4HR2A

Structure of nucleoside diphosphate kinase (ndk) from burkholderia thailandensis bound to adp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
142
structure length
142
Chain Sequence
SMALERTLSIIKPDAVAKNVIGQIYSRFENAGLKIVAARMAHLSRADAEKFYAVHAERPFFKDLVEFMISGPVMIQVLEGEDAILKNRDLMGATDPKKAEKGTIRADFADSIDANAVHGSDAPETARVEIAFFFPEMNVYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Structure of nucleoside diphosphate kinase (NDK) from Burkholderia thailandensis bound to ADP
rcsb
source organism Burkholderia thailandensis
molecule tags Transferase
total genus 47
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2012-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4hr2A00
1UCNA 1LEOA 1F3FA 4HR2A 3FBEA 3GP9A 1HLWA 4FKYA 3WX8A 4DI6A 3PJ9A 1PAEX 3BBBA 4DUTA 3B54A 3Q86A 2HVEA 3VGTA 3Q8UA 4FKXA 2HVDA 1NSKL 2B8QA 1B99A 4EK2A 4F36A 1NDLA 1NDCA 3FCWA 1NUEA 4ANCA 4ENOA 4UOGA 1XQIA 2DXDA 3G2XA 1PKUA 2B8PA 3FBCA 1NSPA 2BEFA 1WKLA 3NGRA 2DY9A 4WBFA 3VVUA 3ZTSA 3BBCA 1NDPA 1NLKL 3NGTA 2VU5A 3EMTA 3ZTOA 1U8WA 1NSQA 1K44A 1JXVA 3BH6B 1NDKA 4S0MA 3MPDA 2AZ3A 3L7UA 3FBBA 3ELHA 3Q8VA 3VGUA 3VVTA 1S5ZA 3ETMA 5C7PA 1KDNA 1WKJA 2ZUAA 4UOFA 3EICA 2DYAA 3EVWA 4KPCA 3JS9A 1BHNA 1EHWA 3R9LA 5CABA 2DXFA 3ZTPA 1XIQA 1MN9A 3EE3A 3NGSA 1BUXA 3EVMA 3ZTRA 3Q8YA 1W7WA 3Q83A 3GPAA 1HIYA 3B6BA 3EJMA 3EVOA 1F6TA 1NB2A 1LWXA 1HHQA 1BE4A 3ENAA 3BH7B 1B4SA 3DDIA 5BXIA 2DXEA 4CP5A 3NGUA 3FCVA 1NPKA 3VGVA 4F4AA 2NCKL 5IOLA 3DKDA 3FKBA 4ANDA 2BX6A 2CWKA 3FBFA 4UOHA 3ZTQA 4W98A 1ZS6A 3VGSA 5CAAA 1NHKL 1S59A 3FC9A 4C6AA 1MN7A 3PRVA 1VYAA 1NCLA 3BBFA 2AZ1A 3Q89A 2HURA 4DZ6A 1WKKA 4O0NA 1S57A 4ANEA 3EM1A
chains in the Genus database with same CATH superfamily
1UEVA 1RAHB 4ED7A 1Y5LB 3Q8UA 4N41A 1RT5A 3NBPA 1GMWD 4CLUA 1UVMA 5KFCA 3QT8A 3SCKE 1VRTA 4KKOA 1E6YA 5L1IA 2V9WA 1X8DA 1OQ3A 5B09A 1K47A 3CMES 2HVZA 2MQQA 1RE1B 1JKHB 1HBNA 3MTKA 2QFIA 3QIDA 3EVWA 1NBEB 4B3RJ 4USTA 1N54B 4LF9J 4KJIA 2AKWB 2RH3A 4NLTA 1EB0A 3CO0P 3PKYA 3BPDA 3HVTB 4DR6F 1I94F 1SJ1A 4YN3B 4UUWA 4X4SA 2MZRA 1XMQJ 1MU2B 2XSJB 1RGVA 2UV8A 3M2VB 2EXUA 1VS3A 4NRUA 4B3MF 1RTDA 4NLGA 1F5BA 3BN4A 2LA4A 1M5SA 5H1SV 2MZQA 4DZ6A 2MYFA 1XK8A 3VF0B 4ANEA 4QWEA 1UETA 2DNYA 2BQUA 1BQMB 2R7VA 3BKUA 2HVDA 2E9RX 1URNA 3BQ2A 2RILA 3Q22A 4X65F 5HMZA 4NYZA 1YRTA 2B5JB 3RUBL 3ZZZA 1K1QA 3NGRA 4X66J 2OEMA 1T8EA 3QIPA 2PFFB 5DG8A 4P2SA 3JYTB 1U6FA 4MTPA 4DR7F 5IWAJ 4HHHA 2EWHA 3EXYA 4LBPA 2LFVA 2B7BB 4WP3A 5C7PA 3KK1A 4LF7J 3CCSS 4DV2J 2JFDA 2QLFB 2EFOA 3U1LA 1FKPB 3EVOA 4A46A 3SEOA 1NB2A 1KEKA 4MIAA 3Q8QB 4X4VA 4CLFA 4NLSA 3E3XA 3PEHA 3N79A 1NK0A 1HFEL 4F4KA 2YKPA 5I42A 5CYJA 2LQBA 3HCXA 2WVFA 1FE4A 4FVMA 1NK5A 3MURP 3DLBA 1QUVA 1TKZA 1DFDA 1YZ7A 3KUGA 1IBKF 1T02A 4FKYA 5M2RA 2Q3PA 2A2CA 2EEYA 1SJQA 4JI6J 3FEXB 2R8JA 3NCRA 1I5OB 4MMOA 5HVFA 2Y0SD 4I2PB 1SH2A 2P9EA 2ZKTA 4USMA 2Y1JA 3MZIA 4WU3A 3EMTA 5HP1A 1L3KA 4CLSA 2KG1A 3FBBA 1WI8A 3Q8VA 5HJXA 2BZ2A 2KFZA 2BKPA 3C15A 3PV8A 2AP6A 2HKEA 3DDNA 2QJ3A 4E2FB 5CXTA 4IQXA 1YZ6A 5HMWA 2F9JA 1W2IA 4XPCA 3PR4A 4DQQA 4IFYB 1YJVA 2OEJA 4DN0A 2PFDA 3DC2A 3EGWB 3FGVA 1RADB 4FF2A 3H42A 4W98A 2LXUA 2HPUA 1TL3A 4DV4F 3I4HX 2FJWA 3EDQB 3QQCD 1K0TA 4GKKJ 2EG1A 3GR1A 2FLPA 1N36F 4GO5X 3M8ZA 1FDDA 4WP9A 1LWEB 4DV0J 1KLNA 1Y5IB 1B3TA 1VQLS 3CDWA 1TVRB 3FUYA 4WTOB 1T9VA 1FNOA 4KV8B 4NA2A 2QGFB 1GMUA 4F02A 4X4RA 1FWKA 1H7XA 1FVSA 3BDPA 2ZWOA 4Z7CA 3BGRA 4KY3A 1SUQA 2YWFA 5HBMB 4I64A 4KIAA 3KNAA 4C8MA 3G6ES 5IT9U 4DV7J 4OZ3A 2ZM6F 2GO8A 4C8KA 1U2CA 1S0NA 1IJFB 1WSRA 4X4OA 5M2UA 1KFDA 3KUEA 4RWXA 4H54A 3ZXWA 4L74A 1EQMA 4AXJA 1FJEB 1UVJA 2W2OP 2CZVC 1P6TA 3FFIA 2ASDA 4K50A 5BYSA 3VGVA 2KVQE 2AV5A 3GIRA 2C42A 4USIA 2UXBJ 1DRZA 4NEYA 4N76A 3J80Y 3GFHA 2OJ3A 3E51A 2YX7A 3HHLB 5ETVA 4OLPA 2R7SA 1NKEA 3DOMA 2UUBJ 4LRCA 3MDFA 2PMHA 2EG2A 1F3FA 2WONA 3FBEA 3K5LA 1Y3KA 4FKXA 3ONQA 2CPEA 2FHJD 2ZVIA 4Q5VA 4OZLA 2CDQA 2Y0BB 2ZE2A 4J5OA 3OFHA 2VIHA 3ISNC 4HI1A 4I68A 5AE2A 4XPEA 4MK9A 3MMCB 3M32B 2KH9A 1FK9A 1S1UA 5A2QY 2LQ8A 4ED3A 1LNQA 2HFOA 3G71S 2OH2A 1VIOA 1U24A 1ZM4A 2GHVC 2RUSA 2IC3B 4YB7A 4DSFA 1GNKA 2ZWPA 2YX4A 1WF2A 2BA9A 2MHNA 1CVJA 5IV3A 3Q8YA 3M1VB 1RAFB 3Q83A 4K5RA 4GRSA 2VASA 2CA9A 3V4MA 2GGPB 3SXLA 1UMJA 1J5EJ 5T41A 1NK7A 4W92B 2YPYA 3H5SA 3L09A 2RAQA 4URSA 2G0IA 1M5VC 1EETB 3AXMA 2CXEA 3PIPQ 4Y6IA 3OR1A 1RT3A 3PYFA 4USUA 4M95A 4KB7A 1S1VB 4QJVA 4ZITA 5C25A 1QSYA 3IC1A 1YBUA 2ILYA 3S01A 3HKZD 1RWWB 2VJVA 1KOOA 4OX8A 1UVNA 1JIHA 4QBUA 4QCLA 4MKYA 3DRPA 4KAIA 2FZKB 3N5BA 3HVAA 3FBCA 4M5DA 3KLIA 2NXNA 1VQ4S 3EX7B 4O3NA 4KO0A 1K73T 2JEGA 1U6ZA 1FJGF 2GFFA 3BPSP 3V4IA 2DNRA 5E3CA 4H4OA 3DMJB 4B3SF 1F1BB 1CJUB 4Y28C 5HL7Q 1RWUA 4A8KA 3UW1A 5A8WB 4AXIA 2YNFA 1K1SA 1PYOB 2DNGA 1QDUB 4NXNF 3LP2B 2OMLA 4ELUA 2JX2A 2CPDA 3R8YA 1YK9A 1AZSB 1TELA 2IVMA 1X9WA 1YX2A 5K14A 2ZNYA 2VA3A 2V2ZA 4M5JA 1SKWA 4U8VA 2GVZA 1E6VA 3WQPA 1V6HA 2CZ4A 2AQ4A 3M30B 2BW7A 4ETZA 2YNHA 3TAPA 3W60A 5GMKa 2KL8A 4HL9A 1DLOB 1WHYA 3T5JA 1YDLA 2XS7A 3NMAA 1FJ7A 2B4PA 3SV4A 3P4UB 4D3GA 2HNDB 4B9MA 4ZHRA 1N5TA 2V4JB 4LFCF 1KSPA 1WHXA 1PC4A 1N34F 3KJVB 5KT6A 1HBUA 1JXVA 1H98A 2ZJPQ 3ELHA 1HWKA 2OSQA 1NAQA 1TR0A 1FO1A 3M6UA 5KFGA 2HHHF 3TAMB 4MFBB 3V2UC 4CLTA 4IOBA 5KFPA 2RRNA 2OPRA 2MJNA 2N3LA 1I1GA 4NASA 3M7VA 1VRUB 3VQTA 1NJYA 4PRFA 2HFUA 4X62F 2OUGA 2BM0A 1D1UA 4DG1A 2C2OB 4Z37A 3RW7A 2JJ4D 3S8SA 2E1MC 5D0GA 2ZFHA 3GLJA 1T03A 4QYZJ 3KLGB 1JLBB 1U8SA 3AOBA 4F26A 3FVYA 1UWBB 3PRBA 5CH7B 4DCJB 4J9PA 2HQ3A 2HBYB 1CG2A 4NZ7A 2ZH9A 1YKWA 1PKUA 3CCES 1RBLA 2EI5A 2JFKA 5K20B 1RCOB 1KHVA 4N5SA 4K4XA 3ZZYA 4PXEA 3S1TA 2HFZA 2Z2YB 4F3OA 2XG8A 4DPYA 4OI0A 2W8LA 4LRBA 1UPPA 3Q24A 3NGSA 3R97A 1T9TA 3MEKA 3KK2A 2DGWA 3JTPA 2UUCJ 2BE2B 2W1BA 3LGHA 5CYQB 3LWLA 4FYXB 1P27B 1LKZA 3U1NA 1WEXA 4LF6J 4Q2MA 4B3TJ 4XAKA 5DRKA 3M4XA 1ZA1B 4OYZA 4RW7A 3BJYA 2MB0B 1D09B 2BR0A 2QEXS 3OTOJ 5IS2A 4DXLA 4JI5J 2H5JB 3UD5A 1J27A 1IKWA 2MLYA 4OJGA 5DQGA 4LF7F 2F4VF 1HNIB 1QUPA 4DV2F 4A8FA 1PG5B 1CULA 1SC1B 1W25A 4PG6A 3R5DA 3PR5B 5FLXY 4LF4J 3T6JA 3HK2A 2XHCA 4JV0A 2MKIA 4HEA9 2XB2D 4DL2A 1M1KT 4EU0A 3I6PA 1IM6A 4ELVA 2CPZA 1F5AA 3N6MA 5K8NA 1HWJA 2RRBA 1KHWA 2ZZMA 2VKZG 1D8YA 4ZIWA 1S7HA 4NPOA 1QSSA 3HHDA 3W3SA 1QE1A 2KHCA 1FKOA 1JKHA 4KE5A 4YUDA 3CDEA 4LIWA 3SQGB 3K8WA 2HZAA 1A0OB 4JI6F 2GIQA 5KT3A 5AXMA 2I6WA 4MH8A 2OGUA 3TZYA 4YHHJ 2UUAJ 4FF1A 1EP4A 2VHGA 4KFBA 1S10A 2J0XA 3T1HJ 3AD8C 1S9EA 2CADA 4DOZA 4OZ2A 4JV1A 5KFNA 4PQUB 1HNZJ 4FVCA 1QAYA 3M2VA 4C3KA 3A3OB 2Z2ZA 2RS8A 5T14A 2D3UA 3UCUP 2XQCA 2A0FB 6FDRA 2HQCA 2X1AA 2I9SA 4MYUA 3M8YA 4PZVA 4B9NA 2YBVA 1Z2ZA 2XCPA 2XULA 2NZ4A 3AD9C 1BQMA 1Q4RA 3TI0A 2B8PA 4J9OA 1LWFB 2C3PA 3R5GA 2PEHA 2DPIA 2A2DA 3L7UA 1PSDA 3JYTA 4J7CA 3WIVA 2GW8A 3W5XA 2XC9A 4CO2A 1K9MT 4LVNP 1UAWA 1IKXA 1XMBA 1VMBA 4DV0F 2IRUA 3ZTRA 3MFIA 2B6AB 1VQPS 2BM1A 2ZD1B 4F3MA 1B7FA 5DM7Q 1FKPA 3QGGA 3DDIA 2UZAA 5BXIA 3I55S 2RDIA 1U7LA 1R8BA 2WVEA 2FJXA 5F8NA 1M5PC 2JL9A 3TA0A 4F4ZA 5L38A 2MEWA 1EARA 2VJUA 1SL0A 1S7IA 3K0JA 3IWXA 1TP7A 3HKWA 2FQQB 4FDFA 3EDRB 3W5ZA 1TKTB 1TFYA 5CD4A 1NDCA 4I7FA 4I2QA 1KNZA 2Z57B 3L3CA 4EUVA 5AE3A 4AFFA 2J7KA 3DN9A 3A1YG 2HVHA 4BS2A 1TQLA 5KAKA 3GONA 4JB8B 2V50A 4A48A 4M94A 1C4CA 4MYTA 3SV3A 2MZJA 1RHJB 5DS7A 3VAGA 4B9UA 2IMWP 1SIWB 2UUBF 1BQNB 2GJIA 3LP0B 3ZZOA 2YQ1A 3DRYA 1Z2LA 4OYOA 2IJNA 4EI2A 2WHOA 2E5JA 2XLKA 3KG4A 3R1HA 4IFYA 3CT9A 3IN5A 5JJBA 4EEYA 1RHMB 2XYPB 3PFOA 2G2YA 2QLBB 4WYWA 5A8KA 2F8HA 1SI9A 4Q8EA 4KHPJ 1TZ0A 3SCJE 2HS3A 1RYSA 3LAMA 3MR3A 3QGPA 4WCEQ 1VQSA 4PG5A 1X4FA 2PMWA 2RQKA 5F8HA 2F5GA 4K0KJ 3RB4A 1U1PA 3MGJA 2M8DB 1LWEA 4G1IA 2VPZB 3QRPA 2X51A 3FCWA 4BDPA 4DUZJ 1DY3A 1TVRA 4QWAA 3W8PA 4KV8A 2AGOA 2CQPA 4M5NA 4RLEA 2F3JA 2CKWA 3OPKA 3HI9A 1VQYA 1FRHA 2ILZA 5ETQA 2VBZA 4IYQA 5G0RB 2D7SA 1RWPB 3GFZA 5DJBA 3QFWA 2CQ2A 1G4CA 2PA3A 3MECB 4B9LA 1DAXA 1U1MA 1U26A 2HS4A 4B3OB 2NQPA 4C4WA 1YBAA 3N4WA 1QLNA 5D4PA 2CQ4A 5F3ZA 3BQ1A 3BR8A 1PBUA 3KMSA 4IG0B 3KLFB 5E2QA 2F9DA 2RF2A 3HHLA 4ECWA 4M1KA 1WG4A 2PMZD 4J9RA 2FVCA 1VISA 3FEZA 2NXJA 4R0EA 5GAHU 5FJ4A 2LDYA 4RNHA 3UFCX 2QX0A 2XMUA 2MQNA 4N77A 5BJRA 1HNVB 2WB1D 4IRKA 4J9QA 3MMCA 2ZEJA 3Q8PB 1SC3B 3I0SB 3HJFA 5DQHA 2CNKB 2IVFB 2E5IA 3C14A 4J91A 4ZP7A 3JTOA 4OL8A 1ZM2A 1V3ZA 3PYDA 3MMAB 2UU9J 2DVIA 2BACA 3IAM9 4Z7YA 2IM0A 1X0PA 9RUBA 2MGZA 2OPSA 1REGX 1FESA 3M1VA 2K7KA 2GGPA 3DI6B 3FKBA 3H5UA 2D74B 4N47A 2CG8A 4ITSA 1RT4B 4X4PA 3I0RA 3BF4A 1UJ6A 4ZVRB 4ELTA 3AB2B 3I5CA 3HHKA 2IFXA 1HMVB 2D9PA 1OMSA 3MAQA 2O5DA 4XK8C 5IM0B 1S1VA 1HYSB 2VPWB 3QWUA 3MOJB 3AXKA 1CBKA 4EFAC 3M2UB 3V6HA 1N0VC 2QIFA 1OPIA 2RIJA 2JH3A 4P10A 2QL7B 3LGMA 3N6NA 3CD7A 2GNKA 3M6VA 3R1LA 2DNMA 1HBOB 1O51A 1OJ4A 1RI7A 2R7WA 4YR2A 3RU0A 4L76A 4PEOA 3DMJA 3AFGA 1FDBA 3PJWA 3Q2TC 2FGCA 4X4TA 4EYHB 4IO1A 3FZBA 2HBQB 1G3OA 1CJTB 2L9WA 2BJ7A 4GVBB 2K1RB 3DOLA 1X5OA 2DHHA 4LMZA 4IDKA 1U45A 1AZSA 1LW0A 3SBMA 2H9ZA 3QJPA 1VGYA 2K8GA 1JWWA 4ZP9A 2DNOA 3I9V9 1SV5A 3CMAS 3EZUA 1ZTWA 4J9UE 2A10A 3M30A 1S0OA 2ABYA 1FRMA 5A0YA 2DNQA 1C0TB 2NSCA 3UWTA 4Q45A 4A8OA 2UUCF 3MPYA 5F8JA 1TL7A 4Y34A 3ZTSA 3P45B 4CLZA 1U8WA 2HNDA 2RDDA 4CLWA 1KVKA 2V4JA 3HVWA 4OHYA 2QG9B 2QSWA 3UN2A 2LKZA 4FF3A 3VVTA 2BQ3A 3OTOF 4MJKA 4I69A 1Q16B 3KKFA 5DLGA 5ETOA 2XMVA 2D3OR 2PEBA 5B0DA 3TAMA 3AQOA 4MFBA 3D6MB 4KGXB 3J7YU 1JLAB 1NZ8A 4OJ3A 4YS2A 3RBEA 5H9EJ 3DGPB 2XMWA 1Z1ZA 4CT9A 3BKTA 5GAEI 4LF4F 3FEYB 4P71A 1X9MA 3M8QA 4R8UB 5AE1A 3B8HA 2H51B 2QLXA 1ITPA 5D15A 2SXLA 3OJUA 2ZH6A 2HYIB 1WTBA 2Y1IA 3S6EA 3EGVA 4PWUA 4KGVB 3KTQA 2DRAA 1WOOA 5FDLB 1JLBA 1GFWB 2WVCA 2XZTB 5KFIA 1RK8A 5F0WA 1NB7A 4LR9A 4QR0A 2Q66A 1UW4A 5E7OB 1G7CB 2W2MP 1EJ7L 2IAJB 1VFJA 2E5LJ 1BC6A 2IA6A 4ID5A 2LMIA 3E8OA 1MN9A 1JLCB 1T3OA 3J7ZT 1JLQA 2HZVA 3SSSA 4F0HA 2B56A 3LPEA 2RE1A 4DV6J 1H6KX 3K8VA 1BE4A 4JI4J 4ECUA 2IBKA 3DM2A 1UVIA 2BE2A 4OYWA 3KK3B 4DN9A 5KFEA 5CYQA 1VQKS 5K8OA 1XNQF 2RHSB 3DXBA 1R27B 3CW2C 4JI0F 4K4YA 2R2UA 1WDDA 3OT9A 4F2RA 4AQYF 4IH6A 3CCRS 3A8JA 1CLFA 4EK2A 3AQPA 5AXLA 4RUCA 4MIWA 5JUMA 1TU0B 1SB6A 2B43A 5D77A 4YFUA 4IUFA 4LF2A 1YG0A 2Y3YA 3CE8A 2DHSA 3WHIA 2UVVA 3DGVA 5E5NA 3CTRA 3N5FA 1O0PA 4ILRA 3TYTA 3T5KA 2C22A 1IWAA 4J9LA 3IS9A 1FNXH 4DQSA 4UZBA 3H2LA 3J7Z5 3NNAA 2AW0A 1KTQA 5F9NA 3SFGA 5GMEA 3W2VB 4I67A 5IOLA 2MXYA 1JXLA 3SDEB 4IH7A 3R7NB 3HHNB 4HH1A 2LDIA 3RYLA 3JAMY 5DDOC 1PGZA 2GZOA 3DXSX 2W9BB 3PRVA 4F67A 4PQUA 5IQ6A 4F0KA 2LU1A 4C8LA 3DOKB 2YKMB 3EM1A 1NO8A 1XR7A 3KJNB 4PXDA 5KT2A 2ZUGA 1YJRA 3TUJC 4IOCQ 1PIEA 3GQCA 3U7JA 4ZCMA 2ATLA 2BEFA 3UQSA 3ENQA 3UVJB 2E66A 