3G2XA

Structure of mimivirus ndk +kpn - n62l double mutant complexed with dtdp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
132
structure length
132
Chain Sequence
QRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNTNPLASAPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
total genus 40
structure length 132
sequence length 132
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2009-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3g2xA00
1XQIA 3ZTRA 3FBFA 1NHKL 1B4SA 1VYAA 3VGVA 3BBFA 4DZ6A 3VVTA 3ZTOA 3DDIA 3JS9A 1K44A 1F3FA 3PRVA 1BUXA 1F6TA 3FBBA 2BEFA 1NB2A 1WKLA 3BH7B 1NUEA 3EMTA 3ETMA 4F4AA 3VGTA 1XIQA 3VVUA 3FCVA 3ZTPA 2HURA 4EK2A 4FKYA 3Q8VA 3EVMA 3PJ9A 1NLKL 2DXFA 4DUTA 2CWKA 4UOGA 1S57A 3ZTSA 3EE3A 3WX8A 1NDKA 3FKBA 3ZTQA 1MN9A 1BE4A 3EICA 3VGUA 4ENOA 3Q89A 3NGUA 1HIYA 2AZ1A 2HVEA 2DY9A 1PAEX 1U8WA 3L7UA 3NGRA 5C7PA 4S0MA 5IOLA 4UOHA 4CP5A 5BXIA 4HR2A 3BBBA 1NDCA 1WKJA 3GPAA 2BX6A 4C6AA 3GP9A 3B54A 3EVWA 3R9LA 2DYAA 3ELHA 1NDPA 4W98A 3NGSA 3Q83A 2NCKL 4F36A 1KDNA 3FCWA 3EVOA 3G2XA 3Q86A 3VGSA 1HHQA 2ZUAA 3BBCA 3MPDA 1B99A 2HVDA 3Q8UA 3EM1A 2DXEA 2B8QA 1LEOA 3FBEA 1NSQA 3BH6B 4ANCA 1ZS6A 3NGTA 1MN7A 2AZ3A 4ANEA 1NDLA 2VU5A 1BHNA 2DXDA 3EJMA 1W7WA 1PKUA 4DI6A 4WBFA 2B8PA 1WKKA 5CABA 1S59A 1HLWA 1EHWA 3FC9A 1JXVA 4UOFA 4ANDA 1NSKL 1S5ZA 1NCLA 4FKXA 4KPCA 5CAAA 1UCNA 3FBCA 1NSPA 3Q8YA 3B6BA 3ENAA 1LWXA 3DKDA 1NPKA 4O0NA
chains in the Genus database with same CATH superfamily
1J27A 1RWXB 1Q79A 4PWWA 1EKRA 4MKYA 3W2WB 4RUAA 2GCFA 3PW2A 5A6WA 3QAEA 2F8MA 4PG6A 1C1BA 4CH1A 5F0WA 1T03A 1XMBA 2P6SA 1JLAB 2GMJA 3AXKA 4C8KA 4AL5A 1RTZA 2W8KA 3BN7A 2UUWA 2IVFB 4CCHA 3VTIA 2KVQE 3MD1A 1F5AA 1OWXA 4LJMA 2XLKA 2F4VF 3RJMB 4CLFA 3GP9A 5ETOA 2ZHOA 2ASDA 4QPXA 4NCAA 1FWKA 2AHOB 2HFOA 1HHQA 2HFSA 4ED1A 2WW4A 2EFOA 3JQKA 5I3UA 4P71A 3GCWP 3BH6B 4IQMA 2XMTA 3PY8A 4WTOB 1VQOS 3Q8PB 5F8JA 4DCPB 4ECZA 1N33F 4MKVA 2VU5A 3QT5A 1H74A 2W2QP 2DO4A 3KLIA 4BDPA 4JOUA 2JX2A 1D8YA 4X64J 4P72A 1DTTB 4PQUA 3IGNA 1I5OB 3SCKE 3VVTA 2C3YA 2W4CA 2JVOA 4IFYB 1XNRJ 2Q43A 2DXFA 4AQYF 3PR4A 4RKUC 1TKZA 4A8QA 2J9DE 4OI3A 2GZOA 5GMEA 4DUZJ 3PHEA 4HHHA 1X4HA 1U45A 3RUBL 5FDLB 1NDCA 2OP5A 4B9NA 1WHYA 3R9LA 4HL9A 3PM9A 2RDDA 5DQIA 1KQFB 2CDRB 4CLTA 3AA8A 4JI0F 1OJ4A 3FSYA 2AX1A 1O8BA 3OPKA 1Q5VA 1UA0A 4CLLA 3D5MA 1V5VA 1GXUA 3I55S 3IG1B 2C2NA 5J2MA 4B08A 5M2RA 5IXUA 2YNIA 1IXKA 1Q1KA 2VG5A 3ZNJ1 4R8UA 3D28A 3JSBA 4P2FA 4GO5X 1TELA 2OFGX 4J9QA 1Y9OA 2J6UA 3PJWA 5U47A 2V63A 1NUEA 5DM6Q 3TR5A 2OPSA 4NI2A 2OJ3A 4M5KA 4RZRA 4HLBA 1RI7A 1T94A 4MMOA 3R27A 4LREA 1WTFA 2ZITA 3GFZA 5K20B 1C4AA 5LJ3Y 4KJIA 3VAFA 4B17A 4DPYA 2OLWA 2N4CA 2FJXA 1KLNA 2C2ZB 1KKHA 3TAMB 3O5TB 4ZPWR 4JI1F 2HFZA 5KG6A 2UXCJ 2HHWA 2JFKA 4X4NA 2V94A 2WK4A 2CNLB 4WE1A 4IRCA 2J5AA 3TA1A 1QJHA 1X31C 3G86A 2Z8QA 1AUDA 4ID8A 1U1OA 2B9WA 5B0CA 2W8LA 2ADCA 4QYRA 4IR9A 4FF4A 1S59A 2PI4A 2E9RX 4JI3F 4DEZA 1TKTA 4X4TA 3UWTA 4OZLA 4ZMMA 3D67A 3HK2A 1T7PA 3LW5C 4G3IA 3A8IA 4P73A 1TVRA 4H4KC 2RHSB 3FCVA 2I2YA 2DNMA 3QWPA 5DQGA 1FFWB 3SFUA 3GIIA 1IKXB 1RTIA 1RA6A 4UW2A 2FYXA 4DV1F 1H38A 1OIAA 4F4YA 2U1AA 3RYLA 3MCMA 4JYAF 1U8WA 1VI7A 4LF8F 1AFIA 5DRKA 1XNQJ 1JJ4A 1KDNA 1YBUA 2GX8A 1JJ2R 2A6MA 2CNKB 1RB0A 3CD0A 1JKHA 1I94J 3NCRA 4GKKJ 2V0NA 2NXUA 2QMWA 2E29A 4WIIA 2NXEA 4NLSA 1NO8A 2B4PA 3HD2A 4QPTA 1RYSA 1UEVA 1HNWJ 2H4WB 4NA2A 3HZEA 2HGNA 1RTJB 1IBKF 4YR0A 1YLXA 2V9WA 1KLMB 2CWXA 3MMBB 4OHVA 1FJGF 4G65A 4RNHA 1FKAF 4USJC 2V8GA 2M4MA 5GAGI 2D9OA 4ZIWA 3L7OA 3SZ2A 2F8EX 3MCOA 2PO4A 1QE1B 2W2PP 2V8DA 1AXQA 1EAYC 1OPIA 3HHLD 3DLGA 4TN2A 2XHWA 3ZTQA 1UFLA 4KB7A 1GFWB 4OHYA 1VC5A 1WC4A 1CJTA 1DURA 1J5EJ 2A6OA 1WC3A 1TL7A 1HBNA 1N34J 4TY9A 4F36A 4ED0A 3M05A 1WF0A 3DOMB 3K58A 5AXKA 1WC1A 2N3OA 2BOAA 2E5HA 4DDFA 3KXDA 5EGYA 1JB0C 4CLYA 1YJRA 3I82A 3JYTB 2W7PA 1VHIA 3N6LA 4BWMA 3NG8A 9ATCB 2DNPA 4N41A 2XMMA 1VOMA 5KFEA 4J90A 1K44A 1UFWA 1IN0A 2G1DA 3A3OB 1QSLA 3O8WA 2FZKB 5BYRA 3RBDA 4IG3B 3IA0A 3W7BA 3E51A 1DJ0A 2MDAA 2RUGA 3OVBA 3UR3C 3OTEA 4CYUB 2DHSA 3L7UA 1HMVB 4DR5J 1RDRA 1I3OB 2HPUA 2F3JA 5C25A 4J9NA 1NDPA 2LP4A 2BJ7A 3M2RB 2LA4A 4PG7A 2QFIA 2MKKA 2JC0A 3CDAA 3SCJE 1IR1A 1YDLA 3MM7B 2VG7A 2DR6A 4LF9J 4C8ZA 2WCXA 2KL8A 4ICLA 5KFIA 1X4EA 3PO4A 4I7FA 1X9MA 1SXLA 3EJMA 2VFTA 5IWAJ 6FD1A 1VBYA 2DNRA 1REGX 2ZWOA 1X0FA 1VLOA 3CCTA 1J2VA 2R4FA 3QIPA 3IO1A 3DU5A 3ISND 1JLEA 3GCXP 1M5HA 4Q0BA 2I6WA 1B7FA 2DNZA 3BH7B 2BE9B 2UXDF 2CPDA 5IQ6A 2DY1A 1U6ZA 3PZPA 4F04B 1WG4A 3OQ2A 1S10A 5ADZA 2Z2YB 4CT9A 1LWCB 1QSYA 3CJTA 4A8YA 3EUNA 3KJVB 2DGQA 5ETLA 3D2WA 2XYGB 2BR0A 3IN5A 1UAWA 2QMXA 3MM9A 1U0HA 4CH7A 2DR8A 1Y3JA 2NPIA 2E1AA 3CJ0A 4Y00A 1NH7A 1RWPB 2DGVA 2VFRA 1R8CA 1ZAXA 1IVZA 2FHKA 2EKYA 5KT6A 2POKA 1C1BB 2YNHA 2O1PA 3W3SA 1T03B 2D7SA 4ZCLA 4ZK7M 4LBHA 3DDKA 4E8UA 5CAAA 3JSYA 4NLQA 4C0BA 5LXRA 4F3OA 1NXIA 3RZAA 2KFZA 2JEFA 2ADBA 4L73A 3RRGA 1F2GA 1U2CA 1UW9A 4CQ1A 3SQGB 4ZHRA 5I3UB 5ETPA 1D9AA 3UPFA 2CWKA 1NBEB 2IY5B 3ZNUA 5AT1B 1F9EB 3ITHA 2DVIA 1MN9A 1O51A 2F65A 1NKCA 2V2KA 1L3SA 3MPWA 4L3NA 3KLIB 2VUGA 2YKAA 1NZAA 3O6QA 2JEJA 1PJ7A 5GADU 1S1XA 5T41A 4TU7A 4QYZK 2N7YA 4B3OA 4PQUB 2FHMA 2G1HA 1EJ7L 1V3RA 2ZC4A 3AQOA 3HHNB 1OY9A 3A13A 1DBDA 5KFCA 2A10A 2R9LA 4DL6A 2YVSA 4QWBA 4I56A 1XC9A 1JLCA 1FTRA 5EWEA 4L72B 4U67Q 2XI2A 1GTEA 1KVKA 2LEBA 4JV0A 2GHVC 2IMOA 2UU9F 1ZTWA 1KVIA 2UVRA 2EXUA 1IM6A 3MAHA 4HT7A 3PO5A 1TKZB 4AYBD 3I5BA 2FLLA 1LXNA 2RQ4A 1E6YA 2HNZA 3BR9A 3R5JB 1RHKB 3ILJA 2HMIB 3MECA 4WU2A 4UTGA 1H2VZ 1WDTA 1RBAA 5J1EA 4DG1A 3CC2S 4C8YA 4JI7J 5JXSA 3HHEA 4BBYA 1R89A 1NDKA 2OUGA 5HJXA 1RAHB 5JMNA 2CNOB 3AD7C 2CXEA 1QSSA 3MUTP 3I4HX 3J7YI 1ELOA 5J2MB 4K50A 4Y34A 2J9CA 2YNIB 2LQ5A 4R0JA 2VG5B 4R8UB 4JV5J 3G87A 1BLUA 1QTMA 3QZ8A 1Y10A 4OX9J 5MLCV 2OPSB 2C1EB 2C42A 4NI2B 5K5MA 3OL8A 1X4DA 4KH0B 3A8EA 3R97A 2B8PA 1HKAA 2BUNA 2LXIA 3F41A 3VAMA 2CZ4A 1N4LA 4B3RF 5F8IA 4J9VA 3A4TA 2X1FA 4E98A 3K7RA 2E5GA 5K14A 4I4BA 8AT1B 3SV3A 1NK0A 3BYPA 1FRMA 3MTKA 2RU9A 3D68A 1TV6A 2G4BA 3PYEA 3ZTPA 2YNGA 4DSJA 4N56A 3AB2B 5L9NA 1N52B 5I3QA 3VAHA 1S1TA 5B0AA 1RACB 5DJBA 5IS2A 1BE4A 3FSXA 4O0IA 4ZA1A 4J9SA 4I6WA 3H5YA 3D6TB 3EZUA 3CC7S 2B9YA 3K89A 4X4UA 3MEDA 2W01A 4TLRA 4Y3CA 1X4AA 1TKTB 1HNXJ 1U2FA 3GIJA 2HVDA 3MPVA 1YSJA 2BKNA 3A3NB 1PGZA 3C15A 4DSIA 1ZS6A 1TVRB 2AZ3A 4LFCJ 3AOCA 3NLCA 2ZJRQ 4CLPA 3X3UA 3MCSA 4KGVB 3DOLA 2AYEA 5DGAA 1RTIB 4M5IA 2YKMA 1Y5LB 2EFVA 4YQWA 4M5JA 2KFYA 4GVBA 2K7KA 2HFNA 3AAWB 4O44A 4X64F 4TY8A 2MZRA 2ASYA 3C66A 2VOOA 2C2DA 1PO6A 4KAIA 2VZ9A 1TL1A 3EZ5A 2JZ5A 1WEYA 3NGUA 2HVEA 2QEXS 1T95A 4K8RA 1TL5A 4EYHB 4DX8H 1XNRF 2EFQA 3Q83A 1RWMB 4FF2A 2FJAB 3MM6A 3CJQA 4DUZF 1EARA 3MM5A 5G4DA 3G8TA 1RWWB 4DJBA 1AUSL 3FRYA 2KHCA 2VPZB 2DXDA 3POTA 1LOUA 2PDAA 2CG8A 2Z2MA 1S0OA 1PG5B 3DLGB 1YJUA 3OXGA 5ETQA 4Q8EA 3KMQA 3IM9A 4A47A 2FVQA 1CJTB 2ILZA 1U1LA 2G0IA 3RB4A 4DQSA 3DI6A 3A1YG 1HBNB 5ETRA 3P3DA 2F1FA 3V6DA 1SJ4P 2WBRA 1NJZA 1Q8BA 2M9KA 2XULA 4O23A 3I0RA 2CKWA 1KBRA 3DLHA 3CIMA 5KFHA 1RCOB 2RT3A 2V67A 4ZCMA 4O3RA 2XY6A 4HTIA 3TW0A 1RXOB 2EKNA 3IWLA 4KIAA 3SSQA 4X4RA 1WDDA 3MUMP 1EQMA 4X4OA 2GV1A 1DRZA 4KYZA 2FHJA 5AE1A 4URGA 1SCJB 1NKBA 1NRKA 4U7UK 3BGRA 2UXCF 1UVNA 4DI6A 1HARA 1UZHA 4JB8B 5CZVA 3I96A 4ZVUB 1FDAA 5E3PA 3CDWA 1X9SA 3QT8A 5C25B 3PW5A 1U47A 4OV6A 1PC5A 4CM2A 4USUA 3FBBA 2JLEA 1UP1A 4JI4J 4BC7A 2HRYA 1MROA 2QA4G 2VG7B 4UOGA 3U27A 5KG0A 4F02A 4ILLA 1N0VC 4ICLB 1GMVA 1K47A 1U1PA 4NXMJ 3MD3A 4F4ZA 4I7FB 1M1KT 2KI2A 3LOUA 1S48A 3M8PA 1YZ7A 1S49A 3N0VA 2OEMA 3QAUA 3N01A 4OYMA 1BXNA 3K5MA 3QIPB 1NB7A 3M4XA 1JLEB 3K5PA 2FIUA 2IM3A 1UJ5A 4YY3J 1GMUA 4Q0BB 1XNQF 2KTQA 2D1CA 1HL6A 2YKPA 4LSNA 4KFBA 3THPA 3CD6S 4TYAA 2HBRB 2QSFA 4WBFA 4LFAJ 2NSBA 1QAJA 3LPYA 3RB0A 3SDEB 4QU6A 3UQSA 1I94F 4GKKF 1FDDA 2VICA 4FS1A 1KRPA 1HNZJ 3DLKA 4NOHA 3ZXWA 3MM9B 4EBEA 1U0HB 1HNWF 4W4MA 2M7SA 4DU7A 2XBPA 5C2CA 2YBVA 5BJRA 3ADAC 3U1LA 2KXFA 4NRUA 3GR0A 5D4LA 4A4JA 1SC6A 1KFSA 3LF0A 4P6QA 4B9LA 5HVFA 1L3KA 2VOPA 2X3GA 2N4DA 1HD0A 1Y4ZB 3IR7B 4B9SA 2AJQA 3KK2A 1HI0P 3NS7B 2FJDB 1TMMA 3KLFA 4CO2A 5LMNJ 1D3WA 5ITHA 4FF1A 4ZJQA 1AZSA 5C24A 4NEZA 5GMDA 2C2KB 1TAQA 1Y11A 1EETA 2WSFC 2XS7A 3V6HA 2V69A 4LT6A 1J5EF 4DV3J 4C4WA 1N34F 1RAOA 3UVJA 3FUYA 4ZHRB 4FYVB 1RK8A 1VRUA 3KOAA 4RJVA 3TX8A 4UY85 3ITHB 5F41A 2B9EA 2RDIA 2MQ8A 1SIWB 5AE3A 3BSAA 2IIHA 3H42A 4M94A 2VBXA 3OSNA 1NHKL 2ILYA 1BD6A 3QZ7A 2OEKA 1T02A 3ZC4A 3FCHA 2PA8D 4B3OB 3KDNA 4F8RA 1HW9A 5IZHA 1M5OC 5D15A 4EK2A 4RU9A 5LMUJ 3QMQA 1X0PA 4YB7A 1S79A 1JLCB 2OH2A 1WG5A 2XQCA 2RE1A 2A18A 4C2MA 3GTYX 4UOHA 2PMHA 1Q53A 1RUSA 3ZZYA 4QR0A 4CTAA 3EVOA 1E6YB 3G9CA 2HNZB 2GS8A 1Q95G 4DHVA 5E5NA 1FA0A 2PFFB 1FDBA 2IM2A 3GWCA 4F4XA 3MECB 4OJ1A 4DR5F 4P2XA 5J1EB 4EMDA 1F2HA 1FI4A 4DG1B 2FUG9 2HBZB 3QNWB 2AKWB 5KOWA 1S5ZA 3EGNA 2HSEB 1S9FA 3MOJB 4X4VA 1ZYQA 4LF9F 1F5BA 2E1MC 2QE5A 3FEZA 2MZQA 3K8WA 1CC8A 4DQRA 3HFVA 4ECVA 3R8YA 5IWAF 3GMGA 3J81U 1E6VA 1QUVA 2W1BA 4K7QA 2DD8S 3PHTA 4Y2IA 3IXQA 3T5JA 4OYZA 3AD9C 2Z58B 1VS3A 3TX0A 2ROPA 4DV2J 2FD2A 1WOSA 3HHLA 3BBBA 1OY8A 1H2UX 2QG9B 4CLWA 3NWRA 3GJRB 1S6PA 2J7KA 1NK7A 1IQZA 4MK8A 2IDEA 1S4EA 2ATCB 1S6QA 3V6JA 3T9ZA 5K14B 3GIRA 3DDNA 7AT1B 5KAKA 3DRYA 4USVA 1TV6B 1N54B 2YNGB 5KFVA 2X7IA 3FZ2A 2XY5A 4NPOA 2KZZA 1S1TB 3DHXA 1H7WA 1VQSA 2VFUA 3IM8A 2HNDA 4MKAA 3PJXA 1N5TA 5B0BA 1KD1T 1TKDA 1QDUB 5ETKA 3DFEA 5EWFA 1TTHB 4PYDA 4NLXA 2IAJA 2WB1D 3M8ZA 2HURA 3H25A 3HZGA 2OAUA 3ILIA 5IQQA 3L7PA 3JTNA 4C0OC 3UN5A 3C15B 1UVJA 1R8BA 4PXBA 3DOLB 3IWNC 3OHAA 1YBAA 2C22A 2YQ0A 2YKMB 3BEGB 4P9SA 1WWHA 2AIRB 3W1YC 4PR6A 2J9EA 1RTHA 4GVBB 3U1NA 3FBEA 3PYGA 4N76A 3OT9A 1JQGA 4TU9A 3CWJA 2K8GA 4O44B 4TY8B 2V2QA 1H2TZ 5HBMA 1RHJB 2AJFE 2H51B 2PD1A 4FDFA 1TL1B 4HTJA 4X66J 3KJNB 1IBMJ 2Z2LA 5L39A 3M8QA 2HHUA 2I38A 1RAEB 1FWLA 3HFKA 4HH0A 5B7WA 2DRDA 2LDIA 1S1WA 4DN0A 4ZVGA 3CJKA 2F7VA 4ED4A 3MM6B 5IM0A 1YK9A 3MM5B 2YWGA 5FD1A 2J76E 3I6PA 4WYLA 4EGLA 2HHHF 2CQIA 4LF5J 4IOCQ 3C2PA 1TL3A 4IO9Q 3PFOA 2DY9A 1ZM2A 3BGUA 3MFHA 3GE9A 4JI7F 4F4KA 1UTAA 2XO6A 3TJAA 1RHQB 4CLZA 2NCKL 2FC8A 4PZVA 3CC4S 8ATCB 1NJXA 1U02A 2CFXA 2HGMA 4ED5A 3DI6B 2XYHB 3FQLA 3E01B 4NLVA 3QJLA 2Z30B 1ZPWX 4X62J 1NDLA 2A2DA 1HYSA 4JV5F 1QAYA 4CO4A 1HLWA 4OYXA 1BWVA 2CJYB 2D3OR 3SV4A 5D78A 4OX9F 3I0RB 2GNKA 4QIWD 2FJWA 1X4CA 5DDRC 2FZCB 4MYTA 2R3VA 4RW4A 3MEGA 2J6SA 2VA3A 3ETMA 3MMCA 3QJPA 1SC1B 4B9VA 3THVA 5D0GA 3LGNA 1NZ8A 4FZVA 2N82B 1F9HA 1PSDA 1PAEX 4OZ5A 4FYXB 4C3KA 2CQHA 3D3BJ 1K0VA 3FCWA 4O4RA 2B4UA 1RISA 