4IOCQ 2KRRA 5EN1A 1G2EA 2JRSA 1M5PC 1VBZA 4C0OC 2CQDA 2DGUA 3UWTA 1VBYA 1Q81T
chains in the Genus database with same CATH superfamily
4YB5A 2DRAA 1U1PA 3G96A 2V4RA 1Q8LA 1NK8A 2X51A 1TP7A 3UI3A 4ATNA 1RTDA 3PRBA 3PYGA 3HF5A 7FD1A 4CLFA 1R8PA 1JJ2R 3QT7A 2BA9A 3KLGA 4FF3A 4RNMA 4ID5B 2HFUA 1Z4UA 3NCPA 2RS8A 2ZZNA 1U1KA 3ETMA 1JLFA 2XNRA 3HO1A 4HYKA 1VQ5S 1FESA 3CWJA 4UQTA 3J81U 1GMVA 4C11B 2UP1A 1H73A 3HSJA 1S5ZA 4HL9A 3ICLA 2DT9A 1QTNB 4OL8A 4MMOA 2W2QP 2CJXB 4FKYA 1UJ4A 1U1RA 2HGMA 2M5YA 2J9DE 5KG3A 2PEHA 4YEAA 1EETB 1QAYA 2XWXA 4OHXA 1RT4B 1RT3B 2RHQB 4M8LA 3G9CA 1R7IA 3TARA 4JI7J 2UXCF 4P7VA 3W61A 2VQEJ 2J8SA 4USIA 5HL7Q 3GQCA 4UZBA 1SIZA 4N8NA 4YR3A 2K1RB 1HR0F 1VHIA 2DR5A 4DV5F 1TELA 3MAAB 3H4BA 1PG5B 3CJ8A 3NGUA 4WZMA 1Q78A 2MKJA 4TU7A 3EICA 4CLTA 2CQ2A 1RLDA 4WTOB 1HYSA 2VQFF 2GX8A 4M63A 1F60B 1EQ0A 2QSWA 4JI2J 3CCUS 4DV7F 3VALA 1TV6B 8ATCB 1CLFA 1TVRB 2B43A 3GONA 5B0GA 1SJ4P 4UOHA 3D4JA 1DURA 2KI2A 4WBFA 1KFSA 4ECQA 1TMMA 3KUHA 4Y2IA 3PFEA 3PIOQ 1K0VA 2Z30B 3LP1B 2IVFB 3AJ2A 2A6OA 5KFUA 5E33A 1M5SA 2LEBA 5D4PA 2M88A 3EXYA 1YBAA 4ICLB 1P9YA 3LALA 1HIYA 1UVIA 1T11A 2PMWA 4EBDA 2DISA 3AD7C 4P2SA 2MQNA 4MFBA 1NH8A 1HHSA 1NHUA 5L46A 1QM9A 3HMJG 4FNHA 3HHLA 2DCUB 2M52A 4X4PA 2VBXA 1F9HA 4G1PA 4AL7A 4Q44A 3VQSA 4BC9A 2H3EB 5KT3A 1IBLJ 1R31A 1RABB 1WACA 1S1UA 3MUTP 4K4XA 3OFGA 4K59A 3QYYA 3DLLQ 2HVEA 4IG3B 3R1HA 3AOBA 3AOCA 4DHVA 4AE5A 1B7YB 3DM2B 5K14A 1WI8A 2K2PA 1D9AA 4F25A 2J6TA 2CG4A 1KN6A 4B3OB 2UVVA 4B9NA 3T9ZA 3IR6B 1EJ7L 3UR0A 3C66A 5HANA 3PR4A 1IKYA 3T41A 3L9ZA 2H4WB 2HFZA 2XMAA 2B9XA 1U8SA 2HMIA 3Q8QB 2DRBA 4RUBA 4CO5A 3LP2B 3G6VA 5I3QA 4ED0A 2C2EA 3KTQA 4X4RA 2VD3A 2XSFA 4CLPA 2QG9B 5JUMA 3UD4P 3PW2A 1S0OA 3I5BA 3C46A 4LFBJ 4ENOA 3OL8A 3TOQA 3PEJA 1T7PA 6FDRA 4JYAJ 3CJQA 1U1OA 1UVKA 3RAMA 3PXGa 2L48A 4IRDA 2W24A 3T9NA 2RUGA 2QL7B 2ROGA 2J0WA 1SPBP 2CAJA 4USTA 3I32A 1JKHB 2ADCA 4YHHJ 4M5HA 4OYXA 3NNHA 1DLOB 3BM7A 3OL9A 1GMWA 1MMDA 1M90T 4DUZF 1T94A 3T5KA 3M8PA 3K59A 3T1HJ 2XMMA 3QNWB 1AZSA 5HROA 4FP9A 2B3TB 4LFCF 3M30A 1EP4B 1QSLA 4B9TA 1CPZA 2DHGA 2YWWA 2OTLS 4USHA 2KT5A 5HQ8A 4P6QA 2AYMA 1TFWA 1GX6A 5F8GA 2AJQA 1HBNA 1HMVB 6FD1A 3R5JB 2HVZA 1F5CA 1HBMA 4CT8A 2ZUGA 3QGPA 2KJVA 4J9MA 3A8EA 1B4SA 4N7TA 5GMDA 3PO4A 4X62J 2CNNB 3CVKA 1RGVA 1RAEB 2C2RA 1TZ0A 1S79A 2QA4G 2OP5A 4DR4J 2LQ5A 2ZH8A 2HSEB 2D3UA 1O5JA 1CQMA 1ZAVA 4DOZA 4I64A 2HHQA 1D8YA 1SJFA 5DQIA 1U6BA 2IRXA 5F3TA 2KYXA 1BQNB 5HMYA 4ZA1A 2DH8A 3AXMA 1X4DA 4F2SA 4Y0FA 3X1LB 5JJBA 2FJEB 1XR7A 5DLFA 2AWZA 3W3SA 1KR4A 2HQFA 5ITHA 2UUCF 2WOMB 2XB2D 4MAKA 2FLLA 4ELUA 4QIEA 1JLQB 1WEYA 4UUWA 1RT5B 4WFYA 2LQ9A 3CO0P 1FI4A 1S9GA 4LF9F 2DY1A 4TXSA 1CQNA 4F3MA 2PT0A 4F3QA 3MCNA 3JTNA 4N77A 1ZPWX 2QTWA 2FHOB 4M5DB 1FCAA 2X7IA 1S6QA 3RR8A 2W8KA 4OYAA 1S9EA 2P9EA 4L72B 5CZXA 1GFWB 1XK8A 2AEMA 1S6PA 4IG0A 5L1LA 3V6JA 1TK5A 4JI3J 3QQCD 1VQ8S 1SC3B 3QPIA 4Z37A 1TUWA 2JHEA 4JBCA 3ENVA 1JWWA 1Q16B 3DOMA 2B5JB 3M32B 1KEKA 4P74A 1S6OA 4TQSA 2OPPB 4DI6A 1MROB 2KB2A 1MG7A 4MK7A 4LBPA 2MQLA 4K0KF 4QYZJ 3EXCX 1RT2A 2IA6A 5CYQA 3KHRA 1U0HA 4CO2A 1DARA 2OPSA 1E6VA 4FYVB 3NGKA 2HZCA 4OFZA 2JEFA 2MZQA 4A46A 1XNRJ 5SZTA 1BXNA 1FWKA 1RZMA 3J81j 3IM8A 1FRJA 3PW0A 5LJ5Y 1FNMA 4ZLNA 2LQJA 2MQ8A 2NUUG 4Q8FA 1KVIA 3N9UC 3HSDA 4WU2A 1V3SA 5DRKA 1FO1A 3CW2C 4TLRA 4NLPA 3MAQA 2J0QD 1LWFA 2FLOA 3TEHB 2NXNA 4A8WA 4HHUA 2LU1A 4ZP7A 1IR0A 3CD5A 3RRKA 1JJCB 3DFEA 5B0DA 3M05A 4J5OA 4LQ3A 4B08A 2XMKA 4I2QB 4K50A 2HHSA 2ZH7A 1R6VA 3JSMA 3NAHA 2KG1A 2V8PA 3DLGA 4MTPA 2CJQA 3DDIA 1IBKJ 2I1RA 3I5CA 3FRYA 3S1TA 1RWUA 2HRTA 2C3UA 2ZVSA 4QBUA 1YJNS 2LP4A 3FRZA 4DV1J 2R2RA 1REVB 1RT1B 3OTEA 1UA1A 3D9BA 3SCLE 4JI5J 2XNQA 3OQ2A 2QLJB 1BQMA 4C98A 2B7CB 5HN0A 2KFYA 4WPAA 1SJ1A 4Z7YA 2JEGA 2CJ9A 3QLHB 4X2BA 1KOOA 4O3PA 4OYBA 2GVDA 2CJAA 2DR6A 1HHQA 3PDNA 1NJXA 5F3ZA 3M2VA 1HWLA 1WSVA 4OJGA 3RGIA 3MUMP 3PW5A 5D77A 5IT9Y 2F4FA 1B99A 2W9CB 1C2PA 1S49A 4BBYA 3PHEA 1FX4A 1VQ7S 3CD6S 4YY3J 5ETRA 2HZAA 3HI9A 3EUNA 2APOA 1IR2A 1W2IA 1WC1A 4N76A 1LKZA 1NXIA 5KG4A 3FGVA 2B8PA 5EWFA 3CCQS 1YJVA 1P1LA 4USUA 2AGOA 2OFHX 2QMUB 5A8KB 4IR1A 4KGVB 1Q5VA 2EVZA 3SI8A 3SBMA 1QSYA 5DQGA 4B9LA 1G3OA 1CG2A 3OL6A 2GJFA 3O44A 3Q2TC 1TFYA 3MM9A 2BJ7A 2C42A 4E98A 4ZVQB 1IR1A 3QT8A 1IBMJ 1LXNA 5CYMA 2MLZA 3CJTA 1QY7A 1TL3A 4F7VA 3G4SS 1HNZF 2VFTA 4MT1A 4J9QA 5HLFA 4K2XA 2KVIA 4I7FA 1FWPA 3BYRA 2XS5A 2ZH1A 2N7CA 5HATA 2CZVC 4WJBA 5I42A 3FEXB 1IM4A 4F04B 4U67Q 3BBFA 2GS8A 4DFJA 5J2QA 4EBEA 5BXIA 2G2OA 4KO0B 4ZVPB 1JLEB 4IO1A 5ETSA 