3KK1B

Hiv-1 reverse transcriptase-dna complex with nuceotide inhibitor gs-9148-diphosphate bound in nucleotide site
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
427
structure length
412
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords Reverse transcriptase p66 subunit
publication title Visualizing the molecular interactions of a nucleotide analog, GS-9148, with HIV-1 reverse transcriptase-DNA complex.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 113
structure length 412
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kk1B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk1B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk1B03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk1B04
2HNZA 5EWFA 4O3RA 4ZPBA 5T14A 4H4MB 3RAXA 2XGPA 1T3NA 2IM3A 4RU9A 2OPSA 4DG1B 3MEDA 4ECQA 1HMVA 5F8GA 3CJ2A 3QGHA 2C28A 3PW0A 1JLCB 3D5MA 4RNOA 1RA7A 4WFYA 2JC1A 5KT2A 1HPZA 2CKWA 3NKYA 1LWFA 3ITHB 1HNVA 4LSLA 3QLHB 4IFVA 5KFDA 1ZETA 4J9RA 3HVTB 1SUQA 5J2QB 5C25A 3H4BA 4H4MA 2HMIB 3QYYA 2IJNA 3KHLA 4RW8B 1QAIA 1RTHA 4ZPCA 1IKXB 4DG1A 2AGPA 2B6AB 5DG7A 3HVWA 4IDKB 1DTQB 3M9OB 1JLCA 1REVB 4K4XA 2AX0A 3QGGA 3H5SA 1T03B 3ISNC 3MFHA 5I3UB 1J5OB 4WXWA 4NLPA 1U09A 4ICLA 3FDSA 3ITHA 3UPFA 3QLHA 4WFZA 4K4VA 1FKPB 3MEGA 2UUTA 3CJ5A 4QW8A 3HVTA 2YNGB 2JLEA 3DMJB 4M95A 5L9XA 5J2QA 4ECVA 4TQSA 5KFVA 5KT3A 5J1EB 2HMIA 4LQ9A 5DLFA 4RW8A 5KG6A 3BR9A 1IKXA 4O3NA 2XI2A 4RUAA 2R8GA 5EWGA 1DTQA 3KHGA 1REVA 4JV1A 3ICLA 1T03A 5F8MA 5I3UA 1J5OA 5F8JA 1S1TB 2XCAA 1MU2B 1DLOB 4KBIA 4Y3CA 4IFYA 4FS2A 4EBCA 2J6UA 1IKVB 1FKPA 2I5JA 4ZPDA 1FK9A 4MKAA 3DMJA 3KMQA 2HWHA 3PHEA 3Q8QB 3RB3A 2VG6B 4NLDA 4QWEA 5J1EA 4IKAA 2YNHB 3T5JA 5I42B 2BANB 4WE1A 3V6JA 2YNIB 1SH3A 3MFIA 4ECRA 3IRXB 3OL7A 2GIRA 3Q8PB 5L1LA 5KFJA 5KT6A 2WTFA 3G6VA 1MU2A 5J2MB 1QE1B 4ED1A 1DLOA 1RTJB 3DYAB 1HQEB 4YR3A 1VRUB 3V81B 2XCPA 1S1XB 2YKMB 1IKVA 1YVFA 3KK3B 3LP0B 1S9GB 2R8HA 5F8LA 2R2RA 2VA2A 4O44A 1BQMB 5C42A 2BE2B 2VG6A 4KV8B 2YNHA 3PW7A 5I42A 4DL6A 4KFBB 3G86A 3LAKA 2ASLA 1IKWA 5KG7A 3IRXA 3GIJA 3V4IA 4NLRA 5KG4A 3MR5A 4K4TA 5J2MA 4Q8FA 3BGRB 4I7FA 1RTJA 2E9RX 1HQEA 1VRUA 3V81A 1T05B 1S1XA 1SV5B 4DL7A 3KK3A 4WYLA 3LP0A 1S9GA 4HYKA 1C1CB 4LSNA 5KG3A 3GV8B 2UVUA 1IM4A 1JX4A 4WFXA 2OPPB 2BE2A 4IH7A 2IMWP 4KFBA 1VRTB 1TKXB 3TAMB 4ECXA 4I2PA 2HNYA 2JEGA 4HKQA 4IH6A 4R5PB 3DDKA 3CO9A 5KG1A 5DQIA 3KHRA 5KFWA 3M8PA 5F8IA 2RKIA 4EO6A 2WB4A 3BGRA 5KFSA 3BSOA 3FRZA 4M94A 1SV5A 3LALA 3TVKA 2R8JA 3DLGB 4ZVGA 1TKZB 4ED8A 1C1CA 5KFCA 2XC9A 4KHRA 1HQUB 4O3SA 3MR6A 2OPPA 2AWZA 4MH8A 4NRUA 5EWEA 1S6PB 1TKTA 3KK1B 3N6NA 1LWCB 1VRTA 1TKXA 2OPRB 3I5AA 1C0TB 4QWDA 2C2EA 2W8LA 3OSPA 4TYAA 3T1AA 3FQKA 3SFUA 4EEYA 1S49A 2IM2A 3DRSB 4IOBA 2W9BA 3SI8A 3GILA 2W7PA 1S97A 4ED7A 3QIPB 1LW2B 4IR1A 2VG7B 2FVCA 2AGQA 4R8UB 1SH0A 1TKZA 3IG1B 4PQUB 1JLAA 5KFOA 4GC7A 2DPIA 2W9AA 1HQUA 1HYSB 1DTTB 1RTDA 1RAJA 4B3OA 4JUZA 4MFBB 3QZ7A 4ED3A 4QPXA 3CWJA 1S6PA 3KK1A 3PJXA 2OPRA 1C0TA 5KFNA 4JV0A 4IQXA 5KG0A 2ZD1B 3KJVB 3DRSA 4PUOB 2W7OA 3RB4A 4URSA 4WYWA 3QIPA 3GIMA 3VQSA 3EPGA 1LW2A 3QO9B 5HP1B 4NLTA 2E9ZA 3T5LA 1TVRB 3LANA 2WONB 2HWIA 2R2SA 4O3QA 4R8UA 2ASDA 3IG1A 4PQUA 3CDWA 1K1QA 4KKOB 3KLEB 1DTTA 1NHVA 3MR2A 4KB7A 4ZP6A 5KFQA 2D41A 2JEJA 3N6MA 5KG5A 5KFLA 2VA3A 3PR4A 4Q44A 4I2QB 1GX6A 4TY8B 3BJYA 4EYIB 4G1QB 3BSCA 3FFIB 1S9FA 4IG3B 2YKNB 2RDIA 2ZD1A 3DLEB 2O5DA 4PUOA 3NAIA 1RYSA 4IR9A 2B43A 5KFAA 4O4RA 5FDLB 3PW2A 3QO9A 3H59A 3H5YA 2BQ3A 1TVRA 2AX1A 2WONA 2WCXA 4F4WA 2B6AA 2UUWA 4IDKA 4KKOA 3KLEA 2ZKUA 5KFUA 4ECZA 3QGIA 1C0UB 4NYZA 5KFYA 4KO0B 1K1SA 2J6TA 4RNHA 1Z4UA 1N5YB 1IKYB 3I5BA 4TY8A 1RT5B 5DGBA 3NGDA 3RB6A 1N4LA 3DOKB 1N48A 1S1VB 4IG3A 2YKNA 2YNGA 3DLEA 3TQ1A 3KK2B 4NRTA 3OLBA 4EBEA 3CDEA 5KFTA 5DQHA 3CIZA 5FDLA 2BRLA 2HAIA 3H2LA 3UDLA 1RT7B 4DL3A 4TN2A 2AGOA 1S1UB 1UWBB 2QV6A 5KFBA 4NLQA 3FSIA 4MIBA 3C6UB 3PW4A 1RT3B 1C0UA 3EPIA 4K4UA 1N56A 1S10A 1S1TA 4H4OB 4KO0A 1KHVA 4RNMA 3BQ1A 5KFXA 1FKOB 4NLSA 1SH2A 1N5YA 1IKYA 3MR3A 3IGNA 1RT5A 5F9NA 3PZPA 1D1UA 3DOKA 1JKHB 1S1VA 4TYBA 2HNDB 3N6LA 4U7CA 1S4FA 4KSEB 3E01B 3LAMA 5C5JA 2AQ4A 4NLGA 1CSJA 1RT7A 4QWAA 4G3IA 5DQGA 4ZMMA 2C2DA 2BANA 1S1UA 1KHWA 1TL3B 1JLBB 4TXSA 2GC8A 2D3UA 2YNIA 1S48A 3C6UA 4X2BA 1RT3A 1JLGB 3Q8RB 2IM1A 2W8KA 1GX5A 2R8IA 3I0RB 1QE1A 5JUMA 3KLFB 4IH5A 3DYAA 4RUCA 1FKOA 2IBKA 2IJFA 2YKMA 4IG0B 4ZP7A 1JLEB 2EC0A 1RT1B 5HLFB 2FLPA 1XR5A 3MECB 4NLWA 3ISND 3E01A 1BQMA 1S0OA 2FVRA 2FVPA 3PW5A 2E9TA 4KV8A 3M8QB 1JXLA 3KHHA 3JSMB 1QAJA 3RAQA 2FJVA 1C1BB 1JLBA 3NAHA 1RT6B 3KOAA 5CYQB 5KFZA 4PWDB 3T5HA 2BR0A 4J9OA 1JLGA 2CJQA 2WK4A 2ALZA 2DPJA 1ZTWA 3C6TB 3DOLB 1I6JA 4RZRA 5KFIA 1T05A 2IC3B 1R0AB 1JLEA 1XR7A 1RT1A 4ECYA 4QW9A 5HLFA 3D28A 4MIAA 4DL5A 4NLUA 4TQRA 3MECA 3BSNA 4ZP8A 3PVXA 2ATLA 4Q0BB 2WOMB 4ECSA 4MK9A 4KAIA 3MEEB 5CYMB 1RDRA 2FLLA 3NL0A 3KLIB 3JSMA 3TAMA 4RW6B 1C1BA 3BSAA 3IS9B 3DM2B 4ZVEA 4U6PA 4R5PA 1RT6A 2WHOA 2JC0A 4K4WA 5CYQA 3G6YA 2IAJB 1W25A 3FQLA 2RDJA 4ECWA 4F50A 4K4SA 3NBPB 4WZMA 3C6TA 3DOLA 4ECTA 2V4QA 3IN5A 4WZQA 2IC3A 1R0AA 4IRCA 