3FEXB

Crystal structure of the cbc-importin alpha complex.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
80
Chain Sequence
b'LLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear cap-binding protein subunit 1
publication title The molecular basis for the regulation of the cap-binding complex by the importins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation, protein transport
total genus 16
structure length 80
sequence length 84
ec nomenclature
pdb deposition date 2008-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3fexB00
2CPZA 3UD4P 2RNEA 2DGVA 4U67Q 3FEYB 5CA5A 1WEXA 3ZZZA 1QVFR 3ZZYA 4FXWA 4Y00A 5ITHA 3CCRS 2OTLS 4W90B 2RS2A 1X4AA 1FHTA 2KN4A 1X4EA 1XN9A 5GADU 2RQ4A 2DO4A 2G0CA 2MKHA 2ZJPQ 2RRAA 1BY9A 2DNZA 2GHPA 1RKJA 2KYXA 2NLWA 4BS2A 4IUFA 5CYJA 1X4HA 3R1HA 3MXHP 2L9WA 2J0SD 5LSLA 3P49B 1YHQS 2I38A 2E44A 2E5IA 4TU9A 1FJCA 3MI7X 2EK6A 1YJNS 2M4MA 4WIIA 1R8PA 1UP1A 3PIOQ 1VQOS 3VAJA 1FJEB 4TU7A 2X1AA 1X4FA 2YH0A 2CQ0A 4C7QA 2RS8A 1DRZA 2DGUA 3NS5A 3SXLA 2DGXA 1Q86T 1F9FA 4LJMA 3MD3A 1WELA 1L3KA 4UQTA 1KQSR 2M7SA 3CMAS 3IWNC 2FPHX 1WHWA 2KU7A 2LKZA 3UCUP 5CXTA 1R8HA 3MUMP 2X1GA 3IRWP 1W2BR 2DNNA 3H2VE 2KFYA 2MZTA 2MZJA 2L41A 3G4SS 1UAWA 2AYEA 2MQNA 2DNPA 3LPYA 3P3DA 2VODA 2A3JA 2RVJA 1VQMS 1U1QA 2MQLA 1VQ5S 3CF5Q 2JX2A 1M5PC 5D78A 2U2FA 5JVGQ 3TO8A 5LXRA 1Q7YT 3H2UB 1NU4A 2KRBA 1OWXA 3CD6S 1WI6A 2DGOA 2KM8C 1H2VZ 5DM7Q 2OTJS 2BZ2A 3B4DA 3CCLS 2AYBA 1N52B 3S6EA 3VAFA 5DETA 3PIPQ 1QVGR 4UY8T 4C0OC 1S79A 2MB0B 4CH0S 2QEXS 2CPHA 1FO1A 1U6FA 3MUTP 1X5SA 4EGLA 2CPFA 5H1SV 5GVQA 4IO9Q 1B7FA 3SDEB 2MGZB 2CJKA 2CPXA 3UCZP 3CPWR 3MDFA 1X4BA 2MJUA 1WWHA 2PEHA 4PKDB 4F26A 1WHYA 3SDEA 1S72S 2MKJA 1X4CA 2DNMA 3TYTA 4TLQA 3UE2A 3VALA 1O0PA 2AYGA 1VC6A 4QQBA 1KOHA 1OO0B 3HI9A 3ULHA 4LMZA 1WEZA 4LIRA 5IM0B 3G6ES 5GMKa 3CCMS 1DZ5A 1UFWA 1WG4A 1NJIT 3N9UC 1VQKS 1U1OA 2MY8A 1M90T 1WG5A 2CQIA 2VONA 5IM0A 2MXYA 3R27A 1URNA 4ED5A 3MURP 1A9NB 4PRFA 1M1KT 1HL6A 2MPUA 1VQ6S 3S8SA 4CQ1A 2X1BA 2RT3A 2X1FA 3CCES 2YKAA 1YIJS 5IFMA 2MHNA 2RRBA 5MLCV 1H2TZ 1VBYA 2DGTA 2KXNB 3S7RA 1JJHA 4M5DB 1VC5A 2XB2D 1YJ9S 2AD9A 2I2YA 2DH7A 2HYIB 3J7YU 2F3JA 2DNHA 5GAGU 4CIOA 1VBXA 2RU3A 3VAGA 1ZH5A 3I56S 3B4MA 3THTA 4V19X 4IOCQ 3UWTA 3NNHA 2CQ2A 2FHOB 2CQ4A 2DGWA 3V4MA 1M5VC 2MY7A 2HVZA 2DNRA 1YWXA 1QM9A 1VQ7S 3U1MA 4F25A 2KG1A 3G71S 1VQ9S 2JVRA 2LMIA 2J76E 2BOPA 2KXHA 1WF0A 4WFAQ 2U1AA 2DHAA 2KHCA 1JJ2R 2G4BA 2ADBA 2KG0A 1PO6A 1HA1A 1VQPS 2HGLA 3CCQS 2YH1A 1WHVA 1SJQA 3CC4S 4RU2A 3DXBA 5DDQC 1YITS 2MSTA 3NNAA 3P5TL 1D8ZA 3D2WA 3BO4A 4Z2XA 2AYMA 4CH1A 2DNKA 2XNRA 3US5A 3P6YC 2MKCA 3L3CA 1VQ4S 3MOJB 2DB1A 4ERDA 1YI2S 1KOOA 2MQMA 3MUVP 2CPIA 3JB9k 3G8TA 5D77A 2M9KA 2JRSA 2M70A 1SJ3P 2OSRA 2LEAA 2KH9A 2LCWA 1WEYA 2D9OA 1U1LA 1U1NA 2E5GA 5GAHU 2JVOA 2N3LA 3UD3P 1ZZFA 1U1PA 1WHXA 2MJNA 1A7GE 5DDPC 1VQ8S 1CVJA 2V94A 2SXLA 4TU8A 3CXCR 1FNXH 1SJFA 1FT8A 1NO8A 5HL7Q 2DHSA 2RQCA 2MYFA 2QA4S 2DH8A 3VF0B 5JVHQ 1H6KX 2N7CA 3VAMA 1M5KC 3I55S 1M5OC 2CQ3A 2MKIA 2XS5A 3EGNA 1U1MA 2K8GA 1HD1A 1N54B 1X5PA 2CQ1A 2F9DA 3CCSS 2EK1A 4WF9Q 4WFNQ 1WI8A 1ZZNA 2DHGA 2JWNA 2CQCA 5LSOA 2KM8B 2N3OA 1YJWS 3FEXB 3CULA 1HD0A 2MKSA 2ZJQQ 1G2EA 2DNGA 2VOPA 2Q79A 4WKRA 1OIAA 2KXFA 1VQNS 1UW4A 2LECA 3BO3A 4QU6A 1KC8T 3LQVA 1K8AT 2MQPA 1FJ7A 2DH9A 3Q2TC 1DBDA 1X0FA 1K73T 4IOAQ 5LXYA 2HGNA 1U1KA 2VOOA 2KT5A 2LA4A 2D9PA 1U1RA 2O3DA 2PE8A 1X5OA 2ADCA 4PR6A 3Q2SC 2OIHA 3NMRA 5FJ4A 4F02A 2OSQA 5EN1A 3U1LA 1SJ4P 2UP1A 5HO4A 3RW6A 2DIVA 2LYVA 1FXLA 2XNQA 2DISA 2LXUA 3TP2A 3EGZA 5GAEU 2MKKA 1JJ4A 2CPDA 3VAIA 4QU7A 2FC8A 5IQQA 3BO2A 2K3KA 2DNOA 2MQQA 2CPEA 4ZKAA 2DNLA 1WTBA 4C4WA 1IQTA 3RW7A 2KI2A 2F9JA 3J7ZT 2E5JA 1AUDA 2NZ4A 2MSSA 2YTCA 3VAHA 3G96A 3S01A 4YB1P 2DITA 2CPJA 2LEBA 2DIUA 1Q81T 2DK2A 2MZ1A 3CCUS 2LA6A 2FY1A 3G8SA 2ERRA 1SJRA 1X4DA 2DGQA 4YUDA 2M52A 3G9CA 2MZQA 2YWKA 1RK8A 2CQHA 2XS7A 3HHNB 1X5TA 1VBZA 2D3OR 3CUNA 1JMTA 4A8XA 2E5HA 2MZRA 2HGMA 5LJ3Y 2ZJRQ 2LQ5A 5DDRC 2G1DA 5DM6Q 2J0QD 1VQLS 1WF1A 2XS2A 5BJRA 1KD1T 2M0GB 2M8DB 2WBRA 2B0GA 2CQDA 4OZ0A 2CPYA 3R1LA 2DGSA 2CQPA 3CTRA 3CCJS 3VAKA 3MD1A 2LXIA 1P1TA 3K0JA 2XSFA 4J5OA 1WG1A 2KRRA 1D9AA 4P6QA 2MZSA 5LJ5Y 1P27B 1Q82T 4WCEQ 2QFJA 3CMES 2CQBA 2L08A 2GO9A 2M2BA 2MMYA 3UCGA 2N82B 1VC0A 1U6BA 1X4GA 3NS6A 1H2UX 3NNCA 2KVIA 2MQOA 1U2FA 2OJ3A 1DHMA 4WFBQ 3BEGB 2DO0A 2EVZA 2J8AA 3OW2R 2HZCA 5DDOC 1N8RT 4FXVA 1OPIA 3CC7S 2FC9A 1N88A 2MGZA 2DHXA 3EX7B 2DNYA 1K9MT 4QPTA 1PGZA 1SXLA 3CC2S 1WF2A 2DNQA 3DLLQ 2M88A 4Y0FA 4W92B 3SMZA 2M8HA 3THPA 4OZ1A 4YOEA 2CQGA 3CCVS 1YTYA 3BS9A 2RUGA
chains in the Genus database with same CATH superfamily
