3JSMB

K65r mutant hiv-1 reverse transcriptase cross-linked to ds-dna and complexed with tenofovir-diphosphate as the incoming nucleotide substrate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
426
structure length
413
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the role of the K65r mutation in HIV-1 reverse transcriptase polymerization, excision antagonism, and tenofovir resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna complex
molecule keywords DNA (5'-D(*A*TP*GP*GP*TP*CP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP
total genus 88
structure length 413
sequence length 426
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3jsmB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jsmB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jsmB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jsmB03
4Q8EA 1NHUA 2B43A 2D3ZA 3BSNA 2VG7A 2YNFB 5CYMB 3KK2A 2WCXA 3FSIA 1RAJA 4URQU 4O4GA 3HHKA 3KLVA 2E9TA 5J2NA 1K1QA 4ZHRB 1RTDB 2ALZA 3PW4A 3IG1B 1HMVB 1MU2A 2W9CA 1TL1B 3OSPA 4ZP8A 1C1CB 5KG0A 2JEIA 3KHRA 2IJFA 5C25B 1TL3B 4NLQA 3M8PA 2ILYA 1C0TA 3N6MA 3PW7A 4IG0A 4ZP9A 1N56A 2HNYB 4I7FB 3M9OB 1RTHB 4RUAA 3PVXA 4NRTA 4JV2A 1D1UA 4ZP6A 4MK7A 4LSNA 3FFIA 3MECA 4KO0B 2W9BA 3G6XA 1S9FA 1LW2B 4PUOB 3M8QB 2VA3A 2GIQA 4PWDA 1JLQB 1HPZB 3BREA 5L1IA 3OHBA 4RW8A 2DPJA 2IC3A 4ECWA 3MR3A 1HMVA 1MU2B 2VG6A 4WXWA 4RNMA 2W9CB 1C1CA 3GV5B 1T03B 4EO6A 4U6PA 3PR5B 3KLEA 5KFRA 5L1LA 3NAHA 3DI6A 4H4OA 1S1WB 3KLFB 2FVQA 2B6AA 1RA6A 4DL4A 3TAMB 3H98A 2YNIB 3C6TA 5KFHA 4M95A 3PZPA 1S9GB 5C24B 3I0RB 5T14A 4O44A 1DTQB 4O4RA 4ECXA 1SUQB 1ZTWA 5I42A 3M9NB 1RT4A 5CYQB 4ZP7A 2XGQA 3MR5A 2YKNA 5KG5A 5HBMA 4R8UB 4QWCA 4J9QA 3LP0B 1HNVA 1JLQA 1RT3A 3G6VA 3N6LA 4KSEB 5KFVA 2UVVA 1RT1A 3GIMA 4RZRA 2D3UA 5F8GA 1QUVA 4ECRA 1XR5A 1JLCB 1RT2A 1VRUA 1LWEA 4I2PA 3DI6B 3KLFA 2FVRA 1RDRA 1T94A 1TP7A 5KFFA 4YR3A 1JXLA 4IQXA 3PW5A 3CDWA 1R0AA 4Q45A 3I0SA 1DTTA 1QAIA 4EEYA 3IN5A 4K50A 1DTQA 3DYAB 4KFBA 3KHHA 1REVB 3ITHB 3Q8PB 2B5JB 4PWDB 3CDUA 4F4YA 4ED7A 3MTKA 4QW8A 1N6QA 4O3QA 3LANA 4R0EA 3LP0A 2UVRA 4RNNA 3V4IA 4K4WA 5I3UA 4NLTA 5DQHA 4QWDA 2BQ3A 3QIDA 4ID5A 4KV8B 2AX0A 4ZVEA 4IRKA 2HNYA 1RTIB 4I7FA 4J9PA 1D0EA 1TV6B 3MF5A 3CVKA 1LWEB 5EDWA 3OLBA 2BE2A 2FJWA 4O44B 2YNHA 1XR6A 4GC6A 1HQUA 5KFDA 4ZHRA 4WFYA 1GX6A 4WE1B 4QW9A 4KFBB 2YKNB 4NCGB 4IH5A 5KG3A 1S1TB 1QE1A 4TYBA 1XR7A 5KFPA 3DRSB 5HP1B 1TKTA 2IM2A 3FQLA 5L1JA 5C25A 5KFTA 1KLMA 2QE5A 3QO9A 5KFLA 5KFBA 4X2BA 1S1WA 3DLKA 1IKWA 5HROB 4URSA 4O3NA 1T3NA 1N5YA 1C1BB 4QWAA 4I2PB 1VRUB 3HKWA 3T5JA 4ED3A 1IKYB 4NLOA 3E51A 4Q43A 4ED6A 3I0SB 1S6QA 1OS5A 2HWHA 4K4SA 4NLRA 1HPZA 1KHVA 5C42A 4R5PA 2BRLA 4G1QA 5J2QA 2IC3B 4RW4B 2RF2A 1FKPB 3KK3B 3OL8A 5L1KA 1S1VB 2WONA 3HVTB 3KLGA 3V6DA 1IM4A 2AWZA 4O3PA 3NGDA 4J9RA 4H4OB 2R2TA 3DLEA 1S0OA 4LQ3A 3BJYA 3JSMA 1S1UA 3MFHA 2R2RA 3IS9A 3DLKB 4I2QB 4KKOB 2E9RX 1RT6A 3KOAA 1SH3A 1C1BA 5KG2A 2E9ZA 1HNIB 2YKMB 5J2PB 2FLLA 2XI2A 5KFCA 4GC7A 2OPRB 4Q0BA 1FK9B 2C2RA 2FVSA 4H54A 5J2NB 4NCGA 3KJVA 3QLHA 4PQUB 5J1EA 4TN2A 1BQNB 3QGIA 3BGRB 2FJVA 1RYSA 1UWBB 3MFIA 3KMQA 4MH8A 4RNOA 1T05B 3HVTA 3V6DB 2ASJA 4IFVA 1HYSB 2V9WA 3QO9B 3KNAA 4K4YA 4KAIA 2BR0A 2W7OA 4TYAA 1C0UA 2ASDA 3KLHA 3LP1B 2JC1A 3CIZA 4J9KA 4FS1A 4ECZA 2AQ4A 2AGQA 1S48A 1HQUB 4MFBB 4YMEA 3QZ8A 4ECVA 1TKZA 4WE1A 2B5JA 4FS2A 3FFIB 3MECB 4NLPA 4EBCA 5KFSA 3DOKB 3BR9A 3QGHA 3T1AA 3Q8QB 2FLNA 3V81B 2AX1A 5J1EB 4EBDA 5KG1A 3QZ7A 2HMIB 2BQUA 5DQIA 3RB6A 2WB4A 3FRZA 5DLGA 2R2SA 1J5OA 3QGGA 4B3OB 3M8PB 4DG1A 4IFVB 4IH7A 1RTJA 3CO9A 1S1UB 4O3SA 3PR4A 4EBEA 1RT6B 1IKYA 1YVFA 3C6UB 3CJ5A 2FJXA 5EWEA 3SFGA 5DLFA 4FBUA 1RYRA 2C28A 1SV5B 5KFOA 1RT7B 2JLEA 4MKBA 2XC9A 4JV0A 3MEGA 3IGNA 3H40A 3H5SA 4RW9B 3GIIA 3QIPB 2HNDA 4IKAA 3PW0A 2ATLA 2W9AA 3V81A 2CKWA 1S1XA 2VA2A 4H4MB 1TQLA 2HAIA 4NYZA 5F8LA 4ZMMA 3BSOA 4RW6B 3EPIA 2WK4A 3T19A 4KB7A 5F8MA 2YNIA 3C6TB 2F8EX 3NBPB 3D5MA 3OHAA 3SI8A 2J6TA 2WRMA 1TVRB 5CYMA 3KK2B 2RDJA 1S10A 2W8LA 1SUQA 3GYNA 4MK8A 1DTTB 4O3RA 2GIRA 4IH6A 2IBKA 5CYQA 3IG1A 2I1RA 3NL0A 3DRPB 5KG6A 1RT7A 3DOKA 5KT2A 4RUCA 4ED1A 3ITHA 4WYWA 4DL6A 4MK9A 3BGRA 1S0NA 4IR1A 4IOBA 2BQRA 1U09A 3I5BA 1FKOA 4TLRA 1T03A 1JLEA 3KLIA 3GILA 3DM2B 2I5JB 5JXSA 2FVPA 3M9MB 3KHGA 2OPPA 3DOLA 2D41A 3NAIA 4QWBA 4ED2A 5DG8A 2YKMA 5J2MA 2GC8A 1TV6A 4M94A 3I0RA 3UQSA 3NBPA 3HVAA 4KO0A 2ZD1B 1LW2A 4PUOA 4NZ0A 4TY8B 2DPIA 2XGPA 2R2UA 1LW0B 3H4BA 4DL7A 1JIHA 2ASLA 4RNFA 3DRPA 4RW9A 5KFUA 2QV6A 3T5KA 2R8GA 2XI3A 3BSCA 1J5OB 1W25A 3EZUA 4B3OA 3SFUA 4RW7B 1I6JA 2AU0A 4K4VA 3DM2A 3RB4A 4KV8A 1JLCA 1RT2B 1JX4A 1RT5A 2BANA 2OPPB 4ZPCA 5C24A 1N5YB 1TKXB 5EWGA 5EWFA 3C6UA 3E01A 3OL7A 2EC0A 4XPEA 4MFBA 2BE2B 2WOMA 5FDLA 5KFWA 4DEZA 3OSNA 3H4DA 2YNHB 3DYAA 5F8HA 3T5LA 2FVCA 1LWCA 4EO8A 2VG7B 2YNFA 1K1SA 5KFYA 3MR2A 3RAQA 4NLGA 4J9SA 4YQWA 1QE1B 3D28A 4TXSA 1TKTB 3N6NA 4IFYB 5I3UB 5KFQA 4MIBA 1JLFB 3BQ2A 2VG5B 3I5AA 3FDSA 4WFXA 3JYTA 3DLGB 2XWYA 5J2MB 4KHMA 4JUZA 4WXOA 3E01B 2IM3A 1VRTB 2JEJA 4DL5A 2R8KA 2UUWA 5JUMA 3PW2A 1N6QB 2OPSB 3LALA 2R8JA 3FQKA 4NLWA 2J6UA 