1UEUA 2C3MA 2VFVA 5CHCB 1S1VA 4ECYA 2IJFA 3S8SA 3SBMA 2VG6A 4DN9A 1IR0A 1LWEA 2CQPA 1W2IA 1MROB 4MT1A 3FK4A 4P7VA 4TVAB 3PKMA 1HNXF 1SH3A 1B64A 4DWIA 5F9NA 4Q2LA 1T9WA 3G8SA 1ZTTA 3D7SB 2BE7D 4OZ3A 2G2ZA 4LFCF 3M8PB 2FB0A 4TNOA 3HJFA 5HL7Q 2YWFA 4N8NA 3GLJA 4JI0J 2LQJA 1MLAA 5GVQA 1LNQA 4OZ1A 2ZZMA 2HZVA 1RBLA 3B8HA 1LW2A 4YR2A 4EWTA 4P10A 1YKWA 4DR7J 4ZITA 1UVLA 3X1LB 4LSNB 4KFBB 2B9XA 5ETNA 2WVCA 1RLDA 2KYZA 3O3LA 2EC2A 2CA9A 3FZBA 1U1KA 4K2XA 3B4DA 4JI8J 3MR5A 3W60A 2D74B 5GADI 3HX9A 3DLKB 1URNA 3D1HA 2KB2A 3D66A 3QGIA 5D3GA 1EP4B 4NLYA 3GV5B 2QMUB 3CCQS 2FTRA 4RWWA 2QLJB 1U8SA 2W4PA 3DGPA 4WFNQ 2DTJA 2X3DA 2UUBJ 4IOBA 4WF9Q 1MWYA 4WP8A 2CUYA 2FGOA 3VGSA 2EEYA 2LECA 1N32J 4I0WA 5HVGA 3KLHB 3BKTA 1HHTP 3KK2B 1DFDA 3PR5B 3KLFB 2J0SD 5E3AA 5DZ7A 3MPUB 2P5VA 1AZSB 5C24B 3TVKA 4ZIVA 1EETB 1MMNA 2DKOB 2VPYB 2QA1A 2JH3A 1UVIA 4PPDA 3AOBA 3LALA 3UVJB 2XLJA 3BQ2A 2VQFJ 1KN6A 4AT1B 1REVA 1VRUB 1GNKA 4DQQA 5KFFA 3P5TL 4J9KA 2BJ1A 4ES2A 3TWZA 2YH1A 1NJWA 2OSQA 4ZVHA 2V68A 1SH0A 3GONA 4DR6J 1KSPA 4LSZB 2LVWA 4YMEA 1BMQB 1IKYA 4LF8J 1RTDA 4O3OA 2JJ4D 1HD1A 1T11A 3V81A 5DG8A 5E0OA 1FHTA 4M1KA 5B0FA 1GMWA 1TQLA 2R42A 4CTAB 5L38A 3IFEA 4JUZA 1IJFB 2QZ8A 3ISZA 4WFXA 1CJKA 4WFZA 2FDNA 3KHLA 2M52A 3LGMA 5A76A 3GILA 5G0RA 2YWEA 5J2NA 2O01C 5FIIA 1PBUA 5ETSA 3H4BA 4JI4F 2FC9A 2W9BA 4N5SA 2XSFA 5DDQC 2KDOA 2HQGA 1S6OA 2VC1A 3KLGA 1VQ6S 4UZCA 3H59A 4C0HA 4NXMF 3M9OB 1IUJA 2ZDPA 4ZVFA 1Q7LB 1E6VB 4ZS6A 3UI3A 2RJZA 1Z2ZA 1UPMB 2HQCA 3BSNA 1HFEL 3BSCA 2BJ9A 5A8WA 4M5NA 1U24A 4HI1A 2BYCA 5FJ4A 1WSRA 2KT2A 1U1MA 2VPWB 3O2IA 3N5FA 3NS6A 2IFXA 2YKNA 1N5QA 2DGOA 4YY3F 2BE2A 1H6KX 4DCJB 2EFGA 3HHLB 1VQMS 5KFOA 2WTFA 1R8AA 2GQQA 3T3FA 2QLXA 4LFAF 1VJQA 1XR5A 1S6PB 1MMLA 1HR0J 4OIXA 1FRHA 5FLXY 2J6TA 4HVZA 3EVMA 4ELTA 4PXEA 4GO7X 5IV4A 1HNZF 3RAXA 4KGZB 2QO3A 2XZTB 1RZMA 1X5TA 3GG1A 2BQRA 3R2DJ 2H5JB 4H54A 2Y8WA 2HK3A 4PAAA 4IRKA 3BS9A 1M5SA 1PYTA 3M9MB 1JJHA 2HNDB 3UD5A 2OEJA 4O3QA 3GJSB 2IAJB 4DSFA 3W9IA 5L9XA 4CNZA 5LMNF 3BKUA 3JQMA 3DN9A 1WKKA 4J9RA 1YI2S 2CIMA 2PA3A 4K4UA 4NE9C 2B0GA 5D6GA 4M95A 1XN9A 4DV3F 2ZNYA 1LQ9A 3HXMA 3JSRA 4UY8T 3GIMA 2YH0A 2EFPA 5KG3A 2AQ4A 3OUYA 2BBEA 3EGWB 3GV7B 2HHTA 1EZZB 2G13A 3VZIA 4TXSA 1RTHB 1AROP 4PYAA 3M30A 4DF4A 3P6YC 4DUYF 4OHWA 1R0CB 5JJBA 5CXTA 4Z7CA 2K7JA 4QOTA 2L3MA 5HBMB 5IOLA 3D1QA 2BJEA 4DL5A 2CQ4A 1FDNA 4U6PA 5LMUF 1R31A 3MWBA 2MKJA 3M8QB 4RBTA 5C2GA 3CCLS 3BBCA 1D09B 3H8YA 5AXLA 2CPEA 2CQDA 4L74A 2W24A 3CJKB 5IM0B 5GAEU 2QLBB 2D3ZA 2UVVA 1GK8A 1QLNA 2RVJA 3M2VA 3GIKA 1SL2A 2XMAA 4ITSA 4K4WA 4ZVEA 2MQMA 3JB9k 4ECSA 4MAKA 2G9OA 3LANA 1M5PC 3LAMA 5A0YA 2O67A 2MQPA 1VBKA 4ERDA 1JLQA 4OJGA 1Q4RA 2AV5A 4NYPA 1RU2A 4QU7A 3J80Y 1HIYA 4EZ6A 3HKZD 4G1IA 4D3GA 5HQ8A 3QT6A 4OQJA 2K3KA 2X51A 4RW6A 4B3TJ 3G82A 1OS5A 2QYGA 4Y65A 1FWPA 4RNNA 1T9VA 2QGFB 4DSKA 1I6JA 4DV2F 5KFAA 1HNVA 3QFHA 4RW4B 5IC6B 5H9EK 1IBLJ 3MEGB 1N5YA 3CF5Q 3DRPA 3MMCB 4K4SA 2ZDOA 4NLRA 1IKVA 1R6YA 1FJ7A 1NK5A 2M0GB 3W62A 1KTVA 2B5JA 1PILA 2H9ZA 2M5YA 4CO1A 3ETOA 2LFVA 1BUXA 1FT8A 5KG5A 2ZUGA 3IRWP 2E5IA 2WZ1A 1S1VB 2F4FA 1LV5A 4YB6A 2VG6B 4CDIA 3RW6A 3AA9A 1LWEB 1RYRA 3CDUA 1WF1A 2ZKUA 2AX0A 1SKWA 3GFYA 4PKDB 4HHJA 3ONQA 1OSCA 5IC4B 5IT0A 4W98A 2VBZA 3EPIA 1JLFA 2DNNA 4A8KA 3U1MA 3GV8B 1IJEB 3MEEA 4GKJJ 2D41A 1RWNB 3H5SA 1K9MT 2R7XA 3K8VA 2MJNA 4F7VA 2ZH9A 1X5SA 3AXMA 2HVHA 1HPZA 4B3SJ 1LW2B 2QC3A 3KUHA 3HJVA 5KFBA 3H98A 2WVFA 2ATLA 4ECUA 1T9YA 2HG4A 1HWIA 1DQAA 3WC2A 5MAOA 3L3CA 1NAQA 2D3O1 3P8BB 3KHHA 4B9MA 3HPOA 1QTNB 2WB4A 2IYGA 1VQ9S 5HQLA 2OELA 4X66F 1IBMF 3RGIA 4CLKA 3MZIA 1T05A 1KVJA 2DJWA 1FD2A 2OTJS 2VDIA 4DR1J 2QLWA 5D3GB 4USIA 3DRSA 5HO4A 2JNJA 2BJDA 3DGPB 3UDEA 1K0TA 3WQPA 3LWLA 5JVHQ 4RW8A 2WHOA 1P9YA 3HKWA 3LWMA 2VH7A 4QIFA 4DV7J 3BF4A 2OD4A 3UN3A 5KG4A 2ZBIA 4LF5F 3G71S 4ZPTR 2ZBCA 4AXJA 5BYSA 1FRXA 3N28A 2KKHA 2MGZA 1BQXA 2HRTA 4DLGA 1H0HB 4Q2MA 3TVYA 3KKFA 1Q78A 1BGXT 1UJ4A 2GIRA 1CULA 1LXJA 4ALZA 3B6BA 3GYNA 1LW0A 1LWXA 2V8PA 1FKPA 5KFKA 4GMKA 3SQOP 4PG4A 4X62F 2LKZA 3IWXA 4OHXA 3HVWA 4I69A 3NXZA 3TJ9A 3CCRS 4AXIA 4KGKA 3A3PB 4M5LA 2GVDA 2CJXB 3EMTA 3N6MA 3QPIA 3N4WA 4YUDA 3P45B 2W4DA 2CJBA 2K2PA 3RG6A 2E9ZA 2L41A 2XYPB 2LXFA 1YJVA 2CPFA 2FHJD 1Q7YT 2HW3A 2ZZTA 5FLXU 1WOOA 3GPAA 1IKYB 1S1UA 3BB5A 1RTDB 4EU0A 3KNAA 4I67A 1LK5A 4AFFA 1L5UA 3V81B 4DL4A 2YX7A 3BDPA 2M8DB 3W63A 2H48B 5SZTA 3OFEA 1VHFA 4NLPA 4GVLA 2AP6A 4JP8A 3BN4A 1V5IB 3OHBA 1H7XA 3PX6A 1UL3A 1CJKB 4DOZA 5HANA 2ROEA 4OYBA 5G0RB 3CO0P 1CEZA 5J2NB 4KGMA 4I68A 4DBQA 2ZH5A 1XEZA 1L3VA 4ER8A 1X5OA 1GXTA 1FNOA 4KRWA 4MIWA 3Q0AA 3GSDA 3JXOA 2W9BB 3MF5A 2KJVA 2VKZG 4USWA 3KLGB 1NPRA 4DX5A 4KKOB 3IC1A 5ETMA 2YX4A 2BDPA 2ACMA 3L9ZA 2F63A 4PABA 3AD8C 2KU7A 4WZQA 4ENOA 2WOMA 4LR9A 3R6LB 2HFUA 2YX1A 3IBWA 2OKQA 3HD1A 5A8WB 4K4TA 1ZM3A 2VODA 4LF7J 4A8OA 3R6GB 1NEEA 1F60B 2DGTA 3AH6A 1N88A 2YKNB 2XB2D 4D3HA 2BE2B 3V4MA 3MTJA 4DR7F 4RX6A 2L48A 1GQEA 2ZC3A 5E33A 1RAIB 2FVRA 4DR3J 2H4YB 1VBXA 3ET6A 4K4XA 1GAOA 1N6QB 3OR1B 4KY3A 1SJRA 4WXWA 5HAOA 3V2UC 1SVDA 3W64A 4JI8F 4HH1A 2XGPA 3BREA 2JEIA 1IKWA 5HP1A 4U96A 3FEYB 3PDNA 4Q44A 4EO6A 2Q6BA 1UWBA 3QQCD 3UFCX 1OSDA 1NSAA 1C1CA 5A2QY 2YQ3A 3SMZA 4NMLA 2UUBF 2GQCA 4XPCA 4OZ0A 1W2BR 1XMOF 1X9WA 3VALA 1RT4A 4ED7A 1S6UA 5IFMA 2HHVA 4YB1P 3FJ2A 5GAGU 1N32F 4MK9A 2P9CA 1QVGR 4NASA 2VFSA 1FFGB 1VK3A 4P2SA 3OVSA 2V8HA 4NA1A 1FRIA 3FMWA 4EBCA 4LIWA 5F3TA 4E2FB 4OYOA 1MU2A 2WAQD 4CH0S 1RT7A 4ZPVR 2C28A 1IBCB 8RUCA 2MMYA 2ZVIA 4UUWA 1M90T 4DV5J 4NCBA 5KFLA 1VK8A 3D0IE 3N79A 3QBCA 2VQFF 2DNKA 2AWZA 3V6KA 5IT9Y 3OUYB 2OTLS 2IBOA 2GAHC 2E7WA 1DAXA 2V4QA 3M30B 3MAQA 3M9NB 3HSDA 3TVZA 1TAUA 3QGPA 2LU1A 2E9TA 4JV1A 2LQ9A 4DR6F 2B4OA 1WEZA 3OTDA 4EFAC 2GC8A 2CJAA 5E2QA 3W8GA 1Y0HA 1AB8A 1KQKA 4CLUA 1YIJS 1FXLA 3BGOP 2IHR1 2ERRA 1AW0A 2Z2ZA 4DUTA 3EE3A 4OX7A 4LRBA 5CYQA 3FRZA 3TUJC 3J7Z5 2JRSA 2E7XA 3K59A 2BX6A 2VBYA 2DISA 3M2VB 2B43A 3GQCA 3ELHA 4X65J 2DNYA 3D54A 4ZN3A 1VQPS 3OLAA 1DTQA 3CDBA 5THWA 5IV3A 3CJ3A 1VR6A 4H4OA 5HSPA 3CTRA 3RBXA 2R7RA 3JAMU 5A0YB 1BHNA 1N5SA 2RRNA 1JLQB 2QT7A 5BR8J 1NSPA 2WVBA 3W61A 1FK9A 1ZM4A 3LP0A 4FBTA 3M6UA 1RT6A 4RW6B 2CVEA 3G82B 3WBZA 3H5UA 4QYZJ 4O4GA 4A48A 1YRTA 2PT0A 1HNVB 5I4MA 2PMZD 4GC6A 4UT4A 2N7CA 1RWVB 1OYDA 3ZZRA 2J9DA 1N5YB 5EWGA 3KYLA 2NYIA 3DRPB 1HR0F 4U7UD 3R5GA 4ZVQB 1FNMA 2I0XA 1XR7A 1IKVB 5ETTA 2C2RA 2MXYA 1SI9A 2YNFA 4C97A 4YDDB 1C2PA 2R7UA 1SB6A 2B5JB 2XG8A 3GU0A 2KM8C 4NXNJ 4FPRA 4KHPJ 1RQ0A 4BWJA 1YQHA 3PYDA 3Q24A 1N0UA 1ZETA 3KUEA 3RRKA 4AE5A 4DSLA 4UUXA 4XIUA 3KHGA 1D9DA 1VQ4S 3H0PA 1D1UA 4YEAA 3C14A 1AA1B 1DHMA 1UCNA 1GXLA 1PJ5A 4ETZA 2W9AA 4DS5A 2IJRA 2HK2A 5DZ6A 2ZH7A 3LGHA 4CT8A 2AEJA 2OHDA 3DDIA 4W92B 1JLFB 1RJJA 2EBGA 2ZH3A 2W2OP 1S7HA 2C2OB 1NK6A 3MEEB 1WNEA 2H3EB 2HRUA 2R2UA 3EWGA 2PE8A 3OJUA 1HPZB 5E3RA 1JNZB 2UUAJ 1DLOA 4QW8A 4WFYA 4ZVSB 2B4VA 3BPSP 2BACA 3ILOA 4XK8C 3LQVA 2HEKA 5M2UA 1VQNS 3OXLA 3MPDA 2IRYA 1NPPA 4WWSA 2HZCA 2QFJA 5C42A 2CPJA 1T05B 4F25A 3G6VA 4QZVB 1VC0A 1WHXA 5D4OA 4B9TA 4NLDA 5KG1A 1RHRB 3TP2A 1KP6A 1A9NB 3DRSB 2CJ9A 4RW8B 2XGQA 3G6ES 2Y0SD 2ZBQA 2HS0A 3H7HB 4EI2A 1T0TV 4FXWA 1HWUA 2QA4S 2W25A 2CVIA 1S9EA 2RD5C 4EBDA 1ZA2B 3CSKA 2XZDB 2MGZB 5KFXA 2ZD1A 2A3JA 2V4RA 4YN3B 4NLGA 1CULB 3Q8SB 1FKOA 3Q86A 1LW0B 2XNQA 1URRA 1LK7A 1FKPB 2ASLA 3T1HJ 3M1VA 1LFWA 1F5CA 4DV4J 4ZPBA 4L75A 2PIIA 3FFIA 1QD1A 4ANCA 3H2LA 4B3TF 2GVDB 3CCWA 2QLFB 1VQ8S 4Q43A 5EX0A 2HNYA 3HCXA 2FQQB 2L9NA 2CNNB 3NNHA 3ZZOA 2KG0A 1GH8A 4ECTA 3C3LA 1RHUB 2I1RA 4NYZA 1IBLF 2VA2A 2C3PA 3HO1A 3AOAA 1S1UB 5AXMA 1SKSA 3N5BA 4PPZA 1H98A 4R5PA 5J2QA 3NY0A 3PEHA 5HI7A 1YTYA 3CD5A 1S99A 2GJIA 2ZEJA 1Q8LA 3FEXB 3W5XA 3OR2A 2JWNA 4DPTA 3NMAA 3C19A 1UKUA 2PI5A 3UD3P 3QO9A 4KBIA 3WC0A 4RW9A 1R0AA 1S9GA 3GFXA 2RRBA 3K2YA 1XERA 1TK5A 4NLTA 4G1PA 1RTJA 3PEJA 5B0EA 3CJSA 3OFGA 6FDRA 3MMBA 2EVZA 2DHGA 1UFKA 2HHHJ 2BKOA 2A1BA 1B0TA 1GTHA 1WELA 3LH2S 2JSXA 4GKJF 3BDEA 3AJ2A 2WOMB 4K0KJ 4EO8A 3NEKA 3M32A 5EHHA 2GGPA 4CWBA 2YTCA 2V8VA 4B3SF 3IGVA 3V5RA 1NHVA 4ZCKA 2UV8G 5J1NA 3CMES 1EX8A 3VVUA 2IM0A 2HGLA 4LFBJ 2H5EA 1VISA 2CDQA 1HBOA 3DXSX 3ZTSA 4X4SA 5M2PA 4LF4J 2Q6CA 4NX9A 2E1PA 3ET6B 2GHPA 3Q89A 2F8HA 1FESA 1WI8A 2ZH6A 4XAKA 2M3DA 2EG2A 4LF1A 1XK8A 1IKWB 5HP1B 4N47A 4DR1F 3NMRA 5LSOA 4N8OA 4G1QA 4DL2A 4FYDA 1UWBB 4ZLPA 1WG1A 4RUCA 1C1CB 2VB6A 3OFHA 4DFMA 1RT4B 2DH9A 2VPXB 4DV7F 1M5VC 1WACA 4C3LA 1SQFA 2LQBA 3N6NA 5K8MA 5I42A 3GJTB 1UVKA 4OYIA 3CCSS 1NCLA 3IS9A 3PV8A 3MI7X 1UPPA 3NAHA 2ZZNA 4ED6A 2HHPA 2Y3YA 2HIQA 4F4WA 4WE1B 5SUHA 1ULRA 5CQGA 4PRFA 3TOQA 4NMXA 2VD3A 5KG2A 1MU2B 1RT7B 2ZVSA 2XC9A 3AQPA 4ZVRB 4F4AA 2ZH8A 3TAQA 1WORA 1DY3A 2GJ2A 2RH3A 3CXCR 2NQPA 3VV2B 1C4CA 1VCTA 3CJ5A 1F3VA 2OMOA 4C3MA 2GW8A 2HVZA 3VQTA 1TK8A 3TAPA 2QRRA 1SKRA 2RHQB 4CI0B 4AL6A 2BQUA 1V3SA 3OTOJ 2DB1A 4JI6J 1GMWD 2W7OA 1YHQS 3NBPA 3DLEA 1FE4A 2MYFA 4RNOA 4DF8A 4NWBA 2QTWA 5AJ3J 3T1YJ 4DQIA 4ANDA 2AGOA 5CYQB 3NCQA 3QIDA 2RB7A 1DQ8A 4HACA 4DL3A 1ZBTA 1TZ0A 1JKHB 3OD2A 1B0VA 3VCDA 2NXJA 3VZHA 1NK8A 4AUKA 4OX8A 3MMAA 2EK6A 2MTLA 5F8NA 1RSCA 3RB6A 1DTQB 2R8HA 3Q8VA 3WDOA 3NGKA 3GG0A 2LDYA 2RIJA 2IDLA 4B9UA 3HSZA 4H4OB 1NHUA 1VRQC 1CQNA 2HFVA 4RW7A 4RU2A 4IH6A 3HVTA 2MSTA 5CZXA 2HS4A 2ZWPA 5L1LA 4WIQA 2Y1IA 1YGYA 3OTCA 3T5KA 1FK9B 1CS4A 3LP0B 4WZMA 3HT0A 1RT6B 2LXUA 2GAGC 4USMA 4DV6J 4LF7F 3BQ1A 4CO3A 1G1XA 4OYAA 4O4GB 3PCOB 4KTQA 2HHXA 2XLIA 4F2RA 1TL7B 2PMWA 4GC7A 1TR0A 5H9FK 2R8KA 3SQGA 3V4IA 2JHEA 2R7QA 2WVDA 4DR3F 4KPYA 2FVPA 1WC6A 4O3PA 5HMZA 2DGUA 3D6MB 2QL5B 2YNFB 2YPZA 2IRXA 5KFRA 2KVIA 4AL7A 1W26A 2PEBA 3ZZ0A 2PGCA 5F8HA 2N3LA 2M8HA 3Q22A 1R27B 2UUCJ 5LSLA 3FMBA 3C6TA 1KNZA 1JIHA 4QR2A 1IR2A 3M8YA 2FPHX 1BQNA 1CG2A 2ZM6J 2GIQA 3T5LA 3C14B 1HHSA 1I1GA 1G7CB 2OI2A 2KXNB 2MQLA 4DLEA 4M5DA 2KM8B 1F9FA 1FX4A 2HMIA 2V9KA 3MGJA 1TP7A 1N36F 2CQ2A 2G2YA 4URQU 1U4BA 2R2SA 3EPGA 5H1SV 3RRHA 2GHWA 1SPBP 4DV5F 4L76A 1NJYA 3ZZZA 3S1TA 2PEHA 4RLEA 3Q2SC 4FS2A 3IP0A 1DLOB 3RW7A 2XNRA 2X1BA 1SH2A 3EYZA 1YJWS 1WJ9A 2Q66A 4FXVA 2HWHA 3VGTA 1EKSA 4IFVA 2UUTA 5C42B 4IR1A 2GQ2A 3M6WA 2RF2A 3R7BB 1ZAVA 3JTOA 3R2CJ 2WW8A 3J7ZT 1SUQA 2AU0A 5KFJA 2JL9A 1TMJA 2DGSA 4OI1A 4ES1A 2UVUA 2YY3A 4F3QA 1V3ZA 3LA0A 3TQEA 2CQCA 4ATNA 5IT4A 4YFUA 2K3IA 1NK9A 4X65F 1JXEA 2CQGA 2BABA 1WF2A 1S9EB 2W2NP 2ZBPA 3QYYA 2R7OA 3HFZB 4KHRA 2B7BB 3I31A 3FC9A 2NXCA 2DH7A 1X4BA 3DKDA 2ZD1B 4Q45A 3OL7A 4IUFA 2LEPA 2LCWA 4FXDA 2RU3A 1VYAA 3MR3A 2VV5A 3C16A 4LSLA 5HVHA 2YNHB 4B02A 1FKOB 2OO4A 5BR8F 3MXHP 3SI8A 3AY0A 