3EDRB

The crystal structure of caspase-7 in complex with acetyl-ldesd-cho
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
93
structure length
93
Chain Sequence
YKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-7
publication title Structural basis for executioner caspase recognition of P5 position in substrates.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 93
sequence length 93
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2008-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3edrB00
2C2MB 1RE1B 3GJRB 2H4YB 1RWKB 2XYPB 5K20B 3QNWB 2CNOB 2XZDB 1RHRB 1PYOB 2QL7B 1SC4B 2QL9B 2QLFB 3D6HB 1RWWB 3P45B 3R6LB 2QLJB 2C2KB 3GJQB 2HBZB 3IBFB 2QL5B 2XZTB 3KJNB 2C2OB 1QTNB 4LSZB 1PAUB 2CJXB 1RHMB 2HBYB 4ZVOB 4DCJB 2QLBB 1RWNB 4ZVTB 1I51B 1RHKB 4ZVRB 1RWXB 2HBQB 1ICEB 2C1EB 1RWMB 2P2CB 1RHUB 2HBRB 2Y1LB 3D6FB 2CDRB 3SIPB 2CNKB 2DKOB 3D6MB 4ZVSB 1NMEB 2XYHB 3R7NB 1I3OB 3R6GB 4ZVQB 3EDRB 4DCPB 1IBCB 2H65B 2XYGB 2H5JB 1BMQB 3GJTB 1QDUB 2H48B 2CJYB 2Y0BB 4ZVUB 2CNNB 1SC1B 3NS7B 3R7BB 1F9EB 3KJQB 2CNLB 1RWVB 2H51B 2H5IB 5IC6B 2C2ZB 3KJFB 5IC4B 1RWOB 1GFWB 3R5JB 3R7SB 4JB8B 2FQQB 3GJSB 4DCOB 3IBCB 2H54B 4ZVPB 1RHQB 1RHJB 1RWPB 3P4UB 1SC3B 3RJMB 3EDQB 2H4WB
chains in the Genus database with same CATH superfamily
2ZD1B 3ZTQA 2BOAA 5D4OA 4F67A 1VC0A 2JC1A 2DGUA 1N52B 4EYHB 5FJ4A 2ZNZA 2ZH1A 2QLJB 4DS4A 3TQEA 1SL1A 4C11A 1NKBA 1PYSB 4ZCKA 3GB0A 4RBTA 5KFLA 1EKRA 4MKVA 3M1VA 4C4WA 2ASDA 3OLAA 3DOLB 1SQEA 2C1EB 2FZCB 4QU6A 3OXFA 1HNZF 1IKVB 1YJTA 1RTDB 3R2DJ 4KFBA 5HBMB 1M5KC 5E3CA 1ZZNA 3MMAA 4WKRA 5DQIA 4ZS6A 5F9LA 3V4MA 3HF5A 2DR5A 3OXLA 4Q8EA 3D3BJ 2CNNB 1UAWA 1PBUA 2P6TA 2H9ZA 5HJYA 4QCLA 3D9BA 1WC6A 2OPSB 1Q16B 4DEZA 1JLAB 2LDYA 3T5LA 1UWAA 5LSRA 3OHBA 3AA9A 1PILA 2MQOA 3CDUA 4N8NA 4USKA 3EPIA 2DGOA 2CA9A 1TR0A 4ZKAA 1PYOB 1HFEL 3UCZP 1QM9A 3Q23A 4M5NA 5HVHA 2M2BA 4M5JA 1SKRA 1HYSB 4F4XA 3OSPA 1NB2A 1N36F 4CI0B 1RQ0A 2GVDB 1RT3B 3PIOQ 4IRDA 5J2MA 3FFIA 2N82B 2E9ZA 3JQMA 4C8KA 4U7UD 2AJFE 5KFDA 4M5KA 2BJ1A 4XAKA 3QPIA 4KIAA 1K9MT 1VGYA 3V6KA 4IOCQ 1XNQJ 3R6GB 3HM9A 3JTPA 2XWXA 2G0JA 3DDNA 1DFDA 3R27A 5HQ8A 2UUCJ 1TUWA 3JQJA 5HP1B 1X0PA 2B7CB 4F4YA 3SI8A 3VTIA 3IMQJ 1SL0A 4TY8A 4LIWA 4D3HA 1ZAVA 4ED5A 1YK9A 4TKTA 2VG7A 2V0NA 1R8BA 3MPVA 3KKFA 4X64F 1DY3A 2DNPA 2B5JB 3OVSA 3G4SS 3M2RB 4K4SA 2RUSA 3P45B 2Z2ZA 5JMNA 4KGVB 1NSKL 1FJGF 2ZH8A 1FD2A 5T7LA 2IVYA 4PRFA 2A1BA 1QTMA 4NLQA 3IS9A 4C3KA 2YX1A 1KHVA 3DLKB 1LXJA 4DR2J 4YOEA 3P96A 1Z4UA 3T41A 4ECVA 3PJXA 2DO0A 1FXDA 2VBXA 1LWXA 1VQ5S 4W92B 3FEZA 3WC2A 2HLTA 5DZ6A 5AE2A 2O3DA 3ISNC 3NBPA 3VAJA 1ITPA 4PXBA 4DUYJ 1FX4A 2WB1D 3DN9A 1QVFR 3E8OA 2HHUA 1S1TA 3VCDA 1YHQS 4JI0F 2Z8QA 2FQQB 4TLRA 3KHGA 2DY1A 2NPIA 2QO3A 3GIIA 1CJKB 3SEOA 1A9NB 1HW8A 3B78A 2GHPA 3IWXA 4ZPBA 1CC8A 3KK2B 4PWDB 3VAIA 5ETRA 2L08A 3SFGA 2GZOA 2VFUA 2N7CA 1Y7PA 3W65A 4MK7A 2FVQA 5FD1A 1OSDA 3V6DB 4LF4F 3JYTB 2BQRA 4MIBA 2I1RA 3AHPA 4RW9B 3EVOA 3SCLE 5KFJA 5CCLA 2HMIA 1YG0A 2MZSA 4ZPDA 4OHXA 1EAYC 5AXNA 2CQ0A 4BDPA 1RT6A 1S12A 4BC7A 1UWBA 1C1CA 5BR8F 2AJ4A 3N01A 3OL8A 3DRPB 4JV5J 2CFXA 4GVLA 3NKYA 3Q22A 2J6UA 3V81B 4F8RA 2YWHA 2A18A 3FQLA 1CJTB 2O66A 1U6FA 3Q8YA 1K0TA 1Y10A 1X31C 3G9CA 3M2VA 2DY9A 1RWPB 3G86A 5IT9Y 2DJWA 3MTKA 2DR8A 4OMFG 3SCJE 4LJMA 3CDAA 2C28A 2DEJA 1RTIB 1R0AB 2EK6A 2C22A 4KPCA 4MFBB 1JLCA 2V67A 3N5BA 5ITHA 1S1VB 1IBKJ 1SIZA 5A8RA 1B64A 4NI2B 1RT2B 2X3DA 2DTJA 2ALYB 3PW4A 1X4GA 5E7OB 1X9MA 2AX1A 3M8QB 4WBFA 3BSCA 1AFIA 2OHDA 1DLOB 3CNQP 3FCVA 3NCPA 3OL9A 2NYHA 3CJ4A 4RW7A 4FNHA 1IKXA 3FSXA 1U0SA 3O3LA 3QAEA 3UD3P 1DQ8A 4A8QA 3IRWP 1FT8A 4AD6A 4CLFA 4FF4A 3LP0A 1F9EB 4LF2A 3CDBA 3KK3B 4C0BA 5KFCA 1L3KA 2YQ1A 3EE3A 4K5SA 5L46A 2B0GA 1KFSA 5BYQA 4EUVA 2RRNA 3H5UA 3G6YA 3UD5A 1S4FA 3PACA 4A8WA 2B56A 1ZYQA 5A0YB 4P74A 2VODA 2CNOB 4DV2J 1WF2A 1WJ9A 2E7WA 3PX4A 4LF7F 3L9ZA 3OL7A 2IM1A 3K8WA 2QL5B 4C97A 4CO5A 1YWXA 4PQUA 2V8VA 3H2LA 1YJWS 4BBYA 4RWWA 3IGVA 5D78A 2HZVA 1E6YB 4I67A 1IR2A 4WFYA 1KLMA 2BE9B 4ZLLA 2V6AA 4ECYA 1IWAA 2D7SA 3HT0A 1RWMB 1GXUA 4LFCJ 1F6TA 4RWXA 4LSNB 2MYFA 5D77A 3FEYB 1S1UA 2J9EA 5MLCV 3C6UB 3QSYB 4R0JA 5ETKA 1P1LA 1FE0A 3NRBA 2LMIA 1TELA 2B4PA 2KZMA 2MZ1A 1UVNA 1QSSA 1DQ9A 5KFSA 3DLJA 4B17A 5DLFA 5H9EJ 2B6AA 3KJVB 2FHMA 1M1HA 2Z30B 2YKPA 2NSCA 2CADA 4EBDA 2DISA 2R7WA 1NCLA 1FJCA 1PJ7A 1AZSB 4M95A 4FKXA 2CPJA 1U09A 3DRYA 2LKZA 1EIYB 4FS1A 2UUAF 1N0VC 4OZLA 3R5BA 1VC6A 3KYLA 3MM5A 3M8RA 2KVIA 1HQ2A 4OJ1A 2W8LA 4L74A 2Q1LA 3SSRA 4CH7A 2MKHA 2XSFA 2WBMA 4G1QB 4NLGA 4JI6F 1RTHA 2AEFA 1X8DA 4YB1P 4X2BA 3THTA 2R7VA 2ILZA 4Y34A 5J1PA 2Y8WA 4F4AA 1T3OA 4TU8A 2VOOA 3LH2S 5K8PA 2R2SA 2I9SA 3IR7B 1FWPA 3PHEA 4DU8A 2UV8G 2V5HG 4YR0A 2V69A 1RK8A 1YBUA 1RHJB 3ET6B 2DEIA 2AD9A 1DTTA 2QYCA 4YY3F 5CHCB 1WTBA 2XO7A 2X1BA 4QPTA 1CSJA 1HR0F 4N56A 1FESA 2CQ4A 5ETLA 2BW7A 4BHQA 3OTCA 3Q8RB 4C8YA 1N36J 3FBFA 1I1GA 4DR5F 3QT7A 3M32B 3W8PA 4RW4A 2FVRA 1S0MA 2YX4A 3L4BC 3LWMA 3ZZZA 2VG6B 5B0EA 4IKAA 2OTJS 3HP6A 3CCJS 5JXSA 4JI7F 3I87A 1GTHA 2LQJA 1WOSA 3DRRA 1Z2ZA 4YHHF 2Z58B 3HVWA 3OTBA 5J1EB 2F3JA 3DMJA 2FLNA 4DX8H 3M6UA 4QQBA 4B08A 1R27B 1QDUB 3T3FA 5FDLA 5C25A 3BGOP 3KDNA 5D0RA 2B8PA 3GYGA 4PR6A 1L3UA 4X64J 4IG3A 3TJAA 4JV0A 1LW0B 3I5AA 2FIUA 1QUVA 2QFIA 3CDWA 1FJGJ 4NPOA 2C2RA 2XYPB 2LA6A 3PG9A 3L09A 3UN3A 2UU9J 1MWZA 2XMJA 3H5YA 5SZTA 2C2DA 3MWBA 1S6PA 3ZNJ1 3SCKE 3QGGA 3BDEA 1JWWA 4J9VA 2W7AA 5CAAA 2W9CB 2K06A 3PTWA 4RJVA 2QFJA 4TNOA 3T5HA 4YFUA 3W2WB 5I3QA 2IAJB 1GXTA 5AXLA 4HTIA 1FRKA 1IXKA 4NMXA 5KOWA 1WI8A 3VAGA 3M30A 4K2XA 5GMEA 1LW2A 1N54B 2V4RA 4IDKA 2LYVA 4JI0J 4HEA9 1KQGB 2JVRA 1HWLA 3U1MA 1GAOA 3QIPA 2W24A 2DCLA 5HMXA 1X4AA 3HSJA 3FCWA 2KXHA 4DR3F 3AXKA 4DL0C 3D5MA 1NDPA 2XWYA 2RAQA 2QSWA 4KR0B 3LALA 4F3QA 4HLBA 4NCAA 1WG5A 2ROEA 3GFXA 4IYQA 2QRRA 2YKMA 2HWTA 3HT3A 5CYMB 3BREA 3AJ2A 2YTCA 1HW9A 4RW8A 4K5RA 4QYZK 1UL3A 1OPZA 3CC7S 3TAMB 3PY8A 2G1HA 1M0SA 5I3UB 2QYGA 1GK8A 1D8YA 3BO2A 2HNYA 4WE1B 4NLRA 3LA0A 2CQBA 1S49A 5K14B 5BR8J 1P1TA 3G6ES 3TAQA 3Q8SB 4Y2AA 3TVZA 2MQ8A 4YS2A 3KLVA 4M63A 2GQCA 3IBWA 2XYGB 3EYZA 2Y0BB 5HLFB 3R5DA 1OPIA 3K7RA 4KGXB 1UZDA 4IH6A 4USHA 3WHIA 3BKTA 4X4TA 4PYAA 4ATNA 4L75A 2JC0A 3W2VA 3ISZA 2IDEA 2YPZA 4CZCA 3CCQS 1EJ7L 4J9UE 3NGRA 2RKIA 3RB0A 3KJNB 4K50A 1PG5B 4ES2A 3EVMA 2VFSA 2JWNA 1KWMA 2AWZA 5KFRA 4DSJA 4LFBF 2KZZA 5CD4A 4OZ2A 3M8ZA 5D15A 2QN6B 3MI7X 3KNAA 4GO7X 2YKQA 3JAMY 1JLBA 1NJZA 3U27A 3NS6A 2FVPA 4C8MA 5IFMA 3D2WA 2FZGB 2DH7A 2OFGX 1S1XB 2M70A 3SFUA 3D7SB 1J2VA 5HVFA 2CJYB 4RW6B 2MQPA 3IO1A 2AP6A 3GZ7A 1CEZA 2FVCA 4ZLJA 2AHOB 1NPKA 1KOOA 3DOKB 3OFHA 4OHYA 1V9OA 2VQEF 3IBCB 4PZVA 3UDVA 2R2TA 4LF7J 3OPKA 1HBUB 1BQNB 3RUBL 4K8RA 4KH0B 1X60A 3MMBB 2P9GA 4O4RA 1V6HA 3WC0A 2KG0A 5KG3A 1BD6A 2XZTB 5MAOA 4P10A 2NUUG 3DLEA 1U1OA 2DGXA 2VKZG 4IUFA 4DX7A 5HMWA 3MUMP 3CPWR 3SSSA 1U7LA 2B4UA 4FZVA 4EFAC 3M6VA 4FPIA 2QE5A 2ROPA 4HTJA 4I6YA 3ISND 1UEVA 3QRRA 4NXMF 4CO1A 4OYWA 1Y4ZB 2BJ8A 3MOJB 3DYAA 2PEBA 2QA2A 3BR9A 3CO0P 2ADCA 2H5EA 3CSKA 1TL7B 2FC9A 5FIIA 1EX8A 1S7HA 3BPSP 2J0QD 1VBXA 1UMJA 5E3PA 2IC3B 4DV7F 3CJSA 3QAUA 5F0WA 3MCMA 2A0FB 4K4VA 4DJBA 3MUTP 4KHRA 3NWRA 3GILA 3K5MA 2EFNA 2Z2LA 3VF0B 3CD0A 3SDEA 2HNDA 2NLWA 1U4BA 1TFYA 1N5VA 2ZJRQ 3CE8A 2RRAA 3ITHB 4IFYB 2UUAJ 2B9YA 1SQGA 2BABA 3THVA 1IBMJ 3LPEA 5D6GA 1QAXA 5IV3A 1WKJA 1PYTA 2MQMA 3DHWC 2BR0A 4QIFA 2DRBA 1RB0A 3F0NA 4NXNJ 1FK9A 4JI6J 4XPEA 1RCOB 2KYXA 2P6SA 2PA3A 1GMUA 3PYEA 1NDLA 2BMBA 4RUCA 1WSRA 2EEYA 3DGPA 3MD1A 2B4VA 1NM2A 4J9NA 2M88A 2R9LA 2EFPA 2HHWA 5AJ3F 4ZVSB 2E1RA 4P7TA 2XZWA 3MAQA 2BE2A 4AL7A 1SC1B 1C0UA 1XWLA 2F8HA 5DDOC 4YY3J 2W2MP 5EWGA 1GFWB 2BJ3A 2PN6A 1HR0J 1RAIB 5HMYA 3A8JA 3KDOA 1JJ2R 1NJYA 1V3RA 3M1VB 4ZIWA 2HQFA 3GP9A 4DR5J 2AJ0A 2HEKA 4A8KA 4KBIA 3HX9A 2F9JA 4F4WA 2QLFB 4CYUA 4KFBB 3Q24A 3MMAB 4C3LA 3QGHA 3KLFA 4EO8A 4PAAA 5CABA 3D0IE 4JI7J 1XQIA 4K4UA 2DD8S 4URQU 4DLGA 2CQ3A 2OPRA 2WCXA 1EP4A 4UUXA 2Y1IA 1S7IA 4DSKA 1NDKA 1UPPA 2OPPA 2BVZA 2BJDA 3PKMA 3KG4A 4UOCA 1H7XA 3RAMA 3DLLQ 1FF2A 1FERA 1RADB 3FZBA 3Q8PB 3E2EA 3G2XA 4NZ0A 3SIPB 2DPIA 1DJ0A 1NRKA 1OY9A 1OSCA 1IBCB 1LKZA 4WP9A 3ZZPA 2HYIB 5U47A 4LFAF 4KC5A 1RWVB 3PCOB 1IN0A 3KWMA 3O8WA 1C1BA 1R8CA 5EN1A 2ZUAA 3JQKA 3K59A 2EC0A 2B8QA 5A2QY 1WEYA 5J2MB 3FFIB 3UVJA 3MFIA 5D4PA 4LR9A 2DB1A 1RABB 1EKSA 4C6AA 2CZ4A 2PFDA 3IG1B 5A8WA 4N76A 1OS5A 2ZC3A 3D67A 4WFNQ 3EX7B 4ZJLA 2EFGA 3TRGA 5LMUJ 2HIYA 4P6QA 4LQ3A 4ECUA 3I31A 2ZWPA 1MN7A 2XMMA 4ZLPA 2VONA 2HQGA 3R97A 1TK0A 5B08A 4CTAA 4J9SA 3H2UB 3O2IA 4TY8B 4U96A 4GKJF 2KJWA 3NS5A 3QRPA 2MKCA 4ZDNA 3KUGA 4ED0A 3DFEA 1HA1A 2KN4A 5DJBA 3CCTA 3NS7B 2V9WA 2J0XA 3HVTA 1YQHA 2GMHA 5T7LB 4M5DA 3R7SB 3QATA 3QBCA 1BE4A 3IS9B 1CS4A 1VQMS 2D1CA 3N6LA 1B0TA 1XTZA 4B3MF 2EXUA 3LP2B 1Q8BA 4JP8A 1WNEA 2R4FA 2J76E 3I9ZA 4YUDA 2BW2A 3HHDA 2CG8A 2ZBIA 3NBPB 8ATCB 4HI1A 9ATCB 3ETOA 4F7VA 4HR2A 3CC4S 3RB3A 3KHLA 1JQGA 2ZUGA 5HL7Q 3W9IA 1HHTP 1F9FA 1YLXA 1RKIA 4EK2A 4CLPA 1DTQB 4WTYA 4PKDB 4KSEB 1K47A 1VQYA 3PEJA 1K0VA 2FHKA 3D1HA 1VIOA 1LWFB 2B3TB 4C48A 2W2NP 4DX6A 5DLGA 2R8KA 3OBIA 4LVOP 3PNIA 4B9NA 4UW2A 3BSAA 8RUCA 3E01A 4FS2A 4RPFA 5DGBA 1U8WA 3V6HA 1Q5VA 1VRTA 4HYKA 2QIFA 2MGZA 3G8SA 2CJ9A 4YDDB 1TFWA 3GG0A 2HMIB 4LFBJ 1X0FA 3QJLA 4HHJA 1YZ7A 2EG2A 3ZZUA 7FD1A 2MB0B 4U8YA 2KFNA 3QQCD 1RT6B 1N34F 4B9TA 2E7VA 1UWBB 3W9HA 4C3MA 4ETZA 3G82B 1C1CB 4LIRA 4ZVTB 3FRZA 3G6VA 1SJQA 2FPHX 3TP2A 4CDIA 2JFDA 4USWA 1F0XA 1JNZB 1KC8T 1GEHA 4M8LA 2MQNA 2KT5A 3M2VB 3OW2R 2W2PP 5T41A 2LDIA 3TUPA 1CC7A 4R5PA 5JVGQ 2XLKA 1JNRB 2YY3A 3X1LB 3T9NA 4EZ6A 2W7OA 1TMMA 1JLCB 2FC8A 2K3IA 2VQEJ 2UUWA 4NEZA 1TL5A 3UW1A 5A8RB 4DDFA 4DG1A 1MWYA 2XGPA 1UVJA 4MAKA 1DBDA 5LJ3Y 4QYRA 1WDDA 4CO2A 2D41A 1RACB 3DRXA 2I6WA 4RW7B 3OUYA 1IKXB 4TU7A 4EU0A 3VR1A 4O23A 4NZ6A 5HATA 4PUOA 1BQXA 3ENWA 3D66A 3LP0B 3KLEB 1U24A 1WOOA 4NXMJ 5B0DA 4OYMA 4BWMA 4N8OA 1KQSR 1R31A 4PPDA 2XM3A 5HROA 1X4CA 1NXIA 1D9DA 2HBRB 2Y1LB 3N9UC 3EGWB 2RH3A 2EVZA 2G9OA 4YEAA 2IA6A 4OYXA 2OD4A 1VMBA 1JKHA 4ZLNA 2HHPA 2M7SA 2VG5A 1H2TZ 2CPDA 4PQUB 4Y0FA 5LMNF 4U8VA 2IM2A 4FBTA 3MM7A 4P9SA 3CJTA 3H25A 1WHWA 2XB2D 1BLUA 4ZP8A 1KLMB 5IT4A 2FJAB 2IBKA 4OIXA 3TWZA 3EPGA 2HZCA 2OGUA 1HARA 2DBBA 3MEDA 2QMWA 1U47A 1NHKL 2PD1A 4TU9A 4EZ9A 3CCMS 4DSIA 2E5LF 3FSIA 2JDJA 1S1UB 1RT7A 1LXNA 2VD3A 3N5FA 2ZOMA 2AYGA 3FVYA 4URSA 5AJ3J 1XMOF 1YI2S 1SJ4P 2GIQA 