3JSMB

K65r mutant hiv-1 reverse transcriptase cross-linked to ds-dna and complexed with tenofovir-diphosphate as the incoming nucleotide substrate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
426
structure length
413
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the role of the K65r mutation in HIV-1 reverse transcriptase polymerization, excision antagonism, and tenofovir resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna complex
molecule keywords DNA (5'-D(*A*TP*GP*GP*TP*CP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP
total genus 88
structure length 413
sequence length 426
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3jsmB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jsmB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jsmB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jsmB03
4U7CA 1RT2A 3GQCA 4IR9A 4IQXA 1K1SA 2IC3B 1S0MA 2AGOA 1S9GA 4RW8B 4NLYA 2JEJA 4J9NA 3I0SB 1LW2A 3N6LA 5KG1A 4IG3A 3DI6A 4MFBA 4WE1B 4Q0BA 3IRXA 3M9MB 1TP7A 1HYSB 3E51A 3HVWA 1LWEA 2XC9A 2YKNA 5HROB 2AQ4A 1JX4A 4Q8FA 1T03B 3EZUA 2HMIB 3MR5A 1RT7A 3DRRB 3KLFB 2XWYA 3DLKA 4ZP8A 4Y34A 2AX0A 1I6JA 1NHUA 4KKOA 5DG7A 2WTFA 3RBDA 1HYSA 1QE1B 3NAIA 3CJ2A 5KFPA 2BR0A 5KFQA 4ECQA 2JEGA 5EUHA 5J2NA 2BQUA 4TYAA 5L1JA 5L1LA 1DTTB 1HQEA 1JKHA 4ZVGA 2JEFA 3KLEA 3UQSA 2HNDB 1TKXB 4RZRA 5KFBA 5KFYA 2W9BB 3DMJB 4Q45A 3V6KA 1LWCB 4IH7A 3CVKA 3PW4A 5CYQA 2VG7B 3I5BA 3PR5B 4K4VA 2OPRA 5FDLA 1N48A 1JKHB 3KJVA 2IM1A 3BSCA 2FLPA 5KT4A 4YQWA 4RW4B 4NLWA 3KK2A 1XR5A 4NLDA 4ZPAA 3MEEB 3DYAB 5F8JA 5CYQB 5D3GA 1LWFB 3ITHA 3E01A 1TVRA 4QW9A 3CJ4A 4ED7A 3MFIA 3DM2B 3I5CA 3QGHA 3MEGB 4OL8A 1RT4A 4I2QA 2I5JB 3TAMA 3KMSA 1SH0A 4J9OA 5C5JA 4KHRA 5EWGA 1BQNA 4RW4A 3SFGA 3CIZA 1UWBB 4KO0A 5EDWA 5J2MA 2IC3A 2ZE2B 3C6UA 3I0RA 3OL9A 3KK3B 1HNVA 3E01B 1JLGA 4IH5A 5JXSA 4QWCA 4FBTA 3GIKA 3MEGA 4ED8A 3DI6B 3KLIA 4I2QB 4WXWA 4Q0BB 4ECWA 5KFNA 3CJ5A 1S9EB 4ECZA 4RW7A 1TL1B 1IKYB 4DG1B 4MK8A 5J2MB 4TQRA 1RT7B 3KLFA 1HARA 4F4WA 3BQ2A 1W25A 2R8KA 5F9NA 4HYKA 4R8UA 2HNZB 5KFLA 1ZETA 1QE1A 3OSPA 2D7SA 1JLAA 4IFVA 2WK4A 4U6PA 4XPEA 2YNFA 5KFHA 1HNIA 5J2NB 1RTDA 4RNOA 2R8IA 3KHLA 4DL4A 1FK9B 3CO9A 2OPPB 5KFZA 2AGPA 3DMJA 3DLGA 5KFTA 1RTIA 1RT6B 2W9CA 2YKNB 5HROA 2OPSB 2XGPA 3V6JA 3H4BA 1REVB 2FVQA 4KB7A 2D41A 5DQHA 4ICLA 1S1XB 4QW8A 1N6QB 2D3UA 3NBPA 3PW2A 2JEIA 2OH2A 5C25A 2ATLA 2UVWA 2R2RA 4KKOB 3HKWA 1T05A 1N4LA 3BJYA 4FS1A 2E9ZA 1KLMA 2UUWA 1MU2A 4X2BA 4K50A 3KLHB 2V4QA 1NHVA 3H5YA 4Y3CA 4Y2AA 4DEZA 4TXSA 3RB4A 5JUMA 2XI2A 3QGGA 5KFFA 2XI3A 3N6NA 4ED2A 3IG1A 3TAMB 1GX5A 2IJFA 5KFKA 4TN2A 3OLAA 1BQNB 1SH2A 1QUVA 1HNVB 2C2RA 3OHBA 2ZE2A 3BSAA 2QE5A 1IM4A 3DOKB 5F8IA 4ECTA 3M8QB 3IGNA 3CJ0A 4Q43A 4KFBB 1S1VB 5C42B 4K4ZA 3T5HA 4PUOB 3FRZA 4EBCA 4ECYA 1C1BA 3OL6A 3BQ1A 4PWDB 3DRSA 5F8NA 3GV7B 2B43A 3OL7A 2UVVA 3FFIA 1HQUB 2FVPA 1EP4B 1EETB 4DL3A 5F8GA 2YNIA 3CDUA 4PWDA 3GYNA 4NLRA 5J2QB 2YKMB 4MKAA 4EO8A 3IN5A 1VRTB 4NZ0A 5DQIA 1RTJA 4IDKB 5I3UB 3V4IA 5HLFA 4DL5A 1EETA 1TQLA 3LP1A 3D28A 1IKYA 2HNYB 1S1XA 3KHGA 5KG4A 1S6QA 2IAJB 4RW6A 1S9FA 1DTQA 4EO6A 5I42B 3GIMA 3CWJA 5KT7A 3LAMA 2ASJA 3V81A 3H4DA 1LWCA 5CYMB 2HNYA 4EYHB 4TY8A 4WFYA 1JLFB 2V4RA 3LAKA 3N6MA 1C2PA 2E9TA 1JLCA 3QO9A 1RTDB 2ZKUA 4NLGA 3KLVA 2RKIA 1FKPB 3NKYA 4ZVEA 4IR1A 4K4UA 3DLGB 1NNDA 2R2SA 3DYAA 1IKXA 4K4TA 1D0EA 4F4ZA 1SUQA 2AWZA 2IMWP 3DLEB 4ICLB 2FJXA 3DDKA 4WXOA 2OPQB 3DOKA 3LP0B 4O4GA 1Z4UA 4JUZA 4O3OA 4KAIA 4YR0A 5KFGA 4KE5A 3OLBA 1DTTA 3HVTB 2B5JB 4MK9A 3GV5B 2HNDA 3MECA 3C6TA 4I2PA 5F8LA 1MU2B 4ED0A 3H40A 1SH3A 4EBEA 5KG3A 1C1BB 4LSLB 1JLGB 1ZTWA 3IS9B 4G1QA 4Q44A 1TKZB 4IRDA 5EWFA 3RB0A 4RW7B 1C1CA 3QZ7A 1K1QA 4KSEB 1JIHA 4IOBA 2W8LA 4NLQA 4WE1A 1C0UB 4G1QB 1J5OA 3I0SA 1OS5A 1LWEB 4MH8A 5KFDA 5J2QA 3V6HA 4YR2A 4EBDA 1T03A 3MR6A 3IRXB 5KFUA 1C1CB 4RU9A 4YR3A 4F50A 5DG9A 2HMIA 3T5JA 3H5XA 1R0AB 3G6YA 2VA2A 3KK3A 2WRMA 4RNFA 4IFYB 1HPZA 3FDSA 1RT3A 2R8JA 2WCXA 3MEDA 2W8KA 4K4WA 4ZPBA 4O3NA 2IBKA 1TKTA 3MR3A 1HQUA 1RT5A 3GIIA 1JLEA 4M94A 1EP4A 2I1RA 5L9XA 3G86A 3Q8SB 2R8GA 4TY8B 1S1WA 1RT1A 5KFOA 4R5PB 1S4FA 2DPIA 3KLEB 3MTKA 5HBMB 5HP1A 4H4MB 4HKQA 3CDWA 1FKPA 4Q8EA 1JLEB 1S0NA 4WFZA 1SUQB 3BGRB 3RB6A 1N56A 5J1EB 4IH6A 4ZVHA 4I7FA 2IA6A 1S6QB 4O4RA 5KFCA 2VG6A 4KV8B 5KFRA 4QWAA 3RBEA 3D5MA 3MR2A 1MMLA 1IKWB 2IJNA 3BSOA 5KT3A 4F4XA 3KK2B 3MECB 3IS9A 1D1UA 3BSNA 5J1EA 1REVA 2I5JA 4ECVA 4J9LA 3JYTA 3DOLB 5F8MA 5KG0A 4QPXA 2V0NA 4DL6A 1JLQB 4ID5A 4MIBA 5KFAA 1T05B 2IM3A 3LP2B 3H59A 4GC6A 3C6UB 3I0RB 3UDLA 3DLEA 1C0UA 4WZMA 4NCGA 1RT2B 4O44B 4F4YA 1S0OA 2BE2B 5EWEA 1S9EA 2WOMA 2QV6A 3C6TB 2ZD1B 1LW2B 2O5DA 1R0AA 1GX6A 1HPZB 4NYZA 2BQ3A 2ILYA 3MEDB 4URSA 3KOAA 3QGIA 4GC7A 4TYBA 2HWHA 1RT5B 5K14B 3BREA 4ZMMA 4JV1A 1RTHA 3OSNA 2RDJA 4J9KA 5KG5A 1T94A 3I5AA 5T14A 2YNGB 4ECUA 3ICLA 3DRRA 3TVKA 1JXLA 1J5OB 2GIRA 1RTIB 3T19A 3OL8A 3GIJA 1KHWA 5KFSA 3RAQA 2AX1A 4WFXA 3M8PB 4J9SA 4NLOA 4H4MA 1JLBA 4QWEA 1N6QA 3HVAA 1S6PA 4ZP7A 3Q8PB 4O3RA 3SFUA 4K4XA 3KHRA 1S10A 1KLMB 4QWBA 2WONA 4ZHRB 3MFHA 3KLHA 4XPCA 2UUTA 4J9PA 2W7PA 