3GZ7A 5A8RA 3M1VB 4DR4J 1A7GE 3FNNA 5KFGA 4YOEA 4OZ2A 1VIXA 4DL0C 3FFIB 3M8WA 2EWHA 5DM7Q 2XEXA 3NGRA 4F0HA 2HNYB 2MY7A 3B54A 3WIUA 2BANA 3QATA 3TZWA 4HDGA 4IQXA 1N5VA 3Q23A 3CIZA 3IRXA 1ZZNA 3QWUA 3AFGA 3DM2A 1YZ6A 3KWMA 3E2EA 4R5PB 5J2QB 4QWAA 4DUYJ 4AD6A 1RKIA 4KO0A 2GJFA 4H4KA 3KLVA 2MHEA 2ZE2A 1S1XB 3PX0A 1EHWA 4NXNF 5K8PA 1TUVA 3OR2B 4KHPF 4YB5A 2XMVA 2YKQA 3GFHA 1FEHA 3CJ8A 5HMYA 5J1PA 1U25A 3CD7A 3FBFA 3KNGA 5F3ZA 4IYQA 1UMJA 2HZAA 5C5JA 2IVYA 3AJ1A 1TFWA 3QO9B 4RW9B 3BO3A 3PW7A 1R0AB 2CPHA 1S9GB 1T8EA 3HVAA 4ETXA 4ZVPB 2Y9HA 1U09A 4QCLA 2DHAA 4DFKA 3PW0A 2IVMA 1Y5IB 3I4PA 2HHQA 2W2MP 4Y0FA 3I9ZA 3UDVA 4LIRA 3SIPB 3MDFA 2MLYA 4ZJOA 2OIHA 1B3TA 3NGSA 1NK4A 2MLXA 4QW9A 1G6BA 3M32B 1OQ6A 4V19X 1PC4A 1FO1A 2GGPB 4DS4A 2UUAF 4QQBA 1U6FA 3KJQB 3KUGA 3HHLC 2XCPA 2NUHA 2XHCA 4RWXA 4Y2KA 5CABA 1HBOB 1G2EA 1OO0B 3VF0B 3TO8A 2KHDA 4ZP8A 2R8GA 4FF3A 1OPZA 2R2TA 3HVRA 2RKIA 2EK1A 3HSGA 4IO1A 4Z7YA 1SBRA 5ETVA 3NOCA 2A0FB 4OYPA 4G1QB 3OXFA 5T14A 2KG1A 4Y2CA 2OSRA 2M2BA 3R5CA 1HBUA 4IOAQ 2IC3A 3PIOQ 1M1HA 4ZCIA 5I42B 3CCUS 3T5HA 3IS9B 4OYWA 4NRTA 2QV6A 2KH9A 4RO0A 1XJWB 3SEOA 3QT7A 2MHNA 2B8QA 3P5BP 1HWLA 4A46A 3VQSA 1AFJA 2XWYA 3TI0A 4ANEA 3EX7B 3MEDB 4ECRA 3CCMS 3T1HF 4USTA 1JMTA 2MKHA 3TYTA 4CZCA 4DV4F 3ENAA 4KE5A 3S01A 2KT3A 4OI0A 4UZBA 3OL6A 3H40A 4Q7AA 4J9PA 2BEFA 3SCIE 2AEMA 2LMIA 1A6LA 1YJ7A 1R0BG 1VQ7S 1U0SA 5LT5A 4M63A 3DRXA 5EN1A 2GO9A 4J9LA 1J5OA 5J2PA 2P8IA 3NBPB 4WU3A 3DLEB 4UOCA 1KR4A 4RL1A 2KT5A 3RAQA 3M2UA 2R7TA 2AGPA 3DYAA 3ISNC 5KTQA 1BQMA 3EVWA 1SJ3P 5B0DA 2J0WA 4R0EA 5HROA 2ZOFA 4DFJA 3SDEA 3ZFVA 3NKYA 4HACB 4KH1B 4UQGA 3MCNA 1F0XA 2A2CA 4WXOA 1NKEA 2IRUA 1S4FA 3ICLA 3NGTA 3EGZA 4KC5A 3MMAB 3MFIA 2CQBA 2XS5A 3MAAA 2UXBJ 4F0KA 2FLOA 2DR5A 3O1LA 2MSSA 5KFZA 1N8RT 2K1RA 4J5OA 4FN5A 1ZH5A 1Q16B 1SIZA 1FTCA 1U26A 4RW7B 3CDEA 1VLYA 3HVTB 2RS8A 2FHOB 2V34A 1F3FA 1X4GA 2B56A 5JVGQ 1U1QA 4ZLJA 3POTB 5CCLA 5KT3A 2YWKA 3I0SA 3W2VA 4K0KF 1CS4B 3OSPA 4JI2J 2LA6A 2BQ3A 3PW4A 4NYOA 4BS2A 2B6AA 3FKBA 3D1OA 3PTWA 2BW7A 4LR7A 1T3NA 1JLGA 4S0MA 1TU0B 3CCJS 2DPIA 2L08A 4LFBF 3V6DB 2I5JA 2C2EA 1HQUA 3V4IB 1M0SA 1ICEB 2DNLA 4LF4F 2OPPA 3DLBA 1X5PA 1R8PA 4DX6A 4WP9A 2V4JA 4I64A 5KT4A 2B7CB 3PACA 2G2OA 2GA7A 3UCZP 4QWDA 1S7IA 2COLA 2BM0A 3QRPA 2BM1A 4CM0A 1VJWA 3UDCA 3MOZA 3C6TB 3RAMA 4YHHJ 3NNAA 2VDHA 1CVJA 1BQNB 1CQMA 3MMJA 2DEIA 4NCGA 5HMXA 4F26A 3BGRB 1R6VA 1SQGA 4EUVA 2AGQA 5HLFA 4M5DB 3HP6A 3P49B 4FVCA 3BSOA 3Q8QB 4NA3A 1LWFA 3RU0A 4YR3A 1RCXB 4DZDA 3ZO7A 3KK1A 5E3CA 4IDKA 2E7VA 2Q1LA 4C6AA 1MWQA 4XDDA 4ED2A 2VQEJ 3D0HE 1V9OA 1P1LA 3J81j 3PFEA 2SXLA 5EUHA 2BJ3A 5KFMA 3UCUP 4Z2XA 4QJVA 3CMAS 2HQFA 5DDOC 1PCAA 4OMFG 4M5HA 5B09A 5CYJA 2G0CA 3TEHB 3OTOF 5KT7A 1BC6A 4IFVB 3PRDA 2XMKA 1FVSA 4PG8A 4JI6F 1U7LA 2E66A 5KFNA 3C6UA 4USKA 1HQEA 4WPAA 4LVNP 4LBPA 1UVMA 1XQIA 3SXLA 3LP2A 2RF2B 3NOGA 3HLUA 3VAGA 1YJ9S 2DIUA 5AJ3F 3T1YF 1SUQB 1MG7A 1RT5A 1WKLA 1FE0A 1UZDA 3CCVS 4IH5A 1U48A 2E5LJ 4QIGA 2AW0A 1NLKL 1IWAA 5F8GA 4C8LA 2C2MB 2NPFA 1XR6A 1FF2A 2GO8A 1B0PA 1SC4B 3P96A 3UNYA 2CYYA 1Q8IA 1YITS 4DMZA 2MKIA 1Y5NB 4MK7A 4QR1A 1FD8A 1VQLS 4WFAQ 5D0EA 1XMOJ 2CJKA 1MMDA 5KFSA 2V6AA 3Q8UA 2EG1A 5HN0A 4RBUA 3CCZA 5F9LA 3C16B 4LSLB 4O3SA 3NRBA 3G6XA 2XWXA 3WX4A 4ECWA 3MR7A 2RQKA 4HDHA 1NNDA 5A8RB 1FVQA 4PWDA 3U7JA 3BJYA 3D6HB 4XO0A 2VASA 4DPXA 1Q0NA 3HMJG 4DV6F 2YQ1A 4TU8A 3KLEA 2BJ8A 3BBFA 5LL6d 5LOQA 2PN6A 2BANB 1Q8KA 4ED3A 3JTPA 3HSJA 2UV8A 3J81Y 3IRXB 2FGCA 3T41A 1R43A 2AT1B 2ZJPQ 3DM2B 2DCUB 5KOXA 2HWIA 1EQ0A 2DITA 3E8OA 2FY8A 4KO0B 3R3TA 5CYMA 3R1LA 1CSJA 4CP5A 5BXIA 2ZE2B 2HKEA 2HVIA 2F9JA 3BO4A 4RPFA 4RUBA 4J9MA 2VF3A 4PG5A 4X84A 1PYOB 4EEYA 1CC7A 2XCAA 3IAM9 1QUPA 2UUCF 3T6BA 2MKSA 1Q86T 4PCQA 3UO0A 2M70A 2HYIB 2ZM6F 4K5RA 3F0NA 3UDLA 2RSQA 4PXCA 5DS7A 3OLBA 4ZLLA 3H90A 5I3PA 2JDJA 1DZ5A 4U9RA 2JVRA 3U02A 3L09A 4O0NA 5LJ5Y 5HMWA 2DR7A 1V6HA 3RBZA 3DOKA 3RBEA 1RBOB 4DZ6A 2R2RA 3A12A 3JS9A 3UW1A 4A8MP 4DPWA 2ZH4A 2ACYA 2ZHAA 1S76D 1NB2A 4K5SA 3DMJA 5DQHA 5KT5A 3LUYA 4KT0C 3EDQB 1ZOTA 1XBWA 1FNXH 1FRKA 9RUBA 4MIBA 3WZ0A 4CRJA 3EICA 3OVAA 1PYSB 1D0EA 1FXDA 4C8NA 3HT3A 1GT8A 5H9EJ 4R25A 4MH8A 3E01A 4C11A 1HA1A 2FZGB 2JEGA 3LP1A 3MPYA 1OQ3A 2GMLA 1Z1ZA 3OTBA 3UN2A 2KYXA 4IH7A 2XI3A 2JFDA 3I5CA 3NNCA 1Y00A 2EBEA 1B99A 1SKUB 3M6XA 2RKIB 2OD6A 3K57A 3VAIA 1B7YB 1S77D 2FY1A 2LLZA 4QWCA 1SQEA 4M5GA 4ID5A 2DPJA 2ZOGA 1Q82T 1RLCL 4JBCA 2KRBA 2E1RA 1S6QB 5GAHU 1HBUB 4LF6J 2ZFHA 2IC3B 4FBUA 3ZTRA 2E44A 2CPYA 3CUNA 3KFWX 3QJJA 2D69A 2P2CB 3I56S 1RU1A 2DT9A 4ZVOB 3THTA 2ROGA 1XWLA 4QIVA 2WSCC 4WCEQ 2DGWA 4F3MA 2KO1A 4I2QA 2XY7A 2R8JA 1KOHA 2Y1RI 2DO0A 1YX2A 1RT1A 3UE2A 3CJ4A 4LRAA 4MFBA 2QJ3A 1YVFA 4KSEB 4PQAA 4DR4F 4MYUA 4OFZA 4WJBA 3CW2C 2CQ1A 4YDXA 4N77A 2I9SA 3KG1A 3CE8A 3A8JA 1XMQJ 3KK3A 2MLZA 1QAXA 4HI2A 1VRTA 3N9UC 3C8YA 2RS2A 4TKTA 3LAKA 4HT5A 3SYZA 1HI8A 3ILLA 3B78A 4UF4A 1U2RA 3H4DA 2HQIA 1Y7PA 1J5OB 1ROFA 2J7UA 3IBCB 1RKJA 2CQ0A 4A8WA 5J2PB 4DFPA 2Q79A 2BVZA 3M2UB 3DYAB 1BQMB 2ZNZA 3TZYA 3F56A 1CJUA 5HROB 3NS5A 4ZP9A 5DLGA 1QVFR 3SFGA 1RT3A 2CAJA 2RDJA 2DNHA 3DGVA 2QL7B 1S12A 1U49A 1KHWA 3PXGa 5DLFA 4BCAA 2DRAA 5D0RA 3GB0A 4JI5J 3CEDA 1A0OB 2E5JA 4GRSA 4OV1A 2Z4PA 5B08A 2YWWA 2YPYA 4PWUA 2BRLA 1T3OA 3C46A 1EP4A 1VQ5S 3MAAB 2YWHA 5EDWA 3PYFA 3KHRA 1S1WB 1FJEB 2DBBA 2K1RB 3L95X 2ABYA 4KV8A 2QA2A 3BR8A 3Q2TC 1L3UA 1TL3B 3KLHA 2M88A 3UNGC 2ZBRA 1O0PA 4FYWB 3H2UB 2MY8A 3I0SB 3W2VB 1WC0A 4B3MJ 2HQ3A 4ZVTB 1YRXA 5CA5A 2B6AB 1VQKS 5AE2A 3FBCA 1VBZA 1HWKA 1OYEA 3TUZC 4FP9A 2VONA 4I6AA 4RBVA 2IJNA 2XSJA 3VAJA 1JLGB 1F1BB 5KFDA 3ZTOA 2I5JB 1HQUB 1RP5A 4NZ6A 2R7WA 3NP5A 4OZJA 4X4QA 1HYSB 3G8QA 4KHMA 1XIQA 2OPPB 1X60A 3SCLE 2XS2A 5CCMA 4EYIB 4MJKA 3QGHA 1WSVA 2BA9A 2V4JB 4NEYA 3OBIA 3I5AA 3I87A 2D3UA 4C7QA 2J0XA 3CNQP 2YXLA 2G0JA 3CPWR 3I9V9 4Y28C 1GEHA 5JUMA 2XMUA 3G2XA 1RHMB 3MHYA 4I2PA 2HIYA 2FVSA 1HNIA 2BKPA 2LEAA 2P9GA 1JK9B 1LKZA 4NCGB 2BW2A 3BM7A 3KG4A 5L1JA 4M8LA 4LRDA 3H5XA 4P75A 4URSA 7FDRA 5HLFB 1W7WA 5KFWA 3IAS9 4H4MA 1LWFB 5KFYA 4KPCA 4RNFA 2FJBB 1D9FA 2B51A 1IM4A 3KK1B 2JLGA 1XTZA 4IDKB 3TZZA 3EXYA 5E3QA 1EIYB 4ECQA 5KT2A 1ZPVA 1N48A 3LPEA 4ZLNA 4U8VA 3JQJA 4E0DA 2ZHBA 2GIFA 3BKFA 1WI6A 5LM7E 3TA0A 2JC1A 3FSIA 5BYQA 4OX6A 4TQSA 1P1TA 2GFFA 4A8SA 1JJCB 1FXRA 4ZPDA 2DNQA 2DK2A 4LMZA 1ZA1B 4M5MA 3TUPA 1FCAA 2Y1LB 1FRLA 4J91A 1ZM9A 2IPOB 1AYEA 4PEOA 3C6UB 4WTYA 1HQEB 2XZWA 3LP2B 3GYGA 2WSEC 4OL8A 2Q3PA 3MR6A 1TKXA 1RAJA 1RT5B 2DIVA 2OPRA 4KR0B 4DL7A 5K9FA 4OI6A 3W66A 4C8MA 4WP3A 3R7SB 3R5AA 1UETA 1KWMA 5KFQA 5HQMA 1NPKA 1YJTA 3KDOA 1U1RA 3CJRA 1WD6A 4CLSA 2V2ZA 2UXBF 1NMEB 1W25A 1S97A 2NR0A 3AB4B 3DLLQ 2NYHA 1UJ6A 2J0QD 4ZP7A 3CO9A 1CLFA 3MM8A 4DR2J 4HEA9 2QIFA 2VIHA 4Z37A 5DETA 4HYKA 5CD4H 4ED8A 4FPIA 2ZH1A 1DQ9A 5AXNA 4PWDB 1H3DA 1M1GA 4TYBA 5F8MA 3MUVP 4JI2F 4DV0J 3KTQA 2H5IB 4ECXA 3DRRA 5E7OB 3T9NA 3KLEB 2Y1JA 4A8XA 3F73A 1EB0A 2RQCA 1LEOA 2AYMA 4KGXB 2BOPA 2X1AA 1NM2A 2RMLA 3RTVA 4X4PA 5RUBA 5T7LA 2C3OA 1REVB 4IKAA 3PRBA 3K0JA 3PVXA 3BYRA 3OW2R 2VHGA 3J7A1 3OJSA 2QX0A 2H65B 1C0UA 1TL4A 5CYMB 1PAUB 2EFNA 4WK1A 3K5OA 4F67A 2Z0GA 2ZH2A 1I51B 2AF6A 4K4ZA 3DXBA 1RABB 2FJVA 3D4JA 3QRRA 1RWOB 4FKYA 3SSRA 2CPZA 4YHHF 1KTQA 3UR0A 1N56A 1OY6A 2HHSA 1CJVA 2OPQA 3NCPA 2GVZA 2ZOMA 5C7PA 2HAIA 1D8ZA 2NZCA 1RT2A 2E1CA 2IYIA 3W8PA 5HJYA 4LRFA 3DOKB 4WK3A 4F50A 2L9WA 3D6FB 3QFWA 3KJFB 3R5DA 4OHZA 7FD1A 3DU6A 3QSIA 2VQEF 1K1QA 3DMJB 3EZOA 1VGYA 3ENWA 1R7IA 2W9CA 4F2SA 4LQ9A 1IQTA 2DEJA 4USHA 5D4PA 4L3KA 2AYBA 1X4FA 4OZNA 3MR2A 2EW9A 3JSMA 4IG0A 1VIOA 3EGVA 5DO2A 2BZ2A 4C11B 1Z4UA 1B4SA 3LP1B 2LQ8A 2IM1A 5CH7B 1MW7A 4Y2AA 4P52A 3US5A 4DX7A 2F4VJ 1NU4A 1FJCA 3WHIA 3CULA 1KFDA 2CZ9A 4WYWA 1T9TA 2MQOA 4Q5VA 1KOOA 1S0VA 3RB3A 5GMKa 4ELVA 2AZ1A 4Y6IA 3NL0A 4ID5B 3FQKA 1QY7A 2EPIA 4LR8A 2E5LF 4W90B 1N33J 5HATA 2ZUAA 1KC8T 1M5KC 4K4VA 1WHVA 1SJQA 3B4MA 4HKQA 2Z57B 1UW4A 3BV8A 3NAIA 2YKOA 2ZKTA 3FGVA 1HQ2A 2BV3A 5KG7A 4YP3A 4K4YA 4I2QB 1SJFA 4ILMA 1UA1A 2NSCA 1RT1B 3QSYB 4AQYJ 3VGVA 1RE1B 3F44A 3QLHA 4XTTA 4MFBB 3CMQA 4ZJLA 1ZZFA 1WEXA 1RAGB 3AHPA 3KK3B 4PUOA 1YJNS 2ALZA 4NLUA 2CPXA 1N36J 1VRTB 3J80U 2QN6B 1C0TA 1JLBA 1DARA 4WKYA 2Y8YA 1JNRB 2HBQB 2WONA 3VWSA 1UWAA 1CBKA 1SJ1A 3CJ2A 1PJ6A 3T6JA 1ZAWA 4ZDNA 2QYCA 2AJ4A 2MB0B 4C8OA 3GSIA 3K5NA 4XDCA 1GX5A 4U7CA 3DLJA 3HI9A 1P27B 5D0HA 1CJUB 2IA0A 1SV5A 1TUWA 1RT3B 3GJQB 5A8KA 4ZN1A 1Z2LA 4U8YA 3P4UB 2O3DA 1HI1A 1ACMB 3T19A 1FFSB 2CPIA 3PKYA 2MPUA 4WFBQ 2HLTA 2MZ1A 1Q81T 3I32A 2D9PA 2XTJP 4KV8B 2KRRA 3BZQA 1HW8A 3AJDA 5L46A 2HBYB 2ZJQQ 2AJ2A 1APSA 4JI1J 1U6BA 1MWZA 2KXHA 3G6YA 2UZAA 1HBMA 1U1NA 3D9BA 3W2WA 4LVOP 2P6TA 1RA7A 4MIAA 2VJVA 4BC9A 4ZPCA 3R7NB 2XSJB 1JLAA 3A8KA 2NUUG 1MSWD 4JI3J 3ZZTA 1WC5A 4NLWA 2PSZA 4RUHA 2DR9A 1PIEA 1MNEA 4NZ7A 3ULHA 1YWXA 2MZTA 2RNEA 1YRUA 3DC2A 2MKYA 1S0MA 2CQ3A 4DQPA 4LRCA 1VQYA 2ASJA 4K59A 3PG9A 2BXJA 2AYGA 2APOA 2MQQA 5K8OA 4DV1J 2XM3A 3CGIA 1O5JA 4JYAJ 4NZ0A 1RAAB 1P9QC 4I2PB 3DNCA 3TRGA 3CB4A 1HNIB 1BY9A 2RRAA 4LF6F 1KS2A 1DTTA 3BQ0A 2DH8A 2B3TB 2OFHX 3LO3A 3H20A 1CPZA 4PXDA 3UD4P 4H4MB 3IBFB 1KEKA 5A6PA 1P8GA 4QIEA 2H54B 1AT1B 2UVWA 3EXCX 3LTOA 2HWTA 2CZVC 1WUUA 4IFYA 3W9JA 3DCAA 3M8RA 4DPOA 1IBKJ 2KFNA 3S6EA 5DG7A 4ILRA 1FJGJ 2O5DA 5FDLA 3ZZUA 3OV7A 4KKOA 3IR5B 2XO7A 1XMQF 3TJ8A 1JXVA 1K73T 3HDSA 3EDRB 2IMWP 3KMSA 3VAKA 3WIVA 3H2VE 4P7TA 5DG9A 4DSEA 3AODA 2C3UA 3IMQJ 2RILA 4U95A 2MJUA 1T9UA 1F6TA 2DRBA 1RWKB 4A8FA 2DGXA 4RNMA 3RR7A 3IG1A 2H1YA 4TLQA 2O66A 3QGGA 3GYXB 4L6V3 1TKXB 3K5LA 3D0GE 3PX4A 3T1AA 2OPRB 3M8SA 3HULA 1N6QA 3OR1A 3HHDA 2L9DA 3TA2A 1JX4A 2DYAA 4JI5F 4LUBA 4EZ9A 1K1SA 1TUGB 2NS1B 3J7AN 3BGLA 2AEFA 1NSQA 2XMJA 3PIPQ 3CCES 2HLUA 3ENQA 1VFJA 3BGFA 2UP1A 1K8AT 3BPDA 3G4SS 3GR1A 2NREA 3W65A 3MM8B 5B0GA 1NSKL 1RADB 3TAMA 3O44A 3ENVA 1FX2A 4LQ3A 3M7VA 2J8SA 2J7WA 1VMBA 4DU8A 1KQSR 4J37A 1R3NA 3VR1A 2DNGA 4B3MF 2R7VA 1S0NA 5E41A 3S7RA 2AD9A 4ZKAA 1JWWA 3DRRB 3TQ1A 1KQGB 5D4NA 1T9XA 2V50A 3PNIA 1S57A 1NJIT 3WX8A 3J7YU 5T7LB 4LF2A 4YS2A 3NGDA 2FJEB 3CVKA 3NWGA 2MQNA 1RGVA 4HR2A 1QAIA 3QRQA 1LFPA 2JOQA 2FVCA 3E3XA 1C0UB 2R8IA 4RR5A 4C48A 4MKBA 2IBKA 3AT1B 1IKXA 1KONA 1X8DA 2U2FA 4DCOB 1RAFB 2DNOA 3TARA 4K2JA 1NH8A 3Q8RB 4ZP6A 3IR6B 1L3TA 4UOFA 4BLGA 4X2BA 2UXDJ 2F9DA 4DPUA 4ES3A 3M6VA 1CJVB 2OPQB 2MZSA 2GVZB 4OI4A 6AT1B 1OMSA 5A2QU 1TK0A 4CO0A 2I8EA 5GAHI 1RT2B 5CD4A 4KQZA 4F0MA 4I1TA 4DXLA 2K06A 1Y3KA 3OFFA 1YBTA 4FNIA 4CNYA 2WVEA 4BHQA 2EC0A 3PJ9A 2J8AA 2WBMA 3R1HA 2Z56B 2LU2A 5L1KA 3ZZPA 4P74A 3UCGA 3MEKA 2MKCA 1KLMA 2W9CB 1WKJA 4MTPA 2VC0A 3RR8A 5LXYA 5F8LA 3OL9A 3JSMB 4IG0B 5H9FJ 1SL0A 2BMBA 1QE1A 2V5HG 2X1GA 4CO5A 5IT9U 4OLPA 4I6YA 1QM9A 1TFYA 2F40A 1MN7A 2HQDA 4JV2A 3CT9A 2KZMA 5L8RC 1VC6A 3MURP 3W5YA 2HAFA 4G6VB 3TUIC 3D3CJ 3W5ZA 2BRKA 2MEWA 3FVYA 2KN4A 4V19J 2PC6A 1S72S 4FKXA 4Q8FA 1HWJA 2XMWA 2QSWA 1YG0A 3DOMA 2MZJA 4OLOA 2NLWA 4CIOA 1H72C 1WTBA 4WKRA 5K8NA 4HHUA 3TEGA 2AJ1A 3K17A 2VBWA 1P6TA 1JXLA 1BWEA 3TANA 4QBUA 2F5GA 4O3NA 2NZ4A 5KFPA 4FNHA 2LYVA 2ALYB 3JYTA 2VKRA 4Y2MA 2GMHA 2QL9B 3B82A 1SC3B 1R8HA 3L4BC 1FEEA 1PBAA 4FVMA 4DR2F 2UU9J 1KHVA 2DHHA 2W7AA 5GAEI 3QLHB 4QWEA 2CJQA 2DXEA 3EM1A 4IG3A 1RWUA 1VDHA 4C9DA 2NXNA 4J9OA 2OGUA 2V2VA 2JLFA 4ZPAA 3JAMY 2DHXA 2AMCB 4TQRA 1GX6A 4CYUA 2OMLA 2Y0BB 4DV0F 2AJ0A 1HMVA 4PUOB 3BO2A 4P2MA 1PKUA 1WOPA 2PFDA 4OJHA 5L1IA 1ITPA 5DDPC 5D8HB 3DHWC 4OI2A 3Q8YA 3M2RA 1C0TB 1B70B 5KFUA 4J9UE 1JLBB 2FLNA 2P9EA 3HF5A 4NLOA 2WONB 1O6XA 4V1Ak 1SL1A 3MM7A 1G4CA 2FLPA 3VHQA 3PRVA 1Q5YA 2CADA 4IRDA 1H73A 2EI5A 2RUSA 3FDSA 5EX3A 4FYYB 2IA6A 1WHWA 4UQTA 2HS3A 3TZXA 4J7CA 3KG0A 1IWGA 3VGUA 1FERA 1SV5B 1UEKA 2CG4A 3G96A 3HHKA 1X7VA 5A8KB 3W9HA 5LSRA 2KJWA 4XPEA 5D77A 2R7SA 4OJ3A 4B3RJ 4ZOSA 3HM9A 1G3OA 4N7TA 2RAQA 2CRLA 1LWCA 4NL5A 1FRJA 5KFTA 3KJVA 3SSSA 2WRMA 4ELUA 5DGBA 2VL1A 3TNVA 2DCLA 4LBIA 3R5BA 5F0UA 2RQMA 4C98A 2VJUA 1HBMB 5HK4A