3FFIB 2KDOA 4JYAJ 1H73A 4B3OA 5A8WA 1GK8A 1T03A 3RB0A 2DEJA 2RKIB 3R5CA 1KR4A 2IAJB 1CBKA 2MKHA 4OYZA 2HQIA 3KXDA 1B0TA 4KGZB 1IKYB 1YHQS 4MKBA 5EWEA 2F63A 1YJNS 2HHXA 4M5DA 3HXMA 3CJTA 2VA3A 1V6HA 3M30A 2YH0A 2BQRA 2CQ0A 5EX0A 4DL3A 3R7NB 5F8HA 4LF6J 4TLRA 1HWKA 3VGTA 5H9FJ 2I1RA 3DDIA 3OPKA 4Y2CA 1I6JA 2N7YA 2LKZA 3MUMP 1S1TB 3P3DA 4PQUA 3PNIA 1LEOA 1FRIA 4FPRA 1RCXB 3D5MA 4DWIA 5E0OA 1OWXA 3CD6S 5IC6B 2BA9A 4C8LA 4RBVA 3GWCA 5DGBA 2Y9HA 3BN7A 2HNYB 3GJTB 3CIMA 1KQKA 1N0VC 5HSPA 1R6YA 1LWCB 3RGIA 3WX4A 1JXLA 3AAWB 3BV8A 4F26A 1HQ2A 3BBBA 4P72A 4F7VA 2XI2A 4ZHRB 3TEGA 4KTQA 2CXEA 4M5GA 3DKDA 2KYZA 3IO1A 4OZJA 3ULHA 1OO0B 1X8DA 4KGMA 4DV1F 4ED8A 2PD1A 2MY8A 1J5OB 1Q4RA 4DSJA 3R27A 2BUNA 4UF4A 2HNZB 1HLWA 4OYBA 5E41A 2X1FA 2XHWA 5IFMA 3QFHA 1SB6A 2DGTA 3MF5A 1YJ9S 3MEKA 2LFVA 5CYQA 1RE1B 4IG3A 4NLDA 4IH7A 4MIBA 3R3TA 3OUYA 2W7AA 1J5EF 4OZLA 4DHVA 1TFWA 1C0TB 3CJ4A 2KB2A 3C6TA 2FHOB 1UJ5A 4F36A 2IA6A 2RSQA 3HHEA 4Y65A 3G71S 5DQIA 1FX4A 1WF0A 1ZAXA 4ZITA 1QAJA 3DOMB 4PEOA 3GE9A 3DXBA 4OYMA 2RILA 1IKVB 2HIQA 1RT5A 4PQAA 4QR0A 4WU3A 2MKCA 4RNNA 1DTQA 3NLCA 3JAMU 1QSYA 4O3QA 3R5GA 2M9KA 2ZZNA 2HHPA 1GEHA 1SJ3P 3HO1A 3N79A 1RWVB 3OHAA 4CO5A 1NK8A 2W2QP 4OX6A 3M2VB 2ZDOA 1PAUB 4JI5J 3DU5A 2WONB 1VHFA 2V94A 3M6VA 2D7SA 1SJFA 2G2OA 5HBMA 5I42B 1NPPA 3THVA 1FD8A 4AL7A 4G65A 4LR8A 2RIJA 5HMXA 4Y28C 3O1LA 5M2RA 1WI8A 4OI4A 2KM8B 4WTOB 3OHBA 1OIAA 2KXFA 3HHLB 4OYOA 2V4RA 3KK1A 2DH9A 5C42B 2PO4A 2KT5A 4FXDA 3PV8A 4UY85 2IRUA 2PE8A 4FS1A 1SI9A 4IOBA 2QGFB 2Z2ZA 5JMNA 4E0DA 2CJ9A 4R5PA 4CLWA 4LRAA 3FCWA 3H4BA 1HHTP 2FY8A 5LMUF 1E6VA 1SH3A 1S5ZA 1UWBB 4DUTA 2R4FA 1WTBA 4BC9A 2JEFA 2KI2A 2OFGX 1F3FA 4NLQA 2J7KA 3W8PA 1KKHA 2DK2A 3H5UA 1GMWA 3V6KA 3CJSA 1SVDA 3HFZB 4DU7A 3S1TA 3LPEA 4J9MA 4ZN3A 1C1BA 1MMLA 2RDDA 5DG8A 1JMTA 1S1UA 4ZDNA 5LJ3Y 5E3PA 9ATCB 3SZ2A 3KWMA 4AYBD 1DQ8A 1JLCB 4OJ1A 1HPZB 2W1BA 4RPFA 3RBXA 1TVRA 3LP2A 4WCEQ 3PRDA 2JNJA 4LSNA 1XNQF 1VC0A 3A1YG 1K0VA 2KVIA 3VVTA 4J7CA 4PG5A 2VKRA 4FYXB 3MR7A 2HZCA 4B3MF 1RTHA 3QAUA 4PXCA 1PGZA 2HWTA 1TAUA 4J9RA 4W92B 2BKPA 4AD6A 4TY8A 2DGVA 4L74A 4TYAA 3W2VA 4DUZF 1KP6A 4HACB 1S6PB 4RW9A 1XC9A 3DYAA 5DZ7A 1YX2A 2HZAA 1GNKA 4MAKA 4K2JA 1X4HA 2ZM6J 2LDYA 4BLGA 3LP0B 3IS9B 3W9JA 2R9LA 2DRAA 1X9MA 1O5JA 3C6UA 4ZS6A 2EK6A 2B9XA 4OI3A 4RR5A 3EXCX 3NS5A 3TRGA 1RT7A 3UNYA 1WHWA 1TKDA 3UCUP 4R8UB 2A6MA 3MECA 1S99A 1CG2A 3FCVA 3JSMA 3TA1A 3NY0A 2YNHB 5ETSA 2H51B 4JI2F 4PCQA 1TAQA 4RL1A 3POTB 4C9DA 4EUVA 3X1LB 2UUBJ 1TKXB 2QEXS 3CE8A 1F2HA 3F44A 4A8QA 1RYSA 2ZE2A 5GMEA 3CPWR 2MJUA 3BSOA 2Y1IA 1NHKL 3MEDB 2IBOA 3FBBA 2R2RA 4NXMF 1S72S 3AB4B 1L3TA 2MKJA 5CYMB 4TLQA 3E2EA 1YJTA 4JI7F 5HP1B 3QZ7A 4I2PA 2NXNA 3MEEB 3FSYA 4Y2KA 4ECYA 4EBCA 5GMKa 3R2DJ 2C3OA 1M90T 2MXYA 3CO0P 5HN0A 4CNZA 4C11B 1N33J 2RT3A 3TWZA 1VBYA 1IM4A 3QT6A 2ZEJA 4Q44A 2DNHA 4CIOA 4N41A 4A8OA 1Y00A 1H72C 5EWGA 3TJ8A 4O3NA 4XPEA 4DOZA 5GMDA 3UWTA 2BMBA 2CQ2A 3H5XA 1S1VB 4M63A 2GIFA 2W01A 1FEHA 5B09A 1JNZB 1G4CA 3SV3A 3IM8A 4BWJA 4FZVA 2V2QA 2GNKA 2BE7D 4RNHA 4USJC 3PW4A 3K5OA 3DOLB 2P9EA 1JLQB 2ZDPA 2BM1A 3D54A 4YR2A 4F4XA 1RT6A 1FDNA 4EO6A 2ZHBA 2RD5C 4DV3F 3R6LB 4YP3A 4G1QA 3RBDA 2YQ0A 1JK9B 1PG5B 4NXNF 4N8OA 1HNXF 3QGGA 2Z57B 1JLEB 2B6AA 3C46A 1XNRJ 1CC7A 4HH0A 5F8LA 4DQIA 4P52A 3D1OA 1FWLA 2VJUA 5KG4A 3AQOA 3UDCA 3I55S 3DU6A 3EGNA 1U1MA 4A8YA 1N54B 3CCSS 2AT1B 4K5SA 4B9LA 2HBRB 4DUYJ 1V3ZA 3EVMA 3GB0A 1VMBA 3PKMA 2GVDB 3LQVA 5KT6A 5IV4A 4IOAQ 5LXYA 1UCNA 2KT2A 4DQQA 4K7QA 4GC7A 3DLEA 3TP2A 3MM5B 1REGX 4F4YA 2W9BB 4DR7J 5KFNA 1TTHB 5KFOA 4EK2A 3J7ZT 2FLLA 2YTCA 5I3UB 2XCAA 5LM7E 3TZWA 5L1KA 3TUJC 2K3IA 2MZQA 3Q8SB 5KFAA 1JLAB 2XS7A 4JV5F 1HFEL 3I0RA 1JLBA 5BR8F 2LQ5A 3M8WA 3JQKA 3TQEA 2XS2A 1WF1A 3IA0A 2CPYA 2PMHA 4EZ6A 1NSKL 2YVSA 4ZVHA 3ZTSA 1KVIA 2D3ZA 2KRRA 3MMBB 2V8VA 1IWAA 3CMES 2CQBA 1WDTA 2HLUA 3AXKA 4FF3A 4U8YA 5IT9U 1U2FA 3P5BP 4RJVA 1XMQF 3GTYX 3C19A 2WW8A 3QIPA 3NL0A 4LFAJ 3CC2S 4EYHB 2NPFA 5CCMA 4B3OB 4DR2F 2PFDA 3BS9A 1PJ7A 4J9SA 3BGOP 1B0VA 3RR7A 2C3MA 1QVFR 4DG1A 2V9WA 4W90B 1X4AA 3QATA 5LMNJ 5KG2A 4URGA 2DNZA 2B3TB 2VBZA 5B0BA 1RKJA 1VK3A 3GIRA 3CW2C 2GQ2A 2E44A 3KFWX 1FJCA 5IQ6A 2VKZG 3AFGA 4AFFA 4HTIA 1HKAA 1LWEA 3KUHA 3UNGC 4DV0F 1IQZA 1V5VA 4LF8F 2ZH8A 2FJDB 3IAS9 4Q45A 2FPHX 1T11A 2N4CA 5G0RB 1RWWB 2NYIA 1Y5NB 3TZXA 1CC8A 2HHSA 3IM9A 4RO0A 1S49A 2V67A 1FRKA 2DTJA 3VQTA 4HTJA 3NWGA 3PEHA 2HHHF 2Z2MA 5AXLA 1U6FA 2A10A 3OVBA 1D09B 5KFXA 5H1SV 4DZ6A 3T1YJ 5IXUA 1X4BA 3EMTA 4FKYA 5F8IA 2KFZA 4N8NA 3ISND 4OI2A 4JBCA 2ZBRA 1U8SA 3FEZA 4DV4J 1C2PA 4NYPA 2J6UA 4ZMMA 5LL6d 2MHNA 2VDIA 1DAXA 4IG3B 1H2TZ 3BPDA 2OMLA 2GCFA 3OUYB 5FLXY 2AD9A 3B6BA 2QRRA 5E3RA 4DV5F 1IXKA 1Q5YA 1EETB 3Q8VA 1QJHA 3C6TB 1TU0B 3CJ2A 1ZH5A 2CRLA 3HD1A 3MTJA 4O23A 2CVEA 4G1IA 1Y11A 3K8VA 1WOSA 5K14A 2HFVA 1S9FA 1YWXA 4ZCIA 4X64F 1OY6A 3U1MA 3DLGA 4TN2A 5KFTA 3NRBA 1TUVA 3V5RA 3J80Y 1APSA 3JXOA 2VQEF 1RT5B 1VQPS 2YH1A 3M9NB 1NXIA 1DTQB 5DDQC 4GVBA 5IWAJ 1XEZA 5KT7A 4RW4B 2XNRA 1T9WA 3W5XA 1I5OB 1VQ4S 2HPUA 3ZTOA 2YWFA 4UT4A 2HRYA 3DRPB 1RTDB 2UZAA 4JI0F 1HWUA 2JRSA 1PBAA 4WE1B 2YWGA 3B82A 2YKPA 4O4GA 4JUZA 1UKUA 5GAHU 1HBOB 1NPKA 2NQPA 1SKSA 2VG5A 2ZBQA 4WBFA 4FF2A 4F2SA 3CXCR 1S6QB 5KFFA 4NZ7A 5HL7Q 3QT5A 2RF2A 2DH8A 4PWWA 2QLWA 2H9ZA 4QCLA 2B51A 3AQPA 4OLPA 4FDFA 4K4ZA 2YQ3A 5J2PA 1KTQA 4IR9A 4EBDA 1VCTA 2Q79A 2BKOA 2W4PA 5C25A 4KGVB 1RBLA 1RYRA 1K73T 1U6ZA 3BSCA 1BXNA 3FK4A 4R5PB 1X5OA 2XSJA 3NKYA 1FWPA 3RW6A 1JLGB 3CDAA 1WKKA 3M4XA 1TK5A 2JC1A 1AFIA 4B3SJ 4QJVA 