1VMBA

Crystal structure of 30s ribosomal protein s6 (tm0603) from thermotoga maritima at 1.70 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
107
structure length
107
Chain Sequence
KERIYESMFIIAPNVPEEERENLVERVKKIIEERVKGKIDKVERMGMRKFAYEIKKFNEGDYTVIYFRCDGQNLQELENFYRVTPEIIRWQTFRRFDLEKKERKAQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S6
publication title Crystal structure of 30S ribosomal protein S6 (TM0603) from Thermotoga maritima at 1.70 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Translation
total genus 29
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2004-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vmbA00
2KJVA 5AJ3F 2J5AA 4NXNF 1XMQF 4B3RF 4YY3F 1VMBA 4X64F 4DR5F 2ZM6F 4DR1F 1XNQF 1QJHA 4DV5F 4K0KF 4X66F 4GKJF 3ZZPA 1IJFB 2YY3A 1RISA 2F4VF 2UUCF 2VQEF 4LF9F 4DV2F 4DR6F 1IJEB 5LMNF 4DV7F 4B3SF 2UU9F 4X62F 4DV3F 1GH8A 4JI2F 4DUZF 1XNRF 1G7CB 4DV1F 4LF7F 2RJZA 4DR4F 1G1XA 4LF4F 4KHPF 4JV5F 2B7BB 1N33F 4JI4F 4DV4F 1HNWF 5LMUF 1FKAF 1IBKF 2UUBF 4LF8F 2KJWA 1I94F 2BXJA 4LFCF 2UUAF 4OX9F 1N34F 2BVZA 2HHHF 2VQFF 5IWAF 1HNZF 4LF6F 3OTOF 4LFBF 1B64A 1IBLF 1IBMF 4DR2F 4JI1F 1FJGF 1XMOF 1HNXF 1N32F 4DV0F 4JI0F 4AQYF 4JYAF 1N36F 4LF5F 4YHHF 1HR0F 5BR8F 1F60B 4B3TF 3R3TA 2B7CB 4JI8F 4JI6F 1CQNA 2UXCF 4GKKF 2UXDF 4LFAF 4DUYF 4JI7F 4DR3F 4X65F 1J5EF 4B3MF 2E5LF 1CQMA 4JI3F 1LOUA 4DR7F 4DV6F 3T1HF 4JI5F 3T1YF 2UXBF 4NXMF
chains in the Genus database with same CATH superfamily
