4HR2A

Structure of nucleoside diphosphate kinase (ndk) from burkholderia thailandensis bound to adp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
142
structure length
142
Chain Sequence
SMALERTLSIIKPDAVAKNVIGQIYSRFENAGLKIVAARMAHLSRADAEKFYAVHAERPFFKDLVEFMISGPVMIQVLEGEDAILKNRDLMGATDPKKAEKGTIRADFADSIDANAVHGSDAPETARVEIAFFFPEMNVYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of nucleoside diphosphate kinase (NDK) from Burkholderia thailandensis bound to ADP
rcsb
source organism Burkholderia thailandensis
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 47
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2012-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4hr2A00
1PAEX 1NPKA 3Q8VA 5CABA 3EVMA 1S59A 4DZ6A 4F4AA 4HR2A 2BX6A 1K44A 2HURA 4CP5A 2NCKL 5C7PA 3B6BA 4WBFA 1S5ZA 3R9LA 2DXFA 3VVUA 5BXIA 1MN9A 1HLWA 1JXVA 3GPAA 3GP9A 3PRVA 3FC9A 1NSKL 5CAAA 3ELHA 3BH6B 4ENOA 3ETMA 3JS9A 2HVEA 1NDLA 1NUEA 3NGSA 3DDIA 3BBFA 3EMTA 1HIYA 2DYAA 2CWKA 3NGUA 3FBCA 3FCWA 3ZTRA 1ZS6A 1UCNA 1WKJA 1U8WA 2AZ3A 2AZ1A 4ANEA 4FKXA 1WKKA 2BEFA 4C6AA 2HVDA 3MPDA 4ANCA 3BBCA 4FKYA 1XIQA 1PKUA 3ZTSA 1S57A 1F6TA 1W7WA 1B4SA 1NDPA 1BHNA 2B8PA 3Q86A 1F3FA 1XQIA 4S0MA 1MN7A 2DXEA 3FBEA 3VVTA 4UOGA 1NSQA 2B8QA 3NGRA 1BE4A 1LEOA 4EK2A 3EVWA 3ZTPA 3ZTQA 3EVOA 1VYAA 1NDCA 1NLKL 3Q89A 2VU5A 3BH7B 3VGSA 2DXDA 4UOFA 3EM1A 3FKBA 1NB2A 3VGUA 3EE3A 3Q8UA 4DUTA 3ENAA 3FBFA 3G2XA 3WX8A 3EJMA 3Q83A 4ANDA 3FCVA 3PJ9A 3Q8YA 1B99A 1KDNA 3B54A 1NDKA 4W98A 1LWXA 4DI6A 1NCLA 3NGTA 1BUXA 1EHWA 3FBBA 3BBBA 4UOHA 2DY9A 3DKDA 3ZTOA 1HHQA 2ZUAA 4KPCA 3VGTA 1NSPA 1WKLA 5IOLA 1NHKL 3EICA 4F36A 3VGVA 3L7UA 4O0NA
chains in the Genus database with same CATH superfamily
2VH7A 3J7Z5 2LEAA 5J2MB 2H48B 3D28A 1KQGB 4JI6J 3D0GE 4GO5X 4YUDA 1N5QA 3M8PA 4NASA 1VQ7S 2O5DA 3CT9A 3F73A 1QM9A 2Z56B 3TQ1A 2ILZA 2BYCA 1D9FA 1GX6A 3VHQA 3UVJB 2DNPA 2HURA 3BKUA 2KN4A 2UXBJ 1DQ8A 2CQGA 2LKZA 3LUYA 5LT5A 3G6YA 4X64J 2CZ4A 2E7WA 2V2KA 2BQUA 2QFJA 4ED3A 3M6XA 1SJ3P 1HLWA 1RU1A 2NXNA 2W4CA 3DRPB 2VPYB 2F8MA 2OKQA 4MH8A 5ETKA 1VQ5S 3NL0A 4O4GB 2XYHB 3UD4P 3R5JB 1RA6A 2UV8G 4RO0A 2YNGA 4J9MA 1VQ8S 1N32F 1BQNB 2KTQA 2DHXA 3DC2A 2Z58B 2RD5C 3TWZA 1YJUA 1NUEA 2C2NA 2YNHA 1D3WA 1P8GA 4J9QA 2PMZD 4AYBD 3UI3A 2CNLB 3EDRB 3R5GA 4DCOB 4HHJA 1VQOS 4DR5J 2FZKB 4KKOA 3MMCA 4UUWA 2W9AA 1ELOA 2MYFA 3P3DA 1I1GA 2RDJA 1JLAB 3RB6A 3E51A 2MJNA 1GXUA 4IFYB 3TVYA 5F8NA 1R3NA 5LJ5Y 4NXNJ 2CQ2A 4USUA 4DL5A 3FMBA 1EARA 4PAAA 5DS7A 1S97A 1YZ7A 3QSYB 1OY8A 2JLEA 2KFNA 2V34A 3CJQA 2HRTA 3BSCA 1FXRA 5IQQA 4DV6J 4LFCJ 2EFPA 4QWBA 4C6AA 1R6VA 1XR6A 4O3OA 4NRTA 4RUHA 1C1BB 3PACA 3ZTSA 5DQGA 4QWDA 3Q24A 1KLMB 2FVCA 2KRRA 2P6TA 2VFUA 3SCJE 4DMZA 5HQ8A 1JQGA 3IG1A 5KFEA 4KH0B 2HMIA 2B8PA 2Z2MA 2HIYA 4EI2A 1HNVA 2GZOA 4ZCIA 5A2QY 3CCES 2BBEA 5HMZA 2CRLA 2IM0A 1S9EB 3LP0B 4K2JA 4DFPA 3V81A 2C28A 2MKKA 2WSCC 1HW8A 4XDCA 2XMVA 3NGRA 4X65F 4JI3J 5D3GA 2KL8A 1FJGF 2MDAA 2OH2A 1KN6A 5J1EB 2BE2B 2KG0A 1YG0A 5GMKa 3P5BP 1UEUA 5I3UB 3BSOA 5HJYA 1RJJA 4Q2MA 2JVRA 3QT8A 2FQQB 3MPVA 5A0YB 3DLBA 2E5LF 3O5TB 3Q89A 1FFGB 1VRUB 2B4UA 3JTOA 1SJQA 3SQGB 2CVEA 3D0HE 2HHWA 3VAGA 2W01A 4LUBA 2GAGC 4RUBA 1H7WA 3F0NA 3QGGA 2FJBB 2MLYA 3IBCB 4OZ5A 3HLUA 3KHGA 4LFBJ 2CQ1A 1Y0HA 3DLLQ 2RU9A 4B9MA 4ED7A 2JZ5A 2KZMA 2HBZB 4PWWA 5A8WA 4Q7AA 3PYFA 1WC1A 3TVZA 3IA0A 3THTA 1NJXA 2J6TA 4Q43A 1JLBB 2W2PP 4A46A 1NHVA 1UJ4A 2ZDOA 2DTJA 3GIRA 3MTJA 5A8WB 3PRBA 1RSCA 4DBQA 2MZ1A 4AL5A 1RYSA 4I56A 3R3TA 4DR6J 3MM8A 3KLGA 2ADBA 1F1BB 4ZKAA 3B78A 1SUQB 2BUNA 2GMHA 1N36J 2VFSA 1YSJA 2CPZA 1FTCA 5G0RB 1X4FA 3EICA 3VGVA 1BQMB 4TU9A 4KY3A 4LJMA 5LMUF 2EBGA 2AJFE 4YY3J 4M95A 1V3SA 4O0NA 3RW7A 4IH7A 2HG4A 4NRUA 4WU3A 4RUCA 4YHHF 2JLGA 3BO2A 5AXMA 2WBMA 5KT3A 2W7OA 2G9OA 2ZZTA 3NS5A 1GMUA 2ZC4A 5C2CA 2OJ3A 4KO0B 1WC5A 2G2OA 3WDOA 3Q8QB 1IBLJ 3D3BJ 3T1HJ 1HR0F 4GKKF 2DNRA 3GFHA 3GZ7A 3NAIA 1DURA 3B82A 4AT1B 1RT2B 4ECTA 1NKEA 1S5ZA 4RW6A 1R6YA 2BE7D 4LRDA 1GK8A 3WC0A 3AJ2A 3DYAB 4I6WA 5K8NA 2DGXA 4FF3A 2G1DA 4E2FB 2AGPA 1HBUB 4YY3F 1S76D 4P2XA 1M5VC 2YQ3A 4OV1A 1WSVA 5FDLB 3TUJC 3CPWR 1LV5A 4JI0J 1NSKL 1VGYA 2B9YA 2UUWA 3FVYA 2XC9A 4I4BA 1NK0A 3PO5A 5GAHU 1HFEL 2LDYA 3M9OB 2CPDA 3K5NA 1KNZA 2VONA 1VIXA 1WWHA 1RQ0A 4DQSA 3NNAA 4C0BA 4GKKJ 4LF6F 1UFLA 2R2RA 3MCMA 1IBCB 1WC0A 2M5YA 3KLVA 1AUDA 4U9RA 2G0JA 2UUCF 4PUOA 4BDPA 4DV0F 1NSAA 2BE9B 2IJNA 2F7VA 3I5CA 1FKAF 5FLXY 1Q78A 4DV7J 3DGVA 4KV8B 3P8BB 3BPSP 2VPXB 1WEYA 3QNWB 5KFPA 2JHEA 1RCXB 2R9LA 2N3LA 3BGLA 4CLYA 2GIRA 4TLQA 3CD7A 4CRJA 2FHKA 3QLHB 2V2VA 3D67A 3MM7A 4OHZA 1S6QA 3G86A 4DG1B 4S0MA 4R0EA 1N54B 4K7QA 2RRBA 4EBDA 4RL1A 2QEXS 3PEJA 3MM7B 5L38A 3QZ8A 2P6SA 2AV5A 1NSQA 3GWCA 1M90T 2AYBA 1NK8A 2ZITA 3D7SB 1OQ6A 3NCRA 4X4PA 1IM6A 3BKFA 4CO1A 3Q8RB 2DJWA 2NXJA 4B08A 3IR7B 5F8GA 4X65J 2O67A 3BDEA 2JFKA 2I6WA 2PI4A 2HFNA 4HHUA 1Y00A 3QGHA 1HL6A 2I2YA 4JV2A 5LJ3Y 2YBVA 3VAKA 4F3QA 2JVOA 2DEIA 4B3RJ 5K8OA 5KFHA 5KFUA 1RTJA 1FF2A 2EW9A 3FKBA 4WFNQ 1YWXA 2FY8A 3FK4A 3GYGA 4OX8A 4XTTA 3WQPA 4QPTA 3DM2A 2QFIA 1FRHA 2E1AA 3EE3A 1QTNB 5HMXA 3G2XA 3LPYA 2R2UA 4ECQA 4DL3A 2OPRB 2MHNA 2RQ4A 2VBWA 1SJ4P 4MFBB 2VG5A 3EJMA 3QT5A 1ULRA 2DNOA 3EZUA 2C2DA 2H65B 2X1BA 4F02A 2FJXA 3NGTA 3LAKA 3E2EA 1XMOF 1N88A 3UCUP 1FX2A 1FKOA 2DIUA 4QIEA 1GMWA 5DG8A 2FC9A 3BDPA 2MTLA 4Q45A 4C0HA 4PQUA 4R8UA 2MPUA 3D1HA 4KHPJ 3OFEA 1TTHB 4HACB 2QMXA 4DR3J 3CCWA 3N28A 3UPFA 4B3SF 1CULA 1CJUA 5A6WA 2VODA 3D1QA 1RU2A 2UU9J 1TL3A 2N4CA 4DHVA 1NZAA 1TL1B 8RUCA 2GHPA 4CM2A 1RHKB 2E1RA 1KSPA 3B8HA 1LWFA 2O1PA 4M63A 3CO9A 3D3CJ 2IMOA 2K06A 3SFGA 4FXVA 5HBMA 3TVKA 1IJEB 4OI6A 4FYYB 4CLKA 4QPXA 3QAUA 2Z8QA 4OFZA 1N5YA 4YQWA 1LWFB 2DD8S 3KK3B 1FERA 1TVRA 4BHQA 4C0OC 4R5PA 2V8GA 1DTQA 3VF0B 5EX3A 1KOOA 2K7KA 3HKZD 4AFFA 3KK3A 4Q8FA 2M8HA 1WI8A 1SB6A 1TL4A 1PILA 2CG4A 2EK6A 4LF4F 1RAFB 1DFDA 3C6UB 2RT3A 4OLPA 1ZOTA 3M2UB 4ID5B 4EEYA 2MZQA 2HQFA 2VQFF 2DPIA 1UAWA 1FX4A 2DGVA 2ZBPA 3C6UA 5ETRA 3LP1A 7AT1B 5IV4A 1H38A 4DV1F 2ATLA 4N41A 3SEOA 1VQSA 3OUYB 3IN5A 2DR8A 4C3LA 1AYEA 3GYXB 1T02A 3LP2A 3FNNA 1FESA 4G1QB 4G6VB 3TARA 4ENOA 2MEWA 1N36F 1HKAA 5I3QA 3R1LA 3M32A 3RAXA 1TFWA 3NOCA 1U6BA 1ITPA 3IS9A 3IRXB 1YRTA 2CAJA 3KK1A 2ASYA 2RS2A 4Y2KA 3ZZRA 1VBYA 2UXBF 4U7UK 1UA0A 2FLPA 5ETSA 1N6QA 1S79A 2PDAA 4ELVA 1PBAA 2NPFA 3MECB 4ILRA 1ZA2B 3MEGB 1PSDA 4OYMA 3ICLA 2I1RA 1CVJA 3HSZA 2O66A 1F5BA 1IKVA 1UVKA 2GHVC 1RP5A 1RZMA 2V2ZA 4JI8F 2XTJP 3QBCA 1XMQF 2RJZA 4EMDA 2MGZB 2RSQA 2J0SD 3MEGA 2XG8A 1MWQA 2OEMA 3HD2A 3LANA 5A0YA 3W1YC 2GQCA 2AX0A 4WKYA 2RHSB 5DM7Q 4B3TJ 1FFWB 4M5DB 2CPIA 4WE1B 1MMLA 5DDOC 3KLIA 1CC7A 1PKUA 4MIBA 2HS4A 1DTTB 5CYMB 1XR5A 3Q8PB 4LF7J 2R8KA 3GTYX 4WXWA 1N33J 3OTBA 1HNIB 4HDGA 1F3FA 2HIQA 4KHMA 4LF1A 2JDJA 4LFCF 1JXEA 1FE4A 2KJWA 3IBFB 2HEKA 2ZH1A 3I0RB 4JI2J 1HQ2A 4LVNP 2ZH7A 1WOPA 3H40A 1YJRA 1KLNA 3UDLA 3PTWA 1SKRA 5FLXU 4EZ9A 2AT1B 4CLUA 4K0KF 4NCBA 1VYAA 4USJC 4Q2LA 3SZ2A 2FZCB 1UWAA 3TW0A 1Y5IB 4NLRA 3DRPA 1OYEA 1RISA 1TL7A 1RWMB 3MAAA 3VGSA 4P7VA 2OIHA 2OHDA 4NLSA 4O4GA 1X5OA 4DV5F 1U1RA 1CEZA 3DRRB 2RQMA 3M6UA 4CWBA 5A8KB 4F4ZA 4LQ9A 1U6FA 2ABYA 3MAAB 3PHEA 2KFZA 1VRTB 3W2VB 3DI6A 2B4PA 2DNKA 2E7XA 2I5JB 2K8GA 4ZP7A 3MR5A 1U48A 2XZDB 1Z1ZA 3KNAA 4DR7J 4ANDA 1IJFB 1B99A 1VRTA 3B54A 1UZHA 5DG7A 1YBUA 2OSQA 3DI6B 1DLOA 3N5FA 3SFUA 2HVHA 2KT3A 3KG1A 4KKOB 2XWYA 3H5XA 2DO4A 2XMWA 5EHHA 1YBAA 1DLOB 1UPMB 4FZVA 1EETA 2VPWB 3MEDB 1E6YB 4YDDB 2ZHAA 2QMWA 4UT4A 1PJ5A 3T1AA 3T5JA 1HBOA 4JYAJ 1Z4UA 3VGTA 4ZJQA 1NO8A 3FSYA 1U7LA 2EVZA 4KAIA 1QE1B 2H4WB 1EETB 4FXDA 1DZ5A 1VISA 3U1NA 2VQEJ 1Q53A 3L9ZA 1AROP 1CBKA 1RT6A 1QDUB 4ZPBA 2BA9A 2DKOB 2V9KA 3KLHB 4Y2IA 3IG1B 3HM9A 5ETLA 2UVWA 1DHMA 4RJVA 2XMMA 3LO3A 3LP0A 4PKDB 4I6AA 2IAJB 3FCHA 4MJKA 2QE5A 2Q66A 1APSA 2VA2A 2YKOA 3V2UC 4MK9A 1X0PA 2COLA 3O8WA 4A8QA 2DBBA 2KJVA 5J1EA 2F65A 1FDAA 2DT9A 2A2DA 5JVHQ 1ZAXA 2CPJA 2F1FA 4OI2A 5F41A 4A8KA 4IOAQ 3SMZA 5KFJA 3TJ9A 1KHWA 3ZC4A 3PO4A 2HVIA 4KFBB 3MM5B 1TV6A 3GJTB 1PG5B 2V50A 2XNQA 3I31A 3VWSA 1X60A 1RHJB 2GJ2A 4I2PA 5F9NA 5B0EA 2QJ3A 1RWKB 4D3GA 1XERA 1RCOB 4UW2A 4ZLJA 5L39A 2V8DA 5ITHA 2FVQA 3SI8A 3Q2TC 4NCGB 4OYIA 4URGA 1NDLA 2ZH2A 4CIOA 1M0SA 2QMUB 1EAYC 3EMTA 1HIYA 4HDHA 3NGUA 4PG8A 1IXKA 1TZ0A 4IG0A 2EFQA 1UVJA 2CYYA 3BGFA 4X4QA 2W9CA 3LPEA 1J5EJ 2FC8A 2HQCA 4PWDB 4RX6A 4DLEA 2AZ3A 3GIMA 2K1RA 1HPZB 1KTVA 3E3XA 2XM3A 4X4RA 5F8HA 2RRAA 2AU0A 1AFJA 1YKWA 3KLGB 1K8AT 2BJ9A 3DMJB 1TAQA 5E3QA 4NXMF 2QLBB 2WZ1A 4WP9A 4F3OA 3G9CA 5KT6A 5G0RA 1BQMA 3DMJA 4A8YA 4X62J 2IY5B 1B4SA 2DGUA 1FXLA 5B08A 4LR9A 2B5JB 1AXQA 1XTZA 2V63A 1GQEA 2YKMA 1UEVA 3D68A 1R0BG 3I4PA 1B70B 5CYQB 5KAKA 4B3MF 1N56A 2CJBA 3IBWA 1MMDA 2B5JA 4CLWA 2QA2A 3HT0A 4WF9Q 3KLFB 2E7VA 1D8ZA 2GMJA 4UY85 4JI4F 4YR3A 3W64A 3L09A 1MLAA 4G65A 2NZ4A 3KLEA 1T9YA 2MQ8A 2XLJA 4GC7A 2FGOA 2GJIA 3M4XA 4MKVA 4J9RA 2OAUA 3DYAA 2YNIA 1H2VZ 1RWPB 2ZH4A 2YH1A 2FVPA 2JEIA 1SL0A 2QYGA 3H2VE 5J2QA 4DUZF 5K8MA 5KFIA 2FUG9 2F63A 3DLEB 3IR5B 2LCWA 4OQJA 2CFXA 1TL5A 1Z2LA 5KFSA 4AXIA 3RR8A 2IVFB 2FZGB 3ZNJ1 1KVKA 4ZLLA 4NA2A 4LIWA 4YP3A 3UW1A 1SV5B 3HHLB 3JAMY 1UJ5A 5I3PA 2RMLA 1HNWJ 4LF2A 2ZZMA 4GKJF 2XBPA 4LIRA 1IKXA 1KDNA 1KEKA 1UEKA 4JI5J 4W92B 5D4LA 3ZNUA 2MKYA 4YMEA 3V4IB 4LF9F 3HX9A 2VFVA 3PNIA 3I56S 1CPZA 4BC7A 5CCMA 4DS5A 3RU0A 5G4DA 1RK8A 1C0TB 2IM1A 2XHWA 4CLTA 4UOHA 4C2MA 4N8OA 5KFTA 2CQ0A 3CJSA 1OWXA 2IRYA 2QT7A 2KYZA 4X4NA 2JH3A 1C0TA 4AXJA 2APOA 4Y34A 3M2RA 1I5OB 1XMOJ 4JI4J 2GIFA 3TZYA 1C0UA 1FRJA 4ZVGA 3P4UB 2FHMA 4N7TA 2EG1A 4TY9A 2DNMA 4FS2A 2KHDA 1TMMA 2LFVA 2MZSA 4B3MJ 4L76A 4PR6A 1KHVA 3H5YA 4NXNF 3UCZP 4DFJA 2KH9A 3J7YI 3FUYA 3ILOA 4RWXA 4LSZB 1FEEA 4DR5F 5GMDA 2HS0A 3I87A 3BJYA 3CCLS 1HHTP 3A3OB 4ZVTB 3G6XA 3ZZUA 4CNYA 3OTOF 4ED5A 4HI2A 3HO1A 4DV6F 3NMRA 1H98A 2HFSA 2HNDB 4QIWD 1VBZA 2XNRA 4IOCQ 1HBNB 2QC3A 1KLMA 3VALA 1KRPA 2A6MA 1DARA 4RNFA 3CW2C 1SC6A 4F8RA 4WK3A 1ROFA 2MXYA 3GP9A 4FBTA 2M0GB 1CJTB 2BM1A 3TA1A 4FYWB 1WHVA 4H4MB 1I94J 3G87A 2Z2ZA 3AB4B 3ISNC 4J9UE 4NZ6A 1VLOA 5KG1A 1YI2S 1D9AA 2DNQA 3GJQB 1N5VA 3H98A 4NLWA 4QZVB 5HVFA 2LQBA 4YS2A 4Z7CA 4EYIB 3ENWA 2Y1RI 3KHHA 3D54A 4I1TA 2R8GA 2BM0A 4KR0B 3MUTP 2XB2D 1RT5A 4KJIA 1WDDA 1DQAA 4ERDA 1VRUA 1D0EA 4KRWA 4K4XA 2VICA 5B09A 1H6KX 2DNYA 1M1GA 1FNOA 2LVWA 4QJVA 5A76A 5L1KA 2GQQA 3UNYA 4A47A 2UV8A 4HACA 5KTQA 3MCNA 1FWLA 1S4EA 1T94A 2E29A 3AA8A 2ZBQA 5D0RA 3ENQA 3PHTA 4IQMA 1FTRA 4EBCA 4ANCA 1CJVA 3TZWA 1N5YB 4O3NA 1KVIA 1G7CB 1XIQA 4CZCA 1NPRA 1S99A 4AL6A 2FY1A 1OPZA 5E41A 2KYXA 1S6PB 5F0WA 4M5MA 