3FEXB

Crystal structure of the cbc-importin alpha complex.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
80
Chain Sequence
LLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The molecular basis for the regulation of the cap-binding complex by the importins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation, protein transport
molecule keywords Nuclear cap-binding protein subunit 1
total genus 16
structure length 80
sequence length 84
ec nomenclature
pdb deposition date 2008-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3fexB00
2ZJQQ 1N88A 3CULA 4OZ0A 2MY7A 2DGQA 1FXLA 2DNHA 2F9DA 5DM6Q 2D3OR 2MQPA 3DXBA 1DHMA 1YWXA 4TU9A 2WBRA 3B4DA 2DNKA 2X1GA 2DO4A 3RW7A 2PE8A 1QVFR 2JX2A 3CCQS 3SDEB 2CPXA 1X4GA 1OPIA 1QM9A 2FC9A 1VQ5S 3NNAA 2LA4A 2DHAA 3MUMP 3CCES 1X4BA 1FJEB 2YWKA 4ED5A 2DO0A 4F26A 2M88A 3CCJS 3MUTP 2X1FA 2EVZA 3P49B 4ERDA 2DGWA 1K9MT 1X0FA 4F25A 1BY9A 2DNZA 1G2EA 1VQLS 2DNNA 4CQ1A 1U1KA 2I38A 1JMTA 3S6EA 4WF9Q 2DNPA 1X5OA 4WKRA 2F9JA 3CXCR 1WG4A 3PIPQ 1ZZFA 4FXWA 2J0SD 1X5SA 2MMYA 1U6FA 1X4AA 2E5HA 2M8HA 5GAHU 1K73T 3K0JA 2LKZA 1X4FA 2FC8A 3V4MA 3R1HA 3U1LA 1VQ9S 1KOHA 1YJ9S 2G1DA 1VQPS 5IM0B 2CQ0A 2ERRA 2G4BA 2CQBA 3NMRA 1KD1T 1HL6A 3G8TA 5JVGQ 3H2UB 2E44A 3VAGA 4UQTA 4M5DB 2EK6A 2OSRA 2QA4S 2N7CA 3S01A 2L41A 2XNQA 2RRBA 1WF2A 2VONA 4WIIA 5LJ3Y 3OW2R 1JJ2R 2KRBA 3ZZZA 2MZ1A 2CQ3A 3UE2A 2KHCA 2KT5A 2CPYA 1URNA 1VQMS 2CQIA 1DZ5A 2OTJS 1WI8A 2LQ5A 3CCSS 2DHXA 2MKKA 2J76E 3CC4S 1VQNS 2V94A 2MQQA 5H1SV 2DGUA 1IQTA 2AYMA 2CQ4A 2RT3A 2KI2A 3VAIA 2CQHA 2MSTA 2LMIA 4CH0S 5LJ5Y 2RQCA 2MZRA 2PEHA 5CXTA 3MD3A 1S79A 4LJMA 1YIJS 1VC0A 4C0OC 5IM0A 2OTLS 2CQGA 2HGMA 4QPTA 2DIVA 2XS2A 2X1BA 3G71S 2LEAA 3G6ES 1NO8A 1WTBA 5GVQA 2HVZA 3CCLS 2K8GA 4QU6A 2J0QD 3CMES 4A8XA 1JJHA 1U6BA 3H2VE 4TU8A 4UY8T 1R8PA 3SXLA 2MKCA 3L3CA 1PGZA 3MOJB 5CA5A 1YI2S 2KU7A 2DH7A 3P6YC 2MZQA 5DM7Q 3DLLQ 4P6QA 3MD1A 2EK1A 2VOPA 4BS2A 2DGTA 2A3JA 3BO3A 2YKAA 1X4DA 1X5PA 1N8RT 2M70A 1U1MA 1VQ6S 2MKJA 2KVIA 2MYFA 5EN1A 1YITS 1JJ4A 1QVGR 2MKHA 3G8SA 1UW4A 5LSLA 2MZJA 1HD0A 2HGLA 1ZZNA 2CQPA 2DNOA 2RU3A 2NZ4A 3THPA 1YJWS 2HZCA 2GO9A 2U1AA 2MQOA 1FNXH 3TP2A 1ZH5A 3I55S 2VOOA 2MZSA 2MY8A 5GAGU 3B4MA 1M90T 2DNMA 1M5VC 1YHQS 4WFBQ 5FJ4A 4QQBA 1RK8A 5JVHQ 2JVOA 3UCGA 1HA1A 1VC5A 3LQVA 3JB9k 3EGZA 2CJKA 2U2FA 4QU7A 2AD9A 4IO9Q 2KFYA 3J7ZT 2CPFA 3D2WA 3Q2TC 3R27A 4W90B 2O3DA 1VQ7S 2E5IA 1M5PC 2CPEA 4Y00A 1H2VZ 1WEZA 1XN9A 2JWNA 3NS6A 2KYXA 3TYTA 4Y0FA 1WHYA 2NLWA 5D78A 1KOOA 2QFJA 3S8SA 2CQ1A 3HI9A 1WHVA 2LYVA 3NS5A 1VC6A 3THTA 1VBZA 3N9UC 4PKDB 4FXVA 2L9WA 3MI7X 2YH1A 2E5JA 1WG5A 3CF5Q 3MURP 3UCUP 3PIOQ 5DDOC 2M9KA 2DGVA 4CIOA 2XS7A 1M5OC 3ZZYA 1KC8T 4Z2XA 2HGNA 3MUVP 1SJFA 2XSFA 5D77A 2FHOB 2JVRA 1UFWA 2RRAA 3CD6S 2BZ2A 3FEXB 3VAMA 2M0GB 2OJ3A 4OZ1A 2N3LA 2CQ2A 2RUGA 1Q7YT 2JRSA 2QEXS 2MQLA 2L08A 2DNRA 3G96A 2MKIA 1RKJA 2MSSA 1WEYA 1FJCA 4EGLA 2D9PA 2KXFA 2MHNA 3EX7B 1VQOS 5GMKa 2YH0A 2DGSA 3NNCA 5DDQC 2N82B 3CUNA 4ZKAA 1H2UX 4IOAQ 4F02A 2G0CA 1OO0B 2YTCA 1FHTA 1F9FA 2RS8A 3Q2SC 2KM8C 1WF0A 1P27B 1SXLA 2DK2A 5IQQA 1X4CA 2MJNA 2B0GA 4WFAQ 2XB2D 2DNGA 3CCUS 2J8AA 4IUFA 2F3JA 2LECA 2XS5A 1WWHA 3G4SS 5CYJA 3CC7S 3BO4A 2RS2A 3BO2A 2DGXA 3U1MA 1SJRA 2LXUA 1AUDA 4YUDA 5BJRA 4YB1P 1K8AT 1H2TZ 3G9CA 1UAWA 1N52B 1UP1A 2MGZA 2DITA 2KRRA 5LSOA 3CC2S 1DBDA 1M1KT 2K3KA 5DDPC 3UD4P 2X1AA 1U1QA 3P3DA 2KM8B 2DNQA 3CCVS 4CH1A 2ADCA 1U2FA 3VALA 1U1PA 2XNRA 1SJQA 3CCMS 2LCWA 1U1LA 2LEBA 3UD3P 4W92B 1FO1A 3VAFA 1D9AA 1SJ3P 2GHPA 1NU4A 2MXYA 2D9OA 2LXIA 3SDEA 2DISA 3VF0B 1O0PA 2ZJPQ 3NNHA 2RVJA 1PO6A 3IRWP 1CVJA 2MJUA 1OIAA 1Q86T 1WG1A 1WHWA 3CPWR 2KXHA 2LA6A 2AYEA 1WELA 2FPHX 3CTRA 1S72S 1M5KC 1YJNS 2Q79A 5LXYA 2HYIB 1WF1A 3RW6A 1A9NB 3P5TL 2CPDA 2N3OA 1Q81T 1YTYA 3J7YU 2I2YA 5LXRA 5DETA 4WFNQ 1D8ZA 4PRFA 1VBYA 2RNEA 4RU2A 3CMAS 2DH9A 3EGNA 2ADBA 2MZTA 4C4WA 5GAEU 3CCRS 5IFMA 1KQSR 3S7RA 1DRZA 4TU7A 2UP1A 2CPZA 2DB1A 2FY1A 1B7FA 4YOEA 1R8HA 2CPHA 3TO8A 5HO4A 4LIRA 1SJ4P 1P1TA 4C7QA 2RQ4A 2M52A 1VQ4S 2DHSA 5MLCV 3LPYA 2KH9A 2DHGA 2CPIA 2E5GA 3SMZA 2MB0B 2CQCA 2M4MA 4LMZA 1HD1A 2MKSA 3FEYB 1N54B 3R1LA 3UWTA 1FJ7A 3I56S 2KN4A 4TLQA 2AYBA 1WI6A 3MXHP 2BOPA 1VQ8S 2ZJRQ 2OIHA 4V19X 2DNYA 3US5A 3VAJA 1X5TA 2M8DB 4WCEQ 1U1OA 4PR6A 2CQDA 1X4HA 3ULHA 5GADU 2KXNB 5DDRC 2M7SA 5ITHA 3VAKA 1U1RA 3IWNC 2SXLA 2KG1A 3UCZP 3BS9A 1L3KA 2MQMA 1X4EA 2MGZB 4IOCQ 2DIUA 2DGOA 2DNLA 1VQKS 5HL7Q 1NJIT 2VODA 4J5OA 2M2BA 2CPJA 2AYGA 1WEXA 2OSQA 4U67Q 3MDFA 3BEGB 1Q82T 1WHXA 1U1NA 3VAHA 2KG0A 3HHNB 1VBXA 1A7GE 1H6KX 1FT8A 2MQNA 2DH8A 1OWXA 2MPUA 1W2BR
chains in the Genus database with same CATH superfamily