1S97A 4HKQA 3LP2B 1FKOB 1DLOB 3GV7B 1BQNA 2OPQB 3DRRB 3CJ2A 2XCPA 3MEEA 3CJ0A 5KT4A 4ZVGA 5KFNA 4HYKA 1JLFA 2IM1A 4MIAA 4ICLA 1HQEB 3T5HA 1WNEA 3GIJA 4KHRA 4ECQA 4ECYA 5KFMA 3V6JA 5F9NA 1JLGA 4ZPAA 4IR9A 1S6PB 1S9GA 5F9LA 1N48A 1IKXB 1S6QB 2IA6A 3OL9A 2W9BB 1LWCB 1S1TA 3TVKA 1JKHA 4KBIA 4NLXA 4J9OA 3QLHB 3KK3A 1TL1A 5J2PA 4PQUA 4ED8A 2CJQA 4WZQA 1HNVB 1RT3B 2UVWA 2W8KA 4FBTA 3H59A 5D3GA 4NLDA 1DLOA 5KT7A 4J9NA 1TL3A 3OLAA 4EYHB 3CWJA 3H2LA 1LWFB 3UDLA 3HVWA 1C0UB 3KHLA 3CJ3A 1JLBA 1HQEA 3DLGA 2XCAA 4K4TA 2JEFA 2WOMB 2YNGB 3DMJA 2WHOA 3CJ4A 5DGBA 4LSNB 4O4GB 2D7SA 2ZKUA 1RTDA 1TKZB 3GQCA 2RKIA 3KJVB 1FKPA 4NLUA 5HBMB 4RW8B 1GX5A 4R8UA 5EUHA 2IJNA 3ICLA 3G6YA 2ILZA 2VG6B 4Y34A 3UPFA 1S9EA 5K14B 5KT3A 4IFYA 2WTFA 4WZMA 3QIPA 5KT5A 1C0TB 4YR0A 2IM0A 1ZETA 5D3GB 3V4IB 1MMLA 4RNHA 1EETA 3ISND 4ZPBA 2R8HA 2VG5A 3H5UA 4KKOA 4I2QA 3TAMA 4J9LA 4ICLB 4ECTA 1SH0A 3EPGA 1S4FA 4LSLA 2V0NA 3G86A 1JLBB 2HNZA 2V4RA 4WFZA 2YNGA 1IKXA 2AGOA 4XPCA 3UR0A 1SV5A 1Z4UA 1HARA 3Q8SB 3NMAA 3LAKA 3TQ1A 1EP4B 3IGVA 1T05A 4NLVA 5KFAA 2BRKA 2OPQA 4MKAA 4ZPDA 4YP3A 5KFXA 2OH2A 4LQ9A 3MEEB 3VQSA 4TQRA 1RTJB 5KFEA 1S49A 3OL6A 3LP1A 1KHWA 1IKWB 3ISNC 5KFJA 2IAJB 4Q44A 3Q8RB 3RBEA 4JV1A 4Q8FA 4K4XA 1R0AB 4J9MA 3MEDB 1TVRA 3KMSA 5KFIA 3NKYA 2HNZB 1JLAA 2ZE2A 4F4ZA 4K4ZA 4ECUA 4KE5A 1JKHB 2RKIB 1BQMB 4YR2A 4RU9A 1RA7A 4XO0A 3RB0A 5HLFA 3DRRA 1EP4A 2R8IA 2C22A 2IMWP 4IG3B 3IRXB 2WONB 3KLGB 4Y2AA 4IRCA 2W7PA 4ID5B 2C2DA 1CSJA 1EETB 1LWFA 3V6KA 4RW7A 2HWIA 4IG0B 4IDKB 4OL8A 5DG7A 5F8NA 4NLYA 3BQ0A 4ECSA 2C2EA 3LAMA 1ZTTA 5C5JA 5KG7A 4ED0A 1REVA 5KFZA 3RAXA 4G3IA 1LW0A 2O5DA 4IRDA 3BQ1A 1QAJA 2HNDB 1IKVB 2RF2B 3DRSA 5HP1A 3I5CA 5DGAA 1BQMA 1S1VA 4Y3CA 4NRUA 3PJWA 4ZVFA 3H5YA 4F4XA 3KK1A 3BSAA 4NLSA 3IRXA 2JC0A 4ZVHA 3CDEA 4RW6A 4O3OA 1HYSA 4QWEA 3DOLB 2FLPA 3IS9B 4DL3A 2B6AB 1RTHA 2IAJA 5DQGA 3DMJB 3RB3A 3GV8B 1NNDA 2ZD1A 5FDLB 2RDIA 4TQSA 1C2PA 1SH2A 4URGA 5KFGA 3V6HA 3RBDA 2UVUA 4RW4A 3PHEA 5F8JA 4EYIB 1S9EB 5K14A 2OPSA 1KLMB 1IKVA 3PJXA 1JLEB 3KLIB 1UWBA 2I5JA 4DL2A 2HMIA 4IG3A 4WYLA 3DLEB 5HROA 1RT1B 3JSMB 5KG4A 2J6SA 1RT5B 2BANB 4TY9A 4DG1B 4U7CA 4LSLB 3JYTB 2V4QA 5KT6A 3MEDA 2OPRA 4Q0BB 1NHVA 4TY8A 4F4WA 1FK9A 1JLGB 1VRTA 1JLAB 2ZE2B 5C42B 1S6PA 4R5PB 5I42B 3M8QA 4G1QB 5J2QB 1RT4B 5KFKA 1N4LA 3DDKA 4QPXA 3MR6A 3MEGB 5L9XA 5HLFB 3LP2A 4K4UA 5F8IA 4F50A 3QYYA 3KLEB 4Y2CA 1S1XB 3H5XA 3KK1B 4H4MA 5DG9A 1S0MA 2AGPA 4IDKA 1TKXA 2UUTA 3GIKA 2JEGA 3KLHB 1HNIA 1RTIA
chains in the Genus database with same CATH superfamily
4DFMA 1YRTA 1J2VA 4CH0S 5A8RB 2F4VJ 1UW4A 4PWUA 4NWBA 1HHQA 5CYMB 3FSIA 1X0FA 4LR9A 3KLVA 2HRYA 4PRFA 2KT3A 1K1QA 1CBKA 1RABB 2LLZA 3R5GA 4CH7A 1RTDB 5MAOA 2ALZA 2ZOFA 4I68A 1DZ5A 1HMVB 1FEEA 1KWMA 2OSQA 3DHWC 2W9CA 3TARA 2XZWA 1OQ6A 5A8KA 2JEIA 2RU9A 3DXSX 1YK9A 4NLQA 3PW7A 3N6MA 2MZRA 4IG0A 4DPOA 1NM2A 1N56A 4I7FB 3A4TA 2J8SA 1RTHB 1EX8A 2MQNA 3PVXA 4JV2A 1KP6A 4L3KA 4DV1F 4O0NA 4XIUA 3GLJA 5IZHA 4LSNA 4BLGA 2JLFA 2CA9A 2IDEA 2MTLA 2AYMA 1S9FA 1KR4A 2DIUA 2LQBA 1WTBA 4PWDA 1HNWJ 2ASYA 5EDWA 5SUHA 1WG5A 1BUXA 1HQ2A 2GO8A 4B9VA 2IC3A 1P9QC 2DIVA 3EYZA 4RBVA 3RRKA 4XTTA 3GV5B 2ZBRA 2MSSA 2KU7A 5A0YB 3JQMA 1Q95G 3NAHA 4H4OA 4HL9A 3RTVA 3BBCA 2V9WA 2UXDJ 3TAMB 1U25A 2YNIB 2Z56B 3PYEA 4DSJA 1G1XA 2W4DA 1FVQA 3MCNA 5DZ7A 1WEYA 1N34J 3H7HB 3WQPA 1H72C 3Q22A 5I42A 1S57A 4HHJA 3M9NB 2RRBA 1EQMA 3MR5A 2DGVA 1VHFA 3MPYA 2YKNA 1D9AA 2NYIA 2V68A 3DXBA 4UF4A 4UZCA 5KG5A 4UZBA 1OQ3A 2XZTB 2MDAA 1EIYB 3MMAA 5IWAF 4F67A 3H25A 1Y5NB 2RHQB 3NOGA 3CCES 4U9RA 2QA4S 2E5IA 4OHZA 4DCJB 3WC2A 2DR9A 2DHSA 2RRNA 3I9V9 2FD2A 3QNWB 4RZRA 4A8OA 4ECRA 3KTQA 3PFOA 4OLPA 3R1LA 4CZCA 1JLCB 4Z37A 1FNOA 2LA6A 1KFSA 3DI6B 4ELVA 5T7LA 1U02A 4B17A 3DGPB 3DCAA 3HZEA 2EPIA 3LGNA 1NK4A 1L5UA 4F3OA 3AA9A 1WOOA 3BBFA 2E7XA 4DPUA 4Q45A 4K50A 4EEYA 4OI6A 3DYAB 6FD1A 4X62F 2UUAJ 2R7SA 2E7VA 2LCWA 2V5HG 3KJFB 4OHXA 3MMCA 4OX6A 2FDNA 1Z2LA 2M7SA 2F8MA 3GE9A 3MTKA 3TI0A 4M5JA 3C2PA 4DF8A 4OZ2A 3KJQB 4TVAB 5E3AA 4RNNA 3HJFA 3PX6A 2BQ3A 2GIFA 4P73A 2IA0A 4ID5A 2AX0A 3VAFA 4IRKA 1VQNS 2IDLA 1N32F 2H5JB 1D0EA 2F65A 2OGUA 1TV6B 1NSPA 1LWEB 3FEZA 1EHWA 3FVYA 4ANCA 4RO0A 1M5VC 2E44A 2FHKA 2YXLA 4PQAA 4ILRA 2Z58B 1SL0A 4ZHRA 1PC4A 2FZGB 4QW9A 5LMNJ 4IH5A 1VIXA 4OQJA 2MQ8A 3C16B 5KG3A 5BJRA 2ZDOA 5D0EA 3WIVA 4HH0A 5KFPA 3OBIA 4OI0A 3FQLA 1TKTA 1A0OB 1WC3A 3GFXA 3LGMA 3O2IA 1KLMA 2QE5A 3HT3A 1WDDA 3ZFVA 1EKRA 2DHAA 2HEKA 1U2RA 3HF5A 2J0SD 4DUTA 2R42A 3UI3A 3DLKA 3QFHA 5HROB 4P7TA 4O3NA 3VHQA 4A8QA 2XLKA 1Q8BA 5A8WB 4QWAA 5THWA 2U2FA 2HVDA 5LJ3Y 4ED3A 1U8WA 2AIRB 2GS8A 2KB2A 1RHJB 4PG6A 4ED6A 3I0SB 1HBNB 3W63A 1L3UA 1OS5A 3PO4A 4K4SA 1KNZA 3P96A 3TX8A 4YY3F 2XMAA 3JB9k 5HAOA 5IC6B 1VC0A 1UKUA 4RW4B 4E0DA 1FKPB 4PG5A 2ZFHA 3H20A 4J5OA 2RUSA 1Y10A 3KLGA 3HVTB 1NSKL 3QGPA 3NGTA 2A3JA 4O3PA 2FHJA 3OPKA 3NGDA 2BOPA 3SV3A 3DLEA 4LQ3A 4PR6A 3TANA 2VQFF 3IS9A 3DNCA 3TWZA 4KKOB 3NCPA 4TKTA 2E9RX 4C9DA 2E9ZA 5KFCA 4GC7A 3K0JA 1VJWA 2OPRB 1EJ7L 4KQZA 4X4VA 4AL7A 1T8EA 4NZ7A 2LFVA 2G9OA 1VI7A 2I9SA 3R2CJ 1UMJA 3KUEA 5HMYA 3C14A 1NSQA 4ZLJA 3HI9A 4MKYA 5J2NB 