4HR2A

Structure of nucleoside diphosphate kinase (ndk) from burkholderia thailandensis bound to adp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
142
structure length
142
Chain Sequence
SMALERTLSIIKPDAVAKNVIGQIYSRFENAGLKIVAARMAHLSRADAEKFYAVHAERPFFKDLVEFMISGPVMIQVLEGEDAILKNRDLMGATDPKKAEKGTIRADFADSIDANAVHGSDAPETARVEIAFFFPEMNVYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Structure of nucleoside diphosphate kinase (NDK) from Burkholderia thailandensis bound to ADP
rcsb
source organism Burkholderia thailandensis
molecule tags Transferase
total genus 47
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2012-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4hr2A00
3VGSA 4S0MA 2DYAA 1XQIA 3BH6B 2AZ3A 1XIQA 2VU5A 3FKBA 4FKYA 3ETMA 1BHNA 3ENAA 1NCLA 2ZUAA 3Q83A 3PRVA 3EMTA 3NGUA 3VVUA 3FCWA 4ENOA 1NB2A 4DI6A 1PAEX 5CAAA 1VYAA 4KPCA 1B99A 4FKXA 1LEOA 1NDKA 3BH7B 1MN9A 1K44A 3ZTRA 2DXDA 4ANDA 3G2XA 3EJMA 4O0NA 3DDIA 4DUTA 1MN7A 3Q89A 3GP9A 3BBBA 1JXVA 1NDCA 1NDLA 3BBCA 2AZ1A 1BUXA 3EE3A 5C7PA 1WKJA 1S59A 3Q8VA 1HLWA 3R9LA 4CP5A 1WKLA 4F4AA 1B4SA 3ZTSA 2HVEA 3ZTQA 3NGRA 2BEFA 2DXFA 3EVWA 3FCVA 2B8QA 3Q86A 3DKDA 3VGVA 4ANEA 3MPDA 3EVOA 3FBFA 4F36A 3NGTA 3FC9A 3BBFA 1ZS6A 4HR2A 5IOLA 4W98A 1PKUA 1NUEA 2NCKL 1KDNA 4EK2A 1NPKA 1HHQA 3B54A 1U8WA 3B6BA 2DXEA 2HVDA 3Q8UA 1WKKA 1NSKL 1NLKL 4UOFA 3VGUA 1S5ZA 2DY9A 3GPAA 1UCNA 2HURA 3EM1A 3VVTA 3Q8YA 1EHWA 1F3FA 2CWKA 5CABA 4C6AA 3FBEA 2B8PA 1LWXA 1W7WA 1S57A 3ZTOA 1NHKL 1NDPA 3WX8A 1F6TA 1HIYA 3PJ9A 4ANCA 3EVMA 3ELHA 4WBFA 3FBCA 4DZ6A 3VGTA 1BE4A 4UOHA 5BXIA 1NSPA 3FBBA 3ZTPA 4UOGA 3JS9A 3EICA 3L7UA 3NGSA 1NSQA 2BX6A
chains in the Genus database with same CATH superfamily
3DRRB 5C24A 2F40A 2Y8WA 1HBMA 2E5IA 3S8SA 4WXOA 2DHHA 3UD5A 3MPYA 4DR1F 4FXWA 1WKJA 1PAUB 1JNZB 1C0TB 3KLFB 3LH2S 1VQ5S 2E5LJ 2ALZA 2WRMA 1WC5A 1LFWA 3JB9k 5HMXA 1KKHA 4CYUA 1PCAA 3OVAA 2JZ5A 1N5SA 4K4TA 3NOGA 3SSQA 2DNOA 2MYFA 4OJGA 5GADI 1S1VA 3HF5A 4KKOB 3UD4P 1EHWA 1HNXJ 3TWZA 1G7CB 3DC2A 1S97A 5LOQA 1JJ2R 4IOBA 4DUYF 3DRPA 1R7IA 2K7KA 4ZS6A 3PO4A 3R97A 2HEKA 3THVA 3GIJA 1REGX 3DNCA 1DHMA 4DF4A 1QAXA 4K4XA 4CO5A 3HPOA 3GSIA 3TQEA 3NOCA 1LK7A 2LA6A 2KYXA 2ZDPA 3B78A 2IC3B 4FN5A 4UY8T 4J9KA 3I6PA 4L73A 3G2XA 1LV5A 4DUTA 1VC6A 1JLAB 4JYAF 3L3CA 2AZ1A 2OHDA 4UTGA 4DR2J 3R8YA 4C7QA 5EUHA 2XMKA 4OIXA 1X60A 4RUCA 3DMJB 3K57A 5T7LA 3CCES 2GO9A 2MPUA 2KN4A 3FQKA 3W8GA 3PKYA 4ZP6A 2OMOA 5D4OA 1ZTTA 5KFDA 1FJGJ 2A6MA 5C24B 4X4QA 2WVFA 1RK8A 1HBMB 3CWJA 1G1XA 2CQ0A 3PVXA 1VIXA 1FRKA 1ZM4A 5DG8A 1FX2A 3U1LA 2QFIA 1FK9A 1SIZA 4C8ZA 4X4OA 2M88A 5KFVA 4PXEA 2W24A 4KC5A 1PG5B 2K06A 1KRPA 2K7JA 3MD1A 4BC7A 3GV5B 1XIQA 3P49B 1IM6A 1N48A 2MHEA 2OJ3A 4JUZA 4ALZA 1X4EA 1S1VB 2GJ2A 4B08A 2DISA 3JSMB 2Z2LA 1YRUA 5D8HB 3H2LA 1XMQJ 3DLGB 9ATCB 4F0KA 4KYZA 1ZM2A 1M1KT 5DG9A 3GYXB 1Q8IA 5F8JA 3KK3A 2AEJA 2HPUA 4DQRA 2E66A 4XAKA 4CM2A 4G3IA 1JJ4A 5FIIA 1RWNB 3BYRA 4DS5A 2JC1A 3MEEA 3OR2A 2EK6A 2ZOMA 4USKA 3NNCA 2HS4A 3CC7S 4ZJOA 2DB1A 2HIQA 3TP2A 3QRQA 3RUBL 1I6JA 1TAQA 1RT2A 2RJZA 4NXMJ 4KV8B 1GH8A 3M1VB 3TZZA 3MXHP 4NLWA 2C2MB 4TU7A 4GVBA 2XM3A 1B7FA 3HX9A 1IBMF 2CPZA 1BQXA 4FF1A 3R6LB 3BKUA 1NK5A 2RQKA 5DDPC 1MN9A 3MURP 1BD6A 4RKUC 1D9DA 4F3QA 2FLNA 2QGFB 4FNHA 5E0OA 2YWWA 5CD4A 5BYSA 2ZE2B 2XO6A 4YQWA 1S1UA 2FZCB 1FK9B 2DHAA 3VGVA 1FEHA 1N32F 2VQFF 4W98A 5E3QA 2MKIA 3KHLA 3JYTB 2UUAJ 1FWPA 2J6UA 1NSKL 1TL5A 3CCLS 5A8RA 4O3NA 2OPQA 2RKIA 2VFSA 1VJWA 2FY1A 1EETA 5KT7A 3MR3A 2GW8A 2DHXA 4K4UA 1S1XA 1SQEA 1OSCA 2UVUA 4MIWA 4F4ZA 9RUBA 1RKIA 2WSFC 4LF5F 2ASDA 1UW4A 2XLJA 1IUJA 1UAWA 2YKOA 4R0EA 2G0JA 4LF8J 1BLUA 2RU3A 4ER8A 4DQIA 3LAKA 3KK3B 4OX6A 1IKVA 4HT5A 1B0PA 2OPPA 3M30A 2NXEA 2A6OA 3PIPQ 3ADAC 4A4JA 5GMEA 1IBLJ 2DH7A 2LQ9A 5C25B 2V94A 4FYWB 4YR2A 1SBRA 2J7UA 4RW6A 5IV4A 2VBWA 2ZBRA 1HNVB 5DM7Q 4U9RA 5CYJA 3M8PB 2V9KA 4K4VA 4QW8A 2C3OA 5I42B 4KB7A 5B08A 2CVEA 3RG6A 1TKXB 5ETVA 2QFJA 3W8PA 1YHQS 2QYCA 3IMQJ 1CBKA 1FVSA 1T3OA 2ACYA 3I0RA 3M2VB 4MJKA 2YNHA 4CLKA 2BW7A 2HQIA 1VIOA 1SC1B 1SUQA 1MSWD 4X62J 4RW8A 2QSWA 4LF9F 4FS1A 1OPIA 1TV6A 3IA0A 3R5DA 1DBDA 2V69A 2EEYA 2P9GA 4KO0A 1NJZA 1YQHA 1VQPS 1S7IA 4DU7A 3KK1A 3K2YA 1Q95G 2M52A 3UN2A 1DLOA 1BWVA 1C0UA 4JP8A 2ZUAA 4LMZA 2KZMA 2GAGC 2NZ4A 4ES1A 1VISA 1IBKF 3M2UA 2OEKA 1N34J 2E5HA 1IXKA 1U0HA 1Q86T 3OW2R 2VFVA 5A8RB 1HHTP 2N4DA 5F0WA 1EETB 4DV5J 5GAHU 2VOOA 3BGRA 1N4LA 2YKAA 4JB8B 4Q0BA 2AF6A 1AFIA 2FVSA 3CSKA 2HQFA 1SQFA 4MFBB 3KJQB 5F0UA 1RT5A 2HFNA 5KFAA 4P7VA 2KB2A 4MKYA 3NAIA 1IKVB 1DRZA 3AD9C 2OPPB 2RNEA 1YI2S 3WX8A 4DL2A 1Y5LB 2A2CA 3I82A 3UNGC 3T1YF 2VD3A 4FBTA 4FXVA 5FDLA 4UY85 3NGSA 3R1HA 2RDIA 1T94A 3N6MA 5DLGA 4ZVGA 2POKA 1QTNB 2E9TA 1QAYA 3KHRA 1K44A 3CD0A 4NCGA 4JV5F 5IC4B 1IJEB 2AP6A 2V4RA 2B4UA 2XZDB 1RAEB 1U1QA 4ZVEA 1SUQB 3M32A 4RW8B 3NNHA 1XJWB 4OHVA 3POTB 4TU8A 1U6FA 5IC6B 4F7VA 4LQ3A 3KK1B 2H5EA 2WONA 2H51B 1C0UB 4YN3B 4RJVA 2ROPA 3KK2B 1LNQA 2KI2A 3FBEA 4QW9A 4TY8B 1D9FA 1OSDA 3QT5A 4RW4A 1RT4A 3GIRA 3C14A 4CLUA 3IR6B 4U96A 4OLOA 5IT4A 2JOQA 2JEFA 4KR0B 2CZ9A 4C0BA 4C9DA 3SMZA 2RS8A 2QA1A 5J1NA 3AXMA 4XPCA 1LW0A 2E7WA 4HI2A 1LWFB 1RT5B 3DLEB 4M5JA 2Z30B 2ZKUA 2ZH4A 2XB2D 2DNNA 1OMSA 1XR6A 3L7PA 5C7PA 2OELA 1VRUB 2IY5B 1Q7YT 1M5KC 3MMBA 2UVWA 2QL5B 4H4MB 3OVBA 5LXRA 1RISA 1RA6A 3M9NB 2HK2A 4ED6A 1RXOB 1U26A 1TQLA 4B9TA 1GNKA 4ECTA 1OS5A 4ZVUB 2MKSA 4CT8A 3HVWA 2XLKA 4LF1A 3OUYA 5J2QA 2JWNA 2F4FA 3IM8A 3ISZA 4R5PB 4QPTA 3MGJA 1VQ7S 3DLBA 1U47A 2DGUA 1JKHB 1B0TA 1TKTA 4DV6J 2FHOB 4WFBQ 4FPRA 4RNFA 4X65J 2I6WA 4WBFA 4LF7F 1JJCB 3HZEA 1T11A 3E2EA 1SH3A 4IOAQ 2GNKA 3PYFA 5KFPA 2QV6A 3IWNC 5KT6A 4DV2F 2OMLA 3PW5A 3JTNA 1UA1A 1E6VB 4RW7A 1NCLA 5IT9U 4LSLB 1XMBA 2WONB 2QIFA 2ZEJA 3QAUA 2GX8A 2DGVA 4FP9A 3NKYA 1U2FA 1JXEA 3DRSB 3KNGA 4WXWA 3TA0A 4KQZA 3ZZYA 3HVAA 5B0CA 4ECZA 3EGNA 2QYGA 1RT4B 2HBYB 1H0HB 1TAUA 1SJ3P 1WSVA 2OKQA 1YBTA 1S0NA 1VJQA 3DOKA 2HHWA 3UVJA 2FHJA 4X4TA 2NS1B 1LW0B 3K8VA 1C1CA 1XNRJ 3PR4A 2W2QP 2E5GA 1LQ9A 4CNZA 3BPSP 4C3KA 5HBMB 2QA4S 2R7XA 2YX4A 1WACA 2CNNB 3A12A 1BQMA 1RAIB 1GEHA 1B7YB 4Q8EA 2MGZA 3MMBB 1NKCA 3QZ8A 2CNOB 2OLWA 1P8GA 1AT1B 1RA7A 1QM9A 5E33A 3NWRA 1LXJA 4K4YA 2CQGA 1RTZA 3D68A 2EFNA 3OUYB 4ED2A 2DNQA 4OX7A 1OQ6A 3BGUA 2ADCA 5F8HA 1TKTB 4F4AA 3TZXA 1UWAA 1QE1A 1Y0HA 1M5VC 1RZMA 3LGNA 4CO0A 5LMNF 2FJVA 3W62A 1G6BA 1HI1A 2HHSA 4ZVQB 1XMOF 1DTTA 2RHQB 2RD5C 4USJC 4DCPB 3RRHA 5B0FA 1RT6B 2ADBA 3QNWB 1FCAA 3GCWP 3MEKA 4F4XA 3GSDA 4NMLA 3B82A 2DNMA 4FNIA 2CQCA 4YHHF 3C2PA 2HFVA 3TX0A 3F56A 5BXIA 3OSNA 4ZPVR 4OZ5A 1FT8A 4DPOA 1URNA 4WE1A 4NASA 5HN0A 2ZOGA 3WC2A 2R7RA 3BSCA 4RNNA 4Y6IA 4AL7A 4I2QB 1OWXA 3W3SA 4TYAA 3BKTA 3GONA 4JV2A 2G2YA 3DOKB 1FDBA 3PX0A 1TU0B 1KLMB 5CHCB 1RHRB 3C66A 2BJEA 5J1PA 4IUFA 2J0WA 3U1NA 3V4IA 1Q8KA 1WHWA 2XGPA 4DV3J 4Y0FA 3RAXA 3C16A 1SH2A 5B0BA 1S4EA 3E01A 1RLCL 1UPMB 3HKZD 1GTHA 4ZA1A 2R7QA 3I31A 1X5PA 2Z2MA 4LFBJ 3PEHA 1RB0A 2MQOA 5FLXY 1S1WA 4PABA 2J8AA 1KSPA 1DY3A 3TR5A 3SBMA 1PC5A 1RT3B 5KG3A 4AFFA 3VGTA 5HJYA 2QLBB 2DIVA 1Q16B 2VG7B 3C6TB 4LF4J 3MM6B 5HROB 1YRXA 1QE1B 3BH6B 3LUYA 3CCQS 4KE5A 4C98A 4PQAA 3DYAB 1VQSA 5CAAA 2UXCF 3PRDA 2FQQB 1VQNS 2IM2A 2ZNZA 2ZWPA 2FVRA 1A7GE 2WW8A 2M3DA 1BGXT 3T5LA 3AA9A 4JBCA 2J0XA 2MHNA 2YXLA 4NEZA 4QIEA 1HBNA 1U8SA 4PCQA 1B4SA 3PM9A 2WB4A 4ECSA 4X4SA 1AXQA 2UZAA 3MHYA 5AXNA 3PKMA 5C2CA 2FZGB 4JI0J 5H9EJ 3WC0A 4TLQA 4DR7J 1TP7A 3J81Y 4M5HA 4A8XA 2L41A 3GPAA 4DQQA 4KGKA 4W4MA 1NH8A 4AL6A 2GQ2A 2OO4A 3IRWP 3EVMA 3V4IB 5EWFA 4DPWA 4NLUA 4ZIWA 3BQ0A 1S6QA 3H98A 2WZ1A 2WVCA 1NH7A 4OHYA 1S9FA 3QLHB 3P6YC 2VASA 1RHMB 1QY7A 2X51A 3E01B 1ZETA 1M5SA 2NSCA 2W7OA 1Q5VA 4NWBA 3DLHA 3LWLA 3C15A 5E7OB 2I0XA 2MTLA 4RU2A 4DR3J 2KHCA 3JQKA 4RW9A 1C4AA 3NXZA 1WUUA 1WHXA 2FGCA 1S72S 1N0VC 1SJFA 4C11B 4CDIA 4I4BA 2RUSA 5JMNA 3IWXA 4Y28C 1ZM9A 3J7ZT 2B56A 4Y34A 3TAMA 2BRLA 4YEAA 1P27B 5ETRA 1XN9A 4JI4J 2F9JA 1NZAA 3WIVA 3QSYB 4DX5A 4G65A 3PV8A 4TQRA 4NA3A 3T1HJ 4ZKAA 3G6XA 1TVRA 2DGSA 5D0GA 4K5SA 4DR5J 1NHKL 2QLXA 2RQ4A 1YJUA 3J81j 2C28A 4NZ7A 3V4MA 2XBPA 3UFCX 1J5OB 4ZVOB 1I3OB 4ID5A 1KHVA 3MEGA 1U48A 5KT5A 7AT1B 3AQPA 4Y00A 2RF2A 3SCIE 2R2UA 4B3MJ 4QCLA 1X4CA 3W2VA 2NLWA 3AAWB 1YG0A 3BO4A 4J5OA 4C8YA 4Y2CA 4OX8A 3GIMA 2VKZG 2KT3A 2PMWA 3IC1A 1FXLA 3HSGA 1KWMA 3SSSA 4F4KA 2PE8A 3PHTA 3ZTSA 3V5RA 4EYHB 1NKEA 4C0OC 2MKYA 1T05A 5ETTA 1S6PA 4H4KC 3TZYA 2QJ3A 3FSIA 5JXSA 2AYBA 2IA0A 5DZ7A 3SFUA 1RDRA 2G2ZA 3HSJA 4PWUA 1MWZA 4FVMA 1WKKA 3D5MA 2VG5A 3Q8YA 2IBKA 3HCXA 2GVZB 3C19A 1CJTA 4LFCF 1RT1A 4YOEA 3FK4A 3CC4S 4QZVB 3AFGA 1SCJB 2F9DA 3FRYA 2A3JA 4OI3A 4XDCA 3CF5Q 1LXNA 2RDDA 2RQMA 3TAMB 5AE3A 1WF0A 5EWGA 2N3LA 1ZAXA 3G8TA 4K0KJ 1PIEA 1DARA 4NYPA 3P8BB 4QR2A 1TVRB 2D3OR 4KPYA 2HW3A 4J9RA 3CMQA 2AJFE 4USVA 1R89A 1TFWA 1NK7A 3NGDA 4DX7A 2WCXA 1SI9A 1WELA 3MTJA 4HR2A 1F2GA 3WBZA 2GZOA 3L7OA 4DLGA 2MY8A 3UWTA 2FJBB 2RF2B 1EB0A 1QSSA 3NS6A 2ATLA 4PEOA 1JLBA 3MFIA 1F3FA 1BWEA 3BS9A 3G6ES 1MMLA 4OYWA 4HI1A 4DMZA 4C2MA 2FJWA 4LSNB 2KHDA 2K2PA 2B3TB 4TKTA 3M9MB 1EX8A 5BYQA 1YBUA 2F7VA 3OTOJ 4OZ1A 4QPXA 4HDGA 3FFIB 1M1GA 2KG1A 3TJAA 1UTAA 2PA3A 1S6PB 1RYRA 2AYMA 1JNRB 2G1HA 1Y5NB 1KOOA 5ETLA 3VAIA 4DV0F 5FLXU 4EU0A 4IG0A 3AJ1A 4N5SA 5ADZA 1QD1A 1NJYA 1NDCA 2VG5B 1T0TV 1VHIA 1LWCB 4PKDB 2Y0SD 2B8QA 3LPEA 3LP0A 5HP1A 4KHPF 2A10A 1ZA2B 5RUBA 3HSZA 2FC8A 3GLJA 4JI3F 4BLGA 1S6UA 4MK7A 1K1QA 1SVDA 5H9EK 4TN2A 2DR7A 1HPZA 4ZN3A 5CABA 2PEBA 2XS2A 2V4QA 1YIJS 2HZCA 4PUOA 2EWHA 4X4UA 1NXIA 4DQPA 1N8RT 2KYZA 3H5XA 1B0VA 3HHEA 1L5UA 2GA7A 1KFDA 4DBQA 2H5JB 5GMKa 2IYIA 5L38A 2AZ3A 4J91A 2M5YA 2ZC3A 5KFLA 3J81U 1QSLA 4KBIA 4DS4A 2BBEA 3GMGA 4KGXB 4O0NA 5KFKA 2ZZNA 1JLBB 2BE2A 2IVMA 2V8DA 4IQXA 4EUVA 1HLWA 5ETSA 4EMDA 2ZH9A 3PRBA 4Q5VA 1CC7A 4OJHA 3D1HA 4I0WA 4NLYA 4OI1A 4HH1A 5KFEA 1X0FA 2M0GB 3K89A 2GJFA 2DK2A 2GMLA 3DRXA 1CJVB 2YWGA 5IQ6A 4R8UA 5KFOA 4DSKA 3HVTA 2F63A 2XSJB 5DDOC 4DSIA 3C46A 3TZWA 3BSOA 4IFYA 2XMJA 4J7CA 4MT1A 3OXLA 1U02A 2GO8A 2VFTA 1REVA 5KG7A 4ELVA 4IG0B 2C3UA 1NPPA 1O6XA 4P75A 5DRKA 2HHQA 3CCJS 3P5TL 4HLBA 3QO9A 1JB0C 5KFXA 4WP9A 2HHXA 3CDEA 4F04B 1WOPA 4K8RA 2A2DA 5HSPA 2Q66A 3VWSA 3QWUA 2XQCA 1S0VA 5F3TA 3J7Z5 2HAIA 1HPZB 1Q53A 1IKWB 2HWIA 5B7WA 2D1CA 4ECXA 3KJVB 2HG4A 1YBAA 5L9NA 3HLUA 3DGPA 3TAPA 2IPOB 4B3RJ 1ITPA 3QGPA 3QIPB 1HWUA 1ZS6A 2RU9A 3HHKA 1HI0P 3SSRA 5KTQA 1EKSA 3IG1A 2Y9HA 2YTCA 2R8KA 1SB6A 5KFMA 3TI0A 4ELUA 3HSDA 2PDAA 3AOCA 1ZZFA 1VK3A 5KG1A 5KFHA 1F6TA 5KFTA 4G1QA 1VRTB 2AQ4A 3EZUA 4N77A 4B9SA 2BE2B 4DL4A 1PSDA 4GKJF 3QJLA 4WFNQ 