4JI1F 4NCGA 2ZJQQ 3RB4A 3MMAB 3CULA 1DLOA 4H4OA 4MTPA 1RU2A 4DU7A 4R8UB 4ZVPB 4DV4J 2PI5A 2F9DA 3GYNA 2HHSA 4LUBA 1CBKA 4DR1J 5K8NA 4QR2A 3Q8QB 4ZVUB 1JXEA 1YWXA 1XBWA 4I1TA 3HULA 3MHYA 4V1Ak 5K9FA 5K5MA 2DNKA 5D3GB 2FD2A 1RT4B 2OFHX 1Y5IB 1TL3A 3HO1A 3MCMA 3ET6A 2FHJA 4DL4A 3PTWA 1Y3JA 1RQ0A 3SDEB 2KJVA 5F8GA 3QZ7A 3C66A 2CPXA 4B3MJ 1XIQA 1R0AA 1X4GA 4MIAA 2F4VF 1QM9A 5HQLA 4JI4F 3NNAA 4PWUA 3QGPA 3IFEA 3KLHB 4K0KF 4P73A 3DI6B 4QZVB 1SKWA 3I0RB 4ED4A 1S97A 1CJVA 4DF4A 1UWBA 3MUTP 2XO7A 3S1TA 3IS9A 4DX5A 2V2QA 4PG7A 3CGIA 4IH5A 1KFSA 3UN2A 1IM4A 1PILA 5KFYA 5CD4H 2YNIB 3RBZA 1K9MT 2LLZA 1FFGB 2VG6B 2F5GA 1S7HA 1HFEL 5A8KB 5EWEA 1GMVA 2Z57B 1BY9A 3DMJA 2E9RX 3LTOA 3MM9A 4HHHA 2KT2A 4AL7A 1NZ8A 1ZTWA 1FX2A 1EX8A 2OHDA 2JOQA 3KLIA 1VQYA 4FVMA 3K58A 1UVIA 1U1KA 3LP2A 2Y9HA 2I38A 4YMEA 3FSXA 1WNEA 1JMTA 1U24A 3SCIE 1D8YA 4WF9Q 4ECZA 3CD0A 3D6MB 2F9JA 3BGRB 1PIEA 2R7QA 3M8PA 4QYZJ 4YOEA 3C6TB 2CJQA 4DSFA 1CS4B 1F6TA 1HW9A 1TMMA 3ELHA 4LF7F 1SV5B 2CA9A 5KG7A 5GAHI 1LWXA 4CO1A 3NGUA 2P9EA 1VQSA 2GC8A 3FSYA 3IP0A 2E5HA 4LRBA 4UF4A 4Z7YA 4CTAB 2GJIA 5KFGA 1YX2A 1UEKA 3JQMA 2QL7B 5D4PA 1RHMB 4DSEA 2C2KB 1RBOB 2JH3A 3BGFA 2DEIA 3C16B 2LKZA 3D66A 3K0JA 3I87A 4TY9A 2HW3A 2EPIA 4NA1A 2FHJD 4KC5A 1H7WA 1X4FA 1Q5YA 3GCXP 3PFEA 3OV7A 1VBKA 1F5BA 2IC3B 1S9GA 3H5XA 1PJ7A 3QRPA 1YJRA 3DXSX 2KT3A 1XMQF 1NEEA 2KDOA 3AB4B 1TUGB 2BYCA 4MYUA 3LALA 1QLNA 4P72A 1UETA 3MF5A 1FKOB 4NXMF 3E8OA 4PWWA 1LK7A 3KHLA 5C24A 2G4BA 2CQBA 3NMRA 4M5NA 1RT5A 4HR2A 3G8TA 1RAIB 3H2UB 1FDBA 1LQ9A 1JLAA 3L09A 4AQYF 1RWUA 5HVGA 3KWMA 4HLBA 5IT4A 2EK6A 3IA0A 5HBMA 2EKNA 2QA4G 4IRKA 3MPVA 3H42A 1XMBA 1K44A 2R7OA 2ZHBA 3N5BA 4TNOA 1U26A 4DV1J 5EX3A 3S01A 4ID5A 4F0MA 2C22A 1LW2A 2WK4A 3Q86A 1KVIA 3D68A 3HSZA 2OPQA 4C3KA 4PXCA 1ICEB 5F3ZA 2LU2A 2DR8A 1DTTB 4X4QA 4WIIA 1NNDA 5LJ3Y 3GJSB 4ZPWR 3BH6B 3CCTA 5KT3A 3OTOF 4WZMA 4TN2A 3R97A 2E1MC 1UJ4A 4CWBA 4LSNB 3NGDA 2G2YA 1UKUA 1YJTA 2KHCA 2FZCB 4NLTA 5HAOA 2CPYA 4F8RA 1UA1A 3ZNJ1 2XMTA 2HFSA 1XERA 1RCXB 3M05A 8ATCB 3NGKA 1FEHA 4ZCLA 3W60A 4FS1A 2UVWA 3FFIA 3WQPA 3CCSS 1FA0A 2DHXA 1HHTP 1N33J 1QDUB 2J76E 3O44A 4TXSA 5H1SV 2DGUA 2IJRA 1HI8A 2J7WA 2KI2A 4KR0B 2BKNA 5EX0A 1JIHA 2MSTA 2LMIA 3IRXA 3RBXA 3DM2A 3U1NA 4RW6A 2RQCA 3K5MA 3B54A 4N7TA 4DF8A 2RKIA 3OBIA 4ETXA 3DOMA 1IBMJ 1YGYA 4RBUA 4DL3A 4DZDA 2IIHA 1ZS6A 3CO0P 2HNDA 1HNVB 4M5LA 1VC0A 2QSWA 2IPOB 5E3AA 4G1QB 3E01B 4LQ3A 2C3YA 1RU1A 1S1VB 4OIXA 5FDLA 1RT5B 3D7SB 3DC2A 3LWLA 1HQEB 1Q7LB 2OAUA 3I82A 5L9NA 3QT6A 1NSQA 2OELA 2YNFB 4QWDA 2F65A 4J9UE 3BKTA 1WTBA 3Q23A 4QU6A 2B51A 4MKAA 3T5LA 1JJHA 1CULB 4N8NA 4B9SA 4PQUB 3H2VE 4LBPA 4P2SA 3RR8A 4UY8T 2FJVA 3UR3C 1S6PA 5KFKA 3L3CA 2XQCA 3JSMB 3DLJA 2DY1A 3CO9A 3B82A 3DU6A 1B0VA 3FMBA 2FVQA 1YJ7A 1BE4A 3C6TA 4J9KA 4DV3J 4GC6A 5IWAF 1RA6A 3P6YC 3R9LA 5HN0A 9RUBA 2W24A 2ZFHA 4P6QA 1H73A 1YBUA 1YKWA 4LT6A 2EK1A 3MMAA 5D15A 4N77A 4DI6A 5LSRA 1V9OA 3C14B 3HCXA 4KRWA 1HPZA 1VLOA 3QWPA 5K8OA 5DQHA 3OL6A 4G3IA 2E7XA 3BO3A 1WOOA 2ZOFA 1M0SA 2YKAA 3QFHA 2ZE2A 4DJBA 4OZ5A 3EICA 4WE1A 5J2NB 2RDDA 4JI1J 3FEZA 3NBPA 1XJWB 2M70A 1OY6A 3DRPB 1BMQB 1V5IB 2H5JB 2J5AA 3F44A 4U7UK 4X66J 2V4RA 3MGJA 1NKBA 2VQFF 4TKTA 5B0CA 1CG2A 3DU5A 1Y0HA 1TKXB 2VFSA 4QR0A 4RU9A 1JJ4A 3R2DJ 3K8VA 2P6TA 4UW2A 2MKYA 2WVCA 2MLXA 3G82B 4EU0A 3PW7A 1LWFB 2HPUA 4OZJA 4A8QA 2CWXA 1UW4A 4I56A 4C8YA 3MAQA 3J7Z5 3K5LA 2FJBB 1VMBA 3D4JA 2C3OA 4B3SJ 4P7VA 1S59A 3GCWP 1WSVA 2RU9A 3GSIA 2ZM6F 2L9DA 5KFIA 3JXOA 1ITPA 4QBUA 2U1AA 2OPPB 2YNHB 4NX9A 3G2XA 5L38A 3TZXA 1U2RA 3TP2A 3VVTA 4KHMA 3FCVA 2IM1A 3MZIA 5DQGA 4O3NA 2NR0A 2AZ3A 4JV5J 1GX6A 3OR2A 4Q7AA 3NY0A 1N36J 5AE1A 1M90T 1TQLA 1RWKB 4LF5F 2DNMA 2EFOA 1BGXT 5I3UB 5ETLA 3TAPA 2YX1A 2VJUA 3TOQA 1M5VC 1RHUB 3D0HE 2BKPA 5KT6A 4DG1B 4C0HA 2BW7A 4WFBQ 1PBUA 1YSJA 3UDVA 2HFNA 4DCPB 2VDHA 2ZC3A 1AW0A 2NXNA 4U7UD 2JVOA 4ZVEA 3JSRA 3UCGA 3RB0A 1HA1A 4Q44A 2RH3A 2QRRA 3F0NA 1KLMB 1R43A 3LQVA 3T5JA 3T9ZA 2UXBJ 3HVTB 4F50A 1KKHA 3MM7B 2ZEJA 3E2EA 5E0OA 4QU7A 1HBNB 2AD9A 3P8BB 2CPFA 3CNQP 1GT8A 3LOUA 4I67A 4AL6A 4JI5J 4FNHA 3R27A 4MK7A 4LSZB 1WKJA 2E5IA 4B08A 4Y00A 4CLTA 5HMYA 1WEZA 1SQGA 2JWNA 4HACB 3NS6A 5HVFA 3SCJE 2UVUA 4ZP6A 1I94F 2ASJA 1LEOA 2ABYA 2E7WA 2H5IB 4DX8H 3HZEA 4NEYA 2QA2A 4DSIA 3I5BA 4Q5VA 1KOOA 4CLYA 4DV0J 2CQ1A 3OLBA 2IAJA 2V2VA 1TK0A 2FB0A 3NCQA 4FNIA 2R7UA 5FDLB 1VC6A 1NMEB 3BPDA 1SC6A 2OPRB 3PDNA 2I5JB 1TKZA 2XYHB 4RPFA 4DX6A 4G1QA 4FXVA 5L1JA 1NSKL 1RHKB 4OJHA 3OUYA 4J9NA 4ECWA 1NDLA 3JQKA 2YKNA 1HWUA 3CDBA 2QT7A 1WG5A 3CF5Q 4NLWA 2FJEB 4AT1B 3PIOQ 3UCUP 1FKPA 3P45B 3FBEA 4NXNF 4KIAA 4P2XA 1PYOB 3A3OB 3TZYA 4HT7A 4CIOA 2B4UA 4I64A 4CZCA 3IXQA 5KG2A 2VICA 3BV8A 1SJFA 5C25B 4PCQA 2XS7A 2CIMA 1S57A 1GH8A 3L95X 4Z2XA 1X0PA 4CO4A 1TFWA 5ETVA 4C8ZA 4I0WA 1RGVA 2BE7D 4A4JA 1UFWA 1FDDA 2EFNA 5A76A 3CD6S 1FE0A 4AXJA 2G2OA 2M0GB 4OYWA 3T41A 2DXDA 1TL1B 4ALZA 2JRSA 5DJBA 2XM3A 2ASDA 2DCLA 4ZPTR 1OQ6A 2QEXS 4C8NA 2WZ1A 2MKIA 2BE9B 2W7PA 2GIRA 3R5GA 4UTGA 2MSSA 1TV6A 1WEYA 4MKVA 5BXIA 2W8KA 3LGMA 4OHYA 3SSRA 1FJCA 4ZVTB 1U4BA 2RMLA 4ZVOB 2MHNA 1GK8A 3A1YG 3EX7B 5GMKa 1EQ0A 2FZGB 4ED2A 1T9TA 1B64A 1IN0A 1JXLA 2CJXB 5J2NA 2XG8A 3DKDA 5DDQC 2W9CB 2GQ2A 4IOAQ 3HD1A 3M8QB 3OL8A 2V67A 3CEDA 3X1LB 1YVFA 3RJMB 5SZTA 3MFHA 3H2LA 2H9ZA 4B3TJ 2BQRA 4X62J 3TAQA 3PCOB 3FQLA 4ZLNA 3FCHA 4IFVB 4ZP8A 5A8WA 1Y10A 3FRYA 3MWBA 3NS7B 3C8YA 1RJJA 4LBHA 3M8YA 3HJVA 4DV4F 4QYRA 4XPCA 5IQQA 2DK2A 3U7JA 1X4CA 5IXUA 2DR5A 4EBCA 4F04B 3BBCA 4Q2MA 5D4LA 3IG1B 2Y0BB 4RZRA 3CCUS 