4NCGA 1T11A 4TN2A 2VJUA 1X9WA 2GA7A 1E6VB 2XMJA 1RBLA 3G87A 3BGRB 3QT7A 2HURA 4YHHJ 1UWBB 1AROP 3M8ZA 1GNKA 2N7CA 3VGSA 3MFIA 1H2UX 3KNAA 2PE8A 2DH7A 2ZZTA 2WSFC 4FYVB 4KAIA 3UWTA 2BR0A 2W7OA 2PI5A 1Y7PA 4M5NA 1A6LA 1PYTA 1U24A 4USHA 3VTIA 3PEJA 4CQ1A 3KLHA 2IYGA 4QU7A 1SC1B 2HHWA 2L9NA 1NLKL 1S48A 3BPDA 2AGQA 1HD1A 4DV4F 1N5VA 2XMWA 1SQEA 3BM7A 5KAKA 1TKZA 4WE1A 1MNEA 3MECB 2O01C 2YWEA 3QAUA 5CHCB 2CJAA 3BR9A 4D3HA 2ZH3A 4YB6A 2W01A 1KQSR 3OT9A 4WWSA 3A8IA 3Q8QB 3OVSA 2AX1A 5J1EB 5KG1A 3QZ7A 3MUVP 1ITPA 2Z4PA 8ATCB 1JXVA 4DV7F 2WB4A 1V5VA 1SJ3P 2XG8A 1Y5LB 1NKBA 4IFVB 4IH7A 2F1FA 2QLWA 4K8RA 1U0HA 3PR4A 2XHWA 4EBEA 1CS4B 3SFGA 4QIWD 5DO2A 2C3OA 1RWVB 4BS2A 4OMFG 1X4FA 3Q2TC 1FRMA 4B02A 3DHXA 2KVQE 2C28A 5K8NA 2JLEA 2DNKA 1XMOJ 4JV0A 3THPA 2RDDA 4PPDA 3GIIA 2Z8QA 2YX1A 3QIPB 4FF2A 3PW0A 1X7VA 2KT5A 2ATLA 3V81A 1NHKL 2VA2A 1UP1A 4DQQA 3FBCA 3NNCA 1TQLA 3TJAA 4IO9Q 2DK2A 2C3MA 3BSOA 1WSRA 5D0GA 1Q53A 3EPIA 4KB7A 2CADA 5F8MA 2GQCA 2GVZA 2YNIA 4MJKA 1N52B 3D5MA 1ZM2A 3WBZA 1RK8A 2WRMA 3KWMA 2WVCA 2C3YA 5E7OB 5GAEI 4LF8F 4OHVA 4DV7J 1S10A 4KC5A 3W9HA 1MWYA 4P9SA 1SC4B 4AQYF 4TU9A 3IG1A 4U95A 2JLGA 2QL9B 1RT7A 3DOKA 2ZVSA 5KT2A 3KHGA 3ITHA 2X1GA 5FLXU 3D2WA 1JJHA 1U47A 1S0NA 4WKRA 2IRXA 1FKOA 3TJ9A 3F44A 3PYGA 4OI4A 3ETOA 1A7GE 5JXSA 3M9MB 3ENAA 3ZZ0A 1RCOB 3DOLA 2EEYA 3NCRA 1I51B 3NAIA 2IVFB 4F36A 5DG8A 2VFUA 1K0VA 5J2MA 3W5XA 1EQ0A 4JI4F 1UVNA 4NI2B 1FEHA 2DITA 3CW2C 1LW2A 4PUOA 2EKNA 3R27A 1HW9A 1S6OA 2W24A 2ZDPA 4NZ0A 2WSEC 3H4BA 2K7KA 2J7WA 3P45B 4J90A 2QSWA 4DV1J 4Y28C 3IA0A 1IJEB 1HWKA 2DKOB 1HBUB 2XI3A 1N0VC 3D66A 1W25A 4LRAA 3MM8A 3GYGA 3DFEA 1N33J 1KTQA 2A1BA 5L38A 1JLCA 2PEHA 4USVA 2XTJP 4OJHA 3OTBA 3PX0A 5AXMA 2OPPB 4ZPCA 3DGPA 5C24A 2JHEA 2ATCB 4CP5A 7FDRA 1Q79A 2QYGA 2FB0A 4ZCIA 2ZC4A 1XJWB 2JFDA 5ETNA 4X4SA 3OSNA 2FY1A 2V2QA 3DYAA 5F8HA 3J7YU 3T5LA 1OWXA 3FCVA 2XB2D 2HGMA 3CE8A 4DV0J 2G2ZA 3CCUS 1X5TA 2N3OA 3D28A 4DV5F 2NXUA 1HBOA 2O66A 1N32J 3M2RB 1TKDA 5CAAA 1TKTB 2CPZA 4PG8A 4ES2A 1IR1A 4DSFA 4DI6A 1ZYQA 3MM5A 4EZ9A 4ITSA 4CO3A 4MIBA 1SC3B 2HGNA 4OX8A 4DSKA 2VG5B 2WZ1A 4DR1J 3FGVA 3FDSA 3W2WB 4X4RA 1L3SA 1KOOA 1JQGA 4NOHA 5E33A 3DLGB 5LOQA 2XWYA 1AUSL 4DZDA 4KHMA 2QFIA 4JUZA 4HDGA 2XQCA 1PILA 4FF1A 3UDVA 4B3TJ 3D9BA 2CPIA 3JQKA 4Z7YA 4ELTA 4ZVOB 2HHXA 1FI4A 3RUBL 3BGLA 3B54A 2OPSB 1EZZB 1FT8A 1WF1A 3FQKA 4QOTA 5ETPA 4DZ6A 4DFPA 3FUYA 3RR7A 4DX7A 4FF3A 4HKQA 2Y8WA 3LP2B 1DLOB 3PNIA 2MQOA 1FRLA 2OPQB 1IN0A 5DZ6A 5IT9Y 3MPVA 3T1YF 2OO4A 3MEEA 5KT4A 2ROGA 1F9FA 4ZVGA 5HO4A 1Y5IB 3QWPA 5LJ5Y 4WK1A 4ICLA 1WNEA 1HL6A 2KYXA 2G1HA 4KHRA 4ECQA 2GGPA 3M2VA 5K8OA 1FFWB 1HI1A 1JLGA 3DC2A 3NXZA 3ZTOA 1UPMB 3CD6S 1N48A 3HHLB 1RADB 3BO4A 4PXCA 2G0IA 1JKHA 3M32B 3QT6A 4DU8A 2OFGX 1YTYA 3EZ5A 2YX4A 3PYFA 3SQGA 2UVWA 2W8KA 3K5MA 4GKJJ 3F56A 1IUJA 3H59A 5KT7A 4J9NA 2OHDA 2DVIA 1RCXB 3CWJA 3JTPA 3B78A 1W26A 3HVWA 4KT0C 2P9EA 3TA1A 2GZOA 5DDQC 5CA5A 3KHLA 2IY5B 1HQEA 5T7LB 1UPPA 2YNGB 1Y0HA 5ETLA 2ZOMA 1NKCA 2CPXA 2D7SA 3TAPA 2W4PA 3R7BB 3J81Y 1G6BA 1A9NB 1TKZB 1LNQA 1OJ4A 2RKIA 4NLUA 1RAEB 3UR3C 1GX5A 3CCSS 4WU2A 2VIHA 2VG6B 4WZMA 2WTFA 1MLAA 3H42A 3R5JB 5A2QU 5IV3A 4YR0A 1U1LA 2IM0A 4ZA1A 4ZKAA 1ZETA 3UW1A 1EETA 3ISND 3NNHA 2DO4A 3TNVA 3W66A 4B3TF 2N7YA 3OTOF 3BDEA 2JRSA 1L3KA 1S4FA 3MM7A 3W8PA 4HT7A 3BGOP 4HEA9 4LSLA 2EXUA 2R7QA 2V0NA 3HP6A 2ACMA 4AQYJ 4ER8A 3HHNB 2HNZA 1WUUA 4HDHA 3EJMA 4WFZA 3KYLA 3S7RA 4DFKA 4ZN3A 4EU0A 3SDEA 2DNYA 4GO5X 4OYWA 2XNRA 4MKVA 3IM8A 5ADZA 1KC8T 3FSYA 2MZ1A 4DPXA 1U6FA 1UZDA 2VPXB 4NLVA 3QATA 1R8CA 2BRKA 5HK4A 2FIUA 2I2YA 4ZPDA 4AXIA 2MKJA 5KFXA 3W5YA 4LQ9A 1X5SA 4TQRA 3BN7A 1S49A 1UA1A 2UUCF 1KHWA 4N47A 2MKIA 3Q8RB 2IAJB 2LQ9A 1PAUB 1OY8A 1TAQA 2V67A 1VQLS 1VDHA 4LF6J 1R0AB 3A8EA 5I3PA 5D4NA 1VC6A 4DU7A 3R3TA 6AT1B 1YWXA 2DHXA 1DAXA 4K5SA 4Y2IA 2DNZA 4F4ZA 1LOUA 2VFRA 2IVYA 3MGJA 3R6GB 4DR6J 3A3NB 1FWKA 1FTRA 4NXMF 4FNHA 4OZLA 4IO1A 1OMSA 2KM8C 3M8SA 3IXQA 3DRRA 1EP4A 3BH7B 2CQ0A 4N7TA 4Y2AA 4WZQA 3KLGB 1GXUA 4OZ5A 2LU2A 3S01A 3HO1A 4M1KA 4FNIA 3CCTA 2K1RA 3F41A 4J91A 1LWFA 4ZDNA 2C2DA 3CD7A 1BE4A 2DGTA 2FGCA 3CGIA 2ZH2A 4YFUA 3JSYA 2CJ9A 2QMXA 2AEFA 2DXEA 2MMYA 5HMWA 1ZAXA 5F41A 2FZKB 4L76A 3BQ0A 1KLNA 2HYIB 2PFFB 3LAMA 2HFOA 5E3PA 1REVA 3RAXA 1V3ZA 1JJCB 1WTFA 2FHMA 2ZHAA 2VQFJ 2RVJA 2GW8A 1YQHA 4A8SA 2AZ3A 1NPKA 2HNDB 2PEBA 3TA2A 4EFAC 3DRSA 4X65F 5DGAA 1TMMA 3PYDA 1RZMA 2V50A 1S1VA 2JH3A 4LIWA 1PIEA 1N0UA 3KK1A 4NLSA 3TUZC 2JC0A 1TR0A 3CDEA 1J5EF 3DOLB 5HVHA 4C6AA 2HHPA 1Q4RA 2X3DA 1V6HA 3EVWA 3DMJB 1S7HA 1WC0A 2BVZA 2FZCB 1DJ0A 2H1YA 4W4MA 3DGVA 1HNZJ 4PXBA 1SJ4P 2W2OP 4TQSA 3NP5A 3U02A 4X4OA 3SEOA 3LWMA 5D6GA 3V6HA 1UFWA 1H98A 3E3XA 2D1CA 2RD5C 2E7WA 3W2VA 2H65B 3KLIB 2E1MC 4LR8A 4JP8A 5AE1A 2I5JA 5LT5A 2L08A 2BXJA 4C0HA 1CPZA 2LYVA 3R97A 3NNAA 4EGLA 1XIQA 4WK3A 2ZHBA 3DDIA 2XBPA 1M1HA 1U1OA 2MXYA 4LF7F 2J9EA 1NHVA 1VGYA 4Q0BB 4TY8A 3FBBA 4CM0A 2IBOA 3X3UA 2ZE2B 5C42B 1S6PA 4R5PB 3AA8A 2RU3A 2XLJA 4V19X 1RT4B 4FP9A 4LRFA 2DGSA 1N4LA 1G3OA 1LQ9A 3DDKA 4NASA 4PYDA 4QPXA 2MB0B 4DUZF 2XZDB 2HHSA 4HHUA 1HD0A 1B3TA 1KONA 4FPRA 5HLFB 