3KK1B

Hiv-1 reverse transcriptase-dna complex with nuceotide inhibitor gs-9148-diphosphate bound in nucleotide site
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
427
structure length
412
Chain Sequence
b'PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase p66 subunit
publication title Visualizing the molecular interactions of a nucleotide analog, GS-9148, with HIV-1 reverse transcriptase-DNA complex.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
total genus 113
structure length 412
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kk1B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk1B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk1B03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk1B04
3KK1A 3PW0A 3NBPB 3HVAA 5KFWA 5K14A 1HNVA 4PWDB 5F9LA 4QWCA 3M9MB 4I2PB 5F8MA 4TY8A 4F4ZA 5L1JA 4RW4B 4U6PA 1RT4B 3G6XA 4J9NA 1RT7B 4R5PB 5HROA 3DLGB 5KFUA 1IKYA 4TY8B 3PW5A 3BREA 3PW2A 1LWCA 4IFYB 4YR0A 1IM4A 4ZHRA 5CYMB 2ILZA 4WXWA 4IRCA 1UWBA 3IS9A 3LAMA 1KHVA 5EWGA 5L1IA 3KJVA 5KT5A 2VG6A 4MIBA 1LWFB 1BQNB 2IAJB 4I7FA 5KFRA 4IFVA 5DG8A 4ECQA 1N5YA 3DYAB 4NLRA 3Q8QB 1R0AB 3CJ0A 1FKOA 1TVRA 5J2MB 1UWBB 3IS9B 1RT2B 3HHKA 2OPQB 4J9RA 1S10A 5HBMB 1S9FA 1S6QB 1EETA 2VA2A 3DM2B 1TKTA 5KT3A 1FKOB 4Q0BA 2B43A 2BRKA 4G1QB 2OH2A 3MF5A 2ASLA 3QGIA 1QUVA 1JLEB 1TV6B 3DOLA 1S0OA 3H5UA 4WYLA 1S4FA 3CJ3A 1TKTB 2JC0A 3MEDB 4R8UB 4Q0BB 5KFMA 1SUQA 5L1LA 3JSMB 2C28A 4FS2A 4URGA 4DL2A 5KG4A 4KBIA 1C1CB 4KO0A 3KLEB 3CWJA 4DL7A 2WHOA 4NCGB 1RTJB 2XWYA 4GC6A 2HMIA 4F4WA 1S49A 2FLNA 1RT3A 3KMQA 5I42A 3PR5B 2CJQA 3KLIB 5J2NA 1RA7A 2UUWA 4RNFA 3BQ0A 1JXLA 2UUTA 3IRXA 2YNIB 2YKMB 4KO0B 3JYTA 4RUAA 1HQUA 4H4OB 5EWEA 5C24B 3H2LA 4ZMMA 5KFHA 1RTHA 3LANA 3BR9A 5L1KA 4ED1A 5J2NB 4ZP8A 1XR7A 1S97A 1RTDA 3TVKA 1TL1A 2ZE2B 1U09A 1JKHA 1LW0B 2RKIB 1ZETA 5KFEA 1T3NA 2AX0A 1IKXA 2ALZA 3MECA 1VRUB 3BSNA 1HYSA 1N56A 3KOAA 2XC9A 2VG5B 2W7OA 4KHMA 4EEYA 2YNFB 3I0SA 2HNDB 3E01A 5DGAA 4KB7A 1KLMB 1FKPA 2OPSA 1BQMB 3FFIA 4IR1A 2B5JA 4ICLA 4X2BA 3KLVA 2O5DA 5KFXA 4RZRA 5KT2A 3V6DB 5KT7A 2XCPA 2WTFA 3GV5B 3BQ2A 1DLOA 4RW7B 2IJFA 2CKWA 3QZ8A 4J9MA 4LSLB 1ZTWA 3CIZA 2AWZA 2J6UA 1RT6A 1HMVB 3DLEB 1JLGB 1S1VA 2YKNA 3T5KA 1IKVB 5C42A 3KHHA 2C2DA 2IBKA 2R2UA 3Q8PB 4ZVHA 1S1XA 4O3QA 5KFCA 2FLLA 3G6YA 3NKYA 1S1WA 3OLBA 3DRSB 2AX1A 4J9LA 4ZP6A 2HNYA 3I0RB 1VRTB 3KHGA 1RT1A 3GQCA 4O3SA 4H54A 3N6MA 2ASDA 2DPIA 5I3UA 2VG7B 3MEGA 1QE1B 1T94A 5KFPA 2WONB 1RA6A 5KG1A 3HVWA 5J2QA 2RDIA 4ZVEA 5J1EA 4I2QB 3RAQA 4QPXA 1RDRA 4WFXA 3KK3A 4ECZA 1RT1B 4RW9A 4RUCA 4MFBB 3CVKA 4WFZA 1IKWA 3LP2A 3MEEA 3CDUA 1S9EB 3UPFA 3T5JA 1RTIB 5C5JA 1C0TA 4KHRA 4ED3A 4Y3CA 3DI6B 3Q8RB 2JLEA 3BSCA 4IG3B 1W25A 3MEEB 3H40A 2BE2B 1S6PB 1LWEA 4ECVA 2I5JA 1MU2B 1RYRA 2OPRA 3HVTB 3NAIA 1DTQB 1SV5B 4RW8A 3M8PA 4RW6A 3IG1A 4EO6A 3M9NB 4IDKB 3H4DA 2XGPA 4IOBA 4DG1A 3NMAA 1T05A 4URQU 3D5MA 5FDLA 3FDSA 3SFGA 3KK1B 4KV8A 1HNVB 5K14B 3FQLA 5DG9A 5KFFA 5KFJA 3Q8SB 2BQRA 1HQEA 4ED0A 3I5BA 3RB3A 2ATLA 4ZPDA 4YR2A 1S0NA 5HROB 4FS1A 4PUOA 3E51A 4J9SA 5KG5A 4WXOA 4J9QA 1IKYB 1JLCA 1RT5A 3QO9A 4EBEA 1LWCB 4K4TA 3KNAA 1K1QA 4ZHRB 3RBEA 3CDEA 1NHUA 5J2PA 3KJVB 2VG6B 3V4IA 2F8EX 2J6TA 2I1RA 1OS5A 4I7FB 3TQ1A 4IFVB 5KFYA 2BANA 1N5YB 2R8KA 2ZKUA 4O4RA 1TVRB 4DEZA 3MR2A 1JLQA 2RF2A 2ASJA 4KFBA 5KT4A 4YQWA 1T03A 4IRKA 4NLQA 1EETB 5KFLA 5EUHA 4QWAA 3QLHA 1REVA 4ID5A 3KLFA 3H5SA 5JUMA 5KG2A 4FBTA 2VA3A 3DOLB 3CJ2A 3T19A 3OL7A 2V9WA 1D1UA 3DMJA 5D3GA 3C6UA 1SH2A 2D41A 3QIPA 2D3ZA 5KG0A 5KFDA 2W9BA 4K4SA 1REVB 3PW4A 2JEIA 1SUQB 3FSIA 4JUZA 3KLGA 1HARA 5KFGA 3V6JA 4Y2AA 3BSAA 2GIRA 2HNZA 4QW9A 4RNNA 3OHAA 4PQUA 4QWBA 3DRPA 2HMIB 2FVRA 4TYAA 2HAIA 2JEFA 1RT3B 4NLXA 5I42B 4Q43A 4K4WA 2IC3A 5DQIA 1TKZA 4ZPCA 3IRXB 4EBCA 3JYTB 1HQUB 3LP1A 2R8JA 3OL8A 4NLUA 2EC0A 1LW2A 4NLDA 3DRPB 2BQUA 2C22A 1HNIA 2FVCA 1RTHB 2IA6A 4NLOA 5F8NA 1JLBA 1TKXA 1JLFA 3NGDA 5L9XA 1TP7A 4Q45A 1N6QA 1RTDB 2XI3A 1TL1B 3GV7B 1JKHB 4F4YA 1IKXB 3MECB 5KFSA 1RYSA 4IH7A 3V6KA 1HYSB 3I5AA 4NRUA 3EPIA 3RB6A 4FBUA 3I0SB 3UQSA 1FK9A 3E01B 3IN5A 4HYKA 3TAMA 2IM3A 1NNDA 3GIJA 2OPSB 1FKPB 1QAIA 4MKBA 5KFBA 4WZMA 3FFIB 3KK2A 2B5JB 4ICLB 2AGQA 4WZQA 2WB4A 2GC8A 1DTTA 5HP1A 3ICLA 4F50A 4Q44A 2AQ4A 1DLOB 4IKAA 3DOKA 2IJNA 2JEGA 3NAHA 3SFUA 2DPJA 4O4GA 3ITHA 3KK2B 3RBDA 4MH8A 3BQ1A 4ED7A 1S9GA 2W9CA 2YNGA 4ZP7A 3NL0A 3DLKA 1RT6B 4IG0A 2HWIA 3GIKA 1S1VB 2YKNB 1D0EA 3ISNC 5DQGA 4ECYA 5C42B 2QE5A 4F4XA 4O4GB 3I5CA 4NLPA 1S1XB 1SH0A 1S1WB 3DLKB 1JX4A 3KHLA 4IQXA 5EDWA 2HNYB 4O3NA 4NLSA 5KT6A 3BGRA 5I3UB 3MEGB 2UVWA 2JEJA 1TL3A 4XPCA 5CYQA 5J2QB 3FQKA 2BQ3A 2E9RX 5J1EB 1C0UA 4ED2A 4K4YA 4QW8A 4KSEB 4R0EA 3MTKA 3KK3B 3C6TA 4U7CA 4ECTA 4O44A 4RW9B 4LQ9A 4LSNA 3T5HA 3KHRA 4NLYA 3LP0A 2R2RA 3H59A 3G86A 5C25A 3M9OB 1IKWB 3LP2B 3PW7A 3MFHA 3QYYA 1C0TB 1I6JA 4RNOA 4Q8FA 4MK8A 1EP4A 1HPZA 4NRTA 1WNEA 3RB0A 1LWEB 2WOMA 4ED6A 4JV1A 2OPPA 3KLHA 2E9TA 2I5JB 1JLAA 2OPRB 2XCAA 5KG6A 4RW8B 3M8PB 4RW6B 3IG1B 4WE1A 2W8LA 1EP4B 3NBPA 3MR3A 4DG1B 4PWDA 1T05B 2V4RA 5FDLB 4I2PA 4RW4A 4EYHB 2B6AA 4Y2CA 3QZ7A 