2CQ0A 4IQMA 2MQMA 3KHRA 4J9VA 2R7RA 2AU0A 2RHQB 2X7IA 4KHMA 2HHQA 1QSLA 4C11B 1SJ3P 2CG4A 2CQHA 4YEAA 2W7OA 3T19A 4ZVOB 2IYGA 2F4FA 1NZAA 5M2PA 1EQ0A 1C1CA 2ACMA 3W2WB 4K0KF 2ZOMA 1TKDA 1S49A 3M9NB 1U2RA 4DR1J 2Q1LA 5SZTA 4J9MA 2ATCB 2Q6BA 1ZPVA 1U02A 1ZS6A 3KLEB 4ZPAA 4DL4A 2M2BA 4JP8A 3EXCX 3FNNA 2BABA 4TNOA 1ZH5A 2RU9A 3P49B 1REVB 2A1BA 3VAJA 1FEEA 1Q5YA 3PJ9A 3B54A 1WC1A 3TA1A 2C2KB 1ULRA 4HVZA 1JLGB 4CRJA 1TAQA 2C1EB 5MAOA 1PAUB 3HO1A 1ZAVA 4N7TA 2FVPA 3A8IA 2DGQA 1C4AA 4RL1A 2LVWA 4OMFG 1DTTB 4OZ5A 1FWLA 3DNCA 1OWXA 3DFEA 3T6BA 3KWMA 4PG7A 2F63A 4F50A 3ADAC 2BQRA 1X4GA 1KQFB 2PD1A 2YY3A 4OYBA 1QTNB 3MOZA 4RNFA 3MUVP 2J9DE 4HDHA 4WZQA 2CQGA 3CWJA 2BJ1A 1FI4A 2OP5A 4CP5A 2HHXA 1KC8T 3M8RA 4ECZA 2NSBA 1G2EA 5ETRA 3PIOQ 2QA4G 2VZ9A 4ZN1A 1RHUB 2ALZA 2IHR1 1ICEB 1T11A 2V34A 1IBMJ 3DLHA 2BMBA 4ZA1A 2L48A 3VR1A 2PI5A 2CQCA 4RBVA 1NPPA 4TXSA 1OO0B 1H0HB 4YDDB 1UFKA 2UUWA 1YBTA 3BSAA 1RTJA 2G1DA 1VBKA 2J0SD 3A3PB 2V2KA 2OPQB 8RUCA 5MLCV 3HFZB 5C24A 4RW8B 2L9DA 4JOUA 2KT5A 3NG8A 2G4BA 3I4PA 2CFXA 3MM6B 2KZZA 1H38A 4KH0B 2M9KA 1NJIT 3PZPA 4IO9Q 4LSLB 1S0VA 2A6OA 4OZNA 2ZDOA 2J8AA 1IBLF 1ROFA 5HVGA 1OYEA 2RJZA 4OYPA 2YX1A 1RABB 3DLEA 2F40A 2DTJA 5CYMB 3G4SS 4B3OA 2AYBA 2HFSA 4ZPCA 4OI1A 1TTHB 2RKIA 2XYHB 2Z58B 1FEHA 1N6QB 2KM8B 1FTCA 4CO0A 1RAOA 1AB8A 4JYAJ 4ZPWR 1S9FA 4IG0A 3TZWA 1BY9A 5JXSA 2ZBIA 4AL6A 1NH7A 4HT5A 4IFVB 1SC4B 1MNEA 3AH6A 1RXOB 4CI0B 3NGDA 4GC7A 3PW2A 3NOCA 4NXMF 4MKVA 4I4BA 3V6DA 1S6OA 3AY0A 3T9ZA 3ENVA 4JUZA 1VQ6S 1WOSA 3CNQP 2ZHBA 2ZBCA 4RNOA 1HNVA 3DRXA 3BSNA 3JS9A 2IBOA 3TWZA 2HFVA 3Q23A 2W9CA 4YR0A 1H73A 2J9CA 3CCQS 2W7PA 1ZAWA 1T95A 1HIYA 3B6BA 2Y8WA 2EPIA 3O2IA 4QYZK 3V6KA 1IXKA 1LV5A 1OY6A 4FYYB 3K59A 3IG1A 2VOPA 3IBFB 5KG3A 1X4CA 3DLGA 3MCOA 3MM5B 1RT4A 4USHA 3B82A 3VQSA 3TP2A 2YH1A 1VI7A 3GR0A 1HHTP 2GMLA 3WX8A 4EO6A 3QPIA 2XO6A 3MR7A 3Q86A 1LWCA 5K9FA 1KP6A 3CD6S 1SPBP 3HT0A 2QMWA 3N01A 2JLEA 1NLKL 1N5VA 1RTZA 3R5CA 2VU5A 4IRDA 3TUPA 3M2UA 1Y4ZB 1LXNA 3CCWA 3CCZA 4DR4F 2FY1A 3WX4A 4KGKA 4G1PA 1PYTA 1TK8A 5BR8J 3F0NA 1JLFA 1QM9A 2VA2A 2RUGA 4PCQA 5L1JA 3MEGA 1HBMA 4QOTA 4LFBJ 2E7XA 1R0AA 4ID8A 2R2TA 3ZZRA 1VHIA 2VG6B 2C3UA 5E3PA 4F4WA 5IC6B 1Q8KA 3GSIA 1CJTA 3LGNA 4FBTA 4WFYA 1MWYA 4GVBA 2E1AA 1VQ8S 3J7AN 4NYOA 2V8DA 3TUZC 1SCJB 1S97A 1D9DA 1CJKA 1WC5A 3O6QA 2OAUA 3B78A 2N4DA 2KT2A 2U1AA 3LO3A 1FF2A 5LT5A 3RG6A 3TARA 1CJVB 1C0TA 1T9YA 5DO2A 3A12A 3MWBA 4P72A 4CDIA 1EKRA 3NXZA 3SSRA 2M4MA 4IR9A 1IM4A 1I3OB 3TOQA 3NAIA 3FSYA 4CO1A 3HXMA 1TFWA 4TY8B 2MJUA 2FZCB 4P6QA 1V5VA 4FYWB 4J37A 1HR0J 3TJ9A 1JLAA 3D67A 2XNRA 4MK7A 5K8PA 2JNJA 4RKUC 3HDSA 1DTQB 2X3GA 4R8UA 1WTFA 4IG3A 2AZ1A 3PG9A 2GC8A 3DHXA 4AD6A 4JI1J 3HSGA 1U4BA 2XNQA 1MG7A 2BYCA 3AAWB 4C48A 4ZS6A 5IC4B 2OFGX 2GO9A 1FX4A 1U1KA 1SKUB 4NRTA 4XDCA 4DV5J 2B9XA 2W01A 3TA2A 1CC8A 5J2NB 4ZVSB 1WG1A 2RVJA 3WC2A 2XWYA 4LBIA 5KG1A 4ES2A 2IAJA 4LFAJ 2BOAA 1CEZA 4R5PB 3G87A 9ATCB 2APOA 1HA1A 4OJHA 3GJTB 2EFQA 2LXIA 1VR6A 3GU0A 1JLCA 3CJKA 4F7VA 3PFEA 1UVLA 3CJ5A 4IOAQ 3UDCA 2YWGA 3IO1A 3D9BA 2ASJA 3UR3C 5KT7A 2FJDB 4L3KA 1RWKB 4UW2A 4K4SA 3KK3A 2UXCF 2E7VA 2VPYB 1RBOB 1N8RT 4HR2A 4ZVUB 4OV1A 1H7WA 3JQMA 4NL5A 2J9DA 2VG5A 4RW6B 3C6UA 1Q7LB 4NE9C 2MQ8A 1NSKL 5CZVA 2IPOB 4BBYA 3E01A 2GHPA 4ANCA 1L3UA 4K7QA 4Y2KA 1XQIA 4RO0A 1NHUA 4O44A 2RRAA 1XWLA 2AJQA 3EYZA 1UVKA 3N28A 3TRGA 2NXEA 1TMJA 2BANB 2E1RA 3W63A 3TVZA 3RR7A 4ZVHA 5CABA 1VK3A 4DQPA 3G82A 3O8WA 3R7BB 1F60B 1FERA 3QRRA 2OIHA 4DX8H 4CYUB 1P8GA 2R2SA 3TANA 4CO4A 4AT1B 4C97A 5ETSA 5ETNA 2VG7B 4A4JA 2EKYA 2IA0A 1MROA 3BO4A 1X4EA 3I32A 1R8AA 3SDEA 1CQNA 4UQGA 3FK4A 3OVSA 4V19J 2AJ0A 4RU9A 1Q7YT 4CTAB 2DGUA 2ZNZA 4M5MA 3IRXA 4CNYA 1S72S 2M0GB 1IKVB 4RW9B 2HGMA 4PUOB 1Y11A 3KLHA 1S0MA 1WORA 3B4DA 2AX0A 3R5AA 3MMBB 2DGTA 4X4QA 2FVQA 4P73A 5J2QA 3KUHA 3H98A 3K57A 4DSEA 2YNGA 5B7WA 5FIIA 1WKJA 4C11A 3T1AA 1F0XA 2MLZA 2VC1A 4PQAA 1XMOJ 4DFMA 4ES3A 2O67A 1FRIA 1M5HA 3MCSA 4DHVA 3POTB 2W2PP 3QYYA 1KLMB 2RT3A 4LF8F 2VC0A 3D2WA 2KI2A 1NPKA 4NLOA 1X9SA 1X5PA 4JI7F 3RAXA 5KFAA 3VGSA 5CAAA 2UP1A 1SBRA 1ZZFA 3LP1B 5KFDA 1VYAA 4WE1A 5K5MA 1JX4A 3DRSA 3TQ1A 4CO3A 3BO2A 1Q5VA 2IM2A 1SL2A 4QPTA 4RZRA 4K4VA 4CZCA 4NLDA 1JLGA 3CDAA 3CVKA 3JXOA 4DPOA 2IJRA 4G65A 4F2SA 3BH6B 2HW3A 4FS2A 1IN0A 4ZOSA 2D3ZA 1DTTA 1L3SA 3OJSA 2JC1A 3OR2B 2R7OA 1JJCB 1RT1A 4DL6A 4M5IA 2ZH8A 4JV5J 2AHOB 3OHAA 1LW2B 4EYIB 1TUWA 3KXDA 4QR1A 3PX0A 4NA1A 1RLCL 4CLPA 4PKDB 1U1LA 1IR0A 2YNIB 2PN6A 3J80U 1XERA 1U0HB 4USVA 1HNXJ 2HNYB 4AL5A 3HHLD 1U09A 3TW0A 3T1YJ 4ED0A 3K5PA 4DUTA 2R3VA 2P6SA 3C16A 1HQEB 1CS4A 2FHMA 3AA9A 3W9IA 3VZIA 4XDDA 3FMBA 3NCQA 3QT5A 1RA6A 2JEFA 1UZHA 3ZTOA 4N56A 4LF5J 4QIGA 1FT8A 4DPXA 1R6VA 2AT1B 1WACA 3CPWR 2WW8A 2OPQA 1VRQC 3OXLA 4JBCA 3FRYA 1VJWA 5LMNJ 3CCMS 4XTTA 2DH9A 3K5MA 3M6XA 3MM6A 4C0BA 2X1GA 1AA1B 1D9FA 4CQ1A 5EX3A 4BLGA 1GTHA 4G3IA 2LLZA 4CT8A 2LEPA 1RUSA 2CJBA 2Z4PA 3CCVS 4BC9A 1B0PA 3MHYA 2XZWA 3D7SB 2P5VA 5CYMA 1KRPA 2EBGA 2BJDA 2MKKA 1LEOA 3IA0A 5J1NA 3OQ2A 1RKJA 4WFNQ 2BBEA 5GVQA 2W8KA 1ELOA 1R43A 1HARA 2C2DA 5EWGA 1K0VA 3PW0A 4LFBF 3OL8A 4RX6A 1Q8LA 3MM7B 1U49A 5G4DA 4BWMA 3J7A1 1NDPA 3PW7A 2Y8YA 3GJQB 2BJ8A 2V5HG 1KFSA 5H9EK 4WK1A 3KDNA 4X64J 4OHZA 4J9NA 1BGXT 5F8MA 2HQFA 1FWPA 5HLFA 3ZC4A 2YKNA 1Q8IA 2VV5A 5F8LA 3RR8A 2UVUA 3VZHA 3J81j 5CCLA 1N0UA 3BSOA 2UUTA 2C3YA 1L3TA 1EIYB 4NZ6A 1XNRF 1M1HA 4ETXA 2ZZNA 1S6PA 4NLXA 3OV7A 2M70A 4ED4A 3AJ1A 4GKJJ 1VJQA 4TQSA 4O0IA 2KYXA 4YB5A 5DDQC 2OI2A 3BBFA 2WTFA 1ZM3A 5KG7A 3MXHP 1MLAA 1S1WA 4DL5A 4OZJA 1N33F 1WC6A 3PJXA 3FSIA 5D4OA 2BXJA 1HNWF 3AODA 2EK6A 4JI3F 2CQIA 1U25A 3MR2A 3RB0A 1HR0F 1T05B 4DFPA 3NBPB 4P7VA 1HPZB 3AD7C 4FPIA 3K89A 4QU7A 2H3EB 4JI8J 2VOOA 2KZMA 1NDKA 3IRWP 1FCAA 1VRTB 4DUYF 1LOUA 4P74A 3TNVA 2X1FA 1ZA2B 2JVOA 2R8GA 3M2RA 4E0DA 3QZ7A 3PX4A 4URQU 1R6YA 3K17A 3LUYA 3DLLQ 4O3OA 2B3TB 4KGMA 1KVJA 2VG6A 4DR5F 3W7BA 2ASYA 4KTQA 1UP1A 4R25A 5IZHA 2KFYA 3I56S 3PTWA 2K7JA 3DYAB 3CCLS 2F8EX 3PNIA 2GVDA 3GP9A 1RTDB 2B4UA 4HACB 2XO7A 2FY8A 3V81A 4P2MA 3CC4S 4CH1A 1FFWB 1OQ6A 3OL7A 1LK7A 5GADI 1RAAB 4DV3F 3THTA 3O5TB 2XCAA 4KSEB 2Z56B 2RDJA 2B0GA 2FHOB 3JSYA 4NLUA 3CJRA 3JSMA 3OVBA 2X3DA 2FLNA 2QA2A 2C3OA 2J7WA 4YY3F 1HW9A 3EE3A 1S1XB 3RAMA 4DQRA 1NKCA 1ZOTA 3L95X 2YKQA 3ITHA 5HN0A 2AF6A 2ASLA 4ED2A 1NPRA 3QFHA 2VKRA 3O44A 4OZ0A 2DNLA 2R8HA 4OI3A 2UXDJ 3GV5B 4L75A 2WBMA 1FDAA 4ZP8A 3LTOA 2HS0A 4QIWD 3L9ZA 3IWLA 1Q81T 1TUGB 1URRA 4NLWA 2OPPA 5I42B 4FXVA 1UW9A 1DARA 4I6YA 2E5HA 4QIFA 3THVA 1FRXA 3ZZ0A 4HTIA 2MKJA 4C8OA 3J81U 2BE9B 1SH3A 3Q2SC 1KS2A 3ZZTA 1VC6A 2KKHA 1ZBTA 3NGTA 3PYEA 1C0UA 1K44A 1KBRA 2X1BA 4O3PA 4DR6J 2GCFA 1H3DA 4HT7A 3FQKA 4UOFA 5J2NA 3GSDA 3L4BC 5HP1B 3H90A 2CPYA 1X5TA 3DDKA 3D28A 3C15B 1CSJA 3OSNA 3OSPA 2FDNA 2AWZA 1W26A 3PACA 3AA8A 4DL3A 3GYNA 1NHKL 2J6SA 1N32J 4PABA 3HSDA 3MAAB 4X2BA 2Z30B 1RAIB 2DR9A 3CXCR 3FQLA 4X4NA 1TL3B 4DR7J 3GWCA 3R5BA 2CDRB 1XMOF 4ZCLA 2CQ1A 5D4NA 3WZ0A 3S7RA 2MQLA 4FBUA 1AXQA 4EBCA 1GMVA 4V19X 4ICLB 2CJAA 4RU2A 3HLUA 5KG6A 3CO9A 4UF4A 3CDBA 4ILLA 3FMWA 2JWNA 4ALZA 2WVBA 3PO5A 4PYDA 2DGVA 3BGRB 3JSBA 5EDWA 1RT7A 1SUQB 5IXUA 5JVGQ 2CJQA 3IM9A 2FHKA 3TO8A 5J1EB 5L9NA 3VWSA 4WK3A 3D1OA 1VQOS 2HNZB 3PY8A 2HIYA 3NS5A 3M8PB 1VC5A 4KRWA 1IBKJ 2DXEA 3T5LA 3NGUA 4CYUA 5DDPC 5DG9A 4KPYA 1JJHA 5SUHA 3FFIB 4C8YA 1UFLA 1MMNA 2VG7A 4DU8A 3ET6B 4BCAA 5EGYA 1RDRA 3RRHA 5ETPA 1UWAA 2HHUA 3KG0A 1HL6A 3BBBA 3OLAA 5LSRA 2I8EA 5IFMA 4O3SA 4CH7A 2WONB 3UCZP 1IKVA 4RW9A 1TMMA 2VDHA 1O8BA 3OHBA 4C98A 2CWXA 1NH8A 5JMNA 3GYXB 2ZZTA 4O23A 1QY7A 2ZE2B 4OI4A 2KB2A 3MD3A 4H4KA 3L7PA 4O3QA 1Y9OA 1V9OA 1S1UB 4W4MA 4DV4J 2GJ2A 3DRRA 2XMKA 2G9OA 3AT1B 1N5YA 4Y2AA 2AYGA 4U96A 3ZZUA 2JDJA 1N36J 2ZOGA 4CLKA 3POTA 5CZXA 3ZFVA 4B3RF 3P6YC 4UOHA 2PT0A 4LF9F 2MMYA 3CD5A 3F41A 3CEDA 2BJEA 2ZH2A 2PGCA 1UFWA 2Z0GA 1IQZA 4LSNB 2YWKA 2RQ4A 3FZ2A 5C2CA 3CCJS 1XMQF 4WYLA 4FS1A 1H2TZ 2R7XA 4ZVPB 2QTWA 4ZP6A 5C25B 3PKMA 1SQEA 3G6XA 5H9FK 4FP9A 4RW4A 2O01C 3GV7B 1WHVA 3I31A 3GIJA 3KG1A 2FIUA 2QL9B 2HRUA 4ZLLA 1FA0A 2B51A 2HHSA 4OQJA 1Q53A 4KPCA 4LRAA 2VF3A 4X66F 1H72C 4WIIA 2XEXA 4Q43A 3V4IB 3W62A 3VAIA 5IWAF 4H4OB 2IJFA 4MKAA 1R7IA 5D6GA 1RAJA 3A4TA 2O3DA 2AIRB 2DNNA 4YQWA 4NLRA 4GC6A 4A8QA 5K14B 3OXFA 1D8ZA 3HZGA 1SJFA 4HDGA 3HPOA 4ZVQB 2QO3A 2V8HA 3A13A 2VICA 2V63A 2DO0A 1U0HA 3UN3A 2HNYA 4MK8A 5A8RB 3G6VA 1R0CB 2YNHB 4M63A 4F04B 2QYCA 3I9ZA 4KHRA 1U1OA 2MKCA 4ES1A 3N0VA 5I3UB 4DPUA 4DZDA 1YWXA 1RHKB 3MEEB 1R89A 5D78A 4QYRA 1VQNS 4WIQA 3VAHA 4QR2A 2GA7A 3HVTA 2ZH1A 2BUNA 1VHFA 2YWHA 2BJ3A 4CNZA 3ILLA 2OEKA 2VBYA 1MU2A 2XSJA 1PC5A 3HHEA 3R6GB 1RWXB 2OO4A 3R2DJ 4C9DA 4C8ZA 4DSKA 5F8GA 2DRBA 2PA8D 4RBUA 1VOMA 2AEMA 4JI8F 4DG1B 4AL7A 1Y00A 5E0OA 2KXNB 3CJQA 1RACB 2B5JA 1TAUA 2KG0A 2R7UA 3HFKA 4B08A 1FJGJ 2DGXA 2VL1A 4PPZA 3W64A 1VIXA 5E41A 1FJCA 4GKKF 4B3SJ 3J7YI 1NSPA 1RTIB 4PWDB 1LXJA 3FSXA 1HD0A 2J7UA 5HATA 2HMIB 3SI8A 3VAMA 3LANA 4DBQA 1JJ4A 2CVIA 5E3RA 4BHQA 3BS9A 3NOGA 3NWRA 3MR5A 2UVWA 2RNEA 2J9EA 1KD1T 4QW8A 1GXLA 2W7AA 3HJVA 3UNGC 3AOCA 1I51B 2QL5B 4DV7F 4R0JA 1KQSR 5HQLA 3KK2B 2GIRA 2H54B 2VDIA 1IJEB 3G6YA 1SXLA 2IDEA 2ROPA 5HJYA 1WSVA 4RNNA 3UI3A 2G2ZA 3FC9A 4DSJA 1UEKA 3K7RA 4C7QA 5D0RA 4F0MA 1NCLA 4LFCJ 2HURA 1YRUA 1WKKA 1YJTA 2E5GA 2E7WA 4I2PA 4RW7B 4LR8A 3SSQA 4MIBA 2UXBF 3K5NA 1DZ5A 1BLUA 2YKAA 2ZH4A 3BN7A 2V8GA 1IKWB 1NUEA 3H8YA 3TQEA 2HHHJ 2HQDA 4RUBA 1AUSL 3P3DA 2HGLA 2D69A 2J6UA 3IR5B 1KQGB 1CULB 1FD2A 3SQOP 4L72B 1YTYA 4DPWA 1T05A 3GTYX 1HPZA 2UXDF 4X62J 4DMZA 2ROEA 1RYRA 3CIZA 5KOWA 1JJ2R 3OD2A 2V6AA 2XWXA 3IWNC 3GCXP 1NK8A 2HAFA 3ZZPA 1P9QC 2YVSA 3CGIA 4OHWA 1QE1B 3TUIC 1B4SA 1FKOB 2FTRA 5A6PA 2HRTA 2NXUA 3WC0A 4USWA 1EP4B 2FLLA 4KFBB 3KJQB 3TX0A 5C5JA 1S9EB 1J5EF 2C2EA 4WWSA 3DYAA 1B99A 4F36A 3W8GA 4HACA 1GXTA 3WDOA 2CPHA 5HBMA 3RB6A 2HSEB 2EK1A 1F3VA 5THWA 2YQ0A 2ZC3A 3PM9A 2AMCB 2ACYA 2KN4A 4RR5A 5L8RC 2MKSA 4DEZA 2Y9HA 2K3IA 1N32F 3H4BA 2LEBA 4J90A 3UDLA 1IQTA 1IKYB 3VALA 4ILMA 3IGVA 4A47A 1IKXB 1S1XA 2JOQA 5HSPA 4A8YA 2XBPA 2F4VJ 3CD0A 4LR7A 2KYZA 2JHEA 2OTLS 3A3NB 3OFEA 2COLA 3ZNUA 3DLJA 2VB6A 4EBDA 1RAGB 3HMJG 3AJDA 2HWIA 2MY7A 4EO8A 3D6TB 3Q8SB 1X4AA 3P5BP 2B9EA 4PR6A 2QZ8A 3FRZA 1WEYA 3C6TB 2I38A 3MCMA 4ZN3A 3H2UB 3M32A 1HI0P 4ERDA 5EUHA 2JSXA 1WDTA 1JLEB 4PG8A 2FPHX 2CJXB 4OX9J 1FFSB 3IXQA 4I7FB 2ZVSA 4I2QB 1U2FA 5B08A 2IC3A 5L1LA 2QN6B 4OX6A 1JXEA 2XYGB 4EBEA 2Z2MA 3CC2S 2M7SA 4WU2A 3NP5A 2D3O1 3SCIE 4AYBD 2W25A 3N6LA 4ECSA 4QIEA 5EWFA 1EETA 3PEJA 1R8PA 1XBWA 5J2MB 3ZTQA 4PAAA 1NMEB 1YLXA 2KJVA 