chains in the Genus database with same CATH topology
1XQIA 3ZTRA 3FBFA 1NHKL 1B4SA 1VYAA 3VGVA 3BBFA 4DZ6A 3VVTA 3ZTOA 3DDIA 3JS9A 1K44A 1F3FA 3PRVA 1BUXA 1F6TA 3FBBA 2BEFA 1NB2A 1WKLA 3BH7B 1NUEA 3EMTA 3ETMA 4F4AA 3VGTA 1XIQA 3VVUA 3FCVA 3ZTPA 2HURA 4EK2A 4FKYA 3Q8VA 3EVMA 3PJ9A 1NLKL 2DXFA 4DUTA 2CWKA 4UOGA 1S57A 3ZTSA 3EE3A 3WX8A 1NDKA 3FKBA 3ZTQA 1MN9A 1BE4A 3EICA 3VGUA 4ENOA 3Q89A 3NGUA 1HIYA 2AZ1A 2HVEA 2DY9A 1PAEX 1U8WA 3L7UA 3NGRA 5C7PA 4S0MA 5IOLA 4UOHA 4CP5A 5BXIA 4HR2A 3BBBA 1NDCA 1WKJA 3GPAA 2BX6A 4C6AA 3GP9A 3B54A 3EVWA 3R9LA 2DYAA 3ELHA 1NDPA 4W98A 3NGSA 3Q83A 2NCKL 4F36A 1KDNA 3FCWA 3EVOA 3G2XA 3Q86A 3VGSA 1HHQA 2ZUAA 3BBCA 3MPDA 1B99A 2HVDA 3Q8UA 3EM1A 2DXEA 2B8QA 1LEOA 3FBEA 1NSQA 3BH6B 4ANCA 1ZS6A 3NGTA 1MN7A 2AZ3A 4ANEA 1NDLA 2VU5A 1BHNA 2DXDA 3EJMA 1W7WA 1PKUA 4DI6A 4WBFA 2B8PA 1WKKA 5CABA 1S59A 1HLWA 1EHWA 3FC9A 1JXVA 4UOFA 4ANDA 1NSKL 1S5ZA 1NCLA 4FKXA 4KPCA 5CAAA 1UCNA 3FBCA 1NSPA 3Q8YA 3B6BA 3ENAA 1LWXA 3DKDA 1NPKA 4O0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XQI A;  3ZTR A;  3FBF A;  1NHK L;  1B4S A;  1VYA A;  3VGV A;  3BBF A;  4DZ6 A;  3VVT A;  3ZTO A;  3DDI A;  3JS9 A;  1K44 A;  1F3F A;  3PRV A;  1BUX A;  1F6T A;  3FBB A;  2BEF A;  1NB2 A;  1WKL A;  3BH7 B;  1NUE A;  3EMT A;  3ETM A;  4F4A A;  3VGT A;  1XIQ A;  3VVU A;  3FCV A;  3ZTP A;  2HUR A;  4EK2 A;  4FKY A;  3Q8V A;  3EVM A;  3PJ9 A;  1NLK L;  2DXF A;  4DUT A;  2CWK A;  4UOG A;  1S57 A;  3ZTS A;  3EE3 A;  3WX8 A;  1NDK A;  3FKB A;  3ZTQ A;  1MN9 A;  1BE4 A;  3EIC A;  3VGU A;  4ENO A;  3Q89 A;  3NGU A;  1HIY A;  2AZ1 A;  2HVE A;  2DY9 A;  1PAE X;  1U8W A;  3L7U A;  3NGR A;  5C7P A;  4S0M A;  5IOL A;  4UOH A;  4CP5 A;  5BXI A;  4HR2 A;  3BBB A;  1NDC A;  1WKJ A;  3GPA A;  2BX6 A;  4C6A A;  3GP9 A;  3B54 A;  3EVW A;  3R9L A;  2DYA A;  3ELH A;  1NDP A;  4W98 A;  3NGS A;  3Q83 A;  2NCK L;  4F36 A;  1KDN A;  3FCW A;  3EVO A;  3G2X A;  3Q86 A;  3VGS A;  1HHQ A;  2ZUA A;  3BBC A;  3MPD A;  1B99 A;  2HVD A;  3Q8U A;  3EM1 A;  2DXE A;  2B8Q A;  1LEO A;  3FBE A;  1NSQ A;  3BH6 B;  4ANC A;  1ZS6 A;  3NGT A;  1MN7 A;  2AZ3 A;  4ANE A;  1NDL A;  2VU5 A;  1BHN A;  2DXD A;  3EJM A;  1W7W A;  1PKU A;  4DI6 A;  4WBF A;  2B8P A;  1WKK A;  5CAB A;  1S59 A;  1HLW A;  1EHW A;  3FC9 A;  1JXV A;  4UOF A;  4AND A;  1NSK L;  1S5Z A;  1NCL A;  4FKX A;  4KPC A;  5CAA A;  1UCN A;  3FBC A;  1NSP A;  3Q8Y A;  3B6B A;  3ENA A;  1LWX A;  3DKD A;  1NPK A;  4O0N A; 
#chains in the Genus database with same CATH topology
 1J27 A;  1RWX B;  1Q79 A;  4PWW A;  1EKR A;  4MKY A;  3W2W B;  4RUA A;  2GCF A;  3PW2 A;  5A6W A;  3QAE A;  2F8M A;  4PG6 A;  1C1B A;  4CH1 A;  5F0W A;  1T03 A;  1XMB A;  2P6S A;  1JLA B;  2GMJ A;  3AXK A;  4C8K A;  4AL5 A;  1RTZ A;  2W8K A;  3BN7 A;  2UUW A;  2IVF B;  4CCH A;  3VTI A;  2KVQ E;  3MD1 A;  1F5A A;  1OWX A;  4LJM A;  2XLK A;  2F4V F;  3RJM B;  4CLF A;  3GP9 A;  5ETO A;  2ZHO A;  2ASD A;  4QPX A;  4NCA A;  1FWK A;  2AHO B;  2HFO A;  1HHQ A;  2HFS A;  4ED1 A;  2WW4 A;  2EFO A;  3JQK A;  5I3U A;  4P71 A;  3GCW P;  3BH6 B;  4IQM A;  2XMT A;  3PY8 A;  4WTO B;  1VQO S;  3Q8P B;  5F8J A;  4DCP B;  4ECZ A;  1N33 F;  4MKV A;  2VU5 A;  3QT5 A;  1H74 A;  2W2Q P;  2DO4 A;  3KLI A;  4BDP A;  4JOU A;  2JX2 A;  1D8Y A;  4X64 J;  4P72 A;  1DTT B;  4PQU A;  3IGN A;  1I5O B;  3SCK E;  3VVT A;  2C3Y A;  2W4C A;  2JVO A;  4IFY B;  1XNR J;  2Q43 A;  2DXF A;  4AQY F;  3PR4 A;  4RKU C;  1TKZ A;  4A8Q A;  2J9D E;  4OI3 A;  2GZO A;  5GME A;  4DUZ J;  3PHE A;  4HHH A;  1X4H A;  1U45 A;  3RUB L;  5FDL B;  1NDC A;  2OP5 A;  4B9N A;  1WHY A;  3R9L A;  4HL9 A;  3PM9 A;  2RDD A;  5DQI A;  1KQF B;  2CDR B;  4CLT A;  3AA8 A;  4JI0 F;  1OJ4 A;  3FSY A;  2AX1 A;  1O8B A;  3OPK A;  1Q5V A;  1UA0 A;  4CLL A;  3D5M A;  1V5V A;  1GXU A;  3I55 S;  3IG1 B;  2C2N A;  5J2M A;  4B08 A;  5M2R A;  5IXU A;  2YNI A;  1IXK A;  1Q1K A;  2VG5 A;  3ZNJ 1;  4R8U A;  3D28 A;  3JSB A;  4P2F A;  4GO5 X;  1TEL A;  2OFG X;  4J9Q A;  1Y9O A;  2J6U A;  3PJW A;  5U47 A;  2V63 A;  1NUE A;  5DM6 Q;  3TR5 A;  2OPS A;  4NI2 A;  2OJ3 A;  4M5K A;  4RZR A;  4HLB A;  1RI7 A;  1T94 A;  4MMO A;  3R27 A;  4LRE A;  1WTF A;  2ZIT A;  3GFZ A;  5K20 B;  1C4A A;  5LJ3 Y;  4KJI A;  3VAF A;  4B17 A;  4DPY A;  2OLW A;  2N4C A;  2FJX A;  1KLN A;  2C2Z B;  1KKH A;  3TAM B;  3O5T B;  4ZPW R;  4JI1 F;  2HFZ A;  5KG6 A;  2UXC J;  2HHW A;  2JFK A;  4X4N A;  2V94 A;  2WK4 A;  2CNL B;  4WE1 A;  4IRC A;  2J5A A;  3TA1 A;  1QJH A;  1X31 C;  3G86 A;  2Z8Q A;  1AUD A;  4ID8 A;  1U1O A;  2B9W A;  5B0C A;  2W8L A;  2ADC A;  4QYR A;  4IR9 A;  4FF4 A;  1S59 A;  2PI4 A;  2E9R X;  4JI3 F;  4DEZ A;  1TKT A;  4X4T A;  3UWT A;  4OZL A;  4ZMM A;  3D67 A;  3HK2 A;  1T7P A;  3LW5 C;  4G3I A;  3A8I A;  4P73 A;  1TVR A;  4H4K C;  2RHS B;  3FCV A;  2I2Y A;  2DNM A;  3QWP A;  5DQG A;  1FFW B;  3SFU A;  3GII A;  1IKX B;  1RTI A;  1RA6 A;  4UW2 A;  2FYX A;  4DV1 F;  1H38 A;  1OIA A;  4F4Y A;  2U1A A;  3RYL A;  3MCM A;  4JYA F;  1U8W A;  1VI7 A;  4LF8 F;  1AFI A;  5DRK A;  1XNQ J;  1JJ4 A;  1KDN A;  1YBU A;  2GX8 A;  1JJ2 R;  2A6M A;  2CNK B;  1RB0 A;  3CD0 A;  1JKH A;  1I94 J;  3NCR A;  4GKK J;  2V0N A;  2NXU A;  2QMW A;  2E29 A;  4WII A;  2NXE A;  4NLS A;  1NO8 A;  2B4P A;  3HD2 A;  4QPT A;  1RYS A;  1UEV A;  1HNW J;  2H4W B;  4NA2 A;  3HZE A;  2HGN A;  1RTJ B;  1IBK F;  4YR0 A;  1YLX A;  2V9W A;  1KLM B;  2CWX A;  3MMB B;  4OHV A;  1FJG F;  4G65 A;  4RNH A;  1FKA F;  4USJ C;  2V8G A;  2M4M A;  5GAG I;  2D9O A;  4ZIW A;  3L7O A;  3SZ2 A;  2F8E X;  3MCO A;  2PO4 A;  1QE1 B;  2W2P P;  2V8D A;  1AXQ A;  1EAY C;  1OPI A;  3HHL D;  3DLG A;  4TN2 A;  2XHW A;  3ZTQ A;  1UFL A;  4KB7 A;  1GFW B;  4OHY A;  1VC5 A;  1WC4 A;  1CJT A;  1DUR A;  1J5E J;  2A6O A;  1WC3 A;  1TL7 A;  1HBN A;  1N34 J;  4TY9 A;  4F36 A;  4ED0 A;  3M05 A;  1WF0 A;  3DOM B;  3K58 A;  5AXK A;  1WC1 A;  2N3O A;  2BOA A;  2E5H A;  4DDF A;  3KXD A;  5EGY A;  1JB0 C;  4CLY A;  1YJR A;  3I82 A;  3JYT B;  2W7P A;  1VHI A;  3N6L A;  4BWM A;  3NG8 A;  9ATC B;  2DNP A;  4N41 A;  2XMM A;  1VOM A;  5KFE A;  4J90 A;  1K44 A;  1UFW A;  1IN0 A;  2G1D A;  3A3O B;  1QSL A;  3O8W A;  2FZK B;  5BYR A;  3RBD A;  4IG3 B;  3IA0 A;  3W7B A;  3E51 A;  1DJ0 A;  2MDA A;  2RUG A;  3OVB A;  3UR3 C;  3OTE A;  4CYU B;  2DHS A;  3L7U A;  1HMV B;  4DR5 J;  1RDR A;  1I3O B;  2HPU A;  2F3J A;  5C25 A;  4J9N A;  1NDP A;  2LP4 A;  2BJ7 A;  3M2R B;  2LA4 A;  4PG7 A;  2QFI A;  2MKK A;  2JC0 A;  3CDA A;  3SCJ E;  1IR1 A;  1YDL A;  3MM7 B;  2VG7 A;  2DR6 A;  4LF9 J;  4C8Z A;  2WCX A;  2KL8 A;  4ICL A;  5KFI A;  1X4E A;  3PO4 A;  4I7F A;  1X9M A;  1SXL A;  3EJM A;  2VFT A;  5IWA J;  6FD1 A;  1VBY A;  2DNR A;  1REG X;  2ZWO A;  1X0F A;  1VLO A;  3CCT A;  1J2V A;  2R4F A;  3QIP A;  3IO1 A;  3DU5 A;  3ISN D;  1JLE A;  3GCX P;  1M5H A;  4Q0B A;  2I6W A;  1B7F A;  2DNZ A;  3BH7 B;  2BE9 B;  2UXD F;  2CPD A;  5IQ6 A;  2DY1 A;  1U6Z A;  3PZP A;  4F04 B;  1WG4 A;  3OQ2 A;  1S10 A;  5ADZ A;  2Z2Y B;  4CT9 A;  1LWC B;  1QSY A;  3CJT A;  4A8Y A;  3EUN A;  3KJV B;  2DGQ A;  5ETL A;  3D2W A;  2XYG B;  2BR0 A;  3IN5 A;  1UAW A;  2QMX A;  3MM9 A;  1U0H A;  4CH7 A;  2DR8 A;  1Y3J A;  2NPI A;  2E1A A;  3CJ0 A;  4Y00 A;  1NH7 A;  1RWP B;  2DGV A;  2VFR A;  1R8C A;  1ZAX A;  1IVZ A;  2FHK A;  2EKY A;  5KT6 A;  2POK A;  1C1B B;  2YNH A;  2O1P A;  3W3S A;  1T03 B;  2D7S A;  4ZCL A;  4ZK7 M;  4LBH A;  3DDK A;  4E8U A;  5CAA A;  3JSY A;  4NLQ A;  4C0B A;  5LXR A;  4F3O A;  1NXI A;  3RZA A;  2KFZ A;  2JEF A;  2ADB A;  4L73 A;  3RRG A;  1F2G A;  1U2C A;  1UW9 A;  4CQ1 A;  3SQG B;  4ZHR A;  5I3U B;  5ETP A;  1D9A A;  3UPF A;  2CWK A;  1NBE B;  2IY5 B;  3ZNU A;  5AT1 B;  1F9E B;  3ITH A;  2DVI A;  1MN9 A;  1O51 A;  2F65 A;  1NKC A;  2V2K A;  1L3S A;  3MPW A;  4L3N A;  3KLI B;  2VUG A;  2YKA A;  1NZA A;  3O6Q A;  2JEJ A;  1PJ7 A;  5GAD U;  1S1X A;  5T41 A;  4TU7 A;  4QYZ K;  2N7Y A;  4B3O A;  4PQU B;  2FHM A;  2G1H A;  1EJ7 L;  1V3R A;  2ZC4 A;  3AQO A;  3HHN B;  1OY9 A;  3A13 A;  1DBD A;  5KFC A;  2A10 A;  2R9L A;  4DL6 A;  2YVS A;  4QWB A;  4I56 A;  1XC9 A;  1JLC A;  1FTR A;  5EWE A;  4L72 B;  4U67 Q;  2XI2 A;  1GTE A;  1KVK A;  2LEB A;  4JV0 A;  2GHV C;  2IMO A;  2UU9 F;  1ZTW A;  1KVI A;  2UVR A;  2EXU A;  1IM6 A;  3MAH A;  4HT7 A;  3PO5 A;  1TKZ B;  4AYB D;  3I5B A;  2FLL A;  1LXN A;  2RQ4 A;  1E6Y A;  2HNZ A;  3BR9 A;  3R5J B;  1RHK B;  3ILJ A;  2HMI B;  3MEC A;  4WU2 A;  4UTG A;  1H2V Z;  1WDT A;  1RBA A;  5J1E A;  4DG1 A;  3CC2 S;  4C8Y A;  4JI7 J;  5JXS A;  3HHE A;  4BBY A;  1R89 A;  1NDK A;  2OUG A;  5HJX A;  1RAH B;  5JMN A;  2CNO B;  3AD7 C;  2CXE A;  1QSS A;  3MUT P;  3I4H X;  3J7Y I;  1ELO A;  5J2M B;  4K50 A;  4Y34 A;  2J9C A;  2YNI B;  2LQ5 A;  4R0J A;  2VG5 B;  4R8U B;  4JV5 J;  3G87 A;  1BLU A;  1QTM A;  3QZ8 A;  1Y10 A;  4OX9 J;  5MLC V;  2OPS B;  2C1E B;  2C42 A;  4NI2 B;  5K5M A;  3OL8 A;  1X4D A;  4KH0 B;  3A8E A;  3R97 A;  2B8P A;  1HKA A;  2BUN A;  2LXI A;  3F41 A;  3VAM A;  2CZ4 A;  1N4L