3FEZA 3QFHA 1K1SA 2U2FA 2OAUA 2R2SA 4RUBA 3BDEA 2YKPA 3IBCB 2VF3A 1U1RA 4P52A 3NGUA 1YDLA 1L3SA 2I5JA 3HFVA 4X2BA 1IN0A 4NMXA 3MM5A 3FSXA 3F73A 2BE9B 2UXDF 3D7SB 3DLJA 4IFYB 3V6DA 3S7RA 3KUHA 3J80Y 3FSYA 2W1BA 3AOAA 4PRFA 2C2DA 3EDQB 2ZZMA 3HM9A 2DCLA 5T14A 4I69A 1TL3B 3OFEA 2VPZB 3O3LA 5C5JA 2AIRB 3ZZ0A 2V8GA 2NPFA 3MTKA 1YJ9S 2HLUA 4A8WA 1CULA 2CPEA 3KG4A 3R5CA 1S5ZA 2OTJS 1XTZA 4AXIA 1V6HA 4QWAA 1RU1A 3SCLE 4UOGA 1FTCA 4CLTA 2CQ2A 2Z58B 2CPDA 4DR1J 4IRKA 2AYGA 3BV8A 4WFAQ 4AQYJ 1H7XA 1X5OA 2PGCA 1R0BG 2DKOB 4K4WA 2W9BA 5F9LA 2EFQA 1Q8BA 1BC6A 2C3PA 3IG1B 2Z4PA 3N6NA 2O01C 3UD3P 3TRGA 2DRDA 3KLVA 3EGWB 4MYTA 2QG9B 4UW2A 2CJXB 4G1QB 2BEFA 4UQTA 2NXNA 2GIFA 4ZLLA 4WYLA 3IR7B 3RU0A 2HVZA 1KN6A 4DUYJ 2YNIA 4JI6F 4DR6F 4K59A 3AD8C 4EBEA 1IR0A 4UUXA 3GWCA 1N54B 3W9IA 3A3NB 4HEA9 3IN5A 1OY6A 1Y5IB 2AGPA 2OPRA 1T3NA 3EPIA 1S76D 3OJSA 2BJ7A 2KT2A 4O3PA 1S57A 2P9CA 3HHLA 3MECB 3EX7B 2VB6A 3HFKA 3OL9A 2IYGA 4I2PA 1FWLA 3CCWA 1FESA 1WTFA 1W2BR 1V5VA 1T03B 4G6VB 1VQ8S 2KJVA 4JYAJ 2E1AA 1VC0A 2QC3A 1WTBA 3O2IA 4DHVA 3CW2C 3MM8A 5M2RA 4ES2A 4WJBA 1AUDA 4AD6A 3IM9A 3IRXB 2YKMB 4ED1A 2DGOA 1HWKA 3ZO7A 2J0SD 2FYXA 4CNYA 4OZLA 2ZKTA 2FHKA 2BANA 4LJMA 4IO9Q 2YPYA 1U09A 3MOZA 4KGZB 3I32A 1M5HA 1HQUB 5LM7E 3J7A1 4ECUA 2R2TA 1NRKA 3V2UC 5H1SV 1S9EA 2UUCF 3RYLA 2XS7A 1FO1A 1RWXB 2C2NA 2DY1A 3D3CJ 5H9FK 4Z2XA 3UR0A 2D3ZA 3D2WA 3H90A 4KY3A 1KR4A 4C6AA 3HD1A 4K2XA 2NR0A 1GMUA 3HMJG 2HRYA 2Q79A 2HFOA 4O3QA 1V5IB 2F1FA 1DJ0A 3KLEA 2DYAA 4KJIA 5KFFA 4EGLA 1VC5A 1FX4A 4QBUA 1EP4B 3CCZA 5D77A 1EARA 4ECYA 2ALYB 1RHQB 4D3HA 3MPWA 1YGYA 4J9SA 1VBKA 3TAQA 1KTVA 2P8IA 3BJYA 1U1OA 2MKJA 2QSFA 3K59A 1T9XA 5HANA 3IXQA 2CQBA 4KHMA 3EVWA 3I5BA 4NXMF 1JLGA 2CJAA 2V8PA 3BBFA 4ED0A 4ZHRB 1ZOTA 4K5RA 2DNRA 2IAJB 5HO4A 3ILOA 2YKNA 2MQLA 5ETOA 3OBIA 2DCUB 4DFMA 1UJ4A 5F8MA 5GAHI 2FLLA 5JUMA 1PJ6A 2KFYA 1IBMJ 1C2PA 3LTOA 2ZH6A 4DG1A 2BW2A 3PEJA 3KWMA 1ZPVA 1RACB 3L7UA 3D0IE 1HBUA 2A1BA 4CZCA 3FQLA 4CLLA 4ZOSA 1CSJA 1OYEA 1I94F 4J9UE 2MLZA 2CNLB 2CZVC 1T8EA 2D7SA 2WHOA 4ZPDA 5C42A 5K8OA 2ZFHA 4MMOA 1FRXA 3RR7A 2VQFJ 2G2OA 1IJFB 2KG0A 3LWMA 2ZVSA 3H42A 3L9ZA 3A3OB 2EFPA 4JI7F 1RWOB 1CG2A 3DCAA 2IM0A 3G6VA 5CH7B 3CJ4A 2VBYA 3ZZZA 5EX3A 3KLEB 4LF8F 3NWGA 5KOXA 4FPIA 3O8WA 1VBYA 1SL0A 3OR1A 3K5NA 4ECVA 2CWKA 4FYXB 3J80U 1VQMS 4OYOA 5AJ3F 5D3GB 5KFUA 2JNJA 4J9MA 1O5JA 2NQPA 2X1AA 4URGA 1EKRA 3HVRA 4ILRA 2IM1A 2LXIA 2IMOA 5M2PA 2VQEF 3QMQA 2HNDA 3LO3A 2CQPA 5FD1A 1GXUA 2YKQA 1RLDA 4X4PA 2XZTB 1R8CA 3CJKA 3VVUA 1VRQC 4WU2A 2HZVA 1RTHB 2IVFB 2D74B 4HHUA 5HL7Q 1RWWB 2GCFA 1DTQA 3MCMA 4LRCA 4DJBA 4NLTA 1X4BA 3D0GE 2AJ1A 4F67A 3CIMA 2X1GA 3MPDA 3T1AA 2F8HA 4DG1B 3PZPA 1KVJA 2BZ2A 4CTAB 1HBUB 2YH0A 4NLSA 5HJXA 4LF9J 2YNFA 5E41A 1TR0A 4X64F 4M63A 4WIQA 2XYPB 4WWSA 3CJ5A 5C42B 4RNOA 2CJ9A 5HI7A 1KVIA 4KRWA 1K0VA 5BJRA 5CCMA 3QGHA 2Y0BB 3HZGA 1QAIA 4ED4A 5HVFA 5AT1B 1Z1ZA 2OSQA 4DV5F 1IBKJ 4OL8A 1CLFA 1KVKA 1P9YA 2HLTA 4EO8A 1FRHA 4M5IA 3GFHA 4CLSA 1HFEL 4S0MA 3WHIA 1NK4A 3PJWA 1NEEA 4ZLNA 1TTHB 4UF4A 5F8NA 1CJUB 2YWHA 4NZ6A 3DXSX 4A8YA 1MWYA 4EYIB 3ISNC 4PXDA 2CPFA 4C3LA 2ZH5A 1WEXA 4FF2A 1JJHA 1U49A 1O51A 4OYXA 1HD0A 1JLFA 5LL6d 3QSIA 3PY8A 2M8HA 4OI4A 5DQIA 4AXJA 4DSLA 2GGPA 2HNDB 2CJBA 2DNKA 2C42A 5ETKA 5J2MA 5J2NB 3N4WA 1AA1B 1UJ5A 3T1YJ 3MCSA 2YNGB 3ZZOA 4ZMMA 2RE1A 2BOPA 2HURA 2EI5A 1AZSA 3M05A 2LU1A 1JLQB 2Y3YA 1L3VA 1DTQB 1E6YA 1W25A 4DFPA 2JLFA 2HFZA 5J2PB 1JWWA 2EFVA 2HNZA 4DV7F 3PW7A 1SC6A 2WAQD 3KOAA 3I87A 3VGSA 1I1GA 2QMWA 4FYDA 4JV5J 1RYSA 5E3AA 4Y2IA 2GMJA 2I38A 3I4PA 2QL7B 2XNQA 4IRCA 6AT1B 4GKKF 2AEFA 4ANDA 2KVIA 1A0OB 3BBBA 1JXVA 3IGNA 2CPJA 2R8GA 4USTA 2E9RX 1NHUA 4Y65A 4NCAA 2OD4A 1VI7A 1ZAVA 1CJKA 3GG0A 4F4YA 3DU6A 1F5AA 3TVYA 2HVDA 4GVLA 3T6JA 4P73A 3NBPA 3KJNB 2KU7A 2HHTA 4OYPA 5B0EA 2X3DA 1RWVB 2W2NP 3A4TA 5D0RA 2VHGA 3G96A 2NUUG 3H2UB 4PG5A 4ITSA 3FCHA 3ELHA 4H4OA 1BE4A 3T3FA 2OEJA 2W9CA 1WF2A 4FBUA 1SXLA 2HWHA 2DTJA 3QYYA 2RHSB 4J9PA 3KUGA 3OTCA 2BYCA 2VG6A 4ZPWR 5I3QA 1YWXA 4LR9A 1C1BA 3MM9B 5J2MB 5A76A 1S7HA 2ZM6F 2H9ZA 1Q81T 3GYGA 4O44A 1NK8A 4OFZA 1TUVA 3D6TB 2P2CB 2LP4A 1WI8A 1SKSA 1Y3JA 4OZNA 1AZSB 1EQ0A 3OL7A 1RHUB 4U8VA 1RBAA 3H8YA 3NGRA 2DHSA 1E6YB 2OTLS 4P2XA 3X1LB 2PFFB 3H5YA 2W2PP 3ENWA 3QT6A 2HHHJ 4LF7J 3CCVS 4OJ3A 5DGBA 4TQSA 4QWCA 2NZCA 1HKAA 4NX9A 2XY7A 4WFXA 4PG4A 2FVPA 1P1TA 5L39A 1MLAA 4PPZA 3U02A 1OJ4A 2F5GA 3DLKA 2QA2A 4HHJA 3GJRB 1YLXA 1U1PA 1HD1A 3NBPB 1B3TA 5CYMA 2JEGA 2APOA 4DN9A 5HVGA 3ZZTA 2ZBQA 3MCOA 1GAOA 3HK2A 1CVJA 4O4GB 3A8KA 3GB0A 1NU4A 3NGKA 2G4BA 1JLEB 3W66A 1GMWA 3QWPA 5E3CA 3EWGA 1VBXA 4NLGA 2W9CB 1S12A 4C97A 3SDEA 4LFAJ 1DFDA 1NJIT 2DXEA 2L08A 1FE0A 1IQTA 1WG5A 2OFGX 4P7TA 1C1BB 1UWBA 4M5DB 3OPKA 4FF3A 1XR5A 2CQDA 4H4KA 4M5KA 4JI2F 4O23A 4HACA 2V4JA 1WG4A 2HBQB 3R5BA 4B3SJ 3ITHA 1ULRA 3DOLB 1YZ7A 1RWMB 4CH1A 1T9TA 3IO1A 3CC2S 4JV1A 3WDOA 5IWAJ 2EXUA 3NMAA 4PQUA 5KG0A 4HH0A 4ZVPB 1S79A 2H4YB 1AYEA 2BE7D 4FF4A 5LMNJ 2JFDA 3FUYA 5J1EB 2BUNA 2KXNB 2BMBA 3AT1B 3FZBA 4JOUA 3TJ8A 1Y00A 1NM2A 4WTOB 3D1OA 2IJRA 3K7RA 2V5HG 2IJFA 4AT1B 2RMLA 4YHHJ 1QUVA 4PPDA 1V9OA 2CWXA 3GR1A 3TOQA 2R8JA 1LOUA 4PG7A 2Z0GA 5D4NA 3R2CJ 3VGUA 3D1QA 1NK0A 5KFQA 3I4HX 3CB4A 2CJKA 4GC7A 6FD1A 2Q6BA 1MU2A 1GX6A 4NXNF 1X8DA 1AB8A 1WORA 3H5SA 2LQ8A 4CYUB 1FNMA 2HGNA 3M8SA 3PFOA 4WU3A 2B6AA 3UQSA 3N01A 2ZD1A 4MK9A 2WVDA 2VDIA 2O67A 2OH2A 1R0CB 1WF1A 1M90T 3DRPB 2AU0A 3SDEB 3HI9A 2FY8A 1RTJA 2MXYA 1KBRA 3K17A 2DRAA 3PFEA 4LFBF 3IAM9 2ZITA 2XYGB 2P9EA 2DHGA 3CCRS 2HBZB 2O5DA 1UWBB 3CO9A 4QWEA 4X66F 4IFVA 1D3WA 4O3OA 1YJWS 2C2EA 1FERA 4OQJA 1F0XA 4IG3A 3S01A 2H3EB 1H2VZ 3HULA 4PG6A 2CYYA 3MMCA 1NUEA 4DDFA 3LANA 1G4CA 4U6PA 4CO1A 2K8GA 4FDFA 4PQUB 5CA5A 4U8YA 2R7OA 4CLYA 5T7LB 4E2FB 3EYZA 2VODA 1VCTA 2HK3A 2UXCJ 2HFUA 3T41A 1S99A 2YPZA 4DL0C 1RUSA 4W92B 3QJPA 1PO6A 5LJ3Y 3N79A 4RPFA 2CDRB 2JEIA 4Y2KA 3MI7X 3IAS9 4FKXA 4DR7F 3TANA 1HQEA 1FDNA 5IQQA 2XWYA 3NAHA 3FMBA 1XK8A 4CIOA 3PR5B 2F8EX 3TW0A 4WK3A 1MU2B 1UZHA 2MEWA 3PYEA 5IT9Y 3VQTA 1UW9A 1OQ3A 1CQMA 3M7VA 3NRBA 2DR6A 2HBRB 3PJXA 2JLEA 4F36A 3RBDA 5IT0A 4PWDA 2BRKA 4EO6A 2ZD1B 4P9SA 2W2OP 4ZPBA 4ZK7M 2LEAA 2KZZA 1I5OB 1YRTA 1HQ2A 1RSCA 4OZ2A 1FEEA 3I9V9 3MUVP 4DSJA 3W61A 2AJ0A 1LKZA 4B9MA 1WD6A 1SC3B 4IFVB 1U1MA 5HMZA 1YK9A 3MEEB 3OR2B 1UFWA 2IBOA 1WSRA 3ZXWA 2BJDA 2IDLA 3D66A 1RTIA 1RT2B 3QQCD 3T1HF 2EKNA 1FWKA 2ZJRQ 4DSEA 4O3RA 2CQ1A 2U1AA 4C8MA 4CH0S 1D1UA 1D0EA 1RE1B 4KTQA 1X31C 5L9XA 2IHR1 4I67A 4GVBB 2ZDOA 3QATA 5HQLA 4ZIVA 3F0NA 4ANEA 1V3SA 1MG7A 3GZ7A 1P9QC 5MAOA 3LGMA 1PKUA 3M8RA 3QIDA 2MZJA 4TLRA 3H4BA 2WTFA 2NREA 3R7SB 2OEMA 4LVOP 3N0VA 1S1UB 2VONA 4NEYA 1LWEA 1XC9A 1MMNA 4MIAA 1N33F 4ZITA 4KGVB 3R7BB 2V8HA 2D69A 2B51A 2RS2A 5LMUF 5DDQC 4QWDA 4NLOA 4KH0B 2BKOA 2OPQB 2MQMA 2R3VA 4QQBA 2CKWA 2RKIB 4AYBD 4PWDB 1X4FA 4C8OA 2IDEA 1S1XB 4IQMA 1WEYA 2O1PA 1SC4B 3HHLC 3KDNA 3RB4A 4I7FA 4ICLA 2C2ZB 1XWLA 2ZBIA 4OZ3A 2F4VF 3JQMA 2QLJB 2BQ3A 1EAYC 1S59A 1QTMA 2FJAB 3SCKE 1CPZA 1ZPWX 1HYSA 3M30B 4LFCJ 1UPPA 1IQZA 2VICA 1SV5A 3B54A 1B70B 2IMWP 4OMFG 1F3VA 4RW6B 4K0KF 2R9LA 3A8EA 3NL0A 4DEZA 4F2RA 1VLYA 5KFCA 1JLCA 1ZBTA 2SXLA 3PX4A 2BM0A 3G8SA 4L74A 3I0RB 3MR5A 3HO1A 4PYAA 2YNHB 5A8KA 2RVJA 3DDKA 4M95A 2Y1RI 2IA6A 1D9AA 4H54A 1CS4A 2K1RA 4ID8A 3PRVA 3T19A 2JEJA 4P71A 3PXGa 1J5EF 1TV6B 3EXYA 2F3JA 4DV4F 1OO0B 1XR7A 2J9CA 4KO0B 2IRXA 5E3PA 4DR4F 3JSBA 1WDTA 4HTIA 3K58A 2BV3A 1U7LA 3PIOQ 4IKAA 1DLOB 5EN1A 2ZH8A 4D3GA 3NGTA 2D3UA 3M2UB 1SKRA 4OV6A 4ED5A 1U0HB 1TL1A 1UMJA 2AKWB 2Y1IA 5CYQA 3M8WA 1UKUA 2ZJPQ 2MQQA 4KT0C 4UOCA 1FKOA 4N8NA 2LYVA 4USHA 3BGRB 2MQNA 3NY0A 2WW4A 4CLFA 4Q0BB 1Q82T 4I7FB 3MFHA 4DFKA 2BABA 2C1EB 3PYDA 3LP1A 1BQNA 3ZNJ1 3KLHA 2QA4G 4F3MA 3PX6A 1FNOA 3DOMA 3FGVA 1X5SA 3KLGA 5A0YA 1APSA 3R5JB 3R1LA 3QPIA 2CJYB 5AXMA 2B4OA 1LEOA 2BKPA 2QN6B 1O8BA 2HNYA 5FDLB 1VQKS 4X4VA 4JI3J 4OI0A 1BUXA 3QGIA 3CJ0A 1S77D 5A6PA 2XMUA 3EGZA 3IFEA 3I0SA 1KFSA 1S48A 2UV8A 3RB0A 5G0RA 4NCGB 2DO4A 4QJVA 1VQ9S 4NE9C 3IS9A 5DQGA 2KRRA 3DI6A 2CQ4A 1R8PA 1ZTWA 3M32B 3OHAA 3OVSA 2VPYB 4FYYB 2XC9A 3OLBA 1U24A 1Q7LB 1JXLA 3OJUA 4Q43A 3UCGA 3G9CA 2DNPA 2GQQA 2H5IB 3OL8A 2V34A 4QIVA 3ENQA 4A8KA 4LRFA 5SZTA 4CO4A 3L4BC 3BR9A 1TMJA 3GQCA 2ZZTA 5KG6A 2XO7A 1R43A 4HHHA 3MMJA 4RR5A 1NB2A 3HT0A 1H74A 2LFVA 2MQPA 1K0TA 4WTYA 4HDHA 3M8YA 4RW4B 5CYQB 3C14B 1FF2A 3R27A 1IWAA 1Y3KA 3JTOA 1WHVA 3G6YA 5B0DA 2M70A 2V2QA 4B3TF 3HHDA 1SJ1A 4FVCA 5I3UA 1X9MA 3MUTP 1BQNB 5L1IA 3VALA 4USIA 3CCTA 3DOMB 4M1KA 3THTA 2CXEA 3KLGB 1HNZF 3HDSA 2W8KA 5K8NA 1YX2A 3KDOA 2BXJA 3DRRA 2XTJP 1NSAA 1FHTA 3KUEA 3GFYA 1NAQA 2FJEB 4NRUA 1Z2LA 4JI5F 1WEZA 2E1CA 2FB0A 2KXFA 2RAQA 2RB7A 2MQ8A 2W01A 3OFGA 5AXKA 4YDXA 2FVCA 2IRYA 4P2SA 5J2QB 2J7WA 1F9EB 2JX2A 2CQIA 3I0SB 4YB5A 3BREA 2VU5A 5D0HA 2NSBA 2VL1A 3Q8RB 1NBEB 3OQ2A 1RWKB 3BDPA 1PAEX 4ZCKA 4KPCA 5L1LA 3MPVA 3MEDA 4ED8A 4OZ0A 3IS9B 2FHJD 3DI6B 4ZPTR 2R8IA 4C8KA 4IR1A 2FJXA 3UR3C 1R27B 5D15A 3JXOA 3TUJC 2ZBPA 3UW1A 4P6QA 4Z7CA 4KKOA 5HK4A 5ITHA 4RW7B 3MOJB 4MIBA 1KNZA 1Q1KA 3C8YA 3UN3A 1TKZA 1DZ5A 3H25A 1EZZB 1QAJA 3VHQA 5AXLA 4ZCLA 2BDPA 4PR6A 4XO0A 1X4DA 2KRBA 3NNAA 3ZZPA 1NLKL 4GKJJ 2VBZA 3FMWA 3M2RA 2B9WA 3TVZA 5GVQA 2D3O1 3TA1A 1KC8T 2IC3A 5HVHA 5FJ4A 2MKHA 2JFKA 5B0AA 1F5BA 4DL7A 3M9OB 3UVJB 3FBBA 3TUZC 3V81A 2UXDJ 4JI8F 1JLAA 3RB6A 2KT5A 3M6WA 1C1CB 2ASJA 1RJJA 2BJ9A 5I3UB 1BHNA 2PSZA 5THWA 3DMJA 1EQMA 3GV8B 4K50A 3CEDA 1X4AA 4DPUA 1BQMB 2KH9A 3BSAA 3I5AA 2MGZB 3RTVA 1NZ8A 5F41A 3VAKA 2XLIA 2VJUA 3N9UC 2DNYA 2PA8D 3PDNA 1KQKA 2MB0B 3K5LA 4TNOA 3CJ8A 5DG7A 2UUBF 4AQYF 4ILLA 1V3RA 2ABYA 3BZQA 3T9ZA 1CEZA 3D6FB 3MDFA 2BQRA 3MEDB 4Q7AA 1TK5A 3P45B 4ANCA 2DGXA 1DTTB 2Z57B 3O6QA 4LSZB 2KDOA 3VAJA 2FJDB 3T5KA 3JSMA 1VBZA 3MUMP 4DPTA 1N5TA 2CG4A 3NS5A 3AA8A 4QU7A 1TKZB 3DLGA 3CJ2A 4GRSA 2XY6A 3MZIA 4ZLJA 3DM2A 1WG1A 4XDDA 5IS2A 4JI6J 4DR6J 3M2RB 4WE1B 3PO5A 2RT3A 1UVNA 2I8EA 2V2KA 4RLEA 3G71S 2E1RA 4ATNA 3CD6S 3TUIC 3S6EA 1HR0F 4OV1A 3IWLA 1YTYA 1PGZA 2AX1A 4P2MA 3GJTB 3I56S 3V81B 1FD8A 1U8WA 3A1YG 4LREA 4ECQA 1NNDA 4KV8A 2R42A 3M1VA 4JI1F 4URSA 2AEMA 4R25A 3P4UB 3C16B 1NKBA 1XERA 1RABB 4LBIA 1U0SA 4XK8C 2HHUA 2CPXA 3GE9A 2DVIA 3KG1A 2LECA 3CCSS 2W9AA 1HW9A 2ROGA 2V8VA 1BMQB 2ZE2A 4FKYA 5K8PA 1TUWA 2MZSA 1S1WB 1L3KA 4DI6A 4RU9A 1B99A 2X7IA 4YY3F 3TX8A 2W7AA 3ETOA 5IXUA 1T9WA 3B4MA 3SZ2A 3JYTA 2GMHA 2UUCJ 3GCXP 1H98A 3MPUB 3LPYA 4CQ1A 4ZJQA 1YJVA 1NO8A 3ISND 3D3BJ 3DKDA 4DUZF 3T9NA 3FBFA 2CQ3A 3FC9A 1FVQA 4A8SA 4X4RA 3TARA 1HBNB 1FD2A 2MZ1A 2D9PA 1YJTA 5HAOA 1NK6A 1QSYA 