3JSMB

K65r mutant hiv-1 reverse transcriptase cross-linked to ds-dna and complexed with tenofovir-diphosphate as the incoming nucleotide substrate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
426
structure length
413
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna complex
molecule keywords DNA (5'-D(*A*TP*GP*GP*TP*CP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP
publication title Structural basis for the role of the K65r mutation in HIV-1 reverse transcriptase polymerization, excision antagonism, and tenofovir resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 88
structure length 413
sequence length 426
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3jsmB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jsmB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jsmB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jsmB03
5KT3A 1LW0A 4K4SA 2FLNA 4IFVB 4RW8B 4R5PB 4WYLA 2R8KA 4J9LA 2C22A 4ZP6A 3VQSA 4MFBB 2W9CA 1TL3B 3QLHA 4O3SA 3G6YA 4NLQA 4NLTA 4ECUA 1RT2A 1KHVA 1FKOB 2B6AA 3H59A 3GV8B 2WONB 4Y2CA 4IKAA 3KLEB 1RT6B 2F8EX 4QPXA 3T5LA 4MK7A 2HNYB 5KFCA 2UUWA 4ZHRB 4K4TA 1HNIB 4Q8FA 4I2QA 5HBMA 3TVKA 3MR2A 5KFUA 3IN5A 4IFYB 4J9SA 3KMSA 5DQIA 2YNHA 3QIPA 1JLAB 2FLPA 4NLUA 5C25B 3V81B 4KE5A 4J9QA 3RB4A 1UWBA 3KK1A 1N4LA 4ED6A 5T14A 3BGRA 2JEFA 4Q45A 4EO6A 3C6UA 2IAJA 1RTJA 1SH2A 3CJ2A 3ITHA 4WE1A 4TXSA 3QIDA 4WFXA 3QZ8A 3GIJA 2FVRA 1S10A 2IJNA 3DMJA 3KLIA 4RNOA 3EZUA 1IKVB 2IM3A 4R8UB 5L1IA 2HMIB 3CJ4A 3M9OB 1CSJA 3T5KA 1RYRA 2DPJA 1S6PB 2B5JB 3LP2B 4RW4B 4RW7B 1RT3B 3Q8RB 1N6QB 4PUOB 3JYTA 2OPQB 4RW9A 3FRZA 5F8JA 4DG1B 4F50A 2XWYA 1ZTTA 4KBIA 4TY9A 3MR3A 2D3UA 3RBDA 1JIHA 1SUQB 4TN2A 1REVA 2FVPA 1N56A 1HYSA 4J9KA 4O4GA 5KFPA 1JLCB 4J9OA 1LWEB 1S9EB 4ICLB 4K4UA 1U09A 4YR3A 4M94A 1TKZB 5DGAA 4IFVA 4R5PA 5HROA 1NHUA 2BRLA 2YNFB 5KFDA 2HNZA 2J6TA 2ILZA 4H4OB 1TL3A 3DRRB 5DG8A 3UPFA 3BQ0A 4K4ZA 2IC3B 1FKOA 5CYMB 1S9GA 2FVSA 3CIZA 3N6MA 5KG3A 5C24A 3D5MA 2WTFA 1S6QB 3KLEA 1RT6A 1JLGB 2VA2A 1VRTB 2HNYA 3M8PA 4ZPDA 3G86A 2R2SA 1HNIA 3CWJA 5KFBA 3PR4A 3GILA 3CDUA 1T3NA 1JLAA 2UVRA 3M9MB 4ECZA 2C2DA 5C25A 1S4FA 3V81A 2GIRA 3I5BA 4YQWA 3H40A 1S1VA 2RKIB 1S48A 3NBPB 4KV8B 4JV2A 2D3ZA 4ED3A 3G6XA 3KLFA 2J6SA 4YR2A 2W8KA 4JV1A 4WFYA 2FVCA 1S0NA 2FLLA 3BSAA 4WZQA 2BQ3A 1QE1A 1IKVA 4KKOB 4R8UA 2HMIA 5EWFA 4NLDA 4F4XA 3MFHA 2B5JA 3LP2A 1C0UA 4RW7A 3OHBA 1N5YB 4ECSA 2AGQA 1N6QA 4PUOA 1S49A 2OPQA 5I42B 4DG1A 3CDWA 1I6JA 4ED8A 1SUQA 1YVFA 4YP3A 4DL5A 3QGGA 2FJXA 3KLHB 4Y3CA 1JLCA 2B43A 2OPRB 1LWEA 1S9EA 2WB4A 3KHHA 3OL9A 4EBCA 2RF2B 3PHEA 4ED1A 4J9PA 1TKZA 5F8LA 3CDEA 3KLGB 1FK9B 1Z4UA 2XI2A 1S9FA 4IR9A 4WZMA 3DYAB 4H4OA 4K4XA 1RTIB 3E01B 1TQLA 1S1TB 5KFTA 3SFGA 2IC3A 4IG0A 2AQ4A 1C1BB 2XC9A 4XPCA 5KFIA 3BQ2A 4ECQA 1S6QA 5EWGA 3QO9B 2R2UA 4O3NA 4QWDA 3KHGA 1SV5B 1VRUB 2BANA 3LP0B 5HP1A 4EBEA 1JLQB 1DTQB 3V4IA 1IM4A 3FQKA 3H5UA 5KT5A 4RNNA 3H5XA 2FVQA 3CO9A 3UDLA 5DG7A 4O4RA 2W9AA 5K14B 4ECWA 4KFBA 2ASDA 1HQEB 3D28A 5KFAA 3IG1A 2RKIA 4ID5A 1D0EA 3MEEB 3NBPA 2OPSA 4KV8A 5I3UB 5KT2A 3KNAA 4U7CA 3IS9B 1LW2B 2OPPB 4Q0BB 3NKYA 4RU9A 1S1XB 4MH8A 3NAHA 4RNFA 2XCAA 3PW5A 4DEZA 5L1JA 4DL4A 3DLEB 1EP4A 2YKNB 4NCGB 1XR5A 1JKHB 2WHOA 3GIIA 2ZKUA 4QWEA 5J2MB 1HNVB 4NLPA 3NMAA 5J2QB 4K4VA 5C42B 2AX0A 3PJWA 4TLRA 3KJVB 1N5YA 5KG5A 4ED7A 3T1AA 1K1QA 3DLKB 5KFLA 5F8NA 4U6PA 5I42A 4WFZA 1HARA 1BQMB 4LSNB 1TKTA 1C0TB 1JX4A 3KLHA 3DM2B 1LWFA 5KFWA 2V4RA 2CKWA 1DLOB 3RB6A 2I5JB 2OPRA 5D3GA 1K1SA 4IH5A 2RF2A 3CJ3A 5KG2A 2C2RA 3KLGA 1TKXB 1RTDB 1FK9A 4ZP8A 5JXSA 1HQUB 1QAIA 3N6LA 3I0RB 3DYAA 3OL6A 1RTIA 3BREA 2UVUA 1S1TA 4TY8B 2ATLA 3V6HA 3BR9A 1C1BA 2AU0A 3PJXA 4HYKA 1MMLA 4LSLB 3KK3A 3LAMA 5KFMA 5KFQA 1RAJA 3QO9A 5KFJA 3MR5A 1JXLA 1SV5A 1VRUA 5L1KA 3LP0A 5DG9A 4IH6A 4O3QA 3DDKA 4K4WA 1DTQA 1JLQA 3M9NB 3DLGB 1KLMB 5DLFA 3T5JA 4H4MB 3GYNA 1RT5B 2HNDB 3IRXB 5K14A 1W25A 5KG0A 3FDSA 4RW8A 4URGA 1HQEA 3BQ1A 1J5OB 1IKXB 3MEEA 4MFBA 5I3UA 2JEGA 4IRKA 1SH3A 2WK4A 4PWDB 3IS9A 1FKPB 5FDLB 4Q0BA 2WRMA 3SFUA 1S1XA 3TAMB 4QWAA 4EYIB 3FSIA 2WONA 2WOMB 3M8QB 4MK8A 1RA7A 2IJFA 3DLEA 5KFYA 3KLVA 4I7FB 2YKNA 2IM1A 3CVKA 4NCGA 1JKHA 4EEYA 4MKAA 1HNVA 1S0MA 4ZHRA 1T03B 3TQ1A 4FS2A 4ZP7A 2BE2B 4F4WA 4IFYA 1RT7B 3KJVA 3SI8A 4LQ3A 3GIMA 1JLEB 3OLBA 1ZTWA 2VA3A 3EPGA 2E9RX 3DLKA 1XR6A 1T94A 5KFZA 3H2LA 1BQMA 3RBEA 2FJVA 2ALZA 1BQNB 4LSNA 4DL3A 2OH2A 3OL8A 2YNIB 1C0TA 3FFIB 3DM2A 4KO0B 5J2PB 4YMEA 5DLGA 2I5JA 3PW7A 2GC8A 1KHWA 5CYQB 1JLFB 4H54A 4GC7A 3KMQA 2FJWA 1TKXA 1RTDA 2AGOA 5F9NA 1HQUA 5KFHA 3UR0A 1S6PA 2I1RA 4HKQA 5L9XA 4DL7A 4RW4A 2JEIA 1RT3A 4O44B 3HKWA 4TY8A 4GC6A 4I2PB 1C1CB 5HLFB 2QV6A 3PVXA 1TVRB 4LSLA 3ICLA 2YKMB 4IDKB 2IM0A 3RAQA 3MFIA 2VG6B 2W9BB 5DQGA 4KHMA 5EUHA 3DLGA 4IRDA 1S0OA 2IA6A 2W7PA 4H4MA 4ICLA 3NGDA 1SH0A 1RT5A 3N6NA 4NLXA 5KFNA 2HNDA 4IOBA 3IRXA 3BSNA 4RW6B 5KFFA 4NLYA 5KG4A 1J5OA 1RT4B 2YNFA 1IKXA 4R0EA 5KFOA 3DRRA 4PWDA 2IBKA 1FKPA 5FDLA 3QIPB 1RA6A 3TAMA 5J2NB 4ZMMA 4Q44A 3MEGB 4Y34A 3H5YA 5CYMA 1T05B 2WOMA 3M8QA 3KK1B 3RB3A 2XI3A 3ISND 3I5CA 4I7FA 1S1WB 2VG5B 