3GYXB 2F9JA 5J1NA 3MPYA 1RT2A 2FVCA 3MMCA 3PXGa 3JSBA 2Z2ZA 2WCXA 4J9VA 2PA8D 1T9YA 1PJ5A 1U0HA 2VF3A 1FKOA 5ETSA 2OPQA 2AGQA 1I5OB 4A8SA 2KTQA 4OL8A 3NOCA 4LF4J 5L8RC 5KG3A 2H3EB 2Q66A 2HHXA 3VGTA 3US5A 3HFVA 1B3TA 2R4FA 1DTQB 1EETB 4P2SA 2DGUA 2KRRA 3BYPA 3R1HA 4DXLA 1SXLA 2R7OA 3VWSA 4ECYA 4ZPTR 1VK8A 2JFKA 3GIRA 3KK2A 3Q24A 1W26A 2CJBA 4FZVA 1HNIA 4M63A 1NH7A 2VODA 3QRPA 4WK3A 1FX2A 3O6QA 3EVMA 3SSSA 4LRBA 1KS2A 4QIEA 2BBEA 4YR3A 1TFYA 1TZ0A 2L08A 1EJ7L 1TQLA 2HLUA 3HFZB 1R43A 1K1QA 4H4KA 5CCLA 3X1LB 1N0UA 1E6VA 2AYGA 5KFQA 2OPRB 3T19A 3FK4A 4F2RA 4X4NA 4F0HA 4O4GB 5J2PB 4LRFA 3CSKA 3OXLA 1NM2A 5J2MA 4C4WA 4KAIA 1O8BA 4KT0C 2RB7A 2ZH7A 1RWKB 3ET6B 1RQ0A 3ZFVA 5K8NA 2HFOA 1AT1B 1M5OC 4PXCA 5KFTA 4IDKA 5HL7Q 3N9UC 2RQMA 3GONA 3FSYA 4M5IA 1S1UA 1KQFB 2ADBA 1SI9A 4WBFA 3MEKA 4YDXA 1MMLA 1FDAA 2HMIB 2HNZB 4IG0A 5ETVA 1ZAVA 2KYZA 4DX7A 1S12A 4ZVPB 3HPOA 2AEMA 3AT1B 2MKCA 2JEGA 3E3XA 4UQTA 1D8ZA 1H3DA 2QYGA 2JJ4D 1QTMA 5JJBA 1UZDA 5KOWA 2W1BA 4EBCA 3KJVA 2J8AA 2RUSA 4IKAA 5LL6d 3I4HX 2GZOA 1N48A 1S9GA 3KLIB 2ASLA 9ATCB 1VQMS 4KTQA 4MH8A 2HFZA 2FD2A 1FD2A 4QWDA 3UNGC 1LWCA 3W8GA 3DLEB 1RSCA 1FJ7A 3NGKA 2ZH6A 3PVXA 4LFBF 4EZ9A 3I9V9 1S7HA 2N3LA 2VPWB 1RTIA 4DV0F 3KLIA 4G1QB 4PXEA 3I5BA 3TVYA 1C0UB 3A8JA 3P45B 9RUBA 1L3TA 2AJ4A 5HBMA 3DXBA 3M8PA 2AJ1A 1FTCA 4O44B 3QLHB 2C2KB 3HDSA 3HVWA 4MK7A 1U1MA 2CWXA 1X7VA 1MMNA 3RR7A 4IR1A 2DNGA 4N41A 1YKWA 1G4CA 2EC0A 3I0RB 2MSSA 1F3VA 3IGVA 1HKAA 4CZCA 4DV2F 4DPXA 1J2VA 2V8DA 1FK9A 3OL6A 2CJKA 4DR4J 2CVEA 2HW3A 3DFEA 5SUHA 2VB6A 4NLOA 1KFDA 2V2KA 3W66A 1PC4A 4Q0BB 2UZAA 1RLDA 2Y9HA 1U26A 4LF6F 4IYQA 4QIGA 1IWGA 3ZNUA 1IBMF 4F0MA 4O0NA 2R2RA 1YLXA 2YKNB 2DR6A 1SIWB 3ILOA 2PA3A 5HAOA 1FWLA 1LFWA 2V6AA 4DX5A 2ILZA 3JTPA 1QD1A 1R31A 3BO4A 2UXCJ 3KJNB 4Q0BA 1A0OB 1EP4A 5GADI 2Y3YA 2W25A 2VFTA 4F4XA 3KLFA 1WC3A 2DRDA 2PMZD 1SV5B 3KLHA 1VCTA 1RBOB 3PEJA 2W9BB 2LLZA 5H9FK 5T7LB 3MWBA 1QE1B 