5J1NA

Lassa virus l protein cap-snatching endonuclease. bound to one manganese ion
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
171
structure length
171
Chain Sequence
GMEEDIACVKDLVSKYLADNERLSRQKLAFLVQTEPRMLLMEGLKLLSLCIEIDSCNANGCEHNSEDKSVERILHDHGILTPSLCFVVPDGYKLTGNVLILLECFVRSSPANFEQKYIEDFKKLEQLKEDLKTVNISLIPLIDGRTSFYNEQIPDWVNDKLRDTLFSLLRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RNA-directed RNA polymerase L
publication title Comparative Structural and Functional Analysis of Bunyavirus and Arenavirus Cap-Snatching Endonucleases.
pubmed doi rcsb
source organism Lassa mammarenavirus
total genus 63
structure length 171
sequence length 171
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17296 ArenaCapSnatch Arenavirus cap snatching domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j1nA02
4MIWA 5J1NA 5J1PA 4I1TA 3JSBA 5IZHA
chains in the Genus database with same CATH superfamily
3N6LA 4M5GA 5KT3A 3CC4S 3AD8C 1NU4A 1RSCA 3EVMA 4DSFA 4OZ2A 3DDNA 5GVQA 4WXOA 4FPIA 3VAHA 3BREA 5DQGA 3DXSX 2E5JA 3NG8A 2GHVC 2YWGA 3KLIB 2XBPA 4F2RA 3BQ0A 1RAGB 2JLGA 4HACA 3CGIA 3UCUP 2LA4A 4Y2KA 1BY9A 1U2FA 4J7CA 9RUBA 1R8CA 5BR8F 4H4KA 3LGMA 4CRJA 1SKWA 4LF4F 2HVEA 3A3NB 4PXDA 2KYZA 3H0PA 2ZZNA 2YTCA 5JXSA 5AXMA 2J6SA 2QRRA 4ZJOA 1Z4UA 3MM5A 1R6YA 2YY3A 4YB5A 4CM2A 4FYXB 5GMEA 4DZ6A 4DX7A 2KM8C 3KLGA 2CJQA 5IC6B 4F8RA 2GX8A 1K1SA 4PG4A 4P10A 4CLFA 2F40A 2J6UA 2BA9A 1XNRF 3RBZA 1QVGR 3CIZA 3IBFB 2ZBIA 3LPEA 2QA2A 2A1BA 1QTMA 3NGKA 4J9QA 4I2PA 1U1LA 1ZS6A 3DMJA 4FNIA 4P7TA 4LBHA 3PYDA 3FSYA 3GYXB 1QAJA 3C66A 1S9EA 1MU2A 3HP6A 4DQPA 4NLOA 1RTJB 2RAQA 1HYSA 4F4WA 3PG9A 5MAOA 4DQSA 2CG8A 2HWTA 1JXVA 2GMLA 2B51A 1VQPS 4IG0A 2DNGA 2RUGA 1NZAA 4C11B 3T6BA 3IO1A 4DR3J 1CJKB 4NLXA 2RKIB 3VGVA 1SVDA 3UI3A 5KFBA 4DR4F 2E5LJ 3KK1B 2JHEA 1G7CB 4ECXA 3BEGB 1WSRA 2OO4A 4PABA 2D74B 2D69A 2OSQA 5D6GA 1WOOA 5A8RA 3TZXA 3UNYA 2HFZA 4DPWA 1Q8LA 1L5UA 2WW4A 3GJTB 3C2PA 2JH3A 1MWQA 1HQ2A 2G0CA 1RHKB 1O6XA 4B3OA 5A0YB 1V9OA 5RUBA 5HROA 5BXIA 4PAAA 5IS2A 3KJNB 2B4PA 4FDFA 1BQNB 1C4AA 4QWCA 3M1VB 1OQ3A 2ZH7A 4K4YA 2CNOB 1EP4A 4F36A 3UN5A 1BQMA 3QGGA 4CP5A 4ZVSB 3GCWP 1FRMA 3C8YA 2CPHA 2D41A 4ZS6A 1U6BA 4DR1F 1BHNA 4B3SJ 2RQMA 5LT5A 2LDIA 1PCAA 5EWGA 4KHMA 3LWMA 2GCFA 4EBCA 2KO1A 2YNGA 3TO8A 2I6WA 4MK9A 5LJ3Y 1YJRA 1UA0A 5LSLA 5E33A 1UW4A 2K1RB 4P71A 4ZVUB 1NK0A 3W63A 2AYBA 1QAYA 4MYUA 4I0WA 1XMQJ 3W9JA 3SQOP 3NRBA 4NMLA 4ECUA 4KV8A 2H5JB 2UXDF 1F1BB 2V2KA 1NK8A 4M1KA 3OSPA 1S1XB 3D6MB 3AT1B 1VRUB 4DV6J 5KFRA 1FKPB 2FUG9 3H59A 5H9FJ 3JYTA 4JI8F 1GMWA 3QT5A 4IR1A 1BWEA 3DGPA 1KS2A 4EBEA 1JLAB 4UY8T 2HURA 1EETB 2FZKB 4MMOA 3FQLA 3R9LA 4ER8A 2W24A 4Y2MA 3FNNA 2LXIA 4YDXA 2MGZB 2WCXA 2XHWA 4MIAA 1QSLA 2GQ2A 1FX2A 4OYPA 2B0GA 3UD4P 2W4DA 2X3DA 5K8PA 4MKYA 3QLHA 2VFUA 2UXCJ 3D66A 2O5DA 2AT1B 2KVQE 2IIHA 3IWXA 1S7IA 3KYLA 2XS2A 1N88A 3SDEB 2VOPA 2EKYA 1NJXA 4AUKA 4FKYA 5HJXA 4RZRA 5HAOA 5IV4A 3LP0B 4BHQA 2VZ9A 3UVJA 1K0VA 1WC3A 1KONA 3PYEA 4OI3A 1F2GA 4X65J 5KFCA 4ED5A 4C7QA 1S0OA 2JFKA 2ASYA 4DOZA 1JLEB 2ATLA 5HO4A 3N5FA 4KHPF 2XI2A 4ZVGA 2YNHA 2XHCA 1RHQB 1S0NA 4DPUA 3NMAA 2V34A 2FVPA 1WWHA 2KT2A 1VC5A 4NXNF 4H4MA 5A6WA 2UUWA 3TQEA 2KJWA 2QYCA 2RH3A 3M2RA 4OYAA 1KWMA 1B3TA 2H54B 1VGYA 5EX3A 4CLUA 1Y5NB 2BACA 1Y11A 3VAIA 1VFJA 3DRYA 3SMZA 1A0OB 4P73A 4XDCA 1DTTA 2BJ9A 1HHTP 2EBEA 1DAXA 4A8KA 1HLWA 1Q78A 3PJXA 2CWKA 3QSYB 2IC3B 1NM2A 2FVCA 3KOAA 2JLEA 1WC4A 2ZEJA 4YDDB 5CD4H 2FHOB 5LMNF 3I9V9 1Y9OA 4M8LA 1H2TZ 1K73T 5DG8A 2FPHX 2N4CA 1REGX 2IA6A 2CQ2A 5DDQC 1U0HA 2LP4A 4ZVEA 2L08A 3KHLA 1KLMA 2DNKA 4PYDA 1YJ7A 5E5NA 1S1WB 3MURP 4PUOB 3H7HB 1KQSR 1QY7A 5IM0B 3W8PA 2G9OA 2H65B 3UDEA 3M6WA 3KHRA 2LFVA 2XLKA 5SUHA 4RU2A 3K5LA 3TQ1A 4IQXA 2XCPA 3ADAC 3CJ5A 2PMZD 4OX9F 3GV8B 1M0SA 1VHFA 1Q86T 4PQUB 2E1PA 4KH0B 4XPEA 4ZPAA 3OR1B 4ZN3A 3TJ8A 1NDLA 4I2QB 2MJNA 5HVGA 2BR0A 2JOQA 4L75A 2V0NA 4K2XA 1Q7LB 2OMLA 4EYIB 2VG6B 3M8PA 2XSFA 4ATNA 3EVWA 4NA1A 5IT0A 2QFJA 2R42A 1N0VC 2AYGA 2C3PA 5ETLA 4Y2CA 4KKOA 4ZP7A 4DLEA 4JI4F 2D3ZA 3QZ7A 1O51A 4QQBA 3HMJG 3EXYA 2DBBA 4WIQA 4KGVB 4IOAQ 4ALZA 3HKWA 2IVMA 1YBUA 4LF2A 4C8LA 5C42B 1XMOF 1U4BA 2KJVA 2R2TA 3ZO7A 1UEKA 4OHZA 1U48A 4RX6A 2B5JA 2W7PA 3BV8A 1URNA 3BGLA 2H48B 1NPRA 1H6KX 3IG1B 2GZOA 4YB7A 1HD1A 2QA4G 1D3WA 1F2HA 1LNQA 5HI7A 4GVBB 1G4CA 3DU5A 5LJ5Y 5BJRA 3NEKA 1N32J 4C3KA 3IBCB 1VQLS 2P8IA 1KN6A 3VVTA 1BGXT 3ZZZA 1H73A 4KFBB 2V4RA 3E2EA 2DO4A 3L95X 1KP6A 3Q8YA 3CCJS 4PXCA 4J9SA 3LAMA 2KT3A 2DHXA 2X1BA 3M8QA 2DITA 3FFIB 4O0IA 2J0XA 3HF5A 3NAHA 1UZHA 5KFZA 1PC5A 2K1RA 1UWBA 2GHPA 4G1QA 4DCPB 4LR9A 1TL3A 3QMQA 2RRNA 3EE3A 4NLQA 4NOHA 5D4OA 2HSEB 5ETSA 2GVZA 1DLOB 2Y0SD 1B0TA 1DRZA 2HHTA 1F5BA 4B9NA 3CD5A 4E0DA 1F3FA 2BYCA 5KG5A 2E9ZA 2C2RA 2POKA 2Q6CA 1IN0A 2CZVC 2SXLA 2R8KA 2UXBJ 2YNFA 1NRKA 3OSNA 2BJ1A 5IT9U 4RW9B 2EWHA 2QC3A 2QT7A 3MECB 2C3UA 1X7VA 4NASA 5T41A 2NLWA 2I5JA 2AD9A 2HS0A 3QZ8A 2XYHB 2XS5A 2HHQA 3Q0AA 5ETMA 3SV4A 3D1HA 1C0UA 5HQLA 3T41A 4LSNA 1VQNS 4ED8A 3R5AA 1SJ4P 1YZ6A 3TP2A 4DL4A 2XSJA 3M6XA 2ZM6F 4ZCKA 4AT1B 2VU5A 4GKJF 3HPOA 2GO8A 3R27A 2HGMA 