2GHWA 3JAMU 4OHXA 2HGNA 3D4JA 5KFHA 5A8KB 3MMJA 1UCNA 1HI1A 4UY8T 3MAAA 4PXCA 4C8NA 1RHQB 4FNHA 4YDXA 2IVYA 6FD1A 4OYAA 3PHEA 1VBYA 4B17A 4W90B 1RSCA 2DRDA 3O3LA 4DCOB 3KJFB 1CJUA 4ICLA 5A8WA 5GAGI 2P2CB 1T7PA 5ADZA 3CJ2A 4WKYA 3LP2A 5B0GA 4UQTA 3T41A 4KH1B 3RTVA 3EVMA 4A8XA 1WWHA 2LXFA 1QTMA 4OYIA 1SJ4P 1RT6B 2ROGA 5KG5A 5J1EA 2FC8A 4DL0C 2HNZA 4XIUA 3M8PA 3D3CJ 2LQ5A 2KXHA 2GQ2A 2W4CA 4QIVA 1S48A 4U8YA 1LFPA 3SCLE 1UTAA 4V1Ak 2FJAB 1DLOA 2LQ9A 1FTRA 2FD2A 1YJUA 4UY85 1F9FA 1N4LA 3RBXA 3ET6A 4I1TA 4LF6F 1Z4UA 4K59A 3BQ0A 2YWEA 4UT4A 2DIUA 4B3TF 1RWNB 2ZBPA 2RF2B 3HHLC 3KJVA 1FNMA 1TV6B 3EZOA 3T9NA 4JI5F 2VBWA 3HD1A 2F8MA 2JLFA 1KOHA 4OYXA 2CPIA 1RWMB 1RLDA 1R0BG 4O4GB 2NR0A 2G0JA 2ADCA 3BGLA 4HTJA 1MSWD 4ZPVR 3UCGA 5CD4H 4XO0A 2XS5A 4EWTA 5LSOA 1U1NA 2R8KA 2F65A 1VRUA 3KMQA 3ZTPA 1VQMS 1Y7PA 3HT3A 5HVHA 3C14B 1HHQA 4MKBA 1NU4A 1Q1KA 4NMXA 4L73A 3RRGA 5ETTA 3OW2R 4A8MP 3KLGA 2MGZB 3VCDA 2OPSB 1DQ8A 2YQ3A 4WFXA 2RMLA 1UWBA 3OTEA 3UDVA 4K4ZA 3Q89A 1HKAA 4YHHF 2UUAF 3NCPA 3I0RB 3CCUS 3T1HF 4LSNA 3D6FB 2B8QA 1HNZF 3DCAA 1FD8A 2R9LA 2XY7A 3N9UC 3FDSA 3GIKA 2H5EA 3CUNA 4WBFA 3HFVA 4QWCA 1IUJA 3MEDB 1R31A 3CMQA 2ZC4A 2VQEJ 4NMLA 2PSZA 2BKOA 2EC2A 2NUHA 2MSTA 5KFBA 4CCHA 2DHAA 2U2FA 1T94A 4I56A 2I5JB 3D1QA 4H4MB 1HNIA 5AT1B 3DOLB 5KFZA 1BWEA 3CB4A 2L41A 1GXUA 3I96A 2BDPA 3KHLA 4IDKB 1KTVA 2CZ9A 1LW0B 2BVZA 2H65B 3CULA 1TL1B 2BRLA 3KFWX 4K2JA 4ECTA 2CPXA 3BR9A 4P2FA 4YP3A 1SV5B 5L9XA 1TKXB 1M5KC 5A8RA 1N56A 4WFZA 2Q79A 4X84A 5A0YB 4OYMA 4NOHA 2IM3A 3EZ5A 3G8SA 1WF0A 1TL7B 3EPIA 1H2UX 3SQGA 3Q0AA 2QA4S 4J9KA 5I3UA 2D41A 1YIJS 1RU1A 3MEEA 1EHWA 1A6LA 5KFTA 1Y0HA 3HSJA 2R7TA 1UA0A 3F56A 1F2HA 2MSSA 2J0QD 2CIMA 1VBZA 5HK4A 1OYDA 2VFRA 2M8HA 5LMUJ 4ZLPA 5AXNA 1F9EB 1IR1A 3HVRA 1RZMA 4OFZA 2HK2A 5HROB 1WG5A 2OELA 3IP0A 4NLQA 2GQQA 1QJHA 3M8QB 4URGA 3C66A 2GMJA 3R5JB 4LJMA 1RISA 2ZDPA 2HVEA 4DX6A 1RT2B 1NDLA 2HBZB 1LWFA 4KHPF 2IRYA 1K8AT 3ICLA 3BYRA 3DHWC 4CH0S 3OTDA 1OY9A 2C2ZB 1Q8BA 3QNWB 5IT9Y 4BC7A 4U7UK 2XM3A 1RTIA 4HLBA 4PWDA 1IBCB 4DUZF 2B6AA 1JNRB 2HMIA 2ZD1A 1SKRA 2MHEA 2DR6A 3MM8B 1IR2A 2WSEC 3D68A 1T9XA 1RKIA 2VBXA 2O66A 2VFVA 3V6JA 3HD2A 4ID5B 1FVQA 3M6WA 1UZDA 2MPUA 2V2QA 5C42B 1PJ6A 3FCVA 4F4AA 3TJAA 2NCKL 5F9LA 4KQZA 1JLQB 4ZKAA 3PDNA 1FX2A 3HM9A 5KG2A 2AX1A 4C3MA 2CJYB 2LCWA 3DM2B 2LYVA 3W65A 1H2VZ 1TKTA 3QAEA 3T3FA 2WRMA 1VBXA 4M5KA 3RJMB 2N7CA 3MUTP 1XTZA 4USKA 3AHPA 5KFOA 2XGPA 1FHTA 1GTEA 3SMZA 5D0EA 2QMXA 1NSAA 5EWEA 1U1QA 3H7HB 5LL6d 4WFBQ 1JB0C 2GAHC 5LJ3Y 1BQNA 4DX7A 3QMQA 3LP0A 5HI7A 3J81Y 2CJKA 2OSRA 4FXDA 3WIUA 4TU7A 3ENWA 3UE2A 4DR3J 4ZJLA 3CJTA 3GIMA 4HHUA 1XN9A 1AW0A 3CC7S 1X5SA 1BUXA 2HQGA 1WC3A 3IS9B 2NPFA 2DKOB 4OZ1A 3QO9B 5KFVA 2CYYA 3C8YA 3VAFA 3QZ8A 4WPAA 3H0PA 5A6WA 2M88A 4N8NA 1O6XA 4OX9F 2BKNA 3QWPA 4KC5A 3B4MA 2AYMA 5GADU 2UU9F 3QGIA 1SVDA 5B0EA 4LQ3A 1N52B 2HBRB 1HW8A 5BYRA 2YH0A 3MI7X 3OFGA 2MDAA 2CPFA 1YJ7A 2LQJA 3PW4A 1CQMA 2H4YB 4LSZB 2V4RA 2XI3A 4IR1A 2Z8QA 2DO4A 4EMDA 2Q43A 4USJC 2A6MA 3TX8A 1SKSA 5G0RA 2DNZA 5KT5A 3UR0A 5KFWA 1X4DA 5KFSA 5L39A 1O5JA 2C2NA 2DNHA 3MCNA 3U1MA 3UDEA 1YI2S 4DX5A 3MECA 3TEGA 2VFTA 4WP8A 2FGOA 3UNYA 2KVIA 3OL6A 5KOXA 1XNQJ 5DZ7A 3I87A 4TN2A 2K2PA 1W2BR 3EJMA 4JI0J 1IKYA 2DH7A 4AQYJ 2HLTA 2E9TA 1C1CB 1WC4A 3KLFA 3TVYA 4MAKA 2FYXA 4ED8A 1QAXA 3PRDA 3WBZA 1NK6A 4NCBA 3OUYB 3IBCB 2D1CA 3BEGB 2YWWA 2GAGC 3PCOB 2J0WA 4HH0A 1YSJA 3US5A 2L08A 4K8RA 4AUKA 2DHXA 4ZPTR 2XMTA 4FN5A 2R4FA 2WK4A 3C6TA 3H5XA 2XMAA 4ZPBA 1F9HA 4TU9A 4ECXA 5H9FJ 2J6TA 2JVRA 3I0SA 3MUMP 5CCMA 3MF5A 1NSQA 2GQCA 2VQFJ 1JLEA 1NXIA 3AB4B 2PC6A 4NLYA 4TY9A 1T9UA 2WSFC 3C3LA 4NCAA 3C19A 3D6HB 2JEIA 1S4EA 3MMAA 2BJ9A 1XR6A 2OMOA 1B64A 1A7GE 1B0TA 2NYHA 4NCGB 4NX9A 3LQVA 1L5UA 3DI6A 4CIOA 4Q0BB 2HLUA 3M9MB 3ISZA 5CQGA 4IKAA 3NMRA 1DURA 1M1GA 4MT1A 4ANDA 3W5YA 2AD9A 1VLOA 3FBFA 2E44A 1R8CA 1NK4A 2QFJA 2OD4A 1U6BA 1NK9A 1HMVA 3MFHA 2G1HA 5J2MA 1BQXA 1ZZNA 1SJRA 5IM0A 3GFYA 3BGFA 1UJ5A 1HYSA 2L9NA 3LWMA 1V3RA 1RQ0A 5DDRC 2RQMA 3GZ7A 1RU2A 3R7SB 4NWBA 2HK3A 1HBOA 3SFUA 1RTJB 3BGUA 1RBAA 5U47A 2O1PA 2K06A 2V9KA 2M5YA 1FXDA 3C46A 2H5IB 2VH7A 3BSCA 3ILIA 3HULA 3ETOA 5LJ5Y 2QC3A 5C24B 3GJRB 2K1RA 4Q44A 1FXRA 3TAQA 3GPAA 3QJLA 1UKUA 2DK2A 3QT6A 4Q2LA 2KJWA 3VAKA 2W24A 2MQPA 2E5LF 4QPXA 1RT6A 4NYPA 1Y5NB 3K2YA 2DISA 5HMYA 1Q78A 3MD1A 1VLYA 3GFXA 3KHHA 4DS5A 3DLEB 4TQRA 2CNOB 4DV6F 2CNLB 5D3GB 4JI4F 2VQEF 3THPA 1YQHA 2RKIB 3NS7B 3H2VE 1GH8A 4ED6A 1GMWA 2EBEA 3TJ8A 2ZBQA 4K4UA 4ENOA 3NKYA 1VC0A 5F0UA 5FD1A 1WKLA 3CIMA 1TV6A 5E33A 1DQ9A 2RS2A 4I6WA 2V69A 2V8PA 3BB5A 2F1FA 1LFWA 2JRSA 2VONA 8AT1B 1H74A 4O4GA 4I6AA 3V6DB 3EICA 2LEAA 1P1LA 2GS8A 4TVAB 3DGPA 1N48A 4E8UA 1ZPWX 4B02A 1PBAA 1PO6A 2V94A 3H40A 5JVHQ 1Q79A 2W9CB 1HWLA 3F44A 1IVZA 1GAOA 2H1YA 4OLOA 2EFVA 4ZPDA 5FDLA 4I0WA 3D54A 4O4RA 3IG1B 3QT7A 2HEKA 3LPYA 3NEKA 3M8WA 1RCXB 3LALA 3DLGB 3SIPB 2FB0A 2WVDA 2WOMB 4ZJQA 2NS1B 2V0NA 3OBIA 2KTQA 1WUUA 2DXDA 1LWCB 2XLJA 5LMUF 1R3NA 1UA1A 4KR0B 1TUVA 1TL4A 4Z2XA 4PPDA 4CWBA 2ALYB 5F41A 5T7LB 1IBLJ 2B9YA 1NHVA 1V3SA 3MEDA 2G0CA 1BXNA 4TU8A 5AJ3J 2DEJA 1JMTA 2IM1A 4RNMA 1S79A 3H4DA 5I3QA 1JLFB 2DNPA 5HQMA 2HQIA 3EUNA 2R2RA 3MEGB 3GB0A 1HBMB 1KR4A 3CJ3A 5HMXA 1R0AB 4UOCA 2EFGA 6AT1B 3ILJA 3TZZA 3NS6A 4U6PA 4ER8A 4Y2IA 4YB6A 1S59A 1FKAF 4HKQA 2E9ZA 1YJWS 1NKBA 1EZZB 2BW2A 2I5JA 5RUBA 4DR1F 4NXMJ 4H4MA 2IYIA 1CPZA 1HLWA 1RHRB 5EHHA 3NGKA 1RB0A 1FRKA 4G1QB 2BOPA 4DL7A 4FNIA 1TL1A 5ITHA 1KKHA 1CJKB 3JTNA 5LOQA 3G2XA 5HQ8A 2VUGA 3BBCA 1TKXA 1D9AA 4F4XA 3PO4A 4A8SA 4Y0FA 2ERRA 2RQCA 5HO4A 1S9GB 2I0XA 4EGLA 2CRLA 1X7VA 1XEZA 1C2PA 1HQUB 3W2VA 3G96A 2HHPA 1OPZA 2D9OA 4TYBA 5KFRA 2XY6A 1PCAA 2W9BA 4ECRA 3DLKB 1FE0A 2CWKA 4UTGA 1YJ9S 4HHJA 5D4LA 3DOKA 2YKMA 2LECA 5IV4A 1ZAXA 4C6AA 5KT4A 4TKTA 5IT4A 1XC9A 5HROA 1AT1B 1F5CA 5I3PA 2DGOA 4LQ9A 3CSKA 2ZHOA 3KNGA 4DR3F 5KFLA 3VGTA 2YPZA 3TEHB 4DR4J 1RA7A 3MM9B 5GMDA 4IG3B 3H20A 3UVJA 1WOPA 1MMDA 1YHQS 4ZVGA 4RBTA 2E29A 2PIIA 5J1PA 1RT2A 1KN6A 1CC7A 1IBMF 2KRRA 3EPGA 4FYVB 2R8IA 5ETLA 2YXLA 4S0MA 2DIVA 5D0HA 2IIHA 1S5ZA 3W2WA 1S4FA 1NEEA 3R6LB 3I5AA 2PO4A 1AFJA 4NI2B 1FXLA 2W2QP 3MM8A 4U67Q 3QSYB 5B0CA 1G1XA 1JQGA 4JI2J 3UPFA 3KLEA 5LXRA 4DLGA 4DSIA 3QBCA 1Y10A 1KWMA 1REVA 2OLWA 5C42A 3G8QA 3CJKB 2ZH3A 1NJWA 5DM6Q 2XS2A 3P8BB 2ZBRA 2J8SA 1M0SA 4Y3CA 4UZCA 3X1LB 1OS5A 1JK9B 2MY8A 4ZVEA 2FHJA 4OI6A 3MAHA 1RTHB 2W2NP 2L3MA 1HI8A 2VG5B 1TL5A 1J5OB 3C6UB 2DY9A 4JYAF 2Y1LB 3PVXA 3E01B 2FUG9 3LF0A 2UVRA 4YOEA 2EW9A 3QJJA 3RAQA 4C2MA 1D3WA 2LU2A 4O44B 1WC0A 2JC0A 2UV8G 1KDNA 2NZCA 3QLHB 2EKNA 3M05A 2CQ3A 2WBRA 1BHNA 2F7VA 3ULHA 1KQKA 4QZVB 2IDLA 4U7UD 4ZIVA 3PX6A 4HYKA 5B0FA 4ED1A 3G82B 1SL1A 3OLBA 2BX6A 2OFHX 3QO9A 1GX6A 2GMHA 3BREA 2B4OA 2NREA 2FVSA 4GO7X 2VQFF 3I82A 2AJ4A 3QGHA 3R3TA 5DZ6A 3M8SA 2ZJRQ 2HWTA 3UD4P 5HAOA 1MROB 3OTBA 4P9SA 3PXGa 3W61A 1WELA 2DJWA 2VD3A 3V5RA 5A2QU 1UJ4A 3ISND 1RAEB 2VFUA 3IRXB 3LH2S 1JNZB 3CCTA 4RW8A 4OV6A 4NZ0A 3D5MA 2DR8A 2V4QA 5DQIA 1Q82T 3KLHB 3HP6A 3Q8RB 3AOAA 4J9SA 2OD6A 3UN5A 1S1TB 3IR6B 1EAYC 3MPWA 3I5BA 4LSLA 2WSCC 4LF1A 4DFKA 3RZAA 3OTCA 4C0OC 2QRRA 3D0HE 4E98A 5J2QB 2CUYA 1XJWB 2YNGB 3OL9A 2HWHA 4FF4A 2UXCJ 4LUBA 1GQEA 1X4HA 2Q6CA 2QSFA 2GIFA 7FDRA 2H4WB 2HG4A 5BR8F 1C1BB 2XTJP 1VK8A 5CHCB 4LIRA 1N6QA 2DR7A 3VHQA 2A3JA 4F8RA 1S6QB 1TK0A 2AJ1A 2IY5B 2NUUG 1HQ2A 4PG4A 4IFVA 1EX8A 3EGNA 5DGAA 1S57A 3OUYA 2HHVA 1Q0NA 3NAHA 3SYZA 4WE1B 3CJSA 3DRSB 2NYIA 2DY1A 3IM8A 3X3UA 2HHWA 3GYGA 4Y2CA 5J2PB 1OIAA 5KFXA 3M9OB 3O1LA 1S99A 3E2EA 4G6VB 1N5SA 1FDNA 2C2MB 3OFFA 5I4MA 2DT9A 3GMGA 2DYAA 4ZVFA 1AYEA 1APSA 2DCUB 1XIQA 5L46A 4DV1J 2HFNA 1SQGA 3GIIA 4ZCIA 1RT1B 4NCGA 1D0EA 1T0TV 2MQOA 4Q0BA 1J2VA 2R42A 3DKDA 4K4TA 3MM5A 3EWGA 3GJSB 4A8WA 2NXCA 3IGNA 1SC6A 2QV6A 2KU7A 5KTQA 2H48B 1UPMB 4DR2J 2C28A 2DEIA 2RU3A 1RT5B 2ZHAA 3A8EA 5GAGU 4DF8A 1WHWA 3CJ0A 4TLQA 5EX0A 3BV8A 4JV2A 2JZ5A 4KKOB 1E6YB 1PJ5A 1MWQA 3C16B 5EN1A 1CS4B 5B0BA 2FJVA 4Y00A 1ZYQA 2N82B 8ATCB 3P96A 4ZMMA 1NJZA 1I6JA 4JI1F 3QRQA 2FJEB 2NLWA 3GE9A 2MZSA 1HBNB 2A18A 4KGZB 4LF8J 3BO3A 3ETMA 4RJVA 4M5GA 1S77D 4B9VA 2C2RA 2OKQA 1YGYA 4OX7A 4JI7J 2JLGA 4DV5F 1QVFR 4B9TA 2LP4A 5L1KA 4QWDA 1SQFA 1F6TA 3CF5Q 2AJFE 1FFGB 4LVOP 3MPUB 1U48A 3BZQA 4DCPB 3VTIA 1U0SA 4DWIA 4LFAF 3IR7B 2PDAA 2XI2A 2CJ9A 3D3BJ 1X4BA 3W9JA 2FVRA 2G13A 4LRFA 1GEHA 3P5TL 2GX8A 1FRLA 3PYGA 1DQAA 5AJ3F 4M8LA 5D3GA 1CJVA 5GAEU 3KYLA 5IQQA 2PI4A 2WCXA 4P2XA 2KM8C 3QIPB 4EZ9A 3BDEA 3BKFA 4UOGA 1VQ7S 2MKYA 1UL3A 3IMQJ 1F2GA 4ZLJA 2N4CA 1HHSA 1SH0A 4NLVA 1QAIA 3EGZA 3KK1B 4TY8A 1WJ9A 5DGBA 3JQJA 2HAIA 1WD6A 4NA3A 4WF9Q 5A76A 1QVGR 4ZDNA 2RSQA 4B9SA 1DHMA 2C3MA 2QT7A 4WXWA 1Q86T 1UEUA 3CJ4A 4IH5A 1W7WA 4Q8FA 3K5OA 2P8IA 5HLFB 4P75A 2DCLA 4IRCA 2VFSA 2M52A 2YKNB 4FZVA 1B70B 4CM2A 1KVIA 1MW7A 1HWIA 3LW5C 1DTQA 1GT8A 2W4PA 7FD1A 3H59A 2JEJA 3BGOP 2P9CA 2GV1A 1TKZB 2CAJA 1MN7A 2DD8S 2V68A 1M90T 2J76E 1S6PB 1X31C 1MWZA 3JSRA 1U47A 5FLXU 2P6TA 3OVAA 4LREA 4U95A 3HX9A 2OHDA 1I94J 3JB9k 4PWWA 2E1CA 1VCTA 2ZJQQ 2WOMA 5DG7A 4F25A 1S1WB 2DH8A 1TK5A 4B3MJ 4EZ6A 1LK5A 4HI2A 4TLRA 4ED5A 3AJ2A 5BYQA 4M5LA 3TR5A 2ZITA 4R5PA 4LBHA 4DF4A 5LM7E 5KFFA 3KLVA 2VODA 4U7CA 5T7LA 1YJNS 2BV3A 4QQBA 4ZVTB 4DS4A 2QLWA 1OSDA 2B9WA 2QYGA 1DBDA 4X65J 5DLFA 4KYZA 1AUDA 5DETA 3ENAA 2QMUB 1HD1A 3RW6A 5E3AA 3M2RB 4ATNA 2I2YA 2CPJA 4WTYA 4L3NA 4RW6A 4QW9A 4K4WA 1L3VA 2FJBB 2R7QA 2IMOA 3UO0A 1GK8A 1SIZA 4ZLNA 4FYDA 2CVEA 2AGQA 4DLEA 4KBIA 2P9GA 2W4DA 3LA0A 2CQDA 2V2VA 4ECYA 5HANA 2DB1A 4NEZA 2GVDB 1IWGA 4G1QA 3NL0A 4JI2F 4QU6A 2BANA 1RWVB 2ZKUA 3L7OA 3V81B 4RPFA 1NNDA 4OJ1A 1S12A 3IFEA 1ZTTA 3D0IE 1XNRJ 2ZH5A 3NWGA 1R8HA 2PE8A 2GJFA 2ADBA 3R9LA 5AXKA 1S9GA 2B7CB 4RUHA 3D66A 3JSMB 2BE7D 4M5HA 3G86A 1U1RA 3KDOA 1HQUA 4ZJOA 1LWXA 2DITA 2CQBA 4OIXA 2G2OA 3BH7B 2K3KA 3RGIA 2WW4A 3U27A 7AT1B 3LAKA 4K2XA 1MMLA 4P7TA 3DOMB 1VQ5S 1N33J 3ITHB 4DJBA 1ACMB 4JV5F 4CTAA 3UD3P 3DLKA 4GVLA 5ETMA 1HNWJ 4JI3J 3H5YA 4O0NA 5KFJA 4RUAA 2M3DA 1M5OC 4PUOA 1RWOB 2HIQA 4U9RA 4YR3A 1EKSA 3MMBA 2WB4A 1X60A 4DUYJ 4DPTA 5B0AA 3MM9A 4ECQA 2MKHA 2OPPB 4DFJA 1ZETA 1FK9B 5F8IA 2AEFA 3W66A 2MLXA 1HNXF 2XMMA 1B0VA 1PYSB 1BWVA 3T1YF 5CA5A 4CO5A 4LRDA 3D1HA 1C0UB 2ZUAA 5GAHI 2XGQA 1KLMA 2AJ2A 3DU6A 1XR5A 3RBZA 3FJ2A 4DR5J 3MPVA 4LF5F 2FZGB 3RRKA 3LOUA 2VPXB 2HRYA 4KT0C 2KXFA 4NI2A 3LP1A 3IAS9 2HVIA 1WEZA 3OR1B 1VDHA 2FLOA 2QE5A 1RT3B 2KT3A 5LMNF 3QAUA 4YMEA 2ZM6J 3CJ8A 1S6UA 3U02A 4X4UA 4AE5A 5KFKA 4Y2MA 4DV3J 2QLJB 2AEJA 3PW5A 1PAEX 2HZCA 2YKOA 3DRPB 2Y1RI 4RWWA 4M5DB 2V67A 3KLIB 2POKA 2E1PA 2EVZA 2I1RA 2DGSA 3H25A 4KO0B 5ETKA 3VVUA 4ZCKA 4YY3J 1RTHA 4GMKA 2W9AA 1YVFA 3W1YC 3OR2A 1J5OA 1BMQB 2OTJS 3QSIA 5C2GA 3A8KA 1KONA 3VV2B 1LW2A 4C0HA 2EFNA 2XLIA 2YNFB 2XMJA 1GX5A 4O3RA 2Z2LA 3QLHA 3CDUA 2WZ1A 3RBDA 3ILOA 3RB3A 2YTCA 4WXOA 1RT7B 3HSZA 1NJXA 2YNIA 4X64F 4WFAQ 2B4VA 1BD6A 3OXGA 4LT6A 1PILA 2DPJA 4K5SA 4TYAA 2GVZB 1QAJA 1E6VB 4ZK7M 1Q95G 1NM2A 3TZXA 2XHWA 1RJJA 3C2PA 3MTJA 4P52A 4L6V3 1HQEA 3TVKA 1WI6A 1T9WA 3HZEA 3MR6A 2J5AA 5KG0A 1S76D 4WJBA 3BYPA 2IRXA 2MTLA 3T5HA 3NY0A 4NLPA 4YB1P 4DV1F 4WKRA 5IT0A 4ZHRB 1QD1A 4GKJF 2NPIA 2EFPA 2XSFA 3W9HA 5E3QA 5KG4A 1HBUB 2HHTA 2V8VA 3KOAA 2DR5A 4FXWA 3NLCA 3GG1A 1N88A 2KHDA 3MPDA 3VGUA 1VQ9S 3HF5A 5KFQA 2OPRB 4DR2F 1S1TA 1FRJA 3NNHA 2FC9A 1AROP 4H4KC 3F73A 1HWUA 4OHVA 4F4YA 2WAQD 2KO1A 2QA1A 5KFMA 3GILA 3KHGA 3GCWP 4DQIA 3R2CJ 3DRRB 4DU7A 2DNKA 4ECVA 5LSLA 1YITS 1N5YB 1WNEA 1RP5A 2EC0A 2RD5C 3G9CA 1C1BA 4D3HA 3K58A 3NRBA 4BWJA 1A9NB 1T03B 4CM0A 1WF1A 2CNNB 1S6QA 2LA6A 4Y65A 1B7YB 1X0FA 3MM7A 5KFUA 2KFNA 3FCHA 1P1TA 1Y3JA 3BM7A 4DI6A 1DJ0A 4CLYA 1V5IB 4PXBA 2ZOFA 4NXNJ 3NNCA 4UUXA 2XY5A 4QWBA 5KFYA 2N3OA 2ZH7A 1T3NA 4F3QA 2RB7A 3DU5A 3JQKA 3ZNJ1 1AFIA 3G8TA 2DBBA 2DHGA 3GG0A 3IBWA 5K8MA 5J2PA 2AZ3A 4RW4B 2MZTA 1ZM9A 5LXYA 4WZMA 4CLLA 2AGPA 2AYEA 2DXFA 1PJ7A 5D8HB 2KDOA 4N8OA 2BRKA 2KRBA 2MZ1A 1LQ9A 4DDFA 1OSCA 2XZDB 1OY8A 3GV8B 3D0GE 1YRXA 3ZO7A 1NRKA 4DSLA 1P9YA 4PYAA 1N34J 3QATA 4OI2A 3SZ2A 4Q7AA 2N7YA 4FPRA 1G6BA 4C3LA 1N5QA 5F3TA 3PHTA 3R27A