2GCFA 2YX7A 5IC6B 1CJVA 2IM3A 1RBLA 2IHR1 3Q2SC 1VLOA 3OLBA 3PJ9A 2C3PA 3NMAA 4NE9C 3GV8B 1PBUA 3JS9A 1H7WA 1NKCA 3SIPB 2MB0B 1CJKB 1H6KX 3T3FA 1DHMA 2AYBA 1AFIA 2GVZA 3DU6A 2FY8A 4BWMA 1VQYA 2R7UA 4J9OA 4WXOA 2VDIA 4OV1A 2ZOGA 3BEGB 2GGPA 3KHGA 4NLSA 4Q0BA 2CQHA 2BMBA 5F41A 4IFYB 1N88A 3WC2A 6AT1B 5IXUA 4U7CA 1Y11A 3DC2A 4PXEA 5AT1B 2GMLA 3F0NA 3N4WA 4WKYA 4KFBB 4P52A 3D0HE 1WC4A 3I0RA 4YFUA 3CJ4A 3BSCA 4O3NA 1T02A 3B4MA 3SQGB 4DPUA 3W9HA 1GTEA 2QA2A 1HD0A 3H0PA 3NS7B 1X9WA 2J9DA 3I4PA 4ED8A 1U1QA 3BGRB 4RZRA 3TANA 1UVMA 2FY1A 1KQSR 5K20B 2P6TA 2Y3YA 5D3GB 2V9KA 3HVAA 3TNVA 4F4WA 4RBTA 1S1WB 2IC3B 2UVWA 3TJ8A 3C6TB 5KT6A 2R42A 5IOLA 2V5HG 2VFVA 4LJMA 1MMLA 3TO8A 2E1CA 3Q83A 4P7TA 3THVA 5DG8A 2WK4A 2J9CA 2O3DA 1HQUA 1LQ9A 2KT2A 2CQBA 1JLCA 3UW1A 4CH1A 4Q45A 1MWYA 2WVBA 2BW7A 3M9NB 2G2ZA 3KMSA 1OSCA 4DV4F 2N4DA 3ZTPA 3CCJS 1YLXA 4DEZA 3IMQJ 4DX6A 3GIRA 5T41A 4OQJA 1OY8A 3GCWP 1VQOS 2HHVA 5AE2A 3W65A 5D15A 3T5JA 2CPHA 3DLKA 1AA1B 2OPQB 2BXJA 1HNWJ 3RU0A 4LBIA 4L76A 1N33F 3W2WA 2RU3A 4RW6A 2EXUA 1XERA 3DOKB 2BVZA 4I56A 3BGFA 2L9DA 4C8KA 1HKAA 2LDYA 3M4XA 1N5YA 3P6YC 3ENAA 4LFAF 1OPIA 1WHXA 3KLEA 5LJ3Y 3IRXB 3PX6A 1QLNA 3KK2B 3AQOA 1R0CB 5C25B 5A2QU 4DF8A 1VFJA 5DM7Q 4UOGA 4UT4A 1SVDA 1NSKL 3SCKE 1ZZFA 2NXEA 3DHXA 3G6XA 3GJRB 3BO4A 1U6FA 4KGZB 4CT9A 1KHWA 2OPRA 3K7RA 3CMAS 1K8AT 3VHQA 2RRNA 4OI3A 1Q4RA 5AXKA 5CAAA 3J7ZT 4JV5F 2EEYA 4NLGA 2VG6B 3M1VB 4PG4A 1Y5LB 4BWJA 2FC8A 4U96A 3LO3A 2ZKUA 5IWAJ 4RU2A 1YWXA 3JB9k 4PPDA 2HQCA 5EN1A 2JRSA 1RU1A 5KFRA 1JNZB 4LRBA 3JXOA 3NBPB 1X0PA 2V2ZA 1UWBA 2M0GB 2J7UA 3HT3A 1SUQB 1KVKA 1RWVB 3I9ZA 3QFWA 5KOWA 3M6UA 3CUNA 1M5VC 4PUOA 3CD7A 4B3TJ 1EKSA 4CM0A 1N6QB 4Q2LA 5HBMA 2Z2ZA 3OD2A 3L3CA 3GFZA 4GKJF 4UY85 4K4SA 2YWHA 2LFVA 2DVIA 2AV5A 2E5HA 2IJRA 3V81A 1Y0HA 2WONB 2Q43A 3DN9A 1YITS 1W2BR 3BF4A 2I38A 4DV3J 2G0JA 1UJ6A 3V4MA 2VA3A 1NK7A 3EE3A 3SV4A 1R6YA 2G0CA 4TLQA 2WVEA 2DGQA 4MKAA 1S57A 3EMTA 1HD1A 2GA7A 3JSYA 3BO3A 5CD4H 1B0TA 4NLUA 1WHYA 2I5JB 4CLUA 5DJBA 2PE8A 2B56A 1OQ3A 5SUHA 5E3CA 5GAEI 1Z2LA 2MZSA 5ETVA 1LFPA 4ZP9A 4WWSA 4OYPA 4DL2A 5ETMA 3H7HB 4HT5A 4I0WA 2PMZD 2ZDOA 4WIQA 4OYMA 1FKPB 4J9RA 3E3XA 2MLXA 1QUVA 3MWBA 2R7QA 4WFXA 1HBOB 1UFWA 2DTJA 1N4LA 3N01A 1OS5A 1LV5A 5BYRA 4QIVA 5F9LA 2R8KA 5I3PA 4CCHA 4L3KA 2WHOA 3QFHA 2ZWOA 3OFFA 5L39A 4CDIA 2B4OA 2MPUA 3VF0B 4RLEA 3FK4A 4A4JA 4PZVA 2MGZA 3A8JA 4YB7A 2OSRA 2FHJD 2Y1LB 4O4RA 3RJMB 2C2KB 2OEMA 2ZJQQ 3U27A 4ECRA 1PJ5A 1FFWB 2RNEA 2DCLA 4DFPA 5FDLB 5BR8J 2DGWA 1HNVA 2E5LF 4EO6A 3D3BJ 1T03B 5D6GA 4LIRA 1HQEB 3UVJA 4DQQA 1YRTA 2CKWA 1KQKA 4PG5A 2FJVA 1XMOJ 3CJKA 1KNZA 5KG0A 2QL9B 3RBEA 2H5EA 1SJRA 1TKTA 5MLCV 4NCBA 3OTOF 3B54A 2ZZMA 4F4ZA 3SQOP 4DJBA 4ZCKA 2Z57B 4EK2A 4JI4J 2ZM6J 4JI8F 1PC4A 2GIRA 2IYIA 4CNYA 1LW0B 4XIUA 4DR2J 2OD6A 1KQGB 5J1EB 4K5RA 9ATCB 5KFPA 2YNGB 4DX7A 4G3IA 2OLWA 1OIAA 2GHPA 4NA2A 2OMLA 3E01A 2U1AA 4D3GA 4GVBA 3DYAB 4OHWA 4O4GA 1PBAA 2HZVA 1HNIB 1TL1A 2JC1A 4DLGA 3FBFA 3S01A 5A0YA 4X65F 1JXEA 3OSPA 3NL0A 4PAAA 2ZWPA 5KFHA 2QYCA 1JMTA 2I2YA 3MM7B 1RWPB 1UEVA 3TUZC 4OZ5A 1SH0A 3FJ2A 3KKFA 2IDLA 4C6AA 1ZBTA 4W92B 1Q5YA 2BE2B 1E6YA 1IJEB 1MU2A 2HLTA 1FKAF 2QLFB 1DTQB 3E2EA 3QAEA 2PMHA 4U7UK 2J6SA 2BOPA 1WI6A 4R0EA 3IS9A 2IVMA 2ZDPA 4DPOA 3PV8A 5E3AA 2IJFA 3QJLA 4GVLA 5E41A 5ETPA 2NLWA 1TUVA 1R0AB 2YH1A 4V1Ak 3UNGC 2PI5A 2XHCA 3NRBA 5HQLA 1C1BA 3LWMA 3BO2A 3OV7A 1YRUA 5IM0A 2DXDA 2AMCB 5KFVA 3CO9A 3RZAA 1N36F 2MDAA 3HVTB 4LF8J 2FVPA 3QRPA 1CVJA 2CXEA 4EWTA 4URQU 2LCWA 5K9FA 1KS2A 2HPUA 1HL6A 2UXBJ 2WBMA 1UPMB 4OV6A 2AKWB 4USMA 4PCQA 1XEZA 3BBBA 1MLAA 1VDHA 5LL6d 1FXRA 3DXSX 1H2VZ 4X4NA 4PXDA 4Y65A 1WEZA 2KO1A 2JL9A 2Y1IA 2MZRA 2KVQE 1HBUA 3OW2R 3PNIA 2R8HA 3NGTA 4O3SA 3TX8A 2MQOA 1N0VC 2BRLA 2D9PA 4HI1A 3KYLA 4W98A 2IMOA 1JIHA 4LSLA 4HTJA 2YKAA 2ABYA 3IN5A 1FTCA 3GMGA 1VCTA 2F8EX 5AXNA 4CQ1A 1NHKL 2YKNA 1R8CA 1YK9A 3K89A 4KE5A 3CCRS 4J9SA 4ECUA 2F1FA 2G1DA 3KK3B 1I5OB 4DL6A 3GIMA 3IG1A 4ECXA 4HVZA 3QAUA 3C6UB 1RCXB 3CB4A 4EO8A 2QX0A 2X1GA 1Z2ZA 2HRUA 2HK3A 4DUYJ 2NREA 1IUJA 3D6TB 7FDRA 1RTJB 5HSPA 2Y9HA 2F65A 1NB2A 4DSLA 4L6V3 2JEIA 1IQZA 3PW7A 5GAHI 2HHXA 3BKFA 3C19A 3EGWB 1JJ4A 2WSFC 4U95A 4OX7A 2VFSA 4NXNF 1NHVA 3OHAA 2CJKA 2A2DA 5K8OA 3N5FA 4DN0A 4OI6A 4B3MJ 4CP5A 2VODA 4OLOA 2FLNA 4KKOA 2N3OA 2HEKA 1ZETA 3FQKA 2CVIA 5I3UA 3QO9B 5KOXA 3BQ0A 2R2SA 3R27A 2R2UA 2BR0A 4P2FA 2W8LA 2ZD1A 5L9NA 1DZ5A 1IQTA 4ZVRB 1TL7B 2FJAB 3GFHA 2BRKA 2RF2B 4MIAA 3TVKA 4WU3A 3UFCX 4DQIA 2YBVA 3I56S 2EG1A 1TL5A 3BPDA 2IM0A 