3RB3A 3V6DA 3MF5A 1TKXA 4JV0A 4LQ9A 5KG2A 3V4IB 5I3UA 4WZQA 4MIAA 3PZPA 3KJVB 2RDIA 3T1AA 3KK1B 1S1WB 5FDLB 4R5PA 1RA6A 4YP3A 4NLPA 2J6TA 1JLQA 4ID5B 2RF2A 5KFXA 4DL2A 3M8QA 4TLRA 1S1UB 3BGRA 2FVSA 4NCGB 3ISND 2YNHB 1S1VA 5F8HA 1JLFA 2WHOA 4KFBA 3KHHA 3FSIA 1LW0A 4TY9A 1VRUA 2JLEA 3NMAA 2BE2A 2ZD1A 3H5UA 3PHEA 3GILA 3T5KA 4IRCA 2WOMB 1QAIA 1S1UA 1FKOB 2IM0A 3H98A 1DLOB 4H4OB 4PQUB 1RYRA 2E9RX 3KLGB 4IG0B 1U09A 3M9OB 2ASDA 3QYYA 3PR4A 5DQGA 3DOLA 3QLHA 3QIPB 1N5YA 4NLTA 4DG1A 4ECRA 3KLIB 2GIQA 2YNIB 3KNAA 2VG5B 4H4OA 1RDRA 1VRTA 2XCPA 1IKVA 4MFBB 4LSLA 4M95A 4NLUA 2YKMA 2YNGA 2ILZA 2W7OA 5KFIA 1TKZA 4KBIA 4WYWA 2J6UA 3QZ8A 3LP1B 3QIPA 1N5YB 4IKAA 2C28A 4FBUA 4IDKA 4YMEA 1QAJA 1CSJA 5DGAA 2DPJA 1DTQB 1HNIB 2GC8A 1JLBB 2IM2A 1JLAB 4IFVB 1HMVB 1RT1B 1KHVA 2YNFB 1TL3B 1TV6A 2OPPA 4LSNA 4NLXA 4RUAA 4ECSA 1SV5A 2ASLA 3LANA 2JC0A 5KFEA 5CYMA 5HBMA 4XO0A 5HP1B 4NLVA 3RAXA 5K14A 4O3QA 1TVRB 3VQSA 3V81B 4NRUA 3Q8QB 2J6SA 4FS2A 1RT6A 2W9CB 3IGVA 1RTHB 5DLFA 2V9WA 4H54A 1YVFA 4URQU 3NAHA 3H5SA 1HQEB 1RYSA 1JLCB 3QO9B 3KK1A 4URGA 2FLNA 4J9QA 2W9AA 2FVRA 2W9BA 5C24A 1S1TB 4EYIB 3SI8A 3M8PA 1RA7A 4RW9A 1IKXB 2YNHA 1XR7A 1C0TA 4TQSA 2D3ZA 2UVUA 5DG8A 4DL7A 4K4SA 1TL1A 4I2PB 4J9MA 2ALZA 2C2DA 2WONB 4ZHRA 2BRKA 3KMQA 2B5JA 5J2PA 3G6VA 1S1TA 3MEEA 3EPGA 1T3NA 2BANB 3KLGA 3ITHB 4IG3B 1C0TB 3DM2A 4NRTA 4O3PA 3Q8RB 3NGDA 4JV2A 3UR0A 1ZTTA 4IG0A 3QLHB 1S97A 1RT4B 2VA3A 1BQMA 2R2TA 2CKWA 4Y2CA 4RUCA 1RAJA 5KT5A 5C42A 2BANA 2RF2B 4QWDA 2C2EA 2VG5A 1FK9A 3HHKA 5KT6A 4IRKA 5KFVA 1S48A 4LQ3A 2OPSA 1S9GB 4ZPCA 2B6AB 1VRUB 2AGQA 3H2LA 3FQLA 2FVCA 3PW0A 4IFYA 4O3SA 2EC0A 1HMVA 2CJQA 1DLOA 4PQUA 1RT3B 4RNNA 4ECXA 4RNHA 4LSNB 3T5LA 2BQRA 1SV5B 4MK7A 3NL0A 1TKTB 3QIDA 4R8UB 1TL3A 1TV6B 5DLGA 5KFMA 5HLFB 4ZVFA 3PVXA 2B6AA 4O44A 2FJVA 1RTJB 3BR9A 4ED6A 3PW5A 2R8HA 2JC1A 4MKBA 4WYLA 3G6XA 3PW7A 2XGQA 4RNMA 4KHMA 5KG6A 1S6PB 4ED3A 3CDEA 4J9RA 3DLKB 3IG1B 4G3IA 3DRPA 1IKVB 2IAJA 4RW6B 5DGBA 5KFJA 5I42A 3PJXA 2AU0A 3UPFA 3V6DB 4K4YA 5D3GB 5L1IA 4B3OA 2VG6B 3OHAA 2UVRA 4RW9B 5KT2A 4I7FB 3M9NB 4ZP9A 3DRPB 3NBPB 2XCAA 3BQ0A 4EEYA 5C25B 2F8EX 1IKWA 2RKIB 4KV8A 5F9LA 2FJWA 3LALA 4PUOA 2HWIA 5J2PB 4KO0B 1UWBA 2FLLA 3CJ3A 2VG7A 3PJWA 4R0EA 3TQ1A 3DRSB 4B3OB 4ZPDA 2OPRB 3JYTB 2OPQA 3LP0A 4O4GB 1WNEA 2WB4A 4NLSA 3GV8B 3FQKA 3FFIB 2C22A 3JSMA 2BRLA 1LW0B 1S49A 1BQMB 4ZP6A 4ED1A 4RW8A 3HVTA 5KG7A 5C24B 1FKOA 3LP2A 3ISNC 1XR6A 5L1KA 1LWFA 2R2UA 5KFWA 2HAIA 2HNZA 3JSMB 3EPIA
chains in the Genus database with same CATH superfamily
3AJ2A 2WBMA 4L75A 1UVIA 4IR9A 1XNRJ 5F3ZA 2QLFB 4IQXA 1K1SA 3V5RA 2XY5A 2AGOA 1S0MA 4ILLA 4RW8B 1SVDA 1FWLA 1N54B 2KU7A 4GVBB 2D3OR 1VC0A 1MN9A 1PG5B 1QM9A 3I0SB 1LW2A 2MQMA 1NRKA 1EHWA 5IV3A 2MY7A 3BF4A 3R5BA 4X4SA 2V68A 3ILOA 1HYSB 3E51A 3NEKA 1JX4A 1T03B 3EZUA 2DIVA 1N88A 1SC1B 1CVJA 3M32B 2HFVA 3T6JA 2JHEA 5CH7B 3DRRB 4RBVA 4KY3A 1SIZA 3RBDA 2WTFA 4X65F 6FDRA 1O8BA 3CJ2A 3MM5B 3FSYA 2MLYA 4YHHJ 5EUHA 1BD6A 2J9DE 1W7WA 4N8OA 2KTQA 2VB6A 4ER8A 4DR4F 2KHDA 2QSFA 3CMAS 5L1LA 1UW4A 2GHWA 1JKHA 3CCWA 4ZVGA 3PYDA 2HNDB 3Q24A 3THPA 1TKXB 1NJXA 2VKRA 5KFBA 1N33F 3DMJB 2VASA 1MMNA 3PW4A 4OV1A 2PFFB 3DLBA 3GR0A 2PD1A 3CT9A 3TVYA 5GAGU 3LWLA 4K4VA 1TL5A 2IM1A 2WSFC 4FYXB 4H4KC 2FLPA 2ZOMA 4HTJA 8ATCB 5KT4A 1I94F 3MPVA 1PYOB 3LTOA 4G65A 5DDRC 2VBXA 1XR5A 1ITPA 2CQ2A 1RGVA 1NJYA 1LWFB 3DGPB 4QW9A 3CJ4A 3JAMU 4ED7A 4A47A 3W64A 2EKYA 3JXOA 2XO7A 3MTJA 1HHTP 3BYRA 2JJ4D 3N4WA 4M5IA 2GO9A 5C5JA 5EWGA 1EAYC 5ETMA 3CIZA 1T9YA 2LQJA 3SCKE 3SFGA 4F0HA 3BO2A 5J2MA 2IVYA 3BGLA 3C6UA 5D6GA 1S72S 2IDEA 4LVOP 2IRUA 1HNVA 3T41A 3DGPA 1JLGA 4OI4A 3CSKA 4C0HA 4DI6A 4QWCA 2OFGX 3GIKA 4FBTA 4C8YA 3ETOA 3OR1B 4PWUA 5T7LB 1MW7A 4ECWA 2N3OA 1XMOF 1R6VA 2VJUA 3QWUA 3QMQA 2RDDA 1A9NB 4ECZA 3GB0A 1KR4A 3PO4A 4OZ1A 3OBIA 1VOMA 2L08A 3AB4B 4KGMA 2VICA 3CD0A 5F9NA 2DGUA 2CPYA 4I6WA 2EFOA 3MM6A 4KYZA 1QE1A 4UZCA 3CW2C 1KLNA 3PO5A 2ZWPA 4USHA 1T8EA 1WHYA 2CQHA 2U1AA 3NCRA 2IFXA 2YNFA 4I56A 4TVAB 5J2NB 1NJWA 1YSJA 3Q2TC 4ZPVR 4WBFA 2DCLA 1FDAA 2BUNA 2OPPB 3TX0A 1XQIA 2IBOA 1MN7A 3R5CA 5KFTA 3J80U 1RTIA 1U6FA 4WPAA 4JI4J 1FFWB 4KB7A 2FVQA 1D9AA 3BPSP 3GWCA 5DQHA 2RT3A 5DZ7A 3R2DJ 2X3GA 3RW7A 1L3TA 1N0VC 4KGZB 1N6QB 2D3UA 1NBEB 3PW2A 2JEIA 2ATLA 2UVWA 2R2RA 1X7VA 1N4LA 2EWHA 4PXCA 3G71S 2CQ0A 1PCAA 2JH3A 4MJKA 3VAJA 4JI1F 1NDPA 1B4SA 1HKAA 4CYUB 3DKDA 2MKYA 3ZXWA 2CPIA 4H4KA 4DCJB 4TXSA 2P2CB 5KFFA 2XI3A 2GVDB 4DPTA 2CNNB 4UOCA 3HMJG 4A8YA 3HXMA 3HZEA 2V2ZA 2I2YA 1M5VC 2MZJA 2ZDPA 1SH2A 1HNVB 4ZCKA 3W66A 3HD1A 2G2YA 2M0GB 4PXBA 3A1YG 1IM4A 3DOKB 1OO0B 1PYSB 4EZ9A 4PABA 2JDJA 2F9DA 5IQ6A 3I4PA 5D4PA 3BB5A 4JI3F 1TU0B 2OTJS 3CXCR 4DV3F 3GPAA 3R3TA 3MR7A 3OUYA 2AW0A 3NS5A 1WELA 2IA0A 2MYFA 4DX5A 4ECYA 1C1BA 4FDFA 3BQ1A 2C2ZB 1IUJA 2HGLA 1N34F 3EX7B 1AZSA 3BBBA 1U6ZA 3EDQB 1RAHB 3CD7A 3GONA 5K8MA 3ZO7A 1U02A 2Z58B 4AUKA 3G6ES 4UY8T 2UVVA 4F04B 2FVPA 3CO0P 2NPIA 3ILJA 5IXUA 4DQIA 4P2MA 1D9FA 1Z1ZA 1NMEB 2DHGA 4N77A 4YB7A 2PE8A 1GXLA 2P8IA 5HSPA 5F8GA 1G6BA 5MLCV 5SZTA 5J2QB 2VZ9A 4LF5J 1Y5LB 4MYUA 4DF4A 1CJUA 1VRTB 2AP6A 5DQIA 4KTQA 