2LA6A 3H25A 4ZS6A 2W2NP 4WIQA 4Z37A 1U1KA 3PR4A 2E1CA 4WKRA 3H59A 1FVQA 4CYUA 2BJ8A 1QSLA 4RZRA 4YHHJ 1C4CA 1RHRB 4DU7A 4A8SA 2RB7A 1F9HA 4C7QA 1J5OA 4QCLA 3EVWA 4J9NA 3OJSA 3I55S 4OMFG 2ZM6J 3KUGA 2NSBA 3TOQA 2ZVSA 2RF2A 2ZH3A 1W2IA 1Q4RA 1VHFA 4WTOB 4P52A 2K3IA 1YLXA 2AIRB 2DR6A 1NXIA 3CJ5A 3RR7A 2DXDA 1P27B 3SV3A 1GTEA 4QR0A 4X4OA 1HWLA 2LXUA 2C3PA 1EQMA 2E5JA 4IFVB 3S01A 4DJBA 3OUYA 3BGOP 2JEGA 4KO0A 5DDRC 4MKAA 4K4YA 2E5GA 4DUTA 4MIAA 3OVSA 1QUVA 1T0TV 2M70A 5AXNA 5H9EJ 3M32B 1RTDA 3QPIA 4ES2A 1YHQS 3Q83A 4MAKA 3QAEA 1RT2A 1X5TA 2IVMA 3QT7A 1N52B 4URQU 1NDKA 2WVFA 4BWJA 2HHHF 4PZVA 4EZ6A 1K0VA 4OI3A 4DI6A 2GGPB 4PG5A 1BUXA 1P9YA 3KHRA 4V19X 2R7UA 1XJWB 3FBBA 2BRLA 4DSKA 2CQ4A 3GIKA 1LXNA 5FDLA 3DKDA 1FVSA 1HNXF 1VI7A 1NMEB 4UOCA 5D4OA 3GIJA 2MGZA 4FS1A 2XLKA 2XYPB 3JXOA 4Y28C 2DVIA 1S0VA 5K20B 2YX7A 1X9MA 3KDNA 3P96A 2WRMA 3X3UA 1KR4A 3CMAS 3LOUA 4YB1P 2FLNA 2WW8A 3RG6A 5K14A 2F3JA 2JC1A 3HZGA 1T9TA 3RUBL 5DETA 4LT6A 3SIPB 3VTIA 3MUMP 2ZJPQ 1BXNA 3ITHB 4RR5A 1V5IB 2BZ2A 4WJBA 5IZHA 2AYMA 4USKA 5K14B 3CCZA 3GR1A 5IT0A 1FO1A 1JJCB 2DGTA 2RQKA 4OHYA 4DPTA 2ZE2A 4IDKB 4M5LA 4RWWA 1FT8A 1X4DA 5H9FJ 3RB4A 5E33A 4B3TF 2FLOA 3A8JA 3S6EA 1WG4A 4WBFA 5BXIA 3MFIA 1WDTA 3D6MB 1FNXH 2P5VA 3M30B 3BO3A 1XMQJ 2KT5A 3PIPQ 4ZPTR 3ZZPA 4ZN1A 3OFGA 4YB7A 3M8SA 2KB2A 1WEXA 2DISA 2HZAA 3DOLB 3FFIB 3PRVA 4F4WA 2FYXA 3DRRA 5CH7B 2KDOA 4OX7A 3ELHA 3G71S 3CMQA 4RW7B 3SSQA 3ZZOA 1Q5VA 1FDBA 3OL7A 5A6PA 3I9V9 4M5JA 2IM2A 2KVQE 2CPYA 2WVBA 4I68A 4QOTA 1BD6A 5D15A 4KYZA 4CLZA 5IM0A 4PABA 4WFAQ 2WK4A 2V6AA 1NKCA 3R7NB 1WC6A 4IO1A 1EX8A 1C1CA 1NB7A 2YX1A 4P71A 1B0TA 1JLFA 3K59A 2ALZA 4OJ3A 5F3ZA 2W7PA 1S1VB 4PPZA 3MPUB 4LR8A 3K58A 3DM2B 4M5HA 4EWTA 5GAEI 2UUTA 3ONQA 3TX0A 5L1LA 3B4MA 3NAHA 1NKBA 3H4BA 2C2EA 4KIAA 2CKWA 4NOHA 4ETXA 2B43A 2J76E 3CJ2A 2YWGA 3LGNA 4LFAF 2B9XA 1LK5A 2WONB 2DK2A 3NS7B 2C22A 4LRFA 1ZM3A 3GV5B 1RADB 2R42A 1FKOB 3HD1A 1T9VA 2D3O1 3AA9A 4IRCA 2PSZA 5DQHA 4PQUB 3HHNB 4YEAA 1PO6A 5GAGI 1KTQA 4G3IA 2NPIA 2EBEA 2WHOA 3BQ0A 2FDNA 2JX2A 3CULA 2UZAA 1RLDA 4JV5J 1WC4A 1Q81T 2CQIA 2KFYA 1QAJA 2B6AA 4DPYA 4B3SJ 2JRSA 4CM0A 2AHOB 1MW7A 4CT8A 3D9BA 2BQ3A 2DPJA 1NLKL 2R8IA 1UL3A 2H5JB 2ZWOA 4DFKA 3QGPA 4UQTA 1KWMA 2E5HA 4X66F 4DSIA 3RGIA 3T1HF 1HQEB 4KFBA 5KFRA 1FJCA 1S1WB 2ZEJA 2JJ4D 2ZNZA 3CGIA 2BJ1A 4CQ1A 3BN7A 1H74A 1HQEA 4F7VA 2OEJA 3I6PA 5HVHA 4NCGA 4YFUA 4ILMA 2M88A 2PE8A 3ILIA 3IM8A 1SVDA 1WOSA 1EB0A 3K5PA 2M2BA 2F9DA 4GO7X 3M2UA 4ID5A 2P9EA 3JSYA 2Q1LA 3GJSB 4MT1A 4QIVA 5ETNA 1IBMF 3N9UC 2HHUA 2VBYA 4F26A 4P2SA 3BBBA 3R7BB 3PV8A 2J8SA 1UA1A 2DIVA 3PX0A 2HGLA 4OZ1A 4XIUA 3EPIA 3W5XA 2ATCB 2K1RB 1VS3A 2DHSA 3HK2A 4M1KA 1RTHB 1V3ZA 2CNNB 1HD0A 1PYTA 1WKLA 4PYAA 3NLCA 1KC8T 2CPEA 3AJDA 3A4TA 5IOLA 3U1MA 2KKHA 2LA4A 1L3SA 1F9FA 3NP5A 3IS9B 3JSRA 4NA3A 1RTHA 3KK1B 3F56A 4JI1F 3BEGB 3BGUA 5ETQA 1OSDA 1WACA 5DG9A 3ET6B 3IRWP 2IC3A 3KMQA 4OX9F 3UD3P 3V6DB 2CWXA 3H2UB 4WZQA 5HMWA 3G4SS 1U2FA 1HNXJ 3GLJA 4O3PA 4RNOA 1SH0A 2IC3B 4ZLNA 2V8PA 3VCDA 1IKYB 4DF4A 4NYZA 4NLVA 1YJ9S 1BWEA 2NCKL 1SH3A 2JSXA 3C8YA 5C7PA 2QLXA 3VVUA 3KLEB 1J27A 5KFAA 5MLCV 1VQMS 1U45A 5F8LA 1IUJA 1MN9A 4C8KA 1T7PA 4K0KJ 2YNIB 3KKFA 5CYMA 3W7BA 3MR2A 2CZ9A 2ROEA 1K0TA 2J9CA 2L3MA 2E5IA 4BCAA 5J2QB 2XYGB 2ZC3A 4JI2F 2ADCA 4LR7A 2L48A 1FK9A 3QO9A 3DHWC 3PX6A 3FRZA 2HSEB 5JXSA 2RILA 3NXZA 2N3OA 3OTDA 3OSNA 5EWFA 1TR0A 1VIOA 1WTBA 3G6VA 3CDBA 3NGSA 3G8TA 2DRDA 3D1OA 4G1IA 2MZJA 5HANA 3CCUS 4RU2A 3EZ5A 5DRKA 2ZKTA 3OR2B 4USHA 3QRPA 3V4IA 5EDWA 2VASA 2ZDPA 4DPUA 2MQQA 4L6V3 4ECUA 3QIDA 4NLUA 4OV6A 3MMJA 4JI7F 4IH6A 1GMVA 2KM8B 4P2MA 4ECYA 4B17A 5AE2A 5GAHI 3BSNA 1WHWA 4DV7F 4LF5J 4ZVOB 3R97A 2BEFA 2W9BB 1N34F 4FVMA 3PW2A 3W2VA 2QO3A 3W9JA 3RBXA 4X2BA 2HNZB 3M2RB 4DX6A 4NI2A 4DV5J 1F2HA 1D8YA 1XBWA 2DH7A 2AEFA 2AGQA 2FVRA 2LQJA 3EX7B 2QA4S 3NGDA 2DXEA 3RZAA 3RBDA 1BMQB 3TZXA 1JKHA 2V4RA 4ZHRA 1HQUB 2XEXA 3MM9B 3QFHA 4USWA 2IM3A 1X5PA 3BR9A 2CADA 4N77A 1C1BA 3M8WA 1JKHB 5LXRA 1QE1A 3OW2R 1S4FA 3MM9A 1U0HB 1PGZA 1S0NA 5KFDA 5KFFA 3ZXWA 3DCAA 3ZZTA 2VUGA 3CVKA 4PXDA 4IYQA 1RT6B 3KLHA 2FIUA 1OO0B 1TUGB 3HHLD 4OYAA 2NR0A 4I69A 5EUHA 2B56A 4AQYF 4UZCA 5D3GB 5SUHA 4WFYA 1CJTA 2K7JA 1Y4ZB 3L4BC 4H4MA 2V5HG 2YQ1A 3IGNA 4DDFA 5CCLA 4RNMA 3ETOA 1U1QA 2BDPA 2DCLA 5BR8F 2HBQB 3PCOB 4OYOA 1JNRB 4OYZA 5HJXA 3W66A 1O0PA 1SCJB 2QV6A 4LSLB 1WUUA 4LF4J 1RT5B 4HT7A 3OJUA 2IA6A 4KQZA 1G4CA 3EGVA 1S7HA 2PC6A 1SBRA 5KT5A 2QLWA 3TI0A 4DR6F 3OTEA 4HT5A 4U96A 2VDIA 3N79A 3IP0A 3CMES 1FKPB 2AJ1A 1MWZA 4NMLA 3US5A 3M6VA 4X4SA 4JB8B 4CCHA 5B0GA 3M2VB 2OUGA 3O44A 1HHSA 1S49A 3K17A 2DHHA 4TKTA 3WX4A 1FA0A 1FKPA 1RAJA 4EGLA 5LXYA 1NK7A 4JV1A 2UU9F 3IFEA 1AZSA 2OPSB 2GX8A 5FIIA 4XPCA 5D78A 3WHIA 3EVMA 2FHJA 3I5BA 2YKNB 3A8IA 4CYUB 4F4AA 1GT8A 3IO1A 4J37A 5IWAJ 2BOPA 1XNRF 1B7FA 4KGMA 1MU2B 3IM9A 4LRCA 3R2DJ 3TAQA 1M5PC 1M5SA 5KT7A 1OJ4A 2UXDJ 3CCTA 4RBUA 3TR5A 3UDEA 1N34J 2HWTA 4F25A 3CB4A 3NNCA 1U2CA 2CPXA 2WW4A 2J6SA 3CD5A 2YKAA 1Q7YT 4B9VA 2V9WA 2WSFC 4P73A 2FJVA 1SI9A 2EEYA 5FJ4A 2CJXB 5CAAA 4JI3F 4IFVA 3GFXA 3T9ZA 2W24A 1X4AA 4DUZJ 1S72S 3MEKA 1V9OA 2GO9A 3KTQA 2GQ2A 3JQJA 4LRAA 1JNZB 3DLKB 2GA7A 4NMXA 4RW6B 5D4NA 3RBZA 2M9KA 1RTDB 1SJ1A 1VQPS 4ZPDA 1R8HA 2MZTA 2DGWA 5HP1A 2DYAA 1WF2A 3THVA 3RRGA 2HWHA 1P1LA 4O23A 4ZPWR 3ZTRA 1YVFA 3CIMA 3CJ0A 4HI1A 1TUVA 2WTFA 4ED0A 4QIGA 1HWKA 2POKA 3ULHA 1ZBTA 1NBEB 5HP1B 4P6QA 3GYNA 2VB6A 4OZ3A 1OYDA 5B0CA 5H9EK 1YTYA 4J5OA 2VA3A 4GKJJ 3FDSA 4P2FA 4ANEA 2R2SA 4ED4A 2MSSA 2F4FA 2CQ3A 4NZ0A 4DV0J 2HPUA 2KU7A 3TANA 3TUZC 1SV5A 2C3YA 3HHLA 4DQPA 1MROB 3LWMA 5K9FA 3KMSA 1OPIA 1IQTA 2NXCA 2OP5A 1N48A 1KP6A 2YPYA 4IUFA 1IKXB 4TYAA 4KHRA 4YR0A 2B9EA 2ROGA 5CA5A 1TKZA 1MROA 3PIOQ 2HLUA 2VJUA 3L7OA 1TK8A 1UVLA 3QJLA 5LM7E 4ECWA 1A0OB 2VC1A 2ZNYA 4EYHB 4KV8A 3M9NB 4DLGA 4K4ZA 4K4UA 1SKSA 4C8OA 1C4AA 4ZJLA 2J6UA 4J9VA 1BE4A 4ZPVR 5I42B 2ZD1A 4KE5A 3OL8A 4L74A 2ZE2B 2R4FA 4IDKA 5KT2A 1Q1KA 3TNVA 1RXOB 2EFOA 2IRUA 3Q2SC 4AUKA 4DL7A 1UTAA 5IC4B 3GILA 3CJKA 1S6QB 4RBVA 2OPQB 3W5YA 4IH5A 2V2QA 4Y0FA 1JMTA 1QAIA 4P72A 2Q43A 5LMNJ 1UJ6A 1UVIA 3DU5A 5GADI 3HULA 1R27B 1W25A 4QYZJ 2YKPA 3OVAA 3HVAA 3CJKB 1CG2A 1XN9A 4PWUA 4OLOA 2DNGA 3DU6A 3DOLA 5E0OA 2MQMA 4NA1A 1N5TA 2RNEA 3AT1B 3OBIA 1F5AA 4KGKA 4NX9A 3VGUA 2CJKA 5KFGA 2MMYA 2MLZA 4RW4B 5KFWA 1DRZA 1Q5YA 2ILYA 4G1PA 2HWIA 4LF8F 2D3UA 3QJJA 2W4PA 2D3OR 2LU2A 3DLGB 4EO6A 4M8LA 4W98A 3GIIA 1LW2A 2UUCJ 2Y3YA 4TY8A 1RTJB 5E2QA 2J9EA 3TX8A 1HR0J 4QYZK 2HS3A 2IYIA 3A3PB 3HSDA 3H8YA 3E01B 3QWUA 5GMEA 2GJFA 1C1CB 1DY3A 1Y5LB 3OFHA 2VOOA 2QGFB 4ZVFA 2G0CA 1CQNA 1Q79A 2OPRA 3ZTOA 3OPKA 3MM6B 2VG5B 4F4YA 1S1VA 4LRBA 2Y1LB 2JFDA 1X8DA 1LWCB 1ICEB 3BQ1A 3FMWA 3EGNA 3UE2A 2MQPA 1I94F 4OL8A 1VK3A 4C9DA 2WCXA 3JAMU 4C8YA 3DOKB 1LWCA 3ENVA 3RB0A 1PAEX 1RA7A 2BJEA 2J9DE 1NPKA 1OS5A 1U09A 1N8RT 1QVFR 2Q3PA 3H20A 1ZTTA 1U1PA 3BQ2A 2VDHA 4V1Ak 3AH6A 1PAUB 2F8HA 2G2YA 5BYSA 1TL3B 2FPHX 3HSJA 1TL1A 1UETA 2HHQA 2C2RA 1WSRA 4CP5A 2LEBA 4KB7A 4F67A 4U7UD 4YDXA 1R31A 1SPBP 3EUNA 3MAHA 2HK2A 3T19A 4DPWA 5HBMB 1S7IA 1DQ9A 1MMNA 4WXOA 2OEKA 1S6PA 3IC1A 1S1TB 1LOUA 4CLLA 4QU7A 3KG4A 5B7WA 1WORA 1T05B 3D6HB 3O2IA 2AJ2A 3HVWA 1RBAA 5F9LA 4WWSA 1S1UA 1SC1B 3U1LA 2H1YA 3DGPB 3MMBB 5CD4H 1LWEA 4FF4A 2YNFA 4GVLA 1PJ7A 1B7YB 2HFZA 3HXMA 3VV2B 2X1GA 1P1TA 2PT0A 1VQ6S 4BS2A 1UZDA 3KUEA 5KFNA 1U26A 1AUSL 3U27A 5KFKA 1FJEB 3IMQJ 3EDQB 4FXWA 1XMBA 3KWMA 3S1TA 2R8HA 4LBPA 5BJRA 5HLFB 1H7XA 2HBYB 3LA0A 3NBPB 4FKXA 1IR0A 4JP8A 2A6OA 3N6NA 4Y3CA 3C15B 2QX0A 2PA3A 3EWGA 2XCPA 4DR4J 2V0NA 1QAXA 3UR0A 3C19A 2BQRA 4LMZA 4O3RA 4K59A 3VAMA 1WC3A 3HHKA 4FPRA 4F04B 2J9DA 3C15A 3MF5A 1RYRA 2RS8A 1JX4A 2HAIA 4MMOA 4OIXA 5T41A 2AQ4A 4USMA 2OELA 3KXDA 3FEYB 3WBZA 5E5NA 4Y65A 5KG5A 4CH0S 2CJ9A 4USTA 3FBEA 5DM6Q 1MSWD 3J7AN 3ZZ0A 3V4MA 1KONA 2FJWA 2BR0A 4M5DA 5DQIA 1IKYA 3EVOA 3MAQA 2PMWA 5FD1A 2MQLA 3GR0A 3I0SB 5EGYA 2HW3A 2ZHOA 4O3QA 4Q0BA 1YJ7A 1CC8A 1Y9OA 2W25A 3V6KA 5DZ6A 3HCXA 5HAOA 4X4TA 3VAIA 1YIJS 3IWLA 4QBUA 1JJHA 3I0RA 3EM1A 2VQFJ 1Q0NA 2H51B 2C2KB 3T1YF 3JB9k 2ZBIA 4KGXB 4DR4F 4L75A 1R8AA 3W8PA 4DV4J 2D3ZA 4GRSA 3HJVA 3W3SA 1Y11A 5BR8J 4FDFA 1X4CA 4M94A 3WX8A 2HQDA 4ZVPB 3AY0A 2YH0A 4D3HA 3HHEA 2XI3A 1Y10A 2DNNA 4HTIA 3K5OA 1K1SA 2LP4A 1ZPVA 4OYBA 4YB6A 1NCLA 5A2QU 4DX7A 3FGVA 4ED1A 2Z2LA 3EGZA 6FDRA 2H9ZA 2BVZA 4FNHA 1MWYA 2EKNA 3FFIA 1XWLA 4Z2XA 4FYVB 2D9OA 2I5JA 3J7YU 4J91A 3R27A 4J7CA 3PKMA 3PRDA 3MR7A 1YZ6A 4CT9A 5EWEA 3OD2A 2KXHA 2HQIA 4P74A 4PYDA 4ELUA 4NI2B 4DSEA 3L7UA 1LXJA 1MG7A 3ILLA 4YN3B 4DV1J 1NH7A 2CDQA 4USIA 5J2PB 5IT9U 1SIZA 2VG6A 3EGWB 4ID8A 3CEDA 3TAMB 4CI0B 4F2RA 3OVBA 3W5ZA 3MEDA 1E6YA 2PFFB 4W4MA 5J2PA 3G82B 1WHXA 2CIMA 4X64F 3TAMA 5HROA 4F4KA 2GHWA 3MPWA 2RAQA 4CH7A 1GNKA 1YQHA 3OTCA 2Z30B 4ICLB 4EO8A 4QWAA 3G82A 3NNHA 3R8YA 2EG2A 5HROB 2B4VA 3R9LA 1S1XA 3QGIA 5K8PA 3IWNC 1T03B 2F4VF 1OMSA 2JNJA 3OXGA 2DR9A 4LF5F 2WONA 3GFZA 4U95A 3X1LB 5K5MA 3PVXA 1VBXA 2Y0BB 1XEZA 1Y7PA 3A3NB 2HHTA 5CZVA 1FNMA 1REVA 1RUSA 1M5HA 1YJNS 2C3MA 1O6XA 1HWIA 2LQ9A 4TLRA 2XSJB 2AYEA 1U1NA 4B3RF 1GAOA 3GG1A 3GFYA 4OHXA 3NRBA 4R0JA 1QY7A 4QU6A 3DLHA 2QL7B 4DR1J 1H73A 1ACMB 2XSJA 3DDIA 4XO0A 2B6AB 1G2EA 2BKNA 3A8KA 3HMJG 3PYEA 3PZPA 1TV6B 2YPZA 1PYSB 2CXEA 3UD5A 5KG7A 1P6TA 1RLCL 4PG7A 2VL1A 2BANA 4EBEA 3HJFA 4M5GA 5J2NB 1NPPA 4TQRA 2HHPA 1EZZB 2HZCA 1KKHA 4DR2F 4FP9A 2A3JA 2RUSA 5JMNA 2RIJA 3N4WA 4ZCMA 1RAHB 4IG0B 4ZJOA 5T7LA 3M2VA 1JB0C 2YWFA 5HVGA 2C2OB 1GFWB 2X3DA 1VFJA 4L73A 3V6JA 2OD6A 9RUBA 2R2TA 3TJ8A 2G13A 5HSPA 1HMVB 1NZ8A 2IRXA 3Q86A 2XY5A 1R7IA 4ALZA 4QYRA 3CJTA 3W9HA 4C3KA 2HKEA 5L9XA 4JUZA 2SXLA 3TEHB 2Y1IA 1HMVA 2XLIA 1U1OA 3UO0A 4Q5VA 2B8QA 4ZVQB 1D1UA 4LVOP 1IBKF 1ZAWA 3H0PA 1KQKA 1QUPA 1SL2A 1VC6A 3R5AA 1S10A 2VQEF 4A8OA 2L41A 1Q86T 4WP3A 1GTHA 2YXLA 4U8VA 2C2ZB 2O3DA 1LK7A 4PCQA 3UFCX 3SXLA 2RUGA 4ZMMA 5L9NA 1YJWS 2QZ8A 3L95X 3M8RA 4LFBF 2R7XA 4A48A 1FWKA 3IAS9 2ZOGA 4CTAB 4QW9A 2MKCA 5DDQC 2KI2A 2CJQA 2R7OA 2ZKUA 3ADAC 3KLFA 8AT1B 4NYPA 3CSKA 5IS2A 2L9NA 1S0MA 1PYOB 2HAFA 3CCMS 2ACYA 4JI5F 2LU1A 1FRIA 1RAAB 2WOMA 3PG9A 2NQPA 3KOAA 3DLKA 1B3TA 1IM4A 4OX9J 1HNWF 4HYKA 1TFYA 2A10A 4DR7F 4DL2A 4MTPA 3G8SA 2CPHA 1S9GA 1I51B 2F5GA 4HHHA 4OI1A 2QG9B 2DGSA 3OR1A 2BJ3A 3Q0AA 2C2MB 1X4BA 1ZPWX 1S9GB 2CQHA 3CJ4A 4U8YA 4F2SA 5KFBA 1JIHA 3QIPB 2MKJA 2QN6B 7FDRA 1H3DA 4H4OA 2ZH6A 2QA4G 4DR1F 2J7UA 4PQAA 1FE0A 3C2PA 1R0CB 2FHOB 2HFUA 3CE8A 4KPYA 1IWAA 1QD1A 3R5CA 2XGPA 4H4OB 3UVJA 5KG3A 2XS7A 5LMUJ 1FXDA 2NLWA 2UVRA 1B0VA 5AXLA 2GIQA 2XHCA 4FF2A 