1FTCA 3MOJB 1SPBP 3LP2A 2YKAA 1NJIT 1S99A 1GT8A 1RJJA 2DO0A 3LUYA 2B9XA 3BKUA 2YTCA 2NZCA 3BKTA 3FC9A 4XDCA 3H5XA 3UFCX 1K73T 1N54B 1H73A 4DQIA 2UUBF 3Q2SC 4OYIA 4IDKA 2AGPA 2UUTA 4H4KC 2JEGA 2ZUGA 2OMLA 5H9FK 1RTIA 2E5JA 3ET6B 3OJSA 2GGPB 2LVWA 3M2VB 1W2IA 1RWPB 3G4SS 1WOSA 2UUCJ 1H7XA 5FIIA 4KGMA 4URQU 1FNMA 3HHKA 2KFYA 3QJLA 1RWNB 3PM9A 6FDRA 4LFAF 2M9KA 4OYXA 1F60B 1RAFB 4C0BA 3IG1B 1R6VA 3A3PB 1MU2A 4HACB 2R7WA 1VQOS 4DPWA 2F63A 2HHVA 1C1CB 8AT1B 2VC1A 1HKAA 4ZLNA 1UETA 1TZ0A 1WG1A 5B0GA 4KIAA 3KHRA 1F0XA 2YPZA 5LSOA 4M5DA 1C0TA 1XERA 2L3MA 3BKFA 3IAS9 1FXDA 3HHDA 1AFJA 2HNYB 1P8GA 2QA2A 4GKJF 1MROA 2VQEF 4RUAA 1G4CA 4ZP6A 5K5MA 5D77A 3CMAS 1XEZA 3G6XA 1YJNS 1LW2B 4PUOB 3M8QB 3CEDA 4OX9F 4QCLA 1BHNA 1N5QA 1UL3A 3SV4A 2EBGA 5HMZA 2EFNA 3LF0A 2Q3PA 4N5SA 2DPJA 4ECWA 4JI3J 1NJWA 1C4CA 4WXWA 2VG6A 4RNMA 1CJTA 1H0HB 1T9YA 1NK7A 1HW8A 1T7PA 3DLHA 4EO6A 1F9HA 3PR5B 2W2PP 2HVEA 3KLEA 1UEUA 2HK2A 4GVBA 1GXTA 2HK3A 3KLFB 1AZSA 5B0FA 1RA6A 3MUTP 4U96A 3H98A 3C6TA 1ZA2B 4M95A 2GO9A 3RBXA 5AE2A 2VJVA 4KPCA 1VMBA 1S9GB 1CQNA 5C24B 2Z0GA 2JSXA 4O44A 4O4RA 5T14A 2OTJS 4ECXA 1URNA 2AJ2A 2XGQA 4CCHA 2FC9A 4QWCA 1PC5A 1OY9A 2IHR1 2Z2YB 3LP0B 1HNVA 1JLQA 1TL5A 5AXNA 1X4DA 3S8SA 2XSFA 1YBAA 2KXFA 1XN9A 4KSEB 3N6LA 3G6VA 4YEAA 1RT1A 1AA1B 4UOFA 2VUGA 3GIMA 2QT7A 2D3UA 5F8GA 1H2VZ 3MM5B 5EN1A 1QDUB 1HWUA 2MGZB 1RT2A 1RHRB 4I2PA 2HGLA 3I32A 1HNWF 1FJ7A 4CLKA 1YJ9S 2V4JB 3PW5A 3BB5A 2DNRA 2FY8A 4ZVUB 1R0AA 2BJ7A 1DTTA 4YB1P 3CCLS 3ULHA 3K8VA 1DTQA 3CC4S 3LPEA 3GFHA 4KFBA 3BYRA 4WCEQ 4CLSA 4ILMA 2LXIA 2OMOA 1OO0B 3GJSB 3CD0A 5C2GA 1UAWA 3CDUA 2CUYA 2J9DE 1NJYA 1IXKA 5C7PA 4QW8A 3PTWA 5HQ8A 2XMVA 2CQBA 3LQVA 2L48A 3GFZA 2CQ4A 3KFWX 1WWHA 5DQHA 1TFWA 3D0HE 3D3BJ 4CTAB 4WFAQ 3WHIA 4C8NA 2JZ5A 4X66J 4KV8B 4Z2XA 3W7BA 4I7FA 1PGZA 2HS4A 4B3MF 1LWXA 3CVKA 1WC5A 4GVLA 2DBBA 3OLBA 2RQCA 3CMES 2OLWA 2C2KB 1J27A 1KS2A 2OI2A 2K7JA 1NUEA 1HQUA 5KFDA 5HJXA 3SCIE 3P5TL 4RX6A 2CWKA 1WC6A 3ZXWA 3EZOA 5F0WA 2ZM6J 4TYBA 1JNZB 5D0HA 2B3TB 3G8SA 2VBWA 2XHCA 4CO0A 4WPAA 3DRSB 5K9FA 2OEMA 5G0RA 3B8HA 2BJ8A 5L1JA 4JV5J 2PMWA 2DH8A 2HRUA 1R7IA 5KFLA 3NMRA 3JS9A 1BMQB 2CDRB 3QRRA 1LKZA 2LDYA 3A1YG 3ELHA 2V63A 1JXEA 5GAGU 1N5YA 1C1BB 5DM7Q 1VBXA 1VRUB 3HKWA 3PKMA 1FJGF 4DR7J 2ABYA 3KJNB 1IKYB 2RQMA 3B4MA 2AEJA 4ZIVA 4Q43A 5HMXA 1UJ6A 1KBRA 3QJPA 1S6QA 2HWHA 4PXDA 1QM9A 5IM0B 1VLOA 1RBAA 3G8QA 4LVNP 1JJ2R 1KRPA 2IC3B 1I94J 2E1RA 2KKHA 5CD4H 3OL8A 3CF5Q 1S1VB 3V6DA 4HT5A 2N4CA 1IM4A 2DXDA 4FPIA 2Y9HA 3GU0A 4C3MA 1P27B 2DNHA 1WHVA 4H4OB 3QBCA 5F3TA 3BJYA 1S0OA 1GMWA 1S1UA 4C98A 1CQMA 5ETMA 3AD8C 3DRYA 2E29A 5B0EA 2V8DA 9ATCB 2ALYB 1HNIB 2YKMB 2EW9A 3CJQA 2FLLA 4Q0BA 1K44A 1YJ7A 5A8RA 2YKQA 3D6HB 3PO5A 3MCOA 1U49A 4H54A 5GADU 4FKYA 1R8HA 4CRJA 3KJVA 3QLHA 1SCJB 1NEEA 3T1HF 1YJWS 4B3SF 1BQNB 3QGIA 4K2XA 1T3OA 4DXLA 5CD4A 2ZJQQ 5F3ZA 2HQIA 2PC6A 3KMQA 1XK8A 3DLJA 1DHMA 3QO9B 4I56A 1FJCA 4U7UD 1NB2A 4DUZJ 2GHWA 4M5IA 4FDFA 1N8RT 4A48A 2B4OA 4M5HA 1OYEA 3AOAA 4CLLA 3IR6B 2AQ4A 1TL7B 3UCUP 1QVFR 3VQTA 1BQXA 3CB4A 1UVMA 5U47A 3LWLA 1AUDA 4MFBB 4YMEA 3QZ8A 1IBCB 1PSDA 2CRLA 3RAMA 1L3TA 4HI2A 4FS2A 2BKNA 2GJFA 4NLPA 2HFSA 3VWSA 4EBCA 3RR8A 1PKUA 3QGHA 5L39A 5BR8F 4ZPVR 4E2FB 3RU0A 5LXRA 4P2XA 2PI4A 4IQXA 4EBDA 2BQUA 4ZJQA 1R8AA 3EDRB 2LMIA 1RACB 2H51B 5DLGA 2KG1A 2J76E 5HQLA 2N4DA 2CXEA 3O6QA 4DG1A 1RWXB 3GSDA 3CO9A 2O67A 4BWMA 3N4WA 5BYSA 3PEHA 2KZZA 1RT6B 3RW6A 3N5FA 3C6UB 1Y4ZB 2DY9A 5DLFA 2B9WA 3MOZA 1RYRA 2W25A 2EFQA 3BEGB 3FMWA 3OR1A 1DBDA 3NEKA 4DUYJ 2MSTA 3MEGA 1X4HA 4AD6A 5ETQA 2HVZA 4CO4A 4RW9B 2KHCA 4FYDA 2HNDA 1ULRA 1R3NA 3H2UB 3MPWA 4IKAA 1VQ7S 3R1HA 2CKWA 2J5AA 1S1XA 1RISA 1S72S 4H4MB 4UOCA 1DRZA 5A8WA 2ZH9A 3GTYX 3RZAA 4K7QA 4A47A 3A3OB 4F04B 1GTHA 2VFVA 3C6TB 1HHSA 1RTZA 1YLXA 2WBRA 2ZEJA 4WP8A 2MQMA 2MKSA 5EX3A 3OHAA 1F9EB 2J6TA 3KK2B 2BMBA 1RGVA 2YWGA 1I5OB 2CNKB 2DTJA 3OXGA 3GYNA 1YBTA 4JV5F 4D3GA 3RG6A 4O3RA 4IH6A 2ZBQA 2IBKA 2W2NP 1RU2A 2KJVA 3ZZUA 3NL0A 2I6WA 3DRPB 5KG6A 4EI2A 4RUCA 4DV3J 5CZVA 2NXNA 3BGRA 2HZCA 4MK9A 4JI1F 3NOCA 4IOBA 4CLFA 2DD8S 2NUUG 4XK8C 2LA4A 3KLIA 1F1BB 2I5JB 2AYEA 1Y3KA 2HLUA 3EVOA 5B0AA 2HVIA 2FVPA 3FCWA 4P2FA 4X65J 2D41A 1PJ7A 4G1IA 2MKKA 2UZAA 1LV5A 1NSAA 4M63A 1DQAA 2KXHA 2PA8D 1TV6A 4M94A 1RAOA 3Q8UA 4USTA 3OVAA 3NBPA 3GCWP 3AJ2A 2CG4A 4KO0A 1N5TA 1S5ZA 2ZD1B 2G0JA 2EK6A 2KJWA 2VC0A 3FZ2A 4TY8B 3LPYA 2ADBA 2R2UA 2Y8YA 1FJGJ 4DL7A 3CIMA 3GG1A 4G6VB 1SVDA 1SKRA 2QV6A 2CVEA 2NZ4A 3SZ2A 2M8HA 3EZUA 2ZBIA 4B9MA 4RW7B 2LQ8A 4CTAA 3UD3P 2WW4A 2D3O1 3DM2A 3AB4B 4KV8A 1RT2B 4Y6IA 1CVJA 4K4VA 2R7TA 2LXUA 1HIYA 2CQ1A 2M52A 2MYFA 2RHSB 3O5TB 4P6QA 3E01A 5EGYA 3OL7A 1RKJA 4DR6F 2WOMA 5KFWA 4Y65A 1UZHA 5IOLA 2QO3A 2FVCA 3RAQA 5L8RC 1VBZA 2E1CA 1VBYA 4JI6J 4C3KA 4LF6F 3OTOJ 3SQOP 3AFGA 4X66F 3DN9A 1U2FA 1GEHA 4N76A 1U6ZA 2L9DA 5H1SV 3N6NA 1X31C 1PAEX 3UNYA 5KFQA 2RUGA 3HFKA 3I5AA 3EMTA 4WFXA 2KI2A 3JYTA 1M5PC 3TYTA 5GAHI 1JNRB 3UCGA 4RBUA 5BR8J 3HSDA 4DQRA 3IP0A 2DR7A 4ZITA 1FESA 4DV6F 4DX6A 2R8KA 1WC1A 2UUWA 4N8NA 5JUMA 3I56S 3FCHA 2CPEA 2WVDA 1UW9A 2ZZNA 1W2BR 4WTYA 3MAHA 1NK9A 