4UOHA 1SKWA 4IDKB 4Z7CA 5I3UB 2MQNA 2GVZB 3D28A 1FDNA 3PG9A 1IKYA 3M7VA 3KHGA 2JOQA 3US5A 1S6QA 1NCLA 3ZTQA 1DTQA 3I6PA 4U7UK 4EO6A 2MPUA 3SQGA 3X1LB 1R8CA 1DFDA 3LAMA 2CPEA 3O5TB 2MQQA 5EX3A 4TU8A 1YJNS 4B3SJ 3JAMY 4EYHB 3LAKA 1RB0A 3GFZA 4L73A 2Y1IA 2E9TA 1JLCA 3QO9A 2MY8A 4X4TA 4DSEA 4NLGA 1S7HA 3P49B 4ZK7M 4YEAA 4ZVEA 2OEJA 1VIOA 3DLGB 2R2SA 2Z56B 5D4OA 4IR1A 1D0EA 3NP5A 1HI1A 1Y7PA 3CCLS 2LCWA 3DLEB 2FJXA 1RADB 2PEBA 4PG6A 3LP0B 4CI0B 1M5HA 1JNRB 2B4PA 2NUUG 4N56A 3PIOQ 2QGFB 4KAIA 3RUBL 4CO1A 1FE0A 4KE5A 3OLBA 2NXNA 3PEJA 1RKJA 3MUVP 3DRXA 2GQ2A 2HNDA 3MECA 3KYLA 1MU2B 2RRBA 5E41A 1SJFA 2FY8A 4WK3A 5F3TA 4LSLB 1WKLA 3THTA 1TUVA 1TK8A 5D0RA 1UAWA 2VJVA 3MWBA 4IRDA 3L09A 1UKUA 2CQ4A 4LF7J 4X4UA 2W24A 4RW7B 3L9ZA 3NOGA 3QFWA 4FXVA 2MHNA 1BE4A 4IOBA 4EBDA 2IVMA 2CQDA 1C0UB 1SL1A 2HZAA 1OS5A 5KFDA 3OR2B 2NYHA 5LJ5Y 4YR2A 2VKZG 4DR1J 1T03A 1G3OA 4MKYA 4B9VA 4RUBA 2ZNZA 4WTOB 4YR3A 4F50A 1RHRB 2OKQA 1RU1A 2EVZA 3UNGC 1R0AB 2B9EA 2OLWA 2C42A 4M5GA 3KK3A 1Q8KA 2WRMA 2ABYA 3IFEA 3MEDA 1F9HA 1RCXB 2ZVSA 2RH3A 3D6FB 3N01A 1T9XA 1FESA 1WHVA 4M94A 5L9XA 1OWXA 3G86A 1DURA 4DZ6A 5A8KA 2F5GA 3D54A 2ACYA 3WHIA 5KFOA 4LR9A 4OZ0A 4AL5A 5CHCB 1PC5A 1U26A 1YZ6A 2KT3A 1HR0J 3VGVA 4F3QA 2NSBA 2DNNA 4PG7A 2K3IA 2Z8QA 3I9V9 4QJVA 4CTAA 2UV8A 1HNWF 2Z30B 3BGRB 2V2VA 4UOFA 1T9WA 2O01C 4X84A 1IBKJ 5J1EB 3GP9A 4IH6A 4WP9A 2CJAA 1XIQA 2CFXA 3LGMA 4K59A 1NK5A 4KV8B 5DDPC 2R7SA 3RBEA 2G4BA 1IM6A 1GAOA 2E5LJ 3BSOA 2VQFF 2VD3A 1IQTA 1F2HA 4LF6F 2UXBF 1HHSA 1SC6A 3GYGA 2QMXA 5I4MA 1LV5A 1SJRA 2HVDA 3DOLB 5AE2A 3W61A 4YFUA 4JI2F 4QPXA 2AT1B 4DL6A 2JL9A 1AFIA 1JLQB 3DU6A 4ID5A 5KFAA 4P9SA 4QU6A 4QIVA 4G6VB 4I4BA 2RQCA 3GSDA 2FHOB 3HT3A 4F0KA 1FRJA 2BBEA 1OSDA 2B9WA 2LDYA 2LQ5A 3TR5A 3B82A 3VGTA 4X62J 1UEKA 3MURP 4L6V3 2XEXA 2ADCA 4F4YA 1S0OA 1CJTB 2HVEA 3CEDA 4FF3A 4X4NA 3C6TB 1Q16B 5CYJA 4OYWA 4JI6F 4LR8A 2PT0A 4FF2A 4UOGA 2DY1A 2BQ3A 1H2UX 2F9JA 2E5GA 3MMCB 1N36F 4UUXA 2Z57B 3TEHB 4WCEQ 2HAFA 4PXDA 2KRBA 5H9EK 1RAOA 1FFSB 4B3MJ 3HFKA 2J7WA 3K17A 3R5GA 4V19J 1KVJA 1ZA1B 3TUIC 1RABB 1JXLA 3GIJA 1RTIB 2DHAA 3EM1A 4NMLA 2AX1A 2PFDA 4WFXA 2HIQA 5L38A 3M8PB 1R6YA 3AXKA 4NLOA 1Q8LA 4H4MA 1BHNA 3HSJA 1FEHA 2B8PA 2LYVA 2MKIA 4QWEA 3K57A 1N6QA 3HVAA 2FQQB 5IWAF 5HN0A 2XMVA 5KOWA 2XZWA 3SFUA 4DSLA 3C3LA 4RL1A 3VAFA 3VF0B 4EMDA 2DBBA 3TJ8A 3KHRA 3MUTP 4N41A 4IQMA 4J9PA 2NUHA 3FRYA 2MB0B 2E66A 2KVQE 3V6DA 3D6TB 1WG4A 4NI2A 1UMJA 4JV0A 2W7PA 2HHUA 1ZAXA 5KG2A 2VPYB 4WZQA 2R7WA 1PAUB 2CJ9A 4MIAA 4OZLA 3PZPA 4C8OA 2MMYA 2RDIA 4YUDA 1XMOJ 3UDCA 3N9UC 5K9FA 7AT1B 2CQGA 4DV4F 1HBOA 1RA6A 2QLBB 3KDOA 4NLPA 4P52A 2LXUA 1JJHA 2M3DA 5AXNA 2RRNA 1OJ4A 2YH0A 2M88A 1N0UA 4M5MA 2C2MB 2CJXB 5ETVA 1S59A 4NCGB 3ISND 1EX8A 2YNHB 2ZUGA 4FPIA 2JVOA 2I6WA 1VBZA 4QCLA 3CCSS 1OQ6A 2X1BA 4DWIA 1YRXA 2BE2A 3QGPA 1H74A 4PQAA 4B17A 1PBUA 1FKOB 3KFWX 4ES1A 5D8HB 4DR2F 3KLGB 2M8HA 2KT2A 3M9OB 3QYYA 4HVZA 2HHHJ 5DQGA 3QLHA 1FNMA 1KONA 3U7JA 4TU9A 3K0JA 2E7WA 3M2VA 3KLIB 2GIQA 4E98A 5JVHQ 1HWUA 3T1YJ 3FBBA 2GIFA 3IBWA 3KTQA 1VRTA 1V5VA 2AHOB 2GCFA 4P75A 3JSYA 1D9DA 4LSLA 4M95A 2OSQA 2GNKA 2YNGA 1CULB 2XYHB 2YWKA 4HACB 4NLUA 4O0IA 1YX2A 1ZM3A 2IVFB 5LMNF 1HBNA 2V8PA 1YI2S 4IDKA 4FZVA 4YMEA 4P74A 3S7RA 4C8LA 2MKJA 1DTQB 2MSTA 3KJQB 3MM7A 1AW0A 1RCOB 1HMVB 2GAHC 3CCRS 1TL3B 4FVMA 4LSNA 4NLXA 5H1SV 4NCAA 3DDNA 1SQEA 3VCDA 1XK8A 1GTHA 3AQOA 5HBMA 5HP1B 3CJRA 4K2XA 4ZCMA 1Q86T 2AV5A 1G4CA 3VQSA 3L7OA 1QSYA 4FS2A 1RTHB 4W92B 1R43A 1B0VA 1SC4B 3G82A 3PRBA 4KGXB 4JI3J 4JI7F 2H54B 1RWPB 1WUUA 4AFFA 2WB1D 3KK1A 3KG0A 4DX6A 3D6HB 2FLNA 4J9QA 4HL9A 4CO2A 2R7UA 2DJWA 5GMEA 2WVDA 2QFIA 4NZ6A 4ED4A 1XNQJ 4PR6A 2COLA 4OX9F 3VQTA 3BO4A 4RW9A 2UXCF 1IKXB 1QUPA 2UVUA 3LF0A 3Q8VA 5H9FJ 2ERRA 1X31C 3VWSA 2KI2A 2ZZTA 4UY85 2NXUA 3Q8YA 4X4RA 2XHCA 2UXCJ 3AY0A 3HCXA 3PX6A 3KLGA 5T41A 3ITHB 3TQEA 4HLBA 4LF5F 1MNEA 2ZOGA 4LUBA 4V1Ak 1XTZA 4NRTA 4O3PA 4A48A 1NK7A 4JV2A 1OSCA 4IG0A 2VA3A 2R4FA 1BQMA 2KO1A 1YGYA 4C0BA 4Y2CA 1G1XA 1AUDA 4Q2LA 4Z2XA 1QSSA 5C42A 2RF2B 1MWZA 4Y6IA 4QWDA 2KZMA 2HVIA 2HBQB 2P9EA 1L3VA 2NR0A 4DPWA 1U1RA 2D69A 2YPYA 3AD7C 1YLXA 3WQPA 2HBRB 3GMGA 2OPSA 2CPFA 4OYOA 1RKIA 3H2LA 2FVCA 2RE1A 2VBZA 2FB0A 5LMUF 1U45A 2PIIA 3I32A 5IOLA 2CJQA 4PQUA 1RT3B 4WFNQ 2YPZA 4DV2F 5GAGI 4MK7A 5HMZA 4JB8B 2LP4A 3Q0AA 3PVXA 4JI8J 2B6AA 2PMHA 2XYGB 4LMZA 2JC1A 4MKBA 5A6WA 5HMYA 2GMLA 4RNMA 4ZLLA 2AYEA 4ZJQA 1FNXH 4J9RA 1UJ5A 2VFSA 4LT6A 1IKVB 2IAJA 4RW6B 4ZVRB 1JJ4A 2BOAA 2BJ9A 3PJXA 3D9BA 1NAQA 3C2PA 1X8DA 2XSJA 3ZC4A 3QT6A 2ZH5A 1N5QA 3UN5A 1X9MA 3J7AN 1RWNB 1WEYA 3G9CA 4DR7F 4EEYA 1TUWA 2MZRA 5F9LA 3HKZD 4KV8A 7FDRA 2FJWA 4PUOA 2HWIA 2QO3A 2QL7B 3FJ2A 3DDIA 3ZZOA 3CJ3A 2FLLA 4CO5A 1NK8A 3PJWA 4R0EA 1S77D 3BV8A 4B3OB 3OXLA 3UN3A 2OPRB 4CLFA 3CDBA 2OPQA 4O4GB 3CC2S 3BN7A 3OVBA 3GV8B 1HBUA 2FGCA 1FWKA 3OTDA 4OYIA 1U24A 3VZHA 4DFKA 4DSJA 1S76D 2L9NA 5KG7A 1KNZA 3A12A 3RR7A 2HURA 5DS7A 2DGTA 3V2UC 2R2UA 1LK7A 2HAIA 3H0PA 4X4VA 1IR0A 2FDNA 1H3DA 3F44A 5EGYA 3M2UB 3MM6B 1RT2A 4U7CA 2KXHA 4Y2IA 1SJ3P 1WEXA 3TO8A 5GADI 1AT1B 4JI0F 2ZC3A 4OX7A 5CD4A 2JRSA 3JTNA 