3G2XA

Structure of mimivirus ndk +kpn - n62l double mutant complexed with dtdp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
132
structure length
132
Chain Sequence
QRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNTNPLASAPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
total genus 40
structure length 132
sequence length 132
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2009-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3g2xA00
3PRVA 1NSKL 3Q8VA 3VVTA 1S5ZA 2DXEA 3ZTRA 2DXDA 3GPAA 4EK2A 3EVOA 3NGTA 1NUEA 4UOFA 5IOLA 3VVUA 4FKXA 4KPCA 3VGTA 1LEOA 3NGRA 1S59A 1PKUA 1B4SA 3EVWA 1NPKA 2BX6A 3MPDA 3FBFA 1JXVA 1MN7A 1NSPA 1XQIA 3Q8YA 3DKDA 2HVEA 3ZTSA 3DDIA 1F6TA 4ANDA 1WKKA 4DZ6A 4F4AA 3NGSA 1S57A 3EMTA 1EHWA 3EM1A 3FBEA 3Q86A 3G2XA 4ENOA 1NHKL 4DI6A 3EE3A 1BUXA 3B54A 1NDKA 4WBFA 1UCNA 2B8QA 1VYAA 3Q89A 3EICA 1HHQA 1BE4A 4UOGA 3ZTOA 3VGSA 1PAEX 2VU5A 4ANCA 2DYAA 1MN9A 3EJMA 3FCWA 5CAAA 5BXIA 2ZUAA 1K44A 2AZ3A 3BBCA 1KDNA 1WKLA 3ETMA 3FBCA 2AZ1A 3VGVA 4ANEA 2DXFA 2HURA 1WKJA 2DY9A 1NCLA 1B99A 3BBFA 4UOHA 1NSQA 4W98A 4FKYA 3FBBA 3ENAA 4O0NA 4S0MA 3BH6B 3WX8A 4C6AA 3B6BA 1BHNA 3R9LA 2NCKL 1NLKL 3GP9A 1LWXA 1NDLA 4HR2A 1HIYA 1ZS6A 1NB2A 3L7UA 3FCVA 1F3FA 3Q83A 3ZTQA 2HVDA 3FKBA 3Q8UA 2B8PA 5CABA 5C7PA 1HLWA 2CWKA 3EVMA 1NDPA 2BEFA 1XIQA 3ELHA 3JS9A 3VGUA 4F36A 4CP5A 1U8WA 3BBBA 3FC9A 3NGUA 1NDCA 3PJ9A 4DUTA 1W7WA 3BH7B 3ZTPA
chains in the Genus database with same CATH superfamily
3Q22A 1WF2A 2X7IA 2IAJA 5MLCV 3TA0A 1GQEA 1E6YA 3IC1A 4KY3A 4MTPA 4KPYA 2JSXA 4L76A 3TAMA 1FNXH 1CS4B 2BJ1A 3QGHA 4A8MP 5T7LB 1ZM3A 3K5OA 4DPUA 3H42A 2DT9A 1RBAA 5JVHQ 3NAHA 3CD7A 2XLIA 3Q89A 1PYSB 4TLRA 5T7LA 3NS6A 2N3OA 1NJIT 1YIJS 2Y1IA 1PG5B 4EEYA 2DXFA 3KWMA 1MLAA 4IOBA 2WVEA 1RT5A 6AT1B 3JQMA 4QIEA 3RR8A 4CNYA 4NWBA 2BEFA 1TKZB 4Q45A 2OH2A 1B64A 3DRRB 3CDBA 3H2VE 3SQGB 3FJ2A 1KOOA 5E3AA 4FPRA 3IS9A 5IC4B 3DXBA 3EDRB 3OD2A 5IXUA 2BMBA 3MTJA 1TKZA 3DRRA 2MEWA 3M32B 5IV4A 2DGWA 3SQGA 1IXKA 1S59A 2U2FA 1FXRA 4DFMA 4EYHB 2RH3A 3IR7B 1G6BA 5EWGA 2OAUA 4J5OA 4DV0F 3M32A 3NEKA 2XMVA 1VQ5S 2GO9A 4F4KA 3Q86A 1NHKL 3BYRA 2IY5B 2ZD1A 5B0CA 3BR9A 3C14B 1YQHA 3PIOQ 2VQFF 3ADAC 3D3BJ 2ZVSA 4GKJJ 1WSVA 3FBCA 4HTIA 3QT8A 4BC7A 1RSCA 1FD8A 3M8PB 4P7TA 2KFNA 5ETPA 4IR1A 3C14A 4MK8A 1WHWA 2NPFA 1NDLA 2P2CB 3PNIA 1KQKA 2W9CB 2HVDA 2CPYA 2HNDB 2H5IB 4TNOA 2RUGA 4ED8A 1ZBTA 2O66A 3D0GE 3M8PA 1RKJA 3A3OB 3HSGA 3V6HA 1JIHA 4E98A 1NZ8A 3M1VB 3LGNA 3MURP 5J2NB 2W9CA 1X31C 1YJ9S 5B0FA 1FDAA 1VLYA 2WCXA 2MKJA 2V94A 5DDRC 3SSRA 1VC5A 2DHAA 2OI2A 1H7XA 3K59A 4DJBA 1N32J 3GG1A 1JX4A 5KOXA 3M1VA 2XZWA 5J2NA 5F3TA 1B70B 3CMQA 5I42B 3GV7B 4ZIWA 1GMWA 4ES2A 2HG4A 3JXOA 2RILA 4OV6A 1WUUA 2OTJS 2XHCA 3TNVA 5I42A 1YZ6A 2AJ4A 1U1OA 4DXLA 4DPXA 4YDXA 2F8MA 1ZTTA 1X9WA 2Z58B 4KQZA 1FJGF 5C42B 3M9NB 3T5HA 1S99A 1EQMA 2AJ1A 4I64A 4CI0B 3M8RA 4ZK7M 1FRKA 4P75A 3N6LA 2JLGA 2JOQA 2H4YB 4DLGA 2VFRA 3M6WA 3AQOA 2HZAA 2C3UA 5C42A 2HPUA 3FSYA 1UFWA 4A8SA 3GMGA 4M5DB 1NSAA 2IJRA 3BKTA 1KEKA 2M0GB 1RAFB 1TL7B 3PRDA 4J9PA 3D6MB 4LRBA 3TX0A 3CSKA 1ZAWA 2OPSB 1FK9A 2FJAB 3PACA 2QG9B 1SQFA 3HFVA 4M5DA 4DL3A 1RZMA 1LFPA 1TL7A 5AE3A 4M1KA 3BSOA 1HWJA 1U1KA 3LP2B 2BE9B 2BM1A 2OPSA 1TZ0A 2DD8S 2E9ZA 2DNRA 4DUYF 1PAUB 4DSFA 4TU9A 4WYLA 3MPVA 2NSCA 3R6GB 3OV7A 1IWAA 4ETZA 3CJKB 4G1PA 3LP2A 2B8QA 1VYAA 6FD1A 2KFYA 4XTTA 2DJWA 4JI6J 2VG7B 1H98A 1JK9B 2AX0A 4ANEA 1VQKS 3PJWA 2PE8A 3ZZOA 3CJKA 2G9OA 3US5A 1B0PA 2V8HA 3SCIE 3HHLD 3H5YA 5C2GA 2B4UA 4BCAA 1QM9A 1NK4A 2VG7A 1F2GA 2LXIA 2P5VA 2IYGA 3ZC4A 1TL1B 5DG9A 3AXKA 2XQCA 4P2FA 3UD3P 1HBNB 5HP1B 3Q2TC 4RUBA 1IQTA 3OFEA 4P10A 5CD4A 3I6PA 3BM7A 4DN9A 3J7Z5 1Y9OA 3VVTA 2ASJA 1TL1A 2V8VA 2OEKA 4KHMA 3FEXB 4O3QA 3MOJB 2FPHX 1DTQA 3TANA 1HBNA 4AQYF 4A8OA 1I94F 5HP1A 2PEHA 3SZ2A 4K4XA 1AYEA 2VOPA 4RNHA 4NLXA 3OBIA 5ETNA 1F6TA 4L75A 4V1Ak 5RUBA 2R7UA 1HI0P 1FVSA 3I5CA 2AEJA 1REVB 2AF6A 3K5PA 2JX2A 5J2PB 5H9EK 5KFTA 2PDAA 2G1HA 3PFEA 2JEIA 4I2PA 4QWBA 1REVA 2ATCB 4ID5B 3PEHA 3BH6B 2ZZNA 2M9KA 3RW7A 5J2PA 1U09A 3TZWA 3AAWB 2NXNA 4QPXA 2BOPA 4F0HA 4MYTA 4U7UD 1VK3A 3QT6A 4ZCLA 4NA3A 5KFUA 3OTOF 2CA9A 4KJIA 2XY7A 2C1EB 2CZVC 4LIRA 3X3UA 1BXNA 3CO9A 2VFTA 3LAMA 3PG9A 4FN5A 4QIVA 3EVOA 5KFDA 1S9EB 1DQAA 1YBUA 2ZKTA 4LF6J 4IFYB 4R0JA 4KGZB 2CG4A 1LK5A 2GS8A 1JKHA 2PMHA 2E9TA 3D2WA 2HVZA 2VG6B 3W9IA 1S9EA 3BO2A 1YVFA 4RW4B 4IFYA 1WORA 4OQJA 4M95A 5F8GA 1Q95G 4QYRA 4DX6A 4XIUA 1GAOA 2A3JA 3AFGA 4LR7A 4WP3A 4DV2J 2VG6A 3CT9A 4WE1B 1HL6A 4I2QB 4RW4A 1DJ0A 2DNHA 4PXBA 3BREA 1JJHA 1O51A 5BR8J 2J9DA 1N88A 1M5OC 3UCZP 1N56A 4WE1A 2EBGA 2VONA 4KR0B 4I2QA 1RLCL 4LFBJ 5KFNA 3Q83A 1VGYA 2OKQA 4ED3A 2B8PA 2BXJA 3CMAS 4FBUA 4GO7X 2XG8A 5KFLA 1WC5A 2MSTA 2QYGA 3Q24A 1TAQA 4CM2A 3UDVA 2YPYA 3IWXA 2DPIA 2GJFA 5A2QY 2MZ1A 1R6VA 4JI8J 1ZYQA 2MLZA 1TUGB 5DETA 3W62A 1J27A 4BWMA 4B3RF 4DQSA 5DM6Q 1U4BA 1O5JA 1L3UA 4EZ6A 4ZPBA 4ZVRB 4U67Q 3T9ZA 7AT1B 5DDQC 1XWLA 1OSDA 2HHHJ 4JI7J 2J7UA 3ISND 1DHMA 1M5PC 4HT7A 3KLIB 4QW8A 3R5GA 1JLGB 2KT5A 5LM7E 3D6HB 3OVBA 1O6XA 1RCXB 4F67A 4X4SA 1VI7A 1NLKL 4QYZK 3DLGB 2P8IA 4N56A 1WEYA 1M1KT 4J9RA 4YR3A 3KLIA 2ZH6A 1KR4A 4ZCMA 4AE5A 1FFGB 1JLGA 5CABA 2WHOA 2R8JA 4BLGA 4OLPA 4DV1F 2OMLA 3DLGA 2L9DA 3PEJA 1SC6A 4DV6F 3UO0A 1VJWA 3QQCD 1V6HA 2QYCA 3T1HF 2HHWA 2BJ9A 1NPPA 4G6VB 3CJSA 4W92B 4RBTA 1VQ7S 1NPKA 2BE7D 1YK9A 4LF9F 2ERRA 2MQNA 3LTOA 3JTOA 3NNHA 4X4RA 3G8TA 2X1GA 4F3QA 2DNLA 1RWKB 1GXUA 1IBKF 5KFPA 2WRMA 3L4BC 1L3SA 4X64J 3M8ZA 3W65A 2FLPA 2RU9A 4IQMA 3TVZA 2LEBA 5DQHA 4KHPJ 1ZM9A 3M9MB 4R8UA 4J9SA 1L3VA 2OEMA 4YDDB 4O4RA 5A8KB 3PHEA 1T3NA 2HRTA 4JV2A 3O2IA 2KVIA 3WDOA 5IQQA 4DV7J 1YBTA 4A8FA 2QMXA 4CLTA 3QRRA 1T02A 1UP1A 1K8AT 4DSIA 2UVVA 4NLVA 3F44A 1S6UA 3OJSA 2IDEA 1BQNB 4BS2A 1IR1A 5BYSA 1WD6A 1S77D 4W4MA 4EFAC 2R7QA 1BQNA 4DV4F 1ULRA 2AEFA 2E5JA 1R8AA 2AEMA 2AJQA 4RPFA 1FESA 2CIMA 2E5GA 2RB7A 5KFRA 3OPKA 1KN6A 1N36J 2OPQB 1LOUA 3UDLA 3BDPA 1CPZA 4B02A 4UY85 5GAHI 4ELUA 2ZUAA 4HHUA 2QN6B 2IRYA 2R2TA 2J0QD 2V69A 2OPQA 1DLOB 1M0SA 1R89A 5B09A 1WG5A 3WHIA 4ECQA 1UPPA 3TZYA 1RYRA 2FY1A 2ZH1A 1J5OB 1VQLS 1PC4A 1HA1A 2WONB 2E7VA 1AFJA 4F4WA 1RISA 2WW8A 3PZPA 1U1QA 3SFUA 3CCES 2ADCA 1H73A 3KFWX 4WFXA 4RNNA 2LEAA 5F0WA 2WONA 1XMBA 2CAJA 3IRWP 2CJXB 5J1PA 3JTNA 2RQMA 5IC6B 3UNYA 4DEZA 4IRDA 2QMWA 1CJKB 1HWUA 4NZ0A 1ICEB 4LFAJ 2WTFA 4OJ3A 1Q5VA 2A0FB 1B3TA 4A4JA 1CJKA 2DTJA 1A6LA 1LWFB 4U9RA 2AZ1A 4B3TF 5I4MA 2BRLA 3POTB 3R5BA 1RWXB 3C8YA 4I68A 2ZH4A 3DM2B 2C28A 3NWGA 2N3LA 4QZVB 5E0OA 2AW0A 2M70A 1LWFA 1URNA 3NBPB 3POTA 1K1SA 2RRBA 2XCAA 3DM2A 3HCXA 1YITS 3J7YU 3QAUA 2DNOA 3MCSA 3HMJG 4AYBD 3NBPA 4DS5A 2Z2ZA 3KDOA 1WTBA 1T3OA 2W4PA 3DGPA 3X1LB 3M4XA 4XK8C 5I3PA 4IYQA 1X5OA 3AA9A 5HAOA 3HHNB 3BKFA 1N33J 3GFZA 4OYAA 4X4QA 4MK7A 2GO8A 4OI0A 1YHQS 2FDNA 1HWLA 1S0NA 2VBZA 3ZZ0A 4G1QB 3HSJA 2E5LJ 3CJ5A 2DR8A 2MY7A 1RAIB 1K0VA 2QX0A 1S0OA 1YJTA 1S1WB 3PFOA 4L6V3 1T9YA 4RKUC 1D9AA 2F4FA 2O67A 2LP4A 4FYDA 4LJMA 2MJUA 2RUSA 4I1TA 1PYTA 1FWLA 1UFKA 1U1LA 4H4MB 4YB1P 5D15A 1S1WA 1DTTB 2WB1D 1NSKL 2GMJA 1P8GA 2DXDA 4DR2F 2YNFB 3IN5A 4DR6F 4K4VA 2ACMA 2GQCA 4HHHA 2C3OA 4H4MA 3IM8A 1NB7A 3TQ1A 2RRNA 4RWXA 1N8RT 4LF5J 2N82B 2CQGA 5LSLA 2C2KB 5DG8A 1S7IA 2XMTA 2KN4A 1SC3B 2DNQA 2YNFA 2HLTA 4XAKA 1WKKA 2IM2A 3TVKA 3D3CJ 1SC1B 4NRTA 1JWWA 2VV5A 4NL5A 4LBPA 3A8EA 1GNKA 4MKAA 5EGYA 4U8VA 1HPZB 2LQ9A 1NKCA 1NHUA 4YEAA 1U2RA 4WF9Q 1RU1A 4DR7F 2NSBA 4PQUB 2MZTA 3VHQA 1YDLA 4DV3F 1I1GA 1GTHA 3B8HA 1HPZA 2ZNYA 4O44B 2Z2LA 3NCPA 2ZNZA 3RB3A 1UW4A 4PQUA 1HMVB 2PD1A 3R8YA 4LF1A 5K14A 4O44A 1FD2A 3KJNB 1H7WA 1KRPA 2E7XA 1A0OB 1HR0J 2YH0A 5HJYA 1GXLA 3W5ZA 4ECXA 3RUBL 4X4UA 3KKFA 1U1PA 3B4DA 2J7KA 3S01A 2ZZMA 1F1BB 4Q5VA 4NASA 5KT2A 2CXEA 3HHLC 3E8OA 3G87A 3NOGA 2HFUA 3MGJA 3LP1A 2CVIA 4Y34A 1WC3A 5KFVA 3I82A 3W1YC 2Z2MA 1U2FA 2RVJA 4DSLA 1F3FA 2LVWA 3KLEB 3UPFA 2NXEA 4NCAA 4KC5A 4EUVA 4EBDA 2QA4G 1FWPA 3MFHA 4OJGA 5DGBA 4HTJA 4WU2A 1RJJA 2GFFA 1X5SA 2Y1RI 3MM5B 3MM8B 3KLEA 1RT4A 3HO1A 5F8MA 5IV3A 3OUYA 2FD2A 1TV6B 2Q43A 4G65A 1H6KX 3M2RB 4F2RA 1VC0A 4HKQA 1MN7A 3MM5A 4RLEA 4ZJQA 3MM8A 2L3MA 4OHVA 1WDDA 4ECTA 4NCBA 1L3KA 2IHR1 2FJEB 1TV6A 5KFAA 2MZRA 2M88A 1RAAB 2ZBCA 1HHQA 3IAS9 1X7VA 1I6JA 2Q6CA 3OXGA 5BXIA 3VV2B 1Y4ZB 1NK0A 1XMQJ 4ZVGA 3WC2A 3IWNC 2VASA 3ZZTA 3KUEA 2HAIA 4FBTA 5HMWA 2HMIB 1ZA1B 4CH7A 2QV6A 4JI2J 2DHXA 1IWGA 3JQKA 1PBUA 1RTZA 2GAHC 2HAFA 1RWWB 1U1NA 1N5QA 5IT9U 4X4NA 2W2MP 3SCKE 2HMIA 1D3WA 5IM0B 3TUPA 1X4AA 2UVRA 5G4DA 1CVJA 3P5BP 2LECA 4IG3A 2V8DA 3FCHA 1D09B 3RYLA 3PCOB 5IM0A 3CPWR 1X4GA 2VL1A 1M1HA 3MPWA 1VQNS 2MQ8A 1VFJA 4C2MA 2A2CA 2A1BA 1NSPA 1X0FA 4DX8H 4QBUA 2YQ3A 3ZZRA 5D0HA 3PW4A 4N77A 1RHKB 1CJVB 4PYAA 3CD6S 2DBBA 3QFHA 2HHVA 2MQPA 4DFJA 4RWWA 5HMYA 1JXLA 2E5IA 9ATCB 1NO8A 3TUIC 4JI5J 1TK5A 5BJRA 4OL8A 1CJVA 2E1PA 4DG1B 1GX5A 2XLJA 1GK8A 4M5LA 2B7CB 1X9MA 4WTYA 3UN5A 4QCLA 4A8YA 5D3GB 2NPIA 1LW2B 4NLGA 1JJCB 4C7QA 4DG1A 3BQ2A 2YPZA 4YMEA 3ZZUA 1KQSR 2MJNA 4OZ3A 2PMWA 3NGDA 2AJ2A 5D3GA 2FQQB 2XI3A 2KYXA 1LW2A 1BY9A 3ZTPA 2XHWA 4YY3J 1YG0A 3GYXB 3GJQB 2KG0A 2UUAF 4DSJA 2XLKA 1XN9A 4LF7F 2KJVA 3ZFVA 5KG2A 3THVA 2EKNA 1T9VA 2BM0A 3IP0A 4ALZA 2DNNA 4LQ3A 3BS9A 2QLJB 4JI4J 2CPZA 1N5TA 4USMA 4KSEB 3UFCX 5J2MB 4OI4A 4DUZF 4UT4A 2I0XA 2DK2A 2ZH8A 4B9NA 3QJJA 2YKOA 4TYBA 2HURA 3VAHA 1N4LA 4UQTA 2LXFA 2IPOB 4K50A 5J2MA 4EGLA 1SPBP 3FQLA 4QR0A 5H1SV 2G4BA 2DNKA 2GIRA 4WFBQ 1AB8A 1UVNA 4Y3CA 5T41A 2YY3A 2B43A 3VGUA 4HT5A 4C11A 4IQXA 3FDSA 4LSLB 1KFSA 5B0GA 2LEPA 3LP0B 3T3FA 2EFVA 1EJ7L 3CCVS 4ZVPB 2N7CA 3OFFA 3VVUA 1OSCA 4LSLA 3LP0A 3THTA 3CMES 3UI3A 2WAQD 4HEA9 3TVYA 4J9LA 1SH2A 1L3TA 3ENVA 3RJMB 3CIZA 4B9TA 1S9GB 2HNZB 3OHAA 4K0KF 2KHCA 4OYOA 2OPRB 2YWHA 4C8MA 3P3DA 3BGFA 1FFWB 3VWSA 2AKWB 1F0XA 2ZZTA 1S9GA 3D0IE 1SC4B 3CB4A 3TUZC 3BBFA 1RBLA 1T94A 3M6VA 4KKOB 2DIVA 3BSCA 2IVYA 3OL6A 4RBVA 1IM6A 4LUBA 2CJ9A 1HNZJ 2GMLA 1TR0A 1N54B 2G0JA 4FF4A 2CUYA 3JSBA 4Q0BB 2X1AA 4IG0A 3QFWA 2CZ4A 4KKOA 2HVHA 2NXJA 5I3UB 3P45B 2EFNA 1Q79A 1T9TA 2HFZA 4FVMA 4J90A 5ITHA 2DNZA 2JEFA 4Y2CA 1VQ9S 5CQGA 2ZBRA 1R8HA 2AJ0A 3ENWA 4Q0BA 2FY8A 2BBEA 2LCWA 4KIAA 5I3UA 1HYSB 2EFQA 4ZITA 3JYTB 3NLCA 5KFXA 3R7BB 3SCJE 2PIIA 1VBKA 2VFUA 3H2UB 4Y2KA 1U48A 4ECVA 5HVGA 3R27A 3TO8A 4ANDA 4BDPA 3T19A 1NKBA 5E3RA 1KHWA 2HQ3A 3FBEA 2YXLA 3JYTA 4Q8EA 4TY9A 4XDCA 3MWBA 2QSFA 3QAEA 1OY8A 1OYEA 4H54A 3VQTA 2F5GA 2BJEA 2R4FA 3CWJA 1WWHA 2BVZA 4RW8B 3U27A 1SQGA 2PSZA 2B4VA 1XR5A 4DR4J 4NMXA 5A8RB 2MGZB 4BHQA 4HI1A 2XWXA 