3KK1B

Hiv-1 reverse transcriptase-dna complex with nuceotide inhibitor gs-9148-diphosphate bound in nucleotide site
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
427
structure length
412
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase p66 subunit
publication title Visualizing the molecular interactions of a nucleotide analog, GS-9148, with HIV-1 reverse transcriptase-DNA complex.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
total genus 113
structure length 412
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kk1B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk1B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk1B03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk1B04
3V81B 4ID5A 3CJ3A 1S9EA 3MFHA 1T03B 4MH8A 1C0TB 1HPZA 4XPCA 4ZPDA 4NLUA 1C1CA 4TY8A 3DRPB 3KK2A 2GC8A 3D28A 4ED6A 2RDIA 4KV8B 2JEIA 1KHWA 4J9OA 1RYSA 1LWEB 3DOKB 2RKIA 4MIAA 1QAJA 4NLQA 3IRXA 5DLFA 2R8IA 5KFHA 3OLAA 1S6QA 2AGPA 2BQUA 4IR9A 5CYMA 3H5XA 5F9NA 4DG1B 3QIDA 4PWDB 4Y34A 4PQUB 4ECUA 3T5KA 1RT1A 2R8HA 3DOLA 4O4GA 1S1TB 1TQLA 1VRTB 1U09A 5DGBA 4RUCA 4RUAA 2BRLA 2FJXA 2HAIA 3LAKA 2IMWP 1IKXA 2HNYA 2YNHB 4NLTA 1GX5A 4TN2A 2BANB 3CDEA 1RT7A 4DL2A 2E9ZA 4RW7A 4ZHRB 1S6PA 3DI6B 2RDJA 2ASLA 3GILA 3PR4A 4RNHA 2AU0A 4O3OA 2XGPA 2HNZA 5FDLA 4M94A 3MEDB 1JLBB 3PHEA 3FQKA 1IKVA 3BGRA 1W25A 3RAXA 5F8GA 4ECWA 4JV0A 1HQEA 5KT3A 4ED1A 4IFYB 1NHVA 3HKWA 2W7OA 3OL7A 1HNIA 3BQ2A 1HNVA 3C6TA 3KLIB 3JYTA 3I5BA 4NRTA 5KG7A 3EPGA 3QGHA 4ZVEA 1TKZA 5KT2A 1ZETA 3BJYA 4IQXA 2IC3A 4R8UB 1IKWB 1RYRA 4RW6B 5KFKA 3LALA 1IKYA 4KHMA 2JEFA 1RT3B 2OPSB 1TKTA 1TVRB 5K14B 5KFAA 2V9WA 3M8PB 2ILZA 3KMSA 4DL5A 4IRDA 2R8JA 3QIPA 3LP0B 2B43A 4WXOA 4YMEA 1JKHB 4I2PB 1S0NA 4IH5A 3N6MA 4ZVGA 5KFVA 1HQUB 4ZPAA 1S0MA 5HP1A 4MKAA 3FFIB 4RNNA 4TYBA 5EUHA 4IG3A 4O3RA 4NCGB 2D41A 3M9MB 2I5JB 1N4LA 4XO0A 3DLEA 1TKXB 3KK3B 4ZMMA 3PW4A 3NKYA 3G86A 4RW4A 3LP1B 3DYAB 1HMVA 3ITHB 5J2QB 4Y2AA 4J9PA 2V4RA 1RT6B 5J2MA 3TVKA 3MFIA 4LQ3A 1FKPB 1JLGB 1DLOB 4KSEB 5J2PA 3KJVA 4RNOA 2ASDA 2YNGB 2O5DA 4Q45A 4DL7A 3ISNC 2YKNB 3KHHA 4WZMA 4FBUA 4QWCA 4URGA 4F4XA 3LP2A 3KK1A 3H59A 2C2DA 1N6QA 4ECTA 1LWFB 1RT2B 1TL1A 5I42A 3MR6A 1VRUA 5CYQB 2VG7B 3DRRB 3HHKA 1JLEB 4H4OA 1RA6A 3Q8RB 2W7PA 1C1BA 3PR5B 4O44A 3N6NA 1JLCA 3MEGA 1N5YA 2V0NA 4YR2A 3M9OB 5L1IA 3BR9A 1GX6A 3KLFA 4FS1A 1EETA 3DLKA 2HMIA 3KLGA 3BQ1A 3PW0A 2YNFA 2OPQA 3DRSA 1RTHA 3BREA 4K4XA 3DM2B 2I1RA 4KFBA 2VG5A 5KFIA 4K4TA 4IFVA 4EYHB 5HROA 5KFMA 5DLGA 5KFNA 1QAIA 4F50A 2FLNA 4H4MB 2B5JB 4RU9A 5KFZA 3DDKA 1T3NA 4MIBA 3GIMA 4GC7A 3V4IA 4J9SA 2VG6B 3QLHA 2OPPA 1RT4A 2R2TA 2B6AB 3DMJA 1OS5A 2WK4A 3GV5B 4IOBA 1C2PA 3BQ0A 3KLEA 2OPRA 3UDLA 3Q8PB 4IKAA 1SUQB 4Y2CA 1BQMB 4IDKB 4ED8A 5KG4A 1XR6A 5KFJA 3KHRA 1JLFB 3V6DB 4NLSA 1RTDA 4QW9A 3E01B 5D3GB 3I0RA 3RBDA 4KE5A 5HBMB 5C42B 1K1SA 4WE1B 3T19A 3I0SA 2XWYA 2HWHA 2ZE2A 4FBTA 3KOAA 4KB7A 1MU2B 4LSNA 3GV8B 4ID5B 3H4BA 3G6XA 3RB0A 1S9EB 2GIQA 4TQSA 2W9BA 1HPZB 3V81A 1C1CB 2CKWA 5DQIA 2RF2A 3KK2B 3Q8SB 1XR5A 3TAMA 2C2RA 2FVSA 3SI8A 2IM0A 2UVVA 2FLLA 4DL6A 4ECZA 5DQHA 3PW5A 3IRXB 5F9LA 4K50A 1S6QB 3CO9A 5F8LA 5CYMB 2BQRA 3LAMA 4WXWA 4Q0BA 4QWDA 3ICLA 1NNDA 4TXSA 1RT1B 3KHGA 4KO0B 2ATLA 3PW2A 4PUOB 4JV2A 1FK9A 4DG1A 3H40A 1JLQA 1SV5B 3IN5A 2ZD1A 3TQ1A 3T1AA 1S0OA 1IKXB 2HNYB 1T05A 1RAJA 1RDRA 3MEEA 4ZP7A 1RTIA 4EEYA 3MF5A 4G1QB 5KT5A 3UPFA 2ASJA 3GYNA 3CDWA 4ED0A 1NHUA 1JLAA 4ICLB 1S6PB 3CIZA 1ZTWA 4DL4A 4J9MA 1REVB 3IGNA 2W9AA 4X2BA 5FDLB 2UUTA 2JLEA 2YNIA 4YR0A 2FJVA 3H98A 3NAIA 5DG9A 4KHRA 3LANA 4O3QA 2C2EA 2E9TA 1S1UA 4I7FA 1DTQA 1HQEB 4TQRA 3KMQA 1HNIB 4ZVFA 4NYZA 1HNVB 3C6TB 3JYTB 3CJ0A 2W8KA 1R0AA 5J2NA 4G3IA 3MR3A 1QE1B 1QUVA 4O3SA 5F8MA 3KLIA 2IC3B 5KG2A 3D5MA 3V6JA 1DTTB 3C6UB 4IH6A 2D3ZA 1IKYB 5KFTA 1JXLA 1FKOA 1TKTB 4URQU 4R8UA 5DGAA 2QE5A 3UQSA 1SH0A 1RT5A 2W9CB 4EBDA 1S48A 3H5SA 4ECVA 3QIPB 3OSNA 1RT3A 2YKMA 2OPSA 4RW8A 3MTKA 5EWEA 3GIIA 5KFUA 4KKOA 3RB6A 2CJQA 3IG1A 3RB3A 1BQNA 5C25A 1T94A 3QGGA 1LW2B 3QZ8A 3CJ5A 1HQUA 5JUMA 4RW9A 5KFQA 4K4YA 1TL3B 1TV6A 4QWAA 3DLEB 4NCGA 4K4UA 2DPJA 2WOMA 4KAIA 4B3OA 5KG3A 4RW4B 2R2RA 1S1WA 5C24A 2VA3A 1HMVB 2BE2A 4I2QA 4TYAA 1S1XA 5KFGA 5KFYA 1S10A 4LSLA 5J2MB 5HLFA 4EBCA 4ECXA 2J6SA 3OHBA 4ED3A 2AX1A 2XC9A 5KFWA 3ITHA 2ZKUA 5J2PB 3KJVB 2JC1A 1KLMA 2ILYA 4IR1A 3JSMA 5KG0A 3H5YA 3CDUA 3QO9A 2BQ3A 5L1JA 1RTJB 4F4WA 3LP2B 3MECA 3KK1B 5F8HA 3T5JA 2IAJA 4DL3A 2IA6A 1C0UA 3FSIA 1TL1B 2JC0A 4NRUA 3GV7B 1S9GA 1VRUB 2J6UA 3T5LA 3UR0A 4O4RA 2QV6A 1JIHA 4EYIB 1LWFA 4EBEA 2BRKA 3T5HA 1C1BB 2ALZA 4O44B 4DEZA 1JLCB 3MEGB 1N5YB 2FVPA 3OLBA 1J5OA 4IRKA 3KLFB 5I3UB 2HNDA 1EETB 3DLKB 4R5PA 1LWCA 2FVQA 5EWFA 3NBPA 3KLGB 1S4FA 2XCPA 3HVTA 2IJFA 2WONB 4ED2A 1N48A 2XI3A 2YNFB 4NLWA 3DLGA 3DRSB 1RTHB 1UWBB 3NAHA 5L1KA 4KFBB 4WYWA 5J1EB 3HVAA 1S1VA 4IFVB 5KFXA 1KHVA 3IS9A 3I5AA 3CWJA 4MK9A 4ZP6A 4NLDA 3KLHA 4MFBB 1Z4UA 3QGIA 2AGQA 4IG0A 1XR7A 1D0EA 1EP4B 1LW0A 4QW8A 3V4IB 4KBIA 5DQGA 5KT7A 3QLHB 4NLVA 2OPPB 1RT4B 3M8QB 2WCXA 2HWIA 3FQLA 3DMJB 3KLEB 4U7CA 2VG6A 2OPRB 2R8GA 