4HR2A

Structure of nucleoside diphosphate kinase (ndk) from burkholderia thailandensis bound to adp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
142
structure length
142
Chain Sequence
SMALERTLSIIKPDAVAKNVIGQIYSRFENAGLKIVAARMAHLSRADAEKFYAVHAERPFFKDLVEFMISGPVMIQVLEGEDAILKNRDLMGATDPKKAEKGTIRADFADSIDANAVHGSDAPETARVEIAFFFPEMNVYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
publication title Structure of nucleoside diphosphate kinase (NDK) from Burkholderia thailandensis bound to ADP
rcsb
source organism Burkholderia thailandensis
total genus 47
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2012-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4hr2A00
1NSKL 1NSPA 1NDPA 2AZ1A 1UCNA 1KDNA 3PRVA 1BE4A 3EICA 3MPDA 4UOGA 1WKJA 3NGRA 1HLWA 1VYAA 3WX8A 1PKUA 1ZS6A 1XIQA 3VVUA 3Q8VA 3EVOA 1F6TA 3EE3A 2CWKA 1PAEX 3VGVA 4DI6A 4F4AA 1W7WA 3R9LA 1MN9A 3Q86A 2ZUAA 5CAAA 3FCVA 3G2XA 3Q8YA 1NSQA 3EMTA 3BBFA 2B8PA 3Q8UA 1BUXA 1NHKL 1S59A 3FKBA 3GP9A 3GPAA 3VGUA 1JXVA 4F36A 4ANEA 4DUTA 2DXDA 4DZ6A 1NUEA 1NDLA 3EM1A 3NGUA 2HVEA 3ZTQA 3FCWA 3ZTRA 4W98A 3VVTA 3BH7B 3EJMA 3FBFA 1WKLA 1HIYA 3ETMA 1LEOA 4EK2A 5CABA 1LWXA 1B4SA 3JS9A 3ELHA 3B54A 2HVDA 1HHQA 5IOLA 2DXFA 3VGTA 3BBBA 3PJ9A 2DXEA 2HURA 4UOFA 3ZTOA 1B99A 3DKDA 4ENOA 4WBFA 2B8QA 3Q83A 4KPCA 3ZTSA 3EVMA 3NGTA 1BHNA 3VGSA 4ANCA 1NDKA 1XQIA 3DDIA 3Q89A 4FKXA 3BBCA 2DY9A 4S0MA 5BXIA 3FBEA 4C6AA 1S57A 3NGSA 3ENAA 1NCLA 2VU5A 3B6BA 2AZ3A 1NPKA 1S5ZA 3BH6B 2NCKL 4CP5A 3L7UA 1NLKL 2BEFA 1EHWA 1U8WA 1K44A 3ZTPA 1NDCA 1MN7A 3EVWA 3FBBA 1F3FA 3FBCA 4O0NA 4ANDA 5C7PA 4HR2A 2BX6A 3FC9A 4UOHA 4FKYA 1NB2A 1WKKA 2DYAA
chains in the Genus database with same CATH superfamily
1W2BR 4P7VA 4LFCJ 2MTLA 4USMA 2ZM6F 3WQPA 2XWXA 1ZS6A 1J5EF 4KO0A 3KG4A 4O44A 2FVQA 4UQTA 2E29A 5D8HB 1YK9A 1L5UA 4USJC 4B3MJ 4FBTA 1JLEB 4FYWB 4OI2A 2N7YA 4G1QA 3HZEA 1FDDA 1U2FA 1Y5LB 3DRPB 1RT7A 2YWGA 3ETMA 4JP8A 2VG5B 5CYQA 2ZE2B 3SQGB 1DTQB 2HURA 2CJXB 1U0HB 3QGIA 2FZGB 2N4DA 1FKOB 1RU1A 2EFPA 3Q83A 3PX0A 1CJVA 3DLKB 4ZN1A 1JB0C 1RHRB 3SV4A 3CGIA 1FRMA 2IDEA 4CO4A 2OAUA 4S0MA 4P2SA 4JI8F 4KQZA 5LMUF 1OY8A 2XS2A 3H59A 5KFRA 2H54B 4FYXB 4KT0C 4A4JA 3KLIB 2U1AA 2CYYA 4RBUA 2YKMB 3PW5A 5K8OA 2PO4A 5KFQA 2YPZA 1SV5A 4EI2A 4RLEA 4EZ9A 2Z56B 2ZKUA 5EWGA 1SUQA 4DV4J 3BKUA 2BQUA 2EWHA 4WFNQ 2ALYB 3W9HA 4KO0B 3HI9A 2YXLA 3EWGA 2JHEA 2AV5A 2XYHB 3D5MA 4RW9A 1EB0A 2YKOA 2BM1A 3FCWA 2R7RA 2QIFA 1F2HA 3T1HF 3D6TB 2A3JA 4G1QB 4U67Q 4O3OA 4JV2A 5IXUA 1ZM9A 3SFGA 3LAMA 2FTRA 4DR3F 2O01C 3M2UA 5CYJA 1PBAA 1X4CA 3MZIA 3TX8A 2IY5B 1RT7B 4C4WA 1F9HA 1IKWA 2IVYA 5FIIA 5EWEA 5CYQB 5F3TA 1RWVB 1MWYA 4G1PA 4USIA 3L7UA 1CJVB 2B56A 1TR0A 3NMRA 4JI7F 2GMHA 2VG7A 3G86A 5DRKA 1FVQA 4QWBA 2I8EA 2NXUA 3SQOP 3HHKA 5IS2A 5F8MA 1S79A 4F4KA 1W7WA 4JI0J 1TKDA 3UW1A 5KT7A 3G6XA 3RW7A 1DHMA 1SV5B 2G1HA 1DZ5A 4CYUA 4O3PA 2G4BA 1SUQB 4ETXA 4CH0S 4I0WA 4WWSA 4NXMJ 2CQ4A 2CQPA 4ZHRA 4DQRA 4OZJA 2HQGA 3K8WA 2CQ2A 1FD8A 5K8NA 3B54A 5LXYA 2EK6A 2J9EA 2AYGA 5F8HA 4RW9B 4DUZJ 2V4RA 1KLNA 3VQSA 3MR3A 5KFEA 4DL0C 4JI5F 4BWJA 2CFXA 3IRXB 1V3RA 3M2UB 3A3NB 4ELUA 3OT9A 3QBCA 4FYYB 4WP9A 2WSCC 4KGVB 4CDIA 4PPZA 2DGUA 1NPKA 2AYBA 4URSA 2IAJA 1IKWB 3AQOA 3O1LA 4CNZA 3ISZA 3BYPA 5HL7Q 3V81A 2F63A 1NSPA 4U9RA 1LWCA 1NXIA 2LP4A 2QLFB 1KNZA 1PC5A 2YQ3A 3BV8A 5EGYA 4KR0B 2R7SA 2VG7B 5DM6Q 2L3MA 4J9MA 2Q3PA 3UI3A 2MZ1A 1FKPA 3DNCA 4AQYF 1S76D 4HTIA 4IOCQ 1GMWA 1VC6A 5C25A 5L1LA 4X4OA 1ZETA 2M5YA 2HKEA 2CDRB 3K5PA 1SB6A 5HROA 3GSIA 2DNLA 1I3OB 4HHUA 1FE4A 2HHHJ 3CB4A 1RT2A 2G9OA 2PC6A 4PG6A 2H4WB 4CYUB 1S1WA 4IFYA 1U6FA 4MK9A 3G71S 5J1EB 1UVJA 3P6YC 1M1HA 3W63A 4ZHRB 1RB0A 4Y2AA 2ZJPQ 3NG8A 5MAOA 2JC0A 2GHWA 4NLDA 1WF2A 4LSLA 1VBYA 3BREA 4L76A 2CQBA 1YRTA 2MYFA 3CCRS 4KV8A 1RWOB 1J27A 5J2MA 2NSCA 2ZFHA 1I6JA 2HQDA 2WW8A 4UTGA 3T1YF 3ITHA 1NDPA 5GAHI 2DEIA 2AMCB 2IAJB 2UXCF 3PRBA 3VV2B 5BYSA 3UPFA 2PSZA 3V81B 3IWNC 1IUJA 5HMYA 1YTYA 1HWIA 4ECQA 1X4AA 1LWCB 2O5DA 3AD9C 1RA7A 4WIIA 4HVZA 3K57A 1N32J 4O3NA 1IWGA 1FKPB 4DV1J 5K8MA 2RDIA 1DFDA 4C3LA 3DLBA 5C25B 2LEBA 3S7RA 1XNRF 4PCQA 5HSPA 3OJSA 2UP1A 2WVBA 2HS3A 4CM0A 3MCNA 5HROB 3MM9A 5KFPA 2FY8A 2KT2A 5HJXA 3CWJA 4DL4A 1BWEA 1RT2B 1JLCA 1S1WB 4EWTA 4IFYB 4JI4F 2OH2A 4FDFA 4DBQA 4OX9J 4I67A 3ENVA 2YWEA 2RF2A 1NCLA 2XZDB 3ICLA 4YUDA 1OY6A 2J9DE 4LSLB 3RU0A 1RWNB 4DR4J 2G2ZA 2PFDA 1KTQA 5J1NA 4B9NA 4KV8B 4QIFA 4DG1A 5J2MB 2C28A 2JEGA 1VQKS 2P9CA 1F0XA 2UU9J 4K4SA 1T11A 3ITHB 3TZXA 3QJPA 3R7NB 5A8KA 2R7UA 1AYEA 4GC7A 1QE1A 3QQCD 2Q66A 4LJMA 3PV8A 1FRLA 3TEHB 2FC9A 5AE3A 4MK7A 3PEJA 4IH7A 3T1AA 3H7HB 1R31A 5CD4A 1FNMA 2WW4A 1WC5A 1IBKF 4GMKA 2C2EA 2XSJA 3VGTA 1T9WA 4CI0B 3DKDA 3R7SB 2IJFA 4JUZA 3UFCX 2E1RA 2MY8A 1TU0B 2WK4A 3NGTA 3MM9B 4OIXA 3Q8PB 1G3OA 2A10A 4LFCF 1SI9A 2MQPA 3R7BB 3Q89A 2LEAA 5KFNA 3ILIA 4P2XA 4IR9A 1JLCB 1NLKL 3TW0A 5M2RA 4FN5A 5AXMA 3CCES 1N5VA 1GFWB 4B3OA 2W25A 1SC3B 4B3MF 3NNAA 1YBTA 3KNAA 1S1XA 2FD2A 3GYXB 5DJBA 2MQNA 1VISA 3QJLA 3M9MB 2MGZA 2WTFA 3SCKE 1AT1B 2GQQA 2AGOA 2ZHAA 1S1TA 4DG1B 4V1Ak 4CNYA 4CIOA 4U7UK 3G2XA 4FF3A 1UKUA 4J90A 1P1TA 2F8MA 2E1AA 1FJEB 3CJTA 4DSFA 1HQUA 1Q81T 5A8KB 1R27B 4IRKA 2DNKA 1QE1B 3DLEB 5KOWA 2OD6A 2OHDA 5ETNA 1OY9A 1VHIA 4NI2B 1F5BA 3HKWA 2WBRA 3HFKA 5F8NA 5A0YA 1RHMB 4WFAQ 5KFIA 3KUHA 3J81j 3BF4A 2LLZA 1TKXA 1A9NB 3HVTA 3NCPA 2XSJB 1TMJA 2BXJA 2QL7B 2Y1JA 1DQ8A 2P6SA 1GH8A 2AQ4A 1KBRA 2I6WA 5KFOA 4OX6A 1FFWB 2KG1A 4DV4F 2NYHA 4EBCA 4YR3A 1HFEL 4ZVGA 1KFDA 3T5HA 1RCOB 4B3OB 3NGRA 1S1XB 2YTCA 3IWXA 3MMJA 1VQMS 3HD2A 4FF4A 4MIAA 5F0UA 4P2MA 2HRUA 2W2OP 2MGZB 2R2UA 1KHVA 3L7OA 1CULA 3FCVA 5KFWA 2ZH3A 3NKYA 2WZ1A 2BJ9A 2RIJA 2LA6A 4LT6A 4C9DA 1VI7A 4B9LA 3CULA 2DH7A 4PZVA 4KSEB 3NP5A 3OTDA 2FJEB 1HQUB 4CRJA 1UFKA 4IQXA 3MAAA 4QPXA 2J6TA 2VA2A 3ZZTA 3LP0B 5HP1A 1N6QA 1AZSB 4NCGA 2XY7A 1S0OA 4I4BA 1P6TA 2MKHA 4V19J 5A0YB 2UUCJ 4K4YA 4OHZA 2HW3A 1TKXB 3HVTB 1D8YA 3K0JA 3QT8A 2FVSA 4CT9A 3S8SA 2RSQA 2Z2ZA 2VPWB 1U45A 4DMZA 1ULRA 2DHGA 1VYAA 3H2UB 4NXMF 2OGUA 3TVZA 2KT5A 4CO0A 2LKZA 4X4NA 2YWKA 3PZPA 1UA1A 2PD1A 2JC1A 4DUZF 1MU2B 2RQMA 3EZ5A 3VQTA 3GP9A 3QGHA 3SSQA 4KHRA 2W2PP 1CULB 1RT4A 2Q6CA 3CJ3A 3DLGA 4USUA 5B0BA 1LWXA 4CLYA 1WTBA 4PYAA 5DQIA 4X65J 4OMFG 2PEHA 3GQCA 1C0TA 2CQIA 1RAGB 3OL6A 2QMXA 2E44A 2C2RA 1C4CA 2GQ2A 1K47A 1PJ7A 3CJ5A 2BBEA 3MAAB 1YJVA 3GIKA 1EKSA 3RRKA 2M4MA 5HP1B 2GAGC 1N6QB 3GIJA 3IR7B 1ZA2B 4NCGB 4OZ1A 2BOAA 4F2RA 1IM4A 2GJFA 1Q1KA 4F0MA 3ZZYA 3HHLA 1C0UA 1GTEA 3F0NA 3NLCA 4HH0A 2F9DA 3KLHA 4EBEA 4E0DA 1QM9A 4WK3A 3DCAA 2J0WA 1QTMA 5D6GA 1WOOA 3N01A 5I3PA 4L73A 1G4CA 3QATA 4M5DB 5EN1A 4HL9A 1FTRA 2Z4PA 1HIYA 1RAJA 5HJYA 3GR0A 4RPFA 3FGVA 4RNHA 2VG6B 4B3SJ 3H20A 2X1GA 4DSIA 2YQ1A 4CLLA 2VFRA 1MMNA 3DLGB 3HULA 2V6AA 4MTPA 1N56A 1NO8A 1IJFB 1CS4A 1G7CB 3K2YA 3BBCA 1C0TB 4FF2A 4UF4A 1RP5A 3CD5A 2XCAA 3VF0B 3AT1B 1QTNB 4HT7A 2RD5C 4DPYA 5CA5A 2BX6A 3HXMA 4ZP9A 2V68A 5KG4A 1SJFA 3D0GE 1Q82T 1K0TA 3H2LA 2XY5A 5T14A 2AZ1A 5HANA 3DI6A 2BKNA 2XMWA 4DN9A 4IOAQ 3HO1A 5E33A 4FYDA 5G4DA 2VOOA 4GVLA 2GC8A 4L75A 4B3RJ 4L6V3 2ZH7A 3HHLB 3QRPA 1C0UB 2AJQA 1LK7A 1R0AB 4HKQA 2XO6A 1N33J 5KFBA 2E5JA 2I0XA 2BDPA 2K1RA 2B7CB 3L09A 4YHHJ 1APSA 3QFWA 4J91A 3HHDA 2OFGX 3PO4A 2GCFA 1X0FA 3OTCA 3RB4A 1ACMB 4OX9F 4EFAC 2PI5A 4FVMA 4QIEA 2R2RA 3MFIA 4ED7A 3QO9A 3RAXA 2U2FA 1LFPA 1IR1A 3BM7A 2VFTA 4DR4F 1T8EA 5HVFA 2QL9B 2OTJS 3DU5A 4RO0A 2XQCA 3RR8A 2FY1A 2UU9F 3IGVA 3T6JA 2VDHA 1QVGR 4IG3A 2IDLA 1CS4B 3EVWA 2K3IA 2ZNZA 3IG1A 4KGKA 1UJ6A 1R89A 2RU9A 2DYAA 5HQ8A 5ETQA 1F2GA 5B08A 4Q43A 2C2MB 1Q8IA 4I7FA 5GMEA 2OD4A 3IM8A 4QU7A 2HHSA 2FVCA 5M2PA 3DI6B 4OI6A 4NLYA 2HBZB 2DCUB 3S6EA 3MEKA 3CJSA 1XR7A 2ZUGA 2VFVA 4PQUB 5IT9U 2MEWA 3KUGA 4QW9A 2K1RB 1S9EA 1VJWA 5MLCV 2V2QA 3FEZA 4MKBA 9ATCB 1OQ6A 2ERRA 2KHCA 1ZM3A 1O51A 2WCXA 3QO9B 1MWQA 1HBOA 2DY9A 2XMKA 2YWWA 4TY8A 3ZZRA 1AFIA 1IR2A 4U7UD 2HVIA 2LA4A 3W3SA 2Y3YA 2HYIB 2GVDB 5CCLA 2IM3A 2HBRB 4A8WA 3X3UA 4R0EA 2IA0A 2W9AA 3UD3P 4DV6J 2C2KB 4IG3B 2YKPA 4USHA 1TUGB 4LF8J 5B0AA 4DV0J 3R1LA 1NRKA 4FVCA 3RBZA 4ERDA 1JLAA 4DX8H 5DDQC 2NXEA 1XBWA 3MUMP 4KH1B 2XZTB 3TA0A 4U95A 2C3UA 4ZPDA 1TAQA 4PAAA 3TI0A 3I82A 2JX2A 2O3DA 3W60A 3SZ2A 2EC0A 1S9EB 3QFHA 1JLGA 3K89A 2NR0A 1NK9A 3IMQJ 2JFDA 3M2VA 3CO0P 3I9ZA 3MR5A 4NASA 1OWXA 5M2UA 3LANA 1VQ4S 3UVJA 4TY8B 3W5ZA 2J0QD 1S0MA 3L4BC 3KXDA 4YEAA 1Q95G 1F1BB 3DN9A 1VS3A 1WC6A 2ZEJA 1XR5A 4BDPA 1N88A 1HKAA 1RACB 3OXGA 1UZHA 3Q8YA 2R42A 3L7PA 4LQ3A 3I96A 4K5RA 1KVIA 3M8QA 3EYZA 2D7SA 3QSYB 1CJUA 4B9TA 2D69A 1VQPS 4KTQA 3Q0AA 4I68A 4AL5A 4AD6A 3DXSX 1B7FA 2XMTA 2XSFA 3JQMA 3GSDA 3CD7A 3A3OB 2ACYA 3THVA 4X62J 1K8AT 5H9FJ 2WB4A 2OJ3A 1H6KX 5IT0A 2XNQA 4FKXA 1TQLA 4U8YA 4NWBA 4KYZA 1X4HA 3KHGA 3JQJA 5DS7A 3D68A 1JLGB 3U1LA 1SQEA 1FX4A 2V63A 4NZ6A 3MAQA 5L1IA 1RHJB 3M2VB 2CNLB 3CSKA 2MSSA 2R2SA 1TL3B 3QGPA 3KOAA 4JI2J 3IS9A 2J7UA 1U1QA 3D0HE 3UVJB 2L08A 2HBYB 4FS1A 1YZ6A 1J5OA 1VRTA 3V4MA 5IV3A 1HD0A 2G0IA 4KHPJ 2PA8D 3KJQB 3M8SA 5KFDA 5CCMA 3J80U 4DL6A 4PG8A 3DLLQ 4L74A 4Y2KA 2XYGB 3DDNA 1S6PA 2L41A 2DNNA 4KY3A 3R6GB 3CNQP 2MB0B 4WP3A 5B0GA 4I6WA 4J9KA 2CUYA 3M8QB 2JZ5A 4CH7A 3A3PB 3LO3A 2J6UA 1CJUB 3QRQA 5GADU 1B99A 2DRAA 2KT3A 4OI0A 3QIPA 4ENOA 2H5JB 4WYWA 3GV7B 4DCJB 5C2GA 3U7JA 3DRXA 3HX9A 1Z4UA 2D74B 4ZLJA 3IWLA 3ZTPA 1YSJA 2UVRA 2Y0BB 5E3RA 3TAQA 3FRZA 3MD1A 1FWKA 3N6LA 3LGMA 2B5JB 4K0KJ 1WKJA 1UEVA 1QUPA 1TELA 1D0EA 3CMQA 3CCTA 2EFOA 1F6TA 2MKIA 1RAHB 4ZVSB 2ZWOA 3H5UA 3IS9B 4B3SF 3IR6B 4F8RA 1X5SA 4ED4A 2C3YA 2G1DA 4DDFA 4HLBA 4I1TA 4K4WA 3MUTP 4WFBQ 1VRTB 2YY3A 1HR0F 4R5PA 3TQEA 2V5HG 3UDVA 2K3KA 1S6PB 2K2PA 4ZVRB 2BJ8A 5HQMA 4CZCA 3RTVA 4Q0BB 3TEGA 2E7WA 1VK3A 3QIPB 2DR9A 2PI4A 4ZVPB 1EQ0A 1D8ZA 1NM2A 4DL5A 3OR2A 1FWPA 2HHWA 2LVWA 1N33F 3IAM9 2FIUA 3BS9A 5AJ3J 5AE1A 1LWEA 1A0OB 1TKTA 3W8GA 3OSNA 4KE5A 1MWZA 3FQKA 1R8CA 1HYSA 1R6YA 3AA9A 1HQEB 3EMTA 1YLXA 3QMQA 4B9SA 5D0RA 4OZ5A 2XMUA 2DB1A 1XK8A 4GRSA 3FSYA 3BR9A 4L3KA 3M6UA 1DJ0A 3C66A 2FJAB 3PJXA 1HBUA 2HNYB 2OMOA 4WZQA 2FB0A 2Z57B 2N4CA 3THPA 4R5PB 1TUWA 4RX6A 1LOUA 5E7OB 4WFYA 2QSFA 2UXBJ 2GHPA 2APOA 1FE0A 3N5BA 3KJNB 2M3DA 3MM6A 1OPZA 3WIVA 2B4VA 1C1BB 3TUJC 5L38A 1KS2A 1M5KC 3CJ2A 1N36J 1WD6A 2ZH8A 3TUZC 1HLWA 1YJNS 4WYLA 4J9OA 1Q86T 5F8JA 2MKCA 3G6ES 4DQSA 1FJGJ 3B8HA 5DO2A 1KTVA 1LWEB 3R6LB 3FMBA 2DHAA 5L9NA 1SJ3P 3AJ1A 1FNOA 2C2OB 1HYSB 3BGFA 1CBKA 3VR1A 3M05A 1VIXA 2EI5A 3MR7A 4LF1A 1OPIA 1IWAA 2OSQA 3OFHA 2LXUA 3BGOP 2NYIA 4WBFA 1MMLA 3CJ4A 4LF5J 2NZ4A 3HZGA 2LFVA 3IO1A 1HBUB 2R7WA 3EGWB 2ASDA 