3PYDA 4QW8A 4NXNJ 2FLOA 1NDKA 3I0SB 1XC9A 4I6YA 3DI6A 2F3JA 2GQCA 5HI7A 1RTDA 3H98A 2XC9A 1WWHA 5B0AA 3F56A 3KDNA 3RUBL 3F73A 1FDNA 2V9WA 1AROP 1SC1B 3CC7S 3IS9B 2BJ7A 3BO4A 4DUZJ 2YKNB 3GONA 3KUEA 5K8PA 4JP8A 2LXUA 3HSGA 3C6UA 4A46A 3K59A 1HQUB 4ILRA 2EXUA 1S9EB 1H2TZ 2HKEA 3G9CA 1U09A 2B8QA 2FQQB 3TWZA 3DLGB 2GAGC 1UZDA 4YDXA 2BA9A 1JLEB 4BLGA 5F8JA 3CC2S 3LGHA 1U6ZA 2QLXA 4OYXA 2I6WA 1MROA 3PY8A 1S6QA 3NGTA 3UD4P 9ATCB 4QYZK 4RW7B 1R3NA 3FGVA 3W5XA 4CDIA 3GILA 4IQMA 2ZC4A 3O3LA 2HZAA 4USTA 2AJQA 2BJ3A 1HBNA 2ZZTA 3ILOA 1DLOB 2QFIA 3MMCA 4ID8A 4WPAA 4OI6A 3HVTA 3WZ0A 4JI6F 1YZ6A 3ZTSA 2I9SA 3HHLC 2XS5A 2HHXA 2XHWA 4WE1B 2YPZA 2JNJA 1HWLA 3CCMS 3OTDA 5ETPA 5HSPA 1U1LA 2LEPA 2UUWA 2YWFA 5KT5A 2DPJA 2HURA 2VC1A 2HRTA 4G65A 4FZVA 4EYHB 3CJSA 1T9VA 4W4MA 1D9AA 1IBKJ 1T9YA 2RE1A 2IDLA 5KFTA 2Y0SD 3GZ7A 1NU4A 4RNOA 1GNKA 1VHFA 3SDEA 3VF0B 2KFZA 2BJDA 2RVJA 3V2UC 3ZZOA 1CVJA 2MJUA 5KFPA 1SH3A 1WG1A 1WHWA 1YRTA 3QBCA 2E66A 4J9VA 4NI2A 4CO2A 4DR6F 3MCNA 2LA6A 4ER8A 2OPSA 2AYEA 2YKMA 2XTJP 2RF2A 3TZZA 4HDHA 1TMJA 2AJ1A 2C3PA 5AT1B 1YJNS 4XPEA 4XIUA 3DDNA 1XNQJ 2IM2A 4B9NA 3FSIA 1DARA 3QLHA 4Y6IA 3M8ZA 2N3OA 2IYGA 2VG5A 1Q0NA 4JI7J 4KV8B 1PC4A 2I2YA 4FYDA 5DETA 1D8ZA 4RW4A 4ECUA 2BVZA 3MR7A 4BWJA 1GMWD 3PX0A 4HL9A 5B7WA 3SI8A 2HNZA 2RNEA 1T9UA 2VQEF 4HHUA 1F9HA 1NHVA 2DH9A 3BQ0A 3AODA 2UUCF 3CCRS 2QA1A 1TK5A 1IKVB 4DPOA 2HQIA 1J5EF 4IH7A 4C8KA 2L48A 3GV7B 2PDAA 3D1QA 5LM7E 3R6GB 4B02A 4H4OB 2HFVA 4CLFA 4DOZA 5J1PA 4ES2A 1B7FA 2HWTA 1FWLA 1WOSA 4WIQA 5HO4A 1SJ4P 1K1QA 1P1TA 2VFVA 3GJQB 2V0NA 3FDSA 3AOCA 5L8RC 2ZH8A 5M2PA 1C1BA 4RLEA 5KFOA 4USKA 3QGIA 2UXDJ 2Y8WA 2C3MA 3SMZA 1C4AA 4B3MF 4YS2A 3R5DA 5A8WB 5B09A 2MKSA 5K20B 1WOPA 2HK2A 2OFGX 3EZUA 3FBBA 4R25A 2WOMA 4ILLA 3MECB 3OXFA 1OSCA 3UWTA 4ZIWA 3I56S 4TLQA 4I4BA 4YHHF 2F8MA 3A12A 3RAMA 3MXHP 2CXEA 3UD5A 2Z56B 5DG8A 4V19X 1GFWB 1EB0A 4ZA1A 1OJ4A 2M8DB 2XMWA 2D74B 4A8MP 3HT3A 1FXDA 4J9RA 3TAMB 4CT8A 3GIMA 4DR2J 1U1OA 1DTQB 3GB0A 3ULHA 1KWMA 2B6AA 1IQZA 5HJYA 4JI8J 4HDGA 4X62F 1S48A 5B0DA 3QLHB 3MAAB 2SXLA 1PJ5A 1AYEA 2AEFA 3POTB 5L46A 3IWNC 1X4EA 5KOWA 2CG4A 4ZJQA 4IYQA 4NLVA 4X4OA 4RW4B 1VQKS 4NLXA 3LP2B 5SUHA 4J5OA 1NJIT 2HHTA 2AYGA 1RAJA 2XLKA 3GG0A 2WBMA 3BEGB 1Z1ZA 2J7UA 3MDFA 4Q8FA 4W98A 4MAKA 2V8VA 1JKHA 1Q82T 4O3QA 1BUXA 2IJNA 2E1AA 3D54A 2IRXA 4CH7A 3NGRA 4EFAC 1RHJB 3K17A 5KFLA 5KG4A 2D3OR 1N4LA 1OWXA 1DHMA 4IDKB 4XDDA 2RB7A 3WC0A 3BQ2A 2DCUB 2W2PP 3VWSA 5KT2A 1VISA 2CDRB 4H4MB 5LMUJ 1IKYB 4Z37A 1NUEA 1Q8LA 4LRFA 4DU8A 1N5YA 3TARA 1YDLA 3HT0A 4DR4F 3FJ2A 3NEKA 4EBDA 1FRXA 2DR7A 1BXNA 1RACB 1UZHA 1UVMA 3KNAA 1UVNA 3ENAA 1KSPA 2WHOA 4DMZA 4ED6A 1N5VA 2WONA 1ZAVA 2D7SA 5ETMA 2JLEA 3EGWB 3UDEA 3ZTRA 2W1BA 3IWXA 2UV8A 3KLEB 1QVFR 1S1XB 2DT9A 2NYIA 3BSOA 4M5HA 1RCOB 4Y2AA 1U0HB 2CNNB 4PXEA 5J2QB 2OP5A 4WYLA 2KHDA 4HI2A 3U02A 4CLWA 4LF9F 2EFGA 3OPKA 3QT5A 3NOGA 4JUZA 4F3MA 4TYBA 4C2MA 3R8YA 3J81Y 2Y1IA 1CC7A 4ECTA 3W66A 3Q8UA 2DHAA 5CZVA 3BSNA 3QGHA 4QW9A 1HBMA 2NCKL 2HFOA 2MLYA 3AT1B 1D0EA 5DZ6A 1N32F 4ED5A 2DO0A 1S7IA 4I6WA 3OL7A 4O3SA 1L3TA 4Q0BB 2NYHA 3IGVA 2M88A 4KH1B 1N34J 4X84A 3CCJS 1JLFB 2IRYA 1MWYA 4J37A 1SCJB 1H3DA 1QTMA 3KMSA 5KFXA 2X1FA 3SFUA 3FBCA 3TNVA 4ECQA 2BM0A 1O8BA 3M2RA 2EBEA 4ERDA 2D1CA 4CM2A 3LPEA 4OX7A 3JTPA 1UEVA 1X0FA 4B9TA 4F25A 3H25A 3PZPA 2WVEA 2IYIA 2IDEA 2DNZA 4C8OA 3CJTA 2ZH5A 3MCOA 2Q3PA 2HWHA 3AJDA 2WAQD 4O0NA 1RBLA 4WP8A 1V3RA 3DHWC 4JI5F 2DNNA 4CQ1A 3KJVB 1RT1A 3J80Y 3S6EA 4KJIA 2JEIA 1HNZF 4IG3A 2B56A 4M5IA 1SL1A 1WG4A 2I8EA 4FXWA 4J9PA 2ACYA 1YK9A 3A8EA 5I3QA 3K7RA 4PG8A 1X5SA 2X51A 1S0VA 1NH8A 1EJ7L 3TUIC 3QO9A 1X4AA 1EETA 5BR8J 4NYPA 4HT5A 1S10A 2M8HA 3RG6A 2WW8A 3NGSA 1NJZA 1K73T 3KG0A 4NYOA 5C7PA 4KO0A 2JFKA 1NJXA 4RW8A 2FC8A 2CRLA 1RT2A 3HHLD 1PAUB 3KK1A 2N7YA 3MM9B 3U1LA 1VQ9S 1GQEA 1KOHA 2AW0A 1FCAA 4ZPBA 1Y5LB 1YJ9S 4Y3CA 2G1DA 4TY8B 4F2RA 3W9IA 5THWA 1TKTA 1YRXA 5B0EA 2UU9F 2CQ0A 1HARA 1RTJA 4KT0C 4QWCA 1TL7A 2B3TB 2ERRA 5AE2A 4F2SA 4JYAJ 1REGX 3W5ZA 3IAM9 2BV3A 2K1RB 3CMQA 4QIGA 2YPYA 4B3OA 2OSRA 4AXIA 5C2GA 1KFDA 2VG5B 4FXDA 3UN5A 2DXEA 3EM1A 5T7LB 2N7CA 3Q8SB 2C2ZB 1W26A 2Z2YB 1WTFA 5KFDA 2V8HA 3W2VA 3T3FA 5D8HB 1D09B 3TVKA 3I96A 2JLFA 1VCTA 1BQNA 2VONA 1YRUA 3BBBA 3U27A 4DV3F 3CJ8A 4DG1A 4WYWA 1NZAA 2PT0A 2Z0GA 4O23A 4F4WA 1HNXF 4DR2F 4OI4A 2MZ1A 5KG3A 1U45A 1SIZA 1XTZA 1FKOA 1SPBP 1Q8KA 1FDAA 1TK8A 2RJZA 3WIUA 1URNA 3P96A 3HHEA 1EHWA 4R8UA 1FVQA 4X4RA 2OMOA 2B43A 3PW5A 3BDPA 2CQIA 4H4MA 4LFAJ 3J81U 2XCAA 1OMSA 2LQ5A 3NBPB 3P5BP 5D0RA 1Q53A 4K4XA 1K0VA 1WD6A 4M5DA 2HQGA 4USUA 4UOHA 3CJ0A 2OEKA 3CC4S 2QJ3A 5KFQA 2MQQA 3EDQB 2XZWA 3DNCA 3NP5A 3KYLA 1HWKA 2UVVA 4YEAA 1AXQA 1QE1A 3GFZA 1XNRJ 4QIVA 4DL7A 2CQHA 4MK8A 2EEYA 4CH0S 3QAUA 1ZOTA 4P10A 3GTYX 1V3ZA 3DN9A 1MLAA 5LJ5Y 3H4BA 5E3RA 2UUTA 3N6MA 2GA7A 5CXTA 3GWCA 3OQ2A 1ZM3A 1S6PB 4H4KC 4XDCA 2B9XA 3MM8B 1YIJS 2E7VA 1T95A 2HFUA 2DTJA 2LP4A 4IH6A 2OTLS 1Q4RA 4Q0BA 1KQGB 1T9WA 3KUGA 1U02A 4QPTA 5D0EA 1PCAA 4ZPVR 1PJ6A 2CJ9A 2RHQB 2JDJA 4A48A 4YDDB 2DPIA 2IHR1 1JLFA 2ZH7A 1LW0A 1FTCA 2LEAA 4GRSA 3VTIA 