1YVFA 2UVUA 4ZPBA 4QPXA 2B6AA 2C28A 1HYSA 1SH2A 2WB4A 1S9FA 1RTDB 1I6JA 3CJ4A 4K4VA 5KG1A 3I5CA 4IDKA 3I0RB 2IM1A 4RNMA 1SH3A 3RAQA 4TY8B 3I0SB 3BSAA 5KFOA 1T03A 4RZRA 1C0TA 3SFGA 5KFBA 4OL8A 3G6VA 4WZQA 3DRPA 2AGOA 2RKIB 4NLRA 4WYLA 4KV8A 2RF2B 2D3UA 4F4ZA 1LWEA 3DOKA 2JEJA 4Q8FA 3TAMB 1JX4A 5KFSA 2UVRA 3DOLB 4O4GB 3E51A 3PJXA 4ECSA 3MR5A 4PWDA 4PQUA 4EO8A 3OL6A 3PJWA 4Q0BB 1S1TA 2BR0A 3KLVA 1VRTA 4K4SA 4ED7A 3H5UA 1FK9B 1RT7B 1JLQB 4RW7B 4J9LA 4Q44A 2YNHA 4KO0A 2DPIA 4PUOA 2ZD1B 2BANA 2UUWA 3OL8A 1SV5A 1T05B 3CJ2A 2IM3A 2WRMA 3MEEB 2HNZB 1RTIB 4ZHRA 3DI6A 4JUZA 4K4ZA 2WTFA 1IKVB 3BGRB 1JLAB 4ZVHA 3PVXA 3BSNA 3EZUA 3GIKA 2E9RX 4G1QA 3MEDA 1HARA 1JLBA 2XI2A 3OSPA 5EWGA 4TY9A 4ICLA 2YNIB 3V6KA 4IFYA 4R0EA 1TKZB 4RNFA 1REVA 2AQ4A 5KFFA 2OH2A 3BSCA 1S1UB 3GIJA 1CSJA 5EDWA 1DTQB 4I7FB 1IM4A 5KFRA 2EC0A 3NL0A 1R0AB 5J2NB 4U6PA 5C5JA 1IKWA 4J9NA 4Q43A 4RW6A 4NLYA 3OL9A 4WFXA 3MR2A 1TVRA 1QE1A 5K14A 4GC6A 3M8PA 3N6LA 4QWEA 1MMLA 4IRCA 1FKOB 4J9RA 3LP0A 5HP1B 1DTTA 1JKHA 3C6UA 4I2PA 4TLRA 2FVRA 1RT5B 4HYKA 4IG3B 1WNEA 2YKMB 4RW8B 5F8IA 3FFIA 4FS2A 2IBKA 4KKOB 5KFEA 2W9CA 3CVKA 4URSA 3IG1B 4NLPA 1BQNB 2I5JA 5C25B 3H4DA 2AX0A 5L1LA 2R8KA 2GIRA 4H54A 4YP3A 4RW9B 5DG7A 4NLGA 1TKXA 3KK3A 4J9KA 4O3NA 3GQCA 1LW2A 1TV6B 3HVWA 4NLXA 4IH7A 3LP1A 3KHLA 3DYAA 5J2QA 4WFZA 4QWBA 1TL3A 2WOMB 4Q8EA 1RT6A 4B3OB 5KFDA 4ZP8A 1S1WB 1JLGA 1FKPA 5C24B 1DLOA 2BE2B 4I2QB 1S1XB 2R2SA 3KNAA 4Y3CA 4LSLB 5HLFB 2XCAA 4ECQA 3IGVA 4YR3A 2YNGA 3PZPA 3BSOA 3M9NB 1N6QB 2YKNA 2C22A 1KLMB 4HKQA 5KFLA 5I42B 3JSMB 3QO9B 5T14A 3Q8QB 3NMAA 4MK7A 4MK8A 4H4OB 1RT2A 2AWZA 4ZPCA 3MECB 2IM2A 2D7SA 2IAJB 5CYQA 2VG7A 3DRRA 1RTJA 1C0UB 3QZ7A 1JLEA 3VQSA 5KT4A 2J6TA 1S9GB 4JV1A 3FDSA 2HMIB 3OHAA 3FRZA 2F8EX 1S49A 4XPEA 5KG6A 2XGQA 2OPQB 1K1QA 3QYYA 4LQ9A 3PW7A 1J5OB 2VG5B 2FVCA 3SFUA 5JXSA 4YQWA 2HNDB 4R5PB 4EO6A 1LWCB 5HROB 2R2UA 3NBPB 2V4QA 3G6YA 2W8LA 3DM2A 3HVTB 4F4YA 1TP7A 3DLGB 5I3UA 4NLOA 2FJWA 2JEGA 1ZTTA 2WONA 2UVWA 5KG5A 1S1VB 4H4MA 2B5JA 1UWBA 4J9QA 4M95A 4MKBA 4K4WA 4ECRA 1N56A 3IS9B 5J1EA 3KLHB 2VA2A 4ZP9A 4IG0B 5DG8A 1RA7A 5F8NA 3ISND 2WHOA 5L9XA 5KT6A 1LW0B 5KFCA 4ECYA 3V6HA 4MFBA 3EPIA 1EP4A 1SUQA 5F8JA 1BQMA 4O3PA 1S97A 5KFPA 2FLPA 3M8QA 1JLFA 3V6DA 1D1UA 1HYSB 3E01A 2ZE2B 5D3GA 2IJNA 4WFYA 4LSNB 3NGDA 5HBMA 5C42A 3H2LA 4WE1A 4NZ0A 3RBEA 3RB4A 2W9BB 1MU2A
chains in the Genus database with same CATH superfamily
1M5SA 4CLUA 4DDFA 2NR0A 2GC8A 1P1LA 4OV6A 2CYYA 1RSCA 4DR1F 4IOAQ 3EDQB 5LL6d 3DOLA 1TQLA 2HIQA 3GLJA 3U7JA 3VQTA 1AROP 4QU7A 3D6FB 3RG6A 4F0HA 3KLIB 4DQQA 4ZVEA 4LF9F 4RW6B 3WX4A 4K2JA 2Z4PA 4RBUA 4ZVPB 3EWGA 5GMDA 2CAJA 1UZDA 1KOHA 4PCQA 4PEOA 5ETMA 5F41A 2OD6A 1VR6A 2Z30B 1Q53A 2I2YA 3AOBA 2VIHA 1RABB 2VZ9A 2ASDA 4WZMA 4HT7A 4JP8A 3CC4S 1N54B 3AA9A 1TU0B 4H4OA 3MM7B 1B0VA 2LU2A 2V0NA 5L1IA 1DY3A 3DLKA 4DU7A 4Z37A 2I1RA 4OYWA 4TNOA 5HATA 1N5VA 4RU9A 4F0KA 5AE3A 1RISA 2HHVA 4BWMA 1SC1B 1U24A 3K5PA 1FEHA 2HHHF 4FBTA 3BKFA 2KU7A 4UW2A 5AXKA 3VGVA 1G4CA 4N77A 5M2RA 4DR2J 4DX8H 1V9OA 2C42A 5GAEI 4YY3F 1FK9A 2IDEA 3PFOA 1WF2A 4OZJA 1R31A 1PYTA 2UXDJ 2MZQA 4PXDA 1WHXA 2UU9F 3OUYA 1REVB 1NB2A 2W2NP 2K8GA 3THPA 4LR8A 1FKAF 2EPIA 4ZVFA 5K8MA 2MKKA 4OX7A 3Q86A 1K73T 1U2FA 4URQU 3D3BJ 1SH0A 4G65A 1S48A 3BBFA 2XULA 1SJRA 1ZOTA 4P6QA 2VC1A 3UNGC 1OYDA 3ZNUA 3NLCA 4B9NA 4OJ1A 5KG3A 1V3RA 1C4CA 3CD6S 3MPWA 3QWPA 4LF6F 5A6WA 5KFWA 1L3TA 1X9SA 1WHYA 5I3PA 1RTJB 3NEKA 3T5JA 5CH7B 1C0UA 3EGNA 1F5BA 3UD4P 3T5LA 3UR0A 2CA9A 3QSIA 2CQPA 3DLKB 2GMLA 2AJ1A 4Q7AA 4USUA 2XY6A 5FLXU 3UD5A 4NASA 3M8ZA 1S4EA 2GX8A 2AGQA 1UW4A 3IAS9 5DJBA 5AJ3J 2PMWA 3IR6B 4CQ1A 2WAQD 3CJ4A 1UEKA 3KWMA 3UWTA 2C2KB 2GQ2A 3DOKA 4YHHF 2DO4A 2FD2A 3MM9B 2V8DA 3GSIA 2RS8A 3KLVA 1FK9B 2DPIA 1XWLA 2DR9A 4DPYA 2DXFA 2F40A 1YG0A 1VHIA 3OUYB 2XI2A 3MURP 4E0DA 1Q5VA 2BX6A 3V6KA 4ZJOA 5DM6Q 1Q4RA 3LWMA 1VHFA 1HWKA 1U0HA 3EUNA 3WDOA 3LUYA 3WX8A 2KG0A 4B9UA 4Q5VA 2VBXA 3HVWA 5F0UA 1REGX 2DK2A 5J2QA 3W9JA 3DU6A 1K8AT 2IIHA 2ZBQA 2Q66A 2ZDOA 1VI7A 1PCAA 4DLEA 4MK7A 2HPUA 2AWZA 1X7VA 1VISA 1C0UB 1F3FA 4DQIA 2R42A 1URRA 2HMIB 2F8EX 4JI0F 3GCWP 2DR6A 2WBRA 4TU9A 2CRLA 3KJNB 1ZTTA 1HA1A 3PIPQ 2Z58B 1GK8A 1SUQA 2VJVA 1GQEA 4C8OA 4JBCA 4WFYA 3NGDA 5CCLA 1HKAA 1HPZA 1H74A 1NBEB 3K0JA 2RDIA 3DOKB 2G2ZA 5KFHA 4PABA 4RUAA 3UFCX 2BOPA 1N0UA 2X3DA 2YWKA 2AYBA 1ZM3A 3M2RA 4M5HA 1DZ5A 4O3OA 1HWUA 3MUVP 1HNIA 1SC4B 4NRTA 2V5HG 1U0HB 4UQGA 2V8HA 1RAEB 5IV3A 4LRAA 4YMEA 4CM2A 4OZ3A 2CPJA 4JI3J 4ES3A 3OTEA 1N4LA 3E3XA 3A4TA 5GMEA 1KOOA 2DNLA 2EKYA 4FDFA 5J2QB 1HMVA 2Z2LA 3W65A 4KQZA 4UUWA 4RU2A 3TA2A 5K8PA 3PV8A 1FESA 3W8GA 3NGTA 2HFVA 2CQDA 4O44A 4LBIA 2BW2A 4RR5A 4DV2F 5LJ3Y 3PY8A 3P45B 2MZ1A 1GMUA 4K4TA 4IFVA 5HROA 2KI2A 4MIBA 2CNOB 2HQCA 1XNQF 1SUQB 5KG4A 2RQCA 4DSIA 3C14B 1R8HA 2VFSA 2RD5C 3JSBA 1QSSA 4OYXA 1HPZB 4AFFA 1TK8A 3FCHA 2VDIA 2OEMA 3HSJA 3D54A 4MIWA 4KGVB 3CD0A 4ELVA 3M2RB 5CHCB 2EFVA 2FJVA 1UTAA 4KHRA 2E9TA 4U9RA 5L8RC 1N88A 3VZIA 4TQRA 1HNIB 1XN9A 3AB4B 3OVBA 1R0AA 5F8MA 2K3IA 4JV5J 1KVJA 2MSSA 5HVFA 4R8UA 4ECVA 1M5OC 2YKMA 2MJNA 4LFBF 3A13A 