4KV8B 5KFAA 4OL8A 1YVFA 1RT4A 5DG7A 2XGQA 3QIDA 4YP3A 2BR0A 4MKAA 2R2SA 2ZD1A 1RT7A 4R5PA 5DLFA 4JV2A 1HQEB 3DLGA 1C2PA 4K50A 5EWFA 2B6AB 1K1SA 4IFYA 5F8JA 4PUOB 1CSJA 3RAXA 1JLCB 1RT5B 5CYMA 3QO9B 5HLFA 2ZD1B 3IGVA 3KMSA 4MK9A 2C2RA 1LWFA 1BQNA 2IAJA 1TQLA 4ZPBA 5J2PB 3IGNA 3DYAA 4ED8A 1R0AA 3V4IB 4NLTA 4WYWA 3H4BA 2W8KA 4ECWA 1ZTTA 5F8GA 4K4ZA 5J2MA 5HLFB 1RT2A 2BANB 2OPQA 5HBMA 2R8HA 4DL3A 3M8QA 1S6QA 3UDLA 1N4LA 5DLGA 3HKWA 3DM2A 1JLQB 2FVSA 2UVRA 3VQSA 2RF2B 3GYNA 4NZ0A 4Y34A 4KFBB 3OL6A 1T03B 5KFZA 4G1QA 2V0NA 4IH5A 1XR5A 3GILA 2FJWA 1JLEA 1TV6A 3QLHB 4ID5B 3KLFB 1N48A 3M8QB 4KKOA 2IM0A 4IR9A 3QGGA 4H4MA 3MEDA 2WRMA 4TYBA 4R8UA 3BSOA 4YR3A 3DMJB 5D3GB 3C6UB 3OLAA 4IRDA 3QIPB 2R2TA 3JSMA 2W9BB 4QWEA 2D7SA 3FRZA 5DQHA 1XR6A 3GV8B 3EPGA 4B3OA 4KKOB 1C1CA 2YNHA 3KLEA 4H4MB 2W9AA 3KLGB 4NCGA 1RTJA 1S48A 4M94A 2UVUA 5F8IA 4YMEA 2HNZB 3EZUA 2R8GA 3KLIA 4PQUB 4O3PA 4RNMA 5F8HA 4B3OB 2V4QA 4O3RA 2IMWP 2YNIA 2YKMA 2YNHB 4JV0A 3OHBA 3BJYA 3PVXA 4H4OA 5KG7A 3LAKA 2IC3B 4TLRA 1TKZB 4ECXA 4ZVGA 5C24A 2D3UA 3LP1B 4K4XA 4WFYA 1LW2B 3N6LA 1C1BA 2ZE2A 5F9NA 1HNIB 4KAIA 4O3OA 3GIIA 4TQSA 4ECUA 4TY9A 1JLBB 1TKXB 1JLFB 4KE5A 1LW0A 4NLVA 2RKIA 4NYZA 5KFQA 3PJWA 1N6QB 4ECRA 3PZPA 4DL4A 4ZVFA 5F8LA 4RU9A 2R8IA 1VRUA 4EO8A 4Q8EA 3GIMA 1SH3A 2VG5A 3OL9A 3T1AA 3N6NA 1C1BB 2YNFA 2W7PA 2HNDA 1KHWA 2JC1A 3PR4A 2AU0A 1KLMA 2FJVA 1BQMA 3MFIA 2GIQA 2FVQA 3CJ4A 2XI2A 4IH6A 3T5LA 1FK9B 1GX6A 4RNHA 4EYIB 3TAMB 4TN2A 5KFIA 2AGPA 1Z4UA 3V6DA 3D28A 4TXSA 4GC7A 5KFVA 4RW7A 3MR5A 1J5OA 3DDKA 2RDJA 4QWDA 1DTTB 5HP1B 4LSLA 3CO9A 3H98A 1GX5A 3DOKB 1HMVA 1JLGA 3DLEA 3ITHB 4K4VA 4EBDA 1IKVA 1S9GB 2YNGB 2W9CB 1J5OB 4HKQA 1S0MA 4IG0B 4MIAA 2FJXA 2E9ZA 3V6HA 2BRLA 4J9OA 4DL6A 3DRSA 4M95A 2QV6A 5KFOA 2J6SA 3QGHA 3LALA 3I0RA 1VRTA 2WK4A 2UVVA 5KFTA 3CJ5A 2AGOA 2VG7A 1QE1A 5T14A 2C2EA 2WONA 3V81A 5KG3A 3SI8A 1JIHA 3BGRB 4I2QA 2ILYA 4K4UA 1TL3B 3H5XA 2FLPA 5CYQB 2IM1A 1C0UB 5JXSA 3OSPA 4ECSA 4MFBA 3V81B 3C6TB 2FVPA 4O44B 1S9EA 5KFKA 4LSNB 1RTIA 3UR0A 3OSNA 3DRRA 3LP0B 4ZP9A 3DI6A 5C25B 3PHEA 1S1TA 4LQ3A 4MK7A 4ZPAA 4G3IA 3ISND 4IG3A 3PJXA 5KFNA 4NLGA 3RB4A 2BE2A 1S6PA 2HWHA 1S1UA 4URSA 1QAJA 5DGBA 1MMLA 2IM2A 3H5YA 1HPZB 3DRRB 1MU2A 3CDWA 3HVTA 3MR6A 4DL5A 1DTQA 1SV5A 4XPEA 1S1TB 4XO0A 2WOMB 1NHVA 2WCXA 4J9PA 4IDKA 2OPPB 3KLHB 4TQRA 1JLAB 1RAJA 4NLWA 3G6VA 1S1UB 4J9KA 4WE1B
chains in the Genus database with same CATH superfamily
3NBPB 3M9MB 1RXOB 4L72B 4FP9A 2LA6A 3ZZOA 1UETA 2EKYA 4F4AA 5SUHA 2FJAB 1VHIA 5D4PA 2QL7B 2C3UA 5B7WA 1N8RT 1BQNB 2M70A 2VA2A 1RBLA 5A0YA 4U95A 4Q0BA 2YWGA 2ASLA 1CBKA 2QG9B 5JJBA 1S79A 3H5UA 3CJ3A 1CJVA 4B9MA 4C0OC 3KUEA 1KVKA 3ADAC 4DSIA 3KLEB 2BX6A 1TK8A 4DL7A 2DNRA 1XNRF 5I42A 3KLIB 4CYUA 4KO0B 1VOMA 1N34J 3BR9A 5J2NB 3OPKA 1KTVA 2DGQA 3VAJA 3CIMA 3T1HJ 3PY8A 2Z58B 2LQ5A 3MPWA 1FA0A 3D67A 4DUYF 2WW8A 2R7OA 4X2BA 2O5DA 2NR0A 2HQFA 1DZ5A 1HMVB 2GX8A 1IKVB 1YZ7A 1M5VC 3OTDA 5GMKa 1VQYA 3LPEA 2E5GA 2MQNA 2Z2ZA 2MZRA 3KJQB 2UXCJ 2LQJA 4FYXB 3D0HE 4RUCA 4KGVB 4B3MF 1NKBA 2EFOA 2CYYA 1ACMB 2JLEA 3A4TA 2DGOA 3LQVA 2OPRA 1SV5B 4RW8A 3NMAA 1W2BR 1Y00A 3KK1B 3L7UA 4KV8A 4Z37A 2YKAA 1UP1A 2ZH6A 1BQXA 2QX0A 5C7PA 2CUYA 7AT1B 3EDRB 3MM5B 2J6TA 2KZMA 1OS5A 2DEIA 2F1FA 3QJPA 4N8OA 1NH7A 2W25A 2RF2A 2YQ3A 5KT4A 1QLNA 1GNKA 1RK8A 3H5SA 3C19A 2F4FA 2MZJA 3CB4A 3PYGA 2R7UA 3X1LB 3W8GA 1SUQB 4UUWA 4QWBA 1E6VB 2CG4A 5D77A 3LWMA 4NLOA 5K9FA 3NGDA 1RAOA 4A8FA 5ETLA 1URNA 4Y2KA 2V69A 2RH3A 1S57A 5E3AA 3UFCX 1YJ7A 3M8ZA 2R9LA 4MKVA 1DTTA 4RWXA 4B3RF 5B09A 1KQFB 1FNOA 3NAHA 5I3QA 1VRQC 2PA3A 4FDFA 4RR5A 3FGVA 3EMTA 3BPDA 1VISA 4OHWA 2O01C 5KT6A 1W26A 2J7UA 3BGRA 1UA1A 4PG7A 3OJSA 5A6WA 3IMQJ 4MYTA 2X3DA 1I51B 3BKFA 1EP4A 2XEXA 4C98A 1VI7A 1XNRJ 2OPPA 3NRBA 4GVBB 1PYSB 3MR3A 3ZNJ1 3HULA 4DMZA 4WU2A 4PUOB 2OI2A 3IGVA 2YY3A 2ZEJA 4DUYJ 3VV2B 3HHNB 3IAM9 3M05A 1X4BA 4ZLJA 5F0UA 2VFUA 1N4LA 3SQOP 1RHJB 1UPMB 4ELTA 2VOOA 2KT5A 5CA5A 4IRDA 3OLAA 5GADI 2H1YA 2E29A 3A3NB 3O44A 5A8WA 4EK2A 2HNZB 3J7Z5 2KN4A 1OMSA 3OHBA 2DEJA 4H4OA 1S72S 2IC3B 2CNLB 4OZ1A 4B3MJ 4WFYA 3C66A 1JLBB 1JLFB 3SQGB 2RKIA 1N6QB 1YX2A 4OYIA 3M6VA 3FEXB 4UZBA 3MFIA 3VCDA 2LEPA 1FK9B 4RNHA 3DU6A 4P72A 4PXEA 5KFVA 4RW7A 2NXUA 1VQ8S 1RWMB 3H20A 1UZHA 4K4VA 2E9ZA 2BE9B 1UA0A 2AEFA 1KFSA 5KFTA 3QGPA 1XK8A 1WC3A 2F4VF 2ZBRA 4YS2A 4QBUA 2V68A 1QAJA 4JOUA 1FX2A 2VFRA 1AT1B 4ID8A 3G6VA 1P8GA 4A8OA 2ROEA 1ZOTA 2E7WA 3PW5A 1LWCA 1UWBA 2UUCF 1LWFB 2ZH5A 1VDHA 1TVRA 3QJLA 3NGRA 4B3RJ 1SQEA 3M8RA 2ZOMA 2MY8A 2K3IA 4LREA 2AIRB 5H9EK 1Q8BA 1LXNA 4ZOSA 4NCGB 1FEEA 1RTJB 4O23A 3SEOA 2G1DA 2YNIB 2YKMB 4G6VB 1WSRA 2BJEA 1WG5A 2BKPA 2KHCA 3R5BA 3D54A 2VZ9A 4A8MP 3ZTQA 2YNFB 2H5EA 4UOHA 2LCWA 3SV4A 2B5JA 3KLVA 4YFUA 2WTFA 4DPXA 2FUG9 4LSLB 3M2RB 4X4TA 3I87A 2FLLA 2FHKA 2N3LA 4HHUA 3B78A 1BWVA 2R7QA 3CMQA 1N54B 1SC4B 5KG1A 1LK7A 4QCLA 2QMWA 4NA3A 1KQGB 4RL1A 4MFBB 3LP2A 4LBIA 2LXIA 5ETKA 5F0WA 1FF2A 4DN0A 1LWEA 3CULA 3HVTB 4HR2A 1I94F 4OHXA 3D5MA 4OX6A 3SFGA 2CPZA 2XWXA 2NREA 1FO1A 1V3SA 5KFFA 1HQEA 2ZWOA 4RBTA 5HROB 3ZXWA 1XNQF 3HDSA 2BANA 4DR6F 2PIIA 