2CJAA 2FJXA 2W2OP 2LEPA 4NL5A 1U6FA 2M7SA 1REVA 3TZXA 1JJ4A 5DM6Q 3BO3A 5C25A 1FXRA 3ZTRA 1FWPA 3N28A 3OFGA 3U1NA 2M70A 1XJWB 1LXNA 3MCSA 1SV5A 3C6UA 5HROB 3H0PA 2Z2YB 1RWWB 5IWAF 3BGFA 3PM9A 3I31A 4A8OA 5DG8A 5M2UA 2C2OB 1LW0B 2V4RA 4AQYJ 3DRYA 1JLGB 2OMLA 3HKZD 5AE3A 3ZXWA 1BGXT 1HI8A 1LW2B 4Y28C 4RNNA 4P2XA 2V0NA 4KGZB 3NKYA 4B9SA 1P27B 3NCQA 3MDFA 2ZBIA 4RW4A 2X1BA 2OLWA 3J7A1 3ELHA 2LKZA 3Q23A 2IJRA 3BM7A 4J9LA 3GP9A 3OFFA 3DOMB 4X64J 5D4NA 2GX8A 3AFGA 4JI6J 2ROPA 3DRSA 4O3SA 3MPUB 3TEGA 2B3TB 4J9OA 3QO9A 5C24A 4MTPA 4ZP6A 4A8XA 2ZJQQ 4NLQA 3EMTA 3LP2B 4RR5A 1VBKA 3OSPA 1MN7A 1UZHA 4DUZF 4CYUA 3CO0P 4ZIWA 2VONA 2B9EA 4KYZA 2BJDA 1D9FA 4CO3A 1XERA 1XR5A 4EGLA 4FS1A 4OJ1A 2JVRA 2LCWA 5HLFB 4J91A 5IS2A 4KB7A 1TKZB 3JB9k 3D6MB 4JI0J 2VBWA 1ZAXA 4GO5X 2EFVA 2GMLA 3HFKA 5HVHA 5B09A 2NYHA 3T9ZA 1RHQB 2E44A 4DR2J 4PG7A 5D77A 4ZP7A 4FF1A 2CPFA 3H90A 5AJ3F 2LXFA 3SDEA 1NHVA 1K0VA 1DBDA 4CTAB 2HEKA 3DGVA 3NGUA 1NJZA 2CQGA 3FRZA 3TR5A 1RZMA 5HO4A 3GZ7A 4I68A 1DRZA 2VG7B 2W8LA 5DGBA 3OL8A 1M5PC 4IFVA 2Y0BB 1HWKA 3MMBA 2P9EA 3VGSA 3QYYA 1S97A 5CYMB 3LUYA 2V4JB 3UCZP 5DLGA 2D69A 5E3CA 3L7OA 2ZJPQ 2EVZA 4LIRA 3NCPA 4LUBA 2QA1A 1AYEA 2HVZA 3RU0A 3QSYB 4FYXB 4WYWA 4I7FA 5I3QA 3PIOQ 4IG3A 4J9RA 4QU7A 4IFYA 2UV8A 3CWJA 3UNYA 1TR0A 3R6LB 1DHMA 3LWMA 2HKEA 2B43A 3OXGA 2HHTA 2E29A 1LOUA 3KLGB 3E2EA 1NK8A 5CYJA 1ZOTA 2W9CB 1NU4A 4OYPA 3HZEA 3HSGA 4I4BA 1VQKS 3KK1A 1VQ6S 1U2CA 4P7TA 1ELOA 3DN9A 3ILIA 4NMXA 3NEKA 1RJJA 2F5GA 1RHJB 5E33A 1HWJA 1U1NA 3E51A 2DHAA 1R6YA 4V19J 5JXSA 3M30A 2MKHA 2LQ5A 3HMJG 5J2NA 3G87A 1G1XA 5EX0A 3H5YA 3CCTA 4C11A 4BS2A 1PAEX 1TV6A 4P2MA 1R0CB 2BACA 4PKDB 3EVOA 4DOZA 1JNZB 3Q8UA 3TA2A 1TUVA 2G13A 2LEAA 