4ZCLA 2OTLS 4JB8B 1HMVB 4P73A 1T9UA 3CJ8A 2C2MB 2DNKA 1WF1A 2AHOB 4F4WA 3CGIA 3MECA 1N8RT 2VPXB 3U1LA 2JH3A 4ZCKA 3NOGA 2QV6A 2DNMA 4O44B 1SJFA 1ZAVA 2BOAA 2XCPA 3NBPA 4ED2A 4NLWA 2DGWA 4UUXA 3HVAA 3J7A1 4IFVB 4CLPA 1KHVA 1Y7PA 1WSVA 2MKHA 4JI5J 3GB0A 3Q83A 3CUNA 2XYHB 4QPXA 3IR7B 1HYSA 2DH7A 4N47A 3TO8A 3I5CA 2MDAA 1MMNA 1T03A 1HBUA 4F3QA 3CPWR 4WYLA 3SXLA 3B8HA 1LWEA 1KEKA 1PO6A 1CC7A 3FBCA 2ZM6F 3OXLA 3G8QA 2M52A 4CLZA 2EBGA 3BDPA 2E7XA 2MZTA 3SZ2A 2NUUG 2ZUGA 4W4MA 2AJ0A 4FF2A 4UOFA 2CFXA 2NXNA 3TZZA 4WJBA 3EZUA 2CPFA 4G1QA 8AT1B 1T9TA 4IFYA 2L9WA 4ERDA 2G2OA 1R0AB 3CDAA 1GXTA 4X4VA 4F02A 3HHLC 2DGQA 1SJQA 2RQ4A 3EXYA 2OO4A 3BGFA 3HHEA 2R7RA 5L38A 2YKMB 2FHMA 2DT9A 1U45A 6FD1A 2ADBA 2DH9A 2W24A 1SJ3P 3FK4A 1W26A 4ZVQB 1OYEA 5KAKA 2Y1RI 4DV4J 2C22A 2XZWA 3MPDA 3L9ZA 3MECB 4ETXA 3QZ7A 4C8NA 4DV5F 5DM7Q 4QCLA 3UN3A 1VQ8S 2YQ1A 2VG5B 1T7PA 3P3DA 3NBPB 3DM2A 1FNOA 9ATCB 1IVZA 1FO1A 2KZMA 1JNRB 2WONA 2E1CA 1UWBA 3R5BA 2HHXA 4ZP9A 2KJVA 3ISND 3R97A 3M2UA 1EP4A 1DQ9A 4LFAF 2LQBA 1HYSB 3FZ2A 3RB4A 2RAQA 4NEYA 1T03B 1HBUB 4MH8A 3OTDA 1R7IA 1X0PA 3FSXA 2BJDA 3D28A 1KVIA 1T9XA 4C6AA 1YDLA 1LWEB 4WIIA 2AGPA 5DS7A 4I6YA 1NH7A 1QLNA 1UVNA 1GEHA 3GFYA 3M2VA 3CB4A 2Q1LA 4KGKA 3CE8A 3BGRA 4PXBA 3JQKA 3SV3A 4IFYB 3J80Y 4KYZA 4LT6A 2QC3A 3LALA 4EU0A 4UOGA 2B4OA 4KR0B 3JAMU 2Y8WA 2XZTB 4ZVGA 2MLZA 4MKAA 1FCAA 5A6PA 4LF8F 4A46A 3TA0A 1NZ8A 2HK3A 4MT1A 3CJKA 4ZMMA 3NKYA 4X64F 2AF6A 2LFVA 3OR2A 3OD2A 2LEBA 1VDHA 2H1YA 2EFNA 3PCOB 1UZHA 1VIXA 3LP2A 1N6QA 4GKKF 2V69A 3CCZA 4DR6F 2JOQA 3TVZA 1VQ9S 3QSYB 2W7PA 1WACA 3GJRB 4MJKA 3PR5B 4F4AA 4FS1A 2A6OA 1UJ4A 2CQ0A 2CQ2A 3DM2B 3O3LA 2IHR1 2ZHBA 2GAGC 2FLNA 4ZS6A 2FC8A 1XERA 4MYTA 1CBKA 4HVZA 1S7HA 2B6AB 1EARA 1OQ3A 1C2PA 4HEA9 1U0SA 1MW7A 1RTDA 3T19A 3QATA 4JI8J 4C0BA 3I55S 4UZCA 3NY0A 5C7PA 3V81A 3Q22A 3Q8SB 3SI8A 1YRTA 2UVVA 3VAFA 1FWKA 1GMVA 3G8TA 2BJ9A 2UUBF 4I6AA 3MEEA 4B3TJ 3M2VB 4Y65A 2YNIA 3J7ZT 3NAIA 1R6YA 3KMQA 5E41A 1U7LA 2YWWA 4LVOP 1DTTB 3FBFA 5A2QY 2GMJA 3MAQA 2WW4A 3PIOQ 4ZA1A 3QFWA 2MGZA 3R5AA 1LW2B 3B78A 5JUMA 4RW9A 4K4YA 2Z57B 3CJKB 5C2CA 3ENAA 5HSPA 4DJBA 3QMQA 2J6SA 3OR2B 3OHBA 2DXDA 1KLMA 1LKZA 3H5YA 3QO9A 3LP2B 4OHWA 2FZGB 4CNYA 2QG9B 1QAXA 1W2BR 3T6JA 2HNDA 2QRRA 1N48A 2ZWOA 4USKA 1L3UA 1N5SA 1S1VA 3R27A 4LF7J 3MAAA 4N76A 2V4JA 4DF8A 3ZZTA 1U2RA 4U7CA 5HMZA 3W3SA 4ZPBA 1M0SA 4B3SF 1NLKL 4LRCA 1RTDB 4CH1A 5GAHU 2WVFA 2OUGA 3BSAA 4RZRA 3R1LA 1R6VA 2DO0A 2D3UA 5KFSA 2X1AA 3MR5A 5DETA 3PJWA 2KB2A 1D8YA 3I32A 2HQFA 1YJUA 1VQKS 4RW7B 1RAOA 2YNHA 1RWNB 3RGIA 1UFLA 3MEEB 2HNZB 1UVJA 3JS9A 1HWLA 2YNIB 3HXMA 3GIJA 1CSJA 1IKWA 4OZNA 4P2FA 4CLWA 4IRCA 1JJHA 2J0WA 2FVRA 4YEAA 2XTJP 1RKIA 4CTAA 1DARA 1PBUA 1CLFA 2MGZB 5ETTA 1HNXF 4DUYF 3PKMA 2Y8YA 4C7QA 4RW9B 3LPYA 1YJWS 3K8WA 4J9KA 4ZIVA 1HHTP 3W2VA 3UCZP 3WIVA 3MMAA 4WIQA 4I0WA 1RAGB 4S0MA 3X3UA 1U8SA 3M8YA 1KLMB 4D3GA 1OMSA 3QO9B 2ZBPA 3GTYX 1H6KX 2VG7A 1M90T 1FDNA 2Q79A 1KQKA 3QJJA 1S49A 2Z2ZA 1SL0A 2DHXA 4ZK7M 2HNDB 2PEBA 5LMUF 1FT8A 1HHSA 4NLOA 3BS9A 1S1VB 3MAAB 2FTRA 1WI6A 2V4JB 2Z2YB 2F3JA 2UXCJ 5F8NA 4FPIA 4IUFA 3KG1A 3UO0A 5ETLA 1PKUA 5KTQA 1RWPB 2P5VA 5EWFA 1F5AA 2NZCA 4RO0A 4F0MA 1HNWF 1GAOA 2JEIA 2RKIA 3OJUA 4DSFA 2E44A 2GJ2A 3HP6A 1SJ4P 2DEIA 2HAIA 4F2SA 1HL6A 2YNHB 1GMWD 1U1OA 3CDEA 1RT7A 3UE2A 1ZZFA 2OMOA 2AJ4A 4RNHA 3D9BA 2AJFE 3ENWA 3KG4A 5F3ZA 3C6TA 5KT2A 3TEGA 1IKWB 2GVDA 1IKYA 4KHMA 1RT3B 2G9OA 2ILZA 3IC1A 4K7QA 3QIPA 2B43A 1UKUA 2RQKA 4CTAB 3G96A 1SVDA 1SQFA 4PZVA 2JHEA 4N41A 3O5TB 4JI1F 3MM6B 3MMAB 4NL5A 1U49A 1ZAXA 4FF1A 4J9VA 2I38A 4ECTA 2VG7B 4PXCA 3AD7C 3OL9A 1FNMA 3MD3A 3BQ1A 3PW0A 4LBPA 4DR5J 4NXNF 4WP3A 4CH7A 1HIYA 2XSJA 3BGLA 3DDKA 4QIVA 3V4IA 5KOXA 4LMZA 4CM0A 4ED8A 1Y4ZB 1XR6A 3NGUA 4NLSA 2F8HA 4DUZJ 1H2TZ 1M5VC 2ZE2A 1VS3A 1R3NA 3H4BA 4WKRA 3BO2A 4AQYF 2IM0A 4I1TA 4FN5A 1H3DA 2FIUA 4KO0B 1MLAA 1AXQA 3LW5C 3T1AA 2DCLA 3EZOA 2D74B 2E1AA 8ATCB 1KC8T 1WTFA 1S6UA 1RP5A 3C6TB 1SCJB 1FRXA 3GFHA 4B17A 4WWSA 3Q24A 2GVDB 2DYAA 1IKYB 2NPIA 2VQEJ 2QE5A 4X65J 4EBDA 3QIPB 3RB3A 1BQNA 1F9FA 2VQFF 1TL3B 2MZSA 1MSWD 1S1WA 4P9SA 2BM1A 1S10A 2G1DA 1BLUA 2YWGA 3HFKA 1HD0A 3D6MB 2R7TA 1H7XA 3NXZA 1IQZA 4CWBA 2KXHA 4YDXA 3ADAC 4C3KA 1K0VA 2FVQA 2APOA 4DV3F 1MN7A 1SKUB 2XSJB 3F56A 4ZP6A 4PRFA 4KT0C 2KL8A 1LW0A 1VRQC 3V4IB 4KBIA 3CTRA 4TVAB 2KN4A 4AUKA 1SH2A 5BYSA 2CPYA 1FX4A 1R43A 3PX0A 1S9FA 3AAWB 4YB6A 3QGPA 2IM1A 4N56A 2QLFB 4DX6A 1G1XA 2CNKB 2HLUA 2H4YB 3W5XA 4V19X 2FHJD 4CO0A 2OIHA 3T3FA 1X9WA 4F67A 4DWIA 4Y2KA 4CI0B 2ROGA 2PEHA 4L3NA 4DX7A 3LP0A 4I2PA 4IG3B 3FFIA 1BQNB 4KGMA 4O3NA 3S7RA 3PYEA 3DYAA 4NE9C 1S1WB 1JLGA 2BJEA 3BSOA 1FDAA 3M9NB 2QX0A 3PEJA 4YOEA 2FGCA 3PX4A 3FCVA 3ZZOA 3DRRA 2AJQA 2DY9A 4L6V3 2EXUA 3NOCA 5JVGQ 4GKJF 4MKBA 2B9YA 3QFHA 4PYAA 3WQPA 1LW0B 2UP1A 3V6HA 5E0OA 3V6DA 2IJNA 4ZLPA 4QIWD 2CXEA 3N79A 4Y6IA 4KJIA 3B4DA 1Z2LA 2HZAA 2PFFB 4XPCA 1Q1KA 3CIMA 3GFZA 2J9DA 4OJHA 2MLYA 1CJKA 2YPZA 2R8HA 1B64A 5E5NA 3EICA 4AL5A 3OTCA 1RQ0A 4JV0A 5KT3A 3CCTA 3HK2A 2XQCA 4IQXA 3PX6A 5G0RA 5KFAA 3KMSA 2O3DA 3LP0B 1X4BA 4I2PB 4DFKA 2JDJA 