A;  4B3R F;  5F8I A;  4J9V A;  3A4T A;  2X1F A;  4E98 A;  3K7R A;  2E5G A;  5K14 A;  4I4B A;  8AT1 B;  3SV3 A;  1NK0 A;  3BYP A;  1FRM A;  3MTK A;  2RU9 A;  3D68 A;  1TV6 A;  2G4B A;  3PYE A;  3ZTP A;  2YNG A;  4DSJ A;  4N56 A;  3AB2 B;  5L9N A;  1N52 B;  5I3Q A;  3VAH A;  1S1T A;  5B0A A;  1RAC B;  5DJB A;  5IS2 A;  1BE4 A;  3FSX A;  4O0I A;  4ZA1 A;  4J9S A;  4I6W A;  3H5Y A;  3D6T B;  3EZU A;  3CC7 S;  2B9Y A;  3K89 A;  4X4U A;  3MED A;  2W01 A;  4TLR A;  4Y3C A;  1X4A A;  1TKT B;  1HNX J;  1U2F A;  3GIJ A;  2HVD A;  3MPV A;  1YSJ A;  2BKN A;  3A3N B;  1PGZ A;  3C15 A;  4DSI A;  1ZS6 A;  1TVR B;  2AZ3 A;  4LFC J;  3AOC A;  3NLC A;  2ZJR Q;  4CLP A;  3X3U A;  3MCS A;  4KGV B;  3DOL A;  2AYE A;  5DGA A;  1RTI B;  4M5I A;  2YKM A;  1Y5L B;  2EFV A;  4YQW A;  4M5J A;  2KFY A;  4GVB A;  2K7K A;  2HFN A;  3AAW B;  4O44 A;  4X64 F;  4TY8 A;  2MZR A;  2ASY A;  3C66 A;  2VOO A;  2C2D A;  1PO6 A;  4KAI A;  2VZ9 A;  1TL1 A;  3EZ5 A;  2JZ5 A;  1WEY A;  3NGU A;  2HVE A;  2QEX S;  1T95 A;  4K8R A;  1TL5 A;  4EYH B;  4DX8 H;  1XNR F;  2EFQ A;  3Q83 A;  1RWM B;  4FF2 A;  2FJA B;  3MM6 A;  3CJQ A;  4DUZ F;  1EAR A;  3MM5 A;  5G4D A;  3G8T A;  1RWW B;  4DJB A;  1AUS L;  3FRY A;  2KHC A;  2VPZ B;  2DXD A;  3POT A;  1LOU A;  2PDA A;  2CG8 A;  2Z2M A;  1S0O A;  1PG5 B;  3DLG B;  1YJU A;  3OXG A;  5ETQ A;  4Q8E A;  3KMQ A;  3IM9 A;  4A47 A;  2FVQ A;  1CJT B;  2ILZ A;  1U1L A;  2G0I A;  3RB4 A;  4DQS A;  3DI6 A;  3A1Y G;  1HBN B;  5ETR A;  3P3D A;  2F1F A;  3V6D A;  1SJ4 P;  2WBR A;  1NJZ A;  1Q8B A;  2M9K A;  2XUL A;  4O23 A;  3I0R A;  2CKW A;  1KBR A;  3DLH A;  3CIM A;  5KFH A;  1RCO B;  2RT3 A;  2V67 A;  4ZCM A;  4O3R A;  2XY6 A;  4HTI A;  3TW0 A;  1RXO B;  2EKN A;  3IWL A;  4KIA A;  3SSQ A;  4X4R A;  1WDD A;  3MUM P;  1EQM A;  4X4O A;  2GV1 A;  1DRZ A;  4KYZ A;  2FHJ A;  5AE1 A;  4URG A;  1SCJ B;  1NKB A;  1NRK A;  4U7U K;  3BGR A;  2UXC F;  1UVN A;  4DI6 A;  1HAR A;  1UZH A;  4JB8 B;  5CZV A;  3I96 A;  4ZVU B;  1FDA A;  5E3P A;  3CDW A;  1X9S A;  3QT8 A;  5C25 B;  3PW5 A;  1U47 A;  4OV6 A;  1PC5 A;  4CM2 A;  4USU A;  3FBB A;  2JLE A;  1UP1 A;  4JI4 J;  4BC7 A;  2HRY A;  1MRO A;  2QA4 G;  2VG7 B;  4UOG A;  3U27 A;  5KG0 A;  4F02 A;  4ILL A;  1N0V C;  4ICL B;  1GMV A;  1K47 A;  1U1P A;  4NXM J;  3MD3 A;  4F4Z A;  4I7F B;  1M1K T;  2KI2 A;  3LOU A;  1S48 A;  3M8P A;  1YZ7 A;  1S49 A;  3N0V A;  2OEM A;  3QAU A;  3N01 A;  4OYM A;  1BXN A;  3K5M A;  3QIP B;  1NB7 A;  3M4X A;  1JLE B;  3K5P A;  2FIU A;  2IM3 A;  1UJ5 A;  4YY3 J;  1GMU A;  4Q0B B;  1XNQ F;  2KTQ A;  2D1C A;  1HL6 A;  2YKP A;  4LSN A;  4KFB A;  3THP A;  3CD6 S;  4TYA A;  2HBR B;  2QSF A;  4WBF A;  4LFA J;  2NSB A;  1QAJ A;  3LPY A;  3RB0 A;  3SDE B;  4QU6 A;  3UQS A;  1I94 F;  4GKK F;  1FDD A;  2VIC A;  4FS1 A;  1KRP A;  1HNZ J;  3DLK A;  4NOH A;  3ZXW A;  3MM9 B;  4EBE A;  1U0H B;  1HNW F;  4W4M A;  2M7S A;  4DU7 A;  2XBP A;  5C2C A;  2YBV A;  5BJR A;  3ADA C;  3U1L A;  2KXF A;  4NRU A;  3GR0 A;  5D4L A;  4A4J A;  1SC6 A;  1KFS A;  3LF0 A;  4P6Q A;  4B9L A;  5HVF A;  1L3K A;  2VOP A;  2X3G A;  2N4D A;  1HD0 A;  1Y4Z B;  3IR7 B;  4B9S A;  2AJQ A;  3KK2 A;  1HI0 P;  3NS7 B;  2FJD B;  1TMM A;  3KLF A;  4CO2 A;  5LMN J;  1D3W A;  5ITH A;  4FF1 A;  4ZJQ A;  1AZS A;  5C24 A;  4NEZ A;  5GMD A;  2C2K B;  1TAQ A;  1Y11 A;  1EET A;  2WSF C;  2XS7 A;  3V6H A;  2V69 A;  4LT6 A;  1J5E F;  4DV3 J;  4C4W A;  1N34 F;  1RAO A;  3UVJ A;  3FUY A;  4ZHR B;  4FYV B;  1RK8 A;  1VRU A;  3KOA A;  4RJV A;  3TX8 A;  4UY8 5;  3ITH B;  5F41 A;  2B9E A;  2RDI A;  2MQ8 A;  1SIW B;  5AE3 A;  3BSA A;  2IIH A;  3H42 A;  4M94 A;  2VBX A;  3OSN A;  1NHK L;  2ILY A;  1BD6 A;  3QZ7 A;  2OEK A;  1T02 A;  3ZC4 A;  3FCH A;  2PA8 D;  4B3O B;  3KDN A;  4F8R A;  1HW9 A;  5IZH A;  1M5O C;  5D15 A;  4EK2 A;  4RU9 A;  5LMU J;  3QMQ A;  1X0P A;  4YB7 A;  1S79 A;  1JLC B;  2OH2 A;  1WG5 A;  2XQC A;  2RE1 A;  2A18 A;  4C2M A;  3GTY X;  4UOH A;  2PMH A;  1Q53 A;  1RUS A;  3ZZY A;  4QR0 A;  4CTA A;  3EVO A;  1E6Y B;  3G9C A;  2HNZ B;  2GS8 A;  1Q95 G;  4DHV A;  5E5N A;  1FA0 A;  2PFF B;  1FDB A;  2IM2 A;  3GWC A;  4F4X A;  3MEC B;  4OJ1 A;  4DR5 F;  4P2X A;  5J1E B;  4EMD A;  1F2H A;  1FI4 A;  4DG1 B;  2FUG 9;  2HBZ B;  3QNW B;  2AKW B;  5KOW A;  1S5Z A;  3EGN A;  2HSE B;  1S9F A;  3MOJ B;  4X4V A;  1ZYQ A;  4LF9 F;  1F5B A;  2E1M C;  2QE5 A;  3FEZ A;  2MZQ A;  3K8W A;  1CC8 A;  4DQR A;  3HFV A;  4ECV A;  3R8Y A;  5IWA F;  3GMG A;  3J81 U;  1E6V A;  1QUV A;  2W1B A;  4K7Q A;  2DD8 S;  3PHT A;  4Y2I A;  3IXQ A;  3T5J A;  4OYZ A;  3AD9 C;  2Z58 B;  1VS3 A;  3TX0 A;  2ROP A;  4DV2 J;  2FD2 A;  1WOS A;  3HHL A;  3BBB A;  1OY8 A;  1H2U X;  2QG9 B;  4CLW A;  3NWR A;  3GJR B;  1S6P A;  2J7K A;  1NK7 A;  1IQZ A;  4MK8 A;  2IDE A;  1S4E A;  2ATC B;  1S6Q A;  3V6J A;  3T9Z A;  5K14 B;  3GIR A;  3DDN A;  7AT1 B;  5KAK A;  3DRY A;  4USV A;  1TV6 B;  1N54 B;  2YNG B;  5KFV A;  2X7I A;  3FZ2 A;  2XY5 A;  4NPO A;  2KZZ A;  1S1T B;  3DHX A;  1H7W A;  1VQS A;  2VFU A;  3IM8 A;  2HND A;  4MKA A;  3PJX A;  1N5T A;  5B0B A;  1KD1 T;  1TKD A;  1QDU B;  5ETK A;  3DFE A;  5EWF A;  1TTH B;  4PYD A;  4NLX A;  2IAJ A;  2WB1 D;  3M8Z A;  2HUR A;  3H25 A;  3HZG A;  2OAU A;  3ILI A;  5IQQ A;  3L7P A;  3JTN A;  4C0O C;  3UN5 A;  3C15 B;  1UVJ A;  1R8B A;  4PXB A;  3DOL B;  3IWN C;  3OHA A;  1YBA A;  2C22 A;  2YQ0 A;  2YKM B;  3BEG B;  4P9S A;  1WWH A;  2AIR B;  3W1Y C;  4PR6 A;  2J9E A;  1RTH A;  4GVB B;  3U1N A;  3FBE A;  3PYG A;  4N76 A;  3OT9 A;  1JQG A;  4TU9 A;  3CWJ A;  2K8G A;  4O44 B;  4TY8 B;  2V2Q A;  1H2T Z;  5HBM A;  1RHJ B;  2AJF E;  2H51 B;  2PD1 A;  4FDF A;  1TL1 B;  4HTJ A;  4X66 J;  3KJN B;  1IBM J;  2Z2L A;  5L39 A;  3M8Q A;  2HHU A;  2I38 A;  1RAE B;  1FWL A;  3HFK A;  4HH0 A;  5B7W A;  2DRD A;  2LDI A;  1S1W A;  4DN0 A;  4ZVG A;  3CJK A;  2F7V A;  4ED4 A;  3MM6 B;  5IM0 A;  1YK9 A;  3MM5 B;  2YWG A;  5FD1 A;  2J76 E;  3I6P A;  4WYL A;  4EGL A;  2HHH F;  2CQI A;  4LF5 J;  4IOC Q;  3C2P A;  1TL3 A;  4IO9 Q;  3PFO A;  2DY9 A;  1ZM2 A;  3BGU A;  3MFH A;  3GE9 A;  4JI7 F;  4F4K A;  1UTA A;  2XO6 A;  3TJA A;  1RHQ B;  4CLZ A;  2NCK L;  2FC8 A;  4PZV A;  3CC4 S;  8ATC B;  1NJX A;  1U02 A;  2CFX A;  2HGM A;  4ED5 A;  3DI6 B;  2XYH B;  3FQL A;  3E01 B;  4NLV A;  3QJL A;  2Z30 B;  1ZPW X;  4X62 J;  1NDL A;  2A2D A;  1HYS A;  4JV5 F;  1QAY A;  4CO4 A;  1HLW A;  4OYX A;  1BWV A;  2CJY B;  2D3O R;  3SV4 A;  5D78 A;  4OX9 F;  3I0R B;  2GNK A;  4QIW D;  2FJW A;  1X4C A;  5DDR C;  2FZC B;  4MYT A;  2R3V A;  4RW4 A;  3MEG A;  2J6S A;  2VA3 A;  3ETM A;  3MMC A;  3QJP A;  1SC1 B;  4B9V A;  3THV A;  5D0G A;  3LGN A;  1NZ8 A;  4FZV A;  2N82 B;  1F9H A;  1PSD A;  1PAE X;  4OZ5 A;  4FYX B;  4C3K A;  2CQH A;  3D3B J;  1K0V A;  3FCW A;  4O4R A;  2B4U A;  1RIS A;  1UEU A;  2C3M A;  2VFV A;  5CHC B;  1S1V A;  4ECY A;  2IJF A;  3S8S A;  3SBM A;  2VG6 A;  4DN9 A;  1IR0 A;  1LWE A;  2CQP A;  1W2I A;  1MRO B;  4MT1 A;  3FK4 A;  4P7V A;  4TVA B;  3PKM A;  1HNX F;  1SH3 A;  1B64 A;  4DWI A;  5F9N A;  4Q2L A;  1T9W A;  3G8S A;  1ZTT A;  3D7S B;  2BE7 D;  4OZ3 A;  2G2Z A;  4LFC F;  3M8P B;  2FB0 A;  4TNO A;  3HJF A;  5HL7 Q;  2YWF A;  4N8N A;  3GLJ A;  4JI0 J;  2LQJ A;  1MLA A;  5GVQ A;  1LNQ A;  4OZ1 A;  2ZZM A;  2HZV A;  1RBL A;  3B8H A;  1LW2 A;  4YR2 A;  4EWT A;  4P10 A;  1YKW A;  4DR7 J;  4ZIT A;  1UVL A;  3X1L B;  4LSN B;  4KFB B;  2B9X A;  5ETN A;  2WVC A;  1RLD A;  2KYZ A;  3O3L A;  2EC2 A;  2CA9 A;  3FZB A;  1U1K A;  4K2X A;  3B4D A;  4JI8 J;  3MR5 A;  3W60 A;  2D74 B;  5GAD I;  3HX9 A;  3DLK B;  1URN A;  3D1H A;  2KB2 A;  3D66 A;  3QGI A;  5D3G A;  1EP4 B;  4NLY A;  3GV5 B;  2QMU B;  3CCQ S;  2FTR A;  4RWW A;  2QLJ B;  1U8S A;  2W4P A;  3DGP A;  4WFN Q;  2DTJ A;  2X3D A;  2UUB J;  4IOB A;  4WF9 Q;  1MWY A;  4WP8 A;  2CUY A;  2FGO A;  3VGS A;  2EEY A;  2LEC A;  1N32 J;  4I0W A;  5HVG A;  3KLH B;  3BKT A;  1HHT P;  3KK2 B;  1DFD A;  3PR5 B;  3KLF B;  2J0S D;  5E3A A;  5DZ7 A;  3MPU B;  2P5V A;  1AZS B;  5C24 B;  3TVK A;  4ZIV A;  1EET B;  1MMN A;  2DKO B;  2VPY B;  2QA1 A;  2JH3 A;  1UVI A;  4PPD A;  3AOB A;  3LAL A;  3UVJ B;  2XLJ A;  3BQ2 A;  2VQF J;  1KN6 A;  4AT1 B;  1REV A;  1VRU B;  1GNK A;  4DQQ A;  5KFF A;  3P5T L;  4J9K A;  2BJ1 A;  4ES2 A;  3TWZ A;  2YH1 A;  1NJW A;  2OSQ A;  4ZVH A;  2V68 A;  1SH0 A;  3GON A;  4DR6 J;  1KSP A;  4LSZ B;  2LVW A;  4YME A;  1BMQ B;  1IKY A;  4LF8 J;  1RTD A;  4O3O A;  2JJ4 D;  1HD1 A;  1T11 A;  3V81 A;  5DG8 A;  5E0O A;  1FHT A;  4M1K A;  5B0F A;  1GMW A;  1TQL A;  2R42 A;  4CTA B;  5L38 A;  3IFE A;  4JUZ A;  1IJF B;  2QZ8 A;  3ISZ A;  4WFX A;  1CJK A;  4WFZ A;  2FDN A;  3KHL A;  2M52 A;  3LGM A;  5A76 A;  3GIL A;  5G0R A;  2YWE A;  5J2N A;  2O01 C;  5FII A;  1PBU A;  5ETS A;  3H4B A;  4JI4 F;  2FC9 A;  2W9B A;  4N5S A;  2XSF A;  5DDQ C;  2KDO A;  2HQG A;  1S6O A;  2VC1 A;  3KLG A;  1VQ6 S;  4UZC A;  3H59 A;  4C0H A;  4NXM F;  3M9O B;  1IUJ A;  2ZDP A;  4ZVF A;  1Q7L B;  1E6V B;  4ZS6 A;  3UI3 A;  2RJZ A;  1Z2Z A;  1UPM B;  2HQC A;  3BSN A;  1HFE L;  3BSC A;  2BJ9 A;  5A8W A;  4M5N A;  1U24 A;  4HI1 A;  2BYC A;  5FJ4 A;  1WSR A;  2KT2 A;  1U1M A;  2VPW B;  3O2I A;  3N5F A;  3NS6 A;  2IFX A;  2YKN A;  1N5Q A;  2DGO A;  4YY3 F;  2BE2 A;  1H6K X;  4DCJ B;  2EFG A;  3HHL B;  1VQM S;  5KFO A;  2WTF A;  1R8A A;  2GQQ A;  3T3F A;  2QLX A;  4LFA F;  1VJQ A;  1XR5 A;  1S6P B;  1MML A;  1HR0 J;  4OIX A;  1FRH A;  5FLX Y;  2J6T A;  4HVZ A;  3EVM A;  4ELT A;  4PXE A;  4GO7 X;  5IV4 A;  1HNZ F;  3RAX A;  4KGZ B;  2QO3 A;  2XZT B;  1RZM A;  1X5T A;  3GG1 A;  2BQR A;  3R2D J;  2H5J B;  4H54 A;  2Y8W A;  2HK3 A;  4PAA A;  4IRK A;  3BS9 A;  1M5S A;  1PYT A;  3M9M B;  1JJH A;  2HND B;  3UD5 A;  2OEJ A;  4O3Q A;  3GJS B;  2IAJ B;  4DSF A;  3W9I A;  5L9X A;  4CNZ A;  5LMN F;  3BKU A;  3JQM A;  3DN9 A;  1WKK A;  4J9R A;  1YI2 S;  2CIM A;  2PA3 A;  4K4U A;  4NE9 C;  2B0G A;  5D6G A;  4M95 A;  1XN9 A;  4DV3 F;  2ZNY A;  1LQ9 A;  3HXM A;  3JSR A;  4UY8 T;  3GIM A;  2YH0 A;  2EFP A;  5KG3 A;  2AQ4 A;  3OUY A;  2BBE A;  3EGW B;  3GV7 B;  2HHT A;  1EZZ B;  2G13 A;  3VZI A;  4TXS A;  1RTH B;  1ARO P;  4PYA A;  3M30 A;  4DF4 A;  3P6Y C;  4DUY F;  4OHW A;  1R0C B;  5JJB A;  5CXT A;  4Z7C A;  2K7J A;  4QOT A;  2L3M A;  5HBM B;  5IOL A;  3D1Q A;  2BJE A;  4DL5 A;  2CQ4 A;  1FDN A;  4U6P