1VMBA

Crystal structure of 30s ribosomal protein s6 (tm0603) from thermotoga maritima at 1.70 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
107
structure length
107
Chain Sequence
KERIYESMFIIAPNVPEEERENLVERVKKIIEERVKGKIDKVERMGMRKFAYEIKKFNEGDYTVIYFRCDGQNLQELENFYRVTPEIIRWQTFRRFDLEKKERKAQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords 30S ribosomal protein S6
publication title Crystal structure of 30S ribosomal protein S6 (TM0603) from Thermotoga maritima at 1.70 A resolution
rcsb
source organism Thermotoga maritima
total genus 29
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2004-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vmbA00
3T1HF 4DUZF 1LOUA 4DR3F 4JI7F 1RISA 4JI1F 2BVZA 2VQEF 1HNZF 4DV3F 1N36F 4NXNF 2F4VF 2UXBF 4AQYF 4X64F 4OX9F 2B7CB 1N34F 4B3MF 3T1YF 4B3SF 4JI5F 1IJEB 2RJZA 5AJ3F 5IWAF 1FJGF 4JI0F 5BR8F 5LMNF 1CQMA 5LMUF 1QJHA 1VMBA 2B7BB 1IJFB 4DV6F 1GH8A 1FKAF 1J5EF 4KHPF 4YHHF 2UU9F 1G7CB 1F60B 1HNWF 1HR0F 1B64A 2HHHF 2UXDF 4LF7F 1N33F 1I94F 1IBKF 4DV0F 4JYAF 1XNQF 3ZZPA 4YY3F 4LF8F 4GKJF 2VQFF 4JI6F 2E5LF 4JI4F 4LFAF 4NXMF 2KJWA 2KJVA 2ZM6F 4DR2F 1IBLF 4X62F 4DV1F 4DR1F 4DV4F 2UUBF 2BXJA 2UUCF 4JI3F 4X66F 4LF9F 3OTOF 4K0KF 4DV7F 2UXCF 4DR5F 4LF5F 4LFBF 1XMQF 4B3RF 4X65F 1G1XA 4LFCF 1HNXF 2YY3A 1CQNA 1N32F 3R3TA 1XNRF 4DUYF 4DR6F 4LF4F 4LF6F 4GKKF 4B3TF 4JV5F 1XMOF 4DV5F 1IBMF 4JI8F 4DR4F 4DR7F 4JI2F 2J5AA 4DV2F 2UUAF
chains in the Genus database with same CATH superfamily
3JSMB 2C2KB 2MLYA 2X3DA 2FVRA 2ZJPQ 2M88A 3MAAA 1TAQA 2AZ3A 3OTDA 2R7VA 1Q53A 2IVYA 1N34F 3QGPA 4MK8A 4NYPA 3GONA 1XQIA 2PDAA 4DV5J 1UEKA 3MCMA 1JLCB 3ITHA 1JB0C 3PYGA 2OTJS 3CD0A 3G82A 3U1MA 3VVUA 2ZWPA 1IJFB 4U7UD 4KGZB 2VBXA 5J2NA 4E8UA 4YB6A 3LGNA 2DT9A 4AT1B 1CC8A 3CJTA 1U2CA 4EO6A 3T9NA 2H5IB 2GFFA 4CO1A 4IG0B 4RO0A 4RW6B 5DG9A 1JLEB 4FN5A 1WWHA 4Y6IA 1VLOA 4PYDA 3OTOF 2HIYA 4JI3J 5KOXA 2C3MA 2AEFA 2PN6A 1VCTA 4X65F 1S1WB 2Y0SD 1D0EA 2DGTA 2RKIA 4HH0A 1HNXF 3VQSA 3KLIA 2FHJA 3M2UB 2HFUA 1EQ0A 1P8GA 4B3TF 4ZVUB 3L7PA 4ELUA 2CQIA 5DLGA 3PW5A 3JTNA 3P4UB 3W65A 2LQ8A 4ZP9A 2HS4A 1ZTTA 1DHMA 2XSJA 1NB7A 4AL6A 3PJ9A 1FRJA 3J7ZT 3MUMP 1EZZB 5EN1A 3HVTB 4QQBA 4NZ7A 4CO0A 5IWAJ 5D4OA 2WK4A 2XMAA 1YJVA 4ED8A 3E3XA 4JV0A 2DNPA 3F73A 4TLRA 1JLBA 1KVIA 2YKNB 4RZRA 4ES3A 1QSLA 2CQGA 1MN9A 3FZBA 2KXNB 2ZBQA 1RACB 1JNZB 3KG0A 4R8UB 2XBPA 1FDNA 2JVOA 2CFXA 5D6GA 4NLSA 3GWCA 3E8OA 4CLLA 1CJUA 1R31A 2HFVA 2J5AA 4QR2A 3VHQA 4O3QA 2GIRA 3CMAS 1JXLA 3QT7A 1KR4A 3AFGA 4NXNF 3CCWA 3MZIA 3TZYA 4NLRA 2KXFA 5KFUA 1HD1A 2GIQA 1CG2A 2YXLA 3W60A 2HHUA 2XY6A 1OSDA 1B99A 2CQPA 3RB6A 2BZ2A 5IFMA 4PUOB 4U67Q 4KHPF 3GSIA 1B64A 1SV5A 1EETB 5HMZA 3O2IA 1MN7A 3UCZP 1RAEB 4PCQA 1HBOB 4W92B 3FEZA 5E3PA 4DQIA 1F9FA 3KK2B 2R8HA 3CGIA 1TFYA 1A7GE 2MZJA 2DKOB 2U2FA 1QUPA 1FKOA 1AFIA 4LR8A 1RA7A 1NB2A 3W61A 3VF0B 3P5TL 3QLHB 1LW0A 1KRPA 2AEJA 3NAHA 2V8VA 5KFNA 4LF9J 3KKFA 2ATLA 5T41A 3FEXB 1U6FA 1S9GA 3NEKA 2ATCB 1PIEA 1ZOTA 3G6YA 4JOUA 1HBNA 2MSSA 2YNGA 2E1MC 1TMMA 2FGCA 4X64J 1R0AB 1R8AA 4J9UE 5AE3A 1N5YB 1U2FA 2DH9A 2OEKA 3NBPA 4Q45A 2FVSA 4EU0A 1TMJA 3IG1A 1HR0F 3PVXA 2J8SA 3MCNA 4ZOSA 1T9TA 1FK9B 1X4EA 2C2OB 2VJUA 1KLMA 2LECA 5ADZA 2J0QD 3M32A 3HSZA 2VPXB 2X3GA 3QT8A 3NGRA 3CJ0A 4EO8A 3QQCD 2KKHA 1U7LA 1GTHA 3RGIA 5D0EA 1IQTA 1C1CA 2A18A 3N79A 1CQNA 1GT8A 2M70A 3SCIE 1NK0A 1PBUA 1KVJA 2CQ3A 4YB1P 1WKKA 4ETZA 4M5LA 1I3OB 2BVZA 4OHVA 4OHZA 2AT1B 2JLFA 3SDEB 2VG6A 1SKSA 4I2PA 1A0OB 3TVKA 2IMWP 4N41A 4DPWA 3GB0A 3UN3A 4X4VA 1S9EB 2Z2ZA 3DLGA 4WXWA 2F65A 5L1IA 1RT5B 1XBWA 2EFOA 1UP1A 2HHWA 2WBRA 1X4DA 2B4UA 2C2NA 3CW2C 3EM1A 4NEZA 1UFKA 4NCGB 4QIEA 1T3OA 2GC8A 1WC4A 2FLLA 3D0IE 4ECSA 3RG6A 5KFMA 2QFJA 1JKHA 1MNEA 3R5AA 2MZTA 1FTCA 5KFVA 4DWIA 2O1PA 4USHA 1V6HA 2LXFA 3IWNC 3V6HA 2BX6A 3A8IA 1BY9A 1RT1A 4CT9A 4DV5F 5H9EJ 1TTHB 2CQHA 2MKSA 1U24A 3KJVB 1F1BB 1ZM4A 1Q7LB 3MM6A 2DD8S 5LT5A 2DIUA 2LQ9A 1EP4A 2D69A 4DQRA 3M7VA 5HVGA 4RW4B 3ZTRA 4EBCA 2GVZB 3VGUA 4X4TA 2XEXA 2ASLA 3K5MA 4GMKA 2RS2A 3GSDA 5JMNA 3V4IA 2DJWA 3DMJB 3KOAA 1KHWA 2XI3A 3DM2A 4YQWA 3H4BA 3JYTA 2OPRA 3NWRA 1BHNA 4J9NA 4TN2A 3NNCA 3W3SA 1ZPVA 4WFXA 3VTIA 3D1HA 3IG1B 2D3O1 3LH2S 3PV8A 4USKA 2XC9A 2LA6A 2ZC4A 1NK5A 4DV7J 3TA2A 5HAOA 4B3RJ 4KV8A 2HGNA 1RE1B 3HT0A 4BWJA 1O6XA 2ASJA 1UJ6A 4OI0A 3MM7B 2GJ2A 4R25A 2RU3A 2J7WA 4ECQA 3I82A 2GAHC 4DR5J 2RVJA 1VK3A 2DNMA 5K20B 4E2FB 4CO3A 3DYAA 4HT7A 2D3UA 1FERA 2NSCA 3D54A 1R8BA 4ILRA 4QPTA 2COLA 2ACYA 5IQ6A 5KG5A 1VQ9S 1TKDA 3EGWB 2CPFA 3Q8SB 5AXLA 1OO0B 2VFUA 3POTB 2LXUA 1VC0A 4C8OA 3WDOA 1C1BB 3W9JA 1O51A 2D41A 1WTFA 3ICLA 2MY7A 5LM7E 2N3OA 4QIFA 5J2MB 1YG0A 3SFGA 3KNAA 3LPYA 4MK9A 5IT9Y 4PXDA 2CQBA 2V4QA 1B0VA 2V63A 1Z4UA 1CJKB 2LCWA 4ED3A 1FX2A 4MFBA 4FYYB 3WC0A 1WC5A 1RT2A 2HQFA 1TVRA 2H1YA 5HBMB 4C0BA 2CPDA 4N56A 4RBUA 1E6VB 1HQEB 5E33A 2DR9A 4A8YA 2ZZNA 4DR6J 5HATA 3K59A 5JJBA 1RYSA 4OHYA 3Q86A 4CLTA 2MYFA 3BJYA 2HWTA 2D9OA 1ZZNA 3TYTA 3MGJA 2KZMA 2VFVA 2WW8A 4KO0B 4M5KA 2BKOA 1TV6A 1H74A 4N77A 2O01C 1GMWD 1Q82T 2IHR1 2JVRA 1N5TA 2QLXA 3DU5A 3RR7A 1CJVA 4GC6A 1RK8A 