3D1HA 3OTOJ 1S0MA 2F1FA 3D66A 3FFIB 3SQGA 1IN0A 2IDLA 3D6HB 2POKA 4RW4A 3DYAB 3KDNA 1JLGB 3LH2S 3M8RA 2MQOA 5IT9Y 4QOTA 1P1TA 3DRRB 1N36J 4DOZA 3G9CA 1JLCA 3NCRA 2QMWA 2F4FA 2VUGA 3VGSA 1MMDA 5D77A 5KFIA 5KFMA 2QLJB 2XMVA 2CQHA 3TVYA 2VG6B 2L9DA 1WEXA 1WKJA 1YGYA 4USHA 4E8UA 3V6DB 1KONA 1VBXA 3Q2TC 4B02A 2XO7A 1RHRB 3I0SA 4LSNA 1NPRA 4KHPJ 5CYJA 1WG5A 3TAMA 1VIOA 2VBYA 2FVSA 3NWGA 4ECZA 3PW5A 2B9WA 3SV4A 1UEVA 1CJKB 5B0BA 4AL7A 1NB7A 3MEKA 3WC0A 4EMDA 2YXLA 4DX5A 3LANA 1VC0A 1LOUA 4A47A 2H3EB 2C3YA 2YKQA 4ENOA 4C0HA 2VONA 3OSNA 5EWEA 4P10A 5GADI 2HLTA 4QJVA 3HX9A 1OPZA 2J0QD 3SQGB 1QM9A 2WOMA 3BH7B 4RW4B 5C24A 3W66A 2VJUA 2WW8A 3JSMA 2CJ9A 5ETNA 3NNCA 3HHLD 3MM8A 2P9EA 2GV1A 5DDOC 4K5SA 1R8AA 2J6UA 2XYPB 2VICA 2HQ3A 1JLCB 3IP0A 4IRKA 1F9EB 1S4FA 1KFSA 4CLLA 2MHEA 1VMBA 2A18A 4ALZA 2CPZA 3PACA 4J9UE 1QAYA 4XIUA 1XBWA 1HLWA 3I0SB 3DRXA 1DURA 2ZBIA 3F44A 2AYGA 3T1HF 2DHAA 2W01A 3EZ5A 2V8VA 3TAMB 1WC5A 3HT3A 1YZ7A 3BDEA 1X60A 2CQ4A 3K17A 3N0VA 3OT9A 4IQMA 5ADZA 5L46A 3H5UA 1FHTA 4AXJA 2NSCA 3HF5A 1YBAA 1FXDA 3J81Y 4JUZA 1HNZF 1EB0A 2ZH5A 3GU0A 1HARA 3TA1A 1YLXA 5D0EA 2VU5A 4F3OA 2JNJA 3NL0A 5LM7E 5KFRA 4ZCMA 2CDRB 4BC7A 5D6GA 1B0PA 2DHSA 4FS2A 4URSA 1ZBTA 2FB0A 2I5JA 2KT2A 3M4XA 3OV7A 2QFJA 5DG7A 1X4GA 2BJ1A 4X4SA 2DXEA 2UUCJ 2CVIA 4O23A 2WOMB 2UXBF 5C24B 1Q82T 1H72C 2MQPA 2WVBA 1RHUB 3JSMB 5T14A 3EGWB 3MM8B 2H5IB 3O1LA 2G4BA 3FVYA 1JLEA 1H0HB 2BZ2A 4RJVA 2VDHA 2FVCA 1QVGR 2AJ2A 4NI2A 4H4KC 2LKZA 4YN3B 1P8GA 4LSZB 5KFCA 2YTCA 2Q3PA 4QYZJ 1T9WA 3KJQB 2BJ3A 5HJYA 4NZ0A 4HTJA 3HULA 2M0GB 1C1CA 4ED6A 1RKJA 2QMXA 1RYSA 1QAJA 5DLFA 3OLAA 2R7SA 4FXVA 2BM0A 3QIDA 3GONA 3T5KA 4O4GA 1SBRA 2HVHA 1T9VA 3RR8A 1FE4A 3CT9A 1XNRJ 1X8DA 3K5MA 1H98A 3EDRB 2C3UA 5BR8F 1NJIT 3RAXA 2B4VA 4DPXA 1NHVA 2IVFB 3OL7A 3VALA 1H2UX 5KG7A 4X62F 3MZIA 3QBCA 3IWXA 3BO4A 4ZPWR 2QL5B 2L08A 4NZ6A 2ADCA 3K5OA 1V5IB 2I5JB 2EBEA 1YRUA 3KUEA 2LXIA 2J7UA 1N32F 4J9PA 1NSKL 2PFDA 3AY0A 3CCUS 5IZHA 2O5DA 1IBCB 5EGYA 1NK7A 1OSDA 4UOCA 3MR6A 4LREA 3GYGA 4JI6J 1JLEB 1TFYA 2HZVA 4ZJQA 3EVMA 4F8RA 1EQ0A 3A8IA 1N34F 1RAIB 1O51A 3THTA 2MQMA 4NI2B 4DR1J 4W98A 3QLHA 2VBWA 4DR3F 2YKOA 2MKJA 5GAEU 4IOBA 2CPEA 3H42A 4IKAA 2F65A 2YBVA 3H2VE 2NXJA 1HQ2A 4KE5A 2HS3A 1T02A 2XHWA 1ZZNA 2J8SA 2GIQA 1ACMB 3BBCA 1C1CB 2QLBB 3LAMA 4MKYA 4QWDA 4LF9J 3PRDA 4DG1A 1U1QA 1EQMA 1WC3A 3MM5A 1T05A 2VC0A 3TJ8A 3MF5A 5KT5A 1NHUA 1FI4A 1D9FA 1T95A 4HDHA 5EX0A 4O3SA 4ZN1A 3D5MA 4IH6A 3HJFA 1VJQA 4FKYA 4NYPA 3MTKA 2OPSA 4DSKA 5ETVA 3QGGA 3HD1A 3CJ5A 2DNZA 4YFUA 4NCGA 2DPJA 1OWXA 3MXHP 2A2CA 5KFGA 4PG5A 2U1AA 2FHKA 2JC1A 4IR1A 3GV7B 2E5IA 1AUSL 2LDIA 1IJEB 4CLTA 2HHHJ 3MCMA 4A8WA 2PMZD 3I96A 4NLDA 3MI7X 3QLHB 2P9GA 3CJTA 4YY3J 1RWMB 3PO4A 1RAAB 3MCNA 1R27B 1SKSA 2KVIA 2UU9J 5K20B 1ZPWX 4P2XA 3WIUA 5F3TA 2ZH1A 3E51A 4M5DA 3TEHB 1RLCL 1IQTA 4ED7A 4I64A 3MCSA 4PUOA 3MM5B 3FEYB 3TYTA 1T05B 2U2FA 3DI6A 1X5PA 1E6VA 2LA4A 1M5HA 5EWGA 2K2PA 8RUCA 3NS5A 2HHWA 3W62A 1UAWA 5C5JA 4LF6J 4UOHA 2BA9A 1QE1A 4MKVA 3FRYA 3KUHA 5E3AA 4HYKA 5B09A 2DNPA 2R7WA 2R8KA 1UPMB 4ZN3A 2BKOA 1ELOA 3RYLA 4A8XA 3SQOP 2CJYB 2M5YA 3SCLE 3HM9A 4X4UA 4Y3CA 4ECQA 3TZWA 3EM1A 3ILJA 5I42B 3GFXA 4DSJA 3Q8QB 2R7UA 2G1HA 4MK8A 4ZLNA 3US5A 5HN0A 5CYQA 1LXNA 2JJ4D 2J6TA 2BUNA 1K1QA 4ZLLA 3ENQA 3OR1B 3SFUA 5A76A 2AIRB 1JWWA 2F9DA 1S76D 4A8OA 3DLHA 3N5BA 4H4MA 1ROFA 4YHHJ 2YPYA 1ZPVA 1LEOA 1YHQS 1J27A 1JLFA 3GIRA 3QRPA 3CD5A 2CJAA 1Q79A 4TY8A 1A6LA 1HBMA 1WDTA 5I4MA 1GMWA 3SEOA 5BYQA 2DEJA 3AXMA 4M5DB 1IM6A 1BGXT 2HVZA 1RHMB 2AEFA 3RW6A 3LAKA 3C8YA 5SZTA 3DI6B 3AJ2A 2RDJA 3JTOA 1E6VB 1FXLA 4AXIA 2MMYA 3FQKA 4ECWA 1C4AA 1LFPA 1FRLA 3UD3P 1VFJA 2QN6B 2OJ3A 1D3WA 2V9WA 3MMCA 4IRDA 3N6MA 5CABA 3HJVA 4ZPVR 1TK5A 4O3RA 3BO3A 4JI0J 1UP1A 3DLEA 1BQXA 3GR1A 4OYMA 2F7VA 3ITHB 2Z8QA 2V4RA 1KSPA 4K0KF 3LTOA 4ZPTR 2E29A 4RNOA 2GA7A 4KRWA 4DL7A 2EG2A 4OJ3A 3KK1A 5AXLA 1FTCA 2IBOA 5CYQB 3CC2S 1PSDA 4BS2A 2AP6A 2YWHA 3BYRA 3M9OB 4GO7X 3D6TB 4I69A 3D0IE 2H65B 1Q8IA 4H4MB 5A8KA 1UA1A 1CEZA 5I3QA 1D9DA 1RT4A 3UI3A 2CPDA 2CPHA 1Q8LA 4CLSA 3HMJG 2M8HA 1BWVA 2PC6A 3BGOP 2RH3A 1JLFB 4QW9A 1L3VA 3RBDA 2A3JA 1K1SA 2HWHA 2KXFA 3D0GE 4QIFA 1DBDA 4WFBQ 3L3CA 3PFEA 4CRJA 2XM3A 3DDNA 1NJZA 1HBMB 2PI5A 1YI2S 3GG1A 3OJSA 3I82A 2XG8A 1J2VA 2G0CA 3H40A 1NUEA 5E7OB 1XIQA 3K2YA 5DDQC 4OLOA 4WBFA 4ICLB 2UUAF 3CCSS 2XY5A 2UUTA 2VKRA 4O3QA 5H9EK 2VPZB 3ZZZA 1X31C 2RMLA 3PTWA 4OZ2A 3MDFA 3KLIA 1Q7LB 2RQMA 4OQJA 2ZH2A 2VFUA 3MMCB 3VAJA 3FUYA 3ZZ0A 4OI3A 4QR2A 2QO3A 4C11A 1KRPA 3R5CA 2RUGA 4X4OA 4DV2J 4CZCA 3DLEB 1YZ6A 2DNHA 5ITHA 2OEJA 2HBRB 2BE2A 4TYAA 4ED3A 2J9EA 3V4MA 3HPOA 4PR6A 2DNQA 1BE4A 1X9MA 4KH1B 2XSFA 3KK1B 1XNQJ 4X4NA 1XJWB 2HW3A 2DITA 4EYIB 1KLNA 4JI7F 3OLBA 2F4VF 2N3LA 5L1KA 2ZUAA 3VAMA 3AJDA 5A8KB 1NEEA 1XR7A 3OTBA 2MQ8A 1RT4B 3ENVA 2ZH7A 3NCPA 1WJ9A 4M1KA 4JYAF 3TX8A 1SKRA 2FHJA 3M8WA 4ANDA 3BKTA 4KY3A 2JWNA 4QBUA 2J5AA 2AGOA 1RAFB 2KRRA 4KV8A 3LWLA 4QPTA 3V5RA 1DAXA 3CJRA 1RAHB 4QYZK 4Q44A 2DNRA 4LFBJ 1LNQA 2AKWB 2E1MC 2XBPA 3PVXA 1N33F 4X66F 2MQNA 1REVA 3QRRA 4WTOB 2IY5B 2NXUA 2RJZA 4J9NA 2CDQA 