chains in the Genus database with same CATH topology
1UCNA 1LEOA 1F3FA 4HR2A 3FBEA 3GP9A 1HLWA 4FKYA 3WX8A 4DI6A 3PJ9A 1PAEX 3BBBA 4DUTA 3B54A 3Q86A 2HVEA 3VGTA 3Q8UA 4FKXA 2HVDA 1NSKL 2B8QA 1B99A 4EK2A 4F36A 1NDLA 1NDCA 3FCWA 1NUEA 4ANCA 4ENOA 4UOGA 1XQIA 2DXDA 3G2XA 1PKUA 2B8PA 3FBCA 1NSPA 2BEFA 1WKLA 3NGRA 2DY9A 4WBFA 3VVUA 3ZTSA 3BBCA 1NDPA 1NLKL 3NGTA 2VU5A 3EMTA 3ZTOA 1U8WA 1NSQA 1K44A 1JXVA 3BH6B 1NDKA 4S0MA 3MPDA 2AZ3A 3L7UA 3FBBA 3ELHA 3Q8VA 3VGUA 3VVTA 1S5ZA 3ETMA 5C7PA 1KDNA 1WKJA 2ZUAA 4UOFA 3EICA 2DYAA 3EVWA 4KPCA 3JS9A 1BHNA 1EHWA 3R9LA 5CABA 2DXFA 3ZTPA 1XIQA 1MN9A 3EE3A 3NGSA 1BUXA 3EVMA 3ZTRA 3Q8YA 1W7WA 3Q83A 3GPAA 1HIYA 3B6BA 3EJMA 3EVOA 1F6TA 1NB2A 1LWXA 1HHQA 1BE4A 3ENAA 3BH7B 1B4SA 3DDIA 5BXIA 2DXEA 4CP5A 3NGUA 3FCVA 1NPKA 3VGVA 4F4AA 2NCKL 5IOLA 3DKDA 3FKBA 4ANDA 2BX6A 2CWKA 3FBFA 4UOHA 3ZTQA 4W98A 1ZS6A 3VGSA 5CAAA 1NHKL 1S59A 3FC9A 4C6AA 1MN7A 3PRVA 1VYAA 1NCLA 3BBFA 2AZ1A 3Q89A 2HURA 4DZ6A 1WKKA 4O0NA 1S57A 4ANEA 3EM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UCN A;  1LEO A;  1F3F A;  4HR2 A;  3FBE A;  3GP9 A;  1HLW A;  4FKY A;  3WX8 A;  4DI6 A;  3PJ9 A;  1PAE X;  3BBB A;  4DUT A;  3B54 A;  3Q86 A;  2HVE A;  3VGT A;  3Q8U A;  4FKX A;  2HVD A;  1NSK L;  2B8Q A;  1B99 A;  4EK2 A;  4F36 A;  1NDL A;  1NDC A;  3FCW A;  1NUE A;  4ANC A;  4ENO A;  4UOG A;  1XQI A;  2DXD A;  3G2X A;  1PKU A;  2B8P A;  3FBC A;  1NSP A;  2BEF A;  1WKL A;  3NGR A;  2DY9 A;  4WBF A;  3VVU A;  3ZTS A;  3BBC A;  1NDP A;  1NLK L;  3NGT A;  2VU5 A;  3EMT A;  3ZTO A;  1U8W A;  1NSQ A;  1K44 A;  1JXV A;  3BH6 B;  1NDK A;  4S0M A;  3MPD A;  2AZ3 A;  3L7U A;  3FBB A;  3ELH A;  3Q8V A;  3VGU A;  3VVT A;  1S5Z A;  3ETM A;  5C7P A;  1KDN A;  1WKJ A;  2ZUA A;  4UOF A;  3EIC A;  2DYA A;  3EVW A;  4KPC A;  3JS9 A;  1BHN A;  1EHW A;  3R9L A;  5CAB A;  2DXF A;  3ZTP A;  1XIQ A;  1MN9 A;  3EE3 A;  3NGS A;  1BUX A;  3EVM A;  3ZTR A;  3Q8Y A;  1W7W A;  3Q83 A;  3GPA A;  1HIY A;  3B6B A;  3EJM A;  3EVO A;  1F6T A;  1NB2 A;  1LWX A;  1HHQ A;  1BE4 A;  3ENA A;  3BH7 B;  1B4S A;  3DDI A;  5BXI A;  2DXE A;  4CP5 A;  3NGU A;  3FCV A;  1NPK A;  3VGV A;  4F4A A;  2NCK L;  5IOL A;  3DKD A;  3FKB A;  4AND A;  2BX6 A;  2CWK A;  3FBF A;  4UOH A;  3ZTQ A;  4W98 A;  1ZS6 A;  3VGS A;  5CAA A;  1NHK L;  1S59 A;  3FC9 A;  4C6A A;  1MN7 A;  3PRV A;  1VYA A;  1NCL A;  3BBF A;  2AZ1 A;  3Q89 A;  2HUR A;  4DZ6 A;  1WKK A;  4O0N A;  1S57 A;  4ANE A;  3EM1 A; 
#chains in the Genus database with same CATH topology
 1UEV A;  1RAH B;  4ED7 A;  1Y5L B;  3Q8U A;  4N41 A;  1RT5 A;  3NBP A;  1GMW D;  4CLU A;  1UVM A;  5KFC A;  3QT8 A;  3SCK E;  1VRT A;  4KKO A;  1E6Y A;  5L1I A;  2V9W A;  1X8D A;  1OQ3 A;  5B09 A;  1K47 A;  3CME S;  2HVZ A;  2MQQ A;  1RE1 B;  1JKH B;  1HBN A;  3MTK A;  2QFI A;  3QID A;  3EVW A;  1NBE B;  4B3R J;  4UST A;  1N54 B;  4LF9 J;  4KJI A;  2AKW B;  2RH3 A;  4NLT A;  1EB0 A;  3CO0 P;  3PKY A;  3BPD A;  3HVT B;  4DR6 F;  1I94 F;  1SJ1 A;  4YN3 B;  4UUW A;  4X4S A;  2MZR A;  1XMQ J;  1MU2 B;  2XSJ B;  1RGV A;  2UV8 A;  3M2V B;  2EXU A;  1VS3 A;  4NRU A;  4B3M F;  1RTD A;  4NLG A;  1F5B A;  3BN4 A;  2LA4 A;  1M5S A;  5H1S V;  2MZQ A;  4DZ6 A;  2MYF A;  1XK8 A;  3VF0 B;  4ANE A;  4QWE A;  1UET A;  2DNY A;  2BQU A;  1BQM B;  2R7V A;  3BKU A;  2HVD A;  2E9R X;  1URN A;  3BQ2 A;  2RIL A;  3Q22 A;  4X65 F;  5HMZ A;  4NYZ A;  1YRT A;  2B5J B;  3RUB L;  3ZZZ A;  1K1Q A;  3NGR A;  4X66 J;  2OEM A;  1T8E A;  3QIP A;  2PFF B;  5DG8 A;  4P2S A;  3JYT B;  1U6F A;  4MTP A;  4DR7 F;  5IWA J;  4HHH A;  2EWH A;  3EXY A;  4LBP A;  2LFV A;  2B7B B;  4WP3 A;  5C7P A;  3KK1 A;  4LF7 J;  3CCS S;  4DV2 J;  2JFD A;  2QLF B;  2EFO A;  3U1L A;  1FKP B;  3EVO A;  4A46 A;  3SEO A;  1NB2 A;  1KEK A;  4MIA A;  3Q8Q B;  4X4V A;  4CLF A;  4NLS A;  3E3X A;  3PEH A;  3N79 A;  1NK0 A;  1HFE L;  4F4K A;  2YKP A;  5I42 A;  5CYJ A;  2LQB A;  3HCX A;  2WVF A;  1FE4 A;  4FVM A;  1NK5 A;  3MUR P;  3DLB A;  1QUV A;  1TKZ A;  1DFD A;  1YZ7 A;  3KUG A;  1IBK F;  1T02 A;  4FKY A;  5M2R A;  2Q3P A;  2A2C A;  2EEY A;  1SJQ A;  4JI6 J;  3FEX B;  2R8J A;  3NCR A;  1I5O B;  4MMO A;  5HVF A;  2Y0S D;  4I2P B;  1SH2 A;  2P9E A;  2ZKT A;  4USM A;  2Y1J A;  3MZI A;  4WU3 A;  3EMT A;  5HP1 A;  1L3K A;  4CLS A;  2KG1 A;  3FBB A;  1WI8 A;  3Q8V A;  5HJX A;  2BZ2 A;  2KFZ A;  2BKP A;  3C15 A;  3PV8 A;  2AP6 A;  2HKE A;  3DDN A;  2QJ3 A;  4E2F B;  5CXT A;  4IQX A;  1YZ6 A;  5HMW A;  2F9J A;  1W2I A;  4XPC A;  3PR4 A;  4DQQ A;  4IFY B;  1YJV A;  2OEJ A;  4DN0 A;  2PFD A;  3DC2 A;  3EGW B;  3FGV A;  1RAD B;  4FF2 A;  3H42 A;  4W98 A;  2LXU A;  2HPU A;  1TL3 A;  4DV4 F;  3I4H X;  2FJW A;  3EDQ B;  3QQC D;  1K0T A;  4GKK J;  2EG1 A;  3GR1 A;  2FLP A;  1N36 F;  4GO5 X;  3M8Z A;  1FDD A;  4WP9 A;  1LWE B;  4DV0 J;  1KLN A;  1Y5I B;  1B3T A;  1VQL S;  3CDW A;  1TVR B;  3FUY A;  4WTO B;  1T9V A;  1FNO A;  4KV8 B;  4NA2 A;  2QGF B;  1GMU A;  4F02 A;  4X4R A;  1FWK A;  1H7X A;  1FVS A;  3BDP A;  2ZWO A;  4Z7C A;  3BGR A;  4KY3 A;  1SUQ A;  2YWF A;  5HBM B;  4I64 A;  4KIA A;  3KNA A;  4C8M A;  3G6E S;  5IT9 U;  4DV7 J;  4OZ3 A;  2ZM6 F;  2GO8 A;  4C8K A;  1U2C A;  1S0N A;  1IJF B;  1WSR A;  4X4O A;  5M2U A;  1KFD A;  3KUE A;  4RWX A;  4H54 A;  3ZXW A;  4L74 A;  1EQM A;  4AXJ A;  1FJE B;  1UVJ A;  2W2O P;  2CZV C;  1P6T A;  3FFI A;  2ASD A;  4K50 A;  5BYS A;  3VGV A;  2KVQ E;  2AV5 A;  3GIR A;  2C42 A;  4USI A;  2UXB J;  1DRZ A;  4NEY A;  4N76 A;  3J80 Y;  3GFH A;  2OJ3 A;  3E51 A;  2YX7 A;  3HHL B;  5ETV A;  4OLP A;  2R7S A;  1NKE A;  3DOM A;  2UUB J;  4LRC A;  3MDF A;  2PMH A;  2EG2 A;  1F3F A;  2WON A;  3FBE A;  3K5L A;  1Y3K A;  4FKX A;  3ONQ A;  2CPE A;  2FHJ D;  2ZVI A;  4Q5V A;  4OZL A;  2CDQ A;  2Y0B B;  2ZE2 A;  4J5O A;  3OFH A;  2VIH A;  3ISN C;  4HI1 A;  4I68 A;  5AE2 A;  4XPE A;  4MK9 A;  3MMC B;  3M32 B;  2KH9 A;  1FK9 A;  1S1U A;  5A2Q Y;  2LQ8 A;  4ED3 A;  1LNQ A;  2HFO A;  3G71 S;  2OH2 A;  1VIO A;  1U24 A;  1ZM4 A;  2GHV C;  2RUS A;  2IC3 B;  4YB7 A;  4DSF A;  1GNK A;  2ZWP A;  2YX4 A;  1WF2 A;  2BA9 A;  2MHN A;  1CVJ A;  5IV3 A;  3Q8Y A;  3M1V B;  1RAF B;  3Q83 A;  4K5R A;  4GRS A;  2VAS A;  2CA9 A;  3V4M A;  2GGP B;  3SXL A;  1UMJ A;  1J5E J;  5T41 A;  1NK7 A;  4W92 B;  2YPY A;  3H5S A;  3L09 A;  2RAQ A;  4URS A;  2G0I A;  1M5V C;  1EET B;  3AXM A;  2CXE A;  3PIP Q;  4Y6I A;  3OR1 A;  1RT3 A;  3PYF A;  4USU A;  4M95 A;  4KB7 A;  1S1V B;  4QJV A;  4ZIT A;  5C25 A;  1QSY A;  3IC1 A;  1YBU A;  2ILY A;  3S01 A;  3HKZ D;  1RWW B;  2VJV A;  1KOO A;  4OX8 A;  1UVN A;  1JIH A;  4QBU A;  4QCL A;  4MKY A;  3DRP A;  4KAI A;  2FZK B;  3N5B A;  3HVA A;  3FBC A;  4M5D A;  3KLI A;  2NXN A;  1VQ4 S;  3EX7 B;  4O3N A;  4KO0 A;  1K73 T;  2JEG A;  1U6Z A;  1FJG F;  2GFF A;  3BPS P;  3V4I A;  2DNR A;  5E3C A;  4H4O A;  3DMJ B;  4B3S F;  1F1B B;  1CJU B;  4Y28 C;  5HL7 Q;  1RWU A;  4A8K A;  3UW1 A;  5A8W B;  4AXI A;  2YNF A;  1K1S A;  1PYO B;  2DNG A;  1QDU B;  4NXN F;  3LP2 B;  2OML A;  4ELU A;  2JX2 A;  2CPD A;  3R8Y A;  1YK9 A;  1AZS B;  1TEL A;  2IVM A;  1X9W A;  1YX2 A;  5K14 A;  2ZNY A;  2VA3 A;  2V2Z A;  4M5J A;  1SKW A;  4U8V A;  2GVZ A;  1E6V A;  3WQP A;  1V6H A;  2CZ4 A;  2AQ4 A;  3M30 B;  2BW7 A;  4ETZ A;  2YNH A;  3TAP A;  3W60 A;  5GMK a;  2KL8 A;  4HL9 A;  1DLO B;  1WHY A;  3T5J A;  1YDL A;  2XS7 A;  3NMA A;  1FJ7 A;  2B4P A;  3SV4 A;  3P4U B;  4D3G A;  2HND B;  4B9M A;  4ZHR A;  1N5T A;  2V4J B;  4LFC F;  1KSP A;  1WHX A;  1PC4 A;  1N34 F;  3KJV B;  5KT6 A;  1HBU A;  1JXV A;  1H98 A;  2ZJP Q;  3ELH A;  1HWK A;  2OSQ A;  1NAQ A;  1TR0 A;  1FO1 A;  3M6U A;  5KFG A;  2HHH F;  3TAM B;  4MFB B;  3V2U C;  4CLT A;  4IOB A;  5KFP A;  2RRN A;  2OPR A;  2MJN A;  2N3L A;  1I1G A;  4NAS A;  3M7V A;  1VRU B;  3VQT A;  1NJY A;  4PRF A;  2HFU A;  4X62 F;  2OUG A;  2BM0 A;  1D1U A;  4DG1 A;  2C2O B;  4Z37 A;  3RW7 A;  2JJ4 D;  3S8S A;  2E1M C;  5D0G A;  2ZFH A;  3GLJ A;  1T03 A;  4QYZ J;  3KLG B;  1JLB B;  1U8S A;  3AOB A;  4F26 A;  3FVY A;  1UWB B;  3PRB A;  5CH7 B;  4DCJ B;  4J9P A;  2HQ3 A;  2HBY B;  1CG2 A;  4NZ7 A;  2ZH9 A;  1YKW A;  1PKU A;  3CCE S;  1RBL A;  2EI5 A;  2JFK A;  5K20 B;  1RCO B;  1KHV A;  4N5S A;  4K4X A;  3ZZY A;  4PXE A;  3S1T A;  2HFZ A;  2Z2Y B;  4F3O A;  2XG8 A;  4DPY A;  4OI0 A;  2W8L A;  4LRB A;  1UPP A;  3Q24 A;  3NGS A;  3R97 A;  1T9T A;  3MEK A;  3KK2 A;  2DGW A;  3JTP A;  2UUC J;  2BE2 B;  2W1B A;  3LGH A;  5CYQ B;  3LWL A;  4FYX B;  1P27 B;  1LKZ A;  3U1N A;  1WEX A;  4LF6 J;  4Q2M A;  4B3T J;  4XAK A;  5DRK A;  3M4X A;  1ZA1 B;  4OYZ A;  4RW7 A;  3BJY A;  2MB0 B;  1D09 B;  2BR0 A;  2QEX S;  3OTO J;  5IS2 A;  4DXL A;  4JI5 J;  2H5J B;  3UD5 A;  1J27 A;  1IKW A;  2MLY A;  4OJG A;  5DQG A;  4LF7 F;  2F4V F;  1HNI B;  1QUP A;  4DV2 F;  4A8F A;  1PG5 B;  1CUL A;  1SC1 B;  1W25 A;  4PG6 A;  3R5D A;  3PR5 B;  5FLX Y;  4LF4 J;  3T6J A;  3HK2 A;  