2K3KA 2OD4A 2X51A 4M5IA 4XDDA 1D9DA 3U7JA 4OI0A 2MLXA 1O8BA 2DGQA 3MURP 1I6JA 4P7TA 2I9SA 2QLJB 2GVDB 2BKPA 4TNOA 4DL0C 1UMJA 4CNZA 2NZCA 5LOQA 2EI5A 2VJVA 1AT1B 1CSJA 5I42A 4OYWA 1UWBA 3PFOA 2W9BA 2CPFA 4OX6A 5KFZA 4CO0A 2ZJQQ 5B0DA 2IBKA 2LXIA 2Y8WA 4X66J 3N01A 2HNZA 1IWGA 3MWBA 5HI7A 1FHTA 2YNHB 3LH2S 3FQLA 4ELTA 2Z4PA 3UR3C 2UVVA 2NS1B 3MOZA 2VIHA 1ZYQA 1CS4B 2CQPA 4NLXA 3MMCB 3H5SA 3ZO7A 4ZLPA 5KFQA 1FRKA 5AJ3J 4AQYJ 4ZHRB 1CS4A 1NJWA 2BV3A 3JQMA 2HHSA 1R43A 3MCOA 5KFMA 2FJEB 4KBIA 2HNDA 3TUPA 1HBNA 2AJ4A 2Z57B 1HNZF 1YDLA 2PGCA 3ILJA 1U0HA 2G1HA 3SSSA 4E98A 5CHCB 2GVZA 1NJIT 1X31C 4HLBA 1F5CA 1UCNA 1ZS6A 3M7VA 2PIIA 4TY8B 5GVQA 3UCGA 4H4KC 2IMWP 5HQMA 2VBZA 1RT4A 2QRRA 2ZFHA 5ETPA 3E01A 2AZ1A 2VZ9A 2A18A 4LBHA 1UP1A 4CLPA 2Q79A 3MM6A 5KOXA 3THPA 4IQXA 4J90A 2XI2A 2AKWB 3BO4A 1RBOB 4DQRA 2N82B 3WIUA 4V19J 3BBCA 5KFVA 2VD3A 2X1FA 3W9IA 3I82A 1W7WA 2ROPA 4LSLA 2V8VA 4P75A 3A12A 1NDPA 5L8RC 3MI7X 3NWGA 2K2PA 1TQLA 5U47A 3SBMA 3UN2A 3VVTA 1L3KA 4JBCA 1JJ2R 4OZNA 3SQGA 5DLFA 4X4VA 4XK8C 1FWPA 2VBXA 3NG8A 4NXMJ 1CJVB 1UFKA 1N4LA 3ZTQA 1CQMA 4FF1A 2XMAA 3RRKA 4QWCA 1RE1B 3CNQP 4P10A 1HYSA 5F8IA 1WNEA 3OTOJ 3EZOA 2CNOB 2XZTB 4DZDA 1AZSB 2OPSA 3SCKE 5AXKA 2X1AA 2IBOA 3H7HB 4UOFA 1BLUA 1SKUB 1YBTA 2R8JA 4NPOA 4DCPB 1B64A 3BYPA 2YKNA 2CQCA 2M4MA 6AT1B 4C8MA 1Q16B 2ZBRA 2OO4A 2ZVIA 3MMAB 1KQFB 2JEFA 1K9MT 1OY9A 3MM8B 2RF2B 3J7A1 2H54B 2NUHA 4CO2A 1BWVA 1PC4A 2GCFA 3PJ9A 1SKWA 4FBUA 3MMAA 5M2RA 1DJ0A 3DXBA 2LQ8A 4X4UA 3BR8A 1IBKJ 2D1CA 1FCAA 2VFRA 1EHWA 2VKRA 5HK4A 2A1BA 4N47A 4N8NA 3TUIC 4DX8H 5HMYA 4J9OA 1M1KT 4DEZA 3HPOA 1KQSR 4B9UA 2DRAA 2E1PA 1G1XA 1RT7B 2GNKA 2J8AA 3PJWA 1HHQA 4K4SA 2CG8A 1X9WA 3ISZA 2IDLA 4Y2MA 2IVYA 2VPZB 1NHKL 3K57A 1HW9A 3OXFA 1VQKS 3RB3A 4JI1J 2XY6A 3L3CA 1HA1A 2W4DA 4HH0A 4K4VA 2RE1A 4WK1A 5F0UA 1M1HA 1JXLA 3CJ3A 3A8EA 3GSDA 1U0SA 2FLLA 2V67A 2V4JB 3W65A 3DN9A 3I96A 4OJ1A 3KJVB 4ZA1A 2CJYB 3FJ2A 5D77A 2MB0B 2ASLA 2XZWA 2BX6A 3D4JA 4FVCA 4NLYA 5EX0A 2BW2A 1K44A 4X62F 1QSYA 2FJAB 3J81U 2WSEC 1AB8A 4TXSA 4CO5A 3D66A 2DXFA 2DNLA 1UVMA 1EQ0A 2V8HA 2RRNA 3TEGA 4Q0BB 1VK8A 4CO4A 2BJDA 3DXSX 2PMHA 3ITHA 4TYBA 1FD8A 3V5RA 2PFDA 1TKZB 1H0HB 4TN2A 2WB4A 1U02A 3LF0A 1VBKA 5F8JA 2UUBF 1F0XA 2CJAA 2VG7B 5F3TA 4JI0F 5A8RB 1GH8A 1URRA 2CQDA 2H4YB 3N0VA 1L3TA 4PUOB 3CCQS 2B51A 2DY1A 4WFZA 3M1VA 1M5KC 4ED6A 4Y2AA 4LF6J 1IVZA 2VHGA 1ZZNA 1OQ3A 2HZVA 4ZVSB 3DHXA 2ASJA 1L3VA 3BBFA 2BACA 2JC0A 1RHMB 4DN0A 1LQ9A 7FD1A 1A7GE 3BGRA 3BN4A 3HHLC 3M8QB 2DEJA 3DOMA 3FBCA 3M8YA 3MDFA 3PDNA 4HVZA 1B0PA 4MYTA 2QL5B 4CDIA 3R2CJ 1RT1B 1WKJA 5IWAF 4IRKA 5AE1A 2YWEA 5GAEU 2WVEA 3BGRB 4DG1A 2F9JA 2IA0A 2J0WA 3HVTB 1IR2A 4RW7A 2J0QD 3QSIA 4DV4F 1RT1A 3GMGA 3FEZA 2DGOA 1NK9A 4ZK7M 2LECA 3NKYA 5B0FA 3MGJA 2MY8A 4BLGA 2DRBA 2EFVA 2HVDA 4C3MA 5KFLA 1X5SA 2ACMA 1KOHA 2MHEA 3G8QA 4R25A 5IM0B 4DX5A 3J7ZT 4OHVA 2HQ3A 4WP8A 2OSRA 4P9SA 2AF6A 3DLGA 3CO0P 4OZJA 3LWLA 2ZH9A 3DRSB 2JOQA 4USVA 4C8ZA 1QSSA 1MN7A 2LQ5A 2PN6A 2FVSA 3C46A 3H42A 1U1LA 2XGQA 2FD2A 1T3NA 4ECSA 4UOGA 5IT4A 3FSXA 2XO7A 2R7TA 1EJ7L 2RDDA 3C16A 4FN5A 4TU8A 3J80U 3BB5A 1FJGJ 4UZBA 1WI6A 3C3LA 1HI0P 1GMWD 1A6LA 1TKXB 3H5UA 1S0OA 3GE9A 1ZTWA 1YGYA 3BS9A 4Q8EA 4MFBA 1T03A 1HI1A 1REGX 4KGVB 3DOKA 3VZHA 1RHUB 1TKXA 2XO6A 3OSPA 1UPPA 4ECRA 2MKSA 4PPDA 3D6FB 1RTIA 4NLTA 2R7RA 1D09B 2C3OA 4HL9A 3CWJA 1REVB 1VMBA 4EUVA 2YTCA 2DHAA 2ZUGA 1K47A 4DU8A 2KVIA 5KT4A 2CA9A 4RW8B 4KGZB 1N5SA 2XWXA 3EXYA 5C2GA 4R8UB 3HT3A 2HHVA 1GX5A 3H4DA 3BSAA 4K4TA 1H2TZ 1PIEA 4QIFA 4O44B 1X4EA 3T5HA 1KVJA 2OI2A 2YWHA 4RW8A 5BYRA 2DR5A 2MY7A 3GV7B 2VKZG 1NK5A 2YWKA 2ZZNA 4NE9C 1PCAA 3DRXA 2OPPA 1YX2A 3CDUA 2LMIA 4E0DA 2XS2A 1O51A 4I67A 3CDEA 1TKTB 2OMLA 1S77D 2XS5A 2EFNA 5J2NA 4KHPF 2Q6BA 5IXUA 4U7CA 1WEZA 3AFGA 3KYLA 4IRDA 1VQNS 1LW0B 4ED2A 1S1UB 3WIVA 1FRLA 5HATA 4F0MA 3DGPA 5B0BA 1DTQB 5H9FK 1RT3A 4HEA9 1RWUA 2FJDB 2AX1A 1WTFA 1YK9A 2YQ0A 4L3KA 4NLDA 4UTGA 4ZP8A 4U67Q 1LW0A 1K1QA 2PD1A 3AB2B 1EKSA 3W60A 2E66A 4OYPA 1X0FA 4C8LA 4B9LA 1ZZFA 2XMTA 1H72C 3ZFVA 2VC0A 5KFXA 4JV0A 4KTQA 2OFGX 2C3UA 2W2MP 3FSIA 3LW5C 4C4WA 4A8XA 2HNYA 4HR2A 3HI9A 1RABB 4ZIWA 1GEHA 3JTNA 1VRQC 3SV4A 1O5JA 1VOMA 2HNYB 3LTOA 4J9LA 1G6BA 2P9GA 4FYXB 4QR1A 5ADZA 2AYGA 4DR2J 4UF4A 4WFBQ 2KZZA 1F3VA 3ET6A 5E3CA 3V6DA 4I64A 2NYIA 2ZM6F 3GPAA 1YRUA 4I2QB 4ZDNA 4N56A 1UVNA 3FZ2A 5D6GA 2XQCA 4B9NA 1N32J 1N6QB 4PG6A 1PJ6A 3FC9A 3NWRA 3PXGa 2MQOA 1RI7A 1VC5A 3DLJA 2UUAJ 1JWWA 4I2QA 3NMAA 1NH8A 1TKDA 3KFWX 2F40A 4FPIA 3Q8SB 2D41A 1W26A 3F41A 4DXLA 2L9DA 2PEBA 2H3EB 3JS9A 2KO1A 2UXCJ 2AEJA 2WOMB 2N7CA 2NUUG 3NEKA 4MKBA 5IFMA 2FHJD 5C5JA 3EYZA 4LF7F 1N33F 3I0SA 4RLEA 4B3OB 2RH3A 2P2CB 2OTJS 1FDDA 3MTKA 2GW8A 3FCWA 5B0AA 3MR6A 1T8EA 1SQFA 1Q8KA 2IPOB 4B9SA 1FK9B 2QYCA 3QO9B 4B3OA 1U8WA 1S6UA 2N4DA 3OLAA 2DB1A 4XPEA 1HNIA 3QIPA 3SCIE 1SC4B 3OFFA 3CC4S 1VDHA 1WKKA 3AOCA 5GAGU 1NU4A 4DUYF 2KXFA 3OL6A 2KM8C 2PA8D 2H5IB 3W61A 4NLPA 2ZWPA 4RU9A 3OR2A 4F3MA 4ER8A 3AAWB 2YX4A 3DDNA 1N0VC 5JUMA 4WCEQ 4H4KA 4IO9Q 2MZRA 1IBLF 3NOGA 4NEZA 2NXUA 4ZP6A 5M2UA 1CJKB 3F44A 3MEEA 4I7FA 1K73T 3N5BA 1FDNA 1RBLA 3J80Y 3HSGA 2G0IA 1V6HA 5I4MA 1ZETA 3P6YC 1BQNA 1CJKA 1JLEB 1S6OA 3AD7C 5KFOA 2JEJA 3MEEB 4MKYA 3QMQA 1TMJA 3GB0A 2LLZA 3RJMB 3ISND 1UWBB 1WD6A 4DCJB 1JLEA 3NCPA 5C25A 1T11A 3HKWA 4PXEA 5D8HB 2A0FB 3TRGA 3QYYA 1NDCA 3DNCA 1NM2A 4LREA 5C25B 1WF1A 4IFYA 3BH7B 3R7SB 2L08A 1LFPA 2VG6B 2P8IA 4BC9A 4EU0A 1HQUA 3L7PA 1BC6A 2O01C 4O4RA 1KS2A 3VZIA 4DPOA 2HHXA 5E3PA 3W62A 4FYDA 4M5NA 1AA1B 2OLWA 3I5AA 4DSLA 4RUAA 1RWWB 1LKZA 3HVRA 2W8KA 2AP6A 3DRYA 3CXCR 2RQCA 3K8VA 2EWHA 1HBOB 3NGKA 5BYQA 3U02A 3UN3A 3GONA 4ES3A 3VAFA 2HFOA 3MFHA 4UQGA 1S1XB 1S48A 2JWNA 3PJXA 2E44A 3O3LA 2QSFA 1I3OB 2GVZB 2AGOA 1GXLA 2BKOA 3GU0A 4N5SA 1JLQA 1W2BR 1S9EA 3T9NA 2BOAA 3K2YA 3PM9A 2GFFA 3HFVA 3V81B 3KDOA 4DWIA 1SIWB 3M8ZA 4DS4A 4RW9B 3CCRS 3CC7S 1A9NB 2YVSA 1RKJA 1JLQB 3MD1A 4KPCA 2YY3A 1Y5NB 3P45B 5I3UA 3VQSA 2C1EB 4K5RA 4RW9A 1WJ9A 4LSNB 2NYHA 3UDVA 4F36A 5JJBA 1RDRA 5MAOA 4AL7A 3CUNA 1E6VA 1M5OC 1MNEA 3UQSA 2NSCA 3OL9A 3SDEA 4ITSA 1E6VB 4LBIA 1KFSA 4WFXA 5IQ6A 3S7RA 2Y9HA 1FRMA 4AE5A 5C24B 2UXDF 3MM5A 1NJYA 2LYVA 1TP7A 4KH1B 5E3AA 1U25A 2R7QA 5THWA 2N7YA 1YRXA 4I2PB 5RUBA 1FJ7A 3TAPA 2KHCA 3BYRA 3MHYA 4ZVRB 5C24A 8ATCB 2QTWA 2WAQD 3OHAA 3B6BA 1HYSB 4RNHA 3M6WA 1NK6A 2MJUA 1JLCB 3PY8A 3P49B 4L72B 4NLQA 2ZJRQ 3TZZA 4OJHA 4DQQA 2BXJA 1Y3JA 1AFIA 1MU2A 3QQCD 1QAYA 4KSEB 2GV1A 1T3OA 2W9CB 4X84A 4ZIVA 3MZIA 2GC8A 3QFWA 1SUQA 3PYDA 2HYIB 1HPZA 2HGNA 5C42B 1RAOA 5IV3A 2HVEA 5T14A 3CC2S 4F50A 3DFEA 2EKYA 3POTA 1UKUA 2HVZA 3BV8A 3IAM9 4B9TA 5C42A 2HRYA 4Y00A 1JLGA 2YWWA 3AJ1A 2D9PA 4MK7A 3PW4A 2FTRA 3GCWP 1GXTA 1CLFA 1R8PA 4ZOSA 3QRQA 3EXCX 4CTAA 1IBMJ 3LAMA 4QR2A 4RPFA 2DH9A 3BZQA 4IKAA 1UW9A 2YKMB 5CYQA 1RT7A 4K5SA 3SYZA 4JI8J 4O3SA 2Z0GA 3C66A 3UN5A 2J7KA 1J5EF 3K0JA 1VQYA 1RTZA 3DDKA 5HO4A 1SJFA 2KT2A 3JYTB 1SH2A 2WBRA 3BREA 4Q44A 1J2VA 4XAKA 1BY9A 1T9XA 3I4HX 3Q23A 1HBUA 2H5EA 1IQZA 4JOUA 4F0KA 5J2MA 2R7VA 1IN0A 1YJVA 2M52A 3RYLA 2W8LA 3M8PB 3CCVS 4QQBA 1Q8BA 3TP2A 3BM7A 1FEHA 2V4JA 3JSBA 3CD0A 4NLGA 3MOJB 3KJFB 1EKRA 3T5KA 4DFMA 1U8SA 3KJQB 3PX4A 2B4OA 3P5TL 4DV3F 3DLEA 4DL6A 3H2LA 2IYGA 1S12A 2AEMA 2BMBA 5ETMA 1YITS 4BWMA 3ZTPA 4OJGA 2ZHBA 1NEEA 1Q8IA 2GO8A 3GCXP 4WPAA 1QTMA 4UY8T 2QL9B 2XMJA 4CO3A 3IR6B 4AD6A 2VF3A 1ZAVA 4K4WA 2LDIA 3AD8C 5D0EA 2CDRB 5EN1A 4Y6IA 2EK1A 2BJ7A 2XY7A 1P9QC 5AT1B 2YNGB 2ZD1B 1RACB 4PEOA 4WIIA 3GQCA 2ZH5A 2GVDA 3TA2A 4LQ3A 3QRRA 3C6TB 2AJQA 4NYOA 4DUYJ 1KFDA 2Q6CA 3TO8A 3KG0A 3QJPA 2AMCB 1HD1A 1Q82T 4JI6F 5GADU 2XSFA 2OPQA 1R89A 4OI4A 3C6TA 4PXBA 3J81j 2YKQA 4A8MP 1ZM2A 2B9WA 3Q8YA 1EIYB 2DNZA 3UNGC 4GMKA 2ZOMA 4C97A 1XC9A 3QLHA 4JI7J 2R3VA 1C0UB 3M8QA 3T1YJ 1ZM9A 3DOMB 3VR1A 1JLAA 3HHDA 3OQ2A 1ZM4A 3AQPA 1NJZA 3W2WB 3R6GB 1U6ZA 1PC5A 3AODA 4ZITA 3PR5B 2DR7A 2QLFB 3HVTA 4RW4A 1OY6A 3K5MA 2ZUAA 2EC0A 3W2WA 3ZZYA 5DGAA 3LQVA 5ETTA 4RBTA 3ZZZA 2GAHC 4CLFA 3CCJS 2V68A 3V6HA 2UUAF 3TA0A 3JTPA 1LW2B 3KJNB 3M9MB 4WZMA 3M05A 2RDIA 4ECVA 2WVDA 1OSCA 2IJFA 3QATA 4LF8J 2HMIB 1LNQA 2VFTA 3MCSA 4ZCLA 1HNVB 3Q8VA 5CABA 2QIFA 3DRSA 4TU7A 5D0HA 1R8BA 3PYGA 3AXMA 1U24A 1RAGB 4HKQA 1UFWA 1RT4B 4ILLA 1WELA 1NRKA 2B7CB 2Y0SD 4MIWA 4A4JA 3MUVP 2BE2A 4KT0C 2C42A 5L1IA 3O6QA 3EPGA 2E5LJ 4NLOA 2DHGA 3I9ZA 1XK8A 4ECXA 1JXVA 4URSA 1NAQA 3HP6A 2IIHA 4PG4A 2X7IA 5IC6B 3RAQA 2UVUA 1RTIB 1TUWA 2Y1JA 1BQXA 5IT9Y 3CD6S 1G3OA 1RAEB 2B7BB 1CULB 1CJUB 1Y3KA 3HFZB 3IXQA 4M5KA 4ZVHA 1HWUA 3GSIA 2ASDA 3D6TB 2DITA 3MD3A 3MXHP 2E9ZA 3OT9A 3HF5A 2MKIA 4O44A 2RHQB 2AW0A 2L9WA 4KC5A 2Y8YA 4U6PA 4DSJA 5DO2A 2CWKA 2F8EX 1HWJA 1S1TA 1JLBA 4OZ0A 4PXCA 3OLBA 1WOOA 2EPIA 2M8DB 4F4XA 2OPPB 1NHUA 2ZBCA 4J9PA 1TVRB 3UWTA 3T3FA 2GMLA 4R5PB 3BPDA 1NNDA 3MMBA 1F60B 2J0XA 4ZP9A 1VJQA 1LWEB 1SXLA 3CJ8A 3E8OA 5CQGA 2YNFB 2XCAA 3RTVA 1TAUA 3AOBA 5E7OB 3CTRA 3R5DA 1WHYA 4CLSA 5J1NA 1T9WA 2WB1D 3QT6A 5KOWA 3D5MA 4J9SA 1J5OB 1RT3B 3R5BA 3R1HA 1FFSB 2B0GA 4FKYA 5CXTA 1ZH5A 5CZXA 2V4QA 1VJWA 3I32A 3K5LA 1HNZJ 4Z7YA 2PI5A 5SZTA 3LP1B 4OHWA 1X4GA 1XQIA 3CIZA 4E8UA 3J81Y 5HLFA 2UP1A 1VQLS 3NBPA 5AJ3F 3T6BA 3NCQA 5JVGQ 3LP2B 4G1QA 1Z2ZA 4EK2A 1LEOA 4LF9J 4RNNA 5ETOA 4O0IA 2D74B 3AQOA 4IR1A 2HQGA 3PW0A 2A2CA 3GG0A 3CDAA 1BGXT 5DGBA 3D2WA 4NL5A 4J9KA 1X9SA 2F4VJ 3AOAA 3D0IE 3LGMA 4DPXA 3MECA 3R6LB 1IR1A 2U2FA 1F2GA 1QVGR 4LFAJ 3OV7A 2KXNB 5HL7Q 1IKVB 1U2RA 2GGPA 3KJVA 4K2XA 1RWVB 4ZCKA 1NB2A 2M7SA 3Q8UA 1R8CA 2G2ZA 5M2PA 3FBFA 4ZPAA 1NK4A 5D0GA 5KFYA 1ZA1B 1RWNB 2HRUA 2U1AA 3SSRA 3KLIB 4I0WA 3B4DA 3MPYA 3VAHA 2KG1A 1PBUA 4JV5F 3KUHA 1DTTA 5EWGA 1FRXA 1U4BA 3N6MA 4DV3J 1HI8A 1RWXB 4OZ2A 1DBDA 1SL1A 1HARA 2P9CA 2VG7A 2DCUB 2DY9A 5A8RA 1VC0A 3S8SA 4MK8A 4ETZA 2UXCF 5KG0A 3TJAA 3K7RA 3TYTA 3M1VB 1NSPA 1L3UA 1RGVA 2E1MC 2BRKA 2J7WA 1EP4B 2KRBA 3FQKA 3UDCA 4DQIA 2PEHA 2BABA 4CH1A 3T6JA 1Q8LA 1VQ4S 3OXLA 4PRFA 4HH1A 1TL7B 2FGCA 1EP4A 2IJRA 2EFGA 4B02A 2FB0A 4C11A 2HK3A 2E9TA 5H1SV 3M30A 4I7FB 1XR7A 1S59A 2ALYB 2LXFA 3O1LA 4TVAB 4DZ6A 4ZN3A 5A8KA 4C11B 1LFWA 3KNGA 5L46A 5F8MA 3VAJA 4DV2F 1DAXA 1VCTA 2PO4A 1KD1T 3RAMA 4MYUA 3CJRA 1T05A 1HBMA 2CUYA 4GVBB 3T5LA 5LMNF 1AW0A 2MKHA 2M3DA 2QSWA 3FEXB 5E3RA 1L5UA 2I8EA 3BF4A 4F0HA 1VHIA 1OIAA 1C2PA 3PKYA 4YOEA 4OYXA 2CZVC 1HBMB 1V3RA 2XMUA 4GVBA 5LSOA 3QZ7A 4A8FA 4W90B 2RKIA 3CCSS 4DSFA 2CQBA 4DOZA 4L3NA 5LSLA 2NREA 1X4HA 2G4BA 2AD9A 2D69A 3K89A 2W7AA 2DO0A 2X3GA 4ICLA 5AE3A 2RKIB 5DDPC 4ED8A 1XNQF 2OGUA 3BH6B 1VR6A 2EXUA 3AD9C 3C16B 1JLFB 3ETMA 3CF5Q 4RKUC 4DR3F 4JYAF 1YJTA 3HZEA 5ETVA 1SQEA 3SQOP 4BBYA 4IR9A 1KBRA 1X7VA 4DF8A 5J1PA 2HLTA 3QWPA 3JSMA 3G6ES 3RRHA 1VQ9S 5HQLA 2IHR1 2WVCA 2JL9A 2R7SA 1TK0A 4NCAA 1URNA 3AXKA 4YB5A 2NXEA 1TK5A 3WZ0A 3JSMB 4N76A 2IAJA 2HFVA 3WC2A 2DH8A 2V94A 5CD4A 3PW7A 5DZ7A 5D4PA 1Q95G 4ZVUB 4WU2A 4C98A 1U1MA 3AHPA 4ZPCA 2E9RX 1SJRA 3MPDA 2LEPA 4LSNA 4ES1A 3KHLA 4H54A 1S57A 2J5AA 1F6TA 5KG4A 2Z2YB 2VV5A 1XNRJ 4K8RA 1BHNA 2VOPA 3BKTA 4I6YA 2BANB 4NEYA 4DV2J 2HGMA 1RKIA 1RAIB 3PFEA 4EFAC 2DNHA 3SDEB 2BW7A 4QWEA 1XNQJ 3CDWA 1TKTA 9ATCB 1S9FA 1U49A 3MR3A 1TU0B 2I0XA 2I38A 3IGVA 3C14B 3W63A 3GV8B 1R0AA 1S1WA 2W2OP 5T7LB 2HHHJ 1H2UX 2HBRB 4FNIA 3Q22A 5LL6d 4IG3B 1WF0A 3C14A 1RWOB 3HFKA 4C8NA 3NY0A 4WYLA 2RU3A 1R0AB 2B3TB 1JLCA 4NZ7A 4NWBA 2ZOFA 3LALA 4IG3A 3A1YG 3G96A 2VU5A 3HDSA 5CYJA 3KK2B 2XMKA 3SCLE 3VQTA 4DL4A 4PWDA 2OMOA 3N6LA 2V69A 4UUXA 3W8GA 3PW5A 4GC6A 3PEHA 2JLFA 2ERRA 2GS8A 1RHQB 1SQGA 3KK2A 4WYWA 3RW6A 4C48A 3A13A 2UUBJ 5KG6A 3ENAA 2W1BA 3OHBA 1JK9B 2IFXA 5L1JA 1JJ4A 3GJRB 2CVIA 3IWXA 3K8WA 4OZLA 2IDEA 4ZVEA 3IRXA 1FD2A 1FI4A 4IOBA 1V5VA 2D7SA 3FCVA 3POTB 6FD1A 2R7WA 4K50A 3H90A 5KG2A 2W2QP 4QW8A 1VLYA 3TQEA 4ATNA 5DLGA 1LWXA 4YR2A 2ZH8A 3RBEA 1JLGB 1N0UA 3T41A 1U47A 1SC3B 1IKWB 2AWZA 2QA1A 1Q7LB 3JQKA 1T9UA 1QLNA 5HN0A 1TELA 2AJ0A 1T95A 4TQSA 3NS6A 2OFHX 5KFCA 1IKWA 4A8WA 1QJHA 1UW4A 4WTYA 3LGHA 1F9EB 1WG1A 4Y2CA 2EC2A 5DJBA 4DN9A 5LSRA 2OTLS 2RVJA 4WE1A 3FRYA 3FZBA 3JYTA 3OR1B 2CNKB 4ECZA 1RB0A 4HTJA 2XULA 2MSTA 1WG5A 2MQNA