4DCPB 4JI2F 3KKFA 3MOZA 4GC6A 4DFJA 3DXSX 3UCGA 4LF4F 3CVKA 4C11B 2PIIA 4H54A 4YP3A 3IWLA 2XB2D 1YRXA 9RUBA 4KPYA 1RT6A 1FKPA 2BE2B 3IGVA 4HKQA 3IBFB 1OY6A 1KN6A 1FJ7A 4DHVA 4ZPCA 4RKUC 1RTJA 4OI2A 4OYIA 3FDSA 3FRZA 2ZZMA 2OPQB 1FJGF 5JXSA 3RRGA 1TUGB 1J5EF 4AE5A 5KG5A 4CDIA 3PJ9A 2KG1A 2MKSA 3GE9A 1P6TA 1NSAA 5A8RB 5DDRC 1S59A 4ZKAA 1RWVB 1WC0A 4WP9A 4LF5F 1B7FA 2I8EA 4FZVA 4RL1A 2ALYB 4FKXA 1QDUB 4KV8B 3ISZA 2XLJA 1JXVA 4YB7A 3ONQA 4NLQA 4IR9A 5CYMA 3BN4A 3MM9A 2FUG9 3FZBA 1CJVB 1GX5A 2AYEA 3IA0A 1NKCA 2ASLA 2HBQB 1AB8A 2G0JA 4FXDA 2D9OA 3QGHA 1KKHA 2OHDA 5KFKA 3MTJA 2JEFA 4IOCQ 2R8JA 2P2CB 1YWXA 4DBQA 2ZJRQ 1HQUB 4DV5J 5FLXY 2J76E 2D41A 2IYIA 2CJKA 4PXEA 1N5TA 1RU2A 1JB0C 5DDPC 2Q6BA 1RT6B 2WZ1A 4J5OA 1FKPB 3F41A 2CNNB 5J2PA 3PYFA 4DPTA 1VGYA 1I3OB 1VQSA 1GH8A 1RGVA 3H59A 3UCUP 1QY7A 4LFAJ 2DGUA 5LSRA 1JJ2R 1XMOF 5AXMA 3RU0A 2HMIA 3LGMA 5LMNF 2YNFA 1RTHA 1CULA 1F1BB 2A2DA 3R3TA 4Q2MA 5KFZA 4ZVRB 3GIMA 1YIJS 4J9SA 2OPPA 4RWXA 2CJXB 1K44A 1HI8A 4AL6A 5SUHA 2RF2A 1CQMA 3R9LA 4DL6A 2ACMA 1QD1A 3DC2A 5CYMB 1VJWA 1SV5B 1CC8A 2ZD1A 1RHJB 1RCOB 5ETPA 1Q16B 4PKDB 2PN6A 4A8YA 1EHWA 2FY8A 3L7OA 4LF8J 4B3RF 2JLEA 2EWHA 2DRBA 4X64J 4USWA 4I7FA 4W90B 2C3OA 3V6JA 3C6UB 3UN2A 1RT5A 3IAM9 4GKKJ 2GHVC 4DR6J 2ZZNA 2B9XA 4DV6F 3IG1A 2R7XA 4U96A 2CZVC 4M5NA 3A3PB 3HHLA 4MTPA 3L7PA 2W25A 5KFYA 4EBCA 2AX1A 4HTIA 1TAQA 5J2PB 2IAJA 2AZ1A 3M8SA 1VC6A 2N4CA 4F25A 5E3RA 4RBVA 2XY7A 3GYXB 2L3MA 4OX9F 4CO5A 2B7CB 3EX7B 2MKYA 4NA3A 4R5PA 1LWCA 2K7JA 3HVTA 1Q95G 2IJFA 2GQCA 2CQIA 2YNFB 4OIXA 1RTHB 1CULB 5B0AA 3TR5A 4WYWA 2ERRA 1JMTA 3I5AA 4QU6A 3KLHA 4MFBB 4WCEQ 3CCLS 3EJMA 5KT7A 5DQGA 2OPPB 2WCXA 2UUBJ 1Y3KA 1TMMA 3UDCA 4C8LA 1IBMF 1Y00A 3FGVA 4U67Q 2VKZG 5H9FK 2H51B 2V34A 3C14A 2RE1A 2RF2B 1RACB 1NAQA 1LK5A 1JX4A 3VZHA 4DQPA 2NQPA 4PWDA 4PQUA 1U1RA 4WP8A 1U1KA 3W60A 4K5RA 1NSPA 2BVZA 3T41A 1TK0A 1AZSA 1PBAA 1UPPA 2ZD1B 2VASA 1IKVB 1KTVA 2MPUA 3GIKA 1WDDA 2M8DB 3ILIA 4DLGA 1TKZB 1RBAA 5KFFA 4M5LA 4I7FB 1U2CA 1URNA 3MR2A 2PA8D 4E98A 2GMHA 3TUJC 1RT5B 4ILMA 5F8IA 1KR4A 2IBKA 3N5FA 1V3ZA 1HR0F 3IG1B 5IOLA 3GQCA 2XMMA 4A8QA 3K7RA 1Q8KA 2KM8B 3EE3A 3SDEA 6AT1B 3HHLB 2LQ9A 4A8FA 2ZJPQ 4X4RA 2VF3A 3H2UB 1TTHB 1NCLA 3FNNA 1UCNA 1AUDA 3DKDA 4DV0F 2K06A 2IAJB 4B3MF 4B3SJ 4JV1A 4UF4A 4Y00A 4LFCF 4OHYA 1VQNS 3CJQA 3TJ9A 1RADB 4YQWA 4R5PB 1LWCB 3HVTB 1D9AA 2H54B 2KHDA 4WKYA 5D0HA 4N8OA 1FFGB 4UTGA 4K4WA 3PRVA 3KLHB 1X5TA 5DG8A 1WC6A 4U95A 1UVKA 1HBOA 1BQMA 3G82A 3RBEA 1U25A 7AT1B 2DIUA 3OFFA 4HDGA 2F8MA 1QUPA 1KHWA 4FYXB 4MIAA 5D78A 1WF0A 3PXGa 3G6ES 4AYBD 4PWDB 4PQUB 1T0TV 2CG8A 1I94F 1AZSB 4G1PA 3N01A 4A4JA 2MJUA 1Y5IB 1HNXJ 4DUYJ 1NPKA 4RLEA 3UVJB 1DQAA 4HI2A 2PSZA 1XC9A 1ZS6A 3JYTA 1RI7A 3ZZYA 2V8GA 4A8SA 3IWNC 1WG1A 3BM7A 3P6YC 2VD3A 2HZCA 4DL5A 3AODA 1R8PA 3GCXP 2MLXA 3RBZA 2W4PA 4EUVA 5LMUJ 1OSCA 3SDEB 4O0NA 3MFIA 4XTTA 1Y5NB 2BABA 3S1TA 3OBIA 4FBUA 5CD4A 1JJCB 1LWFB 3F0NA 4OMFG 2F63A 2WVCA 1C1BA 1NMEB 3I87A 3TP2A 2VG5A 4NZ7A 2MSTA 1QAIA 1HNWJ 3VWSA 4F50A 1UL3A 2ZFHA 2YX4A 3RJMB 2E66A 3TAPA 3GV5B 2JRSA 2OPRA 1HBOB 3UDLA 1DJ0A 1PJ6A 3G71S 1BQMB 2V63A 4PAAA 1R8BA 3G82B 1WEYA 4KB7A 1SIZA 5ETSA 3JTPA 3OVSA 4TQSA 4ATNA 3B4MA 2XMAA 1O5JA 2P6TA 3PW2A 3U1MA 2OD4A 3A3OB 3UN5A 3IN5A 1FTRA 2ZJQQ 1RTIA 2X51A 3IXQA 2W9AA 2HVIA 3R5JB 4GMKA 4OYOA 4JI1J 3JYTB 3CJ0A 3MR3A 3LF0A 2QA1A 3TZXA 3VGTA 2ROEA 4LIWA 4NYOA 2W9CB 3H5SA 2HBZB 1UW9A 3GIIA 2BJ8A 2KM8C 4DR4F 5C25A 2IRYA 1RWKB 3C46A 4ANEA 2RUSA 1VBKA 1U6BA 3GR0A 2R2RA 1NO8A 2VA3A 4NXNJ 2V2QA 4DV1F 3C3LA 4YB1P 2PT0A 3Q2SC 2ZWPA 3M6UA 4O4RA 2I0XA 1OIAA 1C1BB 3M1VA 4QZVB 1I5OB 3DLGA 1U8WA 3NAHA 2OLWA 1VK8A 1VYAA 4PG8A 1WEZA 2NS1B 1MG7A 4AQYJ 2VODA 1Z4UA 1U1NA 4USTA 3DCAA 1S5ZA 4NLVA 3M8QB 2HWIA 3GZ7A 5FIIA 2OPRB 2B6AA 5LT5A 2E1PA 4A8MP 4P7TA 1TL5A 5AT1B 4ZCIA 4P7VA 4NLRA 4WFNQ 1OY8A 4F4ZA 3IM8A 2EFGA 1YTYA 1UA0A 3JAMY 2LQ5A 1EAYC 1VRTA 4ZOSA 3EMTA 2QMUB 2HWTA 1RTIB 5FJ4A 1EZZB 2AV5A 2E7VA 3BSNA 2VQFJ 3RBXA 2X1BA 2HVEA 3KTQA 4WFAQ 1RBOB 2OMLA 5HL7Q 2NXEA 2PI4A 1P9QC 2L48A 2FYXA 3HCXA 5K14A 1S57A 3A8JA 5HP1B 1DTTA 4P74A 2J0SD 2DKOB 5C25B 2HAFA 1NHKL 2X1FA 1LW2A 3AQOA 2KTQA 5T7LA 4DV3J 3ZC4A 2QA4G 2M88A 1G7CB 3NGRA 1IWGA 2C3MA 1V6HA 2QA4S 3VQSA 1WKKA 3R5DA 3C15B 1QJHA 1IR2A 3H20A 1KFDA 3M32B 2G13A 3M1VB 4LQ9A 4EO6A 4C48A 3DLGB 2LEPA 4IO9Q 2OP5A 3UDVA 1M5KC 4J9QA 2VA2A 2MXYA 3FBEA 3BPSP 4C98A 2OTJS 2ZC4A 4O3PA 3D2WA 5D3GA 4HL9A 5HBMA 2KT3A 1XMQF 1K9MT 2Y1IA 2W9BB 2GJFA 2W2OP 3MFHA 4NLUA 3FEZA 1IR1A 4JI4F 1L3KA 3BEGB 1FNXH 2FPHX 2Y3YA 2YQ3A 3HSZA 3TWZA 3ZTQA 4ECUA 1Q81T 1VRTB 1LQ9A 3OQ2A 3UNYA 1Y3JA 2CUYA 1BY9A 4NLTA 3PNIA 1X4AA 3J7AN 4DL2A 5IQ6A 4RW7A 2W4DA 3K8VA 2BYCA 2C1EB 2HNZA 5MLCV 4M94A 2B8PA 4C8MA 3HO1A 2VH7A 1LV5A 4ED1A 2QZ8A 2W7OA 2EKNA 3CCQS 3BJYA 2IC3A 4RPFA 4L76A 2FDNA 5K14B 1PG5B 3BR8A 4OI0A 4IH5A 2IMOA 4FVCA 4ZPAA 2R3VA 2XS2A 2HFUA 2Z0GA 2IYGA 4DS4A 3DU5A 3TAQA 3RR7A 4GKJJ 5T7LB 4KSEB 4X4PA 4ZVSB 4QWCA 2ABYA 3D68A 4F4XA 1F3VA 4C8ZA 3QWUA 3RRKA 2HFNA 2DJWA 3ZTSA 1VOMA 2BEFA 1RK8A 1K47A 2MQQA 1RE1B 4PG7A 2JFDA 3Q8UA 5KFNA 4QYRA 2M7SA 1SC3B 