4RW9B 3DLGA 3JYTB 3V6DB 4EBDA 4KHMA 1N6QB 5J2PB 2WOMA 5L1KA 3MEEA 5CYMA 3RB0A 4MK7A 1LWCA 4Q8EA 1RT2B 4ID5B 4RW6A 3IS9A 5J2NB 3GIKA 1RA6A 4TLRA 1EETB 2IAJA 3KLGB 2JEFA 5HROB 1SUQB 2RF2B 3NBPA 3DLKB 3PR5B 4FS1A 4NLOA 5L1JA 4LQ3A 2VG7A 4NLXA 1OS5A 3HVAA 2F8EX 1TV6B 4RW9A 2R2TA 3KLVA 3JYTA 3V6DA 2IM0A 1RTHB 1WNEA 3RBDA 5C24B 4R0EA 4Y2CA 2ILYA 2FVQA 3LP1B 1HYSA 1N6QA 5J2PA 4ECUA 4ED0A 4MFBA 5KT5A 4FBTA 3CJ3A 5EDWA 2BQUA 4ZVFA 1RT2A 4ID5A 3IGVA 5J2NA 3EZUA 4ICLB 1C2PA 1JLQB 1EETA 4RW4B 3KLGA 3KJVA 3MEGB 3HHKA 5HROA 2RF2A 3DLKA 2WRMA 4DL2A 1TP7A 1S9EB 5HP1A 5KFEA 1TV6A 1JLFB 3CVKA 4YQWA 2R2UA 5EUHA 5C24A 1XR6A 4Q43A 3LP1A 1S1WB 4EO8A 1RTIB 4QWBA 5KFMA 3T5KA 4YR0A 2BQRA 3MTKA 3OSNA 4F4XA 4NLVA 1EP4B 3DI6B 4ED2A 4JV2A 4IRKA 3NMAA 4I2QA 3LP2B 1JLQA 1LW0B 4IFYB 4XPCA 4G1QA 2JEIA 3FFIA 4RW4A 1JIHA 3Q8SB 2I5JB 1FK9B 3CDUA 3OHBA 1NNDA 4O3OA 4YP3A 1S9EA 4ZVHA 1BQNB 4RNFA 3M9NB 1D0EA 1JLFA 4NCGB 2J6SA 3GYNA 3UR0A 2VG5B 4WE1B 1HARA 5K14B 5KFHA 3H40A 1S1WA 1RTIA 3V6KA 3GV7B 1S0NA 3H5UA 3BREA 2V9WA 1EP4A 3DI6A 3HKWA 4MK8A 3LP2A 4J9SA 2D3ZA 1LW0A 4Y34A 3OL6A 3BQ2A 2UVVA 3KK2A 5KG2A 4O44B 5C42B 5F9LA 2FLNA 1BQNA 3GV5B 1UWBA 4NCGA 3UQSA 2FJWA 3SFGA 5KT7A 2VG5A 3OLAA 5K14A 1IKWB 4ZP9A 5F8HA 3KMSA 2W9CB 3V4IB 4ZPAA 4J9NA 3DRPB 1LWEB 4H4OA 5DG9A 5D3GB 4Q45A 4ED6A 4F4YA 2ASJA 3G6XA 3GQCA 2UVRA 2V4RA 4I7FB 3E51A 2OH2A 2ZE2B 2R8KA 1S0MA 1JKHA 3CJ4A 2HNDA 4YR2A 2ILZA 5KFKA 4LSNB 2B5JB 4YMEA 4J9MA 3H5XA 2BRKA 1TL3A 3I0SB 4O3PA 4QWCA 4J9LA 1TL1B 1QUVA 5KFFA 4RNNA 2I1RA 2C2RA 2OPQB 2HNYB 2YNFB 4I2PB 3QZ8A 3OL9A 2W9CA 3BQ0A 4K50A 3I5CA 5DLGA 3DRPA 1LWEA 3M8PB 5D3GA 4DL4A 3I0RA 2RKIB 5HBMB 3KLFA 1ZTTA 5KT4A 5KFPA 4RW7B 3OL8A 1KLMB 2ZE2A 4IG0A 2V0NA 3KLHB 2IA6A 5F8NA 3V6HA 3DRRB 4EYHB 3GIIA 5KFRA 3OHAA 3CJ0A 2B5JA 1S6QB 4ZHRB 4J9PA 1HNIB 4K4YA 2QE5A 4XO0A 4NZ0A 3M8QA 5KFGA 4URQU 3M9MB 3I0SA 4XPEA 4H54A 1RT4B 1TKTB 1TL1A 4TY9A 2XGQA 2OPQA 2YNFA 1MMLA 4PWDA 3T19A 1T94A 3MF5A 2XI3A 5HBMA 2FJXA 4WXOA 2W9BB 3RBEA 4O4GB 4RW7A 4URGA 5DG8A 1KLMA 2FVSA 2HNZB 4IRDA 2XWYA 4DEZA 3KLHA 1RYRA 2UVWA 2OPSB 2D7SA 3MEDB 3DRRA 1HMVB 4GC6A 3H4DA 1JLAB 4Q0BA 4J9KA 5DGAA 1S6QA 4ZHRA 4MKBA 4F4ZA 1HNIA 4FBUA 1RTDB 4B3OB 3QIDA 4Y2AA 4K4ZA 3KLIA 2C22A 1HPZB 1RT4A 3DM2A 4OL8A 3PJWA 1LWFB 4NLYA 4J9QA 2AU0A 1HNVB 5L1IA 4LSLB 3KNAA 4KE5A 4IFVB 3H98A 5JXSA 1NHUA 4O4GA 2GIQA 5C25B 1TQLA
chains in the Genus database with same CATH superfamily
2W2PP 1Q86T 3RAMA 4DS5A 1EZZB 2BVZA 4ZK7M 3HVTB 2PMHA 1V3ZA 1AB8A 4K4XA 4LF5J 5I3UB 1J5OB 2DRDA 1VQ6S 4XTTA 2JLEA 2VF3A 2CVIA 5J1EB 5KG6A 1JJ4A 1Y5IB 4JV1A 1ZAWA 4EGLA 2J6UA 2COLA 3DMJA 1WKJA 1NJWA 3W2VA 4IKAA 1WJ9A 3GONA 2OAUA 3MFIA 3OL7A 3ENAA 2YWWA 5K20B 3BDPA 2F7VA 1FO1A 4HR2A 2GIFA 2KYXA 1IBMF 4PQAA 2QSWA 2E9RX 1NJIT 2DRBA 1X7VA 3KK3A 2HVEA 1FJCA 3IM9A 3FRYA 4C8OA 1G2EA 1NH7A 4IH6A 7FD1A 2C42A 3UCZP 2OPPA 4NRUA 4DR2J 1URNA 3SFUA 3DRSB 2W9BA 3GILA 1IXKA 2FVCA 3THTA 4JUZA 4U67Q 2WW4A 1C0TA 3CTRA 2GVDA 1MWQA 4J9VA 5GVQA 2XWXA 2NCKL 1B7YB 2WONB 3B78A 4DUYF 1CS4B 2LLZA 1QY7A 3DHXA 2D41A 3AA8A 5KG5A 5KFLA 2VA3A 4R0JA 4TY8B 2HQIA 4X4NA 3DLEB 2ZHBA 2RJZA 5KFAA 4CNZA 1PG5B 4DV4F 4DSKA 1T9UA 5IOLA 2U1AA 1RISA 4IQMA 3MCOA 2WVBA 2FB0A 3I5BA 4NPOA 2B7BB 2UUAJ 3K59A 1S1VB 2HHHF 4OYOA 1U1KA 2HAIA 3HPOA 2HVHA 2CG4A 1HNXJ 4MIBA 2VB6A 4OYBA 2GAGC 4KIAA 5B0EA 4DZDA 2XO7A 2DHSA 3IGNA 4X64J 2XS2A 1S4FA 1A0OB 2CQ0A 4AXJA 1XERA 4DX8H 2RQ4A 3MM6A 3V5RA 1RP5A 2BW2A 2ASYA 4NWBA 4IH5A 2JFDA 2Z8QA 1NKEA 4DPWA 1RAFB 1TK5A 2BX6A 2FY1A 1KOHA 1A7GE 3KHHA 1NJYA 2A10A 3W65A 4QYZK 3TP2A 3QRQA 5HQ8A 1WG4A 1R0AB 4XIUA 1OPIA 4BWMA 1TMJA 3MPVA 1WDTA 2VFVA 3CULA 1RDRA 3MURP 3TAMA 1VCTA 3HVRA 2HZAA 3CJTA 4KHMA 3TEGA 2MTLA 3TUPA 1UZHA 1QD1A 4TLRA 3VWSA 2ROEA 3C66A 1X31C 4KYZA 1RTHB 2KT2A 3K57A 2QYGA 3SEOA 5EDWA 1EETA 2DNNA 3MEGB 3SDEA 1S9EB 3N4WA 2GS8A 4Q43A 4ANCA 1RTIB 2BQRA 1H72C 2V5HG 1QSYA 3UVJB 1JLQA 4OJ3A 2I5JB 4W98A 3CDAA 3Q8YA 1XIQA 5HN0A 1XJWB 2J6SA 3D3BJ 3DGVA 2ZH2A 1J5EJ 2CXEA 1KEKA 5C42B 2G1HA 2XSJA 3V4IB 4ZPAA 5B0GA 3GFZA 2V4RA 1JKHA 3I31A 2VQEJ 4LSNB 5EGYA 4DFKA 3H5XA 2A6OA 5JVHQ 4UUXA 4DR3J 4K50A 2PDAA 2QYCA 1YRUA 4NZ6A 3OHAA 4ZVSB 2B5JA 3R5CA 4LRDA 2FTRA 3MM9A 5HMWA 1RHRB 3F0NA 2XI3A 3DFEA 1VQNS 1KLMA 1Y11A 2K06A 4PAAA 3ZXWA 2VZ9A 5D4OA 5AE2A 3OUYA 2HNZA 3OW2R 2XGPA 4C2MA 5CZXA 3QGHA 3SCKE 3KG0A 2DGUA 3PO4A 2NQPA 4J37A 2VHGA 2HMIB 1WHWA 3GPAA 5J1PA 2X3DA 3PACA 1REVB 2PIIA 1FKAF 1RHKB 1N5SA 5G0RA 1WOPA 3HFZB 5KT3A 1JMTA 4LQ9A 3IR6B 3QPIA 5BYRA 3R3TA 1T02A 1VK8A 3T6JA 2HQGA 1KTVA 2LQBA 3DGPB 4F3MA 1FK9A 1GNKA 2OMOA 3PHEA 3Q8QB 2X7IA 4NLDA 2DNRA 2BEFA 2HBRB 5D15A 3AHPA 3MMCA 2GIRA 1KDNA 3D7SB 1FVSA 4HTJA 3TRGA 1RTJB 2MQPA 3JSBA 3DNCA 1WTFA 1HBOA 2Q6BA 3VVTA 2DITA 5E0OA 1XK8A 2C1EB 4ZA1A 1K47A 4K7QA 2H5IB 3HFVA 2DB1A 3TZYA 1CG2A 4HYKA 1CJTB 1ELOA 1E6VA 3AJ2A 3PYDA 4ECXA 2QLJB 3FKBA 2OIHA 4DR7J 2DHXA 1RBOB 1ZZNA 4ZVGA 3DU5A 1HQUB 4O3SA 1D09B 4ILLA 4LR8A 3AQPA 3FQKA 3ET6A 2IM2A 4P9SA 5AXLA 1HYSB 3M2UB 4FKYA 1NK6A 1X4DA 2KG0A 1RCOB 1NDLA 4I1TA 1LW2A 4CTAA 3IG1A 4K5SA 3ZO7A 1B3TA 4KB7A 1FHTA 3PY8A 