3PX0A 2VUGA 4Y28C 3TAPA 4KFBA 4F4KA 3D6TB 2KVIA 2VA3A 3T19A 2CQIA 5D3GA 3C6UA 2UU9F 3CC2S 4F3MA 4HT5A 1FXLA 3KLGA 3V6JA 5IT9U 2GIRA 2F4VJ 1A0OB 4BLGA 1X60A 2KT2A 1S76D 2IA6A 1RTHB 4JI5J 1AYEA 2A1BA 3GP9A 3EPIA 3AB2B 1R0CB 1ZM9A 2B7CB 4MIWA 5KFBA 3FZBA 2GC8A 2IJNA 3NL0A 1RT6B 4IG0A 2UUCJ 5C2CA 5C42B 4QR2A 1DARA 1JX4A 5EDWA 1QTMA 3W2VA 1DAXA 5J2QB 2HZCA 4K4YA 4LF5J 1N32F 4ED4A 2KO1A 4RW9B 1M1KT 1TK5A 3GFXA 2FHMA 1LEOA 3K57A 4GRSA 1JLAA 2XYGB 5H9EJ 1MN9A 2V4RA 2VPZB 1F5BA 1Q86T 4LFBF 2B9EA 3RAXA 4LVNP 2DGXA 5KOWA 3IGNA 2W8KA 4CI0B 5F8GA 2BE7D 1XMQF 5HI7A 4HL9A 4NZ0A 3D7SB 1EKRA 2ZBPA 1B7YB 2AYMA 1T3OA 1WC4A 2RNEA 5EGYA 2ADBA 5D8HB 2D3OR 3SV3A 2GQ2A 3W5YA 2YBVA 3OVAA 1FT8A 1Q95G 3JXOA 2R7WA 5KAKA 3GIIA 2G1HA 3DFEA 4QYZK 2Z4PA 5M2UA 1GFWB 3UE2A 1C1BB 1I94J 2AU0A 1NK9A 2JVRA 4P2XA 3W63A 2O67A 2RE1A 4DV3F 4RUBA 4HKQA 1XNQJ 1MROB 4Q2LA 3KWMA 8ATCB 4DHVA 4MJKA 1S0VA 4N77A 4P2SA 2MGZA 2WONA 3GLJA 4DV0F 2XY7A 2UV8G 2DH8A 3M30B 1U2FA 1IQTA 3AHPA 2UU9J 3LP0B 4LF7F 5BJRA 3GCWP 4IG3A 3PJXA 3RB4A 4NX9A 4FYYB 2DNKA 2GVDB 4TU8A 5HK4A 2GIFA 2JSXA 5D0EA 3DLGB 3PW2A 2HFSA 4IFYB 4IO1A 4ZHRA 4WXWA 1NXIA 1F3FA 4IQMA 5B0FA 2IAJB 4I7FA 1K44A 4DV4F 2R7XA 3QRRA 5AE3A 2YX4A 5J2MB 1RT2B 3TW0A 4ANCA 1TKTA 3UN3A 1WWHA 4ZVRB 2HFNA 3PDNA 4WYLA 1S4FA 1APSA 4E0DA 4Q0BB 2D9OA 4FS2A 3C15B 2WBRA 4QPTA 5D78A 2KI2A 4GC6A 4EZ6A 3PR5B 2UUWA 1N32J 3PO5A 1VGYA 2GHVC 3ZTOA 4NZ6A 2DNYA 4ZP8A 1V5IB 1JKHA 3EVWA 2AX0A 4KB7A 2FJDB 1BHNA 3TVZA 1NZ8A 1U6FA 4DL0C 1RWNB 4R0JA 2BOPA 3DLEB 3ILIA 3ISZA 3UD3P 1S1XA 1S1WA 1VBXA 1UFWA 2BUNA 2V8GA 1XMQJ 1UJ5A 4H54A 3MEGA 1T94A 1QE1B 5IC4B 2B7BB 5E3CA 4ECZA 2CRLA 3MMCB 1IKWA 1GMUA 1RTIB 5C5JA 4KHRA 3Q8RB 4C11A 2NSCA 3RRHA 2BE2B 4KQZA 3BGUA 1DTQB 2AZ3A 4EO6A 2AJFE 3FSYA 4PXCA 4DG1A 4V19J 1GT8A 2EG1A 3L09A 5FDLA 1T9VA 1VK8A 4D3HA 1PAEX 1RWVB 2EBGA 5KG5A 4CO5A 2YPZA 1Y0HA 2XSJA 5J2PA 2ZNYA 1RADB 5KTQA 2I1RA 2RAQA 2DO4A 1JWWA 4AYBD 4CM0A 4QYZJ 1KN6A 2IVMA 4X4OA 4DV3J 3NCPA 3QLHA 1B0VA 3CJ2A 5JMNA 1OQ6A 3FJ2A 1PYTA 3HP6A 3W1YC 1WI6A 1S5ZA 4DV0J 3EXCX 4RNNA 3OHAA 3PYDA 4RU2A 1S7IA 5AXMA 3TA0A 2GGPA 4CLLA 2FVCA 1FJGF 4P2FA 1TKXA 5L9XA 2XI3A 2V2ZA 3O6QA 1NJYA 4FBUA 1FERA 4OHYA 2WB4A 2UUBF 5HP1A 3IWLA 4L3NA 4TVAB 4CLTA 1FKAF 3GJRB 4DV4J 3HHLC 2AW0A 4CLWA 4ED5A 2M4MA 4PYAA 2L9NA 3OFHA 2CJBA 3ZTSA 5J1EB 3DKDA 1NSPA 3W65A 4ZIVA 4ECTA 4DZ6A 2N4DA 1NK8A 3G86A 1S12A 1Z2LA 3PW7A 3RBZA 5CAAA 3RB0A 1ELOA 1VQOS 2BW7A 2I5JB 4PCQA 1VYAA 4WTYA 1EP4B 3ELHA 5KFAA 3QIDA 4DR4F 5BYSA 5CYMA 3OUYB 2DXDA 1R43A 1JQGA 1XC9A 2B0GA 2Y1LB 1L3UA 1V3RA 3CPWR 3BBBA 1XBWA 4C0HA 3D66A 4GO7X 3P6YC 1WI8A 1M5OC 1FRMA 4YMEA 4PQUB 4O3RA 5LXRA 2B9WA 5U47A 2LQBA 3E2EA 1AFJA 4CLPA 5ETVA 1GAOA 2N7CA 4Q8EA 1SH3A 2VG5A 3MPVA 3LF0A 5CCMA 2K06A 2GHWA 2DK2A 3CJ4A 4EYIB 1DBDA 1MWYA 4XDCA 4A8KA 3H0PA 2ZFHA 3A8JA 4DZDA 3FSXA 2OELA 4QU7A 1BUXA 2P9GA 2APOA 2FJXA 2CQCA 4KTQA 4ZPWR 3I0RA 5IV3A 2MSSA 1ZZFA 4JI8F 2XTJP 3OR1B 2ILYA 5JXSA 4LIWA 1SKWA 4URSA 4Y65A 1MMLA 3H5YA 4KYZA 1MU2A 2FHJD 1RAJA 3AOCA 2W4PA 2OSQA 1K9MT 4F4ZA 1FJGJ 3QFHA 1RT4B 4DQQA 3X3UA 2JDJA 3LAMA 3SCJE 3CJ0A 4P75A 2XHWA 1UWBB 3HHKA 2KU7A 1P9QC 1IBLJ 3J81Y 1I5OB 2HQCA 3DM2B 1H74A 4OZNA 5J1PA 3T1YF 3BN7A 4HHJA 5DDOC 1CULA 2M7SA 1OYDA 3AOAA 3Q83A 1RSCA 1B0PA 3KFWX 4DL2A 3ZZTA 2ZH8A 2DNHA 1NBEB 1EARA 4Y6IA 4RUAA 3RBXA 3H2LA 4ZMMA 4M5GA 4DR1F 4QOTA 2RJZA 2BJ1A 4J37A 2FZGB 1FX4A 3MECA 2OSRA 1G1XA 3JQKA 3BGFA 1UVKA 1FKPA 5T41A 4AE5A 2MKKA 3GV5B 2AWZA 4DR4J 3EXYA 3OTOJ 3HCXA 1FRKA 4PZVA 4J5OA 4R25A 3IR7B 2HNYA 1KBRA 4NEZA 2DPIA 2RDIA 4I6YA 4ZCLA 4B3TJ 2XMVA 3CVKA 2EEYA 1MN7A 4DR2J 1H2VZ 4ZPTR 1GMWA 3BSCA 2NXEA 3OR2B 4CDIA 3H40A 1S6PB 4FN5A 1HBUB 1CC8A 1XMOF 3BBCA 3NAIA 3M8PA 4RW6A 2XGPA 1T05A 3LGNA 2AD9A 3VAGA 3JB9k 5E7OB 1NPPA 4DPUA 3UO0A 3EM1A 1HR0F 1OPIA 1BY9A 4ZVPB 1U1MA 3GFZA 3D68A 5KFYA 4OZ3A 3ONQA 4TKTA 2CWKA 5JVGQ 1T03A 2DGTA 1FVQA 3VHQA 2D3O1 2VV5A 1CPZA 1REVA 4ZCMA 1V3ZA 1FFGB 3VQTA 1SH2A 4OYBA 2ZITA 2VKRA 4JI8J 2NCKL 4Q43A 1VMBA 5DQIA 3IRXB 4NLUA 1LW2A 3PJ9A 5F8NA 2G0CA 2VPWB 4LR7A 1WOSA 3CD6S 1IKXB 4LR8A 5KFSA 1Q8LA 3I0SB 3GIJA 2IHR1 3SDEA 2UZAA 4NI2A 3HT3A 4M5DB 1CJKB 3CDBA 2QL5B 4P2MA 1JJ4A 2KVQE 4ECYA 4XIUA 2Z57B 4A47A 4Z7YA 2V6AA 4IQXA 3SZ2A 1QD1A 3T1YJ 2CNKB 3MUMP 2Q3PA 3R97A 1IBMF 3KK3B 2F8HA 3W2VB 2M2BA 4ZCIA 1WJ9A 2SXLA 5K5MA 3D3BJ 1RE1B 3G4SS 1WOOA 2H5IB 2DTJA 3TR5A 4FNIA 3CJSA 4OV6A 4DR1J 2BR0A 1Y11A 3C3LA 3VAIA 4B17A 1N33F 3FBEA 4BC9A 3KUHA 4DUTA 1TQLA 5D0RA 4IO9Q 2E1CA 2GMHA 4CLSA 3R5DA 4OFZA 3R1LA 1R8HA 1JLQB 5RUBA 1FJCA 1NSAA 4LBPA 2PFFB 2HBRB 5DRKA 2CA9A 4DPOA 2PI5A 1FESA 2WRMA 4NOHA 2DGSA 4OYWA 4DV5F 2DRAA 4B3OA 2RHSB 1O8BA 2W9AA 1HBMA 1M5PC 5HATA 4USKA 4V1Ak 1CJTA 1T9WA 5KG7A 2W2PP 1X0FA 3N28A 1MLAA 2F63A 5F8LA 2ATCB 4EO8A 3FMBA 2Q1LA 3MM6B 4OZ2A 2ZHBA 1R6VA 3BYRA 3PR4A 2BBEA 4L3KA 2VDHA 1AUDA 3CDAA 3KUGA 2RUSA 4X4VA 5HO4A 2V67A 2PMHA 4B3SF 1GX5A 2J0XA 3FCVA 1S9GB 2BMBA 4LRFA 1U4BA 2B9YA 4J9OA 4KR0B 2VASA 3F44A 3GR0A 4MAKA 2V9KA 4B02A 4B9TA 2YKOA 1JXEA 1T9UA 4MK7A 3ISND 2MLYA 4DL5A 4C8NA 4XPEA 4J9KA 2FLNA 2M52A 4PWDB 5L1JA 2PFDA 