3S8SA 4O0IA 1FXRA 2D7SA 2BOPA 2Z4PA 2KL8A 3ISZA 3PXGa 4NLVA 4IG3A 1QE1A 4X62J 2FHKA 4LF9F 2EK1A 2H5JB 3GIKA 5HO4A 2YKPA 4UZCA 4ZS6A 4OMFG 3UDEA 2LEAA 2UVRA 3AA8A 4GRSA 4UY8T 9RUBA 5IM0B 1W2IA 1CJTB 4NLGA 3ZTOA 5A6PA 2XZTB 3A8KA 1S48A 2RUSA 2ZJRQ 3T1HF 1SJ4P 2CQ0A 4KKOA 2FYXA 1QAIA 5L8RC 3QGHA 2V2ZA 4M5HA 4C3LA 2WZ1A 2W7OA 3FSXA 2KU7A 2CAJA 4R0EA 2LMIA 2I0XA 5K9FA 5KFSA 5J2QA 1FJGF 1N5QA 1NHKL 3BQ2A 3W63A 3PRBA 4DQQA 4BCAA 5ETOA 2AU0A 2YNFA 1WG4A 1RWKB 2M3DA 4LF7F 2I5JA 2WVBA 3H98A 3R5GA 3D1OA 4Z37A 1ZAVA 5A8KA 1SC1B 2ACMA 1XNQJ 3KXDA 5T7LB 2CNOB 4F4ZA 4DSIA 4DR1J 2IYGA 5HQLA 4O3SA 2N3LA 4TVAB 4LBIA 1LNQA 2PMZD 4DL3A 2YWWA 3MMAA 4LJMA 5I42B 4J9VA 4ZP8A 2C3PA 2GX8A 4FVMA 1WDDA 5KFYA 4TKTA 1WSRA 1U1MA 2RQKA 5LJ3Y 4H4MA 3TJ8A 4NPOA 2QLJB 2YQ1A 4KYZA 3CF5Q 2VG7A 3PW2A 3DGPB 4MK7A 4USJC 2UV8G 1H2TZ 1P6TA 4RLEA 3D1QA 4FBUA 4DL6A 1K9MT 5KFQA 2WVFA 2NXJA 4ZKAA 2QA4G 3ET6B 4F3QA 3K8VA 2BE7D 2Y0BB 2PEBA 2HNYB 3I87A 2FVQA 3EGVA 4RJVA 5BR8J 3J7Z5 1R8PA 4LMZA 3MM9B 1R43A 1DJ0A 1JLFA 3SBMA 3UFCX 1PILA 2DH7A 3THPA 3AAWB 1LXNA 5HMXA 2BJEA 2E1PA 3L4BC 2VQFJ 2WB4A 2EW9A 3H25A 2CPJA 4QOTA 2WONA 3LGMA 4DX5A 3CCQS 2BRKA 3M8PA 2UXCF 5EUHA 4NLUA 2W9CB 1PJ6A 5DRKA 1HWJA 4OI6A 2RSQA 4LF4F 3DOKA 3V6JA 3G8TA 3D7SB 2RS8A 1PKUA 3OJSA 1SKRA 4LR7A 2XNQA 3WX8A 2Z2MA 2IC3B 1S6OA 4Y2KA 2WBMA 3DOMB 4LRBA 1VC6A 3HFKA 4WFAQ 4HI2A 2GVDA 1X9SA 4RNOA 4ITSA 1WF2A 3P8BB 1TKZA 2VJVA 1Q5YA 1F5AA 4DL5A 4MKBA 5EHHA 3PRVA 3M8SA 1URNA 4ICLB 5KG3A 3AJDA 3AODA 3PCOB 2WSCC 4G1QB 3QIDA 4USVA 4NLDA 4PABA 4AL7A 3QGGA 4LF8J 3OHBA 4NLPA 3RAMA 3UD5A 3KLVA 4YR2A 3MM5B 3SV4A 4OZ1A 3IS9A 1ZZFA 2QL9B 4HHJA 2AJQA 2RDJA 1HNVB 2MJNA 2IPOB 2H51B 4DR5F 2E1AA 5ETSA 3TAMA 4JYAJ 2R4FA 2HLTA 1S1TB 1QLNA 4OJHA 1VQ5S 4ECWA 3ILIA 1X5PA 3EVOA 3IR7B 5DZ7A 2HS0A 1GAOA 4OZ3A 3QGIA 1FT8A 3KJQB 1AZSA 2ZBPA 3CTRA 3BBCA 5D78A 3QWPA 4DG1A 2VQEJ 2JX2A 2LU1A 2IA6A 2KVIA 1K0TA 2VG7B 1HPZB 2NYIA 2VPYB 2BANB 5LJ5Y 3PYEA 2O3DA 3OXLA 1R27B 2LA4A 1PJ7A 2ALYB 4Q43A 2DHAA 2EKYA 7AT1B 5J1EB 2BE2A 2J76E 5F8HA 4NRUA 1Q1KA 3GCXP 4OFZA 2OELA 4KGXB 1Y10A 5LMNJ 3C46A 1GXUA 2JEGA 3MI7X 2P6TA 3L7OA 4NA2A 5E3RA 4CLKA 3M1VB 2Z2LA 1VK8A 2HVEA 3T41A 3GJRB 2HZAA 1YIJS 1U6BA 1X4CA 1VGYA 2CWKA 3HSGA 4USUA 1X4FA 1CEZA 5HANA 4K0KF 1KQSR 1HNWJ 4F3OA 4F0HA 3R7SB 2VG5A 2ZD1B 3KTQA 1FI4A 2J7UA 4DR6F 4DX7A 5BXIA 4F4AA 2HGLA 3O5TB 2J9EA 3SIPB 3H59A 2QLFB 2RD5C 1JLAA 5KT6A 4WPAA 1U1KA 2MLXA 5KG6A 4LF5J 1WC0A 1T05B 2YKQA 3CULA 2W24A 1NNDA 1RAOA 5G0RB 2F4VF 1N56A 4K5RA 2E29A 4F4YA 2WOMA 2HWIA 1NK8A 2GJIA 3CEDA 1IR0A 3UCUP 2YX1A 2CZVC 1X7VA 4LR9A 4RW9B 4P9SA 3M8WA 1G7CB 3AHPA 1Q7YT 4CYUA 3PW4A 2V69A 2CG4A 2IJFA 4DV0F 2KT3A 3QIPB 1X9MA 1I94J 1QSYA 3AH6A 3KYLA 2XWYA 4WCEQ 1U1RA 2WRMA 4DCOB 3W5YA 4C0HA 2HBQB 3DLHA 3X1LB 1S0NA 2VASA 2MKHA 2GQQA 3CCLS 3P3DA 4IUFA 1WACA 1WELA 1YBAA 2FVCA 2CRLA 3PR5B 3C6TB 3BR9A 1P9YA 2PE8A 1SBRA 1AT1B 2NXNA 4L3NA 3E2EA 3K5PA 3R1LA 1Y5IB 1ZM9A 5KFIA 5BJRA 1I1GA 1VDHA 4DG1B 4M63A 2L9DA 2D74B 2DHXA 2VKZG 1Q79A 4LREA 1EB0A 2O5DA 1SI9A 2G2ZA 2R7RA 2B56A 2JDJA 2MQNA 2DXFA 1KHVA 1NKCA 4ZPBA 1SJFA 4EMDA 2DNZA 2IAJB 1LWEA 2KG1A 3KK1A 1WHVA 5JXSA 4K50A 2IIHA 1RADB 1ZH5A 1U0SA 1LW2A 3IRWP 2DCUB 4DL2A 2AIRB 1XTZA 4DEZA 3BB5A 4YN3B 3PIPQ 2P6SA 3TZWA 2BJ8A 3AB4B 3DRSB 4DF4A 2RF2B 3A13A 4I6WA 4L6V3 2HWHA 4A47A 2FVPA 3LP0A 4YMEA 5D4NA 4Y2IA 7FDRA 3T5KA 3LA0A 2JWNA 2CJXB 3OJUA 2DNRA 2YPZA 2B43A 1R8HA 3OL8A 4GC7A 4P7TA 4HLBA 2CIMA 2PMHA 3BM7A 3IAM9 4GO7X 1FFSB 3MR5A 4DPXA 3CCTA 3MTKA 2XLIA 2X1FA 4HHHA 4CH1A 4J9MA 1K8AT 4F25A 5IS2A 3G86A 2OJ3A 2MZQA 1IKWA 1REVA 1N33J 2YWEA 3C16A 4TY8A 2GGPB 2AMCB 3R1HA 3M8QB 2L41A 2HQDA 3TQEA 2N4CA 3DLKA 1YTYA 2ZE2B 2MZ1A 1KVKA 3GJTB 2V5HG 2E7WA 4QWCA 1KBRA 2JEJA 2CJYB 1O8BA 4RW7B 3HZEA 1HD0A 3MM8B 1N6QA 3BPDA 4FDFA 2YNIA 2BM0A 2MQPA 2N4DA 4DUZF 1NSPA 2JSXA 3FC9A 1FKPB 3CO9A 1YITS 1NKBA 1VQOS 4DX6A 4M5GA 3R2CJ 4WTYA 2G9OA 4CNZA 4J90A 2XZWA 3EPGA 3DN9A 3HVWA 3ZTSA 2LEBA 1MROA 1CULB 1S6QB 4NLXA 5M2RA 4UUWA 2MQ8A 2MKIA 1B7YB 4WP9A 2R8IA 4WFBQ 4JYAF 1OMSA 1RU2A 1LWFA 1XN9A 4CNYA 2W9BB 1RWNB 4ID5A 2DBBA 1Y5NB 3FMWA 4P52A 1DTTB 5L1JA 2OPQB 2KTQA 4RR5A 5IV3A 4X66F 1FXLA 1FF2A 1LK7A 2W1BA 1URRA 3HHLD 4KT0C 4RWWA 2NPFA 4UTGA 1RAJA 3D3BJ 4UT4A 3JAMY 3I31A 2QLBB 4HH1A 4ELVA 4IRKA 4HTIA 4NLWA 3PZPA 4ZVEA 2E5GA 2B6AA 4OYBA 3H2LA 1S4FA 4KFBA 2DISA 3TAQA 3DRXA 1SH0A 3DXSX 1H38A 2ROGA 2MMYA 4QBUA 3I4PA 1NXIA 2QIFA 4ECXA 2DITA 3WZ0A 4OLPA 1Q8LA 5HQMA 2HHVA 4CTAA 3I56S 5FIIA 1HNWF 3U02A 3SYZA 5KFRA 1D09B 2FZCB 5AE2A 4I2QB 3JAMU 4GVBB 3MR2A 2F1FA 3K5LA 2OPSB 2XB2D 1G2EA 4HACB 3QMQA 2B9EA 2G0IA 2C2DA 1AYEA 1XR5A 3OSNA 4FS2A 1S1VA 3F0NA 4X4QA 4NLTA 1HYSA 1KDNA 1ITPA 4LF5F 1HARA 1YGYA 3RJMB 1UZDA 3CCRS 3IBCB 3TARA 3PW0A 1IBMF 3C6UA 4Y34A 4ID8A 4DX8H 4YEAA 4I7FA 2MKJA 3I55S 2A6MA 1P1LA 4MIAA 1Y0HA 3W1YC 2PO4A 2QYCA 1N36J 5CYQB 2BV3A 1RKJA 3TANA 2UUAJ 2K7JA 1X8DA 2WSEC 2B9YA 2OSQA 2HNZA 1NDLA 1U0HB 1S59A 4U96A 4QYZK 3AT1B 2B4VA 3CC4S 4DLEA 1WG1A 1FNXH 2ZM6F 2IYIA 1YK9A 4IH7A 3SSRA 5AXKA 2NZ4A 3FBEA 5KG2A 3KK3B 5A76A 5L1LA 4DUYF 1UJ4A 4LF6F 5GMKa 1TUWA 4PKDB 