3BSOA 4F3MA 2XULA 4QR2A 1S49A 3QT8A 5ETRA 1WNEA 3R5DA 4UTGA 4DZ6A 2EFPA 2XS2A 1SC6A 5EWEA 1P6TA 3DRXA 4F0KA 3W63A 2HVIA 3T1YF 2GO9A 4D3HA 4PAAA 4ED3A 2JDJA 5F0WA 1Q86T 3O2IA 4ETZA 4CM0A 3PRDA 4HACB 2M88A 4DV5F 3BGRA 3PRBA 3OTBA 1YSJA 1PBUA 4R0JA 4L3NA 1YJVA 2MKSA 2CPZA 2QA4G 3DLLQ 2F65A 2XMJA 3V6DB 2VG5A 1U1KA 2HQ3A 3ZZ0A 1XQIA 5GAGU 2QMXA 2PIIA 2MKJA 5B0CA 2K8GA 1P1TA 4DLEA 4F67A 1CULA 1FERA 4LVOP 4MKBA 3M32A 2CNKB 2IVMA 3MEEA 2R7VA 5DLFA 5KG7A 3J7YI 1VC0A 4EBDA 3BDPA 3ZZZA 5IT9Y 1W2IA 3TW0A 2PEHA 4JI1J 4NMLA 1XMOF 2DISA 2AEFA 3W2WB 3GV8B 1FJCA 1ITPA 4NLUA 5KFWA 1VRUB 1Q5YA 4PRFA 2CA9A 2AYEA 2AD9A 1P1LA 1HQEA 4B3MJ 3NBPB 1UFWA 4ER8A 3OL9A 2G0IA 2CIMA 1RKIA 1RAGB 4LQ9A 2CQ1A 3TI0A 2GVDB 5LT5A 1S6UA 1WTFA 2IMWP 2GGPA 1D1UA 2MQLA 3BV8A 1RISA 2C22A 4RUCA 4K4TA 1O0PA 4B3OB 4W98A 3SMZA 4MIAA 4QQBA 4N8NA 4DHVA 4ZLNA 3I9ZA 1M5HA 2NZCA 2UUWA 4DL5A 3MECA 2MGZA 5B0AA 4QW9A 2YQ0A 4DPYA 5KG0A 3ISND 4OJGA 4HDHA 1B64A 3MUTP 3BGLA 3K0JA 4ECQA 1YBAA 4RUAA 4Q43A 1S1VA 3SQOP 4NEYA 2L9WA 1WELA 4KHMA 4CO4A 3G9CA 5KFUA 4DCJB 7FDRA 3J81U 3TUPA 3N5FA 3TO8A 2GA7A 2QG9B 4DL2A 1RDRA 4HEA9 4ZDNA 3DDIA 2AU0A 4DV6J 3MGJA 1H2UX 1RT5A 3BREA 3KG1A 1HYSA 3W8PA 4ZN1A 3OJUA 3V4IB 4DR5F 1U25A 1TK8A 5CD4H 2OEMA 4Y3CA 4DSFA 3W1YC 4XDDA 5B0EA 2EG2A 2RH3A 2BE2A 3GIMA 4UY85 4NPOA 3AD9C 3NAHA 3VAMA 4P71A 2UP1A 2HURA 4K59A 1SKRA 4EU0A 2Z57B 4Z7CA 2QV6A 1OO0B 4HI2A 4TQRA 1RT6B 5IFMA 5D3GA 2WB4A 4KFBB 1WG4A 3EGVA 4O3QA 4TKTA 2R2UA 4DF8A 3UW1A 4C3MA 5LXRA 5GAEI 3KHRA 2M52A 2OTLS 1IKYA 4I56A 2WOMB 3G96A 2NSCA 3S8SA 3TZWA 4RLEA 1TVRB 3HF5A 2H5EA 3M8QB 3MXHP 1LWEA 3H5UA 2BE7D 5F8NA 1HWUA 4WTYA 4R8UA 4KO0B 2HQGA 3UDEA 3CD0A 1KP6A 1T9XA 1UFLA 2YVSA 3PFEA 2W4PA 