3QGPA 4WZQA 4M5NA 5HROB 5A8RA 2MGZA 2HWHA 4ILLA 1PGZA 3B82A 1SL2A 2CZ9A 1IKWB 1HNIB 1S0VA 2DGQA 1UZHA 4X2BA 1JLBB 2MMYA 5HROA 2H4WB 4ZHRB 3KLFB 4USUA 1CLFA 4OV1A 2FVQA 1IKWA 1HNIA 2RT3A 3AD9C 1RUSA 1JLBA 3DOKB 3PTWA 1BUXA 4ECRA 4ZHRA 4K2JA 3KLFA 2Y9HA 5EN1A 2PA3A 4DF8A 1FWKA 3DOKA 4ZPVR 4FYYB 2E7WA 2YH1A 4IRKA 3LOUA 2NS1B 3K2YA 1ZS6A 4YUDA 1Q8BA 2DRDA 3PYFA 2QFJA 1EETB 1BQMB 2KXNB 2B3TB 3VTIA 1ZA2B 5M2PA 3K8VA 2VJUA 1VQOS 3LH2S 4RO0A 2DEIA 3MR6A 3SYZA 2XY5A 3M6XA 4X62J 3JAMU 1S49A 1EETA 1BQMA 2LQ8A 3I0SA 1Q16B 1UA0A 4ID8A 2R7VA 1XNRF 3EM1A 3HVWA 3G2XA 4OMFG 3WX4A 4B3SJ 2IA6A 3CC2S 3G8QA 2IVMA 3V4MA 1KC8T 2VG5B 4JI0J 2AZ3A 1XNQJ 4PRFA 1XJWB 2RU3A 3HZGA 4U7UK 5THWA 2BKOA 4ECUA 3ZTQA 1VQ6S 2CQBA 3WC0A 4QR2A 1NDPA 3MR3A 1JLQA 3HHEA 3KTQA 2DR6A 2B9WA 2J0WA 4PXDA 2ZOMA 4DU7A 3KHRA 5B0DA 1HNXJ 1CJUB 5U47A 3T1YF 4KHRA 1LFWA 1MW7A 3PW5A 1RKIA 5HBMA 3V6KA 2DEJA 3DRPB 3NRBA 1BLUA 4ZVFA 4BC9A 1UW9A 1CJUA 2OTLS 2YBVA 2AYBA 4CTAB 3I0RA 1AUSL 3DU5A 3TA2A 1M5VC 5F8NA 3DRPA 3D4JA 4X66J 1K73T 3EGZA 5FLXY 2ZBQA 1GMVA 3EE3A 4TU7A 2YKQA 4CTAA 4M5GA 5HLFB 2CPJA 2E66A 2MSSA 1F5CA 3GG0A 5KT4A 2C2EA 3C19A 1BWEA 4OYXA 1FXDA 5HLFA 1TVRB 2ZH5A 1C0TB 3J80Y 5BYQA 4C3LA 1R8CA 3VAKA 3K57A 5F8LA 4TY8B 4KYZA 5B0EA 1SKUB 4Y28C 1Q4RA 4CLUA 2OPPA 2GMHA 1L5UA 1TVRA 1C0TA 1KFDA 3WQPA 3T1AA 7FDRA 1OWXA 2L9WA 3PY8A 3KDNA 5GVQA 1G1XA 1IJFB 5MAOA 5DDPC 2I1RA 1YRUA 3A8IA 1VLOA 4OI2A 5HL7Q 3MCMA 1Q78A 3MM6A 1QVFR 5F8JA 2ACYA 4XPEA 1RT7B 4H4OA 4YB6A 4Z7YA 4KT0C 5ETQA 2XY6A 2LQ5A 2W4DA 4RR5A 1XR6A 5EX3A 3MM9B 2D3OR 3K89A 2FVRA 1RT7A 2FUG9 4ED0A 1FT8A 3D1QA 1CBKA 1TFWA 5DM7Q 1B99A 5K20B 2HHQA 3MM9A 2NQPA 2CFXA 2KM8C 1ZM4A 4MAKA 3BPDA 5E41A 3BEGB 2UXDF 3R6LB 4OHXA 2ASLA 3R5JB 4LFCF 3FC9A 4OZ1A 4DR1F 2UXBF 5E3CA 3EDQB 2XWYA 3H0PA 2WSEC 3OTDA 4I4BA 2R8HA 4ZN1A 3QRQA 4G1IA 3DLLQ 3ZZYA 3IBWA 5KOWA 2VH7A 3M8YA 4DL2A 2UXCF 2V8PA 1IJEB 4JV5F 4YHHF 1OMSA 5ETLA 1N48A 3L95X 5KAKA 2EG2A 1QJHA 2DH7A 2E1RA 4ZOSA 3MI7X 3QWPA 3IMQJ 2RIJA 3BV8A 2HRYA 6FDRA 3I4HX 5AJ3F 4CYUA 3IBCB 5F41A 1ZETA 2HWTA 3M7VA 2LXUA 3GFYA 2X1BA 4NLWA 3ENAA 5HVFA 2ADBA 5KFYA 3R2CJ 3FK4A 4NLUA 5DDOC 3UR0A 1FRHA 4FDFA 3QYYA 3N6MA 3IRXB 4DFKA 3MEKA 1IKVB 4X64F 5KFCA 2GHPA 1JQGA 1DRZA 3AJDA 3HHLA 4DL0C 3GU0A 4AXIA 3S6EA 2A2DA 5D8HB 2FLOA 4EK2A 1KLNA 1K9MT 1P6TA 1NU4A 4CWBA 3IRXA 4JB8B 4OI1A 4JYAF 2PA8D 3CUNA 3EVWA 1MMDA 2ZC4A 3FMWA 2LKZA 4DV0J 1RDRA 2R8KA 5A6WA 4DPYA 1MROB 3EZ5A 1U1MA 2ILYA 5A6PA 3J81Y 4OX9F 4O23A 2ZKUA 5L8RC 3O1LA 3A1YG 1Y3JA 4CO1A 4O4GB 1RTIB 2KU7A 2VQFJ 4Q2LA 4LIWA 4A8WA 2DR7A 1F9HA 3QGIA 1MROA 4DL4A 2ZE2B 1RTIA 1QLNA 4A8KA 2KDOA 2HBYB 3J7AN 2FJBB 4E0DA 3MAHA 2GHVC 1C0UB 3M2VB 2QO3A 3LPYA 3RGIA 1M5HA 4GMKA 2XB2D 2BUNA 3A13A 2ZJRQ 1C0UA 3M2VA 4I67A 2ATLA 5ETKA 1MSWD 1UVIA 3HDSA 4DR3F 4WPAA 2JZ5A 1OJ4A 2N7YA 2HBZB 1RB0A 3JSRA 4UOCA 2RAQA 3OFHA 3IO1A 1EARA 2HBRB 1FNMA 4M94A 2E9RX 3UDEA 5D0EA 2DVIA 4P72A 5KT3A 3MEDB 2XS7A 5HATA 1NKEA 1FJGJ 2H48B 1WG4A 1MN9A 1U8SA 4FYWB 1N0UA 1U02A 1NNDA 3J7ZT 2UUCF 1RABB 3MEDA 3U7JA 4USHA 3Q0AA 3R1HA 2IVFB 1FF2A 4C6AA 4EO8A 4J9MA 3TAPA 3R9LA 2ZOGA 4PZVA 4NLRA 4CT8A 3W9HA 1FHTA 3TP2A 3HT3A 3FKBA 4LBIA 3EVMA 1RBOB 2HS4A 4BWJA 1HBUB 1FKPB 1RCOB 4ER8A 2NYIA 2CJQA 4OHYA 5GAGU 1TUWA 5CCMA 1KNZA 1IKYA 2N4DA 4QQBA 4JI3F 1NUEA 1HBUA 1FKPA 2QLWA 4ED7A 3SCLE 2KXHA 4DUYJ 5J1EB 5E3PA 2GZOA 4FZVA 4Z7CA 3KK3B 1XQIA 2CDQA 5CYJA 3D1OA 1KBRA 1SXLA 5HN0A 4BBYA 2HQFA 5J1EA 1K0TA 3KK3A 4C98A 2VA2A 2JEGA 5DS7A 2C2NA 2MQOA 2KH9A 3M8QB 3CJ3A 4CIOA 1LKZA 1YJWS 4LSZB 1WNEA 1RGVA 3CCMS 4CO5A 3OSPA 3F56A 5H9FJ 3RBXA 1VR6A 1WEZA 3ELHA 2J9CA 1OO0B 2IYIA 4USIA 5KG7A 4DFPA 3QSIA 2XZDB 4GVBB 1I94J 4AQYJ 2K1RB 1R7IA 3G71S 2R2RA 2XGQA 5LXYA 3O44A 1UETA 3VGTA 4I6YA 4LF2A 3SV4A 1KVIA 1ZPWX 4AFFA 1FTRA 3UW1A 1TELA 4LRFA 5HANA 3W7BA 1JB0C 1NXIA 3BB5A 2V67A 4E2FB 4B3OB 3OXFA 3HHKA 3DOMB 4FXDA 3RB4A 1Y00A 1S57A 2C2OB 1KP6A 5DQGA 4DI6A 2W01A 3BO4A 3RAMA 2YWKA 4B3OA 5HQLA 3DOMA 2UZAA 5I3QA 3N4WA 4NA2A 3WX8A 2I38A 4YB5A 3Q23A 4WCEQ 4WYWA 4C97A 3OTOJ 3GJRB 1PJ6A 3H25A 3N9UC 2MQMA 4YR2A 3BDEA 4Y6IA 1FDNA 2ROPA 2KI2A 3RRHA 1S6OA 1RYSA 4MMOA 1ZZNA 1JNZB 4GRSA 2JFDA 2HIQA 4C4WA 3GCWP 3Q8VA 2P9EA 1NPRA 1HHTP 3K5MA 1QAYA 2R8GA 3A3PB 1JLCB 1LXNA 2G0CA 2DR5A 3HFZB 2VC1A 1RT5B 3N79A 4ED5A 1PKUA 2V63A 1SV5B 4PG5A 3VF0B 3M8WA 2MDAA 3C3LA 3BGUA 1JLCA 1HNWF 4EU0A 4EBEA 1PILA 3KUHA 1VRUB 2F65A 1SV5A 1YRTA 2HZVA 2QE5A 2FC9A 3DRSB 1RT1B 3IS9B 4PPZA 3H59A 4NXNF 1QAXA 3H98A 2QT7A 3AD8C 4PXEA 1UJ5A 4IUFA 5KFMA 1VRUA 4NEYA 4PCQA 4OZ0A 5CYQB 3DRSA 1Y11A 1RT1A 2HHSA 3OR2B 1OYDA 4P2SA 1P27B 1QUPA 2P6SA 5CYQA 4PG7A 3G6YA 2ASYA 4WP8A 2AMCB 3OR2A 3AT1B 2ZD1B 3QO9B 3UDCA 2RS8A 2ZHOA 3CNQP 5DZ6A 4UQGA 4CDIA 2XGPA 4B3RJ 1KHVA 5HQ8A 5KFHA 1GT8A 3QO9A 2JH3A 5LMUF 2OHDA 1RWNB 2YKMB 2I6WA 3GV8B 2FZKB 1EHWA 2FGCA 2AGPA 2IM0A 1WC0A 4UOGA 3VGSA 3JSYA 1UZDA 2YKMA 2FHOB 5CAAA 3KLVA 3PKYA 1S97A 2FJWA 5LL6d 3DXSX 3Q8PB 4GO5X 4NLYA 5K8MA 2PFFB 3CDEA 3HVRA 3TJAA 1HARA 3D66A 5A0YA 1ACMB 4DV1J 4LSNB 3FCVA 5E2QA 1KSPA 2MB0B 4X84A 1SUQB 3QNWB 4RW9B 3G6VA 1REGX 2E1MC 1GMUA 4DV6J 1R0BG 2DCLA 2QRRA 3T1HJ 3OR1B 1UEKA 1W26A 4LSNA 2JRSA 3Q8QB 1SUQA 2IC3B 4RW9A 2D9PA 4EI2A 4LF9J 4CNZA 1XR7A 4UY8T 1DFDA 5IOLA 2XBPA 2W4CA 4AL5A 1S6QB 3H90A 2C3YA 1NBEB 7FD1A 3PX6A 3OR1A 4MT1A 4C8KA 2FVSA 1S7HA 1NZAA 4ZVSB 4ZJLA 4A46A 3SSSA 1QD1A 2IC3A 1IBKJ 4OYIA 3VAFA 2LQBA 1V5VA 1D1UA 2MXYA 1D9FA 1S6QA 3TWZA 1RT3A 2ZWOA 2KTQA 3PR4A 3RB0A 4CLZA 1URRA 1IR2A 4H4KC 1G3OA 2OLWA 1WHVA 4I6AA 3AOAA 5IWAF 1FK9B 1JLAB 3HLUA 2KT2A 1WELA 1UAWA 1PIEA 5ETMA 4USTA 3VZIA 3G82B 1AT1B 2ABYA 2K7KA 1JLAA 4WK3A 2NLWA 3AODA 1HLWA 2X3GA 5A2QU 2BJ8A 4KV8B 3OTCA 5KG0A 3G82A 5ETTA 3KOAA 3OHBA 1U1RA 2QIFA 4OZ2A 5EHHA 2LA6A 3S8SA 3SV3A 4B17A 2CJYB 4HVZA 2IMOA 4WKYA 4ZVEA 4KV8A 3MUTP 4DV4J 2ZM6F 2R7TA 3ZTSA 3BO3A 4J9NA 3DDIA 4XO0A 1QUVA 2R7OA 4NPOA 3AD7C 4WBFA 1UCNA 2VC0A 1QSSA 2YX4A 2VBXA 1X5PA 1MMLA 1PAEX 2HQIA 4F3MA 1DTQB 2CNOB 4OZ5A 3WIVA 4PG6A 2UVUA 4LF4F 3R1LA 4DMZA 1ZZFA 3JTPA 3MHYA 2R2UA 5AE1A 1SJQA 3GV5B 1RI7A 1LNQA 4JOUA 1XEZA 4MKYA 4F4YA 4PPDA 1S1XB 5FIIA 4KE5A 1D8YA 5KG4A 4HDHA 2ZUGA 3GJSB 4I2PB 3U1NA 3KMQA 2GQQA 1S1XA 1X5TA 2I5JB 2B56A 3NCRA 2R2SA 3NGSA 1Q7LB 2I8EA 2BOAA 2NUUG 1TFYA 4B3TJ 2GHWA 1TL4A 5IQ6A 2O1PA 2BE2A 3BGRA 2I5JA 4FXWA 1XMOF 3U02A 4OLOA 5M2RA 5HO4A 2FVCA 2HLUA 5K8PA 4HH0A 2H65B 5DZ7A 3ILIA 3PX4A 1JKHB 1U0HB 3DYAA 1MU2B 4WP9A 4P9SA 1F5BA 2OP5A 5ADZA 1U0HA 4O3PA 2HFSA 3AB2B 1MU2A 1SB6A 1DQ9A 1P1LA 1P1TA 4V19J 2CNNB 3PRVA 2PI5A 1RAEB 3AJ2A 2VF3A 4K59A 2KM8B 1DBDA 5HMZA 4EBCA 1D0EA 2R3VA 2G1DA 4DQIA 2KHDA 4C8YA 3R97A 3RRKA 1KKHA 3OQ2A 2HNYB 3BPSP 2WVBA 1SCJB 3FNNA 4Z2XA 1N5VA 4B3MF 1BMQB 4ZP7A 5AT1B 4ATNA 4X65F 4KRWA 4Y2AA 1NEEA 3TQEA 3NGKA 5HK4A 2HNYA 4M5MA 3GCXP 3HJFA 3QJLA 5AXNA 5EUHA 1WHXA 3VGVA 2H5JB 1ZTWA 1KTQA 4F26A 1R0CB 4ZVHA 4R25A 2DH9A 2X3DA 2Q3PA 2PC6A 3MPYA 5AXKA 4ZP6A 2VD3A 3M30B 1U25A 2WSFC 2MZQA 2BW7A 2CG8A 1VHFA 2CKWA 2IBKA 1DZ5A 2LU2A 4N7TA 4M5IA 4DR2J 2VQEF 4YFUA 5H9FK 1FTCA 4ES1A 4UF4A 2WOMB 3M30A 4HH1A 2JDJA 1N34F 3WIUA 2CYYA 5LOQA 4CLSA 1SL0A 3MR2A 3R5CA 2DHHA 3KHHA 1IUJA 3UE2A 3UN3A 1HHSA 1HI8A 4ECSA 2EI5A 4TQSA 2WOMA 2CQHA 1JXVA 4ZLNA 3CC7S 3RW6A 4B08A 3HX9A 3MDFA 4FS2A 1VIOA 4HI2A 4AXJA 3IBFB 3I32A 4DX7A 2ALYB 1VQMS 1CJTB 1VQSA 4EO6A 4IFVB 4I69A 1U47A 2GIQA 3MMAB 2VDIA 4CQ1A 3SDEB 3W8PA 2HK2A 4M5KA 1AXQA 4DR7J 1U6BA 2W2QP 4DV3J 1U0SA 3L7OA 3W3SA 1NK9A 3U1LA 3DDNA 1CJTA 4TVAB 3N28A 4IFVA 4OZNA 2PT0A 4C48A 3MMAA 2R7RA 3SDEA 2Z57B 3PM9A 3OSNA 2QZ8A 2DIUA 3MAAB 2QJ3A 5EWEA 4RNMA 2BA9A 3ISZA 3O3LA 5CZVA 1HQ2A 4RJVA 2B9YA 3RB6A 2LDIA 2QL7B 1BC6A 2ZEJA 3MAAA 4I0WA 2HWIA 1S0MA 2ZITA 4ZP8A 3D68A 3EPGA 1JNRB 4YS2A 1H3DA 2DXEA 1ROFA 2MKIA 2CPIA 1H2TZ 2RDIA 2Y3YA 4ICLB 2ZHBA 2OFHX 5LMNF 4GC7A 4Y2IA 2DNMA 3TEGA 4R8UB 1RHJB 4DDFA 2EEYA 1C1BB 4GKKF 3CVKA 2I9SA 1LXJA 1SQEA 4ICLA 2VKZG 3PO4A 3TZZA 3BQ1A 2F7VA 3D28A 1C1BA 2XSJB 3PHTA 4J9KA 3J81j 3HD1A 1J5EF 4RU2A 4IH7A 5KFQA 2XM3A 3OLBA 1NJWA 2GGPB 1RTJB 3AJ1A 5HVHA 2CRLA 1HKAA 1VISA 2V9WA 3FBBA 4L74A 3EPIA 4K8RA 5K5MA 2XSJA 3QIPB 3DLKB 3LALA 3CEDA 1HIYA 2V68A 1FFSB 3CCWA 2KJWA 2GGPA 1RTJA 2DNYA 2ASDA 1S76D 3IR5B 3QIDA 3QIPA 3DDKA 3DLKA 4DUTA 5AE2A 2KYZA 5E7OB 5HMXA 3DMJB 2FHJD 2VDHA 1V3ZA 1XC9A 4RNOA 1O8BA 2B9EA 1WJ9A 1VRQC 1S1VA 5EX0A 2ZJQQ 3CCJS 1ZPVA 3BGOP 1EP4B 4OYPA 3E01A 1B7FA 1WG1A 1FNOA 1WDTA 3DMJA 3L9ZA 2A18A 2GCFA 4PABA 3DRXA 4NOHA 1PC5A 5A76A 1EKSA 3OTEA 3FMBA 5F3ZA 1EP4A 2KRBA 1FRIA 2JVRA 1Y0HA 2D69A 2GIFA 3HT0A 2V9KA 4QIWD 3L7PA 3W66A 1RTDA 5CYMB 4QU6A 1NRKA 1TAUA 4MYUA 2D7SA 1YI2S 4MJKA 1A9NB 3CE8A 3CO0P 1Q8LA 4UW2A 1T05B 2HHXA 3PV8A 1RAOA 3GQCA 3GR0A 2CDRB 3QLHB 5CYMA 1IBLF 3J7YI 2M3DA 3ICLA 2B9XA 3N5FA 1X4BA 1Y5IB 2F3JA 3CD5A 1W7WA 1T05A 3HVTB 3CJRA 3QLHA 2VPXB 3OFGA 3BN4A 3V81B 3WBZA 3KK1B 3HVTA 2C22A 2CQIA 3VALA 1YZ7A 1WACA 3V81A 5DQIA 1WI6A 4ZIVA 1SI9A 3KK1A 2PGCA 2EG1A 2DGTA 2H1YA 2D74B 3W60A 1ZH5A 1KQFB 1F9FA 3C15B 1X4DA 2WB4A 2MPUA 3DCAA 1WOSA 5A8WB 3AHPA 5K9FA 2L08A 2XYPB 5KFZA 1WEXA 3DGPB 1TTHB 3AB4B 4R0EA 3I96A 3C15A 3V6DB 3KLGB 2POKA 2W7OA 2E1AA 5F8IA 5A8WA 1VQPS 4K4SA 3GP9A 2NREA 2F4VF 3S1TA 1QY7A 3CULA 3H20A 3V6DA 3KLGA 2GX8A 2UUAJ 3ET6B 4LF7J 1YX2A 3KJFB 4NXMF 1I51B 1M90T 3GFXA 4P73A 2HSEB 3GR1A 5KT5A 4M63A 3ET6A 4LF8F 2FGOA 4PXCA 2JLEA 1FXLA 4C9DA 8AT1B 3A8KA 4DUZJ 4DSKA 2XMKA 4WIQA 3MEGB 1G7CB 2ZH9A 1IBCB 4DSEA 4DR5F 1IVZA 1YBAA 4F8RA 1IKXB 1AA1B 1WC4A 5CHCB 5D4OA 3CDAA 2BZ2A 3MEGA 4OJ1A 3MD3A 2EFOA 1K47A 2HFNA 1CS4A 1EIYB 1YTYA 5DO2A 1OY6A 1HWIA 1IKXA 3GONA 2UUBF 1S6PB 4YR0A 2AGQA 3LGHA 2XO6A 3K0JA 3TRGA 4FNIA 2G0IA 2G2YA 4I7FB 1X4FA 2EVZA 3GE9A 1ZOTA 4L3NA 1S6PA 2HK3A 4DV5F 2B6AB 3LANA 4I6WA 1TK0A 4I7FA 4CZCA 2RDDA 1HD1A 1HBOB 2QL9B 3MMJA 1Q8KA 2VA3A 3RAXA 2YKNB 2B6AA 3RBEA 5SUHA 3GIIA 1NK6A 2YKPA 1F3VA 1RACB 4K0KJ 1TKDA 1AFIA 4C0BA 1HBOA 2UU9F 4X4TA 2XO7A 1RWOB 2YKNA 2X51A 2RDJA 3NKYA 3QPIA 1PO6A 5K14B 4U96A 1TU0B 3DFEA 3ZO7A 3MR5A 3T5KA 2NCKL 1U6ZA 1FI4A 4OZLA 1X60A 2J5AA 2OGUA 2OJ3A 3MCOA 2VICA 4FYXB 2Q79A 3R2DJ 3NL0A 1NMEB 3FEZA 1Q82T 3E51A 1SIWB 4K2XA 4USJC 2DRAA 5DRKA 3DLEB 5L46A 2AGOA 4WFNQ 3GSDA 2AX1A 2V2ZA 1YLXA 2RKIB 3LP1B 2FLNA 5GADI 1XBWA 4UOFA 2G2OA 3DLEA 4LQ9A 4LRCA 4I56A 2RKIA 2HVEA 2HNDA 2QLXA 4F4AA 1SKRA 2K2PA 2Q6BA 1EAYC 2MKKA 2OO4A 4WU3A 1NK8A 4KH0B 3TARA 3AOBA 3ZZZA 1FDBA 5KT7A 1RTHB 3CIMA 4C8ZA 1X4EA 1RT4B 2HFVA 3OLAA 2M8HA 4FF2A 4FP9A 3OUYB 3AQPA 3I87A 1RTHA 2ZH2A 1UWAA 2VPWB 5GAEI 3DOLB 2BACA 1KQGB 