4OJGA 1NSPA 4B9SA 3UD4P 2V69A 3MCNA 4LF2A 4BLGA 2MDAA 3BGUA 4YOEA 4DMZA 4EZ6A 1ICEB 3UDEA 2VJUA 5T7LA 1X4BA 4M63A 1N33J 2M2BA 3CDEA 3CE8A 2HGMA 4BHQA 3FSIA 2VU5A 1FTCA 1C0UA 2VFRA 5KFXA 1RWMB 2CA9A 4ZIVA 4B3SJ 1KVJA 2ZZTA 1NJXA 2P9CA 2BANA 2C2ZB 4ED4A 4C97A 4A4JA 2W8KA 2LQ5A 2YKMA 2V4JB 2C3OA 3OT9A 1BQMA 2BA9A 2UUBF 1C1BB 3HF5A 5HQLA 1FRLA 1WEYA 2QJ3A 1WF2A 1UWAA 4RZRA 2MLXA 3TJ8A 3CCES 1NK8A 1D3WA 2FIUA 1CJVA 2C2NA 2VC1A 3BSAA 2HG4A 3CD7A 1RT6A 2FGCA 4CO2A 3NXZA 4WZMA 3C6TA 4OV6A 3MAQA 2VDIA 5ETLA 4JI5J 2XLKA 2KXFA 4RUBA 2EXUA 2XG8A 1MNEA 5CYMA 1FFGB 1HBNB 2MQLA 2L48A 1H3DA 3M32B 4KGVB 3N9UC 3TUJC 3HVAA 4J9UE 1NK4A 2ZBRA 4ATNA 3KLGA 1RHQB 1TK8A 1BQXA 5IV3A 3BKFA 3JSRA 2ZC3A 3T5KA 2CUYA 3KKFA 2RE1A 5MAOA 3PRBA 4OI3A 4UT4A 2YKOA 4Y28C 4B17A 4MYUA 2ZHAA 3EXCX 1UVIA 1RAAB 2XY5A 3J81U 4YB6A 4DV2F 4RL1A 2J8AA 3WQPA 3FBBA 5JJBA 4FP9A 1WC1A 1V5IB 1T11A 4G1PA 1HL6A 1BHNA 2MHEA 5F8HA 2W9CB 1ZM9A 2WSFC 1TL5A 1Y4ZB 3OR1B 4O3PA 1TL1B 1UPMB 2BJ7A 1UA0A 5DLGA 1HNWF 1LWEA 4X65J 1RWOB 5D3GA 3US5A 5IT0A 1LOUA 2ZE2A 4USUA 1QVGR 4J9PA 2DKOB 1Y5LB 4XO0A 2OUGA 2N3LA 1OY9A 3A8KA 2AF6A 5BR8F 3J7A1 3B8HA 3ETMA 3NGKA 4C0BA 3PO5A 2CJAA 2UVWA 1HMVB 4GC6A 4MYTA 3D1HA 2EFOA 3KLIA 3PJWA 1UVKA 2NUHA 1S0OA 4O3RA 2KVQE 2FHKA 3M30A 2DHAA 1S72S 2BDPA 4DI6A 3D5MA 1WEZA 3FUYA 3IMQJ 3O5TB 3M2VB 1SUQA 2QRRA 2AGPA 2B6AB 2V50A 4IDKB 3G8SA 3R1LA 3T9NA 3BH7B 2XMAA 4EI2A 2WW8A 3UPFA 4DQQA 2HQDA 4USKA 3TA2A 4RUAA 3FMWA 3M6WA 3ICLA 2ZH9A 2BE9B 1RBLA 3CJKA 4KQZA 3S1TA 3WIUA 4F2SA 1M5PC 1FFSB 3RR8A 1UJ5A 2EPIA 3T5JA 3CJ8A 4CH0S 3OVSA 2WTFA 3CPWR 4A8YA 3MMBB 2DNGA 2VA2A 2Z0GA 1KLNA 4RKUC 4QR1A 2D9PA 1K8AT 4KFBB 1IKWA 1X8DA 4OHWA 1KQSR 5GMEA 3NCQA 4CLSA 2IYIA 1VRUA 1H7XA 3PDNA 2RDDA 3SCLE 2B51A 2GO8A 4ZVRB 3DLHA 2NS1B 2H5EA 1AYEA 3HHNB 1YJTA 4HKQA 1N34F 1QTMA 2J9EA 4N7TA 3BGRA 3BSOA 3FRZA 3J7YU 4ED8A 5EWEA 3QT6A 1S6PB 4CLZA 1LWCB 1VK3A 2C2EA 1IR2A 2HRTA 2GQ2A 4ZLJA 1DTTB 1OYEA 1F6TA 2ZH7A 2H9ZA 4C8NA 1B0PA 4JI1F 3CDWA 1RGVA 3DXBA 1U6BA 2DEJA 2HHSA 4MKYA 2P6TA 2YKNB 2ZD1A 5A6PA 3ZNJ1 3PW2A 4PG4A 2PGCA 1TVRA 2UUWA 3KLEA 2M3DA 3QGIA 2LXIA 1F5CA 3EXYA 4C3MA 2J6TA 3MTJA 4IOAQ 1Z4UA 1RT5B 2X3GA 3TQ1A 3QJLA 1RT7B 3A1YG 4OI0A 3L09A 4NLQA 4FDFA 3VAKA 4X62F 1IKYA 1D1UA 4Q2LA 4TYBA 2DK2A 3BEGB 1ZA1B 1HD0A 2CQHA 2OSQA 1OMSA 2K3KA 5B0CA 1R7IA 3BN4A 4RUCA 4C7QA 2EC0A 1CEZA 4OX7A 1SB6A 1U1RA 3W2WB 1S6OA 2W4CA 3PG9A 4JI2F 1JNZB 4M5JA 2E1CA 2G2OA 1RXOB 2ALZA 3JAMY 3IAS9 1UKUA 1RSCA 1UZDA 5AXMA 2HHXA 3JSMA 4P7TA 5E7OB 2V4QA 3JYTB 1J27A 4ANDA 1U7LA 2ZOMA 4DZ6A 2Y0BB 1NB7A 2P9EA 4RUHA 3MCMA 5D4PA 4DR5F 1OO0B 4DU7A 3DLKB 2Z57B 2Y1RI 1SJQA 2R2TA 3RBDA 5BYSA 2C2KB 1XMQF 5IQ6A 4ED0A 1X9MA 1REGX 1GFWB 1X5TA 3RYLA 1TU0B 1CS4A 2BM1A 4LRBA 1WDDA 4OLPA 5A0YA 2KO1A 1PCAA 3Q8SB 4Y00A 2JH3A 4RNFA 2XLJA 4QYZJ 3RBZA 4WE1B 1SL1A 3DDIA 3H40A 4OZ1A 4Z2XA 5L46A 1BQNA 1HBUB 1Z2ZA 1YJUA 1MSWD 2FHJA 1BLUA 4JI3F 4YMEA 3HMJG 1VLYA 2BJ9A 3CCLS 1F3VA 3EDRB 2YNFB 2LDYA 4ETXA 1VDHA 2NZCA 3W62A 2IRXA 3CJ0A 4M5KA 1RU1A 1P8GA 1HW9A 3RBEA 2OI2A 2D3OR 2OPSB 3C16A 5D0HA 4U7UK 5F0WA 4ZHRA 1SQGA 4FBUA 2YKQA 3RU0A 4NXMJ 3DU6A 1TL7A 4DV3F 1RQ0A 4HHJA 2H4YB 1RHMB 1QAYA 1P27B 4DG1B 1I3OB 1JLCB 4RNOA 3R2DJ 2J9CA 5KT2A 1XMOJ 4UW2A 4LSLA 3JTOA 5IWAJ 4NMXA 3NCPA 5AE3A 1ZH5A 4H4MA 1RTHA 2YVSA 4LFBJ 3PV8A 1DTQB 5DM6Q 1HHTP 3CCRS 1NDPA 2MY8A 4WBFA 4F3OA 1L3VA 4TU8A 3MEGA 2IJRA 4DLEA 1FD2A 5L9XA 5J2QA 4EMDA 1HI8A 1SVDA 1WELA 3CCVS 2I5JA 2IRUA 2LQ9A 1FI4A 3VGSA 2VG6B 5E3RA 3PXGa 4QWEA 2N3OA 4I6AA 2WB1D 3FCHA 4ZJOA 4DPYA 2QA4G 3Q8UA 2H65B 3V81B 3CC7S 1S1XB 1TELA 3OXFA 1D9FA 5B0BA 5C42A 1CJUA 1ZPWX 3IRXA 4KRWA 3V4IA 3MHYA 1UP1A 1FRJA 5AJ3F 1SV5B 1VQ7S 7FDRA 1O5JA 4LSNA 1VFJA 1FRKA 1J2VA 3CO9A 4L3NA 2K7JA 2HS4A 1LWXA 2HFOA 2RRBA 3TJAA 3B82A 4PG5A 3TVKA 3NS6A 1RHUB 5EHHA 4NMLA 3KK1B 1VRTA 5CAAA 2A18A 3I5AA 1H0HB 3OSPA 2EWHA 1RADB 4UTGA 2JLFA 3FNNA 3SI8A 2VPYB 1OQ3A 1YJVA 4LFCJ 4FYDA 4M5MA 1PSDA 1T3OA 2L41A 2W7OA 3VQSA 4PYDA 4R8UA 1YJRA 1H98A 2M88A 3MCSA 1NHVA 4ELVA 1GK8A 3EGZA 4B9MA 2O5DA 5H1SV 3RW7A 2XY7A 3H5YA 1NPPA 4OYAA 2J0QD 1X60A 2B4VA 3O6QA 1K1SA 1NO8A 1NDCA 2LQ8A 1N5YB 8AT1B 4IG3A 2XMJA 2QTWA 1H6KX 5AE1A 5FDLA 2V8PA 4C9DA 2IMOA 1KFDA 1S10A 1SPBP 3EYZA 3DOMB 4U7CA 3G2XA 3BO2A 4CLTA 2W2QP 3QNWB 5DDQC 4X2BA 3CT9A 2VKRA 3Q8RB 2DXEA 2IM1A 4LVNP 2IBKA 5HLFB 3MM7B 2RUGA 3KOAA 3NGRA 1ZTWA 3LWMA 1KQGB 1WSVA 4QIGA 1P6TA 1RT1A 4DL5A 5DZ6A 1VC5A 4ZP8A 2V9KA 3ZZUA 4ER8A 3AFGA 4WFNQ 2AHOB 1YGYA 2HFZA 2P9GA 3D66A 1U0SA 3HHLB 4H4KA 1M1HA 4N41A 2XYPB 5J2PB 1QSLA 4RW6A 3I4HX 2UXDJ 5ETKA 2IAJA 5HROB 1RAHB 1HI1A 4RW9A 3POTB 1WNEA 4Y2CA 1HYSA 3LP1B 4AYBD 1RWKB 5J2NA 2PMWA 4P73A 1TP7A 4YHHF 1FJEB 1IR1A 2FHOB 1WORA 4X66J 3IM8A 1NU4A 2J5AA 1PYTA 2CZVC 4IOCQ 1FD8A 1VIOA 4DX6A 5IC6B 3GV7B 3VCDA 3K5MA 3RGIA 2FYXA 1U24A 3K0JA 5F9LA 4J5OA 3UQSA 2Q79A 2C3PA 3LGNA 4DJBA 1YTYA 4ZP9A 1UA1A 3DRPB 2GQCA 3P45B 2UVRA 2R42A 3UDVA 1FWKA 2ILZA 1VQ9S 2C2RA 2OPQB 4CLFA 3GJRB 1NLKL 2MYFA 4DL4A 5KT4A 1F9EB 1CPZA 3G8QA 1FNXH 3HJFA 4AL7A 4LF7F 4WFAQ 1K44A 4URQU 1RWNB 2B7CB 4HI2A 3T19A 3KLHA 1VIXA 1VQYA 