4W92B 4A8WA 3TUZC 1YBAA 5DDRC 3BM7A 2EG2A 1NK7A 2NXNA 1IN0A 3MGJA 3HSJA 3MTJA 3M32B 4DDFA 2BW2A 3UW1A 2EVZA 5KT3A 2E1MC 3A1YG 2B43A 5EN1A 3AXKA 1TKTB 1T0TV 1WTFA 3WX4A 2XWYA 1SJFA 4OHVA 1IBMJ 4RNFA 2IPOB 3GG0A 5D0GA 2CAJA 1D09B 3RW7A 2AZ1A 4X4SA 1UJ4A 2KL8A 5L9NA 4HT7A 1K47A 4JYAF 1RWUA 3UI3A 2HHWA 4KC5A 3ULHA 5IWAF 2EFPA 2C2DA 2R2UA 3OV7A 3TA2A 3G6YA 1H72C 4OLOA 3CXCR 5L39A 2ASDA 2VG7B 3HVWA 5CXTA 1KOHA 4RLEA 4AD6A 2XO6A 3Q86A 2FZCB 1WEZA 1CLFA 4DV5J 3HHLD 1R89A 1PC5A 1WC6A 2VBZA 4C11B 4NASA 4IOBA 2R7RA 3PEHA 5IFMA 3M2VB 1EB0A 3E51A 4J9SA 1VBKA 3C8YA 3ZTRA 1ZAVA 3HD2A 2RQMA 5ETSA 1D8ZA 3RAMA 1NO8A 3FK4A 5F3TA 3KJVB 4ETXA 2VG6B 3UCGA 4B3SJ 4USWA 3PX4A 4HTIA 3HKZD 4DLGA 1WKJA 4ID5A 3KLFA 2NPIA 2RRAA 1X0PA 1WELA 1IJEB 2HHXA 1YHQS 2G2YA 1U2RA 2DD8S 3H7HB 4JUZA 1YJ9S 2X1GA 5EX0A 1PBUA 4QJVA 4TYAA 2P6TA 3J7AN 2C22A 1U7LA 1LOUA 5J1NA 2E5LF 1U1RA 1NNDA 1VC5A 3GMGA 2O66A 4MKBA 5LL6d 4CQ1A 3DOKA 3WBZA 2E1AA 3QT7A 2QLJB 2BZ2A 1MMDA 2LXFA 2QE5A 3H2UB 3GSIA 4ILRA 5IQ6A 2LKZA 4EZ9A 2NLWA 3MMBA 3PIOQ 3EVOA 4XDDA 2BQ3A 3C6TA 4O44A 2DYAA 2CPHA 3RR7A 3KHRA 2G13A 4NLYA 3W9HA 4EGLA 3Q2TC 2FIUA 1X4HA 1FFWB 2OEJA 1P6TA 2CJAA 4K0KF 1M1HA 3G96A 4CO0A 5KOXA 2XCAA 3A8EA 3NBPA 1KTQA 2ZH9A 3KNGA 1HHTP 5DG7A 2MQMA 4CT9A 4AXIA 2JJ4D 4UY8T 3QO9B 4G65A 1FI4A 1BQNA 3JTOA 4NLTA 4JYAJ 1HNXJ 3L95X 1IWGA 2A18A 5A8RB 3GYNA 4Y34A 2OAUA 2QO3A 1LQ9A 4M8LA 3QGGA 4H4MA 3G8QA 5FD1A 3D1HA 2GQCA 3KLEA 4U7UK 5MLCV 5HQMA 3BYPA 1KDNA 3UR3C 3KLIA 1H98A 2QSFA 4UOCA 3W9JA 4ECXA 3HX9A 4WF9Q 1HNIB 1LK5A 5FIIA 3PJWA 3MOZA 2KHDA 3GIMA 1DQ8A 4O0NA 5LMUF 3OJUA 4GC7A 2ZZNA 4U8VA 4AQYF 4K59A 3MM7B 1HMVA 2HQGA 3DXSX 1IKVA 4N41A 3NCRA 4FYVB 4DL6A 5CYJA 3K0JA 2Y8YA 2BJ7A 1C0UB 2WZ1A 1QUPA 2FY8A 5C25B 1NSKL 4M5LA 4L74A 1XIQA 4ETZA 1F9FA 3CDWA 1SV5A 3QSIA 2WOMB 3HJVA 1RU1A 2WW4A 3KK1A 3HVAA 1CC7A 1WG1A 1Y7PA 2DKOB 3IBWA 3K8WA 4USUA 3G6XA 4J9NA 1JB0C 2DR6A 2CPYA 2E5LJ 1FRIA 3R7BB 3L7PA 2HWTA 3TRGA 4M5JA 4OI2A 4ZLLA 4F67A 1C4AA 3NEKA 2YQ1A 3QT8A 1SJQA 2RS8A 2H65B 2PE8A 1O5JA 1SUQA 3LWLA 5CHCB 3AA8A 3UDCA 2IJRA 2CJQA 1RA7A 3PTWA 1E6VA 2QA1A 3MOJB 3ENQA 1YBTA 3OQ2A 4K0KJ 4P71A 1VRUB 3U1MA 3HHDA 1S7HA 4A48A 1B0TA 3W5ZA 2L41A 1U49A 3V6DB 4HVZA 4LF8F 2FD2A 2XMKA 3MHYA 2W1BA 4USJC 2EKNA 4QQBA 3NOGA 2EK6A 3A8IA 2WB1D 3PYEA 3OLBA 1MSWD 3T41A 4I69A 1VRTB 1UEUA 1X5OA 2ZJRQ 3JQMA 4CLUA 1Q8IA 1N36F 1D3WA 4RUHA 4L76A 5LT5A 2CQGA 4F0KA 4A8XA 2YWFA 4GVBA 3VR1A 2EI5A 2RS2A 1NDCA 1NHKL 2UXBF 1BD6A 4OI0A 2J8AA 2CJYB 4OHZA 3UCZP 4PUOA 4BHQA 4WXOA 1JMTA 4OX8A 2HS3A 4KGMA 5BR8F 5LMUJ 1S4EA 4AQYJ 4NMLA 5GAEU 2U1AA 2IDLA 1QSYA 3AJDA 1EETB 3NCQA 4NYOA 2P5VA 3KG1A 2V9WA 5KFDA 3FMWA 1REVB 2CNNB 2DR9A 4DV1F 3PRDA 4YHHJ 1RP5A 2HNZA 5GVQA 4JI7F 2HAIA 1BWEA 2IC3A 4ZPCA 3JYTB 2OEMA 1FCAA 5B0GA 1JLBA 1JLFA 3SQGA 3GFYA 1N6QA 7FD1A 3NGKA 2KXNB 1C4CA 3RZAA 4OI3A 1FK9A 2OPSB 4ICLB 4YDXA 1AZSB 2GO9A 1IR0A 2BVZA 2H5JB 2AQ4A 1DLOB 3DLHA 3QT6A 3FBBA 1L3TA 1CJUB 3SDEB 3OVSA 4K2JA 1NAQA 1RAEB 4RKUC 3ZNUA 4I6WA 3Q23A 3IA0A 1FTRA 1F1BB 1Y3JA 3P8BB 1KR4A 4NLSA 3TZZA 2MJNA 3DDIA 2JEJA 1HI1A 4ES1A 2HHUA 4QU6A 2Z2YB 1RAFB 2IVYA 2AV5A 4FYWB 1UL3A 4PG4A 1X4FA 4OQJA 3MPDA 2GVZB 4IYQA 4Q8FA 2GA7A 3TZYA 2XLKA 3HLUA 2E9TA 2VPYB 1NPRA 1HA1A 2LXUA 1WDDA 2W8LA 2LVWA 4E8UA 3DXBA 3MPUB 4NXNF 4LR9A 2HBZB 4ZVSB 4K50A 4OI1A 1RT5B 3F41A 3WC0A 3KMSA 1ZA1B 4UUXA 2RIJA 1LWFA 4C8ZA 3R1HA 3V4IB 1MNEA 4LF8J 3RU0A 1WD6A 2MQQA 3HKWA 3GILA 3H25A 2FPHX 3W3SA 4IR9A 4N47A 3BSOA 4ELVA 1YJTA 4YY3F 4NCGA 1RTJA 2CPJA 4IUFA 2L9WA 2HYIB 4B3OB 2DCUB 2YNIA 2YKMA 4L6V3 2MHEA 2CPXA 2DGVA 2HFUA 5B0CA 4KPYA 3RRKA 1F2HA 3PZPA 2XYHB 4LRBA 2YNFA 1M90T 4HEA9 4TN2A 2UXBJ 4F3OA 3D1OA 2AGPA 4QWDA 4LSLA 3H98A 3M2RA 2Q6BA 4LJMA 4PRFA 2JOQA 3JTNA 3QPIA 4LUBA 2MXYA 5BR8J 2WVDA 3V5RA 3ENAA 4F2RA 2W2MP 1VC0A 4WFAQ 3NS5A 2QIFA 4WKRA 2IM1A 2PO4A 4ZN3A 1NK0A 4MFBA 5KFKA 3CCSS 3OSNA 4DV1J 3OW2R 1YWXA 1TTHB 3HVTA 4JI7J 4XO0A 4CNZA 3KLHB 2VQEF 3R7NB 1IWAA 3F0NA 2XLJA 3I96A 1A7GE 4TY8A 1F5AA 4PG5A 2B4PA 3EJMA 3AAWB 5HROA 4CO2A 1T9TA 2IRXA 5AXLA 2DIVA 4IRCA 1HD0A 2MLXA 2KFYA 2BABA 5HBMB 2A6MA 1K0VA 4G1QB 2YX1A 1JLEB 4WPAA 2J9CA 2Y0BB 2JC0A 4W98A 5HN0A 5L1LA 2BKOA 5KG4A 2HW3A 1U0HB 2J0SD 2BJ8A 2ZJPQ 1YSJA 2DHAA 4C8YA 1RTHA 1XR7A 5D0HA 5AXNA 3Q8VA 3V4MA 1ZETA 3J80U 2AP6A 1Y3KA 2QLFB 3QRQA 4CLYA 4F7VA 1S99A 1BQMB 1H2UX 5BYQA 4NXNJ 4HLBA 2MKHA 1HWIA 1VJQA 5IM0B 1RT6A 5C42A 4RBVA 1YZ6A 3R6LB 1RCXB 1HKAA 2KRRA 3CCUS 4ZP6A 2V8PA 3N6MA 1TU0B 4USTA 5J2QA 4FPIA 1IBKF 4RW9A 3GJSB 5GMEA 3A8KA 1S9EB 4ED3A 4Y3CA 2XHCA 1FEHA 2MTLA 2W24A 3CC4S 4NXMF 1RYRA 3TJ8A 4Q2MA 2E5JA 3RJMB 3TZWA 2LFVA 2MMYA 1VFJA 3FQLA 3I32A 2DIUA 4AL5A 5K8OA 2B9XA 4K4TA 3CCTA 4IFVB 4O4RA 1ZM3A 3RGIA 3MR2A 4NLQA 4LBHA 5DZ7A 2VODA 3DOLB 3MD1A 2RHQB 4Y2IA 4JI6J 1Q5YA 3FEYB 3O5TB 4UQGA 1UKUA 2V63A 1X8DA 4FZVA 1CVJA 3O3LA 2J9DA 1DURA 2H3EB 3DDNA 4LFAF 1RTDB 2FTRA 4AUKA 4ZLNA 5EX3A 5GAGU 1RYSA 1HYSB 1P1LA 4F0MA 2VQEJ 3UQSA 3EICA 4DS4A 4X64F 3FFIB 3FBCA 4F50A 4Q44A 3BQ1A 1Q0NA 4ED7A 5CD4H 2CVIA 3GIKA 1MROA 1TELA 4K7QA 1FJEB 1AUSL 3I31A 4OI4A 4AT1B 2KJWA 3M4XA 5I3UB 