1RTHA 1R6VA 3F44A 3FSYA 2VH7A 4JUZA 3GG1A 1YI2S 1ZS6A 3BO2A 2B8QA 2AZ1A 3SI8A 1HNZJ 2HHPA 4RU9A 2YH0A 4OYZA 4K8RA 4NCBA 1BQNB 4PQUB 2DHHA 3UNYA 1J27A 4ED6A 5B0GA 2ZBIA 3QSIA 2RRNA 5KTQA 3QZ7A 1BQMA 4DPYA 3J81Y 5LMUF 1SL0A 5ETPA 4YB7A 1S1XA 5DGAA 4R5PB 1VYAA 2JEFA 4ED0A 3HZGA 1HL6A 2OUGA 4ZPTR 1NUEA 4P73A 2V4RA 2JZ5A 3UR3C 4CH7A 5HROB 2BXJA 4NYZA 1VQLS 2YKMA 3MEDA 5L1KA 5A8RA 4YR3A 1AUSL 4JV1A 3IGNA 5F8JA 3IP0A 4DR4J 4ZVSB 1TKTA 3JTOA 4ZP7A 5H1SV 4LBHA 5LXRA 1LFWA 3ZZUA 2LP4A 4IRCA 1KOOA 4LRAA 2YNHA 2B7CB 3DRPB 1N8RT 2CDRB 1SJ1A 2FIUA 3ONQA 4P6QA 1IM6A 4Q0BA 3EDRB 3S7RA 4OI3A 1EIYB 2Y1IA 1DRZA 4YHHF 3O3LA 2CG8A 2FDNA 5A2QU 4MKVA 3G9CA 4Y0FA 2XZDB 2RT3A 3UWTA 2DYAA 2RB7A 1PAUB 3RYLA 3FQKA 2HEKA 4PWUA 3JQJA 4ZJQA 3FZ2A 2MKCA 1Z1ZA 2ZVIA 1UVIA 3JSYA 2B0GA 5A8WA 2EBEA 2CJKA 2M4MA 2RHSB 4NI2A 1RCXB 3V5RA 2MGZA 3TR5A 2HIQA 5KG7A 2ILYA 4PWDB 4KAIA 3IBWA 1S6PB 3A3PB 2QE5A 3K5NA 1GQEA 3A3OB 3FCWA 3NGTA 5E0OA 1RTZA 4DMZA 2C1EB 2XG8A 2ZEJA 4M5DA 1GX5A 3DGVA 1M1HA 3WHIA 1J5OB 4C8YA 1WKJA 3KLFB 3CE8A 4O4RA 5CD4A 2HVZA 1KOHA 3EZUA 2KM8B 5FDLB 3L7UA 4LRCA 3T1YJ 4ZN1A 4O3RA 2EWHA 5J2PA 3RRHA 4TU8A 3PYDA 2HNDA 1AXQA 4ZJOA 1HQUA 4UOGA 2B9XA 5AJ3J 3M30A 1RT3B 1Q16B 4W4MA 4LF2A 4RL1A 4Y2CA 3DDNA 2VF3A 4WK3A 4DV4J 2R7OA 4K4UA 3QRPA 5C25A 3MUVP 3K0JA 3N6MA 4P2SA 1RT7B 3KHRA 1R8CA 1JJHA 4TU7A 4USIA 4O44A 4Y2MA 4P2MA 3EDQB 5KFZA 1BWVA 4G65A 4GKKJ 1YRTA 4DV1J 1FNOA 5KG0A 1NK4A 1WORA 4JI7F 1TFWA 1TU0B 3J80Y 5LL6d 2VDHA 1UPMB 1OYEA 3AOCA 3OT9A 2XS5A 3DOLB 4ELTA 4OI1A 5GMDA 4B17A 5LSLA 1IKVA 4WE1A 3W7BA 2BOAA 1HI0P 2XS7A 4JI0F 4UOFA 1JLQB 1SCJB 3JXOA 7FD1A 3JB9k 4J9RA 4DXLA 2LDIA 2HHTA 2UU9F 3CVKA 1NSKL 1NJWA 4A8XA 2QMWA 5MLCV 1UVNA 4U6PA 4YY3F 2KRRA 4N76A 4ZPVR 1U4BA 5DQGA 1FRHA 4K7QA 4MAKA 4KH1B 4ZCLA 5IZHA 2H48B 2BABA 4K4YA 2R7TA 2L9WA 3AJ1A 1Z2LA 1PYTA 1S1UA 4B3OB 5HP1A 5D3GA 3NRBA 2Z57B 1G4CA 2HHXA 3LALA 2HW3A 3CJSA 1YX2A 2UUAF 4C2MA 3HHLB 4DR3F 1GMWA 2ZDOA 1HI8A 1T03B 2AJFE 2QLWA 4NI2B 2IBOA 3GJQB 2YWFA 2HVIA 2AYBA 1ZETA 4J9KA 3VGSA 2MHNA 3RU0A 1TP7A 4OJGA 1N34J 1LWXA 1FJ7A 3OR2B 3SQGB 2HQGA 4M5DB 4ANEA 3JQKA 1QDUB 3UDCA 2J0WA 3BEGB 5ETLA 1FKAF 1S0VA 4ZHRB 4KQZA 4USWA 4BC9A 2IBKA 2R2RA 4NLQA 3I0SA 3NNAA 5EWEA 2K1RB 5C42A 4L73A 3BN4A 3CPWR 2YH1A 2HMIA 1SH2A 3C66A 4UW2A 4DN0A 2QA2A 1APSA 4KPCA 2XULA 1WOSA 1SQFA 1Z2ZA 1U8WA 3MWBA 4ETXA 4IFVA 4YFUA 3HXMA 3ENVA 4X65J 3NOCA 4KRWA 4IOAQ 5A6WA 1HNXJ 4WP3A 4PXCA 3CJ2A 3GPAA 4B3TJ 4NEYA 2B5JB 3I0RB 3OQ2A 5E41A 4FNIA 3UVJB 4FXDA 4Y3CA 3QFWA 3TZZA 1RDRA 2VL1A 2M5YA 2NUHA 4Q8EA 1JJ2R 2KVQE 2G2YA 3A4TA 4CWBA 4IR9A 4JI5F 3CDBA 1M5KC 2WTFA 5F3TA 2CPIA 4MTPA 3KLHA 1HNIB 2HAIA 3FBBA 2POKA 3E01A 3KJNB 1NJXA 1UZHA 3ETOA 4H4OA 4C6AA 2DNKA 4J9LA 4ED4A 3CCUS 2FHJD 2E1RA 5CCLA 1H98A 2AX1A 5KOWA 2XYPB 1Q86T 4URQU 1BLUA 4F0KA 3RRKA 2JFKA 3HHNB 3BDPA 2H5EA 3MECB 3WIVA 4PEOA 3O1LA 3IR5B 2BW7A 2CZ4A 3NCRA 2KM8C 3HVRA 4DR7F 4CDIA 1NK9A 1VR6A 1N88A 3BF4A 1NPPA 2EPIA 1N5VA 4RUAA 2M7SA 2BACA 4QYZJ 1VIXA 3MEGB 4NXNJ 3OR1B 3V6DA 4LSLB 3MMCB 2Q66A 2W7PA 4NMXA 1M5SA 1RBOB 3C14A 1H73A 4X4UA 2AW0A 1RBLA 2BE9B 3ZZRA 3NNHA 2UP1A 5KFEA 4KHPJ 3BQ0A 1QUVA 3IM9A 2XMWA 3QSYB 2RNEA 4IOBA 3NWGA 1CS4A 4ENOA 1VBYA 4N7TA 5DQHA 4O4GA 3C15B 3DI6B 2LVWA 2MEWA 4X84A 1YHQS 3FRZA 2XGPA 1YJ7A 1S4EA 5E5NA 4XIUA 5IC4B 2A6OA 2V68A 2WCXA 4LBPA 1SIWB 3W8GA 3VAFA 3QBCA 4NOHA 3DRRB 4KBIA 4PPDA 3G6VA 3DLEA 2XMJA 1XWLA 3CB4A 1TL3B 5IC6B 1H7WA 2FPHX 2M9KA 1RTJA 4WFZA 3IN5A 2ZITA 5AJ3F 3BGRB 3OTBA 2B4PA 5K8MA 1I6JA 2JHEA 1TK0A 3N6NA 1X0PA 1MU2A 3TVZA 2GO8A 1D9FA 1D9AA 3OHAA 1DURA 4F67A 3Q8VA 3NP5A 2F7VA 4IRDA 1LV5A 3I5BA 2FJWA 4EZ9A 1HR0J 2P5VA 4KSEB 3KLEA 1IKXA 3RB0A 3VAGA 1KQGB 1XJWB 4B9TA 1S0MA 3GIMA 1ZYQA 2C22A 3T19A 4DV1F 3W62A 2HRTA 4ZLPA 4NZ6A 3HHLC 1L3SA 3MMBB 4U9RA 4G1IA 2DR7A 1UW4A 2V4JB 4LFBF 1EAYC 3RBEA 3DFEA 4C7QA 4IDKA 3OL6A 1Y3JA 3D6MB 1JLGA 4FBTA 3UD4P 4A8SA 3M8ZA 5BYQA 2ASYA 3D6HB 2C42A 2G1HA 5IT4A 3BR8A 1N4LA 4DF8A 4TYAA 2M2BA 2NR0A 4ES1A 3M2VA 4RUHA 3BSCA 4PQAA 1WD6A 4F8RA 1T9XA 1AUDA 5F41A 2B8PA 1X4HA 3PR4A 4UQTA 1SC3B 4C8LA 2LYVA 2UVUA 4IQXA 2BJ1A 4NE9C 2QC3A 1UFLA 3EXCX 4TU9A 3D67A 2Q1LA 4S0MA 2EFVA 2YQ3A 3S1TA 3SSQA 2F8HA 4L76A 4LUBA 1FD2A 3FVYA 3A12A 4ZVPB 2LLZA 5HQ8A 1S9FA 4MYTA 3MEEA 4DQSA 2GS8A 4B9UA 4WYWA 3QO9B 2QO3A 2B9WA 4ECTA 1TL7A 1Q0NA 2C28A 1QTNB 4DLGA 2HURA 1RWMB 3DCAA 3ZZZA 3RB3A 2CQDA 4G1PA 1OQ3A 1CSJA 3KDOA 1AROP 2AJ4A 3DHWC 2KDOA 3FSIA 3BKUA 4PG6A 1MSWD 1DLOA 3ZC4A 1S57A 1FCAA 3PIOQ 3EGZA 3NGKA 2ZKUA 4C0OC 3MD3A 5K14A 2ZZMA 1RTDB 4JV5J 3BO3A 2MZRA 4WU2A 2P2CB 2MQMA 1TKXB 3PX0A 2NS1B 4A8KA 3OLAA 2XHCA 1C0UB 4PXEA 3B4DA 2GMJA 1W2BR 1UWBB 4C8NA 2RE1A 3EICA 4LT6A 2RH3A 1B0PA 1NEEA 1V9OA 4F2SA 1LWCB 2V8HA 3HJFA 4EI2A 3UQSA 3QRRA 2K7KA 3NKYA 3TJAA 2X7IA 3IWLA 1CC7A 2XMMA 3SFUA 3ZNUA 2BKNA 1Q78A 2H3EB 3IM8A 3TP2A 2JNJA 1WNEA 4IO9Q 4ANCA 5KFGA 4LFCF 2XY7A 3AA9A 1YVFA 2AP6A 2CVIA 1Y00A 2E5LJ 3MR6A 1NM2A 3Q2SC 4FF3A 3OL9A 4FF2A 2Z2YB 3V81B 4QWAA 5A0YB 1QAJA 2ZH9A 1KNZA 4EEYA 4OX8A 5E3AA 4MKYA 5GMEA 4J9SA 4B9SA 2VB6A 1C4AA 1RAHB 3TI0A 3KUHA 4RW8B 2NXCA 2ZH2A 5B7WA 