3CF5Q 1JLAB 1HNIA 4CT8A 3UI3A 3HHDA 1Y10A 2NR0A 3WBZA 4M5GA 5FJ4A 1TQLA 3J7YI 3OJSA 2R7RA 1PJ6A 3U1MA 3MEDA 2C28A 4GO7X 3NKYA 4EZ9A 4CO1A 3H4BA 5CQGA 4B9UA 3J7AN 3M8YA 2NYHA 3M9OB 2X1FA 2OLWA 1EIYB 2DHGA 4PEOA 3HULA 2WVFA 1MWZA 3C3LA 2BOAA 2G0JA 1ZOTA 2POKA 4F25A 2J8SA 2GA7A 4KY3A 5B0DA 4ELTA 4HDGA 4KC5A 4PPZA 5F8JA 1NUEA 4HACA 2KL8A 3K89A 1FRXA 4OI1A 4ZPDA 2CQ4A 4UY85 4LF9F 4ECRA 4QOTA 4USJC 3UNGC 1EQMA 3K7RA 1Q79A 1PJ5A 3TVYA 1KWMA 1FFWB 3MM8B 2YNHA 3PW7A 5ETPA 2QA1A 2NSBA 1JB0C 3D0HE 3M8RA 1S6UA 1A6LA 1VQMS 2GQQA 1M0SA 1IM4A 3SZ2A 4ES3A 4BWJA 3KJNB 4Y6IA 3EX7B 2FQQB 3IA0A 3GG0A 2LECA 1TKZB 1C1CA 2XC9A 2YWEA 2ZC4A 4J91A 3T1AA 1TR0A 5ADZA 3TYTA 2Z2YB 3GIRA 2W7PA 3QIPB 4X4PA 2FC9A 4ZVQB 3FK4A 2OFGX 3I82A 3VGUA 3SV3A 4CLLA 2MQOA 2OPRA 3GIMA 2B4UA 4CRJA 3K5LA 3EGVA 1OWXA 2KJVA 3ILJA 1KFSA 2JEJA 3GP9A 2AYGA 4I2QB 4QIVA 3K5OA 4C8ZA 1S9FA 3RR7A 1Q82T 1AFJA 2CPIA 3VAIA 1SIZA 3H2UB 2HVDA 3K5PA 3C46A 1ZS6A 2B6AA 4IDKA 4KKOA 4NYZA 4KGZB 1BMQB 1HWIA 3M8WA 4OQJA 1B0VA 4EBEA 3BZQA 1UWBB 3HD1A 2PEHA 1RT3B 1CJKA 2XYGB 1SKUB 4KO0A 3S01A 2AQ4A 3LAMA 4NLGA 4DR6J 4ZMMA 4M1KA 3W5XA 3N5BA 1TL3B 5A8RB 1JLBB 2CDQA 2DO4A 3SCIE 2ERRA 3X1LB 2XZTB 3ISND 3UO0A 2EG2A 2E9TA 3MUMP 3M8QB 1QAJA 4WKYA 4LF5F 4PWDB 2BR0A 4C0HA 2EKNA 4UZCA 1QTNB 3W63A 1YLXA 4FNIA 4JI0J 2B8QA 5IT4A 1FVQA 3NBPB 4PWUA 3AOCA 1PIEA 2YH0A 2BBEA 3F56A 1WSRA 3RW6A 1LWCA 1SCJB 1LEOA 3OJUA 2YPYA 3KLVA 4KPYA 4ZPVR 5C24B 2R7OA 1N6QA 3C15A 2FJEB 4M5DA 4ICLB 2ZH4A 2RF2A 2G9OA 2WRMA 4OYIA 5CYJA 4E98A 2MGZB 4KGMA 4GKKJ 4QWBA 1FF2A 2RMLA 5BXIA 4NLVA 1EP4B 1R8BA 1VQ4S 3RRGA 1YKWA 2W01A 3RTVA 4OV1A 3U1NA 4U7UD 2AEJA 2P8IA 5K14B 2QLWA 3RG6A 3LQVA 4DR2F 1S0NA 4Y34A 1Y3JA 2DXDA 3J81j 3HD2A 1GXTA 3FSYA 5KG2A 4B3TJ 2A1BA 1U8WA 2HURA 5HJYA 1GMVA 1S0MA 2Q6CA 3PX6A 2FJBB 1QUVA 1FNOA 3CO0P 2HNYB 1T9TA 2XNRA 1WC3A 1DZ5A 1LKZA 4B3RF 3GIIA 2D69A 5THWA 3HI9A 3D67A 2DBBA 5HBMA 4OX9J 4O4GB 2UUAF 3EM1A 1XWLA 2XB2D 3M6UA 1HNXF 4OZ2A 4OL8A 2HFVA 4K0KJ 2RUSA 4IFVB 1R89A 3VGVA 4X64F 1U0HA 4G1IA 2CQPA 4ECQA 3CC2S 3FEYB 3K8VA 3TA0A 1LWFA 2MZSA 1NEEA 1HNVA 3MD1A 3PYFA 5EN1A 1OPZA 5KFDA 1X4HA 4ZLLA 2ATCB 2HFSA 5E3CA 2X1GA 2VDHA 3TVZA 2UZAA 3QLHA 1FKPB 4ZVPB 3IP0A 2LVWA 4DU8A 1IKXA 2XI2A 1F5AA 3FCWA 2PFFB 4F8RA 4ZN3A 3WC0A 2XHWA 3MPDA 5JVGQ 4YDXA 5ETNA 4O23A 3RB3A 4WE1A 4X4VA 1MMDA 5AXKA 1DLOA 3EJMA 3LP0B 1H2TZ 1ZM2A 2KRRA 1MROA 5CABA 5J2MA 4UOFA 3O3LA 4C48A 4JYAJ 4RX6A 2DR6A 3C19A 5ETRA 4WFXA 4CZCA 2BE2A 2Q43A 4CO4A 3ZZRA 1NSKL 4TLQA 1KONA 2HHHJ 5F8IA 2N4DA 2J7UA 2ZNYA 3P5TL 2WVCA 1TKXA 3UD3P 5HO4A 4U96A 3M1VB 2ZNZA 2GGPA 1S49A 1VI7A 1S97A 4E0DA 2MB0B 3DLBA 2GO9A 3PJXA 5E33A 2L3MA 1V3SA 1AZSA 3GSIA 1IQTA 1GEHA 2VQEF 1U1LA 2FZCB 1UJ4A 3A13A 3UDCA 3NS5A 4L73A 2XO6A 4DR3F 4CM2A 1R6YA 2CQCA 4PUOA 1RYSA 4IR9A 2QMUB 4OYZA 4M5IA 1VQ5S 5ETTA 1TTHB 1KOOA 3ZTSA 4ZS6A 3SCJE 1N4LA 3DOKB 1YRTA 2JFKA 1YG0A 3S7RA 3H2LA 1VLOA 5KTQA 2DGOA 3UFCX 1U45A 2W2MP 2ZWOA 2DISA 3E01B 1DBDA 2L9NA 2MJNA 5DQGA 3KDNA 4OIXA 4IO1A 3KLFB 2GAHC 3N01A 2OEJA 2V67A 4CO0A 5DRKA 2DR9A 5CYQB 3W5YA 1L3KA 3SIPB 2ALYB 2IC3B 4ECYA 1YJWS 4F0KA 4DQPA 3IS9B 2C3YA 1N52B 1SKWA 4K4WA 4ECWA 3DOLA 4GVBB 2W25A 2WOMA 5FIIA 2DCUB 2QZ8A 4NE9C 3U02A 3GWCA 4MMOA 5EX3A 4UQGA 1UTAA 3A8EA 3KJFB 2XBPA 2MHNA 4CLKA 3HSDA 1CBKA 2JSXA 3PJ9A 3TZWA 4DSJA 4DR7F 1JJHA 1L3SA 4OYXA 5HMXA 2VICA 1S1WA 3KFWX 2B4OA 4QIWD 3BREA 1NH8A 3GSDA 3HKWA 1IJFB 5HAOA 2UVVA 2LYVA 3MZIA 2MMYA 3KMSA 1FCAA 3MGJA 4Q45A 1WG5A 4F4YA 3GQCA 3MM5A 3E51A 2EEYA 5HSPA 3SBMA 2F3JA 2M7SA 4F26A 1U2FA 3HDSA 3I0SB 3MMAB 2FHMA 4NEZA 1QUPA 1WG1A 3OL9A 1NKCA 2E29A 3BQ0A 4F4KA 2ZBQA 3T1YJ 4XPEA 1FRHA 2LFVA 1T94A 1HR0J 3ULHA 3BF4A 2QGFB 3VF0B 4IRDA 5LSRA 1N33F 2NZ4A 1VQKS 5DGAA 4ZCLA 2LA4A 2YX1A 4LREA 3SQGA 5L9NA 2C2MB 1KQKA 4YN3B 3W8PA 4B3SF 5SZTA 2JOQA 4DV0J 1C4CA 3G96A 1HPZA 3ITHB 3FJ2A 1IBLF 2CQDA 3OTBA 4F02A 4Y2MA 4ZPCA 2LQJA 4HDHA 4LF4F 3DKDA 1T03B 3P6YC 2KT3A 1MWYA 3KTQA 2GMJA 4K4VA 4G65A 2UUTA 4QW8A 3CJ5A 1KR4A 3KG1A 4RW8A 4LBIA 4TU7A 4O3NA 1HBMA 1Q53A 4JI7J 1MU2B 2XMKA 1IKVB 3OTCA 3CGIA 1B64A 4F04B 2QFJA 4X84A 4I64A 2ACMA 4LUBA 4WIQA 5LSLA 3VVUA 2FLOA 2E44A 2MPUA 4KV8B 2J0SD 3G86A 2ASLA 3VAJA 4NLRA 3THPA 3J7ZT 3MPUB 2OHDA 4Q8FA 4RWWA 3MR7A 4TKTA 4LSZB 3IXQA 3EGNA 1N54B 4F36A 4M8LA 2IMWP 2I38A 3KHRA 2CQIA 4ALZA 3R5JB 3LWLA 4USIA 2E5LJ 5B0AA 2HIQA 4QWDA 5K8PA 1SXLA 1HHSA 5HJXA 1JLAA 4GC7A 2KM8B 3QZ7A 1HW8A 3HKZD 2JRSA 4LRCA 4HLBA 4K5RA 4NYOA 3PEJA 2DR5A 1NMEB 2YWGA 1KNZA 4X65F 3HCXA 2EBGA 3GYXB 2Y8WA 2VV5A 2K1RB 1U6FA 4WJBA 4WF9Q 3DLLQ 2DGQA 4DV5J 2R9LA 1S1UB 2ZHOA 1ZAXA 3PW4A 2DD8S 4XAKA 4K4UA 2VBZA 3FBCA 3H0PA 3T1HJ 2HKEA 1FKOB 1FJ7A 1SJ4P 2HNDB 2HQ3A 2QA2A 2GC8A 2D3UA 4A8KA 3C6UA 3OV7A 1HFEL 3H8YA 1GX5A 1Y7PA 2R8IA 1R8CA 1NSAA 4HL9A 5E5NA 3NLCA 3MM8A 5IM0B 3EUNA 4NLWA 2DR8A 5IFMA 2AYEA 1M5OC 3UNYA 3L7UA 3QAUA 1NB2A 5KFIA 1FDBA 2G0CA 2VD3A 4MIAA 4NLUA 3PVXA 4DXLA 3E2EA 4DHVA 3LPEA 2FLLA 1GQEA 3NMRA 2G2YA 4HHUA 1RAEB 3JQJA 3TEHB 1U25A 3V6DB 2GVZB 2IBOA 3U7JA 3KJQB 4AE5A 5IC4B 4QR2A 3TOQA 1EJ7L 4ID8A 1IBKJ 5A8KA 3QWUA 1TV6B 2RHSB 4R0EA 5LL6d 