3JYTA 3Q24A 5IT0A 4UW2A 3UR3C 1OY9A 4USVA 4F26A 1DBDA 2RJZA 3QRRA 3HDSA 2R9LA 4QWCA 1DQAA 4LVOP 3HVWA 1UCNA 3BKUA 3DRRB 4PXBA 5GMEA 1PYTA 5DM6Q 5JXSA 1M5KC 2RHSB 3MR7A 2IYGA 5ETOA 1J5EJ 4B3RF 5H1SV 2JZ5A 3OVAA 4NA3A 3UCUP 3DGVA 4RW8A 3LF0A 4NI2A 1SJ3P 1VRTB 4JP8A 5T7LA 3CMQA 3RAQA 3AD8C 5F0WA 4DUTA 1WUUA 5D4NA 1URRA 3SCIE 3MR3A 2EFGA 2WB4A 3KK1A 3DRXA 1J5OB 2QC3A 2M2BA 3UCZP 1N5SA 2UVRA 3E8OA 3BQ1A 1VC5A 2F8HA 4OZJA 1IXKA 3TAMB 2IBKA 4ERDA 3BSOA 3MMCA 4CZCA 4P2XA 1QVFR 3L7UA 1RB0A 5B7WA 4TU9A 4FZVA 4R5PA 1RA7A 4WCEQ 4RW9A 3CDEA 4ZPWR 2G4BA 4ZVGA 4UZCA 3WHIA 2V6AA 5KG2A 1RTZA 2V8VA 1GK8A 2E5JA 3H2LA 1WG1A 2HVIA 2D1CA 4JI1F 3GCXP 5FLXU 2XGQA 3FVYA 1R8BA 3AD9C 4JI7F 1G4CA 4QJVA 3TQ1A 4B9UA 5F8HA 3VR1A 1LWEA 2K06A 1GTHA 2IDEA 4TQRA 3DLEA 5HJYA 1N34J 3OXLA 2D7SA 2ZBPA 1H72C 3KJQB 1FRXA 3GR1A 2GW8A 5C2CA 3HJVA 1RLCL 3G82B 5L1JA 5H9EK 2GQQA 2GZOA 2CQGA 3EVWA 3K57A 4PWDA 5DGAA 3CCZA 3DHWC 3NCQA 3QZ8A 2CPXA 1YIJS 5LMUJ 2FYXA 3ZZRA 1HR0J 1RBAA 4JI2F 1TKXA 3THTA 2DEIA 5C24B 1WSRA 2KRRA 1VBZA 3KJNB 1BGXT 4CYUB 2RQ4A 3KLFA 1U4BA 1ELOA 4QU6A 3PO5A 4M5LA 1V9OA 3F41A 2VQFJ 4XPEA 3BBCA 4KR0B 3POTB 3K5PA 1TKZB 2NS1B 1FKOA 3I6PA 2BDPA 4CTAA 4ANCA 1C4AA 2U2FA 5A8RA 3TQEA 1IN0A 2YKMA 4JV0A 3BSNA 1RT7B 2BEFA 8AT1B 3N79A 2AJ1A 4TU8A 3M2UB 4AD6A 4BC7A 3A4TA 4ED3A 1X9MA 1Q1KA 3KLHA 1S1XB 1NJYA 3D1QA 3J7AN 3LAKA 2YKOA 2MQQA 3HT0A 1HI0P 2C2ZB 3DMJB 1AUDA 3NOCA 4Q43A 3MM6B 2KXHA 3VCDA 5C42A 3GJTB 3H90A 2DGVA 4GC7A 2H54B 4EZ6A 1D3WA 4IOAQ 2BW2A 2DHHA 4IUFA 2L41A 2BANB 3NS6A 1JX4A 4C3LA 1FDNA 2GFFA 3I82A 5ETTA 3QWUA 5DGBA 1IBLF 2BQUA 2H9ZA 4WFNQ 2XZTB 4ES2A 2X1BA 5A6WA 4Y6IA 3D1OA 2W2OP 1CJUA 1RTHB 1WG5A 3PIPQ 3C14B 3I55S 1JLAB 3HFZB 4Y2KA 3N6MA 1NUEA 4HDHA 2YH0A 3JAMY 1O51A 1NO8A 1OWXA 1XR6A 1ICEB 1RTIA 3BDEA 2ZBIA 1NPKA 2CPJA 4BLGA 4DQSA 3CC4S 3OPKA 2VJVA 4B9SA 4C8MA 2UU9J 4KBIA 3AA9A 3SV3A 1MSWD 3IFEA 4M5MA 3AHPA 3R5GA 4ZLLA 1X5SA 3CJ0A 2MQMA 4EU0A 4CM2A 4LFBF 1RTDB 1QAIA 4JYAF 1WF2A 2BKPA 3SMZA 4NYOA 2ZNZA 3KLGB 3A3PB 2MZTA 1JLGA 2V63A 2FJWA 3NY0A 2LLZA 2V50A 1APSA 4B17A 1JLFB 3OVSA 3M6WA 2JX2A 1EKRA 3Q23A 2RRBA 1ZA1B 4YP3A 3JTPA 4YHHF 3R7NB 3MMBA 1QUPA 5L1KA 2RVJA 2YNFA 2ASJA 2E1AA 4KIAA 2IRYA 1NJWA 3ZC4A 1M5OC 4WE1B 3VAIA 3DCAA 2W4CA 3FUYA 3MEEA 4J9UE 1ZM2A 2C3OA 2UVUA 5KFTA 1G7CB 2OH2A 2E7WA 1S10A 3DI6A 2ALYB 4OYZA 4RUAA 1GH8A 3W8PA 1LWCA 1SC4B 2B4PA 1WOOA 3D2WA 3HHNB 4DDFA 1FJ7A 2HFNA 4X62F 2KYZA 3AODA 1HYSB 1NNDA 1HI1A 2I0XA 2ZH4A 2BJ9A 2LECA 5J2PA 2ZNYA 3T5HA 4OJHA 2B9WA 4DR4F 1YJTA 5E7OB 4CH0S 3D0IE 3CCMS 2OEJA 2ZE2B 2R7OA 2YNHA 3BQ2A 2JNJA 2D3ZA 2PEBA 3TJ9A 3A8KA 5LSOA 1YTYA 2CPYA 3I0SA 2KRBA 5E2QA 3Q8VA 2R8GA 5J1PA 3HK2A 2AYEA 3RAXA 1VI7A 2KT3A 4J90A 4AXIA 3M8QA 2HAFA 2NPIA 5D0HA 3A3NB 2CNKB 3PJWA 2DO4A 5KFJA 1WC0A 2B0GA 4PYAA 4ZPAA 4ZHRA 2VC1A 1FEEA 4XPCA 2GQCA 4OMFG 2CPIA 3PM9A 2QIFA 4FYWB 4I6YA 3WX8A 3W5ZA 2D41A 2VG7B 4OX9J 4MFBB 3PEHA 5KFOA 2R7TA 4LSNA 2VBYA 5C5JA 4Q7AA 3K5LA 4JI3F 2GJ2A 4QPXA 3HHLB 3OUYA 2MZJA 1SH2A 4DCJB 2BJ1A 5KFLA 3O1LA 2UXDF 2FJDB 3H20A 1S1UB 3QIDA 1IKXA 4FPIA 5H9FK 2KZZA 1C4CA 4H4OA 2R3VA 1V3ZA 2ZUAA 3IWXA 1OSDA 4USKA 2OEKA 5KAKA 2Y8YA 4ETXA 3DLHA 5K14B 2EI5A 1RA6A 1X4EA 3Q22A 1WJ9A 4USWA 1JLBA 1F0XA 1SC6A 5DO2A 1VBKA 4ED1A 1Q7YT 2B8QA 3VGVA 1H74A 4J9NA 1IKYB 3GTYX 2FPHX 1K44A 2JFKA 2AU0A 2HMIB 1WORA 2V4JA 2NQPA 5J2MB 4C97A 1WC3A 1U2FA 2ATLA 2A3JA 1WF1A 1WG4A 2F40A 2RMLA 4ZS6A 1VOMA 3L4BC 3IR7B 3GJQB 2B7BB 4DU8A 2MY8A 2RAQA 3R7SB 1HI8A 3BV8A 4LRDA 3AY0A 3ISND 1Q7LB 3MTJA 2QO3A 4CNZA 4DR3F 4K7QA 4NYZA 5IV4A 1IBKF 3D1HA 3C8YA 3AT1B 1Q53A 3BH6B 4IRCA 5F8MA 3FCWA 4A47A 1U48A 4LR7A 4DV1F 2L9NA 4QWDA 4YR0A 2JC0A 4UUXA 3M8PB 4JI5F 5HROB 2I9SA 2WW8A 4ZK7M 2QV6A 2Q1LA 3DDKA 1B3TA 3M30B 3KNAA 1JXLA 2DNHA 1KWMA 2QZ8A 2M8HA 5IV3A 3D6FB 2DYAA 1FWLA 2CQPA 3G8QA 1HBNB 4F36A 2MSTA 2DNLA 2IC3A 2V9WA 2DNNA 3MM8A 1HBMB 5D8HB 3ZFVA 1EQMA 1S0NA 1BWEA 2EKYA 2DNOA 2V0NA 2GO9A 2W01A 1G6BA 5F8NA 2HWTA 3O2IA 3FKBA 4Q8EA 2EG2A 2UV8G 2DPIA 2FZGB 4WP9A 2M7SA 2GNKA 2QA1A 1UP1A 3CULA 2A0FB 3MR5A 4MK9A 3KLIA 1RAFB 3AOAA 1LXJA 2C2DA 1WTBA 4XDCA 2AX0A 1RWXB 1KFDA 1X4GA 1IBMF 4CH7A 3OBIA 3QGIA 3M6XA 3DRPA 3OR1A 2DHXA 4C0HA 2NR0A 3CJSA 1KHVA 1N5QA 1FJEB 5FIIA 4WP3A 1S9EB 3D68A 5G4DA 1S6PB 4IG0B 1H0HB 3K0JA 3HKWA 2PGCA 4DL7A 4ER8A 2XCAA 1KC8T 3DOMB 2HNZA 4ZN1A 2AZ3A 2AYGA 2DEJA 3CIZA 4JV2A 2V69A 2O66A 3HZGA 3ITHA 4YS2A 1RT2B 2FJBB 2QLBB 4ZIWA 1U0HB 2OPSB 1E6VB 1C0UA 1Q86T 5KT7A 3QZ7A 2RE1A 3MMJA 2VOPA 2ILYA 3A8IA 3MCSA 2XHWA 1XWLA 4I2PA 1RISA 