2LA6A 5KG1A 4IG3A 4YDXA 1WTFA 2M52A 2NQPA 4Q0BA 4NEYA 3M9MB 1TP7A 2J7UA 4QOTA 2KT5A 3P45B 1LWEA 3JTOA 2VL1A 2DT9A 2XC9A 1SCJB 2ZH7A 4Q8FA 1U8WA 1TTHB 3DOMA 3MD3A 1HHQA 1L3SA 1TAUA 3DNCA 3MR5A 3KLFB 2W01A 1N5TA 2XWYA 4JYAF 2AJ2A 3EVMA 3K5OA 1VGYA 2MQLA 1GH8A 2RNEA 1F60B 1QE1B 3NAIA 4I68A 2VQFJ 1EIYB 2KB2A 2XSJB 4ECQA 9RUBA 2DO0A 3KG1A 3K2YA 4X64J 2BQUA 1RAAB 4HTIA 4NYOA 4LRFA 2NPFA 4LBHA 5CA5A 5L1JA 1SJ4P 1DTTB 2V8HA 4M1KA 3EVWA 2ZITA 3M2RA 3C46A 1VFJA 4DBQA 1JWWA 3NGTA 3ENAA 3GJSB 4IH7A 4OX8A 5CYQA 3I5BA 3PTWA 2QA2A 3TZXA 2E7VA 2VIHA 1K9MT 1KQSR 3UW1A 1YDLA 1JNZB 3A13A 3BBFA 4CZCA 3ILIA 1GK8A 3DC2A 2OMOA 2MTLA 3FCWA 4YQWA 2GHVC 3KK2A 4OI3A 1NB7A 1J5EF 3MEEB 3DYAB 3PYGA 1L5UA 5F8JA 1QD1A 5D3GA 2CVEA 4NEZA 3E01A 4USKA 3DM2B 4EK2A 3QGHA 3MEGB 2YX1A 2Y8YA 4J9OA 2I5JB 2KYZA 2FPHX 1SH0A 5IT9Y 2AMCB 3NCPA 4KHRA 1DQAA 3G2XA 4RW4A 2DR5A 1VISA 4KO0A 1VYAA 2P9GA 5EDWA 3VAIA 3I0RA 1X5OA 1Z2LA 3GIRA 3A8EA 4IH5A 2FZCB 3NS7B 1AUSL 2KKHA 5B0AA 4QYZK 1VQ6S 3MEGA 4X66F 4ED8A 2BJ1A 1YZ7A 4WXWA 4WWSA 2Y9HA 3CD6S 1I3OB 2IPOB 1LK5A 5KFNA 2G9OA 3CJ5A 3DFEA 2KDOA 1TL1B 3PNIA 4DG1B 2B4VA 3T6BA 2QMWA 1RT7B 4MMOA 3W9IA 4GKKJ 3FMBA 4E0DA 1PC4A 2ZHBA 4GO7X 4X66J 1DHMA 2HFNA 5DETA 2LEAA 5K20B 3HX9A 2FJDB 2H1YA 3PY8A 4LF6J 1PGZA 2N4CA 5FIIA 2EFGA 1ZETA 1WTBA 4NMXA 2K06A 2V34A 4F02A 2D7SA 1JLAA 3QATA 5DZ6A 1RTZA 3MUMP 3KUGA 1HNIA 2EK1A 3LUYA 1RTDA 4RNOA 3QJLA 3WBZA 3KHLA 2FHJD 3CO9A 2QLXA 1IR1A 3ZZUA 1FJCA 1ZPVA 2MZ1A 2OPSB 2XGPA 1RP5A 2C2NA 2BJEA 2RIJA 2YXLA 1EKRA 2D41A 3H4BA 2VC1A 3D2WA 1N33J 1U7LA 3CDAA 1S1XB 2J5AA 4C3KA 2VH7A 2BJ8A 2H51B 3A8JA 3HSDA 5AJ3F 5C25A 2XTJP 1FE4A 2POKA 3CD5A 4KKOB 4EI2A 1T05A 3PX0A 5HQMA 4FS1A 4B3SF 2E9ZA 4QYZJ 1KLMA 2KM8B 2E5JA 2OGUA 2CPJA 3AODA 3KLHB 1I94J 4K0KF 1NHVA 3H5YA 3MM8B 4LF9J 2YWEA 2CNKB 4Y3CA 4UQGA 4Y2AA 4CLPA 4DS4A 3FSXA 5JUMA 1VHIA 3QGGA 5L8RC 3R7SB 4DQQA 1LKZA 1T9VA 1UP1A 4CCHA 1KOHA 3LGNA 3TRGA 1P27B 2IJFA 4TN2A 2CUYA 2QN6B 3TUPA 1Y5IB 4RWXA 5D77A 5AE1A 2DNQA 5L39A 3M8QB 4G1PA 3ZTRA 5AE3A 2ZH1A 4WK1A 4Q43A 2D3O1 1M5OC 2B9XA 5IWAJ 4FF1A 2UUBJ 4JV5J 2YH1A 3HM9A 2MXYA 1DRZA 5C42B 1HIYA 3GG0A 3T5HA 1N8RT 3MCMA 1TKDA 3KDNA 2EW9A 4CNZA 3VGUA 1IBMJ 5FJ4A 2ZVIA 3AB2B 3R1HA 4I67A 4PWDB 2OD4A 4KQZA 4OJGA 3CJKB 3DRSA 4B3TF 3FZ2A 1I51B 3GV7B 1SC3B 2E7XA 3W60A 3VAGA 4GRSA 3MPDA 3C14B 3PCOB 4PAAA 5IV4A 1RUSA 1EETB 3GFXA 3NOCA 1HNZF 2OAUA 1HD0A 4FPRA 1CEZA 2QLWA 4C8KA 4PWDA 2O3DA 1TMMA 5DM6Q 3UD3P 4MKAA 2YKMB 3MEKA 2NLWA 4LSZB 1B99A 3D1HA 3OR1A 5T7LA 3ZZTA 5CD4H 4KGKA 1SJQA 1UVKA 1EETA 2LLZA 2VUGA 2KH9A 5GMDA 1F0XA 2HLTA 2BMBA 2IAJB 4RW6A 1S9FA 4I69A 4P10A 3R2CJ 2RHQB 1LNQA 2QC3A 4HDHA 3I9ZA 3VAKA 3UR3C 4LRDA 4BHQA 4QR0A 4C4WA 4DPYA 4CLYA 2DGQA 1VQ8S 3H4DA 2J0XA 2OEKA 1QDUB 1S0VA 3PYFA 5CYMB 2CPDA 4RWWA 3VR1A 3I87A 4DJBA 3IWXA 6FD1A 1U4BA 2HQ3A 4WFYA 1JLFB 2V4RA 1NDCA 2VC0A 1HNWJ 4ED5A 2GW8A 3B6BA 3H25A 4OHVA 4CLSA 2DEIA 1YKWA 3BGFA 3F73A 4OQJA 4DSFA 1FKPB 1X9SA 4K4UA 1KN6A 2RQ4A 2A1BA 2ROEA 1Y9OA 4K4TA 2K3KA 3AA8A 1SUQA 1HBUB 3W63A 2ZH4A 3DDKA 4ICLB 4DPXA 2OPQB 4O4GA 1NEEA 1R0CB 1Z4UA 2A18A 4JUZA 5RUBA 4LFBF 2EC2A 4YR0A 1VMBA 1YWXA 2GJIA 5D0HA 4ILMA 1TL4A 4PYAA 4ZVTB 1RHKB 2G1HA 4DOZA 1YJWS 3PRVA 3C6TA 1FRXA 4I2PA 4NXNF 2ZNYA 1SH3A 3TA2A 5KG3A 4EBEA 2I9SA 2G13A 1C1BB 3WX8A 1JLGB 2VQEJ 3IS9B 1U1NA 5L9NA 1CG2A 3E3XA 4Q44A 4JI2J 1FVQA 1Q4RA 2CNOB 4TLQA 4BCAA 3C15A 2BE7D 3J7YU 4EWTA 4C8ZA 2FHJA 2HQIA 1RQ0A 3I56S 3CC7S 2BM1A 4HHHA 1PBAA 3IP0A 1HW9A 4OZ3A 5FLXU 2EFVA 2MKKA 4DUZJ 1WF1A 1R8PA 2O66A 2W8LA 3OTBA 3M05A 3S01A 4ENOA 2CQPA 4G1QB 1CS4A 2C3MA 4ZVQB 5GAEU 3TZYA 1OY8A 1FT8A 5J2QA 4FNIA 4FKYA 1RBOB 3HJFA 4E8UA 5IC6B 5ITHA 1C1CB 5F0WA 2ZDOA 4RU9A 2E1PA 2C3PA 3OTOF 4JI6J 2HMIA 4KR0B 2CQ1A 1YIJS 2ZBQA 2NYIA 3TA0A 3FNNA 1F3VA 4CLLA 4CO4A 4R0JA 4RPFA 4BBYA 1N36J 4WU2A 4LFAJ 1NJZA 1ELOA 3E2EA 1AZSB 2AJQA 3OTEA 3MHYA 4A8OA 2HQFA 2E5IA 2WCXA 3GJRB 2R8JA 3OTOJ 4ZPBA 5A8RA 4O3NA 3TA1A 4K4WA 1TKTA 2GQCA 2BXJA 1HQUA 1H6KX 1P1LA 3D0GE 1JLEA 1WJ9A 5D0EA 3SV3A 2I1RA 3K7RA 1MROB 3Q8SB 3R5JB 1X5PA 4TY8B 1KVKA 2HQCA 2MLXA 3LWMA 3EZOA 1S4FA 3GSIA 3NNCA 3FEZA 3PYEA 3MMAA 3KLEB 3MTKA 4LFCJ 1GQEA 1REGX 5A8RB 5HBMB 5HP1A 4H4MB 3CDWA 2WBRA 4CM0A 1XC9A 1JLEB 4P71A 4LFBJ 1SUQB 3EUNA 3MPUB 3Q8UA 4LREA 4CO0A 4KH1B 4BC9A 2PC6A 3EGVA 2BACA 2I8EA 4HT7A 3RB6A 2IA6A 4KHPF 2E44A 5LMUJ 1DZ5A 3HSZA 2QL9B 4QWAA 2QX0A 3QJJA 2E29A 2DR7A 2L9DA 2PMZD 1MMLA 5K5MA 3G87A 2IJNA 4BLGA 2G1DA 2AZ1A 5KT3A 3KK2B 3C16B 4RU2A 4AYBD 3IS9A 1D1UA 3AD8C 4JI8F 3BSNA 1UJ6A 2VU5A 2WVBA 3IXQA 4K7QA 2I5JA 4OYZA 3ZNJ1 4ECVA 2DR9A 4LF4F 3JYTA 5F8MA 1ZS6A 3UCZP 5KG0A 1S99A 1KOOA 4DUYJ 2C3UA 4MIBA 1V3RA 4QU7A 4KPCA 1FO1A 4A8QA 2IM3A 3LP2B 3H59A 4P7TA 3I0RB 5G4DA 2B9YA 2N3LA 1D09B 1C0UA 1NH7A 4M5DB 4J9NA 3SCLE 4O44B 1GMUA 1IBCB 3I96A 2ZH6A 2J9EA 2BE2B 1UTAA 3AJDA 1WC4A 4DR1F 2QV6A 3BBCA 5GAHU 1PKUA 1ZOTA 1WC5A 2CZVC 3MPWA 4KT0C 2W25A 5HI7A 4F36A 5B08A 3EYZA 1R0AA 1GX6A 4MYTA 4DHVA 5LSLA 1R27B 2ILYA 4Y2KA 3KOAA 3QGIA 5JJBA 2ZH2A 2LFVA 2R7TA 1O5JA 1RK8A 4OLPA 3VVTA 2HQGA 1VRQC 1WDDA 2MKSA 4J9KA 5KG5A 1DARA 1WKKA 2F4FA 3I5AA 