4CLYA 2JC0A 3BKUA 4X4VA 3BBBA 1WSRA 5GADU 4FNHA 2IM1A 1TL5A 3PJ9A 4F7VA 2J76E 4H4KA 5SZTA 1SJ4P 1Q81T 2RE1A 2VB6A 2I2YA 3DOLA 2JL9A 2J8AA 1I3OB 3RU0A 2FTRA 3SBMA 1SH3A 2FVPA 1F2HA 1YWXA 3OT9A 4YP3A 4B9UA 3L09A 1RHQB 3V2UC 3M05A 2DGVA 1MNEA 1Z2LA 1CQMA 4ES3A 1Y10A 1IBMF 2B51A 5HI7A 2QMUB 1BE4A 3FQKA 3T9NA 3QT7A 4HYKA 4WFAQ 4QJVA 2WVDA 1QSLA 1KONA 2Z8QA 1UTAA 3U1MA 2C2RA 4IG3B 5GAEU 1NSQA 1D8ZA 4WK1A 4QWEA 3WZ0A 3LW5C 1JJ4A 1CQNA 1JXEA 2Y0SD 2IRXA 1FCAA 2JHEA 1PJ7A 4DL7A 1FA0A 1Z1ZA 2VFVA 1FX2A 4QW9A 2COLA 1I5OB 4FPIA 4ZVTB 1FJEB 3C6TB 4URQU 1NJZA 1HNVB 1KWMA 3GYGA 4P52A 4J37A 2QFIA 1W25A 4A48A 3CC4S 1F5AA 4JI1F 1FJCA 3C6TA 1HNVA 1XNRJ 1S12A 3GYNA 2P9CA 4B9SA 1RAHB 4OI3A 2OEJA 2FJDB 3EMTA 3P8BB 1XK8A 3K17A 4FXVA 3B54A 2MLYA 2L41A 2BANB 2MZJA 2ZBIA 1KLMB 2MQLA 3HZEA 1NH8A 4A8QA 1GX6A 1S4EA 2CQPA 1YSJA 4ERDA 4RUAA 1HI1A 1Y7PA 4ED4A 1NCLA 4KBIA 3OTBA 4ZLJA 1VDHA 2BANA 2MLXA 1KLMA 5K8NA 2CQDA 4JBCA 2LMIA 4RBUA 2HHPA 2QLFB 4RNFA 1JLEB 3EZUA 4QIFA 3T1YJ 3CGIA 1AW0A 3ILJA 2BDPA 1JLEA 1QE1B 3ISNC 4OYMA 2DGOA 4AUKA 1VQ8S 2E29A 4ECYA 1VQYA 1HWKA 2YX1A 1HBMB 1YJUA 4ID5A 1S10A 4DBQA 3H8YA 3C66A 3A4TA 3OJUA 9RUBA 5JUMA 1QE1A 5HQMA 1H2UX 3D6FB 4EZ9A 2V6AA 1T7PA 1HBMA 2OMOA 4C11B 5KFWA 1UEVA 2VODA 2APOA 2B5JB 1OQ3A 4ZA1A 4KO0B 3S7RA 2GC8A 3BQ0A 1H38A 2GJIA 4X4PA 4DPTA 3UWTA 1T11A 2HKEA 5B0AA 4ED2A 4O0NA 1N6QB 2B5JA 3PW2A 4KO0A 2RHSB 4PWUA 1VBXA 2IJNA 4AD6A 2FJXA 2WBRA 3SI8A 1H72C 4QU7A 1N6QA 1YGYA 3ILOA 2W2NP 2MHEA 4K5RA 2HIYA 1WHYA 8RUCA 3BR8A 3EGWB 4OHWA 3UVJB 1U24A 4K4WA 4DPWA 2QLBB 3CCQS 3QRPA 3RAQA 3DLJA 2VHGA 4TN2A 1TKXB 2XCPA 3UVJA 5AXLA 2MHNA 2QGFB 3H4DA 2C2DA 5IT0A 2FZCB 2YNGB 2AV5A 2OD4A 2NZ4A 2R42A 4IG0B 2YQ1A 1TKXA 2EK6A 3T5LA 3MTKA 2ZHAA 4P2MA 1HD0A 2J9EA 5B0BA 4OYZA 4F50A 2YNGA 1WF0A 2PN6A 3THPA 3ETMA 4DCJB 4IOAQ 4J9UE 4YB7A 4USVA 3JSMB 1RADB 3G96A 5CZXA 2F63A 5M2UA 2QTWA 2RRAA 2UXDJ 4GKJF 1LWXA 4LFCJ 4DR1J 2UXBJ 3TJ9A 3BZQA 3IFEA 3JSMA 4NZ7A 1R3NA 4WXOA 5JJBA 4LR8A 3SXLA 2W2PP 2FZGB 4O3NA 2PFDA 3K5LA 1EX8A 2DNPA 4OIXA 3P4UB 2UXCJ 4RW7B 4J9VA 4CLKA 4KGXB 4K7QA 3PR5B 4JV5J 4YHHJ 5FLXU 4D3GA 5FDLB 3MOZA 1R6YA 5KFGA 3F41A 4CLWA 1QSYA 4K4TA 1KS2A 1YJ7A 3P96A 4NX9A 4RW7A 2BYCA 3QATA 1N32F 2V4RA 4FF3A 5E5NA 5FDLA 5AJ3J 3PKMA 3DLHA 3ENQA 3UCUP 2M4MA 4EYIB 4F04B 3J80U 3KMSA 2YWGA 2XSFA 4ZPWR 2G13A 4GC6A 4PR6A 4PKDB 4YOEA 1S48A 3CD0A 3G6ES 5JVGQ 3HSZA 2ZDOA 2CNLB 2OIHA 4F02A 4ECWA 2J9DE 5C7PA 5KTQA 3LO3A 3HF5A 3PIPQ 4L3KA 4F4ZA 2A6MA 3VQSA 2KKHA 4Q8FA 5F8HA 4TLQA 4Y65A 2AD9A 1Q0NA 2DB1A 4PAAA 5D0GA 1N5YB 3PJXA 4OJHA 3EGNA 4JYAJ 3BN7A 2JJ4D 3CDUA 3KG4A 3E2EA 4NCGB 2DHSA 2CQ4A 1MMNA 2JWNA 3NMRA 3ZZPA 2BR0A 4OX9J 1U6FA 5JMNA 4IO9Q 2W8LA 1N5YA 2D3O1 5A8KA 3VAIA 2Q66A 2B7BB 2ALZA 3QSYB 4NCGA 4G3IA 4E8UA 2O3DA 4Z37A 3UD5A 3CJTA 1NDKA 2JNJA 2DPJA 4DHVA 1B0VA 1UEUA 2VZ9A 2V8GA 1FRXA 4RW6B 5D77A 2MQQA 1M5SA 5L39A 2FJVA 1ZAVA 3EXCX 2V4QA 4JI6F 3V4IB 4Y0FA 1X8DA 2NYHA 4DPOA 2L9NA 4J9OA 4RUHA 1N52B 2HVIA 4RW6A 4RZRA 3I0SB 1RT6B 4OYWA 4PG8A 1XIQA 2XTJP 2IIHA 3V4IA 2GJ2A 3D67A 4DR3J 2G2ZA 3GTYX 4ZPCA 4O0IA 2ZWPA 1RT6A 3D1HA 3ZTRA 2HS3A 2HGNA 3GSIA 4PEOA 1YJRA 2R8IA 1B4SA 1DLOA 4MIWA 1K1QA 3MD1A 4CO4A 1RK8A 2XMMA 3G8SA 4JUZA 2B0GA 3DRYA 4WKRA 2WVFA 1WF1A 1J5OA 4NLQA 2XNQA 3QWUA 3HHDA 1JLQB 4DLEA 2HQDA 4N47A 2UUCJ 3ONQA 2QA4S 4DU8A 2RQKA 2LYVA 3N6NA 2IRUA 1LWCB 4F4XA 3OVSA 3DNCA 1M1GA 4CRJA 1H0HB 5GAHU 4USWA 5HBMB 2WVCA 2DNGA 5IFMA 3G86A 4ECZA 2PO4A 3FSXA 3NS5A 3I0RB 1LWCA 5KFJA 4ILRA 4C8OA 2YWEA 2HGLA 2J6SA 4N41A 5D4NA 1HW8A 2FHKA 4JI3J 2J6UA 3BH7B 1R27B 2MKHA 4NLTA 2FIUA 2GVDB 3J81U 1R8PA 2HZCA 1GMWD 4FF1A 3ZXWA 3A3NB 2D9OA 3BYPA 3GZ7A 5LXRA 2Y8WA 3SEOA 4Q7AA 2GVDA 3KUGA 4LF6F 2LU1A 2BV3A 1T03B 3IG1B 2OPPB 3MAQA 3N0VA 2O5DA 3MMCB 3V6JA 1S1TB 1Q53A 4QOTA 3I56S 3EICA 3MUVP 3C6UB 1U45A 2HHUA 5ETRA 1EZZB 2FYXA 2C42A 2DYAA 2GW8A 4U95A 3CCUS 3KXDA 2AT1B 4NLSA 2C2MB 1T03A 3IG1A 3UNGC 2BKNA 3MMCA 3HI9A 1ZAXA 4DV2F 1S1TA 3C6UA 1UVLA 4IKAA 2IJFA 2CQ2A 2JVOA 4ZS6A 3MM6B 3FUYA 5BR8F 5KFEA 4H4OB 2RQ4A 4F36A 4J91A 1D9DA 2IMWP 4LBHA 4LFBF 1FRMA 4G1QA 1TQLA 3ZNJ1 3EXYA 3VZHA 5DGAA 2UVWA 1GH8A 4RL1A 3GIMA 3CCLS 1F60B 1VJQA 4OI6A 3BSAA 3DKDA 2PMZD 2Y0BB 2GVZB 2VFSA 3UQSA 3L3CA 4JI8F 2KZZA 2Y8YA 1DTTA 5L9NA 2AIRB 2W25A 2DGUA 2UP1A 3MEEB 2M2BA 3G4SS 2Y1LB 3UR3C 3ZTOA 2GVZA 3JB9k 2WZ1A 2CPDA 4DZDA 2BRKA 2ZJPQ 4HACB 1T9WA 2KB2A 2XMJA 4ZMMA 2HHHF 4JI7F 3MEEA 1RLDA 1BHNA 1LW0B 3TA1A 3NG8A 2IFXA 3KG1A 1RA6A 4HR2A 2MTLA 3GILA 1GFWB 5KT6A 3FEYB 4HACA 4MIAA 1U49A 3FZ2A 3BGLA 4TKTA 4PQAA 1Q7YT 1SKWA 1IN0A 1LW0A 2LDYA 1FKOB 2VPYB 3H5SA 3SIPB 4V19X 3GB0A 4F25A 1DY3A 4CYUB 1RHMB 4KGKA 4A8XA 1FKOA 3UD4P 3LWLA 1HNWJ 1KVKA 1TMJA 2IA0A 1CULB 1RXOB 5CD4H 3G9CA 3I31A 2V2VA 4UZCA 3P6YC 2VIHA 1SH0A 2E44A 2DY1A 2VJVA 2EXUA 1HMVA 3NAIA 4NXNJ 1YJNS 5ETVA 4R5PB 1RQ0A 3TI0A 1SL1A 3NXZA 2YNHB 4PG4A 3LPEA 1CULA 3KK2B 3HHLB 2EW9A 3JQJA 1BWVA 4LRAA 4C8LA 3GIRA 3MXHP 2Z2YB 1RWPB 2K3IA 4R5PA 1VS3A 3OXLA 1QVGR 1Y5LB 2YNHA 2EFPA 4QIGA 5CA5A 3CJ0A 3M6UA 3KK2A 5L1IA 2M8DB 1C2PA 1FEEA 4D3HA 3OL9A 4KHPF 2KO1A 2KT3A 4QWDA 1UKUA 2RD5C 1Y5NB 1BGXT 1G2EA 3G6XA 3NNAA 2BABA 1V3SA 4DCPB 1LWEB 3I4PA 4XDDA 3PYEA 2XYGB 4PWWA 3W63A 3MF5A 3D9BA 3H2LA 4DV7F 4DOZA 2XS5A 5LMUJ 2VPZB 1SBRA 3D54A 1LWEA 3W5XA 1FDDA 3FGVA 3Q8YA 3VR1A 4PYDA 2HGMA 4C3MA 3W8GA 4O3RA 2F8EX 3C46A 4FS1A 2EKYA 3GLJA 5KFBA 1QTMA 4IO1A 4CCHA 5CH7B 4CO3A 1PCAA 3KNGA 2J6TA 3PW7A 3PXGa 1N36F 4NMLA 2KRRA 4JP8A 2WBMA 3M2RA 4FYVB 3BJYA 4IH5A 2P9GA 3LGMA 5BYRA 4DN0A 3L7UA 1B0TA 1IQZA 3DU6A 5IS2A 3EX7B 2Q1LA 3KLHB 4WZMA 2R9LA 5GAGI 1RHRB 4C8NA 3OL8A 1NJXA 3KNAA 1APSA 2HBQB 3MZIA 3IGVA 3KLHA 4ETXA 4P6QA 4MKVA 4WXWA 1TUVA 5KFKA 1T8EA 4ZCIA 3BF4A 4DQQA 2JC1A 2BW2A 1WOOA 4O3SA 3LAKA 1U7LA 5IWAJ 1WI8A 4NEZA 4P2XA 4LFAF 4JV0A 3LUYA 4AT1B 2YWFA 1IKYB 4MK9A 4DQPA 3H40A 4UUXA 2XMWA 2H51B 1U2CA 5D78A 1AROP 2CWXA 1RU2A 4L72B 2W9BB 1N0VC 3QZ7A 2F9JA 3CXCR 4N8OA 3DGVA 4TU8A 4UZBA 2R7WA 1BD6A 4M8LA 2K3KA 3KJQB 3NNCA 2JLFA 4HLBA 3AXMA 4YQWA 4LR9A 2K7JA 2W9BA 3T6JA 4CLLA 4YN3B 3NGTA 4HL9A 2ZM6J 1JJ2R 1S1UB 3QMQA 1MG7A 1T95A 3O8WA 2HEKA 1R43A 4EWTA 1T0TV 3MPDA 1VQ4S 3FBFA 1OPZA 3VAGA 2A10A 1KTVA 3HVAA 2RHQB 4DS4A 1LK7A 3NY0A 1S1UA 1RE1B 4OHZA 3MUMP 3DN9A 4CH0S 2ROGA 1MWYA 1N33F 2XMAA 2ZC3A 2XYHB 2DRBA 2VOOA 4LF4J 2O01C 4ZPDA 2C3MA 2Y1JA 2NXUA 1Z2ZA 3A8JA 4EMDA 1FJ7A 2XC9A 2E5LF 2MKCA 5C5JA 4M5JA 3P49B 5D0RA 2P6TA 1NB2A 2M5YA 4IDKB 5GMDA 4F0MA 4P71A 2HRUA 4NLOA 1S72S 3PW0A 2GQ2A 1U8WA 3ILLA 1NK5A 3LF0A 1RA7A 3DHWC 2UUWA 3HD2A 4IDKA 3SSQA 1SJRA 5E33A 2HQCA 4ED1A 4WWSA 3N01A 4TQRA 2D3UA 4OFZA 2QA1A 1Q8IA 3LQVA 4IR9A 3FRZA 4Y2MA 2QL5B 3FRYA 3KJVB 3R5DA 4NZ6A 4LF5F 2Z4PA 3OW2R 3I9ZA 3KG0A 1XMOJ 4UTGA 3TJ8A 1W2BR 1ELOA 1UWBB 3HFKA 1SJFA 4F2SA 3C16B 5KG3A 4ZKAA 2M52A 3KJVA 1KDNA 2E1CA 4N76A 5J2QB 2DH8A 3TYTA 1UJ6A 4FKYA 3SQOP 3ULHA 4S0MA 3M2UB 1UWBA 2BQUA 3IXQA 3C16A 1ITPA 2XI2A 1V5IB 2VUGA 1DARA 1C4CA 3RG6A 5J2QA 2H9ZA 2HNZA 3PDNA 3M2UA 4C0HA 3CCSS 3IWLA 1NDCA 2CPHA 2OPRA 3R7NB 3NP5A 2V50A 2RNEA 3CF5Q 4IOCQ 2EPIA 2EK1A 2BKPA 1RP5A 5F9NA 1UL3A 1PBAA 4GVLA 5IT9Y 3MCNA 3KHGA 4B3MJ 1SJ3P 4X65J 4W90B 1UFLA 2VBWA 2BJ3A 4HDGA 1DQ8A 1X4HA 1HR0F 2FHJA 3CJQA 4KAIA 1TL3B 2CJAA 5IZHA 2KFZA 3H5UA 2AP6A 1HW9A 2MYFA 1OQ6A 4DL6A 4NLPA 3DC2A 2DO0A 3K5NA 5CCLA 1RAJA 5KFOA 1TL3A 2CQCA 3IGNA 3D7SB 3HJVA 2XEXA 1HYSA 2KG1A 1IR0A 2V4JB 2VQEJ 1VMBA 5AXMA 4U8YA 4IH6A 1UMJA 1N34J 4RX6A 3ITHB 2CPXA 1QAJA 2V4JA 4Q2MA 3SMZA 1PSDA 2AWZA 4RW8A 4U7CA 1PJ5A 3I5BA 3ITHA 3RBDA 2C2ZB 3CCZA 1C4AA 1RWVB 3CJ8A 1FRJA 1CEZA 1S9FA 1FRLA 1RHUB 5A0YB 2JFKA 4KH1B 3NS7B 3AY0A 1TMMA 5LT5A 2EC2A 1JLFB 2H5EA 2YQ0A 4NYZA 1K44A 1DAXA 2H3EB 3E3XA 2GNKA 1WKJA 3B78A 1FVQA 4W98A 1VBYA 1JLFA 2HHTA 1SJ1A 5T14A 2JEJA 3BSNA 5LJ3Y 1R8BA 1XMQF 5JXSA 2FHMA 3HULA 3QT5A 4OYBA 2YKAA 3ETOA 3JS9A 1CSJA 4JI2F 3AA8A 3O6QA 1RT3B 1NHVA 1S4FA 4L73A 2ROEA 3HPOA 1FE4A 2J8SA 5LSOA 1VOMA 5LMNJ 5J1NA 3CW2C 1FO1A 4GKKJ 3DI6B 1OS5A 2KVQE 3OVAA 1TKTB 2BX6A 5ETSA 3DLBA 4B9VA 1UPMB 4DZ6A 3DI6A 1TKTA 2CPEA 4ZVUB 1J5EJ 1V9OA 4M5HA 4ELTA 3R5AA 4ANCA 2VU5A 5L38A 2YNIB 3BBCA 2CVEA 2C3PA 4N8NA 4QWAA 5HSPA 2RJZA 1R31A 4DL5A 1VBZA 4JI5F 2BJ7A 2FC8A 3I55S 1CG2A 2YNIA 4O3OA 3HM9A 4XPCA 3T6BA 4KTQA 5D4PA 3AH6A 4NYPA 5C2CA 3D6TB 2LA4A 1N5SA 2VG5A 2MZSA 2XULA 4WFZA 2OFGX 1V3RA 4P7VA 2MY8A 2AU0A 4ITSA 2GV1A 4YY3F 2NUHA 3FSIA 2CPFA 1UVMA 1B7YB 1P9YA 5HJXA 2V0NA 1LV5A 3QGGA 2B4OA 4KFBB 3MECB 4WTOB 3EZOA 3W61A 4ZPTR 3R7SB 3RBZA 4JI4F 1SKSA 4KFBA 2RS2A 3GWCA 2K06A 4URGA 1UVJA 3MECA 3QBCA 3PX0A 4ZJOA 2R7XA 3ZNUA 2W8KA 2J0SD 2DR9A 1IBLJ 3N5BA 3M8SA 3K58A 3MM7B 4CP5A 1MWZA 3H7HB 1VRTB 4C3KA 2W7AA 2BE2B 3BGRB 3GIKA 3MM7A 2OELA 1WC1A 3IR6B 1AUDA 2W7PA 4AL7A 4DF4A 3FFIB 4ZPAA 1VRTA 2FB0A 5L1LA 5CXTA 1Z4UA 4NE9C 1QDUB 2ILZA 3CCTA 5D4LA 3EUNA 4B9MA 4TXSA 3W5YA 2ZOFA 4TY8A 3DYAB 2IDLA 1Q1KA 1OY9A 5C25B 3FFIA 2N4CA 5D6GA 2V2KA 4WIIA 4RUCA 2AJFE 2NXCA 4DWIA 1VCTA 2B4PA 2W24A 2OUGA 1X9SA 1EB0A 1T9UA 5G0RB 5C25A 5KFFA 2W9AA 2LFVA 2EWHA 2F4VJ 3O5TB 2XS2A 2YTCA 4A47A 1CC8A 2QA2A 1P9QC 1UVKA 5G0RA 2ZH7A 4NYOA 3J7A1 2IM3A 4NXMJ 3W9JA 4J9QA 1HNZF 3LA0A 3RZAA 1GEHA 1HQEB 5DLGA 2NR0A 4NLDA 4NA1A 2BJDA 2UUTA 3CDWA 2BQRA 2RQCA 4LF8J 2OD6A 1VK8A 2CADA 1S5ZA 4U6PA 2CJBA 3W2VB 5DJBA 1HQEA 1S79A 2HQGA 2H54B 1KVJA 4KPCA 2GA7A 1M5KC 3MPUB 3H4BA 3HK2A 1FEHA 4CLFA 3W2VA 5GMKa 3UN2A 2E5HA 4DR5J 4CH1A 4ZN3A 3JAMY 1FKAF 2HFOA 1IM4A 4CLPA 4J7CA 5KFIA 3D0HE 1SVDA 1RAGB 2W2OP 3AOCA 3NOCA 3Q2SC 5FJ4A 1MWQA 2AYEA 5C24B 3VCDA 2DCUB 2UUBJ 1WC6A 1SIZA 4DR6J 4ILMA 1T9XA 5KFSA 1YKWA 2HW3A 3TW0A 5IT4A 5DG7A 2F9DA 4FVCA 4MIBA 1OPIA 5ETOA 5L1JA 5C24A 1EQ0A 1W2IA 4DV5J 3K7RA 3P5TL 4UUWA 3NWRA 2DGXA 3NCQA 1UA1A 1QAIA 4DR4F 4KB7A 3HKZD 4USKA 2DITA 2RF2B 4MH8A 2VKRA 3W2WB 3PVXA 1ZM2A 1F9EB 1RWMB 4FKXA 2QEXS 2J0XA 2UU9J 5FD1A 1UJ4A 3HSDA 1RT2B 1YRXA 2RF2A 3Q8SB 1DURA 3W2WA 4N5SA 4OX8A 3RRGA 4QPTA 4DQRA 5L1KA 5L9XA 3EGVA 1EKRA 1HFEL 1JMTA 4LVOP 4ED6A 4B9LA 4QWCA 4K4ZA 1IKVA 2LLZA 3KYLA 4F0KA 1RT2A 1XTZA 3DHXA 2QC3A 4K5SA 2UV8A 2GAGC 3FCWA 1TK8A 2WK4A 3MMBB 1U26A 2D3ZA 2IBOA 2OSQA 2SXLA 1YJVA 2R7SA 4UOHA 5B7WA 3K8WA 1NM2A 4F3OA 1GTEA 1FE0A 3I9V9 2WSCC 1E6VB 2V34A 3A12A 3VAJA 1KD1T 2YX7A 3MMBA 1H2VZ 3D5MA 2EBEA 4C0OC 3Q8UA 4O4GA 5KG5A 2XMUA 5LSRA 4AL6A 1FX4A 4NI2B 4LT6A 4LREA 1LQ9A 2CQ3A 1E6VA 3PO5A 2PI4A 2ZE2A 3R3TA 4CO0A 5KG1A 4DCOB 3GPAA 3QJPA 1C1CB 4NI2A 1J2VA 1FERA 4ZDNA 2UV8G 3C2PA 3NGRA 1R0AB 4X62F 3QZ8A 4MKBA 1HQUB 1NJYA 2J7WA 2CJKA 1Q5YA 2Z56B 1WOPA 2F1FA 4PWDB 5H9EJ 1AZSB 2LQJA 2V5HG 1C1CA 2HS0A 3EYZA 3MFIA 1Y3KA 1KOHA 2Z0GA 3VAMA 1OIAA 1R0AA 5GMEA 1HQUA 2YVSA 4KGVB 5DLFA 4PWDA 1AZSA 1X0PA 4ZVQB 3B4MA 3CJ2A 3TR5A 4B3SF 4ELVA 1WKLA 4KGMA 1CC7A 3TUJC 1Q86T 4TYAA 2ZFHA 1S1VB 1XERA 3TZXA 1GXTA 1O0PA 4JI0F 2KZMA 3W64A 2ZDPA 3E01B 2PEBA 1XNQF 3HXMA 4JV1A 3RTVA 4WJBA 2AHOB 1H74A 2CQ1A 3FVYA 1QTNB 2RSQA 2X1FA 3H5XA 3CTRA 2V2QA 3NGUA 3NMAA 3GFHA 2RMLA 2F40A 3T41A 4ZLPA 4LRDA 8ATCB 1TP7A 2DISA 3TX8A 2QSWA 3CJ4A 3SFGA 2F8HA 1HNXF 2K8GA 2MKSA 1RTDB 1LEOA 2M7SA 3CCRS 3HKWA 3FZBA 3OL7A 4CM0A 2EFGA 4IRCA 1IBMJ 4OX7A 3F73A 2ZVIA 3EWGA 2W1BA 2D1CA 2DO4A 4K4YA 1PYOB 3KHLA 4RU9A 4ENOA 4OZJA 5F0UA 1G4CA 5KG6A 4P74A 2DKOB 4X66F 2AYGA 3GIJA 2L48A 2DHGA 3T5JA 4Q43A 3HP6A 4LMZA 3IAM9 2BQ3A 2DY9A 4X4OA 3RR7A 4QR1A 3LWMA 4WFYA 4ZP9A 4ZLLA 1VC6A 3Q8RB 1BQXA 3TEHB 2CQ0A 2WW4A 2ZH3A 1VIXA 2ZBPA 4LVNP 2D41A 5F9LA 2YWWA 4JI1J 4ZCKA 2FLLA 1X4CA 2KXFA 4CO2A 4K4UA 3MR7A 2CNKB 3PYGA 3M9OB 4URSA 3M8QA 3IM9A 4HHJA 1VHIA 2AQ4A 4NRUA 2VBYA 2A6OA 4PUOB 2XZTB 5B08A 5K8OA 4ZVOB 4CT9A 2MKYA 2HYIB 4PUOA 4MFBB 2U1AA 1WTFA 1RWUA 4GVBA 2K1RA 3GJTB 3PYDA 4OX6A 2Z30B 4QYZJ 3EJMA 4Y00A 5LJ5Y 3TAQA 2NZCA 3I5AA 1NH7A 3PRBA 2XNRA 3TOQA 4MFBA 3B6BA 2EC0A 2OSRA 5E3QA 3UCGA 4DX5A 4Q44A 5EDWA 2AYMA 2KL8A 5EWFA 1NAQA 3IA0A 2CWKA 2IAJB 3V5RA 2DGSA 3F0NA 1NK7A 1E6YB 1A7GE 3TAMB