4ZPVR 3UR0A 2HGNA 1WG5A 3IMQJ 3CB4A 4U9RA 4WF9Q 4GKKJ 4E2FB 2LU2A 3PW4A 2HHUA 1D8YA 3K5PA 1UWBA 1CPZA 4PWUA 2R3VA 4ZVSB 1UVIA 1T95A 5KT2A 4HI1A 4ZMMA 4PQAA 2OO4A 3MPVA 5AE1A 1VISA 3BGUA 5BYSA 2GS8A 1HBNA 2QL7B 5DDRC 4LSNA 4LF8F 2KT3A 4RU9A 4QBUA 3CDEA 5L9XA 2CQPA 3TA0A 2I5JA 2XWYA 1NK6A 2MQPA 3F0NA 4M95A 1Q8LA 2U1AA 1WEZA 1WD6A 2GO8A 1S1TB 3TA1A 1A6LA 1S5ZA 2MLXA 1MLAA 3AA8A 2QX0A 1PAUB 2V9WA 5B0BA 3HJVA 3HXMA 1RTHA 4QWCA 4N56A 2AGOA 4MK8A 4D3GA 4DUTA 3R5AA 3N6MA 2DGXA 3QNWB 4MMOA 1X4HA 3I5CA 3QQCD 3K89A 1ZPWX 3PR5B 2R2SA 5J2QA 2QSWA 3LAMA 1YQHA 1M1KT 3DLKA 4U8VA 2YY3A 3IRXB 1GFWB 3CIMA 2GW8A 3QZ8A 5LSRA 4USWA 4KQZA 1R3NA 2MKYA 5FDLA 1SB6A 2SXLA 3CCRS 3ENVA 1XN9A 2J7UA 2XTJP 3IRWP 4PWDB 2AEJA 4GVBB 1BQNB 1DARA 2J0XA 2ZHAA 2JNJA 2QYCA 4LFBJ 3FZ2A 4WIIA 4O4RA 4K4ZA 1FJGF 3JSYA 3OPKA 1KKHA 2IA0A 3OQ2A 4DV0J 5HQ8A 5HQLA 4IQMA 2DITA 4OZ2A 2G4BA 2UVRA 4P52A 1DTTA 3IGNA 3VGUA 4JI7F 4M5DB 1HI0P 3THPA 2XCAA 2HPUA 4LREA 1N5QA 4I69A 4J7CA 4U96A 4DLGA 1Q53A 2ZM6F 5KT7A 2FJDB 3DOLB 2MPUA 1U7LA 2MZSA 4WU2A 1B0TA 4P74A 2VBXA 1UA1A 3W7BA 3MR7A 4N47A 2QIFA 4DV2J 4QW8A 2L9NA 5K14A 4UZBA 3DLBA 5DG9A 1Q4RA 3ZNJ1 1S0OA 1MW7A 2WVCA 2ZHBA 2LQ9A 4K50A 4HL9A 4WPAA 3OV7A 4DG1A 1O6XA 4J9QA 3DOLA 3IM9A 2IRYA 3DM2A 1TUWA 4DEZA 1WOOA 1UW9A 1WKKA 3CPWR 3EXYA 3TVZA 2MQNA 4LF6J 3J80Y 1IBMJ 4NA3A 2DNNA 1DURA 1Z2LA 4HHUA 4Z7YA 4UUXA 2GVZB 2W2NP 1X9SA 2DGTA 5CYQA 2PI4A 2LYVA 3AODA 3VAFA 3TQEA 5IT0A 3D66A 3A8EA 2B8PA 4UOFA 5C5JA 4NOHA 2FIUA 1JMTA 2BM0A 2UV8G 1LWFB 2R7WA 2DHXA 1TL1B 3UO0A 1IBCB 3UN3A 1NK7A 1RT4A 1BD6A 3I5AA 2CUYA 2RKIB 4F02A 5ITHA 4Y6IA 4X4OA 3PIPQ 4TYAA 3POTB 3OLAA 2G2YA 3W65A 1GH8A 4DSJA 2RVJA 4ECWA 1LK7A 2AX0A 3DC2A 4F4YA 3BSAA 