4LSLA 2ZBPA 3MEGA 2Q3PA 4M63A 1YWXA 2V5HG 3TVYA 1RTDB 3KLFA 3ZXWA 1UFWA 3ONQA 1S1UA 4PR6A 2VG7A 2ROGA 4RL1A 5K14A 3HULA 3V2UC 2VG5A 2DGSA 3HKZD 4YS2A 2PIIA 2HKEA 4TVAB 4CWBA 3MFIA 4GC7A 1NK6A 1FFWB 2VQEF 3VZIA 1XC9A 2CJ9A 5B7WA 1KHWA 2CXEA 2JL9A 3CCZA 3RR8A 2Y1LB 4Z7YA 3DRRB 1VRTA 3FGVA 2E66A 4DUZJ 4L3KA 2BANA 2EPIA 2RE1A 2KKHA 4A47A 2HNDA 1EARA 3D6FB 4YQWA 2J0WA 2A2DA 3FMWA 2KN4A 2GAGC 2HQFA 1T3NA 1VQ8S 3M2UB 4OLPA 5C2CA 1RT4B 1IKXA 2J0QD 1S1TB 4WE1B 1RAIB 5FIIA 2BE2A 4PG8A 2RDJA 1IUJA 2P9GA 3AY0A 2Q43A 4ICLB 1N6QB 3CCQS 1XBWA 3N28A 5E3QA 1NHVA 1HHQA 4U8YA 4JI5F 3RU0A 1IBCB 3T9NA 1KSPA 2MKHA 2BVZA 3AXMA 1ZH5A 4AL5A 1LK5A 3QNWB 5D4PA 1KTVA 4TY9A 2BZ2A 1LW2B 1HPZB 3C6TA 5LXRA 2R3VA 1YTYA 2DHSA 2UUAF 4UZCA 2KFZA 4UOGA 2HMIB 1MROB 2XYGB 3O44A 2MSSA 2RHSB 1R8PA 3JXOA 4OJGA 4FS2A 1M1HA 3NY0A 4FP9A 4CI0B 5BYQA 3R1HA 4HH1A 3JSYA 2IM3A 4GKKF 3JSBA 1RT6B 3PHTA 4OYXA 1N5TA 4MFBA 1NSPA 4O3PA 1AB8A 1JLCA 2CRLA 2FZCB 3H5SA 1S6PA 2IVFB 2KHDA 3MM9B 2RF2B 4DXLA 4Z2XA 1U45A 2UVWA 1YRXA 3BGOP 2IY5B 3RAMA 4RUHA 3PW2A 2XY7A 1RBOB 3PRBA 3V81A 2Z2YB 4ELVA 2VF3A 1EJ7L 3OTOJ 4OJ3A 4R0EA 4WPAA 4FNHA 1NB2A 3CJ3A 3UQSA 2L3MA 1S6QA 4U67Q 3HT0A 5J1EB 4USTA 2DNNA 5KT7A 1NDPA 1U02A 3I9ZA 4OHVA 1HNIA 4R5PA 3HHLB 2QL9B 2LU2A 4YFUA 3C16A 3AB2B 4RNNA 5D3GA 1D9FA 2HFOA 3U7JA 4F50A 1T9XA 1RWMB 2KT5A 3CMQA 3W2VA 4Q43A 5F8JA 1RBAA 3GMGA 1TUGB 5F3ZA 2HQGA 3PEHA 1NKBA 1DY3A 3OR2A 3L7UA 4TN2A 3ZNJ1 3IXQA 4U6PA 2FLNA 3SCLE 1XJWB 2V8VA 3KLEB 1N54B 1JKHB 2DJWA 4YY3F 5HANA 1X4DA 2OUGA 3GFXA 2FLOA 2EFNA 3MEDA 2RUSA 3MEEA 3O3LA 1DQ8A 1EHWA 1CJTA 4NLDA 3IRXB 4DV7J 2HBQB 3I5BA 4WXWA 1RLDA 4FVMA 1N48A 3BO2A 1WACA 4NPOA 3HZEA 1XQIA 1YX2A 1CVJA 2FJBB 2VB6A 3BKTA 2E5LF 5HK4A 2W1BA 3CJ8A 1JLQA 3QATA 1AROP 2V8GA 4JYAF 1IM6A 1S1VA 3R5GA 4PRFA 1VS3A 2YKPA 2ZBRA 1MSWD 4QIEA 4ZP8A 4OHWA 2DPJA 1LWFA 2XI3A 2MLXA 3FCVA 1KHVA 2UUBJ 3W65A 1JLFB 2VPYB 1GTEA 3U27A 2PT0A 2J0SD 2CUYA 2AEMA 3IS9B 1SC1B 3WIVA 4A8SA 3NGTA 2ZVIA 2XZWA 4CZCA 1UFKA 1W2BR 1YJVA 3G6VA 4I7FB 1DTQA 5HMYA 2HVDA 3L3CA 2HHXA 2ZHAA 2XTJP 4DR2J 2OD6A 4RW8B 3CCVS 1HBOB 4L72B 1HQEB 5U47A 4USHA 5DO2A 1UCNA 1FDDA 1HARA 1RTHB 1S7HA 2R8JA 3DDKA 3EXCX 4L73A 1H74A 3S1TA 1SI9A 1W2IA 3Q2SC 2ZH3A 3BBFA 3MM8A 1AFJA 2ADBA 2HLTA 2XULA 2JEFA 1ULRA 4ECWA 1RT1B 3AHPA 2MZJA 3C14B 5I4MA 1T03A 3BO4A 4LF5J 2WTFA 4EO8A 1D9DA 5L1LA 1R0CB 5J2MB 1N5SA 5ETRA 1LWCA 1YBAA 2HFVA 3T5KA 2WAQD 3DOLB 2EFQA 3CD0A 1T11A 2IJRA 3RB6A 4A8QA 2Z2LA 3ISZA 4QW9A 4C3LA 3D9BA 4OI2A 1RXOB 3VHQA 2BOAA 3K58A 4WFAQ 4ED3A 1S0MA 5T7LA 4USUA 3OVSA 2FVQA 2OPSB 5CCLA 3W3SA 1U1NA 3BDEA 2BX6A 1FJEB 5KFAA 7AT1B 2GJ2A 2HHPA 2YPYA 3C46A 2E7VA 2Z30B 3J7AN 1URRA 5KT2A 4ECZA 3MM7B 1RP5A 2HQCA 4TNOA 3LGHA 4RW4B 2UUCJ 1M5OC 2DR6A 2CJXB 3MMAB 4I6YA 4UT4A 3FJ2A 2K7JA 3VZHA 3ETOA 3KJVB 4WFZA 4X65F 5KFHA 4M5HA 4KPCA 2W7OA 2G0JA 2AX0A 3I87A 1R27B 5DJBA 3OFFA 3FSXA 5KOWA 2YKMB 1TV6A 3GPAA 3PV8A 4CLZA 4DX6A 2V69A 3HJVA 1UZDA 1KKHA 3Q2TC 1NSQA 3HHDA 3Q8VA 1YGYA 4NLSA 2LECA 2CYYA 4X62J 3UDLA 3VGSA 3HHLC 1WEXA 2ZD1B 4F02A 1Q1KA 2DR9A 5KFTA 3A4TA 2AIRB 4GC6A 1VK3A 1KOOA 2MKCA 3SIPB 1HI1A 1DARA 5EWFA 1AW0A 3JB9k 1IBKJ 5G0RA 2FDNA 1HQUB 3HVRA 4PXEA 1G1XA 2R7OA 3TVZA 1U0SA 3OL8A 2WVEA 2G0IA 2CFXA 4ERDA 4DV4F 3K89A 3BGUA 2FHKA 1P27B 3B6BA 3MD1A 2HHSA 3CPWR 1BQXA 2LVWA 4JV5F 4L74A 2J9EA 4DFPA 5K9FA 1RYSA 1VMBA 5CQGA 1JLBB 1RQ0A 3EM1A 1J5OB 3PRDA 2UV8G 3R2DJ 2A6OA 5KFSA 4OI4A 2PN6A 2ROEA 1FJGF 2W9AA 3CJRA 3GYGA 2BABA 2BMBA 2GGPB 3ZTSA 2MZRA 5KFIA 1N5YB 4RU9A 4PPDA 2CJKA 2HG4A 3I56S 3B54A 1B4SA 4CO1A 2DGXA 1OPZA 4PKDB 3EPGA 3RR7A 2ZZTA 5E3RA 1S49A 3US5A 1XR5A 4F3MA 4PQAA 1J27A 1T02A 5KFYA 1RCXB 4B3TF 2DY1A 1UEVA 4ZIWA 1QE1B 4PG6A 4M5DA 4R8UB 3MGJA 4QR2A 1VISA 2IFXA 1NPPA 4N76A 5BR8J 4TY8B 2B43A 4K4XA 1VIXA 2MQNA 4OZLA 5ETNA 1RT2A 5IQ6A 2PDAA 1HBNB 2CQBA 1UETA 3PIOQ 3ILJA 2ZFHA 2ZDPA 3HFKA 3KLHA 2D9OA 2FJAB 2LDYA 3PNIA 4EZ6A 3QFHA 3KMQA 3DI6B 4O4RA 1M5HA 3EZUA 3GP9A 2X1AA 3VGTA 2CPDA 2A18A 3MMJA 4JI2F 3AD7C 3PR4A 2MQMA 1KRPA 5E3CA 1HL6A 3IM9A 4YR2A 2AJFE 2XS7A 5IZHA 2WSFC 2WONA 3I31A 1HBMB 3AOCA 3J80Y 4USIA 4ZHRB 3ITHA 4ZPDA 1NLKL 2BM1A 3CF5Q 1U8WA 2HHHJ 3N9UC 3PYFA 3OL9A 1VJWA 2MDAA 1RWWB 4LRFA 4B17A 4K4SA 2KYXA 2QLJB 1U24A 4CH0S 4ANCA 2Y1JA 5KFUA 3DHWC 3BM7A 1JLGA 2WB4A 1HBUA 3SSQA 3CCLS 4IRCA 1T05B 1TAUA 4C8ZA 1WC5A 3NLCA 2LQ9A 1T9TA 4OX6A 2Z56B 1FJ7A 4NEZA 1U1RA 4OYIA 3GZ7A 1ZAVA 2OGUA 5HJYA 2KXNB 2GFFA 2W9BA 1WF0A 2LMIA 1VQYA 4LFBF 1T94A 5DM6Q 2H5IB 1R8HA 1JXLA 1OWXA 4DR4J 1YRUA 2XG8A 1TL1A 1XNQF 2CQCA 5HBMA 1NHKL 1X9MA 3M32B 5AXNA 3H98A 3DM2B 4F4YA 3EGNA 2NCKL 1PJ7A 1HW8A 4X66J 1WJ9A 3D0IE 2F5GA 2OPRA 2OEKA 3V6DA 2KRBA 4P2MA 4IDKA 2B3TB 2EKNA 4WZQA 1YKWA 1LK7A 1Y3JA 3M30A 4QOTA 3QJJA 1ZYQA 2HQ3A 5DGBA 5CZXA 2J7KA 4CH7A 4TQRA 5H9FK 3NCRA 3N79A 2D1CA 2FY8A 4ILLA 3LA0A 3F56A 4QIWD 1MW7A 1KOHA 4EFAC 4X4NA 4X4UA 2BW7A 4ID5B 5DG9A 3N0VA 4K4UA 2FQQB 2DCLA 3OW2R 2CQ1A 2H51B 3I96A 3KK2A 4OYOA 2V67A 2KRRA 4DQIA 1K9MT 2XWXA 2HFUA 3MM6A 2J7WA 1PJ5A 3E3XA 3R5DA 1S0VA 3SI8A 4NI2B 3CJ2A 2LXUA 4QZVB 1I5OB 2QLXA 5GAHU 1U7LA 2VKZG 5EX0A 4DUZF 1ELOA 3Q83A 1SUQA 