1OYDA 4ECQA 4MTPA 1R27B 3CD5A 2WZ1A 4Y6IA 4LFCJ 5HROA 2E5JA 3UO0A 2MSSA 2JZ5A 1C1BB 3RRGA 3PVXA 1S1UB 2XWXA 5ETPA 3W2WB 1VBZA 2HVIA 3CUNA 2ZWOA 4LF4J 3J7YI 3ZZUA 2QMXA 4ZVGA 1AZSA 4IG0A 1VQLS 4DR6F 1IBKJ 2AMCB 3HF5A 4RWWA 4NLSA 4LSNB 1JLFB 1ZS6A 2EW9A 2OMOA 1Q82T 3MR2A 4WPAA 2M2BA 4OHWA 3NS6A 2XY6A 1RTHB 2NREA 3DLBA 1UVJA 4FXVA 4IRCA 2LU1A 3M2RA 3NGRA 2MGZA 2H54B 4QPTA 5FDLA 2BRKA 4TY8B 2BW7A 4UOCA 4OZ1A 1J2VA 3W2VB 2IRXA 1VRTB 1KTVA 2BEFA 3ZZZA 3ENVA 4K8RA 4ZCLA 1BMQB 1H3DA 4C48A 1GMUA 1YRTA 2NSBA 2Y0SD 3D1QA 3C6UB 3QJPA 3T1HF 3FDSA 5ETQA 1UFKA 3DHWC 2VV5A 3GCXP 1UP1A 1PKUA 3OLAA 2F5GA 2J9EA 1T02A 2RS8A 1JX4A 1Y3JA 1LV5A 3MECB 3KLIA 3DDKA 4UQTA 4DSKA 2RHSB 2KU7A 1RT1A 3C15A 3MCSA 3GJRB 1IBMJ 1HQEA 5ETNA 2VODA 1RWPB 4IFVA 1M5PC 2U2FA 7FD1A 4K4YA 2Q6BA 4KO0A 4WWSA 2J7WA 3OFEA 1H2VZ 4DL2A 4ED7A 4WJBA 4PYDA 1WTFA 4YHHF 3LUYA 2ZE2B 3R9LA 4KPYA 4YN3B 3D67A 1TK8A 3L7OA 4B9UA 3CVKA 4A46A 4Q7AA 4YY3F 1T8EA 2CVIA 3GMGA 1RADB 1RWOB 4Q5VA 1WG4A 3RAXA 2UUCF 2A0FB 4CM2A 1DLOA 2LLZA 4NCAA 3AD9C 1QAYA 1SC1B 2BOAA 4LF8J 1NK6A 2KJVA 2K7KA 5T41A 2MPUA 2X1BA 2D41A 3DXSX 2HQFA 5EUHA 2QL7B 2CUYA 1L3UA 2DH7A 1D1UA 4KV8A 4L6V3 5C7PA 3NEKA 1VDHA 3KJVA 3QMQA 3W9HA 3B4MA 3JAMY 5KFKA 3KLHA 3OSNA 5AT1B 2VFRA 1FEEA 2HVZA 3P4UB 1VQ9S 2GO8A 4M5IA 2BANA 4WFZA 1O51A 2KHCA 3I9V9 4DCJB 3TVYA 2O1PA 4CH1A 2DNKA 2OEJA 4OQJA 3QZ8A 1ACMB 3P6YC 4KFBA 2BDPA 4G1QB 2YWEA 4ZPBA 4DPYA 4ZVRB 2B4VA 3BH6B 5J1PA 2RH3A 2UU9J 2B6AB 4OYAA 2VBWA 2LEAA 5KFWA 5D15A 1DJ0A 4MT1A 2AJFE 1NK4A 3QPIA 3HT3A 1KDNA 1B64A 5HK4A 5HJYA 3HK2A 1EARA 2CQ3A 4FYWB 1G3OA 2J0WA 1KS2A 2EK1A 3D0GE 5L8RC 1HYSA 3HKWA 1FKPA 1ZAVA 4MH8A 4X62F 2DNGA 2F65A 4RUCA 3GYNA 4DL5A 1IR1A 2L9DA 3HSGA 3DLEB 2VQEJ 3DLKA 4JOUA 2Q66A 3Q2SC 2F8EX 5HLFA 4J9QA 2IDLA 2IHR1 4OI6A 3H5SA 2CPDA 3IWLA 5KAKA 2ATLA 4JI0J 2VPWB 3M32A 2ZZTA 4FVMA 5A8KB 3MGJA 3G82B 4EZ9A 3G96A 4QZVB 2E1CA 3I31A 2MZ1A 5E33A 3KKFA 2XCPA 4OV1A 1L3VA 2EG2A 5A2QU 3Q24A 2HVHA 2G0JA 1R0AA 4CYUA 4H4OA 2OKQA 1RT2B 3HULA 4J9NA 1IR2A 4DF8A 3PO4A 4JI4J 2I8EA 2GAGC 3F56A 3K0JA 1RBOB 1UL3A 3VV2B 1Y9OA 2VICA 1TUGB 2F4FA 2CYYA 2MKYA 3M1VA 2LQ8A 3QT7A 1O6XA 1U8WA 1QTNB 1FNOA 1BQMA 5A0YB 1FWKA 4ICLB 1HIYA 1S1XA 5J2MA 1WF2A 2CZ9A 2ZC4A 2G1HA 3TA2A 2XZTB 2VBXA 5E3AA 4CLKA 4ECUA 5RUBA 3ZZYA 1FVSA 1TL5A 1BWVA 3MPVA 4HDGA 3SFUA 1UEUA 3LGNA 3PYDA 4IFYB 4DSLA 4CO4A 2JFKA 2RRAA 2WVBA 3U02A 3FBEA 4AL5A 1NEEA 2V9KA 1FKAF 2J0SD 2ZOGA 2EFQA 3J81j 4DR6J 1LWEB 2YNIB 1IM6A 3OXGA 4KPCA 3GFYA 3QRRA 2R8HA 1O8BA 3FZBA 2UVWA 2MLZA 1UWAA 1DRZA 2CZ4A 1L3KA 2C42A 5AE2A 2EFVA 1UEKA 4O3PA 2MZTA 2I5JB 2WB1D 3LPYA 4PUOA 4F4WA 1CJKB 2J6SA 3QJJA 1S4EA 1Y0HA 2RVJA 1MG7A 1HNIA 4YDDB 2X51A 4WYWA 2MLYA 3KOAA 1NJYA 4K0KF 3MM8B 5EHHA 4Y3CA 5KFEA 3HFKA 4RUAA 4QYZJ 2MB0B 4DCOB 2PFFB 3KLVA 1UEVA 2QC3A 1S9EA 1X5SA 2XULA 4CWBA 3UCZP 4DL6A 5HQLA 4UOHA 3CB4A 1WWHA 2PEHA 1RABB 3CJKA 2BM0A 3QSYB 2PDAA 5E3QA 2HS4A 1D0EA 3UE2A 3QWUA 2V8HA 1O0PA 1XK8A 3HI9A 1FJGJ 2WOMA 1NJIT 3N9UC 4J9LA 2AGOA 1VQKS 1WG5A 2VONA 3BGLA 5T7LA 3D4JA 1HMVB 4NCGB 5JXSA 3S8SA 2VASA 3AOAA 2KTQA 3D3CJ 1F9HA 4NWBA 3R5JB 3LALA 4C8KA 1VBXA 5K14B 2B4PA 2FYXA 1EP4A 1UZDA 5KG6A 3DLGB 4YHHJ 4LF9F 4OZNA 4NCBA 3T9ZA 3RRHA 3TOQA 4KIAA 1N32F 1TUWA 3DOKA 3HLUA 2AW0A 5D6GA 5ETOA 2GJFA 3GFZA 3GYXB 3GLJA 3AHPA 3QLHA 6AT1B 1KOOA 1LW2A 2NYHA 4W98A 1YGYA 5DZ6A 3G8TA 4LFBF 2OPRB 4R25A 3LTOA 1FD2A 4O4GB 4CDIA 1S0NA 1W2IA 2FVPA 1NH8A 2VG5B 1U1LA 3LAKA 4RW6B 1ROFA 4XTTA 2OPSA 3W9IA 4DR1F 2FJVA 3KLEA 1DTTA 5CZXA 2DCLA 3EUNA 2C2NA 4C2MA 4JB8B 3KHHA 3GIJA 2AV5A 1YZ7A 2DJWA 4HL9A 4UUWA 3SSQA 5KG0A 2HBZB 5C25B 2MKSA 2ASDA 3MZIA 4KQZA 2LEPA 4U9RA 5E3CA 4YB7A 2VC0A 4EMDA 2XSJB 2VHGA 2FIUA 1S57A 1NZ8A 1WUUA 1G6BA 1S1WB 3FGVA 4NRUA 2IAJA 1RAOA 2IC3A 4RNMA 3U1LA 2FLPA 4Y2MA 5CD4H 1N34J 4NLWA 4UOGA 2OAUA 2BACA 5HROB 1IKYA 4ZKAA 1NJXA 5B0AA 2DNLA 1OPZA 1KBRA 3A3PB 2CJYB 3IFEA 1Q81T 4J9UE 3IGNA 4ID8A 4X66F 5IT9Y 4NLUA 3SCKE 3BYPA 1X4DA 3JQJA 1AZSB 3A8KA 4IG0B 2NXUA 1M1HA 3CO9A 4YB5A 1S7IA 5DM6Q 3Q8QB 2QA4G 1RAIB 2M0GB 4JI8F 1DQAA 4HHJA 1F3VA 2LXIA 2XSFA 3AJDA 1YDLA 4N47A 2B5JA 3ETMA 2ZH4A 3I4PA 4Q2LA 2L08A 1V3SA 2N82B 3UCGA 1VQSA 3H2LA 3JYTB 2XG8A 2IVMA 3SI8A 3IRXB 4N56A 4HH1A 2CDRB 5BYQA 2HNYA 3DN9A 2V8PA 2DHXA 3DLLQ 3MR5A 3BBCA 3AJ1A 4KHPJ 4XIUA 4DQPA 3ZNJ1 2AX0A 1HNZJ 1MSWD 4TNOA 1J5OA 3FNNA 1RTIA 3OTOF 1AA1B 3TARA 2BKNA 1L5UA 3ZXWA 4F50A 2HLTA 4KY3A 3PIOQ 1T0TV 1RHRB 3KLIB 1S4FA 2OH2A 2OFHX 3LW5C 2AU0A 1RT1B 1RAGB 3C15B 3QGIA 4X65J 1WELA 1C0TA 1HQEB 1ZA2B 3BQ2A 3HVTB 3LWMA 1KNZA 1NSAA 2R7TA 4ZLNA 2E9ZA 3M9MB 1PJ5A 5BYRA 4KO0B 3IAM9 5L1LA 1VQ5S 3CF5Q 2C3YA 1Q16B 2KRBA 5KFLA 3DOMA 2XMJA 3PX6A 3B4DA 1IKVA 1U49A 1S6OA 4MK8A 4CH0S 3MUTP 3DI6B 1ZM3A 4EGLA 1RTJB 1TZ0A 3MPDA 2PMZD 5KFRA 3ONQA 2FGCA 4ZVUB 5A6WA 3M2VA 2BX6A 2VUGA 3VALA 5AE3A 2ZVIA 3NG8A 1KOHA 1DLOB 4HEA9 4OIXA 1UFWA 5L9XA 5I42A 3RZAA 1GXTA 3MPYA 1URNA 2F40A 2CJBA 3PY8A 1OJ4A 2AJQA 2XGPA 1N5SA 3RTVA 3CDUA 1AW0A 3M6WA 2ZUAA 1MNEA 3S7RA 2D3UA 2HK3A 2VB6A 3HHLA 3J7YU 3KLHB 3PJWA 4M5NA 3GG1A 2IVYA 2OUGA 1RA7A 2R3VA 3F41A 1TL3A 4IH5A 