chains in the Genus database with same CATH topology
3PRVA 1NSKL 3Q8VA 3VVTA 1S5ZA 2DXEA 3ZTRA 2DXDA 3GPAA 4EK2A 3EVOA 3NGTA 1NUEA 4UOFA 5IOLA 3VVUA 4FKXA 4KPCA 3VGTA 1LEOA 3NGRA 1S59A 1PKUA 1B4SA 3EVWA 1NPKA 2BX6A 3MPDA 3FBFA 1JXVA 1MN7A 1NSPA 1XQIA 3Q8YA 3DKDA 2HVEA 3ZTSA 3DDIA 1F6TA 4ANDA 1WKKA 4DZ6A 4F4AA 3NGSA 1S57A 3EMTA 1EHWA 3EM1A 3FBEA 3Q86A 3G2XA 4ENOA 1NHKL 4DI6A 3EE3A 1BUXA 3B54A 1NDKA 4WBFA 1UCNA 2B8QA 1VYAA 3Q89A 3EICA 1HHQA 1BE4A 4UOGA 3ZTOA 3VGSA 1PAEX 2VU5A 4ANCA 2DYAA 1MN9A 3EJMA 3FCWA 5CAAA 5BXIA 2ZUAA 1K44A 2AZ3A 3BBCA 1KDNA 1WKLA 3ETMA 3FBCA 2AZ1A 3VGVA 4ANEA 2DXFA 2HURA 1WKJA 2DY9A 1NCLA 1B99A 3BBFA 4UOHA 1NSQA 4W98A 4FKYA 3FBBA 3ENAA 4O0NA 4S0MA 3BH6B 3WX8A 4C6AA 3B6BA 1BHNA 3R9LA 2NCKL 1NLKL 3GP9A 1LWXA 1NDLA 4HR2A 1HIYA 1ZS6A 1NB2A 3L7UA 3FCVA 1F3FA 3Q83A 3ZTQA 2HVDA 3FKBA 3Q8UA 2B8PA 5CABA 5C7PA 1HLWA 2CWKA 3EVMA 1NDPA 2BEFA 1XIQA 3ELHA 3JS9A 3VGUA 4F36A 4CP5A 1U8WA 3BBBA 3FC9A 3NGUA 1NDCA 3PJ9A 4DUTA 1W7WA 3BH7B 3ZTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PRV A;  1NSK L;  3Q8V A;  3VVT A;  1S5Z A;  2DXE A;  3ZTR A;  2DXD A;  3GPA A;  4EK2 A;  3EVO A;  3NGT A;  1NUE A;  4UOF A;  5IOL A;  3VVU A;  4FKX A;  4KPC A;  3VGT A;  1LEO A;  3NGR A;  1S59 A;  1PKU A;  1B4S A;  3EVW A;  1NPK A;  2BX6 A;  3MPD A;  3FBF A;  1JXV A;  1MN7 A;  1NSP A;  1XQI A;  3Q8Y A;  3DKD A;  2HVE A;  3ZTS A;  3DDI A;  1F6T A;  4AND A;  1WKK A;  4DZ6 A;  4F4A A;  3NGS A;  1S57 A;  3EMT A;  1EHW A;  3EM1 A;  3FBE A;  3Q86 A;  3G2X A;  4ENO A;  1NHK L;  4DI6 A;  3EE3 A;  1BUX A;  3B54 A;  1NDK A;  4WBF A;  1UCN A;  2B8Q A;  1VYA A;  3Q89 A;  3EIC A;  1HHQ A;  1BE4 A;  4UOG A;  3ZTO A;  3VGS A;  1PAE X;  2VU5 A;  4ANC A;  2DYA A;  1MN9 A;  3EJM A;  3FCW A;  5CAA A;  5BXI A;  2ZUA A;  1K44 A;  2AZ3 A;  3BBC A;  1KDN A;  1WKL A;  3ETM A;  3FBC A;  2AZ1 A;  3VGV A;  4ANE A;  2DXF A;  2HUR A;  1WKJ A;  2DY9 A;  1NCL A;  1B99 A;  3BBF A;  4UOH A;  1NSQ A;  4W98 A;  4FKY A;  3FBB A;  3ENA A;  4O0N A;  4S0M A;  3BH6 B;  3WX8 A;  4C6A A;  3B6B A;  1BHN A;  3R9L A;  2NCK L;  1NLK L;  3GP9 A;  1LWX A;  1NDL A;  4HR2 A;  1HIY A;  1ZS6 A;  1NB2 A;  3L7U A;  3FCV A;  1F3F A;  3Q83 A;  3ZTQ A;  2HVD A;  3FKB A;  3Q8U A;  2B8P A;  5CAB A;  5C7P A;  1HLW A;  2CWK A;  3EVM A;  1NDP A;  2BEF A;  1XIQ A;  3ELH A;  3JS9 A;  3VGU A;  4F36 A;  4CP5 A;  1U8W A;  3BBB A;  3FC9 A;  3NGU A;  1NDC A;  3PJ9 A;  4DUT A;  1W7W A;  3BH7 B;  3ZTP A; 
#chains in the Genus database with same CATH topology
 3Q22 A;  1WF2 A;  2X7I A;  2IAJ A;  5MLC V;  3TA0 A;  1GQE A;  1E6Y A;  3IC1 A;  4KY3 A;  4MTP A;  4KPY A;  2JSX A;  4L76 A;  3TAM A;  1FNX H;  1CS4 B;  2BJ1 A;  3QGH A;  4A8M P;  5T7L B;  1ZM3 A;  3K5O A;  4DPU A;  3H42 A;  2DT9 A;  1RBA A;  5JVH Q;  3NAH A;  3CD7 A;  2XLI A;  3Q89 A;  1PYS B;  4TLR A;  5T7L A;  3NS6 A;  2N3O A;  1NJI T;  1YIJ S;  2Y1I A;  1PG5 B;  4EEY A;  2DXF A;  3KWM A;  1MLA A;  4IOB A;  2WVE A;  1RT5 A;  6AT1 B;  3JQM A;  4QIE A;  3RR8 A;  4CNY A;  4NWB A;  2BEF A;  1TKZ B;  4Q45 A;  2OH2 A;  1B64 A;  3DRR B;  3CDB A;  3H2V E;  3SQG B;  3FJ2 A;  1KOO A;  5E3A A;  4FPR A;  3IS9 A;  5IC4 B;  3DXB A;  3EDR B;  3OD2 A;  5IXU A;  2BMB A;  3MTJ A;  1TKZ A;  3DRR A;  2MEW A;  3M32 B;  5IV4 A;  2DGW A;  3SQG A;  1IXK A;  1S59 A;  2U2F A;  1FXR A;  4DFM A;  4EYH B;  2RH3 A;  3IR7 B;  1G6B A;  5EWG A;  2OAU A;  4J5O A;  4DV0 F;  3M32 A;  3NEK A;  2XMV A;  1VQ5 S;  2GO9 A;  4F4K A;  3Q86 A;  1NHK L;  3BYR A;  2IY5 B;  2ZD1 A;  5B0C A;  3BR9 A;  3C14 B;  1YQH A;  3PIO Q;  2VQF F;  3ADA C;  3D3B J;  2ZVS A;  4GKJ J;  1WSV A;  3FBC A;  4HTI A;  3QT8 A;  4BC7 A;  1RSC A;  1FD8 A;  3M8P B;  4P7T A;  2KFN A;  5ETP A;  4IR1 A;  3C14 A;  4MK8 A;  1WHW A;  2NPF A;  1NDL A;  2P2C B;  3PNI A;  1KQK A;  2W9C B;  2HVD A;  2CPY A;  2HND B;  2H5I B;  4TNO A;  2RUG A;  4ED8 A;  1ZBT A;  2O66 A;  3D0G E;  3M8P A;  1RKJ A;  3A3O B;  3HSG A;  3V6H A;  1JIH A;  4E98 A;  1NZ8 A;  3M1V B;  3LGN A;  3MUR P;  5J2N B;  2W9C A;  1X31 C;  1YJ9 S;  5B0F A;  1FDA A;  1VLY A;  2WCX A;  2MKJ A;  2V94 A;  5DDR C;  3SSR A;  1VC5 A;  2DHA A;  2OI2 A;  1H7X A;  3K59 A;  4DJB A;  1N32 J;  3GG1 A;  1JX4 A;  5KOX A;  3M1V A;  2XZW A;  5J2N A;  5F3T A;  1B70 B;  3CMQ A;  5I42 B;  3GV7 B;  4ZIW A;  1GMW A;  4ES2 A;  2HG4 A;  3JXO A;  2RIL A;  4OV6 A;  1WUU A;  2OTJ S;  2XHC A;  3TNV A;  5I42 A;  1YZ6 A;  2AJ4 A;  1U1O A;  4DXL A;  4DPX A;  4YDX A;  2F8M A;  1ZTT A;  1X9W A;  2Z58 B;  4KQZ A;  1FJG F;  5C42 B;  3M9N B;  3T5H A;  1S99 A;  1EQM A;  2AJ1 A;  4I64 A;  4CI0 B;  3M8R A;  4ZK7 M;  1FRK A;  4P75 A;  3N6L A;  2JLG A;  2JOQ A;  2H4Y B;  4DLG A;  2VFR A;  3M6W A;  3AQO A;  2HZA A;  2C3U A;  5C42 A;  2HPU A;  3FSY A;  1UFW A;  4A8S A;  3GMG A;  4M5D B;  1NSA A;  2IJR A;  3BKT A;  1KEK A;  2M0G B;  1RAF B;  1TL7 B;  3PRD A;  4J9P A;  3D6M B;  4LRB A;  3TX0 A;  3CSK A;  1ZAW A;  2OPS B;  1FK9 A;  2FJA B;  3PAC A;  2QG9 B;  1SQF A;  3HFV A;  4M5D A;  4DL3 A;  1RZM A;  1LFP A;  1TL7 A;  5AE3 A;  4M1K A;  3BSO A;  1HWJ A;  1U1K A;  3LP2 B;  2BE9 B;  2BM1 A;  2OPS A;  1TZ0 A;  2DD8 S;  2E9Z A;  2DNR A;  4DUY F;  1PAU B;  4DSF A;  4TU9 A;  4WYL A;  3MPV A;  2NSC A;  3R6G B;  3OV7 A;  1IWA A;  4ETZ A;  3CJK B;  4G1P A;  3LP2 A;  2B8Q A;  1VYA A;  6FD1 A;  2KFY A;  4XTT A;  2DJW A;  4JI6 J;  2VG7 B;  1H98 A;  1JK9 B;  2AX0 A;  4ANE A;  1VQK S;  3PJW A;  2PE8 A;  3ZZO A;  3CJK A;  2G9O A;  3US5 A;  1B0P A;  2V8H A;  3SCI E;  3HHL D;  3H5Y A;  5C2G A;  2B4U A;  4BCA A;  1QM9 A;  1NK4 A;  2VG7 A;  1F2G A;  2LXI A;  2P5V A;  2IYG A;  3ZC4 A;  1TL1 B;  5DG9 A;  3AXK A;  2XQC A;  4P2F A;  3UD3 P;  1HBN B;  5HP1 B;  3Q2T C;  4RUB A;  1IQT A;  3OFE A;  4P10 A;  5CD4 A;  3I6P A;  3BM7 A;  4DN9 A;  3J7Z 5;  1Y9O A;  3VVT A;  2ASJ A;  1TL1 A;  2V8V A;  2OEK A;  4KHM A;  3FEX B;  4O3Q A;  3MOJ B;  2FPH X;  1DTQ A;  3TAN A;  1HBN A;  4AQY F;  4A8O A;  1I94 F;  5HP1 A;  2PEH A;  3SZ2 A;  4K4X A;  1AYE A;  2VOP A;  4RNH A;  4NLX A;  3OBI A;  5ETN A;  1F6T A;  4L75 A;  4V1A k;  5RUB A;  2R7U A;  1HI0 P;  1FVS A;  3I5C A;  2AEJ A;  1REV B;  2AF6 A;  3K5P A;  2JX2 A;  5J2P B;  5H9E K;  5KFT A;  2PDA A;  2G1H A;  3PFE A;  2JEI A;  4I2P A;  4QWB A;  1REV A;  2ATC B;  4ID5 B;  3PEH A;  3BH6 B;  2ZZN A;  2M9K A;  3RW7 A;  5J2P A;  1U09 A;  3TZW A;  3AAW B;  2NXN A;  4QPX A;  2BOP A;  4F0H A;  4MYT A;  4U7U D;  1VK3 A;  3QT6 A;  4ZCL A;  4NA3 A;  5KFU A;  3OTO F;  2CA9 A;  4KJI A;  2XY7 A;  2C1E B;  2CZV C;  4LIR A;  3X3U A;  1BXN A;  3CO9 A;  2VFT A;  3LAM A;  3PG9 A;  4FN5 A;  4QIV A;  3EVO A;  5KFD A;  1S9E B;  1DQA A;  1YBU A;  2ZKT A;  4LF6 J;  4IFY B;  4R0J A;  4KGZ B;  2CG4 A;  1LK5 A;  2GS8 A;  1JKH A;  2PMH A;  2E9T A;  3D2W A;  2HVZ A;  2VG6 B;  3W9I A;  1S9E A;  3BO2 A;  1YVF A;  4RW4 B;  4IFY A;  1WOR A;  4OQJ A;  4M95 A;  5F8G A;  1Q95 G;  4QYR A;  4DX6 A;  4XIU A;  1GAO A;  2A3J A;  3AFG A;  4LR7 A;  4WP3 A;  4DV2 J;  2VG6 A;  3CT9 A;  4WE1 B;  1HL6 A;  4I2Q B;  4RW4 A;  1DJ0 A;  2DNH A;  4PXB A;  3BRE A;  1JJH A;  1O51 A;  5BR8 J;  2J9D A;  1N88 A;  1M5O C;  3UCZ P;  1N56 A;  4WE1 A;  2EBG A;  2VON A;  4KR0 B;  4I2Q A;  1RLC L;  4LFB J;  5KFN A;  3Q83 A;  1VGY A;  2OKQ A;  4ED3 A;  2B8P A;  2BXJ A;  3CMA S;  4FBU A;  4GO7 X;  2XG8 A;  5KFL A;  1WC5 A;  2MST A;  2QYG A;  3Q24 A;  1TAQ A;  4CM2 A;  3UDV A;  2YPY A;  3IWX A;  2DPI A;  2GJF A;  5A2Q Y;  2MZ1 A;  1R6V A;  4JI8 J;  1ZYQ A;  2MLZ A;  1TUG B;  5DET A;  3W62 A;  1J27 A;  4BWM A;  4B3R F;  4DQS A;  5DM6 Q;  1U4B A;  1O5J A;  1L3U A;  4EZ6 A;  4ZPB A;  4ZVR B;  4U67 Q;  3T9Z A;  7AT1 B;  5DDQ C;  1XWL A;  1OSD A;  2HHH J;  4JI7 J;  2J7U A;  3ISN D;  1DHM A;  1M5P C;  4HT7 A;  3KLI B;  4QW8 A;  3R5G A;  1JLG B;  2KT5 A;  5LM7 E;  3D6H B;  3OVB A;  1O6X A;  1RCX B;  4F67 A;  4X4S A;  1VI7 A;  1NLK L;  4QYZ K;  3DLG B;  2P8I A;  4N56 A;  1WEY A;  1M1K T;  4J9R A;  4YR3 A;  3KLI A;  2ZH6 A;  1KR4 A;  4ZCM A;  4AE5 A;  1FFG B;  1JLG A;  5CAB A;  2WHO A;  2R8J A;  4BLG A;  4OLP A;  4DV1 F;  2OML A;  3DLG A;  2L9D A;  3PEJ A;  1SC6 A;  4DV6 F;  3UO0 A;  1VJW A;  3QQC D;  1V6H A;  2QYC A;  3T1H F;  2HHW A;  2BJ9 A;  1NPP A;  4G6V B;  3CJS A;  4W92 B;  4RBT A;  1VQ7 S;  1NPK A;  2BE7 D;  1YK9 A;  4LF9 F;  2ERR A;  2MQN A;  3LTO A;  3JTO A;  3NNH A;  4X4R A;  3G8T A;  2X1G A;  4F3Q A;  2DNL A;  1RWK B;  1GXU A;  1IBK F;  5KFP A;  2WRM A;  3L4B C;  1L3S A;  4X64 J;  3M8Z A;  3W65 A;  2FLP A;  2RU9 A;  4IQM A;  3TVZ A;  2LEB A;  5DQH A;  4KHP J;  1ZM9 A;  3M9M B;  4R8U A;  4J9S A;  1L3V A;  2OEM A;  4YDD B;  4O4R A;  5A8K B;  3PHE A;  1T3N A;  2HRT A;  4JV2 A;  3O2I A;  2KVI A;  3WDO A;  5IQQ A;  4DV7 J;  1YBT A;  4A8F A;  2QMX A;  4CLT A;  3QRR A;  1T02 A;  1UP1 A;  1K8A T;  4DSI A;  2UVV A;  4NLV A;  3F44 A;  1S6U A;  3OJS A;  2IDE A;  1BQN B;  4BS2 A;  1IR1 A;  5BYS A;  1WD6 A;  1S77 D;  4W4M A;  4EFA C;  2R7Q A;  1BQN A;  4DV4 F;  1ULR A;  2AEF A;  2E5J A;  1R8A A;  2AEM A;  2AJQ A;  4RPF A;  1FES A;  2CIM