3MM9A 3W64A 3VVUA 5J1NA 1HPZA 5KG4A 2OTLS 4WP8A 1DURA 4M5IA 2B6AB 2MKKA 1NZ8A 1AB8A 1P8GA 3CIZA 3MUVP 2YWKA 1HNVA 1SV5A 2V8PA 1AFJA 3MEGA 3D0HE 4MH8A 2ASYA 2IMOA 1UVIA 5KFOA 4DF8A 3HHEA 5KAKA 2PC6A 4KJIA 3K89A 2NXUA 5GVQA 4O3NA 3BGFA 2WOMA 2DGVA 2DGQA 1SC3B 3MM5B 3LGNA 2QTWA 5HJXA 4IOAQ 2F65A 3RU0A 1JIHA 2RU9A 2ZH9A 1TUVA 4K0KF 3GIJA 2QLXA 1S48A 1IR0A 4N41A 3H2VE 3CJKA 2XY7A 3P6YC 4U9RA 3SBMA 4NLXA 4ZP6A 4X66F 5LM7E 4WU3A 2ZZNA 4ZVRB 1ZM2A 5L1JA 1O8BA 2QA1A 2NS1B 4ZCIA 2YXLA 4UQTA 1FFWB 2W4PA 1KD1T 5GAHI 1T9TA 1SXLA 3Q2SC 4CCHA 2C2NA 1DTTB 4USJC 4LFAJ 5KFFA 2MHEA 4DR6F 1NZAA 3TA2A 2MSSA 3VGVA 5A8KA 1EARA 2X1GA 1Q7LB 2ZM6F 3OQ2A 2MKYA 1M5HA 2KB2A 3AB2B 4QIGA 3VGTA 4QWDA 4DL3A 3UN2A 3MEKA 4RW4B 2Q3PA 4Q8FA 1O0PA 2HNZB 3DOMA 1MROA 4WPAA 3HD2A 5K9FA 3W9JA 5LJ5Y 3DRRB 4WCEQ 4EBCA 4WYWA 4XDDA 2HGNA 4DR1J 4DL2A 1OY6A 2DNQA 3AJ1A 4JI8J 3PV8A 4KKOA 3DMJB 2FJVA 2F8EX 2KHCA 4F2SA 4QJVA 4OI2A 5FDLB 2GVZA 2IRUA 4RU9A 4I7FA 3S01A 2KHDA 2E44A 1S4EA 4GKJJ 1U02A 1BQMA 2LU1A 1T11A 3O1LA 4UOHA 4DUTA 1J5EF 4IG3B 3RRHA 3O6QA 3CJ8A 4U7CA 4YR3A 2AZ3A 5T14A 1VK3A 1TL4A 4EEYA 3C46A 4JBCA 2Z2MA 2R8IA 5B0CA 5EUHA 2KO1A 1R43A 3M6WA 3OVAA 4YQWA 4ED4A 3LUYA 1XNRF 3ENQA 4S0MA 1S6PB 1UZHA 4B3MJ 3C2PA 4V19J 3GIMA 3HXMA 2QV6A 3M9OB 2QLWA 5KFPA 1ZPVA 1B70B 1RHRB 1A6LA 5F8HA 2PMZD 5ETVA 2L48A 1YSJA 4AYBD 3L95X 1KLNA 1WEXA 2CQIA 1AUDA 3E3XA 4LT6A 4ECRA 1EHWA 1FKPA 1W2IA 3K5OA 3ILLA 4O0IA 5G0RA 2POKA 3QIPB 5H9FJ 3HFVA 3M4XA 5ETQA 1FTCA 5AE3A 2XGQA 4DMZA 3M8SA 3D54A 3VALA 2MJUA 3CJQA 1S59A 3BH7B 4WTOB 3TANA 3Q83A 2VUGA 2MY7A 2GIFA 3OXGA 5DO2A 5CCMA 2KT3A 4B9SA 3TQ1A 2WHOA 4F26A 4RW8B 4KV8B 3NLCA 5DRKA 1YJ7A 1UJ5A 4N7TA 1TUGB 5KT6A 1GXLA 5THWA 4ZJQA 2ZH6A 2ZHOA 4BCAA 1URNA 2X3GA 3TX8A 1SIWB 1C4CA 1NSPA 3PW7A 1JLFB 1UW9A 1N34J 3D6HB 2RVJA 2NXJA 1NK8A 4I68A 2PI5A 5C2GA 2MEWA 2UZAA 1PAUB 2KXNB 5JJBA 2OPQA 1F2HA 2W4CA 4G65A 1XN9A 2F9DA 1IQZA 1Q82T 1M5SA 1SVDA 3P5BP 3LW5C 1SH2A 2UVRA 4H4MA 3NEKA 3HI9A 3N28A 2CYYA 2VB6A 1VLOA 4DLEA 2N7YA 2RQMA 2ZOGA 3C3LA 3BV8A 1YJNS 2GAGC 4L73A 4K4XA 4OHZA 2A3JA 2GQ2A 2CDRB 1U1RA 1NPRA 2CVIA 3W2VB 4I2PB 2KL8A 1RLDA 3HPOA 1OYDA 6FD1A 5E2QA 2E1MC 2BRKA 4ZVUB 2CQCA 2RKIB 4C0OC 5L1LA 4LRBA 2OFHX 3GCWP 4UOGA 1N88A 1TL1A 2V2ZA 3KJFB 1PO6A 2ZWOA 4A8YA 2HS4A 4LF5F 4BS2A 1VQ4S 3MAAA 1RDRA 4ZP7A 2Q6CA 3KXDA 2BXJA 1YJ9S 4XIUA 1PIEA 1NK4A 2GGPA 3OLBA 4MKBA 4QZVB 3POTA 2HS0A 3CEDA 3N4WA 5F0UA 5KFAA 5DZ7A 3DU5A 1FXLA 5LSLA 4F50A 3KK1A 3M9NB 1T95A 3H5XA 5IT0A 1X4DA 1VQOS 1YZ6A 4IFVA 3UCGA 1S6QB 5KFWA 3AQPA 2UUBF 3W5ZA 2VFRA 3BPDA 2IM0A 1UTAA 2A6OA 3QWPA 1U6BA 1BWVA 5LT5A 1KVIA 5LMNJ 4Y3CA 3DLGB 3C15A 3WDOA 3Q8UA 4L76A 5EX3A 1Z1ZA 4DPWA 1SH3A 1T9UA 3DLEB 2F1FA 1S79A 1JXLA 1P27B 4MIWA 1T05B 1G7CB 3J7AN 4LQ9A 1LFWA 3TUJC 4PWUA 4OLPA 3KMQA 2E5LJ 1RU1A 5LXYA 5C24A 3CCSS 1APSA 1IM4A 2PMWA 2WSCC 2ZH3A 4OX7A 4DBQA 4QR1A 1KBRA 1ZA2B 3DYAB 3R6LB 3ILIA 3W5YA 3IA0A 3MMJA 2WONA 2VC0A 3MHYA 2HQIA 3BN7A 3GR0A 3N6NA 2O01C 3H90A 5GAHU 1S0OA 1F60B 4G1IA 2FLLA 2MLZA 4H4KA 4J5OA 4C8OA 4WXWA 5HSPA 2F40A 4ILRA 1QY7A 1SCJB 1VR6A 4TLQA 3SDEB 3NNHA 2HNDB 4YB5A 2F4FA 3I5CA 2FY8A 4I0WA 1T7PA 1TKTB 4F25A 4KGZB 1UVMA 4YR2A 3CTRA 4FVCA 2E7XA 3SV4A 2R7UA 2EK1A 5J2PA 1H7WA 4DV4F 2PEHA 4RUAA 2VICA 4N5SA 1MW7A 2VA3A 1S9EB 4DPOA 1S76D 4O3OA 4K0KJ 4BLGA 2HHVA 1ZA1B 4Q45A 5F41A 4ZN1A 2H54B 4DOZA 2N3OA 2COLA 3B6BA 2JJ4D 2EFVA 2YKAA 3JB9k 2M8HA 1HIYA 2CJBA 3G8TA 3DGPB 1IWGA 2IIHA 3EVWA 1J5OA 1FJ7A 5LSOA 1Y9OA 4X66J 2DNYA 3IBFB 1IKVA 5KT4A 3HHLC 2IJNA 1KP6A 4OJHA 2AEJA 2KU7A 2MLYA 3ONQA 1LWEA 2FZKB 2CVEA 1TVRA 1CBKA 4DR6J 3O44A 3OTDA 2YVSA 1O5JA 1CJUA 3J7YI 4KGMA 2FGCA 1JLAA 1N5TA 4QWCA 4OI6A 2PFFB 2XHCA 4A8MP 3DCAA 4BWJA 2YWFA 1D09B 2YNFA 2NR0A 2ILYA 3FZ2A 2DR9A 3GSDA 2WAQD 3KLFB 2JVOA 4B3OB 2H51B 3B4DA 3KG1A 3U1LA 1KHWA 1SBRA 2IBOA 1F5AA 2OPRB 2HKEA 2JLFA 2OPPB 4DQRA 1Q79A 3DXBA 4K4WA 3RB4A 2H4WB 2WSFC 2GVDA 3CXCR 2R2RA 2K7KA 1FEHA 4OJ3A 4OLOA 3LO3A 1EETA 2MJNA 2JEIA 3JTNA 2HG4A 4RUHA 4KY3A 2V8HA 4FDFA 5KT5A 3BN4A 3LQVA 4C0HA 1FVQA 3U7JA 4B9VA 2JEFA 3LOUA 3MXHP 1I51B 2ZHAA 1RHKB 3DLBA 1RWXB 2XY5A 1GMWD 2E1AA 2GJIA 2ERRA 1MLAA 2V2QA 2UUTA 3I32A 3R1LA 3VQSA 1XNRJ 2JEGA 2GJ2A 3CW2C 4ZJOA 3UVJB 1FRJA 4ZPWR 3AD8C 3QGPA 4J9KA 1RAAB 5A8WB 3R5CA 2GAHC 1E6VB 3JS9A 1YVFA 4KH1B 3EGVA 1ZM3A 2HQCA 1RISA 1FRLA 2C3OA 3UQSA 2FD2A 2XCAA 3AD9C 2E9TA 3OTOF 2H4YB 2VBWA 4CTAB 4ECQA 1BY9A 3CC2S 2UXCF 4DV5F 2HAFA 4TY9A 3GG1A 5K8OA 3US5A 4ZCLA 3QO9B 5IZHA 4H4KC 1BC6A 5CYQA 5KG7A 1JLEA 2AV5A 2GC8A 4GRSA 4NASA 1WTFA 4NMLA 2JZ5A 4YN3B 2M8DB 2M4MA 4FF3A 4ZPVR 3HVTB 2FLPA 2HBQB 1FJEB 4M5DB 5D0GA 3L7UA 2JOQA 1HD0A 1CS4B 2ZZMA 2LA4A 2DO4A 2CJAA 5DM6Q 1MU2A 2DNKA 3UO0A 5K8NA 1RBLA 1TQLA 2XYHB 1MN9A 2PSZA 2VQFF 2O5DA 3CUNA 2YNGB 3CJRA 3R7BB 2WW8A 1UFLA 3C66A 4MK8A 2ZJQQ 4PWDA 2HWHA 5LOQA 4ES1A 1OQ6A 2BX6A 3MD3A 3QFWA 2CQDA 3T5KA 1O6XA 5HAOA 1GX5A 3JYTA 4ITSA 4IOBA 3N79A 4WZQA 2Z57B 3A12A 4JI5J 5IT9U 2IRYA 4AL6A 3BM7A 2W7PA 1ULRA 2C42A 3Q0AA 1DQAA 1RCXB 3ILOA 3QZ7A 3K5NA 1RT4A 2QA4S 2U2FA 1KEKA 3ENAA 4ZVOB 4E98A 3SV3A 1RXOB 4X4PA 3QYYA 2K7JA 4WK1A 4R25A 3E01B 1S5ZA 4I6WA 2HPUA 4MMOA 4J9PA 4FKYA 2YKOA 2PA8D 4WF9Q 1VRTB 3I82A 3GFZA 2MGZB 1JXEA 2B4OA 7FDRA 4Z37A 2AYMA 3CMAS 3J7ZT 3V4IA 1VCTA 2V4QA 2PMHA 2KJVA 2GV1A 4P73A 2R7QA 1KOHA 1RTIA 5E3RA 3KMSA 2GW8A 2H5IB 5KFKA 2CPYA 4MFBA 1T94A 1ZTWA 1TL3A 4A8OA 5KG1A 4K4YA 1S1VA 2LECA 4JYAF 1WD6A 1WKLA 3OJUA 4FP9A 3PW2A 1S6UA 4E0DA 3ILJA 2HHTA 1RT2A 4NI2A 4OHVA 4MKYA 3SQGA 2HVZA 2ACYA 3CWJA 1RWKB 4J91A 3X3UA 4QR0A 2UP1A 4R5PB 2M3DA 3DM2A 1VOMA 2RE1A 2NZ4A 1NJXA 2IJRA 4URGA 4ZN3A 3UPFA 5F3TA 2UUBJ 4DU7A 3NGKA 1VRQC 2DRAA 1NLKL 5CYJA 3QLHA 2A2CA 4DV0F 2RRBA 1VQ9S 1YRTA 2CKWA 4MKAA 1WUUA 2XS2A 1FFGB 2YQ0A 1NKCA 1N0UA 3TZXA 2RT3A 3T1AA 1HNXF 4JI3J 3CJ0A 3WQPA 4DFMA 2QSFA 4HT5A 3AXMA 2JSXA 3OUYB 1G1XA 2AZ1A 3TUIC 2ZE2A 2KRRA 4PUOB 3AH6A 2PDAA 1RWOB 4NL5A 2V34A 2DNRA 4X4OA 3DNCA 3F73A 4TN2A 2OEJA 2OSRA 4OX8A 3EZOA 1VJQA 4AXIA 5IOLA 3W8GA 3TO8A 4R8UB 5HROB 4A46A 1N4LA 1DAXA 2NPFA 4J90A 1IVZA 1OO0B 3GMGA 1TK8A 2YH1A 3MCSA 2HQDA 4C9DA 4ANCA 1R6VA 1LNQA 2QLBB 4I2QA 2VG5B 2BA9A 4OYZA 3TEHB 3HZEA 1UW4A 1VDHA 3CJ3A 2Y1RI 3J7YU 1L3SA 1FX2A 4KAIA 2ZFHA 2ZEJA 3TAPA 3LPYA 4F02A 4OHWA 2B9EA 3I0RB 1TP7A 4DV4J 4USUA 4UF4A 2VPWB 3AAWB 3PM9A 4OI0A 4ECWA 1RUSA 4EI2A 2A10A 3MEDB 4Y6IA 1U8SA 3C14A 1RT7B 5D0HA 2I5JA 5IC4B 2EG1A 2ASJA 4LF9F 4W98A 1T0TV 1AZSA 1U1QA 1ZAXA 1TTHB 3MM9B 1VFJA 1G4CA 1HPZB 2AMCB 2QL7B 1T9WA 2CPXA 3AD7C 1XJWB 1FKAF 1AXQA 1MSWD 2XMTA 1X5TA 1C2PA 4M5GA 4OYBA 1SV5B 1KVJA 3VZIA 5LXRA 1H38A 1SH0A 3MEGB 1U0HA 4NLTA 4FYYB 3BDPA 3UD4P 2WVCA 3W63A 1TZ0A 1NH7A 2WOMB 2OUGA 2BOPA 4ALZA 2E5IA 4H4OA 5D3GB 2WVBA 3GJTB 3CJKB 3DU6A 4CT8A 2CPEA 2D3UA 3TOQA 1SL2A 3PHTA 4CLSA 4J9OA 2I0XA 4AXJA 2VDIA 4NE9C 1Q0NA 2DIVA 4DN9A 3K8VA 4M1KA 3CGIA 1RTJA 3T5JA 2WBRA 2V63A 3M32A 4FXDA 1T03A 1ELOA 1ZS6A 3AODA 1AT1B 4QWAA 2VKRA 3OJSA 1FNXH 4KGKA 3P8BB 1NAQA 5DM7Q 1M5OC 4JV2A 4Y2IA 4NRTA 3IFEA 2CIMA 4MT1A 3T1HF 5A8KB 2CQPA 2AW0A 1FI4A 4TVAB 4DCJB 4B3RF 2HFVA 5L1KA 2HHQA 2DYAA 1TKDA 1HWKA 1XR6A 3DOMB 1MROB 1RAJA 1N8RT 2IDLA 4ECXA 3W3SA 3EJMA 1LW0A 5ETTA 1GMVA 4UZBA 1Y3JA 2VL1A 4A8SA 5L39A 2E9RX 1ZM9A 1BMQB 2RIJA 2Y1JA 1J27A 2RMLA 4DX5A 1U25A 4X4QA 4KKOB 3J80Y 1YGYA 3OTOJ 1YRXA 3PW5A 2VBZA 1OWXA 2GVZB 1FRMA 4I7FB 2UXCJ 4V1Ak 4DV5J 1L3TA 2IRXA 5I42B 1GQEA 2CZVC 1BQMB 4P7VA 4OI4A 1HNZJ 1XNQF 3AY0A 4G3IA 3MR3A 3LTOA 4I1TA 5HO4A 1DRZA 2PO4A 1U48A 1M5VC 5C5JA 3MGJA 2MKIA 3ZTSA 3ZZRA 2G2YA 4J9LA 1RKJA 3J7A1 5I4MA 3BYRA 4ID8A 1H3DA 5HVGA 2FJWA 2CDQA 3ZZTA 1Q8KA 2VQFJ 1HBNA 3TVYA 2MMYA 4NCGA 3M2UA 1NMEB 2XG8A 1OQ3A 4QPXA 2VJVA 1Q5YA 5ETSA 1FKOA 5FLXY 3TJ9A 2BANA 4YMEA 3RRKA 3OL6A 1VHFA 2EKYA 1CJVA 1UFKA 4XK8C 2XMWA 3LP1A 3HLUA 2UXBF 4NRUA 1F2GA 1FKPB 2DNNA 1CULB 5G0RB 4JOUA 4DF4A 3P49B 2XS7A 4ZVFA 3TAMA 1FWLA 3OTEA 2ADBA 2ZKUA 2IM3A 2N4CA 1VBYA 2LU2A 3MECB 1IKWB 5A6PA 4WE1A 2J9DE 2OELA 3W1YC 4XDCA 5H9EK 3KLIA 1WDTA 4Y2KA 2HHXA 3JXOA 6AT1B 2OO4A 3K0JA 3M7VA 4XO0A 3EM1A 5ETPA 1RP5A 4HH0A 1RZMA 4LMZA 2BUNA 3KLGA 1SKWA 3Q8QB 1WI6A 3JAMU 3CCRS 4USIA 2HS3A 3T6JA 4DZDA 1JJCB 1RT1A 3GFYA 3ZZOA 2H65B 2E5JA 4Y28C 3G71S 2IA0A 4NLUA 2DGTA 2P8IA 1TAUA 4F3OA 2D3ZA 3FK4A 4YP3A 4ZVHA 1NUEA 2ZDOA 1Q95G 1S1WB 2P9EA 2OPQB 4HDGA 2GMLA 1AA1B 4NX9A 4ZPCA 3CD7A 3FGVA 3HKWA 2VH7A 4H4MB 2DGSA 4DZ6A 1P9YA 4FVMA 3M9MB 5HMZA 1D1UA 1AYEA 2KFZA 1WEZA 1PC4A 4JV5F 1VLYA 3C16A 2AU0A 1WC5A 1BGXT 1W25A 4DV0J 5ETOA 4QBUA 2J8AA 2X1FA 4DV6F 3CD5A 4Y00A 2U1AA 2W01A 4RZRA 1MG7A 1TL1B 3J81Y 1FRHA 1HNXJ 3K58A 2I2YA 4ELVA 3MAAB 2ZBCA 4OFZA 2EPIA 1Y11A 5B0GA 2BJ9A 3W61A 1R0BG 2YH0A 1FEEA 1FTRA 5BYRA 4LRCA 3QSIA 1ROFA 2GGPB 3AFGA 2Y8YA 1VQ8S 3POTB 5KFMA 3IRXA 1IQTA 4LF4J 1IM6A 2J7KA 1QSLA 4NA2A 3A3NB 3ZO7A 1UPMB 4ANEA 5HN0A 4U95A 4IFVB 1RAFB 2JLGA 4E8UA 1NK6A 2P5VA 5DG8A 3BEGB 2YNHA 1HQUB 2J6SA 1YRUA 1JLGB 4L3KA 4LSZB 4ERDA 2G0CA 4DV1F 4EGLA 2E66A 5ADZA 2X51A 4KHMA 1U2FA 3PR4A 2J0SD 3C6TA 1NSQA 1I5OB 2V50A 2DHSA 4Z2XA 2YWEA 2XULA 3RAQA 1BWEA 3KUHA 3PO5A 1DARA 2HAIA 2BKOA 1B7YB 3MM8A 1HBMA 2ZITA 5C24B 4TYBA 2VA2A 4LF9J 3HDSA 3HMJG 5HK4A 4AE5A 3VAKA 3ITHA 2WONB 4OI1A 2LFVA 3TEGA 2CPIA 4IQMA 4ELUA 2YNIA 2DNOA 2EW9A 1Q1KA 4PPZA 4FPRA 4KO0A 3ETMA 5KTQA 4HACA 3IGNA 3DDKA 3AOAA 3CT9A 5AXMA 1F3FA 2XZDB 2CUYA 1YX2A 3PZPA 3MOZA 1AW0A 2WVFA 5AE1A 2HRTA 3BGRB 2RSQA 1N48A 5C7PA 3V2UC 5J2NB 3AOCA 5J2PB 2KTQA 4N47A 1ICEB 5J2QA 1CVJA 3HVAA 4K7QA 1CPZA 1HQEA 2J8SA 2P2CB 2KT2A 3JSYA 1P9QC 1S9GB 4LUBA 3D6MB 2L9DA 1LWCB 1ZAWA 2FTRA 2W1BA 2R8HA 4Q7AA 2VZ9A 1J5OB 4YDXA 4V19X 4OZ3A 4DQPA 1K8AT 4CH1A 4F4ZA 2D69A 1ZOTA 2ZDPA 3CCWA 1UEKA 4FNIA 4PABA 1LWEB 1WC1A 1TVRB 4OYPA 3TVKA 2XO6A 3BB5A 1CJUB 5F8LA 3T1HJ 5A2QU 2K1RA 2WRMA 3R9LA 1HWIA 4B3RJ 2OP5A 5DGAA 2DXDA 2FUG9 2YNFB 5DDQC 2XMKA 3DHXA 3SYZA 2E1PA 3MPYA 2OMOA 3DI6A 5HI7A 4O44B 3WX8A 2DH8A 2RF2B 3NAHA 2NSBA 2MZQA 1RHUB 1FNMA 3V5RA 3UI3A 2F63A 5IM0B 2DPJA 2WB4A 3HJFA 5D4LA 1B4SA 1EETB 2BDPA 2FJBB 2H5JB 1ACMB 3T6BA 1RTZA 1M90T 3J7Z5 3IG1A 4KPYA 2V9KA 4LF1A 3TZZA 2Z0GA 4IR9A 2IPOB 1SKUB 4CM2A 1R8AA 1X4HA 3F41A 5CA5A 2YPYA 3MURP 2XQCA 1WG4A 1GNKA 3P4UB 4KT0C 1K44A 1U2RA 4N77A 3GU0A 4NYPA 3QT6A 4NOHA 2KVQE 3GFHA 3CD6S 1JXVA 3UR0A 1N33F 2KG1A 1G2EA 1F1BB 4DL4A 5C2CA 1PJ5A 2RQCA 2CQHA 1YBAA 4LSLA 3IN5A 2XEXA 2XCPA 2C3YA 3L7OA 1NJWA 