4PPZA 3VF0B 2E5HA 2ZVSA 5EX3A 4M63A 1TL7A 1NXIA 4HH1A 3LGNA 5HJXA 4IDKB 5KFJA 1X4EA 5D3GB 2R9LA 3CC7S 4LRDA 2BE7D 3GWCA 5HBMB 4R0JA 2E5LJ 1SL1A 2FGOA 3G6XA 2ZBCA 1QSLA 4ZVOB 2DHHA 2LP4A 5CA5A 2J9CA 3S01A 1A9NB 4DMZA 3ICLA 2XLKA 4FNHA 1ZA2B 2N82B 3SCJE 1SIWB 4UT4A 3NRBA 4ED0A 3TQEA 5GADU 3K58A 3DXBA 5AXNA 4C8YA 4L74A 4G3IA 1QUVA 2IC3B 4FYDA 3A12A 2YX1A 1F60B 2AYMA 1RBLA 4DPUA 4K8RA 2WSCC 1NK5A 1RT3A 1SQGA 1FJEB 5KFUA 3W63A 4TU8A 3P5BP 2RS2A 4ZIWA 5KFQA 2DGXA 3VV2B 4NXMJ 2OSRA 1AT1B 1FJCA 5HAOA 2YKAA 1VLOA 2FZKB 1NK6A 3MM6A 5KG0A 4JOUA 1GXUA 3D4JA 3BV8A 1RB0A 1U02A 1YJNS 3OW2R 2JC0A 2ZC3A 5FD1A 2V2KA 1IBLF 5I3UB 2HHPA 5MAOA 5B08A 2XI3A 3WZ0A 5J1EB 1WOPA 3FQLA 1TL7B 1ITPA 3NG8A 1NKEA 4F26A 1SH3A 2AMCB 4LF1A 3A8EA 5GVQA 4G6VB 2JEJA 5T41A 5GAGI 2MB0B 3DOLB 2XS7A 4Y2MA 5HK4A 4C8KA 1B4SA 4K4SA 2KKHA 5CCMA 5D8HB 2MZRA 4J9LA 4KO0A 3KUGA 1FVSA 2JVRA 3VCDA 4ZHRA 2NYIA 4ITSA 5D0RA 2W2QP 4DR7F 1U1PA 2ACYA 3UR3C 1E6YA 5IV4A 4NEZA 2DR8A 3M8PA 4YB5A 3W5ZA 3UDEA 1AA1B 1JK9B 3I4PA 1JKHA 4TLRA 1WNEA 3DN9A 4A8KA 3H4DA 4CO3A 2HEKA 1TL3A 2ZZTA 1DLOA 2R2SA 4YR3A 2C3PA 2RRAA 3BKUA 1HHQA 4CLYA 2SXLA 2ZH3A 3Q89A 4H4OB 2UV8A 4RWWA 3CF5Q 4F36A 1Q5YA 1ZM2A 1ZM4A 4C97A 4U8VA 3DOMA 1IR0A 2KO1A 3QYYA 3CCMS 2W8LA 4F7VA 1VQLS 3T1HJ 2FJWA 1D8ZA 3PYGA 2JEGA 3RTVA 3CXCR 2B5JA 3RRHA 2RU3A 1R89A 2WHOA 3CCWA 4L75A 2J7WA 3EPIA 3LPEA 1S97A 5KFPA 2LXFA 4IO1A 3IM9A 3E01A 1TKDA 1F0XA 3FMWA 1HNZJ 1WOOA 1VQMS 2QTWA 4OZ1A 3CNQP 2YH0A 4PYDA 2WVEA 2RIJA 3SCKE 2XMWA 3G87A 1RT1A 5DZ7A 1U09A 5H1SV 2FJXA 2MTLA 1LXJA 5B0CA 5RUBA 4I67A 4ZHRB 1YX2A 2YVSA 3GILA 3JSRA 5L39A 4LR9A 1ZAWA 5F8GA 3AOCA 3CMAS 2UXBJ 3T1YF 1UFKA 4K59A 3EPGA 1TL4A 2D1CA 1E6YB 4C2MA 5JVHQ 3QJLA 3VVUA 4EFAC 3BN7A 3EGZA 1KQGB 3M8PB 3F73A 4OHXA 1JKHB 1U6ZA 4PWUA 4RNNA 1SI9A 4IG3A 4X84A 5AE1A 2LEAA 4K2XA 3Q8YA 3SCIE 3PW4A 4PQAA 1G3OA 1SC6A 1DLOB 2VV5A 4Q45A 1TMJA 1ZM9A 2C2DA 4EZ9A 2VOOA 1UMJA 1XMBA 3DOMB 3N6NA 4YR2A 1U47A 1NK4A 1EETA 2DGTA 1Q0NA 2GGPA 4LBHA 5IWAF 1YJVA 2B5JB 2O67A 1WHVA 1H2VZ 4CH0S 3E01B 5HO4A 2QA2A 3IMQJ 2LQ8A 3KOAA 4DFMA 2NLWA 1AW0A 2RB7A 1X4HA 2C2NA 2GHWA 2RDDA 1HFEL 5BR8J 2ZOMA 2DRAA 5DQHA 2FJBB 1NNDA 4X62J 1RT1B 3QAUA 2HKEA 1JLQA 4I6WA 1FRJA 1IBKF 3TQ1A 1HWIA 2QL9B 2YH1A 1RAJA 3ELHA 3NP5A 4J9MA 1CG2A 3C19A 3L95X 3U02A 4YR0A 2RILA 3K59A 1S1UA 1NPPA 1DTQA 1N32J 5J2NA 2E7WA 3S8SA 3TANA 5KG2A 2HFZA 1RXOB 1KWMA 2OFGX 5DGAA 3MMBA 1SQEA 4F3MA 2XZDB 1PILA 3AJ1A 2EFOA 4BHQA 2HHSA 5B7WA 4DV7F 3QRQA 2E1RA 1N34J 2XHCA 4LSLA 3PG9A 2NUHA 3GSDA 2HHTA 1HI0P 2BW7A 2BQ3A 2OKQA 2M4MA 3KJFB 4DR3J 3FSIA 3CSKA 2KFYA 3HI9A 4EBEA 3T5HA 1J5OA 4OYBA 3N28A 1EETB 2ZITA 4FVMA 2GGPB 1M1GA 2Q43A 4ZVUB 2P8IA 5E33A 1WC4A 4I56A 3MAHA 2VG6A 2C28A 4H4KA 2WB4A 5KG1A 1FDDA 2AZ3A 2HFSA 5KFOA 1C0TA 1NU4A 4OL8A 3AOAA 5CZVA 3LOUA 2GNKA 3RW7A 2H5JB 3LO3A 5LXRA 4ECSA 3OVAA 3OL6A 4M8LA 1JLQB 1S0VA 2VFRA 4L3KA 3KG0A 3D3CJ 2A10A 2EG1A 4UY8T 5HANA 3MEDA 3BB5A 1RWXB 5LSLA 1D09B 1S1UB 3I6PA 3W61A 1DTQB 5J2NB 1FE0A 4Q43A 3H0PA 2MHNA 1TVRA 4WF9Q 1MMLA 4J9RA 3MMBB 1GT8A 1PC5A 2G2YA 1MN9A 3S6EA 2V50A 4IH7A 2QEXS 4LSLB 2V9KA 5KFLA 1UVIA 3SYZA 4OHZA 2W2MP 1J5OB 3BZQA 3AHPA 5HROB 4ECYA 2B9EA 2N7YA 1TP7A 3DLLQ 2XMTA 3P8BB 2ASYA 1RA7A 1RUSA 5THWA 3W1YC 3VTIA 2Y1JA 4MAKA 3EYZA 5L1LA 1MU2A 3CJ3A 3QPIA 1S9EA 1C0TB 4C3MA 2K7KA 3AFGA 4XDCA 4J9OA 2R8IA 1X4FA 1NDKA 2CQ3A 2HG4A 3IBWA 1BUXA 4OV1A 3C16A 4FYYB 2GVZA 2ATCB 3R7BB 3O8WA 3PDNA 3JB9k 5CD4H 1S6PA 1CQNA 4J90A 2EC2A 2ROPA 1SKWA 4C4WA 3SIPB 3MEDB 3AT1B 1ZA1B 4DR2F 1X5OA 3DGPA 4OZ0A 4R8UB 1KQSR 2CZ4A 1RYRA 1KDNA 1TVRB 1B0TA 2UXDF 4WXOA 4BBYA 3M6XA 2QGFB 3M9MB 4GVLA 3W8PA 4XO0A 3WHIA 3QAEA 4Y2AA 2PA3A 4LQ3A 3K89A 1OQ6A 3KJVA 3KHHA 3SSSA 1OY9A 2RT3A 4USVA 1RA6A 3VAHA 1A0OB 1GX6A 4KFBA 4OYAA 1FD2A 4DN9A 3JSYA 4UY85 2BKPA 1OS5A 2WK4A 1PJ7A 2B0GA 3Q8PB 2OAUA 1EKRA 2PD1A 1WKLA 3I0RA 2JFKA 2XWYA 1MU2B 1S9EB 3GJSB 3M6VA 1CJUA 4P72A 5F9LA 4DZ6A 5H9EJ 5AJ3F 2BQRA 2QYGA 4OHVA 1FRMA 1SB6A 1Y0HA 5HQMA 3C16B 2GVZB 5B0EA 4TKTA 4G1QB 2OI2A 4NOHA 3DLBA 1S6PB 4DL4A 4A48A 2G0IA 2C2EA 4OYPA 1OPIA 4G1IA 4ILLA 4K0KJ 3DGPB 4KPCA 1RJJA 1TELA 1RWWB 2CJQA 3M7VA 1VQYA 2FLOA 4OI4A 4QWAA 3I9V9 4KAIA 2HSEB 4QR0A 4I2QA 1UFWA 1S1XA 1VK3A 4USIA 3MHYA 3KJVB 2DTJA 2ILYA 3W9HA 3J80U 4ER8A 3ILLA 4EWTA 4DPWA 1PGZA 3I9ZA 2VOPA 1KS2A 4XK8C 1ICEB 2WONB 1UWBB 3GPAA 4KFBB 3PRBA 5KFXA 5KOWA 1R8CA 3M2UB 1V5VA 1MWQA 1D0EA 2CWKA 1EP4B 4QW8A 2J0XA 3TI0A 1S12A 4EI2A 3I0RB 1XTZA 4WPAA 2UUAJ 3G4SS 3G6VA 2H48B 4WZQA 4KIAA 2R7VA 1Y10A 3IFEA 4X4TA 1Q8BA 1CJUB 4DF4A 1H38A 1LWXA 3PJXA 2HBYB 3QJPA 1LK7A 5DRKA 4USJC 2KYZA 2L9NA 5HVGA 3VAKA 2FZCB 2W4CA 1VQOS 2WRMA 3BGRB 4J91A 3IO1A 3OSPA 4TY9A 2AQ4A 1S6OA 3BSCA 1B7YB 1DFDA 4I68A 4LIRA 4HI1A 1NJYA 2DNGA 4KTQA 4QWEA 3ZTRA 2LCWA 3HZGA 1RU1A 4CLKA 1YJ7A 4OYZA 1NK9A 2CIMA 4JI7J 2QFIA 4CLFA 4QIEA 4GVBA 2LXUA 7FD1A 5HQLA 2V2ZA 4NLXA 2F4VJ 2VPYB 4P2SA 4ZP8A 3DDIA 4I2QB 1S1XB 1RHKB 1N6QB 2C2OB 3HVRA 1WORA 2D7SA 1CPZA 3KYLA 2HHQA 3BF4A 4JI3F 5A2QU 1KBRA 4JYAJ 2GW8A 5ETKA 2R4FA 2PGCA 3T6BA 4ZLJA 2VPWB 1Y9OA 3THVA 2HRTA 1I51B 2CWXA 4CT8A 