5I4MA 3G6ES 3K8WA 1CC8A 3N0VA 1FJGF 1SL2A 1Y00A 2K8GA 5IV3A 4A8XA 1REVA 2XI2A 1U6BA 3UN3A 2VB6A 4L74A 3R3TA 1R8PA 1BD6A 2AHOB 2NXUA 2D69A 3IRXB 3FCWA 4LQ9A 1MU2A 4JI2F 1RYSA 4OI1A 1LNQA 1Z4UA 5J2MA 1JK9B 3M4XA 1BQNB 3TUJC 5CA5A 2OUGA 3K89A 2DH7A 5T41A 4UUXA 2MZQA 4LF8F 2H4YB 4F0KA 3MEEA 4D3HA 4FPIA 3MD1A 1VIXA 4F4XA 1F3FA 3IBWA 3TJ9A 5KT4A 2VOPA 2M3DA 3HVRA 4DV1F 1AZSA 2VIHA 3BYRA 3DFEA 5H9EK 3H5UA 5KFJA 1R6YA 3RRKA 3GIIA 3SSQA 1X4DA 4J91A 2HRUA 3HDSA 3UVJB 1TVRB 3CSKA 4OI0A 2Z2MA 1FK9B 1OSDA 3C46A 1RT2B 2DY9A 2YY3A 5KFNA 2W2OP 4Y2MA 5AJ3J 3KLEA 3K5PA 1VGYA 4WKYA 4X2BA 3SYZA 1KN6A 4A8FA 3DOLA 2OD4A 1FX4A 3TUPA 2GMHA 2R7VA 4IFVA 2MKHA 1T94A 5D0HA 2OI2A 3DGPB 4ICLA 3RU0A 3CWJA 3M2VA 5LSLA 3PHEA 3R5BA 4ZIVA 2MZJA 2D41A 5C24B 3J7AN 5KFUA 2GHVC 4AD6A 1HBUA 1ZZNA 2CQPA 2J8SA 5HANA 1N6QB 1JLAB 3ICLA 1IM6A 4HI1A 2CNKB 2GX8A 2ZBPA 3I0SA 4ZCIA 2RU3A 4C11A 1S0MA 2NZ4A 1XR6A 4DQSA 1FNXH 3HZGA 1VYAA 2D3UA 2R42A 5DLFA 2YWWA 3EMTA 2R9LA 5E3PA 5J1EA 2KFNA 4PABA 2BE2A 1U8SA 2W2MP 2W4DA 4WK3A 3I55S 2GGPA 1ZH5A 5IOLA 2HLUA 4YY3J 4EWTA 3SCLE 6FD1A 2MY8A 3QIPB 2V69A 1UTAA 4QWEA 3OJSA 3CD5A 4NLPA 2QLJB 2RDIA 3HM9A 1WJ9A 2JFDA 4ECXA 3GMGA 5J2PA 3QSIA 4RW9B 1GAOA 4NLGA 5E33A 1R0AB 2DKOB 5FJ4A 3GQCA 4JV2A 1RK8A 2WTFA 3M30B 3MM5A 5HK4A 1XWLA 2V50A 4LF6J 3MAHA 3EJMA 2D3ZA 2FZKB 1HWIA 2U2FA 2VDIA 2V4JA 4ELUA 4USIA 3D0IE 3ISND 4RUAA 2HMIB 2DXFA 3JAMU 3OUYB 5IT0A 5A8RA 3DRYA 1VQ7S 2QTWA 2XYGB 3W8PA 2WB1D 2CPEA 3HD2A 1H2VZ 1FWKA 3LAMA 2ZKUA 7FD1A 4J90A 3W8GA 4ZLJA 2HHQA 3TYTA 5C25A 2YWHA 2AQ4A 3C3LA 2QO3A 2W25A 3DYAB 3HKWA 4Y0FA 2YXLA 2BANB 1WHYA 1B0PA 2RUSA 2VKZG 1LWCB 1WACA 5D78A 2QFJA 2FVRA 3S8SA 1RT3A 2HBYB 3M9NB 3TA2A 1WHVA 2LYVA 2J9EA 3SIPB 5KG1A 3T9NA 4PKDB 4F3QA 4EZ9A 4JI3J 1Y7PA 2L9WA 1XNRF 2VFTA 3T5HA 2YH1A 3BSCA 5CQGA 3M8WA 5HP1B 4LVNP 3MURP 3Q24A 2VBZA 2FJXA 3QYYA 3TUZC 1CULA 2CNLB 5J1EB 2NUUG 4JBCA 4JV0A 2K7KA 2E5LF 1Q16B 2VFRA 3PM9A 3W2VB 2ZBCA 1M5OC 1WDTA 1KC8T 4U8VA 4HACA 4OZLA 5D77A 4DR1F 4KBIA 4FF1A 2PC6A 3IBFB 4USMA 4C6AA 2RRAA 2BM1A 3A8IA 1RI7A 3FEXB 5ETKA 4RUHA 1QSLA 4KHPF 4YB6A 2OJ3A 4I2PB 3MEDA 2QG9B 1SC4B 2RUGA 1PC5A 2CQ2A 2HIYA 6AT1B 3QT8A 1NJYA 4ZITA 2L08A 4JI0J 3I5CA 2DJWA 1SC3B 2NXCA 4DQRA 5KFHA 3W65A 5KFSA 1QAYA 3KG1A 4EGLA 3M9MB 4KGXB 4F3OA 2HHVA 1S99A 4R5PB 4RNNA 1VQOS 5L1LA 5F8LA 2VPZB 2WW4A 1HBOB 1UEUA 1ZTTA 2I1RA 3CJKA 3RB3A 3DOKA 3CUNA 4K4SA 4OYBA 4I2QA 1KONA 2MTLA 2G13A 3PRBA 2IA6A 2H5EA 1KR4A 4NLYA 2W4PA 5A8RB 2G0CA 4C3MA 2QYGA 1I6JA 2YTCA 3H90A 2RILA 2VBXA 1J2VA 4RL1A 1HQUA 2C2OB 5EUHA 4DR5J 4JI7F 3X3UA 2XSJB 3RTVA 2E29A 2BX6A 3DLEB 1KQFB 1Q78A 1NK4A 2J9DA 1UVLA 1E6YB 1WF0A 2O5DA 4L75A 4P2FA 3UO0A 3AD8C 3CD7A 4AFFA 1TU0B 5BR8F 4QPXA 3JSMA 2B0GA 2L9NA 3PKMA 1FESA 2KZMA 3ETMA 3O6QA 2FIUA 2J8AA 3TI0A 4FYVB 1DQAA 2N4DA 1UJ5A 1GXLA 2FHMA 3N28A 3W9JA 1SUQA 1X9MA 2BQUA 1RADB 2LECA 2Y8YA 1RAEB 4FBTA 2HVIA 1OYDA 1HNZJ 1B70B 5CYJA 2PMHA 3BSAA 1G4CA 4A8OA 3QJPA 4I7FA 3BO2A 3BGLA 3SV3A 5HP1A 4NE9C 3LP0B 3FUYA 2AX1A 2WVDA 4P71A 4WP3A 2QC3A 4YUDA 4DV6J 5BJRA 4LR9A 4PQAA 1K8AT 1HQ2A 4Y2CA 3DM2B 3WDOA 4ED0A 2DITA 3NCPA 4FBUA 3I9ZA 4GO7X 1SKSA 1M1KT 1N48A 1HYSA 1HI1A 1J27A 2NPFA 4M5MA 1U1QA 4UY85 3GG1A 4I2PA 3AY0A 2KM8B 1ZAWA 4HTIA 4ZVFA 4DHVA 1UW9A 3Q8PB 4DPTA 4O0IA 3J7YI 3IG1A 1R27B 4K4WA 3TANA 3PEHA 1NK8A 1U2FA 1S0NA 1RT6B 3K2YA 3WHIA 4X64F 3AJ2A 3EPIA 3IGNA 3L7OA 4NWBA 1JXVA 3ISNC 2HWIA 1EETB 3GFYA 4OFZA 3N4WA 4A8SA 4LFCF 1CJKB 1C0TB 2LCWA 4ECYA 1G2EA 2YNFA 5B0GA 3CVKA 4UOFA 2XCPA 2WONB 2P9CA 1BQMA 4ED1A 4LF9J 4DR3F 2V8GA 3GFHA 3GFXA 5G0RB 4CP5A 2GHPA 2C2RA 1SJ3P 3AJ1A 2V6AA 4PQUA 4XTTA 2D9OA 1VIOA 4DUZF 1O0PA 1C1CB 1UCNA 4WTYA 3ZTPA 4C8MA 4JB8B 3E3XA 2ZJPQ 2GHWA 4WFZA 4LSNA 1NRKA 1Q86T 1T3OA 1EP4A 1UMJA 3PR5B 3M2UB 4L72B 4LBIA 3SQGB 2XGPA 2F8EX 1CS4A 1ZYQA 2QX0A 1JX4A 1R6VA 1NB7A 4RUCA 3M32B 3K5OA 3MEGB 4BBYA 1WELA 2GV1A 4A8YA 4GKKJ 1O51A 2CZ9A 1U47A 3W7BA 3AOBA 2NREA 2UUAJ 4CO3A 3MR5A 3LA0A 3UW1A 1FKPB 2Q79A 5GAEI 1R7IA 5LXYA 4B9UA 2HYIB 4EZ6A 4GO5X 3NOCA 2GGPB 2CPDA 4UQGA 2HVEA 2PSZA 1AFIA 2RD5C 2J9CA 3KK2A 4PRFA 3T1AA 1L3SA 3T1HJ 1NLKL 3T19A 1VBYA 4OYMA 1RISA 4NLSA 2UUBF 1SH0A 1DY3A 2QZ8A 4M1KA 3AA9A 2VASA 2MZTA 3GE9A 5GAEU 2GS8A 2ADBA 3BPSP 4MIBA 1YQHA 4RNHA 2YX4A 3PHTA 4OMFG 3QJLA 3CJRA 3MECA 1HMVB 1S1WB 1U7LA 1QUPA 3NCRA 2FJDB 4MKYA 2CPZA 1LV5A 2DB1A 2EWHA 4QIFA 3MM6B 1IKYA 2AP6A 3BN7A 2WCXA 1B3TA 1ELOA 2FY1A 3GJTB 1TAQA 2K7JA 3V6DA 2CPHA 1EKRA 2D3O1 4FPRA 4HKQA 3TAMA 4KGZB 5DLGA 1X8DA 3UQSA 2RQ4A 3BDEA 4ID5B 1SQFA 4UUWA 3VGSA 1Y5NB 4OHWA 5MLCV 1FVSA 4KKOB 2H48B 2HBQB 2R4FA 2E5GA 5KFVA 3DRSB 1C0UA 3LAKA 4DCOB 5CCLA 2MB0B 4TYAA 1HD1A 4ZOSA 1BQMB 2GCFA 3IWLA 3FEYB 4WFXA 3R7NB 1IKWA 3R1LA 3RB6A 2HAIA 1T03A 1FJ7A 1H72C 2XMUA 2PD1A 1IBCB 2V2ZA 3WIVA 3AHPA 2BOPA 1FEEA 3NKYA 3KJFB 2KKHA 4E2FB 4U95A 2DNYA 3LP1A 5M2RA 1X5TA 3SQGA 2C2EA 2AEJA 5K14B 3Q8RB 3NWRA 1RSCA 4Q2LA 4WCEQ 4PR6A 2B4VA 1GTEA 2CQDA 1KTQA 2ATCB 1X4HA 1ZAXA 1S1TB 2ZH3A 4PUOB 3N01A 2KXNB 2NZCA 1N0UA 1B99A 4NLDA 4DEZA 5A2QY 2M7SA 1LW0B 3GR0A 3M6UA 4KPCA 1U1RA 3UCZP 1L3KA 3I4PA 2MQMA 