2Y8YA 3PW7A 3IG1B 5K8NA 1H7XA 3NCRA 2UXBJ 3PYEA 1NKBA 3W62A 3OR1A 3K58A 2UUAJ 2W2NP 4IDKB 1T9VA 1CLFA 2ADBA 2AHOB 4KFBB 2MSTA 3F73A 5F8NA 3K5PA 2QSFA 3JSYA 2FJWA 2FDNA 4DMZA 2AJ4A 5AJ3J 1YQHA 2HQGA 1JWWA 4DR3F 1K1QA 1UVIA 4IR1A 4OHYA 2R7UA 3FKBA 4HVZA 1JLCA 1HPZA 2FVQA 1NB2A 4X4TA 2N3LA 2V2KA 4B17A 4V19J 3UVJA 2PT0A 2D69A 1FTCA 3OT9A 3W64A 2F9DA 1LWXA 4QIGA 3NGSA 4DFPA 4F4KA 5D4LA 3K5NA 3OR2A 4A8WA 3DLKB 2DRDA 4X84A 4JI1F 5LSRA 2HGNA 1U1KA 3MPUB 1E6YB 4HACA 2ADCA 1S6PA 2K2PA 2I0XA 3M32B 4Z7CA 3TR5A 4ZJOA 1L3SA 4LFBJ 1RBAA 4MYUA 2K7JA 4LBHA 3IS9A 4C8MA 1NK7A 4AXIA 3Q0AA 2F1FA 5HMZA 2DITA 4YB1P 4O44A 2B4OA 3EE3A 3DDNA 4DX7A 1R0AB 4CYUB 1JXVA 1N5YB 1S0OA 3OVAA 1JXEA 3FRZA 1BQNA 4U7UK 5DDRC 1QD1A 2AEMA 3J81U 4R8UA 2D3O1 6FDRA 1R8AA 2DGSA 2C2DA 1TP7A 3R5AA 2RQKA 2YNHA 2BE9B 1H38A 3M1VB 4CO0A 4N77A 1T95A 4C8NA 2W7PA 1BQMB 3Q89A 2R8KA 2V50A 2UXDJ 3VGSA 1TKXA 1S1XB 5J2MB 3T5JA 3U7JA 2MDAA 1IBCB 8ATCB 2H5JB 2V69A 5HMWA 2C2KB 1UA0A 2IFXA 3UDLA 4Y0FA 1Q8BA 1EX8A 4DR5F 2CFXA 5J2NA 2CAJA 1B7YB 1S76D 5CYMA 2Y1JA 3PR4A 3K7RA 2R2SA 2EWHA 4N76A 2GIQA 5ITHA 2LU2A 4WIQA 2QYGA 4I67A 2RS2A 1FHTA 1PYOB 5GADU 2DO4A 2GHPA 4DV6F 3PDNA 2A2DA 1IJEB 1FESA 4F8RA 2E5IA 3VGUA 4FP9A 2VG7B 1EJ7L 5C2CA 3CDBA 3C14A 1VQOS 2GJIA 2ZUGA 4TU7A 3WC0A 3QIDA 2Y1RI 3D6MB 4R0EA 2DGUA 3SXLA 5C24A 1NK0A 2W25A 8AT1B 4OX8A 1FK9A 4PUOB 4DQRA 2HS3A 2DNNA 3EM1A 3H2VE 3I5BA 1RWNB 1IKXB 4HHHA 1SJ1A 2PA3A 3GYGA 4KR0B 4Q8FA 5D0GA 2Z58B 3MOZA 3Q8UA 3H2UB 4KGXB 1KEKA 4J37A 2PA8D 1YLXA 1S9EB 3MAHA 1QVGR 4UY8T 4NLGA 3BKFA 2AKWB 1WD6A 2V4QA 3PKYA 3CJKB 3BQ0A 2IYIA 1RKIA 4KH0B 3LWLA 1U45A 3SDEA 4JV1A 3DMJA 2RMLA 1SL1A 1JLEA 4WU2A 2WOMB 3Q8YA 1T3NA 3KUEA 3NGTA 2LP4A 3FQLA 4ID5A 3MEGB 4ZVTB 4DX8H 4WXOA 3QRPA 4ZPTR 3L09A 2CNNB 4LF1A 3FBFA 4ZVPB 1ITPA 3BKTA 2W2MP 3N5FA 3VHQA 4B3RF 1YSJA 1ZA1B 3T19A 1JJCB 1N5TA 4YB6A 1NKEA 2KXNB 1JJHA 1VC5A 2B43A 2G2ZA 3GG0A 4F0KA 1SH2A 2IYGA 2BJ8A 1EP4B 2Y1LB 3HJVA 1U2RA 3EJMA 5KFUA 4V19X 3V6HA 2JOQA 4C0HA 5KT4A 2FHMA 1NSPA 3O44A 2QA2A 1M5VC 2VQFJ 1ZTTA 3DOKB 1VQ7S 1N5QA 5I3QA 2KG1A 4WK3A 2JL9A 1HWLA 2G4BA 3T9NA 2CNKB 1OY8A 1HA1A 3QLHB 4LUBA 1LW2B 1NJWA 4DV2F 5I3UA 2UUWA 2MQMA 3NP5A 2H65B 4G1PA 4NMXA 3A12A 2CNLB 2BJ1A 4G6VB 3AJ2A 3J7A1 2NPIA 2HFSA 1NHVA 2EFGA 2R42A 2D9OA 4QWCA 2AJ0A 1U1PA 5KFSA 5CCLA 5A6PA 3KLEB 1DTTB 3MMBA 2SXLA 3TJ9A 4TU8A 1UTAA 4TVAB 1FT8A 2Z2LA 1VK8A 1WSRA 2FQQB 2MKIA 1N36J 1HD1A 1X5PA 1WOOA 2ZHAA 1ZZNA 2R7RA 3GIKA 2EI5A 1PBUA 3GV8B 4BWMA 4QR1A 1UW4A 5GAHI 5A2QY 1R7IA 1QE1A 2FVRA 2IC3B 1Q5VA 2OPPA 3PM9A 2OIHA 2CA9A 3NMRA 2C2EA 1T3OA 4DR4F 2QTWA 2ZWPA 2LYVA 4I64A 1EZZB 2EG1A 1C4CA 1SH0A 2B4UA 1HR0F 2HQCA 2DNOA 4EYIB 3RW7A 2EBEA 5HI7A 2CPJA 2KJWA 2OI2A 2BJDA 4YUDA 4M5KA 2HNDA 2VC1A 2E5LJ 1YBAA 2ZH1A 1TL4A 4GKKF 1WORA 5G0RA 4OX9F 3MM6B 4MJKA 4XPCA 2B5JB 4ED6A 1QAIA 2QV6A 4P71A 1P1TA 1P6TA 4PABA 3TZZA 5K8MA 5LJ5Y 2IVFB 4AE5A 1XBWA 3QJLA 4K59A 2LQBA 3R8YA 4A48A 5I3PA 1H2UX 3NNCA 2MQOA 4ZVSB 1NCLA 3H8YA 4CLYA 3K57A 3GONA 2XI3A 1OPIA 3CJQA 2R7WA 2FC9A 1RU1A 2AEFA 2CZVC 2XLIA 5DO2A 2DNQA 4MFBB 3N0VA 3IWXA 4OYIA 4A4JA 3ZO7A 2M8HA 3ILJA 3AA9A 3O3LA 1N6QA 3A3OB 1XMBA 3CCRS 4USMA 3CNQP 4NLVA 2DEIA 5KOWA 1RTIB 1VOMA 1D9DA 4NLOA 3MXHP 2L9WA 2XLJA 4A8KA 1Y4ZB 4OJHA 2DD8S 4AQYJ 2V2VA 4U96A 3UFCX 3H90A 3W3SA 1VR6A 1R8PA 3QRQA 2E7XA 3HZEA 2X1AA 4ILLA 1EETA 5T14A 3D9BA 4DV7J 1HNWF 1Y7PA 1IKWB 1BQXA 3ET6B 4LJMA 3NWRA 2OEKA 5AXMA 2X1GA 2IY5B 2C3UA 4EO8A 3DRSA 1NDCA 3ILOA 3U1NA 4ES2A 2XMMA 2ZH5A 1XMOJ 2ROPA 4RNFA 2DT9A 2BW2A 2J9CA 1V5IB 2ZBPA 4DDFA 1X9SA 4M5HA 4ZVQB 3WZ0A 2ZD1A 4PG8A 3IC1A 4RW4A 1ZAWA 5D4OA 4LF5J 4RX6A 4WP9A 2AX1A 1RCOB 4DSIA 1Z2LA 3DRPA 1RTDA 4ZOSA 4P2FA 3TVZA 3TUPA 1BUXA 2CJXB 3R6GB 4JI6F 4HDHA 2KL8A 4WE1A 2HEKA 5AXNA 9RUBA 3SSSA 1NSQA 1HBOA 4LBPA 2CWXA 1D9FA 2YWWA 2EEYA 1CPZA 3MPWA 4FVCA 4IKAA 1F2GA 1VFJA 3MM9A 2YKNA 2HFOA 4YS2A 1U0SA 1S6QA 2GZOA 2CQIA 1K44A 2FZCB 4E8UA 1HL6A 4IQXA 4NEZA 2C3PA 1Q78A 2RUSA 1RHUB 1VJWA 2YPYA 2YWHA 1TL3B 1TMJA 5GAGU 1IJFB 2BV3A 2IJNA 5KFDA 1MU2A 4NLXA 5KFHA 3MCMA 3OR1B 1TL1B 1JLGA 2KHDA 4KGKA 2YKMB 2VD3A 1LK5A 1VQYA 3ENAA 2HGLA 3CCQS 4RU2A 4ZVFA 1VI7A 4P7VA 1M0SA 1JKHA 1RT3B 3AH6A 5KFGA 3MOJB 2B56A 3ZC4A 2ILYA 3M6XA 3W2WA 2VH7A 2J5AA 3LF0A 3HPOA 1HBUB 3UD5A 2ALZA 2OSRA 2ACYA 2O66A 3UVJB 3DNCA 2K1RA 4DEZA 1F1BB 5K8PA 3HP6A 3QWPA 3UD3P 2DR5A 5D3GA 1VQ8S 1CVJA 3NOGA 1JLFA 1QY7A 3ZZ0A 1GXLA 2DHSA 2RQCA 5D0HA 1MWZA 3PHEA 2GGPB 4B9SA 4ILRA 4PXBA 3SQGB 1F5BA 2HVEA 3DM2B 1AROP 1MW7A 1RT4B 2P5VA 3OR2B 2CQCA 2W8KA 1HI0P 3CD0A 4JV2A 2V0NA 1KC8T 2MQPA 3Q8PB 1VRTA 1CQMA 4LF7J 2GVZA 4I0WA 4JP8A 1KLNA 4KRWA 3OBIA 4RBTA 4UZCA 3ZNUA 4RUBA 2OSQA 3RB3A 3M8PB 2OLWA 3ADAC 2K3KA 4O44B 1EIYB 1IQTA 4HKQA 1WKLA 2UXCJ 1NBEB 3VR1A 4XDCA 4DX6A 3BGRB 3KUGA 1SV5A 3OD2A 2M52A 1BQNB 1IBLJ 3HHNB 5F3ZA 3GCWP 4GKJF 2E5HA 2VL1A 2CQPA 3HCXA 3EPGA 2H1YA 1U09A 1YKWA 2YKOA 1X7VA 3ZZPA 2GMJA 4ALZA 5L1IA 1R8BA 2HHTA 3HHDA 1XIQA 1EKSA 2FUG9 3BF4A 2E1MC 1RU2A 3BEGB 1TK0A 4MKAA 2AIRB 1FE4A 1RAHB 1S9GA 4USKA 2D1CA 4X4VA 5J2NB 1FRXA 4MKVA 2CDQA 2C22A 1UPPA 3CCVS 1SIWB 