4KV8A 4M5GA 2IFXA 3V5RA 1VRQC 1WNEA 4KT0C 1FX2A 4P9SA 3UN3A 3TZXA 3T1AA 2BYCA 1LWFB 1FJCA 4LF4J 2J8AA 2MYFA 3PG9A 4P71A 1F5BA 4FBTA 4C0OC 3GYGA 1IKWA 1Q81T 3TRGA 5LOQA 3MTKA 3WQPA 1RI7A 3OFEA 4HACA 2GV1A 3JSMB 1T9TA 2CYYA 1U25A 3DLGB 4ZPTR 2AQ4A 3IRWP 2C3YA 4NEYA 3D7SB 4YB6A 3H2UB 4OZLA 1YBUA 2OMOA 2GIFA 3D3CJ 3D54A 4NLTA 4Q5VA 1S0MA 2NUHA 2ASYA 4AT1B 2J0XA 2C22A 2L08A 3H4DA 3O3LA 1BQMB 5KFBA 3R9LA 1X5TA 3B4DA 4DN9A 1IWGA 2WBRA 4MYTA 5JVHQ 3W2VA 1HARA 5CA5A 3NAIA 2HNDA 2GVDB 1VK8A 4KHMA 3KUGA 3M2VB 1U24A 3QSYB 3LP0B 1NDPA 1HWKA 4CWBA 2ASDA 4Y2CA 1FKPA 3P5TL 5HI7A 2IM2A 3PKMA 2FVRA 3GWCA 1OO0B 1K73T 2EK6A 1U7LA 1UMJA 3H2VE 1XC9A 4H54A 3EVOA 2WZ1A 2CQ3A 4N47A 5B0CA 3T1YJ 5ADZA 4OX8A 4ECTA 2Q6BA 2DH9A 1SKUB 4WIIA 1VJQA 5DG7A 3GP9A 4PABA 4KJIA 4PYDA 1HNWF 3PYDA 2HWIA 1NK4A 1ZTTA 4IYQA 1U26A 3DNCA 2RUSA 3V6KA 4CLLA 1FK9A 1LW2A 2VONA 3R5AA 3KJVA 2O1PA 3MM9B 2FD2A 4L74A 3SZ2A 2P5VA 3P3DA 3CMES 1PYOB 3PX0A 1EB0A 2HRYA 3HFKA 1N33J 5CYMB 2CPFA 2WCXA 2DIUA 3N6LA 1TL3B 1VR6A 2LXIA 5J2NA 4X66J 4NLWA 5DDRC 5KFKA 4NRTA 5HLFB 1ZS6A 2YQ0A 4I7FB 4LFAJ 3VQTA 2W25A 5LSLA 4LRAA 3ZNJ1 3RW6A 4ZVSB 3PW4A 2JFDA 1KTVA 3BREA 4ZLPA 4DS4A 2XO7A 4O3OA 4DSIA 1RQ0A 1NMEB 4NLXA 3TX0A 3LH2S 5J2QB 2Q66A 5T14A 1F5AA 5HJXA 1WEXA 4YR2A 3EWGA 1S4EA 4C8ZA 3DYAA 2WSEC 2VF3A 2ZH9A 1CJVB 2KKHA 2DKOB 4FXDA 2AW0A 4KQZA 2CQ0A 3G86A 2B6AA 2PFDA 2JH3A 5K8NA 5L1IA 1MW7A 5C7PA 4CLYA 4F02A 4G65A 3R5BA 1SL0A 1NH7A 5KG5A 3GZ7A 2XI2A 3Q89A 4EYIB 2XLJA 1PAEX 1RWWB 3SDEA 3VTIA 1FDAA 2ROEA 2RQKA 3RBDA 2GGPB 4Q0BB 1VLYA 4ZN3A 1QJHA 1EX8A 3H5UA 2YPYA 3ZZOA 1FHTA 2QL5B 4DV0J 3GG0A 5LM7E 3TR5A 1SQFA 2BACA 2XZDB 5HVFA 3GYNA 4KPYA 1RYRA 2ZBCA 2OSQA 5LXRA 4GKJJ 3I0RB 4DPWA 2VA2A 1FFSB 1AYEA 2XMJA 3CCES 4NMXA 2J5AA 4PQAA 4JUZA 4OLPA 3ADAC 3HVTA 2JVOA 1TU0B 1BLUA 1SXLA 1R27B 4DFMA 1ZPVA 4ZMMA 2YKQA 2HHHJ 5K8MA 2HHPA 4A8KA 2VASA 3T6JA 5F9NA 4LBHA 4DG1A 4TVAB 2QRRA 1MN7A 2EFOA 2J7KA 4O0NA 2H4YB 1ROFA 2D69A 5B0AA 3WIVA 5DQHA 2EFNA 1IWAA 2ZC4A 4KB7A 1F1BB 3PRDA 1S99A 3RW7A 1SJQA 2RILA 3MOJB 4QZVB 2K7KA 4R25A 3IC1A 1HQUB 4KGKA 5EUHA 1JLCB 3UWTA 5KFDA 4TKTA 5CCLA 5FD1A 1JJHA 4DSJA 3W5XA 5LMNF 3L09A 1KBRA 3CDBA 3MGJA 2PN6A 4RNFA 2W7PA 3H25A 3PYFA 5CZVA 3R6GB 3EM1A 4CLKA 2NXUA 5DG9A 4XDDA 2MMYA 3P8BB 3D67A 3DLKB 5LSRA 2LXFA 2BE9B 3IBCB 3P4UB 4OJ3A 5E3QA 1M1KT 2MZ1A 1XMOF 3W2WB 3HSZA 4RW6B 4A8OA 4M5NA 2AHOB 1RBOB 2X3DA 1N5YB 2Z2YB 1X4CA 4DV6F 3MAHA 3VZHA 3HHKA 4JI4F 2ZM6F 3KLEB 3MCMA 5G0RA 2HBZB 3RBZA 3ZTOA 3ISNC 3LA0A 4DR2F 3LANA 1F6TA 2H5IB 1X5PA 1SKWA 3HM9A 4ITSA 5E0OA 1ZM9A 4UY8T 2Y0BB 4ZLJA 3P45B 1XNQF 2K7JA 2JLEA 4IDKA 2OPRB 1FRLA 4DSEA 4EFAC 3CJ2A 3DDNA 3DKDA 1QDUB 2DB1A 4AXJA 4ID8A 4ELVA 1IKVA 4A8FA 4NEZA 1AW0A 1NAQA 4ZVEA 2VICA 4QWBA 3H59A 3C15A 4C8YA 2J9EA 3I5AA 1YJRA 4RX6A 3MEDB 1NDCA 4ED6A 3Q8UA 2F4VJ 1R8AA 4G1QA 4GC6A 1QE1A 2HNYA 4X65J 2AX1A 2MLYA 4UQGA 1NPRA 2AJ2A 1UWBB 2GO8A 1M1GA 3VAMA 1YBTA 4QCLA 4EZ9A 2EW9A 5KFYA 4R8UA 2WVCA 4PUOB 1T9YA 2J76E 1N54B 2KM8C 4F3OA 3JSRA 3FMBA 2DO0A 1XJWB 3LPYA 3ZTQA 2VH7A 3TUIC 3GIJA 1S9FA 5U47A 4DPXA 4MKVA 4RU9A 4K4YA 3OFHA 3P49B 1RKJA 3MMAA 4QIGA 4GRSA 3W64A 3CGIA 3RUBL 4X4QA 4ALZA 3V81B 2YWKA 4IFVA 4LF8F 3FZ2A 4QW8A 3OLAA 5EDWA 3QGHA 2OTJS 1P1TA 2CIMA 4J9KA 3M6VA 2UXBF 2PSZA 3TI0A 4LF5J 1N36J 2LU2A 5B0FA 1NB7A 5GAEU 4ANEA 4AUKA 2RKIA 1O0PA 3R97A 3QIPA 8RUCA 1ZH5A 3VAFA 3EDQB 1NK6A 4F0HA 3R6LB 4M5JA 2B4VA 1HLWA 1PJ7A 5K5MA 1HNXJ 4DR7J 1NSPA 3NKYA 4FXWA 4DXLA 5L8RC 2VC0A 1X31C 3QJPA 2CRLA 1YGYA 3U1NA 2EC2A 2ZHAA 1CULA 2DXEA 3UPFA 1S1VA 1FRKA 4NCAA 3MM5A 3J81Y 1K47A 5C2GA 2ZJRQ 4FKXA 3H98A 2FVCA 4JB8B 4NCGA 5BYQA 3NP5A 4ED5A 3U1LA 2LDIA 3FFIA 1T9XA 2V8HA 5CD4A 4NASA 3W7BA 2HW3A 1B64A 3MR6A 1RKIA 3MFHA 3IAM9 1TMJA 2XS7A 2MGZB 2LEPA 3HXMA 1XR5A 2BJEA 5E5NA 1YRXA 2ZEJA 2LEAA 1W7WA 1X8DA 4DFKA 2DNGA 3W1YC 2FGOA 4DSKA 1MMNA 2E9RX 4LF6J 1C0TA 1HNVB 4YUDA 1N5VA 3CCWA 4ILMA 4HTIA 1BHNA 5M2PA 2KZMA 3HX9A 2DITA 3UVJB 3TP2A 3VAHA 4CLZA 4DUYF 3GE9A 4F67A 1EZZB 2XZWA 5C24A 3V6DA 1MWZA 3CJKB 2XSJA 4ZVUB 1TKTB 3G6ES 4ILRA 1SL2A 4FBUA 3LGMA 2WVFA 1GMUA 4IKAA 1FRIA 3GSDA 4ZCMA 4ILLA 4OZ0A 2KM8B 5THWA 4TY9A 3KHHA 1V6HA 4I1TA 4P72A 3W8GA 4RBVA 1XMQJ 4JI6J 2XMTA 2WTFA 1SB6A 4X4SA 2DGUA 4B3MF 3PX4A 2AGQA 3PZPA 1NJZA 3WBZA 1FE4A 1VS3A 3GJSB 4ZJQA 4GKKJ 2RD5C 1S1XA 4MH8A 1URNA 4DV2J 4LSZB 3GB0A 3E01B 1DRZA 1BD6A 4GVBB 3K2YA 4O4GB 4NXNJ 1RAIB 3ELHA 3FSYA 1TL1B 3MM6A 3RB3A 3C3LA 4M5KA 4H4KC 3OR2A 2H51B 1ZZNA 3H5SA 1M0SA 4DX5A 1F2HA 2AZ1A 3VVUA 4QR1A 1I1GA 3ZTSA 