3QRRA 2ERRA 1L3UA 3DM2B 2YH1A 1RU2A 4JV0A 3NS7B 4OYAA 3VZIA 5C2GA 3CNQP 3UI3A 4QIGA 1N88A 2LMIA 4ZP7A 3DXBA 2BR0A 4LF6F 3KHGA 4FZVA 2AJQA 4UUWA 3ULHA 5C25A 3CJQA 3RZAA 4CRJA 1UA0A 1VR6A 3EZOA 1N36F 4MTPA 4WZQA 1HNVA 1U25A 3M8PA 4ZP8A 4EEYA 5I42A 4EZ9A 1TKXA 1OYDA 3CCUS 4OLPA 4G1PA 3M8QA 1B64A 1S1TA 1S6QB 3OSPA 5BYRA 2E7VA 3VAFA 3M2VA 4EBCA 1RAAB 1WKLA 1S4FA 1WJ9A 2QMXA 2HVEA 1M5PC 1R8BA 1HWIA 5EHHA 2JSXA 3HJFA 3C15B 2GIRA 1G2EA 5A8WA 3H5UA 2M4MA 2L3MA 1N6QA 2FGOA 4RW9B 3Q8QB 4UT4A 3DRYA 4YFUA 2Y1JA 4Q45A 3THPA 1SJQA 3H4DA 2XWXA 1I94J 2OSRA 2BJ8A 1SL2A 4ILMA 3TEHB 3I5CA 2KVQE 1VDHA 4N41A 3BGLA 2UU9J 4MH8A 4Y3CA 2PMHA 2VZ9A 3PACA 4AUKA 2CADA 2J5AA 4M5MA 1QVFR 3Q83A 2R7TA 2IM3A 5KFBA 4B9UA 2DR9A 3OLAA 5EWEA 1FFWB 3RW6A 4DWIA 2JHEA 4JI7J 4MFBA 4KSEB 1MN7A 4ID5B 2J9DE 3MEGB 3W5YA 3CE8A 3FCVA 4TXSA 3W5ZA 3W2VB 1WOOA 3SFGA 1RQ0A 3TUPA 4V19J 3D6HB 5AJ3J 1FJEB 2V9WA 2HVHA 1T9VA 2UXBF 2N7CA 2VQEJ 3AHPA 3BYPA 4DOZA 1H2UX 4DL6A 5AE2A 2Q6CA 5LT5A 3JQJA 4ZJLA 1NMEB 1T05B 1HBOA 3M8QB 3Q8PB 1S1TB 2ZH7A 2GHVC 1U6ZA 3H2VE 4OHZA 3O44A 3QBCA 2P5VA 4F2SA 1QUPA 2LCWA 3FJ2A 1WC4A 2AWZA 1ZH5A 3GIKA 4USUA 3O1LA 1CJTB 2V68A 5A8WB 1RT1B 3POTA 1XEZA 4BHQA 1N6QB 1RAGB 3CJTA 1OY8A 3JTPA 2V0NA 1PC4A 3MWBA 4OX9F 4NI2A 4FYVB 3J7AN 5LSLA 3ET6A 2FDNA 3GP9A 4YR3A 2L9WA 3BN4A 3OFHA 5L1JA 1R6YA 2G1DA 2KL8A 1HL6A 2YQ1A 4M5LA 2WOMA 4X64J 3KK2A 4TY8A 2AMCB 2MMYA 1FA0A 2MLYA 4Q2MA 2NPIA 3B6BA 5GAGU 1RP5A 2XSFA 1M5OC 1UFLA 4E98A 2HSEB 4URQU 1A6LA 3BB5A 2UP1A 3N6LA 3HT3A 3PW2A 1O0PA 5LSOA 2CDQA 4U7UK 4I64A 3K5MA 4EI2A 4U95A 4HKQA 1AROP 2J76E 2VA3A 3NLCA 3BO2A 4YMEA 4X4NA 4L75A 1LWFA 1HNIA 5ETPA 3DLEA 2DH8A 2UUTA 4KH1B 4ZP9A 3SI8A 2KM8C 1KQFB 3KFWX 3CT9A 1P6TA 2ZNYA 1VRUA 1PBAA 4QU6A 2AW0A 3IR5B 2B9EA 5ETMA 2BA9A 4H4MA 1KQGB 5F8IA 5KFGA 2XGQA 2HKEA 1FFSB 3GG1A 2BVZA 1S10A 2MKCA 3GJQB 1R0AA 4ETXA 2B0GA 3HJVA 4R5PA 1KONA 1HBOB 1GXTA 4N56A 3KXDA 4A8FA 4DCJB 3MD3A 1JKHA 3N28A 2LDIA 3BEGB 2ACMA 1JMTA 4WP8A 1HHSA 2GS8A 2EBGA 3AXKA 4IH6A 4J37A 4NLPA 4DXLA 3E8OA 4DV7J 3D4JA 5B09A 4QWBA 1E6VA 2DBBA 2CJQA 2EC0A 1PILA 3LP0B 2CAJA 1W7WA 5HP1B 1XNQJ 4NI2B 4LSLA 3NP5A 3ET6B 4WIIA 4N76A 2OP5A 4GKKJ 4LVNP 5L8RC 3DRSA 3JAMY 3E51A 2WOMB 1K9MT 3GU0A 1FTRA 1Z2ZA 3AH6A 3GJSB 2ZH1A 4PUOB 1Q8LA 2DEIA 1HMVA 3MM7A 2G9OA 3NCQA 4TVAB 3DU5A 2AJ2A 1M1HA 2XYHB 4DL5A 3G86A 2PI4A 1Q5YA 2LQ5A 4A46A 2AGQA 2P6TA 1RKJA 4DSFA 2DGTA 2LVWA 3FEXB 3CUNA 3A13A 2DO0A 2XHCA 1HNIB 5HBMA 3TO8A 4XIUA 2E44A 3I55S 1UFKA 2JJ4D 1TFYA 4IH5A 4L3KA 4ZPCA 3LGHA 1FJ7A 5BR8F 1YSJA 1R8AA 5KFZA 3G87A 2LXFA 4OHXA 1LK5A 2J8SA 3Q8SB 3UE2A 1HNWJ 3MR6A 2UV8G 4B3OA 2R8HA 3M4XA 4I6AA 1R0AB 2ZM6J 2ZH2A 1UEUA 2W2MP 1LW2A 4R8UB 1HW8A 1PJ7A 3VTIA 3HVTB 2VC1A 2KJWA 2VOPA 4NRTA 4DV1F 1YVFA 1XQIA 1UVMA 3QT8A 1R8HA 1REVB 2HHHF 3WZ0A 1IR2A 4P72A 2FPHX 5GMDA 5GAEU 3Q0AA 3QO9B 3UNYA 1MW7A 3ILLA 1RT6A 4C4WA 4CP5A 2H65B 6FDRA 1X0PA 3KG0A 4ED3A 1YITS 2VFRA 3ONQA 1R31A 3O5TB 4KAIA 1BXNA 2ILYA 2E5LF 2RIJA 2B7BB 3DGPB 3U7JA 4I2QA 5D6GA 1HMVB 3MM7B 4EZ6A 3NCPA 7FD1A 1KLMA 4UOHA 4PG8A 3CDAA 1NSPA 2FHMA 3A8IA 4EFAC 4F0MA 4FS2A 1HNXF 3QAEA 2XULA 4F4WA 3MAHA 2HGMA 5KG5A 4LFAF 3S1TA 1P1LA 2KO1A 2LA4A 4K2JA 5JJBA 5KT2A 2DXDA 2CPYA 4I68A 1NJXA 3K0JA 3RGIA 4UQGA 3BBCA 4Q2LA 4RBUA 2G13A 2HS0A 1QDUB 1IBCB 2QX0A 1FRLA 3PNIA 3SQOP 1VQOS 4M5NA 2NXJA 3RJMB 5K8MA 1VK8A 4B3OB 2I5JB 1URRA 1AFJA 3FNNA 4B3SF 3CIZA 4ETZA 1LW2B 3MM5B 4LF2A 3R5AA 2IFXA 1RT3A 1KEKA 5IWAF 4JI2J 8ATCB 3V6DB 4DR2F 1N5QA 4HL9A 1A9NB 2VG7A 3C6TA 1GQEA 4KIAA 5HMWA 5HQMA 1UZDA 3MM6A 1FI4A 5F9NA 5HROA 5E2QA 2DT9A 1N5YA 2AX0A 4A8OA 2QRRA 3GV7B 4XTTA 1N52B 2XI2A 3R6GB 3DYAA 3NEKA 1WDDA 4BC9A 4ZVFA 2HQGA 1KHWA 5CXTA 3VCDA 1FJGF 4NLXA 2DNGA 3RRGA 2RRBA 3J7YU 3UCZP 1CULB 2BX6A 3QRPA 1TL4A 2J9DA 1D8YA 1IR1A 3W64A 4HT7A 1WWHA 3UO0A 1NDKA 2N7YA 2ZH3A 4QYZJ 4RNHA 3R3TA 2GV1A 2CA9A 2M9KA 1NDLA 1PYOB 3PG9A 2NYIA 2IVYA 5DETA 3HHLD 3RBEA 2DITA 1KS2A 4F02A 1DQAA 1ZM3A 2W9BB 3EZ5A 3EGVA 4NXNJ 3RB3A 4OYBA 4CI0B 1VQLS 3DN9A 2J7KA 1XMQF 1U4BA 3VZHA 3HHNB 2FIUA 3AQOA 1AW0A 3QLHA 3W63A 2VKRA 4DF8A 2B7CB 1TK0A 4ECRA 2RUGA 1IKYA 1W26A 2J6TA 2YNIB 1U1KA 4WYWA 4N7TA 2IIHA 3BM7A 4IRDA 3KKFA 2Z2YB 4F50A 4C11A 2OPRB 4LRAA 4F26A 3QZ7A 4X66J 3HHLB 3JSYA 4P74A 2QO3A 3DGVA 4I2PB 2HHPA 1X4GA 3RRKA 4TYBA 3EJMA 2A0FB 4DX8H 3Q89A 4IOCQ 4O4RA 5KOWA 1N5YB 5DS7A 3EE3A 1VOMA 3Q8VA 2N82B 5GADU 4LIRA 4J9OA 1J27A 1KTQA 3JAMU 4PWWA 3H0PA 2CZ4A 2HQDA 3OV7A 4YB7A 3US5A 3MM8B 5I3PA 3BF4A 3QFWA 4ZVRB 3W60A 1S49A 5IZHA 1KDNA 1HHQA 2NUHA 4CM0A 5DGAA 2JH3A 4A8QA 3VQSA 1NPRA 3R5GA 3AJ2A 1J5OA 1NJWA 4RBVA 2BANB 3MF5A 2ZHBA 3VVTA 2VH7A 2HRTA 4YS2A 3LF0A 2V50A 3W7BA 5KG2A 1T7PA 2HRUA 2IJNA 1ZZNA 2DJWA 1S9EB 3PW0A 4DZ6A 2UUAF 4YUDA 1ICEB 2PC6A 4LUBA 1N32J 3D6MB 3EICA 4E0DA 5EGYA 5LSRA 3SXLA 2QZ8A 1SPBP 2B5JA 4B9NA 2YVSA 2M8DB 1RI7A 2PMZD 1YJRA 1KP6A 2NYHA 2RRNA 2V63A 3U27A 5EDWA 2CVIA 2AJ4A 2OPSA 2DGQA 4WCEQ 2VA2A 1MNEA 1Y10A 5B0GA 1IKYB 3ZZRA 1MROA 2GVZA 1S0OA 3X3UA 4F25A 4LRDA 4LF5J 7FDRA 3Q23A 2VBXA 3QGGA 2HQ3A 3CULA 4M5GA 3ZZUA 5IFMA 1IBLF 2EW9A 4RL1A 2RQCA 3ZNUA 4BS2A 1S0MA 2V67A 3EM1A 3KJFB 2EC2A 3OXGA 4ZN1A 1JLGB 5MLCV 3TJ9A 4C0HA 3IP0A 4LR8A 4ES3A 2FVQA 3BGOP 4N47A 4FXDA 2YKNB 2OD6A 3AJDA 3ZTPA 2CPIA 2QEXS 4OHWA 2YWKA 3CXCR 3KNAA 4F3OA 2XZWA 2FD2A 4X62F 3OTEA 3CMES 1M0SA 2IRUA 4B9LA 3WX4A 2GC8A 1WNEA 2V2VA 3DDIA 1R3NA 3EUNA 3M8ZA 4ZCMA 1AUSL 1NHVA 5JVHQ 2JVOA 1L3TA 3H59A 2YQ3A 1N0UA 3EDRB 3EXCX 1FXRA 3R2DJ 1ZA1B 1N34F 1RAFB 2O3DA 4LSNA 4PAAA 1WC6A 1UVIA 4DZDA 1LFPA 4WPAA 3ILJA 3D9BA 2B5JB 3V6KA 1VQYA 1N33J 2L48A 3RBXA 1J2VA 2PI5A 5LMUJ 3FFIA 1QJHA 3CDBA 4RBTA 5F3ZA 3RBZA 2XMAA 1U1NA 1Y11A 1UEKA 1WI6A 5I4MA 2GVDA 2OPSB 1UL3A 1SKWA 1MWQA 4OYMA 2CRLA 4LR7A 4ZVTB 3LA0A 1MROB 3OR1B 3IGVA 2F4VJ 2CQHA 2KTQA 2GIQA 1UETA 2DGWA 3ICLA 4WKYA 1LWCA 2WB1D 3TQ1A 3OT9A 1Q4RA 2OUGA 3Q2TC 4QIFA 5U47A 5KFRA 2EKYA 1U1LA 3BH7B 1MMDA 1UVLA 2KXHA 2HHVA 2VPWB 4CO2A 4Y2AA 4ZVSB 1FXDA 4L76A 1K8AT 4QYZK 3UDEA 2QL9B 4PXCA 3N5BA 3CJKB 1BY9A 3Q86A 4NYZA 2BOAA 2JVRA 1WC1A 2RDJA 4OJ1A 2HZAA 2WK4A 3A3PB 3BPDA 5ETQA 4TU9A 2DR8A 2F8MA 5CZVA 3ZTOA 5D78A 1IKXA 1VLOA 2OGUA 1N56A 2Q3PA 4NPOA 1HWJA 1F60B 4ECWA 1J5EJ 2YNFB 4QYRA 5AE1A 3PYGA 1JIHA 4IDKA 3UDLA 4DV4J 2PIIA 1UP1A 2G0CA 2E9ZA 4DR4J 4N8OA 4C8LA 2HVIA 5KFNA 2CIMA 2JRSA 4NLDA 1VYAA 1RHJB 2LU2A 1Y7PA 4ZVHA 1TL7A 1SJRA 3G4SS 4BDPA 4DPXA 1CJVA 1ZAWA 4B17A 2B4VA 3NCRA 3H20A 2XSJA 3CD7A 2XHWA 1RBOB 2WVEA 3KTQA 2H48B 1CC8A 2GVDB 3LAMA 5IV3A 3HXMA 3D0HE 5IOLA 4YDDB 2A18A 2NCKL 2RILA 2I1RA 2QT7A 5CQGA 4IH7A 2DIUA 4X84A 1UVKA 3FVYA 1Q79A 2I9SA 1JLFB 2ASYA 2DNLA 1TZ0A 2MZQA 2RSQA 1SQGA 1RTDA 4V19X 1NDPA 2MJNA 2GGPB 5DLFA 2XG8A 4YB1P 4Q8FA 3MR7A 2EPIA 2E29A 4R0JA 3VV2B 1WOSA 4CLWA 2FC9A 3SCJE 1GK8A 2PEHA 3QT7A 1N5VA 1IKWA 4ELTA 2HYIB 4I6WA 2KKHA 3RAMA 3KJVA 2XNRA 4DV6F 3FKBA 4X65F 4O0IA 3GILA 4ENOA 3QIPA 3P96A 1SL1A 2HNZB 4LBPA 3PHEA 5D4LA 1VMBA 1IKXB 1PJ5A 4OYZA 1FE4A 4GO5X 2ZOFA 5HATA 3AODA 3EVOA 4DV2J 3DHXA 5KFYA 4ZCIA 5ETNA 1VRTA 2V6AA 3B4DA 3BSNA 1VHFA 4IDKB 4EK2A 2HFSA 2MZRA 2AHOB 4WF9Q 4NOHA 4RNMA 1W2IA 2DY9A 4I6YA 4P2FA 3VAMA 3TVKA 2UUWA 4EWTA 1EIYB 3FEYB 1LWXA 4ZDNA 1X5TA 5H9FJ 1TL7B 2MZTA 1CJKB 2Y1LB 1RWPB 2LLZA 1VQ6S 1V3ZA 1RGVA 2GHPA 2CUYA 2XCAA 1VQ4S 2XMMA 5DZ6A 2PN6A 4HTJA 2AGOA 1XNRF 1Z4UA 3NMRA 4DLEA 3W9HA 3ENAA 5DDRC 3MAQA 2GQCA 4B3TJ 4I56A 3Q24A 1TL3A 4U7UD 4H4OB 3KHHA 5E5NA 1T02A 4J9VA 1OY9A 2OI2A 1GX5A 4RUAA 1DURA 1Q0NA 2BM1A 2VG6B 1RTDB 2GAHC 2ZVIA 4NA2A 2LDYA 4QR1A 3P5BP 1HNZJ 4I1TA 2C2KB 2W4CA 2ZBCA 4IO1A 4O44B 1T9UA 3IBFB 1NPKA 2Z56B 1UEVA 2AV5A 4JI5J 2EK1A 1RCOB 2L9NA 1DQ9A 1FRMA 3SQGA 4YR0A 2DPIA 2R7SA 4RWWA 3CDUA 1HIYA 4U7CA 3RW7A 1X9SA 5G4DA 4M8LA 1JX4A 4L3NA 3UDVA 2V2ZA 1EJ7L 2MKKA 2RRAA 2FUG9 2H54B 2MSTA 1XMOJ 1SKUB 3AOBA 1GMWD 4MKBA 3UN5A 1WHYA 4RUHA 2MJUA 1DAXA 4J9NA 2O66A 4XPEA 2PO4A 1K73T 8AT1B 3FDSA 3K5OA 3H7HB 3LALA 2ZWOA 4DU8A 1U45A 1IM4A 3DLKB 3SV3A 3AB4B 4RX6A 2G0IA 5KT4A 4YB6A 3MECA 1KLNA 2GJIA 4M94A 3WQPA 5CYMB 1X7VA 3K5PA 1ELOA 4J9QA 1KD1T 1H6KX 3U1MA 4DV3F 2F65A 1FDAA 2ZHOA 1T03A 3D67A 4JI8J 5CZXA 4BBYA 3BKFA 2WBRA 3BQ2A 2J9EA 4A8MP 3MR2A 1YJNS 3TYTA 3QJJA 3IRXA 3D54A 4ZLPA 2YKMA 3MMAA 3DFEA 4CO3A 5L46A 1FKPA 5DJBA 2LXUA 4HYKA 4C48A 2WVBA 4O3SA 3ENVA 2N3OA 4WK1A 5DO2A 2YX1A 2KFNA 3VF0B 3M6UA 4HACB 1HQUA 1RAHB 1I51B 2V4JB 2CG8A 5A2QY 1ZYQA 4LF4F 5E3RA 3ITHB 3W2WA 1F5CA 5CCLA 3SQGB 1RHKB 3C3LA 2EG2A 2UUBJ 4LBHA 2J6SA 2VDHA 3ZTQA 5K14A 1FJCA 4HVZA 5KAKA 3KMSA 2WSCC 4NYOA 3WIUA 1CQNA 1U6BA 2NXUA 4IR9A 3OTBA 3AD7C 3GYNA 2AD9A 2X1BA 4WFYA 5KG4A 3C6UA 3Q8UA 1YJ7A 3KMQA 2CNKB 4CLPA 3OTDA 3P3DA 3CJ3A 2XEXA 2I2YA 3BQ1A 3GFXA 2HS3A 3KYLA 2XMWA 1DQ8A 4B02A 1EP4A 4DFJA 3CD5A 3PJ9A 4JI0F 3ZFVA 3F41A 2BACA 1PYSB 2R7VA 1RBLA 2W4DA 4LRBA 3HP6A 3FCWA 3PCOB 4WFZA 1FRIA 1HR0J 2AT1B 2Z8QA 3EPGA 2KFZA 4ZHRA 2LEPA 4DCOB 2B6AB 1RAOA 2D41A 2IAJA 2COLA 3SEOA 3I9ZA 5JVGQ 4NA1A 1JK9B 3TA2A 4PXBA 3R9LA 1TKDA 5KFIA 2DXFA 4JI1J 1RTJB 2QMUB 3M6VA 1S6OA 3MMAB 4DR3F 4QOTA 3ZC4A 1FKPB 3LQVA 1HWLA 2DEJA 4L6V3 2DNHA 4USMA 1UVJA 4UOFA 4KHRA 2HQCA 3ILIA 1UCNA 2WSEC 4KGMA 4QIWD 3MCNA 1F9FA 4K4SA 5K5MA 4IG3B 1IWGA 4JI4F 3MMCB 3W2WB 1YKWA 2J0QD 3RAQA 3T5HA 1TUGB 4YY3J 2JLGA 4OI2A 4DR5F 2UVVA 3TNVA 5K14B 2EFGA 4Z7YA 2R7WA 3I96A 3R7NB 4NLRA 3ETMA 3Q2SC 4DQSA 5F8GA 1VGYA 3D28A 2MLXA 4DUZJ 5K20B 3C6UB 2JDJA 2QE5A 3L09A 4Q44A 5F8LA 4MYUA 2DR5A 2ASLA 4B3MF 2YWEA 4U67Q 2VIHA 2R7UA 3GR0A 4E8UA 4J9LA 3DHWC 1NB7A 2CFXA 5D3GA 1ROFA 2VUGA 1HQEB 2W7PA 3GFZA 2HMIA 2DNZA 4AE5A 2VC0A 4NLQA 1FRJA 1RCXB 4LF6J 2NXCA 2B43A 2H1YA 2XI3A 4WP3A 2FLOA 5IM0A 1FDDA 2R2RA 1N36J 3M6XA 2KM8B 4P10A 1H3DA 3LOUA 1RTHA 5GAGI 4BCAA 2PD1A 4ERDA 1T95A 2PFDA 1NSQA 2QTWA 4J90A 5D4PA 4NCBA 1X4HA 4LT6A 2MY7A 5A6WA 2YWFA 1RADB 2AYEA 3DLLQ 3RR8A 1H72C 4ED7A 3NG8A 4B9VA 4CTAA 2HIYA 1GTEA 1WC0A 2X1FA 2W8LA 2MSSA 4DX6A 2C2OB 3CDWA 1Q78A 4QR0A 2JL9A 2Z2ZA 2MDAA 4L72B 1HA1A 1RTIB 2JC0A 1FKAF 3OL6A 2UU9F 5T41A 4OZJA 3OFFA 4PYDA 3CMAS 1RAJA 3OHBA 1UJ6A 1XBWA 3L95X 1TK8A 3E3XA 4CWBA 2PT0A 4TY9A 2ROEA 3OD2A 2B8PA 4DL3A 3IBWA 2LQJA 3AY0A 2N4CA 1CJUA 3FBCA 4A48A 4OYIA 3SYZA 5L1KA 2HWTA 2YY3A 1RT7A 1HARA 2HAFA 3V6HA 4DPYA 2YBVA 2W25A 4LQ9A 2HMIB 1LWEB 1U2CA 3OTOF 2BJ1A 2YX7A 3ZTRA 1FFGB 4MAKA 2K3KA 5J2NA 2QLWA 4PZVA 3G82A 3UDCA 4RWXA 4F0HA 1F1BB 2YNGA 2C22A 2E7XA 2E5JA 5IM0B 2UXBJ 1GXLA 3BR8A 3CGIA 4G1IA 8RUCA 1QVGR 3VR1A 4YP3A 3V6JA 4RZRA 1JLQA 3LP2A 2ZJQQ 4BWMA 1SIWB 2M7SA 1SH0A 5J2PA 4ICLB 2P6SA 1OIAA 4KFBA 1GT8A 4WZMA 1D09B 2D9OA 5A2QU 4DV0J 1PBUA 3DDNA 2ILZA 2Y8YA 3CTRA 5KT3A 3GTYX 3W1YC 1GFWB 1HYSB 2H4WB 2FZKB 3Q22A 2ZC4A 1SV5B 4C8NA 2E1PA 3CJRA 1KOHA 5HMYA 2B4PA 2XCPA 4CH7A 4KHPJ 4OX9J 3PTWA 2UVRA 3CVKA 4GC6A 4V1Ak 4NLVA 5K9FA 3EMTA 2Q1LA 1QLNA 2Q43A 2XMVA 2BJ3A 1U2RA 1JLCB 2VFUA 2XY5A 1Y4ZB 2DD8S 2C3YA 4GO7X 3CCMS 2LQBA 4GMKA 2OIHA 3N5FA 5A8KB 1Y9OA 4MK8A 2K3IA 1CS4B 2K1RB 3FRZA 3OXFA 1YZ6A 5GAEI 5HLFA 2XMTA 1RWUA 4EBDA 1H73A 4LIWA 1RT7B 3SV4A 2VV5A 2DPJA 3PW4A 4AL5A 2R4FA 2M2BA 3JSRA 1FNXH 3CJSA 3KLIA 3MAAA 2GHWA 3TEGA 3CO0P 4K7QA 3MM9A 4IYQA 2C3MA 1TL1B 3G82B 2BKNA 1X9WA 3T6BA 1H7WA 1VS3A 3GIIA 2XS5A 2BQUA 2GFFA 2C2RA 1FKOB 5M2UA 2DRBA 2L9DA 3LP2B 1H2TZ 5LXYA 1NK9A 4RO0A 4USWA 2OFHX 2DH9A 3W9JA 4MKAA 1S9GA 3LP1B 4KFBB 2RH3A 4BWJA 3KLHB 4C3MA 2B9YA 1SJ4P 2WBMA 1XNQF 4NL5A 2LKZA 5A0YB 1IVZA 4K4ZA 2VJVA 2HGLA 2YQ0A 3HD2A 2ZHAA 4WKRA 4ZPAA 1JQGA 4W90B 5DM6Q 1TELA 3BGFA 2HNYB 2ZUGA 4CT9A 3SIPB 2EBEA 3UCUP 4Z37A 1R6VA 3F44A 4B3RF 5DQHA 2FLPA 1WC3A 3VAGA 3KLFA 1C0TA 3CPWR 1T9YA 1PYTA 2E1MC 1OPZA 3A8JA 4DN0A 3G8QA 1G3OA 3B8HA 2CPHA 5G0RB 2ATCB 5CD4H 1F9HA 3K8WA 3H40A 3AB2B 3VAHA 1F2HA 4NZ0A 5SUHA 4O4GA 5D0EA 4F8RA 5HLFB 1JLEA 5HQ8A 1K47A 4UZBA 2B9XA 4CCHA 2X3GA 3BN7A 3J7YI 1H38A 1VFJA 3KLIB 3MAAB 2EFOA 2FTRA 5LJ5Y 1C4CA 1HNWF 3LW5C 4CLZA 5BR8J 5EX0A 3W65A 4M5DA 1TMMA 2EG1A 3HFZB 1GMVA 5KFJA 4MKVA 3DOLA 3BO3A 1D8ZA 3T5JA 3HKWA 3UPFA 1ACMB 4OI6A 2EVZA 4Y2MA 4DV1J 5KFSA 1S9GB 1KQSR 2QLFB 4UZCA 2W4PA 1HI8A 5KFWA 5J1EA 3FZ2A 3W5XA 3JS9A 2VPXB 2LEBA 4A47A