1MWYA 4MIAA 3DGVA 3JTNA 2NUHA 2KN4A 1X4EA 3H59A 1BY9A 3HMJG 2IM0A 1EHWA 2RJZA 3R1HA 3KG0A 1GH8A 5F9LA 3C14B 1OQ3A 4H54A 1Z1ZA 2R8GA 4JYAF 5D4PA 4OX7A 5C24B 4ITSA 3NXZA 3AOBA 2G13A 3OVSA 3OJSA 1FK9B 3KDNA 3EDRB 2DGXA 3IWNC 4ED2A 3GSIA 1VHIA 3MTKA 4BC7A 1R8HA 3R97A 1W2BR 1C0UB 2A3JA 1U1QA 1I3OB 5KT2A 2BRLA 5D78A 1Q7YT 1ZM9A 4CT8A 3W63A 2KM8C 1U02A 3ZZOA 4DV1J 4LF6F 1N52B 4K4VA 2FVCA 3HHLC 1VIOA 1HWJA 4O4RA 4ECZA 2X3DA 3SDEB 3DMJB 1ZYQA 4RBUA 3L95X 2UVUA 4I6AA 4G3IA 3HD2A 3KHLA 5H9EJ 3D0IE 4ID5B 1U7LA 4WTYA 1ICEB 1VC6A 2XY5A 3TUIC 1WEZA 3VWSA 1J5EJ 4F0MA 2Z0GA 1GXUA 2PIIA 3CD7A 1HW8A 1SPBP 2FGOA 1H7WA 1YJUA 4CQ1A 4ZPCA 3QT8A 1RWMB 1FNMA 3ZTPA 2IM3A 2ZC3A 2ZOFA 4ZP7A 1FCAA 1QDUB 2HAFA 2M3DA 1DQ9A 4PAAA 1FA0A 3HKZD 1M5SA 1KQFB 5DJBA 3ENQA 3NNHA 1CEZA 4H4MB 3D7SB 4HT7A 3PG9A 4C0BA 4PXDA 2RRNA 5KTQA 3MMAB 2ASLA 2V6AA 2WSFC 2BJEA 2AZ1A 2J76E 3HFVA 1HNVA 4P73A 1OYEA 3E8OA 3T5HA 5A8KA 3G82A 3NNAA 5BYSA 4ZPAA 4Z2XA 2AYMA 4PG6A 4WZQA 2EFOA 2DB1A 1YI2S 2XMAA 2AZ3A 1M1GA 1WC4A 4CLLA 4P2XA 4DQSA 2M70A 3OTDA 2QN6B 2HHQA 1RT2A 3CJ8A 1NUEA 2WCXA 4CRJA 2JVOA 3FSIA 3QSIA 2HS0A 4OHVA 3CDWA 5ETVA 1XWLA 1NNDA 4U8VA 1NO8A 4CLUA 4KKOB 2XZWA 3ISZA 1GTHA 4OYWA 3ITHB 2K8GA 2F4VF 1LXNA 3EZUA 4WFNQ 1FFSB 5A0YA 3B54A 5LMUJ 2ZNYA 2AEJA 4ICLA 1QE1B 1VRUB 1VQNS 4NA2A 2R7SA 3BO3A 2BJ9A 5L9NA 2OPPB 3BDPA 1WC0A 1YK9A 2O3DA 3OTCA 2E9RX 4USUA 4FBUA 1IVZA 4IFYA 3AOCA 2FVSA 3J81Y 1FRLA 3M8SA 4LQ3A 5EN1A 4X4RA 2DISA 4NPOA 2MKKA 3WIUA 3SEOA 4QU7A 4K4UA 5F8MA 2MQQA 1WC3A 2YNIA 1ZM4A 3E01B 2HNDB 4TYBA 4MK9A 2LA6A 3G8SA 1XNQJ 5FLXU 4AL6A 1RAAB 1U2CA 2ZJRQ 4ETXA 4ED1A 1B0PA 3K8WA 5H9EK 1FDDA 4B3MJ 4LRFA 2I5JA 3R1LA 3CTRA 1CJKA 1YJ7A 5HMYA 2HBQB 4LQ9A 4P2MA 2OPQA 2YBVA 1SKWA 1NK5A 2FD2A 5B0EA 3MM8A 4KH1B 2QG9B 4LREA 3J80U 3TNVA 4DUZJ 4UOFA 2LVWA 1CQNA 3OQ2A 2J8AA 4K5RA 5KFZA 1U0HA 3H0PA 1NKCA 3FMBA 2DXEA 3EX7B 4CLFA 1FRHA 1Q95G 4ZJLA 3N6LA 1N6QB 3BN4A 2DR6A 1I51B 3L7UA 2CPZA 3OFGA 1OSDA 3UN2A 2C28A 3FEYB 1ULRA 4CCHA 1LFWA 2FHJD 4FXWA 4Y00A 4X4SA 3K59A 4P7TA 3IR7B 3RAQA 2J6TA 2FTRA 4DFMA 4YR3A 4NMLA 1HMVA 1S0MA 4NCGA 1HI1A 3K5LA 5KFIA 2RQMA 2IDEA 4NYZA 5IT4A 3MI7X 2M4MA 3KLFB 1RACB 3TAMB 3DRRA 4JI2J 1FJEB 3VAJA 4NL5A 2F7VA 4C7QA 3E51A 1BE4A 4USIA 2VG6B 2P9GA 1YRUA 3UR3C 3DRSB 2M7SA 2JEJA 3CJ3A 1F6TA 2ZM6F 3SQOP 1PJ6A 1TQLA 3NGUA 2Z8QA 1U26A 2ZD1B 4NXMJ 5D0RA 3TO8A 5IZHA 1TR0A 4CZCA 3R5BA 2IMOA 4JI7J 5HVGA 3MR6A 2ZFHA 2HVDA 4A8FA 4K4TA 2H5EA 3KNAA 3FVYA 2OPRA 2E66A 2HWHA 3BREA 4C3LA 1NM2A 2QMUB 4DU8A 3NS7B 3AODA 3IP0A 3HX9A 5SUHA 4I56A 3MM9B 4LR7A 2YKNB 3D0HE 5L39A 2NUUG 4HYKA 4RW6A 2OO4A 1OSCA 2AYGA 3FSXA 4N7TA 4PXEA 2W8LA 3VGVA 2KZZA 2UUBF 5B0GA 2ACMA 3PZPA 4ENOA 3MURP 1A9NB 1M1KT 2GAHC 4I7FA 4DBQA 5ETTA 2YKAA 5F0WA 1RWXB 2CNOB 5MLCV 2GIRA 2FB0A 4EBEA 1MU2B 1TKZB 2WSEC 1NDLA 2V2ZA 1ZM2A 1B3TA 2L3MA 3EZ5A 4IO1A 2CQ4A 3V4MA 1S1WA 5D0EA 3K17A 1RB0A 1S77D 1N33F 2DNRA 2Q6CA 4DV3J 4DLGA 1BLUA 4OYXA 2BOPA 4NXNJ 2VFTA 3Q22A 1HNXJ 4QIFA 1FF2A 2U1AA 3AD8C 4NA3A 1JKHB 2XO6A 3BDEA 5D8HB 4OV6A 3LAMA 3TUZC 4KSEB 4P9SA 2XYHB 3PO5A 4JV0A 2OD4A 3RRKA 2HZVA 3FQKA 2MQ8A 2K1RB 1T9UA 5D3GB 5KFVA 3T1AA 5EGYA 4O0NA 2JFDA 2XY7A 1HARA 4OL8A 4ZPWR 1FTRA 2QA4S 1QUPA 2YXLA 3JYTA 1FRMA 3VF0B 5JVHQ 2V34A 1IN0A 2VA2A 4YDXA 5A8RA 1RAFB 4DZDA 3IRXA 4D3HA 2G0IA 3MM7A 2IRYA 2VBYA 3NBPA 3CCZA 3QAEA 1XNRF 2VOPA 2NR0A 3M6UA 3H25A 2UVRA 2GVZB 4QU6A 2Z56B 2K06A 1Q53A 4KJIA 2XEXA 4QIVA 4L72B 1SCJB 4JV5J 1IWGA 2I9SA 1Y3KA 5BR8J 2LXUA 1F9EB 4TQSA 3MCNA 4DUYF 5IQQA 3HVRA 3RUBL 3HDSA 2DR8A 3CCTA 2HQDA 3TX0A 1SV5B 1VIXA 4LRDA 2BE2A 2J9DA 2ERRA 3IN5A 3CMQA 2E7WA 1RI7A 1LQ9A 4M94A 2EFPA 4M5LA 2CQHA 2YQ1A 4JI3F 1N5VA 1WACA 3LH2S 1PYTA 3HVTA 1MROA 2HGMA 2G1DA 1XMQJ 2DRBA 2V8DA 3C66A 2F4VJ 4DR7F 2HFUA 5HVHA 1KLMB 3JS9A 4DR2J 4FS2A 4YMEA 5KG3A 4WZMA 2YNFA 1EAYC 4H4KA 1LK7A 1T9XA 1X4GA 1T94A 4CTAA 2QJ3A 1S9GB 5K20B 4UQGA 3DI6A 1UW9A 3BPSP 1C1CB 4NE9C 1RTJA 4B9VA 1U4BA 1Z4UA 2KO1A 3BBFA 5F8JA 3UD4P 2RNEA 4DN0A 5CA5A 2ILZA 3GR0A 2YKQA 4DV0J 2VU5A 5H9FK 3IXQA 2RQ4A 1JB0C 4NZ0A 2KYXA 3MAQA 4IUFA 5CYJA 1AXQA 5LSLA 2HURA 4LFAF 4I6WA 3MR3A 2ZH6A 3DCAA 3GILA 4ILMA 1TV6B 2X3GA 3OJUA 3ZFVA 4Z37A 2QYCA 1XR5A 1CSJA 4CNYA 5KFCA 1NZAA 2R2UA 2CIMA 5LMNF 1V9OA 2DYAA 2ZOMA 3MD3A 3TW0A 1UZHA 3LA0A 1KQSR 3CMAS 2HHHJ 5GADI 3IG1A 2L41A 1LXJA 1MLAA 5KFQA 5KFBA 3ILLA 2DKOB 2MQLA 5L1JA 4IDKA 4P2SA 4TQRA 5LXRA 2IA0A 1K47A 2OTJS 3KDOA 2ZBIA 4GO7X 3A8EA 3IR5B 2PSZA 1CULA 4C0OC 2V5HG 1FVQA 5KOXA 1PIEA 3SCIE 5I4MA 4Y34A 4LSZB 1GTEA 3W66A 4FN5A 4IO9Q 2CPXA 3HVWA 1JIHA 4F4AA 4YR0A 1U48A 3KHRA 1RXOB 1KSPA 4DPTA 4DV5J 2Z30B 3CIZA 5J2QB 1DZ5A 3I5CA 1REVB 1H98A 1B4SA 3OXFA 2R7OA 4F3OA 4MKYA 2B8PA 1XTZA 4ED5A 3UQSA 2QE5A 4PRFA 4LSLA 3T1YF 4IYQA 3U27A 2AWZA 4J9PA 4X64J 4CLZA 3IMQJ 4NZ6A 1PC4A 1YJVA 2XQCA 4ES1A 3ELHA 3EWGA 4I2QA 2XMVA 4NEYA 2YY3A 4RW7B 4DV4F 3ZTRA 1KFSA 1E6YA 5DQHA 2MY7A 3EYZA 3EVWA 2B7BB 3I87A 1HNVB 1ZOTA 1QM9A 3B8HA 3UPFA 4F25A 3SIPB 1CJTA 2JVRA 2QT7A 2LMIA 3VCDA 4PWDB 4WFAQ 3RBZA 2JLGA 2KG0A 2WRMA 3M8QA 1S6UA 1YITS 1VBKA 2GC8A 2QLXA 4L3NA 2PGCA 2JDJA 