3H0PA 1MW7A 2JVRA 4C8OA 1UA0A 5KFGA 5IV4A 3S01A 5DETA 4DV0F 2ZITA 4RBVA 2WBMA 1KVKA 4N56A 3GCWP 4A48A 3CJRA 2J8AA 3MM6B 4WF9Q 3W61A 3I0SA 2ZZNA 2CWXA 1KRPA 2VQFJ 3W62A 3Q86A 3FFIA 1HA1A 4OJ3A 4WE1A 1JNZB 3T5JA 1BD6A 4N77A 5IFMA 2VODA 3SFUA 2AWZA 4A8MP 3OPKA 3N9UC 1SKRA 1TKZA 3MCMA 4F2SA 3N79A 2J5AA 3CC7S 5ETOA 3VTIA 2AYEA 4ETZA 4QWAA 2VFSA 3HCXA 3PW7A 3NOCA 2JRSA 4O0IA 2HIQA 1NJWA 4ZA1A 3UO0A 1WTFA 2FHMA 1NKCA 3WZ0A 2VICA 3KK3A 3BZQA 2K7JA 1XQIA 5J2NA 2Q43A 3AB2B 1E6VA 2M9KA 1T03A 4LIRA 4AL6A 3HSZA 2XYPB 2OIHA 2E5GA 4C2MA 4OZNA 3CCUS 1HI1A 1M0SA 4KIAA 1IBCB 1N5YA 4OYWA 2KN4A 4HACA 2XZWA 5KG2A 2W2QP 2OFHX 3F56A 1FXLA 3QAEA 3Q8VA 1S97A 2VC1A 3GYNA 3KDNA 3I32A 1VC0A 4X62F 2R7QA 2XWYA 3I0SB 5ADZA 3UCZP 3Q8QB 3I0RA 4HDGA 3FFIB 3F73A 5HK4A 1X4FA 3LH2S 2WRMA 2EK1A 2AT1B 1SKWA 5D4LA 1MMDA 5GADI 3E51A 1TKZB 3AA8A 2XMMA 3JTOA 3OVBA 1QUVA 1REVA 2IYGA 2XULA 1CVJA 1PAUB 5G0RA 4JI6J 1UWBA 4ED0A 1NK8A 2ZJQQ 2DNGA 3KK2A 4J9VA 1U8WA 1H38A 4YOEA 2W7OA 2WVCA 1WC4A 3KK3B 4RW4A 5J2NB 1D1UA 1E6VB 1Y7PA 1GMUA 4KHPF 1T03B 1REGX 1HHTP 1GQEA 5D78A 5E41A 2ZZTA 2G13A 2YX1A 3R3TA 4QW8A 1RABB 3VVUA 2HWIA 2Y1RI 1WEXA 5HVGA 3BSNA 1SH0A 4K2JA 2QX0A 1N5YB 1P1LA 1WJ9A 2OPPA 4HACB 4IFVA 1H98A 2VBWA 1RSCA 2BRKA 2F5GA 3R5AA 4HHHA 3GZ7A 4LFBJ 1RUSA 3VHQA 3BBFA 1SL0A 3DU6A 2P8IA 2QFIA 3I5CA 5IT9Y 4QIVA 2C3OA 3AHPA 4CO5A 3G9CA 2DVIA 1EKRA 2H65B 3LGHA 1NHVA 4N76A 4PG7A 3J81U 5IZHA 5A8WA 3I0RB 3BPSP 1UFLA 1WDTA 3GIRA 3PVXA 4NRUA 4TQRA 5CHCB 2B9EA 2GO8A 1RTHB 4U8VA 3VAFA 4K0KF 1T3OA 3ILJA 4GO7X 1FXRA 4QOTA 1ZAWA 2XB2D 3SCLE 5IQQA 2GIQA 1REVB 2JWNA 5L1KA 2CXEA 1C2PA 3MCOA 2E9TA 3CDUA 2MZQA 5G0RB 4B9VA 1YKWA 2QA4S 4F4YA 1UWBB 1GNKA 2DH9A 3CCMS 3KK2B 5BJRA 2KM8C 4RW4B 4C97A 4IR1A 1XWLA 3AXKA 4YB5A 4ZLNA 2AIRB 2HFOA 3MPWA 2OPPB 4IFVB 4ZVHA 1PG5B 4KAIA 4YDXA 3W2WA 1S72S 3TJ9A 2CPIA 4W98A 2QT7A 1UW4A 1R3NA 3GG0A 5KFMA 1U2CA 1WOPA 2YPYA 1MNEA 1CC7A 2LCWA 3PO5A 2A1BA 4WFXA 2R4FA 4CWBA 5A8WB 2H9ZA 5DZ7A 1IBLJ 3DDIA 3ZFVA 1K9MT 2B51A 4RZRA 5AJ3F 4C6AA 3W9IA 5L1JA 2V4JA 3UN2A 4YB1P 2GGPA 5KFFA 4I2QB 3ZXWA 1A6LA 3TZWA 3FDSA 3GB0A 5CZXA 1GXLA 4P2FA 5LSLA 5FD1A 2C3MA 2D9OA 4CLZA 3UDEA 3DFEA 1FX2A 3HSJA 4W4MA 3TAMA 4GKKJ 1WHYA 1TK8A 3SMZA 2A0FB 2Y8WA 4ED3A 3MM8B 4EBDA 1VQ6S 3TVKA 1DTTA 2CJ9A 5KG7A 2VB6A 4CCHA 1U24A 2HVEA 4K7QA 1OYDA 1KLMA 3IXQA 2QL5B 2MZTA 4JV1A 2Z2MA 1Y00A 3W2WB 2HK3A 5LM7E 3MECA 2V69A 2GQCA 3OQ2A 1BY9A 1N36F 3V6DA 4UT4A 2CPDA 4CLWA 2BE2B 1Q7LB 3MM5B 5E3PA 1PJ6A 1ZA1B 4ZKAA 2R7VA 3SV3A 3JTPA 3DM2A 2EEYA 3N28A 2ZVSA 1H7XA 3V5RA 1FJGF 4LRFA 2V4JB 3FUYA 3ZZUA 2GGPB 4JOUA 3NS6A 2OP5A 3AB4B 2H51B 1BQXA 2BACA 1HI0P 2ILZA 5AXNA 2WHOA 4OLPA 4RWXA 1FJCA 2QA2A 2AJ4A 2YNGA 4C0OC 2WONA 4RNOA 3TAMB 1NHKL 2ASLA 5LXRA 2HFVA 1U6BA 1H72C 4M5JA 2YQ0A 2MJUA 2XI2A 3I5BA 2PN6A 2NXNA 2FJVA 1TL4A 3PFOA 2AKWB 4OZ2A 1DTTB 3PX4A 3PY8A 3NS5A 4UOFA 2JL9A 4IO9Q 3T3FA 1NB7A 2HQIA 2FHJD 2B8QA 3RB0A 4NLRA 1KLMB 2DGXA 1OJ4A 5AT1B 3K5LA 3ZNJ1 3MMCA 3MECB 2OO4A 2VKRA 2I5JB 4NLOA 2A6MA 4LR8A 2EFVA 3O6QA 2VPZB 2VQFF 4P74A 1T9XA 3LP2B 3DM2B 1BE4A 3C46A 3BB5A 3D1HA 4QZVB 2LEPA 3TA1A 5IM0A 3PKYA 4DEZA 1YJRA 3MEDA 5HBMB 1C1CA 1X4BA 3HF5A 3HHNB 3FEXB 2XY6A 3NCQA 4CM2A 3I87A 2VIHA 1CJTA 3OW2R 4DV5J 2ZWPA 1SQGA 1QD1A 2C22A 1QAXA 3G87A 4IH6A 1SQFA 2F40A 3PFEA 2M2BA 3GCXP 2CQGA 3CJ0A 2YNGB 2WONB 2HBQB 4I6AA 2ATCB 1LEOA 2H5EA 3RBEA 1B0PA 1XMOJ 3KYLA 4DS5A 1I94J 5JUMA 3G82B 1FWLA 2FDNA 4PG4A 3FSIA 2BQRA 3E2EA 5AE2A 3GIIA 1T9YA 2VZ9A 3AJ2A 3CCZA 2DY1A 4EO6A 2QTWA 4YS2A 1U6ZA 4WXWA 6AT1B 2D3OR 3LP1A 1LK5A 4C48A 1S10A 3VAGA 4CTAA 1FESA 3EICA 1TAUA 3CJ8A 5H9EK 4LF9F 4O23A 4F25A 2RS8A 2DH8A 3BQ0A 2NXCA 3PCOB 2X51A 2HIYA 5IM0B 3FKBA 3K59A 3PXGa 2GJIA 3MEDB 4ECXA 3MUVP 1U2RA 1Q8LA 4X4SA 1C1CB 3MM7A 4ID5A 2RRNA 1CJTB 4JI6F 2UVVA 2ZNYA 4F3QA 2QA1A 3RYLA 3R5DA 2ZBCA 4OV6A 4PYDA 2LMIA 2XC9A 4ES1A 2VC0A 1UAWA 3OL8A 1TVRA 5E5NA 2YKNA 1S6OA 4OI3A 4OJHA 3U02A 5GAHU 1MROA 1Y9OA 4GKJJ 5LSRA 5E3AA 1XN9A 4LFBF 5E3QA 3GG1A 4YB6A 3TVYA 4B3TJ 2IBKA 3LP1B 1XJWB 1U1MA 4KKOA 4PPDA 1URRA 5U47A 1IN0A 1TFWA 3CT9A 1S4EA 3J7YU 4IRCA 4QQBA 4CTAB 5LOQA 3EE3A 1SCJB 1UZDA 2CWKA 3GJRB 3M8ZA 4RUCA 3LGNA 5KT2A 4LF7J 1BGXT 2M52A 3Q8UA 3MEGA 2JLFA 1SKUB 1S9GA 1YIJS 2UUBJ 3CCSS 4RR5A 4ZP6A 2AGQA 3LPEA 3ZTQA 2ZHOA 3A8EA 2KZMA 1T95A 2IYIA 4ZPWR 1IM6A 4DR2J 4MFBA 4MAKA 2BKOA 3MM7B 4ID5B 2DNOA 2BVZA 3D2WA 2ALZA 3ENWA 1AW0A 2XI3A 2VV5A 3WIUA 4URQU 4DF8A 2ZC3A 1Q4RA 3B6BA 4CP5A 3BH6B 1EHWA 1TVRB 2YKNB 4IYQA 2XG8A 2V67A 4DOZA 1M1KT 2FVRA 1U8SA 4MKYA 2W7PA 2OPRA 2BZ2A 3BGRB 2ZC4A 4W92B 3ZZ0A 4UOGA 1VQ7S 1TK5A 4C11A 1S6QA 3D54A 2IHR1 1PYSB 1RLCL 4KKOB 4ZOSA 3OFFA 4I2PB 4TKTA 3OL9A 3M30A 2R3VA 1LV5A 4CO1A 3WC2A 2H48B 3SDEA 3VGUA 2DXDA 5JXSA 4IRDA 1IBLF 1EETA 3MEGB 2UVUA 4W90B 1M5HA 1ZM2A 3T19A 4KFBA 4EGLA 4NMXA 1DY3A 1H74A 5KG3A 3UWTA 4LVOP 2VPYB 1EARA 5KT6A 3LF0A 4QU6A 1JKHB 4DL7A 3C16A 3UN3A 3SCIE 3CUNA 1N34J 3A8KA 4GKKF 4K2XA 1WI8A 2NSBA 3TWZA 4OJGA 1KDNA 4JB8B 4O44B 4ZVOB 1R43A 5LT5A 2W01A 2DGOA 5F0WA 1VIOA 2GV1A 3CTRA 2R8JA 2MKKA 4AYBD 4NLPA 4ILLA 2HWHA 4ZJLA 2MLXA 2JLEA 1JQGA 4C11B 3NAIA 1RWPB 3NGKA 4DSLA 1RT5A 4DF4A 4DUTA 1ZAXA 1FA0A 3B4DA 1NJZA 1X7VA 3M30B 1X9MA 2CJYB 3SDEB 3SXLA 1EETB 1HNIA 3CCVS 4OFZA 4Y65A 3GJSB 3JQKA 3NL0A 3TQ1A 2MZSA 4KFBB 1MLAA 2M8HA 2V50A 1UEKA 4WXOA 1VBXA 2ZOGA 3C15A 3A1YG 1Q53A 4BLGA 1FRXA 4ZJOA 2RDJA 4PWUA 2RJZA 2RHQB 3H42A 4CO3A 3C16B 1S12A 1NSKL 2W8KA 2DPIA 1S0NA 4FXWA 2NREA 3MWBA 4WPAA 2IBOA 4MT1A 2FJDB 2W4PA 1YBAA 4ZPAA 3PYGA 1GX6A 2IPOB 2P6TA 3A4TA 4K4XA 1VHFA 1SH2A 1WDDA 3MPYA 4X2BA 4XO0A 4ED2A 3MEEA 2COLA 3HKZD 2D9PA 2DGTA 5A6WA 2G2OA 2W9CA 3J81Y 1F60B 3W64A 1VFJA 2HFZA 1YITS 1RT5B 1JXLA 3UE2A 4A8OA 3W66A 4ZLLA 1OMSA 1EJ7L 4CLSA 1ZTWA 1B3TA 2LQBA 4DR1J 4LSNA 4PG5A 4X4QA 4N8NA 5BXIA 1HNIB 3D28A 3EDRB 2CPHA 4GO5X 2VKZG 2FGCA 2V2ZA 1SIZA 4K5SA 2VJVA 1JXEA 3KUEA 3E3XA 1X9WA 4DV5F 4HT5A 2O1PA 3C15B 1B64A 4M63A 4I64A 5GAGI 1FI4A 1TL5A 1UP1A 2MDAA 3K8VA 4FXVA 2IIHA 2VASA 3MOZA 2CNKB 3TAPA 4OYOA 1F5AA 3P4UB 4WJBA 3JAMU 1RWXB 1RT3A 3CPWR 3BGLA 1ZYQA 3MEEB 5D4NA 1RE1B 2HHXA 4XPCA 3I56S 1HHQA 4OYAA 4C8LA 2DXFA 2PT0A 4LREA 2W9CB 3M6WA 3M32A 2F3JA 2JJ4D 3BJYA 2Q6BA 1NJIT 2CQ0A 2AJ0A 4UY85 1W25A 5ETTA 2HGMA 2SXLA 5D0HA 4ZPTR 1FNXH 2AZ3A 2JNJA 2NCKL 5KFSA 1H7WA 3VAJA 1DURA 1HNVA 2A2DA 4HH1A 1Q5YA 4LSNB 2W2MP 4KGZB 2BR0A 1KOOA 3THTA 2Z2YB 5IWAJ 2M7SA 1WWHA 3J7YI 2VONA 3W1YC 1H0HB 3UD4P 2KJVA 1UPPA 3VZHA 2OMLA 3VGVA 4D3GA 3O5TB 3IRWP 5HLFA 2DT9A 3M1VA 3V2UC 4PWDA 4OHVA 1RWMB 3DRYA 3M8WA 4A8QA 3KLFA 4FNHA 2VQEF 5KFCA 2V2VA 5KFAA 5C5JA 1O0PA 4GKJF 1RT3B 1YWXA 4ZLPA 4HEA9 4B3TF 3OVSA 1G6BA 3M32B 4ZIVA 2QO3A 1FKAF 4OYIA 1K44A 4MKVA 5E3CA 2PA3A 3EZUA 4ANDA 4LF7F 1OIAA 1AB8A 2QJ3A 3IN5A 1HNVB 2UUBF 2IA6A 4ED8A 1X4EA 3ONQA 4ILMA 2R8HA 4DV2F 1T9TA 4P72A 1SXLA 1RWKB 4ED6A 4B17A 3KG1A 2N3LA 4DR2F 1JWWA 2HSEB 1SC6A 4IKAA 3US5A 1VOMA 2FLNA 1RTJA 3G6VA 3LALA 2AJ2A 3VWSA 3A12A 5LMUJ 2A2CA 3H5SA 3GLJA 3M1VB 2R8KA 3H5XA 3G8QA 5CABA 4DWIA 2CZ9A 5KG1A 5ETVA 1V9OA 4FXDA 4WZMA 5BYQA 4UZCA 2CPYA 2Z30B 5F9NA 2DHXA 4DX6A 5FDLA 4X4UA 3OTOJ 2RT3A 4I6YA 2RF2B 1PBUA 2RMLA 4CLTA 3IBWA 1TV6A 4DFKA 2HAIA 3EZOA 4LF4J 4QPTA 5SUHA 1S48A 1WC3A 4J9QA 2ZBRA 3RB3A 2K7KA 1NPRA 2MLZA 1FEEA 1RAAB 1V5VA 1VBZA 2WSFC 2V8DA 1WACA 1HD1A 1BMQB 2CADA 3M4XA 1U1RA 5LJ5Y 2KZZA 4D3HA 4Y0FA 2AX1A 3HVWA 5CQGA 3D9BA 3MAHA 1T0TV 2B4UA 3ILOA 4DCPB 2YNHA 2YNFA 5CH7B 1RBOB 3C6UA 5B0EA 4M5IA 3M8PA 5A6PA 1RTJB 2XS5A 4ZCIA 2XMVA 2E9ZA 3TNVA 2CPJA 1N34F 1KONA 4H54A 2ZH5A 3TR5A 2KO1A 4MIBA 3AD7C 3KG0A 3SEOA 2CQ3A 3CCJS 3I5AA 4KPCA 1UETA 3NRBA 4ECZA 4J9UE 5EDWA 3H5YA 1UTAA 2DRBA 5FDLB 1EP4A 1DARA 3OFEA 1TV6B 1VQLS 3QNWB 4R8UA 5CD4H 3SBMA 3RBDA 3I4HX 1M5SA 3N0VA 1S1TB 3M8YA 4GVBA 2CRLA 2DNMA 4DN0A 2ZUAA 1XNQJ 2D3ZA 3CVKA 4CLUA 3MMBA 4XDDA 5THWA 4OI4A 4M1KA 3UNYA 2YNHB 3W9JA 2YNFB 1ICEB 3R27A 2CJKA 2K06A 3C6UB 4J37A 1DAXA 5F8IA 3BSCA 3MD3A 1JJ2R 3CE8A 4F7VA 2HNZA 4M5NA 4JI0F 3M8PB 2IMWP 1HNXJ 2JFKA 1ROFA 4DPTA 2MQMA 2BQ3A 2RAQA 1RHKB 1X5OA 4O3RA 4ZPBA 2DGSA 2CJBA 2CG4A 5DG9A 4ED5A 4QR0A 4NE9C 4KPYA 5HMZA 4NYOA 4V19X 4E2FB 3OXFA 4TXSA 3FBCA 1C4AA 2V8HA 1MG7A 4LRDA 3R8YA 1IBMJ 4OHWA 3LAKA 1W2IA 4N47A 4ECUA 4NLSA 1EP4B 2DBBA 5CZVA 4Z37A 4F4WA 5I4MA 2B4PA 2LDIA 4RU9A 4R8UB 1GT8A 4M5GA 2MZJA 4GVBB 1RAIB 1YZ7A 2HRTA 4XIUA 2Z2LA 4C98A 1X0PA 4YB7A 4DR1F 4AE5A 1S49A 3LOUA 4EUVA 1X60A 2OEKA 4ECTA 3MMBB 4CLFA 2UZAA 2CPXA 1WHWA 1HNZJ 1WSRA 3HSDA 1HMVA 5F3ZA 4QR2A 4WIQA 4K59A 2UXCJ 2IVMA 3RZAA 2ZOFA 2BJ7A 3Q22A 4DSEA 1CLFA 4U6PA 1F9EB 5KAKA 2HEKA 1RXOB 2PMHA 1SIWB 2HNZB 1UVLA 4NCAA 1H2TZ 2QC3A 3OLBA 2HHHF 1NEEA 4C8ZA 3GMGA 1RT6A 1S1VA 3OHBA 3HK2A 2C42A 1IKYA 4Z7YA 4RU2A 2MHNA 3T5LA 2WVDA 1SJ4P 2BUNA 1KQKA 3MR6A 1R0BG 1VQNS 1Y3KA 1NU4A 3EDQB 3BN7A 3R5GA 1LNQA 2V94A 2VBXA 1OSDA 2EW9A 1NK0A 3AQPA 2FJXA 3C3LA 3DMJA 1RT4B 4H4KC 2P2CB 1O6XA 3D3BJ 1NDLA 1S0VA 4YN3B 4F04B 4DX7A 1ZM4A 2MZRA 1X4DA 3R2CJ 3L95X 3FJ2A 2QMWA 1NKEA 2MXYA 1FEHA 3TUIC 4DPOA 3Q2TC 1HI8A 2CZ4A 2UXDJ 2OEJA 2QLJB 5A2QY 3UDLA 3SQGA 1XEZA 1DTQA 1HMVB 3M6VA 2PIIA 1N32F 3DLKA 3M6XA 6FDRA 4DV1F 2MQQA 2GNKA 2AU0A 1FRJA 1QAJA 2V4QA 1IJEB 5B09A 2KFNA 5KFJA 5C42A 3MFHA 1R8PA 3AY0A 3OD2A 1BLUA 4ZVFA 2UUWA 3GFZA 1NB2A 2Z0GA 2VA3A 4HDHA 4OI1A 2NPFA 1KFSA 3D7SB 1RT6B 1S1VB 3KLHB 3KLIA 3NWRA 2HWTA 1IKYB 4G1IA 4HI1A 4DSJA 3KHLA 2CPFA 2CQ1A 3J7Z5 4BWMA 2RHSB 3FZBA 2B8PA 1SL1A 4JV5J 3BQ1A 2DIVA 5J2QA 1T9VA 2IRYA 4R0JA 2IRXA 8AT1B 2BABA 1U09A 5EWFA 3R5BA 4DQPA 5KTQA 2HQCA 3DMJB 4LFAJ 4CT8A 4ZCLA 3SCJE 2EFNA 2HVDA 2Q79A 2J0XA 1DRZA 2G0JA 3AH6A 5DLFA 3BSOA 2F4FA 3VZIA 3JSYA 3L3CA 1YX2A 4FPIA 5EUHA 1NK7A 3DYAA 1FVSA 4USKA 1DLOA 2AGPA 1X9SA 2BMBA 1ZZNA 1I1GA 2BE9B 2J8SA 2F8HA 5C7PA 5D0GA 2HZCA 2J7KA 3EGZA 5GVQA 4F67A 2HQ3A 5DQHA 5C42B 4Y34A 3IAS9 2BM0A 4A46A 2Y1LB 2MKYA 4ER8A 4TYAA 1IR0A 3QPIA 1KC8T 2IVFB 4EU0A 4UZBA 4MYUA 1TMMA 3M7VA 3TARA 5LL6d 3UN5A 2QLBB 3PJWA 4NLVA 3PTWA 5GMDA 4YP3A 3OTOF 2KXNB 4F3MA 4C8MA 4C7QA 2R8IA 4LF4F 5F8LA 3AODA 3B82A 5J2QB 4TU8A 4ZCKA 3JSBA 2E5LJ 1OSCA 4DZDA 2F7VA 5ETKA 4QYZJ 1GEHA 2KRRA 2HNDA 3PACA 3VAIA 2N7CA 3M2RA 2KDOA 4LSZB 2XGPA 2QRRA 1N52B 3NBPA 1QSLA 4HTJA 3IRXA 2VBZA 3IG1B 2QYCA 3DYAB 4Y28C 4UOHA 1DLOB 4ZPVR 4I7FB 5ETSA 4B9UA 5DZ6A 3PRVA 1N54B 2GX8A 5ITHA 2RQKA 4RJVA 4C8KA 1QY7A 3EVOA 4DV3J 4DPWA 3IP0A 3KJFB 1KQGB 1E6YA 3JAMY 2W4CA 3QT5A 1SJQA 2PEBA 2ZZMA 3UCGA 3HJVA 2WOMA 3HDSA 3AOCA 4WU3A 3FBFA 1YJ7A 2O67A 4J5OA 1WI6A 4KJIA 4M5MA 2UV8A 3EPGA 2DXEA 1IKVA 5JVHQ 2QYGA 1RAFB 5L8RC 4DUYJ 5J1EA 