2ALYB 5DZ6A 3AOBA 1HL6A 4ED2A 3AT1B 3K17A 4QW8A 3MMBB 3PHTA 1RBOB 4J9UE 3LP0A 1RZMA 3M9OB 4YB6A 2BJ9A 2C3MA 3QYYA 2VD3A 4L73A 1HFEL 4MK8A 4EI2A 5HANA 1HQ2A 2XQCA 2PT0A 3B6BA 3HXMA 4CCHA 3DLGA 1FD8A 4USIA 4IFYA 5HMYA 1JLCB 5HLFA 2COLA 2YPYA 4OIXA 2IAJA 4FPRA 2C3OA 5J2MA 2KKHA 1RT2A 3ZZRA 2JFKA 2DNPA 3M8QA 1URRA 2NUHA 3M8YA 2FVSA 2BV3A 3ENWA 2V0NA 4IH5A 1XR5A 2F40A 1UTAA 2ZH3A 3TI0A 4M5IA 2N4CA 3AFGA 3PIPQ 5DQHA 3C15A 2RUGA 4H4MB 2DH9A 2R4FA 4WCEQ 1D8YA 1RB0A 2L9DA 4ZJQA 1FXDA 1IBKJ 2NSBA 3TX8A 3LAKA 3IP0A 3I4PA 3LP1B 3GONA 1RUSA 4PYDA 4TY9A 3GIRA 5KFQA 3CJTA 1KSPA 3KDNA 3BO4A 4OYXA 4NXMJ 3GFHA 4AL6A 3TAMB 3EE3A 2POKA 4FYDA 1VCTA 2C2ZB 4WWSA 4DSKA 3CO9A 4DUZJ 1REGX 3U7JA 2OIHA 3DLEA 2Z2MA 3VWSA 2HGMA 2OP5A 2YNGB 2HHQA 4ZIWA 3KXDA 4OYZA 1FRJA 4NWBA 3FRYA 4MT1A 4AXJA 3QMQA 1QE1A 5KG3A 4RPFA 3BO2A 2CFXA 1PSDA 5DM6Q 2RQCA 4B9SA 4UOGA 3MMCA 3PYFA 5F3ZA 2WSFC 1EHWA 1RTIA 1OIAA 3W60A 3PHEA 1RLDA 2VDIA 3IWXA 5KFNA 1NH8A 2BE2A 1OY8A 1RU2A 2HSEB 3HZEA 3TUJC 1DTQA 3ZO7A 4X62F 2AJ1A 4OZJA 3PW0A 4QWCA 1PCAA 1L3SA 4LFAJ 4M63A 3CW2C 1FD2A 2Y1JA 3CD0A 1RWPB 5HQLA 1U1PA 2Y0SD 3IS9A 2XY6A 4QIEA 4X64J 4MIBA 5KFRA 2ROGA 2PSZA 4C3MA 2OPQB 4J9RA 3M6UA 1SBRA 2C1EB 1S6QB 3I6PA 4KRWA 2V8DA 2XS5A 1XJWB 1Q7LB 3FUYA 3K2YA 1VQMS 3MZIA 1S49A 4RO0A 1JXLA 4F0HA 3BQ0A 2XSFA 4GKKF 1KOOA 1NPKA 2GNKA 5D4LA 2ZE2B 2G0IA 2V4JA 1WOPA 3BSNA 2OD6A 2W7OA 2CQ1A 2GFFA 1KLMB 1AFIA 1ICEB 2CWXA 3B4DA 5DO2A 4DXLA 5ETMA 2LU1A 4F04B 3B8HA 3I56S 4NA2A 4F3QA 3DRSB 1U6ZA 5T7LB 4O3SA 5KFPA 2I2YA 5J1EA 1M5SA 4ZKAA 3Q22A 3QNWB 3PNIA 3DI6B 2PGCA 3MURP 3M6WA 1W25A 1WC0A 3QWUA 1CS4B 2I5JA 4WU3A 3US5A 1ZBTA 1JJHA 4DBQA 3ZC4A 3CEDA 2GJIA 5DG9A 1XTZA 4U9RA 3OUYA 4EBEA 1ITPA 3RBEA 2HBQB 4FF2A 4MYUA 1XQIA 2R8KA 2ROPA 2ASJA 1YG0A 4FVMA 5EUHA 3MAAB 2L08A 2CZVC 3LGMA 5E5NA 1LFWA 1HNWF 1FRLA 4PQUA 4WK1A 3DRPA 3M7VA 2XZWA 2Q6CA 2ABYA 2R8JA 3OL8A 2EC0A 4NLDA 2CJ9A 2A10A 2MQ8A 4DSLA 5A8KB 4X62J 3V6KA 2PD1A 3RB6A 1KP6A 4HYKA 5ETTA 2AGQA 2JEGA 5FJ4A 3DLBA 4DR7F 4A8SA 1GXUA 3UDEA 4ZP7A 2DO0A 1S1VB 2YKNB 1E6YA 1UWAA 3PCOB 3DC2A 3MUTP 4UT4A 3CD7A 3KG4A 2KH9A 2EFNA 3OR1A 2E9RX 3AY0A 1Y9OA 4LQ9A 3T5HA 2R2RA 5B0DA 2P8IA 3VGUA 1WNEA 1FE0A 3ZZUA 4JV1A 1WTBA 3EVMA 4QIVA 4JI5F 3OFEA 5B0AA 1ZPVA 4GKKJ 1VQ4S 4BWMA 1UVJA 1H2TZ 3L3CA 2IFXA 1RT4A 1W2IA 1UVIA 1RAIB 1QY7A 3B54A 3SIPB 3CJKB 5DM7Q 4KH0B 1EX8A 3ILJA 2Q66A 4BCAA 3M8SA 4G1PA 3DM2A 3BH7B 3C2PA 3HSZA 1FTCA 2B4OA 1SL1A 3VZIA 3AD9C 2ZBQA 4LF5F 3QIPB 1KEKA 2W9BB 4QWEA 2ZHAA 1NUEA 1XR6A 2YWEA 4U8YA 1N5QA 1SL0A 2RT3A 3J7YI 2MQPA 2UVUA 4M94A 1SIZA 4O3PA 4TNOA 3UVJB 2XLIA 3N6LA 3L4BC 2ADCA 5L38A 2MHNA 2CQ2A 5C2GA 4ECRA 3POTB 3R2CJ 3GR1A 2ZDOA 4S0MA 2JC1A 1FHTA 1VBZA 3CCRS 2W2OP 1CQMA 2YH1A 3PXGa 1K0TA 4ENOA 2MYFA 4ZVQB 3W2WB 3OD2A 1ZZNA 3ITHB 4H4KA 4WP9A 2DVIA 1CEZA 2AT1B 4OJ1A 3P49B 1NDKA 2P9EA 4CWBA 2OD4A 2UVVA 1P27B 4LF4F 1IUJA 2KM8C 3OSPA 2WAQD 4ECSA 1Q7YT 2JL9A 4UF4A 1W7WA 2XYPB 2V94A 3UR0A 2AMCB 3N9UC 3GCXP 1N88A 3OR2A 1HNWJ 1S6PA 1HBUA 4P7TA 5G0RB 4TQRA 1QVFR 1WUUA 3TOQA 3CCZA 2ZWPA 3NLCA 1HWJA 1RBAA 4TY8B 1IM4A 3NWRA 4WP3A 1Y5NB 5H1SV 3UWTA 2IA0A 2LDYA 3JSBA 1X5PA 2W7AA 3Q0AA 1S10A 1I3OB 4YDDB 1QSSA 4DR7J 3GYXB 4KIAA 3HFVA 1KVJA 3CD5A 1HI8A 3MM9B 3MEDB 4R8UB 4FNHA 3BDPA 5DJBA 3M1VB 4PXDA 2WHOA 2FLOA 4TLQA 3RTVA 2XZTB 2RU9A 2FGOA 3IRXA 1NB2A 5EWEA 3TVKA 3D0IE 1LW0B 1SI9A 2HHVA 1IKXA 2CQ0A 3PKMA 3OXFA 3KOAA 1VQKS 3I0SA 3K5NA 2QEXS 3BS9A 1KWMA 1HWLA 4DX5A 4M5DA 1CJKA 3BQ2A 3DGVA 4J9MA 5THWA 1J2VA 2HGLA 2I0XA 3IC1A 2BYCA 1RT1A 1WF2A 2DR7A 3MMJA 1RISA 3MMAB 3KK3A 4ES3A 2ZNZA 3NGTA 3VTIA 2QA4G 1RQ0A 3GG1A 1B70B 2HGNA 2HVDA 1AROP 4HTJA 3PKYA 3VAFA 1N0UA 4DOZA 1HNVB 2HRYA 1WHYA 3AH6A 5KFJA 4L75A 1IKYB 1TR0A 2YXLA 1Q81T 2ZBIA 3TQ1A 2MB0B 4K2XA 1XMBA 4C8KA 4DX6A 1GMWD 3MR7A 2OTLS 1JLQA 2DY1A 2Z8QA 2B8QA 2QT7A 4QWAA 3M6XA 2X1FA 1D1UA 2PEHA 2JEIA 1T9XA 4LF4J 3W8PA 2FQQB 2O1PA 2JEFA 4NLXA 4HI2A 4K4WA 2V2VA 3LA0A 4IOAQ 4PAAA 1G2EA 5GADU 3ETOA 1U1KA 1M5KC 2DB1A 1T02A 4LMZA 1TL1B 1MW7A 3SMZA 3MM6A 2GCFA 4QIWD 2HBYB 3E01B 2DNOA 2LQ8A 1QAIA 1FRXA 4I68A 1DHMA 2KDOA 3BDEA 4O4GA 5LSOA 1S9GA 4LRAA 1L3VA 3DLKA 1VC6A 3NS7B 2ZVIA 3I5CA 1TL7B 2OEKA 3K5PA 3CCES 2OO4A 3WC2A 2MY7A 4QIGA 1VLOA 5A6PA 3EDQB 1T8EA 1C0TB 3GE9A 4A8YA 2XS7A 1SKSA 1FDNA 3S01A 3JAMY 2ZH1A 1H38A 4NRTA 2MEWA 3G71S 2ZUAA 5KG6A 1GXTA 2DT9A 1D9DA 2HQDA 4QZVB 4PWDA 4E2FB 3W61A 1I1GA 3C14B 3SCLE 1YBUA 2ZD1A 2F9JA 1CSJA 2CPFA 3SSSA 4JI2F 1EIYB 5HQ8A 1QSLA 1XN9A 3M32A 4KPCA 5HLFB 2D9PA 4HACB 4HDGA 4I1TA 3M8QB 1AA1B 2EBEA 4Z7CA 2R2TA 1X5SA 4F8RA 3B82A 3UNYA 3BKUA 1LWXA 5F8HA 2IMWP 3BJYA 3PVXA 1TKZB 3QT5A 4K4XA 5F9NA 4O3OA 1KLNA 2JLGA 1PIEA 2DBBA 3OL9A 3BEGB 1N5TA 5ETPA 1WEYA 4JI1J 4OJHA 3ZZ0A 5KFIA 1RAAB 5B08A 5K20B 1FVSA 4F2SA 1A9NB 4OLPA 2DHXA 3MCSA 3V6HA 2CIMA 1IJFB 2E7VA 3NP5A 4DCJB 2AGOA 2VG7A 2LECA 2ZOFA 4GVLA 3EGWB 3JSYA 4N76A 2KXHA 1RWOB 4LF9F 5HMZA 3U02A 1HNZF 1S1UA 2HS0A 5DGBA 4NLWA 2V8VA 4WE1B 1WDTA 4I2PB 3M2VA 2HZAA 4FKYA 1KD1T 4R5PB 2OTJS 2K8GA 2HIQA 2K7JA 3KJVA 1SC3B 2VG6A 5CZVA 3DYAB 1R0AB 3QRPA 1H7WA 1HBNB 3IS9B 4DFPA 4NYPA 