2XHC A;  4JV0 A;  2MKI A;  4HEA 9;  2XB2 D;  4DL2 A;  1M1K T;  4EU0 A;  3I6P A;  1IM6 A;  4ELV A;  2CPZ A;  1F5A A;  3N6M A;  5K8N A;  1HWJ A;  2RRB A;  1KHW A;  2ZZM A;  2VKZ G;  1D8Y A;  4ZIW A;  1S7H A;  4NPO A;  1QSS A;  3HHD A;  3W3S A;  1QE1 A;  2KHC A;  1FKO A;  1JKH A;  4KE5 A;  4YUD A;  3CDE A;  4LIW A;  3SQG B;  3K8W A;  2HZA A;  1A0O B;  4JI6 F;  2GIQ A;  5KT3 A;  5AXM A;  2I6W A;  4MH8 A;  2OGU A;  3TZY A;  4YHH J;  2UUA J;  4FF1 A;  1EP4 A;  2VHG A;  4KFB A;  1S10 A;  2J0X A;  3T1H J;  3AD8 C;  1S9E A;  2CAD A;  4DOZ A;  4OZ2 A;  4JV1 A;  5KFN A;  4PQU B;  1HNZ J;  4FVC A;  1QAY A;  3M2V A;  4C3K A;  3A3O B;  2Z2Z A;  2RS8 A;  5T14 A;  2D3U A;  3UCU P;  2XQC A;  2A0F B;  6FDR A;  2HQC A;  2X1A A;  2I9S A;  4MYU A;  3M8Y A;  4PZV A;  4B9N A;  2YBV A;  1Z2Z A;  2XCP A;  2XUL A;  2NZ4 A;  3AD9 C;  1BQM A;  1Q4R A;  3TI0 A;  2B8P A;  4J9O A;  1LWF B;  2C3P A;  3R5G A;  2PEH A;  2DPI A;  2A2D A;  3L7U A;  1PSD A;  3JYT A;  4J7C A;  3WIV A;  2GW8 A;  3W5X A;  2XC9 A;  4CO2 A;  1K9M T;  4LVN P;  1UAW A;  1IKX A;  1XMB A;  1VMB A;  4DV0 F;  2IRU A;  3ZTR A;  3MFI A;  2B6A B;  1VQP S;  2BM1 A;  2ZD1 B;  4F3M A;  1B7F A;  5DM7 Q;  1FKP A;  3QGG A;  3DDI A;  2UZA A;  5BXI A;  3I55 S;  2RDI A;  1U7L A;  1R8B A;  2WVE A;  2FJX A;  5F8N A;  1M5P C;  2JL9 A;  3TA0 A;  4F4Z A;  5L38 A;  2MEW A;  1EAR A;  2VJU A;  1SL0 A;  1S7I A;  3K0J A;  3IWX A;  1TP7 A;  3HKW A;  2FQQ B;  4FDF A;  3EDR B;  3W5Z A;  1TKT B;  1TFY A;  5CD4 A;  1NDC A;  4I7F A;  4I2Q A;  1KNZ A;  2Z57 B;  3L3C A;  4EUV A;  5AE3 A;  4AFF A;  2J7K A;  3DN9 A;  3A1Y G;  2HVH A;  4BS2 A;  1TQL A;  5KAK A;  3GON A;  4JB8 B;  2V50 A;  4A48 A;  4M94 A;  1C4C A;  4MYT A;  3SV3 A;  2MZJ A;  1RHJ B;  5DS7 A;  3VAG A;  4B9U A;  2IMW P;  1SIW B;  2UUB F;  1BQN B;  2GJI A;  3LP0 B;  3ZZO A;  2YQ1 A;  3DRY A;  1Z2L A;  4OYO A;  2IJN A;  4EI2 A;  2WHO A;  2E5J A;  2XLK A;  3KG4 A;  3R1H A;  4IFY A;  3CT9 A;  3IN5 A;  5JJB A;  4EEY A;  1RHM B;  2XYP B;  3PFO A;  2G2Y A;  2QLB B;  4WYW A;  5A8K A;  2F8H A;  1SI9 A;  4Q8E A;  4KHP J;  1TZ0 A;  3SCJ E;  2HS3 A;  1RYS A;  3LAM A;  3MR3 A;  3QGP A;  4WCE Q;  1VQS A;  4PG5 A;  1X4F A;  2PMW A;  2RQK A;  5F8H A;  2F5G A;  4K0K J;  3RB4 A;  1U1P A;  3MGJ A;  2M8D B;  1LWE A;  4G1I A;  2VPZ B;  3QRP A;  2X51 A;  3FCW A;  4BDP A;  4DUZ J;  1DY3 A;  1TVR A;  4QWA A;  3W8P A;  4KV8 A;  2AGO A;  2CQP A;  4M5N A;  4RLE A;  2F3J A;  2CKW A;  3OPK A;  3HI9 A;  1VQY A;  1FRH A;  2ILZ A;  5ETQ A;  2VBZ A;  4IYQ A;  5G0R B;  2D7S A;  1RWP B;  3GFZ A;  5DJB A;  3QFW A;  2CQ2 A;  1G4C A;  2PA3 A;  3MEC B;  4B9L A;  1DAX A;  1U1M A;  1U26 A;  2HS4 A;  4B3O B;  2NQP A;  4C4W A;  1YBA A;  3N4W A;  1QLN A;  5D4P A;  2CQ4 A;  5F3Z A;  3BQ1 A;  3BR8 A;  1PBU A;  3KMS A;  4IG0 B;  3KLF B;  5E2Q A;  2F9D A;  2RF2 A;  3HHL A;  4ECW A;  4M1K A;  1WG4 A;  2PMZ D;  4J9R A;  2FVC A;  1VIS A;  3FEZ A;  2NXJ A;  4R0E A;  5GAH U;  5FJ4 A;  2LDY A;  4RNH A;  3UFC X;  2QX0 A;  2XMU A;  2MQN A;  4N77 A;  5BJR A;  1HNV B;  2WB1 D;  4IRK A;  4J9Q A;  3MMC A;  2ZEJ A;  3Q8P B;  1SC3 B;  3I0S B;  3HJF A;  5DQH A;  2CNK B;  2IVF B;  2E5I A;  3C14 A;  4J91 A;  4ZP7 A;  3JTO A;  4OL8 A;  1ZM2 A;  1V3Z A;  3PYD A;  3MMA B;  2UU9 J;  2DVI A;  2BAC A;  3IAM 9;  4Z7Y A;  2IM0 A;  1X0P A;  9RUB A;  2MGZ A;  2OPS A;  1REG X;  1FES A;  3M1V A;  2K7K A;  2GGP A;  3DI6 B;  3FKB A;  3H5U A;  2D74 B;  4N47 A;  2CG8 A;  4ITS A;  1RT4 B;  4X4P A;  3I0R A;  3BF4 A;  1UJ6 A;  4ZVR B;  4ELT A;  3AB2 B;  3I5C A;  3HHK A;  2IFX A;  1HMV B;  2D9P A;  1OMS A;  3MAQ A;  2O5D A;  4XK8 C;  5IM0 B;  1S1V A;  1HYS B;  2VPW B;  3QWU A;  3MOJ B;  3AXK A;  1CBK A;  4EFA C;  3M2U B;  3V6H A;  1N0V C;  2QIF A;  1OPI A;  2RIJ A;  2JH3 A;  4P10 A;  2QL7 B;  3LGM A;  3N6N A;  3CD7 A;  2GNK A;  3M6V A;  3R1L A;  2DNM A;  1HBO B;  1O51 A;  1OJ4 A;  1RI7 A;  2R7W A;  4YR2 A;  3RU0 A;  4L76 A;  4PEO A;  3DMJ A;  3AFG A;  1FDB A;  3PJW A;  3Q2T C;  2FGC A;  4X4T A;  4EYH B;  4IO1 A;  3FZB A;  2HBQ B;  1G3O A;  1CJT B;  2L9W A;  2BJ7 A;  4GVB B;  2K1R B;  3DOL A;  1X5O A;  2DHH A;  4LMZ A;  4IDK A;  1U45 A;  1AZS A;  1LW0 A;  3SBM A;  2H9Z A;  3QJP A;  1VGY A;  2K8G A;  1JWW A;  4ZP9 A;  2DNO A;  3I9V 9;  1SV5 A;  3CMA S;  3EZU A;  1ZTW A;  4J9U E;  2A10 A;  3M30 A;  1S0O A;  2ABY A;  1FRM A;  5A0Y A;  2DNQ A;  1C0T B;  2NSC A;  3UWT A;  4Q45 A;  4A8O A;  2UUC F;  3MPY A;  5F8J A;  1TL7 A;  4Y34 A;  3ZTS A;  3P45 B;  4CLZ A;  1U8W A;  2HND A;  2RDD A;  4CLW A;  1KVK A;  2V4J A;  3HVW A;  4OHY A;  2QG9 B;  2QSW A;  3UN2 A;  2LKZ A;  4FF3 A;  3VVT A;  2BQ3 A;  3OTO F;  4MJK A;  4I69 A;  1Q16 B;  3KKF A;  5DLG A;  5ETO A;  2XMV A;  2D3O R;  2PEB A;  5B0D A;  3TAM A;  3AQO A;  4MFB A;  3D6M B;  4KGX B;  3J7Y U;  1JLA B;  1NZ8 A;  4OJ3 A;  4YS2 A;  3RBE A;  5H9E J;  3DGP B;  2XMW A;  1Z1Z A;  4CT9 A;  3BKT A;  5GAE I;  4LF4 F;  3FEY B;  4P71 A;  1X9M A;  3M8Q A;  4R8U B;  5AE1 A;  3B8H A;  2H51 B;  2QLX A;  1ITP A;  5D15 A;  2SXL A;  3OJU A;  2ZH6 A;  2HYI B;  1WTB A;  2Y1I A;  3S6E A;  3EGV A;  4PWU A;  4KGV B;  3KTQ A;  2DRA A;  1WOO A;  5FDL B;  1JLB A;  1GFW B;  2WVC A;  2XZT B;  5KFI A;  1RK8 A;  5F0W A;  1NB7 A;  4LR9 A;  4QR0 A;  2Q66 A;  1UW4 A;  5E7O B;  1G7C B;  2W2M P;  1EJ7 L;  2IAJ B;  1VFJ A;  2E5L J;  1BC6 A;  2IA6 A;  4ID5 A;  2LMI A;  3E8O A;  1MN9 A;  1JLC B;  1T3O A;  3J7Z T;  1JLQ A;  2HZV A;  3SSS A;  4F0H A;  2B56 A;  3LPE A;  2RE1 A;  4DV6 J;  1H6K X;  3K8V A;  1BE4 A;  4JI4 J;  4ECU A;  2IBK A;  3DM2 A;  1UVI A;  2BE2 A;  4OYW A;  3KK3 B;  4DN9 A;  5KFE A;  5CYQ A;  1VQK S;  5K8O A;  1XNQ F;  2RHS B;  3DXB A;  1R27 B;  3CW2 C;  4JI0 F;  4K4Y A;  2R2U A;  1WDD A;  3OT9 A;  4F2R A;  4AQY F;  4IH6 A;  3CCR S;  3A8J A;  1CLF A;  4EK2 A;  3AQP A;  5AXL A;  4RUC A;  4MIW A;  5JUM A;  1TU0 B;  1SB6 A;  2B43 A;  5D77 A;  4YFU A;  4IUF A;  4LF2 A;  1YG0 A;  2Y3Y A;  3CE8 A;  2DHS A;  3WHI A;  2UVV A;  3DGV A;  5E5N A;  3CTR A;  3N5F A;  1O0P A;  4ILR A;  3TYT A;  3T5K A;  2C22 A;  1IWA A;  4J9L A;  3IS9 A;  1FNX H;  4DQS A;  4UZB A;  3H2L A;  3J7Z 5;  3NNA A;  2AW0 A;  1KTQ A;  5F9N A;  3SFG A;  5GME A;  3W2V B;  4I67 A;  5IOL A;  2MXY A;  1JXL A;  3SDE B;  4IH7 A;  3R7N B;  3HHN B;  4HH1 A;  2LDI A;  3RYL A;  3JAM Y;  5DDO C;  1PGZ A;  2GZO A;  3DXS X;  2W9B B;  3PRV A;  4F67 A;  4PQU A;  5IQ6 A;  4F0K A;  2LU1 A;  4C8L A;  3DOK B;  2YKM B;  3EM1 A;  1NO8 A;  1XR7 A;  3KJN B;  4PXD A;  5KT2 A;  2ZUG A;  1YJR A;  3TUJ C;  4IOC Q;  1PIE A;  3GQC A;  3U7J A;  4ZCM A;  2ATL A;  2BEF A;  3UQS A;  3ENQ A;  3UVJ B;  2E66 A;  2CQ0 A;  4IQM A;  2MQM A;  3KHR A;  4J9V A;  2R7R A;  2AU0 A;  2RHQ B;  2X7I A;  4KHM A;  2HHQ A;  1QSL A;  4C11 B;  1SJ3 P;  2CG4 A;  2CQH A;  4YEA A;  2W7O A;  3T19 A;  4ZVO B;  2IYG A;  2F4F A;  1NZA A;  5M2P A;  1EQ0 A;  1C1C A;  2ACM A;  3W2W B;  4K0K F;  2ZOM A;  1TKD A;  1S49 A;  3M9N B;  1U2R A;  4DR1 J;  2Q1L A;  5SZT A;  4J9M A;  2ATC B;  2Q6B A;  1ZPV A;  1U02 A;  1ZS6 A;  3KLE B;  4ZPA A;  4DL4 A;  2M2B A;  4JP8 A;  3EXC X;  3FNN A;  2BAB A;  4TNO A;  1ZH5 A;  2RU9 A;  3P49 B;  1REV B;  2A1B A;  3VAJ A;  1FEE A;  1Q5Y A;  3PJ9 A;  3B54 A;  1WC1 A;  3TA1 A;  2C2K B;  1ULR A;  4HVZ A;  1JLG B;  4CRJ A;  1TAQ A;  2C1E B;  5MAO A;  1PAU B;  3HO1 A;  1ZAV A;  4N7T A;  2FVP A;  3A8I A;  2DGQ A;  1C4A A;  4RL1 A;  2LVW A;  4OMF G;  1DTT B;  4OZ5 A;  1FWL A;  3DNC A;  1OWX A;  3DFE A;  3T6B A;  3KWM A;  4PG7 A;  2F63 A;  4F50 A;  3ADA C;  2BQR A;  1X4G A;  1KQF B;  2PD1 A;  2YY3 A;  4OYB A;  1QTN B;  3MOZ A;  4RNF A;  3MUV P;  2J9D E;  4HDH A;  4WZQ A;  2CQG A;  3CWJ A;  2BJ1 A;  1FI4 A;  2OP5 A;  4CP5 A;  2HHX A;  1KC8 T;  3M8R A;  4ECZ A;  2NSB A;  1G2E A;  5ETR A;  3PIO Q;  2QA4 G;  2VZ9 A;  4ZN1 A;  1RHU B;  2ALZ A;  2IHR 1;  1ICE B;  1T11 A;  2V34 A;  1IBM J;  3DLH A;  2BMB A;  4ZA1 A;  2L48 A;  3VR1 A;  2PI5 A;  2CQC A;  4RBV A;  1NPP A;  4TXS A;  1OO0 B;  1H0H B;  4YDD B;  1UFK A;  2UUW A;  1YBT A;  3BSA A;  1RTJ A;  2G1D A;  1VBK A;  2J0S D;  3A3P B;  2V2K A;  2OPQ B;  8RUC A;  5MLC V;  3HFZ B;  5C24 A;  4RW8 B;  2L9D A;  4JOU A;  2KT5 A;  3NG8 A;  2G4B A;  3I4P A;  2CFX A;  3MM6 B;  2KZZ A;  1H38 A;  4KH0 B;  2M9K A;  1NJI T;  3PZP A;  4IO9 Q;  4LSL B;  1S0V A;  2A6O A;  4OZN A;  2ZDO A;  2J8A A;  1IBL F;  1ROF A;  5HVG A;  1OYE A;  2RJZ A;  4OYP A;  2YX1 A;  1RAB B;  3DLE A;  2F40 A;  2DTJ A;  5CYM B;  3G4S S;  4B3O A;  2AYB A;  2HFS A;  4ZPC A;  4OI1 A;  1TTH B;  2RKI A;  2XYH B;  2Z58 B;  1FEH A;  1N6Q B;  2KM8 B;  1FTC A;  4CO0 A;  1RAO A;  1AB8 A;  4JYA J;  4ZPW R;  1S9F A;  4IG0 A;  3TZW A;  1BY9 A;  5JXS A;  2ZBI A;  4AL6 A;  1NH7 A;  4HT5 A;  4IFV B;  1SC4 B;  1MNE A;  3AH6 A;  1RXO B;  4CI0 B;  3NGD A;  4GC7 A;  3PW2 A;  3NOC A;  4NXM F;  4MKV A;  4I4B A;  3V6D A;  1S6O A;  3AY0 A;  3T9Z A;  3ENV A;  4JUZ A;  1VQ6 S;  1WOS A;  3CNQ P;  2ZHB A;  2ZBC A;  4RNO A;  1HNV A;  3DRX A;  3BSN A;  3JS9 A;  2IBO A;  3TWZ A;  2HFV A;  3Q23 A;  2W9C A;  4YR0 A;  1H73 A;  2J9C A;  3CCQ S;  2W7P A;  1ZAW A;  1T95 A;  1HIY A;  3B6B A;  2Y8W A;  2EPI A;  3O2I A;  4QYZ K;  3V6K A;  1IXK A;  1LV5 A;  1OY6 A;  4FYY B;  3K59 A;  3IG1 A;  2VOP A;  3IBF B;  5KG3 A;  1X4C A;  3DLG A;  3MCO A;  3MM5 B;  1RT4 A;  4USH A;  3B82 A;  3VQS A;  3TP2 A;  2YH1 A;  1VI7 A;  3GR0 A;  1HHT P;  2GML A;  3WX8 A;  4EO6 A;  3QPI A;  2XO6 A;  3MR7 A;  3Q86 A;  1LWC A;  5K9F A;  1KP6 A;  3CD6 S;  1SPB P;  3HT0 A;  2QMW A;  3N01 A;  2JLE A;  1NLK L;  1N5V A;  1RTZ A;  3R5C A;  2VU5 A;  4IRD A;  3TUP A;  3M2U A;  1Y4Z B;  1LXN A;  3CCW A;  3CCZ A;  4DR4 F;  2FY1 A;  3WX4 A;  4KGK A;  4G1P A;  1PYT A;  1TK8 A;  5BR8 J;  3F0N A;  1JLF A;  1QM9 A;  2VA2 A;  2RUG A;  4PCQ A;  5L1J A;  3MEG A;  1HBM A;  4QOT A;  4LFB J;  2E7X A;  1R0A A;  4ID8 A;  2R2T A;  3ZZR A;  1VHI A;  2VG6 B;  2C3U A;  5E3P A;  4F4W A;  5IC6 B;  1Q8K A;  3GSI A;  1CJT A;  3LGN A;  4FBT A;  4WFY A;  1MWY A;  4GVB A;  2E1A A;  1VQ8 S;  3J7A N;  4NYO A;  2V8D A;  3TUZ C;  1SCJ B;  1S97 A;  1D9D A;  1CJK A;  1WC5 A;  3O6Q A;  2OAU A;  3B78 A;  2N4D A;  2KT2 A;  2U1A A;  3LO3 A;  1FF2 A;  5LT5 A;  3RG6 A;  3TAR A;  1CJV B;  1C0T A;  1T9Y A;  5DO2 A;  3A12 A;  3MWB A;  4P72 A;  4CDI A;  1EKR A;  3NXZ A;  3SSR A;  2M4M A;  4IR9 A;  1IM4 A;  1I3O B;  3TOQ A;  3NAI A;  3FSY A;  4CO1 A;  3HXM A;  1TFW A;  