1N5SA 3NEKA 3O2IA 1QAIA 2DPJA 1HBOB 2DITA 4CLPA 2YX7A 2QN6B 1B7YB 3RJMB 1ZTTA 4IG0A 1RHUB 5E0OA 2HNDB 3M2RB 1RZMA 3DGVA 2KM8B 3H4DA 1XNQF 3UR0A 5DLGA 3ADAC 3NBPB 4DU7A 4K4ZA 2ZH6A 3K5MA 4P71A 3R97A 1ZBTA 3PW2A 3WC0A 3KK1A 4C8NA 4E8UA 3NAHA 4Y2MA 5KFVA 4PWWA 2E5HA 3NS7B 3BGUA 4J7CA 1JLAB 2V34A 1JX4A 2UUCF 2IM2A 2L9DA 2XMAA 1CJKA 3MMAA 5SZTA 2FHJA 3GPAA 2AW0A 2MPUA 3PR5B 4DFPA 1HNXF 2POKA 1KD1T 4EMDA 4ALZA 1R8HA 4H4OA 3BH7B 3TX0A 4N8OA 2WVEA 1E6YB 5D4OA 3TP2A 3PR4A 4X4VA 1RTIA 1U1NA 2WOMB 4ES2A 4OYZA 2B43A 2E9RX 3Q23A 4PRFA 1IBMF 3T5KA 3GR1A 3H4BA 4BBYA 1Y5NB 3GJQB 5ETLA 2QE5A 5K5MA 1IKVB 1R8BA 1N8RT 3T41A 4DFJA 2ILYA 4WU2A 3TA2A 5KT5A 2NLWA 1WC0A 3C8YA 1T3NA 4C8YA 4IG0B 4RNFA 4AFFA 2ZH1A 1IKXA 4X65F 4J9SA 2CNNB 4O4GA 2X1FA 1UMJA 3KNGA 1QSSA 2RS2A 2X1AA 1H3DA 1HNZF 1MN9A 3KK1B 4N41A 2R7TA 1T9UA 1G1XA 2DGQA 1YI2S 4JYAJ 4YQWA 2YWHA 1N5QA 3DOLA 4FF1A 3VALA 1M5PC 1RKJA 3BO3A 4N5SA 4O4RA 5I3QA 5HI7A 2BJ3A 3HP6A 1RK8A 1CJKB 3MMAB 3P8BB 5GAEI 1VJQA 2FZCB 4LF6J 3QLHA 4RWWA 5L46A 3DRRA 2WB1D 2BJDA 4H4OB 2HMIA 3PW4A 4PUOA 4ED1A 1P9YA 1U02A 3A8IA 1RTIB 3RBXA 2ASYA 1UJ4A 2V0NA 3NGSA 2W1BA 2AYMA 2EFGA 3P96A 4KHMA 1SC4B 5KFUA 1U1PA 4MMOA 3QIDA 2ZDOA 2KVIA 1KEKA 4NZ0A 2P5VA 1X5TA 4ZN3A 3CJQA 1UCNA 1X4GA 4JI1J 1RI7A 3IA0A 3WDOA 3K7RA 1NJXA 1J5OB 3ETOA 1VRQC 3N5FA 3HT3A 3B4MA 1IKXB 1JNRB 4O4GB 2HLUA 1KN6A 2VHGA 1RHQB 2BA9A 4RNNA 5EX3A 3CMES 3AXMA 3OSPA 1S6UA 1YJUA 2UXDF 1Y11A 1X8DA 2XLJA 3BN4A 1F5CA 2JDJA 3C14A 2MQ8A 3FRYA 2OEMA 3C2PA 1IQTA 3KJVA 3DOLB 2MJNA 1VRUA 3V4IA 1WEZA 3DLEA 4RL1A 4E98A 3CCWA 4NI2A 4ILRA 4B3RF 4KH0B 5KFKA 2R9LA 4NZ7A 2CVEA 1U1OA 3QLHB 2MQOA 3DRRB 5HO4A 2ROPA 2VH7A 2I1RA 3C6TA 4YHHF 3F41A 3PYEA 1HW9A 2HMIB 2JEJA 1AUDA 4PUOB 2UUAJ 1LKZA 1NAQA 5C2CA 2RH3A 3BSAA 3H90A 4NLQA 4YDDB 2JOQA 5F9LA 4EYHB 4NYZA 4JV5F 2DO4A 5B0DA 4XTTA 2JEFA 1XC9A 4WCEQ 2A6OA 4UUWA 3MURP 1Z2LA 2ZVIA 2DNRA 1Y0HA 3SIPB 4LFAF 5JMNA 4UY8T 2RUSA 4ZS6A 5DQGA 3TRGA 4EEYA 1EZZB 5L39A 1N5TA 3HMJG 3K5NA 1QSYA 4L72B 1FDNA 4USTA 4XK8C 4IOBA 5CXTA 5I42A 2GMLA 2C3PA 3DC2A 3DHXA 1O5JA 4F26A 3HVRA 1NK4A 4ZK7M 3AFGA 1WHVA 3C14B 4PXCA 2XCPA 4NLTA 4M5LA 2W9BA 3KJVB 3ZTSA 1VRUB 3V4IB 4NRTA 3CDAA 3LP0A 1SH3A 1D9FA 2F65A 3QJJA 1AZSA 4WTOB 1YRUA 2M0GB 3OR2B 1YJTA 1QVFR 1B70B 2LECA 4DL2A 3AAWB 1K1SA 4X64J 1TL1A 4HI2A 3R5CA 4KB7A 3G8SA 4J9NA 2LU1A 3C6TB 2V9WA 1QLNA 4Y2CA 4ZITA 2ZHBA 4K4TA 2KKHA 1TKTB 4I56A 4OYXA 2ZOMA 4ATNA 3GWCA 1YJWS 2FLOA 2HPUA 2E7VA 1CEZA 3TOQA 2P9GA 2PFFB 5KT4A 1GAOA 1EAYC 4DI6A 5IT4A 3GFHA 3N4WA 3HVAA 1RAEB 5KFXA 4EZ6A 2E5LF 1NSAA 4G65A 3TZYA 5IC4B 1MU2A 3MTKA 4OQJA 3UCUP 1SL2A 2WVFA 4P52A 2E1MC 4K4VA 4DV6F 4QBUA 2EKNA 3FZ2A 4ZDNA 2FGOA 3PJ9A 4LF8F 5I42B 3LUYA 3DXBA 4LMZA 1NK5A 1FJ7A 4ZVQB 1D09B 2DR6A 3DRSA 3JTNA 2DNYA 4RUAA 4B9MA 2HZAA 1WF0A 3U27A 4WK1A 2W9BB 1Y5IB 1X31C 3W8PA 4DV3F 4WKRA 3IC1A 1RQ0A 4PQAA 4RBTA 2VD3A 2ZDPA 4NA3A 1U49A 5AXLA 1RWWB 1QJHA 2FHOB 2GO9A 4IH5A 1TL1B 3QSIA 1U1LA 3TJAA 2E1CA 2GMJA 4A8XA 3N6NA 3BDEA 4DR6J 3GV8B 2C1EB 1PAEX 4MH8A 1RGVA 2GS8A 3W5YA 1LFWA 3CF5Q 4J9PA 2C2NA 3FVYA 4DUYF 3OXLA 2XEXA 3DOKA 1KP6A 1Y4ZB 3QYYA 1ZH5A 3W5XA 2OPQA 1NPPA 1PSDA 1RYSA 1YG0A 1PGZA 1K0VA 2G2YA 2X1BA 3RUBL 1LXNA 5B7WA 3B78A 2GFFA 4M5DA 1KSPA 2CPZA 5JVGQ 1NMEB 1FXDA 2VG6A 5A8RA 3EXCX 2Z8QA 1XMQJ 2YH0A 7AT1B 2KXHA 1Z1ZA 1F3VA 3JXOA 3DDKA 1AA1B 3QWUA 3HM9A 3I6PA 3HJFA 4RNMA 1TP7A 5K9FA 1OQ3A 3DRSB 2IRUA 4ID8A 1JJ4A 2MHEA 1L3VA 5HATA 5DM7Q 3K58A 1WKKA 4ZMMA 2DGWA 2KI2A 1YGYA 3QT7A 2CAJA 5T41A 1CQMA 4YFUA 5D15A 3L9ZA 4WE1B 1YQHA 2JVOA 1NH8A 1J2VA 2MQLA 5L9XA 2EVZA 1PYTA 2JLGA 2EG2A 1UPMB 1Q0NA 2RILA 3KMQA 1R0AA 2JEIA 4M5HA 4TN2A 4ANEA 1HNWJ 1UWAA 3RAMA 1HPZA 1MSWD 1WSVA 2ZKTA 5HMWA 4JI2F 2YWFA 3CJKA 2KRBA 3DOKB 2EBGA 1Y10A 2KB2A 4YY3J 3ZTOA 3MI7X 2OPQB 2X3GA 3PM9A 4TNOA 2VDIA 3AOBA 4DCOB 2HS0A 1G2EA 2D3O1 3H8YA 2OKQA 2EG1A 2RRBA 5A8RB 4TYBA 1GX5A 2OELA 2XNRA 4Q2LA 2HK2A 3VAHA 4X4PA 4A8YA 1CC8A 5HQLA 2D3UA 5K20B 5DG7A 2AJ1A 5CYMA 1RTDA 4JYAF 3LQVA 1GK8A 3M9OB 1HR0J 4IQMA 5DDRC 2OTLS 1XIQA 3VAKA 2HVZA 2BV3A 4LF6F 2CPEA 2V2KA 3FMWA 1NSQA 2R2TA 4Z2XA 3HLUA 3FK4A 4DR7J 2C2ZB 2WSEC 2VJUA 3OV7A 3D1QA 4A8FA 2M70A 3OJUA 5BR8J 2YKQA 3BO4A 4TU7A 3EJMA 1TZ0A 4PQUA 3JS9A 1WG4A 2DJWA 4CH1A 2ATLA 1L3TA 3R1HA 1HPZB 2E66A 4K8RA 1FRKA 1NNDA 2X7IA 3K5OA 4DU8A 1VDHA 3CJKB 4KC5A 3VGSA 3CDBA 4JI1F 4NEZA 3TZZA 2IJNA 4JI3J 4LF2A 3RR7A 1NDCA 4DQIA 5AXKA 2GVDA 4BS2A 4RUBA 3BO2A 1RA6A 1WELA 1FFGB 1UFWA 5CYMB 3CMAS 1PO6A 1RTDB 2BJEA 3SYZA 3IFEA 1CSJA 2PGCA 2RRAA 2GA7A 4ZP8A 4TQSA 1DQAA 3UD5A 1JXVA 2ASJA 4Q8EA 1S1UA 3CC4S 3W2VA 2AX0A 4G6VB 4QYRA 3D3CJ 4DLGA 1Q78A 4WFZA 2UUAF 3CIZA 5LSOA 2B9WA 2IC3A 4Q2MA 3NNHA 3MF5A 2QFJA 4DSKA 1BHNA 2E1PA 2QZ8A 2CA9A 4PABA 4X4TA 3UDCA 1FDAA 2D1CA 3W7BA 4KGXB 4HR2A 3FC9A 1X5PA 1WF1A 4Q45A 4H4MA 4LUBA 3I31A 3FEYB 3NOGA 1RBAA 2M88A 3RGIA 2KYZA 2UXBF 5KFZA 1LW2A 4ECYA 4RW8A 2CQCA 4P10A 3G4SS 4OZ0A 1XR6A 2XTJP 1KHWA 4ZIWA 2NUHA 3PKMA 2NQPA 2JSXA 2I38A 1S7IA 2V8GA 3J7AN 2HS4A 4UQGA 4ICLA 2DNPA 1IQZA 3PIPQ 3EM1A 4DS4A 4AXJA 2W7AA 2FVPA 4QR1A 2YKAA 3EX7B 3WBZA 3HFVA 2L9WA 2KH9A 4X64F 1S1UB 3W2VB 1WEYA 3SSRA 2J76E 3PW0A 3NGDA 3KLEA 5E2QA 3EVMA 2DO0A 3J7ZT 2IC3B 1S7HA 1DBDA 4JV0A 5KG0A 4U7CA 3KLVA 5I3UA 3Q8SB 4ZCMA 4MIWA 4BCAA 4QCLA 2CG8A 3OR1A 4LRCA 3P5BP 3TYTA 2EBEA 1NZ8A 4P9SA 2IJRA 2KJWA 1VQ9S 3C19A 4LF5F 1VCTA 3HSGA 2W8LA 1TL3A 4ECSA 4OHXA 1R7IA 2I2YA 4H4MB 2DNQA 1UVKA 1VMBA 1AFJA 2DR5A 4NLWA 1VGYA 4M94A 4PR6A 1SKSA 3FSXA 1LW2B 3TO8A 4NA1A 4RW8B 4QYZK 3JYTA 3S1TA 2HQFA 3ZTRA 1WNEA 2H1YA 4DLEA 4EK2A 1GMWD 2R7XA 4ICLB 4Q7AA 2EFQA 3KMSA 4C3KA 4L3NA 1YVFA 4O3SA 3V6DB 2RE1A 1FF2A 1F9FA 5H9EJ 2HHUA 1LW0A 2F9JA 4CO2A 2HGNA 4DL3A 5EX0A 1RU2A 4DR6F 3KLEB 2J7WA 3RRHA 4R25A 2F4VJ 2DD8S 1HBNA 1VR6A 5FJ4A 1Z2ZA 1KQSR 5F41A 5I3UB 3OHAA 5BYRA 1U1KA 3PIOQ 2B5JA 3OR1B 1WC1A 5IQ6A 2CJAA 2BW7A 1NH7A 4OJ1A 3GONA 1GXTA 4J9LA 2EXUA 2CQHA 3CW2C 3RW6A 4Q8FA 2F1FA 2CZVC 4Z7CA 4WKYA 5KFLA 1FT8A 2QV6A 3BQ2A 5KG5A 1XMQF 2PMWA 1NHUA 2ZH2A 1TK0A 3Q8RB 4OLOA 4A47A 5DG8A 3Q24A 2YVSA 2VBYA 3ELHA 1A7GE 2BANA 5IOLA 1WG1A 3JYTB 2DEJA 4X66J 4KGMA 4CLKA 1VQ5S 3MMCB 2QLXA 3GFYA 2Y0SD 1GTHA 5D0EA 4F50A 2G0CA 2GIRA 3NY0A 1N0VC 2LXIA 3CCQS 4F4XA 4ZVTB 4Q0BA 3VCDA 5GAGU 4FNIA 2Q1LA 1LW0B 4MYTA 2B4OA 1LQ9A 4LR7A 4EYIB 2DIUA 3BYRA 3PNIA 2YBVA 2K8GA 1M5VC 2ROGA 4DX5A 1YRXA 5H9FK 1B0VA 1T7PA 4OZLA 4JBCA 2B9YA 5GMKa 3JB9k 1HBNB 4F3OA 1HNWF 3CEDA 4ZJQA 1KVJA 1VBKA 4BC7A 3WX4A 3UQSA 4XPEA 2EKYA 2X3DA 1H73A 2GVZA 1YJ9S 4P75A 3A8JA 4YY3F 4QIWD 4LR9A 2YX4A 4MJKA 5LMNJ 2DRDA 3QZ7A 6FD1A 1HQEA 4DZ6A 1NUEA 2JH3A 2XBPA 3BKFA 4LRAA 3VVTA 4F0KA 4USVA 2HG4A 1B4SA 2BOPA 1ZPVA 3BBBA 5J1PA 2HFNA 1HWKA 3I4PA 2HNYA 2XLKA 3LW5C 3E01A 1S9FA 4KRWA 4NMLA 1TTHB 4MK8A 3OFGA 2KU7A 1VQOS 2B3TB 2BANB 3H2VE 1PILA 1KKHA 1JLQA 2LQ8A 4XDCA 2ZH4A 4LBIA 3PYFA 1HQ2A 3H98A 1UW9A 3O8WA 4Y3CA 2WAQD 1FTCA 1L3UA 3KHHA 5RUBA 4ZVUB 1L3SA 1C1BA 2Y1IA 3BR8A 3D1OA 2HFUA 2UUTA 4DR7F 1S4FA 3CO9A 2UV8G 3PHTA 5BR8F 2C2DA 3D6HB 1QDUB 1KQFB 1NJYA 3RG6A 4J9RA 4OYBA 4QJVA 3PHEA 5D77A 2QMUB 2FQQB 4NLUA 4DXLA 1S59A 3POTA 4OZ3A 1SPBP 3Q2SC 1OYEA 1AUSL 4C0BA 1HWLA 4F36A 4C3MA 2YH1A 2GVZB 2F8EX 3FQLA 5KFYA 3RRGA 3LA0A 2RKIA 1WKLA 2GW8A 4JI3F 1P27B 2FUG9 3GILA 4PXDA 2DISA 2N3OA 5D4PA 2LQ9A 3N6MA 4AUKA 1MROB 3MGJA 1PIEA 4ANCA 1NDKA 4YR0A 3E01B 2H3EB 3HD1A 1LXJA 2BEFA 2GZOA 2BJ1A 3OLAA 3UR3C 4TY9A 1JLQB 2KYXA 3ISNC 4Y2IA 4H4KA 1VQSA 1IVZA 2P9EA 2FPHX 1TUVA 2E7XA 5FLXU 2FHKA 3D4JA 4TVAB 1T02A 1S9GB 9RUBA 3DLJA 4YR2A 4ELTA 3OL7A 3M9NB 2RQCA 1WUUA 4FZVA 2RU3A 2RVJA 4AL7A 3D6MB 1HL6A 2GAHC 4MFBB 5A2QU 2ACMA 2PMZD 2NUUG 2QEXS 1YHQS 4QIGA 3POTB 2ZBIA 3NCRA 2E5IA 3CD6S 4ITSA 3O3LA 4TU9A 2RKIB 2ZD1A 1V3SA 2CKWA 4Y00A 2HHTA 2R7OA 3ULHA 4RW6A 1FHTA 7FD1A 1JK9B 4F0HA 3TUPA 2RQ4A 1AROP 3A13A 1FDBA 2OPRB 3IBCB 4OYMA 3FBBA 1RLDA 4O0NA 2LQJA 3ISND 1ZOTA 4NCBA 5EHHA 1ITPA 1S6QB 2NZCA 3KLGA 1D3WA 4A8KA 2A18A 1IXKA 1RBLA 3W65A 3CDWA 3P45B 5IC6B 3TANA 2NPIA 1WG5A 4RUHA 3P5TL 2CJQA 1JJHA 3HHLC 3KHRA 2D41A 2HHPA 4ECRA 1HWJA 2EC2A 2RDDA 3NGUA 2CNOB 4Q44A 1NBEB 3CDEA 4FPRA 3DGPA 4DR5J 3RAQA 4USWA 1S77D 1RT1A 1OO0B 1S57A 2ZD1B 3CXCR 3NNCA 4RW6B 2ZH9A 5ETPA 3OTBA 1SBRA 4M8LA 2W4DA 3R2DJ 3FNNA 1GXUA 1JLFA 4LBPA 5DGBA 2BKPA 1GMVA 3UNGC 3D67A 2KXFA 3WX8A 2LU2A 5J2PA 4RKUC 3RB6A 3PYDA 3OUYA 4QWDA 3KLGB 4IDKA 3BKTA 1Q16B 2XS7A 3HHLD 2ADCA 3JSRA 1D9AA 1FERA 3DOMA 3ZNUA 4IO1A 4BHQA 2V8PA 2L9NA 1VLOA 2VPXB 3WHIA 1K1QA 2HGLA 1Q79A 1I5OB 3VAMA 5KG6A 2YNIA 2F4VF 1Q7YT 4CQ1A 4LF9J 2V9KA 4P6QA 4OX8A 3KWMA 1P8GA 2J0SD 3DGPB 1YBUA 3KTQA 2AJFE 1RTHA 3ILLA 1RT1B 3MDFA 1U7LA 2AEMA 1UEUA 4EO8A 1UL3A 4C0HA 2XLIA 1XMBA 2VF3A 3OVAA 2ZJRQ 2DR8A 1UJ5A 3PDNA 1XMOF 1V5IB 2AHOB 4X4RA 4FP9A 1I94F 1H2UX 4LIWA 4GC6A 2PDAA 3LWLA 3GV5B 2HRYA 5D3GA 1VQ8S 1FFSB 1JLFB 1WHXA 4YMEA 2HFSA 1RJJA 1JMTA 3H25A 3R9LA 3PX6A 4F02A 4FYVB 1OS5A 3AD8C 1I51B 2DNHA 5J2PB 4X66F 4QWEA 1NKBA 2GJ2A 4P73A 3OUYB 3FCHA 3QAUA 4IDKB 3LWMA 2N82B 4DV7J 2LDYA 3DOMB 3F44A 3AJDA 1ELOA 2FC8A 1ZZFA 4URGA 2KFZA 5ETMA 2YNIB 1Q8KA 1V3ZA 2MMYA 4ZP7A 2GIFA 3HHEA 2I9SA 4RW7A 1N4LA 3EGVA 4B08A 4NXNJ 3KDOA 4X84A 4Q5VA 1Q5VA 3P3DA 4B02A 2Z58B 2MLYA 2BE7D 2LYVA 2AEJA 1V6HA 2HVHA 1NZAA 2DHSA 5LMNF 1HARA 4I2QA 1RWUA 2CVIA 5KFTA 7FDRA 1RCXB 2HZVA 1AXQA 4N7TA 1K73T 2Y8YA 2DTJA 2KG0A 3TJ8A 5KFHA 2IMOA 1BQMA 1SJ1A 4OV1A 4TLRA 3GTYX 3MTJA 5D3GB 2O66A 2GHVC 3DLHA 4BC9A 2DR7A 2IM0A 1N0UA 1RADB 2ZM6J 1QAYA 5B0FA 3I55S 3MM8A 2RB7A 1DQ9A 4P7TA 3ZZOA 1J5EJ 4LBHA 1EIYB 4DHVA 3OTEA 2DGVA 2ROEA 2LXFA 3QT6A 3GFXA 3OBIA 1VC5A 4OX7A 2B6AA 2V8VA 4DFMA 3FBEA 3G96A 3CD0A 3HPOA 1M5OC 8ATCB 2QG9B 2XMJA 3ENAA 1ZAVA 3ZO7A 1S5ZA 3AOAA 3ENQA 1RKIA 2BE2A 1CQNA 3MM5A 1KWMA 2VFUA 1URNA 4RW7B 2AF6A 3IR5B 1T05A 2AD9A 1KOHA 4NEYA 4JI8J 3M8RA 1PCAA 5C24A 1L3KA 4WTYA 1H2VZ 3GJTB 5HLFB 3IGNA 3ZC4A 3MR2A 4PWDB 1FO1A 3H40A 1Y3JA 2IM1A 3ZZPA 3MOJB 1BC6A 4KBIA 2FZKB 1BQMB 3KLFB 4XAKA 4DJBA 1FRHA 3EGNA 1HWUA 3ET6A 3T6BA 1U48A 3U1NA 1T94A 3JSMA 4DPUA 5KOXA 1SC1B 1JIHA 3SI8A 1VLYA 1UVNA 3BDPA 1XTZA 3I9V9 5T7LA 3T1HJ 3D6FB 3GIMA 1Q8BA 4NX9A 4NOHA 1ZPWX 4DR3J 2B6AB 2QGFB 2W24A 2I5JA 3EPIA 2OI2A 4K4UA 4DQQA 2BW2A 1VK8A 2HLTA 1N48A 1VQYA 2H5IB 2VL1A 2J9DA 5K8PA 4A8SA 3NWGA 1FK9A 3LP2A 4FS2A 2ZBQA 4Y6IA 4PEOA 2Y9HA 1T05B 3X1LB 4U96A 1FD2A 3IBFB 2DHHA 4JI7J 8RUCA 5CAAA 2ABYA 4ELVA 5C24B 2HAFA 2IFXA 5HBMA 2J6SA 4LRBA 1EQMA 3IM9A 2MKSA 5DDPC 4ES3A 4DPXA 2B0GA 1BQNA 4UUXA 2XHCA 2CIMA 4M5KA 2DNZA 1P9QC 3J80Y 3GYGA 4UOCA 4M95A 1JLBA 1M1GA 1W26A 3ET6B 1LWFA 2R8GA 4NLGA 2MY7A 4TLQA 4ZPCA 3E8OA 3G82A 2AP6A 3MHYA 1M90T 2FJBB 3QRRA 3JSMB 3T9NA 4ZVEA 3QZ8A 5KT3A 5DGAA 4FBUA 5T7LB 1SVDA 4PXBA 4JI5J 4I69A 4PKDB 2CDQA 3D66A 5LJ3Y 3V6HA 2ADBA 2NXJA 1TL7A 3QWPA 1S99A 4WP8A 1U26A 2RUGA 4OL8A 3NXZA 2DKOB 1FK9B 3PG9A 4DR5F 1SJRA 4K50A 3P49B 2B9XA 2OPSA 3LTOA 1UVIA 1PC4A 3QGGA 4AQYJ 1PJ5A 2UVWA 3K17A 4OHYA 4HYKA 1BQNB 3HT0A 2CQDA 3LPYA 2FLPA 1JLBB 4MKAA 1R8AA 1LWFB 4IUFA 1PYOB 3G8TA 2MKJA 2W2NP 1F3FA 2DCLA 1HBMA 3NMAA 3GE9A 4O3QA 2FLLA 2QA4G 1R6VA 1WOSA 3KFWX 3MPDA 2L48A 1PKUA 2RNEA 3V6JA 2BYCA 3HFZB 3MXHP 5HN0A 4F4AA 3MCSA 2XGQA 2FYXA 4F4ZA 2H4YB 3T1YJ 3V6KA 3CCLS 2AEFA 2BRLA 1NK6A 5JJBA 1TL7B 4NPOA 4ECWA 2XM3A 4LVNP 4NL5A 3MPVA 2HHVA 1JJCB 2NS1B 4PXEA 5K14A 4AT1B 3EUNA 1U0SA 3G6YA 2KFYA 2OPSB 5A76A 2M8DB 3EXYA 5ETRA 5F8GA 2QLWA 1YDLA 4LQ9A 4NA2A 1XNRJ 1RISA 2KL8A 2VOPA 2VU5A 1HHSA 2OLWA 1HW8A 5H1SV 2EPIA 1B0TA 3MPUB 4NYPA 2J9CA 3GU0A 3CIMA 4FKYA 2QSWA 4JI4J 1TFYA 4G3IA 1R0CB 2VQEJ 5FLXY 2XO7A 1JLEA 1HBMB 3BGRA 2DK2A 4ECVA 4DV7F 1RTZA 1CPZA 1O8BA 1RYRA 4UW2A 3KKFA 4HHJA 4AXIA 1U47A 3BPDA 1EX8A 3PRDA 2VUGA 5GAEU 1BUXA 2B7BB 3DRPA 3T9ZA 2FJWA 1BXNA 2VG5A 4I2PA 2OUGA 2ZE2A 1CG2A 3J7A1 3PEHA 1U0HA 1FKOA 5HMXA 5IWAF 1UVMA 5HVHA 5HAOA 4NXNF 1RDRA 3O44A 1FCAA 1BWVA 4QWCA 3D0IE 1U25A 5K14B 2MSTA 3CC2S 2HHQA 3SSSA 2KTQA 4NLXA 3DHWC 1U4BA 1WORA 4DV2J 2XHWA 3ZZZA 2OSRA 1FRIA 2KVQE 1IBKJ 5B0CA 1D9DA 3R5JB 2PE8A 1RAOA 2KHDA 2YKMA 4OYPA 1JKHA 5DDOC 1MN7A 2LQ5A 2ZBPA 3BEGB 3U1MA 1XERA 1KR4A