1JLGA 2V0NA 3LP1B 1QUVA 1GX6A 1VRTA 4ECVA 4NLGA 4G1QB 3V6KA 2D7SA 3C6UB 1T03A 1RTJB 5EWEA 2BE2A 1TP7A 4F4ZA 1JLBB 4QW9A 4DL2A 3H4BA 3KLIB 1JLEA 3DI6B 2BRKA 1MU2B 3DOLB 2JEJA 5KFSA 3LAKA 3Q8SB 1C2PA 3MECB 3NAIA 2UVVA 2V4QA 5F8GA 2ILYA 3E51A 1BQNA 4TYAA 4Q8EA 2YNIA 1R0AB 5L1LA 4WXOA 4URSA 2JC1A 5F9LA 1HMVB 3JYTB 1HPZB 4O3RA 3FFIA 4KO0A 5J2PA 4DL6A 4X2BA 2CJQA 3DRPB 3GQCA 2UUTA 3Q8QB 4KKOA 3IGNA 2AGPA 1RYSA 1LWCB 1QAJA 4QWBA 4O44A 1IKYB 4EYHB 4Q43A 1RT1B 4I2PA 1C1CA 5HLFA 5HROB 4ZVEA 4TQRA 4WXWA 3PW2A 3ISNC 2BQUA 4NLVA 1TVRA 2HNZB 2R8HA 2YKMA 4IDKA 3OLAA 3H4DA 2W9BA 2VG6A 4Y2AA 3GV7B 3HVWA 3H5SA 1ZETA 1S9GB 2D41A 4KB7A 2R8GA 3QZ7A 3I0SB 2R8JA 5C24B 1DTTB 3QGIA 4J9MA 1EETB 4MIBA 2VG7B 3DRSB 4RW6A 2E9ZA 3M8PB 3BSOA 4JUZA 5KFEA 3OL7A 1RT4A 4FS1A 1IKWB 3IGVA 1TL1B 3E01A 2C28A 2GIQA 4YR0A 3DOKB 3BJYA 5J2NA 3UQSA 3MEGA 4IRCA 2RDJA 1T05A 4EBDA 2R8IA 1S1VB 2WCXA 3CJ0A 4J9NA 2BR0A 1N48A 2IMWP 4EO8A 2HAIA 5F8IA 3LALA 1S1WA 2VG5A 4B3OB 5KG6A 3LP1A 3PZPA 3KLFB 4MIAA 4G1QA 2AX1A 5KFXA 4NRUA 2W7OA 4ZPCA 2W8LA 3PW4A 3KK2B 3FQLA 4M95A 3H98A 1JLBA 1NHVA 1QE1B 1S1UB 3C6TB 3V6JA 3DI6A 4FBUA 1MU2A 2ZD1B 3DOLA 2BQRA 3HVTB 4MK9A 3KOAA 3MECA 2AWZA 2ASJA 1C0UB 1LW2A 2OPPA 1R0AA 3Q8PB 2E9TA 4ECRA 3HVAA 4KHRA 1HMVA 1HPZA 5C5JA 1RTHB 4IG3B 3DRPA 4NYZA 4O3OA 5KFGA 3OSPA 1S97A 3MF5A 2ZE2B 4PQUB 5J2MA 2R2TA 5J2QA 2XGPA 2IM2A 4ED0A 5C42A 3PW0A 3HHKA 3MTKA 4NLSA 3MEDB 5KT7A 4J9RA 1LWCA 2XGQA 2XCPA 4ZVHA 3G6VA 3EPIA 4ECTA 4URQU 1IKYA 3JSMB 2YNGB 1RT1A 1TV6B 2JC0A 4IR1A 4K50A 4MKBA 2ASLA 4KAIA 1OS5A 2HWIA 3I5AA 3LANA 4IH7A 5EDWA 2C2EA 2V9WA 4IG0B 4NLOA 4NLWA 1DLOA 4ZPBA 3RAXA 3I0SA 2J6UA 1DTTA 3CJ5A 1EETA 2VG7A 3DRSA 3V6DB 2BANB 2R2RA 5HP1B 4NZ0A 3QYYA 4RUAA 3GV5B 5J1EB 3V4IB 1IKWA 3I0RA 4NRTA 1LW0B 1TL1A 1XR7A 4XPEA 4TYBA 3DOKA 4KFBB 3RB0A 2JLEA 2RDIA 3IG1B 4F4YA 4ID5B 5JUMA 3QGHA 4ZVGA 2OPSB 2W9CB 1D1UA 3QLHB 4B3OA 4QW8A 4ZP9A 1RT2B 2B6AB 2DPIA 1KLMA 4KSEB 5KFRA 4LQ9A 5KFVA 3KK2A 4G3IA 1EP4B 1S1UA 3C6TA 2QE5A 4ECXA 3T5HA 4XO0A 4JV0A 2HWHA 2ZD1A 4TQSA 3HVTA 4ZVFA 1NNDA 4I2QB 5HBMB 2UVWA 4RNHA 3GIKA 2YNHB 3T19A 5KFKA 5KG7A 1UWBB 1RTHA 4IG3A 5F8HA 3NL0A 4QWCA 4ED2A 2ZE2A 3BGRB 1GX5A 1TKTB 4PQUA 4O3PA 2IAJB 4OL8A 3KHRA 3ITHB 1LWFB 4WE1B 4NLRA 3MEDA 1RT7A 5D3GB 5KT4A 4ZPAA 3DMJB 4K4YA 3JSMA 2YNGA 4FBTA 1TV6A 5F8MA 4ECYA 5KG1A 4WYWA 3KHLA 3OSNA 2EC0A 5DQHA 4RUCA 5DGBA 4RNMA 3MR6A 4RW9B 3BSCA 1WNEA 4RZRA 3KK3B 3OHAA 4IQXA 5CYQA 1JLFA 1RDRA 3V6DA 2O5DA 1REVB 5KT6A 3PR5B 1HYSB 5J1EA 4O4GB
chains in the Genus database with same CATH superfamily
3TI0A 1A0OB 2U1AA 3HVRA 1VQLS 3G6YA 4Y28C 1L5UA 3QT8A 2LA6A 4I2QA 4OI3A 3MOJB 3QIPA 5B09A 3V81B 2X1FA 1G7CB 4LR8A 1A6LA 1ZZNA 4PWWA 2IAJA 3GIJA 3FVYA 5ETVA 4DL0C 1MN7A 3KLIA 2IM3A 2ZC4A 3EDRB 4HEA9 1HBNA 1R27B 1S57A 2YX4A 4PUOB 2OPQB 3OQ2A 3QT7A 3MAAA 1ZZFA 2MHEA 4J9OA 4LF7J 1M5OC 4JI3J 3DRRB 1FE4A 1S79A 4CWBA 4K0KF 2VA2A 1UJ5A 3W9HA 3I9ZA 2KZMA 3P8BB 2VPYB 2D3ZA 4WFYA 3N79A 4LMZA 3BSAA 1T9YA 3M6VA 1QE1A 2XWXA 3ELHA 5EWFA 2B5JA 3LP2A 1C0UA 5HMZA 2GMLA 4ZIWA 4DG1A 2M3DA 3IWNC 1HWLA 1U47A 1VBKA 1LEOA 4C3MA 1OMSA 3PO4A 5I4MA 3R5JB 2YQ1A 2XS2A 1BHNA 5A0YA 1K44A 1R89A 2JH3A 2ZH1A 2FVQA 3CO9A 2ALYB 3SSQA 2J0XA 4M5MA 2ASDA 1CJKB 2XSJB 2Y0SD 2XCAA 2ZH7A 5CA5A 1X60A 4OJHA 2AX0A 3MGJA 2FDNA 3FNNA 4G1PA 4DLGA 3KJVB 3OR1B 2JLFA 3ZFVA 4WFZA 2CPDA 1HWIA 4DUZJ 3R6LB 1ELOA 1C0TB 4WPAA 3FCVA 3CMAS 2OMOA 1PKUA 2QN6B 2E1PA 2G13A 3M2VA 2RD5C 1RTIA 4WP9A 1X5OA 2VJVA 1NK6A 1KR4A 4U7UK 2NCKL 3W7BA 4LSLB 3LAMA 3NRBA 4O3QA 1F3VA 3HJVA 5DLFA 3NS6A 1RU2A 3R7NB 4K59A 5GAEU 1S7IA 3QT6A 2IJFA 2CRLA 3OR2B 1JKHA 4AL5A 2DNPA 3GIMA 4PAAA 3OVBA 2VA3A 4U7UD 2FJVA 1H7WA 2ALZA 3ZNJ1 2XO6A 5HMWA 2UUAF 1ZAVA 1U49A 5DM7Q 2E7WA 1C1CB 3D0HE 2XYPB 4B9TA 4USUA 2HFZA 2F8MA 5EUHA 3L7OA 5KAKA 4ICLA 3Q89A 3LF0A 4PPDA 3R2CJ 3WHIA 2HQ3A 3CIMA 4PKDB 4KPYA 3H5YA 3M8QA 2B9YA 5D0RA 1S1WB 2VG5B 1WG5A 4PXDA 2D7SA 3MR7A 4HACB 2XM3A 4GO5X 5KFSA 1CEZA 1M1KT 4Q8EA 1R0AB 2OTLS 1WACA 4BWMA 1HMVB 3OTCA 2YQ3A 3W66A 3AOBA 3MM9A 2I8EA 2X3GA 5LL6d 4NOHA 1V9OA 1LWXA 2QT7A 5HLFA 5LSRA 2AIRB 2VICA 4ZS6A 3LO3A 1N5QA 2R7RA 4F2RA 2VFUA 3JAMY 3UVJA 3V5RA 2NZ4A 2C28A 4YR0A 4DDFA 2IBOA 1S1VB 4I64A 4LRFA 3U27A 2FJEB 1K8AT 2QMWA 1R8BA 3MECA 3FBBA 1QVGR 2DR6A 2VUGA 4PEOA 3DRPA 3WC2A 1ZA1B 5JVHQ 1SC1B 4WK3A 4ZN3A 2HWIA 1VLYA 1ZM2A 2MQQA 1CC7A 1LNQA 2G0IA 3OJUA 4NZ0A 4ELTA 1MNEA 3IG1B 4OX7A 1R6VA 4QW8A 4G3IA 1WEZA 1TTHB 2RT3A 4DU7A 2J5AA 2HSEB 3C19A 4IG3A 5D0GA 1Z2ZA 2XYGB 2F63A 4ZPAA 2ZHAA 1NXIA 2QTWA 2FC8A 1YTYA 5DQHA 1FRHA 4PR6A 2RJZA 2VBYA 1U1QA 4JV5F 1HYSB 2Y8YA 2BACA 2FUG9 1VS3A 1A9NB 4WYLA 4HT7A 3ILOA 4MFBB 2W9CA 1TL3B 4O3SA 2DJWA 2B6AA 1SL1A 3QRQA 3KLEB 4MK7A 1GQEA 2KHDA 5IT9U 4DV2F 2OEMA 2MLYA 1N4LA 2RQKA 4LF2A 4CT8A 4NASA 1RTJA 2HGLA 1IM6A 2DGQA 1NKEA 1ZPWX 3EZUA 1HNZF 1WHYA 2R7SA 1PC5A 2QEXS 3MR3A 2D3UA 3THPA 4G6VB 1N36F 1UKUA 1AROP 4RBUA 1S9GA 3D5MA 1I51B 2EK6A 3DHXA 2F40A 4MAKA 4CLKA 4USMA 4DR4F 2C2DA 4RUBA 3H40A 3ZC4A 2X7IA 4ZJQA 2J0WA 3WX8A 2DCLA 3MUTP 2HHHF 2YH0A 1M5HA 1FA0A 1WKKA 3P3DA 1HW9A 2DB1A 1Y00A 5E7OB 1WC5A 4CYUB 4QOTA 