chains in the Genus database with same CATH topology
1PAEX 1NPKA 3Q8VA 5CABA 3EVMA 1S59A 4DZ6A 4F4AA 4HR2A 2BX6A 1K44A 2HURA 4CP5A 2NCKL 5C7PA 3B6BA 4WBFA 1S5ZA 3R9LA 2DXFA 3VVUA 5BXIA 1MN9A 1HLWA 1JXVA 3GPAA 3GP9A 3PRVA 3FC9A 1NSKL 5CAAA 3ELHA 3BH6B 4ENOA 3ETMA 3JS9A 2HVEA 1NDLA 1NUEA 3NGSA 3DDIA 3BBFA 3EMTA 1HIYA 2DYAA 2CWKA 3NGUA 3FBCA 3FCWA 3ZTRA 1ZS6A 1UCNA 1WKJA 1U8WA 2AZ3A 2AZ1A 4ANEA 4FKXA 1WKKA 2BEFA 4C6AA 2HVDA 3MPDA 4ANCA 3BBCA 4FKYA 1XIQA 1PKUA 3ZTSA 1S57A 1F6TA 1W7WA 1B4SA 1NDPA 1BHNA 2B8PA 3Q86A 1F3FA 1XQIA 4S0MA 1MN7A 2DXEA 3FBEA 3VVTA 4UOGA 1NSQA 2B8QA 3NGRA 1BE4A 1LEOA 4EK2A 3EVWA 3ZTPA 3ZTQA 3EVOA 1VYAA 1NDCA 1NLKL 3Q89A 2VU5A 3BH7B 3VGSA 2DXDA 4UOFA 3EM1A 3FKBA 1NB2A 3VGUA 3EE3A 3Q8UA 4DUTA 3ENAA 3FBFA 3G2XA 3WX8A 3EJMA 3Q83A 4ANDA 3FCVA 3PJ9A 3Q8YA 1B99A 1KDNA 3B54A 1NDKA 4W98A 1LWXA 4DI6A 1NCLA 3NGTA 1BUXA 1EHWA 3FBBA 3BBBA 4UOHA 2DY9A 3DKDA 3ZTOA 1HHQA 2ZUAA 4KPCA 3VGTA 1NSPA 1WKLA 5IOLA 1NHKL 3EICA 4F36A 3VGVA 3L7UA 4O0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PAE X;  1NPK A;  3Q8V A;  5CAB A;  3EVM A;  1S59 A;  4DZ6 A;  4F4A A;  4HR2 A;  2BX6 A;  1K44 A;  2HUR A;  4CP5 A;  2NCK L;  5C7P A;  3B6B A;  4WBF A;  1S5Z A;  3R9L A;  2DXF A;  3VVU A;  5BXI A;  1MN9 A;  1HLW A;  1JXV A;  3GPA A;  3GP9 A;  3PRV A;  3FC9 A;  1NSK L;  5CAA A;  3ELH A;  3BH6 B;  4ENO A;  3ETM A;  3JS9 A;  2HVE A;  1NDL A;  1NUE A;  3NGS A;  3DDI A;  3BBF A;  3EMT A;  1HIY A;  2DYA A;  2CWK A;  3NGU A;  3FBC A;  3FCW A;  3ZTR A;  1ZS6 A;  1UCN A;  1WKJ A;  1U8W A;  2AZ3 A;  2AZ1 A;  4ANE A;  4FKX A;  1WKK A;  2BEF A;  4C6A A;  2HVD A;  3MPD A;  4ANC A;  3BBC A;  4FKY A;  1XIQ A;  1PKU A;  3ZTS A;  1S57 A;  1F6T A;  1W7W A;  1B4S A;  1NDP A;  1BHN A;  2B8P A;  3Q86 A;  1F3F A;  1XQI A;  4S0M A;  1MN7 A;  2DXE A;  3FBE A;  3VVT A;  4UOG A;  1NSQ A;  2B8Q A;  3NGR A;  1BE4 A;  1LEO A;  4EK2 A;  3EVW A;  3ZTP A;  3ZTQ A;  3EVO A;  1VYA A;  1NDC A;  1NLK L;  3Q89 A;  2VU5 A;  3BH7 B;  3VGS A;  2DXD A;  4UOF A;  3EM1 A;  3FKB A;  1NB2 A;  3VGU A;  3EE3 A;  3Q8U A;  4DUT A;  3ENA A;  3FBF A;  3G2X A;  3WX8 A;  3EJM A;  3Q83 A;  4AND A;  3FCV A;  3PJ9 A;  3Q8Y A;  1B99 A;  1KDN A;  3B54 A;  1NDK A;  4W98 A;  1LWX A;  4DI6 A;  1NCL A;  3NGT A;  1BUX A;  1EHW A;  3FBB A;  3BBB A;  4UOH A;  2DY9 A;  3DKD A;  3ZTO A;  1HHQ A;  2ZUA A;  4KPC A;  3VGT A;  1NSP A;  1WKL A;  5IOL A;  1NHK L;  3EIC A;  4F36 A;  3VGV A;  3L7U A;  4O0N A; 
#chains in the Genus database with same CATH topology
 2VH7 A;  3J7Z 5;  2LEA A;  5J2M B;  2H48 B;  3D28 A;  1KQG B;  4JI6 J;  3D0G E;  4GO5 X;  4YUD A;  1N5Q A;  3M8P A;  4NAS A;  1VQ7 S;  2O5D A;  3CT9 A;  3F73 A;  1QM9 A;  2Z56 B;  3TQ1 A;  2ILZ A;  2BYC A;  1D9F A;  1GX6 A;  3VHQ A;  3UVJ B;  2DNP A;  2HUR A;  3BKU A;  2KN4 A;  2UXB J;  1DQ8 A;  2CQG A;  2LKZ A;  3LUY A;  5LT5 A;  3G6Y A;  4X64 J;  2CZ4 A;  2E7W A;  2V2K A;  2BQU A;  2QFJ A;  4ED3 A;  3M6X A;  1SJ3 P;  1HLW A;  1RU1 A;  2NXN A;  2W4C A;  3DRP B;  2VPY B;  2F8M A;  2OKQ A;  4MH8 A;  5ETK A;  1VQ5 S;  3NL0 A;  4O4G B;  2XYH B;  3UD4 P;  3R5J B;  1RA6 A;  2UV8 G;  4RO0 A;  2YNG A;  4J9M A;  1VQ8 S;  1N32 F;  1BQN B;  2KTQ A;  2DHX A;  3DC2 A;  2Z58 B;  2RD5 C;  3TWZ A;  1YJU A;  1NUE A;  2C2N A;  2YNH A;  1D3W A;  1P8G A;  4J9Q A;  2PMZ D;  4AYB D;  3UI3 A;  2CNL B;  3EDR B;  3R5G A;  4DCO B;  4HHJ A;  1VQO S;  4DR5 J;  2FZK B;  4KKO A;  3MMC A;  4UUW A;  2W9A A;  1ELO A;  2MYF A;  3P3D A;  1I1G A;  2RDJ A;  1JLA B;  3RB6 A;  3E51 A;  2MJN A;  1GXU A;  4IFY B;  3TVY A;  5F8N A;  1R3N A;  5LJ5 Y;  4NXN J;  2CQ2 A;  4USU A;  4DL5 A;  3FMB A;  1EAR A;  4PAA A;  5DS7 A;  1S97 A;  1YZ7 A;  3QSY B;  1OY8 A;  2JLE A;  2KFN A;  2V34 A;  3CJQ A;  2HRT A;  3BSC A;  1FXR A;  5IQQ A;  4DV6 J;  4LFC J;  2EFP A;  4QWB A;  4C6A A;  1R6V A;  1XR6 A;  4O3O A;  4NRT A;  4RUH A;  1C1B B;  3PAC A;  3ZTS A;  5DQG A;  4QWD A;  3Q24 A;  1KLM B;  2FVC A;  2KRR A;  2P6T A;  2VFU A;  3SCJ E;  4DMZ A;  5HQ8 A;  1JQG A;  3IG1 A;  5KFE A;  4KH0 B;  2HMI A;  2B8P A;  2Z2M A;  2HIY A;  4EI2 A;  1HNV A;  2GZO A;  4ZCI A;  5A2Q Y;  3CCE S;  2BBE A;  5HMZ A;  2CRL A;  2IM0 A;  1S9E B;  3LP0 B;  4K2J A;  4DFP A;  3V81 A;  2C28 A;  2MKK A;  2WSC C;  1HW8 A;  4XDC A;  2XMV A;  3NGR A;  4X65 F;  4JI3 J;  5D3G A;  2KL8 A;  1FJG F;  2MDA A;  2OH2 A;  1KN6 A;  5J1E B;  2BE2 B;  2KG0 A;  1YG0 A;  5GMK a;  3P5B P;  1UEU A;  5I3U B;  3BSO A;  5HJY A;  1RJJ A;  4Q2M A;  2JVR A;  3QT8 A;  2FQQ B;  3MPV A;  5A0Y B;  3DLB A;  2E5L F;  3O5T B;  3Q89 A;  1FFG B;  1VRU B;  2B4U A;  3JTO A;  1SJQ A;  3SQG B;  2CVE A;  3D0H E;  2HHW A;  3VAG A;  2W01 A;  4LUB A;  2GAG C;  4RUB A;  1H7W A;  3F0N A;  3QGG A;  2FJB B;  2MLY A;  3IBC B;  4OZ5 A;  3HLU A;  3KHG A;  4LFB J;  2CQ1 A;  1Y0H A;  3DLL Q;  2RU9 A;  4B9M A;  4ED7 A;  2JZ5 A;  2KZM A;  2HBZ B;  4PWW A;  5A8W A;  4Q7A A;  3PYF A;  1WC1 A;  3TVZ A;  3IA0 A;  3THT A;  1NJX A;  2J6T A;  4Q43 A;  1JLB B;  2W2P P;  4A46 A;  1NHV A;  1UJ4 A;  2ZDO A;  2DTJ A;  3GIR A;  3MTJ A;  5A8W B;  3PRB A;  1RSC A;  4DBQ A;  2MZ1 A;  4AL5 A;  1RYS A;  4I56 A;  3R3T A;  4DR6 J;  3MM8 A;  3KLG A;  2ADB A;  1F1B B;  4ZKA A;  3B78 A;  1SUQ B;  2BUN A;  2GMH A;  1N36 J;  2VFS A;  1YSJ A;  2CPZ A;  1FTC A;  5G0R B;  1X4F A;  3EIC A;  3VGV A;  1BQM B;  4TU9 A;  4KY3 A;  4LJM A;  5LMU F;  2EBG A;  2AJF E;  4YY3 J;  4M95 A;  1V3S A;  4O0N A;  3RW7 A;  4IH7 A;  2HG4 A;  4NRU A;  4WU3 A;  4RUC A;  4YHH F;  2JLG A;  3BO2 A;  5AXM A;  2WBM A;  5KT3 A;  2W7O A;  2G9O A;  2ZZT A;  3NS5 A;  1GMU A;  2ZC4 A;  5C2C A;  2OJ3 A;  4KO0 B;  1WC5 A;  2G2O A;  3WDO A;  3Q8Q B;  1IBL J;  3D3B J;  3T1H J;  1HR0 F;  4GKK F;  2DNR A;  3GFH A;  3GZ7 A;  3NAI A;  1DUR A;  3B82 A;  4AT1 B;  1RT2 B;  4ECT A;  1NKE A;  1S5Z A;  4RW6 A;  1R6Y A;  2BE7 D;  4LRD A;  1GK8 A;  3WC0 A;  3AJ2 A;  3DYA B;  4I6W A;  5K8N A;  2DGX A;  4FF3 A;  2G1D A;  4E2F B;  2AGP A;  1HBU B;  4YY3 F;  1S76 D;  4P2X A;  1M5V C;  2YQ3 A;  4OV1 A;  1WSV A;  5FDL B;  3TUJ C;  3CPW R;  1LV5 A;  4JI0 J;  1NSK L;  1VGY A;  2B9Y A;  2UUW A;  3FVY A;  2XC9 A;  4I4B A;  1NK0 A;  3PO5 A;  5GAH U;  1HFE L;  2LDY A;  3M9O B;  2CPD A;  3K5N A;  1KNZ A;  2VON A;  1VIX A;  1WWH A;  1RQ0 A;  4DQS A;  3NNA A;  4C0B A;  4GKK J;  4LF6 F;  1UFL A;  2R2R A;  3MCM A;  1IBC B;  1WC0 A;  2M5Y A;  3KLV A;  1AUD A;  4U9R A;  2G0J A;  2UUC F;  4PUO A;  4BDP A;  4DV0 F;  1NSA A;  2BE9 B;  2IJN A;  2F7V A;  3I5C A;  1FKA F;  5FLX Y;  1Q78 A;  4DV7 J;  3DGV A;  4KV8 B;  3P8B B;  3BPS P;  2VPX B;  1WEY A;  3QNW B;  5KFP A;  2JHE A;  1RCX B;  2R9L A;  2N3L A;  3BGL A;  4CLY A;  2GIR A;  4TLQ A;  3CD7 A;  4CRJ A;  2FHK A;  3QLH B;  2V2V A;  3D67 A;  3MM7 A;  4OHZ A;  1S6Q A;  3G86 A;  4DG1 B;  4S0M A;  4R0E A;  1N54 B;  4K7Q A;  2RRB A;  4EBD A;  4RL1 A;  2QEX S;  3PEJ A;  3MM7 B;  5L38 A;  3QZ8 A;  2P6S A;  2AV5 A;  1NSQ A;  3GWC A;  1M90 T;  2AYB A;  1NK8 A;  2ZIT A;  3D7S B;  1OQ6 A;  3NCR A;  4X4P A;  1IM6 A;  3BKF A;  4CO1 A;  3Q8R B;  2DJW A;  2NXJ A;  4B08 A;  3IR7 B;  5F8G A;  4X65 J;  2O67 A;  3BDE A;  2JFK A;  2I6W A;  2PI4 A;  2HFN A;  4HHU A;  1Y00 A;  3QGH A;  1HL6 A;  2I2Y A;  4JV2 A;  5LJ3 Y;  2YBV A;  3VAK A;  4F3Q A;  2JVO A;  2DEI A;  4B3R J;  5K8O A;  5KFH A;  5KFU A;  1RTJ A;  1FF2 A;  2EW9 A;  3FKB A;  4WFN Q;  1YWX A;  2FY8 A;  3FK4 A;  3GYG A;  4OX8 A;  4XTT A;  3WQP A;  4QPT A;  3DM2 A;  2QFI A;  1FRH A;  2E1A A;  3EE3 A;  1QTN B;  5HMX A;  3G2X A;  3LPY A;  2R2U A;  4ECQ A;  4DL3 A;  2OPR B;  2MHN A;  2RQ4 A;  2VBW A;  1SJ4 P;  4MFB B;  2VG5 A;  3EJM A;  3QT5 A;  1ULR A;  2DNO A;  3EZU A;  2C2D A;  2H65 B;  2X1B A;  4F02 A;  2FJX A;  3NGT A;  3LAK A;  3E2E A;  1XMO F;  1N88 A;  3UCU P;  1FX2 A;  1FKO A;  2DIU A;  4QIE A;  1GMW A;  5DG8 A;  2FC9 A;  3BDP A;  2MTL A;  4Q45 A;  4C0H A;  4PQU A;  4R8U A;  2MPU A;  3D1H A;  4KHP J;  3OFE A;  1TTH B;  4HAC B;  2QMX A;  4DR3 J;  3CCW A;  3N28 A;  3UPF A;  4B3S F;  1CUL A;  1CJU A;  5A6W A;  2VOD A;  3D1Q A;  1RU2 A;  2UU9 J;  1TL3 A;  2N4C A;  4DHV A;  1NZA A;  1TL1 B;  8RUC A;  2GHP A;  4CM2 A;  1RHK B;  2E1R A;  1KSP A;  3B8H A;  1LWF A;  2O1P A;  4M63 A;  3CO9 A;  3D3C J;  2IMO A;  2K06 A;  3SFG A;  4FXV A;  5HBM A;  3TVK A;  1IJE B;  4OI6 A;  4FYY B;  4CLK A;  4QPX A;  3QAU A;  2Z8Q A;  4OFZ A;  1N5Y A;  4YQW A;  1LWF B;  2DD8 S;  3KK3 B;  1FER A;  1TVR A;  4BHQ A;  4C0O C;  4R5P A;  2V8G A;  1DTQ A;  3VF0 B;  5EX3 A;  1KOO A;  2K7K A;  3HKZ D;  4AFF A;  3KK3 A;  4Q8F A;  2M8H A;  1WI8 A;  1SB6 A;  1TL4 A;  1PIL A;  2CG4 A;  2EK6 A;  4LF4 F;  1RAF B;  1DFD A;  3C6U B;  2RT3 A;  4OLP A;  1ZOT A;  3M2U B;  4ID5 B;  4EEY A;  2MZQ A;  2HQF A;  2VQF F;  2DPI A;  1UAW A;  1FX4 A;  2DGV A;  2ZBP A;  3C6U A;  5ETR A;  3LP1 A;  7AT1 B;  5IV4 A;  1H38 A;  4DV1 F;  2ATL A;  4N41 A;  3SEO A;  1VQS A;  3OUY B;  3IN5 A;  2DR8 A;  4C3L