3IFEA 2FHJA 1NNDA 4LBPA 1FRXA 5A76A 1NEEA 3HSDA 4ECQA 3FZ2A 5JVHQ 1Z1ZA 4URQU 5DS7A 4RNHA 1RAFB 1F9FA 5FDLB 1NCLA 4JI8J 3OUYB 2KFYA 3BSCA 4CO0A 5DDRC 3I32A 2VQFF 3W5ZA 4WFNQ 2RB7A 1CPZA 1T3OA 2UVRA 4ZLJA 1AXQA 4DPXA 4WK3A 2A0FB 2E1AA 4I6AA 4M95A 1F6TA 2DPIA 2V63A 3OLBA 4A8MP 2DRAA 4V19X 3DRSA 2LCWA 4FBUA 2JWNA 2K06A 4C48A 4ZIVA 2WOMA 2QSWA 1BXNA 3HHKA 4Q0BA 3IR7B 4RBUA 3VAGA 3NMRA 1SBRA 2PGCA 4J9LA 1RE1B 2GIQA 3CDWA 5C24B 4ZLNA 4F4XA 3MPDA 1J2VA 4DN9A 3QO9B 4ES2A 2EC2A 4PWUA 4Q5VA 2C2KB 3TAMA 4KHPJ 1RDRA 4WP8A 2DRBA 3H8YA 3O1LA 1Y3KA 1C0TB 3UNGC 3D68A 3ILOA 2Z57B 2CA9A 2AJ4A 4IFYA 2GAHC 4KT0C 4YB6A 5JVGQ 4DL5A 1VR6A 3CDAA 4NXNJ 1TKXA 2EK1A 1UVMA 4ZA1A 4J9MA 3W2WA 2QEXS 1HA1A 1SJ3P 1CQNA 4H4OA 1AT1B 2OMOA 3G82B 1YQHA 3FCHA 3R2CJ 3MMBA 5H9EJ 1Q8IA 3KLVA 4OZ1A 3AJ1A 1WC0A 5B0DA 1XWLA 1PIEA 4N77A 3MTJA 1KBRA 1R0AB 2Y1RI 1I3OB 4Q45A 1TL7B 1WEYA 1N36F 4ZVQB 2DXDA 1JJ4A 1TVRA 5FLXU 2HGNA 4NLPA 2NYIA 4HI2A 2C3OA 1RKIA 2LYVA 2DH7A 2G2OA 3PY8A 2WVFA 4KGKA 1RGVA 3C15B 3RRGA 2JC1A 1Q95G 4X4RA 1U8SA 4LJMA 3WC2A 4DS5A 1TKDA 3THPA 1S9FA 4P2SA 4GMKA 3MAAB 3NXZA 1S72S 1U1KA 5KG4A 3QSIA 3FEYB 5DM7Q 4WP3A 4Y65A 2RRBA 1RBLA 1HWUA 3D3BJ 1B7FA 1QDUB 4L76A 4OX9J 4Q2LA 2F1FA 1VDHA 1S5ZA 4EO6A 4MKVA 3PXGa 1CULA 2V4JA 3NAIA 4DV7F 1SL0A 3OFHA 5FJ4A 4HACB 3K0JA 3NBPA 2QLFB 1IVZA 4QWDA 3CJTA 2JVOA 1X5OA 4OFZA 4RUCA 3PW7A 1SQEA 1TMMA 2OIHA 2HRUA 1H7WA 2GHWA 2VHGA 2AGPA 4TYBA 2MY8A 3MAQA 1VQ5S 1FK9A 2UUBF 4MJKA 4OZNA 1RTIA 3PFEA 2GC8A 2HWHA 4D3HA 4C2MA 3MM5B 3TWZA 5CHCB 3G4SS 2CPZA 3CNQP 1WG1A 4KO0A 3IMQJ 3OLAA 1ZPWX 4ZDNA 1Q5YA 3UWTA 3KLGB 4S0MA 3RGIA 5I3UA 2IBKA 1OQ6A 8AT1B 3JQMA 5C7PA 1OS5A 3CT9A 3T19A 3EVOA 4HT7A 2ZH1A 4FYVB 4PG5A 1UJ5A 3C6UA 4MK7A 4UQTA 5IQQA 4CNYA 3FBEA 2ZHOA 2H4YB 4W90B 2VC1A 3O8WA 1WTBA 2AMCB 1RACB 3BB5A 2IHR1 4I2PB 3DMJB 1H72C 5GMKa 2HRTA 1UVJA 2YKNA 4AFFA 4DV0F 4HDGA 4HT5A 3ILLA 3SCJE 4K5SA 1S9EB 2RD5C 2BW2A 1KLNA 4F4AA 2XMJA 3NOGA 1MU2B 3DLKA 5AT1B 1HKAA 3OXFA 4A48A 1HYSB 2PMWA 2QFIA 1S6UA 3P3DA 2QLBB 3KK3A 1GFWB 1XIQA 1L3SA 3QRQA 2PI4A 3BN7A 2ZDOA 3ISND 4IG0B 2XY6A 1QAXA 4ZP6A 1I94J 4ZKAA 1VBXA 4C8MA 2C2MB 2WK4A 2PA8D 3ZNUA 2KZZA 1D1UA 4I6WA 1V3ZA 3G86A 4DFJA 2DT9A 2EXUA 2BQ3A 1RA6A 1FDAA 5K5MA 5A8RB 2CKWA 3WX4A 3IGNA 1TL4A 4HTIA 4QIVA 1RT5A 3EMTA 2JX2A 1HI0P 3MDFA 1H0HB 3DRPA 4B3OB 4KGMA 5HROB 3K5PA 5BYSA 1NKCA 1ZAWA 2UUCF 4RBVA 3S8SA 3V4IA 2R7SA 1LXJA 3QIDA 4LRAA 1TKZA 2RU3A 4WTYA 5C5JA 2W2QP 4ZPTR 4M5JA 3PZPA 2QMUB 3OJSA 2ROPA 4BCAA 1VQOS 2IRYA 1EP4B 3I4PA 3AA9A 4JBCA 5F8LA 1BQMB 3CUNA 3A8KA 2VA2A 4MH8A 2GVDA 3GSDA 5LL6d 5GAEI 2F9JA 4Q7AA 4DFKA 1SC3B 4OLOA 1O0PA 5J2NA 3W64A 2YNGB 2PE8A 3CDUA 3FVYA 3SYZA 1YJTA 1Y5LB 1J5EJ 3HXMA 4N41A 1RISA 2Z2ZA 4U9RA 3SCKE 2VQEJ 1S10A 4IG3A 5LSRA 2FC8A 3UCZP 2UUTA 4DJBA 1MN7A 5DRKA 1WHYA 2F4VJ 4KV8B 2GA7A 1GTHA 1RHRB 2IM2A 2C42A 3K8WA 2AGOA 3UR3C 2MJUA 3JYTB 1KD1T 2MKIA 4A8FA 3GJQB 1U1OA 3DGPB 3M8YA 4QR1A 3P5TL 2NZ4A 4EK2A 4O44A 3LP1A 2BV3A 3FC9A 1MG7A 4U96A 4Y3CA 4DV1J 1A7GE 5IWAF 3QLHB 1BD6A 3V6KA 1UPMB 1GNKA 4JI5J 2XCAA 5L38A 1VRQC 1SJRA 3OJUA 3B78A 2R2RA 3PR5B 2XO7A 1F5CA 2BQRA 3N01A 4W4MA 1IKWA 3EJMA 1QAIA 3LH2S 3UVJB 4MIBA 1OYEA 4ZP9A 1FERA 1T9VA 3BGRA 2UUAJ 2YWFA 2MYFA 4EWTA 4QWAA 3UN2A 2XY5A 1SKSA 5I42A 1TKTA 5CABA 2P5VA 4OZ0A 2ZUGA 1EAYC 5KT6A 2YNHB 1Y7PA 2HAIA 4NRTA 2NREA 2XEXA 3R1LA 3J7ZT 4H4MB 3TARA 4Q8EA 3CCSS 4FF4A 4Y2IA 2APOA 3GLJA 6AT1B 3M2RB 4GKKJ 3IP0A 3R3TA 4OMFG 2E7XA 1FKOA 4X4PA 3SBMA 4WYWA 2GJFA 1IR0A 3KFWX 1DTTB 1Z2LA 2MKKA 3PX6A 1NJIT 4MTPA 2IDLA 3QQCD 4DX5A 1NSAA 3GV7B 1IQTA 1VJQA 1Q81T 1S59A 4DU7A 3I82A 4IQMA 1SH3A 1B0VA 1R31A 1WC6A 1RWXB 4LQ9A 4R0JA 3H5XA 2YH0A 1HWJA 4ZPBA 2EK6A 3I0SA 1U0HB 2QLWA 1FX4A 1WI6A 5D0HA 1KLMB 3ZZPA 2DNQA 3CCUS 2ADCA 1AZSA 2O1PA 2VODA 3BSNA 1JX4A 2B7CB 5MLCV 4KC5A 1X9WA 2C3YA 2V2VA 3VV2B 1RAAB 1FDBA 2JEGA 2QTWA 4DLGA 2L9NA 2HHHF 3CJKB 1NJWA 4XK8C 1S97A 1GXTA 2DK2A 4I68A 1GMUA 1FKAF 4G1IA 4I67A 1YZ7A 3MMCA 2EFPA 1T9WA 2JFDA 2MZ1A 1GEHA 3FEXB 2DCUB 2BJ7A 1HMVA 4YY3J 3U02A 2ZNYA 2BM0A 3K17A 4KE5A 2OEJA 5KFXA 4J9OA 3R7SB 3HHNB 1MN9A 4UY85 1ZTTA 1NZ8A 3GIIA 4A8XA 3D1OA 2OPQA 2HQIA 2IAJA 4C3MA 4ECYA 2LKZA 3M8PB 1TL5A 4WP9A 4DEZA 3AD9C 2P6TA 3K8VA 4KKOB 1NDCA 2KVIA 1REVA 2MZQA 4E2FB 3IN5A 3M7VA 5M2UA 3DOMA 4HDHA 2HK2A 1SJFA 4JYAJ 4H54A 3R5JB 3UR0A 1X0PA 3CIMA 4QWEA 3A1YG 2GJIA 1N56A 3UN3A 2C28A 4X66F 5KFOA 2B5JB 3UO0A 2QV6A 1BC6A 2HQDA 3H5YA 2QZ8A 3KMSA 1Q5VA 1WI8A 3IBWA 4AD6A 4NYZA 4NZ7A 3HDSA 1WKLA 1IKVA 1WORA 3BGFA 3PKMA 3RBDA 1XMBA 2W25A 1IBMF 2D3UA 1U1QA 4FYYB 5A2QU 3MOJB 5A8WA 2RRAA 3M8QB 1D0EA 1OJ4A 3X1LB 1XERA 4UUWA 9ATCB 4B3MJ 4AXIA 2CJAA 2GMJA 1DHMA 2XMTA 3TA1A 2VD3A 1LW0A 1FESA 2J5AA 3J81U 4TU9A 3QIPA 1UWBB 4G1QB 2DIUA 1MMDA 1TL3B 4M5KA 1NKEA 5KFMA 4UF4A 1EIYB 2E7WA 4J9PA 2RS8A 1X4EA 2GVZB 4DR5F 2JZ5A 1ZM3A 2JVRA 2P6SA 4DV3F 4ED2A 3KUHA 5KG6A 1H38A 2I9SA 2ZH4A 3LF0A 1VOMA 3PCOB 3P4UB 3TAPA 1VHIA 2ILZA 2ZKTA 1K8AT 2YNFB 4DV2F 2XO6A 5L1KA 2AX1A 3J7YI 3MR3A 2LXFA 2WHOA 2I5JB 2ASDA 2CPEA 1SV5A 1Q0NA 3C19A 3D6TB 2HNYA 2R7XA 1H98A 1FDNA 1RCOB 3B4MA 3VAFA 4RBTA 1CS4A 1C0UB 4LSNB 4ID8A 