1RWMB 3N4WA 4K4XA 4ZVTB 2IC3A 1N32J 2DGTA 2OEJA 2NREA 2ERRA 1VRUB 3LP0B 2CPFA 1DTQB 2KJWA 4A8SA 1RAHB 4KHPJ 2BVZA 3W9IA 4PG8A 5IQ6A 4WTYA 2Y8WA 2QLFB 4MH8A 4DEZA 2J8AA 5G0RA 3CC7S 5IV4A 2E66A 1VI7A 5J2MB 3A3OB 4KGZB 4HR2A 2GGPB 4HL9A 4DFPA 3PRBA 4ILMA 3T1HF 4C3KA 4USKA 1I94J 2BX6A 3GR0A 5JXSA 1QAIA 3OL6A 3BREA 3I31A 3NOGA 3BR9A 4O0IA 1NRKA 3QO9A 5DG9A 1VIOA 1J5OB 5I3UA 2QA2A 3SFUA 4QWAA 3FSIA 2WOMB 5F3TA 1VHFA 3OTOJ 4M5HA 4NCGA 2MLXA 4ZHRA 1T03B 3EGNA 1H0HB 3IR5B 2EFGA 1JLEB 3D6MB 1T94A 1U45A 3AAWB 4OYWA 1H74A 2OH2A 1UFKA 3CMQA 4ZK7M 2E5IA 4K8RA 2Z2YB 3RR7A 4HKQA 2Q6BA 3LGHA 3HSGA 4IO9Q 3NGDA 2HZAA 2HNDA 3B78A 1RAEB 2WVFA 2G1HA 1IR1A 2CWKA 5E3AA 2RSQA 4F4ZA 1SC4B 1HKAA 5F8GA 2V9KA 2HVZA 1Y0HA 4DL6A 3Q8QB 2BMBA 1LWCB 4QWBA 3D7SB 3K17A 2W9BA 4Y2AA 3THVA 3H7HB 3ZZPA 4RW6A 2P9CA 3OL7A 3FCHA 4PG6A 3C46A 1SJ3P 1FDDA 5J2NA 4F0HA 3M6XA 1T05A 3HD2A 2V8PA 2PE8A 2W7OA 4DSJA 1W2BR 2NPIA 4GKJF 2LECA 1UAWA 3PYGA 3NOCA 5KFGA 5B0DA 2MKIA 4NYOA 3HHKA 1VQMS 2B9EA 4GMKA 2JC0A 4IR1A 1UETA 1RISA 2NSCA 2DHGA 4ZPBA 3LOUA 2H54B 3V6DB 3CCJS 2BABA 4S0MA 3ZZUA 3ET6B 3QLHB 2YKAA 1EZZB 5IT4A 2X1AA 4JV0A 2YBVA 2ZD1A 2E5LF 2L9WA 3VR1A 3H20A 4ED2A 1Q7LB 1GX5A 2BV3A 1QSLA 4YB6A 5AE3A 1RT7A 2IPOB 1GEHA 2ZH9A 3OV7A 4OYXA 3CF5Q 2WB1D 1E6YA 3J80Y 4RUCA 3C14B 4RNMA 4QR2A 1QSYA 1UFLA 3GJSB 3B4MA 1FDAA 2XNRA 2VONA 1X9MA 4R5PB 1Y7PA 5LJ5Y 2UV8A 1CVJA 4O23A 1UMJA 4ECUA 3RG6A 1HBUB 3BKTA 4Y2CA 3EGWB 3Q22A 3HLUA 3BGRA 2JEFA 5AXMA 1MWYA 1RWOB 4WFXA 2IY5B 4DWIA 3R5GA 4WU2A 2DPJA 3ZTRA 4OZ0A 2RE1A 4LBPA 2LQ8A 4MKYA 1SUQB 2DD8S 2WBRA 4J37A 3LGMA 4X4QA 1RKJA 1S9EB 1FFGB 4M94A 4OQJA 1FEHA 2R7UA 1SJ4P 4H4OB 3OXLA 3THTA 2CVIA 3I6PA 1F2GA 4B9NA 1JLGB 2XY6A 2MKHA 4ZCMA 2UXDF 4HHHA 1ZA2B 4DR5F 2CJBA 4TKTA 2OD6A 2QX0A 2JHEA 2W2OP 4JYAF 2BQ3A 3BGUA 1ZM4A 2DNYA 4NXNF 3OHBA 1N5YB 4C8YA 2EBEA 2BDPA 5LSLA 3L7UA 2XZWA 2H5IB 5GAEI 4X64F 2CWXA 4M8LA 1OY8A 1S9FA 3BGFA 2KTQA 4C11B 2N7CA 5KFIA 3AH6A 3ULHA 2UUAJ 3GFHA 2J0QD 3FJ2A 5E0OA 1GMWD 1VCTA 1NSAA 2OPPB 2FHMA 1Y9OA 2OIHA 2YKNB 4QWEA 3S8SA 1F5AA 1U6FA 3TJ8A 3GG1A 4B3RF 2B3TB 2OELA 3M4XA 2XMMA 4C0HA 2I5JB 5JJBA 4WK1A 1HQUB 3EM1A 3JTNA 4P2XA 1TFYA 2K7KA 1C1BA 4HDHA 4HYKA 4A48A 2CZ4A 3POTB 4LFAF 2DBBA 1PJ7A 3DOMB 2BJ7A 4WU3A 4A46A 4DV7J 1FVSA 2WK4A 3IS9A 4NZ6A 2HQDA 1ZBTA 3BO3A 4RL1A 3JSYA 1FRLA 4FS2A 2BE2B 4HHUA 2P9GA 3EPGA 4CM2A 1J5EJ 4PG7A 3BH6B 3H2LA 3VAHA 1BQMA 3M8ZA 1IBKF 2EXUA 3MM5B 4GKKF 4YMEA 4U95A 2UUCJ 2FJWA 5F9NA 1R8CA 2JEIA 2YKPA 1YJNS 5A6PA 3A13A 3UI3A 3KJQB 4ZCIA 4KHMA 1YJWS 3DLGA 5CD4A 1P9QC 1QAXA 4NLXA 5KFFA 1EKRA 1APSA 5CZVA 2IBKA 1KKHA 2RRNA 2L48A 1MW7A 2EK1A 4X84A 4Y34A 3TJ9A 4BBYA 4A8FA 1GX6A 2BW7A 3GE9A 4LF9F 2AF6A 1R7IA 4M5GA 5ETMA 4CTAB 1WEXA 1G4CA 1RWUA 1TMJA 3T41A 3EGVA 1SKWA 4YB7A 3R5AA 4DSEA 5D77A 5HVGA 2I0XA 3OUYA 2AGPA 3J7Z5 3M8SA 3D0IE 2YKMA 3H4DA 3H5SA 2AP6A 4BWJA 2UUBJ 4KY3A 3GFZA 3K5OA 5EX3A 2DR8A 1YRTA 4LSZB 2YWEA 2KB2A 1IXKA 4JV5J 4XDCA 4ZVRB 2AWZA 5L39A 4KHRA 4LVOP 1MSWD 4ZKAA 3AOCA 3PEHA 3MF5A 4FYDA 1HD0A 2V5HG 2M52A 3G6VA 3EPIA 1IKYA 2BUNA 4C8LA 2ZOFA 4NI2A 4CP5A 1WI6A 3RAXA 5LOQA 4KC5A 4NRTA 4UZBA 4USWA 1HNZJ 4DR3J 2HHUA 3HHLB 2DPIA 1H7XA 1RKIA 2HHWA 4AXIA 3T5HA 2LVWA 1Q53A 1NNDA 3JTOA 1HI1A 4WCEQ 1N36J 1RWPB 2OFGX 2FIUA 2PGCA 2MSSA 2E7XA 1FXRA 2RHSB 2U2FA 3MEDA 1HNWF 1RHKB 5F8MA 3CJRA 1KDNA 2MZSA 4DR4J 3BO2A 3AQPA 3J81U 1REVB 1TL5A 1LW0A 4OZJA 2HHHJ 5BR8J 2H51B 4IFVB 1X31C 1OIAA 1X5TA 4F36A 4QU6A 3BKFA 2AJ2A 1I5OB 1NCLA 1KQGB 1NK8A 4K4TA 4KGVB 5KFUA 3RR8A 2VZ9A 2X1BA 1N5VA 3QIDA 4GVBB 1UL3A 4RJVA 2R7QA 5DDPC 4WIQA 1N6QB 3RBXA 4KBIA 4C98A 3HHEA 2GMHA 3T6JA 4QIVA 4J9KA 1VQ4S 4JB8B 1JLCB 4A8MP 2HHTA 5HROA 3RJMB 1RABB 2ZH6A 5A76A 2PFFB 1PCAA 3BQ0A 3GMGA 3QRPA 3IM8A 1NB2A 2R2SA 3CWJA 1RI7A 4C6AA 2V50A 3W5YA 5C25A 4KV8B 2WBMA 4R25A 3I32A 4CO2A 5FJ4A 2BZ2A 4QIGA 1WDDA 4NLDA 3AXMA 1GMUA 1S49A 4P7TA 3KLHB 2F7VA 2J7UA 1WORA 2Z56B 3PHEA 3CDEA 2PFDA 1Z4UA 3AY0A 4YY3F 2ZITA 3VCDA 1XN9A 1JLQB 3Q2SC 2NQPA 3R6GB 4QIWD 3DNCA 5KFAA 2RKIA 3MEEB 1WSRA 4UY8T 1EP4A 4ILLA 3GIIA 3DXSX 5K8NA 2QLJB 5C42B 2LCWA 3NNAA 2DNQA 2CJ9A 1PBAA 4NA2A 3RB6A 1DLOB 2KI2A 3FMBA 1TKXB 5GMEA 1XC9A 3ENQA 3K0JA 1FO1A 3HHLC 5KFMA 3HMJG 2MGZA 1SV5A 3DDKA 5AE2A 3OXGA 1KFSA 4RW8A 1HQEA 1S1XA 4Q2LA 3TR5A 3FEYB 1F0XA 2I9SA 1HNVA 3JQJA 1O8BA 1WJ9A 4F02A 2KFNA 4LIWA 4CNYA 3IR6B 2FHJD 5K9FA 2VQEF 1S6PA 4RW4A 4Y2IA 4TY8A 4GKJJ 2R7WA 2QMXA 1OPIA 4OHVA 1IBMF 2G1DA 3J80U 5GADI 1FRXA 4Q2MA 4B17A 3EVMA 3R9LA 3ILIA 4OYAA 3W2WB 3AOAA 1RA6A 4NA3A 4XDDA 2ATCB 2HFOA 3DLHA 3Q83A 3GU0A 4G1QB 4QBUA 3H4BA 2JEJA 4EZ6A 1SQEA 2GHPA 2B9WA 2YNIA 5L1LA 2XBPA 3MMBA 2B4UA 2HLTA 2PO4A 3BPDA 1URRA 4ZLLA 1UPPA 5SUHA 5I3QA 4L75A 5B08A 1TVRA 1FX2A 2E5LJ 3SYZA 4DV0F 1HIYA 3I0SB 1FFSB 4BC7A 2YPZA 2VG7B 3W65A 2E9ZA 3M8PB 3DGPB 4FS1A 3BJYA 3MEGA 2R8IA 5LJ3Y 2R4FA 1FCAA 3NNCA 4RBTA 4NRUA 3FQLA 3C6TB 4PRFA 2KZZA 4LT6A 2ZM6F 3DOLA 2DGVA 1DY3A 3OW2R 1HPZA 3JTPA 1GFWB 3Q8UA 1S97A 4H4KC 4UOGA 4X4VA 4OLOA 2EW9A 3EXYA 4LIRA 1AFJA 1AZSA 2QYGA 2C2EA 2BE9B 4ALZA 2QSFA 3NCQA 2GA7A 1VQ7S 3SZ2A 2R9LA 2QA4G 1TL1A 1V5IB 4KFBB 1SJFA 1H73A 