A;  1AYE A;  3GYX B;  1T02 A;  3LP2 A;  3FNN A;  1FES A;  4G1Q B;  4G6V B;  3TAR A;  4ENO A;  2MEW A;  1N36 F;  1HKA A;  5I3Q A;  3R1L A;  3M32 A;  3RAX A;  1TFW A;  3NOC A;  1U6B A;  1ITP A;  3IS9 A;  3IRX B;  1YRT A;  2CAJ A;  3KK1 A;  2ASY A;  2RS2 A;  4Y2K A;  3ZZR A;  1VBY A;  2UXB F;  4U7U K;  1UA0 A;  2FLP A;  5ETS A;  1N6Q A;  1S79 A;  2PDA A;  4ELV A;  1PBA A;  2NPF A;  3MEC B;  4ILR A;  1ZA2 B;  3MEG B;  1PSD A;  4OYM A;  3ICL A;  2I1R A;  1CVJ A;  3HSZ A;  2O66 A;  1F5B A;  1IKV A;  1UVK A;  2GHV C;  1RP5 A;  1RZM A;  2V2Z A;  4JI8 F;  2XTJ P;  3QBC A;  1XMQ F;  2RJZ A;  4EMD A;  2MGZ B;  2RSQ A;  2J0S D;  3MEG A;  2XG8 A;  1MWQ A;  2OEM A;  3HD2 A;  3LAN A;  5A0Y A;  3W1Y C;  2GQC A;  2AX0 A;  4WKY A;  2RHS B;  5DM7 Q;  4B3T J;  1FFW B;  4M5D B;  2CPI A;  4WE1 B;  1MML A;  5DDO C;  3KLI A;  1CC7 A;  1PKU A;  4MIB A;  2HS4 A;  1DTT B;  5CYM B;  1XR5 A;  3Q8P B;  4LF7 J;  2R8K A;  3GTY X;  4WXW A;  1N33 J;  3OTB A;  1HNI B;  4HDG A;  1F3F A;  2HIQ A;  4KHM A;  4LF1 A;  2JDJ A;  4LFC F;  1JXE A;  1FE4 A;  2KJW A;  3IBF B;  2HEK A;  2ZH1 A;  3I0R B;  4JI2 J;  1HQ2 A;  4LVN P;  2ZH7 A;  1WOP A;  3H40 A;  1YJR A;  1KLN A;  3UDL A;  3PTW A;  1SKR A;  5FLX U;  4EZ9 A;  2AT1 B;  4CLU A;  4K0K F;  4NCB A;  1VYA A;  4USJ C;  4Q2L A;  3SZ2 A;  2FZC B;  1UWA A;  3TW0 A;  1Y5I B;  4NLR A;  3DRP A;  1OYE A;  1RIS A;  1TL7 A;  1RWM B;  3MAA A;  3VGS A;  4P7V A;  2OIH A;  2OHD A;  4NLS A;  4O4G A;  1X5O A;  4DV5 F;  1U1R A;  1CEZ A;  3DRR B;  2RQM A;  3M6U A;  4CWB A;  5A8K B;  4F4Z A;  4LQ9 A;  1U6F A;  2ABY A;  3MAA B;  3PHE A;  2KFZ A;  1VRT B;  3W2V B;  3DI6 A;  2B4P A;  2DNK A;  2E7X A;  2I5J B;  2K8G A;  4ZP7 A;  3MR5 A;  1U48 A;  2XZD B;  1Z1Z A;  3KNA A;  4DR7 J;  4AND A;  1IJF B;  1B99 A;  1VRT A;  3B54 A;  1UZH A;  5DG7 A;  1YBU A;  2OSQ A;  3DI6 B;  1DLO A;  3N5F A;  3SFU A;  2HVH A;  2KT3 A;  3KG1 A;  4KKO B;  2XWY A;  3H5X A;  2DO4 A;  2XMW A;  5EHH A;  1YBA A;  1DLO B;  1UPM B;  4FZV A;  1EET A;  2VPW B;  3MED B;  1E6Y B;  4YDD B;  2ZHA A;  2QMW A;  4UT4 A;  1PJ5 A;  3T1A A;  3T5J A;  1HBO A;  4JYA J;  1Z4U A;  3VGT A;  4ZJQ A;  1NO8 A;  3FSY A;  1U7L A;  2EVZ A;  4KAI A;  1QE1 B;  2H4W B;  1EET B;  4FXD A;  1DZ5 A;  1VIS A;  3U1N A;  2VQE J;  1Q53 A;  3L9Z A;  1ARO P;  1CBK A;  1RT6 A;  1QDU B;  4ZPB A;  2BA9 A;  2DKO B;  2V9K A;  3KLH B;  4Y2I A;  3IG1 B;  3HM9 A;  5ETL A;  2UVW A;  1DHM A;  4RJV A;  2XMM A;  3LO3 A;  3LP0 A;  4PKD B;  4I6A A;  2IAJ B;  3FCH A;  4MJK A;  2QE5 A;  2Q66 A;  1APS A;  2VA2 A;  2YKO A;  3V2U C;  4MK9 A;  1X0P A;  2COL A;  3O8W A;  4A8Q A;  2DBB A;  2KJV A;  5J1E A;  2F65 A;  1FDA A;  2DT9 A;  2A2D A;  5JVH Q;  1ZAX A;  2CPJ A;  2F1F A;  4OI2 A;  5F41 A;  4A8K A;  4IOA Q;  3SMZ A;  5KFJ A;  3TJ9 A;  1KHW A;  3ZC4 A;  3PO4 A;  2HVI A;  4KFB B;  3MM5 B;  1TV6 A;  3GJT B;  1PG5 B;  2V50 A;  2XNQ A;  3I31 A;  3VWS A;  1X60 A;  1RHJ B;  2GJ2 A;  4I2P A;  5F9N A;  5B0E A;  2QJ3 A;  1RWK B;  4D3G A;  1XER A;  1RCO B;  4UW2 A;  4ZLJ A;  5L39 A;  2V8D A;  5ITH A;  2FVQ A;  3SI8 A;  3Q2T C;  4NCG B;  4OYI A;  4URG A;  1NDL A;  2ZH2 A;  4CIO A;  1M0S A;  2QMU B;  1EAY C;  3EMT A;  1HIY A;  4HDH A;  3NGU A;  4PG8 A;  1IXK A;  1TZ0 A;  4IG0 A;  2EFQ A;  1UVJ A;  2CYY A;  3BGF A;  4X4Q A;  2W9C A;  3LPE A;  1J5E J;  2FC8 A;  2HQC A;  4PWD B;  4RX6 A;  4DLE A;  2AZ3 A;  3GIM A;  2K1R A;  1HPZ B;  1KTV A;  3E3X A;  2XM3 A;  4X4R A;  5F8H A;  2RRA A;  2AU0 A;  1AFJ A;  1YKW A;  3KLG B;  1K8A T;  2BJ9 A;  3DMJ B;  1TAQ A;  5E3Q A;  4NXM F;  2QLB B;  2WZ1 A;  4WP9 A;  4F3O A;  3G9C A;  5KT6 A;  5G0R A;  1BQM A;  3DMJ A;  4A8Y A;  4X62 J;  2IY5 B;  1B4S A;  2DGU A;  1FXL A;  5B08 A;  4LR9 A;  2B5J B;  1AXQ A;  1XTZ A;  2V63 A;  1GQE A;  2YKM A;  1UEV A;  3D68 A;  1R0B G;  3I4P A;  1B70 B;  5CYQ B;  5KAK A;  4B3M F;  1N56 A;  2CJB A;  3IBW A;  1MMD A;  2B5J A;  4CLW A;  2QA2 A;  3HT0 A;  4WF9 Q;  3KLF B;  2E7V A;  1D8Z A;  2GMJ A;  4UY8 5;  4JI4 F;  4YR3 A;  3W64 A;  3L09 A;  1MLA A;  4G65 A;  2NZ4 A;  3KLE A;  1T9Y A;  2MQ8 A;  2XLJ A;  4GC7 A;  2FGO A;  2GJI A;  3M4X A;  4MKV A;  4J9R A;  2OAU A;  3DYA A;  2YNI A;  1H2V Z;  1RWP B;  2ZH4 A;  2YH1 A;  2FVP A;  2JEI A;  1SL0 A;  2QYG A;  3H2V E;  5J2Q A;  4DUZ F;  5K8M A;  5KFI A;  2FUG 9;  2F63 A;  3DLE B;  3IR5 B;  2LCW A;  4OQJ A;  2CFX A;  1TL5 A;  1Z2L A;  5KFS A;  4AXI A;  3RR8 A;  2IVF B;  2FZG B;  3ZNJ 1;  1KVK A;  4ZLL A;  4NA2 A;  4LIW A;  4YP3 A;  3UW1 A;  1SV5 B;  3HHL B;  3JAM Y;  1UJ5 A;  5I3P A;  2RML A;  1HNW J;  4LF2 A;  2ZZM A;  4GKJ F;  2XBP A;  4LIR A;  1IKX A;  1KDN A;  1KEK A;  1UEK A;  4JI5 J;  4W92 B;  5D4L A;  3ZNU A;  2MKY A;  4YME A;  3V4I B;  4LF9 F;  3HX9 A;  2VFV A;  3PNI A;  3I56 S;  1CPZ A;  4BC7 A;  5CCM A;  4DS5 A;  3RU0 A;  5G4D A;  1RK8 A;  1C0T B;  2IM1 A;  2XHW A;  4CLT A;  4UOH A;  4C2M A;  4N8O A;  5KFT A;  2CQ0 A;  3CJS A;  1OWX A;  2IRY A;  2QT7 A;  2KYZ A;  4X4N A;  2JH3 A;  1C0T A;  4AXJ A;  2APO A;  4Y34 A;  3M2R A;  1I5O B;  1XMO J;  4JI4 J;  2GIF A;  3TZY A;  1C0U A;  1FRJ A;  4ZVG A;  3P4U B;  2FHM A;  4N7T A;  2EG1 A;  4TY9 A;  2DNM A;  4FS2 A;  2KHD A;  1TMM A;  2LFV A;  2MZS A;  4B3M J;  4L76 A;  4PR6 A;  1KHV A;  3H5Y A;  4NXN F;  3UCZ P;  4DFJ A;  2KH9 A;  3J7Y I;  3FUY A;  3ILO A;  4RWX A;  4LSZ B;  1FEE A;  4DR5 F;  5GMD A;  2HS0 A;  3I87 A;  3BJY A;  3CCL S;  1HHT P;  3A3O B;  4ZVT B;  3G6X A;  3ZZU A;  4CNY A;  3OTO F;  4ED5 A;  4HI2 A;  3HO1 A;  4DV6 F;  3NMR A;  1H98 A;  2HFS A;  2HND B;  4QIW D;  1VBZ A;  2XNR A;  4IOC Q;  1HBN B;  2QC3 A;  1KLM A;  3VAL A;  1KRP A;  2A6M A;  1DAR A;  4RNF A;  3CW2 C;  1SC6 A;  4F8R A;  4WK3 A;  1ROF A;  2MXY A;  3GP9 A;  4FBT A;  2M0G B;  1CJT B;  2BM1 A;  3TA1 A;  4FYW B;  1WHV A;  4H4M B;  1I94 J;  3G87 A;  2Z2Z A;  3AB4 B;  3ISN C;  4J9U E;  4NZ6 A;  1VLO A;  5KG1 A;  1YI2 S;  1D9A A;  2DNQ A;  3GJQ B;  1N5V A;  3H98 A;  4NLW A;  4QZV B;  5HVF A;  2LQB A;  4YS2 A;  4Z7C A;  4EYI B;  3ENW A;  2Y1R I;  3KHH A;  3D54 A;  4I1T A;  2R8G A;  2BM0 A;  4KR0 B;  3MUT P;  2XB2 D;  1RT5 A;  4KJI A;  1WDD A;  1DQA A;  4ERD A;  1VRU A;  1D0E A;  4KRW A;  4K4X A;  2VIC A;  5B09 A;  1H6K X;  2DNY A;  1M1G A;  1FNO A;  2LVW A;  4QJV A;  5A76 A;  5L1K A;  2GQQ A;  3UNY A;  4A47 A;  2UV8 A;  4HAC A;  5KTQ A;  3MCN A;  1FWL A;  1S4E A;  1T94 A;  2E29 A;  3AA8 A;  2ZBQ A;  5D0R A;  3ENQ A;  3PHT A;  4IQM A;  1FTR A;  4EBC A;  4ANC A;  1CJV A;  3TZW A;  1N5Y B;  4O3N A;  1KVI A;  1G7C B;  1XIQ A;  4CZC A;  1NPR A;  1S99 A;  4AL6 A;  2FY1 A;  1OPZ A;  5E41 A;  2KYX A;  1S6P B;  5F0W A;  4M5M A;  2LA6 A;  3H25 A;  4ZS6 A;  2W2N P;  4WIQ A;  4Z37 A;  1U1K A;  3PR4 A;  2E1C A;  4WKR A;  3H59 A;  1FVQ A;  4CYU A;  2BJ8 A;  1QSL A;  4RZR A;  4YHH J;  1C4C A;  1RHR B;  4DU7 A;  4A8S A;  2RB7 A;  1F9H A;  4C7Q A;  1J5O A;  4QCL A;  3EVW A;  4J9N A;  3OJS A;  3I55 S;  4OMF G;  2ZM6 J;  3KUG A;  2NSB A;  3TOQ A;  2ZVS A;  2RF2 A;  2ZH3 A;  1W2I A;  1Q4R A;  1VHF A;  4WTO B;  4P52 A;  2K3I A;  1YLX A;  2AIR B;  2DR6 A;  1NXI A;  3CJ5 A;  3RR7 A;  2DXD A;  1P27 B;  3SV3 A;  1GTE A;  4QR0 A;  4X4O A;  1HWL A;  2LXU A;  2C3P A;  1EQM A;  2E5J A;  4IFV B;  3S01 A;  4DJB A;  3OUY A;  3BGO P;  2JEG A;  4KO0 A;  5DDR C;  4MKA A;  4K4Y A;  2E5G A;  4DUT A;  4MIA A;  3OVS A;  1QUV A;  1T0T V;  2M70 A;  5AXN A;  5H9E J;  3M32 B;  1RTD A;  3QPI A;  4ES2 A;  1YHQ S;  3Q83 A;  4MAK A;  3QAE A;  1RT2 A;  1X5T A;  2IVM A;  3QT7 A;  1N52 B;  4URQ U;  1NDK A;  2WVF A;  4BWJ A;  2HHH F;  4PZV A;  4EZ6 A;  1K0V A;  4OI3 A;  4DI6 A;  2GGP B;  4PG5 A;  1BUX A;  1P9Y A;  3KHR A;  4V19 X;  2R7U A;  1XJW B;  3FBB A;  2BRL A;  4DSK A;  2CQ4 A;  3GIK A;  1LXN A;  5FDL A;  3DKD A;  1FVS A;  1HNX F;  1VI7 A;  1NME B;  4UOC A;  5D4O A;  3GIJ A;  2MGZ A;  4FS1 A;  2XLK A;  2XYP B;  3JXO A;  4Y28 C;  2DVI A;  1S0V A;  5K20 B;  2YX7 A;  1X9M A;  3KDN A;  3P96 A;  2WRM A;  3X3U A;  1KR4 A;  3CMA S;  3LOU A;  4YB1 P;  2FLN A;  2WW8 A;  3RG6 A;  5K14 A;  2F3J A;  2JC1 A;  3HZG A;  1T9T A;  3RUB L;  5DET A;  4LT6 A;  3SIP B;  3VTI A;  3MUM P;  2ZJP Q;  1BXN A;  3ITH B;  4RR5 A;  1V5I B;  2BZ2 A;  4WJB A;  5IZH A;  2AYM A;  4USK A;  5K14 B;  3CCZ A;  3GR1 A;  5IT0 A;  1FO1 A;  1JJC B;  2DGT A;  2RQK A;  4OHY A;  4DPT A;  2ZE2 A;  4IDK B;  4M5L A;  4RWW A;  1FT8 A;  1X4D A;  5H9F J;  3RB4 A;  5E33 A;  4B3T F;  2FLO A;  3A8J A;  3S6E A;  1WG4 A;  4WBF A;  5BXI A;  3MFI A;  1WDT A;  3D6M B;  1FNX H;  2P5V A;  3M30 B;  3BO3 A;  1XMQ J;  2KT5 A;  3PIP Q;  4ZPT R;  3ZZP A;  4ZN1 A;  3OFG A;  4YB7 A;  3M8S A;  2KB2 A;  1WEX A;  2DIS A;  2HZA A;  3DOL B;  3FFI B;  3PRV A;  4F4W A;  2FYX A;  3DRR A;  5CH7 B;  2KDO A;  4OX7 A;  3ELH A;  3G71 S;  3CMQ A;  4RW7 B;  3SSQ A;  3ZZO A;  1Q5V A;  1FDB A;  3OL7 A;  5A6P A;  3I9V 9;  4M5J A;  2IM2 A;  2KVQ E;  2CPY A;  2WVB A;  4I68 A;  4QOT A;  1BD6 A;  5D15 A;  4KYZ A;  4CLZ A;  5IM0 A;  4PAB A;  4WFA Q;  2WK4 A;  2V6A A;  1NKC A;  3R7N B;  1WC6 A;  4IO1 A;  1EX8 A;  1C1C A;  1NB7 A;  2YX1 A;  4P71 A;  1B0T A;  1JLF A;  3K59 A;  2ALZ A;  4OJ3 A;  5F3Z A;  2W7P A;  1S1V B;  4PPZ A;  3MPU B;  4LR8 A;  3K58 A;  3DM2 B;  4M5H A;  4EWT A;  5GAE I;  2UUT A;  3ONQ A;  3TX0 A;  5L1L A;  3B4M A;  3NAH A;  1NKB A;  3H4B A;  2C2E A;  4KIA A;  2CKW A;  4NOH A;  4ETX A;  2B43 A;  2J76 E;  3CJ2 A;  2YWG A;  3LGN A;  4LFA F;  2B9X A;  1LK5 A;  2WON B;  2DK2 A;  3NS7 B;  2C22 A;  4LRF A;  1ZM3 A;  3GV5 B;  1RAD B;  2R42 A;  1FKO B;  3HD1 A;  1T9V A;  2D3O 1;  3AA9 A;  4IRC A;  2PSZ A;  5DQH A;  4PQU B;  3HHN B;  4YEA A;  1PO6 A;  5GAG I;  1KTQ A;  4G3I A;  2NPI A;  2EBE A;  2WHO A;  3BQ0 A;  2FDN A;  2JX2 A;  3CUL A;  2UZA A;  1RLD A;  4JV5 J;  1WC4 A;  1Q81 T;  2CQI A;  2KFY A;  1QAJ A;  2B6A A;  4DPY A;  4B3S J;  2JRS A;  4CM0 A;  2AHO B;  1MW7 A;  4CT8 A;  3D9B A;  2BQ3 A;  2DPJ A;  1NLK L;  2R8I A;  1UL3 A;  2H5J B;  2ZWO A;  4DFK A;  3QGP A;  4UQT A;  1KWM A;  2E5H A;  4X66 F;  4DSI A;  3RGI A;  3T1H F;  1HQE B;  4KFB A;  5KFR A;  1FJC A;  1S1W B;  2ZEJ A;  2JJ4 D;  2ZNZ A;  3CGI A;  2BJ1 A;  4CQ1 A;  3BN7 A;  1H74 A;  1HQE A;  4F7V A;  2OEJ A;  3I6P A;  5HVH A;  4NCG A;  4YFU A;  4ILM A;  2M88 A;  2PE8 A;  3ILI A;  3IM8 A;  1SVD A;  1WOS A;  1EB0 A;  3K5P A;  2M2B A;  2F9D A;  4GO7 X;  3M2U A;  4ID5 A;  2P9E A;  3JSY A;  2Q1L A;  3GJS B;  4MT1 A;  4QIV A;  5ETN A;  