4TY8 B;  2MJU A;  2FZC B;  4P6Q A;  1V5V A;  4FYW B;  4J37 A;  1HR0 J;  3TJ9 A;  1JLA A;  3D67 A;  2XNR A;  4MK7 A;  5K8P A;  2JNJ A;  4RKU C;  3HDS A;  1DTQ B;  2X3G A;  4R8U A;  1WTF A;  4IG3 A;  2AZ1 A;  3PG9 A;  2GC8 A;  3DHX A;  4AD6 A;  4JI1 J;  3HSG A;  1U4B A;  2XNQ A;  1MG7 A;  2BYC A;  3AAW B;  4C48 A;  4ZS6 A;  5IC4 B;  2OFG X;  2GO9 A;  1FX4 A;  1U1K A;  1SKU B;  4NRT A;  4XDC A;  4DV5 J;  2B9X A;  2W01 A;  3TA2 A;  1CC8 A;  5J2N B;  4ZVS B;  1WG1 A;  2RVJ A;  3WC2 A;  2XWY A;  4LBI A;  5KG1 A;  4ES2 A;  2IAJ A;  4LFA J;  2BOA A;  1CEZ A;  4R5P B;  3G87 A;  9ATC B;  2APO A;  1HA1 A;  4OJH A;  3GJT B;  2EFQ A;  2LXI A;  1VR6 A;  3GU0 A;  1JLC A;  3CJK A;  4F7V A;  3PFE A;  1UVL A;  3CJ5 A;  4IOA Q;  3UDC A;  2YWG A;  3IO1 A;  3D9B A;  2ASJ A;  3UR3 C;  5KT7 A;  2FJD B;  4L3K A;  1RWK B;  4UW2 A;  4K4S A;  3KK3 A;  2UXC F;  2E7V A;  2VPY B;  1RBO B;  1N8R T;  4HR2 A;  4ZVU B;  4OV1 A;  1H7W A;  3JQM A;  4NL5 A;  2J9D A;  2VG5 A;  4RW6 B;  3C6U A;  1Q7L B;  4NE9 C;  2MQ8 A;  1NSK L;  5CZV A;  2IPO B;  4BBY A;  3E01 A;  2GHP A;  4ANC A;  1L3U A;  4K7Q A;  4Y2K A;  1XQI A;  4RO0 A;  1NHU A;  4O44 A;  2RRA A;  1XWL A;  2AJQ A;  3EYZ A;  1UVK A;  3N28 A;  3TRG A;  2NXE A;  1TMJ A;  2BAN B;  2E1R A;  3W63 A;  3TVZ A;  3RR7 A;  4ZVH A;  5CAB A;  1VK3 A;  4DQP A;  3G82 A;  3O8W A;  3R7B B;  1F60 B;  1FER A;  3QRR A;  2OIH A;  4DX8 H;  4CYU B;  1P8G A;  2R2S A;  3TAN A;  4CO4 A;  4AT1 B;  4C97 A;  5ETS A;  5ETN A;  2VG7 B;  4A4J A;  2EKY A;  2IA0 A;  1MRO A;  3BO4 A;  1X4E A;  3I32 A;  1R8A A;  3SDE A;  1CQN A;  4UQG A;  3FK4 A;  3OVS A;  4V19 J;  2AJ0 A;  4RU9 A;  1Q7Y T;  4CTA B;  2DGU A;  2ZNZ A;  4M5M A;  3IRX A;  4CNY A;  1S72 S;  2M0G B;  1IKV B;  4RW9 B;  2HGM A;  4PUO B;  1Y11 A;  3KLH A;  1S0M A;  1WOR A;  3B4D A;  2AX0 A;  3R5A A;  3MMB B;  2DGT A;  4X4Q A;  2FVQ A;  4P73 A;  5J2Q A;  3KUH A;  3H98 A;  3K57 A;  4DSE A;  2YNG A;  5B7W A;  5FII A;  1WKJ A;  4C11 A;  3T1A A;  1F0X A;  2MLZ A;  2VC1 A;  4PQA A;  1XMO J;  4DFM A;  4ES3 A;  2O67 A;  1FRI A;  1M5H A;  3MCS A;  4DHV A;  3POT B;  2W2P P;  3QYY A;  1KLM B;  2RT3 A;  4LF8 F;  2VC0 A;  3D2W A;  2KI2 A;  1NPK A;  4NLO A;  1X9S A;  1X5P A;  4JI7 F;  3RAX A;  5KFA A;  3VGS A;  5CAA A;  2UP1 A;  1SBR A;  1ZZF A;  3LP1 B;  5KFD A;  1VYA A;  4WE1 A;  5K5M A;  1JX4 A;  3DRS A;  3TQ1 A;  4CO3 A;  3BO2 A;  1Q5V A;  2IM2 A;  1SL2 A;  4QPT A;  4RZR A;  4K4V A;  4CZC A;  4NLD A;  1JLG A;  3CDA A;  3CVK A;  3JXO A;  4DPO A;  2IJR A;  4G65 A;  4F2S A;  3BH6 B;  2HW3 A;  4FS2 A;  1IN0 A;  4ZOS A;  2D3Z A;  1DTT A;  1L3S A;  3OJS A;  2JC1 A;  3OR2 B;  2R7O A;  1JJC B;  1RT1 A;  4DL6 A;  4M5I A;  2ZH8 A;  4JV5 J;  2AHO B;  3OHA A;  1LW2 B;  4EYI B;  1TUW A;  3KXD A;  4QR1 A;  3PX0 A;  4NA1 A;  1RLC L;  4CLP A;  4PKD B;  1U1L A;  1IR0 A;  2YNI B;  2PN6 A;  3J80 U;  1XER A;  1U0H B;  4USV A;  1HNX J;  2HNY B;  4AL5 A;  3HHL D;  1U09 A;  3TW0 A;  3T1Y J;  4ED0 A;  3K5P A;  4DUT A;  2R3V A;  2P6S A;  3C16 A;  1HQE B;  1CS4 A;  2FHM A;  3AA9 A;  3W9I A;  3VZI A;  4XDD A;  3FMB A;  3NCQ A;  3QT5 A;  1RA6 A;  2JEF A;  1UZH A;  3ZTO A;  4N56 A;  4LF5 J;  4QIG A;  1FT8 A;  4DPX A;  1R6V A;  2AT1 B;  1WAC A;  3CPW R;  2WW8 A;  2OPQ A;  1VRQ C;  3OXL A;  4JBC A;  3FRY A;  1VJW A;  5LMN J;  3CCM S;  4XTT A;  2DH9 A;  3K5M A;  3M6X A;  3MM6 A;  4C0B A;  2X1G A;  1AA1 B;  1D9F A;  4CQ1 A;  5EX3 A;  4BLG A;  1GTH A;  4G3I A;  2LLZ A;  4CT8 A;  2LEP A;  1RUS A;  2CJB A;  2Z4P A;  3CCV S;  4BC9 A;  1B0P A;  3MHY A;  2XZW A;  3D7S B;  2P5V A;  5CYM A;  1KRP A;  2EBG A;  2BJD A;  2MKK A;  1LEO A;  3IA0 A;  5J1N A;  3OQ2 A;  1RKJ A;  4WFN Q;  2BBE A;  5GVQ A;  2W8K A;  1ELO A;  1R43 A;  1HAR A;  2C2D A;  5EWG A;  1K0V A;  3PW0 A;  4LFB F;  3OL8 A;  4RX6 A;  1Q8L A;  3MM7 B;  1U49 A;  5G4D A;  4BWM A;  3J7A 1;  1NDP A;  3PW7 A;  2Y8Y A;  3GJQ B;  2BJ8 A;  2V5H G;  1KFS A;  5H9E K;  4WK1 A;  3KDN A;  4X64 J;  4OHZ A;  4J9N A;  1BGX T;  5F8M A;  2HQF A;  1FWP A;  5HLF A;  3ZC4 A;  2YKN A;  1Q8I A;  2VV5 A;  5F8L A;  3RR8 A;  2UVU A;  3VZH A;  3J81 j;  5CCL A;  1N0U A;  3BSO A;  2UUT A;  2C3Y A;  1L3T A;  1EIY B;  4NZ6 A;  1XNR F;  1M1H A;  4ETX A;  2ZZN A;  1S6P A;  4NLX A;  3OV7 A;  2M70 A;  4ED4 A;  3AJ1 A;  4GKJ J;  1VJQ A;  4TQS A;  4O0I A;  2KYX A;  4YB5 A;  5DDQ C;  2OI2 A;  3BBF A;  2WTF A;  1ZM3 A;  5KG7 A;  3MXH P;  1MLA A;  1S1W A;  4DL5 A;  4OZJ A;  1N33 F;  1WC6 A;  3PJX A;  3FSI A;  5D4O A;  2BXJ A;  1HNW F;  3AOD A;  2EK6 A;  4JI3 F;  2CQI A;  1U25 A;  3MR2 A;  3RB0 A;  1HR0 F;  1T05 B;  4DFP A;  3NBP B;  4P7V A;  1HPZ B;  3AD7 C;  4FPI A;  3K89 A;  4QU7 A;  2H3E B;  4JI8 J;  2VOO A;  2KZM A;  1NDK A;  3IRW P;  1FCA A;  1VRT B;  4DUY F;  1LOU A;  4P74 A;  3TNV A;  2X1F A;  1ZA2 B;  2JVO A;  2R8G A;  3M2R A;  4E0D A;  3QZ7 A;  3PX4 A;  4URQ U;  1R6Y A;  3K17 A;  3LUY A;  3DLL Q;  4O3O A;  2B3T B;  4KGM A;  1KVJ A;  2VG6 A;  4DR5 F;  3W7B A;  2ASY A;  4KTQ A;  1UP1 A;  4R25 A;  5IZH A;  2KFY A;  3I56 S;  3PTW A;  2K7J A;  3DYA B;  3CCL S;  2F8E X;  3PNI A;  2GVD A;  3GP9 A;  1RTD B;  2B4U A;  4HAC B;  2XO7 A;  2FY8 A;  3V81 A;  4P2M A;  3CC4 S;  4CH1 A;  1FFW B;  1OQ6 A;  3OL7 A;  1LK7 A;  5GAD I;  1RAA B;  4DV3 F;  3THT A;  3O5T B;  2XCA A;  4KSE B;  2Z56 B;  2RDJ A;  2B0G A;  2FHO B;  3JSY A;  4NLU A;  3CJR A;  3JSM A;  3OVB A;  2X3D A;  2FLN A;  2QA2 A;  2C3O A;  2J7W A;  4YY3 F;  1HW9 A;  3EE3 A;  1S1X B;  3RAM A;  4DQR A;  1NKC A;  1ZOT A;  3L95 X;  2YKQ A;  3ITH A;  5HN0 A;  2AF6 A;  2ASL A;  4ED2 A;  1NPR A;  3QFH A;  2VKR A;  3O44 A;  4OZ0 A;  2DNL A;  2R8H A;  4OI3 A;  2UXD J;  3GV5 B;  4L75 A;  2WBM A;  1FDA A;  4ZP8 A;  3LTO A;  2HS0 A;  4QIW D;  3L9Z A;  3IWL A;  1Q81 T;  1TUG B;  1URR A;  4NLW A;  2OPP A;  5I42 B;  4FXV A;  1UW9 A;  1DAR A;  4I6Y A;  2E5H A;  4QIF A;  3THV A;  1FRX A;  3ZZ0 A;  4HTI A;  2MKJ A;  4C8O A;  3J81 U;  2BE9 B;  1SH3 A;  3Q2S C;  1KS2 A;  3ZZT A;  1VC6 A;  2KKH A;  1ZBT A;  3NGT A;  3PYE A;  1C0U A;  1K44 A;  1KBR A;  2X1B A;  4O3P A;  4DR6 J;  2GCF A;  1H3D A;  4HT7 A;  3FQK A;  4UOF A;  5J2N A;  3GSD A;  3L4B C;  5HP1 B;  3H90 A;  2CPY A;  1X5T A;  3DDK A;  3D28 A;  3C15 B;  1CSJ A;  3OSN A;  3OSP A;  2FDN A;  2AWZ A;  1W26 A;  3PAC A;  3AA8 A;  4DL3 A;  3GYN A;  1NHK L;  2J6S A;  1N32 J;  4PAB A;  3HSD A;  3MAA B;  4X2B A;  2Z30 B;  1RAI B;  2DR9 A;  3CXC R;  3FQL A;  4X4N A;  1TL3 B;  4DR7 J;  3GWC A;  3R5B A;  2CDR B;  1XMO F;  4ZCL A;  2CQ1 A;  5D4N A;  3WZ0 A;  3S7R A;  2MQL A;  4FBU A;  1AXQ A;  4EBC A;  1GMV A;  4V19 X;  4ICL B;  2CJA A;  4RU2 A;  3HLU A;  5KG6 A;  3CO9 A;  4UF4 A;  3CDB A;  4ILL A;  3FMW A;  2JWN A;  4ALZ A;  2WVB A;  3PO5 A;  4PYD A;  2DGV A;  3BGR B;  3JSB A;  5EDW A;  1RT7 A;  1SUQ B;  5IXU A;  5JVG Q;  2CJQ A;  3IM9 A;  2FHK A;  3TO8 A;  5J1E B;  5L9N A;  3VWS A;  4WK3 A;  3D1O A;  1VQO S;  2HNZ B;  3PY8 A;  2HIY A;  3NS5 A;  3M8P B;  1VC5 A;  4KRW A;  1IBK J;  2DXE A;  3T5L A;  3NGU A;  4CYU A;  5DDP C;  5DG9 A;  4KPY A;  1JJH A;  5SUH A;  3FFI B;  4C8Y A;  1UFL A;  1MMN A;  2VG7 A;  4DU8 A;  3ET6 B;  4BCA A;  5EGY A;  1RDR A;  3RRH A;  5ETP A;  1UWA A;  2HHU A;  3KG0 A;  1HL6 A;  3BBB A;  3OLA A;  5LSR A;  2I8E A;  5IFM A;  4O3S A;  4CH7 A;  2WON B;  3UCZ P;  1IKV A;  4RW9 A;  1TMM A;  2VDH A;  1O8B A;  3OHB A;  4C98 A;  2CWX A;  1NH8 A;  5JMN A;  3GYX B;  2ZZT A;  4O23 A;  1QY7 A;  2ZE2 B;  4OI4 A;  2KB2 A;  3MD3 A;  4H4K A;  3L7P A;  4O3Q A;  1Y9O A;  1V9O A;  1S1U B;  4W4M A;  4DV4 J;  2GJ2 A;  3DRR A;  2XMK A;  2G9O A;  3AT1 B;  1N5Y A;  4Y2A A;  2AYG A;  4U96 A;  3ZZU A;  2JDJ A;  1N36 J;  2ZOG A;  4CLK A;  3POT A;  5CZX A;  3ZFV A;  4B3R F;  3P6Y C;  4UOH A;  2PT0 A;  4LF9 F;  2MMY A;  3CD5 A;  3F41 A;  3CED A;  2BJE A;  2ZH2 A;  2PGC A;  1UFW A;  2Z0G A;  1IQZ A;  4LSN B;  2YWK A;  2RQ4 A;  3FZ2 A;  5C2C A;  3CCJ S;  1XMQ F;  4WYL A;  4FS1 A;  1H2T Z;  2R7X A;  4ZVP B;  2QTW A;  4ZP6 A;  5C25 B;  3PKM A;  1SQE A;  3G6X A;  5H9F K;  4FP9 A;  4RW4 A;  2O01 C;  3GV7 B;  1WHV A;  3I31 A;  3GIJ A;  3KG1 A;  2FIU A;  2QL9 B;  2HRU A;  4ZLL A;  1FA0 A;  2B51 A;  2HHS A;  4OQJ A;  1Q53 A;  4KPC A;  4LRA A;  2VF3 A;  4X66 F;  1H72 C;  4WII A;  2XEX A;  4Q43 A;  3V4I B;  3W62 A;  3VAI A;  5IWA F;  4H4O B;  2IJF A;  4MKA A;  1R7I A;  5D6G A;  1RAJ A;  3A4T A;  2O3D A;  2AIR B;  2DNN A;  4YQW A;  4NLR A;  4GC6 A;  4A8Q A;  5K14 B;  3OXF A;  1D8Z A;  3HZG A;  1SJF A;  4HDG A;  3HPO A;  4ZVQ B;  2QO3 A;  2V8H A;  3A13 A;  2VIC A;  2V63 A;  2DO0 A;  1U0H A;  3UN3 A;  2HNY A;  4MK8 A;  5A8R B;  3G6V A;  1R0C B;  2YNH B;  4M63 A;  4F04 B;  2QYC A;  3I9Z A;  4KHR A;  1U1O A;  2MKC A;  4ES1 A;  3N0V A;  5I3U B;  4DPU A;  4DZD A;  1YWX A;  1RHK B;  3MEE B;  1R89 A;  5D78 A;  4QYR A;  1VQN S;  4WIQ A;  3VAH A;  4QR2 A;  2GA7 A;  3HVT A;  2ZH1 A;  2BUN A;  1VHF A;  2YWH A;  2BJ3 A;  4CNZ A;  3ILL A;  2OEK A;  2VBY A;  1MU2 A;  2XSJ A;  1PC5 A;  3HHE A;  3R6G B;  1RWX B;  2OO4 A;  3R2D J;  4C9D A;  4C8Z A;  4DSK A;  5F8G A;  2DRB A;  2PA8 D;  4RBU A;  1VOM A;  2AEM A;  4JI8 F;  4DG1 B;  4AL7 A;  1Y00 A;  5E0O A;  2KXN B;  3CJQ A;  1RAC B;  2B5J A;  1TAU A;  2KG0 A;  2R7U A;  3HFK A;  4B08 A;  1FJG J;  2DGX A;  2VL1 A;  4PPZ A;  3W64 A;  1VIX A;  5E41 A;  1FJC A;  4GKK F;  4B3S J;  3J7Y I;  1NSP A;  1RTI B;  4PWD B;  1LXJ A;  3FSX A;  1HD0 A;  2J7U A;  5HAT A;  2HMI B;  3SI8 A;  3VAM A;  3LAN A;  4DBQ A;  1JJ4 A;  2CVI A;  5E3R A;  4BHQ A;  3BS9 A;  3NOG A;  3NWR A;  3MR5 A;  2UVW A;  2RNE A;  2J9E A;  1KD1 T;  4QW8 A;  1GXL A;  2W7A A;  3HJV A;  3UNG C;  3AOC A;  1I51 B;  2QL5 B;  4DV7 F;  4R0J A;  1KQS R;  5HQL A;  3KK2 B;  2GIR A;  2H54 B;  2VDI A;  1IJE B;  3G6Y A;  1SXL A;  2IDE A;  2ROP A;  5HJY A;  1WSV A;  4RNN A;  3UI3 A;  2G2Z A;  3FC9 A;  4DSJ A;  1UEK A;  3K7R A;  4C7Q A;  5D0R A;  4F0M A;  1NCL A;  4LFC J;  2HUR A;  1YRU A;  1WKK A;  1YJT A;  2E5G A;  2E7W A;  4I2P A;  4RW7 B;  4LR8 A;  3SSQ A;  4MIB A;  2UXB F;  3K5N A;  1DZ5 A;  1BLU A;  2YKA A;  2ZH4 A;  3BN7 A;  2V8G A;  1IKW B;  1NUE A;  3H8Y A;  3TQE A;  2HHH J;  2HQD A;  4RUB A;  1AUS L;  3P3D A;  2HGL A;  2D69 A;  2J6U A;  3IR5 B;  1KQG B;  1CUL B;  1FD2 A;  3SQO P;  4L72 B;  1YTY A;  4DPW A;  1T05 A;  3GTY X;  1HPZ A;  2UXD F;  4X62 J;  4DMZ A;  2ROE A;  1RYR A;  3CIZ A;  5KOW A;  1JJ2 R;  3OD2 A;  2V6A A;  2XWX A;  3IWN