4FBTA 5JMNA 4DUTA 3IGVA 2V68A 1TUWA 2HHUA 4RW4B 1FXLA 2YXLA 5EX0A 4RPFA 2MQ8A 1BD6A 2BJ1A 5LM7E 2CWKA 4N8NA 4NCBA 4JV2A 4IRKA 4I2QA 2F5GA 2DO0A 1W2BR 4O3OA 1F60B 3AXMA 5CCLA 2GW8A 2GMHA 4OMFG 1NZ8A 4I56A 3LP2A 1B4SA 1LW0A 1RLDA 2IDLA 3BQ2A 3B6BA 4O44B 2XEXA 4OZJA 1UWBA 3SFGA 4B3MJ 2VG5A 1SJRA 3GCWP 3OLAA 3HHLD 2V2VA 3PX4A 1RACB 1NBEB 2N82B 3H7HB 2ASJA 4DX7A 1UEVA 1SJ3P 1TK0A 3CC4S 4DS4A 4UQTA 1TUVA 1TL3A 4J9LA 5GAGU 4TVAB 4LMZA 3OL8A 5ETQA 1R27B 1AA1B 2V0NA 4EYHB 2EK1A 3M8QA 5KFGA 2YWHA 1KS2A 1EX8A 4PWDA 2PSZA 4RW7A 4PWWA 1GMWA 3ISZA 4I6YA 5SUHA 1H74A 3D0IE 4K4ZA 3R97A 1RT4A 1Y3KA 3ENVA 4KE5A 2MSTA 4H4KC 5E2QA 4FYVB 3ZZ0A 5ETOA 2XZWA 4AXIA 2A6MA 4ELUA 2AEFA 4ZLNA 1N34J 3ISNC 2H3EB 1T9VA 5CHCB 4ICLA 1Y0HA 4C3LA 2W2OP 2YNGB 3DMJB 3H25A 4DR1J 3EZOA 3NRBA 2DNPA 4EUVA 5F8MA 5F3TA 4K2XA 4LF6J 3QMQA 4FS2A 2MQMA 3R7NB 3PCOB 4KT0C 2HWHA 3G82A 3JSYA 4EU0A 3B4MA 4DPOA 1U02A 3I6PA 2JWNA 3G6VA 3M6VA 2UV8G 2EW9A 3KK3B 2MKSA 2R2RA 1A9NB 1IBCB 2E5JA 1DY3A 5I42A 1YDLA 5D0GA 3AB2B 2BMBA 3SV4A 2ZJQQ 3D4JA 3G4SS 4LF1A 4ZPTR 4K4TA 3DLJA 1T05B 2IY5B 5HQMA 2M4MA 2OPPB 2HNYA 1B7FA 2Q66A 3ZZZA 1Q7LB 2JJ4D 5KFCA 2J7WA 2ZUAA 5DO2A 2B9EA 1F5BA 1C0TB 4X62J 3TJ9A 1TFYA 1JNRB 2O67A 2HAFA 1SH0A 1FWLA 1GTHA 4PG8A 2RD5C 1RAJA 2BKNA 1GMUA 3ETOA 3Q2SC 4IQXA 4ZOSA 2DIUA 2E5IA 1SL2A 2JLGA 2IIHA 3T5LA 4O3QA 1YQHA 3QSIA 2ASDA 4PQUA 2CFXA 3PR4A 1GX6A 3ILIA 2HHQA 1ZPVA 1GAOA 2V8DA 2XQCA 4A48A 3HT3A 1X5OA 5KFUA 3JB9k 5E3AA 4OZNA 2O3DA 1H38A 3KXDA 4RNHA 5DGBA 3OBIA 1RUSA 5K8MA 4NRTA 2PA3A 2H51B 3CMAS 5KFTA 5DQHA 5DDRC 3UDLA 3MM6B 4QU6A 3MAAA 5D6GA 4H4OB 3BQ1A 1NKBA 2QMXA 4NXMF 2Y3YA 4K59A 1RWPB 2KZMA 5B08A 1KHWA 1SJ1A 5D78A 1XMOF 1NK5A 3I0RB 2UXCJ 2XMVA 3W7BA 3KG4A 5IWAF 3AJ1A 1FT8A 1XR5A 1DFDA 3QJPA 2K3IA 4Y0FA 3L3CA 4LFBF 3BBBA 1JLGA 3A8JA 2WK4A 2HHTA 1R8PA 4CWBA 1JLEA 4QW9A 3TAPA 1YZ7A 1GH8A 2WVEA 1LFWA 1G4CA 2E5GA 4XDDA 1HNZJ 1LQ9A 1V3RA 2M5YA 4HVZA 3MEEA 3TI0A 3R6LB 3M1VA 3VAMA 1EETB 4FYXB 3I55S 3TZZA 4MKVA 1Q1KA 4V19J 1KBRA 5CD4H 4P72A 2BQUA 4DWIA 1JLQB 3AQOA 4DCPB 2IVFB 4C8LA 1NK0A 3VR1A 1U26A 2EG1A 5LMUF 3VTIA 1XNQF 3CDUA 3P5BP 1JLFA 4BS2A 2CPFA 2XSJB 1T9YA 3TR5A 1GMWD 4DV3J 1SJFA 4MK8A 5ITHA 1VQOS 3OL6A 4CM0A 4G6VB 1DURA 1KVKA 4JI4J 3NS7B 4J9NA 1X5SA 3UCGA 1T7PA 2XS5A 3EDQB 2MKKA 4P2MA 3CJ4A 2B5JB 2CG8A 3MM9B 2LCWA 5KFFA 4I2PB 3KLFA 3H2VE 2CJYB 1KLMB 1TL4A 2NYIA 2H1YA 3UWTA 2F65A 2RQCA 4B9TA 3FVYA 4WXOA 2R7SA 1CQMA 2HNZB 3OUYB 2XWYA 3DRRA 4J9KA 1S6QA 1SI9A 1RTDB 1OSDA 2VFUA 4PCQA 2HZCA 4FVCA 2F9DA 2K8GA 2JX2A 1BC6A 2LXUA 4MJKA 5HL7Q 4DFMA 4YUDA 4P2FA 3PW0A 1RA7A 4WFYA 3Q8VA 5G0RB 2PI5A 1U47A 4DV7J 4B9LA 2H5JB 1RE1B 5C25A 2KHCA 5KOWA 4PPDA 4OYPA 3SMZA 1F0XA 3SSQA 1LK5A 1WHVA 2VH7A 2WZ1A 4F7VA 4A46A 3FDSA 3BGOP 3HSZA 3BN7A 1M5VC 3MMCB 3SXLA 3TAQA 3P96A 2LXFA 2HW3A 1HBOB 1XTZA 1FJGJ 1HWLA 3W3SA 2YNIB 3QT5A 4WK1A 5GADU 2KYZA 2UXDF 2CJ9A 4RU2A 1M5SA 3IAM9 1U1NA 2XCPA 2E7VA 1F2HA 1YSJA 4I6WA 1ZAVA 1RJJA 2VC0A 2YKAA 3GG1A 2F1FA 1AUDA 5ETMA 1HQEA 1RABB 4DL7A 4LR9A 4WYLA 1S9GA 5KG3A 1JX4A 2RAQA 3AA9A 2PFDA 4X66F 5DQIA 3ET6B 4HEA9 4Y2KA 2A2DA 2QC3A 5LMNJ 2IVYA 3HZGA 1VQSA 4KTQA 1MG7A 3GFHA 4IUFA 4TYAA 2DNMA 4RLEA 1LW2B 2XULA 4CTAB 2UXBJ 3IG1B 4I68A 1HKAA 1RK8A 3QFHA 5GMDA 2ZM6J 4OYWA 4S0MA 3KUEA 1FEHA 3CCUS 4KPCA 4C8MA 2E5HA 1L5UA 4I67A 2F4VJ 2V8VA 4LRFA 5T7LB 4B9VA 1UFLA 3R6GB 3BO3A 3QO9A 3A4TA 2WCXA 3D54A 2ZKUA 1C0UB 3GCXP 5HVHA 2V2QA 2AMCB 1N48A 4HT7A 4JV5J 4QIFA 1RBAA 3OTDA 1N56A 3MR3A 1VBZA 2DH8A 3FEXB 2BM0A 4YY3J 4KSEB 1Q8BA 5C5JA 3D6MB 4XK8C 1UCNA 2MKYA 1UFKA 3M2RA 1UAWA 4YHHJ 4U8VA 1XQIA 4OZLA 5D8HB 1CJVB 4KV8A 4JI6F 2R3VA 1RWVB 1RT6B 4B9NA 3HJVA 5KFZA 3BPSP 3C6TB 1FXRA 1XR7A 3ZZPA 3MECA 3M7VA 4PRFA 2ROGA 5CYMB 5GAGI 3R27A 2HHPA 3DM2B 2Q1LA 1WC0A 4X4RA 3FQLA 2KJWA 2MKJA 4CYUA 1T9XA 4WZQA 4C3KA 2J76E 2R7XA 2WBRA 1WACA 3Q83A 2EFGA 4PG6A 2FZGB 4ZVUB 3KLGB 4NLXA 2F8EX 2V8HA 4ZDNA 3JAMU 3TUIC 1U4BA 2CQGA 1RT2A 4ID5A 3EZUA 1QM9A 4I0WA 2RILA 3HHKA 2KDOA 2QSFA 4LF7J 1PYOB 4MIWA 1CULA 3PKYA 1DRZA 1TFWA 1S57A 2DGWA 1EQ0A 1TZ0A 2FGOA 4D3GA 3ZTPA 3H90A 1T95A 4LF8J 1HARA 2B8PA 3DI6A 1QSSA 2F40A 2DGTA 4ZIWA 2AV5A 4NCGA 5DDOC 2XS7A 3T6BA 4A47A 2RNEA 3VGTA 4F2RA 1LWEB 4ED6A 5D3GB 4I7FB 1C4AA 2ZE2B 1G6BA 3W9JA 2HNDA 1O51A 2Q3PA 5I3PA 4LBHA 3BO4A 2OJ3A 3GR1A 4NA2A 4QWCA 3PKMA 3UE2A 1WD6A 3OD2A 2M0GB 3QJJA 2UUCJ 5LXYA 5IM0A 2HGLA 3LGMA 4CO3A 4ZCIA 1FX4A 2AJ1A 4WWSA 4ITSA 1PAUB 5I4MA 3GMGA 1KQFB 3AD8C 2GFFA 2CNOB 1NAQA 4N77A 2XTJP 4BC9A 2DNLA 4QR0A 1CVJA 5IS2A 4J90A 2O01C 4OI2A 3PFEA 2VASA 1PBUA 4RU9A 1S77D 5F8GA 4DR6F 3Q0AA 2KT5A 4RR5A 1EAYC 3FBFA 3A8IA 3ONQA 4OJ1A 4JBCA 3JTPA 3QYYA 2IJNA 3AD9C 3FEZA 3QGGA 5D4NA 5IQQA 4NLPA 4X4QA 3CJKB 3R5GA 1T8EA 4WFZA 1WTBA 3HVTA 3NGTA 4ECVA 3ZZYA 4PR6A 5CH7B 4JI0F 3VHQA 3AB4B 5I3UA 1J5OA 3I56S 2VQFJ 3BV8A 2DGVA 2EI5A 5J1EA 3LA0A 3D3CJ 2ZEJA 5L1LA 1U1PA 1VRUB 5F8LA 4ETZA 4O44A 2ADCA 3ILLA 4PZVA 1RWUA 1FE0A 3BGRB 3FZ2A 4ED5A 1UPPA 1ACMB 4RBTA 2H54B 3WX8A 4GKKF 1WI8A 2CAJA 4CI0B 4P2SA 1XC9A 1ZM4A 4FPRA 5KFSA 3ZFVA 3DLGB 3MDFA 2MKHA 2RS8A 2GHPA 3K17A 1DARA 4USWA 3N6NA 