chains in the Genus database with same CATH topology
3VGSA 4S0MA 2DYAA 1XQIA 3BH6B 2AZ3A 1XIQA 2VU5A 3FKBA 4FKYA 3ETMA 1BHNA 3ENAA 1NCLA 2ZUAA 3Q83A 3PRVA 3EMTA 3NGUA 3VVUA 3FCWA 4ENOA 1NB2A 4DI6A 1PAEX 5CAAA 1VYAA 4KPCA 1B99A 4FKXA 1LEOA 1NDKA 3BH7B 1MN9A 1K44A 3ZTRA 2DXDA 4ANDA 3G2XA 3EJMA 4O0NA 3DDIA 4DUTA 1MN7A 3Q89A 3GP9A 3BBBA 1JXVA 1NDCA 1NDLA 3BBCA 2AZ1A 1BUXA 3EE3A 5C7PA 1WKJA 1S59A 3Q8VA 1HLWA 3R9LA 4CP5A 1WKLA 4F4AA 1B4SA 3ZTSA 2HVEA 3ZTQA 3NGRA 2BEFA 2DXFA 3EVWA 3FCVA 2B8QA 3Q86A 3DKDA 3VGVA 4ANEA 3MPDA 3EVOA 3FBFA 4F36A 3NGTA 3FC9A 3BBFA 1ZS6A 4HR2A 5IOLA 4W98A 1PKUA 1NUEA 2NCKL 1KDNA 4EK2A 1NPKA 1HHQA 3B54A 1U8WA 3B6BA 2DXEA 2HVDA 3Q8UA 1WKKA 1NSKL 1NLKL 4UOFA 3VGUA 1S5ZA 2DY9A 3GPAA 1UCNA 2HURA 3EM1A 3VVTA 3Q8YA 1EHWA 1F3FA 2CWKA 5CABA 4C6AA 3FBEA 2B8PA 1LWXA 1W7WA 1S57A 3ZTOA 1NHKL 1NDPA 3WX8A 1F6TA 1HIYA 3PJ9A 4ANCA 3EVMA 3ELHA 4WBFA 3FBCA 4DZ6A 3VGTA 1BE4A 4UOHA 5BXIA 1NSPA 3FBBA 3ZTPA 4UOGA 3JS9A 3EICA 3L7UA 3NGSA 1NSQA 2BX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VGS A;  4S0M A;  2DYA A;  1XQI A;  3BH6 B;  2AZ3 A;  1XIQ A;  2VU5 A;  3FKB A;  4FKY A;  3ETM A;  1BHN A;  3ENA A;  1NCL A;  2ZUA A;  3Q83 A;  3PRV A;  3EMT A;  3NGU A;  3VVU A;  3FCW A;  4ENO A;  1NB2 A;  4DI6 A;  1PAE X;  5CAA A;  1VYA A;  4KPC A;  1B99 A;  4FKX A;  1LEO A;  1NDK A;  3BH7 B;  1MN9 A;  1K44 A;  3ZTR A;  2DXD A;  4AND A;  3G2X A;  3EJM A;  4O0N A;  3DDI A;  4DUT A;  1MN7 A;  3Q89 A;  3GP9 A;  3BBB A;  1JXV A;  1NDC A;  1NDL A;  3BBC A;  2AZ1 A;  1BUX A;  3EE3 A;  5C7P A;  1WKJ A;  1S59 A;  3Q8V A;  1HLW A;  3R9L A;  4CP5 A;  1WKL A;  4F4A A;  1B4S A;  3ZTS A;  2HVE A;  3ZTQ A;  3NGR A;  2BEF A;  2DXF A;  3EVW A;  3FCV A;  2B8Q A;  3Q86 A;  3DKD A;  3VGV A;  4ANE A;  3MPD A;  3EVO A;  3FBF A;  4F36 A;  3NGT A;  3FC9 A;  3BBF A;  1ZS6 A;  4HR2 A;  5IOL A;  4W98 A;  1PKU A;  1NUE A;  2NCK L;  1KDN A;  4EK2 A;  1NPK A;  1HHQ A;  3B54 A;  1U8W A;  3B6B A;  2DXE A;  2HVD A;  3Q8U A;  1WKK A;  1NSK L;  1NLK L;  4UOF A;  3VGU A;  1S5Z A;  2DY9 A;  3GPA A;  1UCN A;  2HUR A;  3EM1 A;  3VVT A;  3Q8Y A;  1EHW A;  1F3F A;  2CWK A;  5CAB A;  4C6A A;  3FBE A;  2B8P A;  1LWX A;  1W7W A;  1S57 A;  3ZTO A;  1NHK L;  1NDP A;  3WX8 A;  1F6T A;  1HIY A;  3PJ9 A;  4ANC A;  3EVM A;  3ELH A;  4WBF A;  3FBC A;  4DZ6 A;  3VGT A;  1BE4 A;  4UOH A;  5BXI A;  1NSP A;  3FBB A;  3ZTP A;  4UOG A;  3JS9 A;  3EIC A;  3L7U A;  3NGS A;  1NSQ A;  2BX6 A; 
#chains in the Genus database with same CATH topology
 3DRR B;  5C24 A;  2F40 A;  2Y8W A;  1HBM A;  2E5I A;  3S8S A;  4WXO A;  2DHH A;  3UD5 A;  3MPY A;  4DR1 F;  4FXW A;  1WKJ A;  1PAU B;  1JNZ B;  1C0T B;  3KLF B;  3LH2 S;  1VQ5 S;  2E5L J;  2ALZ A;  2WRM A;  1WC5 A;  1LFW A;  3JB9 k;  5HMX A;  1KKH A;  4CYU A;  1PCA A;  3OVA A;  2JZ5 A;  1N5S A;  4K4T A;  3NOG A;  3SSQ A;  2DNO A;  2MYF A;  4OJG A;  5GAD I;  1S1V A;  3HF5 A;  4KKO B;  3UD4 P;  1EHW A;  1HNX J;  3TWZ A;  1G7C B;  3DC2 A;  1S97 A;  5LOQ A;  1JJ2 R;  4IOB A;  4DUY F;  3DRP A;  1R7I A;  2K7K A;  4ZS6 A;  3PO4 A;  3R97 A;  2HEK A;  3THV A;  3GIJ A;  1REG X;  3DNC A;  1DHM A;  4DF4 A;  1QAX A;  4K4X A;  4CO5 A;  3HPO A;  3GSI A;  3TQE A;  3NOC A;  1LK7 A;  2LA6 A;  2KYX A;  2ZDP A;  3B78 A;  2IC3 B;  4FN5 A;  4UY8 T;  4J9K A;  3I6P A;  4L73 A;  3G2X A;  1LV5 A;  4DUT A;  1VC6 A;  1JLA B;  4JYA F;  3L3C A;  2AZ1 A;  2OHD A;  4UTG A;  4DR2 J;  3R8Y A;  4C7Q A;  5EUH A;  2XMK A;  4OIX A;  1X60 A;  4RUC A;  3DMJ B;  3K57 A;  5T7L A;  3CCE S;  2GO9 A;  2MPU A;  2KN4 A;  3FQK A;  3W8G A;  3PKY A;  4ZP6 A;  2OMO A;  5D4O A;  1ZTT A;  5KFD A;  1FJG J;  2A6M A;  5C24 B;  4X4Q A;  2WVF A;  1RK8 A;  1HBM B;  3CWJ A;  1G1X A;  2CQ0 A;  3PVX A;  1VIX A;  1FRK A;  1ZM4 A;  5DG8 A;  1FX2 A;  3U1L A;  2QFI A;  1FK9 A;  1SIZ A;  4C8Z A;  4X4O A;  2M88 A;  5KFV A;  4PXE A;  2W24 A;  4KC5 A;  1PG5 B;  2K06 A;  1KRP A;  2K7J A;  3MD1 A;  4BC7 A;  3GV5 B;  1XIQ A;  3P49 B;  1IM6 A;  1N48 A;  2MHE A;  2OJ3 A;  4JUZ A;  4ALZ A;  1X4E A;  1S1V B;  2GJ2 A;  4B08 A;  2DIS A;  3JSM B;  2Z2L A;  1YRU A;  5D8H B;  3H2L A;  1XMQ J;  3DLG B;  9ATC B;  4F0K A;  4KYZ A;  1ZM2 A;  1M1K T;  5DG9 A;  3GYX B;  1Q8I A;  5F8J A;  3KK3 A;  2AEJ A;  2HPU A;  4DQR A;  2E66 A;  4XAK A;  4CM2 A;  4G3I A;  1JJ4 A;  5FII A;  1RWN B;  3BYR A;  4DS5 A;  2JC1 A;  3MEE A;  3OR2 A;  2EK6 A;  2ZOM A;  4USK A;  3NNC A;  2HS4 A;  3CC7 S;  4ZJO A;  2DB1 A;  2HIQ A;  3TP2 A;  3QRQ A;  3RUB L;  1I6J A;  1TAQ A;  1RT2 A;  2RJZ A;  4NXM J;  4KV8 B;  1GH8 A;  3M1V B;  3TZZ A;  3MXH P;  4NLW A;  2C2M B;  4TU7 A;  4GVB A;  2XM3 A;  1B7F A;  3HX9 A;  1IBM F;  2CPZ A;  1BQX A;  4FF1 A;  3R6L B;  3BKU A;  1NK5 A;  2RQK A;  5DDP C;  1MN9 A;  3MUR P;  1BD6 A;  4RKU C;  1D9D A;  4F3Q A;  2FLN A;  2QGF B;  4FNH A;  5E0O A;  2YWW A;  5CD4 A;  5BYS A;  2ZE2 B;  2XO6 A;  4YQW A;  1S1U A;  2FZC B;  1FK9 B;  2DHA A;  3VGV A;  1FEH A;  1N32 F;  2VQF F;  4W98 A;  5E3Q A;  2MKI A;  3KHL A;  3JYT B;  2UUA J;  1FWP A;  2J6U A;  1NSK L;  1TL5 A;  3CCL S;  5A8R A;  4O3N A;  2OPQ A;  2RKI A;  2VFS A;  1VJW A;  2FY1 A;  1EET A;  5KT7 A;  3MR3 A;  2GW8 A;  2DHX A;  4K4U A;  1S1X A;  1SQE A;  1OSC A;  2UVU A;  4MIW A;  4F4Z A;  9RUB A;  1RKI A;  2WSF C;  4LF5 F;  2ASD A;  1UW4 A;  2XLJ A;  1IUJ A;  1UAW A;  2YKO A;  4R0E A;  2G0J A;  4LF8 J;  1BLU A;  2RU3 A;  4ER8 A;  4DQI A;  3LAK A;  3KK3 B;  4OX6 A;  1IKV A;  4HT5 A;  1B0P A;  2OPP A;  3M30 A;  2NXE A;  2A6O A;  3PIP Q;  3ADA C;  4A4J A;  5GME A;  1IBL J;  2DH7 A;  2LQ9 A;  5C25 B;  2V94 A;  4FYW B;  4YR2 A;  1SBR A;  2J7U A;  4RW6 A;  5IV4 A;  2VBW A;  2ZBR A;  1HNV B;  5DM7 Q;  4U9R A;  5CYJ A;  3M8P B;  2V9K A;  4K4V A;  4QW8 A;  2C3O A;  5I42 B;  4KB7 A;  5B08 A;  2CVE A;  3RG6 A;  1TKX B;  5ETV A;  2QFJ A;  3W8P A;  1YHQ S;  2QYC A;  3IMQ J;  1CBK A;  1FVS A;  1T3O A;  2ACY A;  3I0R A;  3M2V B;  4MJK A;  2YNH A;  4CLK A;  2BW7 A;  2HQI A;  1VIO A;  1SC1 B;  1SUQ A;  1MSW D;  4X62 J;  4RW8 A;  2QSW A;  4LF9 F;  4FS1 A;  1OPI A;  1TV6 A;  3IA0 A;  3R5D A;  1DBD A;  2V69 A;  2EEY A;  2P9G A;  4KO0 A;  1NJZ A;  1YQH A;  1VQP S;  1S7I A;  4DU7 A;  3KK1 A;  3K2Y A;  1Q95 G;  2M52 A;  3UN2 A;  1DLO A;  1BWV A;  1C0U A;  4JP8 A;  2ZUA A;  4LMZ A;  2KZM A;  2GAG C;  2NZ4 A;  4ES1 A;  1VIS A;  1IBK F;  3M2U A;  2OEK A;  1N34 J;  2E5H A;  1IXK A;  1U0H A;  1Q86 T;  3OW2 R;  2VFV A;  5A8R B;  1HHT P;  2N4D A;  5F0W A;  1EET B;  4DV5 J;  5GAH U;  2VOO A;  3BGR A;  1N4L A;  2YKA A;  4JB8 B;  4Q0B A;  2AF6 A;  1AFI A;  2FVS A;  3CSK A;  2HQF A;  1SQF A;  4MFB B;  3KJQ B;  5F0U A;  1RT5 A;  2HFN A;  5KFA A;  4P7V A;  2KB2 A;  4MKY A;  3NAI A;  1IKV B;  1DRZ A;  3AD9 C;  2OPP B;  2RNE A;  1YI2 S;  3WX8 A;  4DL2 A;  1Y5L B;  2A2C A;  3I82 A;  3UNG C;  3T1Y F;  2VD3 A;  4FBT A;  4FXV A;  5FDL A;  4UY8 5;  3NGS A;  3R1H A;  2RDI A;  1T94 A;  3N6M A;  5DLG A;  4ZVG A;  2POK A;  1QTN B;  2E9T A;  1QAY A;  3KHR A;  1K44 A;  3CD0 A;  4NCG A;  4JV5 F;  5IC4 B;  1IJE B;  2AP6 A;  2V4R A;  2B4U A;  2XZD B;  1RAE B;  1U1Q A;  4ZVE A;  1SUQ B;  3M32 A;  4RW8 B;  3NNH A;  1XJW B;  4OHV A;  3POT B;  4TU8 A;  1U6F A;  5IC6 B;  4F7V A;  4LQ3 A;  3KK1 B;  2H5E A;  2WON A;  2H51 B;  1C0U B;  4YN3 B;  4RJV A;  2ROP A;  3KK2 B;  1LNQ A;  2KI2 A;  3FBE A;  4QW9 A;  4TY8 B;  1D9F A;  1OSD A;  3QT5 A;  4RW4 A;  1RT4 A;  3GIR A;  3C14 A;  4CLU A;  3IR6 B;  4U96 A;  4OLO A;  5IT4 A;  2JOQ A;  2JEF A;  4KR0 B;  2CZ9 A;  4C0B A;  4C9D A;  3SMZ A;  2RS8 A;  2QA1 A;  5J1N A;  3AXM A;  4XPC A;  1LW0 A;  2E7W A;  4HI2 A;  1LWF B;  1RT5 B;  3DLE B;  4M5J A;  2Z30 B;  2ZKU A;  2ZH4 A;  2XB2 D;  2DNN A;  1OMS A;  1XR6 A;  3L7P A;  5C7P A;  2OEL A;  1VRU B;  2IY5 B;  1Q7Y T;  1M5K C;  3MMB A;  2UVW A;  2QL5 B;  4H4M B;  3OVB A;  5LXR A;  1RIS A;  1RA6 A;  3M9N B;  2HK2 A;  4ED6 A;  1RXO B;  1U26 A;  1TQL A;  4B9T A;  1GNK A;  4ECT A;  1OS5 A;  4ZVU B;  2MKS A;  4CT8 A;  3HVW A;  2XLK A;  4LF1 A;  3OUY A;  5J2Q A;  2JWN A;  2F4F A;  3IM8 A;  3ISZ A;  4R5P B;  4QPT A;  3MGJ A;  1VQ7 S;  3DLB A;  1U47 A;  2DGU A;  1JKH B;  1B0T A;  1TKT A;  4DV6 J;  2FHO B;  4WFB Q;  4FPR A;  4RNF A;  4X65 J;  2I6W A;  4WBF A;  4LF7 F;  1JJC B;  3HZE A;  1T11 A;  3E2E A;  1SH3 A;  4IOA Q;  2GNK A;  3PYF A;  5KFP A;  2QV6 A;  3IWN C;  5KT6 A;  4DV2 F;  2OML A;  3PW5 A;  3JTN A;  1UA1 A;  1E6V B;  4RW7 A;  1NCL A;  5IT9 U;  4LSL B;  1XMB A;  2WON B;  2QIF A;  2ZEJ A;  3QAU A;  2GX8 A;  2DGV A;  4FP9 A;  3NKY A;  1U2F A;  1JXE A;  3DRS B;  3KNG A;  4WXW A;  3TA0 A;  4KQZ A;  3ZZY A;  3HVA A;  5B0C A;  4ECZ A;  3EGN A;  2QYG A;  1RT4 B;  2HBY B;  1H0H B;  1TAU A;  1SJ3 P;  1WSV A;  2OKQ A;  1YBT A;  1S0N A;  1VJQ A;  3DOK A;  2HHW A;  3UVJ A;  2FHJ A;  4X4T A;  2NS1 B;  1LW0 B;  3K8V A;  1C1C A;  1XNR J;  3PR4 A;  2W2Q P;  2E5G A;  1LQ9 A;  4CNZ A;  3BPS P;  4C3K A;  5HBM B;  2QA4 S;  2R7X A;  