chains in the Genus database with same CATH topology
1NSKL 1NSPA 1NDPA 2AZ1A 1UCNA 1KDNA 3PRVA 1BE4A 3EICA 3MPDA 4UOGA 1WKJA 3NGRA 1HLWA 1VYAA 3WX8A 1PKUA 1ZS6A 1XIQA 3VVUA 3Q8VA 3EVOA 1F6TA 3EE3A 2CWKA 1PAEX 3VGVA 4DI6A 4F4AA 1W7WA 3R9LA 1MN9A 3Q86A 2ZUAA 5CAAA 3FCVA 3G2XA 3Q8YA 1NSQA 3EMTA 3BBFA 2B8PA 3Q8UA 1BUXA 1NHKL 1S59A 3FKBA 3GP9A 3GPAA 3VGUA 1JXVA 4F36A 4ANEA 4DUTA 2DXDA 4DZ6A 1NUEA 1NDLA 3EM1A 3NGUA 2HVEA 3ZTQA 3FCWA 3ZTRA 4W98A 3VVTA 3BH7B 3EJMA 3FBFA 1WKLA 1HIYA 3ETMA 1LEOA 4EK2A 5CABA 1LWXA 1B4SA 3JS9A 3ELHA 3B54A 2HVDA 1HHQA 5IOLA 2DXFA 3VGTA 3BBBA 3PJ9A 2DXEA 2HURA 4UOFA 3ZTOA 1B99A 3DKDA 4ENOA 4WBFA 2B8QA 3Q83A 4KPCA 3ZTSA 3EVMA 3NGTA 1BHNA 3VGSA 4ANCA 1NDKA 1XQIA 3DDIA 3Q89A 4FKXA 3BBCA 2DY9A 4S0MA 5BXIA 3FBEA 4C6AA 1S57A 3NGSA 3ENAA 1NCLA 2VU5A 3B6BA 2AZ3A 1NPKA 1S5ZA 3BH6B 2NCKL 4CP5A 3L7UA 1NLKL 2BEFA 1EHWA 1U8WA 1K44A 3ZTPA 1NDCA 1MN7A 3EVWA 3FBBA 1F3FA 3FBCA 4O0NA 4ANDA 5C7PA 4HR2A 2BX6A 3FC9A 4UOHA 4FKYA 1NB2A 1WKKA 2DYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NSK L;  1NSP A;  1NDP A;  2AZ1 A;  1UCN A;  1KDN A;  3PRV A;  1BE4 A;  3EIC A;  3MPD A;  4UOG A;  1WKJ A;  3NGR A;  1HLW A;  1VYA A;  3WX8 A;  1PKU A;  1ZS6 A;  1XIQ A;  3VVU A;  3Q8V A;  3EVO A;  1F6T A;  3EE3 A;  2CWK A;  1PAE X;  3VGV A;  4DI6 A;  4F4A A;  1W7W A;  3R9L A;  1MN9 A;  3Q86 A;  2ZUA A;  5CAA A;  3FCV A;  3G2X A;  3Q8Y A;  1NSQ A;  3EMT A;  3BBF A;  2B8P A;  3Q8U A;  1BUX A;  1NHK L;  1S59 A;  3FKB A;  3GP9 A;  3GPA A;  3VGU A;  1JXV A;  4F36 A;  4ANE A;  4DUT A;  2DXD A;  4DZ6 A;  1NUE A;  1NDL A;  3EM1 A;  3NGU A;  2HVE A;  3ZTQ A;  3FCW A;  3ZTR A;  4W98 A;  3VVT A;  3BH7 B;  3EJM A;  3FBF A;  1WKL A;  1HIY A;  3ETM A;  1LEO A;  4EK2 A;  5CAB A;  1LWX A;  1B4S A;  3JS9 A;  3ELH A;  3B54 A;  2HVD A;  1HHQ A;  5IOL A;  2DXF A;  3VGT A;  3BBB A;  3PJ9 A;  2DXE A;  2HUR A;  4UOF A;  3ZTO A;  1B99 A;  3DKD A;  4ENO A;  4WBF A;  2B8Q A;  3Q83 A;  4KPC A;  3ZTS A;  3EVM A;  3NGT A;  1BHN A;  3VGS A;  4ANC A;  1NDK A;  1XQI A;  3DDI A;  3Q89 A;  4FKX A;  3BBC A;  2DY9 A;  4S0M A;  5BXI A;  3FBE A;  4C6A A;  1S57 A;  3NGS A;  3ENA A;  1NCL A;  2VU5 A;  3B6B A;  2AZ3 A;  1NPK A;  1S5Z A;  3BH6 B;  2NCK L;  4CP5 A;  3L7U A;  1NLK L;  2BEF A;  1EHW A;  1U8W A;  1K44 A;  3ZTP A;  1NDC A;  1MN7 A;  3EVW A;  3FBB A;  1F3F A;  3FBC A;  4O0N A;  4AND A;  5C7P A;  4HR2 A;  2BX6 A;  3FC9 A;  4UOH A;  4FKY A;  1NB2 A;  1WKK A;  2DYA A; 
#chains in the Genus database with same CATH topology
 1W2B R;  4P7V A;  4LFC J;  2MTL A;  4USM A;  2ZM6 F;  3WQP A;  2XWX A;  1ZS6 A;  1J5E F;  4KO0 A;  3KG4 A;  4O44 A;  2FVQ A;  4UQT A;  2E29 A;  5D8H B;  1YK9 A;  1L5U A;  4USJ C;  4B3M J;  4FBT A;  1JLE B;  4FYW B;  4OI2 A;  2N7Y A;  4G1Q A;  3HZE A;  1FDD A;  1U2F A;  1Y5L B;  3DRP B;  1RT7 A;  2YWG A;  3ETM A;  4JP8 A;  2VG5 B;  5CYQ A;  2ZE2 B;  3SQG B;  1DTQ B;  2HUR A;  2CJX B;  1U0H B;  3QGI A;  2FZG B;  2N4D A;  1FKO B;  1RU1 A;  2EFP A;  3Q83 A;  3PX0 A;  1CJV A;  3DLK B;  4ZN1 A;  1JB0 C;  1RHR B;  3SV4 A;  3CGI A;  1FRM A;  2IDE A;  4CO4 A;  2OAU A;  4S0M A;  4P2S A;  4JI8 F;  4KQZ A;  5LMU F;  1OY8 A;  2XS2 A;  3H59 A;  5KFR A;  2H54 B;  4FYX B;  4KT0 C;  4A4J A;  3KLI B;  2U1A A;  2CYY A;  4RBU A;  2YKM B;  3PW5 A;  5K8O A;  2PO4 A;  5KFQ A;  2YPZ A;  1SV5 A;  4EI2 A;  4RLE A;  4EZ9 A;  2Z56 B;  2ZKU A;  5EWG A;  1SUQ A;  4DV4 J;  3BKU A;  2BQU A;  2EWH A;  4WFN Q;  2ALY B;  3W9H A;  4KO0 B;  3HI9 A;  2YXL A;  3EWG A;  2JHE A;  2AV5 A;  2XYH B;  3D5M A;  4RW9 A;  1EB0 A;  2YKO A;  2BM1 A;  3FCW A;  2R7R A;  2QIF A;  1F2H A;  3T1H F;  3D6T B;  2A3J A;  4G1Q B;  4U67 Q;  4O3O A;  4JV2 A;  5IXU A;  1ZM9 A;  3SFG A;  3LAM A;  2FTR A;  4DR3 F;  2O01 C;  3M2U A;  5CYJ A;  1PBA A;  1X4C A;  3MZI A;  3TX8 A;  2IY5 B;  1RT7 B;  4C4W A;  1F9H A;  1IKW A;  2IVY A;  5FII A;  5EWE A;  5CYQ B;  5F3T A;  1RWV B;  1MWY A;  4G1P A;  4USI A;  3L7U A;  1CJV B;  2B56 A;  1TR0 A;  3NMR A;  4JI7 F;  2GMH A;  2VG7 A;  3G86 A;  5DRK A;  1FVQ A;  4QWB A;  2I8E A;  2NXU A;  3SQO P;  3HHK A;  5IS2 A;  5F8M A;  1S79 A;  4F4K A;  1W7W A;  4JI0 J;  1TKD A;  3UW1 A;  5KT7 A;  3G6X A;  3RW7 A;  1DHM A;  1SV5 B;  2G1H A;  1DZ5 A;  4CYU A;  4O3P A;  2G4B A;  1SUQ B;  4ETX A;  4CH0 S;  4I0W A;  4WWS A;  4NXM J;  2CQ4 A;  2CQP A;  4ZHR A;  4DQR A;  4OZJ A;  2HQG A;  3K8W A;  2CQ2 A;  1FD8 A;  5K8N A;  3B54 A;  5LXY A;  2EK6 A;  2J9E A;  2AYG A;  5F8H A;  4RW9 B;  4DUZ J;  2V4R A;  1KLN A;  3VQS A;  3MR3 A;  5KFE A;  4DL0 C;  4JI5 F;  4BWJ A;  2CFX A;  3IRX B;  1V3R A;  3M2U B;  3A3N B;  4ELU A;  3OT9 A;  3QBC A;  4FYY B;  4WP9 A;  2WSC C;  4KGV B;  4CDI A;  4PPZ A;  2DGU A;  1NPK A;  2AYB A;  4URS A;  2IAJ A;  1IKW B;  3AQO A;  3O1L A;  4CNZ A;  3ISZ A;  3BYP A;  5HL7 Q;  3V81 A;  2F63 A;  1NSP A;  4U9R A;  1LWC A;  1NXI A;  2LP4 A;  2QLF B;  1KNZ A;  1PC5 A;  2YQ3 A;  3BV8 A;  5EGY A;  4KR0 B;  2R7S A;  2VG7 B;  5DM6 Q;  2L3M A;  4J9M A;  2Q3P A;  3UI3 A;  2MZ1 A;  1FKP A;  3DNC A;  4AQY F;  1S76 D;  4HTI A;  4IOC Q;  1GMW A;  1VC6 A;  5C25 A;  5L1L A;  4X4O A;  1ZET A;  2M5Y A;  2HKE A;  2CDR B;  3K5P A;  1SB6 A;  5HRO A;  3GSI A;  2DNL A;  1I3O B;  4HHU A;  1FE4 A;  2HHH J;  3CB4 A;  1RT2 A;  2G9O A;  2PC6 A;  4PG6 A;  2H4W B;  4CYU B;  1S1W A;  4IFY A;  1U6F A;  4MK9 A;  3G71 S;  5J1E B;  1UVJ A;  3P6Y C;  1M1H A;  3W63 A;  4ZHR B;  1RB0 A;  4Y2A A;  2ZJP Q;  3NG8 A;  5MAO A;  2JC0 A;  2GHW A;  4NLD A;  1WF2 A;  4LSL A;  1VBY A;  3BRE A;  4L76 A;  2CQB A;  1YRT A;  2MYF A;  3CCR S;  4KV8 A;  1RWO B;  1J27 A;  5J2M A;  2NSC A;  2ZFH A;  1I6J A;  2HQD A;  2WW8 A;  4UTG A;  3T1Y F;  3ITH A;  1NDP A;  5GAH I;  2DEI A;  2AMC B;  2IAJ B;  2UXC F;  3PRB A;  3VV2 B;  5BYS A;  3UPF A;  2PSZ A;  3V81 B;  3IWN C;  1IUJ A;  5HMY A;  1YTY A;  1HWI A;  4ECQ A;  1X4A A;  1LWC B;  2O5D A;  3AD9 C;  1RA7 A;  4WII A;  4HVZ A;  3K57 A;  1N32 J;  4O3N A;  1IWG A;  1FKP B;  4DV1 J;  5K8M A;  2RDI A;  1DFD A;  4C3L A;  3DLB A;  5C25 B;  2LEB A;  3S7R A;  1XNR F;  4PCQ A;  5HSP A;  3OJS A;  2UP1 A;  2WVB A;  2HS3 A;  4CM0 A;  3MCN A;  5HRO B;  3MM9 A;  5KFP A;  2FY8 A;  2KT2 A;  5HJX A;  3CWJ A;  4DL4 A;  1BWE A;  1RT2 B;  1JLC A;  1S1W B;  4EWT A;  4IFY B;  4JI4 F;  2OH2 A;  4FDF A;  4DBQ A;  4OX9 J;  4I67 A;  3ENV A;  2YWE A;  2RF2 A;  1NCL A;  2XZD B;  3ICL A;  4YUD A;  1OY6 A;  2J9D E;  4LSL B;  3RU0 A;  1RWN B;  4DR4 J;  2G2Z A;  2PFD A;  1KTQ A;  5J1N A;  4B9N A;  4KV8 B;  4QIF A;  4DG1 A;  5J2M B;  2C28 A;  2JEG A;  1VQK S;  2P9C A;  1F0X A;  2UU9 J;  4K4S A;  1T11 A;  3ITH B;  3TZX A;  3QJP A;  3R7N B;  5A8K A;  2R7U A;  1AYE A;  4GC7 A;  1QE1 A;  3QQC D;  2Q66 A;  4LJM A;  3PV8 A;  1FRL A;  3TEH B;  2FC9 A;  5AE3 A;  4MK7 A;  3PEJ A;  4IH7 A;  3T1A A;  3H7H B;  1R31 A;  5CD4 A;  1FNM A;  2WW4 A;  1WC5 A;  1IBK F;  4GMK A;  2C2E A;  2XSJ A;  3VGT A;  1T9W A;  4CI0 B;  3DKD A;  3R7S B;  2IJF A;  4JUZ A;  3UFC X;  2E1R A;  2MY8 A;  1TU0 B;  2WK4 A;  3NGT A;  3MM9 B;  4OIX A;  3Q8P B;  1G3O A;  2A10 A;  4LFC F;  1SI9 A;  2MQP A;  3R7B B;  3Q89 A;  2LEA A;  5KFN A;  3ILI A;  4P2X A;  4IR9 A;  1JLC B;  1NLK L;  3TW0 A;  5M2R A;  4FN5 A;  5AXM A;  3CCE S;  1N5V A;  1GFW B;  4B3O A;  2W25 A;  1SC3 B;  4B3M F;  3NNA A;  1YBT A;  3KNA A;  1S1X A;  2FD2 A;  3GYX B;  5DJB A;  2MQN A;  1VIS A;  3QJL A;  3M9M B;  2MGZ A;  2WTF A;  3SCK E;  1AT1 B;  2GQQ A;  2AGO A;  2ZHA A;  1S1T A;  4DG1 B;  4V1A k;  4CNY A;  4CIO A;  4U7U K;  3G2X A;  4FF3 A;  1UKU A;  4J90 A;  1P1T A;  2F8M A;  2E1A A;  1FJE B;  3CJT A;  4DSF A;  1HQU A;  1Q81 T;  5A8K B;  1R27 B;  4IRK A;  2DNK A;  1QE1 B;  3DLE B;  5KOW A;  2OD6 A;  2OHD A;  5ETN A;  1OY9 A;  1VHI A;  4NI2 B;  1F5B A;  3HKW A;  2WBR A;  3HFK A;  5F8N A;  5A0Y A;  1RHM B;  4WFA Q;  5KFI A;  3KUH A;  3J81 j;  3BF4 A;  2LLZ A;  1TKX A;  1A9N B;  3HVT A;  3NCP A;  2XSJ B;  1TMJ A;  2BXJ A;  2QL7 B;  2Y1J A;  1DQ8 A;  2P6S A;  1GH8 A;  2AQ4 A;  1KBR A;  2I6W A;  5KFO A;  4OX6 A;  1FFW B;  2KG1 A;  4DV4 F;  2NYH A;  4EBC A;  4YR3 A;  1HFE L;  4ZVG A;  1KFD A;  3T5H A;  1RCO B;  4B3O B;  3NGR A;  1S1X B;  2YTC A;  3IWX A;  3MMJ A;  1VQM S;  3HD2 A;  4FF4 A;  4MIA A;  5F0U A;  4P2M A;  2HRU A;  2W2O P;  2MGZ B;  2R2U A;  1KHV A;  3L7O A;  1CUL A;  3FCV A;  5KFW A;  2ZH3 A;  3NKY A;  2WZ1 A;  2BJ9 A;  2RIJ A;  2LA6 A;  4LT6 A;  4C9D A;  1VI7 A;  4B9L A;  3CUL A;  2DH7 A;  4PZV A;  4KSE B;  3NP5 A;  3OTD A;  2FJE B;  1HQU B;  4CRJ A;  1UFK A;  4IQX A;  3MAA A;  4QPX A;  2J6T A;  2VA2 A;  3ZZT A;  3LP0 B;  5HP1 A;  1N6Q A;  1AZS B;  4NCG A;  2XY7 A;  1S0O A;  4I4B A;  1P6T A;  2MKH A;  4V19 J;  5A0Y B;  2UUC J;  4K4Y A;  4OHZ A;  2HW3 A;  1TKX B;  3HVT B;  1D8Y A;  3K0J A;  3QT8 A;  2FVS A;  4CT9 A;  3S8S A;  2RSQ A;  2Z2Z A;  2VPW B;  1U45 A;  4DMZ A;  1ULR A;  2DHG A;  1VYA A;  3H2U B;  4NXM F;  2OGU A;  3TVZ A;  2KT5 A;  4CO0 