2FLPA 1D1UA 3N9UC 4WTYA 4WE1A 3MGJA 1UEUA 2ZOGA 1X0FA 4ZVTB 3V81B 4ID5A 4C9DA 3TJAA 3KK2A 1N33J 4X66J 4DU8A 3IRXA 1FDBA 1L5UA 1YKWA 1S6QA 1FEEA 4XDDA 4Y34A 2AD9A 4JI2J 5DGBA 1NZAA 2IMWP 3NWRA 1IKXA 4M5KA 4LF4J 2RHSB 2HQIA 2RNEA 3PR4A 3DHWC 3EVOA 3PHEA 3VAIA 1W25A 5IQQA 1HQEA 3BQ2A 2M9KA 2J8AA 2B8QA 1ULRA 1TKTA 1YITS 1NDCA 2H5EA 1IXKA 2YX7A 2GQQA 2EEYA 2VBZA 1FJGJ 5HMYA 3DNCA 2D3OR 4GVBB 1NDPA 2BV3A 3KFWX 3I4HX 1J5EJ 1F9HA 2D9PA 1IJFB 4JV5F 4FF3A 2DH8A 2DHGA 3FCWA 1FD8A 4URGA 5I42A 3NNAA 5E2QA 2QIFA 1DQ8A 3GP9A 4LF5J 3KLGA 2P9CA 3PM9A 3AQPA 4K4XA 2M3DA 3OR1A 2KFZA 1NKBA 3R7SB 5E3QA 2O01C 2X3GA 3J7Z5 1FA0A 5ETQA 4GC7A 4YS2A 3DMJA 3BQ0A 1M1KT 4LR7A 4Y2CA 3P4UB 4USMA 4FYVB 4WE1B 2BJ7A 3CCJS 2ZKTA 4ID5B 3R7NB 3H8YA 3KK2B 3O44A 2EW9A 3AH6A 3IRXB 1S6QB 5F8LA 4JI5F 4TU7A 2CPXA 1AYEA 1BD6A 4FNIA 2IRXA 5IC6B 5LJ5Y 1IKXB 1RDRA 4ZP7A 1S77D 4L72B 2B4PA 2DR7A 2F5GA 4ED4A 2N7CA 1VBYA 1HQEB 3Q0AA 1F6TA 2LECA 2AEMA 2QSWA 1JXLA 2JVOA 1TKTB 2WBMA 1O8BA 1WSRA 3ZZRA 4KKOA 3RB6A 2COLA 2AT1B 3AB2B 4B08A 2DBBA 4N7TA 3W2VB 2EFQA 2GO9A 1XMOJ 5D0GA 5LMNJ 4RBTA 2NZ4A 1GFWB 2VFVA 2CJBA 5HLFA 3ITHA 2ZKUA 1W7WA 3JTNA 4HHHA 3WC2A 5F8HA 3FEXB 1S9GA 1WUUA 1APSA 2BRKA 2CNLB 3CMES 4EGLA 3TUIC 2FVPA 6FDRA 4OLPA 2JLGA 2NYHA 3KLGB 4M5IA 3ETMA 5CQGA 5H9FJ 1Y5LB 5D4OA 2ZH6A 4DV4F 3QQCD 3DMJB 3R1HA 1YVFA 5BYRA 4DCOB 1IWAA 1I6JA 4K4VA 2IA0A 7FDRA 4EZ6A 3FBBA 5KFBA 2DRDA 2RKIB 4B3RJ 3MPVA 2RU9A 1FX2A 1WOSA 4NWBA 4ES2A 2V8PA 3MWBA 3J7YU 1S1TA 2GFFA 1RT7B 3NGSA 3CJ2A 4DV6J 1FRIA 4ZVHA 1JLBA 1TAUA 4ICLA 1A7GE 1NM2A 3DLJA 3OFGA 3V2UC 4R0EA 3IRWP 2OH2A 4C0OC 4D3HA 4ETZA 1RZMA 4Q2LA 4U6PA 4NLYA 4WFXA 3ILOA 5IFMA 4LUBA 2UZAA 3Q23A 1VBZA 4HH0A 1U48A 4B9SA 3WBZA 1H7WA 5HQ8A 1HD1A 3MUMP 4KKOB 5E3CA 1YBTA 4NLPA 4OX9J 3D1OA 2BE9B 1TKXA 3KK3A 1XK8A 5K5MA 2KH9A 5HLFB 2XCAA 2CQBA 2YKNA 4QIGA 2IM2A 1JXEA 1HW9A 2V67A 2BMBA 1S9GB 3AXKA 4I4BA 2XLIA 1IBMJ 2DISA 2RRBA 2BBEA 2R2UA 3TARA 2QJ3A 1VQ4S 5BXIA 1L3SA 2HIYA 2H9ZA 1BHNA 4KC5A 3MR7A 3GMGA 2ZE2B 1YQHA 3KDOA 4Y0FA 5LOQA 1YJRA 2CQCA 4ED5A 5B0DA 1T3OA 1ZH5A 2NXCA 3W64A 2HRYA 2CPIA 4RUHA 3N4WA 5K8NA 5M2PA 2VHGA 1S1TB 2BACA 2QSFA 4RUCA 2BRLA 2CG4A 1QTNB 1Q78A 4JI8F 1VQ6S 4BLGA 3TOQA 1HR0J 5M2UA 3D67A 1JLBB 2KFNA 4FXWA 3D1QA 2ZHOA 2XYGB 3ZNJ1 3PKYA 4V19J 4HR2A 2GHPA 3AD8C 4LRFA 3JQMA 4WU3A 3SSQA 2C2ZB 4DV0J 4IYQA 1S0NA 4B3TF 1PAEX 4B3MJ 5EUHA 2YWFA 3CW2C 4LFCJ 1TKXB 3KK3B 5B0FA 2FJAB 3G86A 5J2MA 2LQJA 1O0PA 1FWLA 2R7OA 1X5SA 2YKNB 2GAHC 3DHXA 1NSQA 3TUPA 2PDAA 2EK1A 3HHKA 3ZXWA 3BR9A 3KLFA 2IPOB 4C3LA 1KP6A 2OPQA 3P5TL 4RX6A 2QLXA 2HQGA 5DLGA 2KDOA 5F0WA 4NMXA 2YWEA 3A3NB 2KRBA 5IT0A 1FFSB 2V6AA 3KLEA 2RVJA 2J9DE 2QL7B 2EK6A 1I94J 5A8RA 2IFXA 3PEHA 3SBMA 3L7UA 3CO0P 2CKWA 5DQIA 2DB1A 3HFVA 3FKBA 2C2RA 4LF7F 3HLUA 4Y2IA 3CO9A 2DIVA 4Q0BA 5D4LA 2DVIA 2YQ0A 3DGVA 2ATLA 4B9VA 1WELA 2E5LF 2CQ1A 2OSQA 1S0OA 1S72S 1AFJA 1CJVA 2KXNB 2ASJA 1ZTWA 3UW1A 3X1LB 3IGNA 3MUTP 3H98A 1V3SA 2DNYA 3W7BA 2L41A 2MY7A 2B3TB 3P96A 3TX0A 2KYXA 4DFPA 2KJWA 5KFTA 3UQSA 1B3TA 3A1YG 2DD8S 2HRUA 2XMJA 1CJTA 1G6BA 2LVWA 1HQUA 4U7UK 4BWJA 1F5CA 5JJBA 5J2MB 4ECXA 2O1PA 4BCAA 3NCQA 5D15A 3CDUA 2ZBRA 3Q8VA 2J7KA 2CADA 4NRUA 4OZ5A 4B9TA 1JIHA 4NXMF 1FF2A 3CCES 4GRSA 3KLFB 4WU2A 5L9NA 2WSEC 5CXTA 2XMKA 2V94A 2FJDB 2EI5A 2DGSA 5JMNA 3W2WA 4F04B 2Z2MA 3KLEB 2X7IA 2R8GA 3G8SA 2ZM6J 4DI6A 3K5NA 4RNMA 1WI8A 5IT9U 4Y28C 3BPDA 1T8EA 3MCOA 2O66A 2XWXA 1RWUA 2Y0BB 3CCRS 1N5QA 3MMJA 2UVRA 4DN0A 3RUBL 1NDLA 1RLDA 2UXCF 1S7IA 2NSBA 4CP5A 4EO8A 4Q0BB 3R2CJ 2HGMA 2DY1A 1P9YA 3T9ZA 1VLYA 5GAHI 3HKZD 3NMRA 4DL0C 2M70A 1SV5A 2VB6A 2XO6A 3QT5A 2IM3A 1IUJA 4K4ZA 4DR4J 2VFTA 3C66A 3R8YA 1R0CB 1N0VC 1KQFB 1O6XA 3VHQA 4V1Ak 1BC6A 3HSDA 5G0RB 4DV1J 2BKNA 3R6LB 2KT5A 2LDYA 2BXJA 2I9SA 3LQVA 3C6UA 2P6SA 2GIFA 5KFEA 1JNZB 1CJTB 3BBBA 3CDBA 4WK1A 4BDPA 3GJQB 3U1NA 4OX8A 3KHLA 4WFZA 2NREA 3PZPA 5EN1A 3POTA 3BGUA 1X4DA 2GZOA 2BDPA 3CCVS 4Z7YA 2CVEA 2DNOA 2AEJA 3I56S 5KG6A 4Z2XA 3W5YA 1YBUA 2V4QA 5IM0A 3O2IA 2AW0A 5D4PA 3FSYA 1N56A 1XEZA 2W2PP 4ECRA 2QT7A 1VQ5S 4P75A 1PAUB 1WTBA 1JJ4A 3W2WB 4MFBA 1B70B 3QT7A 4DS5A 1BWEA 3AD9C 4LSNB 2YKPA 3H2LA 1GTHA 2QLWA 2XEXA 2NPFA 5LSOA 4DR5F 3E2EA 3T9NA 2PE8A 1M1HA 5A8WA 3RAMA 2IVMA 2BQUA 3SMZA 3GJTB 4ZDNA 5F9NA 4HT5A 1GXLA 2CQGA 1SXLA 4OX6A 2XMUA 2IVYA 3BH6B 3FJ2A 1BXNA 1XQIA 3MD1A 2HNYA 4DUZF 4TN2A 4L73A 1AFIA 4CO2A 4CYUA 1YJ9S 2AU0A 2XGPA 1F2GA 2UV8G 3D7SB 5FDLA 2M2BA 4ILRA 4NX9A 5DZ6A 1IKVA 3PHTA 3TZYA 2GJIA 2EFPA 3HKWA 1TKZA 3ET6A 3OXFA 1PJ5A 4U8YA 2HS0A 1TFWA 1FRKA 2JSXA 4PWWA 4MYUA 2Q6CA 4F4KA 2E5GA 1CVJA 2B7BB 3J81U 5HMXA 3TVKA 1Q7YT 1KD1T 4YDDB 4N5SA 3TUZC 3POTB 2VQEF 4X65F 3OFHA 1TL1A 1FXRA 4KGXB 2Y1LB 1B99A 2HGNA 1NJXA 3Q8RB 4DSEA 3MEGA 1FVQA 3FC9A 5CZXA 2PMHA 1XMQJ 3ZTPA 5IM0B 2OGUA 3B82A 4UQTA 1FFWB 1Z2ZA 4JI4J 4DUTA 1UVMA 3HD2A 2YY3A 4QQBA 2PO4A 1T11A 2JZ5A 2NCKL 2WSFC 3GV8B 3M05A 3DRYA 3CEDA 2IJRA 5DO2A 4BC9A 5A8WB 1UJ5A 2FLLA 4K50A 3MPYA 1TUVA 5K8OA 1Z1ZA 1Q86T 2WB1D 1SJ1A 2RRNA 3M30A 3HHNB 2HNYB 3VGUA 3UPFA 3CDWA 1JLAA 4DQRA 5D4NA 4CYUB 5FDLB 2MZJA 3HT0A 2JLFA 2ZNYA 1KNZA 