3OTDA 3W64A 2DNQA 3DRRB 1UEUA 2BKOA 5LMUF 2MY7A 4ECXA 3TX0A 4USKA 3MZIA 2BQUA 3DRPA 4NWBA 2KHDA 5IWAJ 3M8YA 2UUTA 4OI3A 1IKVB 3F56A 1KR4A 4AL7A 4WWSA 1NCLA 3LP0A 4QOTA 1RUSA 1OPIA 1R8CA 2MXYA 1FDDA 3N5BA 4B3TF 1AW0A 3VVTA 1Y5NB 3DHXA 3R9LA 3VR1A 1GTEA 4ZN3A 1UW4A 3UFCX 1SQEA 1RT3A 5IM0B 4DSLA 3DOKA 3T5KA 5CD4A 5C42A 3IFEA 3VQTA 2J8SA 1K9MT 5E5NA 4DUZJ 1G7CB 2CJXB 1PO6A 1T9VA 2KI2A 4Q2MA 1NO8A 4OLPA 3ILJA 1VHFA 5L38A 1Q16B 1YRTA 2BANB 4GC6A 1N33F 3THTA 1RYSA 1BUXA 4DQQA 1KLMA 1SJ4P 1FNXH 2F8MA 1KTQA 4QWEA 2J9EA 3FSXA 2N7YA 4C8ZA 3ZZTA 1EARA 4MIWA 3FRYA 1SBRA 2VHGA 2ZH4A 1NJWA 3H40A 4DMZA 3TAMB 3C6TB 4LFAF 3TANA 2XY5A 2YNFA 5A8RA 2IBKA 4WP3A 3WBZA 2KJVA 2GIQA 5AJ3J 1Z2ZA 5KFGA 4B9LA 2H4WB 1XNQF 4ANDA 5KFJA 2Z2LA 3W62A 4URGA 3PHEA 2FZCB 1H72C 3HM9A 2GC8A 4CH7A 4UY8T 1BWEA 2D3ZA 4CLWA 3DLGB 4TYBA 1L5UA 4DN0A 1T9UA 2VL1A 4GVLA 3V81A 4O3NA 1URRA 4KY3A 1BY9A 3FMWA 2FDNA 4ZCKA 2CPHA 4WFNQ 2QO3A 4ECUA 3ITHB 1R8AA 2HQDA 2EFOA 2D3OR 3QGIA 1AB8A 2Y1LB 4C6AA 1LNQA 4CO2A 1S0NA 4IQXA 4X2BA 2CQHA 3ENWA 3AOCA 2WVEA 2OEKA 3OR2A 2XC9A 5KFRA 3OR1B 2UVWA 1Q5VA 3FBCA 2H1YA 2HHQA 5LSLA 1B70B 1UL3A 1R0AB 3S01A 3PRVA 1S59A 3MOZA 1LEOA 4N8OA 2P8IA 3SCJE 2N82B 4TNOA 2ZVSA 3LQVA 2IA6A 2FHMA 3ZZPA 2WSFC 3P5TL 3A3PB 5KFXA 2AMCB 3M2VB 1N5TA 1I1GA 3IN5A 1NPPA 2RU9A 2HQIA 4EYIB 3ZTSA 1TUGB 2CKWA 4F2SA 3D6TB 2A2DA 4LVNP 3UPFA 1NEEA 3A1YG 1CVJA 3Q8VA 5IOLA 3ZO7A 3DHWC 1N6QB 2JWNA 3QIPA 3BBBA 2HBYB 2BVZA 2YNHB 1QAYA 2WZ1A 3QJLA 3HLUA 4RX6A 1VIOA 3GWCA 4YHHF 3CD5A 1WUUA 2KG0A 2ZOFA 4P2FA 3GILA 1VQNS 3EYZA 2XNRA 2QJ3A 2XZTB 4L75A 4HH1A 3SQGA 2EK1A 3LP1B 2DK2A 3NMRA 2DNHA 4PPZA 4LJMA 3FFIB 2ZJRQ 3T1YJ 1AZSB 3T3FA 2ACMA 1JXVA 2MZTA 2AT1B 2PFFB 2GMHA 