2YX4 A;  1WAC A;  2CNN B;  3A12 A;  1BQM A;  1RAI B;  1GEH A;  1B7Y B;  4Q8E A;  2MGZ A;  3MMB B;  1NKC A;  3QZ8 A;  2CNO B;  2OLW A;  1P8G A;  1AT1 B;  1RA7 A;  1QM9 A;  5E33 A;  3NWR A;  1LXJ A;  4K4Y A;  2CQG A;  1RTZ A;  3D68 A;  2EFN A;  3OUY B;  4ED2 A;  2DNQ A;  4OX7 A;  1OQ6 A;  3BGU A;  2ADC A;  5F8H A;  1TKT B;  4F4A A;  3TZX A;  1UWA A;  1QE1 A;  1Y0H A;  1M5V C;  1RZM A;  3LGN A;  4CO0 A;  5LMN F;  2FJV A;  3W62 A;  1G6B A;  1HI1 A;  2HHS A;  4ZVQ B;  1XMO F;  1DTT A;  2RHQ B;  2RD5 C;  4USJ C;  4DCP B;  3RRH A;  5B0F A;  1RT6 B;  2ADB A;  3QNW B;  1FCA A;  3GCW P;  3MEK A;  4F4X A;  3GSD A;  4NML A;  3B82 A;  2DNM A;  4FNI A;  2CQC A;  4YHH F;  3C2P A;  2HFV A;  3TX0 A;  3F56 A;  5BXI A;  3OSN A;  4ZPV R;  4OZ5 A;  1FT8 A;  4DPO A;  1URN A;  4WE1 A;  4NAS A;  5HN0 A;  2ZOG A;  3WC2 A;  2R7R A;  3BSC A;  4RNN A;  4Y6I A;  4AL7 A;  4I2Q B;  1OWX A;  3W3S A;  4TYA A;  3BKT A;  3GON A;  4JV2 A;  2G2Y A;  3DOK B;  1FDB A;  3PX0 A;  1TU0 B;  1KLM B;  5CHC B;  1RHR B;  3C66 A;  2BJE A;  5J1P A;  4IUF A;  2J0W A;  3U1N A;  3V4I A;  1Q8K A;  1WHW A;  2XGP A;  4DV3 J;  4Y0F A;  3RAX A;  3C16 A;  1SH2 A;  5B0B A;  1S4E A;  3E01 A;  1RLC L;  1UPM B;  3HKZ D;  1GTH A;  4ZA1 A;  2R7Q A;  3I31 A;  1X5P A;  2Z2M A;  4LFB J;  3PEH A;  1RB0 A;  2MQO A;  5FLX Y;  1S1W A;  4PAB A;  2J8A A;  1KSP A;  1DY3 A;  3TR5 A;  3SBM A;  1PC5 A;  1RT3 B;  5KG3 A;  4AFF A;  3VGT A;  5HJY A;  2QLB B;  2DIV A;  1Q16 B;  2VG7 B;  3C6T B;  4LF4 J;  3MM6 B;  5HRO B;  1YRX A;  1QE1 B;  3BH6 B;  3LUY A;  3CCQ S;  4KE5 A;  4C98 A;  4PQA A;  3DYA B;  1VQS A;  5CAA A;  2UXC F;  3PRD A;  2FQQ B;  1VQN S;  2IM2 A;  2ZNZ A;  2ZWP A;  2FVR A;  1A7G E;  2WW8 A;  2M3D A;  1BGX T;  3T5L A;  3AA9 A;  4JBC A;  2J0X A;  2MHN A;  2YXL A;  4NEZ A;  4QIE A;  1HBN A;  1U8S A;  4PCQ A;  1B4S A;  3PM9 A;  2WB4 A;  4ECS A;  4X4S A;  1AXQ A;  2UZA A;  3MHY A;  5AXN A;  3PKM A;  5C2C A;  2FZG B;  4JI0 J;  5H9E J;  3WC0 A;  4TLQ A;  4DR7 J;  1TP7 A;  3J81 Y;  4M5H A;  4A8X A;  2L41 A;  3GPA A;  4DQQ A;  4KGK A;  4W4M A;  1NH8 A;  4AL6 A;  2GQ2 A;  2OO4 A;  3IRW P;  3EVM A;  3V4I B;  5EWF A;  4DPW A;  4NLU A;  4ZIW A;  3BQ0 A;  1S6Q A;  3H98 A;  2WZ1 A;  2WVC A;  1NH7 A;  4OHY A;  1S9F A;  3QLH B;  3P6Y C;  2VAS A;  1RHM B;  1QY7 A;  2X51 A;  3E01 B;  1ZET A;  1M5S A;  2NSC A;  2W7O A;  1Q5V A;  4NWB A;  3DLH A;  3LWL A;  3C15 A;  5E7O B;  2I0X A;  2MTL A;  4RU2 A;  4DR3 J;  2KHC A;  3JQK A;  4RW9 A;  1C4A A;  3NXZ A;  1WUU A;  1WHX A;  2FGC A;  1S72 S;  1N0V C;  1SJF A;  4C11 B;  4CDI A;  4I4B A;  2RUS A;  5JMN A;  3IWX A;  4Y28 C;  1ZM9 A;  3J7Z T;  2B56 A;  4Y34 A;  3TAM A;  2BRL A;  4YEA A;  1P27 B;  5ETR A;  1XN9 A;  4JI4 J;  2F9J A;  1NZA A;  3WIV A;  3QSY B;  4DX5 A;  4G65 A;  3PV8 A;  4TQR A;  4NA3 A;  3T1H J;  4ZKA A;  3G6X A;  1TVR A;  2DGS A;  5D0G A;  4K5S A;  4DR5 J;  1NHK L;  2QLX A;  2RQ4 A;  1YJU A;  3J81 j;  2C28 A;  4NZ7 A;  3V4M A;  2XBP A;  3UFC X;  1J5O B;  4ZVO B;  1I3O B;  4ID5 A;  1KHV A;  3MEG A;  1U48 A;  5KT5 A;  7AT1 B;  3AQP A;  4Y00 A;  2RF2 A;  3SCI E;  2R2U A;  4B3M J;  4QCL A;  1X4C A;  3W2V A;  2NLW A;  3AAW B;  1YG0 A;  3BO4 A;  4J5O A;  4C8Y A;  4Y2C A;  4OX8 A;  3GIM A;  2VKZ G;  2KT3 A;  2PMW A;  3IC1 A;  1FXL A;  3HSG A;  1KWM A;  3SSS A;  4F4K A;  2PE8 A;  3PHT A;  3ZTS A;  3V5R A;  4EYH B;  1NKE A;  4C0O C;  2MKY A;  1T05 A;  5ETT A;  1S6P A;  4H4K C;  3TZY A;  2QJ3 A;  3FSI A;  5JXS A;  2AYB A;  2IA0 A;  5DZ7 A;  3SFU A;  1RDR A;  2G2Z A;  3HSJ A;  4PWU A;  1MWZ A;  4FVM A;  1WKK A;  3D5M A;  2VG5 A;  3Q8Y A;  2IBK A;  3HCX A;  2GVZ B;  3C19 A;  1CJT A;  4LFC F;  1RT1 A;  4YOE A;  3FK4 A;  3CC4 S;  4QZV B;  3AFG A;  1SCJ B;  2F9D A;  3FRY A;  2A3J A;  4OI3 A;  4XDC A;  3CF5 Q;  1LXN A;  2RDD A;  2RQM A;  3TAM B;  5AE3 A;  1WF0 A;  5EWG A;  2N3L A;  1ZAX A;  3G8T A;  4K0K J;  1PIE A;  1DAR A;  4NYP A;  3P8B B;  4QR2 A;  1TVR B;  2D3O R;  4KPY A;  2HW3 A;  4J9R A;  3CMQ A;  2AJF E;  4USV A;  1R89 A;  1TFW A;  1NK7 A;  3NGD A;  4DX7 A;  2WCX A;  1SI9 A;  1WEL A;  3MTJ A;  4HR2 A;  1F2G A;  3WBZ A;  2GZO A;  3L7O A;  4DLG A;  2MY8 A;  3UWT A;  2FJB B;  2RF2 B;  1EB0 A;  1QSS A;  3NS6 A;  2ATL A;  4PEO A;  1JLB A;  3MFI A;  1F3F A;  1BWE A;  3BS9 A;  3G6E S;  1MML A;  4OYW A;  4HI1 A;  4DMZ A;  4C2M A;  2FJW A;  4LSN B;  2KHD A;  2K2P A;  2B3T B;  4TKT A;  3M9M B;  1EX8 A;  5BYQ A;  1YBU A;  2F7V A;  3OTO J;  4OZ1 A;  4QPX A;  4HDG A;  3FFI B;  1M1G A;  2KG1 A;  3TJA A;  1UTA A;  2PA3 A;  1S6P B;  1RYR A;  2AYM A;  1JNR B;  2G1H A;  1Y5N B;  1KOO A;  5ETL A;  3VAI A;  4DV0 F;  5FLX U;  4EU0 A;  4IG0 A;  3AJ1 A;  4N5S A;  5ADZ A;  1QD1 A;  1NJY A;  1NDC A;  2VG5 B;  1T0T V;  1VHI A;  1LWC B;  4PKD B;  2Y0S D;  2B8Q A;  3LPE A;  3LP0 A;  5HP1 A;  4KHP F;  2A10 A;  1ZA2 B;  5RUB A;  3HSZ A;  2FC8 A;  3GLJ A;  4JI3 F;  4BLG A;  1S6U A;  4MK7 A;  1K1Q A;  1SVD A;  5H9E K;  4TN2 A;  2DR7 A;  1HPZ A;  4ZN3 A;  5CAB A;  2PEB A;  2XS2 A;  2V4Q A;  1YIJ S;  2HZC A;  4PUO A;  2EWH A;  4X4U A;  1NXI A;  4DQP A;  1N8R T;  2KYZ A;  3H5X A;  1B0V A;  3HHE A;  1L5U A;  2GA7 A;  1KFD A;  4DBQ A;  2H5J B;  5GMK a;  2IYI A;  5L38 A;  2AZ3 A;  4J91 A;  2M5Y A;  2ZC3 A;  5KFL A;  3J81 U;  1QSL A;  4KBI A;  4DS4 A;  2BBE A;  3GMG A;  4KGX B;  4O0N A;  5KFK A;  2ZZN A;  1JLB B;  2BE2 A;  2IVM A;  2V8D A;  4IQX A;  4EUV A;  1HLW A;  5ETS A;  4EMD A;  2ZH9 A;  3PRB A;  4Q5V A;  1CC7 A;  4OJH A;  3D1H A;  4I0W A;  4NLY A;  4OI1 A;  4HH1 A;  5KFE A;  1X0F A;  2M0G B;  3K89 A;  2GJF A;  2DK2 A;  2GML A;  3DRX A;  1CJV B;  2YWG A;  5IQ6 A;  4R8U A;  5KFO A;  4DSK A;  3HVT A;  2F63 A;  2XSJ B;  5DDO C;  4DSI A;  3C46 A;  3TZW A;  3BSO A;  4IFY A;  2XMJ A;  4J7C A;  4MT1 A;  3OXL A;  1U02 A;  2GO8 A;  2VFT A;  1REV A;  5KG7 A;  4ELV A;  4IG0 B;  2C3U A;  1NPP A;  1O6X A;  4P75 A;  5DRK A;  2HHQ A;  3CCJ S;  3P5T L;  4HLB A;  3QO9 A;  1JB0 C;  5KFX A;  4WP9 A;  2HHX A;  3CDE A;  4F04 B;  1WOP A;  4K8R A;  2A2D A;  5HSP A;  2Q66 A;  3VWS A;  3QWU A;  2XQC A;  1S0V A;  5F3T A;  3J7Z 5;  2HAI A;  1HPZ B;  1Q53 A;  1IKW B;  2HWI A;  5B7W A;  2D1C A;  4ECX A;  3KJV B;  2HG4 A;  1YBA A;  5L9N A;  3HLU A;  3DGP A;  3TAP A;  2IPO B;  4B3R J;  1ITP A;  3QGP A;  3QIP B;  1HWU A;  1ZS6 A;  2RU9 A;  3HHK A;  1HI0 P;  3SSR A;  5KTQ A;  1EKS A;  3IG1 A;  2Y9H A;  2YTC A;  2R8K A;  1SB6 A;  5KFM A;  3TI0 A;  4ELU A;  3HSD A;  2PDA A;  3AOC A;  1ZZF A;  1VK3 A;  5KG1 A;  5KFH A;  1F6T A;  5KFT A;  4G1Q A;  1VRT B;  2AQ4 A;  3EZU A;  4N77 A;  4B9S A;  2BE2 B;  4DL4 A;  1PSD A;  4GKJ F;  3QJL A;  4WFN Q;  3FEZ A;  3QFH A;  1K1S A;  2U2F A;  2OAU A;  2R2S A;  4RUB A;  3BDE A;  2YKP A;  3IBC B;  2VF3 A;  1U1R A;  4P52 A;  3NGU A;  1YDL A;  1L3S A;  2I5J A;  3HFV A;  4X2B A;  1IN0 A;  4NMX A;  3MM5 A;  3FSX A;  3F73 A;  2BE9 B;  2UXD F;  3D7S B;  3DLJ A;  4IFY B;  3V6D A;  3S7R A;  3KUH A;  3J80 Y;  3FSY A;  2W1B A;  3AOA A;  4PRF A;  2C2D A;  3EDQ B;  2ZZM A;  3HM9 A;  2DCL A;  5T14 A;  4I69 A;  1TL3 B;  3OFE A;  2VPZ B;  3O3L A;  5C5J A;  2AIR B;  3ZZ0 A;  2V8G A;  2NPF A;  3MTK A;  1YJ9 S;  2HLU A;  4A8W A;  1CUL A;  2CPE A;  3KG4 A;  3R5C A;  1S5Z A;  2OTJ S;  1XTZ A;  4AXI A;  1V6H A;  4QWA A;  1RU1 A;  3SCL E;  4UOG A;  1FTC A;  4CLT A;  2CQ2 A;  2Z58 B;  2CPD A;  4DR1 J;  4IRK A;  2AYG A;  3BV8 A;  4WFA Q;  4AQY J;  1H7X A;  1X5O A;  2PGC A;  1R0B G;  2DKO B;  4K4W A;  2W9B A;  5F9L A;  2EFQ A;  1Q8B A;  1BC6 A;  2C3P A;  3IG1 B;  2Z4P A;  3N6N A;  2O01 C;  3UD3 P;  3TRG A;  2DRD A;  3KLV A;  3EGW B;  4MYT A;  2QG9 B;  4UW2 A;  2CJX B;  4G1Q B;  2BEF A;  4UQT A;  2NXN A;  2GIF A;  4ZLL A;  4WYL A;  3IR7 B;  3RU0 A;  2HVZ A;  1KN6 A;  4DUY J;  2YNI A;  4JI6 F;  4DR6 F;  4K59 A;  3AD8 C;  4EBE A;  1IR0 A;  4UUX A;  3GWC A;  1N54 B;  3W9I A;  3A3N B;  4HEA 9;  3IN5 A;  1OY6 A;  1Y5I B;  2AGP A;  2OPR A;  1T3N A;  3EPI A;  1S76 D;  3OJS A;  2BJ7 A;  2KT2 A;  4O3P A;  1S57 A;  2P9C A;  3HHL A;  3MEC B;  3EX7 B;  2VB6 A;  3HFK A;  3OL9 A;  2IYG A;  4I2P A;  1FWL A;  3CCW A;  1FES A;  1WTF A;  1W2B R;  1V5V A;  1T03 B;  4G6V B;  1VQ8 S;  2KJV A;  4JYA J;  2E1A A;  1VC0 A;  2QC3 A;  1WTB A;  3O2I A;  4DHV A;  3CW2 C;  3MM8 A;  5M2R A;  4ES2 A;  4WJB A;  1AUD A;  4AD6 A;  3IM9 A;  3IRX B;  2YKM B;  4ED1 A;  2DGO A;  1HWK A;  3ZO7 A;  2J0S D;  2FYX A;  4CNY A;  4OZL A;  2ZKT A;  2FHK A;  2BAN A;  4LJM A;  4IO9 Q;  2YPY A;  1U09 A;  3MOZ A;  4KGZ B;  3I32 A;  1M5H A;  1HQU B;  5LM7 E;  3J7A 1;  4ECU A;  2R2T A;  1NRK A;  3V2U C;  5H1S V;  1S9E A;  2UUC F;  3RYL A;  2XS7 A;  1FO1 A;  1RWX B;  2C2N A;  2DY1 A;  3D3C J;  5H9F K;  4Z2X A;  3UR0 A;  2D3Z A;  3D2W A;  3H90 A;  4KY3 A;  1KR4 A;  4C6A A;  3HD1 A;  4K2X A;  2NR0 A;  1GMU A;  3HMJ G;  2HRY A;  2Q79 A;  2HFO A;  4O3Q A;  1V5I B;  2F1F A;  1DJ0 A;  3KLE A;  2DYA A;  4KJI A;  5KFF A;  4EGL A;  1VC5 A;  1FX4 A;  4QBU A;  1EP4 B;  3CCZ A;  5D77 A;  1EAR A;  4ECY A;  2ALY B;  1RHQ B;  4D3H A;  3MPW A;  1YGY A;  4J9S A;  1VBK A;  3TAQ A;  1KTV A;  2P8I A;  3BJY A;  1U1O A;  2MKJ A;  2QSF A;  3K59 A;  1T9X A;  5HAN A;  3IXQ A;  2CQB A;  4KHM A;  3EVW A;  3I5B A;  4NXM F;  1JLG A;  2CJA A;  2V8P A;  3BBF A;  4ED0 A;  4ZHR B;  1ZOT A;  4K5R A;  2DNR A;  2IAJ B;  5HO4 A;  3ILO A;  2YKN A;  2MQL A;  5ETO A;  3OBI A;  2DCU B;  4DFM A;  1UJ4 A;  5F8M A;  5GAH I;  2FLL A;  5JUM A;  1PJ6 A;  2KFY A;  1IBM J;  1C2P A;  3LTO A;  2ZH6 A;  4DG1 A;  2BW2 A;  3PEJ A;  3KWM A;  1ZPV A;  1RAC B;  3L7U A;  3D0I E;  1HBU A;  2A1B A;  4CZC A;  3FQL A;  4CLL A;  4ZOS A;  1CSJ A;  1OYE A;  1I94 F;  4J9U E;  2MLZ A;  2CNL B;  2CZV C;  1T8E A;  2D7S A;  2WHO A;  4ZPD A;  5C42 A;  5K8O A;  2ZFH A;  4MMO A;  1FRX A;  3RR7 A;  2VQF J;  2G2O A;  1IJF B;  2KG0 A;  3LWM A;  2ZVS A;  3H42 A;  3L9Z A;  3A3O B;  2EFP A;  4JI7 F;  1RWO B;  1CG2 A;  3DCA A;  2IM0 A;  3G6V A;  5CH7 B;  3CJ4 A;  2VBY A;  3ZZZ A;  5EX3 A;  3KLE B;  4LF8 F;  3NWG A;  5KOX A;  4FPI A;  3O8W A;  1VBY A;  1SL0 A;  3OR1 A;  3K5N A;  4ECV A;  2CWK A;  4FYX B;  3J80 U;  1VQM S;  4OYO A;  5AJ3 F;  5D3G B;  5KFU A;  2JNJ A;  4J9M A;  1O5J A;  2NQP A;  2X1A A;  4URG A;  1EKR A;  3HVR A;  4ILR A;  2IM1 A;  2LXI A;  2IMO A;  5M2P A;  2VQE F;  3QMQ A;  2HND A;  3LO3 A;  2CQP A;  5FD1 A;  1GXU A;  2YKQ A;  1RLD A;  4X4P A;  2XZT B;  1R8C A;  3CJK A;  3VVU A;  1VRQ C;  