2R8JA 2HQDA 3C8YA 2J6UA 2XS5A 1FKOB 3GV7B 4DS5A 2MHEA 1M0SA 3CJRA 1YZ6A 2B8QA 2RNEA 3IBFB 4LFAJ 1YJVA 3CJ0A 2VOPA 2XULA 5DETA 4HYKA 1JLFA 2IM1A 4JI2F 3T5HA 3J7A1 2R3VA 4OZ3A 1SL2A 4KRWA 1FERA 4C3LA 2NR0A 1T0TV 4UUXA 4NI2A 2E5LF 1PBAA 4ZPAA 4A8XA 4IR9A 1S9GA 1S6QB 4CLZA 1EKSA 5IM0A 5B7WA 2WW8A 4ZCKA 1LWCB 2W9BB 1AB8A 2YQ1A 3LTOA 1FKAF 4RWXA 4KH1B 1LFWA 2MKCA 5H9FJ 4LFBF 3QLHB 2IIHA 4LF4J 5GAGI 1QY7A 2CJQA 4KTQA 1HNVB 4DSLA 3ISZA 3N5BA 1G2EA 5D3GA 2RS8A 2XSJA 1TL3A 1SKSA 4KHPF 1H74A 4DJBA 2DRAA 4ZPWR 3U27A 1X4EA 2LECA 3T41A 1Q82T 3TZZA 4OX9J 2MGZA 4OYMA 5AXLA 4CYUA 1SQGA 3BR8A 1B7FA 3T1HJ 3BGFA 4C97A 5HSPA 1CS4A 5DGBA 4M5GA 5D4LA 4O4GB 1WSVA 2RAQA 3CCJS 4YOEA 2QA4G 1DURA 3TO8A 5KOWA 1MMDA 1YKWA 3KJVB 3HSGA 5DRKA 3R8YA 5EUHA 2ILZA 4Y34A 3UPFA 5K14B 5DDRC 3CSKA 1ZZNA 4X84A 3K17A 3QIPA 5KT5A 3NS7B 2RS2A 2F4FA 1UJ4A 1R8BA 4LF7J 3GJTB 3P49B 2VG5A 3H5UA 4I2QA 3UD4P 4DV0F 2QLBB 4J9LA 4ECTA 1M1KT 1SH0A 3EPGA 2GMLA 2G4BA 4F02A 1FA0A 4K0KJ 3ZNJ1 3R7NB 1JLBB 1M5SA 4GO7X 2DR5A 2CAJA 2JVOA 3GJQB 1B64A 1IKXA 2MHNA 3CC7S 3AHPA 2NPFA 2HHQA 2QIFA 1U2CA 1S59A 4MTPA 3UR0A 3HM9A 3G6ES 4DF4A 4CO2A 2YWWA 3FKBA 4USIA 2GMJA 4MIWA 3IGVA 1T05A 4KH0B 3MPDA 2OPQA 3D1QA 4MKAA 2OH2A 3MEEB 3W2WA 2FYXA 3JTOA 2D74B 3C66A 3EXYA 5RUBA 2CVIA 2EVZA 1KVIA 3OL6A 3LP1A 2KN4A 4B08A 4JV1A 4DBQA 2HKEA 4L6V3 1QAYA 4K4XA 2GVDB 1LFPA 2ZBPA 4CT8A 2UV8G 3MEDB 3KMSA 3HHLA 3HFVA 4J9MA 1B70B 4NPOA 2CPDA 2KDOA 1BD6A 2KYZA 3OR1B 4ECUA 2DISA 3SMZA 1JKHB 3MM9B 1FNXH 2XYGB 2H54B 2J0XA 2G2OA 1VJQA 2P6TA 5B08A 3RB0A 2AYBA 3RRGA 2OD4A 4I64A 4FF4A 1X0PA 2J8AA 4IG3B 4UOGA 4IRCA 1I1GA 2EWHA 3K5NA 2PO4A 2QSFA 3KKFA 4HI1A 1RWMB 1ZPVA 4P52A 1FE0A 2HWIA 5DG7A 4OL8A 2QLXA 2LP4A 2V8HA 4LIRA 4CLTA 5F8NA 4NLYA 5LMUF 1KFDA 4ZOSA 3L4BC 2IFXA 4P2MA 3MD1A 1CJUB 1KVKA 4PG7A 1IM6A 3MR7A 4OHYA 1OSDA 2ZH7A 5E41A 4K0KF 2EFOA 2O5DA 3BO2A 1D8YA 1M5KC 4WF9Q 1J5EJ 1NPPA 4L74A 3G71S 5HP1A 3GB0A 2HIQA 3AXMA 1BQMA 2AJ1A 3I5CA 4OYOA 4X4NA 1OPIA 1YX2A 3PJWA 4ZVFA 3QT5A 4OZ0A 4O3OA 3IRXA 3CD5A 1N34F 1LXJA 2FJEB 4YN3B 1NK0A 4I6YA 5IV4A 1XC9A 1XMOF 4QPTA 2B6AB 4DL3A 4QU6A 5DQGA 3D0IE 3K59A 3L3CA 1NNDA 2ZD1A 2CQ3A 1FDAA 2RDIA 2VF3A 1SJ1A 1C2PA 3DRXA 2VDHA 1XBWA 1YRUA 1ZPWX 2BA9A 1VK3A 2PA3A 4QIEA 5KFGA 1TK0A 3WDOA 3NWRA 5F8JA 1GMUA 2OPSA 2BX6A 3J80Y 4NXNJ 1IKVA 4JI7J 5B09A 4DL2A 1UTAA 4DL0C 2ERRA 3JSMB 3AJ1A 2KZMA 1P1LA 4WTOB 4DG1B 3GWCA 2VODA 3W3SA 4U7CA 4LSLB 3JYTB 3ENWA 1RWWB 3ENVA 2DT9A 1K9MT 5KT6A 4TNOA 1UVKA 1RWOB 1T9XA 3ILIA 1JLGB 1YJTA 1X4AA 4G1QB 5J2QB 1BWVA 4HR2A 3SCKE 1HBMB 2MZQA 3ZZZA 4DR4J 2J0QD 2WAQD 3E8OA 2VICA 3MEGB 4C8YA 1LK7A 4ZVRB 2VQEJ 3TAQA 3FBEA 3VALA 2P9CA 1VHIA 2OKQA 3CPWR 2JJ4D 1S1XB 3D54A 4Y2CA 5IQQA 2ZJRQ 1LXNA 4H4MA 1F5BA 2YH0A 3M8YA 4XAKA 4CLUA 1S0MA 1IBKJ 4WP3A 1HWJA 3GIKA 1WKLA 5J2PA 3CNQP 1S6UA 1QSSA 1U1RA 3LO3A 2OIHA 2Z30B 4U8YA 3PXGa 3IBCB 1PYSB 4DLGA 2O3DA 2YNFB 2WCXA 3KK2A 3KG0A 5HVGA 4F0MA 1RAJA 2CIMA 2DEIA 3AH6A 4UT4A 2E9TA 3SSRA 5ETSA 3GPAA 2XLIA 4I1TA 3PW4A 1V9OA 1W7WA 1D3WA 3L7PA 4DR5F 4LFCF 3QSYB 5K8PA 2WVFA 3SBMA 4DHVA 1VC5A 1NXIA 2CFXA 3VAMA 2FHOB 2IJFA 5C25B 2K1RB 1TL3B 3TJ8A 1VQ8S 4ENOA 5AE3A 3HHEA 3HPOA 1K8AT 3IR5B 2OTLS 4X4PA 1QD1A 4ZP9A 1RUSA 4DV2J 4UOHA 3M9OB 2CJYB 4HH1A 1YJRA 2RE1A 2H9ZA 4PEOA 5ITHA 2XM3A 3MM7B 1D1UA 1Q8KA 1VQKS 1S76D 2W2QP 3FFIA 4KO0B 4DR3F 2W9BA 3OW2R 2AYGA 8RUCA 4GRSA 3M6UA 1KN6A 2GIQA 5G0RB 5BYRA 1HPZB 1FVSA 3QRQA 2ZC3A 1VQYA 4UQTA 3N9UC 4LRBA 1CULB 3CCQS 3MR3A 2VONA 1HMVA 1SQFA 2IJRA 4OYPA 4E8UA 2W9CB 2FLOA 3NGUA 4LBPA 1FFGB 4OZJA 2G0CA 3VZHA 2HQGA 5KFRA 2ZH1A 5L1LA 3DI6A 2FVQA 1S1WB 2CPYA 2E66A 3I55S 2B8PA 3O1LA 1RE1B 3HVRA 4ED5A 4CYUB 4NZ6A 1AYEA 2SXLA 2LEAA 1NB7A 4A8FA 1ZTWA 3GMGA 4LT6A 5BYQA 7FD1A 1Q7YT 2FGOA 3WZ0A 3VF0B 1RT4A 5CYQB 4ZP7A 1X8DA 3SXLA 2Y0BB 4J9QA 4P7VA 3N0VA 1RT3A 1LK5A 2KRBA 3BN4A 5D78A 2JL9A 2UU9J 4P2SA 3R2DJ 3ZTSA 2R7VA 1AW0A 3ZC4A 2F9DA 2PN6A 5KFVA 1UJ5A 1TU0B 3EXCX 2UVVA 1YRXA 1X5PA 4ALZA 4DR3J 2A0FB 3ILLA 4WIQA 2F9JA 1N36J 1RDRA 1YZ7A 1LWEA 1TP7A 5KFFA 4WFNQ 3KUHA 4F3MA 1NCLA 5HQMA 4YR3A 4NXMJ 3C15B 3GIRA 4M5MA 3CDWA 3CXCR 3I0SA 3UCZP 3HLUA 1IBLF 4JI2J 1Q7LB 3KHHA 1REVB 4C48A 2A2CA 2MLXA 3PV8A 3Q8PB 2B5JB 3AY0A 4PWDB 3LOUA 4HACA 4WIIA 4N8OA 3VVTA 4O3QA 3LANA 4R0EA 2HHHJ 3V4IA 2H5EA 4OI3A 5I3UA 3PIOQ 4NLTA 4K4WA 2ZWPA 4J7CA 1GMWD 3BGUA 3K89A 4IOCQ 3HX9A 2HNYA 1RTIB 5FLXY 1H7WA 2ZJPQ 2BV3A 3OD2A 4J9PA 4JI7F 2AP6A 3MF5A 1YGYA 2CG8A 2HPUA 1Q16B 1F5AA 2CPJA 2GVDA 4OV1A 1N88A 3H0PA 1CC8A 1XQIA 3ZZOA 4NCBA 2YNHA 1XR6A 2CJBA 4RLEA 4HHHA 1WKKA 1WOPA 2BE9B 4MYTA 1RLCL 4WFYA 3T6JA 4DCPB 4C4WA 3M4XA 2YKNB 4NCGB 4LR7A 1SKUB 3AXKA 4PZVA 4C11B 5LM7E 1XR7A 3MPUB 2YPYA 1F2GA 5HP1B 2IM2A 5E3RA 3OTDA 1UWAA 1CJVB 4FYYB 5KFTA 2RRAA 1WG4A 1KDNA 4QYRA 3U1LA 5KFBA 4X2BA 1IKWA 3VAIA 4URSA 4ILLA 3PDNA 1B99A 3HHLC 4ZJOA 5KOXA 2PD1A 3CJTA 2GQ2A 2DCLA 1NDCA 4NLOA 3BS9A 4ZVTB 1QJHA 1VQMS 2HBQB 2VDIA 3C14B 2BBEA 2OUGA 4LBIA 5HL7Q 2BRLA 5C42A 4R5PA 3TZXA 1T9WA 3QJJA 2APOA 3BYPA 1Q86T 3THTA 1HNXF 4DS4A 1NDKA 2FJBB 2V2KA 2XMUA 3DU6A 3TVYA 3EVMA 2JWNA 3ZTQA 2VV5A 3FK4A 4V1Ak 4IUFA 1AZSB 