4FYWB 4DUTA 4KR0B 1IWAA 5A8KA 2XSJB 1HNVA 2MMYA 3JQKA 3DC2A 2VFSA 2AYEA 3FEZA 4WBFA 2HBRB 1UVLA 4LSLB 3MEGB 1T95A 6FDRA 2HAFA 3KLFB 3A13A 1XEZA 5DZ6A 4K7QA 3TI0A 2E1MC 3DLGA 5FD1A 4CM0A 1R6VA 1S1UB 3H42A 2KDOA 2VA3A 4FF3A 3RBXA 2VG7B 5K14B 1BLUA 2VG5B 3IRWP 4ED7A 4P75A 4KSEB 2Y0BB 2FVRA 2CNLB 5DQHA 3FKBA 3TJ9A 3SQGA 2WVBA 1ZZFA 3PW0A 5HMXA 1G6BA 1M1GA 3H2VE 3L7OA 5B0AA 1V6HA 3GV5B 2IA0A 3Q8UA 3TUPA 3WIUA 3QRPA 4ZN1A 1VRTB 2V8DA 3KNGA 2XLIA 2MHEA 3CC2S 5GADI 4C8YA 4WYLA 2BANB 3ZTOA 2NXJA 2CQ0A 2HNDB 4ZLLA 2JEIA 1MNEA 3QT8A 5GAHI 1IKXB 3NGUA 3EZOA 4P2FA 2X1FA 3W60A 4OYWA 2HS4A 1SIZA 1E6YA 2LEPA 3DLHA 2IYIA 2BE2B 2IM1A 5AXLA 3QPIA 3TA2A 5KFGA 2I38A 2DGTA 4HHHA 3J81Y 1U6ZA 4Z7CA 4DV4J 2IMOA 5AJ3F 4KH1B 1DZ5A 2HLUA 3GSIA 1Q79A 1FNOA 3DCAA 1UKUA 4JV5J 1X9SA 1RT3A 2W9CA 5JJBA 3KDOA 1RADB 4JI6F 2P2CB 4O23A 1YG0A 2NZCA 3WZ0A 1F5AA 1HD0A 4LBIA 2DNOA 2Y8WA 2J7UA 1FJGJ 3C6TB 2VICA 1KNZA 3GCXP 3POTA 4HI1A 3HCXA 5F9NA 3PHEA 4UQGA 2DXEA 2FIUA 2ALYB 1MWZA 2YWHA 3RB3A 4Z37A 3FMBA 1V3RA 3CJKA 1LKZA 5CA5A 1S6OA 5HP1A 1X5SA 3F41A 2LLZA 1KVKA 1PJ6A 2COLA 5B08A 1FXDA 2D7SA 2O66A 2U1AA 2ABYA 4F67A 2DR7A 3H40A 2QMXA 4MFBB 1KDNA 3GU0A 3RW7A 1JLCB 4B3TJ 1MMLA 2AQ4A 1S6PB 2YNIA 2Z4PA 5C2GA 4Y2AA 2VPZB 3OQ2A 4C0HA 1PGZA 2BRKA 1M5VC 3BS9A 2DD8S 5HATA 4DG1A 3V81B 4PCQA 2MZTA 3DOKA 2B8PA 1KC8T 3EUNA 1K47A 3L7PA 4QWBA 4ZJQA 2MZSA 3JTNA 1S6QB 4DPTA 5KG3A 3WX8A 3BYPA 2ALZA 3PTWA 3NGSA 4RWWA 1GMWD 1HNIB 4R5PB 1YVFA 3C16B 1B70B 3RRHA 5LMUF 1GK8A 3MR5A 3BH7B 4L3NA 2HNZA 2KG1A 5D3GB 2EFOA 3EZ5A 2XZDB 3MD3A 2R7TA 2NPFA 2NSBA 3ZC4A 1KTQA 2J8AA 2Q6BA 3D6HB 3W2VB 4DFMA 4DMZA 5LXYA 4LIRA 4JI2J 3RB0A 5D4NA 4CYUA 1E6VA 3R5BA 3OR2B 1NK5A 1JIHA 3CTRA 1UA1A 1AUDA 2HW3A 2UU9F 4NEYA 4IYQA 3I6PA 2VFVA 2AW0A 4LF6J 3RB4A 3RZAA 2W8KA 3SSSA 3THVA 2B6AA 3VWSA 3KDNA 3F44A 3NS7B 4LRDA 3MEDB 4F26A 3MEEB 1CJTB 4NMXA 3MAHA 2UV8A 4JV1A 1PSDA 2X3GA 4F0MA 1FWPA 4URSA 2OTLS 2HS3A 3W5XA 2NPIA 2R7RA 1I94F 4QCLA 1X4BA 3CJSA 4AL7A 2BE7D 1Y0HA 4NXMF 5HVHA 3UW1A 4HLBA 1JLQB 1WG5A 4HVZA 4DSKA 2FC9A 4C0OC 3EGWB 3HM9A 4DI6A 2HIQA 1S1VB 1U6FA 4C8NA 4LFBJ 3H2UB 1RT7A 3I0RA 1FF2A 1PYTA 1CJUA 2X1GA 1LWFB 2E1CA 3CC7S 3RUBL 1D8YA 2J9DE 4FPRA 5F8IA 1YBTA 3Q24A 4A4JA 1H7XA 2XWYA 5ITHA 1XNQJ 2FTRA 1S9GA 4I69A 1H2UX 2VC0A 4K4TA 4C8OA 1CJVA 2MQOA 5D0GA 1CLFA 5KOXA 4HYKA 4G1PA 4OL8A 4RW7A 1DTQB 1T7PA 1FXRA 4C9DA 2DHHA 1PKUA 2MEWA 1FD8A 4RUBA 1C1CA 3RYLA 1NDKA 2DGUA 3G87A 4C98A 1VQSA 5KFWA 1X31C 5E2QA 4I4BA 3BZQA 3T5HA 3CCMS 1HNZF 3GONA 2ERRA 1JMTA 3E51A 4IFVB 1AYEA 3NS6A 4M5IA 1JNZB 3MUMP 3SXLA 1UPPA 3EPIA 2ZUAA 3MM8B 4QR0A 3UCGA 1J5EF 2J76E 2YBVA 1PILA 3SV3A 5HLFA 2AP6A 1KQFB 3AJ2A 4JI7J 3DLJA 2EI5A 5CYQA 1T03B 3FQKA 3NWRA 3OTCA 1IKYA 2E44A 5SZTA 5CD4A 4URGA 2F4VF 3HZGA 1O8BA 2HFSA 1FFSB 4B9LA 2J8SA 1LWEA 4WU3A 5B0GA 2M7SA 1LWCB 4F25A 3E01A 3S6EA 2R2SA 4TQSA 4OYBA 5KFKA 3U1MA 1V5IB 3B4DA 1I51B 1ICEB 5CYMA 1H2VZ 3H2LA 2B4OA 3MEKA 4DQRA 3LAKA 3EYZA 3TVKA 2B56A 2M5YA 2PD1A 1RYRA 3G6XA 2CQDA 2NQPA 3FK4A 2HIYA 4CLLA 5J2QA 1ZAXA 3OVAA 1FRKA 5ETOA 4ES1A 5T7LB 4ZLPA 1WOPA 4DV1F 2PEBA 4WWSA 3ZTQA 2V9WA 3DLEA 2WVCA 4E8UA 2VQFJ 3DFEA 3R5CA 3TUZC 3EGVA 4LT6A 3NGRA 2J9DA 2RDIA 2E5IA 2F7VA 4RW6A 3DN9A 5J1NA 5IT9Y 1EB0A 1FTRA 3PIPQ 1HI8A 4B08A 2W2NP 1OPIA 3FCWA 3LTOA 4PZVA 5H9EK 3A8EA 4ECTA 1RZMA 1VBYA 1TFWA 3W8GA 5J2PA 3JSMA 1TV6B 5AE3A 3ZZRA 4WFYA 2QG9B 2OHDA 3GILA 3L4BC 1B99A 2QA4S 1B0PA 2LU1A 3HSGA 3LW5C 3M2VA 4NL5A 5KFFA 2A10A 3UD3P 3Q8QB 3M8WA 2G13A 4J91A 1UMJA 2FLPA 5JUMA 4RJVA 2CQ4A 1S57A 1NK9A 4XAKA 2ZE2A 4DF8A 3KTQA 2MKJA 4DL6A 4O0NA 2Q1LA 2A2CA 3V5RA 3ENVA 4NRUA 1RABB 2BRLA 5L9NA 1M5KC 2A6MA 5G0RB 3Q8PB 1NB7A 3NS5A 3HK2A 4W92B 3DRXA 1YRTA 2X7IA 5L46A 4JI1J 2UZAA 4LFCF 3BR9A 4ZCIA 5M2RA 4AYBD 2HVIA 2IMWP 3IAS9 3DXBA 1OY6A 4MKAA 1RWVB 4DPYA 3GIRA 1GXUA 4JI0F 1IQZA 2F9DA 1UWAA 3LP2A 3Q86A 2M8DB 4UTGA 4DU8A 2ATCB 3PJ9A 1N36J 2JNJA 4EBDA 1IBLJ 3I55S 1VC6A 4ANDA 2NXNA 1OIAA 3K2YA 3J7A1 1ZM9A 4P72A 1FNMA 3MR7A 2DYAA 2PO4A 3H5UA 2YQ1A 2D3OR 4N8NA 3PJWA 3OTEA 4KGXB 3QT6A 4MKBA 1KEKA 2DR8A 3EWGA 3HVTA 1IJEB 4TLQA 3P6YC 4LVOP 2DEIA 2LA6A 3O5TB 2V8PA 2GMHA 4O3NA 4I64A 2L41A 4IRKA 4CO2A 1U1PA 2YWKA 3MXHP 5IFMA 1QUPA 1P1LA 2I8EA 4QU7A 3PDNA 2BUNA 3T3FA 3BYRA 2BJDA 2RT3A 3QRRA 4UOHA 1RA7A 4QJVA 3DYAA 2QL5B 1WNEA 4M5DB 1T0TV 3PO4A 4RKUC 3ET6A 1XR7A 2E1RA 3BSOA 3CD6S 4OX7A 1RT2B 3AFGA 1JJHA 2LEBA 1NBEB 3K5MA 5E7OB 4FXWA 3F0NA 1FXLA 1PC4A 5HN0A 1QLNA 1JXEA 3OV7A 1S99A 4DR6F 3Q22A 3KLHB 3P8BB 2EFVA 3FDSA 3C3LA 1M1KT 2FVSA 4DL7A 4LFAJ 3JS9A 2C2ZB 1KVJA 1OMSA 4JP8A 2BBEA 5C25A 2RNEA 1U1MA 5K8OA 1X5TA 2BXJA 3ZFVA 1TAQA 3D54A 5GAEU 4J5OA 3K7RA 4RO0A 5F8NA 4KHRA 2YXLA 1FCAA 1DURA 2GIFA 4EZ9A 2N82B 3BBCA 2GO9A 3UFCX 1IXKA 3ZZOA 2WONB 3G8TA 3ENQA 1RWUA 3ZZUA 4IFVA 3ITHB 1GAOA 4B3MF 4J9NA 3NCQA 3N5BA 1CSJA 4X4TA 2OPPA 3QGPA 2DH9A 2KG0A 2OD4A 5HQ8A 2HVHA 5KFJA 4DV0J 2F63A 3L9ZA 1UEUA 4ELUA 2HHWA 1JLGB 1HBUB 2NS1B 5I3QA 1RUSA 1KQKA 2R4FA 5L1JA 2AF6A 4IRDA 4GO5X 4PWDA 2HZVA 2QSFA 4NCGA 2R7VA 2W9BB 4KPYA 1N34J 2EBGA 1WDDA 3RW6A 4K5RA 2CVIA 3KG4A 2CPYA 2W4PA 1MWYA 4PYAA 3HSZA 1TP7A 3G96A 