4LBHA 2UU9F 2EBGA 4C11B 3PXGa 5BYSA 3EZ5A 5L9XA 3VAFA 3K5LA 1I3OB 1C0TA 3ZTOA 4PWWA 3LP2A 2UXBJ 2XSJA 1M5PC 4WP3A 3QJPA 5CYQB 1JLEB 1HKAA 5L38A 5KFHA 4F36A 4JI4F 2F4VF 1SJ3P 4ICLA 4NLYA 1B0VA 2E5HA 1N5YA 4ZIVA 4NA3A 7AT1B 1HWJA 4CNYA 2AYEA 4LRFA 4YHHJ 3ZXWA 1NHVA 4G6VB 2O67A 1MU2B 2DNZA 1LK7A 3HHKA 1RI7A 4B9UA 1DTQA 3KNGA 1U1MA 1OIAA 1Q81T 1LWFA 1EB0A 1SI9A 2MZJA 4U67Q 3K57A 4MIAA 2DITA 1FFSB 2CPHA 2LP4A 3I4HX 5HQMA 2L9NA 2AJQA 3NL0A 4E2FB 4A4JA 4FF2A 4YB7A 1KS2A 2VF3A 4DWIA 3D1QA 4QOTA 3RBEA 1HMVA 1Y0HA 2FDNA 1RT4B 2XBPA 3GIKA 2XMVA 4ZVPB 3MTJA 5IQQA 1U1KA 2KFYA 3G82A 1IJEB 3CCVS 2W25A 3KG0A 1I94F 2FY1A 1OY8A 1U1PA 1F3VA 5F3ZA 2GJFA 5E33A 1U45A 1NPPA 1W2BR 4DV6J 1B7FA 3TA0A 4ILMA 3V4IB 4OL8A 2LQ5A 5H1SV 1JK9B 1TKZA 3W62A 3W5XA 2VG7B 4I6AA 1SPBP 4RLEA 1TL3B 1VI7A 1RGVA 3MR5A 2YWWA 4DR3J 1VQPS 2ATCB 4OZ0A 1NEEA 4LRAA 3SQGB 1OJ4A 2D74B 2D9PA 3EDRB 4ECZA 3LF0A 3BQ1A 3BSOA 4C2MA 1JLQA 4NCBA 3DM2B 4NWBA 3W66A 2QJ3A 4UUWA 1YITS 5DS7A 2ASLA 2VPYB 4JB8B 4FN5A 1YKWA 3RW7A 3MPUB 4PG7A 5GMKa 3A8IA 5L9NA 2ABYA 5BJRA 3MDFA 3QLHB 2BQ3A 3KLEA 2BKPA 3MPDA 1S1TB 4DV1J 1OMSA 2LXIA 4JUZA 4AQYF 3TYTA 2QL9B 4IH7A 4O3RA 4JI1F 3UCUP 3NY0A 4NYZA 3LAKA 1S99A 4IG0A 1RAGB 2B9WA 2CWKA 4DSEA 2WK4A 4GVBA 2Q6BA 2WZ1A 4CNZA 2ZE2B 3M8WA 1WG1A 2ATLA 2GQQA 2LEPA 4O4GA 3MR6A 2MHNA 3EGNA 3NOCA 3MPWA 3PJ9A 4DQQA 2YBVA 4LF8F 4WJBA 5GAGI 4CQ1A 3HKZD 1HNIA 2KDOA 1N5SA 4QWEA 3HCXA 4QIEA 3L7PA 4L3NA 1SC6A 1QUPA 4K2JA 3JSBA 1NKEA 4UQGA 1A0OB 4I2QB 2ZBRA 4M94A 2LXFA 4MJKA 4G1PA 1OYEA 2OH2A 4L72B 1NU4A 2DHXA 3UN5A 1JJ4A 2FJDB 1XERA 5JVHQ 4OV1A 4JI2F 1S57A 3D1OA 1H2VZ 2V2KA 2N3LA 4GC7A 3FC9A 3GPAA 2HBYB 3NCQA 4FXVA 2DK2A 3EXYA 4GKKF 3R3TA 1GH8A 1XIQA 3FEXB 3C14B 2I5JB 1YJUA 3GLJA 1DHMA 2OSQA 3CCUS 2RDJA 3UFCX 5EDWA 4OYIA 1UJ6A 1IBMF 4IRCA 4DQIA 2E5GA 5HANA 1JB0C 4ZVQB 4WFZA 4MTPA 3MEEA 2BJ7A 2HGMA 2QC3A 2OMLA 4DV3F 3GTYX 3PYDA 4NXNF 1QE1A 2GX8A 4A8FA 1TV6A 2HFSA 2IYGA 3NG8A 1D8ZA 3R5JB 6FDRA 1F9HA 3GJSB 2GFFA 1MMLA 1UA1A 1U0HB 2B51A 3EUNA 3PRBA 2V2VA 3MM6A 3BGLA 4OV6A 2HFNA 4Q2MA 3S6EA 2KM8C 2KKHA 4HDHA 2C2EA 3IR5B 5B0AA 2J6TA 1SUQA 2GCFA 1Q53A 5RUBA 4NLWA 4H4OB 4ZOSA 2DHGA 1REVA 1XMQF 3JSRA 5B0FA 2K3KA 5EX0A 5K8MA 1RAEB 2FHJA 3SXLA 3QJJA 4DV7J 5M2PA 1U6ZA 1WHVA 1FA0A 4ECTA 3MMCA 1RTJB 2APOA 2GHWA 3A3OB 2YWGA 1T03B 3GV7B 5DG7A 2HNZA 2PT0A 3MCNA 4FYVB 3E51A 4C7QA 4RKUC 2B7BB 4ED7A 1G3OA 3GYXB 3WIVA 3HO1A 3D28A 1IUJA 4ED6A 2R8GA 2DHAA 1PSDA 1R89A 4NLDA 1M1GA 3BH6B 2HIQA 4U6PA 1JJHA 4J7CA 2MLXA 1FNOA 1B3TA 1N33J 4QYZJ 4WU2A 4Z7YA 1VC5A 1RWWB 3BQ0A 4DQSA 3NXZA 3LWLA 3DGVA 3TARA 1MNEA 5DDRC 1QTNB 4TXSA 2IY5B 2OJ3A 3PKYA 4ED1A 1FWKA 3PYGA 4CM0A 1UFWA 1RBAA 1XC9A 4M5MA 3DLHA 3CMES 1FDDA 4WFXA 4DSLA 3PDNA 1QVGR 3AOBA 5F8IA 2GMJA 2XLJA 3IR6B 1VQSA 3RRGA 3BBCA 3H4DA 3BYPA 1S9FA 4QIWD 2VJUA 5LMUF 2JNJA 4LBIA 4JI4J 1HNWF 2F4VJ 4QW8A 3I56S 1ZM4A 4IO9Q 4DL6A 1WF1A 4X62F 1RTHB 1WC4A 1NDCA 3IAS9 2ROGA 3VAMA 1IR1A 2FB0A 5KFIA 5C42A 1VHIA 2BACA 3HZGA 2W2QP 1KVKA 2XTJP 5SUHA 4O3SA 3QT5A 3EZUA 1HBOA 3FBBA 1HBNB 4NCGB 5A76A 3M2UB 4C8ZA 4DR7F 3DRSA 1U26A 1PGZA 2RHSB 2R7XA 2LXUA 1FKOB 3KLHA 1KR4A 2BANB 3OR2A 3ZFVA 3D68A 3EWGA 3BJYA 1CJVB 2J5AA 3W7BA 2QGFB 4DPYA 3LP1B 4WWSA 1K1SA 1X5SA 3QZ8A 1U2CA 2YQ3A 4KV8A 4H54A 3H40A 2BRLA 1LOUA 3MF5A 3BZQA 4X65F 2B9XA 1TKXA 2FJEB 3H98A 1NK7A 3O5TB 3FUYA 4ZHRA 2DRDA 2R42A 4ZPAA 1X5PA 1JLFA 1NSAA 2RNEA 5GAEI 5E3QA 3KLIB 3HK2A 2G2OA 4RL1A 1DZ5A 2Y9HA 2M0GB 4BC9A 2HK2A 3T1YF 1I94J 2IFXA 1I6JA 1SQFA 1IKYA 3BF4A 2CQ2A 5HQLA 1TMJA 1X5OA 3C8YA 3KLGB 3HFKA 5C25B 2CPZA 3TW0A 3KOAA 1XK8A 3DC2A 1RT5A 1NH8A 1UCNA 2MXYA 1RT1B 1TAQA 2V94A 2CJXB 1H2UX 4PCQA 4I2PA 3HSDA 4NA1A 2G0IA 2H1YA 4B9LA 1WF0A 5KG6A 3QRQA 3OR1A 3FBCA 4Q0BA 3PEHA 3U1NA 5F8GA 2ZKTA 2G2ZA 5LL6d 3D6FB 2X7IA 2EI5A 2AIRB 2XMUA 4PQAA 3BKFA 5GAGU 2OIHA 4P72A 2MKSA 1NK5A 1SB6A 2NUHA 2CRLA 2W2OP 4RNHA 3NGTA 1VS3A 3C16B 3PJWA 2FGOA 4PEOA 3M30B 2J0WA 3AA8A 2R2UA 1LW2B 4AQYJ 3RYLA 1YIJS 1PC5A 2ZH5A 4DFJA 4JI1J 1HI0P 2LEAA 4IDKB 1RA6A 1L3VA 1Y00A 3GV8B 5DQHA 4M5LA 2V4JA 1L5UA 1X4EA 3BGUA 4KRWA 4OX6A 4OZ5A 1RA7A 2HFOA 1S6QA 4OQJA 1F5CA 3QWUA 2OD6A 1RYRA 2Y3YA 2L41A 4KHPF 1X9WA 4JV1A 2EFQA 3IXQA 1ZTTA 3DLGA 3IRXB 4OZJA 2YKMB 4LF8J 1VQ7S 4B3TF 3CMQA 3M8YA 1WELA 3ADAC 2RDDA 4HHUA 4WIIA 5CXTA 1P6TA 2VPXB 1UKUA 2EWHA 1T05A 2DXFA 2MSTA 3R7NB 1UA0A 2J7UA 5D8HB 4DCPB 4PG5A 1VISA 1D3WA 1V5VA 2YNHB 2XHWA 4NYOA 2HNYB 5IC6B 2QMUB 4M5HA 3H59A 1GTEA 1KKHA 4FBUA 3MFHA 2ZJPQ 3P3DA 3CJ2A 3PFOA 4CIOA 4JI2J 5K5MA 1YDLA 1RHQB 1WHXA 1ZZFA 1Z2LA 3C6TB 3I9V9 2W9BA 1QAIA 3JSMA 4ZVEA 4B3SF 5B09A 3ZC4A 3QMQA 1WSVA 4OX9F 1AUSL 3FMWA 4GKKJ 1FDBA 4RUBA 4ID5A 2ZH2A 4CLYA 3MM8B 1HBMB 4CLUA 3HHLA 3PFEA 1H6KX 4FYDA 5IS2A 3NNCA 4RNOA 2UV8A 1TKTA 1G6BA 5EWFA 1M1KT 2YNIB 4O3PA 2RS2A 4QU7A 1S9EA 5H9FK 4KO0B 4I69A 2CNKB 4HACB 4P71A 4DV3J 1FE4A 2CAJA 4IR1A 4C98A 3TZYA 3DXSX 3S7RA 3B54A 2DT9A 4HHHA 3MZIA 2LQ9A 3UR3C 1V3ZA 4PG4A 2MY8A 1VQ6S 1N6QA 4D3GA 4PG8A 1JLBB 3GQCA 2PI4A 3OFGA 3PR5B 3PRVA 1RSCA 4WFBQ 1VIXA 1VBKA 1X9SA 3TI0A 4ZP9A 4RBUA 5DDPC 5J2QB 3GJRB 1KN6A 1XMQJ 1HQEB 3FCHA 4EWTA 4DXLA 2DNLA 3UDCA 3TNVA 3IP0A 1RWUA 3NGUA 4DUZF 2PGCA 1QAJA 3I0SA 3HVRA 4CRJA 4I56A 3MCOA 5AT1B 2YKNA 3M8PA 2HHHF 2MKJA 4OYOA 5DG9A 4B3OA 4X4RA 2JX2A 5ETMA 4I64A 4OJGA 2DKOB 2DNHA 2IMWP 4TQSA 1KQKA 2K1RB 2C3UA 2CJKA 2MDAA 4LRDA 4HKQA 2MPUA 3VHQA 2CNLB 4DFPA 3I96A 5KFUA 2BJEA 4NLVA 2ZVIA 4FF1A 5DETA 3ELHA 1HHSA 3JTOA 1XMOJ 2E29A 5KOXA 2DXEA 4RNNA 3DI6B 5KT3A 3FDSA 2D3OR 4UY8T 1NB7A 3NP5A 3F56A 4FYWB 3ICLA 3PO4A 3ZTRA 3WZ0A 3LAMA 4X4UA 1BHNA 3UNGC 3BO3A 1AROP 5A6WA 1XBWA 3VV2B 3UDEA 3RTVA 2WTFA 4XTTA 1VRUA 2AGOA 2EKNA 3B8HA 5KFVA 2LCWA 1E6VA 2ZD1A 4I4BA 2UXDF 2MTLA 4C8NA 2FYXA 2BV3A 4ZMMA 5M2RA 3AT1B 2HVHA 2QG9B 3EICA 4DHVA 4DR1F 1HNWJ 1A7GE 3OSNA 1RLCL 4P2XA 2AGPA 4JI8F 1QJHA 5CZXA 4OYAA 1FK9B 5GAEU 4X62J 2JLEA 4DI6A 2NYIA 2DR7A 3WIUA 3EGZA 1NHUA 5JUMA 5KG5A 3DOLA 3QO9A 1QD1A 3IM8A 4PXCA 1U1LA 2ZVSA 1RAOA 1RTDA 4LSLB 3R2CJ 3FQKA 5HBMA 5BXIA 2K2PA 2GO9A 2BE2B 4ED3A 2XMAA 2E1CA 3PYFA 4QWBA 4DR7J 9RUBA 2RQKA 1GMWA 1C0UB 1Q8LA 4USMA 2ZNYA 1IBLF 2GO8A 1U1NA 2H3EB 1WOPA 4CP5A 2WVEA 1C0TB 2OPSA 4ZPTR 2ZM6J 2XSJB 4WXOA 4ELTA 1HI1A 5IWAF 3TA1A 4X65J 2YNGA 2HLUA 3NGSA 2ZZTA 4ANDA 4CYUB 2OEMA 2MZTA 3HSGA 1SJRA 3QT8A 3NGDA 4ICLB 3EMTA 1C4AA 1N5YB 1SJFA 1RYSA 4UT4A 4WZMA 1EP4B 5M2UA 1WHYA 4P2MA 1HYSA 3QFHA 3VWSA 3T1YJ 3HJVA 3ZZYA 2V8DA 1KDNA 4J9RA 4HI2A 1RT3A 3RR8A 1KONA 2HK3A 3CDEA 4P52A 4Q2LA 4F3MA 4IQXA 2Z56B 3R5AA 3TR5A 1TU0B 3OHAA 1J5EJ 2R8JA 3T19A 3DDIA 2F5GA 3CF5Q 4K4ZA 1URRA 2VV5A 1R7IA 3IM9A 2WVDA 1RAHB 2G13A 1X4FA 2HHSA 2D3O1 1C1BB 1FXRA 5HP1A 1EQMA 1FHTA 3KTQA 1HMVB 4OZ1A 2BEFA 1JX4A 1FDAA 5KT2A 1FD8A 3IWLA 3M6XA 1CQMA 1PAEX 4USVA 2Q66A 1UVKA 4UZCA 2B5JA 3CCES 2I38A 3M2RA 1H0HB 1YJVA 3B4MA 2NQPA 4AT1B 5DQGA 2CZ9A 2SXLA 4OZNA 4HT7A 3AQOA 4EYIB 4C8LA 2DCUB 2F8MA 1D9FA 2A6MA 2RDIA 3KJQB 4ECSA 1REGX 4AFFA 3DLKA 1TKZB 1H73A 2R7SA 2HVIA 2AEMA 2DVIA 4CLWA 3CCLS 4DCOB 4ED2A 1VQNS 2KM8B 3GWCA 5ETNA 4F2RA 4RR5A 3LANA 2C2MB 2WSEC 1H98A 1UP1A 1VQLS 4LR8A 2DR6A 2LEBA 4KHPJ 4ES3A 1MWQA 2HBZB 4WYLA 3PW0A 4LF6F 1LK5A 4B3TJ 3NNAA 5B0BA 1JLQB 4IO1A 2J9CA 1Q8IA 1WWHA 3C19A 3RB6A 2J9DA 3D4JA 1CJKA 2QZ8A 4LR7A 3S8SA 3FKBA 1PBAA 1HI8A 4GO5X 3VGSA 4CO0A 4DFKA 4CWBA 4FXWA 1NJIT 1V3SA 4P2FA 3KK2A 2OKQA 1HD1A 4ZK7M 3NOGA 5KFEA 1NK0A 3GYNA 3BKUA 4NLOA 3N6MA 2H48B 3V6DA 1JMTA 4R8UA 2FLOA 1ZBTA 3Q8VA 4EBEA 4RW9A 4IG0B 1HWUA 2ZC4A 4B3SJ 1T9YA 2NCKL 2CWXA 3AB4B 2HGLA 4GVBB 3ZTPA 4OX9J 2VU5A 3FRYA 1VK8A 1KTQA 3VQTA 3RW6A 4NEYA 3TX0A 3HULA 3LGMA 3UE2A 3WBZA 2LQBA 4O4GB 1K1QA 1B0PA 3G8QA 2QT7A 1Q7YT 3DRPA 3HD1A 5E3AA 2RQ4A 3RR7A 3V81A 3L3CA 3I0RA 3NAIA 4ED8A 3VAHA 3UDLA 3W60A 1CJTA 3CULA 3FBEA 5KFGA 1HNIB 4WKYA 1Y5LB 4TQRA 3A3PB 2NZCA 4LF5J 1R0AA 1QLNA 4F0MA 1NO8A 3BBFA 3J81j 3RZAA 4A8XA 2N4DA 4RO0A 2OEKA 2HRUA 4DR4F 2HZAA 2BBEA 2EFOA 8AT1B 2JH3A 3AJDA 3M8QA 3H5SA 4RNMA 4DPXA 3QGIA 1DLOA 4DSFA 1N32F 4MK9A 2FHJD 3EDQB 3I55S 3BO4A 4KQZA 2AYBA 4DUZJ 3D3CJ 2AT1B 3S1TA 2R7TA 2OAUA 1SC4B 3GJQB 3PIPQ 2ZHBA 4F0KA 3KK3A 4DG1B 3U02A 1T02A 2HHHJ 3MEEB 1K73T 3TZWA 4F4KA 1RWNB 2BE7D 3OVBA 1NK9A 4YB6A 5D3GA 2ZH4A 1QE1B 2ZBQA 1TV6B 2I8EA 5A0YA 1CQNA 2HFUA 3KUEA 5CH7B 2CG4A 1GT8A 3PRDA 2D9OA 2L3MA 2EC2A 3MM6B 1YJRA 2G4BA 2R7RA 1VYAA 4DN0A 1E6YA 4HH1A 1B99A 1SUQB 3BBBA 3K5PA 1GX6A 2R7OA 2KH9A 4B02A 4DPTA 1REVB 3MR7A 4F04B 5E5NA 5KG2A 4A48A 4UTGA 3H8YA 3J80U 4GMKA 4U7UK 3QIDA 5EHHA 4LSNA 4ZVGA 1JKHB 3MMCB 1UEUA 2DGWA 3IWNC 3T9ZA 1O51A 2GIRA 5G4DA 3NMAA 3C6UA 1WC0A 1WACA 2MQLA 2K8GA 3CIMA 3MM7B 5D0EA 2GA7A 4AL5A 2HSEB 2FJXA 2UXDJ 2DNGA 3V6JA 4W4MA 3FSYA 5CQGA 5KG0A 2ZBPA 1D0EA 4L6V3 3A8EA 2VBYA 1U49A 5GADI 2W9AA 3I5BA 4KE5A 4OI3A 4LREA 4KB7A 3EXCX 4RBVA 1LFPA 2R3VA 5KT7A 3KJVA 3GR1A 3SMZA 1KSPA 3GE9A 1N56A 2AX0A 4ER8A 2BYCA 2FVSA 1S10A 4QW9A 1HLWA 5I42A 5AXKA 4IH5A 3PVXA 1YTYA 2LVWA 4Q43A 1SKSA 2ACMA 2VASA 3RBDA 3GONA 5FLXU 2AQ4A 4PG6A 3NCRA 2XY6A 4DL5A 4MYTA 3RG6A 2NREA 3A1YG 1ZH5A 2HFZA 3GSIA 4G1QA 1IBLJ 4X4SA 1HNVB 4QIVA 2HVDA 2JL9A 1LQ9A 2JRSA 3Q89A 3RBXA 3P5TL 2NXEA 5IWAJ 2C2OB 2XI3A 4IRKA 3H7HB 3N0VA 2RUGA 3NWGA 5KFBA 3ET6A 2MZRA 1BXNA 4KTQA 5E41A 3MR2A 1D9AA 3G87A 3PX0A 1HHQA 3R5GA 3HFZB 4HVZA 3VGUA 4DL7A 1UJ4A 1FDNA 2HRYA 1V5IB 2KYZA 1CULA 3BSNA 5C42B 2IYIA 3BS9A 3OFEA 4HL9A 1HBOB 2CQGA 2HWIA 2QMXA 2VG6A 2BZ2A 2AGQA 3MECA 5IXUA 1IKWA 2B43A 2KI2A 5KFQA 3DRSB 2PE8A 3KLHB 2M5YA 1W7WA 2NXCA 3OR2B 1H72C 3SZ2A 2IHR1 2RJZA 2BM1A 2UVWA 3A13A 4RX6A 2Q43A 3G96A 1VJWA 1T8EA 2VIHA 1SJ1A 5J1EA 1W26A 5KFNA 4QR2A 3THPA 3OFFA 2Q79A 1KRPA 4O0NA 2X1AA 1EZZB 3H20A 1LV5A 1S0NA 1F5BA 1TKXB 1Q86T 1RU2A 2AKWB 3ULHA 3KFWX 1S0VA 4ZHRB 3ENVA 1QSYA 2DIUA 1H74A 2CPFA 2DHHA 3PX6A 2V68A 1CLFA 4X4NA 3A8KA 3OT9A 4JI5F 3Q2TC 2JHEA 1TK5A 3J81U 4ETXA 1T3NA 4CLLA 1S1WA 1UETA 2F7VA 1IKYB 3I6PA 1Q4RA 2VFVA 1YBTA 5EWEA 3FNNA 4NLSA 1RT5B 2W9CA 3FMBA 2O1PA 3H4BA 4O3QA 2BQUA 1FRIA 1S97A 2BM0A 1RBOB 1R6YA 3CO9A 3W2WA 2IAJA 5F8NA 2OI2A 3H0PA 1LEOA 3HHNB 2CJQA 3KHRA 1WC3A 2EBEA 2HVEA 2UUCF 3I4PA 4Q44A 1NNDA 2G1DA 3OR1B 4Q0BB 3SSQA 1RE1B 3DKDA 4LF6J 4MYUA 2YX7A 1ZETA 2IVFB 2M52A 3KHHA 1KTVA 2Z4PA 1X7VA 1MMNA 1RHMB 5L1IA 1XR7A 2LQ8A 2GNKA 5CD4H 5F8JA 2HQ3A 2JFKA 2HW3A 2LLZA 3VVTA 3OD2A 4NLPA 1R3NA 3D6TB 4WIQA 2VFTA 4K59A 1S77D 4AUKA 5CYMA 2ZH7A 5E0OA 2GHVC 