1NBEB 1VC6A 1E6YB 1MU2B 3BGOP 3QRQA 2CPDA 4IR9A 1JXVA 1J5EF 5CHCB 1DQ9A 4D3HA 3QJJA 3Q8YA 4K4TA 2BKNA 3IS9B 4WFZA 2DHAA 4A8QA 1DTTA 5IT9U 2M70A 2BJ3A 4LT6A 3UDCA 1YI2S 5A6PA 4NLVA 2VPWB 3NEKA 1RHMB 4B3RJ 3W63A 2DY9A 2HHUA 1VQKS 3B6BA 1KDNA 1C1BB 4DPYA 1WDDA 5IM0B 3CCTA 2V68A 4ZJLA 2G1HA 4KY3A 3L7PA 2A6MA 1VJWA 3EVMA 4RW4A 2DBBA 1VRUA 4NOHA 2AJFE 4AL6A 1LNQA 1YZ6A 4EI2A 2BBEA 3WIUA 5DDOC 1AROP 5KFGA 3CT9A 1BC6A 2VZ9A 2NZCA 2D3OR 1S12A 2CJYB 1C1CA 4Y2AA 1Q79A 1S1TA 2XBPA 4DX8H 3G6YA 2BM1A 3MCOA 5K8PA 4O44A 3FQLA 4L75A 1HBUB 3FMWA 1UFLA 1GAOA 2PI4A 2RQMA 2F5GA 1Y5NB 1SC1B 2QN6B 4ECYA 2HQDA 5IZHA 2MHEA 2ZOMA 3L95X 2KHDA 4WE1A 1N34F 4MJKA 4LRFA 2B51A 4CIOA 2E9ZA 4FVCA 2UUBF 2JSXA 1CJTA 4RNOA 2WRMA 1D9DA 3O8WA 4LSLB 4JI1J 4OX6A 3R5CA 4P10A 3VGTA 2LQBA 3UD3P 4DBQA 2YKNB 2VG5B 1U2RA 5LMUF 4QR0A 3HCXA 2RU9A 1YKWA 2C3MA 1FNXH 3NGSA 3BDPA 3IG1B 1CEZA 3MECB 3KHLA 5AXLA 1RAHB 2ALZA 5GAHU 3THPA 3KJFB 4ELTA 1T05A 1TL4A 3ZNUA 1SH3A 2LMIA 1T3OA 3NGDA 2B9YA 3R5DA 5EWEA 2OD4A 2CQ4A 2CADA 2ZE2A 4RNHA 1U8WA 5KG7A 2AD9A 1Y10A 1ACMB 1I94J 3DOLA 1TK8A 1A7GE 2CUYA 3NOGA 3ZZTA 2HBRB 1KLMA 5GADU 2QMWA 2DR9A 2FTRA 1RT6B 2XWYA 1UZHA 1OY6A 2FHJA 3AB2B 4KKOB 4O0IA 3MR2A 5I3UB 3K8VA 4KHPF 3R7BB 5KT2A 2EWHA 4J9VA 5IC4B 3MF5A 5I4MA 1X5OA 3TWZA 2C28A 4F4YA 2ZD1B 4PRFA 3HFVA 2J6UA 2VG7A 2FVQA 1N48A 4RJVA 3TUPA 4LMZA 2BX6A 3T6BA 3MD3A 5LXYA 5M2UA 5FJ4A 4CI0B 3OXGA 4XTTA 2ZITA 4YDDB 3HPOA 3SSSA 2R8JA 2QJ3A 3MFIA 2W4PA 5KTQA 1Y7PA 5ETLA 4ECVA 3JYTB 2KTQA 3KG1A 4OHVA 3MEGA 4HLBA 4ZJOA 3PY8A 1NM2A 3CDWA 2G13A 3LPEA 4FXVA 3GFXA 3VGUA 4QPTA 4BCAA 1WOPA 1Y00A 5HP1A 3RTVA 3CE8A 1D1UA 4ES3A 3FZBA 2F3JA 4KH1B 4B9VA 3MI7X 3AJ1A 3D28A 2BUNA 5MAOA 3GYXB 4RW8B 4NI2B 1KLNA 2UU9F 1NZAA 4DZDA 5T7LB 4B3SJ 4F2RA 4N5SA 3IGVA 4MKBA 4ZKAA 3RB4A 1TQLA 4O3RA 1PKUA 3M8RA 3KFWX 3LUYA 1X4HA 3KK1B 3DRSA 2E66A 2E1RA 4JI0F 2W9BB 1IVZA 5J2MA 3DGPA 4HDGA 1FDBA 4PQUA 1K0TA 2Z8QA 4YN3B 5GAGI 3C16A 4DWIA 3SXLA 2XYHB 1X60A 3MMCB 2ASLA 1PJ6A 2RB7A 3Q8PB 3CXCR 3MXHP 1U6ZA 3LOUA 2B9EA 1UL3A 1RJJA 4R5PB 1Z1ZA 4RW9B 3Q86A 2DXFA 2VJUA 4FDFA 4A8YA 1DY3A 1SV5A 1BWVA 2O01C 4ZITA 2DNZA 3HHLD 1VBXA 1X4FA 2LXUA 2M3DA 4QU7A 2GQ2A 2A18A 1GEHA 2KDOA 4TY8A 3W9IA 4RW7A 5B08A 1LWEB 2C2OB 3DLEB 2XLKA 3EYZA 1U1MA 1W26A 3WDOA 2V67A 1KRPA 4H4MA 3WX4A 2NSBA 2MEWA 4UTGA 5D4OA 4PWDB 1RXOB 3V4IB 3ENQA 1UTAA 4USJC 4B02A 2UUAJ 4CLSA 2MJUA 3M2RA 2VL1A 2QT7A 2P8IA 4DS5A 4FS2A 2UUTA 4NXMJ 5HO4A 1TKXB 3TJAA 4X64F 4DR1J 2DRDA 3LQVA 1AB8A 4RUHA 1VQ6S 3VAGA 2HYIB 4EMDA 1W25A 1RUSA 1ITPA 2DH7A 3KLFB 4WP8A 4DR6J 1X4BA 2V4QA 2WVDA 4WYLA 1NKBA 2W7OA 4HT7A 2DGSA 1FKOB 3BPSP 5B0BA 3SSQA 4CTAB 1XBWA 1A6LA 1YVFA 3PRVA 4AL5A 3ET6A 5A8RB 1WHWA 3M9OB 2YKMB 5HQMA 4DL0C 3KLHB 5A8WA 1YJWS 4HH0A 5F8JA 2PC6A 2ZKTA 4QWEA 3NLCA 2QLWA 2VPZB 3M9MB 2R4FA 3ZZ0A 4OX9F 1SCJB 5C42B 2FLPA 2OGUA 1MN9A 2Z58B 2AEFA 1GMWD 2ZH3A 3C2PA 4R0JA 2YNIA 4CO3A 2EBEA 2GAGC 4U6PA 2ERRA 1FJGJ 1FD2A 1S0VA 4ZP8A 3V2UC 5B09A 3HHDA 5KFMA 4QYZK 4WTYA 1PAUB 2IA0A 4QQBA 1KD1T 2HBQB 1CJUB 4KH0B 4ID5A 2RQCA 2HFVA 4NZ0A 2CPZA 3TZWA 2AIRB 2UXDJ 3KLVA 2GMJA 4FYDA 3MPYA 2R2TA 3W5YA 4CO4A 2K3IA 1QD1A 1RTIB 1PSDA 3UE2A 4I4BA 2PD1A 4C11A 2MKYA 5D78A 1LEOA 3EZOA 3K5OA 1WC5A 2BABA 4RO0A 4V19X 3A13A 2KH9A 1J2VA 2AT1B 4WYWA 1MNEA 1RHRB 3TA1A 3ENWA 4P2MA 1UPPA 3GIIA 3UN5A 1EETA 4C4WA 2GJIA 4RBUA 5F8LA 1RT4A 3EGZA 1RT3A 4L73A 4C7QA 3SCJE 2RT3A 3G87A 2M8DB 1RWKB 4DMZA 4NPOA 2K1RA 1JLGB 4X4OA 1TKDA 3RRHA 1S6UA 3ZZUA 1B70B 4W90B 3MAAA 1I6JA 1PILA 1OYDA 2HFOA 2AF6A 2HWHA 1IBCB 1BQXA 1KKHA 2O5DA 2QA4S 1X0FA 4PG6A 2JLFA 3MMBB 2YNFB 2YX1A 3BYPA 4LUBA 4ZIVA 3RB6A 4DR3J 3IWNC 1KVJA 1TV6A 4DCPB 3MEEB 1TVRA 2RDDA 4OZ3A 1G2EA 1AUSL 4S0MA 1RACB 5KFZA 1HWIA 1P8GA 2ZBQA 2FGCA 1N32J 4PEOA 3BJYA 2LYVA 2OIHA 1TTHB 3DI6B 4MKYA 1T9UA 5HVHA 3LP1A 3H8YA 4LF7J 2OJ3A 1HFEL 1VHFA 2V94A 1LWCB 5EX0A 4ICLA 5GADI 2QEXS 1WOSA 2P6SA 3HSGA 4DR5J 3CC2S 2BM0A 1QTMA 2RDIA 4E8UA 3A3OB 5J2PB 3LP0A 4HHHA 1NPPA 3QMQA 2ZFHA 1FRMA 2DK2A 1NDKA 2YXLA 1U1LA 1UA0A 2YNHB 1GX5A 1RE1B 2KFZA 3NWRA 3MPWA 2K3KA 5AJ3J 3I0SB 4C0BA 3A12A 1T9VA 4AQYJ 2PFFB 2PDAA 2BKOA 3TZZA 1UWAA 4NZ6A 2VKZG 2HS3A 3M8QB 2Q3PA 3N0VA 2VB6A 1CS4B 2E44A 3KDOA 3BR9A 4F0MA 4IG3A 1VQNS 2FHMA 1KQFB 1UW9A 4ZHRB 2BV3A 2SXLA 2EBGA 2OUGA 2AEJA 3H42A 4I67A 4FN5A 2OI2A 3BZQA 3FBBA 3G2XA 3KXDA 3DM2A 1QVGR 1A9NB 3O6QA 2PO4A 4QIWD 4B3OA 1FERA 2H5JB 1BUXA 4MIBA 3QWPA 1WF0A 4LSNB 1RK8A 3OUYB 2BE7D 1M1HA 2Y8WA 5EHHA 1B0PA 3LGNA 5DDQC 1AT1B 2BOAA 2V8GA 2E1PA 3LP2A 4DCOB 3OHBA 