A;  5LMU F;  1R31 A;  3MWB A;  2MKJ A;  3M8Q B;  4RBT A;  5C2G A;  3CCL S;  3BBC A;  1D09 B;  3H8Y A;  5AXL A;  2CPE A;  2CQD A;  4L74 A;  2W24 A;  3CJK B;  5IM0 B;  5GAE U;  2QLB B;  2D3Z A;  2UVV A;  1GK8 A;  1QLN A;  2RVJ A;  3M2V A;  3GIK A;  1SL2 A;  2XMA A;  4ITS A;  4K4W A;  4ZVE A;  2MQM A;  3JB9 k;  4ECS A;  4MAK A;  2G9O A;  3LAN A;  1M5P C;  3LAM A;  5A0Y A;  2O67 A;  2MQP A;  1VBK A;  4ERD A;  1JLQ A;  4OJG A;  1Q4R A;  2AV5 A;  4NYP A;  1RU2 A;  4QU7 A;  3J80 Y;  1HIY A;  4EZ6 A;  3HKZ D;  4G1I A;  4D3G A;  5HQ8 A;  3QT6 A;  4OQJ A;  2K3K A;  2X51 A;  4RW6 A;  4B3T J;  3G82 A;  1OS5 A;  2QYG A;  4Y65 A;  1FWP A;  4RNN A;  1T9V A;  2QGF B;  4DSK A;  1I6J A;  4DV2 F;  5KFA A;  1HNV A;  3QFH A;  4RW4 B;  5IC6 B;  5H9E K;  1IBL J;  3MEG B;  1N5Y A;  3CF5 Q;  3DRP A;  3MMC B;  4K4S A;  2ZDO A;  4NLR A;  1IKV A;  1R6Y A;  1FJ7 A;  1NK5 A;  2M0G B;  3W62 A;  1KTV A;  2B5J A;  1PIL A;  2H9Z A;  2M5Y A;  4CO1 A;  3ETO A;  2LFV A;  1BUX A;  1FT8 A;  5KG5 A;  2ZUG A;  3IRW P;  2E5I A;  2WZ1 A;  1S1V B;  2F4F A;  1LV5 A;  4YB6 A;  2VG6 B;  4CDI A;  3RW6 A;  3AA9 A;  1LWE B;  1RYR A;  3CDU A;  1WF1 A;  2ZKU A;  2AX0 A;  1SKW A;  3GFY A;  4PKD B;  4HHJ A;  3ONQ A;  1OSC A;  5IC4 B;  5IT0 A;  4W98 A;  2VBZ A;  3EPI A;  1JLF A;  2DNN A;  4A8K A;  3U1M A;  3GV8 B;  1IJE B;  3MEE A;  4GKJ J;  2D41 A;  1RWN B;  3H5S A;  1K9M T;  2R7X A;  3K8V A;  2MJN A;  4F7V A;  2ZH9 A;  1X5S A;  3AXM A;  2HVH A;  1HPZ A;  4B3S J;  1LW2 B;  2QC3 A;  3KUH A;  3HJV A;  5KFB A;  3H98 A;  2WVF A;  2ATL A;  4ECU A;  1T9Y A;  2HG4 A;  1HWI A;  1DQA A;  3WC2 A;  5MAO A;  3L3C A;  1NAQ A;  2D3O 1;  3P8B B;  3KHH A;  4B9M A;  3HPO A;  1QTN B;  2WB4 A;  2IYG A;  1VQ9 S;  5HQL A;  2OEL A;  4X66 F;  1IBM F;  3RGI A;  4CLK A;  3MZI A;  1T05 A;  1KVJ A;  2DJW A;  1FD2 A;  2OTJ S;  2VDI A;  4DR1 J;  2QLW A;  5D3G B;  4USI A;  3DRS A;  5HO4 A;  2JNJ A;  2BJD A;  3DGP B;  3UDE A;  1K0T A;  3WQP A;  3LWL A;  5JVH Q;  4RW8 A;  2WHO A;  1P9Y A;  3HKW A;  3LWM A;  2VH7 A;  4QIF A;  4DV7 J;  3BF4 A;  2OD4 A;  3UN3 A;  5KG4 A;  2ZBI A;  4LF5 F;  3G71 S;  4ZPT R;  2ZBC A;  4AXJ A;  5BYS A;  1FRX A;  3N28 A;  2KKH A;  2MGZ A;  1BQX A;  2HRT A;  4DLG A;  1H0H B;  4Q2M A;  3TVY A;  3KKF A;  1Q78 A;  1BGX T;  1UJ4 A;  2GIR A;  1CUL A;  1LXJ A;  4ALZ A;  3B6B A;  3GYN A;  1LW0 A;  1LWX A;  2V8P A;  1FKP A;  5KFK A;  4GMK A;  3SQO P;  4PG4 A;  4X62 F;  2LKZ A;  3IWX A;  4OHX A;  3HVW A;  4I69 A;  3NXZ A;  3TJ9 A;  3CCR S;  4AXI A;  4KGK A;  3A3P B;  4M5L A;  2GVD A;  2CJX B;  3EMT A;  3N6M A;  3QPI A;  3N4W A;  4YUD A;  3P45 B;  2W4D A;  2CJB A;  2K2P A;  3RG6 A;  2E9Z A;  2L41 A;  2XYP B;  2LXF A;  1YJV A;  2CPF A;  2FHJ D;  1Q7Y T;  2HW3 A;  2ZZT A;  5FLX U;  1WOO A;  3GPA A;  1IKY B;  1S1U A;  3BB5 A;  1RTD B;  4EU0 A;  3KNA A;  4I67 A;  1LK5 A;  4AFF A;  1L5U A;  3V81 B;  4DL4 A;  2YX7 A;  3BDP A;  2M8D B;  3W63 A;  2H48 B;  5SZT A;  3OFE A;  1VHF A;  4NLP A;  4GVL A;  2AP6 A;  4JP8 A;  3BN4 A;  1V5I B;  3OHB A;  1H7X A;  3PX6 A;  1UL3 A;  1CJK B;  4DOZ A;  5HAN A;  2ROE A;  4OYB A;  5G0R B;  3CO0 P;  1CEZ A;  5J2N B;  4KGM A;  4I68 A;  4DBQ A;  2ZH5 A;  1XEZ A;  1L3V A;  4ER8 A;  1X5O A;  1GXT A;  1FNO A;  4KRW A;  4MIW A;  3Q0A A;  3GSD A;  3JXO A;  2W9B B;  3MF5 A;  2KJV A;  2VKZ G;  4USW A;  3KLG B;  1NPR A;  4DX5 A;  4KKO B;  3IC1 A;  5ETM A;  2YX4 A;  2BDP A;  2ACM A;  3L9Z A;  2F63 A;  4PAB A;  3AD8 C;  2KU7 A;  4WZQ A;  4ENO A;  2WOM A;  4LR9 A;  3R6L B;  2HFU A;  2YX1 A;  3IBW A;  2OKQ A;  3HD1 A;  5A8W B;  4K4T A;  1ZM3 A;  2VOD A;  4LF7 J;  4A8O A;  3R6G B;  1NEE A;  1F60 B;  2DGT A;  3AH6 A;  1N88 A;  2YKN B;  2XB2 D;  4D3H A;  2BE2 B;  3V4M A;  3MTJ A;  4DR7 F;  4RX6 A;  2L48 A;  1GQE A;  2ZC3 A;  5E33 A;  1RAI B;  2FVR A;  4DR3 J;  2H4Y B;  1VBX A;  3ET6 A;  4K4X A;  1GAO A;  1N6Q B;  3OR1 B;  4KY3 A;  1SJR A;  4WXW A;  5HAO A;  3V2U C;  1SVD A;  3W64 A;  4JI8 F;  4HH1 A;  2XGP A;  3BRE A;  2JEI A;  1IKW A;  5HP1 A;  4U96 A;  3FEY B;  3PDN A;  4Q44 A;  4EO6 A;  2Q6B A;  1UWB A;  3QQC D;  3UFC X;  1OSD A;  1NSA A;  1C1C A;  5A2Q Y;  2YQ3 A;  3SMZ A;  4NML A;  2UUB F;  2GQC A;  4XPC A;  4OZ0 A;  1W2B R;  1XMO F;  1X9W A;  3VAL A;  1RT4 A;  4ED7 A;  1S6U A;  5IFM A;  2HHV A;  4YB1 P;  3FJ2 A;  5GAG U;  1N32 F;  4MK9 A;  2P9C A;  1QVG R;  4NAS A;  2VFS A;  1FFG B;  1VK3 A;  4P2S A;  3OVS A;  2V8H A;  4NA1 A;  1FRI A;  3FMW A;  4EBC A;  4LIW A;  5F3T A;  4E2F B;  4OYO A;  1MU2 A;  2WAQ D;  4CH0 S;  1RT7 A;  4ZPV R;  2C28 A;  1IBC B;  8RUC A;  2MMY A;  2ZVI A;  4UUW A;  1M90 T;  4DV5 J;  4NCB A;  5KFL A;  1VK8 A;  3D0I E;  3N79 A;  3QBC A;  2VQF F;  2DNK A;  2AWZ A;  3V6K A;  5IT9 Y;  3OUY B;  2OTL S;  2IBO A;  2GAH C;  2E7W A;  1DAX A;  2V4Q A;  3M30 B;  3MAQ A;  3M9N B;  3HSD A;  3TVZ A;  1TAU A;  3QGP A;  2LU1 A;  2E9T A;  4JV1 A;  2LQ9 A;  4DR6 F;  2B4O A;  1WEZ A;  3OTD A;  4EFA C;  2GC8 A;  2CJA A;  5E2Q A;  3W8G A;  1Y0H A;  1AB8 A;  1KQK A;  4CLU A;  1YIJ S;  1FXL A;  3BGO P;  2IHR 1;  2ERR A;  1AW0 A;  2Z2Z A;  4DUT A;  3EE3 A;  4OX7 A;  4LRB A;  5CYQ A;  3FRZ A;  3TUJ C;  3J7Z 5;  2JRS A;  2E7X A;  3K59 A;  2BX6 A;  2VBY A;  2DIS A;  3M2V B;  2B43 A;  3GQC A;  3ELH A;  4X65 J;  2DNY A;  3D54 A;  4ZN3 A;  1VQP S;  3OLA A;  1DTQ A;  3CDB A;  5THW A;  5IV3 A;  3CJ3 A;  1VR6 A;  4H4O A;  5HSP A;  3CTR A;  3RBX A;  2R7R A;  3JAM U;  5A0Y B;  1BHN A;  1N5S A;  2RRN A;  1JLQ B;  2QT7 A;  5BR8 J;  1NSP A;  2WVB A;  3W61 A;  1FK9 A;  1ZM4 A;  3LP0 A;  4FBT A;  3M6U A;  1RT6 A;  4RW6 B;  2CVE A;  3G82 B;  3WBZ A;  3H5U A;  4QYZ J;  4O4G A;  4A48 A;  1YRT A;  2PT0 A;  1HNV B;  5I4M A;  2PMZ D;  4GC6 A;  4UT4 A;  2N7C A;  1RWV B;  1OYD A;  3ZZR A;  2J9D A;  1N5Y B;  5EWG A;  3KYL A;  2NYI A;  3DRP B;  1HR0 F;  4U7U D;  3R5G A;  4ZVQ B;  1FNM A;  2I0X A;  1XR7 A;  1IKV B;  5ETT A;  2C2R A;  2MXY A;  1SI9 A;  2YNF A;  4C97 A;  4YDD B;  1C2P A;  2R7U A;  1SB6 A;  2B5J B;  2XG8 A;  3GU0 A;  2KM8 C;  4NXN J;  4FPR A;  4KHP J;  1RQ0 A;  4BWJ A;  1YQH A;  3PYD A;  3Q24 A;  1N0U A;  1ZET A;  3KUE A;  3RRK A;  4AE5 A;  4DSL A;  4UUX A;  4XIU A;  3KHG A;  1D9D A;  1VQ4 S;  3H0P A;  1D1U A;  4YEA A;  3C14 A;  1AA1 B;  1DHM A;  1UCN A;  1GXL A;  1PJ5 A;  4ETZ A;  2W9A A;  4DS5 A;  2IJR A;  2HK2 A;  5DZ6 A;  2ZH7 A;  3LGH A;  4CT8 A;  2AEJ A;  2OHD A;  3DDI A;  4W92 B;  1JLF B;  1RJJ A;  2EBG A;  2ZH3 A;  2W2O P;  1S7H A;  2C2O B;  1NK6 A;  3MEE B;  1WNE A;  2H3E B;  2HRU A;  2R2U A;  3EWG A;  2PE8 A;  3OJU A;  1HPZ B;  5E3R A;  1JNZ B;  2UUA J;  1DLO A;  4QW8 A;  4WFY A;  4ZVS B;  2B4V A;  3BPS P;  2BAC A;  3ILO A;  4XK8 C;  3LQV A;  2HEK A;  5M2U A;  1VQN S;  3OXL A;  3MPD A;  2IRY A;  1NPP A;  4WWS A;  2HZC A;  2QFJ A;  5C42 A;  2CPJ A;  1T05 B;  4F25 A;  3G6V A;  4QZV B;  1VC0 A;  1WHX A;  5D4O A;  4B9T A;  4NLD A;  5KG1 A;  1RHR B;  3TP2 A;  1KP6 A;  1A9N B;  3DRS B;  2CJ9 A;  4RW8 B;  2XGQ A;  3G6E S;  2Y0S D;  2ZBQ A;  2HS0 A;  3H7H B;  4EI2 A;  1T0T V;  4FXW A;  1HWU A;  2QA4 S;  2W25 A;  2CVI A;  1S9E A;  2RD5 C;  4EBD A;  1ZA2 B;  3CSK A;  2XZD B;  2MGZ B;  5KFX A;  2ZD1 A;  2A3J A;  2V4R A;  4YN3 B;  4NLG A;  1CUL B;  3Q8S B;  1FKO A;  3Q86 A;  1LW0 B;  2XNQ A;  1URR A;  1LK7 A;  1FKP B;  2ASL A;  3T1H J;  3M1V A;  1LFW A;  1F5C A;  4DV4 J;  4ZPB A;  4L75 A;  2PII A;  3FFI A;  1QD1 A;  4ANC A;  3H2L A;  4B3T F;  2GVD B;  3CCW A;  2QLF B;  1VQ8 S;  4Q43 A;  5EX0 A;  2HNY A;  3HCX A;  2FQQ B;  2L9N A;  2CNN B;  3NNH A;  3ZZO A;  2KG0 A;  1GH8 A;  4ECT A;  3C3L A;  1RHU B;  2I1R A;  4NYZ A;  1IBL F;  2VA2 A;  2C3P A;  3HO1 A;  3AOA A;  1S1U B;  5AXM A;  1SKS A;  3N5B A;  4PPZ A;  1H98 A;  4R5P A;  5J2Q A;  3NY0 A;  3PEH A;  5HI7 A;  1YTY A;  3CD5 A;  1S99 A;  2GJI A;  2ZEJ A;  1Q8L A;  3FEX B;  3W5X A;  3OR2 A;  2JWN A;  4DPT A;  3NMA A;  3C19 A;  1UKU A;  2PI5 A;  3UD3 P;  3QO9 A;  4KBI A;  3WC0 A;  4RW9 A;  1R0A A;  1S9G A;  3GFX A;  2RRB A;  3K2Y A;  1XER A;  1TK5 A;  4NLT A;  4G1P A;  1RTJ A;  3PEJ A;  5B0E A;  3CJS A;  3OFG A;  6FDR A;  3MMB A;  2EVZ A;  2DHG A;  1UFK A;  2HHH J;  2BKO A;  2A1B A;  1B0T A;  1GTH A;  1WEL A;  3LH2 S;  2JSX A;  4GKJ F;  3BDE A;  3AJ2 A;  2WOM B;  4K0K J;  4EO8 A;  3NEK A;  3M32 A;  5EHH A;  2GGP A;  4CWB A;  2YTC A;  2V8V A;  4B3S F;  3IGV A;  3V5R A;  1NHV A;  4ZCK A;  2UV8 G;  5J1N A;  3CME S;  1EX8 A;  3VVU A;  2IM0 A;  2HGL A;  4LFB J;  2H5E A;  1VIS A;  2CDQ A;  1HBO A;  3DXS X;  3ZTS A;  4X4S A;  5M2P A;  4LF4 J;  2Q6C A;  4NX9 A;  2E1P A;  3ET6 B;  2GHP A;  3Q89 A;  2F8H A;  1FES A;  1WI8 A;  2ZH6 A;  4XAK A;  2M3D A;  2EG2 A;  4LF1 A;  1XK8 A;  1IKW B;  5HP1 B;  4N47 A;  4DR1 F;  3NMR A;  5LSO A;  4N8O A;  4G1Q A;  4DL2 A;  4FYD A;  1UWB B;  4ZLP A;  1WG1 A;  4RUC A;  1C1C B;  2VB6 A;  3OFH A;  4DFM A;  1RT4 B;  2DH9 A;  2VPX B;  4DV7 F;  1M5V C;  1WAC A;  4C3L A;  1SQF A;  2LQB A;  3N6N A;  5K8M A;  5I42 A;  3GJT B;  1UVK A;  4OYI A;  3CCS S;  1NCL A;  3IS9 A;  3PV8 A;  3MI7 X;  1UPP A;  3NAH A;  2ZZN A;  4ED6 A;  2HHP A;  2Y3Y A;  2HIQ A;  4F4W A;  4WE1 B;  5SUH A;  1ULR A;  5CQG A;  4PRF A;  3TOQ A;  4NMX A;  2VD3 A;  5KG2 A;  1MU2 B;  1RT7 B;  2ZVS A;  2XC9 A;  3AQP A;  4ZVR B;  4F4A A;  2ZH8 A;  3TAQ A;  1WOR A;  1DY3 A;  2GJ2 A;  2RH3 A;  3CXC R;  2NQP A;  3VV2 B;  1C4C A;  1VCT A;  3CJ5 A;  1F3V A;  2OMO A;  4C3M A;  2GW8 A;  2HVZ A;  3VQT A;  1TK8 A;  3TAP A;  2QRR A;  1SKR A;  2RHQ B;  4CI0 B;  4AL6 A;  2BQU A;  1V3S A;  3OTO J;  2DB1 A;  4JI6 J;  1GMW D;  2W7O A;  1YHQ S;  3NBP A;  3DLE A;  1FE4 A;  2MYF A;  4RNO A;  4DF8 A;  4NWB A;  2QTW A;  5AJ3 J;  3T1Y J;  4DQI A;  4AND A;  2AGO A;  5CYQ B;  3NCQ A;  3QID A;  2RB7 A;  1DQ8 A;  4HAC A;  4DL3 A;  1ZBT A;  1TZ0 A;  1JKH B;  3OD2 A;  1B0V A;  3VCD A;  2NXJ A;  3VZH A;  1NK8 A;  4AUK A;  4OX8 A;  3MMA A;  2EK6 A;  2MTL A;  5F8N A;  1RSC A;  3RB6 A;  1DTQ B;  2R8H A;  3Q8V A;  3WDO A;  3NGK A;  3GG0 A;  2LDY A;  2RIJ A;  2IDL A;  4B9U A;  3HSZ A;  4H4O B;  1NHU A;  1VRQ C;  1CQN A;  2HFV A;  4RW7 A;  4RU2 A;  4IH6 A;  3HVT A;  2MST A;  5CZX A;  2HS4 A;  2ZWP A;  5L1L A;  4WIQ A;  2Y1I A;  1YGY A;  3OTC A;  3T5K A;  1FK9 B;  1CS4 A;  3LP0 B;  4WZM A;  3HT0 A;  1RT6 B;  2LXU A;  2GAG C;  4USM A;  4DV6 J;  4LF7 F;  3BQ1 A;  4CO3 A;  1G1X A;  4OYA A;  4O4G B;  3PCO B;  4KTQ A;  2HHX A;  2XLI A;  4F2R