1VRTB 4OHVA 2FLLA 2F63A 2IM0A 3SCKE 1GMUA 1TKXA 1VLYA 2DNLA 3SEOA 4D3GA 4X4VA 4YY3F 2VODA 1VQ6S 4DCJB 3OXGA 1RT4A 2CJAA 1WEXA 4GVBB 1HKAA 2GZOA 4KGKA 5F8NA 2B8PA 2FLPA 3HSJA 1QAIA 2CG8A 1JLBA 3MR3A 2HAFA 1NSAA 2ZUAA 4CLUA 3VAHA 3E01A 5ETSA 1FRJA 2OO4A 2KG0A 1U1NA 3KLHA 1A7GE 2BDPA 3CIMA 2DH8A 4YB7A 1N88A 4OZ0A 2IBOA 2MY7A 4E98A 1RWWB 1NHKL 2W7OA 2B6AB 3ZTQA 1HNWF 5JJBA 4ELTA 1W25A 1RWOB 3KUHA 1FRIA 3QNWB 1FRHA 4RW8B 3DXBA 3UVJA 3UDLA 4HYKA 4TU9A 4FF4A 4UT4A 5HROB 2CADA 2WBRA 2VH7A 4PYDA 4PPDA 2X1GA 2DO4A 4BC7A 1RXOB 2PE8A 1IJFB 5I3UA 4RJVA 4LF2A 1NK9A 1HW8A 3CCQS 2A10A 3EVMA 1S77D 4IKAA 1RUSA 3HP6A 3H5YA 3VZIA 1SL0A 1R8AA 2HS0A 5LMNF 1VQ5S 2C1EB 2O66A 3VV2B 1AB8A 2LA4A 3OHAA 4I6AA 3HPOA 2DVIA 1RYRA 1HNWJ 1HPZB 1GXUA 2YKQA 3NXZA 2HBRB 2ILZA 3MUMP 1FJEB 4ED7A 4B3OB 2YWKA 3ILLA 1SUQB 3MPYA 4OYIA 4F26A 1JWWA 4LFBF 1LK5A 1N32J 1X60A 2O67A 2BE2B 4LF7J 4NMLA 2ZVSA 4X65F 4DN9A 1H98A 2XMMA 2DGWA 4X4SA 1ZPVA 3ET6B 2ZH6A 5D6GA 1L3UA 4CYUA 4NZ7A 3DLHA 5H9FJ 1VRUB 3CE8A 3N79A 2PMZD 4ANCA 3GIJA 4F4ZA 4ZLLA 1IKVA 1NB2A 3MMJA 3V6KA 1KS2A 3W63A 1T7PA 3R7SB 4CI0B 4CM0A 1KEKA 3RRGA 4WZQA 2OKQA 5HMXA 2B9YA 3MM6A 2DNPA 4WKRA 3EWGA 2ALZA 1HMVA 4NMXA 4QJVA 5BYSA 4DL6A 1TL4A 3L7PA 3PIPQ 1ZZFA 2VL1A 4M5KA 3GPAA 1S4FA 2HFZA 1HIYA 3VGUA 2B9WA 4TQSA 4NLRA 1VDHA 3MPWA 1NPKA 1QSYA 2CVEA 1U6FA 3SSSA 1KP6A 2GO8A 3B6BA 8RUCA 2WVFA 1C1BB 5CH7B 4WU3A 3IMQJ 4K2XA 5D4NA 5KFBA 4LSLB 3EZOA 2BJ8A 2Y1RI 4M5GA 1S6OA 1A6LA 2LXFA 3HX9A 5GAHU 1X9WA 2EC0A 5T7LA 3EUNA 1CLFA 3V4MA 5IWAJ 1P6TA 1S9EA 4DS5A 4FS2A 2KL8A 4Y28C 4P52A 1NKCA 1T02A 1IR1A 3EZ5A 2E5LJ 5FLXU 1JLEA 2ROEA 2HS4A 2G2ZA 2H1YA 2HS3A 1ZM9A 1RT1B 2BJ1A 5E2QA 4WJBA 5IM0B 1S6QB 2V8PA 1RAOA 2R2RA 2AGPA 2NQPA 5HMZA 1EIYB 4DPXA 1Q79A 2UV8G 2HRYA 3LANA 7FDRA 1HHQA 5JVGQ 1H7XA 3G87A 4RUBA 2AJ0A 3CT9A 3ADAC 2AGOA 1ACMB 1F60B 1JLCB 1Q8BA 2HK3A 1EKSA 1IUJA 4OL8A 1LXNA 3VGTA 3TQ1A 2A18A 1NPPA 4B3RJ 1VHIA 2QA4S 3PW4A 4LRCA 3M8QA 5CYMB 2HHHJ 3EVOA 4KGMA 1F9EB 2V5HG 3FQKA 3SBMA 2J6UA 4OHZA 2WSFC 4ZPDA 1BLUA 3RAXA 3MOZA 4DUYF 3OFGA 1JKHB 4AUKA 3OW2R 4IR9A 2HHWA 2FHKA 3M1VB 3T1HF 1JJ2R 4K4VA 4KFBA 3ENWA 1VS3A 2UXDF 1Z2ZA 2WOMB 1Y3KA 3NWGA 3HK2A 1S1WA 3OSNA 1TKTB 2CQ3A 3MM5B 3UE2A 2I5JA 4YR2A 4CLPA 2GNKA 3UDCA 2VPXB 5L1IA 4X65J 1HNVA 5B08A 2W4CA 2ZDPA 2KJWA 1GTHA 3GYGA 1WI8A 3LUYA 3PG9A 3KMQA 3OHBA 2OTJS 2ROGA 3D6FB 2XO6A 3QMQA 2VQEJ 4DR3J 1DTQA 1FRKA 2ZUGA 4GVLA 7AT1B 4YP3A 2MKKA 2V94A 3UNGC 2G1HA 3RGIA 1IQTA 3VQTA 2AYMA 1OYEA 1UWAA 2JJ4D 2RT3A 4I2QB 5F0WA 3TQEA 1T3NA 5HROA 1HR0J 2GVDB 2HEKA 3SFGA 3WX4A 3ZC4A 4MYTA 1B4SA 4NASA 2XY5A 5HLFB 2MZRA 1REVB 4P7TA 1AFJA 4H54A 2LQ8A 4U9RA 2CZ4A 3QPIA 3FKBA 1R89A 4N47A 4P9SA 1S1UB 2UXCF 1RT7B 2C2NA 4PXDA 2P8IA 4DBQA 4XO0A 5IM0A 2CQGA 2HGMA 3HKZD 4LRAA 4CO5A 5LMNJ 4DQPA 2YKOA 1LFPA 2HBZB 2RIJA 1LKZA 4YR0A 3CJ4A 3JTOA 1TELA 3NAHA 4EUVA 5C2CA 1RAFB 4HEA9 2X1BA 1X9SA 2XS2A 1RDRA 2AGQA 4PWDA 3KKFA 4MFBB 3M2RB 2HVHA 1LXJA 4ZVSB 1RTHB 1S4EA 2YWEA 4OX8A 2Z30B 2KZZA 2YNGB 3LO3A 3JAMY 4K4TA 4DV2F 1F5AA 3D3CJ 4IR1A 2J0QD 4ZHRB 2IVFB 4TU8A 2CYYA 3PJ9A 2QGFB 2HQFA 1IWGA 2MKCA 3SXLA 1PGZA 4DV6F 2DBBA 1YJUA 1IBLJ 3NG8A 2R8JA 1YI2S 3QRRA 4PWDB 1LWFA 2KU7A 1TKDA 2XZDB 2YKMB 3CIZA 1IJEB 3BKUA 4FYWB 5DM7Q 3DLLQ 4F4AA 1S6UA 2AJ2A 4NXMJ 3KOAA 4BS2A 1S49A 2A3JA 2DGTA 3A13A 1VJWA 1T9XA 4C3LA 2QLFB 1X5PA 1SIWB 1N8RT 3BKFA 2VKRA 1PYTA 1C0TA 4NA2A 1U1MA 1TFYA 2RDJA 4CO0A 3DGVA 2KVIA 1P9QC 3ENVA 3R5JB 2JC0A 3DRRA 3V4IB 2OH2A 1U2CA 4ZVRB 1YITS 2AJ4A 2BACA 2FGCA 4NCAA 3DMJB 1PKUA 1R31A 2J7KA 2ZVIA 2ZH4A 4DL5A 2E1RA 3MTJA 1EAYC 4ZS6A 3A3NB 3FNNA 2ASYA 1HD0A 1F1BB 3T6JA 2HGLA 4DSJA 4X4NA 4IRCA 2XMKA 1RWPB 5H9FK 2ACMA 2DNOA 5MAOA 2F8HA 3FBFA 3MEEB 4ANEA 2A6OA 2C42A 4LREA 5GMEA 5LT5A 4FKXA 2HHPA 2O01C 3FZ2A 4X66F 2ZHAA 2MQOA 2G9OA 2GO9A 2Z4PA 2VD3A 5KG6A 4CT9A 4KYZA 3B8HA 3H8YA 4JI0F 3O2IA 3ZZRA 4ZK7M 2CFXA 3GR1A 2VOOA 4CNYA 1I3OB 2B4PA 2BRLA 3QZ8A 1JNRB 4TLRA 1GEHA 3PFOA 5GAGU 5DQIA 2R8IA 2CVIA 4LF4J 4CYUB 4LFAF 3B4MA 4ZN3A 1P9YA 3HHLB 2P2CB 3IM9A 3MR6A 2ILYA 4K4YA 3C15A 1CJUA 1TL3B 2FLNA 3FK4A 1Q1KA 4WK1A 5CYQB 3G6YA 2XBPA 4E0DA 3VGVA 1A0OB 4L3KA 1NDCA 4DSLA 2FVPA 3LW5C 2UUBJ 2BANA 4QQBA 3TJAA 1U0SA 4WXOA 2BOAA 1AUSL 2WRMA 1HBUB 1NSPA 3AXKA 3EGVA 5A6WA 1VC5A 2YQ0A 3PXGa 1FKAF 3OFEA 2AMCB 2CJKA 1RB0A 1I1GA 3Q89A 4GC7A 3H4DA 4OHXA 4DX7A 1Z2LA 4IO9Q 3I0RA 2KFYA 3LWMA 3J7ZT 1KHWA 3D2WA 2V63A 3CJ2A 2EW9A 4EYIB 2O3DA 4RO0A 1UA0A 2V8DA 5HLFA 1KVJA 1YBAA 1UPPA 3QIPA 1M5PC 4KKOA 3AQPA 1IVZA 1XN9A 1HNIA 3KK3A 3DRSA 3GSDA 4J9MA 4MT1A 1RAGB 1TP7A 4RX6A 2JLGA 4NLUA 5A0YB 1O6XA 4LF4F 1IKWB 4DPYA 2DEJA 3KJVA 1FRMA 2VC0A 1QTNB 3HI9A 1NK6A 2AJFE 4IFYA 1FXRA 4U6PA 2ZNYA 3AQOA 2AZ1A 5ETOA 4OV1A 2EFVA 2BQ3A 1RTHA 2V4JB 1IR0A 1YBTA 4Y34A 3OVBA 1WSRA 3QATA 2X3DA 3QO9B 4PEOA 1RTDB 4YB5A 1MMLA 1RKIA 2RAQA 5DDOC 4BHQA 1GXTA 2EKYA 4LFBJ 4F4YA 4MH8A 5F9LA 1OY9A 4DZ6A 2YQ3A 1VRTA 3ZZYA 1S12A 2ZH9A 3O8WA 2VF3A 4TVAB 1DJ0A 2HVDA 3M1VA 3KK1B 1D3WA 1U49A 1YLXA 3JTNA 4ZPAA 3EPGA 3VAMA 2PI4A 3DCAA 2C2MB 2DHHA 4TY8A 2N3LA 2W2NP 1XMOF 2Z8QA 4GMKA 5AXMA 4AE5A 