2YNGB 1CULA 3ICLA 4USTA 3SQOP 4ECUA 3OL8A 2JVRA 3T19A 1HBNB 1KHWA 1H72C 5KFSA 3RAQA 1J5EJ 4DQRA 4J9SA 1NK0A 1JLBA 3JB9k 2GMJA 5AXMA 4ZP7A 1R0BG 1S6PA 1OMSA 1P1TA 4OJHA 2DEJA 4QQBA 4F26A 3CPWR 1VBYA 5CXTA 4JI0J 2VFRA 4FYWB 1LXNA 1VBKA 2CG8A 2VDHA 1KLMB 4P7VA 4QWBA 2DIUA 3SMZA 2WONA 4I6YA 4A8SA 3MCNA 1FTRA 1R89A 3ZZ0A 1TKXA 3K5PA 4I0WA 1UVJA 4A8KA 4L76A 1FDBA 3DN9A 3N0VA 3T1AA 2FC8A 4L3NA 1WSRA 4R5PA 2HG4A 4YP3A 1UA0A 1Q7YT 1R8HA 4ES2A 2K7JA 1VQYA 2XMWA 3I4HX 4L74A 4DL2A 1GMWD 3M8QA 3NGSA 4TLRA 2HFOA 1UFKA 3ONQA 1SJ1A 3IMQJ 1Q81T 1O0PA 1YBAA 3Q23A 4DQPA 2IRYA 5F8HA 1YBTA 4Y28C 2HGMA 2RB7A 3G8TA 1BC6A 3FZBA 2JLFA 3K8VA 2M7SA 5BYRA 2BDPA 4DX8H 3NMAA 1CJTA 1Q1KA 3AXMA 3CJQA 3PHEA 1HBMB 4KGVB 3QPIA 2Q3PA 4DV1J 2IM0A 1RYRA 4PQUB 1ZZFA 2E9RX 1G7CB 1X4DA 3CC4S 2KYXA 1IWAA 3OR2A 1PO6A 2MSSA 4HI2A 1FRMA 5IZHA 2CJBA 2HHPA 3GLJA 4OHYA 1RHQB 1RWMB 3NS6A 1RDRA 2Q43A 1VQNS 2LQ9A 2XCPA 1IKVA 2JWNA 2ILZA 4KBIA 2J6UA 1YK9A 3LP1B 3QIPA 3PJ9A 3QFHA 2BVZA 3QZ8A 4NASA 4M8LA 2FD2A 1LXJA 2B7CB 1OYEA 1FEEA 5J1NA 4DV2J 2FUG9 2DPJA 2GC8A 1AROP 4YS2A 2CA9A 2GV1A 1VQ4S 4IFVB 4MTPA 1WORA 1C4AA 2AQ4A 2OPPA 4NA3A 4RUAA 1FNOA 2AKWB 3BH6B 3FCVA 4ECSA 1CQNA 1FJGJ 3FBFA 4UTGA 3MMCA 3RAXA 2K1RB 1NHKL 3H42A 4NLVA 2CAJA 1IQZA 1TVRB 4XDCA 3V81B 1VK3A 4NRUA 4USUA 4O3QA 2DVIA 5DLFA 3EXCX 3IGVA 5K8NA 5CZXA 4WP8A 4URQU 1NZAA 1HQEB 1RE1B 4C0OC 4URGA 3HFZB 4NPOA 4O23A 2W9AA 2K1RA 1FXLA 5C24A 1S1TB 2KN4A 3SI8A 4CYUA 3M8PA 4AD6A 3PRDA 1HFEL 2HHSA 4TQSA 4K4SA 1C0TA 3TOQA 5K8PA 2RHSB 2DH9A 3SYZA 3T9ZA 1U1PA 3QRQA 1SQFA 3ENQA 4F7VA 2L48A 4J9MA 4M5LA 2C2DA 4ZHRA 3KMQA 2B5JA 5J2PA 4HEA9 1S1TA 4QR2A 4C98A 4CP5A 4C2MA 5B0DA 2BANB 3OXFA 1LQ9A 1NDKA 1Y3JA 2JNJA 2NXEA 2AIRB 1C0TB 3DM2A 3C15B 4PYDA 3UNYA 2XY6A 1FJ7A 1DJ0A 2HVHA 1OIAA 3P5TL 3CMES 2CKWA 1B3TA 3IWLA 2GA7A 4PCQA 2WSEC 8RUCA 5KT5A 5SUHA 2B3TB 3QSYB 3UI3A 3OUYB 5G0RB 2C2EA 2FIUA 4K0KJ 4ZLNA 2HWTA 1WACA 3IWNC 4IRKA 2HHTA 1S48A 4YN3B 4LQ3A 3K5LA 3M8SA 4P2XA 2Y8WA 2EEYA 3VV2B 1S9GB 2ROPA 2A6MA 4J90A 4UW2A 4ZPCA 5LMNJ 2AGQA 2NXJA 3HHLD 3D3BJ 2L41A 3AOAA 1KSPA 4IFYA 3UWTA 3E8OA 3T5LA 2NSCA 3GU0A 4RNNA 4ECXA 2BQRA 1Q82T 2CDRB 1SL0A 2HK3A 1WEZA 3QIDA 5DLGA 1TL3A 1M5SA 5KFMA 1HW8A 5HLFB 4ELTA 2FJVA 1RAEB 1RTJB 1V3SA 3PW5A 4LRBA 4B9NA 1RHUB 2CZ9A 4WYLA 4WFBQ 3G6XA 1U1QA 4KHMA 5KG6A 4FN5A 3UO0A 5ETKA 4ED3A 2K8GA 1JQGA 1ZAWA 2GVDA 1IBMF 2OSRA 3DLKB 3IG1B 1D8YA 3DRPA 4PZVA 2VOOA 4WKYA 1KDNA 5DGBA 4HACA 2CQBA 4DV6J 1V5IB 4B3TJ 5I42A 2UU9J 4X64F 3UPFA 1KWMA 3V6DB 1X4GA 2DGVA 1EKSA 5D3GB 3ZTSA 2VPZB 2GX8A 3R7BB 1NLKL 2UVRA 3TYTA 4CLWA 4RW9B 1PIEA 1LWXA 2LU1A 3J81j 2VODA 4AQYJ 3DRPB 3NBPB 2XCAA 3AH6A 5C25B 2F8EX 4J5OA 1WG1A 2RKIB 1CC7A 1D3WA 2F63A 5J2PB 3M6WA 1ZM4A 2RU9A 3ETMA 4QBUA 1FFGB 3MZIA 1X60A 2Z0GA 2L3MA 3MM8A 2UUCJ 3JYTB 3LP0A 2RUGA 4ELVA 2QA1A 4J91A 1WNEA 1RXOB 3FQKA 3FFIB 3UN2A 4N76A 1K0VA 3M6XA 3JSMA 2N4DA 2BRLA 1H2VZ 2KG1A 5AXKA 4ZP6A 1I5OB 1AFJA 4RW8A 1ACMB 2R9LA 1FJEB 1X4AA 1FKOA 3LP2A 1XR6A 3WIUA 4LFAF 2FJBB 2WW8A 2W4PA 4ZVSB 1IBKF 3D4JA 3MGJA 4D3GA 4B3RJ 2ZFHA 3R6LB 2EFQA 2DTJA 3MAAB 2ZBPA 3IR5B 5LL6d 4C8NA 3KG4A 2DNOA 3A3PB 4USIA 3TUJC 2YY3A 1FD2A 3F41A 3ADAC 2HSEB 3M2VB 5ETRA 4I64A 4RUHA 3SV4A 2UP1A 3JSBA 4NLYA 3M32A 3WC0A 4AE5A 4DQSA 2JEJA 1NK6A 2ZEJA 5B0FA 4CH0S 4DFPA 4ATNA 3DI6A 4MFBA 2HHXA 3IRXA 1IJFB 2RS8A 1QVFR 3G96A 2XLJA 3C14A 2CJKA 2NREA 5HROB 1V9OA 2OIHA 3MM5A 1VQMS 4GVBA 2DHXA 3IM8A 4PPDA 2QRRA 1LEOA 4GMKA 4LJMA 3DLKA 4Y34A 2CWXA 1I6JA 2BA9A 2WZ1A 3L7PA 1HI8A 1NHUA 4KKOA 2M4MA 5GVQA 3NGKA 1HYSA 5CABA 4DL0C 2H9ZA 2XMKA 3TJ9A 1NZ8A 1Y3KA 3OPKA 4USVA 5AXLA 4DCPB 5IT4A 2J9CA 4L3KA 5KFQA 5KFPA 2BR0A 2JEGA 2XB2D 3HP6A 4RBUA 4ZJOA 2DNKA 4KJIA 2Z2ZA 3MMBA 4J9UE 2VBWA 3FKBA 2H4WB 1WSVA 1X4HA 4U8YA 5BJRA 4RZRA 1FRLA 2KXNB 5KFYA 2W9BB 4ZIVA 4K4XA 1LWCB 1Q8IA 2J8SA 2CYYA 4LRCA 4DR4J 5D78A 3PR5B 4B9TA 2OPRA 1N48A 5IC4B 1L3KA 2IYIA 2M2BA 5B0BA 1JKHB 3BSCA 2WAQD 3M1VA 3QNWB 3O6QA 3T1YF 2ACMA 4KPYA 1ROFA 4NLWA 4P72A 3P3DA 4NLDA 4ZPAA 3W1YC 4EUVA 2RU3A 3NL0A 1UPMB 2G0CA 1I1GA 2RD5C 3ITHA 1TVRA 1UWAA 1W26A 2P6SA 3RJMB 2DXDA 3S8SA 2GQQA 1OY6A 3KKFA 1M5KC 4IOAQ 4I2QA 1VCTA 3NLCA 2PSZA 6AT1B 2H5JB 3AQPA 5LSRA 3VAHA 3ULHA 2OELA 4W98A 1UWBB 3GJQB 4WFAQ 1WC6A 2IC3A 2ZE2B 3VVUA 2J76E 3B78A 3KK3B 5HQLA 1ZH5A 3NWRA 5JXSA 1KQGB 2OEMA 2PEHA 4KIAA 2DH7A 4F2RA 5DDQC 1TR0A 4HDGA 1HWLA 4I2QB 1Q95G 4Q0BB 1T95A 3P5BP 3EDRB 4HT5A 4IO1A 4MT1A 1SKUB 1B70B 2H3EB 3OJSA 3PHTA 4LF1A 1URNA 4RBTA 5J2MB 4CH7A 4TQRA 2Z4PA 4MAKA 1E6VB 2JX2A 1HARA 2XS5A 4ANEA 4F4WA 1YJUA 1W25A 2HGNA 1WWHA 3SXLA 2R8KA 1YG0A 3BO3A 5KFLA 2HHWA 4ZN3A 1VI7A 1N52B 1KRPA 3K89A 1KFSA 4C8MA 3OSPA 4IFVA 3TZWA 3T3FA 4DZDA 2ZKTA 2XWXA 3D7SB 4U6PA 1EB0A 5KFHA 1P9YA 4A8WA 1TELA 1TAQA 2KJVA 2R8IA 1IWGA 4DL4A 1FK9B 3BDPA 3FEXB 1K73T 5KAKA 1BWEA 3DMJA 2JSXA 1RT6B 2YKNB 3M2RB 3V6JA 1UVMA 5HL7Q 5KFKA 4ICLA 4U8VA 2BJ3A 4NCBA 4JI5F 1KFDA 2BE9B 5JMNA 2W2MP 2KJWA 1QAXA 2FLOA 3HKWA 1TUGB 3JQKA 4DR5F 1BUXA 1RBLA 2XQCA 1FHTA 3O44A 2ASYA 3FUYA 5E7OB 4ILRA 2YWFA 4AT1B 3ET6A 4DEZA 3X3UA 3RB4A 2V4JB 2XI2A 3H20A 3S6EA 1WC0A 3N6NA 1Q79A 