5M2UA 2AD9A 1WUUA 2HWTA 1NCLA 1U2CA 3NNCA 3PRVA 2FY8A 5KFOA 2DPIA 3DCAA 5HI7A 1I94J 3EE3A 4QPXA 4B3TF 3BGFA 5KFNA 1MW7A 1HD1A 2ZD1B 3DRSA 4HTIA 3HHLC 4F4AA 3PFOA 1TVRB 2HWIA 4NI2B 2V63A 1SQFA 3KLEB 5KFQA 4Q44A 3ELHA 1DQAA 2I2YA 2MSSA 4EYIB 2OEKA 3FFIB 2RQKA 5FD1A 2F9JA 2FPHX 5ETVA 2WONA 4CH1A 5KFYA 4OI6A 2JNJA 3NGDA 1IKYB 2CPDA 4TY8A 2KZZA 2YNGA 3DLEA 1JXEA 2VPZB 1IWAA 4OX9F 2NPFA 3NY0A 1ZZFA 2AGOA 8ATCB 1UFWA 4CO5A 3ZTRA 4DUZJ 5A2QY 2DNYA 3X3UA 1KHVA 2UU9J 4K0KF 1M1GA 2ZJRQ 1XNRJ 1S1VA 2OTJS 4IYQA 4QWAA 4G3IA 5H9EJ 4OHZA 4IG0B 2HLUA 4ZP7A 3VAFA 3GE9A 2DNHA 2PE8A 2ZH1A 3JSMB 4KHPJ 3LF0A 1FWPA 4BDPA 4J9OA 2CJQA 1IR0A 1D9DA 1T05A 4L76A 4FF3A 1W2IA 2CJKA 3TA1A 4ECSA 1AFIA 4LT6A 2CVEA 3I9V9 3G6YA 3WZ0A 1R0AA 4P74A 2CZ4A 3K8WA 3LOUA 1RU2A 3RB0A 1PO6A 1IWGA 2ROPA 3FBEA 1RA6A 3VV2B 3QAEA 1OSCA 1GXUA 3N0VA 2NREA 1B70B 3PR5B 5KOXA 1SC3B 2AEMA 3CDBA 5CCMA 5A0YB 3VZHA 2QN6B 3UR3C 2AYMA 1QJHA 2QMWA 4B3RJ 3R7SB 4DL2A 5AXNA 3CVKA 2BJEA 4JYAF 4DR4J 2R2UA 1LXNA 3N79A 4F67A 3F44A 3NCRA 3L4BC 1S9EA 4ZVHA 1BQNB 2LEAA 5FLXU 5KFHA 1RTIA 1YRXA 3EZ5A 3UVJA 5LJ5Y 1VC0A 2FLNA 4NX9A 4P6QA 3KDOA 4DQRA 4H4OA 2ADBA 4FYYB 4YR2A 1OIAA 4LIRA 2M8DB 2Z2MA 5KFKA 1S76D 3FGVA 3BGLA 5GADI 4F0HA 1E6YB 3I0RA 1MLAA 3C16B 4ZHRB 4W90B 1VRQC 3NNHA 4TY9A 1PBAA 1RLCL 2ZKTA 3HO1A 1TL7B 4C0OC 2DVIA 2YKPA 1N0VC 1YJ7A 3VAGA 4URGA 1TKDA 1N5VA 3CB4A 3H4DA 2HQCA 4B3OB 4Y2AA 1H2VZ 2MXYA 4LSLB 3GJSB 3TX8A 2MKCA 3H5UA 4ZPBA 3RAXA 4H4MB 2CZ9A 2VJVA 4DF4A 2MJUA 3NOGA 2N7CA 2CKWA 4EWTA 4J9RA 5J2QB 2RQMA 3PHTA 4QBUA 2IFXA 3LUYA 3SQOP 3CCQS 4M95A 2EFVA 4F0MA 1RZMA 2HMIA 2HK2A 4DV1J 5EWGA 1REVA 4FZVA 4ZJQA 5HMYA 2MEWA 4L6V3 3KMQA 1HWJA 2XHCA 3QGPA 3D1OA 3M8ZA 2PEBA 1CJUB 1TAQA 3JTNA 3IRXB 2G2ZA 2VBWA 4K8RA 2HIYA 3DGPA 2R8HA 1HIYA 2DNOA 6AT1B 3BBFA 1YK9A 4CLYA 2V8GA 5KG4A 1RTJA 5K8OA 3AOAA 3PTWA 4Q2MA 3W64A 2LMIA 1B0TA 2EKYA 1VRTB 4I2PA 1D9AA 4P75A 1R3NA 2Z4PA 5KG1A 3I96A 1CJTA 1P1TA 1VBYA 4ZITA 2D1CA 4IR1A 3RRHA 4R8UB 3GFXA 1HQUA 1JJ2R 1RTDA 1FE4A 5FLXY 3KJVB 5HP1B 4E2FB 5GAEU 3M2UA 3OTOJ 1DQ8A 4NZ7A 2QLFB 4IG3B 2OFHX 5FDLB 4IO9Q 3H59A 2BQ3A 4ECZA 3T1YF 4GMKA 1HR0F 3KK2B 4ANEA 2D3O1 3Q86A 2V2KA 1S79A 3W5ZA 1KP6A 1LNQA 4CNYA 1Q0NA 2RU3A 1FRIA 5L8RC 2O1PA 4NEYA 2JHEA 1VOMA 5BJRA 2FZKB 2YNIA 4DV0F 1RAGB 1NK7A 2ZDOA 2J9DA 1N5TA 1RT1B 4TU9A 2CNLB 2CPHA 4A8SA 4C8KA 2AJFE 2FVRA 4OZ3A 1WF0A 1JXLA 4FYWB 3NAHA 2XM3A 2A3JA 3IWNC 2DTJA 1LXJA 2V4JA 4PXDA 3BSNA 1NRKA 3OTEA 4PG7A 4WP9A 4KAIA 2B4PA 3MOZA 3WC2A 2FUG9 3NGSA 2VBXA 4RW6B 1C1BA 4JI7F 2IAJB 3ILOA 1FNMA 1IVZA 4RW9B 3DXSX 2GJ2A 5J2NB 3GIKA 4FXDA 4L75A 4UY8T 3BYPA 3EMTA 4LFAJ 4ZPWR 1OS5A 2R7QA 1H73A 4W4MA 4RJVA 4ECUA 4DN9A 5KT5A 3RUBL 1KSPA 2BUNA 3CJ3A 4ZVFA 3O8WA 1HBNA 3NNAA 3C14B 2KFZA 3M32A 1LK7A 4DV6J 5HVFA 4GKJJ 4X4SA 2HFNA 3MUTP 1Q5VA 1BWEA 4PABA 3ZZOA 3JQKA 5D77A 2E5LF 1VHIA 2BJ8A 5E3PA 3V6KA 1S12A 3QATA 2V9WA 3AT1B 1SC4B 3VALA 2GHVC 2M9KA 3P3DA 4UOCA 2FJWA 4FF2A 1IBLJ 1Q7YT 4C8YA 2WSEC 4FKXA 4AQYJ 1U1OA 1Z1ZA 2W24A 4J9MA 4LF4J 1N36J 3CD0A 4DF8A 2DH9A 2W9CA 5C2GA 2R7WA 1ZTTA 1CQNA 3TX0A 3KLHB 3V6HA 3OR1A 5IV4A 1RKJA 5H9FK 3CW2C 1HNIB 3KYLA 1FX2A 2QE5A 1TKTB 1TL1A 3K58A 4HI1A 1I51B 2FJXA 2FVSA 1RYRA 3MEDB 4DV5F 3AJDA 3DM2A 2HVIA 5IXUA 3NEKA 3T1HF 3IRWP 5T14A 2KFYA 1HMVA 2ZVIA 3CJ2A 3BH6B 2ZVSA 2PD1A 3P49B 2AX0A 2L9DA 3MEKA 4HACB 3M2VA 3V4MA 4RBVA 2BXJA 1S1TB 4KBIA 4Y3CA 4EBCA 4CQ1A 2H48B 2QL5B 4USTA 2YNHB 3U27A 1KRPA 1U1MA 1H2UX 3SYZA 1IBKF 1AXQA 2HBZB 1X9SA 1NZAA 1VGYA 4C11B 1PILA 1NK9A 1NM2A 4I7FA 3D1QA 5T41A 3MMBA 1C1CB 3GV8B 4YB5A 2OP5A 1N32J 1VQ8S 4IH7A 4KFBA 1YITS 2ZJPQ 2DR7A 5KFWA 4DCJB 4EO6A 2CQ2A 4M94A 3LALA 1BXNA 1SC1B 1JXVA 4M5LA 2M8HA 1NPKA 2EC2A 4MH8A 2BJDA 4AFFA 4J7CA 2OPRB 3AH6A 2B9WA 3AXKA 3AODA 4IOBA 5E3QA 4YB7A 3TWZA 3QRRA 4FPIA 2IA0A 1YHQS 4MFBB 1EKSA 4B3MF 1S6PA 3QSYB 4JI8J 3E3XA 3IWXA 5KG0A 3OVAA 3RB4A 3DC2A 1X0PA 3LANA 2MKIA 2HGNA 4CLUA 4KKOB 2VKZG 1DTTA 3MR2A 2AJ4A 2RDIA 1OJ4A 2B43A 4O4RA 2ZBIA 3TNVA 5BYQA 2R7VA 2QEXS 3GFYA 4F4WA 2DEIA 4ZVTB 2MZQA 2Y1JA 1YX2A 1CJKB 3F73A 4KO0B 1O6XA 2E7WA 2F63A 4NXNJ 5DJBA 2YKNA 2U2FA 4YDDB 1UVJA 5DS7A 3P4UB 2NXCA 1S59A 3GB0A 3VAHA 3O2IA 2PA8D 2KI2A 4NLSA 1RT5A 2C3UA 3N6LA 2Y1IA 1RT7A 2CPZA 3PIPQ 4OI4A 3W66A 1PKUA 1AT1B 2GJIA 2HZVA 2QIFA 1X4CA 2DHHA 1K9MT 3RAQA 2OD6A 5L38A 2D9OA 3T5HA 4JB8B 4BC7A 3HT0A 3W2WA 4Q0BB 4FNHA 4PXEA 4DR1F 1JWWA 2E66A 3A3OB 1EHWA 3R2CJ 4LF6F 4K4SA 3IR5B 2AZ1A 1YIJS 3UN3A 2VODA 3DLGA 3M4XA 3U1LA 4EBDA 2AKWB 1VC6A 4KJIA 1N6QB 3C15B 2DNKA 1PYSB 3L7OA 4M5DB 4MK7A 2ZFHA 2IVMA 1JQGA 2LU2A 2P5VA 3Q89A 2RF2B 4LQ3A 3J81Y 1URRA 1IBMJ 2QA4S 3JYTA 3FMBA 2IM0A 4P52A 1PGZA 5A8WB 1Y9OA 2ILYA 3NG8A 2X51A 4DLGA 3D6FB 3IR7B 3HHEA 1AW0A 3DLKA 2W7AA 5KFEA 4NI2A 4CDIA 3IBCB 1HHQA 4F4XA 2M70A 2CPEA 3FFIA 3AOBA 1KVIA 4YP3A 3M9NB 2LEPA 4P2XA 5D0RA 1SIWB 4OFZA 4V19X 2W4PA 3GV5B 2UP1A 3I9ZA 3I32A 3OR2B 4QIEA 2K7KA 2VOOA 3LW5C 3BKTA 1YJ9S 1T9WA 4ENOA 3B54A 3GR0A 4DUYJ 2J9DE 2NXUA 1D8ZA 2BRKA 4KH0B 1HBUA 4CP5A 2NSCA 3RJMB 2YQ0A 3M8PB 3IBFB 1R43A 2RKIB 5HBMB 1M90T 4IG0A 3C8YA 2CNNB 5F8NA 4DV4J 3FCVA 3OFEA 