4KQZA 3ZZ0A 2FYXA 1N5TA 2DNRA 2IAJB 5KFCA 2VFUA 1RKJA 3MM8A 3ZO7A 2BXJA 1OS5A 2Z58B 2VZ9A 2ZH2A 3QFWA 3V6DB 2Z2ZA 4IG0A 4XAKA 2KXFA 3QIDA 2KTQA 2CKWA 1CJKA 1FTRA 1TUWA 3AB2B 1T11A 4OYAA 5F0UA 4TQRA 4CCHA 2DGSA 2FUG9 3RRHA 3ENQA 3ITHB 4FN5A 3W62A 5RUBA 1H2UX 1XMQJ 1C0UB 2Y1LB 5HQMA 2JL9A 2CZVC 2QLBB 1OO0B 2OPQB 3BGUA 3KFWX 2W8LA 1QAJA 1EP4B 3HVAA 2JSXA 2R2TA 1FHTA 2RS8A 1RHQB 1DQ8A 3H59A 1MN9A 2KM8C 4RW7A 1M5SA 1P27B 4QIWD 5J2MB 5F8MA 2BABA 2VG7A 3PO4A 2QMUB 1B0TA 4KPYA 1VK8A 2IRUA 2IBKA 4LR7A 4IUFA 4XK8C 1EQMA 2JZ5A 4A8KA 3QSYB 3V6HA 4R5PA 3K57A 3UR0A 1VBZA 4F7VA 3G4SS 4LF8J 2DR9A 1RT6A 2VV5A 1K0TA 1SKUB 3TEHB 3VR1A 3N6NA 1SJRA 1QAXA 2AV5A 2Q6CA 3IM8A 4DFJA 1DQ9A 2AF6A 4YB1P 5JUMA 1FRLA 5E41A 1UAWA 1UP1A 2MGZA 4Y2KA 1RE1B 2BJ9A 4RW6B 1C4CA 4A47A 2ZM6J 3AD9C 3IO1A 2NXEA 3AA8A 5KTQA 3T6BA 3G82A 5DDPC 3DOMB 4HH1A 2X1AA 2ZOMA 3P3DA 2HQ3A 4EMDA 4B3RF 4K8RA 3CCVS 2ZZMA 3D3BJ 2ZOGA 3HMJG 5F3TA 2VBYA 5CAAA 4CH1A 3ZFVA 1N6QA 3VALA 2Q43A 2P9GA 4RKUC 2R7XA 2J0WA 3OXLA 1IR2A 4NZ0A 4OJ1A 3OLAA 2YNIA 3ZZTA 3GU0A 4C48A 4LSLA 4EI2A 1FWPA 1M1GA 4OZ3A 4HH0A 3KHRA 2ZH1A 1FO1A 4O4GA 2LQBA 4K4ZA 2VJVA 4P75A 1ROFA 3D28A 2HQDA 3BJYA 1TZ0A 2DISA 3PYEA 4MKBA 3NNHA 2BKOA 5BYRA 1PO6A 3IRWP 3W9HA 2HHHF 4ZPCA 2HG4A 3BGOP 3BGRA 3M8PB 3Q83A 4IFYB 4B3TF 4Z7CA 4DDFA 2JC1A 1JNZB 1D1UA 4HTJA 2QL5B 1KDNA 2PIIA 1S1TA 3LGNA 1S72S 4PUOA 1M5KC 2A2DA 3JSBA 2PA3A 1N0VC 4DPUA 2ZBIA 3H7HB 1JQGA 3OL9A 1NBEB 5IC6B 4PYAA 3RW6A 2XYPB 3P5TL 1RLCL 2P5VA 4UOGA 5I3PA 3T5KA 3N6LA 4FDFA 4KO0B 5L9XA 6FDRA 3J7YU 5KFRA 3KLFA 1HWJA 5LXRA 1YG0A 4I68A 3GLJA 1NCLA 2R2UA 1CQMA 1XR7A 1R0BG 3HHLA 1IBMF 2VHGA 4C9DA 4NOHA 5ETQA 3ZNUA 4Q43A 2DRDA 3CMAS 3ONQA 1H38A 3DOLB 3EVWA 5CYQA 2YQ1A 3EGNA 3BH7B 4QWBA 3PX4A 3THVA 2LQ9A 2QYCA 3LF0A 4DLGA 2NSCA 5IFMA 1KQSR 3BM7A 1WORA 3DYAA 3B78A 2JHEA 1DRZA 4DFMA 3IC1A 1OQ3A 2LVWA 2YX7A 4G1IA 1FD8A 2OPSB 1SI9A 4F4KA 2H3EB 1RTIB 4O3RA 3D67A 3T1YJ 1V6HA 4DV0F 2HNYB 1D9FA 4ZVGA 4ZJOA 1KVKA 1R8HA 1SV5A 1HQEA 2OPPA 2YNHA 3IAS9 3TO8A 3DOKB 4LIRA 4ZCMA 1JLGA 3OTEA 1VQ4S 4OYOA 4USVA 3OVAA 5HATA 5A2QU 2DHSA 3CDUA 2R8GA 3CJ5A 3PJXA 2B9EA 2DHGA 3M6XA 2KH9A 1UVJA 2HHUA 3WBZA 2EG2A 2FVCA 1MU2B 1PSDA 3DLEA 1SJ1A 3N5FA 4H4KA 4O4GB 4URGA 2WSCC 2B7BB 2E1PA 2IC3A 1FE4A 2GAHC 3AD7C 1QUVA 2BUNA 2KN4A 3L4BC 2CAJA 4GVBA 5E7OB 1I94J 2AYBA 3KJQB 1XEZA 4FF3A 5K8MA 1XNQF 1RT7A 1N33F 2ASLA 3US5A 1MNEA 1W2IA 1VOMA 1YZ7A 1ZA1B 2F7VA 3CCWA 3M7VA 4IO1A 4NCGB 4CNZA 4USHA 1G3OA 1Y4ZB 2RHSB 2ZD1A 3MMBA 3GV8B 1IBKF 3DLBA 1XMOJ 3BZQA 5GADU 4WP9A 4L76A 1RP5A 4OLOA 4ED8A 3OR1A 2RSQA 5DDRC 4MFBA 3G6VA 3FMWA 4OX9J 5ADZA 2W9BB 4LF5J 1PG5B 2DRBA 1F2GA 2M5YA 1WC3A 4YQWA 3VZHA 3QAEA 2MGZB 2VPYB 1NKEA 4JI6J 4IOCQ 1YJVA 4NA3A 2DGOA 2OEMA 2RKIB 3H20A 5HL7Q 3BBFA 3GV5B 4OZNA 5J2QA 2AWZA 2M2BA 3A4TA 2CPJA 2BBEA 2XHCA 2ZDOA 4M8LA 1JLQA 2OSQA 3RBEA 2V68A 4U67Q 3O1LA 2XI3A 1SKRA 4ELVA 2QLWA 4RWWA 1HR0F 4DV7J 4GKJF 2W01A 1VBXA 2P6SA 4CLSA 3SQOP 1FT8A 2MQNA 3FZBA 3MTKA 1FD2A 2MPUA 5F41A 3NAIA 1I5OB 5K14A 1OPZA 4N76A 4PZVA 1CJVB 5GMDA 2DGQA 1FXLA 1F2HA 1KTVA 2DNHA 4ENOA 1EZZB 1T0TV 5DM6Q 1N56A 2MQPA 4JI2J 2ZWOA 3JYTB 3ITHA 4FYXB 1KHVA 4P2MA 1KLNA 2BJEA 2E9ZA 4S0MA 1AA1B 4Q45A 1L5UA 3TEGA 2BW2A 3PRDA 3B4DA 1L3VA 4K4UA 2H54B 3RW7A 3EE3A 5JMNA 2VPWB 2JX2A 2XZTB 4OI3A 5DG7A 4DR7J 4CRJA 1UFKA 4NLQA 3P4UB 4OQJA 1OPIA 3MEGA 4DN0A 4DFPA 2FC9A 4NRUA 1IKXA 3KHHA 1K47A 2YKPA 1BWEA 1KLMA 1AZSB 5HQ8A 5IC4B 3CCES 1X4BA 2CJBA 1JLCA 1CSJA 5A6PA 3GJRB 4RBTA 3V81A 2C28A 1UL3A 2V2KA 3AFGA 4KHRA 3AOAA 4ED3A 2ROPA 4CTAA 5AXNA 1DURA 2QL9B 1WKLA 2W7AA 4KY3A 4K0KJ 3QQCD 2XWYA 3KK2B 1S0OA 4NL5A 5L39A 3HHKA 2EVZA 3P49B 3E51A 1AT1B 3AAWB 1R8CA 1KRPA 3OFFA 2FGOA 3NL0A 3RZAA 4ES1A 2XULA 1VQLS 2XLIA 2MHEA 1CJUB 5KFWA 2ZKTA 1CJTA 1WDDA 4DLEA 3ISZA 1C1CA 2IVMA 3D6TB 4P74A 1X5OA 4C11B 3VHQA 3CXCR 2KYZA 5KG5A 4CLLA 5AXKA 2K06A 3DRXA 2A1BA 2J0SD 2H4WB 2MMYA 5B0FA 1N5QA 4MJKA 3PYGA 1SQEA 4KB7A 3G86A 3QGGA 4ITSA 4N5SA 4IQXA 2AEMA 4JV1A 5IT9Y 2OD6A 1LWEB 2DR6A 1JLGB 1Q8IA 3HJFA 2VG6A 4K2JA 2ZE2B 5BYQA 5A8KA 3OFHA 4I7FB 1S76D 4WWSA 2EFPA 4O4RA 3EDRB 1NM2A 1UJ6A 1UPMB 1SVDA 3DLKA 3R1HA 1VRUA 1URRA 2APOA 2HNZB 3MCSA 5IT9U 4OX6A 1M5HA 3BF4A 3IN5A 5A0YA 5L1KA 3MEDB 4L73A 4OLPA 1TL1A 5D4OA 5CCMA 1VQPS 1T05A 1QD1A 1RWXB 1HYSB 1FF2A 3ZXWA 1U48A 1ZM4A 4EO6A 4LFCJ 3CCZA 3MMBB 2YVSA 3H5SA 1HL6A 4IG3B 1KD1T 1HI0P 2UUCJ 2E44A 4ATNA 3VAGA 3D6HB 5FD1A 5CZXA 2W2QP 4PAAA 4UQTA 2C2DA 2VA3A 3V81B 4M5DB 4GKKF 5DZ7A 5GAGI 4JYAF 1WC5A 3J7A1 4PPZA 1UWBB 1QE1B 5ETTA 3MUVP 2GMJA 2L41A 4DV5J 3I9V9 4LF1A 3RR7A 2F40A 2NS1B 2XNQA 5E5NA 4F36A 3TZWA 1O5JA 4R0JA 4X64J 2C3UA 3AXMA 1D9DA 2RRBA 3OR2B 1WF2A 5FIIA 4C0BA 1WC4A 2QSFA 5FLXY 4OYPA 4ZVHA 2POKA 2KRBA 2VBWA 2XEXA 4ZLPA 2FVSA 4KH0B 3ZZZA 4AYBD 1BQXA 4M95A 2PFFB 4ANDA 2V9KA 2GJ2A 4AL5A 2KT5A 3W3SA 2XY7A 1T8EA 1TL7B 2K1RA 1IXKA 3AH6A 4FKYA 5DS7A 3KDOA 2RF2B 1VQMS 1F3VA 2QMWA 4ETZA 2PA8D 3HVWA 1MMNA 3UNYA 5KT7A 1DZ5A 3QRQA 3WC2A 2UXCJ 1JB0C 3TVZA 2XWXA 3R6LB 4F0HA 2WSEC 3H40A 3R7BB 4NRTA 1LOUA 3C19A 4YR3A 2GJFA 2CUYA 4F67A 1VQNS 2YWGA 3DRRB 