3IG1A 3O1LA 3UVJA 2KFYA 3TAMB 1GX5A 1RAIB 1WI8A 3IBFB 3ILLA 1URRA 2C2KB 1BQNB 3A3NB 3ZFVA 4HH1A 2C2RA 4B9LA 1DQ9A 1F9EB 3NCQA 5K8OA 2Q6CA 4OHXA 3IGNA 2KXFA 3CJ0A 3BN4A 3HHLC 2X7IA 3MAHA 1JJ2R 3LQVA 4LBPA 3ENWA 4DV0J 1AB8A 1YJ7A 2AJ0A 2VQEF 3CCJS 1N5VA 3M6UA 4AL6A 1YJVA 2QIFA 4EBCA 3T1HJ 3J7A1 3SCJE 1U2RA 3CCZA 2CXEA 1SKSA 3WC2A 1U6BA 3W9JA 5F8NA 2EG1A 4DV0F 1U0HA 2B43A 3MM9B 2A2CA 3OL7A 1OQ3A 3FFIA 1RWUA 1HQUB 2CZ4A 3Q89A 4DSKA 2APOA 4FXDA 2AEFA 1EP4B 2DNPA 2GVZA 3BYPA 3EGZA 3B54A 3BS9A 1YTYA 1ZBTA 3MI7X 4PWWA 2ZBCA 4WF9Q 4EO8A 3PX4A 3PKYA 1RTJA 3W3SA 1SKRA 1E6YB 3MAAA 5HLFA 1TQLA 4F4AA 4DR3J 1A7GE 1V6HA 2HRTA 1NKBA 1SIWB 2XZDB 1A0OB 1FX2A 3OTCA 2GO8A 2D9PA 3R6GB 5I42B 4RR5A 2X51A 4ZJLA 2LQBA 1CJUB 5THWA 3GIMA 1Y11A 2IDLA 1S6UA 2LA4A 4KH0B 4CLZA 5LXRA 2AYBA 2MKCA 1NK4A 1W2IA 3W2WB 2ZZNA 2NXCA 1BMQB 2AEMA 4TY8A 1RWWB 4C7QA 3N6MA 2P6TA 1C2PA 4F25A 2EFNA 1RTDB 4OYBA 3H90A 4ZS6A 2QT7A 2RKIA 3KLVA 3G8SA 4CT8A 2CJYB 3DYAA 3SDEA 3ZZRA 1IKXA 2VDIA 4F4ZA 2DXEA 2CQCA 2O1PA 2VOPA 5IM0A 4NL5A 3RAMA 5I3PA 2R7RA 1UEVA 3CJ8A 4ZCLA 5HJYA 5HJXA 4RO0A 1CC8A 1S12A 1XJWB 2X3DA 1OPIA 3CB4A 3L95X 3MMBB 4MK9A 5AT1B 5KFGA 4ZPWR 4OX6A 4ZKAA 1P9QC 1CBKA 2LEPA 2XSFA 1YBUA 2YWGA 3C16A 4UF4A 2K2PA 4OYAA 3SDEB 4DX7A 5F8LA 4JV5F 1ZTWA 3M30B 4RX6A 1TK5A 2FJEB 1TKZB 1VQ7S 5D15A 2CQIA 3JSRA 3OFFA 1UZDA 2QLJB 2MHEA 3RB0A 1UPPA 4I1TA 3T9NA 2FC9A 2OHDA 3ZZPA 4YDDB 2QMUB 1JIHA 2JFKA 3UCUP 1BGXT 1XERA 3DRYA 1J5OA 3I0SA 4P2SA 4MH8A 2NS1B 1S5ZA 1NM2A 3GR1A 3I31A 5D4LA 1UETA 3R7NB 3UDVA 3IRXB 3U02A 2OUGA 2XNQA 3MR6A 4DN9A 4DF8A 3HHLA 1UFLA 1RU2A 3TI0A 5DG9A 1JJCB 2PMWA 3T5JA 2FZGB 2NCKL 1BQXA 2W1BA 2RMLA 2H5IB 3D68A 2XMJA 2DO4A 2E1AA 2MDAA 2Y0SD 4OHZA 4RNFA 1HPZA 4ANCA 1RT3A 4CTAB 1NSAA 3LGHA 2IBKA 3KUEA 3SBMA 3MR3A 3HT0A 1RT5A 2XMUA 3R5AA 3C8YA 1HWKA 2YKOA 3GIIA 2UUCF 4AXJA 2C2OB 1EQ0A 3BR8A 1JMTA 2R8GA 1WHXA 3N5BA 1S1WA 1FI4A 4ELUA 4R5PB 2O67A 2V8GA 3LOUA 4OYMA 1NSKL 1RSCA 1WC1A 1B7YB 4DCOB 4I6AA 4HKQA 1FKPA 1LOUA 4DXLA 3MCSA 1S0NA 2X1FA 1N56A 4ZVPB 1MLAA 3AT1B 1GEHA 4I7FA 4ZVHA 1FF2A 5KFCA 2VG6A 5KFRA 2FY1A 3R1LA 2CIMA 2Y1RI 4GKKF 4F3MA 2FHKA 3EGWB 1IKWB 1RJJA 3CJTA 3FGVA 4CNYA 2XBPA 2KRRA 4F4XA 1YITS 1F2GA 5J1EA 4IYQA 1QY7A 4USMA 1SQGA 3D0HE 5H9FK 5DDOC 2R7VA 1NDLA 3BKTA 2V0NA 3VTIA 2IRXA 2GGPB 4TNOA 1FRIA 2R7OA 4JOUA 4DV6F 2DNHA 2M70A 3LO3A 4WIIA 1YJ9S 1IVZA 3C6UB 3GFHA 4O0NA 2LMIA 4C97A 3CCVS 4DR6F 3OD2A 5HATA 4ETXA 1WF2A 2AEJA 4WZMA 4NCGA 2EFPA 1RT2B 2V69A 4LR7A 4PG5A 2ADBA 2XS7A 4CRJA 3W2VA 1QLNA 5EWEA 3L4BC 1H98A 4CIOA 3FCHA 1NJIT 3W8GA 2ZH8A 2F65A 2KM8C 1UEUA 2Q1LA 3DHWC 3ZZYA 1L3UA 1HPZB 3MEDB 4CLUA 4GC7A 2ZHAA 3POTB 4X4QA 2HWHA 1RT5B 5K14B 3TX8A 3AD9C 3MOJB 4LF8F 1M5PC 4ZMMA 3OSNA 2RDJA 1TZ0A 1QTNB 1WOPA 2QYGA 3AFGA 1XEZA 4ZN1A 5ADZA 2JFDA 3D0IE 5T14A 1YHQS 4QPTA 2GIRA 1MWQA 1EARA 1AYEA 3L7UA 3KJFB 1NKEA 1IR2A 3KXDA 1UVNA 3MXHP 1WDTA 4C6AA 4DS5A 1K0TA 2QTWA 4O3RA 4F0MA 1NPRA 1FJGF 2PO4A 4F67A 1ZM9A 3OV7A 2WW4A 2HZCA 3UCGA 2GJ2A 2BV3A 4ZHRB 3MFHA 3PV8A 4XPCA 3BGOP 4AL7A 2IMOA 4B9SA 2J0QD 4XDDA 5D0GA 1TFWA 3HF5A 4J37A 2UV8G 5I3UA 2HFZA 4FYDA 3JQMA 3RU0A 1NXIA 2B0GA 2CPXA 4XIUA 3KJVB 5I3QA 4L72B 5E3AA 1JB0C 5FDLB 4WU3A 2X1GA 3OVSA 5LT5A 2V2KA 1BLUA 2H4YB 3MMAB 1CQMA 4Y0FA 3FEYB 2OJ3A 1D8ZA 2SXLA 4XTTA 5G0RA 1WF0A 1S1UB 2OFHX 1WKJA 1U25A 2ZUAA 5KFXA 3HHNB 1M1KT 2QEXS 3NRBA 2J9DA 2ZJPQ 2HRUA 2ZH3A 2A6OA 3CCMS 2PI5A 3FC9A 4K5RA 2XMAA 1NKCA 3NMRA 3FSIA 3MD1A 3RZAA 2JLEA 2LU2A 1YQHA 2V94A 3HLUA 5CCMA 3CE8A 1J2VA 3H5UA 3T5KA 2WOMB 3ZTPA 1S1UA 1DLOB 4H4OB 2DNRA 4DLEA 2BJDA 4LF9F 3HO1A 1CS4B 4CT9A 3K5NA 5JVGQ 4K4ZA 1QTMA 3O3LA 3D6MB 4ZA1A 4JI4F 1N5YA 4ECRA 4DG1A 2EK6A 4M5JA 2VG5B 4H4OA 2HHQA 4CH1A 4M5NA 5DM7Q 3TANA 2F8MA 2HHHF 4MFBB 3IAM9 1G2EA 1SI9A 2W7OA 2CWKA 1TKZA 3QT5A 4WYWA 5ETOA 1N5YB 2C28A 4FBUA 1E6YA 1VC5A 1X4BA 1CSJA 3QWPA 2EBEA 1IJEB 1HNIB 2W2PP 1JLBB 2GZOA 3R97A 1JLAB 4U95A 1X4EA 1WD6A 1FXDA 1RT1B 1KHVA 4USJC 2V8VA 1SV5A 3D3CJ 5BYQA 4BC7A 3J81Y 2KFZA 2AJFE 2JC0A 3FK4A 4XO0A 2H5EA 2LXFA 1HA1A 2HS4A 4ZPTR 5KFEA 3Q8QB 3T1HF 2J6SA 2V9WA 1XNQF 2W9CB 1R31A 4OI6A 1HNZJ 3OJUA 3F56A 4H54A 1YVFA 3NAHA 3BKFA 3H2UB 1T0TV 3PACA 2CQ3A 4GKJJ 5HMXA 1JLCB 3QO9B 3D1OA 5A0YA 1FD8A 2DGXA 2W9BA 5DJBA 2BJ7A 2HQDA 3N28A 3CF5Q 1OPZA 3GCWP 5A8WA 1RA7A 4X4OA 1N34J 3J7YI 1F5BA 2DGWA 1ZPWX 2H48B 2YNHA 1XR7A 2QL5B 2QA4S 1TL1A 5IQQA 1QVGR 1HNXF 4OIXA 2OMLA 1EQMA 2WONB 3TWZA 4ETZA 3AAWB 3G6VA 1VBXA 4U7UD 4C3MA 3EPGA 1T3NA 1HBMA 1Y5NB 3SSQA 3NGRA 2Y1LB 1DAXA 3UR0A 1HNXJ 1B0TA 3QLHB 1X5TA 2HFUA 5BR8F 3EZ5A 1S97A 4K8RA 3PDNA 4JI5J 2BX6A 3RW6A 1WOOA 1GMVA 4A8XA 1RAJA 2B4OA 2M5YA 3W5ZA 2ZH9A 2DR8A 1S79A 2YQ1A 4QYRA 3QJPA 2HZVA 3HHKA 2HVZA 2J0WA 2PA8D 1YJTA 2ZJRQ 2NZCA 3HSGA 2LVWA 4C11A 2XO6A 3RTVA 2CPHA 5HVFA 3M2UA 3UD5A 2XNRA 2B6AB 1VRUB 1JXEA 5H9EJ 1EJ7L 3JQJA 4LIWA 1RISA 2V5HG 4P73A 3UE2A 3PW0A 4DU8A 3MAQA 2OI2A 3EWGA 1HMVA 4FKXA 1X9WA 2A3JA 3P6YC 4LSNB 4BS2A 4HHUA 1SV5B 1H0HB 1X4FA 3BKUA 3QSIA 4UQTA 2HHVA 1TV6B 2QSWA 1VHFA 4Z37A 4QIWD 4ITSA 2DGOA 1M0SA 3BR9A 3WZ0A 3CGIA 2VBYA 5CCLA 5DRKA 2XGQA 3PW7A 2ATCB 2VFVA 1S6PB 