1Z4UA 1RP5A 4DV5J 3MCOA 4YB6A 1EX8A 1M5SA 4X66F 2AJ0A 1IXKA 1PGZA 1FRLA 3PW0A 3SIPB 5LJ5Y 2DGVA 1IUJA 1YI2S 3RBXA 5D78A 3OXFA 1NZ8A 3C46A 2LQJA 5KFZA 1X5SA 2BXJA 5M2RA 4OYMA 2P9GA 1FA0A 4IR9A 3GPAA 4C8MA 2B4PA 2GMJA 1RTJB 1OQ6A 2XI2A 4NLXA 1XMOJ 3BJYA 1N36F 2BE9B 2K7KA 4NCBA 4OV6A 1VGYA 1KTVA 2QEXS 2LA6A 1C4CA 1NK4A 4WFBQ 2YNIA 2FY1A 3RR8A 4P6QA 5DRKA 2XS5A 3CC2S 3IS9A 1I6JA 1KHVA 4OQJA 1U2FA 2YKAA 4OIXA 3VQSA 1LQ9A 4WCEQ 3ENAA 3HT0A 5K20B 1HHTP 2KRBA 2JEFA 5BYQA 4QCLA 1JKHB 3N0VA 4OYZA 2VBYA 2O5DA 2NLWA 2AZ3A 3NP5A 3O1LA 1YRUA 2UVVA 1HNWF 3BQ0A 2RDIA 1EQMA 1YBTA 3R97A 4RU2A 4KJIA 1ZA1B 4K5RA 3HJFA 1XIQA 1F2GA 2Z8QA 3BR9A 2HFVA 3MM9A 2BJ9A 3CJ5A 3D0HE 2B9XA 2D3O1 1C2PA 1XC9A 2KVIA 4OX9J 1KLNA 5C2CA 3IBWA 2ROGA 1HPZB 4KGMA 1RT7B 1QVGR 1UEKA 4LR7A 4DS4A 1U02A 1U6ZA 2XMWA 3QGGA 3R2DJ 1CJTB 5A0YB 2HRYA 1U48A 2MZ1A 4B3RF 2MJNA 4DR5J 4Q7AA 3DMJA 1RT1A 1N5VA 3MAQA 2BJ8A 1RHRB 4OI0A 5K5MA 5B0FA 1ACMB 2OD6A 3TRGA 5I3PA 3GIIA 5A6WA 2KFYA 2G0CA 3MD3A 4BCAA 3RRGA 1S6QA 5AXMA 3CJKB 4C0HA 4XDCA 1HIYA 4ECVA 1NJXA 4JV5F 4C8NA 4FXVA 3T1AA 1WSRA 3MAAA 1D3WA 5L46A 1IKWB 4FPRA 2B0GA 2NYIA 3W5ZA 1S9EA 2OEJA 1G6BA 1K0TA 2IM1A 4C8KA 3WDOA 2VA2A 3CW2C 3M7VA 3U1LA 3AJDA 4ZVFA 2OFGX 1OWXA 1CS4A 2OMOA 1XMBA 3K57A 4C0OC 2DO4A 3HHLB 5KG1A 2IYIA 5A76A 2KVQE 3W9IA 2FUG9 2ZNZA 8ATCB 4GKJF 4LRAA 1S4FA 2RRNA 2GIFA 4DCPB 1L3SA 3MM8A 1LK5A 4ZP9A 2VQEF 2ADCA 5E3RA 1U1QA 2ZOGA 4LF7F 4DL3A 3HHLA 3G82B 3FEYB 2ZDPA 2W7OA 1KOOA 3VCDA 1URNA 4LF8J 2NXUA 1A7GE 2ZWOA 4CCHA 3VAJA 5J1EB 4A8YA 3RB3A 4IH6A 3U27A 1D9AA 1HNZF 5FLXY 1JJ2R 2B4OA 5KFFA 1T0TV 2E9TA 1AUDA 1YHQS 1AXQA 2JLEA 1S77D 3TJAA 4JYAF 1MU2B 1VRTB 3D3CJ 2XO6A 1IR1A 3FMBA 4RW8B 4JI6F 3CC7S 3D7SB 