1BXNA 1DARA 4U8VA 3CCVS 1WJ9A 3JSMA 4DR2F 1T9TA 3DLKB 4I2QB 2DNLA 2N3LA 3IBWA 4JI0F 1SH3A 2VASA 1X9MA 3UDEA 1PJ6A 3I6PA 1KSPA 2H4YB 3CMQA 3MCSA 4I0WA 3UE2A 2XS7A 5E3QA 2FVSA 2BJ1A 2H48B 3AOBA 3MHYA 1M5OC 4ZVPB 3PX4A 1BLUA 5J1EA 5JJBA 3NLCA 3WX8A 2CPHA 3D6TB 5HANA 1RYSA 5K8MA 1I3OB 1L3VA 2FUG9 4RNOA 1T05B 3HVTA 3H2VE 3OQ2A 4IFVA 3WIUA 2ASJA 1XMQJ 1ZZFA 4K4YA 1H38A 3PKYA 3FEXB 4TYAA 1FRXA 4M5DB 3TZWA 4B9LA 3M6XA 4CNZA 2CJXB 2DHHA 2GVZB 2EFGA 2ZBCA 5AJ3J 3LP1B 2JC1A 3CIZA 3AODA 3Q83A 5GAHU 4CNYA 4ECZA 4FVMA 1CEZA 1N36F 2AEMA 1HQUB 1JK9B 1FD2A 1FO1A 1HBNA 2MZJA 3TQEA 3M1VA 3NGKA 3R9LA 1K0TA 3CCZA 4AXJA 4KR0B 2MPUA 4WP9A 2KHDA 3DOKB 1SB6A 1RHMB 4K59A 1VQ9S 4UY8T 2AJQA 3MM9A 4BC7A 2FLNA 3V81B 4Q5VA 1T9UA 1WEZA 4WJBA 2QN6B 2L9WA 1S7IA 1CJTB 4NYPA 1J5OA 3QGGA 2CQGA 4B3OB 1KQKA 4L72B 1RTJA 4LSZB 5M2PA 2RH3A 2C2MB 4J9VA 1IKYA 1XMBA 3A12A 4UQGA 1YVFA 3CJ5A 5EWEA 2FJXA 1GTEA 3P4UB 5GMKa 4DDFA 4K2JA 1O51A 9RUBA 4ANEA 3HT0A 1FE4A 2Y1JA 1O8BA 4FBUA 4F7VA 1RT7B 2DRBA 4MKBA 2XC9A 1N33F 3IGNA 1FWPA 1V3RA 1WEXA 4HTJA 4F3QA 3T6BA 2QLJB 5ETRA 4B9NA 1YG0A 2MY7A 3ILJA 3J81U 5J1PA 3AJDA 4ATNA 3HHLD 3B82A 3GFYA 4ZMMA 2B0GA 4USKA 1KEKA 2M3DA 2UXCJ 4WBFA 1R8PA 3T19A 1ZM9A 4W98A 2F8EX 1NJZA 3BV8A 5IWAJ 3F73A 4AYBD 4YB7A 1HHTP 3FRYA 5D15A 2V4JA 4USJC 1NK6A 3GJRB 1OSCA 2J7UA 3L09A 1DTTB 1B0TA 1PBUA 2DNOA 2GAGC 3WX4A 2V2ZA 5CYQA 5LXYA 4CLYA 2I1RA 1U1QA 5KTQA 4ED1A 3OFEA 3B6BA 1WKJA 3PACA 1TUWA 3GP9A 4IR1A 1CC7A 3D6FB 1U09A 1X5OA 3SCJE 2D3OR 2VBZA 2NXEA 1MG7A 2BQRA 5FJ4A 4NX9A 3M8RA 3I82A 3GILA 2OSRA 3TRGA 1APSA 1H2TZ 3POTB 1VFJA 2O1PA 1FRHA 1VK8A 4UY85 2OPPA 1JWWA 4JI5J 4QWBA 3QAEA 3W64A 5CYJA 4ED2A 5CXTA 2YKMA 4P71A 1Y00A 3U7JA 3UQSA 2DGWA 4Y2KA 1NK8A 1D9FA 1IBKF 3RRHA 5ETOA 2DPIA 2M88A 1EAYC 3FJ2A 2W7AA 1S4EA 1JIHA 2OD6A 3QFWA 1HBMA 1HWLA 2X1FA 3DKDA 3M2UB 5KFUA 4NL5A 3T5KA 3IWXA 2Z2LA 3QWUA 2ROPA 1UCNA 3G82B 3OR2A 3VV2B 1GFWB 2QX0A 2AU0A 1RHQB 2NSCA 3RB4A 1JX4A 2YY3A 1RT5A 1U7LA 3HD1A 4LFCJ 1R31A 1N5YB 3EGVA 3R6LB 3ZZTA 3C6UA 2Z2ZA 5A6WA 5IXUA 5EWFA 2YX7A 4MFBA 4EK2A 5D0RA 1KOHA 2M4MA 2PSZA 2K06A 2YNHB 4PCQA 3TR5A 5I4MA 2YNFA 1B0VA 1K1SA 4NEZA 1G7CB 5CQGA 3LGHA 2G2YA 1F2HA 4NLGA 3DLLQ 3SIPB 2A6MA 1JMTA 5AXKA 1UVLA 1VYAA 4IFYB 5I3UB 2HFUA 3D7SB 4E98A 3HMJG 4NA1A 4WFBQ 5ETTA 2DNPA 5B0DA 2K3KA 2HW3A 2WVBA 4RWWA 3W65A 4F0HA 3EGNA 5J2MB 4DR4F 5GMEA 2IM3A 1ZBTA 3R5BA 3R5AA 1PJ5A 1X9SA 2JEJA 4B3RJ 2C42A 4TU7A 4DX5A 2HZAA 1NRKA 2PGCA 1N6QB 1R0CB 2XNQA 3SQGB 2K2PA 2GHPA 7AT1B 1S97A 2BJEA 2PMZD 1BQNA 1HBUA 4OV6A 1ZH5A 1U8SA 4ZLLA 3P5BP 4UUWA 3D6MB 3TUPA 3AQOA 2P8IA 3TVZA 3MUMP 1I94F 4C8OA 1AXQA 1Q5VA 1HQEB 2A10A 3GIJA 1VQ5S 1EARA 5M2UA 5F9NA 2CZ9A 5SZTA 2IA6A 2M2BA 5F9LA 3MAQA 1X4BA 2KXNB 1S1TA 2V34A 3BZQA 3H8YA 3JSBA 5HI7A 2DCUB 2GV1A 3SI8A 4GKKJ 4NLXA 3T9NA 1TL1A 2BYCA 4ED8A 1HA1A 1RT3B 2HBYB 2VH7A 4Q7AA 2Y1RI 2CQIA 3N79A 1DLOA 1CJKB 3IC1A 2XMMA 2VKZG 1NDLA 2DR6A 4XDDA 5DS7A 2B4UA 5AT1B 4C2MA 1RU1A 1ZS6A 3UDLA 4ZLPA 3C3LA 4YHHF 2XYHB 3CJ3A 4QJVA 5FD1A 4K4TA 3DLGA 3KDOA 2LDIA 5D4PA 2JEFA 3QRPA 2GCFA 2WOMB 3CJ4A 4JI1J 3MDFA 2R7OA 2W4CA 3TP2A 3B4DA 4YUDA 2MJNA 1RTDA 4B3MJ 3GQCA 5HVFA 4F8RA 5A2QY 2WSCC 3SSQA 2DR8A 2KRRA 5HBMB 4RW8B 3CCWA 2Q1LA 4R8UA 2IJNA 1ACMB 3ICLA 3G6YA 3M30B 5H9EK 1S9EA 2FHJD 2OP5A 3BPSP 4KYZA 3AD9C 3GCXP 4QR2A 4MAKA 5LMNF 3ETMA 3V4IB 1MMLA 1FRIA 2C3PA 4FXVA 3VGTA 4DR5J 3N01A 4RUBA 4B3RF 4DMZA 1D9DA 2IRYA 3US5A 2JDJA 4ICLB 3Q89A 4TLQA 3UO0A 4Y00A 2E1PA 1MWZA 4M8LA 4F2RA 2E5GA 3P8BB 2UXBJ 4X64J 4ETZA 1F5CA 2V4RA 2YNGA 4NMLA 2K3IA 2AGOA 5GVQA 4ANDA 1T02A 1FD8A 3Q8SB 1FCAA 1LEOA 2A2DA 3D3CJ 4LRDA 3RGIA 5HN0A 2UXCF 1FRKA 3TQ1A 1EP4B 4X64F 1VRQC 1ZAVA 2GFFA 3OFFA 5KFAA 1WF2A 3ZZYA 1QSYA 4DPYA 2KO1A 2X51A 3CJKA 1H3DA 2AF6A 3UD5A 4CIOA 1RTJB 5L46A 5KFEA 1MW7A 4FN5A 2KTQA 3JTNA 2HFNA 1IKWB 1E6YA 5KFJA 3RBEA 2KFZA 2BJ3A 4QIFA 1S77D 4OLOA 5KFIA 1RWKB 2P5VA 3R7SB 2HNZB 1JLAA 1WF0A 4HLBA 5BXIA 4RU2A 4LJMA 2XS2A 2GQQA 4PPZA 4J9UE 1NKEA 2RKIB 1MMNA 3R5CA 4RU9A 1RA7A 4KGVB 5LL6d 1EB0A 2ZVIA 3K2YA 2YWHA 4XO0A 2VFSA 3ZTPA 3W9IA 5IT0A 4ZPTR 3QSIA 2R8IA 1RLDA 2AHOB 2IMWP 1WORA 3GR1A 4Z7CA 2W7PA 3RW7A 1FX4A 1KKHA 2RILA 1EETB 2Y0SD 2QRRA 2JOQA 4RW7A 3V6KA 3PIPQ 4IG0B 3MM6B 4LF9F 2CNLB 3BF4A 3ADAC 4P72A 4Q2MA 5DDPC 3K5LA 2R7RA 1VS3A 1FFSB 1U1NA 4ECSA 2XYPB 2B7BB 2U1AA 3L95X 5KG7A 5C5JA 2YQ0A 4B3SJ 3M05A 3D0GE 2X3GA 3M6VA 4G3IA 4IRDA 2NLWA 3CDAA 3IWLA 5AJ3F 2BUNA 4LBHA 2N82B 3BQ1A 1U1KA 2RF2B 1B7YB 5CCMA 1GAOA 2HBRB 1NH8A 2QTWA 2YKPA 3A8KA 4CDIA 1YHQS 1M1GA 5A8KB 1GQEA 1SIWB 4ZVSB 2OAUA 3OR2B 3BSAA 3I96A 4ZVHA 2AZ1A 3LA0A 1KQFB 4F4XA 4RW6A 4L73A 3V6JA 1HNXJ 1WACA 3VCDA 1RAAB 4C7QA 2JNJA 3KG1A 4LVOP 3PY8A 1RTHA 2IAJA 2MKHA 3RB3A 3ONQA 4LREA 1P6TA 3EDQB 3GV8B 3AAWB 3EGWB 4FXWA 3A13A 3K8WA 1U26A 2ZOGA 2V8VA 3TEGA 2FQQB 4JI0J 3FMBA 3EE3A 3PHEA 4KGKA 5K14A 2EKYA 1NDPA 5JVGQ 1KLMB 1U1MA 3K7RA 4U7UK 1JJ4A 1Q8IA 1JLEB 1VISA 2XWXA 3W61A 3G82A 1MN7A 4JI6F 1BWEA 3F0NA 4WYLA 5HROA 5B0BA 2RT3A 1VOMA 5A0YA 3NG8A 4CO1A 2JVRA 4C8ZA 1RT5B 2RQ4A 1WHWA 1AT1B 1URRA 4HTIA 3A8JA 4JOUA 2V4QA 3C46A 2H5IB 1Y3JA 2F40A 3AB2B 