4WK3A 4DS5A 2MQQA 4DR2F 1T9XA 1UVLA 4P2SA 2V4JB 2XS5A 1KQFB 1Y3KA 4F0HA 3CVKA 1T9VA 4PXDA 2QX0A 1WKKA 2XC9A 2UVUA 2XNQA 4NZ7A 2V8GA 5IV4A 4X4VA 2PIIA 5I3UA 3HHLD 4DUYF 1XR5A 1HQUA 1IJFB 1JLGA 1VBZA 5K14A 4ILLA 3BQ2A 4Y2CA 4ZITA 3TJ8A 1WORA 1KFDA 3K17A 2NXNA 4RU2A 4JI3F 2ZOFA 5HLFA 2VHGA 1BUXA 2C3MA 2VDHA 3TUZC 5D4NA 2XLIA 4ZCMA 4UY85 1R8PA 3RGIA 1QAYA 3IAM9 5GMDA 2AJ1A 2DH9A 2M9KA 4JYAJ 4CLTA 3M05A 1EQ0A 2Y0SD 4J9MA 4DR4J 3OV7A 2GS8A 2XI2A 3R1HA 4UOFA 2W9BB 3GCXP 2BKNA 2W8KA 3JSMB 4Y2MA 2WW4A 5KFYA 2RILA 2QEXS 2VOPA 4USTA 2HURA 4ID5B 4R0EA 1N32J 3CCZA 4Y65A 3HHLB 1VQKS 1Y5NB 1XEZA 4CO4A 1PJ6A 1X4BA 2CQ1A 3NMRA 2KXFA 4A47A 2JEJA 2QA4G 3BGRA 3RJMB 4PXEA 5J2NA 5IQ6A 3R8YA 4LBPA 1S1XA 3K2YA 3UNYA 3BR8A 3ZZ0A 5B7WA 5I3PA 4RW6A 2OLWA 3IC1A 3LGHA 2IJFA 1S9GA 5GADU 4CO3A 1S72S 1LWCA 3ZNUA 3DOKA 3Q86A 5L8RC 2RB7A 1N6QB 2AJ2A 1HBUA 3VZHA 4P75A 1IBKF 1BQNA 2P9CA 2VPZB 1RJJA 1Q78A 4KYZA 4EMDA 1S6OA 4J9QA 3MMBA 3WX4A 2CXEA 3CB4A 1R0CB 1HL6A 3SQOP 3KK1B 4X84A 3G6XA 4GC6A 4PYDA 4DPUA 2RU3A 2RD5C 3HSZA 2J7WA 5CZVA 2RS8A 1FO1A 5KFXA 1FRXA 3I0SB 4B9MA 2XNRA 4W90B 4CLZA 2YKNB 2Z2YB 4LVNP 2VC1A 3M8PB 3C15B 3UWTA 5K20B 3QNWB 1NBEB 4J37A 1CG2A 4O44A 1TL7A 4TYAA 4CH0S 4XPCA 3D0GE 2A2DA 2RF2A 4EO6A 2C2KB 2W4DA 2AF6A 4DV2F 4CLKA 2IC3A 5KFZA 3A4TA 1XMBA 3H42A 4Z7CA 5IM0A 3CJ5A 3GIRA 3B82A 4RNFA 2IVMA 1MMDA 2ALZA 3F44A 2KRBA 1PKUA 4CT9A 2L9WA 4IFYA 3SCIE 3RAXA 1FCAA 4ZA1A 4K4TA 2UVVA 2RHQB 5EGYA 4LFCF 1FVSA 2DNMA 3RBZA 1ZPWX 1N5QA 2C3PA 4Q5VA 2C2ZB 1KNZA 5KFTA 1PCAA 4WFAQ 4ENOA 3MAHA 1Y5IB 3FJ2A 5F9NA 2FHOB 1R8HA 1VRUB 5F8MA 3GV5B 4FYXB
chains in the Genus database with same CATH topology
2C2MB 1RE1B 3GJRB 2H4YB 1RWKB 2XYPB 5K20B 3QNWB 2CNOB 2XZDB 1RHRB 1PYOB 2QL7B 1SC4B 2QL9B 2QLFB 3D6HB 1RWWB 3P45B 3R6LB 2QLJB 2C2KB 3GJQB 2HBZB 3IBFB 2QL5B 2XZTB 3KJNB 2C2OB 1QTNB 4LSZB 1PAUB 2CJXB 1RHMB 2HBYB 4ZVOB 4DCJB 2QLBB 1RWNB 4ZVTB 1I51B 1RHKB 4ZVRB 1RWXB 2HBQB 1ICEB 2C1EB 1RWMB 2P2CB 1RHUB 2HBRB 2Y1LB 3D6FB 2CDRB 3SIPB 2CNKB 2DKOB 3D6MB 4ZVSB 1NMEB 2XYHB 3R7NB 1I3OB 3R6GB 4ZVQB 3EDRB 4DCPB 1IBCB 2H65B 2XYGB 2H5JB 1BMQB 3GJTB 1QDUB 2H48B 2CJYB 2Y0BB 4ZVUB 2CNNB 1SC1B 3NS7B 3R7BB 1F9EB 3KJQB 2CNLB 1RWVB 2H51B 2H5IB 5IC6B 2C2ZB 3KJFB 5IC4B 1RWOB 1GFWB 3R5JB 3R7SB 4JB8B 2FQQB 3GJSB 4DCOB 3IBCB 2H54B 4ZVPB 1RHQB 1RHJB 1RWPB 3P4UB 1SC3B 3RJMB 3EDQB 2H4WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2M B;  1RE1 B;  3GJR B;  2H4Y B;  1RWK B;  2XYP B;  5K20 B;  3QNW B;  2CNO B;  2XZD B;  1RHR B;  1PYO B;  2QL7 B;  1SC4 B;  2QL9 B;  2QLF B;  3D6H B;  1RWW B;  3P45 B;  3R6L B;  2QLJ B;  2C2K B;  3GJQ B;  2HBZ B;  3IBF B;  2QL5 B;  2XZT B;  3KJN B;  2C2O B;  1QTN B;  4LSZ B;  1PAU B;  2CJX B;  1RHM B;  2HBY B;  4ZVO B;  4DCJ B;  2QLB B;  1RWN B;  4ZVT B;  1I51 B;  1RHK B;  4ZVR B;  1RWX B;  2HBQ B;  1ICE B;  2C1E B;  1RWM B;  2P2C B;  1RHU B;  2HBR B;  2Y1L B;  3D6F B;  2CDR B;  3SIP B;  2CNK B;  2DKO B;  3D6M B;  4ZVS B;  1NME B;  2XYH B;  3R7N B;  1I3O B;  3R6G B;  4ZVQ B;  3EDR B;  4DCP B;  1IBC B;  2H65 B;  2XYG B;  2H5J B;  1BMQ B;  3GJT B;  1QDU B;  2H48 B;  2CJY B;  2Y0B B;  4ZVU B;  2CNN B;  1SC1 B;  3NS7 B;  3R7B B;  1F9E B;  3KJQ B;  2CNL B;  1RWV B;  2H51 B;  2H5I B;  5IC6 B;  2C2Z B;  3KJF B;  5IC4 B;  1RWO B;  1GFW B;  3R5J B;  3R7S B;  4JB8 B;  2FQQ B;  3GJS B;  4DCO B;  3IBC B;  2H54 B;  4ZVP B;  1RHQ B;  1RHJ B;  1RWP B;  3P4U B;  1SC3 B;  3RJM B;  3EDQ B;  2H4W B; 
#chains in the Genus database with same CATH topology
 2ZD1 B;  3ZTQ A;  2BOA A;  5D4O A;  4F67 A;  1VC0 A;  2JC1 A;  2DGU A;  1N52 B;  4EYH B;  5FJ4 A;  2ZNZ A;  2ZH1 A;  2QLJ B;  4DS4 A;  3TQE A;  1SL1 A;  4C11 A;  1NKB A;  1PYS B;  4ZCK A;  3GB0 A;  4RBT A;  5KFL A;  1EKR A;  4MKV A;  3M1V A;  4C4W A;  2ASD A;  3OLA A;  3DOL B;  1SQE A;  2C1E B;  2FZC B;  4QU6 A;  3OXF A;  1HNZ F;  1IKV B;  1YJT A;  1RTD B;  3R2D J;  4KFB A;  5HBM B;  1M5K C;  5E3C A;  1ZZN A;  3MMA A;  4WKR A;  5DQI A;  4ZS6 A;  5F9L A;  3V4M A;  3HF5 A;  2DR5 A;  3OXL A;  4Q8E A;  3D3B J;  2CNN B;  1UAW A;  1PBU A;  2P6T A;  2H9Z A;  5HJY A;  4QCL A;  3D9B A;  1WC6 A;  2OPS B;  1Q16 B;  4DEZ A;  1JLA B;  2LDY A;  3T5L A;  1UWA A;  5LSR A;  3OHB A;  3AA9 A;  1PIL A;  2MQO A;  3CDU A;  4N8N A;  4USK A;  3EPI A;  2DGO A;  2CA9 A;  1TR0 A;  4ZKA A;  1PYO B;  1HFE L;  3UCZ P;  1QM9 A;  3Q23 A;  4M5N A;  5HVH A;  2M2B A;  4M5J A;  1SKR A;  1HYS B;  4F4X A;  3OSP A;  1NB2 A;  1N36 F;  4CI0 B;  1RQ0 A;  2GVD B;  1RT3 B;  3PIO Q;  4IRD A;  5J2M A;  3FFI A;  2N82 B;  2E9Z A;  3JQM A;  4C8K A;  4U7U D;  2AJF E;  5KFD A;  4M5K A;  2BJ1 A;  4XAK A;  3QPI A;  4KIA A;  1K9M T;  1VGY A;  3V6K A;  4IOC Q;  1XNQ J;  3R6G B;  3HM9 A;  3JTP A;  2XWX A;  2G0J A;  3DDN A;  1DFD A;  3R27 A;  5HQ8 A;  2UUC J;  1TUW A;  3JQJ A;  5HP1 B;  1X0P A;  2B7C B;  4F4Y A;  3SI8 A;  3VTI A;  3IMQ J;  1SL0 A;  4TY8 A;  4LIW A;  4D3H A;  1ZAV A;  4ED5 A;  1YK9 A;  4TKT A;  2VG7 A;  2V0N A;  1R8B A;  3MPV A;  3KKF A;  4X64 F;  1DY3 A;  2DNP A;  2B5J B;  3OVS A;  3G4S S;  3M2R B;  4K4S A;  2RUS A;  3P45 B;  2Z2Z A;  5JMN A;  4KGV B;  1NSK L;  1FJG F;  2ZH8 A;  1FD2 A;  5T7L A;  2IVY A;  4PRF A;  2A1B A;  1QTM A;  4NLQ A;  3IS9 A;  4C3K A;  2YX1 A;  1KHV A;  3DLK B;  1LXJ A;  4DR2 J;  4YOE A;  3P96 A;  1Z4U A;  3T41 A;  4ECV A;  3PJX A;  2DO0 A;  1FXD A;  2VBX A;  1LWX A;  1VQ5 S;  4W92 B;  3FEZ A;  3WC2 A;  2HLT A;  5DZ6 A;  5AE2 A;  2O3D A;  3ISN C;  3NBP A;  3VAJ A;  1ITP A;  4PXB A;  4DUY J;  1FX4 A;  2WB1 D;  3DN9 A;  1QVF R;  3E8O A;  2HHU A;  1S1T A;  3VCD A;  1YHQ S;  4JI0 F;  2Z8Q A;  2FQQ B;  4TLR A;  3KHG A;  2DY1 A;  2NPI A;  2QO3 A;  3GII A;  1CJK B;  3SEO A;  1A9N B;  1HW8 A;  3B78 A;  2GHP A;  3IWX A;  4ZPB A;  1CC8 A;  3KK2 B;  4PWD B;  3VAI A;  5ETR A;  2L08 A;  3SFG A;  2GZO A;  2VFU A;  2N7C A;  1Y7P A;  3W65 A;  4MK7 A;  2FVQ A;  5FD1 A;  1OSD A;  3V6D B;  4LF4 F;  3JYT B;  2BQR A;  4MIB A;  2I1R A;  3AHP A;  4RW9 B;  3EVO A;  3SCL E;  5KFJ A;  5CCL A;  2HMI A;  1YG0 A;  2MZS A;  4ZPD A;  4OHX A;  1EAY C;  5AXN A;  2CQ0 A;  4BDP A;  1RT6 A;  1S12 A;  4BC7 A;  1UWB A;  1C1C A;  5BR8 F;  2AJ4 A;  3N01 A;  3OL8 A;  3DRP B;  4JV5 J;  2CFX A;  4GVL A;  3NKY A;  3Q22 A;  2J6U A;  3V81 B;  4F8R A;  2YWH A;  2A18 A;  3FQL A;  1CJT B;  2O66 A;  1U6F A;  3Q8Y A;  1K0T A;  1Y10 A;  1X31 C;  3G9C A;  3M2V A;  2DY9 A;  1RWP B;  3G86 A;  5IT9 Y;  2DJW A;  3MTK A;  2DR8 A;  4OMF G;  3SCJ E;  4LJM A;  3CDA A;  2C28 A;  2DEJ A;  1RTI B;  1R0A B;  2EK6 A;  2C22 A;  4KPC A;  4MFB B;  1JLC A;  2V67 A;  3N5B A;  5ITH A;  1S1V B;  1IBK J;  1SIZ A;  5A8R A;  1B64 A;  4NI2 B;  1RT2 B;  2X3D A;  2DTJ A;  2ALY B;  3PW4 A;  1X4G A;  5E7O B;  1X9M A;  2AX1 A;  3M8Q B;  4WBF A;  3BSC A;  1AFI A;  2OHD A;  1DLO B;  3CNQ P;  3FCV A;  3NCP A;  3OL9 A;  2NYH A;  3CJ4 A;  4RW7 A;  4FNH A;  1IKX A;  3FSX A;  1U0S A;  3O3L A;  3QAE A;  3UD3 P;  1DQ8 A;  4A8Q A;  3IRW P;  1FT8 A;  4AD6 A;  4CLF A;  4FF4 A;  3LP0 A;  1F9E B;  4LF2 A;  3CDB A;  3KK3 B;  4C0B A;  5KFC A;  1L3K A;  2YQ1 A;  3EE3 A;  4K5S A;  5L46 A;  2B0G A;  1KFS A;  5BYQ A;  4EUV A;  2RRN A;  3H5U A;  3G6Y A;  3UD5 A;  1S4F A;  3PAC A;  4A8W A;  2B56 A;  1ZYQ A;  5A0Y B;  4P74 A;  2VOD A;  2CNO B;  4DV2 J;  1WF2 A;  1WJ9 A;  2E7W A;  3PX4 A;  4LF7 F;  3L9Z A;  3OL7 A;  2IM1 A;  3K8W A;  2QL5 B;  4C97 A;  4CO5 A;  1YWX A;  4PQU A;  2V8V A;  3H2L A;  1YJW S;  4BBY A;  4RWW A;  3IGV A;  5D78 A;  2HZV A;  1E6Y B;  4I67 A;  1IR2 A;  4WFY A;  1KLM A;  2BE9 B;  4ZLL A;  2V6A A;  4ECY A;  1IWA A;  2D7S A;  3HT0 A;  1RWM B;  1GXU A;  4LFC J;  1F6T A;  4RWX A;  4LSN B;  2MYF A;  5D77 A;  3FEY B;  1S1U A;  2J9E A;  5MLC V;  3C6U B;  3QSY B;  4R0J A;  5ETK A;  1P1L A;  1FE0 A;  3NRB A;  2LMI A;  1TEL A;  2B4P A;  2KZM A;  2MZ1 A;  1UVN A;  1QSS A;  1DQ9 A;  5KFS A;  3DLJ A;  4B17 A;  5DLF A;  5H9E J;  2B6A A;  3KJV B;  2FHM A;  1M1H A;  2Z30 B;  2YKP A;  2NSC A;  2CAD A;  4EBD A;  2DIS A;  2R7W A;  1NCL A;  1FJC A;  1PJ7 A;  1AZS B;  4M95 A;  4FKX A;  2CPJ A;  1U09 A;  3DRY A;  2LKZ A;  1EIY B;  4FS1 A;  2UUA F;  1N0V C;  4OZL A;  3R5B A;  1VC6 A;  3KYL A;  3MM5 A;  3M8R A;  2KVI A;  1HQ2 A;  4OJ1 A;  2W8L A;  4L74 A;  2Q1L A;  3SSR A;  4CH7 A;  2MKH A;  2XSF A;  2WBM A;  4G1Q B;  4NLG A;  4JI6 F;  1RTH A;  2AEF A;  1X8D A;  4YB1 P;  4X2B A;  3THT A;  2R7V A;  2ILZ A;  4Y34 A;  5J1P A;  2Y8W A;  4F4A A;  1T3O A;  4TU8 A;  2VOO A;  3LH2 S;  5K8P A;  2R2S A;  2I9S A;  3IR7 B;  1FWP A;  3PHE A;  4DU8 A;  2UV8 G;  2V5H G;  4YR0 A;  2V69 A;  1RK8 A;  1YBU A;  1RHJ B;  3ET6 B;  2DEI A;  2AD9 A;  1DTT A;  2QYC A;  4YY3 F;  5CHC B;  1WTB A;  2XO7 A;  2X1B A;  4QPT A;  1CSJ A;  1HR0 F;  4N56 A;  1FES A;  2CQ4 A;  5ETL A;  2BW7 A;  4BHQ A;  3OTC A;  3Q8R B;  4C8Y A;  1N36 J;  3FBF A;  1I1G A;  4DR5 F;  3QT7 A;  3M32 B;  3W8P A;  4RW4 A;  2FVR A;  1S0M A;  2YX4 A;  3L4B C;  3LWM A;  3ZZZ A;  2VG6 B;  5B0E A;  4IKA A;  2OTJ S;  3HP6 A;  3CCJ S;  5JXS A;  4JI7 F;  3I87 A;  1GTH A;  2LQJ A;  1WOS A;  3DRR A;  1Z2Z A;  4YHH F;  2Z58 B;  3HVW A;  3OTB A;  5J1E B;  2F3J A;  3DMJ A;  2FLN A;  4DX8 H;  3M6U A;  4QQB A;  4B08 A;  1R27 B;  1QDU B;  3T3F A;  5FDL A;  5C25 A;  3BGO P;  3KDN A;  5D0R A;  2B8P A;  3GYG A;  4PR6 A;  1L3U A;  4X64 J;  4IG3 A;  3TJA A;  4JV0 A;  1LW0 B;  3I5A A;  2FIU A;  1QUV A;  2QFI A;  3CDW A;  1FJG J;  4NPO A;  2C2R A;  2XYP B;  2LA6 A;  3PG9 A;  3L09 A;  3UN3 A;  2UU9 J;  1MWZ A;  2XMJ A;  3H5Y A;  5SZT A;  2C2D A;  3MWB A;  1S6P A;  3ZNJ 1;  3SCK E;  3QGG A;  3BDE A;  1JWW A;  4J9V A;  2W7A A;  5CAA A;  2W9C B;  2K06 A;  3PTW A;  4RJV A;  2QFJ A;  4TNO A;  3T5H A;  4YFU A;  3W2W B;  5I3Q A;  2IAJ B;  1GXT A;  5AXL A;  4HTI A;  1FRK A;  1IXK A;  4NMX A;  5KOW A;  1WI8 A;  3VAG A;  3M30 A;  4K2X A;  5GME A;  1LW2 A;  1N54 B;  2V4R A;  4IDK A;  2LYV A;  4JI0 J;  4HEA 9;  1KQG B;  2JVR A;  1HWL A;  3U1M A;  1GAO A;  3QIP A;  2W24 A;  2DCL A;  5HMX A;  1X4A A;  3HSJ A;  3FCW A;  2KXH A;  4DR3 F;  3AXK A;  4DL0 C;  3D5M A;  1NDP A;  2XWY A;  2RAQ A;  2QSW A;  4KR0 B;  3LAL A;  4F3Q A;  4HLB A;  4NCA A;  1WG5 A;  2ROE A;  3GFX A;  4IYQ A;  2QRR A;  2YKM A;  2HWT A;  3HT3 A;  5CYM B;  3BRE A;  3AJ2 A;  