A;  2LKZ A;  4X4N A;  2YWK A;  3PZP A;  1UA1 A;  2PD1 A;  2JC1 A;  4DUZ F;  1MU2 B;  2RQM A;  3EZ5 A;  3VQT A;  3GP9 A;  3QGH A;  3SSQ A;  4KHR A;  2W2P P;  1CUL B;  1RT4 A;  2Q6C A;  3CJ3 A;  3DLG A;  4USU A;  5B0B A;  1LWX A;  4CLY A;  1WTB A;  4PYA A;  5DQI A;  4X65 J;  4OMF G;  2PEH A;  3GQC A;  1C0T A;  2CQI A;  1RAG B;  3OL6 A;  2QMX A;  2E44 A;  2C2R A;  1C4C A;  2GQ2 A;  1K47 A;  1PJ7 A;  3CJ5 A;  2BBE A;  3MAA B;  1YJV A;  3GIK A;  1EKS A;  3RRK A;  2M4M A;  5HP1 B;  2GAG C;  1N6Q B;  3GIJ A;  3IR7 B;  1ZA2 B;  4NCG B;  4OZ1 A;  2BOA A;  4F2R A;  1IM4 A;  2GJF A;  1Q1K A;  4F0M A;  3ZZY A;  3HHL A;  1C0U A;  1GTE A;  3F0N A;  3NLC A;  4HH0 A;  2F9D A;  3KLH A;  4EBE A;  4E0D A;  1QM9 A;  4WK3 A;  3DCA A;  2J0W A;  1QTM A;  5D6G A;  1WOO A;  3N01 A;  5I3P A;  4L73 A;  1G4C A;  3QAT A;  4M5D B;  5EN1 A;  4HL9 A;  1FTR A;  2Z4P A;  1HIY A;  1RAJ A;  5HJY A;  3GR0 A;  4RPF A;  3FGV A;  4RNH A;  2VG6 B;  4B3S J;  3H20 A;  2X1G A;  4DSI A;  2YQ1 A;  4CLL A;  2VFR A;  1MMN A;  3DLG B;  3HUL A;  2V6A A;  4MTP A;  1N56 A;  1NO8 A;  1IJF B;  1CS4 A;  1G7C B;  3K2Y A;  3BBC A;  1C0T B;  4FF2 A;  4UF4 A;  1RP5 A;  3CD5 A;  2XCA A;  3VF0 B;  3AT1 B;  1QTN B;  4HT7 A;  2RD5 C;  4DPY A;  5CA5 A;  2BX6 A;  3HXM A;  4ZP9 A;  2V68 A;  5KG4 A;  1SJF A;  3D0G E;  1Q82 T;  1K0T A;  3H2L A;  2XY5 A;  5T14 A;  2AZ1 A;  5HAN A;  3DI6 A;  2BKN A;  2XMW A;  4DN9 A;  4IOA Q;  3HO1 A;  5E33 A;  4FYD A;  5G4D A;  2VOO A;  4GVL A;  2GC8 A;  4L75 A;  4B3R J;  4L6V 3;  2ZH7 A;  3HHL B;  3QRP A;  1C0U B;  2AJQ A;  1LK7 A;  1R0A B;  4HKQ A;  2XO6 A;  1N33 J;  5KFB A;  2E5J A;  2I0X A;  2BDP A;  2K1R A;  2B7C B;  3L09 A;  4YHH J;  1APS A;  3QFW A;  4J91 A;  3HHD A;  2OFG X;  3PO4 A;  2GCF A;  1X0F A;  3OTC A;  3RB4 A;  1ACM B;  4OX9 F;  4EFA C;  2PI5 A;  4FVM A;  4QIE A;  2R2R A;  3MFI A;  4ED7 A;  3QO9 A;  3RAX A;  2U2F A;  1LFP A;  1IR1 A;  3BM7 A;  2VFT A;  4DR4 F;  1T8E A;  5HVF A;  2QL9 B;  2OTJ S;  3DU5 A;  4RO0 A;  2XQC A;  3RR8 A;  2FY1 A;  2UU9 F;  3IGV A;  3T6J A;  2VDH A;  1QVG R;  4IG3 A;  2IDL A;  1CS4 B;  3EVW A;  2K3I A;  2ZNZ A;  3IG1 A;  4KGK A;  1UJ6 A;  1R89 A;  2RU9 A;  2DYA A;  5HQ8 A;  5ETQ A;  1F2G A;  5B08 A;  4Q43 A;  2C2M B;  1Q8I A;  4I7F A;  5GME A;  2OD4 A;  3IM8 A;  4QU7 A;  2HHS A;  2FVC A;  5M2P A;  3DI6 B;  4OI6 A;  4NLY A;  2HBZ B;  2DCU B;  3S6E A;  3MEK A;  3CJS A;  1XR7 A;  2ZUG A;  2VFV A;  4PQU B;  5IT9 U;  2MEW A;  3KUG A;  4QW9 A;  2K1R B;  1S9E A;  1VJW A;  5MLC V;  2V2Q A;  3FEZ A;  4MKB A;  9ATC B;  1OQ6 A;  2ERR A;  2KHC A;  1ZM3 A;  1O51 A;  2WCX A;  3QO9 B;  1MWQ A;  1HBO A;  2DY9 A;  2XMK A;  2YWW A;  4TY8 A;  3ZZR A;  1AFI A;  1IR2 A;  4U7U D;  2HVI A;  2LA4 A;  3W3S A;  2Y3Y A;  2HYI B;  2GVD B;  5CCL A;  2IM3 A;  2HBR B;  4A8W A;  3X3U A;  4R0E A;  2IA0 A;  2W9A A;  3UD3 P;  4DV6 J;  2C2K B;  4IG3 B;  2YKP A;  4USH A;  1TUG B;  4LF8 J;  5B0A A;  4DV0 J;  3R1L A;  1NRK A;  4FVC A;  3RBZ A;  4ERD A;  1JLA A;  4DX8 H;  5DDQ C;  2NXE A;  1XBW A;  3MUM P;  4KH1 B;  2XZT B;  3TA0 A;  4U95 A;  2C3U A;  4ZPD A;  1TAQ A;  4PAA A;  3TI0 A;  3I82 A;  2JX2 A;  2O3D A;  3W60 A;  3SZ2 A;  2EC0 A;  1S9E B;  3QFH A;  1JLG A;  3K89 A;  2NR0 A;  1NK9 A;  3IMQ J;  2JFD A;  3M2V A;  3CO0 P;  3I9Z A;  3MR5 A;  4NAS A;  1OWX A;  5M2U A;  3LAN A;  1VQ4 S;  3UVJ A;  4TY8 B;  3W5Z A;  2J0Q D;  1S0M A;  3L4B C;  3KXD A;  4YEA A;  1Q95 G;  1F1B B;  3DN9 A;  1VS3 A;  1WC6 A;  2ZEJ A;  1XR5 A;  4BDP A;  1N88 A;  1HKA A;  1RAC B;  3OXG A;  1UZH A;  3Q8Y A;  2R42 A;  3L7P A;  4LQ3 A;  3I96 A;  4K5R A;  1KVI A;  3M8Q A;  3EYZ A;  2D7S A;  3QSY B;  1CJU A;  4B9T A;  2D69 A;  1VQP S;  4KTQ A;  3Q0A A;  4I68 A;  4AL5 A;  4AD6 A;  3DXS X;  1B7F A;  2XMT A;  2XSF A;  3JQM A;  3GSD A;  3CD7 A;  3A3O B;  2ACY A;  3THV A;  4X62 J;  1K8A T;  5H9F J;  2WB4 A;  2OJ3 A;  1H6K X;  5IT0 A;  2XNQ A;  4FKX A;  1TQL A;  4U8Y A;  4NWB A;  4KYZ A;  1X4H A;  3KHG A;  3JQJ A;  5DS7 A;  3D68 A;  1JLG B;  3U1L A;  1SQE A;  1FX4 A;  2V63 A;  4NZ6 A;  3MAQ A;  5L1I A;  1RHJ B;  3M2V B;  2CNL B;  3CSK A;  2MSS A;  2R2S A;  1TL3 B;  3QGP A;  3KOA A;  4JI2 J;  3IS9 A;  2J7U A;  1U1Q A;  3D0H E;  3UVJ B;  2L08 A;  2HBY B;  4FS1 A;  1YZ6 A;  1J5O A;  1VRT A;  3V4M A;  5IV3 A;  1HD0 A;  2G0I A;  4KHP J;  2PA8 D;  3KJQ B;  3M8S A;  5KFD A;  5CCM A;  3J80 U;  4DL6 A;  4PG8 A;  3DLL Q;  4L74 A;  4Y2K A;  2XYG B;  3DDN A;  1S6P A;  2L41 A;  2DNN A;  4KY3 A;  3R6G B;  3CNQ P;  2MB0 B;  4WP3 A;  5B0G A;  4I6W A;  4J9K A;  2CUY A;  3M8Q B;  2JZ5 A;  4CH7 A;  3A3P B;  3LO3 A;  2J6U A;  1CJU B;  3QRQ A;  5GAD U;  1B99 A;  2DRA A;  2KT3 A;  4OI0 A;  3QIP A;  4ENO A;  2H5J B;  4WYW A;  3GV7 B;  4DCJ B;  5C2G A;  3U7J A;  3DRX A;  3HX9 A;  1Z4U A;  2D74 B;  4ZLJ A;  3IWL A;  3ZTP A;  1YSJ A;  2UVR A;  2Y0B B;  5E3R A;  3TAQ A;  3FRZ A;  3MD1 A;  1FWK A;  3N6L A;  3LGM A;  2B5J B;  4K0K J;  1WKJ A;  1UEV A;  1QUP A;  1TEL A;  1D0E A;  3CMQ A;  3CCT A;  2EFO A;  1F6T A;  2MKI A;  1RAH B;  4ZVS B;  2ZWO A;  3H5U A;  3IS9 B;  4B3S F;  3IR6 B;  4F8R A;  1X5S A;  4ED4 A;  2C3Y A;  2G1D A;  4DDF A;  4HLB A;  4I1T A;  4K4W A;  3MUT P;  4WFB Q;  1VRT B;  2YY3 A;  1HR0 F;  4R5P A;  3TQE A;  2V5H G;  3UDV A;  2K3K A;  1S6P B;  2K2P A;  4ZVR B;  2BJ8 A;  5HQM A;  4CZC A;  3RTV A;  4Q0B B;  3TEG A;  2E7W A;  1VK3 A;  3QIP B;  2DR9 A;  2PI4 A;  4ZVP B;  1EQ0 A;  1D8Z A;  1NM2 A;  4DL5 A;  3OR2 A;  1FWP A;  2HHW A;  2LVW A;  1N33 F;  3IAM 9;  2FIU A;  3BS9 A;  5AJ3 J;  5AE1 A;  1LWE A;  1A0O B;  1TKT A;  3W8G A;  3OSN A;  4KE5 A;  1MWZ A;  3FQK A;  1R8C A;  1HYS A;  1R6Y A;  3AA9 A;  1HQE B;  3EMT A;  1YLX A;  3QMQ A;  4B9S A;  5D0R A;  4OZ5 A;  2XMU A;  2DB1 A;  1XK8 A;  4GRS A;  3FSY A;  3BR9 A;  4L3K A;  3M6U A;  1DJ0 A;  3C66 A;  2FJA B;  3PJX A;  1HBU A;  2HNY B;  2OMO A;  4WZQ A;  2FB0 A;  2Z57 B;  2N4C A;  3THP A;  4R5P B;  1TUW A;  4RX6 A;  1LOU A;  5E7O B;  4WFY A;  2QSF A;  2UXB J;  2GHP A;  2APO A;  1FE0 A;  3N5B A;  3KJN B;  2M3D A;  3MM6 A;  1OPZ A;  3WIV A;  2B4V A;  1C1B B;  3TUJ C;  5L38 A;  1KS2 A;  1M5K C;  3CJ2 A;  1N36 J;  1WD6 A;  2ZH8 A;  3TUZ C;  1HLW A;  1YJN S;  4WYL A;  4J9O A;  1Q86 T;  5F8J A;  2MKC A;  3G6E S;  4DQS A;  1FJG J;  3B8H A;  5DO2 A;  1KTV A;  1LWE B;  3R6L B;  3FMB A;  2DHA A;  5L9N A;  1SJ3 P;  3AJ1 A;  1FNO A;  2C2O B;  1HYS B;  3BGF A;  1CBK A;  3VR1 A;  3M05 A;  1VIX A;  2EI5 A;  3MR7 A;  4LF1 A;  1OPI A;  1IWA A;  2OSQ A;  3OFH A;  2LXU A;  3BGO P;  2NYI A;  4WBF A;  1MML A;  3CJ4 A;  4LF5 J;  2NZ4 A;  3HZG A;  2LFV A;  3IO1 A;  1HBU B;  2R7W A;  3EGW B;  2ASD A;  3H0P A;  1MW7 A;  2JVR A;  4C8O A;  1UA0 A;  5KFG A;  5IV4 A;  3S01 A;  5DET A;  4DV0 F;  2ZIT A;  4RBV A;  2WBM A;  1KVK A;  4N56 A;  3GCW P;  4A48 A;  3CJR A;  2J8A A;  3MM6 B;  4WF9 Q;  3W61 A;  3I0S A;  2ZZN A;  2CWX A;  1KRP A;  2VQF J;  3W62 A;  3Q86 A;  3FFI A;  1HA1 A;  4OJ3 A;  4WE1 A;  1JNZ B;  3T5J A;  1BD6 A;  4N77 A;  5IFM A;  2VOD A;  3SFU A;  2AWZ A;  4A8M P;  3OPK A;  3N9U C;  1SKR A;  1TKZ A;  3MCM A;  4F2S A;  3N79 A;  2J5A A;  3CC7 S;  5ETO A;  3VTI A;  2AYE A;  4ETZ A;  4QWA A;  2VFS A;  3HCX A;  3PW7 A;  3NOC A;  2JRS A;  4O0I A;  2HIQ A;  1NJW A;  4ZA1 A;  3UO0 A;  1WTF A;  2FHM A;  1NKC A;  3WZ0 A;  2VIC A;  3KK3 A;  3BZQ A;  2K7J A;  1XQI A;  5J2N A;  2Q43 A;  3AB2 B;  1E6V A;  2M9K A;  1T03 A;  4LIR A;  4AL6 A;  3HSZ A;  2XYP B;  2OIH A;  2E5G A;  4C2M A;  4OZN A;  3CCU S;  1HI1 A;  1M0S A;  4KIA A;  1IBC B;  1N5Y A;  4OYW A;  2KN4 A;  4HAC A;  2XZW A;  5KG2 A;  2W2Q P;  2OFH X;  3F56 A;  1FXL A;  3QAE A;  3Q8V A;  1S97 A;  2VC1 A;  3GYN A;  3KDN A;  3I32 A;  1VC0 A;  4X62 F;  2R7Q A;  2XWY A;  3I0S B;  5ADZ A;  3UCZ P;  3Q8Q B;  3I0R A;  4HDG A;  3FFI B;  3F73 A;  5HK4 A;  1X4F A;  3LH2 S;  2WRM A;  2EK1 A;  2AT1 B;  1SKW A;  5D4L A;  1MMD A;  5GAD I;  3E51 A;  1TKZ B;  3AA8 A;  2XMM A;  3JTO A;  3OVB A;  1QUV A;  1REV A;  2IYG A;  2XUL A;  1CVJ A;  1PAU B;  5G0R A;  4JI6 J;  1UWB A;  4ED0 A;  1NK8 A;  2ZJQ Q;  2DNG A;  3KK2 A;  4J9V A;  1U8W A;  1H38 A;  4YOE A;  2W7O A;  2WVC A;  1WC4 A;  3KK3 B;  4RW4 A;  5J2N B;  1D1U A;  1E6V B;  1Y7P A;  1GMU A;  4KHP F;  1T03 B;  1REG X;  1HHT P;  1GQE A;  5D78 A;  5E41 A;  2ZZT A;  2G13 A;  2YX1 A;  3R3T A;  4QW8 A;  1RAB B;  3VVU A;  2HWI A;  2Y1R I;  1WEX A;  5HVG A;  3BSN A;  1SH0 A;  4K2J A;  2QX0 A;  1N5Y B;  1P1L A;  1WJ9 A;  2OPP A;  4HAC B;  4IFV A;  1H98 A;  2VBW A;  1RSC A;  2BRK A;  2F5G A;  3R5A A;  4HHH A;  3GZ7 A;  4LFB J;  1RUS A;  3VHQ A;  3BBF A;  1SL0 A;  3DU6 A;  2P8I A;  2QFI A;  3I5C A;  5IT9 Y;  4QIV A;  2C3O A;  3AHP A;  4CO5 A;  3G9C A;  2DVI A;  1EKR A;  2H65 B;  3LGH A;  1NHV A;  4N76 A;  4PG7 A;  3J81 U;  5IZH A;  5A8W A;  3I0R B;  3BPS P;  1UFL A;  1WDT A;  3GIR A;  3PVX A;  4NRU A;  4TQR A;  5CHC B;  2B9E A;  2GO8 A;  1RTH B;  4U8V A;  3VAF A;  4K0K F;  1T3O A;  3ILJ A;  4GO7 X;  1FXR A;  4QOT A;  1ZAW A;  2XB2 D;  3SCL E;  5IQQ A;  2GIQ A;  1REV B;  2JWN A;  5L1K A;  2CXE A;  1C2P A;  3MCO A;  2E9T A;  3CDU A;  2MZQ A;  5G0R B;  4B9V A;  1YKW A;  2QA4 S;  4F4Y A;  1UWB B;  1GNK A;  2DH9 A;  3CCM S;  3KK2 B;  5BJR A;  2KM8 C;  4RW4 B;  4C97 A;  4IR1 A;  1XWL A;  3AXK A;  4YB5 A;  4ZLN A;  2AIR B;  2HFO A;  3MPW A;  2OPP B;  4IFV B;  4ZVH A;  1PG5 B;  4KAI A;  4YDX A;  3W2W A;  1S72 S;  3TJ9 A;  2CPI A;  4W98 A;  2QT7 A;  1UW4 A;  1R3N A;  3GG0 A;  5KFM A;  1U2C A;  1WOP A;  2YPY A;  1MNE A;  1CC7 A;  2LCW A;  3PO5 A;  2A1B A;  4WFX A;  2R4F A;  4CWB A;  5A8W B;  2H9Z A;  5DZ7 A;  1IBL J;  3DDI A;  3ZFV A;  1K9M T;  2B51 A;  4RZR A;  5AJ3 F;  4C6A A;  3W9I A;  5L1J A;  2V4J A;  3UN2 A;  4YB1 P;  2GGP A;  5KFF A;  4I2Q B;  3ZXW A;  1A6L A;  3TZW A;  3FDS A;  3GB0 A;  5CZX A;  1GXL A;  4P2F A;  5LSL A;  5FD1 A;  2C3M A;  2D9O A;  4CLZ A;  3UDE A;  3DFE A;  1FX2 A;  3HSJ A;  4W4M A;  3TAM A;  4GKK J;  1WHY A;  1TK8 A;  3SMZ A;  2A0F B;  2Y8W A;  4ED3 A;  3MM8 B;  4EBD A;  1VQ6 S;  3TVK A;  1DTT A;  2CJ9 A;  5KG7 A;  2VB6 A;  4CCH A;  1U24 A;  2HVE A;  4K7Q A;  1OYD A;  1KLM A;  3IXQ A;  2QL5 B;  2MZT A;  4JV1 A;  2Z2M A;  1Y00 A;  3W2W B;  2HK3 A;  5LM7 E;  3MEC A;  2V69 A;  2GQC A;  3OQ2 A;  1BY9 A;  1N36 F;  3V6D A;  4UT4 A;  2CPD A;  4CLW A;  2BE2 B;  1Q7L B;  3MM5 B;  5E3P A;  1PJ6 A;  1ZA1 B;  4ZKA A;  2R7V A;  3SV3 A;  3JTP A;  3DM2 A;  2EEY