1A6LA 1HHQA 1UVNA 3CCLS 1R6YA 4DPYA 3QSYB 2E7XA 3MF5A 3QGIA 1F60B 1S0OA 2FC8A 2VQFF 5FLXY 1FDAA 1U1QA 3JSMB 5MAOA 4CLFA 3OBIA 4F4WA 2NS1B 1IVZA 2XULA 5KFHA 2B8PA 4ZVUB 3NGUA 1RAHB 1YRXA 5KFEA 5BXIA 4I4BA 1VQ6S 2V4JB 2N3OA 3TVYA 4WIIA 2CNOB 4JI4F 3G9CA 3UD5A 2J6UA 4B9VA 1JLGB 3T5KA 3KHHA 1IBLF 4JI2J 3DHXA 3RUBL 4C8LA 3HO1A 1G7CB 5ETNA 2E44A 2W01A 3D2WA 2Q43A 3VZHA 4I2QB 2P2CB 2NZ4A 4PXBA 1TMMA 3RRGA 3T5JA 1VQNS 1KVIA 2ZH2A 3QWPA 1RLCL 3VVTA 3OFGA 4URQU 5B0EA 2HVIA 2FGCA 3HJFA 3SXLA 3KJNB 1Q1KA 4TU7A 4CO1A 2KZZA 5JVHQ 3R5AA 4M5HA 3EWGA 3QO9A 3ET6A 1SL2A 1UCNA 2H54B 2QA4S 2F8EX 2K2PA 1N5YB 3UD4P 2VBWA 3OTOF 2O3DA 1X4GA 3D0GE 2V8HA 5A8RA 5LSLA 3DOMB 1O6XA 4FBTA 3THVA 1BC6A 3FSIA 4B3TF 2GO8A 5KFGA 4DR2F 2UXDF 3QQCD 1L5UA 1RT3B 3N4WA 4HHHA 4LF9J 2CDQA 3DRPB 3RYLA 1HNIA 2CG8A 3NXZA 1HNZJ 3GV7B 1TUWA 4IH7A 2OJ3A 3P45B 4UW2A 4NMXA 3PRVA 1M1GA 5AT1B 4RBUA 1Q53A 2K1RB 2E5HA 4IKAA 3MM7A 2VFVA 3GSDA 4MH8A 4MTPA 5A76A 2DRBA 2HWIA 1G4CA 1SCJB 4ZPVR 3GZ7A 3WX8A 3I4HX 1E6YB 2XMMA 1YGYA 2OLWA 2J7KA 3HI9A 1C0UA 3AODA 4ITSA 2IY5B 3MM8B 3J81U 4BBYA 2VQFJ 5C25A 3MFHA 2IYIA 2DGWA 4CRJA 4LF1A 3W5XA 1UEVA 4DQIA 2VF3A 2WOMA 2XZDB 2XG8A 4UY85 3IG1B 5CD4A 1BGXT 3D3CJ 3F56A 2F7VA 4Y2CA 1FJ7A 2R2SA 1HW9A 4P7VA 2DJWA 5EWFA 4B08A 1X31C 2C2RA 1PAUB 2C42A 2F8MA 4P74A 4JI4J 4CIOA 3R7SB 5KFZA 2M5YA 2DGUA 2EFVA 4TYBA 3DMJB 4PEOA 4C2MA 2NUUG 3I9V9 3GV8B 1H6KX 3BO3A 2QFIA 3PV8A 2DISA 2D3UA 4K4UA 3CF5Q 1VRUA 2JWNA 4KHPF 1KHWA 2FJVA 3FC9A 2FVQA 1V5VA 3V6DA 1PYOB 1VBYA 5ADZA 1J5OA 2HQIA 4DI6A 1UW9A 4D3GA 3PM9A 2JZ5A 4F36A 5D15A 1S0MA 4XTTA 4BC7A 1EQMA 2HHHF 4B9UA 1VRTA 3N5FA 3BGOP 5IZHA 4PKDB 1S59A 1TL3B 3IR6B 2HEKA 2LP4A 3FCWA 1KC8T 3QFWA 4LSNB 2F9DA 2ZUGA 2UXDJ 3IWNC 1HPZB 3AA9A 9ATCB 1Q4RA 2JX2A 1YLXA 3KDOA 5AE2A 2JHEA 4WTOB 4RW4B 4U6PA 4DSEA 2OFGX 1RT7B 2A6OA 2PEBA 4PABA 4PWWA 5E3RA 4Z2XA 5L1IA 1SKRA 1HD1A 1HWKA 1FKOA 1SJ1A 1YQHA 5E3QA 1EETA 1LNQA 2MQOA 4CP5A 2BRKA 2OH2A 3T3FA 2GS8A 4F25A 4N5SA 4IOCQ 4JI0F 4FF3A 2DY9A 3CCQS 1D9AA 1GTHA 2LLZA 1U25A 1ZPWX 3JYTA 3G8TA 1RABB 4K8RA 1U09A 2CZ9A 1T3NA 5CH7B 1N0VC 2ASYA 2ZC4A 4NPOA 2YWWA 2XC9A 2HNDB 1FNXH 2OPSA 4ICLA 4C3LA 1KQKA 5KFXA 3DGPB 1AZSA 5KT2A 3T6JA 5KT7A 1DLOA 1CJUA 1ZTWA 4LRDA 1DQAA 1F5CA 1WHWA 1U1OA 3DRYA 4FKXA 3NKYA 3D1QA 3HVRA 4J9LA 1U48A 1IXKA 3BN4A 1RA6A 1O0PA 1RDRA 1RT1B 3RR8A 4M5MA 3CDUA 4X4QA 2GVZA 2X3GA 6FD1A 3D6MB 3OVBA 4IDKB 3CSKA 4HH1A 5K14B 1Y10A 4HDHA 2BQRA 1HBOB 3G8SA 1S0NA 4FS1A 1RT5A 4KHPJ 1K1QA 1F3VA 1NHUA 3V4IA 4X4PA 1WKLA 2FHOB 3Q8UA 4OZ5A 2MLZA 2QMUB 1JK9B 2D3ZA 2CPIA 2HHHJ 3CMAS 1P9YA 3BSAA 2HMIB 2FVRA 1HQUB 1OSCA 1ZYQA 1NSQA 5B0BA 1TP7A 3O2IA 2JFDA 2AJ2A 4FXWA 4WZMA 2QZ8A 5IS2A 3HHLB 2LA4A 4WZQA 3NNCA 1NKCA 2K3KA 2VH7A 1UPPA 5DQGA 1D0EA 2FJBB 2MZ1A 4O4GB 3DLKB 2IVFB 3B4MA 2HG4A 4DN9A 4KSEB 4DQPA 4JI0J 2QLXA 4N8NA 3BF4A 2L3MA 3R5JB 3C16B 3NWGA 1T7PA 3KLHA 2AJ4A 5D6GA 4WFNQ 2ZZTA 2DHGA 4OL8A 2AKWB 2DXFA 1YRUA 3NNAA 2ZD1B 2GV1A 3P5TL 4ELUA 2FYXA 4A4JA 3PG9A 2DNNA 4CNYA 3CMES 3TQEA 5HBMA 5K8MA 5DLGA 3CCVS 3GJQB 3SYZA 4G1QA 1SKUB 1JLEA 3P5BP 1B64A 2V34A 2MSTA 3BPSP 1IQZA 1U0HA 3K8VA 4KT0C 3CUNA 4ZVOB 4I6AA 3A12A 4C48A 4JV0A 2Y8WA 2VJVA 1CG2A 3OFFA 2NXCA 2HKEA 7FDRA 5LJ5Y 1B3TA 3CC7S 5IV4A 2GJFA 4TQSA 2RILA 4ZVFA 2ACMA 3T1AA 1BQMA 1ZM2A 2H9ZA 1X9MA 1YIJS 2VBXA 3D28A 1NDPA 3Q2SC 5IM0A 4ZCKA 1RWXB 2HFVA 5L8RC 1Y5IB 2W9CB 1HNXF 4CO3A 5E33A 2ZBCA 4F26A 1LKZA 4USVA 5IT9Y 2J6SA 3D6FB 3L7OA 2QYGA 1Q78A 1MWQA 3K59A 4X84A 4MMOA 2OMLA 5EHHA 5CYQB 2FVPA 1S9EA 3VAKA 4ZP9A 1VK3A 2IDEA 1S1TA 4LQ3A 4OYOA 2IM2A 1UVLA 4EMDA 2EPIA 2WCXA 1RHMB 1S1UB 5KFWA 5D4OA 3EGZA 3P3DA 5LMNF 1RACB 1RAGB 3BREA 2LYVA 4ER8A 4KGKA 1RKIA 5KT5A 3R5CA 4IFVA 3Q8QB 3TYTA 1PGZA 3TUPA 4Y00A 3G82B 2OGUA 1ZM4A 2HRUA 1TV6B 3DOLA 3SBMA 1FE4A 4CH1A 4K5SA 2C28A 4KBIA 1C1CB 3EGNA 1TL4A 4YOEA 1KQSR 2G9OA 2ZKTA 2HS4A 5C24B 2HPUA 5L1KA 3FEZA 2WBMA 4ZJOA 2GW8A 1RTDA 4JI3F 2HVZA 1HYSA 3FVYA 1KKHA 3FFIA 2WVEA 3AB4B 3T6BA 1TFYA 4RZRA 2H51B 3MAQA 2XCPA 2IJFA 1UEKA 5IQQA 4DR6J 2IBKA 3IM8A 5KFCA 2KRBA 3KKFA 4DX8H 5AJ3F 4DFKA 3ILOA 3KHGA 3IRWP 5I3UA 1HWUA 4KH1B 3R8YA 2OHDA 1Z2ZA 3MAHA 4H4KC 4WP8A 3CJRA 2GHPA 1T9YA 2MKIA 9RUBA 4CT8A 5CZXA 1NCLA 4I56A 3M9NB 1H73A 1T11A 1RI7A 3FDSA 2OFHX 2NPFA 5K8NA 2Q79A 1QTNB 2KFZA 4F02A 3Q8SB 3I5BA 2X1BA 4DF8A 1JLCA 1OPZA 3N0VA 1FFSB 1MWZA 3ET6B 3TANA 4YQWA 1WACA 2F5GA 4IRKA 5A0YB 1GQEA 5KFLA 2C2KB 4MKYA 4ILLA 5BYRA 2R3VA 4USMA 2YWKA 3PW4A 1CJVB 3W7BA 4QW9A 2Z30B 1R27B 5I42B 2DNLA 2FJEB 4CYUB 3LP1A 1SB6A 2J9DE 3ZTPA 1OY6A 1R0BG 4OZLA 4GMKA 5E3PA 1PBAA 2GQQA 1SIWB 4OX7A 4P6QA 2G0JA 3IN5A 3NOCA 3TAMA 4DU8A 4LFBJ 3KK2A 2AYEA 3THPA 5LMNJ 3QATA 3AXMA 2DPJA 3JS9A 1YKWA 5HMXA 2YNGA 3LUYA 2V2QA 2P9CA 3ISNC 5DDPC 3PX6A 4NLPA 5GMDA 2Y1RI 4EFAC 2J0QD 4DWIA 4DV6F 3MCMA 4XPCA 4R0EA 3BBFA 4YHHF 4NL5A 5IOLA 1I6JA 4RNOA 2M0GB 2LEBA 1T95A 2OPRB 1AXQA 4RW8B 3TEGA 8RUCA 2RQKA 1VIOA 3T9NA 4I64A 3QZ7A 4KV8B 4JI3J 3BH6B 4AFFA 1R8BA 5F8JA 1X5TA 3CGIA 3MCOA 2MJUA 4M5NA 1HW8A 5IXUA 4K4ZA 4J7CA 4DX7A 1DJ0A 2OPQA 2KXFA 1EJ7L 1S6QA 2UVRA 3VQSA 2RF2B 3OL6A 2A3JA 3VF0B 