3UVJA 2KHCA 3KXDA 4NYZA 1PYOB 3CD7A 3H90A 3ETOA 3SSRA 3ET6B 2D3ZA 3J7YI 4ELUA 1TUWA 3VVTA 4RW8A 3EVWA 1GNKA 2HHUA 3QZ8A 1H73A 3H7HB 4PG4A 4B3OA 1VQPS 4Z7CA 2XC9A 1UWAA 2XS5A 4DSLA 5L1JA 2OEKA 4DL3A 2IA6A 3VAGA 1TL1B 2MKCA 2R7QA 1WWHA 4XAKA 1LWFA 2ALZA 3MEGB 1KVKA 3QNWB 1U26A 4EK2A 1K0TA 3B54A 3L09A 4HHJA 3U27A 4ES1A 3IS9A 4MK9A 1HW8A 3QGIA 1YJTA 3HFZB 4UZBA 3EGVA 5GAGU 3LA0A 3JXOA 4FYWB 1HI1A 3MOJB 2A1BA 5IXUA 3D0HE 3SFGA 3DRPA 1S79A 2OELA 4Q8FA 4N8NA 2MYFA 4O4GB 4O0IA 4FP9A 2BR0A 5IT4A 4QR1A 3PO5A 3M30B 2ZH4A 2BANA 2UUWA 2KVQE 3JQJA 2LYVA 1JLAB 2E9RX 1RCXB 5HI7A 3IBCB 5B0GA 4YUDA 2RSQA 3TNVA 4U7UD 3ZZUA 4CIOA 3M6WA 5ETRA 2D69A 4RW8B 3DFEA 3TW0A 5C2GA 2W9CA 4OJGA 4J37A 2GIRA 1IBLJ 1I1GA 3NNHA 1P27B 3LP1A 4B9LA 1U1LA 4Q8EA 4B3OB 3CJSA 2YNGA 1CS4A 4OI1A 3VR1A 2N3OA 4CO1A 3QT8A 1TR0A 5IS2A 1RT2A 5CAAA 2KZZA 3GG0A 2MQLA 2CZ9A 5A0YA 3OTOF 2DGOA 4J7CA 3P49B 3HZEA 2HYIB 2X1GA 3R6GB 3OHAA 4NA2A 4M5GA 4P2MA 4F2RA 2GCFA 2V68A 1NH8A 5HVHA 3ZFVA 1MNEA 3H25A 2UVWA 1U4BA 3IS9B 1JQGA 5L9XA 1MWYA 5F8JA 1N36F 3M8QA 4M5JA 3BYPA 2HURA 2B56A 2VL1A 3TRGA 5C42A 1KTQA 2HQDA 4OFZA 2ZHAA 4DR7J 2RHQB 4ZPDA 4LRBA 3DRPB 1HBNA 3RZAA 3H5XA 4WK3A 4DG1B 3KNGA 4NPOA 1FERA 4M5MA 2HS4A 2GO8A 4CT9A 2BANB 2JL9A 2E9ZA 4PPDA 2B51A 3NS6A 4KHPF 4AD6A 2B4UA 4PG6A 1HNVA 3I5BA 4HHUA 3K5LA 1EIYB 1ZETA 3OFEA 4DXLA 2ZVIA 2Y9HA 2OPSB 3AA8A 1RWOB 1SL2A 1N52B 1NK0A 5KFVA 1BMQB 5HP1A 1YK9A 4TYBA 4DQSA 1OJ4A 4DCJB 2IRUA 4NCGB 2LLZA 3NS7B 1UJ6A 4W92B 3LP1B 3ZO7A 4B9MA 1EKSA 1MWZA 2YNGB 1CS4B 2A0FB 3ISNC 4E2FB 1DRZA 2N4DA 2MEWA 1NRKA 3C2PA 2LU1A 1PYSB 2W7AA 1RT2B 3CMQA 5GMKa 1VRUA 5A0YB 4CNZA 5J1PA 3MPUB 1N5YA 1EJ7L 5HMWA 3C15A 2LMIA 1RTZA 3M32A 3R5GA 3DRSA 4ZITA 3BREA 2FJEB 4EYHB 3A8KA 5E3PA 5U47A 1PIEA 4KH0B 5ETOA 1T3NA 1QTMA 2DCUB 3L4BC 1S99A 2FQQB 2R2TA 2EVZA 2FC9A 3KHRA 2A6MA 2DGVA 5C42B 3RB0A 4ELTA 1W2IA 4ANCA 2W9BA 1HBNB 1FWPA 1XR5A 5LXYA 1PC4A 3T1YJ 2DNNA 4AT1B 4WXWA 4TXSA 2V2VA 3KHGA 4X4QA 1WC1A 4PUOB 4JV2A 2D3O1 3G2XA 2ZEJA 1ZYQA 4HACA 4EEYA 3GYNA 3CIZA 2K3KA 2ZH9A 4X2BA 4HLBA 1VC5A 2HVDA 5DG9A 4TLQA 4FF4A 4NCAA 2W8KA 1HNVB 3OXGA 1QE1B 1YSJA 1R0BG 2K1RA 1X4CA 1FKOA 3ULHA 1FRHA 5EHHA 4CO4A 1MROA 2JX2A 1T94A 4OZLA 4OI6A 5IC4B 1TZ0A 4ZJLA 1TV6A 4CCHA 4K4UA 2HK2A 1NJWA 2XNRA 5IWAJ 2DR5A 2ZOFA 3E8OA 4FPRA 3OPKA 1VRUB 3K57A 1M5PC 2FHOB 4DEZA 1N5YB 3ZZPA 1U1MA 1GTEA 1UETA 2UUCF 1F2HA 1WD6A 3DRSB 3O6QA 4ID8A 3W9IA 1EX8A 3CWJA 2Y0SD 2WVDA 4IG0A 1T9YA 1QVFR 2XNQA 2UVUA 1IBKJ 3NGKA 3ZTOA 4IDKA 4LJMA 3RAQA 4TY8B 1HWJA 4NMLA 2OFHX 2Z56B 4NA1A 3OL8A 4HACB 3CULA 2WTFA 2ZDPA 1LFWA 1NK8A 2E5JA 4DV7J 2MKIA 4RNFA 1VQ7S 5EDWA 4P71A 1IM4A 2EC0A 1SPBP 4RW6A 5BJRA 2K1RB 3N6LA 1FKOB 3IR5B 3QT6A 2I6WA 3EXCX 1Y11A 2H4WB 2F9JA 1XNRF 1MROB 3HHDA 1OO0B 2AX0A 2MY8A 4GO5X 4NLGA 2QYCA 1TV6B 4MMOA 4QWBA 5KFDA 4KGZB 5AE2A 1DHMA 3I31A 3KNAA 2ZH8A 2FY1A 3R2DJ 3B6BA 2ZNZA 1WG4A 2LA6A 3PYDA 2W1BA 3NMAA 1U6FA 1WHWA 5KT4A 3MM7A 3J81j 1QSYA 4XPEA 2XGQA 3LGHA 4R25A 3FMBA 3PW7A 4DZDA 5J1NA 5K9FA 3G6YA 4F4YA 4LF2A 4DPOA 5I3UA 1UVLA 3HDSA 4M95A 4LVNP 5J1EA 4IG0B 2HGLA 2GS8A 5G4DA 3HSGA 5KT6A 2HFOA 4NCBA 1VCTA 4JI6F 4RUBA 1RHQB 4P52A 1G2EA
chains in the Genus database with same CATH topology
3V81B 4ID5A 4C9DA 1M5SA 1U25A 1Z2LA 2DIUA 3OFFA 2PFFB 4XPCA 1Q1KA 4HDGA 4DDFA 2NR0A 3KK2A 2GC8A 1P1LA 2F8MA 2CYYA 1QUPA 3CIMA 4DR1F 3GFZA 1KHWA 4MIAA 5D78A 1WF0A 3IRXA 1FDBA 3PXGa 3G6ES 1L5UA 4IOAQ 1S6QA 2J9DA 4AYBD 1FEEA 4OJHA 5LL6d 4XDDA 4PWDB 4Y34A 4PQUB 2R8HA 3DOLA 2AD9A 1TQLA 5DGBA 1NZAA 1I94F 1B64A 2IMWP 1IKXA 4G1PA 3N01A 4A4JA 2HIQA 2MJUA 5E5NA 2HQIA 1Y5IB 3U7JA 3VQTA 4AL5A 2RNEA 3PR4A 3OTCA 3DHWC 4RLEA 1RQ0A 3PHEA 3VAIA 1DQAA 1AROP 1W25A 4QU7A 5IQQA 4HI2A 2PSZA 4JV0A 1HQEA 5KT3A 3CCTA 3BQ2A 1XC9A 3KLIB 3JYTA 1RI7A 3ZZYA 3HK2A 4DQQA 2V8GA 4ZVEA 4A8SA 2M9KA 3IWNC 1WG1A 4IQXA 2J8AA 3BM7A 4LF9F 3P6YC 1ULRA 4RW6B 2HZCA 2VD3A 3PX6A 3WX4A 5G0RA 1TKTA 2Z4PA 5KFAA 1YITS 3KMSA 2O3DA 4DL5A 2H5EA 4RBUA 1R8PA 3LP0B 1IXKA 1X4BA 4I2PB 4DFKA 2JDJA 3D1HA 2YX7A 1S0MA 2F1FA 3FFIB 2GQQA 3SQGA 2VBZA 1IN0A 5HMYA 1KOHA 3DNCA 2D3OR 4PCQA 2POKA 2W4PA 5F41A 4EUVA 2BV3A 2OD6A 4RW4A 1OSCA 3DYAB 3SDEB 3KFWX 3I4HX 1Q53A 3MFIA 2I2YA 1JLGB 3LH2S 2D9PA 2VZ9A 1Y5NB 3M8RA 1IJFB 4JV5F 4FF3A 2ASDA 2BABA 2DH8A 3S1TA 2DHGA 3OBIA 4WZMA 4FBUA 1FD8A 4URGA 4HT7A 2MQOA 3CC4S 1LWFB 5I42A 1N54B 4QOTA 1P1TA 3NNAA 5IT9Y 3AA9A 3DRRB 4OMFG 4H4OA 3MM7B 5E2QA 2QIFA 4DOZA 3G9CA 1C1BA 1JLCA 1B0VA 2LU2A 1DQ8A 2V0NA 5L1IA 3I87A 3DLKA 3TP2A 3NCRA 3KLGA 2QMWA 2P9CA 3PM9A 3AQPA 4Z37A 2VUGA 4K4XA 2I1RA 2VG5A 2M3DA 1MMDA 3OR1A 4TNOA 4NZ7A 5D77A 5KFIA 2MSTA 1NKBA 2KFZA 5KFMA 5E3QA 1QAIA 1N5VA 2O01C 3VWSA 4F50A 1UL3A 2ZFHA 4RU9A 2X3GA 3J7Z5 2XMVA 2YX4A 5AE3A 2CQHA 1FA0A 1RISA 4GC7A 2E66A 3TVYA 2VG6B 2HHVA 3DMJA 4BWMA 3TAPA 3GV5B 2JRSA 2L9DA 3BQ0A 1M1KT 1U24A 2OPRA 1HBOB 3K5PA 3UDLA 1WEXA 1DJ0A 3G71S 4Y2CA 1BQMB 1FEHA 1YGYA 4USHA 4E8UA 3V6DB 1KONA 1R8BA 1VBXA 3Q2TC 4B02A 2XO7A 4WE1B 1WEYA 3I0SA 3CCJS 2HHHF 2ZKTA 4FBTA 4KB7A 4LSNA 1SIZA 4ID5B 3JTPA 3OVSA 4TQSA 2KU7A 4ATNA 3H8YA 4UW2A 5AXKA 3KK2B 5CYJA