2MY8A 3MEDA 1IR0A 1KTVA 3IM9A 4EZ6A 4F4WA 1WHXA 1FK9A 2DHGA 1R89A 2R4FA 3OFHA 2MJUA 1VQ6S 5I42B 3M8QA 1S12A 2CQ2A 4A8MP 1FDNA 4MMOA 1WD6A 2A18A 2J9DA 3MR6A 3G96A 3MMCB 1Y11A 1FX2A 2Y1LB 3HZGA 1B4SA 5GAEU 1NK5A 5CCLA 3KLEB 5LMUJ 1NJXA 4LF5J 3KK1B 1HWIA 2FTRA 1WHYA 2HIYA 3W5ZA 5DG9A 1HR0J 1HI8A 2HHTA 1TKXA 1UFLA 3DLBA 3DDNA 2Q43A 4MK8A 4U6PA 4C0OC 4DFJA 2AV5A 3EM1A 4Q8EA 2F7VA 2LXFA 3D4JA 1NHUA 2B43A 2D3ZA 3QT8A 3TW0A 4I67A 3D1OA 4ES1A 2VG7A 3BSNA 2BM1A 2JX2A 4O4GA 2UXDF 1RAHB 5J2NA 2B4VA 4QR1A 2BZ2A 2X1BA 3DOMB 4ZHRB 1OIAA 4DR1F 2DNGA 2PT0A 2GNKA 3CDBA 3IAM9 2F4VF 1TL1B 4ETXA 3OSPA 1SJQA 4ZP8A 5KG0A 3W2VB 3NGRA 2XO6A 2NXJA 3L9ZA 3FNNA 3J7YI 3ZZPA 3M8PA 2ILYA 3RBZA 2D9PA 1H6KX 2H3EB 2DY1A 3PFEA 4I4BA 2X1AA 1F3FA 3KDNA 3POTA 3UVJA 1RB0A 4U67Q 5DDOC 2BJDA 2DNMA 3HJVA 3V4MA 4KGXB 2YKOA 3ILOA 4NRTA 3MD3A 4JBCA 2CZVC 2CQHA 3NY0A 5CZXA 3EX7B 4MK7A 5DM6Q 1TAUA 4DR2J 3MECA 1WDTA 2HFZA 4DX8H 2VA3A 1RQ0A 1RWUA 3GR0A 1JLQB 3BREA 4X4QA 2R9LA 1U4BA 5L1IA 3OHBA 4RW8A 1U6BA 3N28A 2VZ9A 2AD9A 2QYCA 1MU2B 5D8HB 2OJ3A 3G9CA 3M2UA 3U1NA 1CJKA 3P6YC 1C1CA 1T03B 3K57A 3AQPA 3TUIC 2XY5A 4A8YA 2HSEB 1VCTA 2BABA 4DL4A 4QR0A 1NAQA 2B6AA 4OYAA 4LFBJ 2ZH8A 2Q6CA 5KFHA 3PZPA 3IWNC 2LQJA 2XY6A 1MWQA 2RB7A 1DQ8A 5ETKA 5IFMA 2VU5A 2VKRA 3I0RB 1DTQB 1SUQB 2BW7A 3J7AN 4AUKA 3W9JA 5IQ6A 2I38A 4B9UA 5HBMA 4R8UB 2R7XA 3KUGA 1RP5A 1ICEB 2FJDB 1E6VA 2HS0A 2J0WA 2QC3A 4FYWB 3Q8YA 3TA0A 1TTHB 1JB0C 4H4KA 2BOAA 1BGXT 1GK8A 1QUVA 2AW0A 2Z57B 1XR5A 3CJKB 4DN9A 4QIGA 1WI8A 2D69A 2LEBA 1VRUA 2YH1A 3KLFA 2FVRA 3ZZRA 4A8WA 1T94A 2D9OA 1E6YB 2W1BA 1JXLA 1R43A 1V3SA 3FBFA 1QAIA 3L7OA 3UN2A 3IN5A 2V94A 2V8GA 4CM2A 4LMZA 2J9CA 4L75A 2MZTA 5IS2A 2H4WB 3ITHB 3TZYA 1KQGB 2IPOB 4F4YA 4ED7A 3JQJA 2HHUA 2C1EB 1N6QA 2OEJA 4A4JA 3LP0A 1M5HA 2VPZB 3VR1A 2UVRA 3VGUA 3MAAA 4QWDA 5F8IA 4ID8A 2MKYA 3QIDA 2LU1A 3GSIA 3VZIA 1IJFB 4ZVEA 5LSRA 3T9ZA 1ROFA 1FJEB 1QLNA 2EFPA 4ZK7M 2XO7A 2M0GB 2RQKA 2J7KA 3HXMA 4C8KA 1FRJA 5T41A 3J7ZT 2EC0A 2BE2A 1XNRJ 2FJWA 2HRTA 4O44B 2BACA 3OFGA 4OJGA 4CWBA 1QAXA 3CTRA 3BBBA 4GC6A 2VB6A 3AOCA 4NXNF 1GX6A 4WE1B 2NPIA 4KFBB 2KG0A 5HATA 1S1TB 2QJ3A 1QE1A 4RPFA 1CULA 2POKA 2AJ4A 3C19A 4JI8J 3MTJA 1Y9OA 2YWKA 5C25A 1Z1ZA 3MM8B 1SBRA 3SYZA 4DCOB 3QO9A 1F6TA 4Y0FA 2UXBF 1S1WA 1T3NA 1QTMA 1U0HB 4I2PB 2I0XA 4RR5A 3T5JA 2DGXA 1D8ZA 5DJBA 4QYZK 3E51A 2B4PA 3IO1A 1S0VA 5H9EJ 2XY7A 2HQCA 4OZNA 4P10A 1UEKA 4AFFA 5LSLA 2VL1A 4NLRA 1NMEB 5IT9U 1HPZA 1KHVA 4LUBA 4NEYA 2RJZA 2YWFA 3LH2S 4G1QA 5J2QA 1RSCA 2XMTA 4QQBA 3OJUA 4ZJLA 2RF2A 2DJWA 1HNZF 3KK3B 4NE9C 4R0JA 1SI9A 4RL1A 2BJ9A 4EMDA 5L1KA 2WONA 3M30A 2AJ0A 2XMKA 4UW2A 2UP1A 3HK2A 1IR2A 2IMOA 2AWZA 2UV8A 4J9RA 2R2TA 1FDDA 2WBMA 4J37A 2NYHA 4PG4A 2Q66A 4UTGA 2PFDA 3MFHA 2R2RA 2GAHC 1BC6A 1RT6A 2CYYA 4N56A 1C1BA 5KG2A 2UU9F 2G13A 3KOAA 5J2PB 4Y2MA 2XI2A 4RKUC 3VAKA 4OX7A 3VAGA 1FK9B 2C2RA 5EX0A 4QBUA 2NXCA 3AT1B 2HG4A 1C4AA 2DNNA 4PQUB 1B0PA 1XNQF 2DNQA 2FJVA 4DOZA 2MLZA 1SJRA 3V5RA 2B9EA 4MH8A 4IQMA 1MSWD 3V6DB 4AT1B 4A8KA 1HYSB 2CWXA 2MQLA 4IYQA 1NPRA 2W2MP 1IVZA 1C0UA 1NU4A 4F25A 2GX8A 5HJYA 2AMCB 4NA2A 2ASDA 2BDPA 4WKYA 1RAGB 1TL4A 3K5OA 3UNGC 4JB8B 2ZM6F 4J9KA 4FS1A 1Q5YA 5EHHA 3KXDA 4ED4A 2ZWOA 4ECVA 2QA1A 1XNQJ 4K5RA 2B5JA 3FFIB 1CG2A 3CJSA 4QZVB 3M32A 1UVIA 3DOMA 1RBOB 5KFSA 4BC9A 4DPTA 2KH9A 1IBMF 2HWTA 4ZCMA 2VHGA 4JYAF 2RIJA 3T1AA 3IMQJ 2HMIB 4I6AA 1HBOB 5DQIA 3RB6A 3EGZA 3M2RA 3QMQA 3FRZA 3CT9A 2BW2A 3H5YA 4FKXA 2R2SA 1FDBA 2P2CB 4CLWA 3Q23A 1DQ9A 3M8PB 1IBMJ 4F0KA 1U0SA 4ERDA 2VOOA 1S1UB 2QFJA 4N41A 4O3SA 3D68A 4NA3A 3SCLE 1U1PA 1KVJA 2CZ4A 3D67A 1P1TA 3CULA 3OXLA 2QL5B 3Q86A 4L3NA 2DB1A 2DGOA 2JFKA 2ZUAA 3I4HX 1M90T 1SV5B 5KFOA 3G2XA 4DSEA 3H40A 5E5NA 4C11A 2X7IA 1RI7A 2V6AA 2RMLA 2XEXA 1T9VA 3FSXA 3H5SA 3BH6B 4BHQA 5A6PA 2W9AA 3GYXB 1FF2A 2OELA 3MMBA 1IQTA 2HAIA 4NYZA 1P9YA 3W8GA 5F8LA 1VQSA 3UVJB 3OUYB 4RW6B 2WK4A 2BKOA 4USWA 2WVEA 3NBPB 5CH7B 4X62J 1SC6A 1TL7A 1TVRB 5CYMA 3C15A 3O44A 5E3CA 2RDJA 1O0PA 2IYIA 4CH1A 2W8LA 1SUQA 1RHKB 4MT1A 2GIRA 3MZIA 1XMQF 3J7Z5 2V69A 1YDLA 3QPIA 4Q2LA 4BWJA 3OV7A 4WYWA 4DL6A 4QYZJ 5E0OA 1GMVA 3VGVA 4TU8A 3THVA 2C3UA 3I5BA 4NMXA 3BO3A 2A6OA 2HAFA 2E5HA 4TLRA 1T03A 3TUJC 1D09B 1JLEA 3PHTA 3DM2B 2F5GA 3PG9A 3PCOB 4C8MA 3ZTRA 4CLPA 2P9GA 2YBVA 1BY9A 3Q24A 4ZS6A 2MQPA 4KGZB 4P75A 4JI3F 2GC8A 3K5PA 3OTEA 3I0RA 4OFZA 2DRDA 3HVAA 1IWGA 4F26A 2AT1B 3CCMS 3H90A 2UUBJ 1FHTA 2XGPA 2NUHA 1LW0B 2MEWA 2QLFB 4FVCA 4DR7F 5E2QA 3HDSA 2ASLA 4LF9J 2LQ5A 2CQCA 1YSJA 2HFVA 2OEKA 3DRPA 4RW9A 4RNFA 3BDPA 4V19J 2NQPA 2C2ZB 4OYBA 4AL5A 2ZH6A 2R8GA 1OPZA 1VLYA 3BSCA 3S6EA 1J5OB 2PDAA 1CJVA 1R27B 4B3OA 3MAAB 3MMJA 1I6JA 4M5KA 4OYZA 3SFUA 1SJFA 2P6SA 3SSSA 5IC4B 2BANA 3MXHP 5EWGA 1TKXB 3JAMU 2ZH5A 4DV5J 4XPEA 1Q81T 2BE2B 1FWLA 5FDLA 4FZVA 4DEZA 3H4DA 4OZ1A 3W60A 3VAHA 3T3FA 3T1YJ 3MR2A 1LWCA 4EO8A 2VG7B 5KFYA 3Q0AA 2ADCA 1RHUB 3I9ZA 1HLWA 4RBTA 3MMAB 4N77A 1QE1B 4YQWA 1TELA 4J9SA 1KD1T 2AJFE 4C8LA 4TXSA 3TX0A 4FYXB 2YVSA 2KT2A 4BBYA 5B0CA 2BM0A 1JLFB 3NRBA 3BQ2A 5M2RA 4CT9A 4GMKA 2M70A 4PKDB 1DFDA 4G65A 4YDDB 2B51A 4WXOA 3K58A 3E01B 2EG2A 3M6WA 