2MJNA 3CDEA 3H7HB 5CQGA 1SL2A 2QA4G 3A3OB 2BEFA 1KBRA 1OYDA 2DGSA 2DHSA 2AU0A 3QBCA 5LOQA 3IR6B 2ZM6F 3OW2R 5L1IA 4B3OA 2OP5A 2VG6B 3OHAA 4Q7AA 2V63A 2Y3YA 4LF7F 4I7FB 3RRKA 3O2IA 3M9NB 3LA0A 2IJRA 2ALZA 1IKWA 1NH8A 2A0FB 2XULA 3TUZC 3LALA 2VA2A 1CLFA 1UWBA 3RRHA 3GCXP 3HHDA 3RG6A 5C2CA 3TQ1A 3DRSB 2IHR1 4NX9A 3VGSA 4F8RA 3AJ1A 2G0IA 2XYPB 3H8YA 2HPUA 2WB4A 4DR7J 4K5SA 1Q5VA 5EN1A 2GHPA 2DNZA 4C9DA 4KC5A 1U0SA 4CDIA 1LW0B 1IBLJ 3M8YA 3N79A 3W65A 4ED1A 3HVTA 5C24B 3R27A 5L1KA 3ISNC 4TKTA 1VQLS 2FTRA 4R25A 2W2OP 3S1TA 5KFWA 5E3CA 4Q5VA 3TAPA 1U1LA 1IBLF 1T9TA 3QRRA 2HLUA 2J8AA 3EPIA 3CULA 4KRWA 3GQCA 2DHHA 2Q6BA 3QT8A 4FVCA 5HVHA 1XMQJ 2IC3B 1S9GA 2RQKA 5ETSA 4ZITA 3LPYA 2RAQA 2DR6A 3MDFA 5HK4A 4M5HA 3N6LA 1SXLA 1HR0F 4C48A 4WE1B 2ZOFA 4QZVB 4AXIA 3J81U 1XMQF 3HVWA 2A2DA 2YKNA 1PAEX 1U49A 2HMIB 1FWPA 1JXVA 3SZ2A 2UUAF 1Q5YA 3U1MA 2F4VF 2VFUA 3NY0A 1RT7A 2W4CA 3JTPA 4ZP8A 4PG8A 4IO9Q 3D67A 2AX0A 1XBWA 2PA3A 2ZWOA 4NA1A 2ROGA 5DG7A 1RWXB 1Q78A 3GFYA 4IOCQ 2AF6A 2YWWA 4QIGA 2WVCA 4ALZA 4OYXA 2W4DA 5J2NA 1PILA 2MZSA 4LVNP 4TYAA 3W9HA 2K7KA 1Q8BA 1HQEA 5HVGA 2J7KA 3CNQP 3KLEA 4N7TA 3UQSA 3K5MA 4A4JA 2JEFA 3L3CA 4BDPA 4WP3A 1Y10A 4J9VA 3V6KA 2R7XA 4Q45A 2W7AA 3CVKA 2UXDJ 2VG7B 2AJ1A 4B9UA 3AHPA 3OFEA 2DXFA 5FDLA 3MM7B 3KJVA 3C19A 3I82A 3UDEA 4NXMJ 1H38A 4B9MA 2E1CA 2Z2YB 1F3FA 3DXSX 4RW4B 2UXDF 3KJNB 7FD1A 1U48A 2I0XA 1TL7A 4ID8A 5CYQB 5CZVA 4QIEA 3G4SS 4QIFA 3MFIA 2DCUB 3I5CA 4OL8A 1B0PA 1O6XA 3MCOA 4JBCA 2YKAA 1RT4A 3TAMA 3KMSA 4B3RF 1UZHA 2CNLB 1BQNA 4G1IA 4BWJA 3MOZA 4DU7A 2D74B 3CTRA 3OFGA 4B3MF 5C7PA 4OV6A 3OL9A 2DNYA 1NK9A 3NWGA 3E01B 2I38A 3M30A 8AT1B 5M2PA 3Q2SC 4DV3J 2KZZA 4ZCIA 3W5XA 2W2QP 3DI6B 3KLIA 2JZ5A 3OVAA 3VALA 3HZGA 1KC8T 1S9EB 4RW7A 1ICEB 1IKYB 2BKOA 2GJFA 2XHWA 2DD8S 3IBCB 4MK8A 3KLFA 3K58A 3DCAA 1EZZB 2N7CA 3BQ2A 3TVZA 2YX7A 3QT7A 3MM9A 2VONA 2MEWA 2EXUA 4R8UA 2HNZB 1KEKA 4HYKA 3B8HA 1RAFB 2KHCA 1VQKS 2RS2A 3NXZA 2HYIB 2N7YA 5IT9U 2WK4A 2YWHA 1QAYA 2C1EB 1TFYA 4XPEA 2V6AA 4WIQA 1V3ZA 1DQ8A 3CUNA 2HFSA 1FA0A 1K44A 4DR6J 2E1RA 5KFZA 4DR3F 2AGPA 1ULRA 3DLGA 1RI7A 2HS3A 5ETTA 5HROA 1NUEA 2W9CA 3DLLQ 5U47A 2LQ8A 3PEHA 1T7PA 1REVB 2AYGA 2Z2LA 4XK8C 4QW8A 5D4NA 3SQGB 3NBPA 2A10A 5HQ8A 1J27A 4XAKA 2OH2A 2AZ3A 2AJ4A 3RBXA 3BJYA 4A8FA 2V9KA 1ZM2A 5MAOA 2UUWA 1MU2A 4FYVB 4X2BA 2L9WA 4K50A 2V4QA 3DGVA 3U27A 1HWIA 4DR2J 5A8WB 2HS0A 4DSIA 4DDFA 1GTEA 2KL8A 1WOSA 2M8DB 1ZYQA 2DNMA 3W62A 1ZZNA 1FRHA 5E3RA 3HPOA 4ED2A 1VS3A 1P6TA 3OLAA 1BXNA 4FXWA 4WTYA 2NZ4A 1QUVA 1VDHA 2HEKA 4HHJA 5M2RA 3OHBA 2ZE2A 1VQ5S 3BSAA 2QE5A 5F8IA 4ECTA 2VFTA 1UL3A 2YVSA 1RWKB 4KFBB 3O8WA 4RLEA 4OZ2A 1PSDA 4EZ6A 2ZJQQ 1S1VB 1N32F 4ZVUB 1AXQA 2DY9A 4PUOB 3FRZA 5LXYA 3OL6A 3PFOA 4OI0A 4C11B 1DBDA 2VHGA 5ETLA 1UA1A 1N32J 4OZ5A 3OXGA 4TU7A 1S4EA 1XWLA 3W5YA 3SIPB 3FBCA 3K59A 3EJMA 1VJQA 4FP9A 4DL3A 4F3OA 4Y2MA 2YNIA 3CDUA 3GYNA 4OI2A 1DY3A 4NLRA 5A76A 3A4TA 5FD1A 4LFCF 1NPPA 3IN5A 5L46A 3EICA 4E2FB 4NZ0A 3IR7B 1VQPS 3KNGA 4CLKA 1M1GA 1T3OA 3V4IA 4UZBA 2R7QA 4DL5A 2QG9B 3LP1A 3PKMA 4OJ3A 5E5NA 2HNYB 1PYTA 1S1XA 2PGCA 3H2VE 3ZZZA 5KG4A 4ZIWA 4ZLJA 3WDOA 4W4MA 2CVIA 2YQ0A 4RKUC 4DMZA 2U2FA 1X5SA 3HFVA 3B4MA 3CWJA 5KT7A 4LIRA 3NNAA 1U2FA 3TW0A 2ASJA 3V81A 2WSCC 1KD1T 2P5VA 1LWCA 1PJ7A 3BH7B 3EVOA 4NE9C 4EGLA 1XMBA 1H7WA 2HNYA 2BKPA 3ELHA 2RQMA 3DLJA 4BWMA 3WX4A 4ES3A 2IY5B 1MROA 3ZNUA 4Y65A 1XNRF 2BKNA 3EGNA 3A8KA 5GMKa 2ZKUA 1RZMA 5FLXY 1RLDA 2DRAA 1GXUA 2WVEA 4M5KA 3NKYA 4ZVOB 2GFFA 4CLTA 1KVIA 2GS8A 1NNDA 3P4UB 3DU5A 5HO4A 4GVLA 2DNLA 2AWZA 3ZTOA 1K47A 1UJ4A 4B08A 2IMWP 2DKOB 4WXOA 2Q66A 3DOKA 2MLZA 4O3OA 3B4DA 2ALYB 4OZJA 3HD2A 4CM2A 5KOXA 3BDEA 1DTTA 3HVTB 2B5JB 2DNGA 3GV5B 4JP8A 3UFCX 3Q22A 2Y0BB 4YB1P 1VQOS 2AD9A 2UU9F 4ED0A 3H40A 1A6LA 1VJWA 3TZZA 4G1QA 4X65J 1O51A 3AOCA 5EWFA 1GT8A 2HIYA 1GNKA 4YHHF 4JI7J 4HH0A 3QZ7A 1C1CA 1K1QA 4GKJF 4KSEB 4Y00A 2HRYA 4ZDNA 2OTLS 4X62F 4NA2A 4NOHA 2D9OA 4NLQA 3Q83A 4WE1A 3RGIA 2ZBIA 3TEGA 4YB6A 3W8PA 3IO1A 4OX9J 1LWEB 1S6OA 3V6HA 3IRWP 2VPXB 5KFUA 1RBAA 2CDQA 3U1LA 2GAGC 1KQKA 1U8SA 2XY7A 3GG1A 4DUTA 4ANDA 3H5XA 1IXKA 3GTYX 3G6YA 2DISA 5LJ3Y 3BEGB 2RILA 5CAAA 4IFYB 1IN0A 2V2QA 3FDSA 3POTA 2Y1JA 2J0SD 4J7CA 3TP2A 1MMDA 4DPUA 2W8KA 2X1AA 1XN9A 2F3JA 4MKVA 4S0MA 3TNVA 1PJ6A 2DRDA 2LDIA 4OI1A 1EP4A 3MMJA 5IS2A 5E0OA 1RWVB 2BOPA 3CJSA 1U1KA 1R8BA 1AA1B 2B8QA 4OZNA 4Q2MA 1RT1A 4NYPA 4IUFA 4KHPJ 2B56A 2B51A 2BW2A 2DPIA 4FYYB 3V4MA 1UVLA 5BXIA 1B64A 3M4XA 1SPBP 4Q8EA 5C2GA 2H65B 4WFZA 3QRPA 3SEOA 5M2UA 1S6QB 2YKPA 4O4RA 2V4JA 1HWJA 3I55S 1R3NA 1VC6A 4LF4J 2MGZB 1OY9A 3D5MA 3MR2A 2HW3A 4OMFG 1TL7B 4DV5F 3THVA 1S57A 1P8GA 4EU0A 4DUYF 3MECB 2XLIA 3SSRA 1T9UA 2HBYB 2Q79A 3SCIE 4DV4J 1REVA 4M63A 5B0EA 4N47A 1NB2A 4J9LA 4NWBA 1SB6A 5B0CA 4DV5J 2FZKB 3BPDA 1GMWA 4FNHA 1H2TZ 5F41A 2YTCA 3A8IA 3CCQS 1T05B 4YOEA 3PXGa 3HK2A 3IM9A 4GC6A 1X4CA 3UDLA 3DLEA 2DB1A 3RRGA 1H7XA 2JLGA 5A2QY 4RJVA 2UZAA 2E5HA 2FJAB 1S9EA 1CJKB 2WOMA 1KS2A 5B7WA 2IYGA 3UD4P 2G0JA 2PN6A 2ZD1B 3D1QA 4P6QA 4DLGA 2MQ8A 1LW2B 2O5DA 2OD6A 1X0FA 2KG0A 2RVJA 2LKZA 4F2SA 4NYZA 1VLYA 3CCTA 4DR5J 4URSA 4TYBA 