2JLEA 2RDIA 4LR9A 4B3OA 2Z57B 5GMKa 2VC0A 1X4EA 4I2QB 2FYXA 3DCAA 3KXDA 3ZZYA 2IAJB 1LWFB 4HI2A 4FBTA 2UXDJ 1ZH5A 3D68A 2H65B 3VGVA 1HBNB 3SSRA 3N0VA 4LFCF 1VMBA 2JVOA 3B82A 1TL7A 1DRZA 5B0AA 5KT3A 2ZH8A 3VGSA 4NXNJ 3QQCD 2ZC3A 2KT5A 3H59A 3FZBA 4B3MF 3KG0A 1D9AA 4X64J 2UUWA 3SQGA 1EJ7L 7FDRA 1UWBA 2V6AA 3LTOA 3L9ZA 3BKUA 3W5XA 3ITHA 3QZ8A 2BEFA 5K8PA 2HPUA 3PM9A 2B5JB 3LP2B 5FLXY 2C3PA 3AXKA 3CCLS 2B56A 4DG1B 2BM0A 1ZTTA 2XLJA 3ILJA 2FC9A 3J7A1 5KFPA 5C2CA 1S12A 2BRLA 1SQGA 4B3RJ 4FPIA 2YKOA 2H4WB 4I56A 4B9SA 4FN5A 5A0YB 1BMQB 5B0GA 4J5OA 1MMNA 2V8GA 1WOSA 3TEGA 4JV2A 1N5SA 4AL6A 4WZQA 3ETOA 4QIEA 3FZ2A 4LFAJ 1VQOS 1OPZA 3OTEA 1B7YB 1F60B 1PGZA 2ZVIA 3SIPB 4CH7A 2PA3A 2EEYA 2F9JA 4ITSA 1IJEB 4Y3CA 1OSDA 3P49B 3MXHP 1QY7A 1VYAA 3RRKA 3M2VB 1YK9A 2OP5A 1RTIB 4CLFA 4M5IA 2K2PA 2NXUA 2XC9A 5EWGA 4GKKJ 3H5UA 2A1BA 3W9JA 3D1OA 2MDAA 1G6BA 2XLKA 2DR9A 3MOZA 3MZIA 3M8RA 1GMVA 2WHOA 1UVLA 1JKHB 4OFZA 2AEMA 4K4VA 1PYOB 3T1AA 1VFJA 4G1IA 1EAYC 4P71A 4OX9F 1Q8IA 4LF9J 3I0RB 3DYAA 3HFKA 3G8SA 3EJMA 2H5JB 1Q8LA 3EVOA 5K14A 4URGA 3HSJA 2QYCA 4A4JA 4ATNA 4IQMA 3ADAC 3JXOA 5IV3A 3M8QB 2IM1A 4CRJA 4NXMJ 2J0SD 2HHQA 2FHKA 4LQ3A 2Z0GA 5E5NA 6AT1B 2PSZA 4DL3A 3F73A 3A12A 2QZ8A 3MM9B 2GC8A 3P5BP 1KHWA 1H72C 3F0NA 5KFHA 2CUYA 3MUMP 5HLFB 3PVXA 3RAQA 1X4AA 5T41A 2HFUA 3UVJB 2EWHA 2DNZA 4LRDA 5J1PA 2YNFA 1TELA 2FY8A 1FKPA 1B99A 3GG0A 2BW2A 4I7FA 1M90T 1V5VA 2V0NA 1PO6A 1RWWB 1DHMA 3MECB 3ZTQA 2ZH4A 5F9LA 3VV2B 4KO0A 3DRPB 1AFIA 4WP3A 1WHXA 2NYIA 4F4AA 1U4BA 2LQBA 1QAJA 5ETTA 1U1RA 4OJ3A 3FCWA 5C24B 2FB0A 4DMZA 5CH7B 4MIBA 4X62J 3KJFB 3HKZD 4XK8C 3TW0A 1HNWJ 1GAOA 3HXMA 2RDJA 4C9DA 2K06A 2Y1IA 3PIOQ 2W8LA 3NMRA 1JLBA 1PYTA 1NHVA 1KSPA 3GJRB 4PYDA 3IRWP 4LRAA 1TR0A 2HGNA 3M32A 2DH7A 3LQVA 4IG3B 3OSPA 3CCWA 3W8GA 5ETRA 4NLSA 3VF0B 1U1KA 2XCPA 3QSYB 3VALA 2CJAA 1OS5A 1KBRA 4IG0B 2CNLB 1FJGF 3EZOA 1XR7A 2GQ2A 3LH2S 3DOKA 4CCHA 3QGHA 2W9CB 4ZP9A 4ZPWR 2B6AB 8ATCB 2M70A 1CQNA 1P27B 1FVQA 1X7VA 3KHRA 3SQOP 1FJ7A 1IQTA 5D3GB 2CPHA 4PG5A 5CHCB 1GXLA 4HDGA 3K5LA 2JWNA 1F1BB 4RZRA 1JLFA 5E3RA 5K20B 4UTGA 1WC3A 4F3QA 3MCNA 3HCXA 5THWA 2QG9B 2X1GA 1NHKL 4NLQA 1RT2A 5CZXA 3UNYA 3K5MA 5HSPA 2AW0A 4QPXA 1H98A 1R8PA 4F67A 2F4VJ 1NUEA 1RLDA 4YY3J 3C16A 3N5FA 1F9HA 5D4NA 5L1IA 4NX9A 4MT1A 4W4MA 3EX7B 3NWRA 2FHOB 3CUNA 4RW9A 4NMXA 1NDKA 3NGSA 4K4UA 3WQPA 4YR3A 4ES2A 3R97A 1NHUA 2RS2A 1RSCA 2HNZA 4YDXA 4DF4A 1B64A 1YKWA 2HK3A 2IC3B 2VHGA 1FD8A 2CJXB 5L38A 1HBMA 3VVUA 2M2BA 1Q86T 2Y1JA 1JJCB 4E2FB 3UD3P 2AJ1A 2KYXA 5G0RB 1FXDA 3UDEA 3I55S 3KDOA 2YPYA 4RW7A 3UNGC 2XMVA 4WJBA 2B4VA 1U1MA 4CO3A 2MKJA 2KVIA 1YRXA 3BZQA 4JI7F 1AA1B 1BLUA 1TKZA 1BD6A 3LW5C 4MTPA 2XI2A 2ZJQQ 1N88A 2DGOA 2IRYA 5KFTA 1WTBA 2R7VA 1NJWA 4B9LA 3QO9B 2R2UA 1T3NA 3V4IA 1HNXF 2VQEJ 2W9AA 2CG4A 1WF1A 1D0EA 2OPSA 5I3UB 4U7CA 3TEHB 1NLKL 1H2UX 4FNHA 1XQIA 3CCUS 3VHQA 4NCGB 3CJQA 3TYTA 4B02A 4P74A 3EE3A 3DC2A 2GVZA 5CABA 2BJDA 2V4RA 1EQMA 2XSFA 2C2RA 3KLGA 1FK9A 2DHAA 5IOLA 1GXUA 2C2NA 4P75A 3J81j 3M2UA 5KFQA 3IAM9 2IFXA 1RP5A 3M9NB 3R5DA 2HNDB 4F0MA 1W25A 3TAPA 1IN0A 1NDLA 2HVHA 1HBOA 2M88A 2WVCA 2IRUA 4DBQA 5A6WA 4DV0J 5CD4H 1U1NA 2M8HA 1FTCA 2VC1A 1FDNA 2Q3PA 5T7LA 3RBEA 2MQPA 3K7RA 3TAQA 1FJEB 2HRTA 3E8OA 3F44A 4H54A 4EGLA 2KU7A 3DRYA 2ZM6J 1R8AA 2EFQA 1M5SA 2W9BB 3AJ1A 1ZM9A 3DU5A 4AFFA 2RIJA 1RT5A 5H9EK 1VQSA 3BSNA 3CCZA 4RW6B 3DRRA 5J2NB 1T05B 3KK1B 1OO0B 3HT3A 1QUVA 3MUVP 1HR0F 1P1LA 5A8KA 1TP7A 4KQZA 1VK8A 3LAKA 2R7OA 2V4QA 2AYEA 1BQNA 1VJQA 2J9DA 1CS4B 4RX6A 2CJQA 1C4AA 1VQKS 4O44A 4EYHB 1Q16B 2E1MC 4ZLJA 1R0BG 2RVJA 2UXCJ 1G2EA 1U48A 3IGVA 1B3TA 1KN6A 4YN3B 5GVQA 3BGLA 2HRUA 1U26A 2CFXA 1QTMA 3KKFA 2UP1A 1RAAB 1VR6A 4M95A 2NXJA 7AT1B 3JQMA 3DI6A 2MTLA 2ZD1B 2CQPA 2Y9HA 2LQ9A 5K5MA 4OZLA 2DO0A 1N33J 3FK4A 4L72B 4B3MJ 1Q8BA 4ECTA 1U1PA 2CA9A 4LBHA 1RT1A 2N82B 4P73A 2V69A 4IH7A 1X4BA 3W61A 2HBZB 1L3UA 3OFFA 4DOZA 1JJ4A 2BANB 1UZDA 2PI5A 2DITA 2HZVA 3AA9A 1MROA 4P2FA 2H4YB 2CQ2A 2HG4A 4XO0A 3HVTA 3FBEA 5DS7A 4ZVUB 4BCAA 2DNRA 3TVYA 5KFKA 2V63A 4A8KA 3B54A 2NUHA 2OEKA 1NK4A 2CQBA 3BGRB 1TKTB 4K4YA 1K9MT 2XEXA 3I9V9 3KHLA 2EC0A 4DV3F 3FBFA 2CZVC 2ZH5A 1RDRA 3TZWA 3WIVA 1WF0A 1BC6A 2R8KA 2GMJA 3BM7A 3J7ZT 2WONB 4KRWA 4JI2J 1G1XA 4U67Q 3N5BA 5F41A 3KMSA 1WI8A 1MMDA 4KE5A 4ED6A 1AXQA 5RUBA 3BYPA 1SCJB 4HACA 4D3GA 4DU8A 1IR2A 4ZVSB 2GW8A 4NE9C 1DFDA 2HAFA 2YWGA 2KVQE 2CG8A 5ETSA 2FVPA 1OYDA 1RACB 5A8WA 1U09A 2KFZA 1E6VA 2XMAA 4K4ZA 5B0BA 5L8RC 1AUSL 2QA4S 1VBXA 2DH9A 4G65A 4UUWA 4PCQA 3M1VA 3GPAA 3GTYX 4OX9J 3H25A 1S1VA 3UWTA 1T3OA 2MJUA 1NH7A 1IJFB 1X5PA 4KHPF 4DUYJ 2GHVC 3NS5A 4CLSA 2G0CA 4U8VA 3A8EA 2MY7A 4TLQA 4DCJB 3U1MA 4Z7CA 1TQLA 2IJRA 1C1BB 1ROFA 3JQKA 3N28A 5KT5A 5DG7A 1OJ4A 4V1Ak 1K0TA 4ECWA 3IG1A 1KQKA 3IS9B 2HQFA 1SQFA 3UW1A 4ANEA 3ZTSA 2YXLA 5LXYA 1BWVA 1K1QA 5H9FK 1BQMB 1WG1A 2DGWA 4A8OA 5KFWA 2C2ZB 1R0CB 2RF2A 5DDOC 3JSBA 4HTJA 5A2QU 3O1LA 1WSVA 3RUBL 3VAMA 3V6HA 3FGVA 2AU0A 3QFHA 1RAJA 4K4WA 2MQ8A 3IAS9 3DLGB 1KLMB 3G6ES 4TU7A 3C2PA 4JI4J 2IIHA 2RMLA 4MFBA 1RWXB 2JEGA 3KLVA 4Q7AA 4MK8A 3DLEA 2E1AA 2ZVSA 4F4WA 3NGRA 2HGMA 2RU9A 