2FJWA 1TMJA 4G1IA 4DR5F 3K89A 5AJ3J 2IRUA 1Y5LB 3EPGA 2J7WA 2YNHA 1PILA 1NK6A 1S48A 3D9BA 4LF7J 1S6OA 1FDBA 4OYMA 2J0WA 2ZE2A 4KAIA 3J7ZT 1U45A 1WEXA 1VLYA 4ZJLA 1F2GA 1OWXA 1PC4A 1WC1A 1NZAA 5DDQC 1KLMA 1SPBP 4ZDNA 3N5BA 3T5LA 1UZDA 1Z4UA 2W2NP 3E3XA 4TXSA 3DDKA 2RDJA 1DTTB 2VHGA 3CCJS 1J5OB 3TUIC 4B9NA 3DRSA 5T7LA 3EUNA 1GK8A 3U1NA 4ES2A 3BGRB 3QBCA 2BKNA 3DNCA 2V2KA 2H4YB 1HHSA 3DRRA 3DI6A 2ZZMA 2HLTA 2DNGA 2VJUA 1CS4A 1NHVA 2OPPB 4TU9A 1UJ6A 3OTBA 5HMWA 4LFCF 3P96A 3N79A 2D69A 1X4AA 4GO5X 1X4CA 1IBCB 5EWGA 1SJ3P 2D74B 3TNVA 2CADA 1JJCB 1VQ9S 2NQPA 1U26A 5LOQA 3FBFA 2ZHOA 1OY9A 1NK5A 1FKOB 3MAAA 4ZVTB 1OO0B 3H42A 5K8PA 4C9DA 4KGXB 4P10A 4DV6J 1WSVA 3CWJA 5A8WB 5SZTA 2UUTA 4H4OB 3J7A1 2MKJA 3LANA 5HVHA 1NLKL 5ITHA 1S97A 5HAOA 3PFEA 5A8KA 2RKIB 4KHMA 2VL1A 3AQOA 3AD7C 4WKYA 4IR1A 2MKSA 3S7RA 5LSRA 4RW7B 5HJYA 3O1LA 4C6AA 1S1VA 2YKNA 1U8SA 4ZVHA 3JSRA 2R7SA 2J8SA 4YB7A 2DNMA 2HIYA 2M9KA 1UVMA 2PI4A 3DN9A 3RAQA 3CO0P 2CXEA 4DR5J 3MEEA 1L3KA 3Q8YA 2K7KA 2MDAA 5L46A 2G4BA 2J9EA 2M8HA 2HAFA 1MG7A 3G2XA 1FWKA 3CJKA 2RRNA 2DR5A 3OXGA 1LWCB 2UUBJ 3M8WA 1X7VA 1TVRB 2QMXA 4DEZA 1WG4A 1XERA 2DCLA 3QAUA 5JUMA 2QSWA 2L48A 5M2RA 1U0SA 1H3DA 3QIPA 2W9BA 2DR8A 2I9SA 2EXUA 1HARA 2R7TA 1SC6A 3UVJA 1SJRA 2IBOA 4GKJF 2QYCA 2HHSA 3LTOA 3POTA 4FF4A 3UDVA 1DFDA 2EFGA 4FF1A 4F4YA 4C7QA 1VQLS 4NRUA 2VBYA 3UNGC 2NZCA 4ALZA 2B5JB 4U67Q 4U96A 3W2WA 4LFCJ 4CLZA 4UTGA 3ITHA 3HSGA 4Y0FA 2Y1IA 1SH0A 3FZ2A 2WSCC 2PN6A 3GTYX 4JI6F 2KG0A 3KG0A 1N52B 2CVEA 5DETA 5HL7Q 4OYAA 3W9IA 3LP2B 2JLFA 3WHIA 1WF0A 2YKPA 5G0RA 3R6GB 1LWEB 4ED6A 2PC6A 2MZQA 4CTAA 2KYXA 4EYHB 3S8SA 1YVFA 4YP3A 2G2OA 5ETQA 1HQEB 3PFOA 2J76E 3HHEA 4M5KA 5E2QA 3ILLA 4N7TA 4ZPBA 1X4EA 3IAS9 1U8WA 2BANB 4WFBQ 1YTYA 2XNQA 2R8HA 4KFBB 3MM9A 1FWLA 3CNQP 2BEFA 5M2PA 4KJIA 4KKOA 3HD1A 4DV2F 3MEDA 4R8UA 1RCOB 1EAYC 5D3GB 3C6UB 1KNZA 3M1VA 3KLGB 2R8GA 1GTEA 3A3OB 4RNMA 2HHTA 1Q5VA 3TAQA 3MI7X 1TK0A 4C8OA 2FB0A 2QTWA 2DNQA 1LW0A 4NLVA 4NYZA 4DL4A 3IBCB 2RDDA 3CCWA 3W66A 2LU2A 2AF6A 2BA9A 3NNHA 4M1KA 2C2OB 4RWWA 4Q5VA 4IG0B 4ZS6A 4N56A 3LALA 1LFPA 2B3TB 1IM6A 5T14A 2C2EA 3V81A 3MMAA 3SI8A 5A2QU 2Y3YA 3H5XA 3NG8A 3IXQA 1ROFA 1HLWA 2CZ4A 2MZSA 2DXEA 4NLGA 3HF5A 4I0WA 1S1TB 1GMVA 2B56A 2C2MB 1JLAB 2I8EA 1HNVA 3CTRA 2VB6A 4GKJJ 1HIYA 2X7IA 1ZH5A 5KFUA 1IKYA 4C4WA 3VALA 1NU4A 4YR0A 4JBCA 4DUZF 4ECQA 3MPYA 2HFOA 3LH2S 3TO8A 5D4NA 5A2QY 4DFJA 5AXKA 1QUVA 4LF2A 2PDAA 1F6TA 4URGA 3MXHP 5CABA 1PO6A 3MD3A 1UFLA 4U7UD 1XMOJ 1LXJA 4JB8B 3ZZZA 1TL1A 2XMUA 2QLWA 2ALZA 1Q16B 3E01A 4CO4A 5AE1A 1HR0J 2CKWA 3CIZA 2YVSA 1RHUB 1RTZA 3Q8PB 1TL7A 4ERDA 5E0OA 4V19X 3G6ES 1WKKA 2MGZB 2WONB 2BXJA 1U2CA 4J9VA 4WFXA 3HFZB 1TAQA 2BJDA 4JP8A 4DV2J 4WFZA 3UPFA 3BB5A 2RU3A 3K5MA 1C0TA 2FC9A 3S6EA 2BACA 4IG3B 3SCKE 4C8MA 4W90B 3VGTA 2ZM6F 1ZAXA 4QYRA 1XEZA 4XK8C 3C14A 1QJHA 4CLKA 3RB3A 4YR2A 3TARA 4NCBA 2Z2LA 3KNAA 4ZHRB 1ZAWA 3DRXA 4DPWA 4I7FB 3L9ZA 2B4VA 4DCOB 4HACA 2U2FA 4QR1A 1NRKA 2CPEA 3OL7A 3RW6A 2VIHA 5KG0A 2JRSA 4I67A 3JQJA 4P52A 2CPDA 4Y2AA 3HPOA 1SQFA 4P9SA 1QM9A 2JH3A 1UMJA 3UN5A 1TKZA 4ATNA 1VIXA 3H90A 1YJUA 2VC1A 4Q7AA 2DHSA 1GEHA 1JKHB 1TUGB 4X4UA 1VR6A 2BOAA 2IM3A 5E41A 3LOUA 5H9FK 2MKYA 3EZ5A 1RKJA 4OV1A 3ICLA 1N33J 2EW9A 3WIUA 3KK2B 5CCLA 2XS2A 1Q82T 1S1XB 3BZQA 3DCAA 1S1WB 2HK3A 4DR3F 1DY3A 3LGHA 3MEGB 2GMJA 3FQKA 4LIRA 2UUAF 1R8PA 3MTKA 1YJNS 3VGSA 2ACYA 2ZOGA 1IKWB 4UOFA 1SXLA 1EKSA 2DH7A 2EK1A 1R7IA 3GPAA 4HI1A 2BDPA 1XWLA 4CM2A 1OJ4A 3UN2A 1NB7A 4DFMA 4WE1A 3HSDA 4DG1B 2FZKB 5FDLB 4I2PA 2B6AA 3KYLA 2DRDA 2XGQA 1N5SA 4R5PA 1KRPA 4JV2A 3UCUP 3CJ8A 1C2PA 5GAEI 1YJVA 2NXJA 3TJAA 4X4NA 1U1NA 4FXVA 2XSJB 5J2PB 3FKBA 3DYAA 1R0AA 2PMZD 3H4BA 1ZTTA 3TEHB 1HBNA 3GJTB 4DL3A 3M2UA 3I82A 1VQPS 2YX7A 3QLHB 2IM0A 2W4DA 3JSMA 2QL9B 3PO4A 2MKCA 1G6BA 5F8IA 2VONA 3CCMS 2GZOA 2YNHB 1UAWA 4LT6A 4KGZB 4TLRA 1B7FA 1NJXA 2EWHA 2GGPB 1TKXB 1FDDA 4PQAA 2ZM6J 3TZXA 4IH6A 4KY3A 1UW4A 1JXVA 3GWCA 2ERRA 1YRTA 5HP1B 2FHJA 4C3KA 4NE9C 3TJ9A 1NEEA 1JLGA 3EGVA 2QA2A 4EBDA 3VVUA 2HHPA 4MIAA 3EYZA 2QV6A 3V2UC 4OYPA 1R3NA 2EFQA 4LVOP 1NJIT 1QAYA 3MUVP 2XB2D 4I2QA 2F65A 2AEJA 3I9ZA 3EX7B 1NJWA 3O8WA 4G3IA 3DRRB 3BKTA 4USHA 4CZCA 4YB5A 1K8AT 2KT3A 4OI6A 4ZN1A 2FDNA 3BGLA 1IR2A 1VQSA 2JNJA 3R9LA 1IR1A 1NM2A 3IR5B 1J27A 5DS7A 5CYMB 4C97A 1KHVA 5IWAJ 1EZZB 1N5YA 1TAUA 4NLRA 1S9FA 4RX6A 1TUVA 2H4WB 3DOMA 4LF6F 4DS5A 2M8DB 1RHRB 3EZOA 3NS6A 2E1PA 5H9FJ 4DR3J 1QAXA 2N7YA 4CH7A 3CE8A 1NMEB 5IC6B 1Y4ZB 4KO0A 2UUAJ 1RT3A 3KMQA 1KONA 5J2NA 4EUVA 5GAHU 1U24A 1Z1ZA 5HVFA 3SCIE 1JJ2R 4ED1A 2F3JA 3MCNA 2ZDPA 1VS3A 1RHKB 1FWPA 2VG5B 1DQ9A 1HI0P 2P6SA 3Q89A 2XMTA 2HK2A 2GMLA 2IIHA 2K1RA 2ZVSA 2AYBA 2HURA 3JTPA 2E66A 2KG1A 3AD8C 3ZZPA 5HVGA 4O3QA 3A13A 3I0RB 1FXRA 1B4SA 1R8AA 2AEMA 1UFKA 1VQ5S 4QPXA 3MM8A 2LEAA 4WK3A 2IMOA 2CQDA 1SJ4P 3K58A 4YN3B 4C0BA 3MEEB 1OYEA 5I4MA 4ECVA 2RRBA 4OX9F 1MU2B 3BV8A 4X4RA 3IG1A 3H4DA 3OTCA 1OQ3A 4QR0A 3E8OA 3H8YA 1ULRA 5IT0A 1SVDA 3LPYA 5I3PA 2UV8A 4J90A 3D4JA 4ZPDA 1X9SA 3ENVA 3MM5A 5CQGA 4J9QA 1CQNA 4WJBA 1ZA2B 3R2DJ 3CDEA 2CQBA 2OKQA 3S1TA 2ZKUA 1PJ5A 