4K4YA 2AP6A 2YNFA 5DETA 3UN5A 3LTOA 3UCUP 4P7VA 2R8GA 2F8HA 5DG8A 2KHDA 1U0HB 1WHXA 4Z7CA 1BY9A 1FRMA 1U2RA 4F4ZA 1VYAA 2YX7A 4HH0A 4CT9A 1XN9A 1LWFB 4NLYA 2AU0A 1HNVB 4GO5X 4DSIA 1J5EF 2IM3A 2OTLS 2OPSA 4WFBQ 3G71S 4FN5A 1MN9A 2MZRA 3R1HA 1UW9A 4N56A 1S0VA 2HVZA 4L72B 4LRAA 3QLHB 4OZ5A 2N7YA 2UXCF 3PYGA 2QT7A 3KHLA 1IKXB 4DG1A 2BW7A 4ZJLA 2KFNA 2K2PA 2KM8C 1JLCA 2EFQA 4X4TA 2V6AA 4ES1A 3IWLA 4R25A 4DPXA 4DBQA 4N47A 5GAEI 4L3KA 5KFVA 5CA5A 4OJHA 2GCFA 3CCJS 1DTQA 4ZN1A 3EVWA 1DLOB 3L7PA 3CCTA 5IT9U 4MTPA 1R31A 1SKRA 1HNZF 4Q7AA 1IJEB 4HHHA 2DY9A 3LPYA 1MROB 2XSFA 5KT6A 5J2MB 1QE1B 2BE7D 2KG1A 2VIHA 4ED1A 3K5NA 1OYDA 2BE2B 2VG6A 1YJNS 4DL6A 5GMKa 2RSQA 3ENWA 2HYIB 4Y65A 3W61A 3V81A 2V94A 1S1XA 2AJ2A 2VPXB 5LSOA 2ZWPA 1R0BG 5HATA 1V5VA 5K8NA 3ZZTA 1YZ6A 1WC6A 1TKXB 4NYPA 1E6YA 5F3ZA 1FESA 2GGPB 1Z2LA 2KN4A 1SV5A 2NPIA 2HHVA 1Q81T 2L08A 4RO0A 2W1BA 2J0WA 4EEYA 1AZSB 5K5MA 2B56A 4ED7A 2VG7B 3PNIA 4KGXB 4M5NA 1X9WA 1VS3A 2LDIA 4B3OA 4JI4F 1AUSL 3KK1A 2DH7A 4JV0A 1SL0A 2HQFA 4PUOB 2PI4A 3CNQP 2NLWA 1SKSA 2OD4A 1FA0A 1NJZA 4ZP6A 3E8OA 4DX5A 3N6MA 5LOQA 2MY7A 3BJYA 2FC8A 4G1QB 2ZUGA 4P71A 1KD1T 3OQ2A 3M6XA 4WP3A 3QRPA 2ZOFA 1XBWA 3EVOA 4DL3A 3TZXA 1X4EA 3EPIA 4KH1B 1N5YA 3R5AA 3BB5A 1WF1A 3CCSS 3OXLA 5LJ3Y 5B7WA 1LFPA 1O0PA 1S48A 4KR0B 2L9WA 4CLWA 2KB2A 2IJFA 3PM9A 4DV7F 4PYAA 3DOMA 2FLPA 9RUBA 4CIOA 3OFGA 3W8GA 2FVPA 3P8BB 2FJVA 2AW0A 5LMUJ 5DZ7A 1XNQJ 3DOLB 2OGUA 4WTYA 1F9FA 5HLFA 3D68A 3MM7A 3Q2TC 1ROFA 1N8RT 2WOMB 4MK9A 3NL0A 1S99A 2YBVA 4WK3A 8RUCA 1KC8T 2Y8YA 2N4CA 1W25A 2ZZNA 4ECTA 4IRCA 4X4OA 1L3UA 3IC1A 1WC4A 1FJGF 4NASA 1RKIA 5F41A 3I87A 3HHLA 1G1XA 2PN6A 2BV3A 3W1YC 2RS2A 3MAHA 5IT9Y 5J2PA 1SBRA 2VFSA 3KJVA 5HROA 1U49A 3R9LA 1HWKA 2QG9B 5HP1A 3POTA 1X0FA 5EUHA 4U95A 2KTQA 3LP1A 1S1WB 4EO8A 3G87A 2RHQB 3OSNA 1QDUB 4IFYB 2DNZA 2JEIA 4OHYA 5B09A 5C7PA 3OHBA 1NNDA 2KXNB 5CXTA 4TNOA 5LMNF 1XEZA 3MM5B 2D3ZA 4Z7YA 3KK2A 4OLOA 1NHKL 3R5BA 2UXBF 1KN6A 4JI5F 1PJ7A 1WEXA 4YS2A 3H20A 1UVNA 3D9BA 2ZM6F 4JP8A 2OKQA 2DYAA 4RNNA 3QZ8A 3DRPA 1GT8A 2F4VF 2DIVA 2Z2LA 1EKRA 3DDNA 3CD6S 1DAXA 1FXDA 2OPQA 3SQGB 1SQEA 2YWFA 3MF5A 4UF4A 5ETSA 5CD4A 4JV5F 2D7SA 1BWVA 1HPZB 2DXFA 4J9QA 5L1IA 5JXSA 1R8HA 4B08A 3D2WA 1HLWA 5LXRA 4YY3F 3HX9A 2FHJD 1WHYA 2ZZMA 2PO4A 3HSJA 1RB0A 2O66A 3ZTQA 3TW0A 1V6HA 2UUBJ 4U8YA 4RW8B 1QAIA 5U47A 3WHIA 1HBMB 1VQLS 1BGXT 3MFHA 1JJCB 4WXWA 2YX4A 3C14A 2VPWB 1VR6A 1RAIB 1OY8A 2NXEA 3BR8A 5DLFA 3NWGA 3KHGA 1U8SA 3BPDA 2XCAA 5H9FJ 2GJFA 4D3HA 2DT9A 1UW4A 3AAWB 3MI7X 3LO3A 1WKKA 4AD6A 2AIRB 3BBCA 4ERDA 4YR3A 3DYAB 3CJRA 3ZC4A 3BDEA 2PMZD 2Z2ZA 2MQNA 4GRSA 2RH3A 4XDCA 4WTOB 1IQZA 2OSRA 3ENQA 4Y2IA 2I8EA 3MPYA 4Q5VA 1X4AA 3TUZC 2A2CA 4AL5A 2MLYA 4K2JA 4DPUA 4UZBA 4R5PB 3KUGA 2VONA 2DJWA 1F1BB 3TQEA 4B02A 2KH9A 5HVGA 3C2PA 4CH7A 3MPWA 1ZM3A 1CC8A 4OHXA 2Z30B 1UVMA 1TKTA 4LF8F 4DV2J 2A0FB 2W2NP 5KAKA 4FXWA 1FDDA 4DSLA 1TKZA 3CXCR 2W9AA 3CWJA 2ZBCA 3DRXA 3UW1A 3G8TA 2XMMA 3QIPA 3EPGA 1M5HA 2E9ZA 1CLFA 4JI6J 2DRAA 2R2SA 2VOPA 1K1QA 2RRAA 4USMA 1HNWJ 3CIMA 3J80U 3NAIA 2JVOA 1Q8KA 2UUCF 4A8XA 2CPJA 2BKPA 3WIVA 3R7BB 2XZDB 1VBKA 5BR8J 4OX8A 3RB6A 2XYHB 3VZIA 4U9RA 1QLNA 3CMES 4AL6A 1WOOA 2QFIA 3C6UB 5L39A 1S1TA 2CQ3A 2W4DA 1SH2A 4LR7A 5HMZA 2ZH8A 4A8OA 2J0XA 2C2DA 1FDNA 4TXSA 4ILRA 1S5ZA 4QZVB 1RT3A 5AT1B 2HLTA 2LA6A 4NCAA 2GHWA 3FSXA 4USHA 3BM7A 1UJ6A 4C11A 7AT1B 5A8RA 1JLBA 2DGXA 1Q16B 2Y1LB 4ILMA 3Q23A 1I6JA 3CCMS 3S6EA 2ACYA 3D28A 2ATLA 1M5KC 3WX4A 2VL1A 4PKDB 4U6PA 4WU2A 2JC0A 2RDJA 5A8KB 4F50A 2VQFF 2HFUA 5D0EA 4C98A 2HRYA 4MT1A 1D8YA 1I1GA 5L1KA 2X1AA 5HANA 4BBYA 4Q8EA 1TAUA 4EK2A 1B99A 3GYGA 4FS1A 3NBPA 3DHWC 1QAXA 3MD3A 2OO4A 4WP8A 2R7TA 3KWMA 4MFBA 1NDKA 4X4UA 4EFAC 1RCXB 1PC4A 2AT1B 3HM9A 2ZITA 3SSRA 4A8WA 5C24A 1FTRA 2G13A 3MTKA 2FJAB 5M2PA 3LP2B 1LW0B 4XPCA 3AY0A 3IO1A 1N5QA 3HK2A 3W2VB 4LVOP 2MGZA 5HK4A 3OFHA 2VG5B 2P2CB 2R4FA 5C2CA 1EP4A 1PAEX 4J9SA 3GJTB 2QO3A 1I5OB 3PEHA 2I6WA 2DY1A 3EICA 2AJ0A 5K14A 1I94F 1OQ6A 4MAKA 5DG9A 2OH2A 2C3MA 4JI1J 3D6HB 3GLJA 3OFFA 2ZH6A 4QU7A 1U1QA 3I4PA 2D74B 2P6SA 3I5CA 2EK6A 2IYGA 5KFPA 4RW7B 4NA3A 2ZH5A 4NZ0A 3HSGA 4H54A 1RT4B 3CSKA 4RWXA 1RWXB 2EFNA 2YPZA 1YI2S 3CEDA 2W9BB 4Q0BA 3J80Y 2RIJA 4RBUA 4DQIA 3M05A 1YBAA 4DUZF 2XY6A 2GVDB 3H98A 2UU9F 1K0VA 1DQ9A 2SXLA 5H9EK 4O4GA 2GIQA 5EWFA 1XNRF 2Y9HA 2C2OB 3PRDA 2PT0A 4DL0C 2JC1A 2XMUA 2XNQA 1X4FA 2F8MA 4IFVA 3MMJA 4QPTA 3LGHA 3MXHP 3LH2S 3NGUA 5A8WA 2H4WB 4JI2J 5I3QA 5DG7A 3T41A 3H5SA 4KHPF 1K73T 5GAHU 2IPOB 3G82B 2FD2A 3BR9A 1SC6A 1WI6A 2MQQA 3TANA 3CD5A 1X4GA 1FKPA 2G1DA 1JK9B 2RRNA 4NOHA 5I42B 6FDRA 1SH3A 2XMTA 1CC7A 3HLUA 4DR5J 2HBQB 1IN0A 1YVFA 2QL9B 3RZAA 3CCZA 1XMQJ 3OR2A 3GIJA 1DJ0A 1W7WA 3NP5A 1U6ZA 1F3FA 3LP0A 2UV8A 2UVUA 5A6WA 4DR4F 3TAMB 2LP4A 1IUJA 2JEGA 3OPKA 4FVMA 3DDKA 3M8PA 3QQCD 2RKIA 3G6ES 1NPRA 2WB4A 3EWGA 1YBUA 2R8JA 3RRKA 3MR6A 2RT3A 4OHVA 3GU0A 4E8UA 4P10A 4DN0A 3GZ7A 1Q95G 4NA1A 2AGQA 2MLZA 1H7WA 2DGSA 4PQUB 4PXCA 2MZ1A 1UL3A 1W26A 3EGWB 2OMLA 1FEEA 3SSSA 4JI3J 1UEUA 3SDEB 4DCOB 4NLTA 2QLXA 2HPUA 3PX0A 2AYBA 3BSCA 1V9OA 6FD1A 2ZOGA 