2MMYA 3OLBA 1XR6A 4AL7A 3MMAB 3I82A 3M2RA 3TUZC 2GJIA 2RU3A 3OUYB 5AXNA 4DPTA 1JWWA 2IYIA 3HKWA 1D8ZA 3OVAA 3BBFA 1JB0C 2DTJA 4NEYA 2YKMB 4MMOA 1SBRA 1TUGB 6FDRA 5IM0A 4IRDA 3KUHA 5KFNA 3N6NA 2CQGA 4IYQA 2DEIA 1TAQA 1HFEL 4BC9A 3TAMA 2C42A 3QFWA 3MCMA 4NLGA 2YWHA 4V19X 2HQCA 1FJGJ 2LXUA 5DDRC 2W4CA 3A4TA 3MPYA 3JYTB 5J2PA 2C2OB 3FC9A 2ROPA 4UY85 2RHQB 1WTFA 3FEXB 4X4UA 1IKYB 4PYAA 4IDKA 3GV7B 2BBEA 4K2XA 1YRUA 3CCTA 3NGUA 4CDIA 4IOAQ 4LBIA 2K3KA 1CJVA 2DYAA 2BR0A 3GSIA 4ZCKA 2GHWA 2XNQA 3PW4A 1XNQF 9ATCB 3EXCX 4FBUA 3TZXA 1N8RT 1TL4A 5J2MA 2H3EB 3MEDB 3PXGa 3FUYA 4L6V3 2MKSA 1T95A 1B70B 1BE4A 4QJVA 4CLYA 2J6UA 4XAKA 3PIPQ 4FF3A 4RKUC 1LW0B 1ZOTA 4B3SF 1CBKA 2W2QP 4X65J 2MXYA 3RW6A 4OZ2A 2V67A 3BO4A 1R43A 1RUSA 4KGKA 3ZZ0A 2ZE2A 3P6YC 3R5CA 1CJTA 3GIRA 3HHDA 3MI7X 1TV6A 3SCIE 2NZCA 1YG0A 2ACMA 1WNEA 4IQXA 4F26A 3PR5B 1UW9A 4K4SA 3US5A 2FLNA 1BQXA 1U6ZA 2ZWOA 2GX8A 2G2ZA 5BJRA 3G2XA 4JI7J 4FYYB 4PXCA 2LFVA 4IFYB 5C25B 3QJPA 4XTTA 2AT1B 3CDAA 4Q45A 4ZLPA 3R27A 4EO6A 3JSRA 3K8WA 5SZTA 5CQGA 2HVDA 3Q2TC 1RWNB 1HNXJ 3CTRA 1CSJA 1BGXT 4KTQA 2HZCA 3Q8VA 2R7TA 3C66A 1U0HA 5ETNA 1YJ9S 1PG5B 2IVFB 1EQ0A 2V2VA 1O0PA 3HT0A 1P9YA 4LF8F 3AFGA 3CIZA 2FTRA 3ZNUA 5KFBA 2JVRA 1S4FA 2RKIB 2DR7A 4ED3A 2J6SA 3R1LA 1OYEA 2PMHA 2V2QA 3SSSA 1H6KX 4LR7A 2V2KA 3BN4A 3CDWA 3T9NA 1VDHA 2AJ0A 4M5JA 1T0TV 4CLUA 1UVNA 2GO8A 4F25A 2VB6A 2GVDA 4CM0A 4ECQA 1S6QA 1YI2S 2MGZB 1SV5B 4X4OA 3LPEA 5IQQA 3H90A 1HQEB 3DDIA 2N4CA 1LW2B 4C4WA 1S1XB 1KEKA 4MYUA 1FWPA 4OV6A 2GQCA 5D0HA 1HNVB 1P8GA 4DV7F 5DDQC 4ZOSA 4PPZA 1JX4A 2MHNA 3PYEA 2Y3YA 2CQ0A 1HR0J 1T11A 2V34A 1J5EF 1RU1A 4TY8B 2ZZNA 3C14A 3AD7C 1MMLA 5ETOA 5E41A 3UDVA 2UUCF 4HT5A 4MIWA 1Q5YA 1EIYB 3K5NA 4C0BA 2LP4A 4IRKA 4DV4J 2XB2D 1UP1A 3WC0A 3V6KA 4UOHA 4AT1B 1PSDA 2O1PA 3C3LA 4ZDNA 3B8HA 4LSNA 2CNNB 2J7WA 2YNIB 3MMBB 4DN0A 3DM2A 3TA2A 1RTDA 3O8WA 2CQ1A 2VODA 3OVSA 1RWKB 2GIFA 2HHSA 2QV6A 1TVRB 2BKOA 1S0OA 1LXJA 3Q0AA 3AA8A 3PX6A 3KUEA 1J27A 2XY7A 3MEGB 2CADA 2W2MP 1JLGA 4DN9A 5D4LA 3J7YI 1NK9A 3C6UB 4DFJA 4PWUA 2UUBF 3A8JA 3DOLB 4RR5A 3E51A 1VHIA 3AD8C 5GAHI 1HPZB 3FFIA 1HD1A 4FKXA 3IGNA 2VPZB 4X4TA 3CC4S 2ZHBA 3MAQA 2MSTA 4AYBD 3ZTOA 4ZVEA 4C8MA 2VG6A 4OX8A 3W1YC 2V2ZA 4C3LA 1ZAWA 4J9MA 3QAEA 3VGTA 4JUZA 1TL1B 4RLEA 4CO1A 4CLTA 4RWWA 2HFVA 5KOWA 2M4MA 4EBDA 4X4SA 4DV3J 4B3OB 3MHYA 2N3LA 1MU2A 4FP9A 2NXCA 4DR3F 3QJJA 2OGUA 2OPPA 1VQ8S 3HVAA 3CNQP 1KTVA 3EVWA 3NY0A 3CJ8A 1X9SA 4URQU 2VF3A 4OI6A 1HA1A 2UXBF 2LQJA 3JS9A 5E3PA 3TUJC 2DHSA 1HQ2A 2WVDA 4OI2A 1TL7B 5KOXA 1IKWA 2YH1A 4TYBA 3MMCA 4JI8F 4F0KA 1AUDA 4JI6F 2PA8D 4ID5B 1VC0A 1D1UA 1VBZA 5LMNJ 3KYLA 3POTA 3KK2A 1S1UA 2HWHA 5BR8F 3IC1A 3Q23A 4ZVFA 3TP2A 4E0DA 5CCLA 3DFEA 2Q43A 1UWBB 1X0PA 5F8HA 3NL0A 1RHJB 5LT5A 3ITHB 3W64A 1RE1B 1WELA 5DGBA 3HO1A 1RJJA 5AT1B 5KT6A 1GMWA 3IR7B 4Z7YA 2IHR1 4C8OA 4WKRA 2F5GA 4WWSA 2HS3A 3VQSA 4HI1A 3BDPA 2F8EX 4N8OA 2GZOA 3EICA 5HBMA 5ITHA 2FLPA 4J9QA 5DZ6A 4DZDA 1Q78A 4TXSA 4WE1A 4FPRA 5MLCV 4RNOA 2A6OA 2C2MB 3TA1A 1RT3B 1KLNA 5F8JA 3LGNA 4F50A 1VRQC 3CW2C 1XMQF 3CPWR 3GJTB 1T02A 1TAUA 5EHHA 3PX4A 3O5TB 1R6YA 3UN3A 4OZ1A 2ASYA 5CYMB 5B0CA 1PJ5A 3WBZA 1LKZA 5CXTA 2CYYA 2HNYA 4EU0A 4OI0A 2XTJP 2UVRA 4P10A 4F4KA 4OMFG 3IP0A 1M5VC 4JV1A 2FVCA 2D1CA 1FE0A 3E2EA 2MQMA 4AD6A 1SL0A 1XWLA 1N54B 1NO8A 3MMJA 1TZ0A 2ZNYA 5HMXA 2AKWB 3TANA 4EBCA 4ED1A 3DYAB 3E01B 3HM9A 5DJBA 1U1LA 2LDIA 4K2JA 4XPCA 1PBUA 3R7BB 3SEOA 2OSQA 1SIWB 5IC4B 3UDLA 4NMLA 5K14B 4L76A 2KRRA 2F65A 2OUGA 4RNFA 1OQ3A 5F3ZA 2D3O1 3W63A 2FLOA 2G4BA 2ZKUA 3NMAA 3UCGA 1DQ8A 3O2IA 5KFLA 5F8NA 5I42A 4RWXA 1ZS6A 4CNZA 1I3OB 2CJYB 1RB0A 2JSXA 2OPRA 2DNKA 3RRHA 4NZ7A 5H9EJ 2L41A 3CDBA 2NXNA 4K5SA 1S1TA 2XS7A 2P9EA 2ZDPA 5CAAA 4B3TF 1U02A 3SDEA 1JMTA 5GADU 1SH3A 1N0UA 1FKPB 4Q0BA 1FHTA 2HWTA 4I7FB 2VQFF 4EEYA 1S0MA 1VQYA 3I96A 1ZTWA 2V4JA 2M5YA 3MPVA 4KO0B 4OHYA 5HJXA 5LXRA 1NJIT 5CYJA 1XNQJ 1X9WA 3KMQA 1NMEB 1UPMB 4Y2MA 3G9CA 3R7SB 1DARA 2GS8A 2MQLA 2VKRA 2B4PA 2M7SA 4ZPVR 2DNOA 3CCRS 5HQMA 2WW8A 5HANA 3UD4P 1JK9B 3L3CA 2D9OA 4P72A 1JLBB 1WC1A 3U7JA 7FD1A 2COLA 3D67A 3NAIA 1AW0A 4B3SJ 3UCZP 2ZHOA 2F1FA 4LVNP 4URSA 3M32B 4ETZA 2ZUGA 3S1TA 2OI2A 1WF2A 2CQ4A 3GQCA 2FJDB 2O3DA 1NB7A 2QL5B 4RUHA 2AYGA 2A3JA 3ISNC 1RQ0A 1L3TA 1AB8A 4H4KA 3KFWX 3IBWA 3H8YA 1CG2A 2MZTA 2DIUA 4UQTA 3DOKB 1WG4A 5BXIA 2CQ3A 3L95X 2WCXA 3CJ0A 3L4BC 1L3VA 4ENOA 3I4PA 2HAIA 5F8IA 4TVAB 1KQSR 2HK2A 5D0EA 5IT9Y 3CO0P 3KG1A 3V6JA 3W5ZA 3TOQA 3MTJA 4O3OA 4RO0A 2WZ1A 4ED0A 5C42A 3IXQA 2MQOA 2KT3A 4WIIA 4NL5A 4PQAA 2AD9A 4DPWA 1DLOA 4I1TA 3DRSA 5HP1B 4NCBA 1Q79A 1WC0A 1L3SA 5JUMA 4LJMA 4ZJLA 2VOPA 4DSFA 1O5JA 1RT2B 5KFVA 2QE5A 3GJQB 2JJ4D 4I0WA 4J90A 3W62A 2IDLA 1YBAA 3GIKA 3CULA 4KIAA 1S5ZA 3D6HB 3WIUA 4LF8J 3C16B 1NPPA 5KT4A 4OYPA 1FXLA 3J7AN 2AEJA 2E44A 4RW9B 3BSCA 2A18A 3KK3B 3OHAA 4DFKA 3NNHA 1N52B 3JAMU 4M5LA 2Z2LA 1JXVA 1DJ0A 2L08A 5E3QA 2HYIB 2BJ1A 2DNHA 2XS5A 2E5JA 1ZPVA 4WP8A 1HBMB 4ERDA 3MR2A 4J9SA 3IN5A 1F2HA 5T14A 2QLWA 2MKKA 1UEKA 4B08A 3SMZA 1NJYA 4RW7B 2NS1B 2VFTA 1V6HA 5BYSA 1S76D 2ZH2A 2ZOGA 4OHZA 5M2RA 1TKZB 4DR2F 3IM9A 1IQZA 2ILZA 