A;  2E5G A;  2RB7 A;  5KFR A;  3OPK A;  1KN6 A;  1N36 J;  2OPQ B;  1LOU A;  3UDL A;  3BDP A;  1CPZ A;  4B02 A;  4UY8 5;  5GAH I;  4ELU A;  2ZUA A;  4HHU A;  2QN6 B;  2IRY A;  2R2T A;  2J0Q D;  2V69 A;  2OPQ A;  1DLO B;  1M0S A;  1R89 A;  5B09 A;  1WG5 A;  3WHI A;  4ECQ A;  1UPP A;  3TZY A;  1RYR A;  2FY1 A;  2ZH1 A;  1J5O B;  1VQL S;  1PC4 A;  1HA1 A;  2WON B;  2E7V A;  1AFJ A;  4F4W A;  1RIS A;  2WW8 A;  3PZP A;  1U1Q A;  3SFU A;  3CCE S;  2ADC A;  1H73 A;  3KFW X;  4WFX A;  4RNN A;  2LEA A;  5F0W A;  2WON A;  1XMB A;  2CAJ A;  3IRW P;  2CJX B;  5J1P A;  3JTN A;  2RQM A;  5IC6 B;  3UNY A;  4DEZ A;  4IRD A;  2QMW A;  1CJK B;  1HWU A;  4NZ0 A;  1ICE B;  4LFA J;  2WTF A;  4OJ3 A;  1Q5V A;  2A0F B;  1B3T A;  4A4J A;  1CJK A;  2DTJ A;  1A6L A;  1LWF B;  4U9R A;  2AZ1 A;  4B3T F;  5I4M A;  2BRL A;  3POT B;  3R5B A;  1RWX B;  3C8Y A;  4I68 A;  2ZH4 A;  3DM2 B;  2C28 A;  3NWG A;  2N3L A;  4QZV B;  5E0O A;  2AW0 A;  2M70 A;  1LWF A;  1URN A;  3NBP B;  3POT A;  1K1S A;  2RRB A;  2XCA A;  3DM2 A;  3HCX A;  1YIT S;  3J7Y U;  3QAU A;  2DNO A;  3MCS A;  3HMJ G;  4AYB D;  3NBP A;  4DS5 A;  2Z2Z A;  3KDO A;  1WTB A;  1T3O A;  2W4P A;  3DGP A;  3X1L B;  3M4X A;  4XK8 C;  5I3P A;  4IYQ A;  1X5O A;  3AA9 A;  5HAO A;  3HHN B;  3BKF A;  1N33 J;  3GFZ A;  4OYA A;  4X4Q A;  4MK7 A;  2GO8 A;  4OI0 A;  1YHQ S;  2FDN A;  1HWL A;  1S0N A;  2VBZ A;  3ZZ0 A;  4G1Q B;  3HSJ A;  2E5L J;  3CJ5 A;  2DR8 A;  2MY7 A;  1RAI B;  1K0V A;  2QX0 A;  1S0O A;  1YJT A;  1S1W B;  3PFO A;  4L6V 3;  1T9Y A;  4RKU C;  1D9A A;  2F4F A;  2O67 A;  2LP4 A;  4FYD A;  4LJM A;  2MJU A;  2RUS A;  4I1T A;  1PYT A;  1FWL A;  1UFK A;  1U1L A;  4H4M B;  4YB1 P;  5D15 A;  1S1W A;  1DTT B;  2WB1 D;  1NSK L;  2GMJ A;  1P8G A;  2DXD A;  4DR2 F;  2YNF B;  3IN5 A;  4DR6 F;  4K4V A;  2ACM A;  2GQC A;  4HHH A;  2C3O A;  4H4M A;  3IM8 A;  1NB7 A;  3TQ1 A;  2RRN A;  4RWX A;  1N8R T;  4LF5 J;  2N82 B;  2CQG A;  5LSL A;  2C2K B;  5DG8 A;  1S7I A;  2XMT A;  2KN4 A;  1SC3 B;  2DNQ A;  2YNF A;  2HLT A;  4XAK A;  1WKK A;  2IM2 A;  3TVK A;  3D3C J;  1SC1 B;  4NRT A;  1JWW A;  2VV5 A;  4NL5 A;  4LBP A;  3A8E A;  1GNK A;  4MKA A;  5EGY A;  4U8V A;  1HPZ B;  2LQ9 A;  1NKC A;  1NHU A;  4YEA A;  1U2R A;  4WF9 Q;  1RU1 A;  4DR7 F;  2NSB A;  4PQU B;  2MZT A;  3VHQ A;  1YDL A;  4DV3 F;  1I1G A;  1GTH A;  3B8H A;  1HPZ A;  2ZNY A;  4O44 B;  2Z2L A;  3NCP A;  2ZNZ A;  3RB3 A;  1UW4 A;  4PQU A;  1HMV B;  2PD1 A;  3R8Y A;  4LF1 A;  5K14 A;  4O44 A;  1FD2 A;  3KJN B;  1H7W A;  1KRP A;  2E7X A;  1A0O B;  1HR0 J;  2YH0 A;  5HJY A;  1GXL A;  3W5Z A;  4ECX A;  3RUB L;  4X4U A;  3KKF A;  1U1P A;  3B4D A;  2J7K A;  3S01 A;  2ZZM A;  1F1B B;  4Q5V A;  4NAS A;  5KT2 A;  2CXE A;  3HHL C;  3E8O A;  3G87 A;  3NOG A;  2HFU A;  3MGJ A;  3LP1 A;  2CVI A;  4Y34 A;  1WC3 A;  5KFV A;  3I82 A;  3W1Y C;  2Z2M A;  1U2F A;  2RVJ A;  4DSL A;  1F3F A;  2LVW A;  3KLE B;  3UPF A;  2NXE A;  4NCA A;  4KC5 A;  4EUV A;  4EBD A;  2QA4 G;  1FWP A;  3MFH A;  4OJG A;  5DGB A;  4HTJ A;  4WU2 A;  1RJJ A;  2GFF A;  1X5S A;  2Y1R I;  3MM5 B;  3MM8 B;  3KLE A;  1RT4 A;  3HO1 A;  5F8M A;  5IV3 A;  3OUY A;  2FD2 A;  1TV6 B;  2Q43 A;  4G65 A;  1H6K X;  3M2R B;  4F2R A;  1VC0 A;  4HKQ A;  1MN7 A;  3MM5 A;  4RLE A;  4ZJQ A;  3MM8 A;  2L3M A;  4OHV A;  1WDD A;  4ECT A;  4NCB A;  1L3K A;  2IHR 1;  2FJE B;  1TV6 A;  5KFA A;  2MZR A;  2M88 A;  1RAA B;  2ZBC A;  1HHQ A;  3IAS 9;  1X7V A;  1I6J A;  2Q6C A;  3OXG A;  5BXI A;  3VV2 B;  1Y4Z B;  1NK0 A;  1XMQ J;  4ZVG A;  3WC2 A;  3IWN C;  2VAS A;  3ZZT A;  3KUE A;  2HAI A;  4FBT A;  5HMW A;  2HMI B;  1ZA1 B;  4CH7 A;  2QV6 A;  4JI2 J;  2DHX A;  1IWG A;  3JQK A;  1PBU A;  1RTZ A;  2GAH C;  2HAF A;  1RWW B;  1U1N A;  1N5Q A;  5IT9 U;  4X4N A;  2W2M P;  3SCK E;  2HMI A;  1D3W A;  5IM0 B;  3TUP A;  1X4A A;  2UVR A;  5G4D A;  1CVJ A;  3P5B P;  2LEC A;  4IG3 A;  2V8D A;  3FCH A;  1D09 B;  3RYL A;  3PCO B;  5IM0 A;  3CPW R;  1X4G A;  2VL1 A;  1M1H A;  3MPW A;  1VQN S;  2MQ8 A;  1VFJ A;  4C2M A;  2A2C A;  2A1B A;  1NSP A;  1X0F A;  4DX8 H;  4QBU A;  2YQ3 A;  3ZZR A;  5D0H A;  3PW4 A;  4N77 A;  1RHK B;  1CJV B;  4PYA A;  3CD6 S;  2DBB A;  3QFH A;  2HHV A;  2MQP A;  4DFJ A;  4RWW A;  5HMY A;  1JXL A;  2E5I A;  9ATC B;  1NO8 A;  3TUI C;  4JI5 J;  1TK5 A;  5BJR A;  4OL8 A;  1CJV A;  2E1P A;  4DG1 B;  1GX5 A;  2XLJ A;  1GK8 A;  4M5L A;  2B7C B;  1X9M A;  4WTY A;  3UN5 A;  4QCL A;  4A8Y A;  5D3G B;  2NPI A;  1LW2 B;  4NLG A;  1JJC B;  4C7Q A;  4DG1 A;  3BQ2 A;  2YPZ A;  4YME A;  3ZZU A;  1KQS R;  2MJN A;  4OZ3 A;  2PMW A;  3NGD A;  2AJ2 A;  5D3G A;  2FQQ B;  2XI3 A;  2KYX A;  1LW2 A;  1BY9 A;  3ZTP A;  2XHW A;  4YY3 J;  1YG0 A;  3GYX B;  3GJQ B;  2KG0 A;  2UUA F;  4DSJ A;  2XLK A;  1XN9 A;  4LF7 F;  2KJV A;  3ZFV A;  5KG2 A;  3THV A;  2EKN A;  1T9V A;  2BM0 A;  3IP0 A;  4ALZ A;  2DNN A;  4LQ3 A;  3BS9 A;  2QLJ B;  4JI4 J;  2CPZ A;  1N5T A;  4USM A;  4KSE B;  3UFC X;  5J2M B;  4OI4 A;  4DUZ F;  4UT4 A;  2I0X A;  2DK2 A;  2ZH8 A;  4B9N A;  3QJJ A;  2YKO A;  4TYB A;  2HUR A;  3VAH A;  1N4L A;  4UQT A;  2LXF A;  2IPO B;  4K50 A;  5J2M A;  4EGL A;  1SPB P;  3FQL A;  4QR0 A;  5H1S V;  2G4B A;  2DNK A;  2GIR A;  4WFB Q;  1AB8 A;  1UVN A;  4Y3C A;  5T41 A;  2YY3 A;  2B43 A;  3VGU A;  4HT5 A;  4C11 A;  4IQX A;  3FDS A;  4LSL B;  1KFS A;  5B0G A;  2LEP A;  3LP0 B;  3T3F A;  2EFV A;  1EJ7 L;  3CCV S;  4ZVP B;  2N7C A;  3OFF A;  3VVU A;  1OSC A;  4LSL A;  3LP0 A;  3THT A;  3CME S;  3UI3 A;  2WAQ D;  4HEA 9;  3TVY A;  4J9L A;  1SH2 A;  1L3T A;  3ENV A;  3RJM B;  3CIZ A;  4B9T A;  1S9G B;  2HNZ B;  3OHA A;  4K0K F;  2KHC A;  4OYO A;  2OPR B;  2YWH A;  4C8M A;  3P3D A;  3BGF A;  1FFW B;  3VWS A;  2AKW B;  1F0X A;  2ZZT A;  1S9G A;  3D0I E;  1SC4 B;  3CB4 A;  3TUZ C;  3BBF A;  1RBL A;  1T94 A;  3M6V A;  4KKO B;  2DIV A;  3BSC A;  2IVY A;  3OL6 A;  4RBV A;  1IM6 A;  4LUB A;  2CJ9 A;  1HNZ J;  2GML A;  1TR0 A;  1N54 B;  2G0J A;  4FF4 A;  2CUY A;  3JSB A;  4Q0B B;  2X1A A;  4IG0 A;  3QFW A;  2CZ4 A;  4KKO A;  2HVH A;  2NXJ A;  5I3U B;  3P45 B;  2EFN A;  1Q79 A;  1T9T A;  2HFZ A;  4FVM A;  4J90 A;  5ITH A;  2DNZ A;  2JEF A;  4Y2C A;  1VQ9 S;  5CQG A;  2ZBR A;  1R8H A;  2AJ0 A;  3ENW A;  4Q0B A;  2FY8 A;  2BBE A;  2LCW A;  4KIA A;  5I3U A;  1HYS B;  2EFQ A;  4ZIT A;  3JYT B;  3NLC A;  5KFX A;  3R7B B;  3SCJ E;  2PII A;  1VBK A;  2VFU A;  3H2U B;  4Y2K A;  1U48 A;  4ECV A;  5HVG A;  3R27 A;  3TO8 A;  4AND A;  4BDP A;  3T19 A;  1NKB A;  5E3R A;  1KHW A;  2HQ3 A;  3FBE A;  2YXL A;  3JYT A;  4Q8E A;  4TY9 A;  4XDC A;  3MWB A;  2QSF A;  3QAE A;  1OY8 A;  1OYE A;  4H54 A;  3VQT A;  2F5G A;  2BJE A;  2R4F A;  3CWJ A;  1WWH A;  2BVZ A;  4RW8 B;  3U27 A;  1SQG A;  2PSZ A;  2B4V A;  1XR5 A;  4DR4 J;  4NMX A;  5A8R B;  2MGZ B;  4BHQ A;  4HI1 A;  2XWX A;  3QGP A;  4WZQ A;  4M5N A;  5HRO B;  5A8R A;  2MGZ A;  2HWH A;  4ILL A;  1PGZ A;  3B82 A;  1SL2 A;  2CZ9 A;  1IKW B;  1HNI B;  1S0V A;  2DGQ A;  1UZH A;  4X2B A;  1JLB B;  2MMY A;  5HRO A;  2H4W B;  4ZHR B;  3KLF B;  4USU A;  1CLF A;  4OV1 A;  2FVQ A;  1IKW A;  1HNI A;  2RT3 A;  3AD9 C;  1RUS A;  1JLB A;  3DOK B;  3PTW A;  1BUX A;  4ECR A;  4ZHR A;  4K2J A;  3KLF A;  2Y9H A;  5EN1 A;  2PA3 A;  4DF8 A;  1FWK A;  3DOK A;  4ZPV R;  4FYY B;  2E7W A;  2YH1 A;  4IRK A;  3LOU A;  2NS1 B;  3K2Y A;  1ZS6 A;  4YUD A;  1Q8B A;  2DRD A;  3PYF A;  2QFJ A;  1EET B;  1BQM B;  2KXN B;  2B3T B;  3VTI A;  1ZA2 B;  5M2P A;  3K8V A;  2VJU A;  1VQO S;  3LH2 S;  4RO0 A;  2DEI A;  3MR6 A;  3SYZ A;  2XY5 A;  3M6X A;  4X62 J;  3JAM U;  1S49 A;  1EET A;  1BQM A;  2LQ8 A;  3I0S A;  1Q16 B;  1UA0 A;  4ID8 A;  2R7V A;  1XNR F;  3EM1 A;  3HVW A;  3G2X A;  4OMF G;  3WX4 A;  4B3S J;  2IA6 A;  3CC2 S;  3G8Q A;  2IVM A;  3V4M A;  1KC8 T;  2VG5 B;  4JI0 J;  2AZ3 A;  1XNQ J;  4PRF A;  1XJW B;  2RU3 A;  3HZG A;  4U7U K;  5THW A;  2BKO A;  4ECU A;  3ZTQ A;  1VQ6 S;  2CQB A;  3WC0 A;  4QR2 A;  1NDP A;  3MR3 A;  1JLQ A;  3HHE A;  3KTQ A;  2DR6 A;  2B9W A;  2J0W A;  4PXD A;  2ZOM A;  4DU7 A;  3KHR A;  5B0D A;  1HNX J;  1CJU B;  5U47 A;  3T1Y F;  4KHR A;  1LFW A;  1MW7 A;  3PW5 A;  1RKI A;  5HBM A;  3V6K A;  2DEJ A;  3DRP B;  3NRB A;  1BLU A;  4ZVF A;  4BC9 A;  1UW9 A;  1CJU A;  2OTL S;  2YBV A;  2AYB A;  4CTA B;  3I0R A;  1AUS L;  3DU5 A;  3TA2 A;  1M5V C;  5F8N A;  3DRP A;  3D4J A;  4X66 J;  1K73 T;  3EGZ A;  5FLX Y;  2ZBQ A;  1GMV A;  3EE3 A;  4TU7 A;  2YKQ A;  4CTA A;  4M5G A;  5HLF B;  2CPJ A;  2E66 A;  2MSS A;  1F5C A;  3GG0 A;  5KT4 A;  2C2E A;  3C19 A;  1BWE A;  4OYX A;  1FXD A;  5HLF A;  1TVR B;  2ZH5 A;  1C0T B;  3J80 Y;  5BYQ A;  4C3L A;  1R8C A;  3VAK A;  3K57 A;  5F8L A;  4TY8 B;  4KYZ A;  5B0E A;  1SKU B;  4Y28 C;  1Q4R A;  4CLU A;  2OPP A;  2GMH A;  1L5U A;  1TVR A;  1C0T A;  1KFD A;  3WQP A;  3T1A A;  7FDR A;  1OWX A;  2L9W A;  3PY8 A;  3KDN A;  5GVQ A;  1G1X A;  1IJF B;  5MAO A;  5DDP C;  2I1R A;  1YRU A;  3A8I A;  1VLO A;  4OI2 A;  5HL7 Q;  3MCM A;  1Q78 A;  3MM6 A;  1QVF R;  5F8J A;  2ACY A;  4XPE A;  1RT7 B;  4H4O A;  4YB6 A;  4Z7Y A;  4KT0 C;  5ETQ A;  2XY6 A;  2LQ5 A;  2W4D A;  4RR5 A;  1XR6 A;  5EX3 A;  3MM9 B;  2D3O R;  3K89 A;  2FVR A;  1RT7 A;  2FUG 9;  4ED0 A;  1FT8 A;  3D1Q A;  1CBK A;  1TFW A;  5DM7 Q;  1B99 A;  5K20 B;  2HHQ A;  3MM9 A;  2NQP A;  2CFX A;  2KM8 C;  1ZM4 A;  4MAK A;  3BPD A;  5E41 A;  3BEG B;  2UXD F;  3R6L B;  4OHX A;  2ASL A;  3R5J B;  4LFC F;  3FC9 A;  4OZ1 A;  4DR1 F;  2UXB F;  5E3C A;  3EDQ B;  2XWY A;  3H0P A;  2WSE C;  3OTD A;  4I4B A;  2R8H A;  4ZN1 A;  3QRQ A;  4G1I A;  3DLL Q;  3ZZY A;  3IBW A;  5KOW A;  2VH7 A;  3M8Y A;  4DL2 A;  2UXC F;  2V8P A;  1IJE B;  4JV5 F;  4YHH F;  1OMS A;  5ETL A;  1N48 A;  3L95 X;  5KAK A;  2EG2 A;  1QJH A;  2DH7 A;  2E1R A;  4ZOS A;  3MI7 X;  3QWP A;  3IMQ J;  2RIJ A;  3BV8 A;  2HRY A;  6FDR A;  3I4H X;  5AJ3 F;  4CYU A;  3IBC B;  5F41 A;  1ZET A;  2HWT A;  3M7V A;  2LXU A;  3GFY A;  2X1B A;  4NLW A;  3ENA A;  5HVF A;  2ADB A;  5KFY A;  3R2C J;  3FK4 A;  4NLU A;  5DDO C;  3UR0 A;  1FRH A;  4FDF A;  3QYY A;  3N6M A;  3IRX B;  4DFK A;  3MEK A;  1IKV B;  4X64 F;  5KFC A;  2GHP A;  1JQG A;  1DRZ A;  3AJD A;  3HHL A;  4DL0 C;  3GU0 A;  4AXI A;  3S6E A;  2A2D A;  5D8H B;  2FLO A;  4EK2 A;  1KLN A;  1K9M T;  1P6T A;  1NU4 A;  4CWB A;  3IRX A;  4JB8 B;  4OI1 A;  4JYA F;  2PA8 D;  3CUN A;  3EVW A;  1MMD