4G3IA 1NH8A 4BS2A 1C1BA 2W8LA 1JWWA 3JQJA 2RQCA 1TL1B 5HBMB 3M8SA 3M6UA 2ZJRQ 2Y9HA 3HFZB 3CSKA 4JV2A 1HWIA 3QWPA 4YR3A 3OPKA 2OPRB 3V6DB 4IDKB 1NHUA 2ZOMA 3G9CA 1OSDA 2MKYA 3OL6A 2ZH8A 2I1RA 4F4KA 2L9WA 2KL8A 3M30B 5CAAA 4AQYF 1SKUB 3QT7A 2M9KA 3DKDA 1MLAA 2FZGB 4CTAA 2CJBA 4HR2A 3LALA 2AU0A 2E5GA 1GQEA 4MIWA 2AJ0A 2N7CA 4RR5A 4O3QA 4O4GA 4BWMA 3KK2B 5ETKA 4Q8FA 4C8KA 1RAEB 2R8IA 4HKQA 3T1YJ 3MM6B 5IXUA 4ZCMA 3GR1A 1WHWA 1P9QC 1PYSB 2B4VA 3KLIA 2N4DA 3R7BB 1SL1A 2M4MA 4K2JA 4D3GA 3ELHA 1HR0F 1SUQB 3NL0A 4CDIA 2R7UA 2HWIA 1V3SA 1Y00A 4QU6A 4ZVRB 1XN9A 2R8GA 4JI3F 4DN0A 3GR0A 3CCRS 2EEYA 1N4LA 1NAQA 4WFXA 4M5NA 3T5JA 3MCSA 1B64A 3VQTA 2OH2A 1N0UA 4PWWA 2E9TA 3VGUA 2M52A 5J1PA 1HFEL 3W9HA 4YHHF 3IWNC 2GNKA 2DNMA 2ZH2A 2LEAA 3T1AA 1KFDA 2CQ3A 4CO4A 4NYOA 2YWWA 1QVFR 2N3LA 4X84A 2CPIA 3NOCA 5ETPA 4FXDA 1FHTA 5IWAJ 2B9WA 3EGZA 5HQMA 4WKYA 1W7WA 4DR7J 4N7TA 3OFGA 1Q16B 4CT9A 5I3PA 3DRSB 1QM9A 3N6MA 3QWUA 2HK3A 3MZIA 3I5CA 5LSOA 2CNKB 1U2CA 3RTVA 2WOMB 4V19J 4Q0BB 2PMHA 4B9UA 1Q8KA 2CAJA 5DDOC 1ROFA 1WG4A 3D0HE 1S4EA 5B0EA 2OP5A 1A9NB 1R3NA 1ZOTA 3N6NA 3TAMB 4GRSA 4YP3A 2YX1A 4ZPVR 1APSA 4J9UE 4M94A 2MXYA 3MF5A 4NZ0A 4AL6A 2B9YA 3T9ZA 3W9IA 1BWVA 2DO0A 5BYRA 4IFYB 4KGZB 3PVXA 3HO1A 3J81j 1TKXB 1RTJA 3ENAA 2ZNZA 5IOLA 3SFGA 1N33F 3MWBA 3W2WB 1VQKS 3LANA 3RRKA 1VCTA 1M90T 4H4OB 3M8ZA 5KFNA 4ZVPB 2OFHX 2ZVSA 2PEHA 2VASA 3CXCR 3MMBB 4C11A 2V68A 1YITS 1CJKA 2RKIA 2OELA 2DH8A 1FT8A 3KK1A 1GMVA 4P2XA 1ZA1B 2IM0A 1TTHB 3M9MB 2IDEA 4ZK7M 1WELA 3HVAA 1TVRB 1TZ0A 3I4HX 3WDOA 1U25A 1TUVA 4KTQA 5A0YA 4B9TA 2WW8A 3HJFA 1RTZA 1FVQA 2YVSA 3TEHB 3O6QA 1YLXA 1BQNA 2RMLA 1HIYA 5B0FA 3B8HA 2H1YA 3I5AA 3M1VA 5KG7A 4BC9A 2G2ZA 3TAQA 1RU1A 2C2DA 4NLTA 3T5LA 4F3QA 4KAIA 1RHMB 5IT4A 4LUBA 4NLGA 2BJEA 4LF6F 3P5BP 4LF9F 5D77A 1L3VA 6FD1A 2QA1A 3Q23A 2NSCA 4QPXA 1HHSA 1RAJA 1CULB 2V4JB 4CQ1A 1TK0A 3PYGA 2B8QA 1FE0A 3NBPB 4QW8A 1PO6A 2DIVA 3GIKA 3PX0A 2C2EA 1K0TA 3J7YU 4OYMA 1I1GA 3PW5A 2WBMA 1PBUA 1AA1B 3D67A 1N52B 2CWXA 4CLTA 3CULA 1HWLA 3UPFA 2Y1IA 3FSIA 4KRWA 3VCDA 2XB2D 3FBCA 1PAEX 2M2BA 1VQ6S 2MLYA 1S1XA 2DGVA 1VRUA 4OQJA 1FK9B 1FKPA 1WD6A 1ZTWA 1RTIB 2PA3A 4JV0A 1F3VA 4LRCA 3T6JA 2BKOA 4DV5J 1JLAA 2B4UA 5EGYA 1EETA 2K2PA 4DF4A 4KO0B 4WIIA 4DL0C 3TEGA 4Q44A 1WKJA 4Q2MA 1HNXF 2OTJS 3DNCA 2Z0GA 1FFGB 3BPSP 3DGVA 4ED4A 3FUYA 3MR2A 2MLZA 5I3UB 1Z2ZA 4CLKA 3QJPA 1B7YB 3MPYA 2MGZA 5AE2A 4BBYA 3HD2A 2W2PP 1Q53A 1SCJB 3C6UB 3AOBA 4X4VA 1FTCA 2XMMA 4O3OA 3D0GE 3OBIA 3HHLD 3QJLA 4XIUA 5E3AA 2XMUA 1TFYA 2RU9A 2MSTA 3GG1A 3SDEA 4JOUA 2MQQA 4FZVA 1QSYA 3GIJA 2B9EA 2K3KA 3CE8A 2YKNB 3LP0A 1IBMJ 2N3OA 2NUHA 4DWIA 1LOUA 2VJVA 4JI7F 1Q82T 3CMES 1CC7A 4CNZA 1IJFB 1JLEA 3D7SB 5GADU 3MPUB 3DLKB 4OX8A 1WF2A 2DGQA 5F41A 3BQ1A 2M88A 2IJFA 4ES3A 5DLFA 1TK5A 3KK3B 3BSAA 2BOPA 1GX6A 4K0KF 2H3EB 2FY1A 4DUYF 4DR5J 1RU2A 1FEHA 4DV3J 1DQ9A 4YR0A 5DZ7A 1R89A 1BE4A 1JB0C 4IOCQ 4U7CA 3HFVA 4RWXA 4OHXA 2ZJQQ 1D9AA 4ITSA 4OI1A 1P9YA 4DV2J 2K7KA 3NKYA 2AJ1A 2MY7A 1JJCB 4UOFA 1RJJA 2XQCA 4WTOB 2M0GB 4PEOA 3LGNA 1RT5B 3W1YC 5ADZA 2DTJA 3BO3A 2BKPA 3DRPB 3EX7B 2XMKA 2IC3A 2JEJA 1R8BA 2JRSA 2ZOGA 4HEA9 1ZZNA 4ED1A 4LR7A 3V4IB 4W98A 1TKZB 2V50A 3TUJC 4X4SA 5CCMA 5B0BA 3D5MA 4M5MA 2YKAA 2DGWA 1QUVA 1X4CA 3S01A 1IM4A 4Y28C 1HNWJ 1MMNA 4ZJLA 1S1WA 3OTBA 2YX7A 3G71S 1ZPVA 2UP1A 4PUOA 1FWLA 3TRGA 5IM0A 2GVDB 4CO5A 4FS1A 3M4XA 1C2PA 3KJQB 2H9ZA 1D09B 2DNZA 5J2NB 4DCOB 4PQUA 2DNLA 4LF8J 2Z2MA 4F2SA 4BC7A 4OHYA 3OR1A 2K3IA 1FRIA 4IG3B 3OVBA 2OFGX 4I2QA 4J90A 4IKAA 3THTA 1S48A 4LSZB 5KG1A 3VALA 1OY8A 3UDVA 3KKFA 1VBKA 2YPZA 1QTNB 2FJWA 4CLWA 2VBZA 1YI2S 1PYOB 5HSPA 3T1HJ 4DDFA 4PPZA 3FRZA 2VG6A 2WRMA 3TOQA 2V8HA 4JB8B 4TU7A 3BF4A 2GV1A 4X64J 1SPBP 1WKKA 3MI7X 4L6V3 4JI1F 4K59A 1K1QA 8ATCB 4X4OA 5K20B 1OSCA 3UD5A 1U49A 4UW2A 4KBIA 1SKRA 4X4QA 1RHJB 4O44B 3LP1B 5KFVA 2V94A 3CEDA 4DS4A 3TX0A 1WUUA 2E29A 3MCNA 5DETA 2ZHBA 5F8HA 3W5YA 3SEOA 5C42A 5G4DA 5AJ3J 1IBLF 3IGVA 2C1EB 1SC4B 2BQUA 2Q79A 3M9NB 4USWA 1P1TA 2XLJA 4MK8A 1H3DA 3IG1A 4PXBA 5DGAA 2HRYA 4JI6J 5F9LA 2KH9A 2CDQA 4DPOA 5EUHA 1R8AA 1G2EA 3PACA 1IKWB 3GIMA 1HW9A 1AFIA 4GVBA 1YJWS 4K50A 4KB7A 2CPJA 2J6TA 3BGRB 1U09A 4KFBA 2JSXA 5I42B 1TKTB 2EG2A 2EFGA 4EUVA 2M70A 3PKYA 3DHXA 4J37A 5HVFA 2ZH5A 4DL3A 4YEAA 2LQ8A 3AB4B 3JTOA 2Y8YA 1WTFA 3FFIA 2PFDA 2ZJPQ 3CB4A 2IRXA 2AJ2A 5GAGU 3GB0A 4XPCA 2H5EA 4AXJA 1IR2A 2HPUA 2C2NA 2CJYB 2W2MP 5D8HB 3ZTRA 1FKOB 1V5VA 3TR5A 5AXKA 2EC0A 3RAXA 3HT3A 2AWZA 1DLOA 2M8HA 3D2WA 2RDDA 4DR3F 3D4JA 4IH5A 3IR5B 3H4BA 2M3DA 4IH7A 1FI4A 4UUXA 1UP1A 1FD2A 5KG2A 3HLUA 4RW9A 4HL9A 2NXEA 2FHJD 1RLCL 3MECA 3TW0A 2AGQA 4U7UD 1SXLA 4LFAF 3H90A 1ZA2B 4A8WA 2CG4A 1Q7YT 4IO1A 3MOZA 2BDPA 3I0SB 1QJHA 2ZITA 4U8VA 1QD1A 4RLEA 5HL7Q 2RQKA 2IRUA 2VUGA 1AZSB 3MHYA 2VBYA 3ILIA 4ECRA 4LF1A 1UFLA 3CWJA 5EN1A 3D28A 2Y3YA 5LMUJ 2X51A 4OV1A 2FGOA 1NMEB 5CXTA 5KTQA 1GX5A 2FHMA 4B3RJ 1TU0B 1EQ0A 4PG7A 1Q8BA 5IC4B 5D4LA 7FDRA 2KU7A 3U1NA 2MHNA 3BJYA 1RTDA 1JK9B 4B9MA 3G8SA 2NXUA 2ZH6A 1LQ9A 3MPWA 4AE5A 2R7QA 4B3SF 1DQAA 3FRYA 3CDBA 3MMCB 1L3TA 2UU9J 1UVIA 5H1SV 4EYHB 5FLXY 1EX8A 5DLGA 4HH0A 1HMVB 