2ZC4A 5HMWA 1W2BR 1M90T 3BREA 3CMQA 2RUSA 2HK2A 1RTHA 1NSPA 3M6VA 3N5FA 2YKQA 4OHWA 4JV1A 2BYCA 1T02A 9ATCB 1T94A 1NSQA 1CPZA 2V50A 1FRKA 1SBRA 3KWMA 3R8YA 4IRCA 2OO4A 3DRRA 4LBIA 1RAGB 1J5OB 3TVKA 3RR8A 3Q86A 2F40A 5GADU 4X4PA 1WG5A 2RRAA 4WJBA 1FXRA 3CCES 2G2ZA 3HHLB 3W2WA 1HI0P 3NG8A 2YQ3A 4N8NA 4Z7YA 3Q8PB 2YX4A 4DPOA 2FHMA 2Z2MA 4V19X 2BZ2A 5LM7E 5EHHA 4YY3F 3GYXB 2MGZA 2EPIA 1Q0NA 3GE9A 1FERA 3R5DA 4DV7J 1S10A 2PI4A 1C4CA 1RACB 3KLHA 2UUTA 2W2NP 5E3PA 2D1CA 2XG8A 3RB3A 4HR2A 1NPKA 3MF5A 5LSOA 4N5SA 1U47A 4LQ9A 3V4IB 3G82B 5IM0B 1X0PA 4YY3J 3FMWA 4DV7F 5A8KB 1ZAVA 3KK1B 1RHJB 1S1WB 2VPWB 2DRBA 2KFNA 3LH2S 1U1MA 2QZ8A 2J6TA 2HKEA 4GO5X 1JLQA 4ID5B 2RF2A 2YBVA 1N5SA 2MQPA 3HHEA 3BGRA 2BW7A 3EXYA 5J1PA 4PRFA 2FVSA 1YRUA 2LXIA 3PIPQ 5E33A 1KP6A 1S1VA 2EBGA 2XZTB 2HBZB 2CRLA 1JLFA 3QAEA 1Y4ZB 4KFBA 2WHOA 4U67Q 3KHHA 1LW0A 4TY9A 1CJKA 1VRUA 2E1MC 2ZBRA 5F0UA 3C66A 3W2VB 2ZD1A 4K2JA 4ERDA 3GILA 3TAQA 2RSQA 4OFZA 2XS2A 1QAIA 3H98A 3OT9A 5BR8J 4JI1J 1T11A 3K8WA 4IG0B 1U09A 3CJKA 2ASDA 1YRTA 2F1FA 3BM7A 3PR4A 1UW9A 3DOLA 1Z2ZA 2R3VA 3QIPB 4NLTA 4LF2A 2MJUA 4F4KA 2C3OA 3IA0A 4B02A 2GGPA 5BYSA 2YNIB 1UFWA 4DV1F 1LFWA 4NXMF 3KNAA 1F5AA 1NU4A 1WHWA 3PM9A 1HLWA 4LF8J 1R7IA 3AOBA 3VHQA 1NO8A 5AJ3J 1FKAF 4EFAC 4PG4A 2YKMA 1MWYA 4ZOSA 5KFIA 1U2CA 4CQ1A 4U96A 4CO3A 4IKAA 5A6PA 1QAJA 1Y0HA 1BY9A 2AYMA 3D66A 3IAS9 5DGAA 2FGOA 2EKNA 4NZ7A 2IM2A 2XMTA 2YNFB 1TV6A 2EG2A 2F7VA 2BM0A 2ASLA 3QAUA 3TARA 3QQCD 3LANA 5CYMA 1Q7LB 5K14A 4A46A 1BWVA 1TK0A 1RT6A 1Q53A 3U1NA 2QYCA 3VAMA 2DYAA 3TJAA 1HD1A 4P2FA 2B4UA 3KUHA 2DH8A 4YB5A 3H5SA 1WI6A 1RYSA 1QSLA 2UUBF 3PFEA 4PXEA 3HULA 2ZM6J 4DN0A 1HBOB 3ISZA 2FVRA 4OYPA 3HI9A 4PEOA 4EYIB 1F9FA 1M1HA 3OQ2A 3LW5C 3M8ZA 3OFHA 2N82B 2D3ZA 1TMJA 3DHXA 5DG8A 4DL7A 1CJVB 1HL6A 3UVJB 3ET6B 5A2QU 4I2PB 1S7IA 1WC3A 2KVIA 5ETPA 1E6VA 1ZA2B 2BRKA 2LECA 2EI5A 5ETNA 3MEEA 1QJHA 4NI2B 3BGUA 3P8BB 2CPZA 3W7BA 4IG3B 2VF3A 2IIHA 3NGDA 2XLKA 3Q8RB 1UCNA 1ZTTA 1CJVA 1RWOB 2MKHA 1RT4B 1HQ2A 2R2TA 3DOMB 2CADA 3LPEA 4RUCA 3DLHA 1KTQA 1GFWB 3AA9A 1F6TA 4HI1A 3MPYA 1H73A 2XMMA 5HAOA 5HANA 2MZQA 2BANA 3HVRA 1VIXA 1K8AT 4A8MP 4W90B 5IT0A 1U1OA 1LFPA 2VG5A 1FK9A 5KT6A 3M8RA 1U0HB 3DXBA 3EE3A 3JS9A 5KFVA 2ZZMA 1F5CA 2FYXA 4OJ1A 2ZHOA 4PKDB 4D3HA 5IFMA 3NNHA 1FCAA 3FQLA 1VK8A 4USWA 2DITA 2P9CA 4O3SA 2EC0A 3SSSA 5E3QA 1DLOA 3G8QA 5GAHI 1FTCA 3M8WA 4RNHA 3F0NA 3J7ZT 1Y00A 3FBEA 4MIWA 4CWBA 2E5LF 1TKTB 4U9RA 4R8UB 1VQ9S 2UUAJ 2M9KA 1FDDA 4M5DA 3WIVA 4ZVFA 1KKHA 3BZQA 2WVFA 2VV5A 2F4VJ 4O44A 1MG7A 2GMHA 3EMTA 2UXBJ 4ED6A 1R8AA 4DFJA 1YJRA 2F8HA 4UT4A 2R8HA 4FF4A 4QR1A 4JYAJ 3RYLA 2G2OA 5KTQA 1F1BB 4WKRA 3J7Z5 4G3IA 1B7FA 1FX4A 2DK2A 2CG4A 4PPZA 2QJ3A 1VQSA 2QFJA 5KFJA 2PDAA 4NXNJ 5A0YB 3CIMA 3R9LA 3CCUS 3IC1A 4K4YA 2LEBA 3NGUA 4OLOA 1KQFB 4UUWA 1GXTA 5GAEI 4ZLPA 4DFMA 1APSA 5KT2A 1JK9B 3HJVA 4ZP9A 3BQ0A 1PJ5A 3FVYA 1FVSA 4KO0B 2V8DA 4DUZF 3RBZA 3J80Y 3GZ7A 4LRAA 1RHMB 5B0GA 2VG7A 4ZPDA 4AQYF 2MZTA 4NLSA 2XM3A 1MSWD 1VLOA 2C3YA 2V67A 5DO2A 2C22A 5E2QA 3P96A 3HDSA 3M1VB 1S49A 3GJTB 1BQMB 2MQOA 2RJZA 2B7BB 5ETQA 1VR6A 3ENVA 2R42A 4C3LA 3VZIA 5B09A 1KTVA 1RLCL 5EX0A 1LWFA 2BABA 2HNZA 3JSMB
chains in the Genus database with same CATH topology
3AJ2A 2WBMA 4IR9A 5F3ZA 4IQXA 1K1SA 3V5RA 2XY5A 2AGOA 1S0MA 4ILLA 4RW8B 2KU7A 1N54B 2D3OR 1VC0A 1QM9A 4J9NA 2MQMA 3I0SB 1LW2A 1NRKA 2MY7A 3BF4A 3R5BA 4X4SA 1HYSB 3E51A 1JX4A 1T03B 3EZUA 2DIVA 1N88A 1CVJA 3M32B 3T6JA 2JHEA 5CH7B 3DRRB 4RBVA 1SIZA 3RBDA 2WTFA 4X65F 6FDRA 1O8BA 3CJ2A 3MM5B 3FSYA 5EUHA 1BD6A 2J9DE 4N8OA 2KTQA 2VB6A 4DR4F 2KHDA 2QSFA 3CMAS 5L1LA 1UW4A 2GHWA 1JKHA 3CCWA 4ZVGA 2HNDB 3Q24A 3THPA 1TKXB 1NJXA 2VKRA 5KFBA 1N33F 3DMJB 2VASA 1MMNA 3PW4A 4OV1A 2PFFB 3DLBA 3GR0A 2PD1A 3CT9A 3TVYA 5GAGU 3LWLA 4K4VA 1TL5A 2IM1A 2WSFC 4H4KC 2FLPA 2ZOMA 4HTJA 1I94F 5KT4A 3MPVA 5DDRC 2VBXA 1XR5A 2CQ2A 1RGVA 1NJYA 1LWFB 4QW9A 3CJ4A 4ED7A 4A47A 2EKYA 2XO7A 3MTJA 1HHTP 2JJ4D 3N4WA 2GO9A 5C5JA 5EWGA 3SFGA 3CIZA 2LQJA 3SCKE 3BO2A 5J2MA 2IVYA 3BGLA 3C6UA 5D6GA 1S72S 4LVOP 2IRUA 1HNVA 3DGPA 1JLGA 4OI4A 3CSKA 4C0HA 4QWCA 4FBTA 2OFGX 3GIKA 4C8YA 3ETOA 3OR1B 4PWUA 5T7LB 1MW7A 4ECWA 2N3OA 1XMOF 3QWUA 3QMQA 1A9NB 4ECZA 3GB0A 1KR4A 3PO4A 4OZ1A 3OBIA 1VOMA 2L08A 3AB4B 4KGMA 3CD0A 5F9NA 2DGUA 2CPYA 4I6WA 2EFOA 3MM6A 1QE1A 1KLNA 3PO5A 4USHA 1T8EA 1WHYA 2CQHA 2U1AA 3NCRA 2IFXA 2YNFA 4I56A 3Q2TC 5J2NB 1YSJA 4ZPVR 2DCLA 1FDAA 2BUNA 2OPPB 2IBOA 3R5CA 5KFTA 1RTIA 1U6FA 4KB7A 2FVQA 1D9AA 3GWCA 5DQHA 2RT3A 2X3GA 3RW7A 1L3TA 1N0VC 1N6QB 2D3UA 3PW2A 2JEIA 2ATLA 2UVWA 2R2RA 1X7VA 1N4LA 2EWHA 4PXCA 3G71S 2CQ0A 2JH3A 4MJKA 3VAJA 4JI1F 2CPIA 4H4KA 4TXSA 5KFFA 2XI3A 4A8YA 3HMJG 4UOCA 3HXMA 3HZEA 2I2YA 1M5VC 2MZJA 2ZDPA 1SH2A 1HNVB 4ZCKA 2M0GB 4PXBA 3A1YG 1IM4A 3DOKB 1OO0B 4EZ9A 2JDJA 2F9DA 5IQ6A 3I4PA 5D4PA 3BB5A 4JI3F 2OTJS 3CXCR 4DV3F 3R3TA 3OUYA 2AW0A 3NS5A 1WELA 2IA0A 2MYFA 4ECYA 1C1BA 3BQ1A 2HGLA 1IUJA 1N34F 3EX7B 1U6ZA 3CD7A 5K8MA 4AUKA 3G6ES 4UY8T 2UVVA 2FVPA 2NPIA 5IXUA 4DQIA 1D9FA 1Z1ZA 2DHGA 4N77A 4YB7A 5F8GA 2PE8A 1GXLA 5MLCV 1G6BA 5SZTA 5J2QB 2VZ9A 1Y5LB 4MYUA