A;  2ZC4 A;  3FMW A;  2LKZ A;  4DV0 J;  1RDR A;  2R8K A;  5A6W A;  4DPY A;  1MRO B;  3EZ5 A;  1U1M A;  2ILY A;  5A6P A;  3J81 Y;  4OX9 F;  4O23 A;  2ZKU A;  5L8R C;  3O1L A;  3A1Y G;  1Y3J A;  4CO1 A;  4O4G B;  1RTI B;  2KU7 A;  2VQF J;  4Q2L A;  4LIW A;  4A8W A;  2DR7 A;  1F9H A;  3QGI A;  1MRO A;  4DL4 A;  2ZE2 B;  1RTI A;  1QLN A;  4A8K A;  2KDO A;  2HBY B;  3J7A N;  2FJB B;  4E0D A;  3MAH A;  2GHV C;  1C0U B;  3M2V B;  2QO3 A;  3LPY A;  3RGI A;  1M5H A;  4GMK A;  2XB2 D;  2BUN A;  3A13 A;  2ZJR Q;  1C0U A;  3M2V A;  4I67 A;  2ATL A;  5ETK A;  1MSW D;  1UVI A;  3HDS A;  4DR3 F;  4WPA A;  2JZ5 A;  1OJ4 A;  2N7Y A;  2HBZ B;  1RB0 A;  3JSR A;  4UOC A;  2RAQ A;  3OFH A;  3IO1 A;  1EAR A;  2HBR B;  1FNM A;  4M94 A;  2E9R X;  3UDE A;  5D0E A;  2DVI A;  4P72 A;  5KT3 A;  3MED B;  2XS7 A;  5HAT A;  1NKE A;  1FJG J;  2H48 B;  1WG4 A;  1MN9 A;  1U8S A;  4FYW B;  1N0U A;  1U02 A;  1NND A;  3J7Z T;  2UUC F;  1RAB B;  3MED A;  3U7J A;  4USH A;  3Q0A A;  3R1H A;  2IVF B;  1FF2 A;  4C6A A;  4EO8 A;  4J9M A;  3TAP A;  3R9L A;  2ZOG A;  4PZV A;  4NLR A;  4CT8 A;  3W9H A;  1FHT A;  3TP2 A;  3HT3 A;  3FKB A;  4LBI A;  3EVM A;  1RBO B;  2HS4 A;  4BWJ A;  1HBU B;  1FKP B;  1RCO B;  4ER8 A;  2NYI A;  2CJQ A;  4OHY A;  5GAG U;  1TUW A;  5CCM A;  1KNZ A;  1IKY A;  2N4D A;  4QQB A;  4JI3 F;  1NUE A;  1HBU A;  1FKP A;  2QLW A;  4ED7 A;  3SCL E;  2KXH A;  4DUY J;  5J1E B;  5E3P A;  2GZO A;  4FZV A;  4Z7C A;  3KK3 B;  1XQI A;  2CDQ A;  5CYJ A;  3D1O A;  1KBR A;  1SXL A;  5HN0 A;  4BBY A;  2HQF A;  5J1E A;  1K0T A;  3KK3 A;  4C98 A;  2VA2 A;  2JEG A;  5DS7 A;  2C2N A;  2MQO A;  2KH9 A;  3M8Q B;  3CJ3 A;  4CIO A;  1LKZ A;  1YJW S;  4LSZ B;  1WNE A;  1RGV A;  3CCM S;  4CO5 A;  3OSP A;  3F56 A;  5H9F J;  3RBX A;  1VR6 A;  1WEZ A;  3ELH A;  2J9C A;  1OO0 B;  2IYI A;  4USI A;  5KG7 A;  4DFP A;  3QSI A;  2XZD B;  4GVB B;  1I94 J;  4AQY J;  2K1R B;  1R7I A;  3G71 S;  2R2R A;  2XGQ A;  5LXY A;  3O44 A;  1UET A;  3VGT A;  4I6Y A;  4LF2 A;  3SV4 A;  1KVI A;  1ZPW X;  4AFF A;  1FTR A;  3UW1 A;  1TEL A;  4LRF A;  5HAN A;  3W7B A;  1JB0 C;  1NXI A;  3BB5 A;  2V67 A;  4E2F B;  4B3O B;  3OXF A;  3HHK A;  3DOM B;  4FXD A;  3RB4 A;  1Y00 A;  1S57 A;  2C2O B;  1KP6 A;  5DQG A;  4DI6 A;  2W01 A;  3BO4 A;  3RAM A;  2YWK A;  4B3O A;  5HQL A;  3DOM A;  2UZA A;  5I3Q A;  3N4W A;  4NA2 A;  3WX8 A;  2I38 A;  4YB5 A;  3Q23 A;  4WCE Q;  4WYW A;  4C97 A;  3OTO J;  3GJR B;  1PJ6 A;  3H25 A;  3N9U C;  2MQM A;  4YR2 A;  3BDE A;  4Y6I A;  1FDN A;  2ROP A;  2KI2 A;  3RRH A;  1S6O A;  1RYS A;  4MMO A;  1ZZN A;  1JNZ B;  4GRS A;  2JFD A;  2HIQ A;  4C4W A;  3GCW P;  3Q8V A;  2P9E A;  1NPR A;  1HHT P;  3K5M A;  1QAY A;  2R8G A;  3A3P B;  1JLC B;  1LXN A;  2G0C A;  2DR5 A;  3HFZ B;  2VC1 A;  1RT5 B;  3N79 A;  4ED5 A;  1PKU A;  2V63 A;  1SV5 B;  4PG5 A;  3VF0 B;  3M8W A;  2MDA A;  3C3L A;  3BGU A;  1JLC A;  1HNW F;  4EU0 A;  4EBE A;  1PIL A;  3KUH A;  1VRU B;  2F65 A;  1SV5 A;  1YRT A;  2HZV A;  2QE5 A;  2FC9 A;  3DRS B;  1RT1 B;  3IS9 B;  4PPZ A;  3H59 A;  4NXN F;  1QAX A;  3H98 A;  2QT7 A;  3AD8 C;  4PXE A;  1UJ5 A;  4IUF A;  5KFM A;  1VRU A;  4NEY A;  4PCQ A;  4OZ0 A;  5CYQ B;  3DRS A;  1Y11 A;  1RT1 A;  2HHS A;  3OR2 B;  1OYD A;  4P2S A;  1P27 B;  1QUP A;  2P6S A;  5CYQ A;  4PG7 A;  3G6Y A;  2ASY A;  4WP8 A;  2AMC B;  3OR2 A;  3AT1 B;  2ZD1 B;  3QO9 B;  3UDC A;  2RS8 A;  2ZHO A;  3CNQ P;  5DZ6 A;  4UQG A;  4CDI A;  2XGP A;  4B3R J;  1KHV A;  5HQ8 A;  5KFH A;  1GT8 A;  3QO9 A;  2JH3 A;  5LMU F;  2OHD A;  1RWN B;  2YKM B;  2I6W A;  3GV8 B;  2FZK B;  1EHW A;  2FGC A;  2AGP A;  2IM0 A;  1WC0 A;  4UOG A;  3VGS A;  3JSY A;  1UZD A;  2YKM A;  2FHO B;  5CAA A;  3KLV A;  3PKY A;  1S97 A;  2FJW A;  5LL6 d;  3DXS X;  3Q8P B;  4GO5 X;  4NLY A;  5K8M A;  2PFF B;  3CDE A;  3HVR A;  3TJA A;  1HAR A;  3D66 A;  5A0Y A;  1ACM B;  4DV1 J;  4LSN B;  3FCV A;  5E2Q A;  1KSP A;  2MB0 B;  4X84 A;  1SUQ B;  3QNW B;  4RW9 B;  3G6V A;  1REG X;  2E1M C;  1GMU A;  4DV6 J;  1R0B G;  2DCL A;  2QRR A;  3T1H J;  3OR1 B;  1UEK A;  1W26 A;  4LSN A;  2JRS A;  3Q8Q B;  1SUQ A;  2IC3 B;  4RW9 A;  2D9P A;  4EI2 A;  4LF9 J;  4CNZ A;  1XR7 A;  4UY8 T;  1DFD A;  5IOL A;  2XBP A;  2W4C A;  4AL5 A;  1S6Q B;  3H90 A;  2C3Y A;  1NBE B;  7FD1 A;  3PX6 A;  3OR1 A;  4MT1 A;  4C8K A;  2FVS A;  1S7H A;  1NZA A;  4ZVS B;  4ZJL A;  4A46 A;  3SSS A;  1QD1 A;  2IC3 A;  1IBK J;  4OYI A;  3VAF A;  2LQB A;  1V5V A;  1D1U A;  2MXY A;  1D9F A;  1S6Q A;  3TWZ A;  1RT3 A;  2ZWO A;  2KTQ A;  3PR4 A;  3RB0 A;  4CLZ A;  1URR A;  1IR2 A;  4H4K C;  1G3O A;  2OLW A;  1WHV A;  4I6A A;  3AOA A;  5IWA F;  1FK9 B;  1JLA B;  3HLU A;  2KT2 A;  1WEL A;  1UAW A;  1PIE A;  5ETM A;  4UST A;  3VZI A;  3G82 B;  1AT1 B;  2ABY A;  2K7K A;  1JLA A;  4WK3 A;  2NLW A;  3AOD A;  1HLW A;  2X3G A;  5A2Q U;  2BJ8 A;  4KV8 B;  3OTC A;  5KG0 A;  3G82 A;  5ETT A;  3KOA A;  3OHB A;  1U1R A;  2QIF A;  4OZ2 A;  5EHH A;  2LA6 A;  3S8S A;  3SV3 A;  4B17 A;  2CJY B;  4HVZ A;  2IMO A;  4WKY A;  4ZVE A;  4KV8 A;  3MUT P;  4DV4 J;  2ZM6 F;  2R7T A;  3ZTS A;  3BO3 A;  4J9N A;  3DDI A;  4XO0 A;  1QUV A;  2R7O A;  4NPO A;  3AD7 C;  4WBF A;  1UCN A;  2VC0 A;  1QSS A;  2YX4 A;  2VBX A;  1X5P A;  1MML A;  1PAE X;  2HQI A;  4F3M A;  1DTQ B;  2CNO B;  4OZ5 A;  3WIV A;  4PG6 A;  2UVU A;  4LF4 F;  3R1L A;  4DMZ A;  1ZZF A;  3JTP A;  3MHY A;  2R2U A;  5AE1 A;  1SJQ A;  3GV5 B;  1RI7 A;  1LNQ A;  4JOU A;  1XEZ A;  4MKY A;  4F4Y A;  4PPD A;  1S1X B;  5FII A;  4KE5 A;  1D8Y A;  5KG4 A;  4HDH A;  2ZUG A;  3GJS B;  4I2P B;  3U1N A;  3KMQ A;  2GQQ A;  1S1X A;  1X5T A;  2I5J B;  2B56 A;  3NCR A;  2R2S A;  3NGS A;  1Q7L B;  2I8E A;  2BOA A;  2NUU G;  1TFY A;  4B3T J;  2GHW A;  1TL4 A;  5IQ6 A;  2O1P A;  2BE2 A;  3BGR A;  2I5J A;  4FXW A;  1XMO F;  3U02 A;  4OLO A;  5M2R A;  5HO4 A;  2FVC A;  2HLU A;  5K8P A;  4HH0 A;  2H65 B;  5DZ7 A;  3ILI A;  3PX4 A;  1JKH B;  1U0H B;  3DYA A;  1MU2 B;  4WP9 A;  4P9S A;  1F5B A;  2OP5 A;  5ADZ A;  1U0H A;  4O3P A;  2HFS A;  3AB2 B;  1MU2 A;  1SB6 A;  1DQ9 A;  1P1L A;  1P1T A;  4V19 J;  2CNN B;  3PRV A;  2PI5 A;  1RAE B;  3AJ2 A;  2VF3 A;  4K59 A;  2KM8 B;  1DBD A;  5HMZ A;  4EBC A;  1D0E A;  2R3V A;  2G1D A;  4DQI A;  2KHD A;  4C8Y A;  3R97 A;  3RRK A;  1KKH A;  3OQ2 A;  2HNY B;  3BPS P;  2WVB A;  1SCJ B;  3FNN A;  4Z2X A;  1N5V A;  4B3M F;  1BMQ B;  4ZP7 A;  5AT1 B;  4ATN A;  4X65 F;  4KRW A;  4Y2A A;  1NEE A;  3TQE A;  3NGK A;  5HK4 A;  2HNY A;  4M5M A;  3GCX P;  3HJF A;  3QJL A;  5AXN A;  5EUH A;  1WHX A;  3VGV A;  2H5J B;  1ZTW A;  1KTQ A;  4F26 A;  1R0C B;  4ZVH A;  4R25 A;  2DH9 A;  2X3D A;  2Q3P A;  2PC6 A;  3MPY A;  5AXK A;  4ZP6 A;  2VD3 A;  3M30 B;  1U25 A;  2WSF C;  2MZQ A;  2BW7 A;  2CG8 A;  1VHF A;  2CKW A;  2IBK A;  1DZ5 A;  2LU2 A;  4N7T A;  4M5I A;  4DR2 J;  2VQE F;  4YFU A;  5H9F K;  1FTC A;  4ES1 A;  4UF4 A;  2WOM B;  3M30 A;  4HH1 A;  2JDJ A;  1N34 F;  3WIU A;  2CYY A;  5LOQ A;  4CLS A;  1SL0 A;  3MR2 A;  3R5C A;  2DHH A;  3KHH A;  1IUJ A;  3UE2 A;  3UN3 A;  1HHS A;  1HI8 A;  4ECS A;  2EI5 A;  4TQS A;  2WOM A;  2CQH A;  1JXV A;  4ZLN A;  3CC7 S;  3RW6 A;  4B08 A;  3HX9 A;  3MDF A;  4FS2 A;  1VIO A;  4HI2 A;  4AXJ A;  3IBF B;  3I32 A;  4DX7 A;  2ALY B;  1VQM S;  1CJT B;  1VQS A;  4EO6 A;  4IFV B;  4I69 A;  1U47 A;  2GIQ A;  3MMA B;  2VDI A;  4CQ1 A;  3SDE B;  3W8P A;  2HK2 A;  4M5K A;  1AXQ A;  4DR7 J;  1U6B A;  2W2Q P;  4DV3 J;  1U0S A;  3L7O A;  3W3S A;  1NK9 A;  3U1L A;  3DDN A;  1CJT A;  4TVA B;  3N28 A;  4IFV A;  4OZN A;  2PT0 A;  4C48 A;  3MMA A;  2R7R A;  3SDE A;  2Z57 B;  3PM9 A;  3OSN A;  2QZ8 A;  2DIU A;  3MAA B;  2QJ3 A;  5EWE A;  4RNM A;  2BA9 A;  3ISZ A;  3O3L A;  5CZV A;  1HQ2 A;  4RJV A;  2B9Y A;  3RB6 A;  2LDI A;  2QL7 B;  1BC6 A;  2ZEJ A;  3MAA A;  4I0W A;  2HWI A;  1S0M A;  2ZIT A;  4ZP8 A;  3D68 A;  3EPG A;  1JNR B;  4YS2 A;  1H3D A;  2DXE A;  1ROF A;  2MKI A;  2CPI A;  1H2T Z;  2RDI A;  2Y3Y A;  4ICL B;  2ZHB A;  2OFH X;  5LMN F;  4GC7 A;  4Y2I A;  2DNM A;  3TEG A;  4R8U B;  1RHJ B;  4DDF A;  2EEY A;  1C1B B;  4GKK F;  3CVK A;  2I9S A;  1LXJ A;  1SQE A;  4ICL A;  2VKZ G;  3PO4 A;  3TZZ A;  3BQ1 A;  2F7V A;  3D28 A;  1C1B A;  2XSJ B;  3PHT A;  4J9K A;  3J81 j;  3HD1 A;  1J5E F;  4RU2 A;  4IH7 A;  5KFQ A;  2XM3 A;  3OLB A;  1NJW A;  2GGP B;  1RTJ B;  3AJ1 A;  5HVH A;  2CRL A;  1HKA A;  1VIS A;  2V9W A;  3FBB A;  4L74 A;  3EPI A;  4K8R A;  5K5M A;  2XSJ A;  3QIP B;  3DLK B;  3LAL A;  3CED A;  1HIY A;  2V68 A;  1FFS B;  3CCW A;  2KJW A;  2GGP A;  1RTJ A;  2DNY A;  2ASD A;  1S76 D;  3IR5 B;  3QID A;  3QIP A;  3DDK A;  3DLK A;  4DUT A;  5AE2 A;  2KYZ A;  5E7O B;  5HMX A;  3DMJ B;  2FHJ D;  2VDH A;  1V3Z A;  1XC9 A;  4RNO A;  1O8B A;  2B9E A;  1WJ9 A;  1VRQ C;  1S1V A;  5EX0 A;  2ZJQ Q;  3CCJ S;  1ZPV A;  3BGO P;  1EP4 B;  4OYP A;  3E01 A;  1B7F A;  1WG1 A;  1FNO A;  1WDT A;  3DMJ A;  3L9Z A;  2A18 A;  2GCF A;  4PAB A;  3DRX A;  4NOH A;  1PC5 A;  5A76 A;  1EKS A;  3OTE A;  3FMB A;  5F3Z A;  1EP4 A;  2KRB A;  1FRI A;  2JVR A;  1Y0H A;  2D69 A;  2GIF A;  3HT0 A;  2V9K A;  4QIW D;  3L7P A;  3W66 A;  1RTD A;  5CYM B;  4QU6 A;  1NRK A;  1TAU A;  4MYU A;  2D7S A;  1YI2 S;  4MJK A;  1A9N B;  3CE8 A;  3CO0 P;  1Q8L A;  4UW2 A;  1T05 B;  2HHX A;  3PV8 A;  1RAO A;  3GQC A;  3GR0 A;  2CDR B;  3QLH B;  5CYM A;  1IBL F;  3J7Y I;  2M3D A;  3ICL A;  2B9X A;  3N5F A;  1X4B A;  1Y5I B;  2F3J A;  3CD5 A;  1W7W A;  1T05 A;  3HVT B;  3CJR A;  3QLH A;  2VPX B;  3OFG A;  3BN4 A;  3V81 B;  3WBZ A;  3KK1 B;  3HVT A;  2C22 A;  2CQI A;  3VAL A;  1YZ7 A;  1WAC A;  3V81 A;  5DQI A;  1WI6 A;  4ZIV A;  1SI9 A;  3KK1 A;  2PGC A;  2EG1 A;  2DGT A;  2H1Y A;  2D74 B;  3W60 A;  1ZH5 A;  1KQF B;  1F9F A;  3C15 B;  1X4D A;  2WB4 A;  2MPU A;  3DCA A;  1WOS A;  5A8W B;  3AHP A;  5K9F A;  2L08 A;  2XYP B;  5KFZ A;  1WEX A;  3DGP B;  1TTH B;  3AB4 B;  4R0E A;  3I96 A;  3C15 A;  3V6D B;  3KLG B;  2POK A;  2W7O A;  2E1A A;  5F8I A;  5A8W A;  1VQP S;  4K4S A;  3GP9 A;  2NRE A;  2F4V F;  3S1T A;  1QY7 A;  3CUL A;  3H20 A;  3V6D A;  3KLG A;  2GX8 A;  2UUA J;  3ET6 B;  4LF7 J;  1YX2 A;  3KJF B;  4NXM F;  1I51 B;  1M90 T;  3GFX A;  4P73 A;  2HSE B;  3GR1 A;  5KT5 A;  4M63 A;  3ET6 A;  4LF8 F;  2FGO A;  4PXC A;  2JLE A;  1FXL A;  4C9D A;  8AT1 B;  3A8K A;  4DUZ J;  4DSK A;  2XMK A;  4WIQ A;  3MEG B;  1G7C B;  2ZH9 