5D77A 3W2WA 5BYSA 2PA8D 1R6YA 4JI8J 1IM4A 4ILLA 5EWGA 3UDVA 3D3CJ 1RTIA 3IR6B 1KC8T 2O67A 1RHMB 1UW9A 2R8JA 1RT6B 1S97A 3PKYA 4YR0A 1WC6A 1RJJA 2L9NA 4BLGA 3TX8A 4JV2A 1IBKF 1VRTA 3EWGA 2IM1A 3AOAA 2OI2A 1ZTWA 2Q43A 1GEHA 5ETNA 2KJVA 1WC1A 1RWPB 2IA0A 2GV1A 5K8PA 2CNLB 3OUYB 3M9MB 3BSNA 3AXKA 5KFWA 2IRUA 3US5A 2ZUAA 2HS3A 1N52B 1DARA 1IXKA 5ETTA 1PCAA 2IFXA 1FNMA 1TL7B 4KGVB 2UUBJ 4ZCMA 1ZAXA 4Q2LA 3THTA 1SKUB 4XDDA 3MAAB 4F4XA 2KYZA 4DV3F 3B54A 5ETRA 5I3UA 5B09A 3NMAA 2W01A 4OI2A 1UVLA 1F3VA 1YJWS 2DPJA 2FD2A 2YBVA 3ITHB 4L74A 3FFIA 3G82B 3LP2A 3UR0A 3S01A 2GHPA 1NK7A 1W26A 5J2NB 4E98A 3M2RA 4I68A 1V3ZA 3CJKA 5KFAA 4GO5X 2R2UA 3J7YI 1X5SA 4U8VA 1QVGR 3VWSA 1UMJA 2Y3YA 3HHEA 3CD6S 2V2VA 2RKIB 3KLIB 1Y5LB 2F63A 2CPEA 2ADBA 1R89A 3ELHA 3UW1A 2QL7B 4K5SA 4DPTA 3KG4A 2OFHX 1LFPA 4V1Ak 1Y4ZB 2DB1A 3T1HJ 2GNKA 2XSJB 1SH3A 3SMZA 1HHTP 8RUCA 4A8QA 3BH6B 2KFNA 3Q2TC 4QZVB 1WOPA 1W7WA 2BEFA 3L3CA 2KG0A 4NASA 1FJGJ 1SL2A 2HKEA 3DLBA 3CDWA 3MAHA 1RKIA 2DEIA 2F9JA 1Q8KA 1JLBB 1WF1A 1SXLA 2OD4A 3HI9A 1GMVA 1VHIA 4TNOA 2D3OR 3BREA 4H4KC 4LF7J 1YRUA 2M8HA 1XR6A 2BQ3A 2YX4A 4FNHA 4ZVTB 2FLNA 1O0PA 5KFOA 2DPIA 5CH7B 3NMRA 1K44A 2WHOA 1H72C 1FO1A 5CYMA 4NRTA 4XDCA 4NLYA 3GYXB 1IUJA 4P2FA 4BWMA 2CJQA 1L3UA 2HK2A 2AYMA 1KP6A 1TELA 1FX4A 3KLGA 2FJEB 2OKQA 1CJUB 2GAGC 3SXLA 2YWHA 1ZAWA 4DV2F 1KKHA 3LPEA 3GJSB 1LOUA 3ILJA 3PFOA 2OP5A 1U26A 2J6SA 2K2PA 4IFYA 5KT4A 4LSZB 2RMLA 4FPRA 1HBUA 1U1LA 3K57A 1JQGA 2Y8YA 4X4NA 3KHLA 1SJRA 4B9MA 2BJ9A 1F5CA 1RAIB 1SV5B 1HBMA 3CWJA 2XNRA 3CD5A 2X1AA 2H4YB 1VRUA 4QJVA 1V3SA 1KQFB 2HHHF 3AB2B 5F9LA 1RABB 1NHUA 4YDDB 2FY1A 4OZLA 3W5XA 4ZCIA 2ZC3A 1H2VZ 2C3YA 4RUBA 2H9ZA 4AXIA 1FKOB 5HJYA 4TXSA 1IBCB 3KJFB 2UXCJ 2BQUA 4MT1A 1LW0B 1SVDA 4C11A 3LP1A 2KHCA 4JV5F 4LF4J 2YKOA 1UEVA 4C8MA 1S9GB 4FF1A 3GLJA 3HCXA 1HBNB 1BGXT 2YNGB 4DJBA 3BZQA 4ECVA 1H2UX 4M8LA 1GK8A 2AGOA 3W5ZA 5DDPC 2QT7A 2GW8A 4QW8A 4OYPA 3NBPB 5HLFA 2H54B 3QT6A 2ZZTA 4Y65A 5L46A 3V6KA 2P8IA 1X0FA 1SKWA 1KLMB 2AYGA 3PO4A 4I0WA 4USMA 1C0TA 3N0VA 3HHDA 1VJWA 3M32B 1FE4A 1E6YA 3OD2A 4K4VA 4LSNA 4GKJF 3J7YU 5C24A 2E5LF 4F04B 3CMQA 2DGUA 4BS2A 3TEGA 1PC4A 5JUMA 4QW9A 4PXBA 1M5OC 1U49A 1YJRA 1C1CB 5E7OB 3HO1A 2KFZA 4WJBA 3PX4A 4PG5A 2YWKA 4NWBA 1JIHA 4FS1A 5IT0A 5GAGI 3GP9A 2Q6CA 4JI8F 3LF0A 2RRAA 4C4WA 1PO6A 2FHOB 4FYWB 2VG6B 3GFZA 4I2PB 2JJ4D 3EYZA 3KFWX 3C2PA 1F2GA 2IDEA 2PMWA 1N32J 4LQ3A 4B3MF 2EC2A 3DLGB 3PY8A 1VI7A 5GAHI 2PI4A 2RDIA 1S49A 1NDCA 4MKAA 3NLCA 5C2CA 3KHHA 4P72A 2EG1A 2W7AA 1VMBA 1TL1A 2JRSA 4NZ0A 1OPZA 3Q24A 3LOUA 2OTLS 1YKWA 2OPPA 1JKHB 3FCVA 2FHMA 3W66A 3PEHA 1Y11A 4DR2F 1PBAA 2UUBF 3ILOA 3KG1A 3TUPA 2NXEA 2HAFA 1UL3A 1SL1A 5D4PA 2ZH6A 4N8NA 1WEXA 4K0KJ 4TLQA 3WC2A 4JB8B 1KTQA 3PEJA 1RT1B 2CYYA 2F8EX 3KNGA 2AKWB 2HBZB 3MMJA 4CO5A 1YJTA 1NJZA 1T9UA 2PT0A 2P9EA 4EUVA 4DL7A 2BR0A 1S79A 1OY6A 1DTQA 2IRXA 2AD9A 3MM6B 2CQ1A 2ALZA 4ZLLA 4HEA9 3PM9A 1EP4B 1TAUA 2VODA 2ERRA 4HI1A 2F4VJ 2XMKA 1I5OB 3MOJB 1SC6A 4OV1A 4JI2J 2BA9A 2E7VA 4MIBA 2XGQA 2NZCA 3V4IB 5L38A 5CA5A 5KAKA 3HLUA 3IRXA 3DM2B 3S6EA 2VIHA 3JYTB 2OPRB 5KFDA 4A8OA 1BQXA 2JFDA 4NLOA 1HHQA 4J91A 4DV0J 3J7A1 2RILA 5CABA 4ZJLA 3RBZA 4O23A 2QZ8A 2F9DA 4I67A 2YQ0A 2DR6A 2QMUB 4HL9A 3TW0A 3HM9A 4KV8B 1X4BA 2J7KA 5K8OA 3M05A 1FTRA 5MAOA 4B9NA 1SUQA 1RISA 4JI1F 1HMVA 2FJDB 1GTEA 3DYAB 2UV8A 3CC2S 4N47A 1JMTA 4C8ZA 4XTTA 1VQNS 4DSFA 3DDKA 3HF5A 4I64A 3TUJC 4HDHA 2APOA 4OV6A 4TQRA 4K59A 1JLCA 3GV5B 1QJHA 5T14A 5EX3A 1TR0A 4J9QA 3VAJA 1VS3A 3WX4A 5H9EK 4LRFA 4KGMA 3UI3A 3L9ZA 2ROPA 4WP8A 4KPYA 4DL0C 3G2XA 3BYPA 2UUCF 4IG0A 4XPCA 2WB1D 4CRJA 4RW6A 1JLEA 2HG4A 3TX0A 4MFBB 4DBQA 2J9DA 1RT2B 1S1WA 4ECUA 1TVRB 3K2YA 1XMOF 5GAGU 3M2UA 1CBKA 1NK6A 5GADI 3IGVA 1P27B 3THVA 2AJ0A 2XMVA 2QMXA 2W2NP 1QSSA 1P1TA 1RYRA 2UXBF 1UVMA 1BWEA 4HYKA 3U7JA 2J8AA 1J2VA 2U1AA 1F2HA 4OYWA 3CMES 3IXQA 5GAHU 3HVTA 1H3DA 1TV6B 5AE1A 1Y9OA 1KN6A 1GH8A 3FRYA 3HKWA 4Q7AA 2H4WB 4NMLA 5HI7A 2FTRA 4RPFA 1S7IA 1CJVB 2C3UA 4F0MA 3FDSA 1RP5A 4LIRA 3ZZPA 4PWWA 1TUGB 5KFBA 1RLDA 3NCPA 4IG3B 1TQLA 3DNCA 1DQ8A 1QE1B 2FQQB 2QJ3A 3GIIA 3ETMA 2AGPA 2YKNA 3PX6A 3CC7S 3FBCA 2V6AA 4EYHB 1IWAA 2XMTA 3QZ8A 4C8KA 2CPHA 4R8UA 4DFKA 3AQPA 2DO4A 1WHWA 3I9V9 3GIJA 2HSEB 4OZNA 4ZPWR 5IQQA 4PRFA 3M6VA 4KKOB 4FYDA 1OYDA 2C2RA 3FGVA 2AJ2A 1UWAA 1JXVA 4KHRA 3LWMA 3QRQA 4EBDA 4DUZJ 3GR0A 3R9LA 4K4SA 2OEJA 1IKYA 1L3VA 2HZVA 1WEZA 4AQYF 3CJQA 3H40A 2CJ9A 4A46A 5CCMA 5J2QB 2E66A 1RUSA 3HSDA 2XM3A 1H0HB 4ZP6A 4FXVA 1WHYA 2IY5B 6FDRA 3WBZA 3IC1A 1SIZA 3GV8B 1NZ8A 2ROEA 3A8EA 2YNFB 3BQ1A 4Y28C 3K17A 2VDIA 2I5JB 4HR2A 5I3PA 2W4PA 4OYAA 1YDLA 4PUOA 5A8KB 4B02A 1QM9A 2ZUGA 4FF4A 2B51A 1EETA 4X2BA 5KFXA 4DS5A 4KY3A 5D0RA 2OH2A 1HBOA 4B9LA 3KK2A 4QU6A 3MMAB 4X66J 2F4FA 2DGOA 4H4MB 4V19J 2I2YA 1N32F 4MIWA 1FRIA 1QD1A 5C2GA 3VGTA 2VC1A 3QLHA 2DXDA 3I9ZA 1GMUA 5KFHA 2IVMA 2DRDA 3BGOP 3UPFA 4RNFA 2XI2A 2JH3A 2FLOA 1EQMA 1YLXA 3UCGA 2PFFB 2HQ3A 4CCHA 3EUNA 2RJZA 3VVTA 5B0CA 1R0AA 1VQYA 3GTYX 3NCQA 1N5YA 1LXJA 2W8LA 1JLFB 2MHEA 4OYOA 1ZPWX 2ZFHA 2D9PA 2EFQA 4PPZA 2W8KA 3GYNA 1FK9A 4JP8A 2ZVSA 1XC9A 