4WU2 A;  2HZV A;  1RTH B;  2IVF B;  2D74 B;  4HHU A;  5HL7 Q;  1RWW B;  2GCF A;  1DTQ A;  3MCM A;  4LRC A;  4DJB A;  4NLT A;  1X4B A;  3D0G E;  2AJ1 A;  4F67 A;  3CIM A;  2X1G A;  3MPD A;  3T1A A;  2F8H A;  4DG1 B;  3PZP A;  1KVJ A;  2BZ2 A;  4CTA B;  1HBU B;  2YH0 A;  4NLS A;  5HJX A;  4LF9 J;  2YNF A;  5E41 A;  1TR0 A;  4X64 F;  4M63 A;  4WIQ A;  2XYP B;  4WWS A;  3CJ5 A;  5C42 B;  4RNO A;  2CJ9 A;  5HI7 A;  1KVI A;  4KRW A;  1K0V A;  5BJR A;  5CCM A;  3QGH A;  2Y0B B;  3HZG A;  1QAI A;  4ED4 A;  5HVF A;  5AT1 B;  1Z1Z A;  2OSQ A;  4DV5 F;  1IBK J;  4OL8 A;  1CLF A;  1KVK A;  1P9Y A;  2HLT A;  4EO8 A;  1FRH A;  4M5I A;  3GFH A;  4CLS A;  1HFE L;  4S0M A;  3WHI A;  1NK4 A;  3PJW A;  1NEE A;  4ZLN A;  1TTH B;  4UF4 A;  5F8N A;  1CJU B;  2YWH A;  4NZ6 A;  3DXS X;  4A8Y A;  1MWY A;  4EYI B;  3ISN C;  4PXD A;  2CPF A;  4C3L A;  2ZH5 A;  1WEX A;  4FF2 A;  1JJH A;  1U49 A;  1O51 A;  4OYX A;  1HD0 A;  1JLF A;  5LL6 d;  3QSI A;  3PY8 A;  2M8H A;  4OI4 A;  5DQI A;  4AXJ A;  4DSL A;  2GGP A;  2HND B;  2CJB A;  2DNK A;  2C42 A;  5ETK A;  5J2M A;  5J2N B;  3N4W A;  1AA1 B;  1UJ5 A;  3T1Y J;  3MCS A;  2YNG B;  3ZZO A;  4ZMM A;  2RE1 A;  2BOP A;  2HUR A;  2EI5 A;  1AZS A;  3M05 A;  2LU1 A;  1JLQ B;  2Y3Y A;  1L3V A;  1DTQ B;  1E6Y A;  1W25 A;  4DFP A;  2JLF A;  2HFZ A;  5J2P B;  1JWW A;  2EFV A;  2HNZ A;  4DV7 F;  3PW7 A;  1SC6 A;  2WAQ D;  3KOA A;  3I87 A;  3VGS A;  1I1G A;  2QMW A;  4FYD A;  4JV5 J;  1RYS A;  5E3A A;  4Y2I A;  2GMJ A;  2I38 A;  3I4P A;  2QL7 B;  2XNQ A;  4IRC A;  6AT1 B;  4GKK F;  2AEF A;  4AND A;  2KVI A;  1A0O B;  3BBB A;  1JXV A;  3IGN A;  2CPJ A;  2R8G A;  4UST A;  2E9R X;  1NHU A;  4Y65 A;  4NCA A;  2OD4 A;  1VI7 A;  1ZAV A;  1CJK A;  3GG0 A;  4F4Y A;  3DU6 A;  1F5A A;  3TVY A;  2HVD A;  4GVL A;  3T6J A;  4P73 A;  3NBP A;  3KJN B;  2KU7 A;  2HHT A;  4OYP A;  5B0E A;  2X3D A;  1RWV B;  2W2N P;  3A4T A;  5D0R A;  2VHG A;  3G96 A;  2NUU G;  3H2U B;  4PG5 A;  4ITS A;  3FCH A;  3ELH A;  4H4O A;  1BE4 A;  3T3F A;  2OEJ A;  2W9C A;  1WF2 A;  4FBU A;  1SXL A;  2HWH A;  2DTJ A;  3QYY A;  2RHS B;  4J9P A;  3KUG A;  3OTC A;  2BYC A;  2VG6 A;  4ZPW R;  5I3Q A;  1YWX A;  4LR9 A;  1C1B A;  3MM9 B;  5J2M B;  5A76 A;  1S7H A;  2ZM6 F;  2H9Z A;  1Q81 T;  3GYG A;  4O44 A;  1NK8 A;  4OFZ A;  1TUV A;  3D6T B;  2P2C B;  2LP4 A;  1WI8 A;  1SKS A;  1Y3J A;  4OZN A;  1AZS B;  1EQ0 A;  3OL7 A;  1RHU B;  4U8V A;  1RBA A;  3H8Y A;  3NGR A;  2DHS A;  1E6Y B;  2OTL S;  4P2X A;  3X1L B;  2PFF B;  3H5Y A;  2W2P P;  3ENW A;  3QT6 A;  2HHH J;  4LF7 J;  3CCV S;  4OJ3 A;  5DGB A;  4TQS A;  4QWC A;  2NZC A;  1HKA A;  4NX9 A;  2XY7 A;  4WFX A;  4PG4 A;  2FVP A;  1P1T A;  5L39 A;  1MLA A;  4PPZ A;  3U02 A;  1OJ4 A;  2F5G A;  3DLK A;  2QA2 A;  4HHJ A;  3GJR B;  1YLX A;  1U1P A;  1HD1 A;  3NBP B;  1B3T A;  5CYM A;  2JEG A;  2APO A;  4DN9 A;  5HVG A;  3ZZT A;  2ZBQ A;  3MCO A;  1GAO A;  3HK2 A;  1CVJ A;  4O4G B;  3A8K A;  3GB0 A;  1NU4 A;  3NGK A;  2G4B A;  1JLE B;  3W66 A;  1GMW A;  3QWP A;  5E3C A;  3EWG A;  1VBX A;  4NLG A;  2W9C B;  1S12 A;  4C97 A;  3SDE A;  4LFA J;  1DFD A;  1NJI T;  2DXE A;  2L08 A;  1FE0 A;  1IQT A;  1WG5 A;  2OFG X;  4P7T A;  1C1B B;  1UWB A;  4M5D B;  3OPK A;  4FF3 A;  1XR5 A;  2CQD A;  4H4K A;  4M5K A;  4JI2 F;  4O23 A;  4HAC A;  2V4J A;  1WG4 A;  2HBQ B;  3R5B A;  4B3S J;  3ITH A;  1ULR A;  3DOL B;  1YZ7 A;  1RWM B;  4CH1 A;  1T9T A;  3IO1 A;  3CC2 S;  4JV1 A;  3WDO A;  5IWA J;  2EXU A;  3NMA A;  4PQU A;  5KG0 A;  4HH0 A;  4ZVP B;  1S79 A;  2H4Y B;  1AYE A;  2BE7 D;  4FF4 A;  5LMN J;  2JFD A;  3FUY A;  5J1E B;  2BUN A;  2KXN B;  2BMB A;  3AT1 B;  3FZB A;  4JOU A;  3TJ8 A;  1Y00 A;  1NM2 A;  4WTO B;  3D1O A;  2IJR A;  3K7R A;  2V5H G;  2IJF A;  4AT1 B;  2RML A;  4YHH J;  1QUV A;  4PPD A;  1V9O A;  2CWX A;  3GR1 A;  3TOQ A;  2R8J A;  1LOU A;  4PG7 A;  2Z0G A;  5D4N A;  3R2C J;  3VGU A;  3D1Q A;  1NK0 A;  5KFQ A;  3I4H X;  3CB4 A;  2CJK A;  4GC7 A;  6FD1 A;  2Q6B A;  1MU2 A;  1GX6 A;  4NXN F;  1X8D A;  1AB8 A;  1WOR A;  3H5S A;  2LQ8 A;  4CYU B;  1FNM A;  2HGN A;  3M8S A;  3PFO A;  4WU3 A;  2B6A A;  3UQS A;  3N01 A;  2ZD1 A;  4MK9 A;  2WVD A;  2VDI A;  2O67 A;  2OH2 A;  1R0C B;  1WF1 A;  1M90 T;  3DRP B;  2AU0 A;  3SDE B;  3HI9 A;  2FY8 A;  1RTJ A;  2MXY A;  1KBR A;  3K17 A;  2DRA A;  3PFE A;  4LFB F;  3IAM 9;  2ZIT A;  2XYG B;  2P9E A;  2DHG A;  3CCR S;  2HBZ B;  2O5D A;  1UWB B;  3CO9 A;  4QWE A;  4X66 F;  4IFV A;  1D3W A;  4O3O A;  1YJW S;  2C2E A;  1FER A;  4OQJ A;  1F0X A;  4IG3 A;  3S01 A;  2H3E B;  1H2V Z;  3HUL A;  4PG6 A;  2CYY A;  3MMC A;  1NUE A;  4DDF A;  3LAN A;  1G4C A;  4U6P A;  4CO1 A;  2K8G A;  4FDF A;  4PQU B;  5CA5 A;  4U8Y A;  2R7O A;  4CLY A;  5T7L B;  4E2F B;  3EYZ A;  2VOD A;  1VCT A;  2HK3 A;  2UXC J;  2HFU A;  3T41 A;  1S99 A;  2YPZ A;  4DL0 C;  1RUS A;  4W92 B;  3QJP A;  1PO6 A;  5LJ3 Y;  3N79 A;  4RPF A;  2CDR B;  2JEI A;  4Y2K A;  3MI7 X;  3IAS 9;  4FKX A;  4DR7 F;  3TAN A;  1HQE A;  1FDN A;  5IQQ A;  2XWY A;  3NAH A;  3FMB A;  1XK8 A;  4CIO A;  3PR5 B;  2F8E X;  3TW0 A;  4WK3 A;  1MU2 B;  1UZH A;  2MEW A;  3PYE A;  5IT9 Y;  3VQT A;  1UW9 A;  1OQ3 A;  1CQM A;  3M7V A;  3NRB A;  2DR6 A;  2HBR B;  3PJX A;  2JLE A;  4F36 A;  3RBD A;  5IT0 A;  4PWD A;  2BRK A;  4EO6 A;  2ZD1 B;  4P9S A;  2W2O P;  4ZPB A;  4ZK7 M;  2LEA A;  2KZZ A;  1I5O B;  1YRT A;  1HQ2 A;  1RSC A;  4OZ2 A;  1FEE A;  3I9V 9;  3MUV P;  4DSJ A;  3W61 A;  2AJ0 A;  1LKZ A;  4B9M A;  1WD6 A;  1SC3 B;  4IFV B;  1U1M A;  5HMZ A;  1YK9 A;  3MEE B;  3OR2 B;  1UFW A;  2IBO A;  1WSR A;  3ZXW A;  2BJD A;  2IDL A;  3D66 A;  1RTI A;  1RT2 B;  3QQC D;  3T1H F;  2EKN A;  1FWK A;  2ZJR Q;  4DSE A;  4O3R A;  2CQ1 A;  2U1A A;  4C8M A;  4CH0 S;  1D1U A;  1D0E A;  1RE1 B;  4KTQ A;  1X31 C;  5L9X A;  2IHR 1;  4I67 A;  4GVB B;  2ZDO A;  3QAT A;  5HQL A;  4ZIV A;  3F0N A;  4ANE A;  1V3S A;  1MG7 A;  3GZ7 A;  1P9Q C;  5MAO A;  3LGM A;  1PKU A;  3M8R A;  3QID A;  2MZJ A;  4TLR A;  3H4B A;  2WTF A;  2NRE A;  3R7S B;  2OEM A;  4LVO P;  3N0V A;  1S1U B;  2VON A;  4NEY A;  1LWE A;  1XC9 A;  1MMN A;  4MIA A;  1N33 F;  4ZIT A;  4KGV B;  3R7B B;  2V8H A;  2D69 A;  2B51 A;  2RS2 A;  5LMU F;  5DDQ C;  4QWD A;  4NLO A;  4KH0 B;  2BKO A;  2OPQ B;  2MQM A;  2R3V A;  4QQB A;  2CKW A;  2RKI B;  4AYB D;  4PWD B;  1X4F A;  4C8O A;  2IDE A;  1S1X B;  4IQM A;  1WEY A;  2O1P A;  1SC4 B;  3HHL C;  3KDN A;  3RB4 A;  4I7F A;  4ICL A;  2C2Z B;  1XWL A;  2ZBI A;  4OZ3 A;  2F4V F;  3JQM A;  2QLJ B;  2BQ3 A;  1EAY C;  1S59 A;  1QTM A;  2FJA B;  3SCK E;  1CPZ A;  1ZPW X;  1HYS A;  3M30 B;  4LFC J;  1UPP A;  1IQZ A;  2VIC A;  1SV5 A;  3B54 A;  1B70 B;  2IMW P;  4OMF G;  1F3V A;  4RW6 B;  4K0K F;  2R9L A;  3A8E A;  3NL0 A;  4DEZ A;  4F2R A;  1VLY A;  5KFC A;  1JLC A;  1ZBT A;  2SXL A;  3PX4 A;  2BM0 A;  3G8S A;  4L74 A;  3I0R B;  3MR5 A;  3HO1 A;  4PYA A;  2YNH B;  5A8K A;  2RVJ A;  3DDK A;  4M95 A;  2Y1R I;  2IA6 A;  1D9A A;  4H54 A;  1CS4 A;  2K1R A;  4ID8 A;  3PRV A;  3T19 A;  2JEJ A;  4P71 A;  3PXG a;  1J5E F;  1TV6 B;  3EXY A;  2F3J A;  4DV4 F;  1OO0 B;  1XR7 A;  2J9C A;  4KO0 B;  2IRX A;  5E3P A;  4DR4 F;  3JSB A;  1WDT A;  4HTI A;  3K58 A;  2BV3 A;  1U7L A;  3PIO Q;  4IKA A;  1DLO B;  5EN1 A;  2ZH8 A;  4D3G A;  3NGT A;  2D3U A;  3M2U B;  1SKR A;  4OV6 A;  4ED5 A;  1U0H B;  1TL1 A;  1UMJ A;  2AKW B;  2Y1I A;  5CYQ A;  3M8W A;  1UKU A;  2ZJP Q;  2MQQ A;  4KT0 C;  4UOC A;  1FKO A;  4N8N A;  2LYV A;  4USH A;  3BGR B;  2MQN A;  3NY0 A;  2WW4 A;  4CLF A;  4Q0B B;  1Q82 T;  4I7F B;  3MFH A;  4DFK A;  2BAB A;  2C1E B;  3PYD A;  3LP1 A;  1BQN A;  3ZNJ 1;  3KLH A;  2QA4 G;  4F3M A;  3PX6 A;  1FNO A;  3DOM A;  3FGV A;  1X5S A;  3KLG A;  5A0Y A;  1APS A;  3R5J B;  3R1L A;  3QPI A;  2CJY B;  5AXM A;  2B4O A;  1LEO A;  2BKP A;  2QN6 B;  1O8B A;  2HNY A;  5FDL B;  1VQK S;  4X4V A;  4JI3 J;  4OI0 A;  1BUX A;  3QGI A;  3CJ0 A;  1S77 D;  5A6P A;  2XMU A;  3EGZ A;  3IFE A;  3I0S A;  1KFS A;  1S48 A;  2UV8 A;  3RB0 A;  5G0R A;  4NCG B;  2DO4 A;  4QJV A;  1VQ9 S;  4NE9 C;  3IS9 A;  5DQG A;  2KRR A;  3DI6 A;  2CQ4 A;  1R8P A;  1ZTW A;  3M32 B;  3OHA A;  3OVS A;  2VPY B;  4FYY B;  2XC9 A;  3OLB A;  1U24 A;  1Q7L B;  1JXL A;  3OJU A;  4Q43 A;  3UCG A;  3G9C A;  2DNP A;  2GQQ A;  2H5I B;  3OL8 A;  2V34 A;  4QIV A;  3ENQ A;  4A8K A;  4LRF A;  5SZT A;  4CO4 A;  3L4B C;  3BR9 A;  1TMJ A;  3GQC A;  2ZZT A;  5KG6 A;  2XO7 A;  1R43 A;  4HHH A;  3MMJ A;  4RR5 A;  1NB2 A;  3HT0 A;  1H74 A;  2LFV A;  2MQP A;  1K0T A;  4WTY A;  4HDH A;  3M8Y A;  4RW4 B;  5CYQ B;  3C14 B;  1FF2 A;  3R27 A;  1IWA A;  1Y3K A;  3JTO A;  1WHV A;  3G6Y A;  5B0D A;  2M70 A;  2V2Q A;  4B3T F;  3HHD A;  1SJ1 A;  4FVC A;  5I3U A;  1X9M A;  3MUT P;  1BQN B;  5L1I A;  3VAL A;  4USI A;  3CCT A;  3DOM B;  4M1K A;  3THT A;  2CXE A;  3KLG B;  1HNZ F;  3HDS A;  2W8K A;  5K8N A;  1YX2 A;  3KDO A;  2BXJ A;  3DRR A;  2XTJ P;  1NSA A;  1FHT A;  3KUE A;  3GFY A;  1NAQ A;  2FJE B;  4NRU A;  1Z2L A;  4JI5 F;  1WEZ A;  2E1C A;  2FB0 A;  2KXF A;  2RAQ A;  2RB7 A;  2MQ8 A;  2W01 A;  3OFG A;  5AXK A;  4YDX A;  2FVC A;  2IRY A;  4P2S A;  5J2Q B;  2J7W A;  1F9E B;  2JX2 A;  2CQI A;  3I0S B;  4YB5 A;  3BRE A;  2VU5 A;  5D0H A;  2NSB A;  2VL1 A;  3Q8R B;  1NBE B;  3OQ2 A;  1RWK B;  3BDP A;  1PAE X;  4ZCK A;  4KPC A;  5L1L A;  3MPV A;  3MED A;  4ED8 A;  4OZ0 A;  3IS9 B;  2FHJ D;  3DI6 B;  4ZPT R;  2R8I A;  4C8K A;  4IR1 A;  2FJX A;  3UR3 C;  1R27 B;  5D15 A;  3JXO A;  3TUJ C;  2ZBP A;  3UW1 A;  4P6Q A;  4Z7C A;  4KKO A;  5HK4 A;  5ITH A;  4RW7 B;  3MOJ B;  4MIB A;  1KNZ A;  1Q1K A;  3C8Y A;  3UN3 A;  1TKZ A;  1DZ5 A;  3H25 A;  1EZZ B;  1QAJ A;  3VHQ A;  5AXL A;  4ZCL A;  2BDP A;  4PR6 A;  4XO0 A;  1X4D A;  2KRB A;  3NNA A;  3ZZP A;  1NLK L;  4GKJ J;  2VBZ A;  3FMW A;  3M2R A;  2B9W A;  3TVZ A;  5GVQ A;  2D3O 1;  3TA1 A;  1KC8 T;  2IC3 A;  5HVH A;  5FJ4 A;  2MKH A;  2JFK A;  5B0A A;  1F5B A;  4DL7 A;  3M9O B;  3UVJ B;  3FBB A;  3TUZ C;  3V81 A;  2UXD J;  4JI8 F;  1JLA A;  3RB6 A;  2KT5 A;  3M6W A;  1C1C B;  2ASJ A;  1RJJ A;  2BJ9 A;  5I3U B;  1BHN A;  2PSZ A;  5THW A;  3DMJ A;  1EQM A;  3GV8 B;  4K50 A;  3CED A;  1X4A A;  4DPU A;  1BQM B;  2KH9 A;  3BSA A;  3I5A A;  2MGZ B;  3RTV A;  1NZ8 A;  5F41 A;  3VAK A;  2XLI A;  2VJU A;  3N9U C;  2DNY A;  2PA8 D;  3PDN A;  1KQK A;  2MB0 B;  3K5L A;  4TNO A;  3CJ8 A;  5DG7 A;  2UUB F;  4AQY