A;  1TL7 B;  2PMW A;  4GC7 A;  1TR0 A;  5H9F K;  2R8K A;  3SQG A;  3V4I A;  2JHE A;  2R7Q A;  2WVD A;  4DR3 F;  4KPY A;  2FVP A;  1WC6 A;  4O3P A;  5HMZ A;  2DGU A;  3D6M B;  2QL5 B;  2YNF B;  2YPZ A;  2IRX A;  5KFR A;  2KVI A;  4AL7 A;  1W26 A;  2PEB A;  3ZZ0 A;  2PGC A;  5F8H A;  2N3L A;  2M8H A;  3Q22 A;  1R27 B;  2UUC J;  5LSL A;  3FMB A;  3C6T A;  1KNZ A;  1JIH A;  4QR2 A;  1IR2 A;  3M8Y A;  2FPH X;  1BQN A;  1CG2 A;  2ZM6 J;  2GIQ A;  3T5L A;  3C14 B;  1HHS A;  1I1G A;  1G7C B;  2OI2 A;  2KXN B;  2MQL A;  4DLE A;  4M5D A;  2KM8 B;  1F9F A;  1FX4 A;  2HMI A;  2V9K A;  3MGJ A;  1TP7 A;  1N36 F;  2CQ2 A;  2G2Y A;  4URQ U;  1U4B A;  2R2S A;  3EPG A;  5H1S V;  3RRH A;  2GHW A;  1SPB P;  4DV5 F;  4L76 A;  1NJY A;  3ZZZ A;  3S1T A;  2PEH A;  4RLE A;  3Q2S C;  4FS2 A;  3IP0 A;  1DLO B;  3RW7 A;  2XNR A;  2X1B A;  1SH2 A;  3EYZ A;  1YJW S;  1WJ9 A;  2Q66 A;  4FXV A;  2HWH A;  3VGT A;  1EKS A;  4IFV A;  2UUT A;  5C42 B;  4IR1 A;  2GQ2 A;  3M6W A;  2RF2 A;  3R7B B;  1ZAV A;  3JTO A;  3R2C J;  2WW8 A;  3J7Z T;  1SUQ A;  2AU0 A;  5KFJ A;  2JL9 A;  1TMJ A;  2DGS A;  4OI1 A;  4ES1 A;  2UVU A;  2YY3 A;  4F3Q A;  1V3Z A;  3LA0 A;  3TQE A;  2CQC A;  4ATN A;  5IT4 A;  4YFU A;  2K3I A;  1NK9 A;  4X65 F;  1JXE A;  2CQG A;  2BAB A;  1WF2 A;  1S9E B;  2W2N P;  2ZBP A;  3QYY A;  2R7O A;  3HFZ B;  4KHR A;  2B7B B;  3I31 A;  3FC9 A;  2NXC A;  2DH7 A;  1X4B A;  3DKD A;  2ZD1 B;  4Q45 A;  3OL7 A;  4IUF A;  2LEP A;  2LCW A;  4FXD A;  2RU3 A;  1VYA A;  3MR3 A;  2VV5 A;  3C16 A;  4LSL A;  5HVH A;  2YNH B;  4B02 A;  1FKO B;  2OO4 A;  5BR8 F;  3MXH P;  3SI8 A;  3AY0 A;  3GZ7 A;  5A8R A;  3M1V B;  4DR4 J;  1A7G E;  3FNN A;  5KFG A;  4YOE A;  4OZ2 A;  1VIX A;  4DL0 C;  3FFI B;  3M8W A;  2EWH A;  5DM7 Q;  2XEX A;  3NGR A;  4F0H A;  2HNY B;  2MY7 A;  3B54 A;  3WIU A;  2BAN A;  3QAT A;  3TZW A;  4HDG A;  4IQX A;  1N5V A;  3Q23 A;  3CIZ A;  3IRX A;  1ZZN A;  3QWU A;  3AFG A;  3DM2 A;  1YZ6 A;  3KWM A;  3E2E A;  4R5P B;  5J2Q B;  4QWA A;  4DUY J;  4AD6 A;  1RKI A;  4KO0 A;  2GJF A;  4H4K A;  3KLV A;  2MHE A;  2ZE2 A;  1S1X B;  3PX0 A;  1EHW A;  4NXN F;  5K8P A;  1TUV A;  3OR2 B;  4KHP F;  4YB5 A;  2XMV A;  2YKQ A;  3GFH A;  1FEH A;  3CJ8 A;  5HMY A;  5J1P A;  1U25 A;  3CD7 A;  3FBF A;  3KNG A;  5F3Z A;  4IYQ A;  1UMJ A;  2HZA A;  5C5J A;  2IVY A;  3AJ1 A;  1TFW A;  3QO9 B;  4RW9 B;  3BO3 A;  3PW7 A;  1R0A B;  2CPH A;  1S9G B;  1T8E A;  3HVA A;  4ETX A;  4ZVP B;  2Y9H A;  1U09 A;  4QCL A;  2DHA A;  4DFK A;  3PW0 A;  2IVM A;  1Y5I B;  3I4P A;  2HHQ A;  2W2M P;  4Y0F A;  3I9Z A;  3UDV A;  4LIR A;  3SIP B;  3MDF A;  2MLY A;  4ZJO A;  2OIH A;  1B3T A;  3NGS A;  1NK4 A;  2MLX A;  4QW9 A;  1G6B A;  3M32 B;  1OQ6 A;  4V19 X;  1PC4 A;  1FO1 A;  2GGP B;  4DS4 A;  2UUA F;  4QQB A;  1U6F A;  3KJQ B;  3KUG A;  3HHL C;  2XCP A;  2NUH A;  2XHC A;  4RWX A;  4Y2K A;  5CAB A;  1HBO B;  1G2E A;  1OO0 B;  3VF0 B;  3TO8 A;  2KHD A;  4ZP8 A;  2R8G A;  4FF3 A;  1OPZ A;  2R2T A;  3HVR A;  2RKI A;  2EK1 A;  3HSG A;  4IO1 A;  4Z7Y A;  1SBR A;  5ETV A;  3NOC A;  2A0F B;  4OYP A;  4G1Q B;  3OXF A;  5T14 A;  2KG1 A;  4Y2C A;  2OSR A;  2M2B A;  3R5C A;  1HBU A;  4IOA Q;  2IC3 A;  3PIO Q;  1M1H A;  4ZCI A;  5I42 B;  3CCU S;  3T5H A;  3IS9 B;  4OYW A;  4NRT A;  2QV6 A;  2KH9 A;  4RO0 A;  1XJW B;  3SEO A;  3QT7 A;  2MHN A;  2B8Q A;  3P5B P;  1HWL A;  4A46 A;  3VQS A;  1AFJ A;  2XWY A;  3TI0 A;  4ANE A;  3EX7 B;  3MED B;  4ECR A;  3CCM S;  3T1H F;  4UST A;  1JMT A;  2MKH A;  3TYT A;  4CZC A;  4DV4 F;  3ENA A;  4KE5 A;  3S01 A;  2KT3 A;  4OI0 A;  4UZB A;  3OL6 A;  3H40 A;  4Q7A A;  4J9P A;  2BEF A;  3SCI E;  2AEM A;  2LMI A;  1A6L A;  1YJ7 A;  1R0B G;  1VQ7 S;  1U0S A;  5LT5 A;  4M63 A;  3DRX A;  5EN1 A;  2GO9 A;  4J9L A;  1J5O A;  5J2P A;  2P8I A;  3NBP B;  4WU3 A;  3DLE B;  4UOC A;  1KR4 A;  4RL1 A;  2KT5 A;  3RAQ A;  3M2U A;  2R7T A;  2AGP A;  3DYA A;  3ISN C;  5KTQ A;  1BQM A;  3EVW A;  1SJ3 P;  5B0D A;  2J0W A;  4R0E A;  5HRO A;  2ZOF A;  4DFJ A;  3SDE A;  3ZFV A;  3NKY A;  4HAC B;  4KH1 B;  4UQG A;  3MCN A;  1F0X A;  2A2C A;  4WXO A;  1NKE A;  2IRU A;  1S4F A;  3ICL A;  3NGT A;  3EGZ A;  4KC5 A;  3MMA B;  3MFI A;  2CQB A;  2XS5 A;  3MAA A;  2UXB J;  4F0K A;  2FLO A;  2DR5 A;  3O1L A;  2MSS A;  5KFZ A;  1N8R T;  2K1R A;  4J5O A;  4FN5 A;  1ZH5 A;  1Q16 B;  1SIZ A;  1FTC A;  1U26 A;  4RW7 B;  3CDE A;  1VLY A;  3HVT B;  2RS8 A;  2FHO B;  2V34 A;  1F3F A;  1X4G A;  2B56 A;  5JVG Q;  1U1Q A;  4ZLJ A;  3POT B;  5CCL A;  5KT3 A;  2YWK A;  3I0S A;  3W2V A;  4K0K F;  1CS4 B;  3OSP A;  4JI2 J;  2LA6 A;  2BQ3 A;  3PW4 A;  4NYO A;  4BS2 A;  2B6A A;  3FKB A;  3D1O A;  3PTW A;  2BW7 A;  4LR7 A;  1T3N A;  1JLG A;  4S0M A;  1TU0 B;  3CCJ S;  2DPI A;  2L08 A;  4LFB F;  3V6D B;  2I5J A;  2C2E A;  1HQU A;  3V4I B;  1M0S A;  1ICE B;  2DNL A;  4LF4 F;  2OPP A;  3DLB A;  1X5P A;  1R8P A;  4DX6 A;  4WP9 A;  2V4J A;  4I64 A;  5KT4 A;  2B7C B;  3PAC A;  2G2O A;  2GA7 A;  3UCZ P;  4QWD A;  1S7I A;  2COL A;  2BM0 A;  3QRP A;  2BM1 A;  4CM0 A;  1VJW A;  3UDC A;  3MOZ A;  3C6T B;  3RAM A;  4YHH J;  3NNA A;  2VDH A;  1CVJ A;  1BQN B;  1CQM A;  3MMJ A;  2DEI A;  4NCG A;  5HMX A;  4F26 A;  3BGR B;  1R6V A;  1SQG A;  4EUV A;  2AGQ A;  5HLF A;  4M5D B;  3HP6 A;  3P49 B;  4FVC A;  3BSO A;  3Q8Q B;  4NA3 A;  1LWF A;  3RU0 A;  4YR3 A;  1RCX B;  4DZD A;  3ZO7 A;  3KK1 A;  5E3C A;  4IDK A;  2E7V A;  2Q1L A;  4C6A A;  1MWQ A;  4XDD A;  4ED2 A;  2VQE J;  3D0H E;  1V9O A;  1P1L A;  3J81 j;  3PFE A;  2SXL A;  5EUH A;  2BJ3 A;  5KFM A;  3UCU P;  4Z2X A;  4QJV A;  3CMA S;  2HQF A;  5DDO C;  1PCA A;  4OMF G;  4M5H A;  5B09 A;  5CYJ A;  2G0C A;  3TEH B;  3OTO F;  5KT7 A;  1BC6 A;  4IFV B;  3PRD A;  2XMK A;  1FVS A;  4PG8 A;  4JI6 F;  1U7L A;  2E66 A;  5KFN A;  3C6U A;  4USK A;  1HQE A;  4WPA A;  4LVN P;  4LBP A;  1UVM A;  1XQI A;  3SXL A;  3LP2 A;  2RF2 B;  3NOG A;  3HLU A;  3VAG A;  1YJ9 S;  2DIU A;  5AJ3 F;  3T1Y F;  1SUQ B;  1MG7 A;  1RT5 A;  1WKL A;  1FE0 A;  1UZD A;  3CCV S;  4IH5 A;  1U48 A;  2E5L J;  4QIG A;  2AW0 A;  1NLK L;  1IWA A;  5F8G A;  4C8L A;  2C2M B;  2NPF A;  1XR6 A;  1FF2 A;  2GO8 A;  1B0P A;  1SC4 B;  3P96 A;  3UNY A;  2CYY A;  1Q8I A;  1YIT S;  4DMZ A;  2MKI A;  1Y5N B;  4MK7 A;  4QR1 A;  1FD8 A;  1VQL S;  4WFA Q;  5D0E A;  1XMO J;  2CJK A;  1MMD A;  5KFS A;  2V6A A;  3Q8U A;  2EG1 A;  5HN0 A;  4RBU A;  3CCZ A;  5F9L A;  3C16 B;  4LSL B;  4O3S A;  3NRB A;  3G6X A;  2XWX A;  3WX4 A;  4ECW A;  3MR7 A;  2RQK A;  4HDH A;  1NND A;  5A8R B;  1FVQ A;  4PWD A;  3U7J A;  3BJY A;  3D6H B;  4XO0 A;  2VAS A;  4DPX A;  1Q0N A;  3HMJ G;  4DV6 F;  2YQ1 A;  4TU8 A;  3KLE A;  2BJ8 A;  3BBF A;  5LL6 d;  5LOQ A;  2PN6 A;  2BAN B;  1Q8K A;  4ED3 A;  3JTP A;  3HSJ A;  2UV8 A;  3J81 Y;  3IRX B;  2FGC A;  3T41 A;  1R43 A;  2AT1 B;  2ZJP Q;  3DM2 B;  2DCU B;  5KOX A;  2HWI A;  1EQ0 A;  2DIT A;  3E8O A;  2FY8 A;  4KO0 B;  3R3T A;  5CYM A;  3R1L A;  1CSJ A;  4CP5 A;  5BXI A;  2ZE2 B;  2HKE A;  2HVI A;  2F9J A;  3BO4 A;  4RPF A;  4RUB A;  4J9M A;  2VF3 A;  4PG5 A;  4X84 A;  1PYO B;  4EEY A;  1CC7 A;  2XCA A;  3IAM 9;  1QUP A;  2UUC F;  3T6B A;  2MKS A;  1Q86 T;  4PCQ A;  3UO0 A;  2M70 A;  2HYI B;  2ZM6 F;  4K5R A;  3F0N A;  3UDL A;  2RSQ A;  4PXC A;  5DS7 A;  3OLB A;  4ZLL A;  3H90 A;  5I3P A;  2JDJ A;  1DZ5 A;  4U9R A;  2JVR A;  3U02 A;  3L09 A;  4O0N A;  5LJ5 Y;  5HMW A;  2DR7 A;  1V6H A;  3RBZ A;  3DOK A;  3RBE A;  1RBO B;  4DZ6 A;  2R2R A;  3A12 A;  3JS9 A;  3UW1 A;  4A8M P;  4DPW A;  2ZH4 A;  2ACY A;  2ZHA A;  1S76 D;  1NB2 A;  4K5S A;  3DMJ A;  5DQH A;  5KT5 A;  3LUY A;  4KT0 C;  3EDQ B;  1ZOT A;  1XBW A;  1FNX H;  1FRK A;  9RUB A;  4MIB A;  3WZ0 A;  4CRJ A;  3EIC A;  3OVA A;  1PYS B;  1D0E A;  1FXD A;  4C8N A;  3HT3 A;  1GT8 A;  5H9E J;  4R25 A;  4MH8 A;  3E01 A;  4C11 A;  1HA1 A;  2FZG B;  2JEG A;  3LP1 A;  3MPY A;  1OQ3 A;  2GML A;  1Z1Z A;  3OTB A;  3UN2 A;  2KYX A;  4IH7 A;  2XI3 A;  2JFD A;  3I5C A;  3NNC A;  1Y00 A;  2EBE A;  1B99 A;  1SKU B;  3M6X A;  2RKI B;  2OD6 A;  3K57 A;  3VAI A;  1B7Y B;  1S77 D;  2FY1 A;  2LLZ A;  4QWC A;  1SQE A;  4M5G A;  4ID5 A;  2DPJ A;  2ZOG A;  1Q82 T;  1RLC L;  4JBC A;  2KRB A;  2E1R A;  1S6Q B;  5GAH U;  1HBU B;  4LF6 J;  2ZFH A;  2IC3 B;  4FBU A;  3ZTR A;  2E44 A;  2CPY A;  3CUN A;  3KFW X;  3QJJ A;  2D69 A;  2P2C B;  3I56 S;  1RU1 A;  2DT9 A;  4ZVO B;  3THT A;  2ROG A;  1XWL A;  4QIV A;  2WSC C;  4WCE Q;  2DGW A;  4F3M A;  2KO1 A;  4I2Q A;  2XY7 A;  2R8J A;  1KOH A;  2Y1R I;  2DO0 A;  1YX2 A;  1RT1 A;  3UE2 A;  3CJ4 A;  4LRA A;  4MFB A;  2QJ3 A;  1YVF A;  4KSE B;  4PQA A;  4DR4 F;  4MYU A;  4OFZ A;  4WJB A;  3CW2 C;  2CQ1 A;  4YDX A;  4N77 A;  2I9S A;  3KG1 A;  3CE8 A;  3A8J A;  1XMQ J;  3KK3 A;  2MLZ A;  1QAX A;  4HI2 A;  1VRT A;  3N9U C;  3C8Y A;  2RS2 A;  4TKT A;  3LAK A;  4HT5 A;  3SYZ A;  1HI8 A;  3ILL A;  3B78 A;  4UF4 A;  1U2R A;  3H4D A;  2HQI A;  1Y7P A;  1J5O B;  1ROF A;  2J7U A;  3IBC B;  1RKJ A;  2CQ0 A;  4A8W A;  5J2P B;  4DFP A;  2Q79 A;  2BVZ A;  3M2U B;  3DYA B;  1BQM B;  2ZNZ A;  3TZY A;  3F56 A;  1CJU A;  5HRO B;  3NS5 A;  4ZP9 A;  5DLG A;  1QVF R;  3SFG A;  1RT3 A;  2CAJ A;  2RDJ A;  2DNH A;  3DGV A;  2QL7 B;  1S12 A;  1U49 A;  1KHW A;  3PXG a;  5DLF A;  4BCA A;  2DRA A;  5D0R A;  3GB0 A;  4JI5 J;  3CED A;  1A0O B;  2E5J A;  4GRS A;  4OV1 A;  2Z4P A;  5B08 A;  2YWW A;  2YPY A;  4PWU A;  2BRL A;  1T3O A;  3C46 A;  1EP4 A;  1VQ5 S;  3MAA B;  2YWH A;  5EDW A;  3PYF A;  3KHR A;  1S1W B;  1FJE B;  2DBB A;  2K1R B;  3L95 X;  2ABY A;  4KV8 A;  2QA2 A;  3BR8 A;  3Q2T C;  1L3U A;  1TL3 B;  3KLH A;  2M88 A;  3UNG C;  2ZBR A;  1O0P A;  4FYW B;  3H2U B;  2MY8 A;  3I0S B;  3W2V B;  1WC0 A;  4B3M J;  2HQ3 A;  4ZVT B;  1YRX A;  5CA5 A;  2B6A B;  1VQK S;  5AE2 A;  3FBC A;  1VBZ A;  1HWK A;  1OYE A;  3TUZ C;  4FP9 A;  2VON A;  4I6A A;  4RBV A;  2IJN A;  2XSJ A;  3VAJ A;  1JLG B;  1F1B B;  5KFD A;  3ZTO A;  2I5J B;  1HQU B;  1RP5 A;  4NZ6 A;  2R7W A;  3NP5 A;  4OZJ A;  4X4Q A;  1HYS B;  3G8Q A;  4KHM A;  1XIQ A;  2OPP B;  1X60 A;  3SCL E;  2XS2 A;  5CCM A;  4EYI B;  4MJK A;  3QGH A;  1WSV A;  2BA9 A;  2V4J B;  4NEY A;  3OBI A;  3I5A A;  3I87 A;  2D3U A;  4C7Q A;  2J0X A;  3CNQ P;  2YXL A;  2G0J A;  3CPW R;  3I9V 9;  4Y28 C;  1GEH A;  5JUM A;  2XMU A;  3G2X A;  1RHM B;  3MHY A;  4I2P A;  2HIY A;  2FVS A;  1HNI A;  2BKP