2YTC A;  1HW9 A;  4RW8 A;  4K5R A;  4QYZ K;  1UL3 A;  1OPZ A;  3CC7 S;  3TAM B;  3PY8 A;  2G1H A;  1M0S A;  5I3U B;  2QYG A;  1GK8 A;  1D8Y A;  3BO2 A;  2HNY A;  4WE1 B;  4NLR A;  3LA0 A;  2CQB A;  1S49 A;  5K14 B;  5BR8 J;  1P1T A;  3G6E S;  3TAQ A;  3Q8S B;  4Y2A A;  3TVZ A;  2MQ8 A;  4YS2 A;  3KLV A;  4M63 A;  2GQC A;  3IBW A;  2XYG B;  3EYZ A;  2Y0B B;  5HLF B;  3R5D A;  1OPI A;  3K7R A;  4KGX B;  1UZD A;  4IH6 A;  4USH A;  3WHI A;  3BKT A;  4X4T A;  4PYA A;  4ATN A;  4L75 A;  2JC0 A;  3W2V A;  3ISZ A;  2IDE A;  2YPZ A;  4CZC A;  3CCQ S;  1EJ7 L;  4J9U E;  3NGR A;  2RKI A;  3RB0 A;  3KJN B;  4K50 A;  1PG5 B;  4ES2 A;  3EVM A;  2VFS A;  2JWN A;  1KWM A;  2AWZ A;  5KFR A;  4DSJ A;  4LFB F;  2KZZ A;  5CD4 A;  4OZ2 A;  3M8Z A;  5D15 A;  2QN6 B;  3MI7 X;  3KNA A;  4GO7 X;  2YKQ A;  3JAM Y;  1JLB A;  1NJZ A;  3U27 A;  3NS6 A;  2FVP A;  4C8M A;  5IFM A;  3D2W A;  2FZG B;  2DH7 A;  2OFG X;  1S1X B;  2M70 A;  3SFU A;  3D7S B;  1J2V A;  5HVF A;  2CJY B;  4RW6 B;  2MQP A;  3IO1 A;  2AP6 A;  3GZ7 A;  1CEZ A;  2FVC A;  4ZLJ A;  2AHO B;  1NPK A;  1KOO A;  3DOK B;  3OFH A;  4OHY A;  1V9O A;  2VQE F;  3IBC B;  4PZV A;  3UDV A;  2R2T A;  4LF7 J;  3OPK A;  1HBU B;  1BQN B;  3RUB L;  4K8R A;  4KH0 B;  1X60 A;  3MMB B;  2P9G A;  4O4R A;  1V6H A;  3WC0 A;  2KG0 A;  5KG3 A;  1BD6 A;  2XZT B;  5MAO A;  4P10 A;  2NUU G;  3DLE A;  1U1O A;  2DGX A;  2VKZ G;  4IUF A;  4DX7 A;  5HMW A;  3MUM P;  3CPW R;  3SSS A;  1U7L A;  2B4U A;  4FZV A;  4EFA C;  3M6V A;  4FPI A;  2QE5 A;  2ROP A;  4HTJ A;  4I6Y A;  3ISN D;  1UEV A;  3QRR A;  4NXM F;  4CO1 A;  4OYW A;  1Y4Z B;  2BJ8 A;  3MOJ B;  3DYA A;  2PEB A;  2QA2 A;  3BR9 A;  3CO0 P;  2ADC A;  2H5E A;  3CSK A;  1TL7 B;  2FC9 A;  5FII A;  1EX8 A;  1S7H A;  3BPS P;  2J0Q D;  1VBX A;  1UMJ A;  5E3P A;  2IC3 B;  4DV7 F;  3CJS A;  3QAU A;  5F0W A;  3MCM A;  2A0F B;  4K4V A;  4DJB A;  3MUT P;  4KHR A;  3NWR A;  3GIL A;  3K5M A;  2EFN A;  2Z2L A;  3VF0 B;  3CD0 A;  3SDE A;  2HND A;  2NLW A;  1U4B A;  1TFY A;  1N5V A;  2ZJR Q;  3CE8 A;  2RRA A;  3ITH B;  4IFY B;  2UUA J;  2B9Y A;  1SQG A;  2BAB A;  3THV A;  1IBM J;  3LPE A;  5D6G A;  1QAX A;  5IV3 A;  1WKJ A;  1PYT A;  2MQM A;  3DHW C;  2BR0 A;  4QIF A;  2DRB A;  1RB0 A;  3F0N A;  4NXN J;  1FK9 A;  4JI6 J;  4XPE A;  1RCO B;  2KYX A;  2P6S A;  2PA3 A;  1GMU A;  3PYE A;  1NDL A;  2BMB A;  4RUC A;  1WSR A;  2EEY A;  3DGP A;  3MD1 A;  2B4V A;  1NM2 A;  4J9N A;  2M88 A;  2R9L A;  2EFP A;  2HHW A;  5AJ3 F;  4ZVS B;  2E1R A;  4P7T A;  2XZW A;  3MAQ A;  2BE2 A;  4AL7 A;  1SC1 B;  1C0U A;  1XWL A;  2F8H A;  5DDO C;  4YY3 J;  2W2M P;  5EWG A;  1GFW B;  2BJ3 A;  2PN6 A;  1HR0 J;  1RAI B;  5HMY A;  3A8J A;  3KDO A;  1JJ2 R;  1NJY A;  1V3R A;  3M1V B;  4ZIW A;  2HQF A;  3GP9 A;  4DR5 J;  2AJ0 A;  2HEK A;  4A8K A;  4KBI A;  3HX9 A;  2F9J A;  4F4W A;  2QLF B;  4CYU A;  4KFB B;  3Q24 A;  3MMA B;  4C3L A;  3QGH A;  3KLF A;  4EO8 A;  4PAA A;  5CAB A;  3D0I E;  4JI7 J;  1XQI A;  4K4U A;  2DD8 S;  4URQ U;  4DLG A;  2CQ3 A;  2OPR A;  2WCX A;  1EP4 A;  4UUX A;  2Y1I A;  1S7I A;  4DSK A;  1NDK A;  1UPP A;  2OPP A;  2BVZ A;  2BJD A;  3PKM A;  3KG4 A;  4UOC A;  1H7X A;  3RAM A;  3DLL Q;  1FF2 A;  1FER A;  1RAD B;  3FZB A;  3Q8P B;  3E2E A;  3G2X A;  4NZ0 A;  3SIP B;  2DPI A;  1DJ0 A;  1NRK A;  1OY9 A;  1OSC A;  1IBC B;  1LKZ A;  4WP9 A;  3ZZP A;  2HYI B;  5U47 A;  4LFA F;  4KC5 A;  1RWV B;  3PCO B;  1IN0 A;  3KWM A;  3O8W A;  1C1B A;  1R8C A;  5EN1 A;  2ZUA A;  3JQK A;  3K59 A;  2EC0 A;  2B8Q A;  5A2Q Y;  1WEY A;  5J2M B;  3FFI B;  3UVJ A;  3MFI A;  5D4P A;  4LR9 A;  2DB1 A;  1RAB B;  1EKS A;  4C6A A;  2CZ4 A;  2PFD A;  3IG1 B;  5A8W A;  4N76 A;  1OS5 A;  2ZC3 A;  3D67 A;  4WFN Q;  3EX7 B;  4ZJL A;  2EFG A;  3TRG A;  5LMU J;  2HIY A;  4P6Q A;  4LQ3 A;  4ECU A;  3I31 A;  2ZWP A;  1MN7 A;  2XMM A;  4ZLP A;  2VON A;  2HQG A;  3R97 A;  1TK0 A;  5B08 A;  4CTA A;  4J9S A;  3H2U B;  3O2I A;  4TY8 B;  4U96 A;  4GKJ F;  2KJW A;  3NS5 A;  3QRP A;  2MKC A;  4ZDN A;  3KUG A;  4ED0 A;  3DFE A;  1HA1 A;  2KN4 A;  5DJB A;  3CCT A;  3NS7 B;  2V9W A;  2J0X A;  3HVT A;  1YQH A;  2GMH A;  5T7L B;  4M5D A;  3R7S B;  3QAT A;  3QBC A;  1BE4 A;  3IS9 B;  1CS4 A;  1VQM S;  2D1C A;  3N6L A;  1B0T A;  1XTZ A;  4B3M F;  2EXU A;  3LP2 B;  1Q8B A;  4JP8 A;  1WNE A;  2R4F A;  2J76 E;  3I9Z A;  4YUD A;  2BW2 A;  3HHD A;  2CG8 A;  2ZBI A;  3NBP B;  8ATC B;  4HI1 A;  9ATC B;  3ETO A;  4F7V A;  4HR2 A;  3CC4 S;  3RB3 A;  3KHL A;  1JQG A;  2ZUG A;  5HL7 Q;  3W9I A;  1HHT P;  1F9F A;  1YLX A;  1RKI A;  4EK2 A;  4CLP A;  1DTQ B;  4WTY A;  4PKD B;  4KSE B;  1K47 A;  1VQY A;  3PEJ A;  1K0V A;  2FHK A;  3D1H A;  1VIO A;  1LWF B;  2B3T B;  4C48 A;  2W2N P;  4DX6 A;  5DLG A;  2R8K A;  3OBI A;  4LVO P;  3PNI A;  4B9N A;  4UW2 A;  3BSA A;  8RUC A;  3E01 A;  4FS2 A;  4RPF A;  5DGB A;  1U8W A;  3V6H A;  1Q5V A;  1VRT A;  4HYK A;  2QIF A;  2MGZ A;  3G8S A;  2CJ9 A;  4YDD B;  1TFW A;  3GG0 A;  2HMI B;  4LFB J;  1X0F A;  3QJL A;  4HHJ A;  1YZ7 A;  2EG2 A;  3ZZU A;  7FD1 A;  2MB0 B;  4U8Y A;  2KFN A;  3QQC D;  1RT6 B;  1N34 F;  4B9T A;  2E7V A;  1UWB B;  3W9H A;  4C3M A;  4ETZ A;  3G82 B;  1C1C B;  4LIR A;  4ZVT B;  3FRZ A;  3G6V A;  1SJQ A;  2FPH X;  3TP2 A;  4CDI A;  2JFD A;  4USW A;  1F0X A;  1JNZ B;  1KC8 T;  1GEH A;  4M8L A;  2MQN A;  2KT5 A;  3M2V B;  3OW2 R;  2W2P P;  5T41 A;  2LDI A;  3TUP A;  1CC7 A;  4R5P A;  5JVG Q;  2XLK A;  1JNR B;  2YY3 A;  3X1L B;  3T9N A;  4EZ6 A;  2W7O A;  1TMM A;  1JLC B;  2FC8 A;  2K3I A;  2VQE J;  2UUW A;  4NEZ A;  1TL5 A;  3UW1 A;  5A8R B;  4DDF A;  4DG1 A;  1MWY A;  2XGP A;  1UVJ A;  4MAK A;  1DBD A;  5LJ3 Y;  4QYR A;  1WDD A;  4CO2 A;  2D41 A;  1RAC B;  3DRX A;  2I6W A;  4RW7 B;  3OUY A;  1IKX B;  4TU7 A;  4EU0 A;  3VR1 A;  4O23 A;  4NZ6 A;  5HAT A;  4PUO A;  1BQX A;  3ENW A;  3D66 A;  3LP0 B;  3KLE B;  1U24 A;  1WOO A;  4NXM J;  5B0D A;  4OYM A;  4BWM A;  4N8O A;  1KQS R;  1R31 A;  4PPD A;  2XM3 A;  5HRO A;  1X4C A;  1NXI A;  1D9D A;  2HBR B;  2Y1L B;  3N9U C;  3EGW B;  2RH3 A;  2EVZ A;  2G9O A;  4YEA A;  2IA6 A;  4OYX A;  2OD4 A;  1VMB A;  1JKH A;  4ZLN A;  2HHP A;  2M7S A;  2VG5 A;  1H2T Z;  2CPD A;  4PQU B;  4Y0F A;  5LMN F;  4U8V A;  2IM2 A;  4FBT A;  3MM7 A;  4P9S A;  3CJT A;  3H25 A;  1WHW A;  2XB2 D;  1BLU A;  4ZP8 A;  1KLM B;  5IT4 A;  2FJA B;  2IBK A;  4OIX A;  3TWZ A;  3EPG A;  2HZC A;  2OGU A;  1HAR A;  2DBB A;  3MED A;  2QMW A;  1U47 A;  1NHK L;  2PD1 A;  4TU9 A;  4EZ9 A;  3CCM S;  4DSI A;  2E5L F;  3FSI A;  2JDJ A;  1S1U B;  1RT7 A;  1LXN A;  2VD3 A;  3N5F A;  2ZOM A;  2AYG A;  3FVY A;  4URS A;  5AJ3 J;  1XMO F;  1YI2 S;  1SJ4 P;  2GIQ A;  3MM9 A;  3W64 A;  3VVU A;  5J1N A;  1HPZ A;  5KG4 A;  2OTL S;  4WP8 A;  1DUR A;  4M5I A;  2B6A B;  2MKK A;  1NZ8 A;  1AB8 A;  1P8G A;  3CIZ A;  3MUV P;  2YWK A;  1HNV A;  1SV5 A;  2V8P A;  1AFJ A;  3MEG A;  3D0H E;  4MH8 A;  2ASY A;  2IMO A;  1UVI A;  5KFO A;  4DF8 A;  3HHE A;  5KAK A;  2PC6 A;  4KJI A;  3K89 A;  2NXU A;  5GVQ A;  4O3N A;  3BGF A;  2WOM A;  2DGV A;  2DGQ A;  1SC3 B;  3MM5 B;  3LGN A;  2QTW A;  5HJX A;  4IOA Q;  2F65 A;  3RU0 A;  1JIH A;  2RU9 A;  2ZH9 A;  1TUV A;  4K0K F;  3GIJ A;  2QLX A;  1S48 A;  1IR0 A;  4N41 A;  3H2V E;  3CJK A;  2XY7 A;  3P6Y C;  4U9R A;  3SBM A;  4NLX A;  4ZP6 A;  4X66 F;  5LM7 E;  4WU3 A;  2ZZN A;  4ZVR B;  1ZM2 A;  5L1J A;  1O8B A;  2QA1 A;  2NS1 B;  4ZCI A;  2YXL A;  4UQT A;  1FFW B;  2W4P A;  1KD1 T;  5GAH I;  1T9T A;  1SXL A;  3Q2S C;  4CCH A;  2C2N A;  1DTT B;  4USJ C;  4LFA J;  5KFF A;  2MHE A;  4DR6 F;  1NZA A;  3TA2 A;  2MSS A;  3VGV A;  5A8K A;  1EAR A;  2X1G A;  1Q7L B;  2ZM6 F;  3OQ2 A;  2MKY A;  1M5H A;  2KB2 A;  3AB2 B;  4QIG A;  3VGT A;  4QWD A;  4DL3 A;  3UN2 A;  3MEK A;  4RW4 B;  2Q3P A;  4Q8F A;  1O0P A;  2HNZ B;  3DOM A;  1MRO A;  4WPA A;  3HD2 A;  5K9F A;  3W9J A;  5LJ5 Y;  3DRR B;  4WCE Q;  4EBC A;  4WYW A;  4XDD A;  2HGN A;  4DR1 J;  4DL2 A;  1OY6 A;  2DNQ A;  3AJ1 A;  4JI8 J;  3PV8 A;  4KKO A;  3DMJ B;  2FJV A;  2F8E X;  2KHC A;  4F2S A;  4QJV A;  4OI2 A;  5FDL B;  2GVZ A;  2IRU A;  4RU9 A;  4I7F A;  3S01 A;  2KHD A;  2E44 A;  1S4E A;  4GKJ J;  1U02 A;  1BQM A;  2LU1 A;  1T11 A;  3O1L A;  4UOH A;  4DUT A;  1J5E F;  4IG3 B;  3RRH A;  3O6Q A;  3CJ8 A;  4U7C A;  4YR3 A;  2AZ3 A;  5T14 A;  1VK3 A;  1TL4 A;  4EEY A;  3C46 A;  4JBC A;  2Z2M A;  2R8I A;  5B0C A;  5EUH A;  2KO1 A;  1R43 A;  3M6W A;  3OVA A;  4YQW A;  4ED4 A;  3LUY A;  1XNR F;  3ENQ A;  4S0M A;  1S6P B;  1UZH A;  4B3M J;  3C2P A;  4V19 J;  3GIM A;  3HXM A;  2QV6 A;  3M9O B;  2QLW A;  5KFP A;  1ZPV A;  1B70 B;  1RHR B;  1A6L A;  5F8H A;  2PMZ D;  5ETV A;  2L48 A;  1YSJ A;  4AYB D;  3L95 X;  1KLN A;  1WEX A;  2CQI A;  1AUD A;  3E3X A;  4LT6 A;  4ECR A;  1EHW A;  1FKP A;  1W2I A;  3K5O A;  3ILL A;  4O0I A;  5G0R A;  2POK A;  3QIP B;  5H9F J;  3HFV A;  3M4X A;  5ETQ A;  1FTC A;  5AE3 A;  2XGQ A;  4DMZ A;  3M8S A;  3D54 A;  3VAL A;  2MJU A;  3CJQ A;  1S59 A;  3BH7 B;  4WTO B;  3TAN A;  3Q83 A;  2VUG A;  2MY7 A;  2GIF A;  3OXG A;  5DO2 A;  5CCM A;  2KT3 A;  4B9S A;  3TQ1 A;  2WHO A;  4F26 A;  4RW8 B;  4KV8 B;  3NLC A;  5DRK A;  1YJ7 A;  1UJ5 A;  4N7T A;  1TUG B;  5KT6 A;  1GXL A;  5THW A;  4ZJQ A;  2ZH6 A;  2ZHO A;  4BCA A;  1URN A;  2X3G A;  3TX8 A;  1SIW B;  1C4C A;  1NSP A;  3PW7 A;  1JLF B;  1UW9 A;  1N34 J;  3D6H B;  2RVJ A;  2NXJ A;  1NK8 A;  4I68 A;  2PI5 A;  5C2G A;  2MEW A;  2UZA A;  1PAU B;  2KXN B;  5JJB A;  2OPQ A;  1F2H A;  2W4C A;  4G65 A;  1XN9 A;  2F9D A;  1IQZ A;  1Q82 T;  1M5S A;  1SVD A;  3P5B P;  3LW5 C;  1SH2 A;  2UVR A;  4H4M A;  3NEK A;  3HI9 A;  3N28 A;  2CYY A;  2VB6 A;  1VLO A;  4DLE A;  2N7Y A;  2RQM A;  2ZOG A;  3C3L A;  3BV8 A;  1YJN S;  2GAG C;  4L73 A;  4K4X A;  4OHZ A;  2A3J A;  2GQ2 A;  2CDR B;  1U1R A;  1NPR A;  2CVI A;  3W2V B;  4I2P B;  2KL8 A;  1RLD A;  3HPO A;  1OYD A;  6FD1 A;  5E2Q A;  2E1M C;  2BRK A;  4ZVU B;  2CQC A;  2RKI B;  4C0O C;  5L1L A;  4LRB A;  2OFH X;  3GCW P;  4UOG A;  1N88 A;  1TL1 A;  2V2Z A;  3KJF B;  1PO6 A;  2ZWO A;  4A8Y A;  2HS4 A;  4LF5 F;  4BS2 A;  1VQ4 S;  3MAA A;  1RDR A;  4ZP7 A;  2Q6C A;  3KXD A;  2BXJ A;  1YJ9 S;  4XIU A;  1PIE A;  1NK4 A;  2GGP A;  3OLB A;  4MKB