2V2VA 3PJXA 5A2QY 1HWJA 1UVLA 1IKXB 3R2DJ 4H4OB 3IO1A 4CLWA 2H1YA 2X1FA 4F4AA 2IY5B 2CJBA 1SKSA 2CG8A 2RIJA 3NWGA 3MZIA 1JLBB 1GXLA 1JKHA 2XMUA 2MXYA 3LWLA 3VVTA 3GFYA 5D0EA 2VFRA 1SQGA 2VQEF 1NKEA 2HHTA 1DLOA 4PR6A 2V4JB 2KU7A 2XYPB 2XTJP 4A8XA 1F3FA 4LR9A 4LF4F 4A8MP 2A1BA 2Q79A 1EP4A 3I31A 1RHQB 2ADBA 2UXCJ 4NL5A 2W2NP 4O3QA 2OAUA 4RWXA 3W62A 2FHKA 5IQQA 2PA8D 2DD8S 1RHJB 3LTOA 1HMVA 2V2KA 3CCLS 4DV5J 2Z2LA 3L7OA 1PCAA 3HHEA 3QT6A 5H9EJ 3QBCA 1FA0A 1Y9OA 1WKLA 3KG4A 4ANDA 2NXJA 3B82A 3K5NA 1QAXA 2MJNA 1YJ9S 2IM1A 3EGNA 3AAWB 2HK2A 3GU0A 4DV7J 4BHQA 3UDLA 3UCGA 2F63A 2CQIA 3WZ0A 2LA4A 1N56A 1BQNA 5CH7B 1T3NA 3DLBA 2FJXA 3R1LA 3GSIA 1EAYC 2DNPA 4Z2XA 3DU5A 1FXDA 2DGTA 4X4TA 1EIYB 2WOMA 4F0KA 4KHRA 3BKTA 1L3UA 4DL5A 1HPZB 1JLQA 3MM8B 1RT5A 4V19J 3G8TA 3FDSA 1UW4A 1L3VA 2ACMA 1X4AA 1ZA2B 3DRYA 3UNYA 1X9SA 2X1AA 4LREA 3N5BA 3UN2A 4LRCA 3T1YF 4M5DA 3P5BP 3IWLA 1QSSA 1WWHA 4LF1A 5F8IA 4ECZA 5LT5A 1A0OB 4X4VA 5KFQA 3KMQA 1RAAB 4IO9Q 3US5A 2IAJB 4MK8A 4IOCQ 2B5JA 3KLIB 3M32A 4IQMA 4OI1A 1M5HA 2OPPA 1YJ7A 2NPFA 2DJWA 4WFAQ 2E5IA 2F9JA 1MROA 1H7XA 2YKPA 1SQEA 1S48A 1Y4ZB 2AGPA 3MPUB 3DRPB 3OR1B 4UF4A 3OXFA 1RHUB 4X66F 2FZCB 4ED4A 2CFXA 3HD1A 4HKQA 1ZAXA 1VISA 1VGYA 1FEHA 4KPCA 2XO6A 3CDAA 3JQKA 2QFJA 1OPZA 1GXUA 3FEZA 4ZPBA 3R2CJ 3HKZD 1JQGA 3LAMA 4TN2A 4ECWA 2JOQA 1SI9A 1ZM3A 3BN4A 1VC0A 1V5IB 3MPDA 3HHLC 3B8HA 3R8YA 5HAOA 2HNZB 2GIQA 3W9JA 4PXCA 3GPAA 3MURP 3GILA 2HKEA 3EZ5A 4FF2A 4ED7A 3EDRB 3OL7A 5JVGQ 4WK1A 1H2TZ 5IFMA 2A2CA 3ITHB 1XMBA 4I2QA 4B9MA 2ACYA 1C0UB 4TNOA 5DETA 4X84A 3T1HF 2Y0SD 2C1EB 4QWAA 5KT4A 4I2PB 2P9GA 4KV8B 2ZZTA 2KG0A 3T5LA 3EX7B 3MEDA 3AA8A 1T95A 4UOCA 2MKKA 2YWGA 1REVA 2FVSA 1RT1A 5E3PA 3HZEA 4DUZJ 1N0UA 3CSKA 1L3TA 1OJ4A 3MD1A 1WELA 3HD2A 1YQHA 3J7A1 3I96A 5CQGA 2OO4A 3PTWA 2BJDA 2XG8A 4LFCJ 2W4DA 1XTZA 2EFVA 4IRKA 2DNYA 4L3NA 1TK0A 4DV0F 3QLHA 9RUBA 1IKWB 1NSQA 3MOZA 4RUCA 3TW0A 4HACB 3RB0A 2W9CA 2MHNA 2Y1JA 4I6AA 1K1SA 4RWWA 5KFIA 3LGHA 3NG8A 5KG1A 4DLEA 3GV7B 2OKQA 2HHHF 3RBXA 4WZQA 1DJ0A 3ETOA 4ZOSA 1K1QA 2ZBRA 4KYZA 5A8KA 3ILOA 3VV2B 2NYHA 3W2VB 4Z7CA 2HNDB 3IXQA 2C2MB 3CCSS 1TUGB 3LW5C 3PR5B 3H5YA 4J9PA 2DPJA 3ZZPA 2UUCJ 2P2CB 1NRKA 2G9OA 1HW8A 2HFSA 3VZIA 4LF9J 3JTOA 4NLOA 2FB0A 3H40A 2E7VA 4K4WA 1OYEA 4F4KA 2CDQA 4ZPDA 4F8RA 4N41A 5IS2A 3E51A 4OHZA 3I87A 3KNGA 1U49A 2DNRA 5LMNJ 3JAMU 2W1BA 4G6VB 4HHJA 2ATCB 1BE4A 2MY7A 4KO0A 1FK9B 1LW2B 3NMRA 3KJVB 1XNRF 1JLEA 4ZPVR 1KTQA 4IH6A 1ZAWA 1NSAA 2VHGA 1NDLA 4K0KJ 3B78A 4ZVHA 5H9FJ 1RP5A 3D66A 3D6HB 1D0EA 3I4HX 2DGOA 5J2NB 1R89A 1GT8A 1HHTP 2BQ3A 1HW9A 4DPTA 1CC7A 3F56A 5KFXA 1CJKA 4DV6J 4FS1A 2KL8A 2J7WA 2N7YA 2Q6CA 2FIUA 1N5TA 1VYAA 2VKRA 3RRGA 1VQ9S 1WHVA 2RH3A 3J80U 4ZPCA 4RKUC 2HGNA 1Y3JA 1XNQJ 1WDTA 3OVBA 4PKDB 2N3LA 1VMBA 4IFYA 4NLYA 1FDDA 4J9LA 2YQ1A 3ONQA 3K17A 1NK9A 4UOFA 2E1MC 4KFBA 2F4VF 4LR8A 2B6AB 3KUEA 1T8EA 4EGLA 4URGA 1Q95G 3SQGA 1VQMS 2VUGA 4OI2A 4KTQA 1AZSB 3QGGA 2KN4A 2ILZA 4LIWA 3M8YA 1R0BG 3SDEB 3ZZYA 3BGRA 5CABA 2M4MA 4C3KA 1H98A 2W2PP 1FVQA 3OTBA 4CO1A 5D3GA 4ECSA 1BY9A 5RUBA 3UD5A 4I69A 4OIXA 1WKJA 1S1WA 4PG8A 4YY3F 3C6TA 5E3RA 3W66A 4XO0A 2JLGA 3OJUA 3K58A 3GV5B 2HQIA 2XC9A 4QOTA 1TAQA 2UV8A 3KG0A 4LF5F 5EGYA 5KFWA 4KC5A 2D9OA 1VQSA 2ROPA 3CC7S 3CJRA 3OTDA 3G8SA 1X7VA 1R3NA 2ZOFA 3BGUA 1L3KA 2J0SD 2XYGB 2VIHA 1HNXF 1LK7A 4DR7F 2UZAA 3UQSA 5HVGA 3IM9A 4DG1B 1EHWA 1S77D 3WC0A 1RAGB 1FRHA 2OFGX 2MSSA 5A76A 2BZ2A 4OYOA 2HURA 2OPQA 4URSA 2RSQA 1SBRA 2PIIA 3FCHA 3M7VA 4J7CA 2EKNA 1S9GB 3DOKA 5KFFA 5M2RA 1GQEA 1S6QB 2HGLA 4C3MA 1FXLA 3U7JA 4GO5X 3JQMA 3IRXA 2DNMA 3KK2A 4IH7A 2JJ4D 1YSJA 5C25A 1VQLS 5FLXY 3PYEA 1HQ2A 1L5UA 1HNZJ 3K5MA 5ETNA 3F44A 1KOHA 4LF6F 4ZVOB 2AJ0A 4CRJA 1YG0A 3ULHA 4NWBA 2VG5A 5DLGA 4H4KA 1T0TV 4WKRA 2Y1RI 4C48A 4M95A 1VQ4S 2OELA 1U47A 3GLJA 2CWXA 2VG6A 1Y5IB 3IP0A 4NMLA 5CYQB 3MECA 4C8LA 3M1VA 1IJFB 2VBWA 4PG7A 5KFSA 1NJIT 1N52B 5G0RB 2C2NA 4GMKA 1NLKL 2HAIA 4XK8C 5D0GA 2VFUA 1XMQF 4JI6F 1O6XA 3NBPA 2CDRB 2NSCA 4YB1P 3CIMA 4YQWA 2EPIA 3N28A 3AXKA 3UDEA 1SUQA 3SEOA 2WW4A 2VPYB 4GKKF 2XCPA 3TVYA 2CQCA 4DV2F 4DQRA 4IDKB 5KFAA 4PWWA 2CA9A 1CBKA 2G0IA 5JMNA 1RT6A 1XN9A 1Q8IA 3IBFB 3BN7A 4MIWA 1N6QA 4WF9Q 3M8WA 4HH1A 2R7SA 2F8MA 3OTCA 2HG4A 4HEA9 1IKVB 3R3TA 4NLQA 5L38A 4OHYA 1F9FA 2DNKA 3DXBA 4TYAA 3C15B 2WONA 2H65B 3J7Z5 4G1QB 3ILJA 1QE1B 2HNYB 3QATA 2IJNA 1EARA 1NCLA 3X3UA 2LA6A 4FF4A 2EFQA 2HBYB 4R8UB 4C9DA 3KOAA 2I5JA 1TAUA 2WSCC 1LFWA 4PWUA 4A8SA 3EPIA 4LF2A 2Z4PA 4DL4A 2E29A 1D9FA 4Q2MA 2OHDA 3QSIA 