3PHEA 2WONB 3H5XA 1FA0A 4CIOA 3OBIA 3M8PB 1R3NA 2GIFA 1FVSA 3UDLA 3R27A 4DCJB 5E2QA 3H2UB 1VQKS 1S12A 2HFNA 2V2QA 4AUKA 4L3KA 4L75A 1U02A 2XS2A 2MPUA 3DOKB 1OY8A 4I1TA 1KFDA 1Q8IA 4J9OA 4OQJA 5C5JA 3B8HA 5ETKA 4JI2F 1IBMJ 3GMGA 4U95A 1FE0A 5GADU 4DSEA 1K1SA 3CNQP 2GVDB 5E3CA 2J9CA 4QU7A 1NRKA 3GR1A 1RSCA 2V94A 2NUUG 1TKZB 2CJBA 3SDEA 4HT5A 3G96A 3KHGA 2AYEA 1EKRA 1IKYB 2MQQA 2LFVA 1S9EA 2XO6A 4I6YA 2GQ2A 3L09A 1RT5A 4CM0A 2HQCA 2DY9A 1ICEB 2QV6A 4NCGA 1DBDA 1WEYA 5EX0A 5HMYA 3IS9B 5B0AA 3CCJS 4LFAF 2RHQB 4IYQA 3P45B 4U8YA 2QYGA 2ZM6J 4CZCA 2CQ2A 3FEYB 3B78A 4AL5A 1CVJA 3TAMB 1F9EB 2BKPA 1YRXA 3HX9A 4K4TA 1NAQA 1G6BA 3Q8PB 5L9NA 5HL7Q 4EYIB 2MJUA 4UOHA 1AA1B 4DUYJ 2GHVC 4OZJA 4LF6J 3T1AA 5KFPA 1AZSB 3GYGA 4ALZA 1NH8A 2KXHA 4G3IA 2Q3PA 1EARA 4WF9Q 3KJVA 2NXUA 1VRQC 3JQMA 3KUEA 3V4MA 3BBBA 2VZ9A 2BMBA 4A8WA 4ECYA 2DGXA 4CLPA 4B3SF 4TQSA 2BE2B 3M9NB 1M1KT 1Q95G 4RWXA 5DS7A 5CZVA 4Q8FA 2B7BB 5LMUJ 4RW4A 2GVZA 2W4CA 3OFFA 3DMJA 5DM6Q 4X4OA 4ZA1A 1UETA 5KFFA 1YJUA 3HDSA 1B70B 1FEEA 4J7CA 3HFZB 4PYAA 3VCDA 1VBKA 3JSRA 3AXMA 3HK2A 3I6PA 3ADAC 2CQCA 1XK8A 3P96A 2MZSA 2VG5B 2UXDJ 3D5MA 4OZ0A 1RWXB 4HKQA 1B0TA 1ELOA 2RDDA 1JK9B 3BYRA 2FB0A 1JLAB 4WIQA 3Q89A 3MFHA 3B4MA 3MM7A 3ZNJ1 5HVHA 2CPYA 4WFYA 1ZA1B 4RBTA 1YSJA 2WOMB 2YPYA 4NX9A 2AGQA 3DLLQ 4EZ6A 2BM1A 3MCOA 2BYCA 2A10A 5L9XA 1NHVA 3FKBA 3MFIA 4AYBD 3G71S 4UF4A 1Q81T 2V34A 1WTBA 1PGZA 4EFAC 4Z2XA 4CYUB 4CT8A 1Q5VA 4PG8A 4YHHJ 4OX9J 1ROFA 4BDPA 5K8NA 5CHCB 2DGSA 2E9RX 3H5YA 1HW8A 3L95X 3POTA 3BKTA 1C2PA 2UVWA 4QYRA 1C1BA 4K2JA 3H5SA 2C2MB 4P71A 3J7AN 2HYIB 4KTQA 3Q23A 2LU2A 2WSFC 1V5VA 4IO1A 5DJBA 5J2MA 6FD1A 5EGYA 3HVAA 3OFGA 4ECRA 1UA0A 3I96A 2KO1A 2MSTA 2VA2A 1KFSA 5AT1B 1N54B 1CJKA 2IM2A 3ZZYA 1RLCL 4PAAA 4FKXA 3SEOA 3JTPA 3TQ1A 4EK2A 3IMQJ 4LIWA 2OSRA 5HBMA 1N0UA 1Y3KA 2OEMA 2R8GA 1E6VA 4M5NA 1HQEA 4E0DA 4YOEA 3CJ3A 2J6TA 2Z30B 3GQCA 3Q8RB 2DGWA 1VQ4S 3AQOA 1KSPA 3HSJA 2VA3A 3CUNA 1X9WA 3RB4A 3DC2A 3MUTP 4KO0A 3R6LB 1LWEB 1HW9A 4WXOA 3FK4A 4CI0B 3IAS9 3KK1B 3BV8A 3JS9A 2HRYA 3F56A 1MLAA 4JI3F 3NS5A 1J5EJ 2CQ4A 1LKZA 1RWUA 4J9PA 1PYSB 3QJLA 1LW2B 3VAIA 3FMBA 2V8GA 3D2WA 3ISNC 2R42A 2BJ3A 2G0JA 2EFNA 4AD6A 2AX0A 5IM0A 1CJTA 2G13A 1HHSA 1DAXA 3N5FA 1YJ9S 4C3KA 4JI7J 3HULA 3R7BB 3VAKA 3LP0B 4CLUA 1XMBA 5IV4A 4RNMA 2ZDPA 3SCKE 2DVIA 3SZ2A 2EXUA 2JLGA 3K89A 1FVQA 2L48A 4WU3A 2ZH3A 2X1BA 1YBTA 2J0SD 5IWAF 2EI5A 1JXEA 4JI0J 4IH5A 3IWXA 3W64A 2BDPA 1PSDA 1QY7A 4CO2A 3D0HE 1OPIA 4WZQA 1IKWB 3IBFB 4O0NA 1REVB 4HDGA 4TY8B 3C16B 2UU9J 2E9ZA 5LOQA 2ZH4A 4NCAA 1RWVB 4YY3J 2V50A 2CKWA 4P2XA 2FJAB 2JEIA 4B08A 3DLKB 3MURP 1VHFA 1JJ4A 5T7LA 4DPOA 3I5AA 8ATCB 3PO5A 3MPWA 3H0PA 1N6QB 4A4JA 2YNIB 5I42A 4P75A 1RHQB 3NXZA 2VBZA 1N0VC 4DR3J 1AFJA 3DGPA 3FQLA 1IVZA 2R7WA 3M6WA 4PG7A 2ZKTA 4N8OA 3T6JA 3B6BA 3CJRA 1WF0A 3N5BA 3TOQA 3NY0A 3ET6A 1MROB 1F3FA 1GXLA 5DGBA 1HKAA 1S0OA 2HNYA 3OVSA 1WI8A 2ZH8A 4OHWA 3SSSA 1LWFB 2BJ7A 3MM9A 2DIVA 2KH9A 4ID5B 1JNRB 2I38A 4AE5A 4DU7A 3PG9A 2Y1JA 1NPRA 1O5JA 2YWGA 2NYHA 2VFSA 3D28A 4DCPB 5IT9U 5D15A 2ZH1A 4URGA 2VV5A 4YDXA 3ZO7A 2QSFA 2W9CA 2YY3A 3MR7A 4OYIA 3UN5A 1LEOA 1XIQA 1T94A 2WVCA 1KD1T 2B6AB 4KFBB 3R5DA 2IC3A 4ED2A 3DLJA 3DOMA 4X64F 1T7PA 4F26A 1VQPS 4P10A 3ZXWA 3TAPA 2J9DE 1S76D 4C97A 2LXIA 1AB8A 1RQ0A 3RW7A 4JI5J 1V3RA 4CTAB 1SJ3P 1HIYA 2GQCA 4KIAA 1VIOA 2CZ9A 3IFEA 1KWMA 3D6TB 1SJQA 3R8YA 2OD6A 2UXDF 4ICLA 3G4SS 2CNKB 3G6ES 2F40A 4G1QA 4DU8A 2R3VA 5KG1A 5ETMA 5A2QY 1S1VB 2CDQA 1HYSB 4I69A 5GAEI 4ED5A 1FJCA 1MWZA 3MM5A 4ATNA 1T9VA 4HTJA 4X4SA 1HNVA 4DN9A 1G1XA 5DM7Q 4OYXA 5DQIA 4M94A 3C8YA 3A8JA 3C6UB 4WZMA 4WFNQ 1S1TA 2P9CA 4I7FB 2QRRA 1FDAA 1N48A 4DR7J 5K5MA 2DNQA 2GMHA 3OXFA 1SB6A 1UCNA 2ADCA 1FRLA 4OX9F 1T0TV 1RHKB 4D3GA 3SCJE 1WHXA 1HPZA 3EVWA 4IQMA 2Y9HA 3CCSS 2BANA 1VQ7S 5B0BA 2G2OA 3TVYA 1ZBTA 3FNNA 2AF6A 1D9DA 4TY9A 5B0EA 2YTCA 2WVEA 5J1EA 2HNZB 1FD8A 2HBRB 1VQ6S 1T95A 4NA3A 2WW4A 5HVFA 3UD3P 4DSLA 3EJMA 4A8FA 1OQ6A 3M1VA 1OY9A 2CNNB 3DDIA 3OVBA 5JVGQ 1UEUA 2Z56B 3RAXA 3CJ4A 2QGFB 4G6VB 4Z7YA 1GFWB 2DNHA 2BW2A 1NJYA 4WKRA 2EFPA 4KH0B 1RTHB 5CYJA 3DXBA 2ZD1A 3HP6A 1OSCA 4WKYA 3W8PA 4ZVHA 1HLWA 3BS9A 3RTVA 2R9LA 4NYOA 3OFEA 3W9HA 2K8GA 1U8SA 4KE5A 3OFHA 1FFWB 1KONA 1T05A 3M8YA 1VQ8S 3KDNA 2C3OA 3ILLA 5G0RA 1BQMB 3GZ7A 5HJXA 2ZOFA 2E5IA 3GU0A 1WSVA 2E44A 4FKYA 1S1XB 1GNKA 2QSWA 4URSA 1J5EF 4B9VA 4RW9A 3W2VA 1RAGB 2O66A 2VD3A 4ZLJA 4ZVGA 3PFEA 2FY8A 2VOPA 3GFHA 3I32A 2R7XA 1A6LA 3QIPA 1L3KA 2X1GA 3SV3A 1ZA2B 3QFHA 4O3OA 3PJXA 1HWLA 2YKMB 3MEDB 4QR1A 3H7HB 5KT2A 4DV7F 2AQ4A 5A8RB 4B3RF 2FJVA 4LFBJ 1RCOB 4F36A 8AT1B 3CCES 5CD4H 3LANA 3CCVS 2E5HA 4GVLA 1TKTB 1IBLJ 1SC4B 3DHXA 1X5OA 1UA1A 2YX7A 3UNGC 3C6TA 4CH0S 3ENWA 3K5OA 2UZAA 4DS4A 4ZPDA 3ZZOA 5CXTA 1HFEL 2YNHB 3R5CA 1M0SA 1RAFB 4UOCA 5D4LA 4Q0BB 1RU1A 5BYRA 3HPOA 2R7SA 4Q5VA 1WOOA 3HKZD 3MXHP 1QTMA 3TRGA 1M90T 1FRKA 5I3QA 5DDQC 1FRMA 3MPYA 4YB5A 3EPIA 1NMEB 1EKSA 3MEKA 2OO4A 5FLXY 1XEZA 5F8LA 2IAJA 2Z58B 3QYYA 3P49B 4DV6J 1BMQB 5GAEU 4RBVA 5A8WB 4WYLA 4ZLNA 2MGZB 2MKKA 1TL5A 3PACA 1K0VA 1W25A 4DSJA 4F2RA 4NXMJ 1HA1A 3OL7A 4UZBA 4P7VA 