C;  3GCX P;  1NK8 A;  2HAF A;  3ZZP A;  1P9Q C;  2YVS A;  3CGI A;  4OHW A;  1QE1 B;  3TUI C;  1B4S A;  1FKO B;  2FTR A;  5A6P A;  2HRT A;  2NXU A;  3WC0 A;  4USW A;  1EP4 B;  2FLL A;  4KFB B;  3KJQ B;  3TX0 A;  5C5J A;  1S9E B;  1J5E F;  2C2E A;  4WWS A;  3DYA A;  1B99 A;  4F36 A;  3W8G A;  4HAC A;  1GXT A;  3WDO A;  2CPH A;  5HBM A;  3RB6 A;  2HSE B;  2EK1 A;  1F3V A;  5THW A;  2YQ0 A;  2ZC3 A;  3PM9 A;  2AMC B;  2ACY A;  2KN4 A;  4RR5 A;  5L8R C;  2MKS A;  4DEZ A;  2Y9H A;  2K3I A;  1N32 F;  3H4B A;  2LEB A;  4J90 A;  3UDL A;  1IQT A;  1IKY B;  3VAL A;  4ILM A;  3IGV A;  4A47 A;  1IKX B;  1S1X A;  2JOQ A;  5HSP A;  4A8Y A;  2XBP A;  2F4V J;  3CD0 A;  4LR7 A;  2KYZ A;  2JHE A;  2OTL S;  3A3N B;  3OFE A;  2COL A;  3ZNU A;  3DLJ A;  2VB6 A;  4EBD A;  1RAG B;  3HMJ G;  3AJD A;  2HWI A;  2MY7 A;  4EO8 A;  3D6T B;  3Q8S B;  1X4A A;  3P5B P;  2B9E A;  4PR6 A;  2QZ8 A;  3FRZ A;  1WEY A;  3C6T B;  2I38 A;  3MCM A;  4ZN3 A;  3H2U B;  3M32 A;  1HI0 P;  4ERD A;  5EUH A;  2JSX A;  1WDT A;  1JLE B;  4PG8 A;  2FPH X;  2CJX B;  4OX9 J;  1FFS B;  3IXQ A;  4I7F B;  2ZVS A;  4I2Q B;  1U2F A;  5B08 A;  2IC3 A;  5L1L A;  2QN6 B;  4OX6 A;  1JXE A;  2XYG B;  4EBE A;  2Z2M A;  3CC2 S;  2M7S A;  4WU2 A;  3NP5 A;  2D3O 1;  3SCI E;  4AYB D;  2W25 A;  3N6L A;  4ECS A;  4QIE A;  5EWF A;  1EET A;  3PEJ A;  1R8P A;  1XBW A;  5J2M B;  3ZTQ A;  4PAA A;  1NME B;  1YLX A;  2KJV A;  2GHW A;  3JAM U;  4OHX A;  2HGN A;  3D4J A;  5KFH A;  5A8K B;  3MMJ A;  1UCN A;  1HI1 A;  4UY8 T;  3MAA A;  4PXC A;  4C8N A;  1RHQ B;  4FNH A;  4YDX A;  2IVY A;  6FD1 A;  4OYA A;  3PHE A;  1VBY A;  4B17 A;  4W90 B;  1RSC A;  2DRD A;  3O3L A;  4DCO B;  3KJF B;  1CJU A;  4ICL A;  5A8W A;  5GAG I;  2P2C B;  1T7P A;  5ADZ A;  3CJ2 A;  4WKY A;  3LP2 A;  5B0G A;  4UQT A;  3T41 A;  4KH1 B;  3RTV A;  3EVM A;  4A8X A;  1WWH A;  2LXF A;  1QTM A;  4OYI A;  1SJ4 P;  1RT6 B;  2ROG A;  5KG5 A;  5J1E A;  2FC8 A;  4DL0 C;  2HNZ A;  4XIU A;  3M8P A;  3D3C J;  2LQ5 A;  2KXH A;  2GQ2 A;  2W4C A;  4QIV A;  1S48 A;  4U8Y A;  1LFP A;  3SCL E;  1UTA A;  4V1A k;  2FJA B;  1DLO A;  2LQ9 A;  1FTR A;  2FD2 A;  1YJU A;  4UY8 5;  1F9F A;  1N4L A;  3RBX A;  3ET6 A;  4I1T A;  4LF6 F;  1Z4U A;  4K59 A;  3BQ0 A;  2YWE A;  4UT4 A;  2DIU A;  4B3T F;  1RWN B;  2ZBP A;  2RF2 B;  3HHL C;  3KJV A;  1FNM A;  1TV6 B;  3EZO A;  3T9N A;  4JI5 F;  2VBW A;  3HD1 A;  2F8M A;  2JLF A;  1KOH A;  4OYX A;  2CPI A;  1RWM B;  1RLD A;  1R0B G;  4O4G B;  2NR0 A;  2G0J A;  2ADC A;  3BGL A;  4HTJ A;  1MSW D;  4ZPV R;  3UCG A;  5CD4 H;  4XO0 A;  2XS5 A;  4EWT A;  5LSO A;  1U1N A;  2R8K A;  2F65 A;  1VRU A;  3KMQ A;  3ZTP A;  1VQM S;  1Y7P A;  3HT3 A;  5HVH A;  3C14 B;  1HHQ A;  4MKB A;  1NU4 A;  1Q1K A;  4NMX A;  4L73 A;  3RRG A;  5ETT A;  3OW2 R;  4A8M P;  3KLG A;  2MGZ B;  3VCD A;  2OPS B;  1DQ8 A;  2YQ3 A;  4WFX A;  2RML A;  1UWB A;  3OTE A;  3UDV A;  4K4Z A;  3Q89 A;  1HKA A;  4YHH F;  2UUA F;  3NCP A;  3I0R B;  3CCU S;  3T1H F;  4LSN A;  3D6F B;  2B8Q A;  1HNZ F;  3DCA A;  1FD8 A;  2R9L A;  2XY7 A;  3N9U C;  3FDS A;  3GIK A;  2H5E A;  3CUN A;  4WBF A;  3HFV A;  4QWC A;  1IUJ A;  3MED B;  1R31 A;  3CMQ A;  2ZC4 A;  2VQE J;  4NML A;  2PSZ A;  2BKO A;  2EC2 A;  2NUH A;  2MST A;  5KFB A;  4CCH A;  2DHA A;  2U2F A;  1T94 A;  4I56 A;  2I5J B;  3D1Q A;  4H4M B;  1HNI A;  5AT1 B;  3DOL B;  5KFZ A;  1BWE A;  3CB4 A;  2L41 A;  1GXU A;  3I96 A;  2BDP A;  3KHL A;  4IDK B;  1KTV A;  2CZ9 A;  1LW0 B;  2BVZ A;  2H65 B;  3CUL A;  1TL1 B;  2BRL A;  3KFW X;  4K2J A;  4ECT A;  2CPX A;  3BR9 A;  4P2F A;  4YP3 A;  1SV5 B;  5L9X A;  1TKX B;  1M5K C;  5A8R A;  1N56 A;  4WFZ A;  2Q79 A;  4X84 A;  5A0Y B;  4OYM A;  4NOH A;  2IM3 A;  3EZ5 A;  3G8S A;  1WF0 A;  1TL7 B;  3EPI A;  1H2U X;  3SQG A;  3Q0A A;  2QA4 S;  4J9K A;  5I3U A;  2D41 A;  1YIJ S;  1RU1 A;  3MEE A;  1EHW A;  1A6L A;  5KFT A;  1Y0H A;  3HSJ A;  2R7T A;  1UA0 A;  3F56 A;  1F2H A;  2MSS A;  2J0Q D;  2CIM A;  1VBZ A;  5HK4 A;  1OYD A;  2VFR A;  2M8H A;  5LMU J;  4ZLP A;  5AXN A;  1F9E B;  1IR1 A;  3HVR A;  1RZM A;  4OFZ A;  2HK2 A;  5HRO B;  1WG5 A;  2OEL A;  3IP0 A;  4NLQ A;  2GQQ A;  1QJH A;  3M8Q B;  4URG A;  3C66 A;  2GMJ A;  3R5J B;  4LJM A;  1RIS A;  2ZDP A;  2HVE A;  4DX6 A;  1RT2 B;  1NDL A;  2HBZ B;  1LWF A;  4KHP F;  2IRY A;  1K8A T;  3ICL A;  3BYR A;  3DHW C;  4CH0 S;  3OTD A;  1OY9 A;  2C2Z B;  1Q8B A;  3QNW B;  5IT9 Y;  4BC7 A;  4U7U K;  2XM3 A;  1RTI A;  4HLB A;  4PWD A;  1IBC B;  4DUZ F;  2B6A A;  1JNR B;  2HMI A;  2ZD1 A;  1SKR A;  2MHE A;  2DR6 A;  3MM8 B;  1IR2 A;  2WSE C;  3D68 A;  1T9X A;  1RKI A;  2VBX A;  2O66 A;  2VFV A;  3V6J A;  3HD2 A;  4ID5 B;  1FVQ A;  3M6W A;  1UZD A;  2MPU A;  2V2Q A;  5C42 B;  1PJ6 A;  3FCV A;  4F4A A;  3TJA A;  2NCK L;  5F9L A;  4KQZ A;  1JLQ B;  4ZKA A;  3PDN A;  1FX2 A;  3HM9 A;  5KG2 A;  2AX1 A;  4C3M A;  2CJY B;  2LCW A;  3DM2 B;  2LYV A;  3W65 A;  1H2V Z;  1TKT A;  3QAE A;  3T3F A;  2WRM A;  1VBX A;  4M5K A;  3RJM B;  2N7C A;  3MUT P;  1XTZ A;  4USK A;  3AHP A;  5KFO A;  2XGP A;  1FHT A;  1GTE A;  3SMZ A;  5D0E A;  2QMX A;  1NSA A;  5EWE A;  1U1Q A;  3H7H B;  5LL6 d;  4WFB Q;  1JB0 C;  2GAH C;  5LJ3 Y;  1BQN A;  4DX7 A;  3QMQ A;  3LP0 A;  5HI7 A;  3J81 Y;  2CJK A;  2OSR A;  4FXD A;  3WIU A;  4TU7 A;  3ENW A;  3UE2 A;  4DR3 J;  4ZJL A;  3CJT A;  3GIM A;  4HHU A;  1XN9 A;  1AW0 A;  3CC7 S;  1X5S A;  1BUX A;  2HQG A;  1WC3 A;  3IS9 B;  2NPF A;  2DKO B;  4OZ1 A;  3QO9 B;  5KFV A;  2CYY A;  3C8Y A;  3VAF A;  3QZ8 A;  4WPA A;  3H0P A;  5A6W A;  2M88 A;  4N8N A;  1O6X A;  4OX9 F;  2BKN A;  3QWP A;  4KC5 A;  3B4M A;  2AYM A;  5GAD U;  2UU9 F;  3QGI A;  1SVD A;  5B0E A;  4LQ3 A;  1N52 B;  2HBR B;  1HW8 A;  5BYR A;  2YH0 A;  3MI7 X;  3OFG A;  2MDA A;  2CPF A;  1YJ7 A;  2LQJ A;  3PW4 A;  1CQM A;  2H4Y B;  4LSZ B;  2V4R A;  2XI3 A;  4IR1 A;  2Z8Q A;  2DO4 A;  4EMD A;  2Q43 A;  4USJ C;  2A6M A;  3TX8 A;  1SKS A;  5G0R A;  2DNZ A;  5KT5 A;  3UR0 A;  5KFW A;  1X4D A;  5KFS A;  5L39 A;  1O5J A;  2C2N A;  2DNH A;  3MCN A;  3U1M A;  3UDE A;  1YI2 S;  4DX5 A;  3MEC A;  3TEG A;  2VFT A;  4WP8 A;  2FGO A;  3UNY A;  2KVI A;  3OL6 A;  5KOX A;  1XNQ J;  5DZ7 A;  3I87 A;  4TN2 A;  2K2P A;  1W2B R;  3EJM A;  4JI0 J;  1IKY A;  2DH7 A;  4AQY J;  2HLT A;  2E9T A;  1C1C B;  1WC4 A;  3KLF A;  3TVY A;  4MAK A;  2FYX A;  4ED8 A;  1QAX A;  3PRD A;  3WBZ A;  1NK6 A;  4NCB A;  3OUY B;  3IBC B;  2D1C A;  3BEG B;  2YWW A;  2GAG C;  3PCO B;  2J0W A;  4HH0 A;  1YSJ A;  3US5 A;  2L08 A;  4K8R A;  4AUK A;  2DHX A;  4ZPT R;  2XMT A;  4FN5 A;  2R4F A;  2WK4 A;  3C6T A;  3H5X A;  2XMA A;  4ZPB A;  1F9H A;  4TU9 A;  4ECX A;  5H9F J;  2J6T A;  2JVR A;  3I0S A;  3MUM P;  5CCM A;  3MF5 A;  1NSQ A;  2GQC A;  2VQF J;  1JLE A;  1NXI A;  3AB4 B;  2PC6 A;  4NLY A;  4TY9 A;  1T9U A;  2WSF C;  3C3L A;  4NCA A;  3C19 A;  3D6H B;  2JEI A;  1S4E A;  3MMA A;  2BJ9 A;  1XR6 A;  2OMO A;  1B64 A;  1A7G E;  1B0T A;  2NYH A;  4NCG B;  4NX9 A;  3LQV A;  1L5U A;  3DI6 A;  4CIO A;  4Q0B B;  2HLU A;  3M9M B;  3ISZ A;  5CQG A;  4IKA A;  3NMR A;  1DUR A;  1M1G A;  4MT1 A;  4AND A;  3W5Y A;  2AD9 A;  1VLO A;  3FBF A;  2E44 A;  1R8C A;  1NK4 A;  2QFJ A;  2OD4 A;  1U6B A;  1NK9 A;  1HMV A;  3MFH A;  2G1H A;  5J2M A;  1BQX A;  1ZZN A;  1SJR A;  5IM0 A;  3GFY A;  3BGF A;  1UJ5 A;  1HYS A;  2L9N A;  3LWM A;  1V3R A;  1RQ0 A;  5DDR C;  2RQM A;  3GZ7 A;  1RU2 A;  3R7S B;  4NWB A;  2HK3 A;  1HBO A;  3SFU A;  1RTJ B;  3BGU A;  1RBA A;  5U47 A;  2O1P A;  2K06 A;  2V9K A;  2M5Y A;  1FXD A;  3C46 A;  2H5I B;  2VH7 A;  3BSC A;  3ILI A;  3HUL A;  3ETO A;  5LJ5 Y;  2QC3 A;  5C24 B;  3GJR B;  2K1R A;  4Q44 A;  1FXR A;  3TAQ A;  3GPA A;  3QJL A;  1UKU A;  2DK2 A;  3QT6 A;  4Q2L A;  2KJW A;  3VAK A;  2W24 A;  2MQP A;  2E5L F;  4QPX A;  1RT6 A;  4NYP A;  1Y5N B;  3K2Y A;  2DIS A;  5HMY A;  1Q78 A;  3MD1 A;  1VLY A;  3GFX A;  3KHH A;  4DS5 A;  3DLE B;  4TQR A;  2CNO B;  4DV6 F;  2CNL B;  5D3G B;  4JI4 F;  2VQE F;  3THP A;  1YQH A;  2RKI B;  3NS7 B;  3H2V E;  1GH8 A;  4ED6 A;  1GMW A;  2EBE A;  3TJ8 A;  2ZBQ A;  4K4U A;  4ENO A;  3NKY A;  1VC0 A;  5F0U A;  5FD1 A;  1WKL A;  3CIM A;  1TV6 A;  5E33 A;  1DQ9 A;  2RS2 A;  4I6W A;  2V69 A;  2V8P A;  3BB5 A;  2F1F A;  1LFW A;  2JRS A;  2VON A;  8AT1 B;  1H74 A;  4O4G A;  4I6A A;  3V6D B;  3EIC A;  2LEA A;  1P1L A;  2GS8 A;  4TVA B;  3DGP A;  1N48 A;  4E8U A;  1ZPW X;  4B02 A;  1PBA A;  1PO6 A;  2V94 A;  3H40 A;  5JVH Q;  1Q79 A;  2W9C B;  1HWL A;  3F44 A;  1IVZ A;  1GAO A;  2H1Y A;  4OLO A;  2EFV A;  4ZPD A;  5FDL A;  4I0W A;  3D54 A;  4O4R A;  3IG1 B;  3QT7 A;  2HEK A;  3LPY A;  3NEK A;  3M8W A;  1RCX B;  3LAL A;  3DLG B;  3SIP B;  2FB0 A;  2WVD A;  2WOM B;  4ZJQ A;  2NS1 B;  2V0N A;  3OBI A;  2KTQ A;  1WUU A;  2DXD A;  1LWC B;  2XLJ A;  5LMU F;  1R3N A;  1UA1 A;  4KR0 B;  1TUV A;  1TL4 A;  4Z2X A;  4PPD A;  4CWB A;  2ALY B;  5F41 A;  5T7L B;  1IBL J;  2B9Y A;  1NHV A;  1V3S A;  3MED A;  2G0C A;  1BXN A;  4TU8 A;  5AJ3 J;  2DEJ A;  1JMT A;  2IM1 A;  4RNM A;  1S79 A;  3H4D A;  5I3Q A;  1JLF B;  2DNP A;  5HQM A;  2HQI A;  3EUN A;  2R2R A;  3MEG B;  3GB0 A;  1HBM B;  1KR4 A;  3CJ3 A;  5HMX A;  1R0A B;  4UOC A;  2EFG A;  6AT1 B;  3ILJ A;  3TZZ A;  3NS6 A;  4U6P A;  4ER8 A;  4Y2I A;  4YB6 A;  1S59 A;  1FKA F;  4HKQ A;  2E9Z A;  1YJW S;  1NKB A;  1EZZ B;  2BW2 A;  2I5J A;  5RUB A;  4DR1 F;  4NXM J;  4H4M A;  2IYI A;  1CPZ A;  1HLW A;  1RHR B;  5EHH A;  3NGK A;  1RB0 A;  1FRK A;  4G1Q B;  2BOP A;  4DL7 A;  4FNI A;  1TL1 A;  5ITH A;  1KKH A;  1CJK B;  3JTN A;  5LOQ A;  3G2X A;  5HQ8 A;  2VUG A;  3BBC A;  1TKX A;  1D9A A;  4F4X A;  3PO4 A;  4A8S A;  4Y0F A;  2ERR A;  2RQC A;  5HO4 A;  1S9G B;  2I0X A;  4EGL A;  2CRL A;  1X7V A;  1XEZ A;  1C2P A;  1HQU B;  3W2V A;  3G96 A;  2HHP A;  1OPZ A;  2D9O A;  4TYB A;  5KFR A;  2XY6 A;  1PCA A;  2W9B A;  4ECR A;  3DLK B;  1FE0 A;  2CWK A;  4UTG A;  1YJ9 S;  4HHJ A;  5D4L A;  3DOK A;  2YKM A;  2LEC A;  5IV4 A;  1ZAX A;  4C6A A;  5KT4 A;  4TKT A;  5IT4 A;  1XC9 A;  5HRO A;  1AT1 B;  1F5C A;  5I3P A;  2DGO A;  4LQ9 A;  3CSK A;  2ZHO A;  3KNG A;  4DR3 F;  5KFL A;  3VGT A;  2YPZ A;  3TEH B;  4DR4 J;  1RA7 A;  3MM9 B;  5GMD A;  4IG3 B;  3H20 A;  3UVJ A;  1WOP A;  1MMD A;  1YHQ S;  4ZVG A;  4RBT A;  2E29 A;  2PII A;  5J1P A;  1RT2 A;  1KN6 A;  1CC7 A;  1IBM F;  2KRR A;  3EPG A;  4FYV B;  2R8I A;  5ETL A;  2YXL A;  4S0M