1Q8KA 5KFCA 1RWOB 2MKIA 1RYSA 2HS4A 4PPZA 1PGZA 4I68A 1RWNB 3SSRA 4AYBD 3MMAB 1U2CA 2M9KA 2JVRA 1P9QC 4IFVB 4NYPA 4OYIA 1HBOA 2PA3A 2YY3A 3EZUA 4KSEB 4NLDA 4NX9A 5B0EA 3AH6A 2XEXA 4LVNP 4TYBA 2YQ3A 2HHWA 4NA1A 3GIKA 1L3SA 7AT1B 4OZNA 3ZXWA 1M5PC 4Y28C 2CQDA 1VBYA 3BR8A 5F0UA 2XY5A 5HMZA 2RKIB 2W9BA 2XMVA 3QIPB 2RDJA 4DV4J 4MYUA 2BJ8A 2DR8A 1S7HA 2QYGA 3J7YU 1PYSB 5DS7A 2YWFA 5FDLA 3PACA 2FQQB 4C8OA 5KT5A 4A48A 1T03A 1H38A 1XQIA 2QGFB 1HQEA 2CVEA 1WD6A 2E7XA 4W4MA 1D8ZA 1CULB 5DZ6A 4N8OA 4FF1A 2NXCA 3ISZA 2XULA 1UEKA 1S1VB 4Y34A 3MM5B 1KP6A 3MPVA 1Q8BA 3FSXA 4ZCIA 2DR7A 3QT5A 4NCGB 1G1XA 1J27A 3U02A 1SL1A 1H2UX 3G71S 3FEYB 1RSCA 3FFIB 1Q82T 1DAXA 2QMXA 1LW0A 2UUWA 2IIHA 5I42B 3Q8SB 2P9CA 2UUBJ 1YHQS 5J1EA 1RWMB 3F73A 2E9TA 4P75A 1S72S 2YNGA 1N8RT 2LVWA 4U8VA 1C0TB 4EYHB 3V4IA 4RPFA 3A1YG 3FBEA 5IWAF 1TR0A 2MTLA 4WK3A 5BYSA 3RYLA 3JSBA 1DFDA 2LKZA 1RU2A 4ZDNA 2ZJPQ 4JV5J 1HNIA 3CTRA 4DL3A 3V6DB 2WAQD 1ZM4A 1YZ7A 4K5SA 2XSJB 1RHKB 1P27B 3MM7A 2JDJA 2RS2A 2W7AA 1NU4A 2XM3A 2GVZB 1I94F 3FCVA 2E5GA 1H3DA 3GG1A 1I3OB 1R8HA 4B3TF 1KONA 1UVNA 2BE2A 4NZ7A 3TAPA 1OQ6A 4N56A 1DTQA 5AE1A 2V34A 3ILIA 3NS5A 2CNLB 2FC9A 2MKSA 4K4UA 3T19A 4QR2A 2F7VA 4FPRA 2IRUA 3PKYA 4RL1A 4IOBA 2YVSA 2ZVIA 3CD0A 1R0AA 3EGVA 4QIFA 4DV3F 1QAJA 4ZP6A 4YDXA 4AFFA 3D5MA 4HI2A 2LQ8A 3CCVS 2MQPA 4KHPJ 3OR2B 5AE3A 2BQRA 1Q0NA 3Q0AA 4YOEA 2A10A 4P73A 4ZVTB 2KXNB 5EWGA 3TAQA 3M8SA 5EX3A 1GXTA 1U02A 4U8YA 1U1NA 4BS2A 3IGNA 3PHTA 3H5XA 5ETQA 2COLA 4OZ2A 3TEGA 2VU5A 3TZYA 4WFBQ 1ZYQA 2IPOB 3SFGA 2R7XA 1AFJA 1FNOA 2CQ1A 2NYIA 1FFGB 1DTTB 2FZKB 3OT9A 4Y2MA 5CCMA 4U9RA 4RNNA 3DLJA 1YDLA 2HIYA 4DQPA 3BGLA 3CPWR 3JQJA 4B3SF 3CDUA 3OSNA 2HS0A 2ZHOA 3CJ3A 1BMQB 1YX2A 2GHVC 1I51B 1SKRA 4OI4A 3KDNA 2HQGA 1IM6A 3MHYA 4RW4B 2HVDA 1RAJA 1U0SA 5ETKA 4BDPA 1VRUB 4Y3CA 4ES1A 3U1MA 3TA0A 4KGMA 1RDRA 5BR8F 4IQXA 1UZDA 2CZ4A 3W60A 1UJ5A 1NK5A 4JI0J 3KK3A 3CEDA 5J1NA 1C1CB 1FT8A 2D74B 1S1TB 2YTCA 3BSAA 3J80Y 3HP6A 3S7RA 1U45A 3VWSA 3C6UA 2EFPA 3HJFA 1LOUA 2E5LJ 4O44B 4XAKA 4K2JA 2JWNA 4FVMA 2B4UA 5CXTA 2KXFA 2W9AA 2GHWA 4J37A 3VAKA 4ZCLA 1RTJA 4I6WA 4G1IA 2XQCA 4DZ6A 5BJRA 1CJTB 3OTOJ 5KG6A 3VAJA 5D4LA 3SFUA 1R43A 3ILLA 1D09B 3VGSA 4JI8J 1S59A 2UUAF 1UEUA 4K4VA 4FYXB 2MKCA 1P6TA 2QLXA 4YMEA 1NZ8A 2VV5A 3NCRA 2KJWA 2D3O1 4NXMF 1WC6A 3RR7A 2IBOA 4EUVA 4DR1F 3SYZA 1FD8A 3QO9A 3AFGA 3OJSA 3CF5Q 4C8NA 1JNRB 2YPZA 1CSJA 2ZH5A 3KWMA 4DR6F 1VK3A 4OJ1A 1WKKA 1FF2A 1UFKA 2VBZA 4M5IA 3M8ZA 1T05B 1TL7A 1F9EB 4X64J 2RF2A 2GC8A 4F50A 3BB5A 3EJMA 2CZ9A 3MUVP 1S4FA 3AQPA 4JV1A 3D0GE 2Z56B 2FUG9 3HLUA 3DOLB 2L9WA 3CNQP 3DRRA 3RG6A 1KLMB 2DIVA 2WB1D 2V2QA 1CS4A 2QE5A 2CWKA 5HBMB 4NLRA 2FDNA 2V8DA 2AP6A 2DGXA 1PC5A 1K9MT 4DF4A 2KFNA 2XI3A 3N6NA 3PFOA 1VRTA 4NRUA 3HULA 3IBWA 1LK5A 3TA2A 1FJGF 4ZVFA 4QW9A 3MEKA 4FNIA 3S6EA 1UETA 2DHSA 1UKUA 3IAS9 2DNQA 3P96A 5KFNA 4OYWA 4Y00A 1ULRA 4DU7A 3MEGB 5L9XA 3NNAA 1J5OA 4EEYA 5HMXA 1JK9B 2XY6A 1XIQA 3ZZZA 2R7VA 2ZC3A 1RAOA 4CO0A 5HP1B 5D0RA 5IQ6A 3TAMA 3MDFA 1DQ8A 4KAIA 4WXWA 2R7RA 3CJ5A 2I6WA 4ETZA 4DSFA 1VIXA 4GO7X 3AB4B 1O8BA 3TUJC 5HMWA 2YX4A 1FTRA 3J7YI 2XLIA 1S76D 4K8RA 2KHCA 3FNNA 5CYJA 1B7FA 1PIEA 1OMSA 3EPGA 5GAGU 3S8SA 3HVRA 3DRSB 5DZ7A 4QYRA 1V5VA 3O5TB 4F4XA 3ZTRA 5KFEA 3DGPB 3FSIA 1JB0C 4E0DA 2POKA 4ED2A 4PQUB 3G82A 2ZHBA 2HLUA 2EC0A 4OI0A 4U7UD 3C16B 3TVZA 1LWXA 2ZH2A 5DDPC 4IH5A 2MKHA 4KRWA 1F3VA 4C2MA 1F2GA 2AJ4A 1SV5B 2EK1A 2N82B 3I9V9 2G2YA 2NCKL 4J91A 1WTFA 5GVQA 4CYUA 4M94A 2XS2A 4LQ9A 2VOOA 1N32F 4TY8B 2Z0GA 4RW7B 3POTA 1U09A 1TKZA 1NK0A 1Y3KA 1GNKA 4O23A 1UAWA 5HK4A 3UO0A 4H4MB 4LF7F 1RADB 2R8IA 2X3GA 2XY7A 1SIWB 1RT7A 3M2UA 1KSPA 5GMKa 4K4ZA 4RR5A 1V3RA 3UDVA 1HWUA 2F9DA 2YWEA 1ZTWA 3M2RB 4DR5F 4M1KA 2IMWP 3DMJA 4KGXB 2VDHA 5IT4A 2JEJA 1CC8A 2O67A 2XGPA 4X4UA 2RRAA 4JOUA 5A0YB 1AXQA 1FVSA 1HPZA 3FBCA 1ZOTA 5AXMA 2CPEA 1S97A 1VIOA 1S7IA 2VPXB 5AJ3F 3PCOB 4EBCA 2R7WA 2BANA 3BH7B 4AQYF 2H48B 2HQ3A 2NZ4A 2IVYA 2HIQA 3NXZA 2Z2MA 1B0VA 2CNOB 1REGX 3ET6B 3K8WA 2XMWA 4E2FB 3PVXA 2GAHC 2GMHA 1T9WA 5A8WB 1RTHA 2IAJA 1PO6A 3V6HA 3C14A 3ZO7A 3TYTA 2QFIA 1JLAA 4FYYB 1NEEA 3BS9A 3FC9A 3IA0A 3NNCA 1VQPS 2QSFA 3NGRA 1HA1A 1RCOB 1YJUA 4HR2A 3D6MB 1MWQA 1UVJA 2K8GA 3Q8RB 2ZH6A 3AJDA 4OZ1A 2I8EA 2L3MA 2N4CA 3GR0A 1FE0A 2HVHA 2YNIB 2W2MP 3IR5B
chains in the Genus database with same CATH topology