F;  4ILL A;  1V3R A;  2ABY A;  3BZQ A;  3T9Z A;  1CEZ A;  3D6F B;  3MDF A;  2BQR A;  3MED B;  4Q7A A;  1TK5 A;  3P45 B;  4ANC A;  2DGX A;  1DTT B;  2Z57 B;  3O6Q A;  4LSZ B;  2KDO A;  3VAJ A;  2FJD B;  3T5K A;  3JSM A;  1VBZ A;  3MUM P;  4DPT A;  1N5T A;  2CG4 A;  3NS5 A;  3AA8 A;  4QU7 A;  1TKZ B;  3DLG A;  3CJ2 A;  4GRS A;  2XY6 A;  3MZI A;  4ZLJ A;  3DM2 A;  1WG1 A;  4XDD A;  5IS2 A;  4JI6 J;  4DR6 J;  3M2R B;  4WE1 B;  3PO5 A;  2RT3 A;  1UVN A;  2I8E A;  2V2K A;  4RLE A;  3G71 S;  2E1R A;  4ATN A;  3CD6 S;  3TUI C;  3S6E A;  1HR0 F;  4OV1 A;  3IWL A;  1YTY A;  1PGZ A;  2AX1 A;  4P2M A;  3GJT B;  3I56 S;  3V81 B;  1FD8 A;  1U8W A;  3A1Y G;  4LRE A;  4ECQ A;  1NND A;  4KV8 A;  2R42 A;  3M1V A;  4JI1 F;  4URS A;  2AEM A;  4R25 A;  3P4U B;  3C16 B;  1NKB A;  1XER A;  1RAB B;  4LBI A;  1U0S A;  4XK8 C;  2HHU A;  2CPX A;  3GE9 A;  2DVI A;  3KG1 A;  2LEC A;  3CCS S;  2W9A A;  1HW9 A;  2ROG A;  2V8V A;  1BMQ B;  2ZE2 A;  4FKY A;  5K8P A;  1TUW A;  2MZS A;  1S1W B;  1L3K A;  4DI6 A;  4RU9 A;  1B99 A;  2X7I A;  4YY3 F;  3TX8 A;  2W7A A;  3ETO A;  5IXU A;  1T9W A;  3B4M A;  3SZ2 A;  3JYT A;  2GMH A;  2UUC J;  3GCX P;  1H98 A;  3MPU B;  3LPY A;  4CQ1 A;  4ZJQ A;  1YJV A;  1NO8 A;  3ISN D;  3D3B J;  3DKD A;  4DUZ F;  3T9N A;  3FBF A;  2CQ3 A;  3FC9 A;  1FVQ A;  4A8S A;  4X4R A;  3TAR A;  1HBN B;  1FD2 A;  2MZ1 A;  2D9P A;  1YJT A;  5HAO A;  1NK6 A;  1QSY A;  3QRR A;  2ERR A;  1L3U A;  3DM2 B;  2YH1 A;  1RU2 A;  4JV0 A;  3NS7 B;  4OYA A;  3VZI A;  5C2G A;  3CNQ P;  3UI3 A;  4QIG A;  1N88 A;  2LMI A;  4ZP7 A;  3DXB A;  2BR0 A;  4LF6 F;  3KHG A;  4FZV A;  2AJQ A;  4UUW A;  3ULH A;  5C25 A;  3CJQ A;  3RZA A;  4CRJ A;  1UA0 A;  1VR6 A;  3EZO A;  1N36 F;  4MTP A;  4WZQ A;  1HNV A;  1U25 A;  3M8P A;  4ZP8 A;  4EEY A;  5I42 A;  4EZ9 A;  1TKX A;  1OYD A;  3CCU S;  4OLP A;  4G1P A;  3M8Q A;  1B64 A;  1S1T A;  1S6Q B;  3OSP A;  5BYR A;  2E7V A;  3VAF A;  3M2V A;  4EBC A;  1RAA B;  1WKL A;  1S4F A;  1WJ9 A;  2QMX A;  2HVE A;  1M5P C;  1R8B A;  1HWI A;  5EHH A;  2JSX A;  3HJF A;  3C15 B;  2GIR A;  1G2E A;  5A8W A;  3H5U A;  2M4M A;  2L3M A;  1N6Q A;  2FGO A;  4RW9 B;  3Q8Q B;  4UT4 A;  3DRY A;  4YFU A;  2Y1J A;  4Q45 A;  3THP A;  1SJQ A;  3H4D A;  2XWX A;  1I94 J;  2OSR A;  2BJ8 A;  1SL2 A;  4ILM A;  3TEH B;  3I5C A;  2KVQ E;  1VDH A;  4N41 A;  3BGL A;  2UU9 J;  4MH8 A;  4Y3C A;  2PMH A;  2VZ9 A;  3PAC A;  4AUK A;  2CAD A;  2J5A A;  4M5M A;  1QVF R;  3Q83 A;  2R7T A;  2IM3 A;  5KFB A;  4B9U A;  2DR9 A;  3OLA A;  5EWE A;  1FFW B;  3RW6 A;  4DWI A;  2JHE A;  4JI7 J;  4MFB A;  4KSE B;  1MN7 A;  4ID5 B;  2J9D E;  3MEG B;  3W5Y A;  3CE8 A;  3FCV A;  4TXS A;  3W5Z A;  3W2V B;  1WOO A;  3SFG A;  1RQ0 A;  3TUP A;  4V19 J;  3D6H B;  5AJ3 J;  1FJE B;  2V9W A;  2HVH A;  1T9V A;  2UXB F;  2N7C A;  2VQE J;  3AHP A;  3BYP A;  4DOZ A;  1H2U X;  4DL6 A;  5AE2 A;  2Q6C A;  5LT5 A;  3JQJ A;  4ZJL A;  1NME B;  1T05 B;  1HBO A;  3M8Q B;  3Q8P B;  1S1T B;  2ZH7 A;  2GHV C;  1U6Z A;  3H2V E;  4OHZ A;  3O44 A;  3QBC A;  2P5V A;  4F2S A;  1QUP A;  2LCW A;  3FJ2 A;  1WC4 A;  2AWZ A;  1ZH5 A;  3GIK A;  4USU A;  3O1L A;  1CJT B;  2V68 A;  5A8W B;  1RT1 B;  3POT A;  1XEZ A;  4BHQ A;  1N6Q B;  1RAG B;  3CJT A;  1OY8 A;  3JTP A;  2V0N A;  1PC4 A;  3MWB A;  4OX9 F;  4NI2 A;  4FYV B;  3J7A N;  5LSL A;  3ET6 A;  2FDN A;  3GP9 A;  4YR3 A;  2L9W A;  3BN4 A;  3OFH A;  5L1J A;  1R6Y A;  2G1D A;  2KL8 A;  1HL6 A;  2YQ1 A;  4M5L A;  2WOM A;  4X64 J;  3KK2 A;  4TY8 A;  2AMC B;  2MMY A;  1FA0 A;  2MLY A;  4Q2M A;  2NPI A;  3B6B A;  5GAG U;  1RP5 A;  2XSF A;  1M5O C;  1UFL A;  4E98 A;  2HSE B;  4URQ U;  1A6L A;  3BB5 A;  2UP1 A;  3N6L A;  3HT3 A;  3PW2 A;  1O0P A;  5LSO A;  2CDQ A;  4U7U K;  4I64 A;  3K5M A;  4EI2 A;  4U95 A;  4HKQ A;  1ARO P;  2J76 E;  2VA3 A;  3NLC A;  3BO2 A;  4YME A;  4X4N A;  4L75 A;  1LWF A;  1HNI A;  5ETP A;  3DLE A;  2DH8 A;  2UUT A;  4KH1 B;  4ZP9 A;  3SI8 A;  2KM8 C;  1KQF B;  3KFW X;  3CT9 A;  1P6T A;  2ZNY A;  1VRU A;  1PBA A;  4QU6 A;  2AW0 A;  3IR5 B;  2B9E A;  5ETM A;  2BA9 A;  4H4M A;  1KQG B;  5F8I A;  5KFG A;  2XGQ A;  2HKE A;  1FFS B;  3GG1 A;  2BVZ A;  1S10 A;  2MKC A;  3GJQ B;  1R0A A;  4ETX A;  2B0G A;  3HJV A;  4R5P A;  1KON A;  1HBO B;  1GXT A;  4N56 A;  3KXD A;  4A8F A;  4DCJ B;  3MD3 A;  1JKH A;  3N28 A;  2LDI A;  3BEG B;  2ACM A;  1JMT A;  4WP8 A;  1HHS A;  2GS8 A;  2EBG A;  3AXK A;  4IH6 A;  4J37 A;  4NLP A;  4DXL A;  3E8O A;  4DV7 J;  3D4J A;  5B09 A;  4QWB A;  1E6V A;  2DBB A;  2CJQ A;  2EC0 A;  1PIL A;  3LP0 B;  2CAJ A;  1W7W A;  5HP1 B;  1XNQ J;  4NI2 B;  4LSL A;  3NP5 A;  3ET6 B;  4WII A;  4N76 A;  2OP5 A;  4GKK J;  4LVN P;  5L8R C;  3DRS A;  3JAM Y;  3E51 A;  2WOM B;  1K9M T;  3GU0 A;  1FTR A;  1Z2Z A;  3AH6 A;  3GJS B;  2ZH1 A;  4PUO B;  1Q8L A;  2DEI A;  1HMV A;  3MM7 A;  2G9O A;  3NCQ A;  4TVA B;  3DU5 A;  2AJ2 A;  1M1H A;  2XYH B;  4DL5 A;  3G86 A;  2PI4 A;  1Q5Y A;  2LQ5 A;  4A46 A;  2AGQ A;  2P6T A;  1RKJ A;  4DSF A;  2DGT A;  2LVW A;  3FEX B;  3CUN A;  3A13 A;  2DO0 A;  2XHC A;  1HNI B;  5HBM A;  3TO8 A;  4XIU A;  2E44 A;  3I55 S;  1UFK A;  2JJ4 D;  1TFY A;  4IH5 A;  4L3K A;  4ZPC A;  3LGH A;  1FJ7 A;  5BR8 F;  1YSJ A;  1R8A A;  5KFZ A;  3G87 A;  2LXF A;  4OHX A;  1LK5 A;  2J8S A;  3Q8S B;  3UE2 A;  1HNW J;  3MR6 A;  2UV8 G;  4B3O A;  2R8H A;  3M4X A;  4I6A A;  1R0A B;  2ZM6 J;  2ZH2 A;  1UEU A;  2W2M P;  1LW2 A;  4R8U B;  1HW8 A;  1PJ7 A;  3VTI A;  3HVT B;  2VC1 A;  2KJW A;  2VOP A;  4NRT A;  4DV1 F;  1YVF A;  1XQI A;  1UVM A;  3QT8 A;  1R8H A;  1REV B;  2HHH F;  3WZ0 A;  1IR2 A;  4P72 A;  2FPH X;  5GMD A;  5GAE U;  3Q0A A;  3QO9 B;  3UNY A;  1MW7 A;  3ILL A;  1RT6 A;  4C4W A;  4CP5 A;  2H65 B;  6FDR A;  1X0P A;  3KG0 A;  4ED3 A;  1YIT S;  2VFR A;  3ONQ A;  1R31 A;  3O5T B;  4KAI A;  1BXN A;  2ILY A;  2E5L F;  2RIJ A;  2B7B B;  3DGP B;  3U7J A;  4I2Q A;  5D6G A;  1HMV B;  3MM7 B;  4EZ6 A;  3NCP A;  7FD1 A;  1KLM A;  4UOH A;  4PG8 A;  3CDA A;  1NSP A;  2FHM A;  3A8I A;  4EFA C;  4F0M A;  4FS2 A;  1HNX F;  3QAE A;  2XUL A;  4F4W A;  3MAH A;  2HGM A;  5KG5 A;  4LFA F;  3S1T A;  1P1L A;  2KO1 A;  2LA4 A;  4K2J A;  5JJB A;  5KT2 A;  2DXD A;  2CPY A;  4I68 A;  1NJX A;  3K0J A;  3RGI A;  4UQG A;  3BBC A;  4Q2L A;  4RBU A;  2G13 A;  2HS0 A;  1QDU B;  1IBC B;  2QX0 A;  1FRL A;  3PNI A;  3SQO P;  1VQO S;  4M5N A;  2NXJ A;  3RJM B;  5K8M A;  1VK8 A;  4B3O B;  2I5J B;  1URR A;  1AFJ A;  3FNN A;  4B3S F;  3CIZ A;  4ETZ A;  1LW2 B;  3MM5 B;  4LF2 A;  3R5A A;  2IFX A;  1RT3 A;  1KEK A;  5IWA F;  4JI2 J;  8ATC B;  3V6D B;  4DR2 F;  1N5Q A;  4HL9 A;  1A9N B;  2VG7 A;  3C6T A;  1GQE A;  4KIA A;  5HMW A;  5HQM A;  1UZD A;  3MM6 A;  1FI4 A;  5F9N A;  5HRO A;  5E2Q A;  2DT9 A;  1N5Y A;  2AX0 A;  4A8O A;  2QRR A;  3GV7 B;  4XTT A;  1N52 B;  2XI2 A;  3R6G B;  3DYA A;  3NEK A;  1WDD A;  4BC9 A;  4ZVF A;  2HQG A;  1KHW A;  5CXT A;  3VCD A;  1FJG F;  4NLX A;  2DNG A;  3RRG A;  2RRB A;  3J7Y U;  3UCZ P;  1CUL B;  2BX6 A;  3QRP A;  1TL4 A;  2J9D A;  1D8Y A;  1IR1 A;  3W64 A;  4HT7 A;  1WWH A;  3UO0 A;  1NDK A;  2N7Y A;  2ZH3 A;  4QYZ J;  4RNH A;  3R3T A;  2GV1 A;  2CA9 A;  2M9K A;  1NDL A;  1PYO B;  3PG9 A;  2NYI A;  2IVY A;  5DET A;  3HHL D;  3RBE A;  2DIT A;  1KS2 A;  4F02 A;  1DQA A;  1ZM3 A;  2W9B B;  3EZ5 A;  3EGV A;  4NXN J;  3RB3 A;  4OYB A;  4CI0 B;  1VQL S;  3DN9 A;  2J7K A;  1XMQ F;  1U4B A;  3VZH A;  3HHN B;  2FIU A;  3AQO A;  1AW0 A;  3QLH A;  3W63 A;  2VKR A;  4DF8 A;  2B7C B;  1TK0 A;  4ECR A;  2RUG A;  1IKY A;  1W26 A;  2J6T A;  2YNI B;  1U1K A;  4WYW A;  4N7T A;  2IIH A;  3BM7 A;  4IRD A;  3KKF A;  2Z2Y B;  4F50 A;  4C11 A;  2OPR B;  4LRA A;  4F26 A;  3QZ7 A;  4X66 J;  3HHL B;  3JSY A;  4P74 A;  2QO3 A;  3DGV A;  4I2P B;  2HHP A;  1X4G A;  3RRK A;  4TYB A;  3EJM A;  2A0F B;  4DX8 H;  3Q89 A;  4IOC Q;  4O4R A;  5KOW A;  1N5Y B;  5DS7 A;  3EE3 A;  1VOM A;  3Q8V A;  2N82 B;  5GAD U;  4LIR A;  4J9O A;  1J27 A;  1KTQ A;  3JAM U;  4PWW A;  3H0P A;  2CZ4 A;  2HQD A;  3OV7 A;  4YB7 A;  3US5 A;  3MM8 B;  5I3P A;  3BF4 A;  3QFW A;  4ZVR B;  3W60 A;  1S49 A;  5IZH A;  1KDN A;  1HHQ A;  2NUH A;  4CM0 A;  5DGA A;  2JH3 A;  4A8Q A;  3VQS A;  1NPR A;  3R5G A;  3AJ2 A;  1J5O A;  1NJW A;  4RBV A;  2BAN B;  3MF5 A;  2ZHB A;  3VVT A;  2VH7 A;  2HRT A;  4YS2 A;  3LF0 A;  2V50 A;  3W7B A;  5KG2 A;  1T7P A;  2HRU A;  2IJN A;  1ZZN A;  2DJW A;  1S9E B;  3PW0 A;  4DZ6 A;  2UUA F;  4YUD A;  1ICE B;  2PC6 A;  4LUB A;  1N32 J;  3D6M B;  3EIC A;  4E0D A;  5EGY A;  5LSR A;  3SXL A;  2QZ8 A;  1SPB P;  2B5J A;  4B9N A;  2YVS A;  2M8D B;  1RI7 A;  2PMZ D;  1YJR A;  1KP6 A;  2NYH A;  2RRN A;  2V63 A;  3U27 A;  5EDW A;  2CVI A;  2AJ4 A;  2OPS A;  2DGQ A;  4WCE Q;  2VA2 A;  1MNE A;  1Y10 A;  5B0G A;  1IKY B;  3ZZR A;  1MRO A;  2GVZ A;  1S0O A;  3X3U A;  4F25 A;  4LRD A;  4LF5 J;  7FDR A;  3Q23 A;  2VBX A;  3QGG A;  2HQ3 A;  3CUL A;  4M5G A;  3ZZU A;  5IFM A;  1IBL F;  2EW9 A;  4RL1 A;  2RQC A;  3ZNU A;  4BS2 A;  1S0M A;  2V67 A;  3EM1 A;  3KJF B;  2EC2 A;  3OXG A;  4ZN1 A;  1JLG B;  5MLC V;  3TJ9 A;  4C0H A;  3IP0 A;  4LR8 A;  4ES3 A;  2FVQ A;  3BGO P;  4N47 A;  4FXD A;  2YKN B;  2OD6 A;  3AJD A;  3ZTP A;  2CPI A;  2QEX S;  4OHW A;  2YWK A;  3CXC R;  3KNA A;  4F3O A;  2XZW A;  2FD2 A;  4X62 F;  3OTE A;  3CME S;  1M0S A;  2IRU A;  4B9L A;  3WX4 A;  2GC8 A;  1WNE A;  2V2V A;  3DDI A;  1R3N A;  3EUN A;  3M8Z A;  4ZCM A;  1AUS L;  1NHV A;  5JVH Q;  2JVO A;  1L3T A;  3H59 A;  2YQ3 A;  1N0U A;  3EDR B;  3EXC X;  1FXR A;  3R2D J;  1ZA1 B;  1N34 F;  1RAF B;  2O3D A;  4LSN A;  4PAA A;  1WC6 A;  1UVI A;  4DZD A;  1LFP A;  4WPA A;  3ILJ A;  3D9B A;  2B5J B;  3V6K A;  1VQY A;  1N33 J;  2L48 A;  3RBX A;  1J2V A;  2PI5 A;  5LMU J;  3FFI A;  1QJH A;  3CDB A;  4RBT A;  5F3Z A;  3RBZ A;  2XMA A;  1U1N A;  1Y11 A;  1UEK A;  1WI6 A;  5I4M A;  2GVD A;  2OPS B;  1UL3 A;  1SKW A;  1MWQ A;  4OYM A;  2CRL A;  4LR7 A;  4ZVT B;  3LA0 A;  1MRO B;  3OR1 B;  3IGV A;  2F4V J;  2CQH A;  2KTQ A;  2GIQ A;  1UET A;  2DGW A;  3ICL A;  4WKY A;  1LWC A;  2WB1 D;  3TQ1 A;  3OT9 A;  1Q4R A;  2OUG A;  3Q2T C;  4QIF A;  5U47 A;  5KFR A;  2EKY A;  1U1L A;  3BH7 B;  1MMD A;  1UVL A;  2KXH A;  2HHV A;  2VPW B;  4CO2 A;  4Y2A A;  4ZVS B;  1FXD A;  4L76 A;  1K8A T;  4QYZ K;  3UDE A;  2QL9 B;  4PXC A;  3N5B A;  3CJK B;  1BY9 A;  3Q86 A;  4NYZ A;  2BOA A;  2JVR A;  1WC1 A;  2RDJ A;  4OJ1 A;  2HZA A;  2WK4 A;  3A3P B;  3BPD A;  5ETQ A;  4TU9 A;  2DR8 A;  2F8M A;  5CZV A;  3ZTO A;  5D78 A;  1IKX A;  1VLO A;  2OGU A;  1N56 A;  2Q3P A;  4NPO A;  1HWJ A;  1F60 B;  4ECW A;  1J5E J;  2YNF B;  4QYR A;  5AE1 A;  3PYG A;  1JIH A;  4IDK A;  3UDL A;  4DV4 J;  2PII A;  1UP1 A;  2G0C A;  2E9Z A;  4DR4 J;  4N8O A;  4C8L A;  2HVI A;  5KFN A;  2CIM A;  2JRS A;  4NLD A;  1VYA A;  1RHJ B;  2LU2 A;  1Y7P A;  4ZVH A;  1TL7 A;  1SJR A;  3G4S S;  4BDP A;  4DPX A;  1CJV A;  1ZAW A;  4B17 A;  2B4V A;  3NCR A;  3H20 A;  2XSJ A;  3CD7 A;  2XHW A;  1RBO B;  2WVE A;  3KTQ A;  2H48 B;  1CC8 A;  2GVD B;  3LAM A;  5IV3 A;  3HXM A;  3D0H E;  5IOL A;  4YDD B;  2A18 A;  2NCK L;  2RIL A;  2I1R A;  2QT7 A;  5CQG A;  4IH7 A;  2DIU A;  4X84 A;  1UVK A;  3FVY A;  1Q79 A;  2I9S A;  1JLF B;  2ASY A;  2DNL A;  1TZ0 A;  2MZQ A;  2RSQ A;  1SQG A;  1RTD A;  4V19 X;  1NDP A;  2MJN A;  2GGP B;  5DLF A;  2XG8 A;  4YB1 P;  4Q8F A;  3MR7 A;  2EPI A;  2E29 A;  4R0J A;  3VV2 B;  1WOS A;  4CLW A;  2FC9 A;  3SCJ E;  1GK8 A;  2PEH A;  3QT7 A;  1N5V A;  1IKW A;  4ELT A;  2HYI B;  4I6W A;  2KKH A;  3RAM A;  3KJV A;  2XNR A;  4DV6 F;  3FKB A;  4X65 F;  4O0I A;  3GIL A;  4ENO A;  3QIP A;  3P96 A;  1SL1 A;  2HNZ B;  4LBP A;  3PHE A;  5D4L A;  1VMB A;  1IKX B;  1PJ5 A;  4OYZ A;  1FE4 A;  4GO5 X;  2ZOF A;  5HAT A;  3AOD A;  3EVO A;  4DV2 J;  3DHX A;  5KFY A;  4ZCI A;  5ETN A;  1VRT A;  2V6A A;  3B4D A;  3BSN A;  1VHF A;  4IDK B;  4EK2 A;  2HFS A;  2MZR A;  2AHO B;  4WF9 Q;  4NOH A;  4RNM A;  1W2I A;  2DY9 A;  4I6Y A;  4P2F A;  3VAM A;  3TVK A;  2UUW A;  4EWT A;  1EIY B;  3FEY B;  1LWX A;  4ZDN A;  1X5T A;  5H9F J;  1TL7 B;  2MZT A;  1CJK B;  2Y1L B;  1RWP B;  2LLZ A;  1VQ6 S;  1V3Z A;  1RGV A;  2GHP A;  2CUY A;  2XCA A;  1VQ4 S;  2XMM A;  5DZ6 A;  2PN6 A;  4HTJ A;  2AGO A;  1XNR F;  1Z4U A;  3NMR A;  4DLE A;  3W9H A;  3ENA A;  5DDR C;  3MAQ A;  2GQC A;  4B3T J;  4I56 A;  3Q24 A;  1TL3 A;  4U7U D;  4H4O B;  3KHH A;  5E5N A;  1T02 A;  4J9V A;  1OY9 A;  2OI2 A;  1GX5 A;  4RUA A;  1DUR A;  1Q0N A;  2BM1 A;  2VG6 B;  1RTD B;  2GAH C;  2ZVI A;  4NA2 A;  2LDY A;  4QR1 A;  3P5B P;  1HNZ J;  4I1T A;  2C2K B;  2W4C A;  2ZBC A;  4IO1 A;  4O44 B;  1T9U A;  3IBF B;  1NPK A;  2Z56 B;  1UEV A;  2AV5 A;  4JI5 J;  2EK1 A;  1RCO B;  2L9N A;  1DQ9 A;  1FRM A;  3SQG A;  4YR0 A;  2DPI A;  2R7S A;  4RWW A;  3CDU A;  1HIY A;  4U7C A;  3RW7 A;  1X9S A;  5G4D A;  4M8L A;  1JX4 A;  4L3N A;  3UDV A;  2V2Z A;  1EJ7 L;  2MKK A;  2RRA A;  2FUG 9;  2H54 B;  2MST A;  1XMO J;  1SKU B;  3AOB A;  1GMW D;  4MKB A;  3UN5 A;  1WHY A;  4RUH A;  2MJU A;  1DAX A;  4J9N A;  2O66 A;  4XPE A;  2PO4 A;  1K73 T;  8AT1 B;  3FDS A;  3K5O A;  3H7H B;  3LAL A;  2ZWO A;  4DU8 A;  1U45 A;  1IM4 A;  3DLK B;  3SV3 A;  3AB4 B;  4RX6 A;  2G0I A;  5KT4 A;  4YB6 A;  3MEC A;  1KLN A;  2GJI A;  4M94 A;  3WQP A;  5CYM B;  1X7V A;  3K5P A;  1ELO A;  4J9Q A;  1KD1 T;  1H6K X;  3U1M A;  4DV3 F;  2F65 A;  1FDA A;  2ZHO A;  1T03 A;  3D67 A;  4JI8 J;  5CZX A;  4BBY A;  3BKF A;  2WBR A;  3BQ2 A;  2J9E A;  4A8M P;  3MR2 A;  1YJN S;  3TYT A;  3QJJ A;  3IRX A;  3D54 A;  4ZLP A;  2YKM A;  3MMA A;  3DFE A;  4CO3 A;  5L46 A;  1FKP A;  5DJB A;  2LXU A;  4HYK A;  4C48 A;  2WVB A;  4O3S A;  3ENV A;  2N3O A;  4WK1 A;  5DO2 A;  2YX1 A;  2KFN A;  3VF0 B;  3M6U A;  4HAC B;  1HQU A;  1RAH B;  1I51 B;  2V4J B;  2CG8 A;  5A2Q Y;  1ZYQ A;  4LF4 F;  5E3R A;  3ITH B;  3W2W A;  1F5C A;  5CCL A;  3SQG B;  1RHK B;  3C3L A;  2EG2 A;  2UUB J;  4LBH A;  2J6S A;  2VDH A;  3ZTQ A;  5K14 A;  1FJC A;  4HVZ A;  5KAK A;  3KMS A;  2WSC C;  4NYO A;  3WIU A;  1CQN A;  1U6B A;  2NXU A;  4IR9 A;  3OTB A;  3AD7 C;  3GYN A;  2AD9 A;  2X1B A;  4WFY A;  5KG4 A;  3C6U A;  3Q8U A;  1YJ7 A;  3KMQ A;  2CNK B;  4CLP A;  3OTD A;  3P3D A;  3CJ3 A;  2XEX A;  2I2Y A;  3BQ1 A;  3GFX A;  2HS3 A;  3KYL A;  2XMW A;  1DQ8 A;  4B02 A;  1EP4 A;  4DFJ A;  3CD5 A;  3PJ9 A;  4JI0 F;  3ZFV A;  3F41 A;  2BAC A;  1PYS B;  2R7V A;  1RBL A;  2W4D A;  4LRB A;  3HP6 A;  3FCW A;  3PCO B;  4WFZ A;  1FRI A;  1HR0 J;  2AT1 B;  2Z8Q A;  3EPG A;  2KFZ A;  4ZHR A;  2LEP A;  4DCO B;  2B6A B;  1RAO A;  2D41 A;  2IAJ A;  2COL A;  3SEO A;  3I9Z A;  5JVG Q;  4NA1 A;  1JK9 B;  3TA2 A;  4PXB A;  3R9L A;  1TKD A;  5KFI A;  2DXF A;  4JI1 J;  1RTJ B;  2QMU B;  3M6V A;  1S6O A;  3MMA B;  4DR3 F;  4QOT A;  3ZC4 A;  1FKP B;  3LQV A;  1HWL A;  2DEJ A;  4L6V 3;  2DNH A;  4USM A;  1UVJ A;  4UOF A;  4KHR A;  2HQC A;  3ILI A;  1UCN A;  2WSE C;  4KGM A;  4QIW D;  3MCN A;  1F9F A;  4K4S A;  5K5M A;  4IG3 B;  1IWG A;  4JI4 F;  3MMC B;  3W2W B;  1YKW A;  2J0Q D;  3RAQ A;  3T5H A;  1TUG B;  4YY3 J;  2JLG A;  4OI2 A;  4DR5 F;  2UVV A;  3TNV A;  5K14 B;  2EFG A;  4Z7Y A;  2R7W A;  3I96 A;  3R7N B;  4NLR A;  3ETM A;  3Q2S C;  4DQS A;  5F8G A;  1VGY A;  3D28 A;  2MLX A;  4DUZ J;  5K20 B;  3C6U B;  2JDJ A;  2QE5 A;  3L09 A;  4Q44 A;  5F8L A;  4MYU A;  2DR5 A;  2ASL A;  4B3M F;  2YWE A;  4U67 Q;  2VIH A;  2R7U A;  3GR0 A;  4E8U A;  4J9L A;  3DHW C;  1NB7 A;  2CFX A;  5D3G A;  1ROF A;  2VUG A;  1HQE B;  2W7P A;  3GFZ A;  2HMI A;  2DNZ A;  4AE5 A;  2VC0 A;  4NLQ A;  1FRJ A;  1RCX B;  4LF6 J;  2NXC A;  2B43 A;  2H1Y A;  2XI3 A;  4WP3 A;  2FLO A;  5IM0 A;  1FDD A;  2R2R A;  1N36 J;  3M6X A;  2KM8 B;  4P10 A;  1H3D A;  3LOU A;  1RTH A;  5GAG I;  4BCA A;  2PD1 A;  4ERD A;  1T95 A;  2PFD A;  1NSQ A;  2QTW A;  4J90 A;  5D4P A;  4NCB A;  1X4H A;  4LT6 A;  2MY7 A;  5A6W A;  2YWF A;  1RAD B;  2AYE A;  3DLL Q;  3RR8 A;  1H72 C;  4ED7 A;  3NG8 A;  4B9V A;  4CTA A;  2HIY A;  1GTE A;  1WC0 A;  2X1F A;  2W8L A;  2MSS A;  4DX6 A;  2C2O B;  3CDW A;  1Q78 A;  4QR0 A;  2JL9 A;  2Z2Z A;  2MDA A;  4L72 B;  1HA1 A;  1RTI B;  2JC0 A;  1FKA F;  3OL6 A;  2UU9 F;  5T41 A;  4OZJ A;  3OFF A;  4PYD A;  3CMA S;  1RAJ A;  3OHB A;  1UJ6 A;  1XBW A;  3L95 X;  1TK8 A;  3E3X A;  4CWB A;  2PT0 A;  4TY9 A;  2ROE A;  3OD2 A;  2B8P A;  4DL3 A;  3IBW A;  2LQJ A;  3AY0 A;  2N4C A;  1CJU A;  3FBC A;  4A48 A;  4OYI A;  3SYZ A;  5L1K A;  2HWT A;  2YY3 A;  1RT7 A;  1HAR A;  2HAF A;  3V6H A;  4DPY A;  2YBV A;  2W25 A;  4LQ9 A;  2HMI B;  1LWE B;  1U2C A;  3OTO F;  2BJ1 A;  2YX7 A;  3ZTR A;  1FFG B;  4MAK A;  2K3K A;  5J2N A;  2QLW A;  4PZV A;  3G82 A;  3UDC A;  4RWX A;  4F0H A;  1F1B B;  2YNG A;  2C22 A;  2E7X A;  2E5J A;  5IM0 B;  2UXB J;  1GXL A;  3BR8 A;  3CGI A;  4G1I A;  8RUC A;  1QVG R;  3VR1 A;  4YP3 A;  3V6J A;  4RZR A;  1JLQ A;  3LP2 A;  2ZJQ Q;  4BWM A;  1SIW B;  2M7S A;  1SH0 A;  5J2P A;  4ICL B;  2P6S A;  1OIA A;  4KFB A;  1GT8 A;  4WZM A;  1D09 B;  2D9O A;  5A2Q U;  4DV0 J;  1PBU A;  3DDN A;  2ILZ A;  2Y8Y A;  3CTR A;  5KT3 A;  3GTY X;  3W1Y C;  1GFW B;  1HYS B;  2H4W B;  2FZK B;  3Q22 A;  2ZC4 A;  1SV5 B;  4C8N A;  2E1P A;  3CJR A;  1KOH A;  5HMY A;  2B4P A;  2XCP A;  4CH7 A;  4KHP J;  4OX9 J;  3PTW A;  2UVR A;  3CVK A;  4GC6 A;  4V1A k;  4NLV A;  5K9F A;  3EMT A;  2Q1L A;  1QLN A;  2Q43 A;  2XMV A;  2BJ3 A;  1U2R A;  1JLC B;  2VFU A;  2XY5 A;  1Y4Z B;  2DD8 S;  2C3Y A;  4GO7 X;  3CCM S;  2LQB A;  4GMK A;  2OIH A;  3N5F A;  5A8K B;  1Y9O A;  4MK8 A;  2K3I A;  1CS4 B;  2K1R B;  3FRZ A;  3OXF A;  1YZ6 A;  5GAE I;  5HLF A;  2XMT A;  1RWU A;  4EBD A;  1H73 A;  4LIW A;  1RT7 B;  3SV4 A;  2VV5 A;  2DPJ A;  3PW4 A;  4AL5 A;  2R4F A;  2M2B A;  3JSR A;  1FNX H;  3CJS A;  3KLI A;  3MAA A;  2GHW A;  3TEG A;  3CO0 P;  4K7Q A;  3MM9 A;  4IYQ A;  2C3M A;  1TL1 B;  3G82 B;  2BKN A;  1X9W A;  3T6B A;  1H7W A;  1VS3 A;  3GII A;  2XS5 A;  2BQU A;  2GFF A;  2C2R A;  1FKO B;  5M2U A;  2DRB A;  2L9D A;  3LP2 B;  1H2T Z;  5LXY A;  1NK9 A;  4RO0 A;  4USW A;  2OFH X;  2DH9 A;  3W9J A;  4MKA A;  1S9G A;  3LP1 B;  4KFB B;  2RH3 A;  4BWJ A;  3KLH B;  4C3M A;  2B9Y A;  1SJ4 P;  2WBM A;  1XNQ F;  4NL5 A;  2LKZ A;  5A0Y B;  1IVZ A;  4K4Z A;  2VJV A;  2HGL A;  2YQ0 A;  3HD2 A;  2ZHA A;  4WKR A;  4ZPA A;  1JQG A;  4W90 B;  5DM6 Q;  1TEL A;  3BGF A;  2HNY B;  2ZUG A;  4CT9 A;  3SIP B;  2EBE A;  3UCU P;  4Z37 A;  1R6V A;  3F44 A;  4B3R F;  5DQH A;  2FLP A;  1WC3 A;  3VAG A;  3KLF A;  1C0T A;  3CPW R;  1T9Y A;  1PYT A;  2E1M C;  1OPZ A;  3A8J A;  4DN0 A;  3G8Q A;  1G3O A;  3B8H A;  2CPH A;  5G0R B;  2ATC B;  5CD4 H;  1F9H A;  3K8W A;  3H40 A;  3AB2 B;  3VAH A;  1F2H A;  4NZ0 A;  5SUH A;  4O4G A;  5D0E A;  4F8R A;  5HLF B;  1JLE A;  5HQ8 A;  1K47 A;  4UZB A;  2B9X A;  4CCH A;  2X3G A;  3BN7 A;  3J7Y I;  1H38 A;  1VFJ A;  3KLI B;  3MAA B;  2EFO A;  2FTR A;  5LJ5 Y;  1C4C A;  1HNW F;  3LW5 C;  4CLZ A;  5BR8 J;  5EX0 A;  3W65 A;  4M5D A;  1TMM A;  2EG1 A;  3HFZ B;  1GMV A;  5KFJ A;  4MKV A;  3DOL A;  3BO3 A;  1D8Z A;  3T5J A;  3HKW A;  3UPF A;  1ACM B;  4OI6 A;  2EVZ A;  4Y2M A;  4DV1 J;  5KFS A;  1S9G B;  1KQS R;  2QLF B;  4UZC A;  2W4P A;  1HI8 A;  5KFW A;  5J1E A;  3FZ2 A;  3W5X A;  3JS9 A;  2VPX B;  2LEB A;  4A47 A; 
#chains in the Genus database with same CATH homology
 3VGS A;  4S0M A;  2DYA A;  1XQI A;  3BH6 B;  2AZ3 A;  1XIQ A;  2VU5 A;  3FKB A;  4FKY A;  3ETM A;  1BHN A;  3ENA A;  1NCL A;  2ZUA A;  3Q83 A;  3PRV A;  3EMT A;  3NGU A;  3VVU A;  3FCW A;  4ENO A;  1NB2 A;  4DI6 A;  1PAE X;  5CAA A;  1VYA A;  4KPC A;  1B99 A;  4FKX A;  1LEO A;  1NDK A;  3BH7 B;  1MN9 A;  1K44 A;  3ZTR A;  2DXD A;  4AND A;  3G2X A;  3EJM A;  4O0N A;  3DDI A;  4DUT A;  1MN7 A;  3Q89 A;  3GP9 A;  3BBB A;  1JXV A;  1NDC A;  1NDL A;  3BBC A;  2AZ1 A;  1BUX A;  3EE3 A;  5C7P A;  1WKJ A;  1S59 A;  3Q8V A;  1HLW A;  3R9L A;  4CP5 A;  1WKL A;  4F4A A;  1B4S A;  3ZTS A;  2HVE A;  3ZTQ A;  3NGR A;  2BEF A;  2DXF A;  3EVW A;  3FCV A;  2B8Q A;  3Q86 A;  3DKD A;  3VGV A;  4ANE A;  3MPD A;  3EVO A;  3FBF A;  4F36 A;  3NGT A;  3FC9 A;  3BBF A;  1ZS6 A;  4HR2 A;  5IOL A;  4W98 A;  1PKU A;  1NUE A;  2NCK L;  1KDN A;  4EK2 A;  1NPK A;  1HHQ A;  3B54 A;  1U8W A;  3B6B A;  2DXE A;  2HVD A;  3Q8U A;  1WKK A;  1NSK L;  1NLK L;  4UOF A;  3VGU A;  1S5Z A;  2DY9 A;  3GPA A;  1UCN A;  2HUR A;  3EM1 A;  3VVT A;  3Q8Y A;  1EHW A;  1F3F A;  2CWK A;  5CAB A;  4C6A A;  3FBE A;  2B8P A;  1LWX A;  1W7W A;  1S57 A;  3ZTO A;  1NHK L;  1NDP A;  3WX8 A;  1F6T A;  1HIY A;  3PJ9 A;  4ANC A;  3EVM A;  3ELH A;  4WBF A;  3FBC A;  4DZ6 A;  3VGT A;  1BE4 A;  4UOH A;  5BXI A;  1NSP A;  3FBB A;  3ZTP A;  4UOG A;  3JS9 A;  3EIC A;  3L7U A;  3NGS A;  1NSQ A;  2BX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...