3EVOA 2VFSA 3V4IB 3AD7C 3L3CA 4IRDA 5HVFA 1N5YA 2XMTA 3GFXA 1XR6A 1HW9A 1NAQA 3M2UB 4A8SA 4RWXA 4DF4A 3CJ0A 3CCWA 2M5YA 3W1YC 4DSEA 3IBFB 1ZZFA 1SKRA 3OFHA 1FXRA 5IWAF 3A8JA 4MK7A 4RW8B 2R7QA 1F5AA 3T3FA 1FNXH 2WHOA 2O01C 2N7CA 1M5KC 5L46A 4DLEA 4Q8EA 3PW5A 4ANCA 1SIZA 3QGHA 3MCOA 3KK2B 2N3OA 1VISA 5KFPA 3RAMA 4V1Ak 1RGVA 3KLGA 3PRVA 2RE1A 2R7XA 1DARA 4KBIA 2PC6A 2BBEA 3D6TB 4ZP6A 4QW8A 3M8YA 4NI2B 3PJXA 1FJ7A 1N56A 1KFDA 1LW0A 2LA4A 2AP6A 2W4CA 3BJYA 1SC3B 1ELOA 5E7OB 5A76A 1WC6A 3W7BA 2FZGB 2DIVA 4KAIA 3RJMB 5GAEU 1JJ4A 2CJQA 2WBMA 3PFEA 3LGMA 3N5BA 2Y3YA 2NZ4A 2LQ9A 2VG7A 3QGPA 2XZDB 3VAHA 4I4BA 3O2IA 1GMWD 5B08A 2FY1A 1XQIA 2DGQA 1PYSB 3NCQA 3EXYA 2EC0A 2NXCA 3VTIA 4ZK7M 1SUQB 4B3SF 1YZ6A 4LR9A 2M8DB 2B0GA 2OPQB 5HQMA 1IKXA 4LFCF 2ZNZA 4J5OA 4FKXA 3H42A 3UI3A 2QFJA 1VJQA 2MMYA 4C8OA 1FRJA 2XM3A 1U0HB 4LF4F 3MWBA 3H20A 4YFUA 5DDOC 1PCAA 3WHIA 2HAIA 1IBKF 1WNEA 4GO5X 1SXLA 2XO7A 3T1HJ 2GQCA 3WDOA 1R8CA 2FJEB 4ETZA 1G7CB 4QPXA 3L9ZA 3H98A 3MEGA 4ZLPA 1WOPA 4USWA 4XAKA 2OGUA 2NLWA 1AFJA 3CWJA 1UJ6A 4JI3J 3DRRB 1GAOA 5B0DA 3KJNB 5KFMA 1X4FA 1U25A 3ISNC 2JEIA 4O0IA 2JEGA 3MHYA 4CT9A 2CG8A 3I96A 4LVNP 3AY0A 3SYZA 4LVOP 1VQMS 3DGPB 3NOCA 1DURA 1NU4A 1WI6A 4YY3J 4NX9A 3S6EA 2B7CB 5CZVA 2UUCJ 5ADZA 1FKOA 3TEHB 1IBMF 1FDAA 2A18A 4U6PA 1MMDA 5KG7A 2QLJB 3MDFA 2DPIA 4USVA 2HHVA 4I68A 3VVUA 1T05A 1DY3A 4ER8A 2IM2A 2L9NA 1JQGA 5A8WB 3DC2A 4QQBA 4RNOA 1T03B 4LMZA 2RAQA 1T7PA 3DHXA 5IS2A 1VLYA 3WBZA 2Z4PA 2CG4A 4ECVA 4PG7A 4I7FB 2VF3A 1UMJA 2CJAA 4B9TA 3FUYA 3H5YA 3FC9A 4M5DB 3M30B 5CQGA 4F3MA 5IT0A 5DQGA 5CAAA 4ZIVA 4QWDA 3EZOA 2DGWA 2RDIA 3T41A 1Q8IA 3KNGA 1UVKA 3ILIA 2IM1A 4PQUB 2GQQA 1N0UA 3KJQB 3P8BB 2ZHOA 3GU0A 5C2GA 4UZBA 3P45B 1RAJA 1JJ2R 5C5JA 2RDJA 1KHVA 1WHVA 3PEJA 4DPOA 3CC4S 3BO4A 4XO0A 3SBMA 3O5TB 3HVAA 2R2TA 1D8YA 5GAGI 3I0SA 4C8ZA 5J1NA 2CPIA 4FYVB 3IR6B 4EFAC 3IBWA 4HLBA 1SBRA 3CT9A 2DXDA 3BGUA 3MM6A 2BQUA 1HBNA 2HHWA 1HBMA 1WHXA 3EGWB 4X62J 2B9YA 3GQCA 3P96A 3RU0A 5A8RB 2KT3A 3MM7B 5CHCB 3NBPB 3W5ZA 2UU9F 4WF9Q 3CSKA 1YBUA 4O3RA 4ES3A 3JSBA 2ROEA 3G8QA 4MFBA 4ZP8A 3HSZA 5CYQB 4I6YA 1RHJB 2HKEA 1K8AT 3Q2TC 2R7VA 2DCUB 4LT6A 4PR6A 2J9DE 1RDRA 4ED3A 5FJ4A 4F02A 3NAIA 5CD4A 2HFZA 1VGYA 2HMIA 3V81A 1RWUA 2WAQD 2CADA 2QA1A 1R89A 3PW2A 1S48A 2BE2B 2F9JA 1BC6A 3OXLA 1QLNA 2FLOA 1FI4A 8RUCA 3G9CA 1MROB 2HG4A 1IKWA 3ET6A 1X5TA 5DRKA 4A8XA 4CLSA 3FRYA 1XERA 2J0QD 1QAXA 2HK2A 1A6LA 2EXUA 2WBRA 4OZ0A 5DG7A 3R5DA 5L38A 3CCJS 2W7OA 4C3MA 2EFNA 5HANA 2YNFB 3T6BA 1WSVA 4KC5A 4CTAB 5HBMB 2VIHA 4USTA 4X4OA 1PSDA 1DHMA 2HQ3A 4WFBQ 3V6DA 3Q86A 4BDPA 2B9WA 1N88A 4JI4F 1RP5A 4NYOA 1S0VA 3T5KA 2M88A 2APOA 3MMCA 2KKHA 3OTEA 3KK1B 4S0MA 4I1TA 2XYPB 1S10A 4ZLLA 2VZ9A 4GVLA 3GJSB 2C2OB 3W5YA 1XN9A 2QIFA 1E6VB 2GV1A 5IOLA 1R43A 5KFJA 2NCKL 3KK3A 2HW3A 3I6PA 4AUKA 4HT5A 2GX8A 2V68A 3WC2A 4K0KJ 4DCPB 3I82A 1SKUB 4ANEA 2P6SA 1W7WA 3EDQB 4RKUC 2AJ2A 1F9FA 1P8GA 4XDDA 3RBEA 3C2PA 2WVEA 1TL1A 2KFYA 2E29A 3ZZRA 2KFNA 4QIWD 3X3UA 4ZA1A 1KWMA 2YKMA 1SQFA 2XC9A 4J90A 3CGIA 1TVRB 5JVGQ 1I94F 3LP2B 4M95A 3BB5A 3BKUA 3DLHA 1CULB 5DM7Q 4X4PA 1BWEA 4FYDA 1Q8KA 1RT3A 3BR8A 4ECSA 2CPHA 1FO1A 3H40A 1UVMA 1C4AA 5ETRA 2LQJA 2CJKA 1HBUA 4KHRA 1TL7A 2ZH2A 4B02A 4J91A 1YVFA 2AJ1A 2ATCB 3J7Z5 4K50A 3KMSA 3J7AN 1X4CA 4KB7A 1S97A 2UUTA 3EGVA 3G6ES 4RW9B 4LSLB 3DYAB 3L4BC 5IM0A 2GGPA 3Q8RB 3PCOB 4X4UA 1J27A 3MAAA 1HQUA 1UFLA 4LF9J 3SQGA 3DM2A 4MMOA 1RT4A 2RRBA 4NLTA 3CJ5A 4Q0BA 1N32J 2JSXA 5F0UA 4QWBA 4I2QB 2PN6A 3CDEA 1FJGF 3UN5A 2F3JA 4WK1A 2WVDA 2CWKA 5EWFA 1AB8A 1RT7B 3THTA 3G6XA 4IOCQ 4K4SA 2BVZA 5G4DA 4P74A 1CJTB 2UVVA 3JSRA 2V4JA 3M8PA 2HRTA 4FF4A 3O6QA 3M8QB 3JSMB 1FFWB 4B9NA 1DFDA 3N28A 3KG4A 3JQMA 2PI4A 7FDRA 3GP9A 3P5TL 1WC1A 2NZCA 3BGRA 1SC6A 3KJFB 4ANDA 2B9EA 2WB4A 4DR1J 3JB9k 4FNHA 3N6MA 5D77A 5BXIA 1CJUA 4I69A 1LFPA 5K9FA 2W9CA 1FERA 1U1NA 3RG6A 3M8ZA 4M5MA 3HHKA 1SC4B 1GFWB 4AT1B 1KVKA 1A7GE 2HIYA 4I2PB 5SZTA 4HR2A 4OYPA 2JJ4D 2ABYA 1RHQB 2XMKA 1M5OC 4ECXA 3PX0A 2CQ1A 2WK4A 3KLGB 4MIWA 1NK9A 3WX8A 3FEXB 4A47A 1RWKB 1LW0B 5B7WA 2E1PA 2EPIA 4B08A 2VJVA 1DBDA 1X0FA 4X66J 5F41A 3MMJA 4DPUA 2AF6A 3FMWA 2XMWA 4DPXA 2XLKA 5HO4A 4H4KC 3EGZA 1IR0A 4E2FB 2FC8A 2XWYA 4JI8J 1S12A 4L75A 4OHZA 1YG0A 1T9YA 1FFGB 2W24A 3DFEA 1GT8A 2G9OA 3CCUS 3D3BJ 3TJAA 1RT6B 2BYCA 2P9CA 2MZRA 1N34F 2Q3PA 1YRXA 5BJRA 4M8LA 1C0UA 2F8MA 1KHWA 5F8GA 3VAKA 3MD1A 3UDEA 2GA7A 4F3QA 4FPIA 4TXSA 3GV5B 1D9AA 3BSAA 2QL9B 1EQMA 2GO9A 3GZ7A 1QSSA 4ZLJA 1U6BA 1CJVA 3ICLA 5KFYA 5KT5A 1Y10A 2JLFA 4DJBA 2OJ3A 3KYLA 1JNRB 2DO0A 4C97A 4W4MA 2C2ZB 2RU9A 1N8RT 3CC7S 3R7SB 2YX7A 4KE5A 2DNYA 3OTOJ 1K9MT 4ZIWA 2CQGA 2YNGA 2AQ4A 3CEDA 3N01A 5K8OA 1QUVA 1U24A 4ATNA 1RA6A 3GIMA 1S7HA 3D6HB 1TMMA 2ZJPQ 4BS2A 3W65A 3HT0A 1SQEA 2ZBCA 1WC5A 4LIWA 4MYTA 1N4LA 2GFFA 4KHPF 3TX8A 3DRXA 4WIIA 3M7VA 3G86A 1HNZF 3HJFA 3AA8A 3OV7A 3BGFA 1WJ9A 4DSFA 3I0RB 2NXEA 1JLBB 1FE0A 3LGHA 1UVLA 3RB6A 2X7IA 4H4MA 5HJXA 3MMAA 2DNPA 2P6TA 3TVKA 1LWFA 2W2OP 4Y2IA 1P9YA 2PEBA 2DGOA 5DG9A 1FKOB 1NHUA 3PYFA 3VAFA 4X65F 3QO9A 3MFIA 1S79A 4CLTA 4KYZA 4PYAA 2E1RA 4LF2A 1GX5A 2CPFA 2I6WA 4J9KA 2W9AA 3QIPB 1T05B 4ECWA 5ETLA 3C16A 4PKDB 3IGVA 1WHYA 1PAEX 4YEAA 1FXDA 2GMLA 4DG1B 3TA0A 3T6JA 4LIRA 4L73A 3CCMS 4HI1A 1U1OA 4UTGA 2OELA 4KKOA 1GMVA 1RTZA 4F04B 4DPWA 4ELTA 1R31A 2L48A 3KTQA 3ITHA 1K0TA 4BBYA 3G6VA 3V6JA 4FBTA 1U47A 2XB2D 3BH7B 1VRUA 4B3TF 4CH7A 3FJ2A 3KG1A 2XTJP 4NRTA 2N4DA 2RU3A 3VAGA 3BYRA 1H0HB 1I94J 2DBBA 1B99A 3W8GA 1BD6A 2QO3A 1I1GA 3G2XA 2IJFA 2QLFB 4DR3J 4B9MA 1VRQC 2AGQA 2E1AA 2GHWA 3VZIA 2KZMA 4J9VA 1SJQA 3E01A 1D8ZA 3I0SB 1K1SA 4XK8C 2OEMA 4ZCKA 2O67A 1EB0A 3FCHA 4FNIA 5HAOA 1NH7A 1KONA 4FF1A 3RB4A 1EKRA 2QMWA 3I32A 2UXBF 1HBNB 4GRSA 1HBMB 1XR7A 2UUAF 1MMNA 2E5GA 4BHQA 2E7VA 5DDPC 2GW8A 4JI1J 3SCLE 5MAOA 5AJ3F 5E5NA 2VFVA 3VAMA 5J1EA 2XS5A 4L3KA 3OFFA 4UUXA 2JWNA 4DS4A 2POKA 1AYEA 1HD0A 1SQGA 2ZJQQ 1RAEB 4WKRA 1R0BG 2LECA 4EI2A 2A6OA 1PILA 1NJZA 2IMWP 2ZKTA 4DL0C 2J0XA 2COLA 3E3XA 1OQ6A 2HBYB 2HMIB 3V81B 2QX0A 3PW0A 3PXGa 1RUSA 2DXFA 2UP1A 2ZH9A 2QL5B 2XNQA 3UN3A 1NDKA 1WKJA 4NLPA 5HATA 4C6AA 1ZBTA 3D1HA 1NDPA 2DVIA 2W2PP 1R0CB 1AUDA 4GVBB 3KLFA 3GIIA 3HZGA 3TAMA 2PI5A 2W4DA 4X2BA 3A13A 2VPXB 3D66A 2VG6A 2D3OR 1UPMB 4IQMA 2Z2YB 2V63A 5K5MA 2CQDA 3LANA 1ZPVA 4PPZA 1WG1A 3C3LA 1Z2ZA 2MZSA 4DR5J 1P27B 3LP1A 1QSLA 4Y2AA 3V2UC 2HSEB 2RF2B 3V6DB 3MFHA 4QIEA 3PX4A 1X31C 4M5JA 2DY1A 3SV4A 2EVZA 1MWQA 4DV6J 4K4WA 3ETOA 5J2PB 2AGPA 2ASJA 3G6YA 3MMCB 3H7HB 1RQ0A 3KMQA 1B70B 2RUGA 2BABA 2MTLA 1TKTA 1CS4A 4U67Q 4C8YA 1WEXA 3FFIA 2UXDF 4WXWA 4O3OA 3A4TA 2HFNA 1RLCL 3KK3B 2R8JA 2RKIA 1X0PA 2EBGA 2OHDA 2OD6A 4F4ZA 1GQEA 3QYYA 3TI0A 2I38A 2DY9A 2IPOB 1RSCA 2H3EB 2P2CB 2FJAB 3PRBA 2GHVC 2DR7A 2XGQA 3TANA 5CABA 2FJXA 2QFIA 4QYZK 4URQU 1TKZA 1Q86T 4U7UD 4OLOA 3K89A 4ZCMA 2MZJA 3G4SS 1UAWA 2MQNA 2DR9A 1TFYA 4DXLA 2R8IA 1UA1A 3GFHA 1G1XA 1S1TA 1YJRA 4GMKA 2JX2A 4DFKA 2O5DA 4OZ3A 3RYLA 5DLGA 2ZVSA 3CCLS 2AYBA 1IUJA 2CKWA 1W26A 3CJRA 2OP5A 1F5CA 2QZ8A 1TL7B 3PHTA 1ZETA 3Q83A 2HWIA 3M2RB 2MGZB 3W61A 3PTWA 5FDLB 3DLJA 4B3RJ 3T5LA 1KN6A 5KG1A 2DNMA 3TYTA 3NGDA 1LWCA 4E98A 2FLNA 1SL2A 4ZHRA 1KVJA 5IM0B 4ECRA 3PACA 3MAAB 1HQUB 2KVQE 1SL0A 2JHEA 1Q8LA 5DS7A 3WIVA 4CLPA 1AUSL 4Q0BB 3GV7B 1VQ6S 1PC5A 3I4HX 2YX4A 4QOTA 3AT1B 4LRCA 1WDDA 2V8GA 2RB7A 1QTMA 3BZQA 2HNZA 4D3GA 4O3SA 2C2RA 3WQPA 4RLEA 4OMFG 2Y0BB 1OMSA 2I2YA 3GPAA 2YX1A 4DV2J 5HQ8A 1VYAA 3I56S 5ETKA 4ELVA 5AXKA 2V4JB 2VFUA 2XBPA 4X4NA 4ZVEA 2JLEA 3NMAA 1D3WA 4HI2A 3OSPA 3TQ1A 4IFVB 2GJ2A 4WYLA 3F0NA 4DS5A 1HWIA 3OLBA 1NPRA 2DHAA 2FZKB 1PO6A 3M9OB 1YBTA 3FZ2A 3D2WA 4ZPDA 3US5A 2VPZB 3BM7A 1CJUB 1RISA 4ERDA 3MUVP 2Q43A 3BSNA 3KHGA 2VQFF 2W9CB 4OZ5A 1RHMB 1VS3A 2ZITA 3K5MA 4J9OA 1WEYA 2IBKA 3NAHA 4TY9A 3VQSA 1KLMA 1ZTWA 1MN7A 1LNQA 1X9WA 3A3NB 4B3TJ 2BQ3A 2NS1B 2WONA 3NCPA 3PYGA 1GX6A 4URSA 4C98A 3HM9A 3SSRA 4LBIA 4U7CA 4DR4J 2DHGA 1C1CA 3ZZTA 3PJ9A 5LSOA 2VDHA 2ZKUA 3K2YA 4OI1A 1MN9A 1HR0J 3CULA 2H5IB 1G2EA 1NRKA 1ZPWX 3ENWA 4KV8B 4QW9A 1UVNA 3KJVB 2VOOA 1U1RA 3FBCA 5LT5A 1N36F 5C42A 4AXJA 1UETA 3OL7A 1FXLA 4GKKJ 3VAIA 4OX9J 2JC0A 2BANB 2H48B 4WFXA 5DGAA 2CPEA 5JJBA 4F2RA 3QBCA 1TV6A 3TZYA 2P8IA 3SFGA 3OL8A 2LEBA 2DIUA 1UWBA 3D6FB 2DHHA 1SJRA 4WKYA 4RU9A 2YWKA 3QFWA 2XMUA 4C3KA 4OJ3A 2C1EB 4USHA 4RZRA 3L7PA 6FD1A 5GAEI 3N6NA 4UW2A 4NOHA 1KRPA 3GSDA 1CJVB 4QWEA 4P6QA 2WTFA 4ZP9A 3QNWB 1TELA 2RHQB 2E5LF 3A8IA 5F9NA 4DI6A 1Q7LB 5THWA 4CO3A 3M8RA 2WVCA 1HYSB 4GC6A 1FKPB 2YNGB 1Y5IB 3NGKA 1LKZA 3SMZA 1HHSA 4OI0A 4YOEA 3OW2R 2IIHA 4DX5A 2FHJA 3M05A 4F67A 5JUMA 5J2QA 2OTLS 2XHCA 2H4YB 1HNWJ 1OY9A 2ZZMA 1REVA 2G0CA 5HLFB 2UV8G 4HHUA 4IH6A 5B0CA 4OHXA 3P49B 1RZMA 3RR8A 4DL4A 1NMEB 4TU9A 5FIIA 2GS8A 4F0HA 2F8HA 3LP0A 2DPJA 1P9QC 4A8MP 2J7UA 4KT0C 1KQGB 2BXJA 7AT1B 5IV3A 2GMHA 4PZVA 3PFOA 4RW7A 4H4OB 3I9ZA 2QLBB 3HSJA 3SCJE 2YPZA 4ZN1A 5CXTA 1R6VA 1LWFB 3IRWP 1HHQA 2AYEA 3R7BB 4CM0A 4CI0B 4JI6J 4AQYF 1FX2A 5IC4B 4ZJQA 4PWDA 1EQ0A 3QO9B 4DV7F 2BZ2A 5DETA 3V4IA 3PIPQ 4ED0A 3POTA 3B78A 4WP3A 3ZTQA 3C16B 3M2UA 3OTBA 5GVQA 2Y8WA 1B7FA 3GJQB 1T9TA 2H4WB 2FJBB 4PPDA 3N4WA 3OL9A 4KHMA 2EKNA 1XMOF 1X60A 4P10A 3UR0A 2UV8A 2A1BA 4CO2A 3MEDA 4LRBA 1N48A 5F3TA 3I5AA 4RW8A 1NLKL 5B0FA 4LF5F 5HP1A 3Q23A 2NXJA 2XYGB 3HSDA 3MEEA 4M1KA 2E9TA 4TKTA 4QWAA 5KG5A 3EPIA 4ZVOB 4JI5F 3GR1A 3CCES 3OL6A 1YIJS 4L76A 2MHEA 1RJJA 3KK2A 2G2YA 4C11A 2MEWA 4CO1A 4NA1A 1BHNA 2HYIB 4QYRA 3HHLD 4NI2A 2Q1LA 1VLOA 3D68A 1Y5LB 2LXFA 2EC2A 4Z7YA 2C2MB 1LOUA 2PMWA 3UW1A 1FDBA 1S1VA 1HI8A 4WP8A 1HNIB 2KXHA 4RUHA 2ASYA 5ETMA 3C8YA 2VPYB 3R2CJ 2B8QA 1RLDA 3LOUA 1W25A 1AT1B 4DN9A 4N5SA 3DOLA 3VZHA 4K2XA 5LOQA 2HRUA 1H74A 5D4NA 1JLQA 1Q0NA 2ZH7A 4Q43A 3JTOA 2KH9A 3TAPA 2LCWA 1SUQA 4ECTA 5E2QA 5KT3A 5AE1A 1XJWB 2MJNA 4ELUA 1UJ4A 4YQWA 1M5HA 4PG4A 5J1EB 3BR9A 2MYFA 5EDWA 1A0OB 1H6KX 5T7LB 3IBCB 4ZPVR 4R0JA 2MLXA 5CH7B 3O8WA 4FYYB 3PR5B 2D74B 1YJWS 2BJ7A 4OJGA 3UDVA 4K4XA 1S59A 1BGXT 1V3RA 2D9PA 3AXMA 2GVDA 2LDIA 3LO3A 4OFZA 1SJ4P 1Q79A 4GKJJ 2A2CA 5M2UA 5M2PA 4PWUA 3BO2A 2ALYB 2HHUA 3MM5A 4NASA 4ED4A 4C4WA 5U47A 3S01A 2W9BA 3G87A 4LF7F 3W60A 3AB2B 4QBUA 2EKYA 1P1LA 2JH3A 1RK8A 3JTPA 4EU0A 2BJ3A 4CP5A 2ROGA 4NLYA 1JLAA 5FD1A 1Q1KA 1R3NA 4DFJA 1OS5A 4BCAA 4WFYA 3QQCD 1KD1T 3D28A 2WSCC 3LP1B 3H4DA 4EEYA 4OZ2A 1URRA 3DGPA 2UXCF 4EWTA 2OPSB 2FHKA 3EICA 5EX3A 4U95A 4QR2A 4NLRA 4IRKA 2BR0A 1RHKB 1IBLF 3BQ1A 4P75A 1F0XA 1F60B 2WVFA 2ZH3A 2WW4A 2QSWA 3TAQA 1NB7A 2J8SA 4X4QA 4Q2MA 2IJRA 1TKTB 3DRYA 1CS4B 2NSCA 5DLFA 3THPA 4DL7A 1YTYA