1YIJS 4AUKA 2MKCA 4DXLA 2BA9A 1PIEA 4M5DA 5G4DA 4F8RA 1RT6A 4L3NA 1RCOB 3M8PA 2OFHX 1JLAA 3I5BA 3BB5A 2FHJA 5H9FJ 2GJFA 1VLOA 3G6XA 4UZCA 1RHUB 2HBQB 2F3JA 4R8UA 2HMIA 1YZ6A 2KDOA 1IUJA 3N9UC 2AGQA 5M2UA 4EUVA 2XMKA 2GVZB 3PYFA 1YVFA 4DL5A 3QGGA 4B9UA 1QDUB 4JI0F 1U1OA 2B43A 3KLGB 1FK9B 1KVKA 3SXLA 4Z37A 4ZA1A 3OJSA 3M2UB 2MEWA 4EBEA 9RUBA 4YB1P 3VZHA 5B7WA 3DXBA 4KFBA 4DQQA 1Y11A 2GAHC 3RZAA 5HN0A 1HBOB 3NKYA 5IWAF 3HHLD 1XR5A 5J2QB 1RZMA 5KG5A 1KD1T 1Y3JA 4DX5A 5T7LB 1U2CA 2VV5A 3HP6A 3QWUA 4LUBA 1TK5A 1LWFA 4NXMF 4BHQA 3N6LA 2E1RA 1OY9A 2VBWA 2ATLA 4MJKA 1XBWA 3PJXA 3MR5A 5M2PA 1RT5B 2NUUG 2JFDA 4U96A 3SCLE 5ETQA 1X4GA 2H1YA 1XK8A 2EG1A 4NWBA 3CCVS 3D1HA 5A8KB 3SI8A 2E9RX 3NCRA 2Q6CA 1BQNB 2B51A 3QAUA 2RRAA 1NK7A 2ZOMA 2QC3A 4N47A 1IWGA 2AEFA 4Y0FA 2KO1A 2DXFA 3UR0A 4O44B 2E1CA 2PMWA 4HH1A 2DRDA 2VOOA 3RGIA 1H2VZ 4H4MA 2FLLA 2VU5A 4IOBA 3IRXA 4ELUA 5KG4A 1IKXA 3KDNA 2FGCA 2HS4A 2UXBJ 2DNMA 1B0VA 1NSKL 2EC2A 1W7WA 4X62F 3UN2A 3K5PA 4P2SA 3DI6B 4JBCA 3UDCA 1YJVA 5F0UA 4LF6F 4JI8J 4JI6J 3NP5A 2JC1A 1B0PA 2POKA 1NM2A 2VKZG 2LU1A 4U9RA 1RBOB 1RT1B 2ROGA 4UQGA 4HTIA 3ETMA 2BQUA 2ABYA 3ZZOA 2ZJPQ 3H42A 2ZZTA 4P6QA 2XMTA 5IFMA 1RT4A 1KTQA 4Q5VA 2GIQA 3UQSA 1MROB 4QPTA 4EO8A 3W2VA 2OKQA 3KLFB 2DKOB 4DHVA 4U8YA 2B8QA 3HVTB 5HVHA 1ACMB 2Z58B 1UVJA 3MCOA 4L3KA 2E9TA 2HBYB 4WBFA 4ECRA 3U02A 2EFPA 2R2TA 3O6QA 3GONA 2UZAA 1V3SA 3CJTA 1SVDA 1ZM3A 2F4FA 3QMQA 2M0GB 1TK8A 3GCWP 3M30A 3PJ9A 1EETA 1Y4ZB 4IO1A 2J9EA 2BXJA 3I0RA 2CQCA 4NYPA 5U47A 3G82A 1FESA 2Z30B 4LF5J 3D3CJ 1XMQJ 1PILA 4TQSA 4RNHA 4LRCA 1JJ2R 3T19A 5E33A 3WZ0A 1UW4A 1WC6A 2UV8G 1ZYQA 4PQUA 3TUIC 4O3PA 4DS4A 4EI2A 4NLRA 3A3NB 4GVLA 2YNGA 2XO7A 2FD2A 3G8QA 2F4VF 3GWCA 5KG1A 3OSNA 3UCUP 2Y1RI 2DRAA 2YX1A 4J91A 4I67A 5A8WB 4DPOA 1E6VB 4QR0A 4OHXA 4ZP6A 2OLWA 2XHCA 3CJKA 5KFCA 1AYEA 2MB0B 5D15A 3M1VB 3QJLA 1TKDA 3KJNB 2KH9A 3CJ2A 2IRXA 1JJHA 3CJ4A 1YITS 1Q81T 4DV1J 1U25A 3MM7A 3KG4A 3CT9A 1EX8A 4AXJA 3FRZA 4ILRA 1N56A 2W4PA 3HPOA 2QLBB 2LEBA 1U8SA 2FQQB 2DGSA 3IWXA 2KL8A 2FVSA 1URNA 5C24A 1X4FA 1VRTB 3F41A 3G86A 1HNIA 5D4OA 3MEKA 3HHNB 4DV6F 3NGKA 4CQ1A 1PYSB 4DR6F 1CLFA 4P52A 4DZ6A 2W8KA 4B3TJ 1HWJA 4DFMA 5LSOA 4KKOB 2Y1LB 4F4XA 4QCLA 4ER8A 1GTHA 3HFZB 3WX4A 3D54A 1NAQA 4YP3A 1ITPA 3ENWA 1Q1KA 2VQFJ 4DV5F 1LWEA 3MM6A 2QJ3A 2RF2B 4OLPA 2GO9A 4IG0A 2RB7A 1J2VA 5IS2A 4O3NA 2B7CB 3SCKE 3FQKA 1S6OA 5ETPA 1UEVA 3P5TL 3DKDA 1TU0B 2DISA 2KXFA 1KFDA 3PW5A 4CH0S 2DY1A 5L1JA 4ES3A 3DLEB 3O44A 1LK5A 4NLPA 2GCFA 5J1NA 1R8HA 4Y00A 5K8OA 1EB0A 1CULA 2QSWA 1LXNA 1G3OA 2PC6A 4AQYF 5HQ8A 3M2RB 1KONA 5D3GA 1L3KA 2IA0A 5HQLA 1VOMA 4FNIA 4FZVA 2C3YA 2VH7A 2A2DA 2BOPA 5IM0B 1LFPA 2YTCA 2K3IA 3BQ1A 3QGPA 4OX6A 3TAMB 1K73T 1Y5LB 3TQ1A 2WSCC 2HKEA 4CLPA 3VZIA 5EX0A 5H1SV 3CMES 2FZKB 5C2GA 4EFAC 3QWPA 3TRGA 5J2PB 4OZNA 3PW7A 3EUNA 4KR0B 5CYQB 1RXOB 5LMUJ 2IDEA 2C3MA 2MLZA 2QLXA 3AB4B 3AT1B 5GAGI 2A2CA 4IDKB 2LMIA 3TJAA 1FNOA 1FI4A 3KTQA 2PMZD 1RTZA 2B8PA 4ES1A 5FDLA 3QIPB 1CJVB 1VC5A 2HBRB 2A6MA 1U2RA 1QM9A 5EWEA 1UWAA 2UXCF 3KLIB 3Q8SB 3IBCB 3G8TA 4LF4J 2UU9F 4WXOA 4O3RA 4DPYA 3LWMA 2W01A 2HIQA 2HFNA 2J9DE 3MAAB 5K8MA 2AV5A 3NCPA 1F9EB 4X66F 4J9UE 3J81Y 1N33F 2R8GA 4KB7A 2CQIA 4D3HA 5B0EA 4IRCA 2CNKB 3LP1A 2VBZA 3D3BJ 4JP8A 1AT1B 2AX1A 4F3MA 1T7PA 1QE1B 2BYCA 1Y5IB 1XMOF 2BQRA 3KOAA 3AB2B 1C0UB 2LEAA 1OWXA 2ZE2B 2XY5A 1CJTB 1N34F 2GV1A 3MTKA 4OI4A 1TV6B 2KRBA 4NLOA 1DTTA 3CJ5A 1BWEA 2R2RA 4X4PA 2P5VA 1BUXA 1QJHA 2FZCB 2RRBA 4N7TA 4WTOB 3VVTA 4DR2J 5IC6B 4ZVOB 1RWVB 4N56A 1RTHA 3RRGA 4OJGA 4JI2F 3FSYA 1WWHA 1VIXA 4X4RA 4KT0C 4QIFA 1U0HB 4P9SA 1KNZA 3K2YA 2O5DA 4B9VA 5J1EA 2FY1A 2FZGB 1Q8KA 2KXHA 1VQPS 1VJWA 4W92B 2C22A 1FNXH 1TK0A 2ZJRQ 3GV8B 3GFYA 4JI0J 4FVCA 5DQIA 2YNHA 2DXDA 1HWKA 4FF1A 3RB4A 2C1EB 3KK1A 4JI1J 5IXUA 1D3WA 4KH0B 3MWBA 3IO1A 1KVIA 4FDFA 3GR1A 1S10A 1S7HA 2CDQA 3DMJA 2L3MA 3PG9A 2B0GA 2VASA 4CI0B 2C3OA 1CS4A 3MM8A 4TY9A 4DQIA 4DSLA 1JIHA 5IT0A 5BYQA 5IWAJ 3CEDA 1M5PC 4ICLB 2EFNA 1NKCA 4GO7X 2VPXB 4DUYF 5DG8A 3K57A 3UPFA 2LKZA 4C8KA 2VPWB 1FKOA 1LFWA 2GVDB 1LK7A 3A1YG 1S6QB 2XMWA 2HRYA 2CQDA 2DY9A 2ZEJA 5LM7E 5C7PA 1NU4A 2AJFE 4KH1B 2E5HA 3OXFA 1IKVA 1WOPA 5HJYA 2Q1LA 3ZXWA 4A8QA 4RBVA 2ZBCA 5ETKA 2QL7B 5A8RA 2CPXA 2IMOA 4K0KJ 2WB4A 3OL9A 4K7QA 5IZHA 4EWTA 4IR9A 1MG7A 1UVMA 5DRKA 3BV8A 3M6WA 4USJC 4QWDA 2BANA 4O4RA 2YWWA 4QYZK 3NBPA 4EZ9A 3HDSA 3DGVA 4A47A 4DQRA 2AJ4A 3OTDA 4TU8A 1X4HA 4JI4F 1T9XA 2A10A 2AYBA 3PJWA 3PV8A 4ED7A 3NLCA 1OQ6A 4U6PA 5MAOA 4LSNB 1GK8A 3UE2A 1TKTA 2QA1A 1FTRA 3DM2B 2FPHX 2VL1A 1RTDB 2UVUA 3TA0A 3MD3A 4LF6J 1GT8A 2CPJA 1F9FA 1X0FA 1HW8A 4KYZA 1D8YA 3T5JA 3BH7B 1TFWA 2GJ2A 3C8YA 4YFUA 4OYZA 1I1GA 1X4DA 2WONA 5KFYA 4WF9Q 4MKAA 2XMUA 1SKRA 2RNEA 2MYFA 1FRMA 3DLKA 2BJ9A 2YVSA 3KUGA 4A8XA 3LUYA 3FFIB 3K59A 1SJQA 2ADBA 2J76E 2GFFA 2AGOA 2I1RA 2VFRA 4I4BA 4OYOA 2XULA 1M1GA 1UA1A 3CSKA 1N5TA 3R5BA 3ICLA 3MFIA 2VG6B 5DQGA 2LQ5A 3IFEA 2W7PA 1KQFB 5FD1A 2OAUA 5KFOA 4PWDA 3HFVA 1HI8A 3PFEA 4Y65A 3PACA 4HHJA 4DJBA 1Q95G 4DLEA 1RTJB 2LU2A 1MU2B 5DZ7A 1C2PA 3HULA 1S99A 4WFNQ 2ZKTA 1NSQA 2PIIA 2W25A 4FYWB 3PHTA 