1IBM F;  3N9U C;  2HHU A;  2VBY A;  4F26 A;  4P2S A;  3BBB A;  3R7B B;  3PV8 A;  2J8S A;  1UA1 A;  2DIV A;  3PX0 A;  2HGL A;  4OZ1 A;  4XIU A;  3EPI A;  3W5X A;  2ATC B;  2K1R B;  1VS3 A;  2DHS A;  3HK2 A;  4M1K A;  1RTH B;  1V3Z A;  2CNN B;  1HD0 A;  1PYT A;  1WKL A;  4PYA A;  3NLC A;  1KC8 T;  2CPE A;  3AJD A;  3A4T A;  5IOL A;  3U1M A;  2KKH A;  2LA4 A;  1L3S A;  1F9F A;  3NP5 A;  3IS9 B;  3JSR A;  4NA3 A;  1RTH A;  3KK1 B;  3F56 A;  4JI1 F;  3BEG B;  3BGU A;  5ETQ A;  1OSD A;  1WAC A;  5DG9 A;  3ET6 B;  3IRW P;  2IC3 A;  3KMQ A;  4OX9 F;  3UD3 P;  3V6D B;  2CWX A;  3H2U B;  4WZQ A;  5HMW A;  3G4S S;  1U2F A;  1HNX J;  3GLJ A;  4O3P A;  4RNO A;  1SH0 A;  2IC3 B;  4ZLN A;  2V8P A;  3VCD A;  1IKY B;  4DF4 A;  4NYZ A;  4NLV A;  1YJ9 S;  1BWE A;  2NCK L;  1SH3 A;  2JSX A;  3C8Y A;  5C7P A;  2QLX A;  3VVU A;  3KLE B;  1J27 A;  5KFA A;  5MLC V;  1VQM S;  1U45 A;  5F8L A;  1IUJ A;  1MN9 A;  4C8K A;  1T7P A;  4K0K J;  2YNI B;  3KKF A;  5CYM A;  3W7B A;  3MR2 A;  2CZ9 A;  2ROE A;  1K0T A;  2J9C A;  2L3M A;  2E5I A;  4BCA A;  5J2Q B;  2XYG B;  2ZC3 A;  4JI2 F;  2ADC A;  4LR7 A;  2L48 A;  1FK9 A;  3QO9 A;  3DHW C;  3PX6 A;  3FRZ A;  2HSE B;  5JXS A;  2RIL A;  3NXZ A;  2N3O A;  3OTD A;  3OSN A;  5EWF A;  1TR0 A;  1VIO A;  1WTB A;  3G6V A;  3CDB A;  3NGS A;  3G8T A;  2DRD A;  3D1O A;  4G1I A;  2MZJ A;  5HAN A;  3CCU S;  4RU2 A;  3EZ5 A;  5DRK A;  2ZKT A;  3OR2 B;  4USH A;  3QRP A;  3V4I A;  5EDW A;  2VAS A;  2ZDP A;  4DPU A;  2MQQ A;  4L6V 3;  4ECU A;  3QID A;  4NLU A;  4OV6 A;  3MMJ A;  4JI7 F;  4IH6 A;  1GMV A;  2KM8 B;  4P2M A;  4ECY A;  4B17 A;  5AE2 A;  5GAH I;  3BSN A;  1WHW A;  4DV7 F;  4LF5 J;  4ZVO B;  3R97 A;  2BEF A;  2W9B B;  1N34 F;  4FVM A;  3PW2 A;  3W2V A;  2QO3 A;  3W9J A;  3RBX A;  4X2B A;  2HNZ B;  3M2R B;  4DX6 A;  4NI2 A;  4DV5 J;  1F2H A;  1D8Y A;  1XBW A;  2DH7 A;  2AEF A;  2AGQ A;  2FVR A;  2LQJ A;  3EX7 B;  2QA4 S;  3NGD A;  2DXE A;  3RZA A;  3RBD A;  1BMQ B;  3TZX A;  1JKH A;  2V4R A;  4ZHR A;  1HQU B;  2XEX A;  3MM9 B;  3QFH A;  4USW A;  2IM3 A;  1X5P A;  3BR9 A;  2CAD A;  4N77 A;  1C1B A;  3M8W A;  1JKH B;  5LXR A;  1QE1 A;  3OW2 R;  1S4F A;  3MM9 A;  1U0H B;  1PGZ A;  1S0N A;  5KFD A;  5KFF A;  3ZXW A;  3DCA A;  3ZZT A;  2VUG A;  3CVK A;  4PXD A;  4IYQ A;  1RT6 B;  3KLH A;  2FIU A;  1OO0 B;  1TUG B;  3HHL D;  4OYA A;  2NR0 A;  4I69 A;  5EUH A;  2B56 A;  4AQY F;  4UZC A;  5D3G B;  5SUH A;  4WFY A;  1CJT A;  2K7J A;  1Y4Z B;  3L4B C;  4H4M A;  2V5H G;  2YQ1 A;  3IGN A;  4DDF A;  5CCL A;  4RNM A;  3ETO A;  1U1Q A;  2BDP A;  2DCL A;  5BR8 F;  2HBQ B;  3PCO B;  4OYO A;  1JNR B;  4OYZ A;  5HJX A;  3W66 A;  1O0P A;  1SCJ B;  2QV6 A;  4LSL B;  1WUU A;  4LF4 J;  1RT5 B;  4HT7 A;  3OJU A;  2IA6 A;  4KQZ A;  1G4C A;  3EGV A;  1S7H A;  2PC6 A;  1SBR A;  5KT5 A;  2QLW A;  3TI0 A;  4DR6 F;  3OTE A;  4HT5 A;  4U96 A;  2VDI A;  3N79 A;  3IP0 A;  3CME S;  1FKP B;  2AJ1 A;  1MWZ A;  4NML A;  3US5 A;  3M6V A;  4X4S A;  4JB8 B;  4CCH A;  5B0G A;  3M2V B;  2OUG A;  3O44 A;  1HHS A;  1S49 A;  3K17 A;  2DHH A;  4TKT A;  3WX4 A;  1FA0 A;  1FKP A;  1RAJ A;  4EGL A;  5LXY A;  1NK7 A;  4JV1 A;  2UU9 F;  3IFE A;  1AZS A;  2OPS B;  2GX8 A;  5FII A;  4XPC A;  5D78 A;  3WHI A;  3EVM A;  2FHJ A;  3I5B A;  2YKN B;  3A8I A;  4CYU B;  4F4A A;  1GT8 A;  3IO1 A;  4J37 A;  5IWA J;  2BOP A;  1XNR F;  1B7F A;  4KGM A;  1MU2 B;  3IM9 A;  4LRC A;  3R2D J;  3TAQ A;  1M5P C;  1M5S A;  5KT7 A;  1OJ4 A;  2UXD J;  3CCT A;  4RBU A;  3TR5 A;  3UDE A;  1N34 J;  2HWT A;  4F25 A;  3CB4 A;  3NNC A;  1U2C A;  2CPX A;  2WW4 A;  2J6S A;  3CD5 A;  2YKA A;  1Q7Y T;  4B9V A;  2V9W A;  2WSF C;  4P73 A;  2FJV A;  1SI9 A;  2EEY A;  5FJ4 A;  2CJX B;  5CAA A;  4JI3 F;  4IFV A;  3GFX A;  3T9Z A;  2W24 A;  1X4A A;  4DUZ J;  1S72 S;  3MEK A;  1V9O A;  2GO9 A;  3KTQ A;  2GQ2 A;  3JQJ A;  4LRA A;  1JNZ B;  3DLK B;  2GA7 A;  4NMX A;  4RW6 B;  5D4N A;  3RBZ A;  2M9K A;  1RTD B;  1SJ1 A;  1VQP S;  4ZPD A;  1R8H A;  2MZT A;  2DGW A;  5HP1 A;  2DYA A;  1WF2 A;  3THV A;  3RRG A;  2HWH A;  1P1L A;  4O23 A;  4ZPW R;  3ZTR A;  1YVF A;  3CIM A;  3CJ0 A;  4HI1 A;  1TUV A;  2WTF A;  4ED0 A;  4QIG A;  1HWK A;  2POK A;  3ULH A;  1ZBT A;  1NBE B;  5HP1 B;  4P6Q A;  3GYN A;  2VB6 A;  4OZ3 A;  1OYD A;  5B0C A;  5H9E K;  1YTY A;  4J5O A;  2VA3 A;  4GKJ J;  3FDS A;  4P2F A;  4ANE A;  2R2S A;  4ED4 A;  2MSS A;  2F4F A;  2CQ3 A;  4NZ0 A;  4DV0 J;  2HPU A;  2KU7 A;  3TAN A;  3TUZ C;  1SV5 A;  2C3Y A;  3HHL A;  4DQP A;  1MRO B;  3LWM A;  5K9F A;  3KMS A;  1OPI A;  1IQT A;  2NXC A;  2OP5 A;  1N48 A;  1KP6 A;  2YPY A;  4IUF A;  1IKX B;  4TYA A;  4KHR A;  4YR0 A;  2B9E A;  2ROG A;  5CA5 A;  1TKZ A;  1MRO A;  3PIO Q;  2HLU A;  2VJU A;  3L7O A;  1TK8 A;  1UVL A;  3QJL A;  5LM7 E;  4ECW A;  1A0O B;  2VC1 A;  2ZNY A;  4EYH B;  4KV8 A;  3M9N B;  4DLG A;  4K4Z A;  4K4U A;  1SKS A;  4C8O A;  1C4A A;  4ZJL A;  2J6U A;  4J9V A;  1BE4 A;  4ZPV R;  5I42 B;  2ZD1 A;  4KE5 A;  3OL8 A;  4L74 A;  2ZE2 B;  2R4F A;  4IDK A;  5KT2 A;  1Q1K A;  3TNV A;  1RXO B;  2EFO A;  2IRU A;  3Q2S C;  4AUK A;  4DL7 A;  1UTA A;  5IC4 B;  3GIL A;  3CJK A;  1S6Q B;  4RBV A;  2OPQ B;  3W5Y A;  4IH5 A;  2V2Q A;  4Y0F A;  1JMT A;  1QAI A;  4P72 A;  2Q43 A;  5LMN J;  1UJ6 A;  1UVI A;  3DU5 A;  5GAD I;  3HUL A;  1R27 B;  1W25 A;  4QYZ J;  2YKP A;  3OVA A;  3HVA A;  3CJK B;  1CG2 A;  1XN9 A;  4PWU A;  4OLO A;  2DNG A;  3DU6 A;  3DOL A;  5E0O A;  2MQM A;  4NA1 A;  1N5T A;  2RNE A;  3AT1 B;  3OBI A;  1F5A A;  4KGK A;  4NX9 A;  3VGU A;  2CJK A;  5KFG A;  2MMY A;  2MLZ A;  4RW4 B;  5KFW A;  1DRZ A;  1Q5Y A;  2ILY A;  4G1P A;  2HWI A;  4LF8 F;  2D3U A;  3QJJ A;  2W4P A;  2D3O R;  2LU2 A;  3DLG B;  4EO6 A;  4M8L A;  4W98 A;  3GII A;  1LW2 A;  2UUC J;  2Y3Y A;  4TY8 A;  1RTJ B;  5E2Q A;  2J9E A;  3TX8 A;  1HR0 J;  4QYZ K;  2HS3 A;  2IYI A;  3A3P B;  3HSD A;  3H8Y A;  3E01 B;  3QWU A;  5GME A;  2GJF A;  1C1C B;  1DY3 A;  1Y5L B;  3OFH A;  2VOO A;  2QGF B;  4ZVF A;  2G0C A;  1CQN A;  1Q79 A;  2OPR A;  3ZTO A;  3OPK A;  3MM6 B;  2VG5 B;  4F4Y A;  1S1V A;  4LRB A;  2Y1L B;  2JFD A;  1X8D A;  1LWC B;  1ICE B;  3BQ1 A;  3FMW A;  3EGN A;  3UE2 A;  2MQP A;  1I94 F;  4OL8 A;  1VK3 A;  4C9D A;  2WCX A;  3JAM U;  4C8Y A;  3DOK B;  1LWC A;  3ENV A;  3RB0 A;  1PAE X;  1RA7 A;  2BJE A;  2J9D E;  1NPK A;  1OS5 A;  1U09 A;  1N8R T;  1QVF R;  2Q3P A;  3H20 A;  1ZTT A;  1U1P A;  3BQ2 A;  2VDH A;  4V1A k;  3AH6 A;  1PAU B;  2F8H A;  2G2Y A;  5BYS A;  1TL3 B;  2FPH X;  3HSJ A;  1TL1 A;  1UET A;  2HHQ A;  2C2R A;  1WSR A;  4CP5 A;  2LEB A;  4KB7 A;  4F67 A;  4U7U D;  4YDX A;  1R31 A;  1SPB P;  3EUN A;  3MAH A;  2HK2 A;  3T19 A;  4DPW A;  5HBM B;  1S7I A;  1DQ9 A;  1MMN A;  4WXO A;  2OEK A;  1S6P A;  3IC1 A;  1S1T B;  1LOU A;  4CLL A;  4QU7 A;  3KG4 A;  5B7W A;  1WOR A;  1T05 B;  3D6H B;  3O2I A;  2AJ2 A;  3HVW A;  1RBA A;  5F9L A;  4WWS A;  1S1U A;  1SC1 B;  3U1L A;  2H1Y A;  3DGP B;  3MMB B;  5CD4 H;  1LWE A;  4FF4 A;  2YNF A;  4GVL A;  1PJ7 A;  1B7Y B;  2HFZ A;  3HXM A;  3VV2 B;  2X1G A;  1P1T A;  2PT0 A;  1VQ6 S;  4BS2 A;  1UZD A;  3KUE A;  5KFN A;  1U26 A;  1AUS L;  3U27 A;  5KFK A;  1FJE B;  3IMQ J;  3EDQ B;  4FXW A;  1XMB A;  3KWM A;  3S1T A;  2R8H A;  4LBP A;  5BJR A;  5HLF B;  1H7X A;  2HBY B;  3LA0 A;  3NBP B;  4FKX A;  1IR0 A;  4JP8 A;  2A6O A;  3N6N A;  4Y3C A;  3C15 B;  2QX0 A;  2PA3 A;  3EWG A;  2XCP A;  4DR4 J;  2V0N A;  1QAX A;  3UR0 A;  3C19 A;  2BQR A;  4LMZ A;  4O3R A;  4K59 A;  3VAM A;  1WC3 A;  3HHK A;  4FPR A;  4F04 B;  2J9D A;  3C15 A;  3MF5 A;  1RYR A;  2RS8 A;  1JX4 A;  2HAI A;  4MMO A;  4OIX A;  5T41 A;  2AQ4 A;  4USM A;  2OEL A;  3KXD A;  3FEY B;  3WBZ A;  5E5N A;  4Y65 A;  5KG5 A;  4CH0 S;  2CJ9 A;  4UST A;  3FBE A;  5DM6 Q;  1MSW D;  3J7A N;  3ZZ0 A;  3V4M A;  1KON A;  2FJW A;  2BR0 A;  4M5D A;  5DQI A;  1IKY A;  3EVO A;  3MAQ A;  2PMW A;  5FD1 A;  2MQL A;  3GR0 A;  3I0S B;  5EGY A;  2HW3 A;  2ZHO A;  4O3Q A;  4Q0B A;  1YJ7 A;  1CC8 A;  1Y9O A;  2W25 A;  3V6K A;  5DZ6 A;  3HCX A;  5HAO A;  4X4T A;  3VAI A;  1YIJ S;  3IWL A;  4QBU A;  1JJH A;  3I0R A;  3EM1 A;  2VQF J;  1Q0N A;  2H51 B;  2C2K B;  3T1Y F;  3JB9 k;  2ZBI A;  4KGX B;  4DR4 F;  4L75 A;  1R8A A;  3W8P A;  4DV4 J;  2D3Z A;  4GRS A;  3HJV A;  3W3S A;  1Y11 A;  5BR8 J;  4FDF A;  1X4C A;  4M94 A;  3WX8 A;  2HQD A;  4ZVP B;  3AY0 A;  2YH0 A;  4D3H A;  3HHE A;  2XI3 A;  1Y10 A;  2DNN A;  4HTI A;  3K5O A;  1K1S A;  2LP4 A;  1ZPV A;  4OYB A;  4YB6 A;  1NCL A;  5A2Q U;  4DX7 A;  3FGV A;  4ED1 A;  2Z2L A;  3EGZ A;  6FDR A;  2H9Z A;  2BVZ A;  4FNH A;  1MWY A;  2EKN A;  3FFI A;  1XWL A;  4Z2X A;  4FYV B;  2D9O A;  2I5J A;  3J7Y U;  4J91 A;  3R27 A;  4J7C A;  3PKM A;  3PRD A;  3MR7 A;  1YZ6 A;  4CT9 A;  5EWE A;  3OD2 A;  2KXH A;  2HQI A;  4P74 A;  4PYD A;  4ELU A;  4NI2 B;  4DSE A;  3L7U A;  1LXJ A;  1MG7 A;  3ILL A;  4YN3 B;  4DV1 J;  1NH7 A;  2CDQ A;  4USI A;  5J2P B;  5IT9 U;  1SIZ A;  2VG6 A;  3EGW B;  4ID8 A;  3CED A;  3TAM B;  4CI0 B;  4F2R A;  3OVB A;  3W5Z A;  3MED A;  1E6Y A;  2PFF B;  4W4M A;  5J2P A;  3G82 B;  1WHX A;  2CIM A;  4X64 F;  3TAM A;  5HRO A;  4F4K A;  2GHW A;  3MPW A;  2RAQ A;  4CH7 A;  1GNK A;  1YQH A;  3OTC A;  2Z30 B;  4ICL B;  4EO8 A;  4QWA A;  3G82 A;  3NNH A;  3R8Y A;  2EG2 A;  5HRO B;  2B4V A;  3R9L A;  1S1X A;  3QGI A;  5K8P A;  3IWN C;  1T03 B;  2F4V F;  1OMS A;  2JNJ A;  3OXG A;  2DR9 A;  4LF5 F;  2WON A;  3GFZ A;  4U95 A;  3X1L B;  5K5M A;  3PVX A;  1VBX A;  2Y0B B;  1XEZ A;  1Y7P A;  3A3N B;  2HHT A;  5CZV A;  1FNM A;  1REV A;  1RUS A;  1M5H A;  1YJN S;  2C3M A;  1O6X A;  1HWI A;  2LQ9 A;  4TLR A;  2XSJ B;  2AYE A;  1U1N A;  4B3R F;  1GAO A;  3GG1 A;  3GFY A;  4OHX A;  3NRB A;  4R0J A;  1QY7 A;  4QU6 A;  3DLH A;  2QL7 B;  4DR1 J;  1H73 A;  1ACM B;  2XSJ A;  3DDI A;  4XO0 A;  2B6A B;  1G2E A;  2BKN A;  3A8K A;  3HMJ G;  3PYE A;  3PZP A;  1TV6 B;  2YPZ A;  1PYS B;  2CXE A;  3UD5 A;  5KG7 A;  1P6T A;  1RLC L;  4PG7 A;  2VL1 A;  2BAN A;  4EBE A;  3HJF A;  4M5G A;  5J2N B;  1NPP A;  4TQR A;  2HHP A;  1EZZ B;  2HZC A;  1KKH A;  4DR2 F;  4FP9 A;  2A3J A;  2RUS A;  5JMN A;  2RIJ A;  3N4W A;  4ZCM A;  1RAH B;  4IG0 B;  4ZJO A;  5T7L A;  3M2V A;  1JB0 C;  2YWF A;  5HVG A;  2C2O B;  1GFW B;  2X3D A;  1VFJ A;  4L73 A;  3V6J A;  2OD6 A;  9RUB A;  2R2T A;  3TJ8 A;  2G13 A;  5HSP A;  1HMV B;  1NZ8 A;  2IRX A;  3Q86 A;  2XY5 A;  