5EHHA 3QGIA 4N8OA 4OZJA 3QAUA 1XTZA 2VBWA 2CQIA 4EEYA 1DJ0A 2OPQB 2MTLA 1A6LA 1XMQF 4V1Ak 3WQPA 2IAJB 3BR8A 2QN6B 1N34F 1HWKA 2FJVA 4KIAA 3HSJA 2VOOA 1KQGB 1REVB 3DRRA 3GQCA 2QYGA 4DV6F 4USVA 4CT8A 4NXMJ 4EU0A 3AOAA 3W62A 2F3JA 3LOUA 3DOMB 4B9SA 1TUWA 2DHAA 7FD1A 4C4WA 2DHGA 2C2OB 4K4WA 3A8JA 4MAKA 5HMWA 1W26A 4KY3A 1X8DA 2MQLA 3K59A 4HTJA 3M2UA 2ASJA 4DL2A 1LXNA 1RT4A 1CG2A 1S1TA 1D8ZA 1YHQS 1Y4ZB 4WE1A 1NK4A 1T9YA 4ZVOB 5KFLA 1R43A 5D15A 4ZVHA 3NP5A 4WKRA 1SQGA 4X2BA 4ICLA 3UE2A 1N6QA 2UXCF 2K8GA 1NXIA 2ZOFA 4F7VA 4J9RA 3R6GB 1UVNA 1VQMS 5LM7E 5E0OA 1F60B 4CIOA 3MCMA 4ED0A 1VQ9S 2D3O1 1IKVB 3V6HA 4LRBA 2IVYA 3AXKA 3J7Z5 3BN4A 2C3MA 2XMAA 1X4AA 1LW2A 2ZBQA 1HNZJ 1HPZA 5A8WB 3GJRB 4YN3B 2HMIA 1MROA 2OKQA 2VKRA 3EDRB 1FJCA 2WZ1A 4QYZK 5L39A 4ZMMA 3T1YF 1LW0B 3QIPB 5HMZA 3TZWA 1ZM4A 3VF0B 4C6AA 5D78A 2XGQA 3DDIA 1WSVA 3PO5A 4IH6A 3VAMA 3TZYA 4O3RA 2EVZA 1SH2A 4G65A 5B0CA 4ELTA 1TK8A 1RT6A 2WSEC 2HFNA 4QIFA 3LWLA 4IO9Q 1UAWA 3KWMA 4LF7J 3AODA 4WK1A 1VQ4S 4QBUA 1YIJS 3GFHA 3MM9A 2RF2A 4M5LA 2RSQA 1WDTA 2CZ4A 4IOBA 1SV5B 2YH1A 2VH7A 5KAKA 1GT8A 2HNYB 2V2QA 2MQPA 1X4HA 5ETQA 3X3UA 3G6YA 4UOCA 2G4BA 5F8GA 1CS4B 4DSIA 3K57A 1N5VA 4NE9C 4P74A 3J80U 1BUXA 3P45B 4DBQA 2VIHA 5A8KB 4ZVTB 1HNVB 4RNFA 5J1EA 4ILRA 4DR7F 4KQZA 1RAHB 1M5PC 3R97A 4N47A 4OJ1A 3HHLA 3BBBA 1VIOA 2VV5A 2IPOB 4F0HA 2CIMA 2VONA 2XC9A 1S76D 4NA2A 1ACMB 1YK9A 3DLGB 3NNCA 1YJNS 2JLFA 2MQ8A 1FRLA 4XO0A 5L9XA 2U2FA 4U95A 1YSJA 4LVNP 1X4GA 4YUDA 2FJXA 1ZM2A 4LR8A 3KLEA 2PFFB 2ACMA 2KI2A 2CNNB 3SQGB 4QYRA 3VQSA 3NCPA 1JKHA 2XMWA 4HHJA 4B9VA 4G6VB 2PC6A 3KJFB 1PBAA 4FXVA 1Y10A 4NLVA 1T8EA 4ZPWR 3AAWB 4NX9A 3WBZA 3IRXA 2IJNA 3P96A 4NLRA 2RQ4A 3N4WA 4CH1A 2F65A 5F0UA 1N5QA 3CDEA 5KFEA 4O3SA 1YDLA 3H4DA 4NLUA 5E3PA 3ZZYA 3TX8A 2OSRA 5ETVA 4F0KA 1ZETA 1E6YB 1NJYA 1RWOB 2RJZA 4NLYA 1RK8A 2AEFA 4LF4J 2FYXA 4LFCJ 3W7BA 5IV3A 4N56A 1SJ1A 4LMZA 5L8RC 3A8IA 1FVSA 1VC0A 1N8RT 1O5JA 4CLSA 3D1QA 1JLFA 3R8YA 4JI0J 3KNAA 1RT3B 2W9CB 2LQJA 3IS9A 4YOEA 4WFBQ 4WF9Q 4TYAA 2I2YA 4I7FA 3ICLA 4CLPA 3SZ2A 1N32F 4EGLA 3R6LB 3POTB 4U7UK 4RW8A 4F04B 1HBOA 3MPVA 1XNRJ 3BKFA 1TMJA 1DBDA 1RWPB 1HQEA 1XR6A 3SFUA 2ZC4A 2ZZMA 2FLLA 3MUTP 5HP1B 2FB0A 3M6VA 1RTHA 2J9CA 5B09A 4DCJB 5DQIA 3BPDA 3AJDA 1Y5IB 2NR0A 2KXHA 2OAUA 4A8OA 3GTYX 1FRHA 1VQ7S 1RI7A 1RT1A 3ZZ0A 1VYAA 3C14A 3M05A 2YQ0A 4KJIA 4J9VA 1F0XA 5J2MA 5F8MA 3ETMA 2YNIB 2FJEB 3PW4A 1P6TA 4NZ6A 4J9KA 1XK8A 3KG1A 3UDCA 2UXBF 2LQBA 3SSRA 4FF1A 2W7AA 4FN5A 4DG1B 4ED6A 2KFNA 3DOLA 4NLWA 3DOKB 1RWNB 3A12A 4C0BA 3DLLQ 4DV5F 3EDQB 4YMEA 2UVVA 1JQGA 3VTIA 1S79A 4ZPCA 3OXLA 3LUYA 3A3OB 4DR6J 1ZBTA 3PFOA 3LO3A 2OPSA 2OJ3A 2HNZB 3TUIC 4ZITA 3OD2A 4MYTA 1LEOA 3KXDA 4ANEA 2HHVA 2CDRB 1CC8A 2NYHA 3MM7A 1WF1A 4CYUB 1E6VB 4RW4A 3H25A 4DSJA 5F3TA 1PAUB 4YB1P 1NO8A 2R2UA 3MMAA 2KHCA 5KFPA 3KJVA 1UJ4A 2BKNA 2MKSA 2DKOB 1F9EB 3RG6A 2AJQA 4K4VA 2B6AB 2XZTB 2YKMA 3CD7A 2N7YA 4EI2A 2QIFA 1FWKA 4DR1J 2RS2A 4F3OA 2HEKA 4LIWA 3IAM9 1L3KA 2Z8QA 3QFWA 4USKA 2RHQB 3CO0P 4NCAA 2QGFB 3GWCA 2KZMA 3VAKA 3KHHA 3V6JA 3OFEA 1KVIA 2CADA 2ZD1A 3RAQA 1F9HA 3BQ2A 5K8MA 4RUAA 1SIWB 4FF2A 3TNVA 2AZ1A 3F73A 1AUSL 4OI0A 4P7VA 3DU6A 2UXDJ 1SB6A 4HHUA 4WJBA 4QIGA 1RT7B 3I0RB 3HD1A 1CJUB 1HQUA 3WC0A 3IC1A 4I56A 3MTKA 1UJ6A 4ECVA 1FE4A 4TU8A 2O01C 5JMNA 1S9GB 1M5SA 2AEJA 1Q4RA 2CQPA 1CJVB 3AA8A 1VK8A 2GQQA 3GE9A 2MB0B 1LWXA 3ISNC 1OO0B 4P6QA 4RW7B 4WZMA 2DNHA 3B82A 4ZOSA 1IWGA 2VPXB 1HNWF 1JLBA 1C1CB 1J5OA 4TLRA 1SL2A 5D0RA 1WEZA 4FYDA 4DZDA 2BEFA 4UZBA 3QBCA 1IR1A 4AQYJ 2V6AA 2DY9A 4ETXA 1T9UA 2E9RX 2DNYA 1KFSA 2GGPA 2NUUG 2V9KA 3CVKA 1N5YA 3RBEA 5KFQA 1EQMA 4LF8F 1CQMA 3GJSB 3HX9A 5HLFB 1LFWA 1WC1A 4QPTA 4BWJA 4RPFA 3NGDA 5CYQB 1RAOA 2AKWB 2BJ8A 1IKYB 1NH7A 5A6PA 2WB1D 1LWEB 2H4WB 1VI7A 4B02A 4K4ZA 3T1HF 3E01B 1TQLA 3CJ0A 4DSEA 1GH8A 1W25A 2XYPB 2AZ3A 3PEJA 1RKJA 5KT4A 1X5PA 3PM9A 4X64F 2ILYA 1HR0J 5CYMB 2RIJA 1CEZA 5A2QY 1QE1A 3OHAA 2YKOA 2ZWOA 4R8UA 4JI3J 1WHXA 2CQGA 2V2ZA 3G8QA 1LV5A 3DLBA 4WCEQ 3Q8SB 5J2QB 4TY8A 2FD2A 2L9DA 1U26A 3OTOF 2DGOA 3U1LA 2FJDB 2KXFA 1G3OA 2NXCA 1HBNA 1QSSA 2D9PA 2RILA 2UVUA 3MFHA 3LQVA 4LREA 3W61A 1FNXH 4TXSA 3DLEB 3A3PB 4OV6A 2GIRA 4YHHJ 3VAJA 5EDWA 2GW8A 2DR5A 1BMQB 1TELA 3DI6A 2XM3A 4DHVA 3VR1A 4RW6B 5LMNJ 3CCES 3QGHA 2OEMA 4ETZA 4A46A 3AQOA 2XNRA 2BJ3A 4F4ZA 1NUEA 4NCBA 3CO9A 3VVUA 2VBXA 1EKRA 4BDPA 5J2PB 3JSMB 2OLWA 4DSLA 5CH7B 2F8MA 1RHUB 1NPKA 3OXGA 1FEEA 3ZZTA 4KYZA 1HBMA 4Y00A 3M8RA 4ZHRA 5K8NA 4IUFA 2HBYB 2LQ5A 1X0FA 2JDJA 3M2VB 1P8GA 4USMA 3NWGA 5ETTA 2DRDA 4IR9A 3FZBA 2QO3A 4USJC 3TANA 1R7IA 2DNRA 2FGCA 3ULHA 1UTAA 2ZE2B 3HHEA 4OZ3A 3BKUA 3SCIE 1T05A 1YJ9S 1EKSA 4OJHA 4OZ5A 2PI5A 1N33J 2CPXA 2ZBCA 2ZWPA 1WHVA 1KR4A 4Y34A 2YX4A 3CJQA 5KFDA 4NYPA 3JAMU 1NK7A 3JTPA 1FA0A 3ENWA 1CBKA 3TJAA 4BLGA 2VFTA 4ECSA 4JI4J 1NJZA 4R25A 1SC6A 4RNMA 1FO1A 4ZVFA 2A3JA 2CQHA 2V4QA 3BH6B 3QYYA 2B7BB 3LP2B 4FBTA 3M9OB 5CZVA 3M32A 2HVZA 2W01A 4EMDA 3DM2A 2EW9A 1XMOJ 1X4FA 1SQFA 3OL7A 3WHIA 2VDIA 4Y0FA 2DEJA 4B3RF 5AE1A 2O67A 1X60A 4OIXA 3LPYA 4DR2F 2DNPA 2QX0A 3OT9A 1GXLA 2YWEA 2G1HA 2HHUA 5F0WA 2QL7B 1VLYA 3IA0A 3HVTB 