A;  1IBC B;  4DSE A;  4DR5 F;  1IVZ A;  1YBA A;  4F8R A;  1IKX B;  1AA1 B;  1WC4 A;  5CHC B;  5D4O A;  3CDA A;  2BZ2 A;  3MEG A;  4OJ1 A;  3MD3 A;  2EFO A;  1K47 A;  2HFN A;  1CS4 A;  1EIY B;  1YTY A;  5DO2 A;  1OY6 A;  1HWI A;  1IKX A;  3GON A;  2UUB F;  1S6P B;  4YR0 A;  2AGQ A;  3LGH A;  2XO6 A;  3K0J A;  3TRG A;  4FNI A;  2G0I A;  2G2Y A;  4I7F B;  1X4F A;  2EVZ A;  3GE9 A;  1ZOT A;  4L3N A;  1S6P A;  2HK3 A;  4DV5 F;  2B6A B;  3LAN A;  4I6W A;  1TK0 A;  4I7F A;  4CZC A;  2RDD A;  1HD1 A;  1HBO B;  2QL9 B;  3MMJ A;  1Q8K A;  2VA3 A;  3RAX A;  2YKN B;  2B6A A;  3RBE A;  5SUH A;  3GII A;  1NK6 A;  2YKP A;  1F3V A;  1RAC B;  4K0K J;  1TKD A;  1AFI A;  4C0B A;  1HBO A;  2UU9 F;  4X4T A;  2XO7 A;  1RWO B;  2YKN A;  2X51 A;  2RDJ A;  3NKY A;  3QPI A;  1PO6 A;  5K14 B;  4U96 A;  1TU0 B;  3DFE A;  3ZO7 A;  3MR5 A;  3T5K A;  2NCK L;  1U6Z A;  1FI4 A;  4OZL A;  1X60 A;  2J5A A;  2OGU A;  2OJ3 A;  3MCO A;  2VIC A;  4FYX B;  2Q79 A;  3R2D J;  3NL0 A;  1NME B;  3FEZ A;  1Q82 T;  3E51 A;  1SIW B;  4K2X A;  4USJ C;  2DRA A;  5DRK A;  3DLE B;  5L46 A;  2AGO A;  4WFN Q;  3GSD A;  2AX1 A;  2V2Z A;  1YLX A;  2RKI B;  3LP1 B;  2FLN A;  5GAD I;  1XBW A;  4UOF A;  2G2O A;  3DLE A;  4LQ9 A;  4LRC A;  4I56 A;  2RKI A;  2HVE A;  2HND A;  2QLX A;  4F4A A;  1SKR A;  2K2P A;  2Q6B A;  1EAY C;  2MKK A;  2OO4 A;  4WU3 A;  1NK8 A;  4KH0 B;  3TAR A;  3AOB A;  3ZZZ A;  1FDB A;  5KT7 A;  1RTH B;  3CIM A;  4C8Z A;  1X4E A;  1RT4 B;  2HFV A;  3OLA A;  2M8H A;  4FF2 A;  4FP9 A;  3OUY B;  3AQP A;  3I87 A;  1RTH A;  2ZH2 A;  1UWA A;  2VPW B;  5GAE I;  3DOL B;  2BAC A;  1KQG B;  4CLY A;  2JC0 A;  3BKU A;  4X4V A;  3BBB A;  1WSR A;  5GAD U;  4FNH A;  2IM1 A;  1TL5 A;  3PJ9 A;  4F7V A;  2J76 E;  4H4K A;  5SZT A;  1SJ4 P;  1Q81 T;  2RE1 A;  2VB6 A;  2I2Y A;  3DOL A;  2JL9 A;  2J8A A;  1I3O B;  3RU0 A;  2FTR A;  3SBM A;  1SH3 A;  2FVP A;  1F2H A;  1YWX A;  3OT9 A;  4YP3 A;  4B9U A;  3L09 A;  1RHQ B;  3V2U C;  3M05 A;  2DGV A;  1MNE A;  1Z2L A;  1CQM A;  4ES3 A;  1Y10 A;  1IBM F;  2B51 A;  5HI7 A;  2QMU B;  1BE4 A;  3FQK A;  3T9N A;  3QT7 A;  4HYK A;  4WFA Q;  4QJV A;  2WVD A;  1QSL A;  1KON A;  2Z8Q A;  1UTA A;  3U1M A;  2C2R A;  4IG3 B;  5GAE U;  1NSQ A;  1D8Z A;  4WK1 A;  4QWE A;  3WZ0 A;  3LW5 C;  1JJ4 A;  1CQN A;  1JXE A;  2Y0S D;  2IRX A;  1FCA A;  2JHE A;  1PJ7 A;  4DL7 A;  1FA0 A;  1Z1Z A;  2VFV A;  1FX2 A;  4QW9 A;  2COL A;  1I5O B;  4FPI A;  4ZVT B;  1FJE B;  3C6T B;  4URQ U;  1NJZ A;  1HNV B;  1KWM A;  3GYG A;  4P52 A;  4J37 A;  2QFI A;  1W25 A;  4A48 A;  3CC4 S;  1F5A A;  4JI1 F;  1FJC A;  3C6T A;  1HNV A;  1XNR J;  1S12 A;  3GYN A;  2P9C A;  4B9S A;  1RAH B;  4OI3 A;  2OEJ A;  2FJD B;  3EMT A;  3P8B B;  1XK8 A;  3K17 A;  4FXV A;  3B54 A;  2MLY A;  2L41 A;  2BAN B;  2MZJ A;  2ZBI A;  1KLM B;  2MQL A;  3HZE A;  1NH8 A;  4A8Q A;  1GX6 A;  1S4E A;  2CQP A;  1YSJ A;  4ERD A;  4RUA A;  1HI1 A;  1Y7P A;  4ED4 A;  1NCL A;  4KBI A;  3OTB A;  4ZLJ A;  1VDH A;  2BAN A;  2MLX A;  1KLM A;  5K8N A;  2CQD A;  4JBC A;  2LMI A;  4RBU A;  2HHP A;  2QLF B;  4RNF A;  1JLE B;  3EZU A;  4QIF A;  3T1Y J;  3CGI A;  1AW0 A;  3ILJ A;  2BDP A;  1JLE A;  1QE1 B;  3ISN C;  4OYM A;  2DGO A;  4AUK A;  1VQ8 S;  2E29 A;  4ECY A;  1VQY A;  1HWK A;  2YX1 A;  1HBM B;  1YJU A;  4ID5 A;  1S10 A;  4DBQ A;  3H8Y A;  3C66 A;  3A4T A;  3OJU A;  9RUB A;  5JUM A;  1QE1 A;  5HQM A;  1H2U X;  3D6F B;  4EZ9 A;  2V6A A;  1T7P A;  1HBM A;  2OMO A;  4C11 B;  5KFW A;  1UEV A;  2VOD A;  2APO A;  2B5J B;  1OQ3 A;  4ZA1 A;  4KO0 B;  3S7R A;  2GC8 A;  3BQ0 A;  1H38 A;  2GJI A;  4X4P A;  4DPT A;  3UWT A;  1T11 A;  2HKE A;  5B0A A;  4ED2 A;  4O0N A;  1N6Q B;  2B5J A;  3PW2 A;  4KO0 A;  2RHS B;  4PWU A;  1VBX A;  2IJN A;  4AD6 A;  2FJX A;  2WBR A;  3SI8 A;  1H72 C;  4QU7 A;  1N6Q A;  1YGY A;  3ILO A;  2W2N P;  2MHE A;  4K5R A;  2HIY A;  1WHY A;  8RUC A;  3BR8 A;  3EGW B;  4OHW A;  3UVJ B;  1U24 A;  4K4W A;  4DPW A;  2QLB B;  3CCQ S;  3QRP A;  3RAQ A;  3DLJ A;  2VHG A;  4TN2 A;  1TKX B;  2XCP A;  3UVJ A;  5AXL A;  2MHN A;  2QGF B;  3H4D A;  2C2D A;  5IT0 A;  2FZC B;  2YNG B;  2AV5 A;  2OD4 A;  2NZ4 A;  2R42 A;  4IG0 B;  2YQ1 A;  1TKX A;  2EK6 A;  3T5L A;  3MTK A;  2ZHA A;  4P2M A;  1HD0 A;  2J9E A;  5B0B A;  4OYZ A;  4F50 A;  2YNG A;  1WF0 A;  2PN6 A;  3THP A;  3ETM A;  4DCJ B;  4IOA Q;  4J9U E;  4YB7 A;  4USV A;  3JSM B;  1RAD B;  3G96 A;  5CZX A;  2F63 A;  5M2U A;  2QTW A;  2RRA A;  2UXD J;  4GKJ F;  1LWX A;  4LFC J;  4DR1 J;  2UXB J;  3TJ9 A;  3BZQ A;  3IFE A;  3JSM A;  4NZ7 A;  1R3N A;  4WXO A;  5JJB A;  4LR8 A;  3SXL A;  2W2P P;  2FZG B;  4O3N A;  2PFD A;  3K5L A;  1EX8 A;  2DNP A;  4OIX A;  3P4U B;  2UXC J;  4RW7 B;  4J9V A;  4CLK A;  4KGX B;  4K7Q A;  3PR5 B;  4JV5 J;  4YHH J;  5FLX U;  4D3G A;  5FDL B;  3MOZ A;  1R6Y A;  5KFG A;  3F41 A;  4CLW A;  1QSY A;  4K4T A;  1KS2 A;  1YJ7 A;  3P96 A;  4NX9 A;  4RW7 A;  2BYC A;  3QAT A;  1N32 F;  2V4R A;  4FF3 A;  5E5N A;  5FDL A;  5AJ3 J;  3PKM A;  3DLH A;  3ENQ A;  3UCU P;  2M4M A;  4EYI B;  4F04 B;  3J80 U;  3KMS A;  2YWG A;  2XSF A;  4ZPW R;  2G13 A;  4GC6 A;  4PR6 A;  4PKD B;  4YOE A;  1S48 A;  3CD0 A;  3G6E S;  5JVG Q;  3HSZ A;  2ZDO A;  2CNL B;  2OIH A;  4F02 A;  4ECW A;  2J9D E;  5C7P A;  5KTQ A;  3LO3 A;  3HF5 A;  3PIP Q;  4L3K A;  4F4Z A;  2A6M A;  3VQS A;  2KKH A;  4Q8F A;  5F8H A;  4TLQ A;  4Y65 A;  2AD9 A;  1Q0N A;  2DB1 A;  4PAA A;  5D0G A;  1N5Y B;  3PJX A;  4OJH A;  3EGN A;  4JYA J;  3BN7 A;  2JJ4 D;  3CDU A;  3KG4 A;  3E2E A;  4NCG B;  2DHS A;  2CQ4 A;  1MMN A;  2JWN A;  3NMR A;  3ZZP A;  2BR0 A;  4OX9 J;  1U6F A;  5JMN A;  4IO9 Q;  2W8L A;  1N5Y A;  2D3O 1;  5A8K A;  3VAI A;  2Q66 A;  2B7B B;  2ALZ A;  3QSY B;  4NCG A;  4G3I A;  4E8U A;  2O3D A;  4Z37 A;  3UD5 A;  3CJT A;  1NDK A;  2JNJ A;  2DPJ A;  4DHV A;  1B0V A;  1UEU A;  2VZ9 A;  2V8G A;  1FRX A;  4RW6 B;  5D77 A;  2MQQ A;  1M5S A;  5L39 A;  2FJV A;  1ZAV A;  3EXC X;  2V4Q A;  4JI6 F;  3V4I B;  4Y0F A;  1X8D A;  2NYH A;  4DPO A;  2L9N A;  4J9O A;  4RUH A;  1N52 B;  2HVI A;  4RW6 A;  4RZR A;  3I0S B;  1RT6 B;  4OYW A;  4PG8 A;  1XIQ A;  2XTJ P;  2IIH A;  3V4I A;  2GJ2 A;  3D67 A;  4DR3 J;  2G2Z A;  3GTY X;  4ZPC A;  4O0I A;  2ZWP A;  1RT6 A;  3D1H A;  3ZTR A;  2HS3 A;  2HGN A;  3GSI A;  4PEO A;  1YJR A;  2R8I A;  1B4S A;  1DLO A;  4MIW A;  1K1Q A;  3MD1 A;  4CO4 A;  1RK8 A;  2XMM A;  3G8S A;  4JUZ A;  2B0G A;  3DRY A;  4WKR A;  2WVF A;  1WF1 A;  1J5O A;  4NLQ A;  2XNQ A;  3QWU A;  3HHD A;  1JLQ B;  4DLE A;  2HQD A;  4N47 A;  2UUC J;  3ONQ A;  2QA4 S;  4DU8 A;  2RQK A;  2LYV A;  3N6N A;  2IRU A;  1LWC B;  4F4X A;  3OVS A;  3DNC A;  1M1G A;  4CRJ A;  1H0H B;  5GAH U;  4USW A;  5HBM B;  2WVC A;  2DNG A;  5IFM A;  3G86 A;  4ECZ A;  2PO4 A;  3FSX A;  3NS5 A;  3I0R B;  1LWC A;  5KFJ A;  4ILR A;  4C8O A;  2YWE A;  2HGL A;  2J6S A;  4N41 A;  5D4N A;  1HW8 A;  2FHK A;  4JI3 J;  2J6U A;  3BH7 B;  1R27 B;  2MKH A;  4NLT A;  2FIU A;  2GVD B;  3J81 U;  1R8P A;  2HZC A;  1GMW D;  4FF1 A;  3ZXW A;  3A3N B;  2D9O A;  3BYP A;  3GZ7 A;  5LXR A;  2Y8W A;  3SEO A;  4Q7A A;  2GVD A;  3KUG A;  4LF6 F;  2LU1 A;  2BV3 A;  1T03 B;  3IG1 B;  2OPP B;  3MAQ A;  3N0V A;  2O5D A;  3MMC B;  3V6J A;  1S1T B;  1Q53 A;  4QOT A;  3I56 S;  3EIC A;  3MUV P;  3C6U B;  1U45 A;  2HHU A;  5ETR A;  1EZZ B;  2FYX A;  2C42 A;  2DYA A;  2GW8 A;  4U95 A;  3CCU S;  3KXD A;  2AT1 B;  4NLS A;  2C2M B;  1T03 A;  3IG1 A;  3UNG C;  2BKN A;  3MMC A;  3HI9 A;  1ZAX A;  4DV2 F;  1S1T A;  3C6U A;  1UVL A;  4IKA A;  2IJF A;  2CQ2 A;  2JVO A;  4ZS6 A;  3MM6 B;  3FUY A;  5BR8 F;  5KFE A;  4H4O B;  2RQ4 A;  4F36 A;  4J91 A;  1D9D A;  2IMW P;  4LBH A;  4LFB F;  1FRM A;  4G1Q A;  1TQL A;  3ZNJ 1;  3EXY A;  3VZH A;  5DGA A;  2UVW A;  1GH8 A;  4RL1 A;  3GIM A;  3CCL S;  1F60 B;  1VJQ A;  4OI6 A;  3BSA A;  3DKD A;  2PMZ D;  2Y0B B;  2GVZ B;  2VFS A;  3UQS A;  3L3C A;  4JI8 F;  2KZZ A;  2Y8Y A;  1DTT A;  5L9N A;  2AIR B;  2W25 A;  2DGU A;  2UP1 A;  3MEE B;  2M2B A;  3G4S S;  2Y1L B;  3UR3 C;  3ZTO A;  2GVZ A;  3JB9 k;  2WZ1 A;  2CPD A;  4DZD A;  2BRK A;  2ZJP Q;  4HAC B;  1T9W A;  2KB2 A;  2XMJ A;  4ZMM A;  2HHH F;  4JI7 F;  3MEE A;  1RLD A;  1BHN A;  1LW0 B;  3TA1 A;  3NG8 A;  2IFX A;  3KG1 A;  1RA6 A;  4HR2 A;  2MTL A;  3GIL A;  1GFW B;  5KT6 A;  3FEY B;  4HAC A;  4MIA A;  1U49 A;  3FZ2 A;  3BGL A;  4TKT A;  4PQA A;  1Q7Y T;  1SKW A;  1IN0 A;  1LW0 A;  2LDY A;  1FKO B;  2VPY B;  3H5S A;  3SIP B;  4V19 X;  3GB0 A;  4F25 A;  1DY3 A;  4CYU B;  1RHM B;  4KGK A;  4A8X A;  1FKO A;  3UD4 P;  3LWL A;  1HNW J;  1KVK A;  1TMJ A;  2IA0 A;  1CUL B;  1RXO B;  5CD4 H;  3G9C A;  3I31 A;  2V2V A;  4UZC A;  3P6Y C;  2VIH A;  1SH0 A;  2E44 A;  2DY1 A;  2VJV A;  2EXU A;  1HMV A;  3NAI A;  4NXN J;  1YJN S;  5ETV A;  4R5P B;  1RQ0 A;  3TI0 A;  1SL1 A;  3NXZ A;  2YNH B;  4PG4 A;  3LPE A;  1CUL A;  3KK2 B;  3HHL B;  2EW9 A;  3JQJ A;  1BWV A;  4LRA A;  4C8L A;  3GIR A;  3MXH P;  2Z2Y B;  1RWP B;  2K3I A;  4R5P A;  1VS3 A;  3OXL A;  1QVG R;  1Y5L B;  2YNH A;  2EFP A;  4QIG A;  5CA5 A;  3CJ0 A;  3M6U A;  3KK2 A;  5L1I A;  2M8D B;  1C2P A;  1FEE A;  4D3H A;  3OL9 A;  4KHP F;  2KO1 A;  2KT3 A;  4QWD A;  1UKU A;  2RD5 C;  1Y5N B;  1BGX T;  1G2E A;  3G6X A;  3NNA A;  2BAB A;  1V3S A;  4DCP B;  1LWE B;  3I4P A;  4XDD A;  3PYE A;  2XYG B;  4PWW A;  3W63 A;  3MF5 A;  3D9B A;  3H2L A;  4DV7 F;  4DOZ A;  2XS5 A;  5LMU J;  2VPZ B;  1SBR A;  3D54 A;  1LWE A;  3W5X A;  1FDD A;  3FGV A;  3Q8Y A;  3VR1 A;  4PYD A;  2HGM A;  4C3M A;  3W8G A;  4O3R A;  2F8E X;  3C46 A;  4FS1 A;  2EKY A;  3GLJ A;  5KFB A;  1QTM A;  4IO1 A;  4CCH A;  5CH7 B;  4CO3 A;  1PCA A;  3KNG A;  2J6T A;  3PW7 A;  3PXG a;  1N36 F;  4NML A;  2KRR A;  4JP8 A;  2WBM A;  3M2R A;  4FYV B;  3BJY A;  4IH5 A;  2P9G A;  3LGM A;  5BYR A;  4DN0 A;  3L7U A;  1B0T A;  1IQZ A;  3DU6 A;  5IS2 A;  3EX7 B;  2Q1L A;  3KLH B;  4WZM A;  2R9L A;  5GAG I;  1RHR B;  4C8N A;  3OL8 A;  1NJX A;  3KNA A;  1APS A;  2HBQ B;  3MZI A;  3IGV A;  3KLH A;  4ETX A;  4P6Q A;  4MKV A;  4WXW A;  1TUV A;  5KFK A;  1T8E A;  4ZCI A;  3BF4 A;  4DQQ A;  2JC1 A;  2BW2 A;  1WOO A;  4O3S A;  3LAK A;  1U7L A;  5IWA J;  1WI8 A;  4NEZ A;  4P2X A;  4LFA F;  4JV0 A;  3LUY A;  4AT1 B;  2YWF A;  1IKY B;  4MK9 A;  4DQP A;  3H40 A;  4UUX A;  2XMW A;  2H51 B;  1U2C A;  5D78 A;  1ARO P;  2CWX A;  1RU2 A;  4L72 