1WF1A 4PPDA 2UP1A 1VQ7S 1YI2S 2H48B 3IFEA 1V6HA 3PEJA 1X9WA 3DMJA 2D41A 1CULB 2VICA 4K4SA 4PR6A 1JNZB 2BM0A 3DLLQ 2GAGC 1J5EF 4EBCA 4W4MA 2HQ3A 4XAKA 2YH0A 6FDRA 4Q45A 2VC0A 3GYGA 3MECB 2JVOA 1FKPB 2HRTA 2QGFB 3MDFA 5IT4A 3HFKA 3ETMA 3RBDA 4B9LA 3DU5A 1V9OA 4CH0S 5ETRA 2X1AA 2KB2A 2LQ9A 3ZFVA 1F0XA 3I55S 2CJKA 3KHLA 2HNYB 1PKUA 4O3NA 3C46A 2QC3A 3T9ZA 2UVWA 1TL3A 1PJ6A 4LF6J 2J5AA 2LDIA 4NA1A 2FY1A 2QN6B 2IRYA 2NYHA 4LSNA 4YEAA 3HZGA 3H59A 3AJ1A 4DU7A 3TP2A 1HPZA 1AB8A 4DSJA 3M8PB 4RW6B 2I38A 2RQ4A 4X66F 1KS2A 1T05B 3WIVA 3G87A 4ILMA 4RW4A 2NYIA 2CQHA 1BLUA 2HFZA 4MKAA 1RT7A 5DLFA 4CTAB 1K1SA 1NK4A 1YDLA 4MK9A 5F41A 3NY0A 1D9FA 4ED8A 3LW5C 4ECWA 4DF4A 4X65F 3UDLA 1T03B 1TFWA 4ZA1A 1N48A 2Z0GA 3KJFB 2R42A 4PG6A 3HT0A 2M88A 4YR3A 2VU5A 2D7SA 3FRZA 4KKOB 1QDUB 5LJ3Y 1MMNA 3EZUA 2V4QA 5GAGI 4K5RA 4ZVGA 2MQLA 1LW2B 4ECUA 1EQ0A 4KE5A 1K73T 4RU9A 2AYGA 4OX9J 3N6NA 4BDPA 4Y2MA 3ZZYA 2W7PA 2HNDA 2WVCA 2GIQA 1GX6A 2C2NA 3DGPA 4NI2B 1LV5A 2XO7A 3CT9A 4ANDA 4AL7A 2XNRA 1QVGR 4OMFG 2GAHC 2ZH7A 4M95A 3AJ2A 2Y9HA 3QGHA 3IBFB 3CJ5A 1WORA 1JIHA 3BR8A 2FLPA 1Q79A 4LSZB 4DQSA 3V81B 4YUDA 5G4DA 4WBFA 2A0FB 2HWHA 2XBPA 1WC5A 5ETOA 3MR6A 4IDKA 1J5EJ 2M3DA 4WIQA 3AQPA 5K14A 5F9LA 4O0IA 5F8MA 2DHHA 2N82B 1HBOA 1BXNA 4JI1F 3THTA 3WZ0A 4PWUA 2XY5A 2ILZA 2WVFA 4DQRA 5DG8A 2MPUA 1GXLA 3VGVA 4UQTA 3K7RA 3NMRA 2AJ0A 1R8CA 2CQ4A 2VPXB 2VOPA 4PPZA 2WVBA 2I6WA 4UZCA 1KFDA 5KFMA 1H7XA 1N36J 2XMAA 1HBMB 2YTCA 2YWHA 2HMIA 2PMWA 1CJTB 4FXDA 1HQUA 3CJQA 3R5GA 4ZLPA 1RWWB 2C3YA 2MZTA 1NKEA 4P73A 4NEYA 1ZS6A 1RHQB 1N56A 3JAMU 4OJ3A 4EEYA 2OMOA 3DLJA 5DGAA 4OJGA 3GU0A 4X66J 4ZITA 2X51A 1WHXA 2RVJA 3HHLA 3W64A 2XM3A 3QZ8A 2VFSA 3NGSA 2PA8D 1O51A 2ZC3A 4ANEA 1DRZA 3LO3A 3N01A 1RJJA 1X4DA 2RSQA 2AX1A 2QJ3A 3WQPA 4X65J 3GQCA 3U1LA 4ZVEA 2CJXB 3F73A 4FVCA 3H2VE 1YK9A 1R31A 3R27A 4BWJA 3GB0A 2A2DA 2CQ3A 5LM7E 3C16A 4A46A 2RB7A 2QFJA 3R3TA 2QRRA 3TX0A 4DV7F 4ED0A 3Q24A 2ATLA 2A2CA 1BE4A 3A3PB 3PACA 5HJXA 6AT1B 2DNZA 3K5LA 2HVHA 2IYGA 5KG2A 3FNNA 1SC1B 1PJ7A 1NDLA 2VKZG 4EU0A 3IO1A 4BS2A 4JV5F 3QAEA 2ZJQQ 1U1LA 1SQGA 3HMJG 4A8QA 2BQUA 2Z56B 4EWTA 3J7YU 1FNMA 3J81j 2V5HG 3RG6A 4NZ7A 1F9EB 2B51A 3I5AA 3D6HB 2RD5C 4DPTA 3VAHA 1TKDA 1S77D 2KTQA 2V50A 1N5VA 3SFUA 4ZK7M 2W9CA 3PRBA 2DITA 4F4XA 2CDRB 4DCPB 2VFTA 4LRCA 4YB1P 1BMQB 4RJVA 4E98A 1U02A 2YKQA 5CYQA 1B99A 2R7VA 2HZVA 4U7CA 3QJJA 1N34F 1U6BA 1F9HA 2C3PA 1JNRB 4YY3J 3J80Y 4NCAA 2AJQA 3SSRA 3OTEA 5LXYA 5FLXU 3T1HF 2W2QP 2XMJA 1YITS 1GH8A 2B4UA 2D1CA 1RWKB 3P4UB 3KTQA 1S6UA 2LMIA 1M0SA 4PG8A 2B6AB 2EC2A 2WSEC 4HH0A 1P1TA 2G2ZA 4DLEA 2RMLA 4WYWA 2OUGA 2YQ0A 4OZ0A 1TZ0A 3G82A 2CQPA 3DHWC 4J91A 3TWZA 3W62A 5GAHI 2UXCF 1TV6A 4ID5B 3KLFB 3M2UB 3SSQA 2ZH4A 3OXLA 8AT1B 1C1CA 2E5IA 4DSFA 1Q8KA 3VAMA 5C24A 3U27A 1C1BA 2BM1A 1YJRA 1H0HB 1U47A 2R8IA 3FCHA 3MEKA 3OT9A 2KFNA 3HK2A 2XI2A 1NJZA 3K5OA 2BJ3A 4DV7J 3MR5A 2GJ2A 1YJWS 1PG5B 2E1RA 3DOKB 2XMWA 2KM8B 2BRLA 2HVEA 2KYZA 3HM9A 2QLBB 5KFOA 1VHFA 2WK4A 3MWBA 1WHVA 2HLUA 3M30A 1FRHA 3WDOA 2W4CA 1G3OA 3IM9A 3TA1A 1RGVA 1AW0A 3C6TB 4O44B 1M5HA 1TL5A 2GVDA 5HSPA 4ZPAA 1VJWA 2AHOB 4DJBA 1OSDA 4QIFA 4JV5J 2KJVA 4J9PA
chains in the Genus database with same CATH topology
3TOQA 2FLNA 3NBPB 1UJ6A 2M52A 4PWDB 3CCZA 3M9MB 3OTBA 3NLCA 5L1JA 1HWJA 4L72B 4W92B 4A8WA 5HMWA 3TUZC 1YBAA 4FP9A 3P96A 4LFCF 2LA6A 5DDRC 3ZZOA 1UETA 3N79A 2EKYA 1X4AA 3BM7A 4GO5X 4TY8B 5SUHA 2EG2A 2FJAB 1X4CA 1NK7A 5D4PA 1IM4A 2C3UA 5B7WA 1N8RT 1Y5NB 5EWGA 1IN0A 5H1SV 1SJ3P 3MGJA 2D74B 3UWTA 2IA0A 3MTJA 2LDYA 1BQNB 3TNVA 3JSBA 1X5PA 2W7AA 3Q0AA 3M32B 1VQ9S 4DDFA 2NQPA 2M70A 1S10A 4YDDB 1QSSA 1U26A 2BW2A 3UW1A 3GYXB 2ZHOA 4KIAA 5A0YA 2VA2A 1NK5A 2EVZA 5KT3A 2E1MC 1FKOB 3A1YG 1KVJA 4Q0BA 2B43A 3CD5A 5EN1A 1HI8A 1OO0B 3MM9B 2YWGA 2ASLA 5JJBA 1S79A 3H5UA 5K8PA 4C9DA 3CJ3A 1TKTB 1WTFA 3MEDB 4R8UB 3WX4A 4B9MA 4FNHA 4C0OC 3BDPA 5DJBA 4DSIA 3M1VB 3KLEB 1TK8A 3CWJA 4PXDA 4DL7A 2WHOA 2DNRA 5A8WB 2FLOA 2XWYA 4TLQA 1SJFA 5SZTA 4OHVA 1XNRF 3RTVA 5I42A 3KLIB 2RU9A 4RNFA 2FGOA 2UUTA 3IRXA 4KO0B 1VOMA 4H4OB 3J7A1 5EWEA 3GG0A 2MKJA 3LANA 3BR9A 5ITHA 5J2NB 1S97A 3OPKA 1KTVA 2DGQA 3D0IE 3TVKA 3CIMA 3VAJA 3PFEA 5A8KA 3RW7A 3PY8A 1LW0B 2RKIB 1SI9A 2LQ5A 1IKXA 2CQ0A 3MPWA 2HHVA 1FA0A 3PKMA 3OXFA 3KOAA 4X4SA 4KHMA 2VL1A 1VQKS 3I0SA 3K5NA 1UJ4A 3AQOA 2QEXS 3BS9A 4WKYA 5L9NA 4HT7A 4DUYF 2WW8A 1HWLA 2R7OA 4IR1A 4X2BA 2MKSA 3S7RA 2O5DA 5LSRA 4M5DA 3BQ2A 4JYAF 1RWUA 3UI3A 2NR0A 4RW7B 2HHWA 4KC5A 3ULHA 5IWAF 4J9MA 1DZ5A 3O1LA 1HMVB 5THWA 1J2VA 2HGLA 2EFPA 1S1VA 2YKNA 1U8SA 2GX8A 1IKVB 1M5VC 2C2DA 2R2UA 3OTDA 2I0XA 4ZVHA 3TA2A 3OV7A 3IC1A 3JSRA 2BYCA 3G6YA 2R7SA 5GMKa 4OLOA 4YB7A 2DNMA 2M9KA 1VQYA 3CXCR 1UVMA 5L39A 2PI4A 2E5GA 1RT1A 1WF2A 2DR7A 2ASDA 3DN9A 3MMJA 2VG7B 1RISA 2MQNA 3MMAB 3HVWA 5CXTA 1KOHA 2MZRA 3RAQA 4RLEA 3KK3A 2LQJA 4ES3A 3D0HE 2ZNZA 4RUCA 3VTIA 1WEZA 2QA4G 3MEEA 4B3MF 1L3KA 1RQ0A 1NKBA 2EFOA 3GG1A 2CYYA 1CLFA 3HHLD 2JLEA 1R89A 2K7KA 1PC5A 2MDAA 2HGNA 2DGOA 3LQVA 2VBZA 1AROP 2OPRA 4C11B 4HTJA 1SV5B 4RW8A 4IOBA 2R7RA 3NMAA 3PKYA 1W2BR 3VAFA 1Y00A 2G4BA 3PEHA