2IBOA 4OYZA 2RVJA 2Q66A 2CPFA 4XTTA 2F4FA 5DG7A 5LOQA 3PX4A 2P9CA 4ID5A 4LF9J 4TKTA 2W4CA 5EWEA 3K5OA 2KM8B 2WSCC 3W66A 3FBFA 3O2IA 4LF5F 3PRVA 4P52A 1NSKL 4JUZA 2GS8A 4CO3A 2R8HA 2CZ9A 3DYAB 4ZCLA 2KTQA 4NI2A 1UW9A 2I0XA 3ET6B 4Y6IA 2PSZA 2CVEA 2HBZB 3CCWA 3CCTA 2GQCA 1PG5B 2R9LA 2VJUA 2AYMA 5GAGI 2KB2A 3GG0A 2HGLA 1C4CA 2HZCA 5GMDA 3MR6A 4LQ3A 2VPWB 2B9XA 5FDLA 3BDPA 3OUYA 4RNOA 1K44A 5L1IA 1L3UA 2ZC3A 3IM8A 2ACYA 3TYTA 3CMAS 2YKQA 1S4FA 3H20A 3E8OA 1HNXJ 4DQQA 1S12A 1S77D 4XDDA 3D3CJ 5C25B 3K5NA 2G2YA 1DFDA 3FBBA 3S7RA 4GVLA 3IWLA 1VLOA 5DDPC 3GFZA 4CCHA 3Q8RB 2IYGA 2QE5A 2L48A 4FVCA 3TZZA 3JAMY 2DVIA 2W2OP 2ZM6J 3OHBA 3V4MA 3AH6A 3G2XA 1FRJA 2XGPA 4GKJJ 2ZKUA 1UL3A 2YQ3A 1LFPA 3P49B 8RUCA 3CJ4A 2OPPB 2DXFA 3QAEA 4ILMA 3JSRA 1ITPA 4E98A 1U47A 5C24A 3ZTPA 2QJ3A 2Z58B 3KHGA 3QO9A 3L09A 1JNRB 2VDHA 4X62F 3MCOA 2QMWA 3HVWA 2VFRA 5CYJA 2OI2A 3EICA 5KG0A 3NNHA 1R0BG 2VL1A 3KUEA 4ENOA 3Q89A 2DISA 1C0TA 2O3DA 2AHOB 2BE9B 2WBRA 1VBZA 4PWDB 3G6ES 4LF7F 4CLYA 4NCGB 4K0KJ 3AQPA 4NWBA 1RB0A 4DUYJ 3OTDA 1IBKF 4FKXA 3KG0A 5E41A 3R7NB 2F8EX 1OYDA 4C97A 4MT1A 3HI9A 5M2PA 3GFYA 2WVDA 1C1BB 1YJUA 3G82A 4N5SA 2ZH9A 2XNQA 2AV5A 4I1TA 4QYZJ 5KT5A 3KUGA 2R7WA 1SJQA 1UVKA 3RJMB 5T14A 1R0AA 2JJ4D 1TL7A 4DX8H 1RWKB 2JC0A 3NNAA 2HYIB 4K8RA 1JJ2R 1EZZB 2F8HA 2HZAA 1I6JA 1SH0A 3IR6B 2MPUA 1WOSA 2DB1A 1U2RA 2P9EA 2G1DA 5D0EA 2ASLA 4CTAB 3C15A 3CW2C 1OY9A 2C22A 4A8YA 4GO7X 2EG1A 1TR0A 4WU2A 4H4KC 5THWA 3TA0A 2XMVA 3GYNA 4NA3A 4OI6A 2E5HA 4O4GB 4P9SA 3MAAA 3MUVP
chains in the Genus database with same CATH topology
3N6LA 5KT3A 2FJWA 2HS4A 3CC4S 1SIZA 1E6YA 2LEPA 2VBZA 5KFSA 1YI2S 3DLHA 2IYIA 4OI4A 2BE2B 2IM1A 2PN6A 5AXLA 2ROEA 3QPIA 3TA2A 5KFGA 1NU4A 2I38A 2DGTA 1FJGF 3J81Y 1U6ZA 2IMOA 4DSFA 2W9AA 5AJ3F 4DDFA 4PPZA 3FRZA 2VG6A 2WRMA 3TOQA 2V8HA 3DDNA 5GVQA 4WXOA 3VAHA 1DZ5A 4TU7A 2HLUA 2BABA 3BF4A 2GV1A 1Q79A 1FNOA 3BREA 3DCAA 5DQGA 3DXSX 1UKUA 3MI7X 4L6V3 2E5JA 4JI1F 3NG8A 2GGPB 4K59A 2GHVC 2YWGA 1K1QA 2MZRA 2XBPA 3KLIB 5KFIA 4F2RA 4X4OA 3BQ0A 1N5YB 1X9SA 1RT3A 2W9CA 4RU9A 5JJBA 2JLGA 1OSCA 4PPDA 4JI6F 1U49A 4UW2A 2CJKA 2HG4A 3I56S 4KBIA 1SKRA 3CGIA 3UCUP 2LA4A 4Y2KA 4O23A 4X4QA 4O44B 3LP1B 1YG0A 5KFVA 4CO1A 3WZ0A 1F5AA 1HD0A 2V94A 3CEDA 1BY9A 4DS4A 2DNOA 1U2FA 2J7UA 1R8CA 2DGXA 1OPZA 2E29A 4PKDB 3EPGA 3C6TB 5BR8F 5DETA 2ZHBA 3RR7A 5F8HA 5E3RA 3SEOA 5C42A 1S49A 5G4DA 3US5A 4H4KA 1IBLF 3LGMA 3IGVA 1KNZA 1XR5A 3POTA 4HI1A 5F9NA 4F3MA 2BQUA 2Q79A 3PHEA 4PQAA 4UQGA 1SKWA 4LF4F 3M9NB 2FIUA 1T02A 5KFYA 1MWZA 1P1TA 2YWHA 2XLJA 4MK8A 4Z37A 1H3DA 3FMBA 3RB3A 1V3RA 3CJKA 3IG1A 4PXDA 4B3TF 2KYZA 1LKZA 5CA5A 1UEVA 2ZZNA 1S6OA 4PXBA 5DGAA 2HRYA 5HP1A 2YTCA 5JXSA 1X5SA 5AXMA 2J6SA 2QRRA 1QE1B 3F41A 5F9LA 2LLZA 2KH9A 1Z4UA 4PG6A 3MM5A 1R6YA 2CDQA 4M5DA 4R8UB 4DPOA 3MGJA 5EUHA 4QR2A 2YY3A 4YB5A 1R8AA 1G2EA 2IFXA 3PACA 1IKWB 2COLA 5B08A 3GIMA 1HW9A 1FXDA 1AFIA 2KM8C 1YJWS 4N76A 4K50A 4KB7A 4TY8B 2B43A 2CPJA 2D7SA 4K4XA 2O66A 2J6TA 1VIXA 2MQNA 4OZLA 2U1AA 2ABYA 3BGRB 4F67A 3KLGA 2DR7A 1RT2A 5IQ6A 2PDAA 1HBNB 2QMXA 3H40A 4MFBB 2CJQA 1U09A 2CQBA 4KFBA 1UETA 2JSXA 5I42B 4F8RA 1TKTB 2GX8A 3PIOQ 2EG2A 1K1SA 2EFGA 2ZDPA 2ZFHA 3HFKA 3RW7A 1JLCB 4EUVA 4PG4A 2M70A 3PKYA 3DHXA 1MMLA 2F40A 4J37A 2AQ4A 1S6PB 2ZH5A 2J6UA 2YNIA 2Z4PA 4DL3A 4YEAA 3AB4B 3KLHA 2D9OA 2FJAB 2LDYA 3JTOA 3PNIA 2BA9A 4Y2AA 1XNRF 2VPZB 1WTFA 3OQ2A 3FFIA 2ZJPQ 4C0HA 1QVGR 1PGZA 4EZ6A 3CIZA 2ZBIA 3KMQA 2BRKA 3CB4A 3DI6B 1M5VC 4O4RA 1M5HA 2IRXA 3BS9A 2DD8S 3EZUA 4DG1A 3V81B 2QA2A 4PCQA 2MZTA 3DOKA 5GAGU 3GB0A 2A1BA 1KC8T 4XPCA 2H5EA 3EUNA 4AXJA 3L7PA 1QTMA 4QWBA 2X1AA 3NGKA 2HPUA 4J9QA 2CPDA 4I2PA 2MZSA 1U1LA 3DMJA 3JTNA 4FNIA 1S6QB 4P7TA 5D8HB 1FKOB 3TR5A 2A18A 3MMJA 5AXKA 5KG3A 2EC0A 4JI2F 3RAXA 3HT3A 2AWZA 1DLOA 3FSYA 2M8HA 3GYXB 2ALZA 3D2WA 1QAJA 3PR4A 4RWWA 4DR3F 1HNIB 3C66A 4IH5A 1S9EA 2MQMA 4R5PB 1KRPA 1YVFA 3IR5B 3H4BA 5E3CA 1HL6A 2M3DA 4YR2A 4IH7A 2AJFE 2XS7A 4UUXA 1UP1A 1MU2A 2WSFC 5IZHA 3HP6A 4DQPA 1FD2A 3RRHA 2WONA 3I31A 5KG2A 5LMUF 3HLUA 4NLOA 4RW9A 3MR5A 1RTJB 4HL9A 1HBMB 2HNZA 4L3NA 2KG1A 5D3GB 3J80Y 2EFOA 3EZ5A 1HYSA 4USIA 4ZHRB 4F4WA 2FHJD 3ITHA 3MD3A 3MECA 2R7TA 3TW0A 2NPFA 2AGQA 2NSBA 3ZC4A 1SXLA 4ZPDA 1KTQA 5MAOA 4LFAF 4DQSA 4A8WA 2HWTA 2CG4A 2BM1A 3CF5Q 2J8AA 2GMLA 2B51A 2Q6BA 3N9UC 1VQPS 3OL9A 3W2VB 4DFMA 4DMZA 5LXYA 4IO1A 1Q7YT 4LIRA 3MOZA 1VJWA 2MDAA 3I0SB 4IG0A 2BDPA 3RB0A 1QJHA 5D4NA 2ZITA 2DNGA 2RUGA 1NZAA 1E6VA 4B17A 4C11B 4K4SA 2KYXA 1U24A 3R5BA 3OR2B 4CH0S 3T6BA 2Y1JA 3IO1A 4RLEA 5KFUA 3DHWC 1JIHA 1NK5A 3CTRA 1UA1A 5HL7Q 4NLXA 2RKIB 2RQKA 2IRUA 2VUGA 3BM7A 1AUDA 3MHYA 3UI3A 2VBYA 1JLGA 5KFBA 2WB4A 4DR4F 1HBUA 4ECRA 3SSQA 3KK1B 3CCLS 2JHEA 2HW3A 1G7CB 1UFLA 3CWJA 5EN1A 3D28A 2UU9F 4ECXA 3BEGB 4IYQA 4IRCA 2OO4A 2D74B 1T05B 2OSQA 1TAUA 3I6PA 5D6GA 2X51A 4C8ZA 4OV1A 2VFVA 2FGOA 5A8RA 2AW0A 5CXTA 2HFZA 3RB4A 3RZAA 3NLCA 2W8KA 3SSSA 5KTQA 1GX5A 1Q8LA 2FHMA 2LQ9A 4OX6A 3THVA 1L5UA 1FJ7A 2B6AA 3VWSA 1U1RA 3C2PA 3GZ7A 1ZAVA 3F44A 2KXNB 4PG7A 1Q8BA 3MEDB 4F26A 2GFFA 2JH3A 3MEEB 5D4LA 2W9BA 7FDRA 2KU7A 3U1NA 2MHNA 1WF0A 2G0CA 3BJYA 2LMIA 