A;  2DIV A;  5D0H A;  2IIH A;  1S5Z A;  3W2W A;  1S4F A;  1NEE A;  3R6L B;  3I5A A;  2PO4 A;  1AFJ A;  4NI2 B;  1FXL A;  2W2Q P;  3MM8 A;  4U67 Q;  3QSY B;  5B0C A;  1G1X A;  1JQG A;  4JI2 J;  3UPF A;  3KLE A;  5LXR A;  4DLG A;  4DSI A;  3QBC A;  1Y10 A;  1KWM A;  1REV A;  2OLW A;  5C42 A;  3G8Q A;  3CJK B;  2ZH3 A;  1NJW A;  5DM6 Q;  2XS2 A;  3P8B B;  2ZBR A;  2J8S A;  1M0S A;  4Y3C A;  4UZC A;  3X1L B;  1OS5 A;  1JK9 B;  2MY8 A;  4ZVE A;  2FHJ A;  4OI6 A;  3MAH A;  1RTH B;  2W2N P;  2L3M A;  1HI8 A;  2VG5 B;  1TL5 A;  1J5O B;  3C6U B;  2DY9 A;  4JYA F;  2Y1L B;  3PVX A;  3E01 B;  2FUG 9;  3LF0 A;  2UVR A;  4YOE A;  2EW9 A;  3QJJ A;  3RAQ A;  4C2M A;  1D3W A;  2LU2 A;  4O44 B;  1WC0 A;  2JC0 A;  2UV8 G;  1KDN A;  2NZC A;  3QLH B;  2EKN A;  3M05 A;  2CQ3 A;  2WBR A;  1BHN A;  2F7V A;  3ULH A;  1KQK A;  4QZV B;  2IDL A;  4U7U D;  4ZIV A;  3PX6 A;  4HYK A;  5B0F A;  4ED1 A;  3G82 B;  1SL1 A;  3OLB A;  2BX6 A;  2OFH X;  3QO9 A;  1GX6 A;  2GMH A;  3BRE A;  2B4O A;  2NRE A;  2FVS A;  4GO7 X;  2VQF F;  3I82 A;  2AJ4 A;  3QGH A;  3R3T A;  5DZ6 A;  3M8S A;  2ZJR Q;  2HWT A;  3UD4 P;  5HAO A;  1MRO B;  3OTB A;  4P9S A;  3PXG a;  3W61 A;  1WEL A;  2DJW A;  2VD3 A;  3V5R A;  5A2Q U;  1UJ4 A;  3ISN D;  1RAE B;  2VFU A;  3IRX B;  3LH2 S;  1JNZ B;  3CCT A;  4RW8 A;  4OV6 A;  4NZ0 A;  3D5M A;  2DR8 A;  2V4Q A;  5DQI A;  1Q82 T;  3KLH B;  3HP6 A;  3Q8R B;  3AOA A;  4J9S A;  2OD6 A;  3UN5 A;  1S1T B;  3IR6 B;  1EAY C;  3MPW A;  3I5B A;  4LSL A;  2WSC C;  4LF1 A;  4DFK A;  3RZA A;  3OTC A;  4C0O C;  2QRR A;  3D0H E;  4E98 A;  5J2Q B;  2CUY A;  1XJW B;  2YNG B;  3OL9 A;  2HWH A;  4FF4 A;  2UXC J;  4LUB A;  1GQE A;  1X4H A;  2Q6C A;  2QSF A;  2GIF A;  7FDR A;  2H4W B;  2HG4 A;  5BR8 F;  1C1B B;  2XTJ P;  1VK8 A;  5CHC B;  4LIR A;  1N6Q A;  2DR7 A;  3VHQ A;  2A3J A;  4F8R A;  1S6Q B;  1TK0 A;  2AJ1 A;  2IY5 B;  2NUU G;  1HQ2 A;  4PG4 A;  4IFV A;  1EX8 A;  3EGN A;  5DGA A;  1S57 A;  3OUY A;  2HHV A;  1Q0N A;  3NAH A;  3SYZ A;  4WE1 B;  3CJS A;  3DRS B;  2NYI A;  2DY1 A;  3IM8 A;  3X3U A;  2HHW A;  3GYG A;  4Y2C A;  5J2P B;  1OIA A;  5KFX A;  3M9O B;  3O1L A;  1S99 A;  3E2E A;  4G6V B;  1N5S A;  1FDN A;  2C2M B;  3OFF A;  5I4M A;  2DT9 A;  3GMG A;  2DYA A;  4ZVF A;  1AYE A;  1APS A;  2DCU B;  1XIQ A;  5L46 A;  4DV1 J;  2HFN A;  1SQG A;  3GII A;  4ZCI A;  1RT1 B;  4NCG A;  1D0E A;  1T0T V;  2MQO A;  4Q0B A;  1J2V A;  2R42 A;  3DKD A;  4K4T A;  3MM5 A;  3EWG A;  3GJS B;  4A8W A;  2NXC A;  3IGN A;  1SC6 A;  2QV6 A;  2KU7 A;  5KTQ A;  2H48 B;  1UPM B;  4DR2 J;  2C28 A;  2DEI A;  2RU3 A;  1RT5 B;  2ZHA A;  3A8E A;  5GAG U;  4DF8 A;  1WHW A;  3CJ0 A;  4TLQ A;  5EX0 A;  3BV8 A;  4JV2 A;  2JZ5 A;  4KKO B;  1E6Y B;  1PJ5 A;  1MWQ A;  3C16 B;  5EN1 A;  1CS4 B;  5B0B A;  2FJV A;  4Y00 A;  1ZYQ A;  2N82 B;  8ATC B;  3P96 A;  4ZMM A;  1NJZ A;  1I6J A;  4JI1 F;  3QRQ A;  2FJE B;  2NLW A;  3GE9 A;  2MZS A;  1HBN B;  2A18 A;  4KGZ B;  4LF8 J;  3BO3 A;  3ETM A;  4RJV A;  4M5G A;  1S77 D;  4B9V A;  2C2R A;  2OKQ A;  1YGY A;  4OX7 A;  4JI7 J;  2JLG A;  4DV5 F;  1QVF R;  4B9T A;  2LP4 A;  5L1K A;  4QWD A;  1SQF A;  1F6T A;  3CF5 Q;  2AJF E;  1FFG B;  4LVO P;  3MPU B;  1U48 A;  3BZQ A;  4DCP B;  3VTI A;  1U0S A;  4DWI A;  4LFA F;  3IR7 B;  2PDA A;  2XI2 A;  2CJ9 A;  3D3B J;  1X4B A;  3W9J A;  2FVR A;  2G13 A;  4LRF A;  1GEH A;  3P5T L;  2GX8 A;  1FRL A;  3PYG A;  1DQA A;  5AJ3 F;  4M8L A;  5D3G A;  1CJV A;  5GAE U;  3KYL A;  5IQQ A;  2PI4 A;  2WCX A;  4P2X A;  2KM8 C;  3QIP B;  4EZ9 A;  3BDE A;  3BKF A;  4UOG A;  1VQ7 S;  2MKY A;  1UL3 A;  3IMQ J;  1F2G A;  4ZLJ A;  2N4C A;  1HHS A;  1SH0 A;  4NLV A;  1QAI A;  3EGZ A;  3KK1 B;  4TY8 A;  1WJ9 A;  5DGB A;  3JQJ A;  2HAI A;  1WD6 A;  4NA3 A;  4WF9 Q;  5A76 A;  1QVG R;  4ZDN A;  2RSQ A;  4B9S A;  1DHM A;  2C3M A;  2QT7 A;  4WXW A;  1Q86 T;  1UEU A;  3CJ4 A;  4IH5 A;  1W7W A;  4Q8F A;  3K5O A;  2P8I A;  5HLF B;  4P75 A;  2DCL A;  4IRC A;  2VFS A;  2M52 A;  2YKN B;  4FZV A;  1B70 B;  4CM2 A;  1KVI A;  1MW7 A;  1HWI A;  3LW5 C;  1DTQ A;  1GT8 A;  2W4P A;  7FD1 A;  3H59 A;  2JEJ A;  3BGO P;  2P9C A;  2GV1 A;  1TKZ B;  2CAJ A;  1MN7 A;  2DD8 S;  2V68 A;  1M90 T;  2J76 E;  1S6P B;  1X31 C;  1MWZ A;  3JSR A;  1U47 A;  5FLX U;  2P6T A;  3OVA A;  4LRE A;  4U95 A;  3HX9 A;  2OHD A;  1I94 J;  3JB9 k;  4PWW A;  2E1C A;  1VCT A;  2ZJQ Q;  2WOM A;  5DG7 A;  4F25 A;  1S1W B;  2DH8 A;  1TK5 A;  4B3M J;  4EZ6 A;  1LK5 A;  4HI2 A;  4TLR A;  4ED5 A;  3AJ2 A;  5BYQ A;  4M5L A;  3TR5 A;  2ZIT A;  4R5P A;  4LBH A;  4DF4 A;  5LM7 E;  5KFF A;  3KLV A;  2VOD A;  4U7C A;  5T7L A;  1YJN S;  2BV3 A;  4QQB A;  4ZVT B;  4DS4 A;  2QLW A;  1OSD A;  2B9W A;  2QYG A;  1DBD A;  4X65 J;  5DLF A;  4KYZ A;  1AUD A;  5DET A;  3ENA A;  2QMU B;  1HD1 A;  3RW6 A;  5E3A A;  3M2R B;  4ATN A;  2I2Y A;  2CPJ A;  4WTY A;  4L3N A;  4RW6 A;  4QW9 A;  4K4W A;  1L3V A;  2FJB B;  2R7Q A;  2IMO A;  3UO0 A;  1GK8 A;  1SIZ A;  4ZLN A;  4FYD A;  2CVE A;  2AGQ A;  4DLE A;  4KBI A;  2P9G A;  2W4D A;  3LA0 A;  2CQD A;  2V2V A;  4ECY A;  5HAN A;  2DB1 A;  4NEZ A;  2GVD B;  1IWG A;  4G1Q A;  3NL0 A;  4JI2 F;  4QU6 A;  2BAN A;  1RWV B;  2ZKU A;  3L7O A;  3V81 B;  4RPF A;  1NND A;  4OJ1 A;  1S12 A;  3IFE A;  1ZTT A;  3D0I E;  1XNR J;  2ZH5 A;  3NWG A;  1R8H A;  2PE8 A;  2GJF A;  2ADB A;  3R9L A;  5AXK A;  1S9G A;  2B7C B;  4RUH A;  3D66 A;  3JSM B;  2BE7 D;  4M5H A;  3G86 A;  1U1R A;  3KDO A;  1HQU A;  4ZJO A;  1LWX A;  2DIT A;  2CQB A;  4OIX A;  2G2O A;  3BH7 B;  2K3K A;  3RGI A;  2WW4 A;  3U27 A;  7AT1 B;  3LAK A;  4K2X A;  1MML A;  4P7T A;  3DOM B;  1VQ5 S;  1N33 J;  3ITH B;  4DJB A;  1ACM B;  4JV5 F;  4CTA A;  3UD3 P;  3DLK A;  4GVL A;  5ETM A;  1HNW J;  4JI3 J;  3H5Y A;  4O0N A;  5KFJ A;  4RUA A;  2M3D A;  1M5O C;  4PUO A;  1RWO B;  2HIQ A;  4U9R A;  4YR3 A;  1EKS A;  3MMB A;  2WB4 A;  1X60 A;  4DUY J;  4DPT A;  5B0A A;  3MM9 A;  4ECQ A;  2MKH A;  2OPP B;  4DFJ A;  1ZET A;  1FK9 B;  5F8I A;  2AEF A;  3W66 A;  2MLX A;  1HNX F;  2XMM A;  1B0V A;  1PYS B;  1BWV A;  3T1Y F;  5CA5 A;  4CO5 A;  4LRD A;  3D1H A;  1C0U B;  2ZUA A;  5GAH I;  2XGQ A;  1KLM A;  2AJ2 A;  3DU6 A;  1XR5 A;  3RBZ A;  3FJ2 A;  4DR5 J;  3MPV A;  4LF5 F;  2FZG B;  3RRK A;  3LOU A;  2VPX B;  2HRY A;  4KT0 C;  2KXF A;  4NI2 A;  3LP1 A;  3IAS 9;  2HVI A;  1WEZ A;  3OR1 B;  1VDH A;  2FLO A;  2QE5 A;  1RT3 B;  2KT3 A;  5LMN F;  3QAU A;  4YME A;  2ZM6 J;  3CJ8 A;  1S6U A;  3U02 A;  4X4U A;  4AE5 A;  5KFK A;  4Y2M A;  4DV3 J;  2QLJ B;  2AEJ A;  3PW5 A;  1PAE X;  2HZC A;  2YKO A;  3DRP B;  2Y1R I;  4RWW A;  4M5D B;  2V67 A;  3KLI B;  2POK A;  2E1P A;  2EVZ A;  2I1R A;  2DGS A;  3H25 A;  4KO0 B;  5ETK A;  3VVU A;  4ZCK A;  4YY3 J;  1RTH A;  4GMK A;  2W9A A;  1YVF A;  3W1Y C;  3OR2 A;  1J5O A;  1BMQ B;  2OTJ S;  3QSI A;  5C2G A;  3A8K A;  1KON A;  3VV2 B;  1LW2 A;  4C0H A;  2EFN A;  2XLI A;  2YNF B;  2XMJ A;  1GX5 A;  4O3R A;  2Z2L A;  3QLH A;  3CDU A;  2WZ1 A;  3RBD A;  3ILO A;  3RB3 A;  2YTC A;  4WXO A;  1RT7 B;  3HSZ A;  1NJX A;  2YNI A;  4X64 F;  4WFA Q;  2B4V A;  1BD6 A;  3OXG A;  4LT6 A;  1PIL A;  2DPJ A;  4K5S A;  4TYA A;  2GVZ B;  1QAJ A;  1E6V B;  4ZK7 M;  1Q95 G;  1NM2 A;  3TZX A;  2XHW A;  1RJJ A;  3C2P A;  3MTJ A;  4P52 A;  4L6V 3;  1HQE A;  3TVK A;  1WI6 A;  1T9W A;  3HZE A;  3MR6 A;  2J5A A;  5KG0 A;  1S76 D;  4WJB A;  3BYP A;  2IRX A;  2MTL A;  3T5H A;  3NY0 A;  4NLP A;  4YB1 P;  4DV1 F;  4WKR A;  5IT0 A;  4ZHR B;  1QD1 A;  4GKJ F;  2NPI A;  2EFP A;  2XSF A;  3W9H A;  5E3Q A;  5KG4 A;  1HBU B;  2HHT A;  2V8V A;  3KOA A;  2DR5 A;  4FXW A;  3NLC A;  3GG1 A;  1N88 A;  2KHD A;  3MPD A;  3VGU A;  1VQ9 S;  3HF5 A;  5KFQ A;  2OPR B;  4DR2 F;  1S1T A;  1FRJ A;  3NNH A;  2FC9 A;  1ARO P;  4H4K C;  3F73 A;  1HWU A;  4OHV A;  4F4Y A;  2WAQ D;  2KO1 A;  2QA1 A;  5KFM A;  3GIL A;  3KHG A;  3GCW P;  4DQI A;  3R2C J;  3DRR B;  4DU7 A;  2DNK A;  4ECV A;  5LSL A;  1YIT S;  1N5Y B;  1WNE A;  1RP5 A;  2EC0 A;  2RD5 C;  3G9C A;  1C1B A;  4D3H A;  3K58 A;  3NRB A;  4BWJ A;  1A9N B;  1T03 B;  4CM0 A;  1WF1 A;  2CNN B;  1S6Q A;  2LA6 A;  4Y65 A;  1B7Y B;  1X0F A;  3MM7 A;  5KFU A;  2KFN A;  3FCH A;  1P1T A;  1Y3J A;  3BM7 A;  4DI6 A;  1DJ0 A;  4CLY A;  1V5I B;  4PXB A;  2ZOF A;  4NXN J;  3NNC A;  4UUX A;  2XY5 A;  4QWB A;  5KFY A;  2N3O A;  2ZH7 A;  1T3N A;  4F3Q A;  2RB7 A;  3DU5 A;  3JQK A;  3ZNJ 1;  1AFI A;  3G8T A;  2DBB A;  2DHG A;  3GG0 A;  3IBW A;  5K8M A;  5J2P A;  2AZ3 A;  4RW4 B;  2MZT A;  1ZM9 A;  5LXY A;  4WZM A;  4CLL A;  2AGP A;  2AYE A;  2DXF A;  1PJ7 A;  5D8H B;  2KDO A;  4N8O A;  2BRK A;  2KRB A;  2MZ1 A;  1LQ9 A;  4DDF A;  1OSC A;  2XZD B;  1OY8 A;  3GV8 B;  3D0G E;  1YRX A;  3ZO7 A;  1NRK A;  4DSL A;  1P9Y A;  4PYA A;  1N34 J;  3QAT A;  4OI2 A;  3SZ2 A;  4Q7A A;  2N7Y A;  4FPR A;  1G6B A;  4C3L A;  1N5Q A;  5F3T A;  3PHT A;  3R27 A; 
#chains in the Genus database with same CATH homology
 1UCN A;  1LEO A;  1F3F A;  4HR2 A;  3FBE A;  3GP9 A;  1HLW A;  4FKY A;  3WX8 A;  4DI6 A;  3PJ9 A;  1PAE X;  3BBB A;  4DUT A;  3B54 A;  3Q86 A;  2HVE A;  3VGT A;  3Q8U A;  4FKX A;  2HVD A;  1NSK L;  2B8Q A;  1B99 A;  4EK2 A;  4F36 A;  1NDL A;  1NDC A;  3FCW A;  1NUE A;  4ANC A;  4ENO A;  4UOG A;  1XQI A;  2DXD A;  3G2X A;  1PKU A;  2B8P A;  3FBC A;  1NSP A;  2BEF A;  1WKL A;  3NGR A;  2DY9 A;  4WBF A;  3VVU A;  3ZTS A;  3BBC A;  1NDP A;  1NLK L;  3NGT A;  2VU5 A;  3EMT A;  3ZTO A;  1U8W A;  1NSQ A;  1K44 A;  1JXV A;  3BH6 B;  1NDK A;  4S0M A;  3MPD A;  2AZ3 A;  3L7U A;  3FBB A;  3ELH A;  3Q8V A;  3VGU A;  3VVT A;  1S5Z A;  3ETM A;  5C7P A;  1KDN A;  1WKJ A;  2ZUA A;  4UOF A;  3EIC A;  2DYA A;  3EVW A;  4KPC A;  3JS9 A;  1BHN A;  1EHW A;  3R9L A;  5CAB A;  2DXF A;  3ZTP A;  1XIQ A;  1MN9 A;  3EE3 A;  3NGS A;  1BUX A;  3EVM A;  3ZTR A;  3Q8Y A;  1W7W A;  3Q83 A;  3GPA A;  1HIY A;  3B6B A;  3EJM A;  3EVO A;  1F6T A;  1NB2 A;  1LWX A;  1HHQ A;  1BE4 A;  3ENA A;  3BH7 B;  1B4S A;  3DDI A;  5BXI A;  2DXE A;  4CP5 A;  3NGU A;  3FCV A;  1NPK A;  3VGV A;  4F4A A;  2NCK L;  5IOL A;  3DKD A;  3FKB A;  4AND A;  2BX6 A;  2CWK A;  3FBF A;  4UOH A;  3ZTQ A;  4W98 A;  1ZS6 A;  3VGS A;  5CAA A;  1NHK L;  1S59 A;  3FC9 A;  4C6A A;  1MN7 A;  3PRV A;  1VYA A;  1NCL A;  3BBF A;  2AZ1 A;  3Q89 A;  2HUR A;  4DZ6 A;  1WKK A;  4O0N A;  1S57 A;  4ANE A;  3EM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...