A;  4QZV B;  3POT A;  2HS0 A;  3CED A;  3N4W A;  5F0U A;  5KFA A;  5DZ7 A;  3DU5 A;  1FXL A;  5LSL A;  4F50 A;  3KK1 A;  3M9N B;  1T95 A;  3H5X A;  5IT0 A;  1X4D A;  1VQO S;  1YZ6 A;  4IFV A;  3UCG A;  1S6Q B;  5KFW A;  3AQP A;  2UUB F;  3W5Z A;  2VFR A;  3BPD A;  2IM0 A;  1UTA A;  2A6O A;  3QWP A;  1U6B A;  1BWV A;  5LT5 A;  1KVI A;  5LMN J;  4Y3C A;  3DLG B;  3C15 A;  3WDO A;  3Q8U A;  4L76 A;  5EX3 A;  1Z1Z A;  4DPW A;  1SH3 A;  1T9U A;  3DLE B;  2F1F A;  1S79 A;  1JXL A;  1P27 B;  4MIW A;  1T05 B;  1G7C B;  3J7A N;  4LQ9 A;  1LFW A;  3TUJ C;  4PWU A;  4OLP A;  3KMQ A;  2E5L J;  1RU1 A;  5LXY A;  5C24 A;  3CCS S;  1APS A;  1IM4 A;  2PMW A;  2WSC C;  2ZH3 A;  4OX7 A;  4DBQ A;  4QR1 A;  1KBR A;  1ZA2 B;  3DYA B;  3R6L B;  3ILI A;  3W5Y A;  3IA0 A;  3MMJ A;  2WON A;  2VC0 A;  3MHY A;  2HQI A;  3BN7 A;  3GR0 A;  3N6N A;  2O01 C;  3H90 A;  5GAH U;  1S0O A;  1F60 B;  4G1I A;  2FLL A;  2MLZ A;  4H4K A;  4J5O A;  4C8O A;  4WXW A;  5HSP A;  2F40 A;  4ILR A;  1QY7 A;  1SCJ B;  1VR6 A;  4TLQ A;  3SDE B;  3NNH A;  2HND B;  4YB5 A;  2F4F A;  3I5C A;  2FY8 A;  4I0W A;  1T7P A;  1TKT B;  4F25 A;  4KGZ B;  1UVM A;  4YR2 A;  3CTR A;  4FVC A;  2E7X A;  3SV4 A;  2R7U A;  2EK1 A;  5J2P A;  1H7W A;  4DV4 F;  2PEH A;  4RUA A;  2VIC A;  4N5S A;  1MW7 A;  2VA3 A;  1S9E B;  4DPO A;  1S76 D;  4O3O A;  4K0K J;  4BLG A;  2HHV A;  1ZA1 B;  4Q45 A;  5F41 A;  4ZN1 A;  2H54 B;  4DOZ A;  2N3O A;  2COL A;  3B6B A;  2JJ4 D;  2EFV A;  2YKA A;  3JB9 k;  2M8H A;  1HIY A;  2CJB A;  3G8T A;  3DGP B;  1IWG A;  2IIH A;  3EVW A;  1J5O A;  1FJ7 A;  5LSO A;  1Y9O A;  4X66 J;  2DNY A;  3IBF B;  1IKV A;  5KT4 A;  3HHL C;  2IJN A;  1KP6 A;  4OJH A;  2AEJ A;  2KU7 A;  2MLY A;  3ONQ A;  1LWE A;  2FZK B;  2CVE A;  1TVR A;  1CBK A;  4DR6 J;  3O44 A;  3OTD A;  2YVS A;  1O5J A;  1CJU A;  3J7Y I;  4KGM A;  2FGC A;  1JLA A;  1N5T A;  4QWC A;  4OI6 A;  2PFF B;  2XHC A;  4A8M P;  3DCA A;  4BWJ A;  2YWF A;  1D09 B;  2YNF A;  2NR0 A;  2ILY A;  3FZ2 A;  2DR9 A;  3GSD A;  2WAQ D;  3KLF B;  2JVO A;  4B3O B;  2H51 B;  3B4D A;  3KG1 A;  3U1L A;  1KHW A;  1SBR A;  2IBO A;  1F5A A;  2OPR B;  2HKE A;  2JLF A;  2OPP B;  4DQR A;  1Q79 A;  3DXB A;  4K4W A;  3RB4 A;  2H4W B;  2WSF C;  2GVD A;  3CXC R;  2R2R A;  2K7K A;  1FEH A;  4OJ3 A;  4OLO A;  3LO3 A;  1EET A;  2MJN A;  2JEI A;  3JTN A;  2HG4 A;  4RUH A;  4KY3 A;  2V8H A;  4FDF A;  5KT5 A;  3BN4 A;  3LQV A;  4C0H A;  1FVQ A;  3U7J A;  4B9V A;  2JEF A;  3LOU A;  3MXH P;  1I51 B;  2ZHA A;  1RHK B;  3DLB A;  1RWX B;  2XY5 A;  1GMW D;  2E1A A;  2GJI A;  2ERR A;  1MLA A;  2V2Q A;  2UUT A;  3I32 A;  3R1L A;  3VQS A;  1XNR J;  2JEG A;  2GJ2 A;  3CW2 C;  4ZJO A;  3UVJ B;  1FRJ A;  4ZPW R;  3AD8 C;  3QGP A;  4J9K A;  1RAA B;  5A8W B;  3R5C A;  2GAH C;  1E6V B;  3JS9 A;  1YVF A;  4KH1 B;  3EGV A;  1ZM3 A;  2HQC A;  1RIS A;  1FRL A;  2C3O A;  3UQS A;  2FD2 A;  2XCA A;  3AD9 C;  2E9T A;  3OTO F;  2H4Y B;  2VBW A;  4CTA B;  4ECQ A;  1BY9 A;  3CC2 S;  2UXC F;  4DV5 F;  2HAF A;  4TY9 A;  3GG1 A;  5K8O A;  3US5 A;  4ZCL A;  3QO9 B;  5IZH A;  4H4K C;  1BC6 A;  5CYQ A;  5KG7 A;  1JLE A;  2AV5 A;  2GC8 A;  4GRS A;  4NAS A;  1WTF A;  4NML A;  2JZ5 A;  4YN3 B;  2M8D B;  2M4M A;  4FF3 A;  4ZPV R;  3HVT B;  2FLP A;  2HBQ B;  1FJE B;  4M5D B;  5D0G A;  3L7U A;  2JOQ A;  1HD0 A;  1CS4 B;  2ZZM A;  2LA4 A;  2DO4 A;  2CJA A;  5DM6 Q;  1MU2 A;  2DNK A;  3UO0 A;  5K8N A;  1RBL A;  1TQL A;  2XYH B;  1MN9 A;  2PSZ A;  2VQF F;  2O5D A;  3CUN A;  2YNG B;  3CJR A;  3R7B B;  2WW8 A;  1UFL A;  3C66 A;  4MK8 A;  2ZJQ Q;  4PWD A;  2HWH A;  5LOQ A;  4ES1 A;  1OQ6 A;  2BX6 A;  3MD3 A;  3QFW A;  2CQD A;  3T5K A;  1O6X A;  5HAO A;  1GX5 A;  3JYT A;  4ITS A;  4IOB A;  3N79 A;  4WZQ A;  2Z57 B;  3A12 A;  4JI5 J;  5IT9 U;  2IRY A;  4AL6 A;  3BM7 A;  2W7P A;  1ULR A;  2C42 A;  3Q0A A;  1DQA A;  1RCX B;  3ILO A;  3QZ7 A;  3K5N A;  1RT4 A;  2QA4 S;  2U2F A;  1KEK A;  3ENA A;  4ZVO B;  4E98 A;  3SV3 A;  1RXO B;  4X4P A;  3QYY A;  2K7J A;  4WK1 A;  4R25 A;  3E01 B;  1S5Z A;  4I6W A;  2HPU A;  4MMO A;  4J9P A;  4FKY A;  2YKO A;  2PA8 D;  4WF9 Q;  1VRT B;  3I82 A;  3GFZ A;  2MGZ B;  1JXE A;  2B4O A;  7FDR A;  4Z37 A;  2AYM A;  3CMA S;  3J7Z T;  3V4I A;  1VCT A;  2V4Q A;  2PMH A;  2KJV A;  2GV1 A;  4P73 A;  2R7Q A;  1KOH A;  1RTI A;  5E3R A;  3KMS A;  2GW8 A;  2H5I B;  5KFK A;  2CPY A;  4MFB A;  1T94 A;  1ZTW A;  1TL3 A;  4A8O A;  5KG1 A;  4K4Y A;  1S1V A;  2LEC A;  4JYA F;  1WD6 A;  1WKL A;  3OJU A;  4FP9 A;  3PW2 A;  1S6U A;  4E0D A;  3ILJ A;  2HHT A;  1RT2 A;  4NI2 A;  4OHV A;  4MKY A;  3SQG A;  2HVZ A;  2ACY A;  3CWJ A;  1RWK B;  4J91 A;  3X3U A;  4QR0 A;  2UP1 A;  4R5P B;  2M3D A;  3DM2 A;  1VOM A;  2RE1 A;  2NZ4 A;  1NJX A;  2IJR A;  4URG A;  4ZN3 A;  3UPF A;  5F3T A;  2UUB J;  4DU7 A;  3NGK A;  1VRQ C;  2DRA A;  1NLK L;  5CYJ A;  3QLH A;  2A2C A;  4DV0 F;  2RRB A;  1VQ9 S;  1YRT A;  2CKW A;  4MKA A;  1WUU A;  2XS2 A;  1FFG B;  2YQ0 A;  1NKC A;  1N0U A;  3TZX A;  2RT3 A;  3T1A A;  1HNX F;  4JI3 J;  3CJ0 A;  3WQP A;  4DFM A;  2QSF A;  4HT5 A;  3AXM A;  2JSX A;  3OUY B;  1G1X A;  2AZ1 A;  3TUI C;  2ZE2 A;  2KRR A;  4PUO B;  3AH6 A;  2PDA A;  1RWO B;  4NL5 A;  2V34 A;  2DNR A;  4X4O A;  3DNC A;  3F73 A;  4TN2 A;  2OEJ A;  2OSR A;  4OX8 A;  3EZO A;  1VJQ A;  4AXI A;  5IOL A;  3W8G A;  3TO8 A;  4R8U B;  5HRO B;  4A46 A;  1N4L A;  1DAX A;  2NPF A;  4J90 A;  1IVZ A;  1OO0 B;  3GMG A;  1TK8 A;  2YH1 A;  3MCS A;  2HQD A;  4C9D A;  4ANC A;  1R6V A;  1LNQ A;  2QLB B;  4I2Q A;  2VG5 B;  2BA9 A;  4OYZ A;  3TEH B;  3HZE A;  1UW4 A;  1VDH A;  3CJ3 A;  2Y1R I;  3J7Y U;  1L3S A;  1FX2 A;  4KAI A;  2ZFH A;  2ZEJ A;  3TAP A;  3LPY A;  4F02 A;  4OHW A;  2B9E A;  3I0R B;  1TP7 A;  4DV4 J;  4USU A;  4UF4 A;  2VPW B;  3AAW B;  3PM9 A;  4OI0 A;  4ECW A;  1RUS A;  4EI2 A;  2A10 A;  3MED B;  4Y6I A;  1U8S A;  3C14 A;  1RT7 B;  5D0H A;  2I5J A;  5IC4 B;  2EG1 A;  2ASJ A;  4LF9 F;  4W98 A;  1T0T V;  1AZS A;  1U1Q A;  1ZAX A;  1TTH B;  3MM9 B;  1VFJ A;  1G4C A;  1HPZ B;  2AMC B;  2QL7 B;  1T9W A;  2CPX A;  3AD7 C;  1XJW B;  1FKA F;  1AXQ A;  1MSW D;  2XMT A;  1X5T A;  1C2P A;  4M5G A;  4OYB A;  1SV5 B;  1KVJ A;  3VZI A;  5LXR A;  1H38 A;  1SH0 A;  3MEG B;  1U0H A;  4NLT A;  4FYY B;  3BDP A;  3UD4 P;  2WVC A;  3W63 A;  1TZ0 A;  1NH7 A;  2WOM B;  2OUG A;  2BOP A;  4ALZ A;  2E5I A;  4H4O A;  5D3G B;  2WVB A;  3GJT B;  3CJK B;  3DU6 A;  4CT8 A;  2CPE A;  2D3U A;  3TOQ A;  1SL2 A;  3PHT A;  4CLS A;  4J9O A;  2I0X A;  4AXJ A;  2VDI A;  4NE9 C;  1Q0N A;  2DIV A;  4DN9 A;  3K8V A;  4M1K A;  3CGI A;  1RTJ A;  3T5J A;  2WBR A;  2V63 A;  3M32 A;  4FXD A;  1T03 A;  1ELO A;  1ZS6 A;  3AOD A;  1AT1 B;  4QWA A;  2VKR A;  3OJS A;  1FNX H;  4KGK A;  3P8B B;  1NAQ A;  5DM7 Q;  1M5O C;  4JV2 A;  4Y2I A;  4NRT A;  3IFE A;  2CIM A;  4MT1 A;  3T1H F;  5A8K B;  2CQP A;  2AW0 A;  1FI4 A;  4TVA B;  4DCJ B;  4B3R F;  2HFV A;  5L1K A;  2HHQ A;  2DYA A;  1TKD A;  1HWK A;  1XR6 A;  3DOM B;  1MRO B;  1RAJ A;  1N8R T;  2IDL A;  4ECX A;  3W3S A;  3EJM A;  1LW0 A;  5ETT A;  1GMV A;  4UZB A;  1Y3J A;  2VL1 A;  4A8S A;  5L39 A;  2E9R X;  1ZM9 A;  1BMQ B;  2RIJ A;  2Y1J A;  1J27 A;  2RML A;  4DX5 A;  1U25 A;  4X4Q A;  4KKO B;  3J80 Y;  1YGY A;  3OTO J;  1YRX A;  3PW5 A;  2VBZ A;  1OWX A;  2GVZ B;  1FRM A;  4I7F B;  2UXC J;  4V1A k;  4DV5 J;  1L3T A;  2IRX A;  5I42 B;  1GQE A;  2CZV C;  1BQM B;  4P7V A;  4OI4 A;  1HNZ J;  1XNQ F;  3AY0 A;  4G3I A;  3MR3 A;  3LTO A;  4I1T A;  5HO4 A;  1DRZ A;  2PO4 A;  1U48 A;  1M5V C;  5C5J A;  3MGJ A;  2MKI A;  3ZTS A;  3ZZR A;  2G2Y A;  4J9L A;  1RKJ A;  3J7A 1;  5I4M A;  3BYR A;  4ID8 A;  1H3D A;  5HVG A;  2FJW A;  2CDQ A;  3ZZT A;  1Q8K A;  2VQF J;  1HBN A;  3TVY A;  2MMY A;  4NCG A;  3M2U A;  1NME B;  2XG8 A;  1OQ3 A;  4QPX A;  2VJV A;  1Q5Y A;  5ETS A;  1FKO A;  5FLX Y;  3TJ9 A;  2BAN A;  4YME A;  3RRK A;  3OL6 A;  1VHF A;  2EKY A;  1CJV A;  1UFK A;  4XK8 C;  2XMW A;  3LP1 A;  3HLU A;  2UXB F;  4NRU A;  1F2G A;  1FKP B;  2DNN A;  1CUL B;  5G0R B;  4JOU A;  4DF4 A;  3P49 B;  2XS7 A;  4ZVF A;  3TAM A;  1FWL A;  3OTE A;  2ADB A;  2ZKU A;  2IM3 A;  2N4C A;  1VBY A;  2LU2 A;  3MEC B;  1IKW B;  5A6P A;  4WE1 A;  2J9D E;  2OEL A;  3W1Y C;  4XDC A;  5H9E K;  3KLI A;  1WDT A;  4Y2K A;  2HHX A;  3JXO A;  6AT1 B;  2OO4 A;  3K0J A;  3M7V A;  4XO0 A;  3EM1 A;  5ETP A;  1RP5 A;  4HH0 A;  1RZM A;  4LMZ A;  2BUN A;  3KLG A;  1SKW A;  3Q8Q B;  1WI6 A;  3JAM U;  3CCR S;  4USI A;  2HS3 A;  3T6J A;  4DZD A;  1JJC B;  1RT1 A;  3GFY A;  3ZZO A;  2H65 B;  2E5J A;  4Y28 C;  3G71 S;  2IA0 A;  4NLU A;  2DGT A;  2P8I A;  1TAU A;  4F3O A;  2D3Z A;  3FK4 A;  4YP3 A;  4ZVH A;  1NUE A;  2ZDO A;  1Q95 G;  1S1W B;  2P9E A;  2OPQ B;  4HDG A;  2GML A;  1AA1 B;  4NX9 A;  4ZPC A;  3CD7 A;  3FGV A;  3HKW A;  2VH7 A;  4H4M B;  2DGS A;  4DZ6 A;  1P9Y A;  4FVM A;  3M9M B;  5HMZ A;  1D1U A;  1AYE A;  2KFZ A;  1WEZ A;  1PC4 A;  4JV5 F;  1VLY A;  3C16 A;  2AU0 A;  1WC5 A;  1BGX T;  1W25 A;  4DV0 J;  5ETO A;  4QBU A;  2J8A A;  2X1F A;  4DV6 F;  3CD5 A;  4Y00 A;  2U1A A;  2W01 A;  4RZR A;  1MG7 A;  1TL1 B;  3J81 Y;  1FRH A;  1HNX J;  3K58 A;  2I2Y A;  4ELV A;  3MAA B;  2ZBC A;  4OFZ A;  2EPI A;  1Y11 A;  5B0G A;  2BJ9 A;  3W61 A;  1R0B G;  2YH0 A;  1FEE A;  1FTR A;  5BYR A;  4LRC A;  3QSI A;  1ROF A;  2GGP B;  3AFG A;  2Y8Y A;  1VQ8 S;  3POT B;  5KFM A;  3IRX A;  1IQT A;  4LF4 J;  1IM6 A;  2J7K A;  1QSL A;  4NA2 A;  3A3N B;  3ZO7 A;  1UPM B;  4ANE A;  5HN0 A;  4U95 A;  4IFV B;  1RAF B;  2JLG A;  4E8U A;  1NK6 A;  2P5V A;  5DG8 A;  3BEG B;  2YNH A;  1HQU B;  2J6S A;  1YRU A;  1JLG B;  4L3K A;  4LSZ B;  4ERD A;  2G0C A;  4DV1 F;  4EGL A;  2E66 A;  5ADZ A;  2X51 A;  4KHM A;  1U2F A;  3PR4 A;  2J0S D;  3C6T A;  1NSQ A;  1I5O B;  2V50 A;  2DHS A;  4Z2X A;  2YWE A;  2XUL A;  3RAQ A;  1BWE A;  3KUH A;  3PO5 A;  1DAR A;  2HAI A;  2BKO A;  1B7Y B;  3MM8 A;  1HBM A;  2ZIT A;  5C24 B;  4TYB A;  2VA2 A;  4LF9 J;  3HDS A;  3HMJ G;  5HK4 A;  4AE5 A;  3VAK A;  3ITH A;  2WON B;  4OI1 A;  2LFV A;  3TEG A;  2CPI A;  4IQM A;  4ELU A;  2YNI A;  2DNO A;  2EW9 A;  1Q1K A;  4PPZ A;  4FPR A;  4KO0 A;  3ETM A;  5KTQ A;  4HAC A;  3IGN A;  3DDK A;  3AOA A;  3CT9 A;  5AXM