3V4IA 1U8WA 2XMJA 1XK8A 4KV8A 2CQ4A 1NDPA 4ECRA 2JEGA 2VUGA 3VAIA 1GX5A 5DGAA 1B7YB 1K1SA 2MLZA 1RWVB 4NZ6A 2PEHA 4J9QA 4JV5F 2R7WA 3JS9A 1MROB 3HXMA 4FF2A 1RAAB 1VR6A 3MD3A 2QV6A 4KFBB 3PW0A 3VCDA 1S79A 4LJMA 5C42A 4C0OC 2EFQA 1SH2A 1FI4A 2QN6B 2OLWA 4ZJLA 4RWXA 3FFIB 2ZD1B 2DIVA 4QOTA 4RR5A 5LOQA 1HBOA 2VQFJ 4FYYB 3V6JA 2ZNZA 4X4TA 3G71S 2ZBQA 4NPOA 5GADI 2DYAA 5DGBA 2AU0A 1NO8A 1Y9OA 2HVZA 5GVQA 5LMUF 3CCLS 1M1HA 3ZTOA 2FJAB 3CMES 5E3QA 1S9FA 4KHPJ 2K3IA 2HLTA 2XSJA 3IR6B 2GVDA 4B3SF 4DR4J 2R8KA 3C2PA 1DFDA 5IS2A 3MOJB 3BN4A 1DTTA 2PO4A 5KOXA 3K5NA 3EXYA 2HNDB 1FNMA 3A8KA 1PAEX 4U8YA 3M6WA 3DGPA 4O44B 3BREA 4QR1A 2HZVA 3FVYA 1KBRA 3DHXA 2WB4A 1NK5A 4NCBA 3OTBA 2IJFA 4UZBA 3LP1B 1HLWA 4PG5A 2Q66A 1BWVA 3J80U 4IG0B 4KE5A 1MWQA 1FNOA 4J9SA 2V4QA 2F4VJ 2KVQE 5J1NA 3D5MA 2HSEB 4DUYJ 1LWEA 1NHUA 4C98A 2XMAA 3DLKB 2MKJA 2YNGA 4Y65A 3BQ1A 2MYFA 4WBFA 4ECVA 4V19J 2QIFA 3DDIA 1ZBTA 2KO1A 1KNZA 5EN1A 4JI8F 3TVYA 3KG4A 1T05B 1QVGR 4JI4J 3CDAA 5G4DA 4OZ2A 1SBRA 5B0BA 5EWFA 4RW9A 3G8SA 2GMLA 2LDYA 3GIKA 1CEZA 5J2PB 2R8HA 1PBAA 4WTOB 3MR2A 4B9MA 3W2WA 1V5VA 3BYPA 3L7UA 2FTRA 4LR8A 2B7CB 2ZHOA 2BMBA 3HLUA 5JXSA 4N41A 3RBDA 3THPA 1YJWS 2HZCA 2RRNA 2N4CA 4IOBA 3TRGA 2HMIA 3FRZA 2Q6BA 4RNFA 1N5YB 3KTQA 5HBMB 1H0HB 3RYLA 2GVZB 2Q1LA 3PR4A 3NMAA 4DR7F 2MZSA 3UFCX 4KAIA 1TVRA 2A0FB 1MW7A 4DL0C 1EARA 3JQJA 1RBAA 1RWMB 2FY8A 3QWUA 1RA7A 3I6PA 4YHHJ 2ATLA 4E8UA 4K7QA 5DO2A 2BR0A 5AXLA 3HSDA 3C6UB 3UI3A 3HFVA 4M5JA 3KLIB 1NJWA 2NPIA 1BC6A 5CHCB 5IV4A 4WXWA 4ZN1A 5KAKA 1YHQS 3QJJA 4ICLB 3M6VA 1RT3B 4N8OA 2IY5B 4USJC 1TAUA 3PX6A 1TL5A 1FFWB 5JVHQ 1W7WA 3OTOJ 4I69A 2L3MA 2OPRA 3TJ8A 4LRDA 1HBMB 4MK9A 3JB9k 3EGZA 2IVYA 3OSPA 2CJYB 1RTIA 3JSYA 2HQCA 4DV7F 4GKJJ 2UU9J 2CDQA 3ILJA 5EWGA 4LF6F 1NAQA 5ETRA 3ZZPA 3D9BA 2IMOA 2IFXA 2QE5A 1G6BA 5ETNA 3IR5B 4EBEA 3Q2TC 4M94A 3G8QA 2B4OA 3PYFA 2R2SA 3POTA 2A6MA 2MEWA 4C8LA 4W90B 2NUHA 4ZDNA 4DXLA 4AQYJ 5CYMA 4HHJA 1J5EJ 2JEFA 4A8WA 2J0XA 2KYXA 2B5JB 5F8IA 3CJQA 5DG9A 3Q8YA 4OX9F 3W64A 4DS4A 5AJ3F 4IRDA 2NLWA 4J7CA 2NSBA 2YBVA 3G6XA 1V3SA 3OD2A 4L3NA 2O1PA 4ZVQB 4IDKA 3NS5A 3TX8A 4DFKA 2ZZNA 4JOUA 2IA0A 3THTA 5E3CA 1X31C 3N9UC 4DR6J 3J81j 3MI7X 1RZMA 2UVRA 4DV2J 3KLGA 2E5JA 3PNIA 1VI7A 3WX8A 1RTZA 1N36F 3L9ZA 1E6VA 3OR1B 1FFSB 4ZHRA 4EO8A 1P8GA 4B9VA 2M9KA 2DGVA 5D0GA 4DPWA 5EGYA 3CJKB 2AKWB 3I32A 3IBCB 2AIRB 3NLCA 4B17A 2HGNA 2PN6A 2ALYB 3OTCA 1HNIB 2XMVA 4K5SA 4QIEA 2XSFA 4KGVB 4KSEB 2FHOB 4J9OA 4FVCA 2ZITA 2JVRA 4LIWA 2DRAA 2BZ2A 3F41A 3HF5A 1E6YA 4G1PA 3BB5A 4OZ1A 5KFZA 2R3VA 2Z2LA 2XLJA 1N34F 2IMWP 1Q7YT 3T1YF 3CW2C 2MQLA 2PFDA 3HFZB 3G96A 1I51B 4DL2A 2Y1JA 2R7SA 2VG7B 4U7CA 4OV6A 2D9PA 2HNYA 3C14A 1P1LA 4O3PA 1DAXA 4BC9A 5KFFA 1X7VA 1VJQA 4U96A 2YH0A 2AX0A 5H9EJ 3NNCA 3UPFA 3RAQA 2OMLA 4KTQA 1LFWA 3KLVA 3LP0A 3Q22A 4Y2IA 4PXBA 2N82B 4ZKAA 2FJWA 1J5OA 4F02A 1H74A 4YN3B 3OJUA 2W9AA 4L6V3 3TA1A 1ZETA 4X4UA 2LFVA 1JLBB 3CDEA 1F9FA 2LDIA 4BWMA 1VFJA 3D0GE 3Q2SC 2GIQA 3GP9A 5HVHA 5IZHA 2MQ8A 1SXLA 2EBGA 2MJNA 2NXJA 1TV6B 1R0CB 1PYSB 4WFAQ 4YFUA 4ECSA 1G7CB 2OEJA 2XB2D 2DNGA 4MIWA 3D1OA 4DQQA 3PV8A 4OJGA 5CD4A 3W61A 1TKZB 1QSSA 2LQJA 3GIRA 5T14A 3OT9A 2AT1B 1BHNA 3MEKA 3KLFB 3PACA 4LVOP 3ETOA 4EK2A 4JI3F 4DWIA 1QY7A 2RS2A 1HHSA 2DGXA 3U1MA 3KLGB 4K5RA 1Q5VA 2WVBA 2EI5A 3I4HX 2PMWA 3C15B 3R5CA 5KFMA 4OJ3A 3VVUA 1AUDA 2G0IA 1U0HA 3BR9A 3LH2S 1XR5A 3PVXA 2JEJA 1N52B 5I42B 1NPRA 3CJ3A 3CDWA 3MPDA 2LU1A 1APSA 3W1YC 2KRRA 5LSOA 1QJHA 1DBDA 4HVZA 4NI2B 2F1FA 2K3KA 1KQKA 2ZBRA 3EXCX 3PW2A 1MMDA 5HJXA 1MSWD 3D1HA 3TX0A 2DNQA 4O3OA 1OY8A 2H65B 4DQIA 3KXDA 2ADCA 1N5SA 1ZA2B 4CLZA 2HIQA 1RHRB 2QMXA 3MM7A 3W5YA 2V34A 1U1PA 2FDNA 3GYXB 3KNGA 2VA2A 3M9OB 4BDPA 2XNRA 1SJQA 3Q8VA 3DRPA 1VK3A 3PO5A 3KHGA 1IWAA 2LEBA 4OI2A 3KK3B 4CLKA 2B5JA 3UD3P 2GFFA 1HNXJ 3VAFA 4W92B 2G0JA 2W9CA 5F8HA 3A3PB 4FP9A 4OYZA 2ZWPA 2MXYA 2LXIA 1VRQC 3MPUB 2IM3A 2K2PA 2R7TA 1S1XA 1OIAA 3SV4A 3CPWR 1IKXB 3MFIA 2KXHA 2UUAF 3W2WB 3QT7A 1G1XA 3R2CJ 3MMCB 2J9DE 2MDAA 3HHDA 3R5AA 4ILMA 1NK7A 2FPHX 3CTRA 3CB4A 3M30A 2X3GA 5U47A 5F9NA 2RQMA 3PKYA 4ES3A 1GMWA 1IBLF 1MN7A 1ZM2A 2BEFA 1C2PA 1NK0A 4Q8EA 2W9BA 1A9NB 1WF1A 2GVZA 1Q81T 2F4FA 1YTYA 4URSA 4ZP7A 2UXBF 4WFNQ 1WKKA 1FK9A 3TA0A 2GQQA 2EC2A 8AT1B 3PRVA 5LL6d 4N56A 5G0RA 3BR8A 5KFAA 1WC1A 4ZMMA 4RU2A 1TUVA 4RNMA 3FC9A 3M2UA 1CJTB 3I5AA 4C4WA 2E1CA 2VU5A 1RTJB 3A8JA 3DLGA 5IQ6A 3M32A 3I31A 3PJWA 3M2VB 1S1UA 4X4PA 3S7RA 1CPZA 3SZ2A 1F0XA 2CWKA 3OVSA 1WC6A 4TU7A 3M8RA 1LWCA 3O5TB 4PG6A 1T03B 2UP1A 3VQSA 1WC0A 1TTHB 3HFKA 1U25A 2KB2A 3PEJA 5HMWA 1FERA 1WUUA 3ZZUA 4NYZA 1Y11A 3JYTA 5M2UA 1S5ZA 4USWA 2XGQA 3DDKA 4K50A 4C7QA 1CQNA 1XQIA 2M52A 3MAAA 5EHHA 4G6VB 5D3GA 4UOCA 2PGCA 4WU2A 2UZAA 3LPYA 2CPIA 3M8SA 1J5OB 2GW8A 3C16A 2CQCA 2M4MA 4LMZA 4QCLA 2I0XA 2RQKA 1JJCB 4NLOA 2Y3YA 1R8BA 1N54B 1MWZA 1S9GB 2PEBA 4DV5F 1RWNB 1RLDA 1JLQB 4WFYA 5AE3A 1WI6A 1Q95G 1TR0A 3H0PA 1VQ8S 2J6SA 2EG1A 2ZJRQ 5C42B 2OIHA 1RABB 4UZCA 3VAJA 2OGUA 2CNOB 4URQU 4R0EA 1ZPWX 1UVKA 2X7IA 4M63A 4PG4A 4ZP9A 1MG7A 1S1VA 2A2CA 1RAHB 2COLA 3EYZA 1ULRA 4RBVA 1E6VB 2BRKA 1FJGJ 4DSKA 4DR5F 5ITHA 3Q0AA 3VAKA 4EEYA 3NRBA 4DUTA 2KG1A 3BS9A 4QWAA 2J6TA 5I42A 3TW0A 2DIUA 1NH7A 5CABA 2R7RA 3TR5A 4K59A 1LW2B 2GIFA 4J9LA 2XY6A 4B9LA 3KJNB 2H51B 3IR7B 4ZCKA 3ILIA 2E9TA 1SB6A 2DD8S 3V5RA 4BCAA 5EDWA 5KFEA 1UFLA 1F5CA 4NEZA 1WHXA 5C5JA 4O44A 4MMOA 5DRKA 3HHNB 4C97A 1H6KX 5KG0A 1NXIA 1W2BR