A;  3N28 A;  2ZVS A;  1H7X A;  3V5R A;  1FJG F;  4LRF A;  2V4J B;  3FUY A;  3ZZU A;  2GGP B;  4JOU A;  3NS6 A;  2OP5 A;  3AB4 B;  2H51 B;  1BQX A;  2BAC A;  1HI0 P;  2ILZ A;  5AXN A;  2WHO A;  4OLP A;  4RWX A;  1FJC A;  2QA2 A;  2AJ4 A;  2YNG A;  4C0O C;  2WON A;  4RNO A;  3TAM B;  1NHK L;  2ASL A;  5LXR A;  2HFV A;  1U6B A;  1H72 C;  4M5J A;  2YQ0 A;  2MJU A;  2XI2 A;  3I5B A;  2PN6 A;  2NXN A;  2FJV A;  1TL4 A;  3PFO A;  2AKW B;  4OZ2 A;  1DTT B;  3PX4 A;  3PY8 A;  3NS5 A;  4UOF A;  2JL9 A;  4IO9 Q;  3T3F A;  1NB7 A;  2HQI A;  2FHJ D;  2B8Q A;  3RB0 A;  4NLR A;  1KLM B;  2DGX A;  1OJ4 A;  5AT1 B;  3K5L A;  3ZNJ 1;  3MMC A;  3MEC B;  2OO4 A;  2VKR A;  2I5J B;  4NLO A;  2A6M A;  4LR8 A;  2EFV A;  3O6Q A;  2VPZ B;  2VQF F;  4P74 A;  1T9X A;  3LP2 B;  3DM2 B;  1BE4 A;  3C46 A;  3BB5 A;  3D1H A;  4QZV B;  2LEP A;  3TA1 A;  5IM0 A;  3PKY A;  4DEZ A;  1YJR A;  3MED A;  5HBM B;  1C1C A;  1X4B A;  3HF5 A;  3HHN B;  3FEX B;  2XY6 A;  3NCQ A;  4CM2 A;  3I87 A;  2VIH A;  1CJT A;  3OW2 R;  4DV5 J;  2ZWP A;  1SQG A;  1QD1 A;  2C22 A;  1QAX A;  3G87 A;  4IH6 A;  1SQF A;  2F40 A;  3PFE A;  2M2B A;  3GCX P;  2CQG A;  3CJ0 A;  2YNG B;  2WON B;  2HBQ B;  4I6A A;  2ATC B;  1LEO A;  2H5E A;  3RBE A;  1B0P A;  1XMO J;  3KYL A;  4DS5 A;  1I94 J;  5JUM A;  3G82 B;  1FWL A;  2FDN A;  4PG4 A;  3FSI A;  2BQR A;  3E2E A;  5AE2 A;  3GII A;  1T9Y A;  2VZ9 A;  3AJ2 A;  3CCZ A;  2DY1 A;  4EO6 A;  2QTW A;  4YS2 A;  1U6Z A;  4WXW A;  6AT1 B;  2D3O R;  3LP1 A;  1LK5 A;  4C48 A;  1S10 A;  3VAG A;  4CTA A;  1FES A;  3EIC A;  1TAU A;  3CJ8 A;  5H9E K;  4LF9 F;  4O23 A;  4F25 A;  2RS8 A;  2DH8 A;  3BQ0 A;  2NXC A;  3PCO B;  2X51 A;  2HIY A;  5IM0 B;  3FKB A;  3K59 A;  3PXG a;  2GJI A;  3MED B;  4ECX A;  3MUV P;  1U2R A;  1Q8L A;  4X4S A;  1C1C B;  3MM7 A;  4ID5 A;  2RRN A;  1CJT B;  4JI6 F;  2UVV A;  2ZNY A;  4F3Q A;  2QA1 A;  3RYL A;  3R5D A;  2ZBC A;  4OV6 A;  4PYD A;  2LMI A;  2XC9 A;  4ES1 A;  2VC0 A;  1UAW A;  3OL8 A;  1TVR A;  5E5N A;  2YKN A;  1S6O A;  4OI3 A;  4OJH A;  3U02 A;  5GAH U;  1MRO A;  1Y9O A;  4GKJ J;  5LSR A;  5E3A A;  1XN9 A;  4LFB F;  5E3Q A;  3GG1 A;  4YB6 A;  3TVY A;  4B3T J;  2IBK A;  3LP1 B;  1XJW B;  1U1M A;  4KKO A;  4PPD A;  1URR A;  5U47 A;  1IN0 A;  1TFW A;  3CT9 A;  1S4E A;  3J7Y U;  4IRC A;  4QQB A;  4CTA B;  5LOQ A;  3EE3 A;  1SCJ B;  1UZD A;  2CWK A;  3GJR B;  3M8Z A;  4RUC A;  3LGN A;  5KT2 A;  4LF7 J;  1BGX T;  2M52 A;  3Q8U A;  3MEG A;  2JLF A;  1SKU B;  1S9G A;  1YIJ S;  2UUB J;  3CCS S;  4RR5 A;  4ZP6 A;  2AGQ A;  3LPE A;  3ZTQ A;  2ZHO A;  3A8E A;  2KZM A;  1T95 A;  2IYI A;  4ZPW R;  1IM6 A;  4DR2 J;  4MFB A;  4MAK A;  2BKO A;  3MM7 B;  4ID5 B;  2DNO A;  2BVZ A;  3D2W A;  2ALZ A;  3ENW A;  1AW0 A;  2XI3 A;  2VV5 A;  3WIU A;  4URQ U;  4DF8 A;  2ZC3 A;  1Q4R A;  3B6B A;  4CP5 A;  3BH6 B;  1EHW A;  1TVR B;  2YKN B;  4IYQ A;  2XG8 A;  2V67 A;  4DOZ A;  1M1K T;  2FVR A;  1U8S A;  4MKY A;  2W7P A;  2OPR A;  2BZ2 A;  3BGR B;  2ZC4 A;  4W92 B;  3ZZ0 A;  4UOG A;  1VQ7 S;  1TK5 A;  4C11 A;  1S6Q A;  3D54 A;  2IHR 1;  1PYS B;  1RLC L;  4KKO B;  4ZOS A;  3OFF A;  4I2P B;  4TKT A;  3OL9 A;  3M30 A;  2R3V A;  1LV5 A;  4CO1 A;  3WC2 A;  2H48 B;  3SDE A;  3VGU A;  2DXD A;  5JXS A;  4IRD A;  1IBL F;  1EET A;  3MEG B;  2UVU A;  4W90 B;  1M5H A;  1ZM2 A;  3T19 A;  4KFB A;  4EGL A;  4NMX A;  1DY3 A;  1H74 A;  5KG3 A;  3UWT A;  4LVO P;  2VPY B;  1EAR A;  5KT6 A;  3LF0 A;  4QU6 A;  1JKH B;  4DL7 A;  3C16 A;  3UN3 A;  3SCI E;  3CUN A;  1N34 J;  3A8K A;  4GKK F;  4K2X A;  1WI8 A;  2NSB A;  3TWZ A;  4OJG A;  1KDN A;  4JB8 B;  4O44 B;  4ZVO B;  1R43 A;  5LT5 A;  2W01 A;  2DGO A;  5F0W A;  1VIO A;  2GV1 A;  3CTR A;  2R8J A;  2MKK A;  4AYB D;  4NLP A;  4ILL A;  2HWH A;  4ZJL A;  2MLX A;  2JLE A;  1JQG A;  4C11 B;  3NAI A;  1RWP B;  3NGK A;  4DSL A;  1RT5 A;  4DF4 A;  4DUT A;  1ZAX A;  1FA0 A;  3B4D A;  1NJZ A;  1X7V A;  3M30 B;  1X9M A;  2CJY B;  3SDE B;  3SXL A;  1EET B;  1HNI A;  3CCV S;  4OFZ A;  4Y65 A;  3GJS B;  3JQK A;  3NL0 A;  3TQ1 A;  2MZS A;  4KFB B;  1MLA A;  2M8H A;  2V50 A;  1UEK A;  4WXO A;  1VBX A;  2ZOG A;  3C15 A;  3A1Y G;  1Q53 A;  4BLG A;  1FRX A;  4ZJO A;  2RDJ A;  4PWU A;  2RJZ A;  2RHQ B;  3H42 A;  4CO3 A;  3C16 B;  1S12 A;  1NSK L;  2W8K A;  2DPI A;  1S0N A;  4FXW A;  2NRE A;  3MWB A;  4WPA A;  2IBO A;  4MT1 A;  2FJD B;  2W4P A;  1YBA A;  4ZPA A;  3PYG A;  1GX6 A;  2IPO B;  2P6T A;  3A4T A;  4K4X A;  1VHF A;  1SH2 A;  1WDD A;  3MPY A;  4X2B A;  4XO0 A;  4ED2 A;  3MEE A;  2COL A;  3HKZ D;  2D9P A;  2DGT A;  5A6W A;  2G2O A;  2W9C A;  3J81 Y;  1F60 B;  3W64 A;  1VFJ A;  2HFZ A;  1YIT S;  1RT5 B;  1JXL A;  3UE2 A;  4A8O A;  3W66 A;  4ZLL A;  1OMS A;  1EJ7 L;  4CLS A;  1ZTW A;  1B3T A;  2LQB A;  4DR1 J;  4LSN A;  4PG5 A;  4X4Q A;  4N8N A;  5BXI A;  1HNI B;  3D28 A;  3EDR B;  2CPH A;  4GO5 X;  2VKZ G;  2FGC A;  2V2Z A;  1SIZ A;  4K5S A;  2VJV A;  1JXE A;  3KUE A;  3E3X A;  1X9W A;  4DV5 F;  4HT5 A;  2O1P A;  3C15 B;  1B64 A;  4M63 A;  4I64 A;  5GAG I;  1FI4 A;  1TL5 A;  1UP1 A;  2MDA A;  3K8V A;  4FXV A;  2IIH A;  2VAS A;  3MOZ A;  2CNK B;  3TAP A;  4OYO A;  1F5A A;  3P4U B;  4WJB A;  3JAM U;  1RWX B;  1RT3 A;  3CPW R;  3BGL A;  1ZYQ A;  3MEE B;  5D4N A;  1RE1 B;  2HHX A;  4XPC A;  3I56 S;  1HHQ A;  4OYA A;  4C8L A;  2DXF A;  2PT0 A;  4LRE A;  2W9C B;  3M6W A;  3M32 A;  2F3J A;  2JJ4 D;  3BJY A;  2Q6B A;  1NJI T;  2CQ0 A;  2AJ0 A;  4UY8 5;  1W25 A;  5ETT A;  2HGM A;  2SXL A;  5D0H A;  4ZPT R;  1FNX H;  2AZ3 A;  2JNJ A;  2NCK L;  5KFS A;  1H7W A;  3VAJ A;  1DUR A;  1HNV A;  2A2D A;  4HH1 A;  1Q5Y A;  4LSN B;  2W2M P;  4KGZ B;  2BR0 A;  1KOO A;  3THT A;  2Z2Y B;  5IWA J;  2M7S A;  1WWH A;  3J7Y I;  2VON A;  3W1Y C;  1H0H B;  3UD4 P;  2KJV A;  1UPP A;  3VZH A;  2OML A;  3VGV A;  4D3G A;  3O5T B;  3IRW P;  5HLF A;  2DT9 A;  3M1V A;  3V2U C;  4PWD A;  4OHV A;  1RWM B;  3DRY A;  3M8W A;  4A8Q A;  3KLF A;  4FNH A;  2VQE F;  5KFC A;  2V2V A;  5KFA A;  5C5J A;  1O0P A;  4GKJ F;  1RT3 B;  1YWX A;  4ZLP A;  4HEA 9;  4B3T F;  3OVS A;  1G6B A;  3M32 B;  4ZIV A;  2QO3 A;  1FKA F;  4OYI A;  1K44 A;  4MKV A;  5E3C A;  2PA3 A;  3EZU A;  4AND A;  4LF7 F;  1OIA A;  1AB8 A;  2QJ3 A;  3IN5 A;  1HNV B;  2UUB F;  2IA6 A;  4ED8 A;  1X4E A;  3ONQ A;  4ILM A;  2R8H A;  4DV2 F;  1T9T A;  4P72 A;  1SXL A;  1RWK B;  4ED6 A;  4B17 A;  3KG1 A;  2N3L A;  4DR2 F;  1JWW A;  2HSE B;  1SC6 A;  4IKA A;  3US5 A;  1VOM A;  2FLN A;  1RTJ A;  3G6V A;  3LAL A;  2AJ2 A;  3VWS A;  3A12 A;  5LMU J;  2A2C A;  3H5S A;  3GLJ A;  3M1V B;  2R8K A;  3H5X A;  3G8Q A;  5CAB A;  4DWI A;  2CZ9 A;  5KG1 A;  5ETV A;  1V9O A;  4FXD A;  4WZM A;  5BYQ A;  4UZC A;  2CPY A;  2Z30 B;  5F9N A;  2DHX A;  4DX6 A;  5FDL A;  4X4U A;  3OTO J;  2RT3 A;  4I6Y A;  2RF2 B;  1PBU A;  2RML A;  4CLT A;  3IBW A;  1TV6 A;  4DFK A;  2HAI A;  3EZO A;  4LF4 J;  4QPT A;  5SUH A;  1S48 A;  1WC3 A;  4J9Q A;  2ZBR A;  3RB3 A;  2K7K A;  1NPR A;  2MLZ A;  1FEE A;  1RAA B;  1V5V A;  1VBZ A;  2WSF C;  2V8D A;  1WAC A;  1HD1 A;  1BMQ B;  2CAD A;  3M4X A;  1U1R A;  5LJ5 Y;  2KZZ A;  4D3H A;  4Y0F A;  2AX1 A;  3HVW A;  5CQG A;  3D9B A;  3MAH A;  1T0T V;  2B4U A;  3ILO A;  4DCP B;  2YNH A;  2YNF A;  5CH7 B;  1RBO B;  3C6U A;  5B0E A;  4M5I A;  3M8P A;  5A6P A;  1RTJ B;  2XS5 A;  4ZCI A;  2XMV A;  2E9Z A;  3TNV A;  2CPJ A;  1N34 F;  1KON A;  4H54 A;  2ZH5 A;  3TR5 A;  2KO1 A;  4MIB A;  3AD7 C;  3KG0 A;  3SEO A;  2CQ3 A;  3CCJ S;  3I5A A;  4KPC A;  1UET A;  3NRB A;  4ECZ A;  4J9U E;  5EDW A;  3H5Y A;  1UTA A;  2DRB A;  5FDL B;  1EP4 A;  1DAR A;  3OFE A;  1TV6 B;  1VQL S;  3QNW B;  4R8U A;  5CD4 H;  3SBM A;  3RBD A;  3I4H X;  1M5S A;  3N0V A;  1S1T B;  3M8Y A;  4GVB A;  2CRL A;  2DNM A;  4DN0 A;  2ZUA A;  1XNQ J;  2D3Z A;  3CVK A;  4CLU A;  3MMB A;  4XDD A;  5THW A;  4OI4 A;  4M1K A;  3UNY A;  2YNH B;  3W9J A;  2YNF B;  1ICE B;  3R27 A;  2CJK A;  2K06 A;  3C6U B;  4J37 A;  1DAX A;  5F8I A;  3BSC A;  3MD3 A;  1JJ2 R;  3CE8 A;  4F7V A;  2HNZ A;  4M5N A;  4JI0 F;  3M8P B;  2IMW P;  1HNX J;  2JFK A;  1ROF A;  4DPT A;  2MQM A;  2BQ3 A;  2RAQ A;  1RHK B;  1X5O A;  4O3R A;  4ZPB A;  2DGS A;  2CJB A;  2CG4 A;  5DG9 A;  4ED5 A;  4QR0 A;  4NE9 C;  4KPY A;  5HMZ A;  4NYO A;  4V19 X;  4E2F B;  3OXF A;  4TXS A;  3FBC A;  1C4A A;  2V8H A;  1MG7 A;  4LRD A;  3R8Y A;  1IBM J;  4OHW A;  3LAK A;  1W2I A;  4N47 A;  4ECU A;  4NLS A;  1EP4 B;  2DBB A;  5CZV A;  4Z37 A;  4F4W A;  5I4M A;  2B4P A;  2LDI A;  4RU9 A;  4R8U B;  1GT8 A;  4M5G A;  2MZJ A;  4GVB B;  1RAI B;  1YZ7 A;  2HRT A;  4XIU A;  2Z2L A;  4C98 A;  1X0P A;  4YB7 A;  4DR1 F;  4AE5 A;  1S49 A;  3LOU A;  4EUV A;  1X60 A;  2OEK A;  4ECT A;  3MMB B;  4CLF A;  2UZA A;  2CPX A;  1WHW A;  1HNZ J;  1WSR A;  3HSD A;  1HMV A;  5F3Z A;  4QR2 A;  4WIQ A;  4K59 A;  2UXC J;  2IVM A;  3RZA A;  2ZOF A;  2BJ7 A;  3Q22 A;  4DSE A;  1CLF A;  4U6P A;  1F9E B;  5KAK A;  2HEK A;  1RXO B;  2PMH A;  1SIW B;  2HNZ B;  1UVL A;  4NCA A;  1H2T Z;  2QC3 A;  3OLB A;  2HHH F;  1NEE A;  4C8Z A;  3GMG A;  1RT6 A;  1S1V A;  3OHB A;  3HK2 A;  2C42 A;  1IKY A;  4Z7Y A;  4RU2 A;  2MHN A;  3T5L A;  2WVD A;  1SJ4 P;  2BUN A;  1KQK A;  3MR6 A;  1R0B G;  1VQN S;  1Y3K A;  1NU4 A;  3EDQ B;  3BN7 A;  3R5G A;  1LNQ A;  2V94 A;  2VBX A;  1OSD A;  2EW9 A;  1NK0 A;  3AQP A;  2FJX A;  3C3L A;  3DMJ A;  1RT4 B;  4H4K C;  2P2C B;  1O6X A;  3D3B J;  1NDL A;  1S0V A;  4YN3 B;  4F04 B;  4DX7 A;  1ZM4 A;  2MZR A;  1X4D A;  3R2C J;  3L95 X;  3FJ2 A;  2QMW A;  1NKE A;  2MXY A;  1FEH A;  3TUI C;  4DPO A;  3Q2T C;  1HI8 A;  2CZ4 A;  2UXD J;  2OEJ A;  2QLJ B;  5A2Q Y;  3UDL A;  3SQG A;  1XEZ A;  1DTQ A;  1HMV B;  3M6V A;  2PII A;  1N32 F;  3DLK A;  3M6X A;  6FDR A;  4DV1 F;  2MQQ A;  2GNK A;  2AU0 A;  1FRJ A;  1QAJ A;  2V4Q A;  1IJE B;  5B09 A;  2KFN A;  5KFJ A;  5C42 A;  3MFH A;  1R8P A;  3AY0 A;  3OD2 A;  1BLU A;  4ZVF A;  2UUW A;  3GFZ A;  1NB2 A;  2Z0G A;  2VA3 A;  4HDH A;  4OI1 A;  2NPF A;  1KFS A;  3D7S B;  1RT6 B;  1S1V B;  3KLH B;  3KLI A;  3NWR A;  2HWT A;  1IKY B;  4G1I A;  4HI1 A;  4DSJ A;  3KHL A;  2CPF A;  2CQ1 A;  3J7Z 5;  4BWM A;  2RHS B;  3FZB A;  2B8P A;  1SL1 A;  4JV5 J;  3BQ1 A;  2DIV A;  5J2Q A;  1T9V A;  2IRY A;  4R0J A;  2IRX A;  8AT1 B;  2BAB A;  1U09 A;  5EWF A;  3R5B A;  4DQP A;  5KTQ A;  2HQC A;  3DMJ B;  4LFA J;  4CT8 A;  4ZCL A;  3SCJ E;  2EFN A;  2HVD A;  2Q79 A;  2J0X