A;  1F3F A;  2XZD B;  2CUY A;  1YX2 A;  3PZP A;  3MOZ A;  1AW0 A;  2WVF A;  5AE1 A;  2HRT A;  3BGR B;  2RSQ A;  1N48 A;  5C7P A;  3V2U C;  5J2N B;  3AOC A;  5J2P B;  2KTQ A;  4N47 A;  1ICE B;  5J2Q A;  1CVJ A;  3HVA A;  4K7Q A;  1CPZ A;  1HQE A;  2J8S A;  2P2C B;  2KT2 A;  3JSY A;  1P9Q C;  1S9G B;  4LUB A;  3D6M B;  2L9D A;  1LWC B;  1ZAW A;  2FTR A;  2W1B A;  2R8H A;  4Q7A A;  2VZ9 A;  1J5O B;  4YDX A;  4V19 X;  4OZ3 A;  4DQP A;  1K8A T;  4CH1 A;  4F4Z A;  2D69 A;  1ZOT A;  2ZDP A;  3CCW A;  1UEK A;  4FNI A;  4PAB A;  1LWE B;  1WC1 A;  1TVR B;  4OYP A;  3TVK A;  2XO6 A;  3BB5 A;  1CJU B;  5F8L A;  3T1H J;  5A2Q U;  2K1R A;  2WRM A;  3R9L A;  1HWI A;  4B3R J;  2OP5 A;  5DGA A;  2DXD A;  2FUG 9;  2YNF B;  5DDQ C;  2XMK A;  3DHX A;  3SYZ A;  2E1P A;  3MPY A;  2OMO A;  3DI6 A;  5HI7 A;  4O44 B;  3WX8 A;  2DH8 A;  2RF2 B;  3NAH A;  2NSB A;  2MZQ A;  1RHU B;  1FNM A;  3V5R A;  3UI3 A;  2F63 A;  5IM0 B;  2DPJ A;  2WB4 A;  3HJF A;  5D4L A;  1B4S A;  1EET B;  2BDP A;  2FJB B;  2H5J B;  1ACM B;  3T6B A;  1RTZ A;  1M90 T;  3J7Z 5;  3IG1 A;  4KPY A;  2V9K A;  4LF1 A;  3TZZ A;  2Z0G A;  4IR9 A;  2IPO B;  1SKU B;  4CM2 A;  1R8A A;  1X4H A;  3F41 A;  5CA5 A;  2YPY A;  3MUR P;  2XQC A;  1WG4 A;  1GNK A;  3P4U B;  4KT0 C;  1K44 A;  1U2R A;  4N77 A;  3GU0 A;  4NYP A;  3QT6 A;  4NOH A;  2KVQ E;  3GFH A;  3CD6 S;  1JXV A;  3UR0 A;  1N33 F;  2KG1 A;  1G2E A;  1F1B B;  4DL4 A;  5C2C A;  1PJ5 A;  2RQC A;  2CQH A;  1YBA A;  4LSL A;  3IN5 A;  2XEX A;  2XCP A;  2C3Y A;  3L7O A;  1NJW A;  4LBH A;  2UU9 F;  2EBG A;  4C11 B;  3PXG a;  5BYS A;  3EZ5 A;  5L9X A;  3VAF A;  3K5L A;  1I3O B;  1C0T A;  3ZTO A;  4PWW A;  3LP2 A;  2UXB J;  2XSJ A;  1M5P C;  4WP3 A;  3QJP A;  5CYQ B;  1JLE B;  1HKA A;  5L38 A;  5KFH A;  4F36 A;  4JI4 F;  2F4V F;  1SJ3 P;  4ICL A;  4NLY A;  1B0V A;  2E5H A;  1N5Y A;  4ZIV A;  4NA3 A;  7AT1 B;  1HWJ A;  4CNY A;  2AYE A;  4LRF A;  4YHH J;  3ZXW A;  1NHV A;  4G6V B;  2O67 A;  1MU2 B;  2DNZ A;  1LK7 A;  3HHK A;  1RI7 A;  4B9U A;  1DTQ A;  3KNG A;  1U1M A;  1OIA A;  1Q81 T;  1LWF A;  1EB0 A;  1SI9 A;  2MZJ A;  4U67 Q;  3K57 A;  4MIA A;  2DIT A;  1FFS B;  2CPH A;  2LP4 A;  3I4H X;  5HQM A;  2L9N A;  2AJQ A;  3NL0 A;  4E2F B;  4A4J A;  4FF2 A;  4YB7 A;  1KS2 A;  2VF3 A;  4DWI A;  3D1Q A;  4QOT A;  3RBE A;  1HMV A;  1Y0H A;  2FDN A;  1RT4 B;  2XBP A;  3GIK A;  2XMV A;  4ZVP B;  3MTJ A;  5IQQ A;  1U1K A;  2KFY A;  3G82 A;  1IJE B;  3CCV S;  2W25 A;  3KG0 A;  1I94 F;  2FY1 A;  1OY8 A;  1U1P A;  1F3V A;  5F3Z A;  2GJF A;  5E33 A;  1U45 A;  1NPP A;  1W2B R;  4DV6 J;  1B7F A;  3TA0 A;  4ILM A;  3V4I B;  4OL8 A;  2LQ5 A;  5H1S V;  1JK9 B;  1TKZ A;  3W62 A;  3W5X A;  2VG7 B;  4I6A A;  1SPB P;  4RLE A;  1TL3 B;  1VI7 A;  1RGV A;  3MR5 A;  2YWW A;  4DR3 J;  1VQP S;  2ATC B;  4OZ0 A;  1NEE A;  4LRA A;  3SQG B;  1OJ4 A;  2D74 B;  2D9P A;  3EDR B;  4ECZ A;  3LF0 A;  3BQ1 A;  3BSO A;  4C2M A;  1JLQ A;  4NCB A;  3DM2 B;  4NWB A;  3W66 A;  2QJ3 A;  4UUW A;  1YIT S;  5DS7 A;  2ASL A;  2VPY B;  4JB8 B;  4FN5 A;  1YKW A;  3RW7 A;  3MPU B;  4PG7 A;  5GMK a;  3A8I A;  5L9N A;  2ABY A;  5BJR A;  3MDF A;  3QLH B;  2BQ3 A;  3KLE A;  2BKP A;  3MPD A;  1S1T B;  4DV1 J;  1OMS A;  2LXI A;  4JUZ A;  4AQY F;  3TYT A;  2QL9 B;  4IH7 A;  4O3R A;  4JI1 F;  3UCU P;  3NY0 A;  4NYZ A;  3LAK A;  1S99 A;  4IG0 A;  1RAG B;  2B9W A;  2CWK A;  4DSE A;  2WK4 A;  4GVB A;  2Q6B A;  2WZ1 A;  4CNZ A;  2ZE2 B;  3M8W A;  1WG1 A;  2ATL A;  2GQQ A;  2LEP A;  4O4G A;  3MR6 A;  2MHN A;  3EGN A;  3NOC A;  3MPW A;  3PJ9 A;  4DQQ A;  2YBV A;  4LF8 F;  4WJB A;  5GAG I;  4CQ1 A;  3HKZ D;  1HNI A;  2KDO A;  1N5S A;  4QWE A;  3HCX A;  4QIE A;  3L7P A;  4L3N A;  1SC6 A;  1QUP A;  4K2J A;  3JSB A;  1NKE A;  4UQG A;  1A0O B;  4I2Q B;  2ZBR A;  4M94 A;  2LXF A;  4MJK A;  4G1P A;  1OYE A;  2OH2 A;  4L72 B;  1NU4 A;  2DHX A;  3UN5 A;  1JJ4 A;  2FJD B;  1XER A;  5JVH Q;  4OV1 A;  4JI2 F;  1S57 A;  3D1O A;  1H2V Z;  2V2K A;  2N3L A;  4GC7 A;  3FC9 A;  3GPA A;  2HBY B;  3NCQ A;  4FXV A;  2DK2 A;  3EXY A;  4GKK F;  3R3T A;  1GH8 A;  1XIQ A;  3FEX B;  3C14 B;  2I5J B;  1YJU A;  3GLJ A;  1DHM A;  2OSQ A;  3CCU S;  2RDJ A;  3UFC X;  5EDW A;  4OYI A;  1UJ6 A;  1IBM F;  4IRC A;  4DQI A;  2E5G A;  5HAN A;  1JB0 C;  4ZVQ B;  4WFZ A;  4MTP A;  3MEE A;  2BJ7 A;  2HGM A;  2QC3 A;  2OML A;  4DV3 F;  3GTY X;  3PYD A;  4NXN F;  1QE1 A;  2GX8 A;  4A8F A;  1TV6 A;  2HFS A;  2IYG A;  3NG8 A;  1D8Z A;  3R5J B;  6FDR A;  1F9H A;  3GJS B;  2GFF A;  1MML A;  1UA1 A;  1U0H B;  2B51 A;  3EUN A;  3PRB A;  2V2V A;  3MM6 A;  3BGL A;  4OV6 A;  2HFN A;  4Q2M A;  3S6E A;  2KM8 C;  2KKH A;  4HDH A;  2C2E A;  3IR5 B;  5B0A A;  2J6T A;  1SUQ A;  2GCF A;  1Q53 A;  5RUB A;  4NLW A;  4H4O B;  4ZOS A;  2DHG A;  1REV A;  1XMQ F;  3JSR A;  5B0F A;  2K3K A;  5EX0 A;  5K8M A;  1RAE B;  2FHJ A;  3SXL A;  3QJJ A;  4DV7 J;  5M2P A;  1U6Z A;  1WHV A;  1FA0 A;  4ECT A;  3MMC A;  1RTJ B;  2APO A;  2GHW A;  3A3O B;  2YWG A;  1T03 B;  3GV7 B;  5DG7 A;  2HNZ A;  2PT0 A;  3MCN A;  4FYV B;  3E51 A;  4C7Q A;  4RKU C;  2B7B B;  4ED7 A;  1G3O A;  3GYX B;  3WIV A;  3HO1 A;  3D28 A;  1IUJ A;  4ED6 A;  2R8G A;  2DHA A;  1PSD A;  1R89 A;  4NLD A;  1M1G A;  3BH6 B;  2HIQ A;  4U6P A;  1JJH A;  4J7C A;  2MLX A;  1FNO A;  1B3T A;  1N33 J;  4QYZ J;  4WU2 A;  4Z7Y A;  1VC5 A;  1RWW B;  3BQ0 A;  4DQS A;  3NXZ A;  3LWL A;  3DGV A;  3TAR A;  1MNE A;  5DDR C;  1QTN B;  4TXS A;  2IY5 B;  2OJ3 A;  3PKY A;  4ED1 A;  1FWK A;  3PYG A;  4CM0 A;  1UFW A;  1RBA A;  1XC9 A;  4M5M A;  3DLH A;  3CME S;  1FDD A;  4WFX A;  4DSL A;  3PDN A;  1QVG R;  3AOB A;  5F8I A;  2GMJ A;  2XLJ A;  3IR6 B;  1VQS A;  3RRG A;  3BBC A;  3H4D A;  3BYP A;  1S9F A;  4QIW D;  2VJU A;  5LMU F;  2JNJ A;  4LBI A;  4JI4 J;  1HNW F;  2F4V J;  4QW8 A;  3I56 S;  1ZM4 A;  4IO9 Q;  4DL6 A;  1WF1 A;  4X62 F;  1RTH B;  1WC4 A;  1NDC A;  3IAS 9;  2ROG A;  3VAM A;  1IR1 A;  2FB0 A;  5KFI A;  5C42 A;  1VHI A;  2BAC A;  3HZG A;  2W2Q P;  1KVK A;  2XTJ P;  5SUH A;  4O3S A;  3QT5 A;  3EZU A;  1HBO A;  3FBB A;  1HBN B;  4NCG B;  5A76 A;  3M2U B;  4C8Z A;  4DR7 F;  3DRS A;  1U26 A;  1PGZ A;  2RHS B;  2R7X A;  2LXU A;  1FKO B;  3KLH A;  1KR4 A;  2BAN B;  3OR2 A;  3ZFV A;  3D68 A;  3EWG A;  3BJY A;  1CJV B;  2J5A A;  3W7B A;  2QGF B;  4DPY A;  3LP1 B;  4WWS A;  1K1S A;  1X5S A;  3QZ8 A;  1U2C A;  2YQ3 A;  4KV8 A;  4H54 A;  3H40 A;  2BRL A;  1LOU A;  3MF5 A;  3BZQ A;  4X65 F;  2B9X A;  1TKX A;  2FJE B;  3H98 A;  1NK7 A;  3O5T B;  3FUY A;  4ZHR A;  2DRD A;  2R42 A;  4ZPA A;  1X5P A;  1JLF A;  1NSA A;  2RNE A;  5GAE I;  5E3Q A;  3KLI B;  3HK2 A;  2G2O A;  4RL1 A;  1DZ5 A;  2Y9H A;  2M0G B;  4BC9 A;  2HK2 A;  3T1Y F;  1I94 J;  2IFX A;  1I6J A;  1SQF A;  1IKY A;  3BF4 A;  2CQ2 A;  5HQL A;  1TMJ A;  1X5O A;  3C8Y A;  3KLG B;  3HFK A;  5C25 B;  2CPZ A;  3TW0 A;  3KOA A;  1XK8 A;  3DC2 A;  1RT5 A;  1NH8 A;  1UCN A;  2MXY A;  1RT1 B;  1TAQ A;  2V94 A;  2CJX B;  1H2U X;  4PCQ A;  4I2P A;  3HSD A;  4NA1 A;  2G0I A;  2H1Y A;  4B9L A;  1WF0 A;  5KG6 A;  3QRQ A;  3OR1 A;  3FBC A;  4Q0B A;  3PEH A;  3U1N A;  5F8G A;  2ZKT A;  2G2Z A;  5LL6 d;  3D6F B;  2X7I A;  2EI5 A;  2AIR B;  2XMU A;  4PQA A;  3BKF A;  5GAG U;  2OIH A;  4P72 A;  2MKS A;  1NK5 A;  1SB6 A;  2NUH A;  2CRL A;  2W2O P;  4RNH A;  3NGT A;  1VS3 A;  3C16 B;  3PJW A;  2FGO A;  4PEO A;  3M30 B;  2J0W A;  3AA8 A;  2R2U A;  1LW2 B;  4AQY J;  3RYL A;  1YIJ S;  1PC5 A;  2ZH5 A;  4DFJ A;  4JI1 J;  1HI0 P;  2LEA A;  4IDK B;  1RA6 A;  1L3V A;  1Y00 A;  3GV8 B;  5DQH A;  4M5L A;  2V4J A;  1L5U A;  1X4E A;  3BGU A;  4KRW A;  4OX6 A;  4OZ5 A;  1RA7 A;  2HFO A;  1S6Q A;  4OQJ A;  1F5C A;  3QWU A;  2OD6 A;  1RYR A;  2Y3Y A;  2L41 A;  4KHP F;  1X9W A;  4JV1 A;  2EFQ A;  3IXQ A;  1ZTT A;  3DLG A;  3IRX B;  4OZJ A;  2YKM B;  4LF8 J;  1VQ7 S;  4B3T F;  3CMQ A;  3M8Y A;  1WEL A;  3ADA C;  2RDD A;  4HHU A;  4WII A;  5CXT A;  1P6T A;  2VPX B;  1UKU A;  2EWH A;  1T05 A;  2DXF A;  2MST A;  3R7N B;  1UA0 A;  2J7U A;  5D8H B;  4DCP B;  4PG5 A;  1VIS A;  1D3W A;  1V5V A;  2YNH B;  2XHW A;  4NYO A;  2HNY B;  5IC6 B;  2QMU B;  4M5H A;  3H59 A;  1GTE A;  1KKH A;  4FBU A;  3MFH A;  2ZJP Q;  3P3D A;  3CJ2 A;  3PFO A;  4CIO A;  4JI2 J;  5K5M A;  1YDL A;  1RHQ B;  1WHX A;  1ZZF A;  1Z2L A;  3C6T B;  3I9V 9;  2W9B A;  1QAI A;  3JSM A;  4ZVE A;  4B3S F;  5B09 A;  3ZC4 A;  3QMQ A;  1WSV A;  4OX9 F;  1AUS L;  3FMW A;  4GKK J;  1FDB A;  4RUB A;  4ID5 A;  2ZH2 A;  4CLY A;  3MM8 B;  1HBM B;  4CLU A;  3HHL A;  3PFE A;  1H6K X;  4FYD A;  5IS2 A;  3NNC A;  4RNO A;  2UV8 A;  1TKT A;  1G6B A;  5EWF A;  1M1K T;  2YNI B;  4O3P A;  2RS2 A;  4QU7 A;  1S9E A;  5H9F K;  4KO0 B;  4I69 A;  2CNK B;  4HAC B;  4P71 A;  4DV3 J;  1FE4 A;  2CAJ A;  4IR1 A;  4C98 A;  3TZY A;  3DXS X;  3S7R A;  3B54 A;  2DT9 A;  4HHH A;  3MZI A;  2LQ9 A;  3UR3 C;  1V3Z A;  4PG4 A;  2MY8 A;  1VQ6 S;  1N6Q A;  4D3G A;  4PG8 A;  1JLB B;  3GQC A;  2PI4 A;  3OFG A;  3PR5 B;  3PRV A;  1RSC A;  4WFB Q;  1VIX A;  1VBK A;  1X9S A;  3TI0 A;  4ZP9 A;  4RBU A;  5DDP C;  5J2Q B;  3GJR B;  1KN6 A;  1XMQ J;  1HQE B;  3FCH A;  4EWT A;  4DXL A;  2DNL A;  3UDC A;  3TNV A;  3IP0 A;  1RWU A;  3NGU A;  4DUZ F;  2PGC A;  1QAJ A;  3I0S A;  3HVR A;  4CRJ A;  4I56 A;  3MCO A;  5AT1 B;  2YKN A;  3M8P A;  2HHH F;  2MKJ A;  4OYO A;  5DG9 A;  4B3O A;  4X4R A;  2JX2 A;  5ETM A;  4I64 A;  4OJG A;  2DKO B;  2DNH A;  2IMW P;  4TQS A;  1KQK A;  2K1R B;  2C3U A;  2CJK A;  2MDA A;  4LRD A;  4HKQ A;  2MPU A;  3VHQ A;  2CNL B;  4DFP A;  3I96 A;  5KFU A;  2BJE A;  4NLV A;  2ZVI A;  4FF1 A;  5DET A;  3ELH A;  1HHS A;  3JTO A;  1XMO J;  2E29 A;  5KOX A;  2DXE A;  4RNN A;  3DI6 B;  5KT3 A;  3FDS A;  2D3O R;  4UY8 T;  1NB7 A;  3NP5 A;  3F56 A;  4FYW B;  3ICL A;  3PO4 A;  3ZTR A;  3WZ0 A;  3LAM A;  4X4U A;  1BHN A;  3UNG C;  3BO3 A;  1ARO P;  5A6W A;  1XBW A;  3VV2 B;  3UDE A;  3RTV A;  2WTF A;  4XTT A;  1VRU A;  2AGO A;  2EKN A;  3B8H A;  5KFV A;  2LCW A;  1E6V A;  2ZD1 A;  4I4B A;  2UXD F;  2MTL A;  4C8N A;  2FYX A;  2BV3 A;  4ZMM A;  5M2R A;  3AT1 B;  2HVH A;  2QG9 B;  3EIC A;  4DHV A;  4DR1 F;  1HNW J;  1A7G E;  3OSN A;  1RLC L;  4P2X A;  2AGP A;  4JI8 F;  1QJH A;  5CZX A;  4OYA