5SZTA 1RHUB 1L3TA 2NQPA 1WKLA 2DH8A 4OI4A 2M8DB 3DRSA 1XMQJ 2RF2A 4K2XA 4H54A 3RR8A 3U1NA 3TO8A 5J2PB 5FLXU 2W25A 1VQMS 2R2TA 4BBYA 4ED1A 2XTJP 2KFYA 3R97A 5M2UA 2EEYA 3EZOA 2V9WA 1R0BG 2HNDB 2RAQA 2ASDA 4CLFA 5ETQA 3MOZA 1HQUB 1M1GA 1F60B 1RXOB 2ZH5A 2AHOB 3M30B 1KQKA 4XPEA 2XHWA 2GO9A 4RU2A 3UN2A 1PJ5A 3WQPA 5THWA 2LKZA 2GGPA 2XSFA 3W2VB 4X62F 5C25B 3M8RA 3M8QA 2HLUA 3EE3A 1F9HA 5CZXA 4MMOA 4O44B 2ZE2A 4LFCJ 4XO0A 1EHWA 3I4HX 3UO0A 2UUWA 1U1OA 3Q8QB 1S99A 2BBEA 2IVFB 4RW7A 3MM8A 3T5LA 4TYBA 3T5JA 3WIUA 1NDPA 4A8MP 1IKVB 4ECZA 4WE1B 2MQLA 1NSAA 5F0WA 2I9SA 1FKPA 3DKDA 3MAQA 1IQZA 4D3HA 2K3KA 3OXGA 5F8MA 3Q83A 2VOOA 2R2SA 1VLYA 3CXCR 4QIGA 3EX7B 4CLZA 3BO4A 1RAAB 4QCLA 2BRLA 3LGHA 2UUTA 1KEKA 2DXEA 1CULA 1S6QA 3W9IA 1U6ZA 4PR6A 1YJNS 4FYVB 3C3LA 2PC6A 4F7VA 4QPXA 5U47A 3GILA 1IBKJ 1XNQF 1XR7A 2RQMA 2R7UA 2EC0A 4DR1F 2W9BA 2DK2A 2AJ1A 3BPSP 1D8ZA 1DTTA 1YQHA 1S1UB 2OPQA 3QT5A 2JL9A 5HP1B 5D3GB 2NCKL 3G8QA 3RRGA 1B4SA 2LQJA 2LQBA 2CVEA 1PG5B 5DDRC 1JWWA 3GFYA 1WC3A 2NREA 1MW7A 2LEPA 1NO8A 2AEMA 4DV3J 2XLJA 1S5ZA 3UE2A 2PA3A 3VQTA 2DHGA 4CO4A 5BR8F 5DO2A 3LTOA 3HMJG 3ULHA 4DZDA 2AWZA 3I0SB 3ZTQA 5C42B 4Y2AA 5LSRA 3AJ2A 2VHGA 3FJ2A 5EDWA 2D3ZA 1GX6A 1ZM3A 2HMIB 4I2QA 2VQFF 2I6WA 4GVBA 3IO1A 2DHSA 2MY8A 1HI1A 2OPSA 3KMSA 1NPKA 2GCFA 2WAQD 4M95A 1AW0A 1YBUA 2RIJA 4HACA 5ETVA 4IFVB 1OWXA 2QX0A 1T11A 3OTCA 3OV7A 1MWQA 2J6UA 1L5UA 4CP5A 4WWSA 1U45A 1PAEX 2Z8QA 2L3MA 4LVOP 2IM0A 2V8DA 1RWWB 3M6UA 3ZFVA 3GIRA 5F3ZA 2XMUA 4F02A 4DFPA 4EBEA 2F5GA 1N5SA 3MPUB 4M5JA 1XNRJ 4OLOA 4RNNA 3ENQA 3KLHB 5CYQA 4XK8C 2KYXA 3E01B 3D9BA 3PRDA 2IJNA 2KT5A 2EG2A 4H4OB 1JX4A 4J37A 4O3NA 2ZNYA 1TUVA 5D0HA 5ITHA 2IDLA 2GMLA 1RB0A 1UAWA 1R7IA 1U0HA 3BN7A 5CQGA 4LF8F 4C9DA 3GFXA 2MDAA 1QAXA 1IBLF 2VFRA 5LSOA 3MR3A 2IJRA 4MH8A 5KFTA 2MTLA 3FUYA 3T9ZA 1HQ2A 1S7HA 4QIVA 5FJ4A 1K73T 5DDOC 1BUXA 4WTOB 2DNOA 1LQ9A 1FRXA 5IXUA 3KK3A 1U48A 1TZ0A 1DFDA 4DV2J 1FXDA 1Y7PA 3U27A 2VQEF 1VBZA 4DHVA 5F8GA 2L08A 4P74A 1IR2A 4ZVOB 4X4PA 3V6DB 2N7YA 3EVMA 1UPPA 3N28A 4ANDA 4CM2A 2JOQA 2XQCA 4PQUA 1BQNA 2A2CA 1JJCB 2HQIA 3O6QA 1C4CA 3C14B 2D1CA 1UJ5A 4UY85 1RA6A 2VPWB 1FWKA 5LMNF 3OPKA 5M2PA 4N5SA 4DV6F 4Q44A 2W2OP 2QN6B 1Q4RA 1UKUA 5AXNA 2HHHJ 1IN0A 4R5PA 1CS4B 4U7CA 4NXMF 4I6AA 1WI6A 4IH6A 4OZ5A 4O4GB 3NGDA 2XCAA 2QFIA 1Q8BA 2JC0A 5HROA 4M5MA 1X4AA 2NLWA 4QR0A 3Q22A 1XMQF 2PD1A 3NGUA 2YVSA 1WUUA 2ZOMA 3OVAA 2Y8WA 1NLKL 1VQSA 2C2ZB 2KI2A 3CJ8A 2OFGX 3DLEB 2HGMA 3I5CA 5IOLA 3TWZA 1T8EA 3BKFA 1RTJB 5L39A 4WK1A 3CIMA 3CO0P 1MU2B 4M1KA 2V2KA 3DRPA 1PC5A 3VZHA 2K3IA 1MMNA 4OJ3A 3KLEB 1IKXB 3QATA 3NS6A 5KT5A 2WVDA 1I94F 2CUYA 4ZDNA 3N9UC 2G0CA 3P5BP 4K4XA 5J1NA 4GKJJ 5CAAA 1CPZA 3DRYA 3ZTPA 1DZ5A 3H42A 4IDKB 5DG8A 2XCPA 2G1DA 1JLGB 1BXNA 4MYUA 3F41A 4DOZA 4JI6J 5H9FK 3A3NB 2KN4A 2MXYA 5E3QA 4PWDA 3M6XA 2RQ4A 1S6PA 4USTA 2QG9B 3M2VB 5F0UA 3D6FB 2PEHA 4BC7A 4YS2A 2DR5A 4O3PA 4OL8A 4ZIVA 1NJIT 1J5OA 2M0GB 4B3MJ 3KLFA 3HHKA 1B7FA 1RGVA 3VGVA 1U1NA 4R0JA 5FDLA 4KR0B 1UVKA 3QWUA 4ZITA 2VU5A 4I56A 1QAYA 2A3JA 3MPDA 2V8PA 2DCLA 2I8EA 2YKAA 4W98A 2ZJQQ 1VOMA 1YZ6A 5F9NA 4DI6A 1U1PA 4FYXB 3CSKA 4CLSA 2EBGA 2R7QA 2PSZA 3MEEB 4RX6A 4QWEA 4OZ2A 2HPUA 1D8YA 2ILZA 1RT3A 5GVQA 5HMWA 3BH7B 3D66A 4DR2J 2IRYA 4CQ1A 1RHJB 4KJIA 2MQOA 3CDAA 3VAHA 3SQOP 2E5JA 2ZH7A 3FBFA 3PW7A 2EKNA 3CIZA 1RT7A 4DSKA 4DDFA 4IKAA 1DLOB 3HD1A 4F3MA 4KC5A 1SPBP 2W2MP 3BGFA 1MG7A 1FEHA 1EJ7L 4KB7A 5K14B 2H65B 1D3WA 3DOLA 3MPVA 3J81U 2JC1A 2VFTA 2VONA 4DQPA 2E7XA 4Z7CA 4QWDA 2LDYA 3NS7B 1CQMA 1MMLA 4LF1A 1I51B 1JLQA 3AOBA 1SQEA 1VFJA 2Q79A 1N33F 3C19A 1M5HA 4Q2MA 1U47A 1ACMB 4LRDA 3GV7B 2HK3A 1H6KX 3KWMA 1RI7A 2ZNZA 2CPXA 2DO0A 2I1RA 2OGUA 3BBFA 2HFOA 2VBWA 1M5PC 1XNRF 4Y00A 2ZBCA 3CD7A 4B3OA 3O8WA 3TNVA 1REGX 2ZHAA 1OJ4A 2F3JA 5B08A 3M9OB 3HD2A 2R8KA 3HHLA 6AT1B 4JI1J 1X4GA 4QWBA 1T03A 3BGLA 3W2WB 3NL0A 4JBCA 1KS2A 1VISA 1WDTA 2DRBA 1RTIB 3IA0A 4OIXA 4ZMMA 2QEXS 1NZAA 1RT4A 4CLWA 1RWOB 2G4BA 3OR2A 3SQGA 3R2DJ 1GXTA 1VRTB 2A0FB 2E9TA 1F5BA 4ZHRA 5AXMA 3R6GB 4ZCKA 4BHQA 4K4ZA 5KG4A 3V2UC 4EGLA 2K1RA 3VALA 3RUBL 1S72S 3LUYA 3BDEA 5HK4A 4QIWD 1PYOB 3H90A 3OSPA 2UUCJ 2A2DA 5SUHA 4NA1A 2MLZA 4ER8A 3T6BA 3HT3A 3QAUA 3CJ5A 2XYHB 1ULRA 1HWIA 4JI4J 1NDKA 3P6YC 2DNGA 1XMOJ 3LO3A 2B5JA 3I0RA 4ZN3A 1DQ9A 2SXLA 1U09A 2V0NA 5I3UB 2DGVA 4CLYA 1S6UA 1KLNA 3TUIC 3UVJA 3TZXA 2ZHOA 3K58A 2XLKA 2CPZA 3RBXA 3TJ9A 2QA4S 1H7XA 2UXBJ 3VV2B 4PG4A 1SQGA 3FFIB 3QPIA 2ZBRA 3LP2B 1P9QC 2GJFA 4L72B 3M2RB 3CJKB 3RAQA 3EMTA 3Q8YA 4FPIA 3PTWA 2OLWA 1HNIA 2OMLA 2J0XA 3EGNA 4RNHA 4W90B 3RZAA 2FGOA 1NSQA 1QVFR 2QA1A 3QAEA 3GE9A 2FUG9 2PI5A 9ATCB 4ILMA 2ZOGA 1FWLA 1G3OA 4RUCA 3N01A 3FCHA 4DFMA 1TK5A 5D8HB 5D0GA 4DL4A 1WJ9A 2DGQA 3R5BA 1R0CB 3TEHB 5LXYA 3G6XA 2EVZA 3J80U 1VJQA 3MECA 3TUZC 3B82A 4MJKA 3LQVA 2BJDA 1KTVA 1OS5A 1CLFA 1T9WA 4OX6A 4DPUA 2HZCA 1NBEB 3N4WA 1N36F 1FFGB 5DZ6A 4AQYJ 4YUDA 2DTJA 1B3TA 2KZZA 3MEGA 3H8YA 1BC6A 2EFGA 3OR1A 3LAKA 4HVZA 5HSPA 4LSLA 2DRAA 4HHUA 3MMCA 1T02A 3AD7C 2UVVA 3TA1A 1RT4B 4OHXA 1NU4A 2LQ5A 1UFWA 2BUNA 1FWPA 5B0FA 2Y1RI 2XYGB 2FZGB 4JI6F 2V67A 3BGUA 