A;  1DRZ A;  2G0J A;  3AH6 A;  5DLF A;  3BSO A;  2F4F A;  3VZI A;  3JSY A;  3L3C A;  1YX2 A;  4FPI A;  5EUH A;  1NK7 A;  3DYA A;  1FVS A;  4USK A;  1DLO A;  2AGP A;  1X9S A;  2BMB A;  1ZZN A;  1I1G A;  2BE9 B;  2J8S A;  2F8H A;  5C7P A;  5D0G A;  2HZC A;  2J7K A;  3EGZ A;  5GVQ A;  4F67 A;  2HQ3 A;  5DQH A;  5C42 B;  4Y34 A;  3IAS 9;  2BM0 A;  4A46 A;  2Y1L B;  2MKY A;  4ER8 A;  4TYA A;  1IR0 A;  3QPI A;  1KC8 T;  2IVF B;  4EU0 A;  4UZB A;  4MYU A;  1TMM A;  3M7V A;  3TAR A;  5LL6 d;  3UN5 A;  2QLB B;  3PJW A;  4NLV A;  3PTW A;  5GMD A;  4YP3 A;  3OTO F;  2KXN B;  4F3M A;  4C8M A;  4C7Q A;  2R8I A;  4LF4 F;  5F8L A;  3AOD A;  3B82 A;  5J2Q B;  4TU8 A;  4ZCK A;  3JSB A;  2E5L J;  1OSC A;  4DZD A;  2F7V A;  5ETK A;  4QYZ J;  1GEH A;  2KRR A;  2HND A;  3PAC A;  3VAI A;  2N7C A;  3M2R A;  2KDO A;  4LSZ B;  2XGP A;  2QRR A;  1N52 B;  3NBP A;  1QSL A;  4HTJ A;  3IRX A;  2VBZ A;  3IG1 B;  2QYC A;  3DYA B;  4Y28 C;  4UOH A;  1DLO B;  4ZPV R;  4I7F B;  5ETS A;  4B9U A;  5DZ6 A;  3PRV A;  1N54 B;  2GX8 A;  5ITH A;  2RQK A;  4RJV A;  4C8K A;  1QY7 A;  3EVO A;  4DV3 J;  4DPW A;  3IP0 A;  3KJF B;  1KQG B;  1E6Y A;  3JAM Y;  2W4C A;  3QT5 A;  1SJQ A;  2PEB A;  2ZZM A;  3UCG A;  3HJV A;  2WOM A;  3HDS A;  3AOC A;  4WU3 A;  3FBF A;  1YJ7 A;  2O67 A;  4J5O A;  1WI6 A;  4KJI A;  4M5M A;  2UV8 A;  3EPG A;  2DXE A;  1IKV A;  5JVH Q;  2QYG A;  1RAF B;  5L8R C;  4DUY J;  5J1E A;  1N5S A;  3NEK A;  3O2I A;  1QAI A;  2DPJ A;  1HBO B;  2DIT A;  4CLP A;  2YX7 A;  2QN6 B;  1B7Y B;  3RJM B;  1ZTT A;  4IG0 A;  1RHU B;  5E0O A;  2HND B;  3M2R B;  1RZM A;  3DGV A;  2KM8 B;  3H4D A;  1XNQ F;  3UR0 A;  5DLG A;  3ADA C;  3NBP B;  4DU7 A;  4K4Z A;  2ZH6 A;  3K5M A;  4P71 A;  3R97 A;  1ZBT A;  3PW2 A;  3WC0 A;  3KK1 A;  4C8N A;  4E8U A;  3NAH A;  4Y2M A;  5KFV A;  4PWW A;  2E5H A;  3NS7 B;  3BGU A;  4J7C A;  1JLA B;  2V34 A;  1JX4 A;  2UUC F;  2IM2 A;  2L9D A;  2XMA A;  1CJK A;  3MMA A;  5SZT A;  2FHJ A;  3GPA A;  2AW0 A;  2MPU A;  3PR5 B;  4DFP A;  1HNX F;  2POK A;  1KD1 T;  4EMD A;  4ALZ A;  1R8H A;  4H4O A;  3BH7 B;  3TX0 A;  4N8O A;  2WVE A;  1E6Y B;  5D4O A;  3TP2 A;  3PR4 A;  4X4V A;  1RTI A;  1U1N A;  2WOM B;  4ES2 A;  4OYZ A;  2B43 A;  2E9R X;  3Q23 A;  4PRF A;  1IBM F;  3T5K A;  3GR1 A;  3H4B A;  4BBY A;  1Y5N B;  3GJQ B;  5ETL A;  2QE5 A;  5K5M A;  1IKV B;  1R8B A;  1N8R T;  3T41 A;  4DFJ A;  2ILY A;  4WU2 A;  3TA2 A;  5KT5 A;  2NLW A;  1WC0 A;  3C8Y A;  1T3N A;  4C8Y A;  4IG0 B;  4RNF A;  4AFF A;  2ZH1 A;  1IKX A;  4X65 F;  4J9S A;  2CNN B;  4O4G A;  2X1F A;  1UMJ A;  3KNG A;  1QSS A;  2RS2 A;  2X1A A;  1H3D A;  1HNZ F;  1MN9 A;  3KK1 B;  4N41 A;  2R7T A;  1T9U A;  1G1X A;  2DGQ A;  1YI2 S;  4JYA J;  4YQW A;  2YWH A;  1N5Q A;  3DOL A;  4FF1 A;  3VAL A;  1M5P C;  1RKJ A;  3BO3 A;  4N5S A;  4O4R A;  5I3Q A;  5HI7 A;  2BJ3 A;  3HP6 A;  1RK8 A;  1CJK B;  3MMA B;  3P8B B;  5GAE I;  1VJQ A;  2FZC B;  4LF6 J;  3QLH A;  4RWW A;  5L46 A;  3DRR A;  2WB1 D;  2BJD A;  4H4O B;  2HMI A;  3PW4 A;  4PUO A;  4ED1 A;  1P9Y A;  1U02 A;  3A8I A;  1RTI B;  3RBX A;  2ASY A;  1UJ4 A;  2V0N A;  3NGS A;  2W1B A;  2AYM A;  2EFG A;  3P96 A;  4KHM A;  1SC4 B;  5KFU A;  1U1P A;  4MMO A;  3QID A;  2ZDO A;  2KVI A;  1KEK A;  4NZ0 A;  2P5V A;  1X5T A;  4ZN3 A;  3CJQ A;  1UCN A;  1X4G A;  4JI1 J;  1RI7 A;  3IA0 A;  3WDO A;  3K7R A;  1NJX A;  1J5O B;  3ETO A;  1VRQ C;  3N5F A;  3HT3 A;  3B4M A;  1IKX B;  1JNR B;  4O4G B;  2HLU A;  1KN6 A;  2VHG A;  1RHQ B;  2BA9 A;  4RNN A;  5EX3 A;  3CME S;  3AXM A;  3OSP A;  1S6U A;  1YJU A;  2UXD F;  1Y11 A;  1X8D A;  2XLJ A;  3BN4 A;  1F5C A;  2JDJ A;  3C14 A;  2MQ8 A;  3FRY A;  2OEM A;  3C2P A;  1IQT A;  3KJV A;  3DOL B;  2MJN A;  1VRU A;  3V4I A;  1WEZ A;  3DLE A;  4RL1 A;  4E98 A;  3CCW A;  4NI2 A;  4ILR A;  4B3R F;  4KH0 B;  5KFK A;  2R9L A;  4NZ7 A;  2CVE A;  1U1O A;  3QLH B;  2MQO A;  3DRR B;  5HO4 A;  2ROP A;  2VH7 A;  2I1R A;  3C6T A;  4YHH F;  3F41 A;  3PYE A;  1HW9 A;  2HMI B;  2JEJ A;  1AUD A;  4PUO B;  2UUA J;  1LKZ A;  1NAQ A;  5C2C A;  2RH3 A;  3BSA A;  3H90 A;  4NLQ A;  4YDD B;  2JOQ A;  5F9L A;  4EYH B;  4NYZ A;  4JV5 F;  2DO4 A;  5B0D A;  4XTT A;  2JEF A;  1XC9 A;  4WCE Q;  2A6O A;  4UUW A;  3MUR P;  1Z2L A;  2ZVI A;  2DNR A;  1Y0H A;  3SIP B;  4LFA F;  5JMN A;  4UY8 T;  2RUS A;  4ZS6 A;  5DQG A;  3TRG A;  4EEY A;  1EZZ B;  5L39 A;  1N5T A;  3HMJ G;  3K5N A;  1QSY A;  4L72 B;  1FDN A;  4UST A;  4XK8 C;  4IOB A;  5CXT A;  5I42 A;  2GML A;  2C3P A;  3DC2 A;  3DHX A;  1O5J A;  4F26 A;  3HVR A;  1NK4 A;  4ZK7 M;  3AFG A;  1WHV A;  3C14 B;  4PXC A;  2XCP A;  4NLT A;  4M5L A;  2W9B A;  3KJV B;  3ZTS A;  1VRU B;  3V4I B;  4NRT A;  3CDA A;  3LP0 A;  1SH3 A;  1D9F A;  2F65 A;  3QJJ A;  1AZS A;  4WTO B;  1YRU A;  2M0G B;  3OR2 B;  1YJT A;  1QVF R;  1B70 B;  2LEC A;  4DL2 A;  3AAW B;  1K1S A;  4X64 J;  1TL1 A;  4HI2 A;  3R5C A;  4KB7 A;  3G8S A;  4J9N A;  2LU1 A;  3C6T B;  2V9W A;  1QLN A;  4Y2C A;  4ZIT A;  2ZHB A;  4K4T A;  2KKH A;  1TKT B;  4I56 A;  4OYX A;  2ZOM A;  4ATN A;  3GWC A;  1YJW S;  2FLO A;  2HPU A;  2E7V A;  1CEZ A;  3TOQ A;  2P9G A;  2PFF B;  5KT4 A;  1GAO A;  1EAY C;  4DI6 A;  5IT4 A;  3GFH A;  3N4W A;  3HVA A;  1RAE B;  5KFX A;  4EZ6 A;  2E5L F;  1NSA A;  4G65 A;  3TZY A;  5IC4 B;  1MU2 A;  3MTK A;  4OQJ A;  3UCU P;  1SL2 A;  2WVF A;  4P52 A;  2E1M C;  4K4V A;  4DV6 F;  4QBU A;  2EKN A;  3FZ2 A;  4ZDN A;  2FGO A;  3PJ9 A;  4LF8 F;  5I42 B;  3LUY A;  3DXB A;  4LMZ A;  1NK5 A;  1FJ7 A;  4ZVQ B;  1D09 B;  2DR6 A;  3DRS A;  3JTN A;  2DNY A;  4RUA A;  4B9M A;  2HZA A;  1WF0 A;  3U27 A;  4WK1 A;  2W9B B;  1Y5I B;  1X31 C;  3W8P A;  4DV3 F;  4WKR A;  3IC1 A;  1RQ0 A;  4PQA A;  4RBT A;  2VD3 A;  2ZDP A;  4NA3 A;  1U49 A;  5AXL A;  1RWW B;  1QJH A;  2FHO B;  2GO9 A;  4IH5 A;  1TL1 B;  3QSI A;  1U1L A;  3TJA A;  2E1C A;  2GMJ A;  4A8X A;  3N6N A;  3BDE A;  4DR6 J;  3GV8 B;  2C1E B;  1PAE X;  4MH8 A;  1RGV A;  2GS8 A;  3W5Y A;  1LFW A;  3CF5 Q;  4J9P A;  2C2N A;  3FVY A;  4DUY F;  3OXL A;  2XEX A;  3DOK A;  1KP6 A;  1Y4Z B;  3QYY A;  1ZH5 A;  3W5X A;  2OPQ A;  1NPP A;  1PSD A;  1RYS A;  1YG0 A;  1PGZ A;  1K0V A;  2G2Y A;  2X1B A;  3RUB L;  1LXN A;  5B7W A;  3B78 A;  2GFF A;  4M5D A;  1KSP A;  2CPZ A;  5JVG Q;  1NME B;  1FXD A;  2VG6 A;  5A8R A;  3EXC X;  2Z8Q A;  1XMQ J;  2YH0 A;  7AT1 B;  2KXH A;  1Z1Z A;  1F3V A;  3JXO A;  3DDK A;  1AA1 B;  3QWU A;  3HM9 A;  3I6P A;  3HJF A;  4RNM A;  1TP7 A;  5K9F A;  1OQ3 A;  3DRS B;  2IRU A;  4ID8 A;  1JJ4 A;  2MHE A;  1L3V A;  5HAT A;  5DM7 Q;  3K58 A;  1WKK A;  4ZMM A;  2DGW A;  2KI2 A;  1YGY A;  3QT7 A;  2CAJ A;  5T41 A;  1CQM A;  4YFU A;  5D15 A;  3L9Z A;  4WE1 B;  1YQH A;  2JVO A;  1NH8 A;  1J2V A;  2MQL A;  5L9X A;  2EVZ A;  1PYT A;  2JLG A;  2EG2 A;  1UPM B;  1Q0N A;  2RIL A;  3KMQ A;  1R0A A;  2JEI A;  4M5H A;  4TN2 A;  4ANE A;  1HNW J;  1UWA A;  3RAM A;  1HPZ A;  1MSW D;  1WSV A;  2ZKT A;  5HMW A;  4JI2 F;  2YWF A;  3CJK A;  2KRB A;  3DOK B;  2EBG A;  1Y10 A;  2KB2 A;  4YY3 J;  3ZTO A;  3MI7 X;  2OPQ B;  2X3G A;  3PM9 A;  4TNO A;  2VDI A;  3AOB A;  4DCO B;  2HS0 A;  1G2E A;  2D3O 1;  3H8Y A;  2OKQ A;  2EG1 A;  2RRB A;  5A8R B;  4TYB A;  1GX5 A;  2OEL A;  2XNR A;  4Q2L A;  2HK2 A;  3VAH A;  4X4P A;  4A8Y A;  1CC8 A;  5HQL A;  2D3U A;  5K20 B;  5DG7 A;  2AJ1 A;  5CYM A;  1RTD A;  4JYA F;  3LQV A;  1GK8 A;  3M9O B;  1HR0 J;  4IQM A;  5DDR C;  2OTL S;  1XIQ A;  3VAK A;  2HVZ A;  2BV3 A;  4LF6 F;  2CPE A;  2V2K A;  3FMW A;  1NSQ A;  2R2T A;  4Z2X A;  3HLU A;  3FK4 A;  4DR7 J;  2C2Z B;  2WSE C;  2VJU A;  3OV7 A;  3D1Q A;  4A8F A;  2M70 A;  3OJU A;  5BR8 J;  2YKQ A;  3BO4 A;  4TU7 A;  3EJM A;  1TZ0 A;  4PQU A;  3JS9 A;  1WG4 A;  2DJW A;  4CH1 A;  2ATL A;  1L3T A;  3R1H A;  1HPZ B;  2E66 A;  4K8R A;  1FRK A;  1NND A;  2X7I A;  3K5O A;  4DU8 A;  1VDH A;  3CJK B;  4KC5 A;  3VGS A;  3CDB A;  4JI1 F;  4NEZ A;  3TZZ A;  2IJN A;  4JI3 J;  4LF2 A;  3RR7 A;  1NDC A;  4DQI A;  5AXK A;  2GVD A;  4BS2 A;  4RUB A;  3BO2 A;  1RA6 A;  1WEL A;  1FFG B;  1UFW A;  5CYM B;  3CMA S;  1PO6 A;  1RTD B;  2BJE A;  3SYZ A;  3IFE A;  1CSJ A;  2PGC A;  2RRA A;  2GA7 A;  4ZP8 A;  4TQS A;  1DQA A;  3UD5 A;  1JXV A;  2ASJ A;  4Q8E A;  1S1U A;  3CC4 S;  3W2V A;  2AX0 A;  4G6V B;  4QYR A;  3D3C J;  4DLG A;  1Q78 A;  4WFZ A;  2UUA F;  3CIZ A;  5LSO A;  2B9W A;  2IC3 A;  4Q2M A;  3NNH A;  3MF5 A;  2QFJ A;  4DSK A;  1BHN A;  2E1P A;  2QZ8 A;  2CA9 A;  4PAB A;  4X4T A;  3UDC A;  1FDA A;  2D1C A;  3W7B A;  4KGX B;  4HR2 A;  3FC9 A;  1X5P A;  1WF1 A;  4Q45 A;  4H4M A;  4LUB A;  3I31 A;  3FEY B;  3NOG A;  1RBA A;  2M88 A;  3RGI A;  2KYZ A;  2UXB F;  5KFZ A;  1LW2 A;  4ECY A;  4RW8 A;  2CQC A;  4P10 A;  3G4S S;  4OZ0 A;  1XR6 A;  2XTJ P;  1KHW A;  4ZIW A;  2NUH A;  3PKM A;  2NQP A;  2JSX A;  2I38 A;  1S7I A;  2V8G A;  3J7A N;  2HS4 A;  4UQG A;  4ICL A;  2DNP A;  1IQZ A;  3PIP Q;  3EM1 A;  4DS4 A;  4AXJ A;  2W7A A;  2FVP A;  4QR1 A;  2YKA A;  3EX7 B;  3WBZ A;  3HFV A;  2L9W A;  2KH9 A;  4X64 F;  1S1U B;  3W2V B;  1WEY A;  3SSR A;  2J76 E;  3PW0 A;  3NGD A;  3KLE A;  5E2Q A;  3EVM A;  2DO0 A;  3J7Z T;  2IC3 B;  1S7H A;  1DBD A;  4JV0 A;  5KG0 A;  4U7C A;  3KLV A;  5I3U A;  3Q8S B;  4ZCM A;  4MIW A;  4BCA A;  4QCL A;  2CG8 A;  3OR1 A;  4LRC A;  3P5B P;  3TYT A;  2EBE A;  1NZ8 A;  4P9S A;  2IJR A;  2KJW A;  1VQ9 S;  3C19 A;  4LF5 F;  1VCT A;  3HSG A;  2W8L A;  1TL3 A;  4ECS A;  4OHX A;  1R7I A;  2I2Y A;  4H4M B;  2DNQ A;  1UVK A;  1VMB A;  1AFJ A;  2DR5 A;  4NLW A;  1VGY A;  4M94 A;  4PR6 A;  1SKS A;  3FSX A;  1LW2 B;  3TO8 A;  4NA1 A;  4RW8 B;  4QYZ K;  3JYT A;  3S1T A;  2HQF A;  3ZTR A;  1WNE A;  2H1Y A;  4DLE A;  4EK2 A;  1GMW D;  2R7X A;  4ICL B;  4Q7A A;  2EFQ A;  3KMS A;  4C3K A;  4L3N A;  1YVF A;  4O3S A;  3V6D B;  2RE1 A;  1FF2 A;  1F9F A;  5H9E J;  2HHU A;  1LW0 A;  2F9J A;  4CO2 A;  2HGN A;  4DL3 A;  5EX0 A;  1RU2 A;  4DR6 F;  3KLE B;  2J7W A;  3RRH A;  4R25 A;  2F4V J;  2DD8 S;  1HBN A;  1VR6 A;  5FJ4 A;  1Z2Z A;  1KQS R;  5F41 A;  5I3U B;  3OHA A;  5BYR A;  1U1K A;  3PIO Q;  2B5J A;  3OR1 B;  1WC1 A;  5IQ6 A;  2CJA A;  2BW7 A;  1NH7 A;  4OJ1 A;  3GON A;  1GXT A;  4J9L A;  2EXU A;  2CQH A;  3CW2 C;  3RW6 A;  4Q8F A;  2F1F A;  2CZV C;  4Z7C A;  4WKY A;  5KFL A;  1FT8 A;  2QV6 A;  3BQ2 A;  5KG5 A;  1XMQ F;  2PMW A;  1NHU A;  2ZH2 A;  1TK0 A;  3Q8R B;  4OLO A;  4A47 A;  5DG8 A;  3Q24 