chains in the Genus database with same CATH topology
3MMCA 3FFIB 1SIWB 2KDOA 2KKHA 3OTEA 3KK1B 4I1TA 2VBXA 4B3OA 1MWYA 5E3AA 1S10A 5A8WA 4ECUA 4MIAA 2VZ9A 3ZZYA 1T03A 1FVSA 1TL5A 2NUHA 3JTNA 3MPVA 4HDGA 3SFUA 1UEUA 3LGNA 3RB0A 2RKIB 4IFYB 4DSLA 3R5CA 1KR4A 2KN4A 1X4EA 4CO4A 3H59A 1XN9A 2IAJB 2JFKA 2MKHA 2QIFA 2RRAA 1BY9A 3U02A 2HQIA 3HMJG 4AL5A 1B0TA 1NEEA 2IM0A 2V9KA 1FKAF 2RJZA 1E6VB 2GV1A 3R1HA 2J0SD 2ZOGA 1R43A 5KFJA 1IKYB 3KK3A 3KG0A 1YHQS 4MKBA 1GH8A 5F9LA 2EFQA 5EWEA 1OQ3A 2HW3A 4H54A 1Z1ZA 3I6PA 4AUKA 1LWEB 2YNIB 2R8GA 3OXGA 1YJNS 4JYAF 2HHXA 4HT5A 3GFYA 2GX8A 4M5DA 5D4PA 3HXMA 4OX7A 5C24B 4ITSA 3WC2A 2VA3A 1V6HA 2R8HA 2G13A 3M30A 1O8BA 3FZBA 3I82A 2UVWA 2YH0A 3OVSA 2CQ0A 2BQRA 3OJSA 5EX0A 4DL3A 1FK9B 2P6SA 1DRZA 5F8HA 2CZ4A 2DGXA 4RKUC 4TLRA 1P8GA 1F9FA 1HWKA 1L3KA 5H9FJ 3IWNC 2C42A 5AE2A 2I1RA 3OPKA 4XDDA 4Y2CA 4ED2A 1I6JA 2N7YA 2LKZA 2EFVA 3MTKA 4BC7A 1R8HA 3MUMP 3RBEA 3C2PA 1W2BR 4O3PA 1TL1A 2KFYA 2E29A 1C0UB 2MZTA 1S1TB 3ZZRA 2KFNA 2I5JB 2WB1D 3LPYA 3P3DA 4QIWD 3X3UA 3PNIA 4F4WA 4PUOA 4PQUA 2A3JA 2J6SA 3QJJA 4ZA1A 2RVJA 1Y0HA 2YKMA 1FRIA 4FPRA 1HNIA 4YDDB 2X51A 2XC9A 4WYWA 1U1QA 3D5MA 5KT2A 4DWIA 5E0OA 3KOAA 3CGIA 2BRLA 1TVRB 5D78A 5JVGQ 1NJYA 1I94F 4K0KF 3LP2B 3MM8B 4M95A 3BB5A 1Q7YT 1ZM9A 4CT8A 3DLHA 1OWXA 3CD6S 2KM8C 3ZZOA 5DM7Q 5EHHA 2BA9A 4X4PA 1BWEA 4Y3CA 4C8LA 4RBVA 4FYDA 5KFEA 1N52B 4LF6F 3GWCA 5DGBA 1RT3A 3BR8A 3HFKA 3BN7A 4K4VA 4RUAA 4QYZJ 4ECSA 2FVCA 2MB0B 3HHLC 2PFFB 3KLVA 2CPHA 1FO1A 3H40A 1UEVA 1UVMA 1S9EA 1VIOA 1C4AA 1X5SA 1HWJA 2HNYB 2XULA 4O4RA 4ECZA 3SDEB 3CIMA 1KQKA 2LQJA 1N0VC 3DMJB 2CJKA 1HBUA 4RBUA 4DL6A 3UCZP 1ZYQA 3L95X 4KHRA 2ZH2A 3CB4A 1R6YA 2UVUA 1LWCB 1WWHA 3WX4A 4I6AA 1JXLA 2PEHA 3CJKA 3AAWB 4F26A 2BM0A 4B02A 2PDAA 1YVFA 4G3IA 2XI2A 2AJ1A 3J7Z5 3KHLA 4ZHRB 2OH2A 4K50A 5E3QA 5H9EJ 2HS4A 4KTQA 3KMSA 1D0EA 3D0IE 1X4CA 4ID5B 3UE2A 3QWUA 1U7LA 2V8HA 4WTYA 1O0PA 4KB7A 1VC6A 2KYZA 3IO1A 4OZJA 1XK8A 1OO0B 1X8DA 3HI9A 4KGMA 3ULHA 4DV1F 4ED8A 3TUIC 2XY5A 1WEZA 1S97A 2UUTA 2WOMA 3G6ES 4RW9B 3VWSA 1NJIT 3N9UC 2Z0GA 4J9LA 4LSLB 2AGOA 1VQKS 1GXUA 2PD1A 2MY8A 1J5OB 2PIIA 1Q4RA 3CD7A 1WG5A 1HW8A 3DYAB 2VONA 3BGLA 2FGOA 5IM0A 5T7LA 3R27A 4DSJA 2GGPA 3Q8RB 1HMVB 1H7WA 2BUNA 2HNZB 4X4UA 4NCGB 5E41A 1YJUA 5JXSA 1HQUA 1UFLA 2VASA 4CQ1A 3S8SA 4ZPCA 3SQGA 1FNMA 3DM2A 4MMOA 2X1FA 2XHWA 2IM3A 1RT4A 5IFMA 2ZC3A 2RRBA 4NLTA 2KTQA 3CJ5A 4Q0BA 1SB6A 2DGTA 2JSXA 5F0UA 3MF5A 4NWBA 2ZOFA 4QWBA 1YJ9S 4ZP7A 4I2QB 1FCAA 3MEKA 5CYQA 2PN6A 3CDEA 4IG3A 1FJGF 2F3JA 3LALA 4NLDA 4IH7A 4MIBA 4C8KA 3R3TA 4WK1A 3OUYA 2W7AA 1VBXA 1J5EF 5K14B 2M3DA 1DQ9A 4OZLA 2B4PA 5EWFA 4DHVA 1TFWA 1FA0A 1RT7B 3THTA 3G6XA 1EP4A 1C0TB 3HKZD 3CJ4A 1M5SA 4IOCQ 2KB2A 4K4SA 2BVZA 1KQFB 5G4DA 3C6TA 5DJBA 3ENQA 3NNHA 5KG6A 3DLGB 4H4MB 2FHOB 1CEZA 4HT7A 2UVVA 3JSRA 1UJ5A 4C0BA 4PXDA 2RRNA 4LF9F 4OZNA 5KTQA 3MMAB 2IA6A 2RSQA 3HHEA 2ASLA 2V4JA 3M8PA 3T9ZA 4NCBA 4Y65A 3G71S 3RRHA 3TOQA 5DQIA 4FF4A 2WSFC 3M8QB 3O6QA 2BJEA 3JSMB 4KIAA 1N32F 2J76E 4B9NA 1HNVA 1DFDA 1WF0A 3DOKA 3HLUA 3N28A 1ZAXA 3KG4A 2PI4A 2AW0A 3E8OA 3T5HA 5D6GA 1QAJA 5A8KA 3GE9A 3DXBA 7FDRA 5BYSA 3NNAA 3P5TL 4ZPAA 4Z2XA 2AYMA 2RILA 3GFZA 4PG6A 1IKVB 3GYXB 4WZQA 2HIQA 1RT5A 4PQAA 3AHPA 3BGRA 1SC6A 3QLHA 4QR0A 2MKCA 4WU3A 2EFOA 4RNNA 2DB1A 1DTQA 1YI2S 1KOOA 1LW2A 3NLCA 2WB4A 3JB9k 1YGYA 3G8TA 4LFBF 4FNHA 2OPRB 3N6MA 4R25A 5D77A 4O3QA 1QSYA 1FD2A 4O4GB 2M9KA 4I69A 4DQSA 2ZZNA 2HHPA 2M70A 1S0NA 1SJ3P 3HO1A 1W2IA 3N79A 2FVPA 3OTDA 1LFPA 3OHAA 5K9FA 4CO5A 1NK8A 2HHQA 1RT2A 1NH8A 2VG5B 2W9CA 1FERA 1U1NA 1U1LA 4OX6A 2WCXA 3LAKA 2JVOA 3FSIA 3HHKA 3M2VB 4RW6B 1ROFA 2HS0A 2ZDOA 1A7GE 4OHVA 3DU5A 4I2PB 2WONB 3CDWA 5SZTA 2OPSA 1VHFA 2V94A 3M6VA 1XWLA 1NNDA 2D7SA 1SJFA 1NO8A 2JJ4D 5HBMA 5I42B 2ABYA 3THVA 4KKOB 4DR1F 2FJVA 3KLEA 2XZWA 1DTTA 1FD8A 4AL7A 5CZXA 3ISZA 2DCLA 2RIJA 5HMXA 2XMKA 1GTHA 3EUNA 1M5OC 4Y28C 3O1LA 4C2MA 5M2RA 3KHHA 3ITHB 4ECXA 2K8GA 3GIJA 3PX0A 2CQ1A 2F4VF 2WK4A 1LXNA 2AV5A 3KLGB 3EZUA 4WFNQ 1WI8A 2DJWA 4MIWA 1NK9A 4HL9A 5A0YA 4OI4A 4UUWA 2KM8B 3SSQA 5KG0A 2ZNYA 3FEXB 4ICLA 3OHBA 4A47A 5C25B 1QE1B 2MKSA 1LW0B 1VRUB 2ASDA 1OIAA 2KXFA 5B7WA 3MZIA 1VQNS 4NA2A 2R7SA 4KQZA 3HHLB 3BO3A 2LEPA 2EPIA 4U9RA 5E3CA 4B08A 4YB7A 2VC0A 5L9NA 2V4RA 3KK1A 2DH9A 1DBDA 1X0FA 2OPPB 3BDPA 5C42B 2PO4A 2XSJB 2KT5A 4FXDA 5F41A 3PV8A 2FIUA 2O3DA 4UY85 3OTCA 2E9RX 4FBUA 2IRUA 2PE8A 4FS1A 1SI9A 1G6BA 1S1WB 3MMJA 4IOBA 4IFYA 3FGVA 4NRUA 3J81Y 2FVSA 1FRLA 2AF6A 2IAJA 3M8SA 2IC3A 4E0DA 3FMWA 2XMWA 3U1LA 4RNMA 4X4RA 2FLPA 2CJ9A 4LQ3A 4R5PA 5HO4A 5EN1A 4H4KC 4Y2MA 2DISA 4NPOA 5CD4H 3H4BA 1HHTP 4NLWA 3EGZA 2MKKA 2OAUA 2BACA 5LMUF 1IR0A 1E6VA 5HROB 3SEOA 1SH3A 4QU7A 4K4UA 2FC8A 5F8MA 2XWYA 2MQQA 1IKYA 1UWBB 4ZKAA 4O