4C48A 2OHDA 1M5VC 4LVNP 5J1PA 2Y1LB 5CYMB 5F8IA 3ISND 5KFJA 2DY1A 3VR1A 1T9YA 3OLBA 2W2QP 3KLGB 2GA7A 1RHRB 2QTWA 3C15A 1V5IB 3DI6A 1WG5A 1XERA 4ES2A 1BD6A 1LK5A 2X51A 2DNNA 3PJWA 3OTOJ 3H2VE 4XAKA 5EWFA 4IFYB 1HNZF 4AFFA 3DRRA 4ZIWA 3JSBA 1HBUB 2M52A 1FDDA 3NAIA 2HFSA 4RKUC 2E1CA 4DZ6A 4FP9A 3M4XA 1TL3A 2Z0GA 4OJ1A 2CADA 3Q8UA 2Q6BA 1HBMB 3BGRA 1VRUB 3AD9C 2XWXA 2HHQA 2HVHA 3ZZTA 3U1LA 3DU6A 1UTAA 2FC8A 5DG7A 3SCLE 3OTEA 2HRUA 4KGKA 2IMOA 3LW5C 3PKMA 2W4DA 4V19X 3H20A 5G4DA 2HVDA 4IR1A 5KT7A 2DEJA 3MMBA 3T5HA 4C11B 3LP1B 2V4JA 1RZMA 3PHTA 2EK6A 4J5OA 2NPIA 3MHYA 3PYFA 4DR4F 2FC9A 4F4WA 3CCMS 2VPZB 1VBXA 1FJEB 2F8MA 4ERDA 2NSBA 2VKRA 4WIIA 1ZM2A 1VC5A 1NH7A 5DETA 2B3TB 3Q0AA 1YZ7A 1EX8A 3X3UA 3HJVA 2N7CA 3A1YG 5HLFB 1FESA 5KT3A 5FD1A 3BSAA 5RUBA 2ZWOA 3AY0A 1DY3A 2FZKB 3N6LA 3G8SA 4NL5A 2GHWA 1RBAA 2P9GA 4F4KA 1UVJA 4ZVFA 2QL5B 2RU9A 3MTJA 1C0TB 3CCZA 1E6YB 4LSNB 2RUGA 5C24B 3QJJA 5H9FJ 1S77D 4LQ9A 4LFAJ 4ZK7M 4A48A 2ABYA 3PNIA 1A9NB 2ZHBA 3QO9A 4H4KA 3JSMA 1DQAA 3PDNA 1YWXA 3GG0A 3TA0A 3ZZ0A 4K4WA 3KMQA 1IR1A 3CDUA 4FVCA 5DLFA 2C2EA 5F8NA 1MWYA 2DR8A 1F6TA 4X4RA 1F0XA 2FJXA 2VUGA 1X31C 4U7UK 2GZOA 2OMOA 4UUXA 3T1YF 4AXJA 4C98A 1NCLA 5KFCA 1IJEB 4ED7A 3OW2R 4B3SJ 1RTDA 3RBDA 3HFVA 3MDFA 2W9AA 4DFJA 1MMDA 2KT2A 4ZVRB 1TL1B 4OX7A 3D68A 1TKXA 2MKYA 4WBFA 4FXWA 3K7RA 1K1QA 4M5IA 2OPPB 1C0UA 3NGSA 1IWGA 2B4OA 5JVHQ 1U2RA 4ZVQB 4PZVA 2KRBA 2BQRA 1UWBA 3R5JB 2VC0A 3CDEA 3EZ5A 2XY5A 1U1QA 4JI4F 2HHSA 1TK8A 1OIAA 3O44A 2HBYB 2AV5A 2KJWA 2RRBA 5HN0A 4DV4F 1TL4A 2OAUA 1LWCA 2KB2A 4UQGA 2DNYA 4I4BA 2CJAA 2VBYA 3D0GE 5I4MA 3QNWB 3AD8C 4GKKF 3LAMA 2FJBB 2A1BA 1HWUA 3NOGA 3J81j 1DTQB 3CT9A 3V81A 5A0YA 4KHMA 2PIIA 4DUTA 3ENAA 2V9KA 3E51A 5KFLA 2W2PP 3MCSA 3RW6A 2XO7A 1FDBA 1S10A 4ZPAA 4EWTA 2MB0B 4RW8A 2N82B 4FZVA 2CA9A 3H4DA 3QJPA 1X5TA 3IRXB 2OIHA 5B0DA 3EXYA 4OYMA 1FHTA 2PFDA 2CXEA 2CWXA 1RT6A 1HWKA 3GCWP 3T3FA 2FLPA 2VICA 3VAMA 2DNLA 3G87A 2K06A 1X60A 3H5UA 3LWLA 2HFZA 2PGCA 4ZPCA 3MF5A 3MD1A 3K8WA 3VZIA 5C7PA 1U25A 5KFKA 4C3MA 1T3NA 3BSOA 3R7NB 2KHDA 2JLEA 2RQCA 3OUYA 4IOCQ 4YP3A 1NKEA 2IM3A 1K47A 3NG8A 3KUGA 3D4JA 3R3TA 4F50A 1BE4A 1D1UA 1SUQB 1HMVB
chains in the Genus database with same CATH topology
1UEVA 4C8MA 1S9GB 1X5OA 3JSMB 1UA1A 4ELVA 2YX7A 4IRKA 4HTIA 3UNGC 4FF1A 3C6TA 4CH0S 4NLWA 3PZPA 3ENWA 3K5OA 2FVRA 2UZAA 4DS4A 4ZPDA 4ZVEA 1HBNB 3ZZOA 2ZJPQ 1HFEL 5CXTA 1BGXT 2E5GA 2M88A 2YNGB 4DJBA 2B6AA 2YNHB 3BZQA 4ECVA 1TAQA 1H2UX 4M8LA 3H2LA 3OTDA 2AGOA 3R5CA 1S4FA 5DDPC 4KFBA 2R7VA 1M0SA 2DISA 3TAQA 3DRXA 1Q53A 2IVYA 1SH0A 2QT7A 3QGPA 1N34F 2GW8A 4MK8A 4NYPA 4UOCA 3DXSX 2PDAA 4QW8A 5D4LA 1H38A 4Q0BB 2ROGA 2MMYA 3NBPB 5BYRA 3HPOA 2R7SA 4Q5VA 1JLCB 5HLFA 4QBUA 3I4PA 3ITHA 1JB0C 2QIFA 4ECXA 2OTJS 3HKZD 2DITA 3WZ0A 4OLPA 4Y65A 3CD0A 1Q8LA 3U1MA 3MXHP 2HHVA 3V6KA 1IJFB 4CTAA 3I56S 1X0FA 2VBXA 5J2NA 4E8UA 5FIIA 1SKWA 3TRGA 1M90T 1QTMA 1HNWF 1KLMB 4YB6A 1FRKA 3U02A 3LGNA 5I3QA 2DT9A 3SYZA 2AYGA 5KFRA 5DDQC 1CC8A 3PO4A 5AE2A 4I0WA 1FRMA 4I2QB 3MR2A 1C0TA 3N0VA 3HHDA 1VJWA 3T9NA 3MPYA 3M32B 1FE4A 1E6YA 2F1FA 4YB5A 4LSNA 4K4VA 3EPIA 4GKJF 3J7YU 3K5LA 2OPSB 5C24A 2GFFA 4CO1A 2E5LF 2XB2D 3MEKA 1G2EA 2OO4A 5FLXY 3QMQA 2DGUA 4IG0B 1XEZA 4BS2A 5F8LA 2C2DA 2IAJA 1PC4A 5JUMA 4QW9A 3QYYA 1XR5A 3OSNA 4PXBA 4FS2A 3P49B 1S1VA 4RW6B 5DG9A 1M5OC 1JLEB 4FN5A 1WWHA 4Y6IA 4X4QA 1U49A 4NLTA 1HYSA 3OTOF 5GAEU 1YJRA 4RBVA 5A8WB 2C3MA 1C1CB 5KOXA 5E7OB 3HO1A 2KFZA 4WJBA 4LF5F 2PN6A 3PX4A 1HARA 4WYLA 4X65F 4PG5A 1S1WB 2Y0SD 1D0EA 2DGTA 2MGZB 2RKIA 2YWKA 1JIHA 1YGYA 4HH0A 4NWBA 3VQSA 1TL5A 2MKKA 4FS1A 5IT0A 3PACA 3KLIA 1K0VA 1W25A 3CCRS 4DSJA 2FHJA 4F2RA 3M2UB 5GAGI 3TARA 1P8GA 4B3TF 1HA1A 3PW0A 1IBMF 3L7PA 2Q6CA 3C6UA 4JI8F 4ELUA 2CQIA 5DLGA 3OL7A 4Y34A 4P7VA 3PW5A 4ID8A 5SZTA 3JTNA 1L3TA 4DX8H 3LF0A 4YEAA 2NQPA 2DH8A 4OI4A 2RRAA 4C4WA 4I7FA 1PO6A 2MKJA 2FHOB 3I55S 2VG6B 4ZP9A 2M8DB 1P1LA 3GFZA 3DRSA 1Y0HA 2JJ4D 4I2PB 4MIAA 2RF2A 2HS4A 3EYZA 1ZTTA 1DHMA 2XSJA 1NB7A 4K2XA 4H54A 4AL6A 2PO4A 3KFWX 3RR8A 3C2PA 1F2GA 3U1NA 2QYCA 4LQ3A 4B3MF 1FRJA 3J7ZT 3MUMP 5EN1A 3TO8A 5J2PB 3DLGB 3PY8A 5CYQB 2W25A 2BV3A 1RKJA 3HVTB 1VI7A 1VQMS 5GAHI 4QQBA 2R2TA 3TANA 2PI4A 2RDIA 1S49A 4NZ7A 4CO0A 5D4OA 4BBYA 2WK4A 4MKAA 2K7JA 3NLCA 3KHHA 1YJVA 2EG1A 1X8DA 4ED1A 2KFYA 4ED8A 3E3XA 5M2UA 2W7AA 2WSEC 2B9YA 2OSQA 1VMBA 4JV0A 2V9WA 2HNDB 1TL1A 2ASDA 3MOZA 1HQUB 2DNPA 2JRSA 4NZ0A 3F73A 4TLRA 1F60B 2HNZA 1OPZA 3Q24A 3LOUA 1JLBA 2OTLS 2ZH5A 1KVIA 3M30B 1KQKA 4XPEA 2OPPA 1JKHB 2XHWA 2B4VA 2GO9A 4RU2A 3CC4S 2FHMA 4DLEA 1WG1A 5THWA 2YKNB 4RZRA 4ES3A 1FNXH 1QSLA 2LKZA 2GGPA 2XSFA 2CQGA 3PEHA 2ZM6F 3FZBA 4DR2F 2KXNB 3W2VB 4X62F 2IYIA 2UUBF 5C25B 3KG1A 3M8RA 3M8QA 1JNZB 1UL3A 2HLUA 4IH7A 5D4PA 1SL1A 2ZH6A 4N8NA 3SSRA 1WEXA 3KG0A 4R8UB 5AXKA 2XBPA 4TLQA 5CZXA 1FDNA 3WC2A 1KTQA 4MMOA 2NZ4A 4O44B 3PEJA 2ZE2A 1RT1B 5KG2A 3KK3B 2CYYA 2JVOA 2CFXA 2F8EX 3KNGA 4XO0A 5D6GA 4NLSA 3GWCA 3I4HX 5L1LA 4DUYF 1UJ4A 4LF6F 3E8OA 3MMJA 1YJTA 4CO5A 2UUWA 1NJZA 1U1OA 5GMKa 2PT0A 4PKDB 2P9EA 3Q8QB 1S99A 1RTHA 2BBEA 4EUVA 2IVFB 1R31A 2J5AA 3F44A 