1R7I A;  4ALZ A;  4QYR A;  3CJT A;  3W9H A;  4C3K A;  2HKE A;  5L9X A;  4JUZ A;  2SXL A;  3TEH B;  2Y1I A;  1HMV A;  2XLI A;  1U1O A;  3UO0 A;  4Q5V A;  2B8Q A;  4ZVQ B;  1D1U A;  4LVO P;  1IBK F;  1ZAW A;  3H0P A;  1KQK A;  1QUP A;  1SL2 A;  1VC6 A;  3R5A A;  1S10 A;  2VQE F;  4A8O A;  2L41 A;  1Q86 T;  4WP3 A;  1GTH A;  2YXL A;  4U8V A;  2C2Z B;  2O3D A;  1LK7 A;  4PCQ A;  3UFC X;  3SXL A;  2RUG A;  4ZMM A;  5L9N A;  1YJW S;  2QZ8 A;  3L95 X;  3M8R A;  4LFB F;  2R7X A;  4A48 A;  1FWK A;  3IAS 9;  2ZOG A;  4CTA B;  4QW9 A;  2MKC A;  5DDQ C;  2KI2 A;  2CJQ A;  2R7O A;  2ZKU A;  3ADA C;  3KLF A;  8AT1 B;  4NYP A;  3CSK A;  5IS2 A;  2L9N A;  1S0M A;  1PYO B;  2HAF A;  3CCM S;  2ACY A;  4JI5 F;  2LU1 A;  1FRI A;  1RAA B;  2WOM A;  3PG9 A;  2NQP A;  3KOA A;  3DLK A;  1B3T A;  1IM4 A;  4OX9 J;  1HNW F;  4HYK A;  1TFY A;  2A10 A;  4DR7 F;  4DL2 A;  4MTP A;  3G8S A;  2CPH A;  1S9G A;  1I51 B;  2F5G A;  4HHH A;  4OI1 A;  2QG9 B;  2DGS A;  3OR1 A;  2BJ3 A;  3Q0A A;  2C2M B;  1X4B A;  1ZPW X;  1S9G B;  2CQH A;  3CJ4 A;  4U8Y A;  4F2S A;  5KFB A;  1JIH A;  3QIP B;  2MKJ A;  2QN6 B;  7FDR A;  1H3D A;  4H4O A;  2ZH6 A;  2QA4 G;  4DR1 F;  2J7U A;  4PQA A;  1FE0 A;  3C2P A;  1R0C B;  2FHO B;  2HFU A;  3CE8 A;  4KPY A;  1IWA A;  1QD1 A;  3R5C A;  2XGP A;  4H4O B;  3UVJ A;  5KG3 A;  2XS7 A;  5LMU J;  1FXD A;  2NLW A;  2UVR A;  1B0V A;  5AXL A;  2GIQ A;  2XHC A;  4FF2 A;  2K3K A;  2OD4 A;  2X51 A;  4M5I A;  4XDD A;  1D9D A;  3U7J A;  4OI0 A;  2MLX A;  1O8B A;  2DGQ A;  3MUR P;  1I6J A;  4P7T A;  2I9S A;  2QLJ B;  2GVD B;  2BKP A;  4TNO A;  4DL0 C;  1UMJ A;  4CNZ A;  2NZC A;  5LOQ A;  2EI5 A;  2VJV A;  1AT1 B;  1CSJ A;  5I42 A;  4OYW A;  1UWB A;  3PFO A;  2W9B A;  2CPF A;  4OX6 A;  5KFZ A;  4CO0 A;  2ZJQ Q;  5B0D A;  2IBK A;  2LXI A;  2Y8W A;  4X66 J;  3N01 A;  2HNZ A;  1IWG A;  3MWB A;  5HI7 A;  1FHT A;  2YNH B;  3LH2 S;  3FQL A;  4ELT A;  2Z4P A;  3UR3 C;  2UVV A;  2NS1 B;  3MOZ A;  2VIH A;  1ZYQ A;  1CS4 B;  2CQP A;  4NLX A;  3MMC B;  3H5S A;  3ZO7 A;  4ZLP A;  5KFQ A;  1FRK A;  5AJ3 J;  4AQY J;  4ZHR B;  1CS4 A;  1NJW A;  2BV3 A;  3JQM A;  2HHS A;  1R43 A;  3MCO A;  5KFM A;  2FJE B;  4KBI A;  2HND A;  3TUP A;  1HBN A;  2AJ4 A;  2Z57 B;  1HNZ F;  1YDL A;  2PGC A;  3ILJ A;  1U0H A;  2G1H A;  3SSS A;  4E98 A;  5CHC B;  2GVZ A;  1NJI T;  1X31 C;  4HLB A;  1F5C A;  1UCN A;  1ZS6 A;  3M7V A;  2PII A;  4TY8 B;  5GVQ A;  3UCG A;  4H4K C;  2IMW P;  5HQM A;  2VBZ A;  1RT4 A;  2QRR A;  2ZFH A;  5ETP A;  3E01 A;  2AZ1 A;  2VZ9 A;  2A18 A;  4LBH A;  1UP1 A;  4CLP A;  2Q79 A;  3MM6 A;  5KOX A;  3THP A;  4IQX A;  4J90 A;  2XI2 A;  2AKW B;  3BO4 A;  1RBO B;  4DQR A;  2N82 B;  3WIU A;  4V19 J;  3BBC A;  5KFV A;  2VD3 A;  2X1F A;  3W9I A;  3I82 A;  1W7W A;  2ROP A;  4LSL A;  2V8V A;  4P75 A;  3A12 A;  1NDP A;  5L8R C;  3MI7 X;  3NWG A;  2K2P A;  1TQL A;  5U47 A;  3SBM A;  3UN2 A;  3VVT A;  1L3K A;  4JBC A;  1JJ2 R;  4OZN A;  3SQG A;  5DLF A;  4X4V A;  4XK8 C;  1FWP A;  2VBX A;  3NG8 A;  4NXM J;  1CJV B;  1UFK A;  1N4L A;  3ZTQ A;  1CQM A;  4FF1 A;  2XMA A;  3RRK A;  4QWC A;  1RE1 B;  3CNQ P;  4P10 A;  1HYS A;  5F8I A;  1WNE A;  3OTO J;  3EZO A;  2CNO B;  2XZT B;  4DZD A;  1AZS B;  2OPS A;  3SCK E;  5AXK A;  2X1A A;  2IBO A;  3H7H B;  4UOF A;  1BLU A;  1SKU B;  1YBT A;  2R8J A;  4NPO A;  4DCP B;  1B64 A;  3BYP A;  2YKN A;  2CQC A;  2M4M A;  6AT1 B;  4C8M A;  1Q16 B;  2ZBR A;  2OO4 A;  2ZVI A;  3MMA B;  1KQF B;  2JEF A;  1K9M T;  1OY9 A;  3MM8 B;  2RF2 B;  3J7A 1;  2H54 B;  2NUH A;  4CO2 A;  1BWV A;  1PC4 A;  2GCF A;  3PJ9 A;  1SKW A;  4FBU A;  3MMA A;  5M2R A;  1DJ0 A;  3DXB A;  2LQ8 A;  4X4U A;  3BR8 A;  1IBK J;  2D1C A;  1FCA A;  2VFR A;  1EHW A;  2VKR A;  5HK4 A;  2A1B A;  4N47 A;  4N8N A;  3TUI C;  4DX8 H;  5HMY A;  4J9O A;  1M1K T;  4DEZ A;  3HPO A;  1KQS R;  4B9U A;  2DRA A;  2E1P A;  1G1X A;  1RT7 B;  2GNK A;  2J8A A;  3PJW A;  1HHQ A;  4K4S A;  2CG8 A;  1X9W A;  3ISZ A;  2IDL A;  4Y2M A;  2IVY A;  2VPZ B;  1NHK L;  3K57 A;  1HW9 A;  3OXF A;  1VQK S;  3RB3 A;  4JI1 J;  2XY6 A;  3L3C A;  1HA1 A;  2W4D A;  4HH0 A;  4K4V A;  2RE1 A;  4WK1 A;  5F0U A;  1M1H A;  1JXL A;  3CJ3 A;  3A8E A;  3GSD A;  1U0S A;  2FLL A;  2V67 A;  2V4J B;  3W65 A;  3DN9 A;  3I96 A;  4OJ1 A;  3KJV B;  4ZA1 A;  2CJY B;  3FJ2 A;  5D77 A;  2MB0 B;  2ASL A;  2XZW A;  2BX6 A;  3D4J A;  4FVC A;  4NLY A;  5EX0 A;  2BW2 A;  1K44 A;  4X62 F;  1QSY A;  2FJA B;  3J81 U;  2WSE C;  1AB8 A;  4TXS A;  4CO5 A;  3D66 A;  2DXF A;  2DNL A;  1UVM A;  1EQ0 A;  2V8H A;  2RRN A;  3TEG A;  4Q0B B;  1VK8 A;  4CO4 A;  2BJD A;  3DXS X;  2PMH A;  3ITH A;  4TYB A;  1FD8 A;  3V5R A;  2PFD A;  1TKZ B;  1H0H B;  4TN2 A;  2WB4 A;  1U02 A;  3LF0 A;  1VBK A;  5F8J A;  2UUB F;  1F0X A;  2CJA A;  2VG7 B;  5F3T A;  4JI0 F;  5A8R B;  1GH8 A;  1URR A;  2CQD A;  2H4Y B;  3N0V A;  1L3T A;  4PUO B;  3CCQ S;  2B51 A;  2DY1 A;  4WFZ A;  3M1V A;  1M5K C;  4ED6 A;  4Y2A A;  4LF6 J;  1IVZ A;  2VHG A;  1ZZN A;  1OQ3 A;  2HZV A;  4ZVS B;  3DHX A;  2ASJ A;  1L3V A;  3BBF A;  2BAC A;  2JC0 A;  1RHM B;  4DN0 A;  1LQ9 A;  7FD1 A;  1A7G E;  3BGR A;  3BN4 A;  3HHL C;  3M8Q B;  2DEJ A;  3DOM A;  3FBC A;  3M8Y A;  3MDF A;  3PDN A;  4HVZ A;  1B0P A;  4MYT A;  2QL5 B;  4CDI A;  3R2C J;  1RT1 B;  1WKJ A;  5IWA F;  4IRK A;  5AE1 A;  2YWE A;  5GAE U;  2WVE A;  3BGR B;  4DG1 A;  2F9J A;  2IA0 A;  2J0W A;  3HVT B;  1IR2 A;  4RW7 A;  2J0Q D;  3QSI A;  4DV4 F;  1RT1 A;  3GMG A;  3FEZ A;  2DGO A;  1NK9 A;  4ZK7 M;  2LEC A;  3NKY A;  5B0F A;  3MGJ A;  2MY8 A;  4BLG A;  2DRB A;  2EFV A;  2HVD A;  4C3M A;  5KFL A;  1X5S A;  2ACM A;  1KOH A;  2MHE A;  3G8Q A;  4R25 A;  5IM0 B;  4DX5 A;  3J7Z T;  4OHV A;  2HQ3 A;  4WP8 A;  2OSR A;  4P9S A;  2AF6 A;  3DLG A;  3CO0 P;  4OZJ A;  3LWL A;  2ZH9 A;  3DRS B;  2JOQ A;  4USV A;  4C8Z A;  1QSS A;  1MN7 A;  2LQ5 A;  2PN6 A;  2FVS A;  3C46 A;  3H42 A;  1U1L A;  2XGQ A;  2FD2 A;  1T3N A;  4ECS A;  4UOG A;  5IT4 A;  3FSX A;  2XO7 A;  2R7T A;  1EJ7 L;  2RDD A;  3C16 A;  4FN5 A;  4TU8 A;  3J80 U;  3BB5 A;  1FJG J;  4UZB A;  1WI6 A;  3C3L A;  1HI0 P;  1GMW D;  1A6L A;  1TKX B;  3H5U A;  1S0O A;  3GE9 A;  1ZTW A;  1YGY A;  3BS9 A;  4Q8E A;  4MFB A;  1T03 A;  1HI1 A;  1REG X;  4KGV B;  3DOK A;  3VZH A;  1RHU B;  1TKX A;  2XO6 A;  3OSP A;  1UPP A;  4ECR A;  2MKS A;  4PPD A;  3D6F B;  1RTI A;  4NLT A;  2R7R A;  1D09 B;  2C3O A;  4HL9 A;  3CWJ A;  1REV B;  1VMB A;  4EUV A;  2YTC A;  2DHA A;  2ZUG A;  1K47 A;  4DU8 A;  2KVI A;  5KT4 A;  2CA9 A;  4RW8 B;  4KGZ B;  1N5S A;  2XWX A;  3EXY A;  5C2G A;  4R8U B;  3HT3 A;  2HHV A;  1GX5 A;  3H4D A;  3BSA A;  4K4T A;  1H2T Z;  1PIE A;  4QIF A;  4O44 B;  1X4E A;  3T5H A;  1KVJ A;  2OI2 A;  2YWH A;  4RW8 A;  5BYR A;  2DR5 A;  2MY7 A;  3GV7 B;  2VKZ G;  1NK5 A;  2YWK A;  2ZZN A;  4NE9 C;  1PCA A;  3DRX A;  2OPP A;  1YX2 A;  3CDU A;  2LMI A;  4E0D A;  2XS2 A;  1O51 A;  4I67 A;  3CDE A;  1TKT B;  2OML A;  1S77 D;  2XS5 A;  2EFN A;  5J2N A;  4KHP F;  2Q6B A;  5IXU A;  4U7C A;  1WEZ A;  3AFG A;  3KYL A;  4IRD A;  1VQN S;  1LW0 B;  4ED2 A;  1S1U B;  3WIV A;  1FRL A;  5HAT A;  4F0M A;  3DGP A;  5B0B A;  1DTQ B;  5H9F K;  1RT3 A;  4HEA 9;  1RWU A;  2FJD B;  2AX1 A;  1WTF A;  1YK9 A;  2YQ0 A;  4L3K A;  4NLD A;  4UTG A;  4ZP8 A;  4U67 Q;  1LW0 A;  1K1Q A;  2PD1 A;  3AB2 B;  1EKS A;  3W60 A;  2E66 A;  4OYP A;  1X0F A;  4C8L A;  4B9L A;  1ZZF A;  2XMT A;  1H72 C;  3ZFV A;  2VC0 A;  5KFX A;  4JV0 A;  4KTQ A;  2OFG X;  2C3U A;  2W2M P;  3FSI A;  3LW5 C;  4C4W A;  4A8X A;  2HNY A;  4HR2 A;  3HI9 A;  1RAB B;  4ZIW A;  1GEH A;  3JTN A;  1VRQ C;  3SV4 A;  1O5J A;  1VOM A;  2HNY B;  3LTO A;  4J9L A;  1G6B A;  2P9G A;  4FYX B;  4QR1 A;  5ADZ A;  2AYG A;  4DR2 J;  4UF4 A;  4WFB Q;  2KZZ A;  1F3V A;  3ET6 A;  5E3C A;  3V6D A;  4I64 A;  2NYI A;  2ZM6 F;  3GPA A;  1YRU A;  4I2Q B;  4ZDN A;  4N56 A;  1UVN A;  3FZ2 A;  5D6G A;  2XQC A;  4B9N A;  1N32 J;  1N6Q B;  4PG6 A;  1PJ6 A;  3FC9 A;  3NWR A;  3PXG a;  2MQO A;  1RI7 A;  1VC5 A;  3DLJ A;  2UUA J;  1JWW A;  4I2Q A;  3NMA A;  1NH8 A;  1TKD A;  3KFW X;  2F40 A;  4FPI A;  3Q8S B;  2D41 A;  1W26 A;  3F41 A;  4DXL A;  2L9D A;  2PEB A;  2H3E B;  3JS9 A;  2KO1 A;  2UXC J;  2AEJ A;  2WOM B;  2N7C A;  2NUU G;  3NEK A;  4MKB A;  5IFM A;  2FHJ D;  5C5J A;  3EYZ A;  4LF7 F;  1N33 F;  3I0S A;  4RLE A;  4B3O B;  2RH3 A;  2P2C B;  2OTJ S;  1FDD A;  3MTK A;  2GW8 A;  3FCW A;  5B0A A;  3MR6 A;  1T8E A;  1SQF A;  1Q8K A;  2IPO B;  4B9S A;  1FK9 B;  2QYC A;  3QO9 B;  4B3O A;  1U8W A;  1S6U A;  2N4D A;  3OLA A;  2DB1 A;  4XPE A;  1HNI A;  3QIP A;  3SCI E;  1SC4 B;  3OFF A;  3CC4 S;  1VDH A;  1WKK A;  3AOC A;  5GAG U;  1NU4 A;  4DUY F;  2KXF A;  3OL6 A;  2KM8 C;  2PA8 D;  2H5I B;  3W61 A;  4NLP A;  2ZWP A;  4RU9 A;  3OR2 A;  4F3M A;  4ER8 A;  3AAW B;  2YX4 A;  3DDN A;  1N0V C;  5JUM A;  4WCE Q;  4H4K A;  4IO9 Q;  2MZR A;  1IBL F;  3NOG A;  4NEZ A;  2NXU A;  4ZP6 A;  5M2U A;  1CJK B;  3F44 A;  3MEE A;  4I7F A;  1K73 T;  3N5B A;  1FDN A;  1RBL A;  3J80 Y;  3HSG A;  2G0I A;  1V6H A;  5I4M A;  1ZET A;  3P6Y C;  1BQN A;  1CJK A;  1JLE B;  1S6O A;  3AD7 C;  5KFO A;  2JEJ A;  3MEE B;  4MKY A;  3QMQ A;  1TMJ A;  3GB0 A;  2LLZ A;  3RJM B;  3ISN D;  1UWB B;  1WD6 A;  4DCJ B;  1JLE A;  3NCP A;  5C25 A;  1T11 A;  3HKW A;  4PXE A;  5D8H B;  2A0F B;  3TRG A;  3QYY A;  1NDC A;  3DNC A;  1NM2 A;  4LRE A;  5C25 B;  1WF1 A;  4IFY A;  3BH7 B;  3R7S B;  2L08 A;  1LFP A;  2VG6 B;  2P8I A;  4BC9 A;  4EU0 A;  1HQU A;  3L7P A;  1BC6 A;  2O01 C;  4O4R A;  1KS2 A;  3VZI A;  4DPO A;  2HHX A;  5E3P A;  3W62 A;  4FYD A;  4M5N A;  1AA1 B;  2OLW A;  3I5A A;  4DSL A;  4RUA A;  1RWW B;  1LKZ A;  3HVR A;  2W8K A;  2AP6 A;  3DRY A;  3CXC R;  2RQC A;  3K8V A;  2EWH A;  1HBO B;  3NGK A;  5BYQ A;  3U02 A;  3UN3 A;  3GON A;  4ES3 A;  3VAF A;  2HFO A;  3MFH A;  4UQG A;  1S1X B;  1S48 A;  2JWN A;  3PJX A;  2E44 A;  3O3L A;  2QSF A;  1I3O B;  2GVZ B;  2AGO A;  1GXL A;  2BKO A;  3GU0 A;  4N5S A;  1JLQ A;  1W2B R;  1S9E A;  3T9N A;  2BOA A;  3K2Y A;  3PM9 A;  2GFF A;  3HFV A;  3V81 B;  3KDO A;  4DWI A;  1SIW B;  3M8Z A;  4DS4 A;  4RW9 B;  3CCR S;  3CC7 S;  1A9N B;  2YVS A;  1RKJ A;  1JLQ B;  3MD1 A;  4KPC A;  2YY3 A;  1Y5N B;  3P45 B;  5I3U A;  3VQS A;  2C1E B;  4K5R A;  4RW9 A;  1WJ9 A;  4LSN B;  2NYH A;  3UDV A;  4F36 A;  5JJB A;  1RDR A;  5MAO A;  4AL7 A;  3CUN A;  1E6V A;  1M5O