B;  2W9B B;  1N0V C;  3QZ7 A;  2F9J A;  3CXC R;  4N8O A;  3DGV A;  4TU8 A;  4UZB A;  2R7W A;  1BD6 A;  4M8L A;  2K3K A;  3KJQ B;  3NNC A;  2JLF A;  4HLB A;  3AXM A;  4YQW A;  4LR9 A;  2K7J A;  2W9B A;  3T6J A;  4CLL A;  4YN3 B;  3NGT A;  4HL9 A;  2ZM6 J;  1JJ2 R;  1S1U B;  3QMQ A;  1MG7 A;  1T95 A;  3O8W A;  2HEK A;  1R43 A;  4EWT A;  1T0T V;  3MPD A;  1VQ4 S;  3FBF A;  1OPZ A;  3VAG A;  2A10 A;  1KTV A;  3HVA A;  2RHQ B;  4DS4 A;  1LK7 A;  3NY0 A;  1S1U A;  1RE1 B;  4OHZ A;  3MUM P;  3DN9 A;  4CH0 S;  2ROG A;  1MWY A;  1N33 F;  2XMA A;  2ZC3 A;  2XYH B;  2DRB A;  2VOO A;  4LF4 J;  2O01 C;  4ZPD A;  2C3M A;  2Y1J A;  2NXU A;  1Z2Z A;  3A8J A;  4EMD A;  1FJ7 A;  2XC9 A;  2E5L F;  2MKC A;  5C5J A;  4M5J A;  3P49 B;  5D0R A;  2P6T A;  1NB2 A;  2M5Y A;  4IDK B;  5GMD A;  4F0M A;  4P71 A;  2HRU A;  4NLO A;  1S72 S;  3PW0 A;  2GQ2 A;  1U8W A;  3ILL A;  1NK5 A;  3LF0 A;  1RA7 A;  3DHW C;  2UUW A;  3HD2 A;  4IDK A;  3SSQ A;  1SJR A;  5E33 A;  2HQC A;  4ED1 A;  4WWS A;  3N01 A;  4TQR A;  2D3U A;  4OFZ A;  2QA1 A;  1Q8I A;  3LQV A;  4IR9 A;  3FRZ A;  4Y2M A;  2QL5 B;  3FRY A;  3KJV B;  3R5D A;  4NZ6 A;  4LF5 F;  2Z4P A;  3OW2 R;  3I9Z A;  3KG0 A;  1XMO J;  4UTG A;  3TJ8 A;  1W2B R;  1ELO A;  1UWB B;  3HFK A;  1SJF A;  4F2S A;  3C16 B;  5KG3 A;  4ZKA A;  2M52 A;  3KJV A;  1KDN A;  2E1C A;  4N76 A;  5J2Q B;  2DH8 A;  3TYT A;  1UJ6 A;  4FKY A;  3SQO P;  3ULH A;  4S0M A;  3M2U B;  1UWB A;  2BQU A;  3IXQ A;  3C16 A;  1ITP A;  2XI2 A;  1V5I B;  2VUG A;  1DAR A;  1C4C A;  3RG6 A;  5J2Q A;  2H9Z A;  2HNZ A;  3PDN A;  3M2U A;  4C0H A;  3CCS S;  3IWL A;  1NDC A;  2CPH A;  2OPR A;  3R7N B;  3NP5 A;  2V50 A;  2RNE A;  3CF5 Q;  4IOC Q;  2EPI A;  2EK1 A;  2BKP A;  1RP5 A;  5F9N A;  1UL3 A;  1PBA A;  4GVL A;  5IT9 Y;  3MCN A;  3KHG A;  4B3M J;  1SJ3 P;  4X65 J;  4W90 B;  1UFL A;  2VBW A;  2BJ3 A;  4HDG A;  1DQ8 A;  1X4H A;  1HR0 F;  2FHJ A;  3CJQ A;  4KAI A;  1TL3 B;  2CJA A;  5IZH A;  2KFZ A;  3H5U A;  2AP6 A;  1HW9 A;  2MYF A;  1OQ6 A;  4DL6 A;  4NLP A;  3DC2 A;  2DO0 A;  3K5N A;  5CCL A;  1RAJ A;  5KFO A;  1TL3 A;  2CQC A;  3IGN A;  3D7S B;  3HJV A;  2XEX A;  1HYS A;  2KG1 A;  1IR0 A;  2V4J B;  2VQE J;  1VMB A;  5AXM A;  4U8Y A;  4IH6 A;  1UMJ A;  1N34 J;  4RX6 A;  3ITH B;  2CPX A;  1QAJ A;  2V4J A;  4Q2M A;  3SMZ A;  1PSD A;  2AWZ A;  4RW8 A;  4U7C A;  1PJ5 A;  3I5B A;  3ITH A;  3RBD A;  2C2Z B;  3CCZ A;  1C4A A;  1RWV B;  3CJ8 A;  1FRJ A;  1CEZ A;  1S9F A;  1FRL A;  1RHU B;  5A0Y B;  2JFK A;  4KH1 B;  3NS7 B;  3AY0 A;  1TMM A;  5LT5 A;  2EC2 A;  1JLF B;  2H5E A;  2YQ0 A;  4NYZ A;  1K44 A;  1DAX A;  2H3E B;  3E3X A;  2GNK A;  1WKJ A;  3B78 A;  1FVQ A;  4W98 A;  1VBY A;  1JLF A;  2HHT A;  1SJ1 A;  5T14 A;  2JEJ A;  3BSN A;  5LJ3 Y;  1R8B A;  1XMQ F;  5JXS A;  2FHM A;  3HUL A;  3QT5 A;  4OYB A;  2YKA A;  3ETO A;  3JS9 A;  1CSJ A;  4JI2 F;  3AA8 A;  3O6Q A;  1RT3 B;  1NHV A;  1S4F A;  4L73 A;  2ROE A;  3HPO A;  1FE4 A;  2J8S A;  5LSO A;  1VOM A;  5LMN J;  5J1N A;  3CW2 C;  1FO1 A;  4GKK J;  3DI6 B;  1OS5 A;  2KVQ E;  3OVA A;  1TKT B;  2BX6 A;  5ETS A;  3DLB A;  4B9V A;  1UPM B;  4DZ6 A;  3DI6 A;  1TKT A;  2CPE A;  4ZVU B;  1J5E J;  1V9O A;  4M5H A;  4ELT A;  3R5A A;  4ANC A;  2VU5 A;  5L38 A;  2YNI B;  3BBC A;  2CVE A;  2C3P A;  4N8N A;  4QWA A;  5HSP A;  2RJZ A;  1R31 A;  4DL5 A;  1VBZ A;  4JI5 F;  2BJ7 A;  2FC8 A;  3I55 S;  1CG2 A;  2YNI A;  4O3O A;  3HM9 A;  4XPC A;  3T6B A;  4KTQ A;  5D4P A;  3AH6 A;  4NYP A;  5C2C A;  3D6T B;  2LA4 A;  1N5S A;  2VG5 A;  2MZS A;  2XUL A;  4WFZ A;  2OFG X;  1V3R A;  4P7V A;  2MY8 A;  2AU0 A;  4ITS A;  2GV1 A;  4YY3 F;  2NUH A;  3FSI A;  2CPF A;  1UVM A;  1B7Y B;  1P9Y A;  5HJX A;  2V0N A;  1LV5 A;  3QGG A;  2B4O A;  4KFB B;  3MEC B;  4WTO B;  3EZO A;  3W61 A;  4ZPT R;  3R7S B;  3RBZ A;  4JI4 F;  1SKS A;  4KFB A;  2RS2 A;  3GWC A;  2K06 A;  4URG A;  1UVJ A;  3MEC A;  3QBC A;  3PX0 A;  4ZJO A;  2R7X A;  3ZNU A;  2W8K A;  2J0S D;  2DR9 A;  1IBL J;  3N5B A;  3M8S A;  3K58 A;  3MM7 B;  4CP5 A;  1MWZ A;  3H7H B;  1VRT B;  4C3K A;  2W7A A;  2BE2 B;  3BGR B;  3GIK A;  3MM7 A;  2OEL A;  1WC1 A;  3IR6 B;  1AUD A;  2W7P A;  4AL7 A;  4DF4 A;  3FFI B;  4ZPA A;  1VRT A;  2FB0 A;  5L1L A;  5CXT A;  1Z4U A;  4NE9 C;  1QDU B;  2ILZ A;  3CCT A;  5D4L A;  3EUN A;  4B9M A;  4TXS A;  3W5Y A;  2ZOF A;  4TY8 A;  3DYA B;  2IDL A;  1Q1K A;  1OY9 A;  5C25 B;  3FFI A;  2N4C A;  5D6G A;  2V2K A;  4WII A;  4RUC A;  2AJF E;  2NXC A;  4DWI A;  1VCT A;  2B4P A;  2W24 A;  2OUG A;  1X9S A;  1EB0 A;  1T9U A;  5G0R B;  5C25 A;  5KFF A;  2W9A A;  2LFV A;  2EWH A;  2F4V J;  3O5T B;  2XS2 A;  2YTC A;  4A47 A;  1CC8 A;  2QA2 A;  1P9Q C;  1UVK A;  5G0R A;  2ZH7 A;  4NYO A;  3J7A 1;  2IM3 A;  4NXM J;  3W9J A;  4J9Q A;  1HNZ F;  3LA0 A;  3RZA A;  1GEH A;  1HQE B;  5DLG A;  2NR0 A;  4NLD A;  4NA1 A;  2BJD A;  2UUT A;  3CDW A;  2BQR A;  2RQC A;  4LF8 J;  2OD6 A;  1VK8 A;  2CAD A;  1S5Z A;  4U6P A;  2CJB A;  3W2V B;  5DJB A;  1HQE A;  1S79 A;  2HQG A;  2H54 B;  1KVJ A;  4KPC A;  2GA7 A;  1M5K C;  3MPU B;  3H4B A;  3HK2 A;  1FEH A;  4CLF A;  3W2V A;  5GMK a;  3UN2 A;  2E5H A;  4DR5 J;  4CH1 A;  4ZN3 A;  3JAM Y;  1FKA F;  2HFO A;  1IM4 A;  4CLP A;  4J7C A;  5KFI A;  3D0H E;  1SVD A;  1RAG B;  2W2O P;  3AOC A;  3NOC A;  3Q2S C;  5FJ4 A;  1MWQ A;  2AYE A;  5C24 B;  3VCD A;  2DCU B;  2UUB J;  1WC6 A;  1SIZ A;  4DR6 J;  4ILM A;  1T9X A;  5KFS A;  1YKW A;  2HW3 A;  3TW0 A;  5IT4 A;  5DG7 A;  2F9D A;  4FVC A;  4MIB A;  1OPI A;  5ETO A;  5L1J A;  5C24 A;  1EQ0 A;  1W2I A;  4DV5 J;  3K7R A;  3P5T L;  4UUW A;  3NWR A;  2DGX A;  3NCQ A;  1UA1 A;  1QAI A;  4DR4 F;  4KB7 A;  3HKZ D;  4USK A;  2DIT A;  2RF2 B;  4MH8 A;  2VKR A;  3W2W B;  3PVX A;  1ZM2 A;  1F9E B;  1RWM B;  4FKX A;  2QEX S;  2J0X A;  2UU9 J;  5FD1 A;  1UJ4 A;  3HSD A;  1RT2 B;  1YRX A;  2RF2 A;  3Q8S B;  1DUR A;  3W2W A;  4N5S A;  4OX8 A;  3RRG A;  4QPT A;  4DQR A;  5L1K A;  5L9X A;  3EGV A;  1EKR A;  1HFE L;  1JMT A;  4LVO P;  4ED6 A;  4B9L A;  4QWC A;  4K4Z A;  1IKV A;  2LLZ A;  3KYL A;  4F0K A;  1RT2 A;  1XTZ A;  3DHX A;  2QC3 A;  4K5S A;  2UV8 A;  2GAG C;  3FCW A;  1TK8 A;  2WK4 A;  3MMB B;  1U26 A;  2D3Z A;  2IBO A;  2OSQ A;  2SXL A;  1YJV A;  2R7S A;  4UOH A;  5B7W A;  3K8W A;  1NM2 A;  4F3O A;  1GTE A;  1FE0 A;  3I9V 9;  2WSC C;  1E6V B;  2V34 A;  3A12 A;  3VAJ A;  1KD1 T;  2YX7 A;  3MMB A;  1H2V Z;  3D5M A;  2EBE A;  4C0O C;  3Q8U A;  4O4G A;  5KG5 A;  2XMU A;  5LSR A;  4AL6 A;  1FX4 A;  4NI2 B;  4LT6 A;  4LRE A;  1LQ9 A;  2CQ3 A;  1E6V A;  3PO5 A;  2PI4 A;  2ZE2 A;  3R3T A;  4CO0 A;  5KG1 A;  4DCO B;  3GPA A;  3QJP A;  1C1C B;  4NI2 A;  1J2V A;  1FER A;  4ZDN A;  2UV8 G;  3C2P A;  3NGR A;  1R0A B;  4X62 F;  3QZ8 A;  4MKB A;  1HQU B;  1NJY A;  2J7W A;  2CJK A;  1Q5Y A;  2Z56 B;  1WOP A;  2F1F A;  4PWD B;  5H9E J;  1AZS B;  2LQJ A;  2V5H G;  1C1C A;  2HS0 A;  3EYZ A;  3MFI A;  1Y3K A;  1KOH A;  2Z0G A;  3VAM A;  1OIA A;  1R0A A;  5GME A;  1HQU A;  2YVS A;  4KGV B;  5DLF A;  4PWD A;  1AZS A;  1X0P A;  4ZVQ B;  3B4M A;  3CJ2 A;  3TR5 A;  4B3S F;  4ELV A;  1WKL A;  4KGM A;  1CC7 A;  3TUJ C;  1Q86 T;  4TYA A;  2ZFH A;  1S1V B;  1XER A;  3TZX A;  1GXT A;  1O0P A;  4JI0 F;  2KZM A;  3W64 A;  2ZDP A;  3E01 B;  2PEB A;  1XNQ F;  3HXM A;  4JV1 A;  3RTV A;  4WJB A;  2AHO B;  1H74 A;  2CQ1 A;  3FVY A;  1QTN B;  2RSQ A;  2X1F A;  3H5X A;  3CTR A;  2V2Q A;  3NGU A;  3NMA A;  3GFH A;  2RML A;  2F40 A;  3T41 A;  4ZLP A;  4LRD A;  8ATC B;  1TP7 A;  2DIS A;  3TX8 A;  2QSW A;  3CJ4 A;  3SFG A;  2F8H A;  1HNX F;  2K8G A;  2MKS A;  1RTD B;  1LEO A;  2M7S A;  3CCR S;  3HKW A;  3FZB A;  3OL7 A;  4CM0 A;  2EFG A;  4IRC A;  1IBM J;  4OX7 A;  3F73 A;  2ZVI A;  3EWG A;  2W1B A;  2D1C A;  2DO4 A;  4K4Y A;  1PYO B;  3KHL A;  4RU9 A;  4ENO A;  4OZJ A;  5F0U A;  1G4C A;  5KG6 A;  4P74 A;  2DKO B;  4X66 F;  2AYG A;  3GIJ A;  2L48 A;  2DHG A;  3T5J A;  4Q43 A;  3HP6 A;  4LMZ A;  3IAM 9;  2BQ3 A;  2DY9 A;  4X4O A;  3RR7 A;  4QR1 A;  3LWM A;  4WFY A;  4ZP9 A;  4ZLL A;  1VC6 A;  3Q8R B;  1BQX A;  3TEH B;  2CQ0 A;  2WW4 A;  2ZH3 A;  1VIX A;  2ZBP A;  4LVN P;  2D41 A;  5F9L A;  2YWW A;  4JI1 J;  4ZCK A;  2FLL A;  1X4C A;  2KXF A;  4CO2 A;  4K4U A;  3MR7 A;  2CNK B;  3PYG A;  3M9O B;  4URS A;  3M8Q A;  3IM9 A;  4HHJ A;  1VHI A;  2AQ4 A;  4NRU A;  2VBY A;  2A6O A;  4PUO B;  2XZT B;  5B08 A;  5K8O A;  4ZVO B;  4CT9 A;  2MKY A;  2HYI B;  4PUO A;  4MFB B;  2U1A A;  1WTF A;  1RWU A;  4GVB A;  2K1R A;  3GJT B;  3PYD A;  4OX6 A;  2Z30 B;  4QYZ J;  3EJM A;  4Y00 A;  5LJ5 Y;  3TAQ A;  2NZC A;  3I5A A;  1NH7 A;  3PRB A;  2XNR A;  3TOQ A;  4MFB A;  3B6B A;  2EC0 A;  2OSR A;  5E3Q A;  3UCG A;  4DX5 A;  4Q44 A;  5EDW A;  2AYM A;  2KL8 A;  5EWF A;  1NAQ A;  3IA0 A;  2CWK A;  2IAJ B;  3V5R A;  2DGS A;  3F0N A;  1NK7 A;  1E6Y B;  1A7G E;  3TAM B; 
#chains in the Genus database with same CATH homology
 3PRV A;  1NSK L;  3Q8V A;  3VVT A;  1S5Z A;  2DXE A;  3ZTR A;  2DXD A;  3GPA A;  4EK2 A;  3EVO A;  3NGT A;  1NUE A;  4UOF A;  5IOL A;  3VVU A;  4FKX A;  4KPC A;  3VGT A;  1LEO A;  3NGR A;  1S59 A;  1PKU A;  1B4S A;  3EVW A;  1NPK A;  2BX6 A;  3MPD A;  3FBF A;  1JXV A;  1MN7 A;  1NSP A;  1XQI A;  3Q8Y A;  3DKD A;  2HVE A;  3ZTS A;  3DDI A;  1F6T A;  4AND A;  1WKK A;  4DZ6 A;  4F4A A;  3NGS A;  1S57 A;  3EMT A;  1EHW A;  3EM1 A;  3FBE A;  3Q86 A;  3G2X A;  4ENO A;  1NHK L;  4DI6 A;  3EE3 A;  1BUX A;  3B54 A;  1NDK A;  4WBF A;  1UCN A;  2B8Q A;  1VYA A;  3Q89 A;  3EIC A;  1HHQ A;  1BE4 A;  4UOG A;  3ZTO A;  3VGS A;  1PAE X;  2VU5 A;  4ANC A;  2DYA A;  1MN9 A;  3EJM A;  3FCW A;  5CAA A;  5BXI A;  2ZUA A;  1K44 A;  2AZ3 A;  3BBC A;  1KDN A;  1WKL A;  3ETM A;  3FBC A;  2AZ1 A;  3VGV A;  4ANE A;  2DXF A;  2HUR A;  1WKJ A;  2DY9 A;  1NCL A;  1B99 A;  3BBF A;  4UOH A;  1NSQ A;  4W98 A;  4FKY A;  3FBB A;  3ENA A;  4O0N A;  4S0M A;  3BH6 B;  3WX8 A;  4C6A A;  3B6B A;  1BHN A;  3R9L A;  2NCK L;  1NLK L;  3GP9 A;  1LWX A;  1NDL A;  4HR2 A;  1HIY A;  1ZS6 A;  1NB2 A;  3L7U A;  3FCV A;  1F3F A;  3Q83 A;  3ZTQ A;  2HVD A;  3FKB A;  3Q8U A;  2B8P A;  5CAB A;  5C7P A;  1HLW A;  2CWK A;  3EVM A;  1NDP A;  2BEF A;  1XIQ A;  3ELH A;  3JS9 A;  3VGU A;  4F36 A;  4CP5 A;  1U8W A;  3BBB A;  3FC9 A;  3NGU A;  1NDC A;  3PJ9 A;  4DUT A;  1W7W A;  3BH7 B;  3ZTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...