4RW7A 3FSYA 4DL7A 3MM8A 4QR2A 3T5LA 2BR0A 4TYBA 1S79A 3T5JA 4O3QA 2VH7A 4JUZA 4A8MP 2GIRA 3GG1A 1IKVB 1DTQA 2IRXA 4ECZA 2AD9A 1YI2S 4WE1B 3MM6B 3CMAS 2CQ1A 2ALZA 2MQLA 3BO2A 1JXLA 1KR4A 4HEA9 3SI8A 3PM9A 1EP4B 2HHPA 4RU9A 4NXNF 1TAUA 2YH0A 5F0WA 2ERRA 2VODA 4NCBA 4HI1A 1BQNB 2I9SA 4PQUB 1FKPA 3MAQA 3CCWA 1IQZA 2XMKA 4D3HA 3MZIA 2K3KA 4ED6A 5B0GA 3OXGA 1SC6A 4NLRA 4OV1A 3MOJB 5F8MA 2KXFA 5KFUA 2ZBIA 2VOOA 2BA9A 2RRNA 5KTQA 1HD1A 2R2SA 3QZ7A 2GIQA 4MIBA 1BQMA 1CG2A 1VLYA 2XGQA 3CXCR 4QIGA 3EX7B 3V4IB 3J81Y 5L38A 2HHUA 2XY6A 1OSDA 5LMUF 2CQPA 5CA5A 3BO4A 3RB6A 1SL0A 2BZ2A 5IFMA 4QCLA 5KAKA 4PUOB 2BRLA 3HLUA 4U67Q 3IRXA 2UUTA 1KEKA 4KHPF 3DM2B 4YB7A 1S1XA 5DGAA 3S6EA 1S6QA 1B64A 1U6ZA 4PR6A 1SV5A 1EETB 2OPRB 3JYTB 1YJNS 4R5PB 5KFDA 3C3LA 4A8OA 2PC6A 5HMZA 3O2IA 2JEFA 1BQXA 2JFDA 3UCZP 4NLOA 4QPXA 5U47A 3GILA 1XNQF 4ED0A 3HZGA 1HL6A 4PCQA 3J7A1 2RILA 4ZPTR 1XR7A 1HBOB 2RQMA 4O23A 2V4RA 4W92B 3FEZA 2QZ8A 5E3PA 4DQIA 1F9FA 2JZ5A 3KK2B 2EC0A 2R7UA 3UR3C 4CH7A 4DR1F 2F9DA 5HROB 2DK2A 2AJ1A 2BXJA 2W9BA 2R8HA 4I67A 4NYZA 1VQLS 3CGIA 1TFYA 1A7GE 2MZJA 1D8ZA 1DTTA 1YQHA 2U2FA 1QUPA 1FKOA 1S1UB 2OPQA 1AFIA 4HL9A 3TW0A 2YKMA 2JL9A 3HM9A 3MEDA 5HP1B 5D3GB 3G8QA 4KV8B 5L1KA 1RA7A 3RRGA 2LQJA 2LQBA 5A8RA 2CVEA 4YR3A 5DDRC 1X4BA 4JV1A 2J7KA 3VF0B 3P5TL 3QLHB 1LW0A 1JWWA 3GFYA 3IGNA 5K8OA 5F8JA 1KRPA 3M05A 1FTRA 5MAOA 4B9NA 1TKTA 3JTOA 4ZP7A 3NAHA 2V8VA 5KFNA 1SUQA 3KKFA 1RISA 5H1SV 5LXRA 1HMVA 1MW7A 2FJDB 2ATLA 2NREA 5T41A 1GTEA 3DYAB 1U6FA 3FEXB 1LFWA 1S9GA 2LEPA 3ZZUA 2UV8A 3CC2S 1NO8A 1ZOTA 3G6YA 4JOUA 4IRCA 4N47A 1HBNA 1JMTA 4C8ZA 1KOOA 2MSSA 2YNGA 2YNHA 1VQNS 2E1MC 2B7CB 4DSFA 2FGCA 2XLJA 3UE2A 2PA3A 3DRPB 1R0AB 3DDKA 3HF5A 1N8RT 1R8AA 1SJ1A 5AE3A 2FIUA 4I64A 1N5YB 1U2FA 2DH9A 3ONQA 4P6QA 3VQTA 2DHGA 3TUJC 4Q0BA 4HDHA 2APOA 4CO4A 5BR8F 3NBPA 5DO2A 3HMJG 3S7RA 4Q45A 3ULHA 4TQRA 4K59A 1JLCA 4OI3A 3GV5B 2Y1IA 1QJHA 5T14A 2FVSA 5EX3A 1TR0A 2AWZA 4EU0A 4YHHF 1DRZA 3O3LA 2FDNA 3IG1A 4J9QA 1HR0F 3I0SB 3PVXA 5C42B 4ZOSA 4Y2AA 5LSRA 3AJ2A 1FK9B 3G9CA 3VAJA 4Y0FA 1X4EA 1VS3A 1KLMA 3FJ2A 3WX4A 5EDWA 2D3ZA 2RT3A 1GX6A 1ZM3A 3UWTA 2LECA 4I2QA 2HMIB 5ADZA 2VQFF 2J0QD 2RB7A 3IO1A 2DHSA 4KGMA 3M32A 3UI3A 2MY8A 2ROPA 1HI1A 4KPYA 2OPSA 3RYLA 3FQKA 4DL0C 3KMSA 2VPXB 2GCFA 2WAQD 4M95A 2X3GA 1AW0A 2RIJA 4PWUA 2UUCF 4IG0A 4IFVB 1OWXA 4XPCA 2WB1D 3CJ0A 3FZ2A 2MKCA 4EO8A 2KKHA 1U7LA 4RW6A 1GTHA 1JLEA 3OTCA 1Z1ZA 1UVIA 3JSYA 3OV7A 2B0GA 2HG4A 2EBEA 1C1CA 5A8WA 1IQTA 2A18A 2J6UA 3N79A 2CJKA 4MFBB 1L5UA 2M4MA 1CQNA 1GT8A 2J9DA 4DBQA 2M70A 1RT2B 1S1WA 3V5RA 3SCIE 4ECUA 2MGZA 3TR5A 2HIQA 1TVRB 3K2YA 5KG7A 1NK0A 2ILYA 1U45A 1XMOF 1KVJA 4PWDB 5GAGU 4KAIA 2CQ3A 2Z8QA 3IBWA 3M2UA 1S6PB 2L3MA 4LVOP 2V8DA 2IM0A 2QE5A 4YB1P 3K5NA 1GQEA 1NK6A 5GADI 3M6UA 3IGVA 4ETZA 1P27B 3ZFVA 5E0OA 4DMZA 5F3ZA 2XMUA 2BVZA 4OHVA 3THVA 2AJ0A 2XMVA 2QMXA 2XG8A 4F02A 4OHZA 4M5DA 4DFPA 1QSSA 1GX5A 1P1TA 2JLFA 3SDEB 2VG6A 4EBEA 1RYRA 1J5OB 4C8YA 2UXBF 1SKSA 4I2PA 1N5SA 3KLFB 3CE8A 4O4RA 1UVMA 2HVZA 1KOHA 3EZUA 4OLOA 2KM8B 1BWEA 4HYKA 3TVKA 2IMWP 4N41A 5FDLB 3U7JA 4RNNA 2J8AA 1J2VA 2U1AA 3GB0A 4O3RA 3ENQA 3CMES 2EWHA 3KLHB 4X4VA 3IXQA 1S9EB 5J2PA 3DLGA 4WXWA 5CYQA 5GAHU 3HVTA 5L1IA 1H3DA 1TV6B 4XK8C 1RT5B 1XBWA 2EFOA 1UP1A 2HHWA 2WBRA 1X4DA 5AE1A 2KYXA 3E01B 2B4UA 1Y9OA 1KN6A 3RRHA 3PRDA 2IJNA 2KT5A 4NCGB 4QIEA 3FRYA 4TU8A 1GH8A 2EG2A 3HKWA 4H4OB 1T3OA 1JX4A 4Q7AA 5HI7A 4NMLA 2FTRA 2GC8A 4J37A 4O3NA 2ZNYA 1TUVA 2HNDA 1AXQA 5ITHA 1HQUA 2GMLA 2C3UA 2FLLA 1UAWA 3D0IE 1R7IA 3FDSA 1RP5A 2B9XA 3BN7A 4LIRA 4ECSA 5CQGA 3ZZPA 5KFMA 4LF8F 2QFJA 3M30A 5KFBA 1RT3B 3NCPA 1JKHA 1Q16B 4IG3B 1TQLA 3DNCA 1DQ8A 1QE1B 4C9DA 1MNEA 3GFXA 2MDAA 3GIIA 1QAXA 3R5AA 2AGPA 4Y2CA 1IBLF 2VFRA 5LSOA 3DDNA 2YKNA 3MR3A 3PX6A 2MZTA 4MH8A 1FTCA 5KFTA 5KFVA 4DWIA 3T9ZA 2O1PA 4USHA 4WK3A 3CC7S 2R7OA 1S7HA 1V6HA 2LXFA 4K4UA 3IWNC 5C25A 4QIVA 4EYHB 3V6HA 5FJ4A 3MUVP 1K73T 5DDOC 2XMTA 3K0JA 3QZ8A 4C8KA 2CPHA 4R8UA 4DFKA 3AQPA 3N6MA 4P2SA 2DO4A 1RT7B 1WHWA 3KHRA 1R8CA 2DNOA 3I9V9 1JJHA 4TU7A 3GIJA 1LQ9A 1FRXA 4OZNA 4USIA 4O44A 1BY9A 1RT1A 4Y2MA 4ZPWR 5IXUA 5IQQA 5KFZA 3KK3A 4CT9A 4DV5F 4PRFA 3M6VA 4KKOB 1YRTA 5H9EJ 4FYDA 1U48A 1FNOA 5KG0A 2C2RA 3FGVA 2CQHA 1TZ0A 1U24A 2MKSA 1NK4A 4JI7F 1TFWA 1DFDA 4KHRA 3LWMA 1FXDA 1Y7PA 3J80Y 5LL6d 4EBDA 3GR0A 3KJVB 4K4SA 3U27A 1ZM4A 2VQEF 1VBZA 2XS5A 3DOLB 4DHVA 4ELTA 4OI1A 4B17A 5F8GA 2L08A 1IKYA 1Q7LB 5LSLA 1IKVA 1L3VA 4X4PA 4WE1A 2N7YA 1WEZA 3MM6A 2DD8S 5LT5A 3W7BA 4AQYF 3V6DB 2DIUA 3H40A 2CJ9A 2LQ9A 4A46A 5CCMA 5J2QB 1EP4A 4DQRA 3N28A 2E66A 2JOQA 1BQNA 2A2CA 4PQUA 1HI0P 1H0HB 2HQIA 3O6QA 2XS7A 1C4CA 4ZP6A 4FXVA 2D1CA 1UJ5A 1WHYA 4JI0F 6FDRA 4UY85 1RA6A 2VPWB 4RW4B 3WBZA 3IC1A 1SIZA 1JLQB 5LMNF 4EBCA 3OPKA 4X4TA 2XEXA 3GV8B 2ASLA 2ROEA 3A8EA 4GMKA 3K5MA 2RS2A 3GSDA 7FD1A 3JB9k 2YNFB 3BQ1A 3V4IA 5M2PA 4N5SA 4DV6F 4Y28C 2DJWA 4Q44A 4J9RA 2I5JB 3DMJB 5I3PA 3KOAA 2W4PA 2LDIA 2HHTA 2UU9F 3CVKA 1Q4RA 4PUOA 5A8KB 1KHWA 1UKUA 1NJWA 4B02A 1QM9A 5AXNA 4A8XA 2XI3A 3DM2A 2QMWA 5MLCV 2ZUGA 4YQWA 4FF4A 1IN0A 3H4BA 1UVNA 4U6PA 2B51A 1EETA 2OPRA