C;  1MNE A;  3UQS A;  2NSC A;  3OL9 A;  3SDE A;  4ITS A;  1E6V B;  4LBI A;  1KFS A;  4WFX A;  5IQ6 A;  3S7R A;  2Y9H A;  1FRM A;  4AE5 A;  5C24 B;  2UXD F;  3MM5 A;  1NJY A;  2LYV A;  1TP7 A;  4KH1 B;  5E3A A;  1U25 A;  2R7Q A;  5THW A;  2N7Y A;  1YRX A;  4I2P B;  5RUB A;  1FJ7 A;  3TAP A;  2KHC A;  3BYR A;  3MHY A;  4ZVR B;  5C24 A;  8ATC B;  2QTW A;  2WAQ D;  3OHA A;  3B6B A;  1HYS B;  4RNH A;  3M6W A;  1NK6 A;  2MJU A;  1JLC B;  3PY8 A;  3P49 B;  4L72 B;  4NLQ A;  2ZJR Q;  3TZZ A;  4OJH A;  4DQQ A;  2BXJ A;  1Y3J A;  1AFI A;  1MU2 A;  3QQC D;  1QAY A;  4KSE B;  2GV1 A;  1T3O A;  2W9C B;  4X84 A;  4ZIV A;  3MZI A;  2GC8 A;  3QFW A;  1SUQ A;  3PYD A;  2HYI B;  1HPZ A;  2HGN A;  5C42 B;  1RAO A;  5IV3 A;  2HVE A;  5T14 A;  3CC2 S;  4F50 A;  3DFE A;  2EKY A;  3POT A;  1UKU A;  2HVZ A;  3BV8 A;  3IAM 9;  4B9T A;  5C42 A;  2HRY A;  4Y00 A;  1JLG A;  2YWW A;  3AJ1 A;  2D9P A;  4MK7 A;  3PW4 A;  2FTR A;  3GCW P;  1GXT A;  1CLF A;  1R8P A;  4ZOS A;  3QRQ A;  3EXC X;  4CTA A;  1IBM J;  3LAM A;  4QR2 A;  4RPF A;  2DH9 A;  3BZQ A;  4IKA A;  1UW9 A;  2YKM B;  5CYQ A;  1RT7 A;  4K5S A;  3SYZ A;  4JI8 J;  4O3S A;  2Z0G A;  3C66 A;  3UN5 A;  2J7K A;  1J5E F;  3K0J A;  1VQY A;  1RTZ A;  3DDK A;  5HO4 A;  1SJF A;  2KT2 A;  3JYT B;  1SH2 A;  2WBR A;  3BRE A;  4Q44 A;  1J2V A;  4XAK A;  1BY9 A;  1T9X A;  3I4H X;  3Q23 A;  1HBU A;  2H5E A;  1IQZ A;  4JOU A;  4F0K A;  5J2M A;  2R7V A;  1IN0 A;  1YJV A;  2M52 A;  3RYL A;  2W8L A;  3M8P B;  3CCV S;  4QQB A;  1Q8B A;  3TP2 A;  3BM7 A;  1FEH A;  2V4J A;  3JSB A;  3CD0 A;  4NLG A;  3MOJ B;  3KJF B;  1EKR A;  3T5K A;  4DFM A;  1U8S A;  3KJQ B;  3PX4 A;  2B4O A;  3P5T L;  4DV3 F;  3DLE A;  4DL6 A;  3H2L A;  2IYG A;  1S12 A;  2AEM A;  2BMB A;  5ETM A;  1YIT S;  4BWM A;  3ZTP A;  4OJG A;  2ZHB A;  1NEE A;  1Q8I A;  2GO8 A;  3GCX P;  4WPA A;  1QTM A;  4UY8 T;  2QL9 B;  2XMJ A;  4CO3 A;  3IR6 B;  4AD6 A;  2VF3 A;  1ZAV A;  4K4W A;  2LDI A;  3AD8 C;  5D0E A;  2CDR B;  5EN1 A;  4Y6I A;  2EK1 A;  2BJ7 A;  2XY7 A;  1P9Q C;  5AT1 B;  2YNG B;  2ZD1 B;  1RAC B;  4PEO A;  4WII A;  3GQC A;  2ZH5 A;  2GVD A;  3TA2 A;  4LQ3 A;  3QRR A;  3C6T B;  2AJQ A;  4NYO A;  4DUY J;  1KFD A;  2Q6C A;  3TO8 A;  3KG0 A;  3QJP A;  2AMC B;  1HD1 A;  1Q82 T;  4JI6 F;  5GAD U;  2XSF A;  2OPQ A;  1R89 A;  4OI4 A;  3C6T A;  4PXB A;  3J81 j;  2YKQ A;  4A8M P;  1ZM2 A;  2B9W A;  3Q8Y A;  1EIY B;  2DNZ A;  3UNG C;  4GMK A;  2ZOM A;  4C97 A;  1XC9 A;  3QLH A;  4JI7 J;  2R3V A;  1C0U B;  3M8Q A;  3T1Y J;  1ZM9 A;  3DOM B;  3VR1 A;  1JLA A;  3HHD A;  3OQ2 A;  1ZM4 A;  3AQP A;  1NJZ A;  3W2W B;  3R6G B;  1U6Z A;  1PC5 A;  3AOD A;  4ZIT A;  3PR5 B;  2DR7 A;  2QLF B;  3HVT A;  4RW4 A;  1OY6 A;  3K5M A;  2ZUA A;  2EC0 A;  3W2W A;  3ZZY A;  5DGA A;  3LQV A;  5ETT A;  4RBT A;  3ZZZ A;  2GAH C;  4CLF A;  3CCJ S;  2V68 A;  3V6H A;  2UUA F;  3TA0 A;  3JTP A;  1LW2 B;  3KJN B;  3M9M B;  4WZM A;  3M05 A;  2RDI A;  4ECV A;  2WVD A;  1OSC A;  2IJF A;  3QAT A;  4LF8 J;  2HMI B;  1LNQ A;  2VFT A;  3MCS A;  4ZCL A;  1HNV B;  3Q8V A;  5CAB A;  2QIF A;  3DRS A;  4TU7 A;  5D0H A;  1R8B A;  3PYG A;  3AXM A;  1U24 A;  1RAG B;  4HKQ A;  1UFW A;  1RT4 B;  4ILL A;  1WEL A;  1NRK A;  2B7C B;  2Y0S D;  4MIW A;  4A4J A;  3MUV P;  2BE2 A;  4KT0 C;  2C42 A;  5L1I A;  3O6Q A;  3EPG A;  2E5L J;  4NLO A;  2DHG A;  3I9Z A;  1XK8 A;  4ECX A;  1JXV A;  4URS A;  1NAQ A;  3HP6 A;  2IIH A;  4PG4 A;  2X7I A;  5IC6 B;  3RAQ A;  2UVU A;  1RTI B;  1TUW A;  2Y1J A;  1BQX A;  5IT9 Y;  3CD6 S;  1G3O A;  1RAE B;  2B7B B;  1CUL B;  1CJU B;  1Y3K A;  3HFZ B;  3IXQ A;  4M5K A;  4ZVH A;  1HWU A;  3GSI A;  2ASD A;  3D6T B;  2DIT A;  3MD3 A;  3MXH P;  2E9Z A;  3OT9 A;  3HF5 A;  2MKI A;  4O44 A;  2RHQ B;  2AW0 A;  2L9W A;  4KC5 A;  2Y8Y A;  4U6P A;  4DSJ A;  5DO2 A;  2CWK A;  2F8E X;  1HWJ A;  1S1T A;  1JLB A;  4OZ0 A;  4PXC A;  3OLB A;  1WOO A;  2EPI A;  2M8D B;  4F4X A;  2OPP B;  1NHU A;  2ZBC A;  4J9P A;  1TVR B;  3UWT A;  3T3F A;  2GML A;  4R5P B;  3BPD A;  1NND A;  3MMB A;  1F60 B;  2J0X A;  4ZP9 A;  1VJQ A;  1LWE B;  1SXL A;  3CJ8 A;  3E8O A;  5CQG A;  2YNF B;  2XCA A;  3RTV A;  1TAU A;  3AOB A;  5E7O B;  3CTR A;  3R5D A;  1WHY A;  4CLS A;  5J1N A;  1T9W A;  2WB1 D;  3QT6 A;  5KOW A;  3D5M A;  4J9S A;  1J5O B;  1RT3 B;  3R5B A;  3R1H A;  1FFS B;  2B0G A;  4FKY A;  5CXT A;  1ZH5 A;  5CZX A;  2V4Q A;  1VJW A;  3I32 A;  3K5L A;  1HNZ J;  4Z7Y A;  2PI5 A;  5SZT A;  3LP1 B;  4OHW A;  1X4G A;  1XQI A;  3CIZ A;  4E8U A;  3J81 Y;  5HLF A;  2UP1 A;  1VQL S;  3NBP A;  5AJ3 F;  3T6B A;  3NCQ A;  5JVG Q;  3LP2 B;  4G1Q A;  1Z2Z A;  4EK2 A;  1LEO A;  4LF9 J;  4RNN A;  5ETO A;  4O0I A;  2D74 B;  3AQO A;  4IR1 A;  2HQG A;  3PW0 A;  2A2C A;  3GG0 A;  3CDA A;  1BGX T;  5DGB A;  3D2W A;  4NL5 A;  4J9K A;  1X9S A;  2F4V J;  3AOA A;  3D0I E;  3LGM A;  4DPX A;  3MEC A;  3R6L B;  1IR1 A;  2U2F A;  1F2G A;  1QVG R;  4LFA J;  3OV7 A;  2KXN B;  5HL7 Q;  1IKV B;  1U2R A;  2GGP A;  3KJV A;  4K2X A;  1RWV B;  4ZCK A;  1NB2 A;  2M7S A;  3Q8U A;  1R8C A;  2G2Z A;  5M2P A;  3FBF A;  4ZPA A;  1NK4 A;  5D0G A;  5KFY A;  1ZA1 B;  1RWN B;  2HRU A;  2U1A A;  3SSR A;  3KLI B;  4I0W A;  3B4D A;  3MPY A;  3VAH A;  2KG1 A;  1PBU A;  4JV5 F;  3KUH A;  1DTT A;  5EWG A;  1FRX A;  1U4B A;  3N6M A;  4DV3 J;  1HI8 A;  1RWX B;  4OZ2 A;  1DBD A;  1SL1 A;  1HAR A;  2P9C A;  2VG7 A;  2DCU B;  2DY9 A;  5A8R A;  1VC0 A;  3S8S A;  4MK8 A;  4ETZ A;  2UXC F;  5KG0 A;  3TJA A;  3K7R A;  3TYT A;  3M1V B;  1NSP A;  1L3U A;  1RGV A;  2E1M C;  2BRK A;  2J7W A;  1EP4 B;  2KRB A;  3FQK A;  3UDC A;  4DQI A;  2PEH A;  2BAB A;  4CH1 A;  3T6J A;  1Q8L A;  1VQ4 S;  3OXL A;  4PRF A;  4HH1 A;  1TL7 B;  2FGC A;  1EP4 A;  2IJR A;  2EFG A;  4B02 A;  2FB0 A;  4C11 A;  2HK3 A;  2E9T A;  5H1S V;  3M30 A;  4I7F B;  1XR7 A;  1S59 A;  2ALY B;  2LXF A;  3O1L A;  4TVA B;  4DZ6 A;  4ZN3 A;  5A8K A;  4C11 B;  1LFW A;  3KNG A;  5L46 A;  5F8M A;  3VAJ A;  4DV2 F;  1DAX A;  1VCT A;  2PO4 A;  1KD1 T;  3RAM A;  4MYU A;  3CJR A;  1T05 A;  1HBM A;  2CUY A;  4GVB B;  3T5L A;  5LMN F;  1AW0 A;  2MKH A;  2M3D A;  2QSW A;  3FEX B;  5E3R A;  1L5U A;  2I8E A;  3BF4 A;  4F0H A;  1VHI A;  1OIA A;  1C2P A;  3PKY A;  4YOE A;  4OYX A;  2CZV C;  1HBM B;  1V3R A;  2XMU A;  4GVB A;  5LSO A;  3QZ7 A;  4A8F A;  4W90 B;  2RKI A;  3CCS S;  4DSF A;  2CQB A;  4DOZ A;  4L3N A;  5LSL A;  2NRE A;  1X4H A;  2G4B A;  2AD9 A;  2D69 A;  3K89 A;  2W7A A;  2DO0 A;  2X3G A;  4ICL A;  5AE3 A;  2RKI B;  5DDP C;  4ED8 A;  1XNQ F;  2OGU A;  3BH6 B;  1VR6 A;  2EXU A;  3AD9 C;  3C16 B;  1JLF B;  3ETM A;  3CF5 Q;  4RKU C;  4DR3 F;  4JYA F;  1YJT A;  3HZE A;  5ETV A;  1SQE A;  3SQO P;  4BBY A;  4IR9 A;  1KBR A;  1X7V A;  4DF8 A;  5J1P A;  2HLT A;  3QWP A;  3JSM A;  3G6E S;  3RRH A;  1VQ9 S;  5HQL A;  2IHR 1;  2WVC A;  2JL9 A;  2R7S A;  1TK0 A;  4NCA A;  1URN A;  3AXK A;  4YB5 A;  2NXE A;  1TK5 A;  3WZ0 A;  3JSM B;  4N76 A;  2IAJ A;  2HFV A;  3WC2 A;  2DH8 A;  2V94 A;  5CD4 A;  3PW7 A;  5DZ7 A;  5D4P A;  1Q95 G;  4ZVU B;  4WU2 A;  4C98 A;  1U1M A;  3AHP A;  4ZPC A;  2E9R X;  1SJR A;  3MPD A;  2LEP A;  4LSN A;  4ES1 A;  3KHL A;  4H54 A;  1S57 A;  2J5A A;  1F6T A;  5KG4 A;  2Z2Y B;  2VV5 A;  1XNR J;  4K8R A;  1BHN A;  2VOP A;  3BKT A;  4I6Y A;  2BAN B;  4NEY A;  4DV2 J;  2HGM A;  1RKI A;  1RAI B;  3PFE A;  4EFA C;  2DNH A;  3SDE B;  2BW7 A;  4QWE A;  1XNQ J;  3CDW A;  1TKT A;  9ATC B;  1S9F A;  1U49 A;  3MR3 A;  1TU0 B;  2I0X A;  2I38 A;  3IGV A;  3C14 B;  3W63 A;  3GV8 B;  1R0A A;  1S1W A;  2W2O P;  5T7L B;  2HHH J;  1H2U X;  2HBR B;  4FNI A;  3Q22 A;  5LL6 d;  4IG3 B;  1WF0 A;  3C14 A;  1RWO B;  3HFK A;  4C8N A;  3NY0 A;  4WYL A;  2RU3 A;  1R0A B;  2B3T B;  1JLC A;  4NZ7 A;  4NWB A;  2ZOF A;  3LAL A;  4IG3 A;  3A1Y G;  3G96 A;  2VU5 A;  3HDS A;  5CYJ A;  3KK2 B;  2XMK A;  3SCL E;  3VQT A;  4DL4 A;  4PWD A;  2OMO A;  3N6L A;  2V69 A;  4UUX A;  3W8G A;  3PW5 A;  4GC6 A;  3PEH A;  2JLF A;  2ERR A;  2GS8 A;  1RHQ B;  1SQG A;  3KK2 A;  4WYW A;  3RW6 A;  4C48 A;  3A13 A;  2UUB J;  5KG6 A;  3ENA A;  2W1B A;  3OHB A;  1JK9 B;  2IFX A;  5L1J A;  1JJ4 A;  3GJR B;  2CVI A;  3IWX A;  3K8W A;  4OZL A;  2IDE A;  4ZVE A;  3IRX A;  1FD2 A;  1FI4 A;  4IOB A;  1V5V A;  2D7S A;  3FCV A;  3POT B;  6FD1 A;  2R7W A;  4K50 A;  3H90 A;  5KG2 A;  2W2Q P;  4QW8 A;  1VLY A;  3TQE A;  4ATN A;  5DLG A;  1LWX A;  4YR2 A;  2ZH8 A;  3RBE A;  1JLG B;  1N0U A;  3T41 A;  1U47 A;  1SC3 B;  1IKW B;  2AWZ A;  2QA1 A;  1Q7L B;  3JQK A;  1T9U A;  1QLN A;  5HN0 A;  1TEL A;  2AJ0 A;  1T95 A;  4TQS A;  3NS6 A;  2OFH X;  5KFC A;  1IKW A;  4A8W A;  1QJH A;  1UW4 A;  4WTY A;  3LGH A;  1F9E B;  1WG1 A;  4Y2C A;  2EC2 A;  5DJB A;  4DN9 A;  5LSR A;  2OTL S;  2RVJ A;  4WE1 A;  3FRY A;  3FZB A;  3JYT A;  3OR1 B;  2CNK B;  4ECZ A;  1RB0 A;  4HTJ A;  2XUL A;  2MST A;  1WG5 A;  2MQN A; 
#chains in the Genus database with same CATH homology
 1PAE X;  1NPK A;  3Q8V A;  5CAB A;  3EVM A;  1S59 A;  4DZ6 A;  4F4A A;  4HR2 A;  2BX6 A;  1K44 A;  2HUR A;  4CP5 A;  2NCK L;  5C7P A;  3B6B A;  4WBF A;  1S5Z A;  3R9L A;  2DXF A;  3VVU A;  5BXI A;  1MN9 A;  1HLW A;  1JXV A;  3GPA A;  3GP9 A;  3PRV A;  3FC9 A;  1NSK L;  5CAA A;  3ELH A;  3BH6 B;  4ENO A;  3ETM A;  3JS9 A;  2HVE A;  1NDL A;  1NUE A;  3NGS A;  3DDI A;  3BBF A;  3EMT A;  1HIY A;  2DYA A;  2CWK A;  3NGU A;  3FBC A;  3FCW A;  3ZTR A;  1ZS6 A;  1UCN A;  1WKJ A;  1U8W A;  2AZ3 A;  2AZ1 A;  4ANE A;  4FKX A;  1WKK A;  2BEF A;  4C6A A;  2HVD A;  3MPD A;  4ANC A;  3BBC A;  4FKY A;  1XIQ A;  1PKU A;  3ZTS A;  1S57 A;  1F6T A;  1W7W A;  1B4S A;  1NDP A;  1BHN A;  2B8P A;  3Q86 A;  1F3F A;  1XQI A;  4S0M A;  1MN7 A;  2DXE A;  3FBE A;  3VVT A;  4UOG A;  1NSQ A;  2B8Q A;  3NGR A;  1BE4 A;  1LEO A;  4EK2 A;  3EVW A;  3ZTP A;  3ZTQ A;  3EVO A;  1VYA A;  1NDC A;  1NLK L;  3Q89 A;  2VU5 A;  3BH7 B;  3VGS A;  2DXD A;  4UOF A;  3EM1 A;  3FKB A;  1NB2 A;  3VGU A;  3EE3 A;  3Q8U A;  4DUT A;  3ENA A;  3FBF A;  3G2X A;  3WX8 A;  3EJM A;  3Q83 A;  4AND A;  3FCV A;  3PJ9 A;  3Q8Y A;  1B99 A;  1KDN A;  3B54 A;  1NDK A;  4W98 A;  1LWX A;  4DI6 A;  1NCL A;  3NGT A;  1BUX A;  1EHW A;  3FBB A;  3BBB A;  4UOH A;  2DY9 A;  3DKD A;  3ZTO A;  1HHQ A;  2ZUA A;  4KPC A;  3VGT A;  1NSP A;  1WKL A;  5IOL A;  1NHK L;  3EIC A;  4F36 A;  3VGV A;  3L7U A;  4O0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...