4TKTA 1H2VZ 2NPFA 2DJWA 4YB5A 5CCLA 4WFAQ 5FD1A 2DRAA 2E5IA 1U1PA 2F9JA 1JJHA 4X4NA 1MROA 3G96A 4DSJA 2V4RA 4PXDA 4Y65A 1Q8LA 1NK8A 2X51A 1TP7A 3UI3A 1H7XA 4ATNA 3L09A 5LMNF 1RTDA 3PRBA 2YKPA 1SQEA 3HF5A 3CDBA 3MGJA 7FD1A 1WEZA 1S48A 1Y4ZB 2KO1A 2JL9A 2AGPA 1R8PA 3DRPB 2PN6A 3OR1B 4RNFA 1JJ2R 3OXFA 2W7PA 2Y1IA 3H25A 2MZRA 1HBUA 4X66F 3OW2R 5CZVA 3PNIA 2R8HA 2BA9A 2CFXA 4O3SA 3KLGA 3TX8A 4FF3A 4RNMA 4ID5B 2NXUA 2MQOA 5DG9A 4XDDA 4HKQA 1ZAXA 2MMYA 1N0VC 2BRLA 1Z4UA 2D9PA 3NCPA 2RS8A 1VGYA 1FEHA 2ZZNA 3DLKB 5LSRA 2LXFA 3CDAA 4HI1A 4OJ3A 1U1KA 3KYLA 1JLFA 2QFJA 2IMOA 2XNRA 5E3QA 1OPZA 1GXUA 1M1KT 3FEZA 4ZPBA 2MZ1A 1XMOF 3W2WB 3HO1A 4HYKA 4RW6B 3HKZD 1VQ5S 3LAMA 4A8OA 4TN2A 1FESA 4ECWA 1JIHA 3CWJA 4LSLA 2JOQA 4HTJA 4UQTA 1SI9A 1ZM3A 3BN4A 1VC0A 2YKAA 2ABYA 4C11B 3IN5A 2UP1A 1FTCA 3GMGA 3HHLC 3B8HA 4HL9A 1N5YB 3ICLA 2F8EX 2GIQA 2DT9A 1X4CA 2HNZB 5AXNA 4OL8A 4MMOA 4DV6F 4CQ1A 2YKNA 4PXCA 3MAHA 1R8CA 3VZHA 3HHKA 4JI4F 4KE5A 3MURP 3GILA 2ZM6F 3CCRS 4J9SA 4ECUA 2F1FA 2G1DA 3EZ5A 3KLEB 3KK3B 1UJ4A 5G0RA 4DL6A 1U1RA 4FF2A 2HGMA 2M5YA 3ISNC 2J9DE 5KG3A 4ED7A 2PEHA 4YEAA 3GIMA 3OL7A 1EETB 4DR2F 1QAYA 3LANA 2XWXA 5JVGQ 4OHXA 4WK1A 1SKWA 1X5PA 3IG1A 1RT4B 3HM9A 1RT3B 3G9CA 4M8LA 1H2TZ 4ITSA 5E0OA 4ECXA 1R7IA 3TARA 4HVZA 3QAUA 3C6UB 5IFMA 2UXCF 2A2CA 1ZM9A 3ITHB 1XMBA 4P7VA 4I2QA 4UY8T 3CB4A 4EO8A 4B9MA 2X1GA 1Z2ZA 2ACYA 1XNQF 1C0UB 4USIA 2HRUA 2K7JA 5HL7Q 2JLEA 4TNOA 2NREA 3GQCA 5DETA 1SIZA 1IUJA 4N8NA 4YR3A 2K1RB 4X84A 4IDKA 1HR0F 2OPRB 3T1HF 1FRLA 2DR5A 7FDRA 4DV5F 4DSEA 2Y0SD 4QWAA 4EFAC 3CJ2A 3H4BA 5KT4A 1RTJB 3DDNA 4I2PB 2P9GA 4KV8B 2KG0A 3T5LA 3EX7B 3MEDA 4DSLA 4WZMA 1Q78A 2MKJA 3AA8A 2DB1A 4TU7A 4L6V3 4AXJA 1T95A 2JEIA 1IQZA 4UOCA 3PW7A 5GAHI 2HHXA 4ID8A 2CQ2A 4ELVA 2MKKA 2YWGA 1REVA 2FVSA 1HYSA 1RT1A 2VQFF 1IKVA 3EGWB 4A8FA 5E3PA 3HZEA 2GX8A 1AW0A 1NAQA 1N0UA 3CSKA 1JJ4A 1L3TA 2WSFC 4ZVEA 3MD1A 4M63A 1F60B 1WELA 4OX7A 2VFSA 2QSWA 4QWBA 1YQHA 3H59A 3J7A1 3I96A 3CCUS 4C8YA 4DV7F 5CQGA 2J9EA 4NXNF 3VALA 3I5AA 1TV6B 1NHVA 1YJRA 2BJDA 2OO4A 2XG8A 3OHAA 2CJKA 4RX6A 3MEDB 2A2DA 5K8OA 2W4DA 3N5FA 4ED6A 1XTZA 2EFVA 1CLFA 1TVRB 4OI6A 4DN0A 4IRKA 2B43A 5B0GA 2DNYA 4L3NA 1SJ4P 1R8AA 4G1QA 1TK0A 4DV0F 3QLHA 4GC6A 1QE1A 2HNYA 2VODA 2AX1A 4OLOA 2FLNA 1IKWB 1DURA 4KKOA 2N3OA 4UQGA 2KI2A 1ZETA 3FQKA 2CVIA 5I3UA 3MOZA 4RUCA 1UWBB 2GO8A 3QO9B 5KOXA 3BQ0A 3TW0A 3VAMA 4ECQA 1KFSA 2R2SA 3R27A 2R2UA 3RB0A 2BR0A 4QCLA 2W9CA 2EW9A 4EZ9A 2W8LA 5KFYA 2ZD1A 4Y2IA 3PFEA 5L9NA 2MHNA 4R8UA 1DZ5A 3PIOQ 2Y1JA 1IQTA 4PUOB 1K0VA 3LP1B 4I6AA 1K1SA 4RWWA 2FJAB 3GFHA 5KFIA 2IVFB 3AJ2A 3NG8A 2BRKA 5KFUA 5KG1A 2J76E 2RF2B 5E33A 1M5SA 4MIAA 5D4PA 2LEBA 2M88A 4DLEA 1N54B 3GV7B 3TVKA 4WU3A 3EXYA 3UFCX 3JSRA 2OKQA 1YBAA 2KM8C 4F3OA 4DQIA 2HHHF 3I56S 3FMBA 4ICLB 3LALA 2EG1A 2DO0A 4WZQA 1TL5A 2IM0A 1UVIA 3JYTA 3LPYA 3Q24A 1DJ0A 5IT0A 4UW2A 3UR3C 3ETOA 4F26A 1DBDA 2RJZA 2VH7A 3TUIC 3GIJA 1S9FA 3HDSA 5U47A 2R9LA 4RU9A 4QWCA 3OFHA 4K4YA 1DQAA 4ZOSA 3P49B 4LVOP 1RKJA 1K1QA 3HVWA 3MMAA 4EBDA 4QIGA 3CGIA 4X4QA 3DRRB 2DISA 4ALZA 4P2SA 4PXBA 3V81B 2MQNA 2YWKA 5A8KA 2KZMA 4MFBA 1NH8A 4IFVA 4LF8F 5DM6Q 3FZ2A 1HHSA 1NHUA 4QW8A 5JXSA 3OLAA 1M5KC 5EDWA 2IYGA 3W2VB 1QM9A 3HMJG 4B3RF 5H1SV 4FNHA 2JZ5A 3QGHA 3HHLA 2OTJS 1P1TA 2CIMA 2DCUB 2HNDB 2M52A 3IXQA 3OVAA 3CCSS 4NA3A 4X4PA 4J9KA 3M6VA 2VBXA 3LW5C 2UXBF 3PR5B 3UCUP 3H5YA 4J9PA 2PSZA 4G1PA 3ZZPA 3TI0A 2DPJA 4AL7A 4Q44A 3VQSA 4RW8A 3LF0A 4BC9A 2LU2A 5B0FA 1SJ3P 1VRTB 5GAEU 1NB7A 5KT3A 4AUKA 1R31A 2RKIA 1O0PA 1WACA 1NRKA 3QIPA 2G9OA 1S1UA 3MUTP 4K4XA 1ZH5A 3OFGA 3VAFA 1NK6A 1HW8A 3QYYA 4K59A 5T7LA 3VZIA 3DLLQ 3RAQA 4IG3B 5F0WA 2B4VA 5D4NA 1URRA 3JTOA 4NLOA 3R1HA 5K5MA 2FB0A 3H40A 3NKYA 3SCIE 4DHVA 3MR3A 4FXWA 4K4WA 5L8RC 2VC0A 2EFGA 2WB4A 4F4KA 3KK1A 4AE5A 3DM2B 2CDQA 5K14A 3DRXA 1WI8A 3QJPA 4ZPDA 2K2PA 4F8RA 4N41A 2CRLA 1D9AA 5IS2A 1YGYA 3E51A 4F25A 1J5OB 2J6TA 3U1NA 4OHZA 3I87A 2M2BA 3KNGA 3UCZP 1U49A 2CG4A 2ZHAA 1N5SA 1KN6A 4B3OB 2UVRA 3E8OA 3BQ1A 1VC5A 3T9ZA 2UVVA 4B9NA 2F8HA 3IR6B 3UR0A 3UPFA 2DNRA 3C66A 1S1VA 3PR4A 1FRKA 4NCAA 1IKYA 3MM5A 3J81Y 4OZJA 2ZJRQ 1IXKA 3H98A 3TAMB 2IBKA 2HFZA 2FVCA 3MMCA 4G6VB 4NCGA 4HHJA 4CZCA 3BSOA 1QVFR 5BYQA 3NP5A 4ED5A 3U1LA 2LDIA 2B9XA 1U8SA 5B7WA 2MY7A 3FFIA 2V8HA 4TU9A 2HMIA 3Q8QB 2DRBA 3W7BA 4FZVA 4KO0A 1FK9B 1LW2B 2HW3A 4CO5A 3NMRA 1B64A 3MR6A 3KJVB 1XNRF 1RKIA 3LP2B 3G6VA 4R5PA 5I3QA 3MFHA 1RA7A 1JLEA 4WCEQ 4ED0A 4RW9A 3CDEA 1KTQA 3IAM9 4ZPVR 4ZPWR 2G4BA 4ZVGA 4IH6A 1ZAWA 2C2EA 3KTQA 2XS7A 4X4RA 2MGZB 2VD3A 2LEPA 2XSFA 5KG2A 3HXMA 5JUMA 3UD4P 1XR5A 3PW2A 1S0OA 3B78A 2V8VA 2BJEA 4ZVHA 3I5BA 1YRXA 5E5NA 3C46A 5H9FJ 1RP5A 2LEAA 3OL8A 4DFKA 1X8DA <