2MZJA 2LEBA 3MUVP 1ITPA 2IRYA 3MAAB 4HH1A 2OEMA 3BKUA 2KRBA 3OLBA 2IHR1 4TN2A 3OVBA 2QV6A 2AZ3A 4USVA 2YWKA 4F3QA 4CCHA 4RNMA 3RBXA 3TO8A 2NUUG 5F9NA 5K9FA 3DOKA 1JKHB 1GXLA 2WVDA 3M8SA 1BE4A 1TMMA 1VHFA 1CSJA 4LFCF 1R0CB 3D0GE 1HWUA 1JLGB 2V2ZA 1QVFR 1QE1A 4O0IA 1JLEB 3ZTOA 2HBYB 3A12A 3E01A 4LIWA 2HRUA 3B4DA 3PW5A 1XMBA 2RB7A 2BJ3A 1WC5A 2IDEA 1N88A 4PXBA 5J1NA 2XMWA 1M1KT 1ZA2B 4DFJA 1VISA 4TQRA 1APSA 5IZHA 2CJXB 2ZDPA 3CUNA 3MEEB 2J7KA 3QT7A 3TARA 4ZLPA 4DV1F 4ZVEA 3DN9A 2CJBA 5CYQA 1WOSA 4UUWA 2FDNA 1RHJB 3IN5A 2IC3A 3GJQB 2XLIA 4WKRA 4WIIA 3IS9A 2B3TB 2E1AA 5G4DA 1VQPS 2JEFA 5L1JA 4GVBA 2VG7A 2QL7B 2YH1A 1HQ2A 3MOJB 3A3NB 3PIOQ 2FVQA 3OXGA 1C2PA 5AJ3J 2APOA 1ULRA 2YY3A 1JLFB 4DDFA 3NOCA 2B9YA 1XR6A 2JL9A 3KUHA 5KFMA 5LT5A 3UD5A 4UOHA 2NXJA 4G1QA 3D6TB 1S7HA 1R6VA 1FDAA 1FK9B 3H42A 1UMJA 2KU7A 4HT5A 4NL5A 3UR0A 1EB0A 1GTEA 3THVA 9ATCB 4Z37A 1NSQA 4N8OA 2RVJA 2BABA 5KT7A 4C4WA 4WU3A 4BCAA 1S7IA 2E1PA 3O44A 2HSEB 3JXOA 4N76A 3JQMA 2R8KA 4LBPA 2GMLA 2CDRB 1E6VB 3OTOF 3DRYA 1KTQA 2ZH3A 4DFPA 1VMBA 1MN7A 4FF1A 1R8AA 3DRRB 1S6QB 4LJMA 3I0SA 3MMAA 2XGQA 4QCLA 1MMLA 4AT1B 4ZVOB 4JOUA 2E1MC 1O8BA 2BYCA 4MKBA 2DNQA 3IBWA 1BUXA 2ABYA 1NHUA 5C25B 1T3NA 5M2RA 4KGKA 3HP6A 2NXNA 3KNGA 4WCEQ 1DHMA 2CPXA 1ZETA 5MLCV 3HVWA 4N5SA 4O0NA 3V2UC 5D4LA 4ZCKA 1U09A 3ITHA 1Q4RA 3L95X 4TQSA 2MZTA 4FXVA 1WWHA 2G0IA 2Z58B 1T03A 3NWRA 1EARA 2WBMA 2DCLA 3BS9A 4IFYA 1UVLA 1RWWB 2GZOA 4MKAA 4ZCMA 1VJQA 1Y5NB 4YB1P 1G7CB 2BANB 1L3TA 2GX8A 3V6JA 3Q8PB 5KFJA 1MU2A 2BOPA 1HQEB 2YKMB 1IKVA 4LFAF 1S9GB 2RU9A 1BQMB 2ZBPA 3QBCA 3UN2A 3LAKA 2JDJA 4C6AA 2CNKB 1Y00A 5KG7A 2KVIA 3MR5A 3N5FA 2QX0A 2BACA 3CJQA 3R5DA 4L74A 4DV6F 2LU1A 3ZNUA 4GKJF 3L9ZA 1Q8LA 5RUBA 4WPAA 3F41A 3W9HA 1PC5A 1IM6A 1KKHA 4V1Ak 1FERA 2JZ5A 1AROP 4KHRA 2X1BA 2AWZA 3N28A 2HK3A 4OZ0A 1RAOA 1UETA 2W8LA 4OX6A 4DPTA 2CPYA 2Z56B 3HZEA 3HXMA 3CJSA 3QT8A 1ZBTA 1HA1A 4ED3A 2YQ3A 2WAQD 5DM7Q 4URSA 2HS3A 4WYWA 3QO9B 4AQYF 4AUKA 4A8FA 1RI7A 1N36F 1HI0P 1OY6A 5B0FA 3QFWA 2CYYA 3S8SA 2AX1A 1UEKA 3AD7C 3QWPA 1P9QC 2VFTA 2HS0A 5A76A 2KXHA 3CIZA 2B9XA 2BRLA 4QYRA 4YEAA 5KFBA 1NXIA 4DSEA 3M2RB 2K1RA 2CWXA 3PZPA 2YTCA 2F4FA 1S1UA 2I0XA 3R8YA 3HFKA 5JUMA 3DYAA 1FKOA 4QQBA 3Q22A 4UOGA 2WSCC 2G4BA 3T3FA 3A3PB 3MECB 4A8QA 3ADAC 1YWXA 2Y0SD 4A8MP 4QJVA 2V34A 1WKLA 2DPJA 5F0UA 4CYUB 1S4EA 4FF4A 5A2QU 5E41A 3KLIB 2I9SA 2HEKA 4R5PA 2GV1A 2QLBB 2WHOA 4I4BA 2YQ1A 3JS9A 1T0TV 3W9IA 3M30B 4GVLA 4LF9J 1Q8IA 4I69A 1F2GA 1ZYQA 1RT2B 4ID5B 5CZVA 2CRLA 1SUQB 1YBTA 3J7Z5 3CMQA 4NLOA 1P9YA 1CULB 2HHWA 3V6DA 3VQTA 2EBEA 2GVZA 4ZKAA 3T9ZA 4YFUA 2PC6A 3BYRA 3CCWA 2CQ1A 1LV5A 3K2YA 2FJDB 1TV6A 4YQWA 1N32F 1MMNA 4M5HA 2KKHA 4YR0A 4ED2A 3DI6B 3NMAA 1JIHA 4RW4A 2EFPA 4CLPA 1D0EA 4NCGB 3W60A 3GYNA 3PYEA 2JVRA 1G3OA 5GAHI 4OYMA 1N0UA 2EVZA 1K0TA 1P1LA 3O1LA 1Q78A 1F9HA 2CQBA 2E7XA 3FZBA 3EVMA 4DSFA 1IKWB 2CADA 2LKZA 1VJWA 4JI8F 3G6XA 2R7UA 2GNKA 3G9CA 2E1RA 4W92B 1VBXA 2BZ2A 3FC9A 2B0GA 2I1RA 2BKOA 3MWBA 3GTYX 1U48A 1RTZA 2IA6A 1TUGB 3Q24A 5KFRA 3M9MB 2VBYA 4DOZA 1X5PA 2CIMA 2VUGA 2AJQA 4NXNF 4DEZA 4ES2A 2M52A 3QIDA 2C22A 3WDOA 1Q5YA 4DQSA 5DDPC 2OELA 3KNAA 3IFEA
chains in the Genus database with same CATH topology
3OJSA 5HL7Q 2R7RA 4YUDA 3RAMA 4DFMA 1Q86T 1J5EF 2IM3A 3U1MA 4DS5A 2OPSA 4WFBQ 3G71S 2OTLS 3MEDA 4FN5A 2MZRA 3R1HA 2C28A 3PW0A 2BVZA 4GO7X 1RA7A 4WFYA 4N56A 3NKYA 1S0VA 5G0RB 2HVZA 4EZ9A 4L72B 4CO1A 4ZK7M 2PI5A 3QLHB 4OZ5A 1U47A 4B9LA 3HVTB 2N7YA 2UXCF 2PMHA 5C25A 3H4BA 2KHCA 5CQGA 5KOWA 4PPDA 2QT7A 3SMZA 3KHLA 1F0XA 4B9UA 1IKXB 4DG1A 1V3ZA 3SSQA 2KFNA 1LK5A 1WHVA 2K2PA 2KM8C 3M9OB 1JLCA 2VH7A 4K4XA 2X1FA 2OLWA 2EFQA 5I3UB 1J5OB 4X4TA 2DHGA 4A46A 3FDSA 1VQ6S 4ES1A 3IWLA 1MWZA 4R25A 2JLEA 4DBQA 3C3LA 4N47A 2CVIA 5GAEI 3BN7A 5KFVA 5CA5A 5J1EB 5KG6A 1ZOTA 2POKA 4F25A 1JJ4A 1Y5IB 4OJHA 2GA7A 2GCFA 5B0DA 4ELTA 3CCJS 3MMCB 1DTQA 1M5VC 3SXLA 4HDGA 4JV1A 3TAQA 1ZAWA 4EGLA 4KC5A 3P96A 4PPZA 5F8JA 1DLOB 2LXFA 2J6UA 1FRXA 2COLA 4OI1A 3L7PA 3CCTA 4MTPA 2HW3A 1R31A 4ZPDA 1SKRA 2CQ4A 3DMJA 4UY85 1HBOB 1XTZA 1NJWA 1HNZF 3W2VA 4Q7AA 4IKAA 1IJEB 1HWLA 4LF9F 2OAUA 3W3SA 2YNIB 3MFIA 4ECRA 3LPYA 4QOTA 4USJC 4WK1A 3UNGC 3OL7A 1MROB 2KYZA 5GADU 2XSFA 5KT6A 3K7RA 2UXDF 5J2MB 2CJ9A 4RU2A 1QE1B 2KG1A 1M5SA 1Q79A 3IAM9 4ED1A 3TVYA 3BDPA 1U1NA 2XCPA 2F7VA 3K5NA 1FO1A 3MM8B 1YSJA 4I6WA 2KYXA 1IBMF 1ZAVA 2BE2B 2VG6A 1YJNS 2YNHA 3PW7A 4DL6A 4PQAA 5GMKa 1RJJA 2QA1A 2RSQA 2VC0A 3ENWA 2YKAA 2NSBA 3GG1A 2F1FA 1AUDA 2HYIB 2QSWA 1JB0C 4Y65A 3D0HE 3M8RA 2E9RX 1HQEA 3V81A 1NJIT 2V94A 1S1XA 4DL7A 1S6UA 1X7VA 3KK3A 1A6LA 2VPXB 4WYLA 1VQMS 1S9GA 5LSOA 5KG3A 1FJCA 2GQQA 1M0SA 1IM4A 1JX4A 3SZ2A 4ES3A 5K8NA 3ZZTA 3AA9A 3FRYA 4C8OA 1G2EA 4BWJA 1TKXB 4X66F 1NH7A 4IH6A 5DQIA 4NYPA 1E6YA 7FD1A 1FESA 2GGPB 4Y6IA 5F3ZA 3EX7B 3IA0A 4HEA9 1Z2LA 4Y2KA 2C42A 2KN4A 3GG0A 2A2DA 1SV5A 2NPIA 3UCZP 2HHVA 2LECA 1TKZB 1C1CA 1Q81T 2XC9A 2YWEA 2IVYA 2L08A 2OPPA 2ZC4A 1VQSA 3HZGA 4KTQA 4NRUA 2J0WA 1URNA 3GFHA 4IUFA 4TYAA 3T1AA 1TR0A 3SFUA 4EEYA 5K5MA 3DRSB 3TYTA 5ADZA 2B56A 2DNMA 2W9BA 3GILA 1IXKA 4RLEA 2W7PA