A;  1FK9 B;  5GAE U;  4X62 J;  2JLE A;  4DI6 A;  2NYI A;  2DR7 A;  3WIU A;  3EGZ A;  1NHU A;  5JUM A;  5KG5 A;  3DOL A;  3QO9 A;  1QD1 A;  3IM8 A;  4PXC A;  1U1L A;  2ZVS A;  1RAO A;  1RTD A;  4LSL B;  3R2C J;  3FQK A;  5HBM A;  5BXI A;  2K2P A;  2GO9 A;  2BE2 B;  4ED3 A;  2XMA A;  2E1C A;  3PYF A;  4QWB A;  4DR7 J;  9RUB A;  2RQK A;  1GMW A;  1C0U B;  1Q8L A;  4USM A;  2ZNY A;  1IBL F;  2GO8 A;  1U1N A;  2H3E B;  1WOP A;  4CP5 A;  2WVE A;  1C0T B;  2OPS A;  4ZPT R;  2ZM6 J;  2XSJ B;  4WXO A;  4ELT A;  1HI1 A;  5IWA F;  3TA1 A;  4X65 J;  2YNG A;  2HLU A;  3NGS A;  2ZZT A;  4AND A;  4CYU B;  2OEM A;  2MZT A;  3HSG A;  1SJR A;  3QT8 A;  3NGD A;  4ICL B;  3EMT A;  1C4A A;  1N5Y B;  1SJF A;  1RYS A;  4UT4 A;  4WZM A;  1EP4 B;  5M2U A;  1WHY A;  4P2M A;  1HYS A;  3QFH A;  3VWS A;  3T1Y J;  3HJV A;  3ZZY A;  2V8D A;  1KDN A;  4J9R A;  4HI2 A;  1RT3 A;  3RR8 A;  1KON A;  2HK3 A;  3CDE A;  4P52 A;  4Q2L A;  4F3M A;  4IQX A;  2Z56 B;  3R5A A;  3TR5 A;  1TU0 B;  3OHA A;  1J5E J;  2R8J A;  3T19 A;  3DDI A;  2F5G A;  3CF5 Q;  4K4Z A;  1URR A;  2VV5 A;  1R7I A;  3IM9 A;  2WVD A;  1RAH B;  2G13 A;  1X4F A;  2HHS A;  2D3O 1;  1C1B B;  1FXR A;  5HP1 A;  1EQM A;  1FHT A;  3KTQ A;  1HMV B;  4OZ1 A;  2BEF A;  1JX4 A;  1FDA A;  5KT2 A;  1FD8 A;  3IWL A;  3M6X A;  1CQM A;  1PAE X;  4USV A;  2Q66 A;  1UVK A;  4UZC A;  2B5J A;  3CCE S;  2I38 A;  3M2R A;  1H0H B;  1YJV A;  3B4M A;  2NQP A;  4AT1 B;  5DQG A;  2CZ9 A;  2SXL A;  4OZN A;  4HT7 A;  3AQO A;  4EYI B;  4C8L A;  2DCU B;  2F8M A;  1D9F A;  2A6M A;  2RDI A;  3KJQ B;  4ECS A;  1REG X;  4AFF A;  3DLK A;  1TKZ B;  1H73 A;  2R7S A;  2HVI A;  2AEM A;  2DVI A;  4CLW A;  3CCL S;  4DCO B;  4ED2 A;  1VQN S;  2KM8 B;  3GWC A;  5ETN A;  4F2R A;  4RR5 A;  3LAN A;  2C2M B;  2WSE C;  1H98 A;  1UP1 A;  1VQL S;  4LR8 A;  2DR6 A;  2LEB A;  4KHP J;  4ES3 A;  1MWQ A;  2HBZ B;  4WYL A;  3PW0 A;  4LF6 F;  1LK5 A;  4B3T J;  3NNA A;  5B0B A;  1JLQ B;  4IO1 A;  2J9C A;  1Q8I A;  1WWH A;  3C19 A;  3RB6 A;  2J9D A;  3D4J A;  1CJK A;  2QZ8 A;  4LR7 A;  3S8S A;  3FKB A;  1PBA A;  1HI8 A;  4GO5 X;  3VGS A;  4CO0 A;  4DFK A;  4CWB A;  4FXW A;  1NJI T;  1V3S A;  4P2F A;  3KK2 A;  2OKQ A;  1HD1 A;  4ZK7 M;  3NOG A;  5KFE A;  1NK0 A;  3GYN A;  3BKU A;  4NLO A;  3N6M A;  2H48 B;  3V6D A;  1JMT A;  4R8U A;  2FLO A;  1ZBT A;  3Q8V A;  4EBE A;  4RW9 A;  4IG0 B;  1HWU A;  2ZC4 A;  4B3S J;  1T9Y A;  2NCK L;  2CWX A;  3AB4 B;  2HGL A;  4GVB B;  3ZTP A;  4OX9 J;  2VU5 A;  3FRY A;  1VK8 A;  1KTQ A;  3VQT A;  3RW6 A;  4NEY A;  3TX0 A;  3HUL A;  3LGM A;  3UE2 A;  3WBZ A;  2LQB A;  4O4G B;  1K1Q A;  1B0P A;  3G8Q A;  2QT7 A;  1Q7Y T;  3DRP A;  3HD1 A;  5E3A A;  2RQ4 A;  3RR7 A;  3V81 A;  3L3C A;  3I0R A;  3NAI A;  4ED8 A;  3VAH A;  3UDL A;  3W60 A;  1CJT A;  3CUL A;  3FBE A;  5KFG A;  1HNI B;  4WKY A;  1Y5L B;  4TQR A;  3A3P B;  2NZC A;  4LF5 J;  1R0A A;  1QLN A;  4F0M A;  1NO8 A;  3BBF A;  3J81 j;  3RZA A;  4A8X A;  2N4D A;  4RO0 A;  2OEK A;  2HRU A;  4DR4 F;  2HZA A;  2BBE A;  2EFO A;  8AT1 B;  2JH3 A;  3AJD A;  3M8Q A;  3H5S A;  4RNM A;  4DPX A;  3QGI A;  1DLO A;  4DSF A;  1N32 F;  4MK9 A;  2FHJ D;  3EDQ B;  3I55 S;  3BO4 A;  4KQZ A;  2AYB A;  4DUZ J;  3D3C J;  2AT1 B;  3S1T A;  2R7T A;  2OAU A;  1SC4 B;  3GJQ B;  3PIP Q;  2ZHB A;  4F0K A;  3KK3 A;  4DG1 B;  3U02 A;  1T02 A;  2HHH J;  3MEE B;  1K73 T;  3TZW A;  4F4K A;  1RWN B;  2BE7 D;  3OVB A;  1NK9 A;  4YB6 A;  5D3G A;  2ZH4 A;  1QE1 B;  2ZBQ A;  1TV6 B;  2I8E A;  5A0Y A;  1CQN A;  2HFU A;  3KUE A;  5CH7 B;  2CG4 A;  1GT8 A;  3PRD A;  2D9O A;  2L3M A;  2EC2 A;  3MM6 B;  1YJR A;  2G4B A;  2R7R A;  1VYA A;  4DN0 A;  1E6Y A;  4HH1 A;  1B99 A;  1SUQ B;  3BBB A;  3K5P A;  1GX6 A;  2R7O A;  2KH9 A;  4B02 A;  4DPT A;  1REV B;  3MR7 A;  4F04 B;  5E5N A;  5KG2 A;  4A48 A;  4UTG A;  3H8Y A;  3J80 U;  4GMK A;  4U7U K;  3QID A;  5EHH A;  4LSN A;  4ZVG A;  1JKH B;  3MMC B;  1UEU A;  2DGW A;  3IWN C;  3T9Z A;  1O51 A;  2GIR A;  5G4D A;  3NMA A;  3C6U A;  1WC0 A;  1WAC A;  2MQL A;  2K8G A;  3CIM A;  3MM7 B;  5D0E A;  2GA7 A;  4AL5 A;  2HSE B;  2FJX A;  2UXD J;  2DNG A;  3V6J A;  4W4M A;  3FSY A;  5CQG A;  5KG0 A;  2ZBP A;  1D0E A;  4L6V 3;  3A8E A;  2VBY A;  1U49 A;  5GAD I;  2W9A A;  3I5B A;  4KE5 A;  4OI3 A;  4LRE A;  4KB7 A;  3EXC X;  4RBV A;  1LFP A;  2R3V A;  5KT7 A;  3KJV A;  3GR1 A;  3SMZ A;  1KSP A;  3GE9 A;  1N56 A;  2AX0 A;  4ER8 A;  2BYC A;  2FVS A;  1S10 A;  4QW9 A;  1HLW A;  5I42 A;  5AXK A;  4IH5 A;  3PVX A;  1YTY A;  2LVW A;  4Q43 A;  1SKS A;  2ACM A;  2VAS A;  3RBD A;  3GON A;  5FLX U;  2AQ4 A;  4PG6 A;  3NCR A;  2XY6 A;  4DL5 A;  4MYT A;  3RG6 A;  2NRE A;  3A1Y G;  1ZH5 A;  2HFZ A;  3GSI A;  4G1Q A;  1IBL J;  4X4S A;  1HNV B;  4QIV A;  2HVD A;  2JL9 A;  1LQ9 A;  2JRS A;  3Q89 A;  3RBX A;  3P5T L;  2NXE A;  5IWA J;  2C2O B;  2XI3 A;  4IRK A;  3H7H B;  3N0V A;  2RUG A;  3NWG A;  5KFB A;  3ET6 A;  2MZR A;  1BXN A;  4KTQ A;  5E41 A;  3MR2 A;  1D9A A;  3G87 A;  3PX0 A;  1HHQ A;  3R5G A;  3HFZ B;  4HVZ A;  3VGU A;  4DL7 A;  1UJ4 A;  1FDN A;  2HRY A;  1V5I B;  2KYZ A;  1CUL A;  3BSN A;  5C42 B;  2IYI A;  3BS9 A;  3OFE A;  4HL9 A;  1HBO B;  2CQG A;  2HWI A;  2QMX A;  2VG6 A;  2BZ2 A;  2AGQ A;  3MEC A;  5IXU A;  1IKW A;  2B43 A;  2KI2 A;  5KFQ A;  3DRS B;  2PE8 A;  3KLH B;  2M5Y A;  1W7W A;  2NXC A;  3OR2 B;  1H72 C;  3SZ2 A;  2IHR 1;  2RJZ A;  2BM1 A;  2UVW A;  3A13 A;  4RX6 A;  2Q43 A;  3G96 A;  1VJW A;  1T8E A;  2VIH A;  1SJ1 A;  5J1E A;  1W26 A;  5KFN A;  4QR2 A;  3THP A;  3OFF A;  2Q79 A;  1KRP A;  4O0N A;  2X1A A;  1EZZ B;  3H20 A;  1LV5 A;  1S0N A;  1F5B A;  1TKX B;  1Q86 T;  1RU2 A;  2AKW B;  3ULH A;  3KFW X;  1S0V A;  4ZHR B;  3ENV A;  1QSY A;  2DIU A;  1H74 A;  2CPF A;  2DHH A;  3PX6 A;  2V68 A;  1CLF A;  4X4N A;  3A8K A;  3OT9 A;  4JI5 F;  3Q2T C;  2JHE A;  1TK5 A;  3J81 U;  4ETX A;  1T3N A;  4CLL A;  1S1W A;  1UET A;  2F7V A;  1IKY B;  3I6P A;  1Q4R A;  2VFV A;  1YBT A;  5EWE A;  3FNN A;  4NLS A;  1RT5 B;  2W9C A;  3FMB A;  2O1P A;  3H4B A;  4O3Q A;  2BQU A;  1FRI A;  1S97 A;  2BM0 A;  1RBO B;  1R6Y A;  3CO9 A;  3W2W A;  2IAJ A;  5F8N A;  2OI2 A;  3H0P A;  1LEO A;  3HHN B;  2CJQ A;  3KHR A;  1WC3 A;  2EBE A;  2HVE A;  2UUC F;  3I4P A;  4Q44 A;  1NND A;  2G1D A;  3OR1 B;  4Q0B B;  3SSQ A;  1RE1 B;  3DKD A;  4LF6 J;  4MYU A;  2YX7 A;  1ZET A;  2IVF B;  2M52 A;  3KHH A;  1KTV A;  2Z4P A;  1X7V A;  1MMN A;  1RHM B;  5L1I A;  1XR7 A;  2LQ8 A;  2GNK A;  5CD4 H;  5F8J A;  2HQ3 A;  2JFK A;  2HW3 A;  2LLZ A;  3VVT A;  3OD2 A;  4NLP A;  1R3N A;  3D6T B;  4WIQ A;  2VFT A;  4K59 A;  1S77 D;  4AUK A;  5CYM A;  2ZH7 A;  5E0O A;  2GHV C;  4WK3 A;  4DS5 A;  2MQQ A;  4DR2 F;  1T9X A;  1UVL A;  4P2S A;  2V4J B;  2XS5 A;  1KQF B;  1Y3K A;  4F0H A;  3CVK A;  1T9V A;  4PXD A;  2QX0 A;  1WKK A;  2XC9 A;  2UVU A;  2XNQ A;  4NZ7 A;  2V8G A;  5IV4 A;  4X4V A;  2PII A;  5I3U A;  3HHL D;  4DUY F;  1XR5 A;  1HQU A;  1IJF B;  1JLG A;  1VBZ A;  5K14 A;  4ILL A;  3BQ2 A;  4Y2C A;  4ZIT A;  3TJ8 A;  1WOR A;  1KFD A;  3K17 A;  2NXN A;  4RU2 A;  4JI3 F;  2ZOF A;  5HLF A;  2VHG A;  1BUX A;  2C3M A;  2VDH A;  3TUZ C;  5D4N A;  2XLI A;  4ZCM A;  4UY8 5;  1R8P A;  3RGI A;  1QAY A;  3IAM 9;  5GMD A;  2AJ1 A;  2DH9 A;  2M9K A;  4JYA J;  4CLT A;  3M05 A;  1EQ0 A;  2Y0S D;  4J9M A;  4DR4 J;  3OV7 A;  2GS8 A;  2XI2 A;  3R1H A;  4UOF A;  2W9B B;  3GCX P;  2BKN A;  2W8K A;  3JSM B;  4Y2M A;  2WW4 A;  5KFY A;  2RIL A;  2QEX S;  2VOP A;  4UST A;  2HUR A;  4ID5 B;  4R0E A;  1N32 J;  3CCZ A;  4Y65 A;  3HHL B;  1VQK S;  1Y5N B;  1XEZ A;  4CO4 A;  1PJ6 A;  1X4B A;  2CQ1 A;  3NMR A;  2KXF A;  4A47 A;  2JEJ A;  2QA4 G;  3BGR A;  3RJM B;  4PXE A;  5J2N A;  5IQ6 A;  3R8Y A;  4LBP A;  1S1X A;  3K2Y A;  3UNY A;  3BR8 A;  3ZZ0 A;  5B7W A;  5I3P A;  4RW6 A;  2OLW A;  3IC1 A;  3LGH A;  2IJF A;  1S9G A;  5GAD U;  4CO3 A;  1S72 S;  1LWC A;  3ZNU A;  3DOK A;  3Q86 A;  5L8R C;  2RB7 A;  1N6Q B;  2AJ2 A;  1HBU A;  3VZH A;  4P75 A;  1IBK F;  1BQN A;  2P9C A;  2VPZ B;  1RJJ A;  1Q78 A;  4KYZ A;  4EMD A;  1S6O A;  4J9Q A;  3MMB A;  3WX4 A;  2CXE A;  3CB4 A;  1R0C B;  1HL6 A;  3SQO P;  3KK1 B;  4X84 A;  3G6X A;  4GC6 A;  4PYD A;  4DPU A;  2RU3 A;  2RD5 C;  3HSZ A;  2J7W A;  5CZV A;  2RS8 A;  1FO1 A;  5KFX A;  1FRX A;  3I0S B;  4B9M A;  2XNR A;  4W90 B;  4CLZ A;  2YKN B;  2Z2Y B;  4LVN P;  2VC1 A;  3M8P B;  3C15 B;  3UWT A;  5K20 B;  3QNW B;  1NBE B;  4J37 A;  1CG2 A;  4O44 A;  1TL7 A;  4TYA A;  4CH0 S;  4XPC A;  3D0G E;  2A2D A;  2RF2 A;  4EO6 A;  2C2K B;  2W4D A;  2AF6 A;  4DV2 F;  4CLK A;  2IC3 A;  5KFZ A;  3A4T A;  1XMB A;  3H42 A;  4Z7C A;  5IM0 A;  3CJ5 A;  3GIR A;  3B82 A;  4RNF A;  2IVM A;  1MMD A;  2ALZ A;  3F44 A;  2KRB A;  1PKU A;  4CT9 A;  2L9W A;  4IFY A;  3SCI E;  3RAX A;  1FCA A;  4ZA1 A;  4K4T A;  2UVV A;  2RHQ B;  5EGY A;  4LFC F;  1FVS A;  2DNM A;  3RBZ A;  1ZPW X;  1N5Q A;  2C3P A;  4Q5V A;  2C2Z B;  1KNZ A;  5KFT A;  1PCA A;  4WFA Q;  4ENO A;  3MAH A;  1Y5I B;  3FJ2 A;  5F9N A;  2FHO B;  1R8H A;  1VRU B;  5F8M A;  3GV5 B;  4FYX B; 
#chains in the Genus database with same CATH homology
 2C2M B;  1RE1 B;  3GJR B;  2H4Y B;  1RWK B;  2XYP B;  5K20 B;  3QNW B;  2CNO B;  2XZD B;  1RHR B;  1PYO B;  2QL7 B;  1SC4 B;  2QL9 B;  2QLF B;  3D6H B;  1RWW B;  3P45 B;  3R6L B;  2QLJ B;  2C2K B;  3GJQ B;  2HBZ B;  3IBF B;  2QL5 B;  2XZT B;  3KJN B;  2C2O B;  1QTN B;  4LSZ B;  1PAU B;  2CJX B;  1RHM B;  2HBY B;  4ZVO B;  4DCJ B;  2QLB B;  1RWN B;  4ZVT B;  1I51 B;  1RHK B;  4ZVR B;  1RWX B;  2HBQ B;  1ICE B;  2C1E B;  1RWM B;  2P2C B;  1RHU B;  2HBR B;  2Y1L B;  3D6F B;  2CDR B;  3SIP B;  2CNK B;  2DKO B;  3D6M B;  4ZVS B;  1NME B;  2XYH B;  3R7N B;  1I3O B;  3R6G B;  4ZVQ B;  3EDR B;  4DCP B;  1IBC B;  2H65 B;  2XYG B;  2H5J B;  1BMQ B;  3GJT B;  1QDU B;  2H48 B;  2CJY B;  2Y0B B;  4ZVU B;  2CNN B;  1SC1 B;  3NS7 B;  3R7B B;  1F9E B;  3KJQ B;  2CNL B;  1RWV B;  2H51 B;  2H5I B;  5IC6 B;  2C2Z B;  3KJF B;  5IC4 B;  1RWO B;  1GFW B;  3R5J B;  3R7S B;  4JB8 B;  2FQQ B;  3GJS B;  4DCO B;  3IBC B;  2H54 B;  4ZVP B;  1RHQ B;  1RHJ B;  1RWP B;  3P4U B;  1SC3 B;  3RJM B;  3EDQ B;  2H4W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...