1RTDA 1JK9B 1VQYA 4B9MA 4LFBF 3MAHA 1T94A 3G8SA 2NXUA 2UV8A 4JV1A 1PSDA 4B3OA 2X3GA 2ZH6A 5A0YB 5DM6Q 1LQ9A 1V9OA 5HROA 1R8HA 4URSA 3MPWA 4AE5A 2R7QA 1JXLA 4B3SF 1OWXA 2OTLS 2HS3A 1DQAA 2NPIA 2R7RA 5IS2A 1I94F 1YRUA 3FRYA 2B4PA 3CDBA 3MMCB 4QCLA 1X4BA 1L3TA 1UVIA 1BQNB 5H1SV 4EYHB 5FLXY 2XG8A 1TL1A 4AL7A 1XNQF 2CQCA 1Y0HA 5HBMA 5DLGA 1C4AA 4HH0A 1X9MA 4QWCA 1HMVB 3M1VB 1OQ3A 4NXMF 3UW1A 3M32B 4HLBA 5EHHA 1JLQB 5AXNA 2ZH7A 1WG5A 3H98A 4HVZA 3DM2B 3QGIA 4K4YA 4DSKA 2FC9A 4C0OC 4F4YA 1EP4A 3EGNA 4N8OA 3EGWB 3HM9A 4OZJA 1BQMA 2HIQA 3QAUA 1XTZA 1S1VB 2VBWA 3QGGA 1HW8A 1U6FA 2CQIA 4EEYA 1DJ0A 1FRMA 2OPQB 3C8YA 3D0IE 1A6LA 2CPHA 4C8NA 2OPRA 1XMQF 2D41A 4ZS6A 3V6DA 2KRBA 3H2UB 1RT7A 3I0RA 4IDKA 2IAJB 3BR8A 1U6BA 1FF2A 2B3TB 2X1GA 4DR1F 1LWFB 4WZQA 1N34F 2E1CA 1HWKA 3CC7S 1D8YA 4KIAA 2FJVA 1LK7A 2RQMA 2J9DE 4FPRA 5F8IA 3Q24A 5LT5A 2LDIA 4A4JA 5EWGA 1Y3JA 1H7XA 3M30A 2VOOA 4KHMA 3LWMA 2GCFA 1KQGB 4EBCA 1REVB 4QOTA 2KO1A 3QJJA 1ZYQA 3DRRA 2HQ3A 3GQCA 4DV6F 2XWYA 5ITHA 5DGBA 2FTRA 5CZXA 2J7KA 1S9GA 4CT8A 4I69A 4EU0A 1H2UX 2YNGA 4CH7A 3TO8A 4TQRA 2VC0A 4K4TA 4C8OA 4MK9A 5LJ3Y 1YJRA 2F3JA 3NCRA 3LOUA 1UA0A 3N79A 4B9SA 5LSLA 2D1CA 5E33A 2MQOA 1CLFA 1UW4A 2DHAA 4ILLA 2K1RB 5KOXA 7FD1A 4C4WA 1NK0A 4HYKA 2DHGA 4G1PA 4OL8A 4K4WA 3F56A 4QIWD 4RW7A 1MW7A 2AYBA 1DTQB 1QAYA 1KOHA 4MAKA 4EFAC 5HMWA 4X4UA 4X4NA 4MYUA 1T7PA 1FXRA 4I0WA 4ID5B 4C9DA 1X8DA 2MQLA 5DG9A 3K59A 4HTJA 1FD8A 3N0VA 4K4UA 3M2UA 1C1CA 3RYLA 2ASJA 3NRBA 4NMLA 1LXNA 4ECUA 1RT4A 2DGUA 4DL2A 4C98A 2DCLA 4KV8A 1CG2A 1S1TA 1D8ZA 1VQSA 2V2KA 1Y4ZB 4WE1A 1YHQS 1NK8A 4M1KA 2UXDF 3OW2R 5KFWA 2CQ1A 3I96A 5E2QA 3OSPA 1NK4A 4I4BA 5KFLA 1R43A 3BZQA 1S1XB 3T5HA 3KK2A 1VRUB 3CCMS 4ZVHA 1HNZF 3NP5A 4WKRA 5KFRA 2KRRA 1FKPB 2ERRA 4DQIA 4X2BA 2FUG9 4ICLA 1K9MT 2XWXA 3H59A 3UE2A 5H9FJ 1JMTA 3E51A 3JYTA 1N6QA 2UXCF 2K8GA 4IFVB 4JI8F 4IR1A 3MM6A 2J7WA 2ZOFA 3NS6A 1BWEA 3E3XA 3DGPA 1KS2A 1JNZB 3MUMP 3R5DA 3SXLA 3SI8A 1S0VA 4J9RA 3EPIA 4EBEA 1JLAB 3CJ2A 2LXUA 4QZVB 4UY8T 1UVNA 1EETB 1VQMS 3MM8B 4QR0A 5E0OA 1F60B 4CIOA 2QLXA 3UCGA 5GAHU 1J5EF 1U7LA 2VKZG 5EX0A 4ED0A 4MMOA 1VQ9S 4DUZF 1ELOA 2J76E 1IKVB 3V6HA 1PILA 1SUQA 2IVYA 3SV3A 5HLFA 3FQLA 3IFEA 2FHJA 2AP6A 1KQFB 1NNDA 2W24A 1FRXA 3AJ2A 3DLJA 3FNNA 4Y2MA 3J7Z5 1NEEA 2EI5A 3BN4A 5CYQA 2LXIA 4YDXA 4ECQA 2C3MA 3FZ2A 1T03B 2MGZB 1X4AA 2WCXA 1LW2A 2XHWA 3FQKA 3OTCA 5JVHQ 1IKYA 2E44A 5SZTA 4MIAA 4URGA 2GQ2A 1QSLA 2B0GA 1HPZA 2F4VF 5A8WB 3HZGA 1O8BA 1Z1ZA 3UD4P 2W4DA 5K8PA 4B9LA 4URQU 5DS7A 3QLHA 4RNHA 4MKYA 1LWEA 4WU3A 2VFUA 5B0GA 1F9FA 2M7SA 5FDLB 3OUYB 2O5DA 2HMIA 2KFYA 1LWCB 1MROA 3BSCA 4F25A 3E01A 3S6EA 2R2SA 2OKQA 2VKRA 4TQSA 5KFKA 1FJCA 3U1MA 4CO0A 5DDRC 5L39A 3IWXA 4ZMMA 3I32A 3KYLA 3T1YF 2XS2A 1LW0B 3B4DA 2VQFF 1N88A 3SDEB 3QIPB 5HMZA 5CYMA 4WFNQ 1H2VZ 3H2LA 2RB7A 1CPZA 2VOPA 1T3OA 2EKYA 1NJXA 2UVRA 4AUKA 2B4OA 1ZM4A 3VF0B 3MEKA 5D78A 2XGQA 4DQRA 1AXQA 3LAKA 3EYZA 3TVKA 2B56A 2M5YA 2PD1A 4IH6A 4RZRA 3PO5A 4WK3A 3VAMA 1RYRA 2E1AA 3G6XA 3LP0B 2CQDA 4BHQA 4I6AA 2NQPA 2VZ9A 4O3RA 2EVZA 1K0VA 1SH2A 5B0CA 4ELTA 1KONA 4OI3A 5J2QA 1ZAXA 1F2GA 3OVAA 1TK8A 5KFCA 4ED5A 1FRKA 4C7QA 4M95A 1RT6A 4ES1A 1S0OA 2JFKA 2DPIA 5T7LB 2ASYA 2WSEC 3OLBA 2HFNA 4DOZA 1JLEB 4ZLPA 4A8MP 2ATLA 4DV1F 2DRAA 4V19X 5HO4A 4QIFA 3LWLA 4IO9Q 3DRSA 1UAWA 3N5FA 4KHPF 2LCWA 4FBUA 2XI2A 2JWNA 3KWMA 4ZVGA 2YNHA 2V9WA 4WK1A 3DLEA 4E8UA 1VQ4S 4QBUA 1YIJS 1S0NA 2WOMA 3DFEA 3GFHA 3MM9A 2RF2A 3NMAA 3R5CA 2QSWA 3TUZC 2FVPA 1WWHA 2KT2A 3HHKA 2RSQA 4Q0BA 4LT6A 1VC5A 2CZ4A 4IOBA 3IR7B 4RBUA 2J9DA 3VAGA 3NMRA 2RDIA 1SV5B 2YH1A 1SBRA 2VH7A 4H4MA 5KAKA 4NXNF 1GT8A 2HNYB 2E5IA 2PGCA 2MQPA 4J9LA 1X4HA 2F7VA 4RW6A 5A6WA 2GIQA 2UUWA 3CDWA 3DN9A 3X3UA 5C24B 3G6YA 4F4XA 4UOCA 2G4BA 1J2VA 4DN9A 2KJWA 5F8GA 2QYCA 5J1NA 5IT9Y 3QO9B 4ES2A 2RH3A 3M2RA 1FTRA 3PIPQ 4DSIA 3K57A 1N5VA 1VGYA 1HI8A 5EX3A 4PWUA 4DBQA 4Q5VA 5A8KB 1Y5NB 2BACA 4B08A 1HNVB 4RNFA 3TAMA 5J1EA 1OPIA 1RDRA 4ILRA 2DRBA 3H8YA 3O1LA 4DR7F 1Y3KA 4KQZA 3VAIA 1VFJA 1M5PC 1C0TB 3DRYA 3SMZA 3UNGC 3A8EA 4ECTA 4XDCA 4N47A 1DTTA 1HHTP 1VBYA 1TFWA 2EBEA 3HHLA 4OJ1A 5J2PA 3JSMA 1TV6B 2AJ4A 4IFYA 4KT0C 1DAXA 4YB6A 4A8KA 5AE3A 5JVGQ 3ZZRA 4DL5A 3CDAA 1Q78A 1VIOA 2VV5A 1TKXA 3PJXA 4WFYA 2CIMA 2VONA 2EK1A 3GILA 2XC9A 1UVMA 1S76D 4ZA1A 4J9MA 2QA4S 1B0PA 4NA2A 3W2WA 2IC3B 2QEXS 2FVCA 1HA1A 2LU1A 3KOAA 2JLEA 3NNCA 3DLGB 3LW5C 3M2VA 4NL5A 2JLFA 4YDDB 1YJNS 5KFFA 1SJ3P 2A10A 5CD4H 3UD3P 1CQNA 2FHOB 4H4OA 3Q8QB 5LMNF 3I9V9 1Y9OA 4M8LA 1FRLA 2G13A 1H2TZ 4XO0A 1UMJA 1K73T 2OMOA 5DG8A 2FPHX 2N4CA 5L9XA 2U2FA 2IA6A 2CQ2A 2FLPA 5JUMA 1YQHA 2CQ4A 5DDQC 3FCHA 3MMBA 4ZVEA 2L08A 3KHLA 1KLMA 5H9EJ 1YSJA 2DNKA 1NK9A 5E5NA 1Q8IA 3KLVA 4LVNP 4OZ1A 3AJ1A 1X4GA 5B0DA 4XAKA 2ZE2A 4YUDA 4DF8A 3KTQA 2FJXA 2MKJA 1XWLA 1ZM2A 1S1WB 4N77A 3MTJA 4DL6A 2Q1LA 2A2CA 3MURP 3KLEA 3V5RA 2PFFB 3ENVA 4NRUA 2BRLA 2KI2A 5L9NA 1M5KC 4PUOB 1R0AB 2Y1RI 3SQGB 4QYRA 3VQSA 1KQSR 1QY7A 3NCPA 5G0RB 5IM0B 1JKHA 2XMWA 4Q45A 3Q8PB 1WEYA 2G9OA 1NB7A 1N36F 3NS5A 3M6WA 3KHRA 4HHJA 3HK2A 4W92B 3DRXA 1JJ4A 2XLKA 4B9VA 5SUHA 1TVRA 1YRTA 2HGNA 4RU2A 4G6VB 4NLPA