A;  2LEA A;  2P9G A;  1JK9 B;  1LKZ A;  4NCG B;  2BW2 A;  3BM7 A;  3KG4 A;  5L1J A;  4M8L A;  4LRD A;  3H5X A;  4P75 A;  4URS A;  7FDR A;  5HLF B;  1W7W A;  5KFW A;  3IAS 9;  4H4M A;  1LWF B;  5KFY A;  4KPC A;  4RNF A;  2FJB B;  1D9F A;  2B51 A;  1IM4 A;  3KK1 B;  2JLG A;  1XTZ A;  4IDK B;  3TZZ A;  3EXY A;  5E3Q A;  1EIY B;  4ECQ A;  5KT2 A;  1ZPV A;  1N48 A;  3LPE A;  4ZLN A;  4U8V A;  3JQJ A;  4E0D A;  2ZHB A;  2GIF A;  3BKF A;  1WI6 A;  5LM7 E;  3TA0 A;  2JC1 A;  3FSI A;  5BYQ A;  4OX6 A;  4TQS A;  1P1T A;  2GFF A;  4A8S A;  1JJC B;  1FXR A;  4ZPD A;  2DNQ A;  2DK2 A;  4LMZ A;  1ZA1 B;  4M5M A;  3TUP A;  1FCA A;  2Y1L B;  1FRL A;  4J91 A;  1ZM9 A;  2IPO B;  1AYE A;  4PEO A;  3C6U B;  4WTY A;  1HQE B;  2XZW A;  3LP2 B;  3GYG A;  2WSE C;  4OL8 A;  2Q3P A;  3MR6 A;  1TKX A;  1RAJ A;  1RT5 B;  2DIV A;  2OPR A;  4KR0 B;  4DL7 A;  5K9F A;  4OI6 A;  3W66 A;  4C8M A;  4WP3 A;  3R7S B;  3R5A A;  1UET A;  1KWM A;  5KFQ A;  5HQM A;  1NPK A;  1YJT A;  3KDO A;  1U1R A;  3CJR A;  1WD6 A;  4CLS A;  2V2Z A;  2UXB F;  1NME B;  1W25 A;  1S97 A;  2NR0 A;  3AB4 B;  3DLL Q;  2NYH A;  1UJ6 A;  2J0Q D;  4ZP7 A;  3CO9 A;  1CLF A;  3MM8 A;  4DR2 J;  4HEA 9;  2QIF A;  2VIH A;  4Z37 A;  5DET A;  4HYK A;  5CD4 H;  4ED8 A;  4FPI A;  2ZH1 A;  1DQ9 A;  5AXN A;  4PWD B;  1H3D A;  1M1G A;  4TYB A;  5F8M A;  3MUV P;  4JI2 F;  4DV0 J;  3KTQ A;  2H5I B;  4ECX A;  3DRR A;  5E7O B;  3T9N A;  3KLE B;  2Y1J A;  4A8X A;  3F73 A;  1EB0 A;  2RQC A;  1LEO A;  2AYM A;  4KGX B;  2BOP A;  2X1A A;  1NM2 A;  2RML A;  3RTV A;  4X4P A;  5RUB A;  5T7L A;  2C3O A;  1REV B;  4IKA A;  3PRB A;  3K0J A;  3PVX A;  3BYR A;  3OW2 R;  2VHG A;  3J7A 1;  3OJS A;  2QX0 A;  2H65 B;  1C0U A;  1TL4 A;  5CYM B;  1PAU B;  2EFN A;  4WK1 A;  3K5O A;  4F67 A;  2Z0G A;  2ZH2 A;  1I51 B;  2AF6 A;  4K4Z A;  3DXB A;  1RAB B;  2FJV A;  3D4J A;  3QRR A;  1RWO B;  4FKY A;  3SSR A;  2CPZ A;  4YHH F;  1KTQ A;  3UR0 A;  1N56 A;  1OY6 A;  2HHS A;  1CJV A;  2OPQ A;  3NCP A;  2GVZ A;  2ZOM A;  5C7P A;  2HAI A;  1D8Z A;  2NZC A;  1RT2 A;  2E1C A;  2IYI A;  3W8P A;  5HJY A;  4LRF A;  3DOK B;  4WK3 A;  4F50 A;  2L9W A;  3D6F B;  3QFW A;  3KJF B;  3R5D A;  4OHZ A;  7FD1 A;  3DU6 A;  3QSI A;  2VQE F;  1K1Q A;  3DMJ B;  3EZO A;  1VGY A;  3ENW A;  1R7I A;  2W9C A;  4F2S A;  4LQ9 A;  1IQT A;  2DEJ A;  4USH A;  5D4P A;  4L3K A;  2AYB A;  1X4F A;  4OZN A;  3MR2 A;  2EW9 A;  3JSM A;  4IG0 A;  1VIO A;  3EGV A;  5DO2 A;  2BZ2 A;  4C11 B;  1Z4U A;  1B4S A;  3LP1 B;  2LQ8 A;  2IM1 A;  5CH7 B;  1MW7 A;  4Y2A A;  4P52 A;  3US5 A;  4DX7 A;  2F4V J;  1NU4 A;  1FJC A;  3WHI A;  3CUL A;  1KFD A;  2CZ9 A;  4WYW A;  1T9T A;  2MQO A;  4Q5V A;  1KOO A;  1S0V A;  3RB3 A;  5GMK a;  4ELV A;  2AZ1 A;  4Y6I A;  3NL0 A;  4ID5 B;  3FQK A;  1QY7 A;  2EPI A;  4LR8 A;  2E5L F;  4W90 B;  1N33 J;  5HAT A;  2ZUA A;  1KC8 T;  1M5K C;  4K4V A;  1WHV A;  1SJQ A;  3B4M A;  4HKQ A;  2Z57 B;  1UW4 A;  3BV8 A;  3NAI A;  2YKO A;  2ZKT A;  3FGV A;  1HQ2 A;  2BV3 A;  5KG7 A;  4YP3 A;  4K4Y A;  4I2Q B;  1SJF A;  4ILM A;  1UA1 A;  2NSC A;  1RT1 B;  3QSY B;  4AQY J;  3VGV A;  1RE1 B;  3F44 A;  3QLH A;  4XTT A;  4MFB B;  3CMQ A;  4ZJL A;  1ZZF A;  1WEX A;  1RAG B;  3AHP A;  3KK3 B;  4PUO A;  1YJN S;  2ALZ A;  4NLU A;  2CPX A;  1N36 J;  1VRT B;  3J80 U;  2QN6 B;  1C0T A;  1JLB A;  1DAR A;  4WKY A;  2Y8Y A;  1JNR B;  2HBQ B;  2WON A;  3VWS A;  1UWA A;  1CBK A;  1SJ1 A;  3CJ2 A;  1PJ6 A;  3T6J A;  1ZAW A;  4ZDN A;  2QYC A;  2AJ4 A;  2MB0 B;  4C8O A;  3GSI A;  3K5N A;  4XDC A;  1GX5 A;  4U7C A;  3DLJ A;  3HI9 A;  1P27 B;  5D0H A;  1CJU B;  2IA0 A;  1SV5 A;  1TUW A;  1RT3 B;  3GJQ B;  5A8K A;  4ZN1 A;  1Z2L A;  4U8Y A;  3P4U B;  2O3D A;  1HI1 A;  1ACM B;  3T19 A;  1FFS B;  2CPI A;  3PKY A;  2MPU A;  4WFB Q;  2HLT A;  2MZ1 A;  1Q81 T;  3I32 A;  2D9P A;  2XTJ P;  4KV8 B;  2KRR A;  3BZQ A;  1HW8 A;  3AJD A;  5L46 A;  2HBY B;  2ZJQ Q;  2AJ2 A;  1APS A;  4JI1 J;  1U6B A;  1MWZ A;  2KXH A;  3G6Y A;  2UZA A;  1HBM A;  1U1N A;  3D9B A;  3W2W A;  4LVO P;  2P6T A;  1RA7 A;  4MIA A;  2VJV A;  4BC9 A;  4ZPC A;  3R7N B;  2XSJ B;  1JLA A;  3A8K A;  2NUU G;  1MSW D;  4JI3 J;  3ZZT A;  1WC5 A;  4NLW A;  2PSZ A;  4RUH A;  2DR9 A;  1PIE A;  1MNE A;  4NZ7 A;  3ULH A;  1YWX A;  2MZT A;  2RNE A;  1YRU A;  3DC2 A;  2MKY A;  1S0M A;  2CQ3 A;  4DQP A;  4LRC A;  1VQY A;  2ASJ A;  4K59 A;  3PG9 A;  2BXJ A;  2AYG A;  2APO A;  2MQQ A;  5K8O A;  4DV1 J;  2XM3 A;  3CGI A;  1O5J A;  4JYA J;  4NZ0 A;  1RAA B;  1P9Q C;  4I2P B;  3DNC A;  3TRG A;  3CB4 A;  1HNI B;  1BY9 A;  2RRA A;  4LF6 F;  1KS2 A;  1DTT A;  3BQ0 A;  2DH8 A;  2B3T B;  2OFH X;  3LO3 A;  3H20 A;  1CPZ A;  4PXD A;  3UD4 P;  4H4M B;  3IBF B;  1KEK A;  5A6P A;  1P8G A;  4QIE A;  2H54 B;  1AT1 B;  2UVW A;  3EXC X;  3LTO A;  2HWT A;  2CZV C;  1WUU A;  4IFY A;  3W9J A;  3DCA A;  3M8R A;  4DPO A;  1IBK J;  2KFN A;  3S6E A;  5DG7 A;  4ILR A;  1FJG J;  2O5D A;  5FDL A;  3ZZU A;  3OV7 A;  4KKO A;  3IR5 B;  2XO7 A;  1XMQ F;  3TJ8 A;  1JXV A;  1K73 T;  3HDS A;  3EDR B;  2IMW P;  3KMS A;  3VAK A;  3WIV A;  3H2V E;  4P7T A;  5DG9 A;  4DSE A;  3AOD A;  2C3U A;  3IMQ J;  2RIL A;  4U95 A;  2MJU A;  1T9U A;  1F6T A;  2DRB A;  1RWK B;  4A8F A;  2DGX A;  4RNM A;  3RR7 A;  3IG1 A;  2H1Y A;  4TLQ A;  2O66 A;  3QGG A;  3GYX B;  4L6V 3;  1TKX B;  3K5L A;  3D0G E;  3PX4 A;  3T1A A;  2OPR B;  3M8S A;  3HUL A;  1N6Q A;  3OR1 A;  3HHD A;  2L9D A;  3TA2 A;  1JX4 A;  2DYA A;  4JI5 F;  4LUB A;  4EZ9 A;  1K1S A;  1TUG B;  2NS1 B;  3J7A N;  3BGL A;  2AEF A;  1NSQ A;  2XMJ A;  3PIP Q;  3CCE S;  2HLU A;  3ENQ A;  1VFJ A;  3BGF A;  2UP1 A;  1K8A T;  3BPD A;  3G4S S;  3GR1 A;  2NRE A;  3W65 A;  3MM8 B;  5B0G A;  1NSK L;  1RAD B;  3TAM A;  3O44 A;  3ENV A;  1FX2 A;  4LQ3 A;  3M7V A;  2J8S A;  2J7W A;  1VMB A;  4DU8 A;  1KQS R;  4J37 A;  1R3N A;  3VR1 A;  2DNG A;  4B3M F;  2R7V A;  1S0N A;  5E41 A;  3S7R A;  2AD9 A;  4ZKA A;  1JWW A;  3DRR B;  3TQ1 A;  1KQG B;  5D4N A;  1T9X A;  2V50 A;  3PNI A;  1S57 A;  1NJI T;  3WX8 A;  3J7Y U;  5T7L B;  4LF2 A;  4YS2 A;  3NGD A;  2FJE B;  3CVK A;  3NWG A;  2MQN A;  1RGV A;  4HR2 A;  1QAI A;  3QRQ A;  1LFP A;  2JOQ A;  2FVC A;  3E3X A;  1C0U B;  2R8I A;  4RR5 A;  4C48 A;  4MKB A;  2IBK A;  3AT1 B;  1IKX A;  1KON A;  1X8D A;  2U2F A;  4DCO B;  1RAF B;  2DNO A;  3TAR A;  4K2J A;  1NH8 A;  3Q8R B;  4ZP6 A;  3IR6 B;  1L3T A;  4UOF A;  4BLG A;  4X2B A;  2UXD J;  2F9D A;  4DPU A;  4ES3 A;  3M6V A;  1CJV B;  2OPQ B;  2MZS A;  2GVZ B;  4OI4 A;  6AT1 B;  1OMS A;  5A2Q U;  1TK0 A;  4CO0 A;  2I8E A;  5GAH I;  1RT2 B;  5CD4 A;  4KQZ A;  4F0M A;  4I1T A;  4DXL A;  2K06 A;  1Y3K A;  3OFF A;  1YBT A;  4FNI A;  4CNY A;  2WVE A;  4BHQ A;  2EC0 A;  3PJ9 A;  2J8A A;  2WBM A;  3R1H A;  2Z56 B;  2LU2 A;  5L1K A;  3ZZP A;  4P74 A;  3UCG A;  3MEK A;  2MKC A;  1KLM A;  2W9C B;  1WKJ A;  4MTP A;  2VC0 A;  3RR8 A;  5LXY A;  5F8L A;  3OL9 A;  3JSM B;  4IG0 B;  5H9F J;  1SL0 A;  2BMB A;  1QE1 A;  2V5H G;  2X1G A;  4CO5 A;  5IT9 U;  4OLP A;  4I6Y A;  1QM9 A;  1TFY A;  2F40 A;  1MN7 A;  2HQD A;  4JV2 A;  3CT9 A;  2KZM A;  5L8R C;  1VC6 A;  3MUR P;  3W5Y A;  2HAF A;  4G6V B;  3TUI C;  3D3C J;  3W5Z A;  2BRK A;  2MEW A;  3FVY A;  2KN4 A;  4V19 J;  2PC6 A;  1S72 S;  4FKX A;  4Q8F A;  1HWJ A;  2XMW A;  2QSW A;  1YG0 A;  3DOM A;  2MZJ A;  4OLO A;  2NLW A;  4CIO A;  1H72 C;  1WTB A;  4WKR A;  5K8N A;  4HHU A;  3TEG A;  2AJ1 A;  3K17 A;  2VBW A;  1P6T A;  1JXL A;  1BWE A;  3TAN A;  4QBU A;  2F5G A;  4O3N A;  2NZ4 A;  5KFP A;  4FNH A;  2LYV A;  2ALY B;  3JYT A;  2VKR A;  4Y2M A;  2GMH A;  2QL9 B;  3B82 A;  1SC3 B;  1R8H A;  3L4B C;  1FEE A;  1PBA A;  4FVM A;  4DR2 F;  2UU9 J;  1KHV A;  2DHH A;  2W7A A;  5GAE I;  3QLH B;  4QWE A;  2CJQ A;  2DXE A;  3EM1 A;  4IG3 A;  1RWU A;  1VDH A;  4C9D A;  2NXN A;  4J9O A;  2OGU A;  2V2V A;  2JLF A;  4ZPA A;  3JAM Y;  2DHX A;  2AMC B;  4TQR A;  1GX6 A;  4CYU A;  2OML A;  2Y0B B;  4DV0 F;  2AJ0 A;  1HMV A;  4PUO B;  3BO2 A;  4P2M A;  1PKU A;  1WOP A;  2PFD A;  4OJH A;  5L1I A;  1ITP A;  5DDP C;  5D8H B;  3DHW C;  4OI2 A;  3Q8Y A;  3M2R A;  1C0T B;  1B70 B;  5KFU A;  4J9U E;  1JLB B;  2FLN A;  2P9E A;  3HF5 A;  4NLO A;  2WON B;  1O6X A;  4V1A k;  1SL1 A;  3MM7 A;  1G4C A;  2FLP A;  3VHQ A;  3PRV A;  1Q5Y A;  2CAD A;  4IRD A;  1H73 A;  2EI5 A;  2RUS A;  3FDS A;  5EX3 A;  4FYY B;  2IA6 A;  1WHW A;  4UQT A;  2HS3 A;  3TZX A;  4J7C A;  3KG0 A;  1IWG A;  3VGU A;  1FER A;  1SV5 B;  1UEK A;  2CG4 A;  3G96 A;  3HHK A;  1X7V A;  5A8K B;  3W9H A;  5LSR A;  2KJW A;  4XPE A;  5D77 A;  2R7S A;  4OJ3 A;  4B3R J;  4ZOS A;  3HM9 A;  1G3O A;  4N7T A;  2RAQ A;  2CRL A;  1LWC A;  4NL5 A;  1FRJ A;  5KFT A;  3KJV A;  3SSS A;  2WRM A;  4ELU A;  5DGB A;  2VL1 A;  3TNV A;  2DCL A;  4LBI A;  3R5B A;  5F0U A;  2RQM A;  4C98 A;  2VJU A;  1HBM B;  5HK4 A; 
#chains in the Genus database with same CATH homology
 1XQI A;  3ZTR A;  3FBF A;  1NHK L;  1B4S A;  1VYA A;  3VGV A;  3BBF A;  4DZ6 A;  3VVT A;  3ZTO A;  3DDI A;  3JS9 A;  1K44 A;  1F3F A;  3PRV A;  1BUX A;  1F6T A;  3FBB A;  2BEF A;  1NB2 A;  1WKL A;  3BH7 B;  1NUE A;  3EMT A;  3ETM A;  4F4A A;  3VGT A;  1XIQ A;  3VVU A;  3FCV A;  3ZTP A;  2HUR A;  4EK2 A;  4FKY A;  3Q8V A;  3EVM A;  3PJ9 A;  1NLK L;  2DXF A;  4DUT A;  2CWK A;  4UOG A;  1S57 A;  3ZTS A;  3EE3 A;  3WX8 A;  1NDK A;  3FKB A;  3ZTQ A;  1MN9 A;  1BE4 A;  3EIC A;  3VGU A;  4ENO A;  3Q89 A;  3NGU A;  1HIY A;  2AZ1 A;  2HVE A;  2DY9 A;  1PAE X;  1U8W A;  3L7U A;  3NGR A;  5C7P A;  4S0M A;  5IOL A;  4UOH A;  4CP5 A;  5BXI A;  4HR2 A;  3BBB A;  1NDC A;  1WKJ A;  3GPA A;  2BX6 A;  4C6A A;  3GP9 A;  3B54 A;  3EVW A;  3R9L A;  2DYA A;  3ELH A;  1NDP A;  4W98 A;  3NGS A;  3Q83 A;  2NCK L;  4F36 A;  1KDN A;  3FCW A;  3EVO A;  3G2X A;  3Q86 A;  3VGS A;  1HHQ A;  2ZUA A;  3BBC A;  3MPD A;  1B99 A;  2HVD A;  3Q8U A;  3EM1 A;  2DXE A;  2B8Q A;  1LEO A;  3FBE A;  1NSQ A;  3BH6 B;  4ANC A;  1ZS6 A;  3NGT A;  1MN7 A;  2AZ3 A;  4ANE A;  1NDL A;  2VU5 A;  1BHN A;  2DXD A;  3EJM A;  1W7W A;  1PKU A;  4DI6 A;  4WBF A;  2B8P A;  1WKK A;  5CAB A;  1S59 A;  1HLW A;  1EHW A;  3FC9 A;  1JXV A;  4UOF A;  4AND A;  1NSK L;  1S5Z A;  1NCL A;  4FKX A;  4KPC A;  5CAA A;  1UCN A;  3FBC A;  1NSP A;  3Q8Y A;  3B6B A;  3ENA A;  1LWX A;  3DKD A;  1NPK A;  4O0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...