A;  2YVS A;  2VBY A;  3ELH A;  1A7G E;  2BAN A;  5IOL A;  1WG1 A;  3JYT B;  2DEJ A;  4X66 J;  4KGM A;  4CLK A;  1VQ5 S;  3MMC B;  2QLX A;  3GFY A;  2Y0S D;  1GTH A;  5D0E A;  4F50 A;  2G0C A;  2GIR A;  3NY0 A;  1N0V C;  2LXI A;  3CCQ S;  4F4X A;  4ZVT B;  4Q0B A;  3VCD A;  5GAG U;  4FNI A;  2Q1L A;  1LW0 B;  4MYT A;  2B4O A;  1LQ9 A;  4LR7 A;  4EYI B;  2DIU A;  3BYR A;  3PNI A;  2YBV A;  2K8G A;  1M5V C;  2ROG A;  4DX5 A;  1YRX A;  5H9F K;  1B0V A;  1T7P A;  4OZL A;  4JBC A;  2B9Y A;  5GMK a;  3JB9 k;  1HBN B;  4F3O A;  1HNW F;  3CED A;  4ZJQ A;  1KVJ A;  1VBK A;  4BC7 A;  3WX4 A;  3UQS A;  4XPE A;  2EKY A;  2X3D A;  1H73 A;  2GVZ A;  1YJ9 S;  4P75 A;  3A8J A;  4YY3 F;  4QIW D;  4LR9 A;  2YX4 A;  4MJK A;  5LMN J;  2DRD A;  3QZ7 A;  6FD1 A;  1HQE A;  4DZ6 A;  1NUE A;  2JH3 A;  2XBP A;  3BKF A;  4LRA A;  3VVT A;  4F0K A;  4USV A;  2HG4 A;  1B4S A;  2BOP A;  1ZPV A;  3BBB A;  5J1P A;  2HFN A;  1HWK A;  3I4P A;  2HNY A;  2XLK A;  3LW5 C;  3E01 A;  1S9F A;  4KRW A;  4NML A;  1TTH B;  4MK8 A;  3OFG A;  2KU7 A;  1VQO S;  2B3T B;  2BAN B;  3H2V E;  1PIL A;  1KKH A;  1JLQ A;  2LQ8 A;  4XDC A;  2ZH4 A;  4LBI A;  3PYF A;  1HQ2 A;  3H98 A;  1UW9 A;  3O8W A;  4Y3C A;  2WAQ D;  1FTC A;  1L3U A;  3KHH A;  5RUB A;  4ZVU B;  1L3S A;  1C1B A;  2Y1I A;  3BR8 A;  3D1O A;  2HFU A;  2UUT A;  4DR7 F;  1S4F A;  3CO9 A;  2UV8 G;  3PHT A;  5BR8 F;  2C2D A;  3D6H B;  1QDU B;  1KQF B;  1NJY A;  3RG6 A;  4J9R A;  4OYB A;  4QJV A;  3PHE A;  5D77 A;  2QMU B;  2FQQ B;  4NLU A;  4DXL A;  1S59 A;  3POT A;  4OZ3 A;  1SPB P;  3Q2S C;  1OYE A;  1AUS L;  4C0B A;  1HWL A;  4F36 A;  4C3M A;  2YH1 A;  2GVZ B;  2F8E X;  3FQL A;  5KFY A;  3RRG A;  3LA0 A;  2RKI A;  1WKL A;  2GW8 A;  4JI3 F;  1P27 B;  2FUG 9;  3GIL A;  4PXD A;  2DIS A;  2N3O A;  5D4P A;  2LQ9 A;  3N6M A;  4AUK A;  1MRO B;  3MGJ A;  1PIE A;  4ANC A;  1NDK A;  4YR0 A;  3E01 B;  2H3E B;  3HD1 A;  1LXJ A;  2BEF A;  2GZO A;  2BJ1 A;  3OLA A;  3UR3 C;  4TY9 A;  1JLQ B;  2KYX A;  3ISN C;  4Y2I A;  4H4K A;  1VQS A;  1IVZ A;  2P9E A;  2FPH X;  1TUV A;  2E7X A;  5FLX U;  2FHK A;  3D4J A;  4TVA B;  1T02 A;  1S9G B;  9RUB A;  3DLJ A;  4YR2 A;  4ELT A;  3OL7 A;  3M9N B;  2RQC A;  1WUU A;  4FZV A;  2RU3 A;  2RVJ A;  4AL7 A;  3D6M B;  1HL6 A;  2GAH C;  4MFB B;  5A2Q U;  2ACM A;  2PMZ D;  2NUU G;  2QEX S;  1YHQ S;  4QIG A;  3POT B;  2ZBI A;  3NCR A;  2E5I A;  3CD6 S;  4ITS A;  3O3L A;  4TU9 A;  2RKI B;  2ZD1 A;  1V3S A;  2CKW A;  4Y00 A;  2HHT A;  2R7O A;  3ULH A;  4RW6 A;  1FHT A;  7FD1 A;  1JK9 B;  4F0H A;  3TUP A;  2RQ4 A;  1ARO P;  3A13 A;  1FDB A;  2OPR B;  3IBC B;  4OYM A;  3FBB A;  1RLD A;  4O0N A;  2LQJ A;  3ISN D;  1ZOT A;  4NCB A;  5EHH A;  1ITP A;  1S6Q B;  2NZC A;  3KLG A;  1D3W A;  4A8K A;  2A18 A;  1IXK A;  1RBL A;  3W65 A;  3CDW A;  3P45 B;  5IC6 B;  3TAN A;  2NPI A;  1WG5 A;  4RUH A;  3P5T L;  2CJQ A;  1JJH A;  3HHL C;  3KHR A;  2D41 A;  2HHP A;  4ECR A;  1HWJ A;  2EC2 A;  2RDD A;  3NGU A;  2CNO B;  4Q44 A;  1NBE B;  3CDE A;  4FPR A;  3DGP A;  4DR5 J;  3RAQ A;  4USW A;  1S77 D;  1RT1 A;  1OO0 B;  1S57 A;  2ZD1 B;  3CXC R;  3NNC A;  4RW6 B;  2ZH9 A;  5ETP A;  3OTB A;  1SBR A;  4M8L A;  2W4D A;  3R2D J;  3FNN A;  1GXU A;  1JLF A;  4LBP A;  5DGB A;  2BKP A;  1GMV A;  3UNG C;  3D67 A;  2KXF A;  3WX8 A;  2LU2 A;  5J2P A;  4RKU C;  3RB6 A;  3PYD A;  3OUY A;  4QWD A;  3KLG B;  4IDK A;  3BKT A;  1Q16 B;  2XS7 A;  3HHL D;  2ADC A;  3JSR A;  1D9A A;  1FER A;  3DOM A;  3ZNU A;  4IO1 A;  4BHQ A;  2V8P A;  2L9N A;  1VLO A;  2VPX B;  3WHI A;  1K1Q A;  2HGL A;  1Q79 A;  1I5O B;  3VAM A;  5KG6 A;  2YNI A;  2F4V F;  1Q7Y T;  4CQ1 A;  4LF9 J;  2V9K A;  4P6Q A;  4OX8 A;  3KWM A;  1P8G A;  2J0S D;  3DGP B;  1YBU A;  3KTQ A;  2AJF E;  1RTH A;  3ILL A;  1RT1 B;  3MDF A;  1U7L A;  2AEM A;  1UEU A;  4EO8 A;  1UL3 A;  4C0H A;  2XLI A;  1XMB A;  2VF3 A;  3OVA A;  2ZJR Q;  2DR8 A;  1UJ5 A;  3PDN A;  1XMO F;  1V5I B;  2AHO B;  4X4R A;  4FP9 A;  1I94 F;  1H2U X;  4LIW A;  4GC6 A;  2PDA A;  3LWL A;  3GV5 B;  2HRY A;  5D3G A;  1VQ8 S;  1FFS B;  1JLF B;  1WHX A;  4YME A;  2HFS A;  1RJJ A;  1JMT A;  3H25 A;  3R9L A;  3PX6 A;  4F02 A;  4FYV B;  1OS5 A;  3AD8 C;  1I51 B;  2DNH A;  5J2P B;  4X66 F;  4QWE A;  1NKB A;  2GJ2 A;  4P73 A;  3OUY B;  3FCH A;  3QAU A;  4IDK B;  3LWM A;  2N82 B;  4DV7 J;  2LDY A;  3DOM B;  3F44 A;  3AJD A;  1ELO A;  2FC8 A;  1ZZF A;  4URG A;  2KFZ A;  5ETM A;  2YNI B;  1Q8K A;  1V3Z A;  2MMY A;  4ZP7 A;  2GIF A;  3HHE A;  2I9S A;  4RW7 A;  1N4L A;  3EGV A;  4B08 A;  4NXN J;  3KDO A;  4X84 A;  4Q5V A;  1Q5V A;  3P3D A;  4B02 A;  2Z58 B;  2MLY A;  2BE7 D;  2LYV A;  2AEJ A;  1V6H A;  2HVH A;  1NZA A;  2DHS A;  5LMN F;  1HAR A;  4I2Q A;  1RWU A;  2CVI A;  5KFT A;  7FDR A;  1RCX B;  2HZV A;  1AXQ A;  4N7T A;  1K73 T;  2Y8Y A;  2DTJ A;  2KG0 A;  3TJ8 A;  5KFH A;  2IMO A;  1BQM A;  1SJ1 A;  4OV1 A;  4TLR A;  3GTY X;  3MTJ A;  5D3G B;  2O66 A;  2GHV C;  3DLH A;  4BC9 A;  2DR7 A;  2IM0 A;  1N0U A;  1RAD B;  2ZM6 J;  1QAY A;  5B0F A;  3I55 S;  3MM8 A;  2RB7 A;  1DQ9 A;  4P7T A;  3ZZO A;  1J5E J;  4LBH A;  1EIY B;  4DHV A;  3OTE A;  2DGV A;  2ROE A;  2LXF A;  3QT6 A;  3GFX A;  3OBI A;  1VC5 A;  4OX7 A;  2B6A A;  2V8V A;  4DFM A;  3FBE A;  3G96 A;  3CD0 A;  3HPO A;  1M5O C;  8ATC B;  2QG9 B;  2XMJ A;  3ENA A;  1ZAV A;  3ZO7 A;  1S5Z A;  3AOA A;  3ENQ A;  1RKI A;  2BE2 A;  1CQN A;  3MM5 A;  1KWM A;  2VFU A;  1URN A;  4RW7 B;  2AF6 A;  3IR5 B;  1T05 A;  2AD9 A;  1KOH A;  4NEY A;  4JI8 J;  3M8R A;  1PCA A;  5C24 A;  1L3K A;  4WTY A;  1H2V Z;  3GJT B;  5HLF B;  3IGN A;  3ZC4 A;  3MR2 A;  4PWD B;  1FO1 A;  3H40 A;  1Y3J A;  2IM1 A;  3ZZP A;  3MOJ B;  1BC6 A;  4KBI A;  2FZK B;  1BQM B;  3KLF B;  4XAK A;  4DJB A;  1FRH A;  3EGN A;  1HWU A;  3ET6 A;  3T6B A;  1U48 A;  3U1N A;  1T94 A;  3JSM A;  4DPU A;  5KOX A;  1SC1 B;  1JIH A;  3SI8 A;  1VLY A;  1UVN A;  3BDP A;  1XTZ A;  3I9V 9;  5T7L A;  3T1H J;  3D6F B;  3GIM A;  1Q8B A;  4NX9 A;  4NOH A;  1ZPW X;  4DR3 J;  2B6A B;  2QGF B;  2W24 A;  2I5J A;  3EPI A;  2OI2 A;  4K4U A;  4DQQ A;  2BW2 A;  1VK8 A;  2HLT A;  1N48 A;  1VQY A;  2H5I B;  2VL1 A;  2J9D A;  5K8P A;  4A8S A;  3NWG A;  1FK9 A;  3LP2 A;  4FS2 A;  2ZBQ A;  4Y6I A;  4PEO A;  2Y9H A;  1T05 B;  3X1L B;  4U96 A;  1FD2 A;  3IBF B;  2DHH A;  4JI7 J;  8RUC A;  5CAA A;  2ABY A;  4ELV A;  5C24 B;  2HAF A;  2IFX A;  5HBM A;  2J6S A;  4LRB A;  1EQM A;  3IM9 A;  2MKS A;  5DDP C;  4ES3 A;  4DPX A;  2B0G A;  1BQN A;  4UUX A;  2XHC A;  2CIM A;  4M5K A;  2DNZ A;  1P9Q C;  3J80 Y;  3GYG A;  4UOC A;  4M95 A;  1JLB A;  1M1G A;  1W26 A;  3ET6 B;  1LWF A;  2R8G A;  4NLG A;  2MY7 A;  4TLQ A;  4ZPC A;  3E8O A;  3G82 A;  2AP6 A;  3MHY A;  1M90 T;  2FJB B;  3QRR A;  3JSM B;  3T9N A;  4ZVE A;  3QZ8 A;  5KT3 A;  5DGA A;  4FBU A;  5T7L B;  1SVD A;  4PXB A;  4JI5 J;  4I69 A;  4PKD B;  2CDQ A;  3D66 A;  5LJ3 Y;  3V6H A;  2ADB A;  2NXJ A;  1TL7 A;  3QWP A;  1S99 A;  4WP8 A;  1U26 A;  2RUG A;  4OL8 A;  3NXZ A;  2DKO B;  1FK9 B;  3PG9 A;  4DR5 F;  1SJR A;  4K50 A;  3P49 B;  2B9X A;  2OPS A;  3LTO A;  1UVI A;  1PC4 A;  3QGG A;  4AQY J;  1PJ5 A;  2UVW A;  3K17 A;  4OHY A;  4HYK A;  1BQN B;  3HT0 A;  2CQD A;  3LPY A;  2FLP A;  1JLB B;  4MKA A;  1R8A A;  1LWF B;  4IUF A;  1PYO B;  3G8T A;  2MKJ A;  2W2N P;  1F3F A;  2DCL A;  1HBM A;  3NMA A;  3GE9 A;  4O3Q A;  2FLL A;  2QA4 G;  1R6V A;  1WOS A;  3KFW X;  3MPD A;  2L48 A;  1PKU A;  2RNE A;  3V6J A;  2BYC A;  3HFZ B;  3MXH P;  5HN0 A;  4F4A A;  3MCS A;  2XGQ A;  2FYX A;  4F4Z A;  2H4Y B;  3T1Y J;  3V6K A;  3CCL S;  2AEF A;  2BRL A;  1NK6 A;  5JJB A;  1TL7 B;  4NPO A;  4ECW A;  2XM3 A;  4LVN P;  4NL5 A;  3MPV A;  2HHV A;  1JJC B;  2NS1 B;  4PXE A;  5K14 A;  4AT1 B;  3EUN A;  1U0S A;  3G6Y A;  2KFY A;  2OPS B;  5A76 A;  2M8D B;  3EXY A;  5ETR A;  5F8G A;  2QLW A;  1YDL A;  4LQ9 A;  4NA2 A;  1XNR J;  1RIS A;  2KL8 A;  2VOP A;  2VU5 A;  1HHS A;  2OLW A;  1HW8 A;  5H1S V;  2EPI A;  1B0T A;  3MPU B;  4NYP A;  2J9C A;  3GU0 A;  3CIM A;  4FKY A;  2QSW A;  4JI4 J;  1TFY A;  4G3I A;  1R0C B;  2VQE J;  5FLX Y;  2XO7 A;  1JLE A;  1HBM B;  3BGR A;  2DK2 A;  4ECV A;  4DV7 F;  1RTZ A;  1CPZ A;  1O8B A;  1RYR A;  4UW2 A;  3KKF A;  4HHJ A;  4AXI A;  1U47 A;  3BPD A;  1EX8 A;  3PRD A;  2VUG A;  5GAE U;  1BUX A;  2B7B B;  3DRP A;  3T9Z A;  2FJW A;  1BXN A;  2VG5 A;  4I2P A;  2OUG A;  2ZE2 A;  1CG2 A;  3J7A 1;  3PEH A;  1U0H A;  1FKO A;  5HMX A;  5IWA F;  1UVM A;  5HVH A;  5HAO A;  4NXN F;  1RDR A;  3O44 A;  1FCA A;  1BWV A;  4QWC A;  3D0I E;  1U25 A;  5K14 B;  2MST A;  3CC2 S;  2HHQ A;  3SSS A;  2KTQ A;  4NLX A;  3DHW C;  1U4B A;  1WOR A;  4DV2 J;  2XHW A;  3ZZZ A;  2OSR A;  1FRI A;  2KVQ E;  1IBK J;  5B0C A;  1D9D A;  3R5J B;  2PE8 A;  1RAO A;  2KHD A;  2YKM A;  4OYP A;  1JKH A;  5DDO C;  1MN7 A;  2LQ5 A;  2ZBP A;  3BEG B;  3U1M A;  1XER A;  1KR4 A; 
#chains in the Genus database with same CATH homology
 1NSK L;  1NSP A;  1NDP A;  2AZ1 A;  1UCN A;  1KDN A;  3PRV A;  1BE4 A;  3EIC A;  3MPD A;  4UOG A;  1WKJ A;  3NGR A;  1HLW A;  1VYA A;  3WX8 A;  1PKU A;  1ZS6 A;  1XIQ A;  3VVU A;  3Q8V A;  3EVO A;  1F6T A;  3EE3 A;  2CWK A;  1PAE X;  3VGV A;  4DI6 A;  4F4A A;  1W7W A;  3R9L A;  1MN9 A;  3Q86 A;  2ZUA A;  5CAA A;  3FCV A;  3G2X A;  3Q8Y A;  1NSQ A;  3EMT A;  3BBF A;  2B8P A;  3Q8U A;  1BUX A;  1NHK L;  1S59 A;  3FKB A;  3GP9 A;  3GPA A;  3VGU A;  1JXV A;  4F36 A;  4ANE A;  4DUT A;  2DXD A;  4DZ6 A;  1NUE A;  1NDL A;  3EM1 A;  3NGU A;  2HVE A;  3ZTQ A;  3FCW A;  3ZTR A;  4W98 A;  3VVT A;  3BH7 B;  3EJM A;  3FBF A;  1WKL A;  1HIY A;  3ETM A;  1LEO A;  4EK2 A;  5CAB A;  1LWX A;  1B4S A;  3JS9 A;  3ELH A;  3B54 A;  2HVD A;  1HHQ A;  5IOL A;  2DXF A;  3VGT A;  3BBB A;  3PJ9 A;  2DXE A;  2HUR A;  4UOF A;  3ZTO A;  1B99 A;  3DKD A;  4ENO A;  4WBF A;  2B8Q A;  3Q83 A;  4KPC A;  3ZTS A;  3EVM A;  3NGT A;  1BHN A;  3VGS A;  4ANC A;  1NDK A;  1XQI A;  3DDI A;  3Q89 A;  4FKX A;  3BBC A;  2DY9 A;  4S0M A;  5BXI A;  3FBE A;  4C6A A;  1S57 A;  3NGS A;  3ENA A;  1NCL A;  2VU5 A;  3B6B A;  2AZ3 A;  1NPK A;  1S5Z A;  3BH6 B;  2NCK L;  4CP5 A;  3L7U A;  1NLK L;  2BEF A;  1EHW A;  1U8W A;  1K44 A;  3ZTP A;  1NDC A;  1MN7 A;  3EVW A;  3FBB A;  1F3F A;  3FBC A;  4O0N A;  4AND A;  5C7P A;  4HR2 A;  2BX6 A;  3FC9 A;  4UOH A;  4FKY A;  1NB2 A;  1WKK A;  2DYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...