4P2MA 1FFWB 1FERA 2R42A 4N76A 3DU6A 2YKQA 4I2PA 1WOOA 1H38A 2WW4A 3H2VE 1S9GB 2D41A 2EG2A 1B7FA 3IMQJ 2QO3A 3UD5A 1IKWB 2QL9B 2KT2A 3GZ7A 2NXEA 4O0NA 3MMCB 1TUVA 3HJFA 2IMWP 1NH8A 1YZ7A 5KG6A 3KK2B 3I4HX 3C15A 4FXVA 1S1UB 2ZFHA 3VAGA 1RHMB 1YJ7A 4X65F 1YSJA 4F3OA 4NCAA 3HSDA 2GNKA 2IM2A 2AHOB 5KT7A 3VWSA 2JRSA 1Q0NA 1UCNA 3EMTA 3MD1A 3FBCA 5JMNA 4KAIA 2O66A 3LANA 3ENAA 4PABA 4ZLNA 2AMCB 1VQ9S 2M9KA 3VAIA 1NPRA 1BY9A 1N0VC 1S59A 4ZIVA 3QRRA 3S7RA 1KLMA 2DVIA 4ECXA 3SBMA 1CJUA 4DCOB 8AT1B 1NZ8A 4FVMA 5HBMB 2UVWA 1FF2A 2H9ZA 2DK2A 5KG7A 4C48A 4OL8A 4WE1B 3JSMA 2DNLA 4DPXA 3MCSA 4DV6J 3MMAA 2JLGA 4PZVA 2Y0BB 4DR6J 2OSRA 2E7VA 2YX7A 3DHWC 4FF4A 1MWZA 4KPCA 3VAKA 1PJ6A 1FWLA 2M8DB 3EYZA 3NG8A 2V68A 3T9ZA 2QIFA 4DV5J 2HNYB 4ZHRB 3N01A 1UTAA 3OTBA 4CIOA 2AYMA 4C2MA 3OFHA 1D09B 4UT4A 2CIMA 1SH2A 1YBUA 2FVRA 3TX8A 3M9OB 3Q8RB 3KWMA 3JYTA 1HHQA 1REGX 2K1RA 4O4GA 3AHPA 3F56A 4QU7A 4DV2J 5DGAA 1M1HA 3VQTA 2E5GA 5KG3A 4AQYJ 4USHA 1RK8A 5ADZA 2JNJA 3R3TA 2RUGA 4ECZA 1QLNA 2ZZMA 3V81A 2GIRA 4J7CA 1Y3KA 1W2IA 2RQ4A 1XERA 8RUCA 3TZYA 1H3DA 3DN9A 3M8YA 4YOEA 4PUOA 2OPQA 5I42B 3KNGA 2FJXA 5FIIA 2OPRB 2PI4A 2Q79A 1SKSA 1ZAXA 3UN5A 5HO4A 3OFEA 1S1TB 1F5CA 3SFGA 2W2PP 4PXBA 3SDEB 1XTZA 1IM4A 4YHHF 2XZTB 3I87A 1UA0A 3D28A 3M7VA 5DM6Q 5EN1A 1JNRB 4Q0BB 1VGYA 5BYRA 1Y10A 2H5EA 3V2UC 1RHRB 4XIUA 4TLRA 5D4PA 2RQMA 2DIVA 2V4JB 4DV4F 4KGXB 4L73A 4CH1A 2BM1A 5FLXU 2LDYA 2CJKA 4DS5A 1QAYA 1CQMA 2A0FB 5D78A 5HAOA 1W26A 4OYBA 2UU9J 1KVJA 4K5RA 2NYHA 5KG0A 2VDIA 2Z8QA 1CJKA 2OHDA 2XSJA 4X66J 3E3XA 2WRMA 5E3CA 1VK3A 2IYGA 3PRVA 4NA1A 1RA7A 3T1HJ 4EMDA 4DSKA 3QATA 2AZ1A 4IFYA 1RT7B 3KJVA 3OR1A 3I56S 3J7YU 1E6YB 3R8YA 4YUDA 3OL8A 2K8GA 1C0TA 3AJ2A 3NGTA 1U24A 4UOFA 2MJNA 5GAHU 3TX0A 2WSFC 2WVEA 2XG8A 5L9XA 3RAMA 1WD6A 4IUFA 1XMOJ 1Q4RA 4LSLA 4CLZA 2ADCA 1HLWA 4NPOA 4ANCA 3O3LA 1FRKA 1SH0A 1N34J 3MAHA 2JDJA 3UFCX 1NDPA 3QSIA 1U6BA 1T9TA 3I5CA 2W7AA 3OR2A 4FF2A 2JOQA 3LPYA 1CC8A 4QW9A 3TUPA 1YWXA 3QNWB 2BRKA 2UVVA 4TYAA 2ROEA 3VGUA 1KWMA 2F9DA 2GAGC 3A3PB 3A8KA 2KKHA 1C1CA 1U7LA 2KM8B 2LYVA 2HHXA 3QZ7A 3DRSB 4OZ5A 3QPIA 2LXFA 1S1WA 2VG5A 1XMBA 4ANDA 4FYXB 4ZPCA 4R0JA 2ASJA 1KC8T 2ZBQA 1LW2A 3OFGA 1R0AA 2EFOA 1NBEB 3JB9k 1HMVA 5LMNF 1RAFB 2WSEC 3HX9A 1XNRF 2QFIA 4HVZA 2CNOB 4J9RA 2KHCA 2ASLA 1FNMA 2V9WA 2LLZA 4FXWA 2DT9A 4ZITA 4AE5A 1UJ6A 2W2NP 3RB0A 4QZVB 2YY3A 1S72S 3PTWA 4ZN1A 3L7PA 5KFRA 3T1YF 2R3VA 1LV5A 4P7VA 3RW7A 2EI5A 2RILA 4HH0A 4WKYA 4F7VA 3Q86A 1SC6A 4BS2A 2RUSA 4ECYA 3FKBA 3GLJA 3MR6A 1OY6A 4Y6IA 2DNNA 2N7YA 2DCUB 3PKYA 3B4DA 2JX2A 2VD3A 4J9LA 2KG0A 4USVA 1DURA 2DNGA 3EGZA 2MZ1A 2BKPA 2G0JA 4M5DB 1RT6B 3T5LA 1JLAB 1XJWB 1JNZB 4CO0A 1PAEX 3C6UA 1NKBA 2DHXA 4DPUA 2IJNA 4R8UB 2HMIB 1SJRA 1RYRA 3D1QA 2MZJA 2OO4A 2CAJA 2R7XA 1FKAF 2NSBA 1KRPA 4TN2A 2Z4PA 1Z1ZA 2OJ3A 1HYSA 5CCMA 5AXLA 3LWLA 2D69A 4M5NA 4M5KA 5KFDA 1TL3A 1DQAA 3KLEA 3FSXA 4ZPDA 2XZDB 2W1BA 3M9MB 3FRYA 3EZ5A 2P2CB 3BF4A 1MLAA 1S0NA 2JL9A 1WKLA 3P96A 2HS0A 1HHSA 2X51A 1HL6A 3ZZZA 2HHPA 1O51A 4ECSA 1SL2A 2QGFB 2KM8C 4KJIA 4ED8A 1WDTA 5DETA 5GMDA 1VQ5S 3PEJA 3TNVA 3UR3C 4JOUA 4OJ1A 4DR5J 1SKUB 2CQHA 2QMUB 3K58A 2B7BB 3KHGA 3D66A 4JYAJ 2KJVA 1NDCA 3AODA 4ID5A 4RU9A 2I2YA 1TMMA 3GFXA 4C8NA 2DGUA 3AQOA 4M63A 1FEEA 5D8HB 1PC4A 1YX2A 3DRXA 4MYTA 4NI2B 2KFYA 2OD4A 1IBCB 2CKWA 1RBAA 2HW3A 3CJ3A 4CYUA 5KG2A 5D6GA 3PNIA 1NJZA 4WFBQ 4QQBA 5ETLA 1JXLA 1VRUA 3LP0A 2MY8A 1DTQA 2HEKA 1HI0P 4H4MB 2DHHA 3D0GE 3IRXB 1YDLA 4DQPA 3TARA 4ZVPB 2RQCA 1IKXB 3NEKA 3T6BA 2HQIA 3PYDA 1UJ4A 4DR1F 2GGPA 2YQ0A 1TUWA 2XYHB 2RS8A 2V8DA 5AJ3F 3M8WA 4DF8A 3BDEA 1RT3A 1A7GE 2DR5A 2IM0A 4TNOA 1U0SA 2IA6A 2G9OA 2FJAB 4OIXA 4LFBF 2IVMA 4ID8A 4NLYA 1J5OA 1RT4B 3GCXP 2AZ3A 5CYMA 2WOMA 3W2VB 1IBKJ 4DSIA 4ETXA 4ECVA 1EKSA 1QTNB 1T03A 2WAQD 3L09A 2V8VA 1JLEA 4ZPTR 2MPUA 1X5SA 4JI5F 2EPIA 4PG4A 1T9VA 4C97A 1HHTP 5DO2A 1Q82T 1GTEA 2J7KA 3ZZRA 3FEZA 1SXLA 4V19J 5HROB 3PW2A 4WXWA 3VAFA 1P6TA 1S4EA 5HK4A 1D9FA 3CC2S 3MURP 4GRSA 3M30B 4I6WA 2R8JA 5HMYA 3QGIA 1EETB 1UFWA 3BSOA 3CGIA 1SC3B 3G96A 3E01A 2CXEA 3D6FB 3HD1A 2O01C 1N48A 3G82B 5I3PA 2X3DA 2NR0A 3NWGA 4MIAA 5KFXA 2CVEA 4PXEA 3BYRA 3FMWA 3NS7B 3RU0A 1NPKA 2Z2ZA 4MK9A 4N5SA 3Q8PB 5C5JA 4PQUB 2EVZA 4UOCA 3ENVA 1FWKA 1LWCA 2XGQA 2DH8A 2YNGB 3P45B 3OBIA 1V3ZA 2ZBIA 1PAUB 1T8EA 4NLWA 1IBLF 3QYYA 3DDNA 3GB0A 5AE1A 1OSCA 4B9MA 2CPEA 1UEUA 3UO0A 4LQ9A 2JFKA 1EP4B 3CJKB 1VQNS 2OTJS 1F6TA 1B4SA 4QWCA 3W3SA 3D2WA 3PRDA 1WHVA 3MM7B 3BR8A 4WYWA 2PEBA 1S6UA 3V6DA 5HL7Q 4RW8B 2HLUA 2D9PA 3ET6A 3QLHA 3AJDA 4NLTA 1QVFR 4M1KA 1BXNA 2ACYA 3B6BA 2PD1A 1X4CA 3EDQB 1HNIB 4Q8FA 4DR7F 3TVKA 1JQGA 3V4MA 4FKYA 1VQ6S 4YHHJ 2APOA 1DBDA 2NPFA 2EKNA 1S6PB 4RW4B 3GSDA 1T9UA 1NK0A 2H48B 4DI6A 2XWYA 1XIQA 5A2QY 2KN4A 1LWEB 3MM6B 3PFOA 3HF5A 4R5PA 3RYLA 3CB4A 2HVIA 2Z2MA 4QYZJ 3OT9A 2IVYA 4E98A 1HBUA 2N3OA 3ZO7A 2CPYA 3N6MA 3CJSA 4OYMA 4QR1A 4OHWA 3PR4A 3CDUA 4I68A 2I6WA 3X1LB 1S48A 4F2SA 2C2KB 4UF4A 2VIHA 4N77A 3IA0A 1K0VA 1X8DA 1RBLA 4UUXA 1DZ5A 3MDFA 5AXKA 1CULB 1SUQA 2WVBA 3KHHA 1S9EA 2OMLA 3LA0A 4I6YA 2CPIA 4J9PA 4OYIA 4OV1A 1FD2A 3W8PA 4H4OA 2DGXA 2AQ4A 