1VRTB 5A76A 2QG9B 4PWWA 4YDXA 1ZAWA 4DL5A 1RAIB 1AFIA 1VBKA 3SDEB 4BDPA 3LALA 3I4PA 4JI4J 1ZM4A 2HQ3A 4NLWA 2ROEA 4KY3A 4DLEA 2G1DA 4DWIA 1MN9A 2XSJB 3O3LA 1CLFA 2QMUB 4ZN1A 3DRRB 3QQCD 3CJ2A 4DQPA 2XCPA 2GJIA 1Q78A 2CPFA 1QVGR 5J1NA 5KFNA 3CCRS 1UA0A 2UUAF 4MIAA 5JMNA 2HZVA 4GKKF 3RYLA 2Q6BA 4YY3J 4ECYA 5KFMA 1HI0P 2L41A 1S79A 2HS3A 4NYOA 1YIJS 1S6PB 4JYAJ 5F0UA 1IKXB 1WI6A 3P3DA 2GJ2A 4AL6A 2BKPA 1HR0F 3OL9A 1YJUA 3C16A 3M1VB 5MLCV 4KHPJ 4KJIA 5IT4A 4YB5A 4KBIA 3TVKA 4LF8J 4J9OA 4PQUA 3KK3A 2ZZMA 2B9YA 3UN3A 3G8TA 3WC0A 3IR7B 4HVZA 3O8WA 4AE5A 2VPYB 4FBTA 4NLDA 4PAAA 4EYHB 3OVBA 2HLTA 3S1TA 3OLAA 4CO5A 2EC2A 2KVIA 4B9TA 1TUGB 3H2LA 1GH8A 3CJ8A 1LWFB 1Q0NA 4YS2A 3CO0P 3EWGA 1C0UB 1WC4A 3PJ9A 1JLBA 1O5JA 2DXFA 3OTCA 3W1YC 4A46A 3D1HA 2MZSA 2XCAA 2VBXA 2WHOA 3DMJA 4S0MA 4LSNB 5JVHQ 1N5SA 2ZKUA 2V2VA 3HD2A 3PRBA 2ACYA 3Q8VA 1UEVA 2QZ8A 3M7VA 1FKPA 4X4UA 4CI0B 4W92B 2CJKA 4F4AA 2HBZB 3OXFA 1IQZA 5KT3A 2EI5A 2DGUA 4IFYA 1ELOA 1RKIA 2OFHX 3UN5A 4ES3A 1C0TB 1QUPA 1OY6A 5D3GB 1SIZA 2E1AA 4RNHA 4ZPBA 1QTNB 4F2SA 2CQDA 2R8HA 1ZOTA 4DV6J 4KKOA 1OYDA 3LW5C 2BEFA 3TAMA 1MROB 4I69A 4JI8F 4DN0A 3JXOA 2Y1IA 3JSRA 1NBEB 1F3VA 2ZHOA 5C2CA 4LF4F 4IOAQ 1U45A 3G86A 1PG5B 4DV2F 1PCAA 2ZKTA 5L9NA 2V8PA 4XPCA 4LF2A 1SV5A 3PRVA 1Z4UA 1HARA 3V2UC 4OI2A 2E5LJ 4O0IA 1TMJA 1VR6A 3LAKA 3FZBA 4M5LA 2FJAB 4USMA 4LF5F 3NMAA 4X4TA 2KL8A 3NS5A 2EFVA 5ETVA 1TK8A 1IWAA 2PIIA 5G4DA 4YP3A 4GVBB 4EUVA 3VQSA 2Z2MA 5GADI 2NCKL 4F4KA 3IFEA 4PYAA 2F8HA 3OUYA 3ISNC 3IRWP 4DUYF 4BCAA 4Q44A 4Q8FA 3VAJA 4K4UA 3GZ7A 4W90B 2M8DB 3ET6A 1TVRA 1X4CA 2FPHX 4ZIWA 3ZO7A 4EWTA 3NKYA 2ZE2A 2HHHF 4K4ZA 1X4GA 4R25A 1XWLA 3X1LB 4KE5A 3AD7C 2WB1D 4JI5F 2C2OB 2VD3A 2VPWB 1BQMB 2GMHA 3FEYB 4YR2A 4DV4J 3MEKA 3MI7X 4NCAA 1XNRF 1NZAA 1SXLA 5HLFA 2RSQA 1O6XA 2EK1A 2COLA 2PMHA 5I3QA 4ZCLA 2C22A 3IRXB 2WONB 1IBLJ 4OHWA 1YBUA 1NZ8A 1NH7A 3I31A 2ZNZA 4ID5B 3GONA 3NWGA 5K20B 1CSJA 1Q1KA 2K8GA 4RJVA 3M8WA 4IDKB 1U48A 1ZA1B 2B7CB 2KM8B 3R5DA 5CABA 2C2EA 2LEPA 4USUA 3ZNUA 1ZTTA 1WELA 3MCMA 4PXEA 3NGSA 4ED0A 2C2NA 5KFZA 2ZNYA 1NO8A 1LW0A 3DU5A 1X60A 2EBEA 1QAJA 2F3JA 1IKVB 2EG1A 2DEJA 3EICA 2CQPA 1VIOA 1QSLA 4Y3CA 3MURP 1RXOB 3L7UA 4NRUA 2KFNA 3TOQA 2QGFB 2AKWB 3PRDA 4LRCA 2NSBA 2V9KA 2MQQA 4QWEA 2QEXS 4B9SA 4QIVA 1HYSA 1SKWA 2FLPA 1TFYA 3IS9B 1Z2ZA 2CNNB 4ZVQB 1VQPS 5GMDA 4KPYA 2IRUA 2FC8A 1UVJA 5FDLB 2LKZA 5D4OA 1SH2A 1CJUA 1DY3A 2Q79A 4URGA 3RBDA 3ENQA 2UVUA 1FXLA 3EUNA 1GXLA 4RW4A 2I8EA 4EYIB 1S9EB 1R0BG 4OI1A 1YI2S 2ZH4A 4OIXA 4OJ3A 3HKZD 3NS6A 3PJXA 1REGX 3HSJA 3HFZB 3CC2S 1PO6A 1UWBA 1V5IB 4DQSA 3E2EA 2HMIA 2MLYA 4IG3A 3I87A 4OJ1A 3NCQA 4P74A 4RUHA 2YQ3A 3DLEB 3HULA 1YITS 1RT1B 3J80U 2DH9A 3MWBA 2ZITA 5KG4A 3U1MA 2BANB 4TY9A 3RJMB 3W62A 1VQ4S 2J6SA 2BE7D 3HCXA 3KG4A 3TEHB 2NREA 3GG0A 1R6YA 2HVHA 4DV3F 3J81j 2B56A 2OPRA 1T95A 3VVUA 2CNOB 2CDQA 3CUNA 2R7UA 1VRTA 1JLAB 1TUVA 2VFTA 4LF1A 4WU3A 5KFKA 3HSZA 1ZM3A 1PYOB 2M5YA 4DSIA 1FXRA 4O23A 4PABA 2DGQA 5L9XA 2GHVC 1HFEL 1SL1A 4ELUA 4MYUA 1K47A 2HQFA 4F50A 1TK5A 3QYYA 2NS1B 1XTZA 3MMBB 4I6WA 2Y3YA 4FXDA 1UFKA 2IVMA 3UDCA 3JAMY 2QL7B 2VBYA 2DYAA 2QMWA 4G1PA 3MM6A 1Q8LA 3KLHB 1HNIA 3PW2A 3KNGA
chains in the Genus database with same CATH topology
4DFMA 1YRTA 1J2VA 4CH0S 5A8RB 1UW4A 4PWUA 4NWBA 5CYMB 3FSIA 1X0FA 3KLVA 2HRYA 4PRFA 2KT3A 1K1QA 4CH7A 2LLZA 1RTDB 5MAOA 2ALZA 2ZOFA 4I68A 1DZ5A 1HMVB 1FEEA 2OSQA 3DHWC 2W9CA 3TARA 2XZWA 1OQ6A 5A8KA 2JEIA 2RU9A 3DXSX 4NLQA 3PW7A 3N6MA 2MZRA 4IG0A 4DPOA 1N56A 4I7FB 1RTHB 2MQNA 3PVXA 4JV2A 4DV1F 4XIUA 5IZHA 4LSNA 2JLFA 1S9FA 2AYMA 1KR4A 2DIUA 2LQBA 1WTBA 4PWDA 2ASYA 5SUHA 1WG5A 2GO8A 4B9VA 2IC3A 1P9QC 2DIVA 3EYZA 4RBVA 3RRKA 3GV5B 2MSSA 2KU7A 5A0YB 3NAHA 2V9WA 4H4OA 4HL9A 3RTVA 3TAMB 1U25A 2YNIB 4DSJA 1G1XA 2W4DA 1FVQA 1WEYA 3Q22A 5I42A 4HHJA 3M9NB 2RRBA 3MR5A 2DGVA 1VHFA 3MPYA 2YKNA 1D9AA 2NYIA 3DXBA 5KG5A 1OQ3A 2MDAA 3MMAA 5IWAF 4F67A 3H25A 1Y5NB 3CCES 2QA4S 4U9RA 2E5IA 4OHZA 3WC2A 2DR9A 2DHSA 2RRNA 3I9V9 2FD2A 4RZRA 4A8OA 4ECRA 3KTQA 3PFOA 4OLPA 3R1LA 4CZCA 1JLCB 4Z37A 1FNOA 2LA6A 1KFSA 3DI6B 4ELVA 5T7LA 4B17A 1NK4A 1L5UA 3DCAA 3HZEA 2EPIA 3LGNA 4F3OA 4IQXA 3AA9A 2E7XA 4Q45A 4K50A 4EEYA 4OI6A 3DYAB 6FD1A 4X62F 2R7SA 2LCWA 2V5HG 4OX6A 4OHXA 3MMCA 5G0RA 2FDNA 1Z2LA 2M7SA 2F8MA 3GE9A 3MTKA 3TI0A 3C2PA 4DF8A 5E3AA 4RNNA 3HJFA 3PX6A 2BQ3A 2IA0A 4ID5A 2AX0A 3VAFA 4IRKA 1VQNS 1N32F 1D0EA 1TV6B 1LWEB 3FEZA 3FVYA 1M5VC 2E44A 2FHKA 4PQAA 4ILRA 1SL0A 4ZHRA 1PC4A 4QW9A 4IH5A 1VIXA 4OQJA 5KG3A 5BJRA 2ZDOA 4HH0A 5KFPA 3OBIA 4OI0A 3FQLA 1TKTA 3GFXA 3LGMA 3O2IA 1KLMA 2QE5A 3HT3A 3ZFVA 2J0SD 2DHAA 1U2RA 3HF5A 3UI3A 3DLKA 5HROB 4P7TA 4O3NA 4A8QA 1Q8BA 5A8WB 4QWAA 5THWA 2U2FA 5LJ3Y 4ED3A 2KB2A 4PG6A 4ED6A 3I0SB 1HBNB 1L3UA 1OS5A 3PO4A 4K4SA 1KNZA 3P96A 3TX8A 4YY3F 3JB9k 1VC0A 1UKUA 4RW4B 4E0DA 1FKPB 4PG5A 2ZFHA 3H20A 4J5OA 3KLGA 3HVTB 3QGPA 2A3JA 4O3PA 2FHJA 3OPKA 3NGDA 2BOPA 3SV3A 3DLEA 4LQ3A 3TANA 2VQFF 3IS9A 3DNCA 2E9RX 4KKOB 3NCPA 4TKTA 4C9DA 2E9ZA 5KFCA 4GC7A 3K0JA 1VJWA 2OPRB 4KQZA 4X4VA 4AL7A 1T8EA 4NZ7A 2G9OA 1VI7A 2I9SA 1UMJA 5HMYA 3HI9A 4MKYA 5J2NB