chains in the Genus database with same CATH topology
4JI1F 4NCGA 2ZJQQ 3RB4A 3MMAB 3CULA 1DLOA 4H4OA 4MTPA 4R8UB 2PI5A 2F9DA 3GYNA 2HHSA 4LUBA 5K8NA 4QR2A 3Q8QB 1JXEA 1YWXA 1XBWA 4I1TA 3MHYA 5K9FA 5K5MA 2DNKA 5D3GB 2FD2A 1RT4B 2OFHX 1Y5IB 1TL3A 2FHJA 4DL4A 1Y3JA 1RQ0A 3SDEB 2KJVA 5F8GA 3QZ7A 3C66A 2CPXA 4PWDA 1R0AA 1X4GA 4MIAA 2F4VF 1QM9A 4JI4F 3NNAA 4PWUA 3QGPA 3IFEA 3KLHB 4K0KF 3DI6B 4QZVB 1SKWA 3I0RB 1S97A 4DF4A 1UWBA 3MUTP 2XO7A 3S1TA 3IS9A 1KFSA 4PG7A 3CGIA 4IH5A 5CD4H 1IM4A 1PILA 5KFYA 2YNIB 1K9MT 2LLZA 2VG6B 5A8KB 1FJGF 1S7HA 1HFEL 5EWEA 1BY9A 3DMJA 2E9RX 3MM9A 2KT2A 4AL7A 1ZTWA 2JOQA 3KLIA 1VQYA 4FVMA 3K58A 1U1KA 3LP2A 2I38A 4YMEA 3FSXA 1WNEA 1JMTA 1U24A 3SCIE 1D8YA 4WF9Q 4ECZA 3CD0A 2F9JA 3BGRB 3M8PA 2R7QA 4QYZJ 3C6TB 2CJQA 4DSFA 1HW9A 4LF7F 1SV5B 5KG7A 5GAHI 4CO1A 2P9EA 1VQSA 2GC8A 3FSYA 2E5HA 4CTAB 2GJIA 5KFGA 4DSEA 5D4PA 2JH3A 3BGFA 3K0JA 2LKZA 2HW3A 3I87A 4TY9A 2EPIA 4NA1A 2FHJD 4KC5A 1H7WA 1X4FA 3PFEA 3OV7A 1F5BA 2IC3B 1S9GA 3H5XA 1YJRA 3DXSX 2KT3A 1XMQF 1NEEA 2KDOA 3AB4B 4MYUA 2BYCA 3LALA 1QLNA 1UETA 3MF5A 1FKOB 4NXMF 3E8OA 1LK7A 3KHLA 5C24A 2G4BA 2CQBA 3NMRA 1RT5A 3G8TA 3H2UB 1FDBA 1LQ9A 1JLAA 3L09A 4AQYF 1RWUA 5IT4A 3KWMA 4HLBA 2EK6A 3IA0A 5HBMA 4IRKA 2QA4G 3MPVA 1XMBA 2R7OA 2ZHBA 3N5BA 4TNOA 1U26A 5EX3A 3S01A 4ID5A 2C22A 1LW2A 2WK4A 1KVIA 2DR8A 4C3KA 2OPQA 5F3ZA 4PXCA 1D9DA 2LU2A 1DTTB 4X4QA 4WIIA 1NNDA 5LJ3Y 4ZPWR 5KT3A 3CCTA 3OTOF 4WZMA 4TN2A 2E1MC 1UJ4A 4LSNB 3NGDA 1UKUA 1YJTA 2KHCA 4NLTA 2CPYA 4F8RA 1UA1A 2XMTA 1XERA 3M05A 3NGKA 1FEHA 4ZCLA 2UVWA 4FS1A 3FFIA 3CCSS 1FA0A 2DHXA 1HHTP 2J76E 3O44A 4TXSA 5H1SV 2DGUA 1HI8A 2J7WA 2KI2A 4KR0B 5EX0A 1JIHA 2MSTA 2LMIA 3IRXA 3DM2A 3U1NA 4RW6A 2RQCA 3K5MA 4DF8A 2RKIA 3OBIA 4ETXA 3DOMA 1YGYA 4RBUA 4DL3A 1VC0A 2HNDA 1HNVB 2QSWA 5E3AA 4G1QB 3E01B 4LQ3A 2C3YA 1S1VB 4OIXA 5FDLA 1RT5B 3LWLA 3DC2A 1HQEB 1Q7LB 2OAUA 3I82A 5L9NA 2YNFB 4QWDA 1WTBA 3Q23A 4QU6A 2B51A 4MKAA 3T5LA 1JJHA 4N8NA 4B9SA 4PQUB 3H2VE 4P2SA 3RR8A 4UY8T 2FJVA 3UR3C 1S6PA 5KFKA 3L3CA 3JSMB 3DLJA 3CO9A 3B82A 3DU6A 1B0VA 3FMBA 2FVQA 3C6TA 4GC6A 4J9KA 3P6YC 5IWAF 1RA6A 5HN0A 2W24A 2ZFHA 4P6QA 4LT6A 5LSRA 2EK1A 3MMAA 4N77A 1V9OA 4KRWA 5DQHA 3OL6A 1HPZA 3QWPA 5K8OA 4G3IA 2E7XA 3BO3A 2ZOFA 4DJBA 1M0SA 2YKAA 2ZE2A 4OZ5A 4WE1A 5J2NB 3FEZA 3NBPA 2M70A 3DRPB 2J5AA 3F44A 4U7UK 1NKBA 2V4RA 3MGJA 2VQFF 4TKTA 5B0CA 1CG2A 3DU5A 1Y0HA 1TKXB 2VFSA 4QR0A 4RU9A 1JJ4A 3K8VA 2P6TA 4UW2A 3PW7A 4EU0A 1LWFB 2HPUA 4OZJA 4A8QA 4C8YA 1UW4A 4I56A 3MAQA 3J7Z5 3K5LA 2FJBB 1VMBA 2C3OA 4P7VA 2RU9A 2ZM6F 2L9DA 5KFIA 4QBUA 2U1AA 2OPPB 2YNHB 4NX9A 5L38A 1U2RA 3TP2A 4KHMA 2IM1A 3MZIA 5DQGA 4O3NA 1GX6A 3OR2A 4Q7AA 5AE1A 1M90T 1TQLA 4LF5F 2DNMA 2EFOA 1BGXT 5I3UB 2YX1A 3TOQA 1M5VC 3D0HE 5KT6A 4DG1B 4C0HA 4WFBQ 1YSJA 2HFNA 2ZC3A 1AW0A 2JVOA 4ZVEA 3JSRA 3UCGA 3RB0A 1HA1A 4Q44A 2RH3A 2QRRA 3LQVA 1KLMB 1R43A 3T5JA 4JV2A 3T9ZA 3HVTB 4F50A 3MM7B 3E2EA 5E0OA 4QU7A 1HBNB 2AD9A 2CPFA 4I67A 1GT8A 3LOUA 4AL6A 4FNHA 3R27A 4MK7A 2E5IA 4B08A 4Y00A 5HMYA 1WEZA 2JWNA 3NS6A 3SCJE 2UVUA 4ZP6A 1I94F 2ASJA 2ABYA 2E7WA 4DX8H 3HZEA 2QA2A 4DSIA 3I5BA 4Q5VA 1KOOA 2CQ1A 3OLBA 2IAJA 1TK0A 2FB0A 3NCQA 4FNIA 2R7UA 5FDLB 1VC6A 3PDNA 3V6HA 1SC6A 2OPRB 1VBZA 2I5JB 1TKZA 5L1JA 1NK0A 1RTDB 4G1QA 4FXVA 4J9NA 4OJHA 3OUYA 2NR0A 4ECWA 2YKNA 1HWUA 3CDBA 2QT7A 1WG5A 3CF5Q 4NLWA 2FJEB 3PIOQ 3UCUP 4NXNF 1FKPA 4KIAA 1XC9A 4HT7A 4CIOA 2B4UA 4I64A 4CZCA 3IXQA 5KG2A 1SJFA 2XS7A 1GH8A 5C25B 4PCQA 2CIMA 3L95X 4Z2XA 1X0PA 4CO4A 1TFWA 4C8ZA 4I0WA 1RGVA 4A4JA 1UFWA 1FDDA 2EFNA 3CD6S 1FE0A 4AXJA 2M0GB 1TL1B 4ALZA 2JRSA 5DJBA 2ASDA 2QEXS 2DCLA 4ZPTR 1OQ6A 4X4VA 4C8NA 2W7PA 2MKIA 2GIRA 2MSSA 1TV6A 1WEYA 2W8KA 4OHYA 1FJCA 3LGMA 3SSRA 1U4BA 2RMLA 2MHNA 3EX7B 3A1YG 5GMKa 4ED2A 1IN0A 1JXLA 5J2NA 2XG8A 5DDQC 2W9CB 2GQ2A 4IOAQ 3M8QB 3OL8A 3CEDA 3X1LB 1YVFA 5SZTA 3MFHA 3H2LA 2H9ZA 2BQRA 3TAQA 3FQLA 3FCHA 4IFVB 4ZP8A 5A8WA 3MWBA 3FRYA 3C8YA 1RJJA 4DV4F 4QYRA 4XPCA 5IQQA 2DK2A 3U7JA 1X4CA 5IXUA 2DR5A 4EBCA 4Q2MA 5D4LA 3IG1B 4RZRA 3CCUS 4QW8A 2FLOA 3I0SB 4I6YA 3DI6A 2F3JA 2GQCA 5HI7A 1RTDA 3H98A 2XC9A 1WWHA 5B0AA 3F56A 3F73A 2V9WA 2XS5A 1FDNA 1AROP 3CC7S 3IS9B 3BO4A 2YKNB 5K8PA 2LXUA 3C6UA 4A46A 3K59A 1HQUB 4ILRA 1S9EB 1H2TZ 3G9CA 1U09A 3DLGB 4YDXA 2BA9A 1JLEB 5F8JA 3CC2S 3PY8A 1U6ZA 2QLXA 1MROA 1S6QA 3UD4P 4RW7B 1R3NA 3FGVA 3GILA 4IQMA 2ZC4A 3O3LA 2AJQA 1HBNA 1L3VA 3MMCA 1DLOB 4ID8A 4OI6A 3HVTA 3WZ0A 4JI6F 2HHXA 2I9SA 3HHLC 2XHWA 4WE1B 3CCMS 1HWLA 3OTDA 1U1LA 2LEPA 2UUWA 2YWFA 5KT5A 2DPJA 2VC1A 4FZVA 4EYHB 1D9AA 2RE1A 5KFTA 2Y0SD 3GZ7A 1NU4A 4RNOA 1GNKA 1VHFA 3SDEA 3VF0B 2KFZA 2BJDA 2RVJA 3V2UC 3ZZOA 1CVJA 2MJUA 5KFPA 1SH3A 1WG1A 1WHWA 1YRTA 4CO2A 2E66A 4DR6F 2LA6A 2OPSA 2AYEA 2YKMA 2RF2A 4HDHA 2AJ1A 2C3PA