1VC6A 2VFVA 2RAQA 5HP1A 6FD1A 3BBCA 2V94A 2D3OR 3U1NA 5KT2A 3KNAA 3PY8A 3H0PA 4LF7F 4YS2A 2DEJA 4JI3F 1N5YA 3SV4A 1HARA 1AZSB 3G87A 4IH5A 2PDAA 4BLGA 4ZP8A 5HATA 4DUTA 1QD1A 1YJRA 2FJBB 3CD5A 3OD2A 4C11A 4E8UA 2BOAA 2PT0A 3KK3A 4LREA 2RDDA 5KFJA 5L1KA 4IH6A 3TZZA 3PO5A 4N41A 1B0TA 2YWKA 1SJ1A 1Z2LA 1RGVA 2J8SA 5FDLB 4EYIB 2YKNA 2LXIA 3H2UB 5KFZA 1M5KC 5L46A 1WKJA 2I5JA 4USIA 4GC7A 5KTQA 1HQUA 1ICEB 4DL7A 1K47A 1NK5A 2EFVA 3QT5A 1XNRJ 2AJQA 3DOMA 1YBTA 3SQGB 3CD0A 3IWLA 4CT9A 1SPBP 3S6EA 2KYZA 4DUZF 4ZMMA 4Q44A 3G71S 3RB3A 2XI3A 3ISND 3LP1B 2VFSA 1VBYA 2BE2A 4DL2A 1JXEA 4C0OC 5JVGQ 1CPZA 1KOOA 3S01A 2ILYA 3D4JA 3OPKA 3MM5A 1IBMJ 1Q7YT 4X2BA 2HHVA 3DLBA 2UUTA 2ZDOA 1SIZA 1QUPA 1NSPA 3BEGB 1RYSA 3T1YJ 4Q43A 4X4NA 4TQRA 1KS2A 4NLVA 1FRJA 3OLAA 1M0SA 3DLJA 2RH3A 1DTTB 4FXDA 1NEEA 2I38A 1FDBA 1UVIA 3RTVA 5KFEA 3CCMS 1WEYA 3NXZA 2LEPA 4J9NA 2O67A 4Z2XA 2ZNZA 3ZZTA 3HK2A 4CTAA 2DXEA 1UVKA 2VDHA 2HURA 1YHQS 3BN7A 2ZBPA 1RTHB 4NYZA 4LF5F 2P6SA 3X3UA 1KOHA 5J2QA 4ZVHA 3K8VA 2YWFA 2ZUAA 3HI9A 4RU2A 4K50A 4MKBA 2C3UA 1EARA 4ZCLA 5EDWA 2JZ5A 3GV5B 5J1EB 3BS9A 3SV3A 4XPEA 3TVZA 1YJTA 4C7QA 3RBZA 3GYGA 2J9CA 3Q24A 2PN6A 2YNHB 2F8HA 2XQCA 3ISZA 3M05A 4LRBA 1WC4A 1QSSA 2HQGA 3DMJB 3MPWA 3PKMA 3A8IA 4ED5A 1C4CA 3MM8B 2QFJA 4A8WA 1S77D 5EGYA 2N4DA 1YQHA 4DV1F 1RHQB 3IBFB 1GH8A 3HHLA 3D6TB 1KHVA 1FKOB 4IKAA 3HSZA 5L9NA 1YJUA 4CO5A 1YLXA 2MZRA 4NLUA 4WFAQ 4LFCJ 3T3FA 1IKVB 3PDNA 2W4DA 3T5KA 2W24A 3ONQA 1V3RA 1UZHA 1F3FA 4DX6A 4I69A 3RBDA 5A8RB 1REVA 1YGYA 4KGMA 4YEAA 2G2YA 4IFVA 2YNFB 2J6TA 2XLIA 1S0VA 2B9XA 1H2TZ 2WTFA 4ZVQB 2BJ3A 2KXNB 1IR0A 1WUUA 4TU9A 1RAIB 3GILA 1Y5NB 4USTA 4YQWA 3NBPB 3KLFA 4YR2A 2VJUA 4GVBA 4FYVB 1P1TA 4DQSA 1MWQA 3MFHA 2HFSA 1N6QA 1I6JA 2EKYA 3CCSS 2NLWA 1JLCA 3Q8YA 1F5BA 5F8LA 4DR1J 4WZMA 1MN9A 3R1HA 1RAGB 3WDOA 3MPDA 3BQ2A 4BDPA 4RNNA 3H5XA 5AJ3J 3QBCA 3K89A 4DX7A 1FJCA 5F0WA 4KV8A 3NAHA 2ZBRA 4DL4A 2P6TA 1NJXA 2P8IA 3TQEA 1IVZA 2GQQA 2MZQA 4LFBJ 4YDDB 4RPFA 2HVEA 2PEHA 3ILLA 3DLKB 4A8YA 1RLCL 4F04B 2L9NA 3CE8A 3VAJA 3HZGA 3KLHA 1K1SA 3PCOB 4EK2A 1Q5VA 3CD7A 4JI5J 5HVFA 1DAXA 3SCJE 1EHWA 2G2OA 3P4UB 2LA4A 1JLQA 3CXCR 1RADB 5LMUF 3GYNA 1LOUA 3BPSP 4HLBA 5GAGU 2VBXA 3FDSA 1IWAA 1GXTA 3MEEA 3MPUB 4PWDB 1LQ9A 3EWGA 4W98A 3CVKA 1D9DA 1ULRA 4ZP7A 2D74B 4W90B 5E2QA 2BJEA 1N32F 1WHWA 1RCXB 3U1LA 5DLGA 2DO4A 4CO4A 1JLFB 1TKXA 4ZJOA 1R3NA 4LF4F 4GC6A 4I2PB 3GP9A 1U2FA 2SXLA 4CZCA 1FT8A 3M6UA 4ELVA 3TWZA 4R0EA 4NEZA 1O6XA 1DQ9A 1VRTA 1IBLJ 1I94F 3C15B 2CPZA 2MKYA 2FGOA 3GYXB 1VISA 2EBGA 2ZH3A 4KKOA 2DRBA 4Y2KA 3AD9C 2K7JA 2V8HA 4I6AA 5B0FA 2HNZB 2R8HA 3TO8A 3OTOF 3HVWA 3R2DJ 1ZETA 3W2WA 1T9WA 3G4SS 1SB6A 3LALA 3PZPA 4G1QA 4N8NA 4OI1A 3H98A 1CJUB 4C8ZA 2XHWA 1SI9A 4YB5A 4MKVA 2CZ9A 4UW2A 1R31A 2Q66A 1FX4A 4LF1A 5HI7A 2XGPA 3PW0A 2HIYA 1HWUA 2L9DA 3ZTPA 1GNKA 3JSMB 1KP6A 1XEZA 3CCQS 4DR7J 4DCPB 3CCES 4IOCQ 3I5AA 1RAOA 2BJ8A 2B4OA 1NZAA 4OZ3A 2KG1A 3VTIA 3I0SA 3HZEA 2VG7A 4RUAA 4DX8H 3V4IB 3DGPA 4QYRA 4J9VA 4F4YA 3CD6S 4ZVGA 2OPSB 4CLWA 4KSEB 3BGOP 3C6TA 2QRRA 4ED4A 3DLLQ 2XMJA 2E29A 3D9BA 3BBBA 2ZWPA 2MQNA 3W60A 2BE7D 4L74A 3PX0A 4JI1F 2BKNA 4CLLA 1U8WA 2K1RB 5CYQA 1FRIA 4O4GB 2CDRB
chains in the Genus database with same CATH topology
5KT3A 3TI0A 4WKRA 2ZH8A 3T9ZA 2U1AA 2HS3A 3VQSA 4HI1A 2ZC3A 2KT5A 3HVRA 1VQLS 3G6YA 4Y28C 3BDPA 3H59A 2QIFA 3FZBA 1L5UA 4B3MF 3KG0A 1D9AA 2F8EX 4N8OA 2HNYB 2UUWA 4ZHRB 2LA6A 3N01A 3SQGA 4I2QA 5HBMA 3OTBA 4OI3A 3MOJB 5ITHA 3QIPA 2FLPA 5B09A 3V81B 4CIOA 2X1FA 7FDRA 4J9QA 1G7CB 1UWBA 2AYMA 4C2MA 3OFHA 1A6LA 1Q78A 1ZZNA 2CIMA 2IAJA 1SH2A 4TXSA 3ITHA 4WE1A 3FVYA 4FPRA 3QZ8A 3GIJA 2FVRA 3TX8A 5MLCV 4DL0C 4RNOA 3KLIA 2IM3A 5K8PA 2ZC4A 2HPUA 3PM9A 4HEA9 3M9OB 1HBNA 1R27B 2B5JB 3LP2B 3TA1A 5FLXY 1RT3B 3Q8RB 3KWMA 1KLNA 2YX4A 2C3PA 4PUOB 3JYTA 3CCLS 2OPQB 2B56A 3OQ2A 5F8JA 4DG1B 3LGNA 4F50A 2BM0A 1ZTTA 2XLJA 2K1RA 2FC9A 1XMQF 3CPWR 3J7A1 4O4GA 1ZZFA 2MHEA 5KFPA 4J9OA 3AHPA 3F56A 1T02A 1TAUA 4QU7A 1M5OC 5EHHA 3PX4A 5DGAA 3O5TB 1R6YA 2BRLA 4OZ1A 2ASYA 3DRRB 3VQTA 1FE4A 2E5GA 5CYMB 1S79A 2YKOA 5B0CA 4I56A 5KG3A 4K0KF 4USHA 3WBZA 1RK8A 1LKZA 2VA2A 1UJ5A 2CYYA 4FN5A 5ADZA 2HNYA 5CXTA 4B9SA 5A0YB 3I9ZA 4EU0A 5B0GA 4OI0A 2KZMA 2UVRA 3R3TA 4J5OA 1MMNA 2RUGA 2VPYB 4ECZA 3V81A 2GIRA 1QLNA 2ZZMA 4F4KA 2V8GA 1Y3KA 4OMFG 4JV2A 2D3ZA 1W2IA 2RQ4A 1N5SA 4WFYA 2FVCA 3N79A 4AL6A 1M5VC 1XERA 2FLLA 4JV1A 4LMZA 3BSAA 3M6VA 4WZQA 3ETOA 1QE1A 1FE0A 2D1CA 2XWXA 4QIEA 1H3DA 3FZ2A 5EWFA 3DN9A 3E2EA 1VQOS 2MQMA 1OPZA 2B5JA 3LP2A 1C0UA 3OTEA 5HMZA 4YOEA 4PUOA 1F60B 2GMLA 2OPQA 5I42B 4DG1A 3KNGA 1SL0A 1PGZA 1XWLA 1N54B 1NO8A 3MMJA 4CH7A 2PA3A 1TZ0A 2ZNYA 2FJXA 2F9JA 2M3DA 1IJEB 4ITSA 1OSDA 4Y3CA 3P49B 5HMXA 3MXHP 5FIIA 2OPRB 1HWLA 3TANA 3IWNC 4EBCA 1U47A 1QY7A 2PI4A 4ED1A 2Q79A 3RRKA 1SKSA 1ZAXA 3M2VB 5HO4A 3DYAB 2OP5A 1RTIB 3E01B 3OFEA 4C3MA 1S1TB 1F5CA 3SFGA 3PO4A 3HM9A 4PXBA 5DJBA 1U1LA 2LDIA 2K2PA 2NXUA 5I4MA 2XC9A 4XPCA 3SEOA 5EWGA 2OSQA 2XS2A 3SDEB 1SIWB 1XTZA 5A0YA 3H5UA 1IM4A 1R89A 4YHHF 3I87A 2JH3A 2ZH1A 2FVQA 2A1BA 3CO9A 3SSQA 3UDLA 4NMLA 1UA0A 5K14B 2J0XA 2ASDA 3D1OA