4Q8EA 2V8PA 1SUQA 1ZH5A 1R0BG 3BGOP 3GIJA 4LBHA 4JI5F 4DQPA 4LF1A 2BMBA 3LA0A 3I4PA 5B08A 4CQ1A 3C8YA 1CC8A 3GE9A 5A2QU 1UVLA 3IG1A 1IR0A 4HTJA 4XPCA 1FESA 3MEDB 4F4KA 2VICA 1HQUA 2NXCA 2ALYB 1IJEB 2PEBA 3QBCA 4GMKA 4I6WA 1C1CB 4DL6A 2XSFA 5I42A 1JLAA 3A13A 4J9NA 2D1CA 3WIUA 1SJ1A 4X4QA 3PR4A 4DI6A 4MFBA 1GQEA 4WYLA 3U7JA 3AQOA 1H74A 3EM1A 2F4FA 1BHNA 1SL0A 1HFEL 2BQ3A 4JBCA 3N4WA 4DPOA 4B9MA 2AJFE 2VH7A 4I2PA 3GG1A 1T11A 4DR2F 1YITS 1FJGJ 4UZCA 1KFSA 3MOJB 2HAFA 4CP5A 3KXDA 2DY9A 3EPGA 2CPJA 4ICLB 3RRKA 2JVOA 4LRCA 1RK8A 4JI7J 2R8IA 5F8LA 3SSRA 2AIRB 2LMIA 1Q79A 1YWXA 3HVTA 3SCIE 2GCFA 4C8YA 2HBZB 4NXNF 2BOAA 3L95X 2ZM6J 2IDEA 2K3IA 2WONB 6FDRA 1HBMA 2JEJA 2H54B 5DM7Q 4M5NA 5DGAA 3OVAA 4ZLPA 4X4SA 1RAIB 5HJXA 5D4LA 1T9TA 2HS3A 5IV4A 1OSCA 4FKXA 2VFRA 1S1XB 4ED5A 1U47A 1ULRA 5G4DA 4ELVA 3L3CA 4ANCA 4YB5A 5KFEA 1JNRB 1QM9A 3AHPA 2I2YA 3B78A 3AAWB 3D5MA 1X9MA 2POKA 2Q43A 1HBOA 3G6XA 2IVYA 4WE1A 4ID8A 3NNAA 3QWUA 1HBUA 1CJKB 1X4AA 5KTQA 3OD2A 4Y2CA 2B5JB 2BV3A 1FWKA 3WX8A 1YK9A 4NLDA 4NZ0A 4XTTA 1ICEB 2DTJA 1YJWS 4ES1A 3T1HF 4ALZA 3JS9A 1S1WA 1SC1B 1XK8A 2IRXA 1RU2A 2XWXA 2MY8A 3D6HB 2MTLA 2KH9A 2VASA 1NPRA 2WAQD 3IAS9 2XMAA 4A8MP 1WEXA 4X4PA 2CQ2A 3CMES 2GJ2A 3OUYA 4PYAA 1F2HA 2ZWPA 5I3UB 2Y0SD 4UQGA 4NYPA 4I2QB 1VQYA 2GAHC 1YTYA 3TUJC 2DPJA 2AWZA 2C3UA 4PZVA 1H2TZ 7AT1B 2RQCA 4JP8A 4JV1A 3C14B 2FHJD 2XYPB 2QN6B 1QTNB 3GMGA 2I1RA 4CM2A 4KR0B 1TKTB 4J9SA 2B6AB 4MT1A 3G86A 2YKMB 1IKXA 4NLTA 5F3ZA 3PYDA 3M2RB 1N8RT 4M1KA 3MUMP 3V6HA 4USHA 1T3OA 2Q79A 2QT7A 2B4VA 1HR0F 1DQAA 2IBOA 2DH9A 4B3TJ 1WDTA 3SYZA 4RW6A 1CJUB 3HKWA 5FJ4A 1AROP 1MSWD 1LV5A 4OHZA 1HNVB 2CQIA 3D0IE 3FQLA 5HMZA 2RU3A 2DNRA 2BABA 4KC5A 2KXHA 4ZJOA 4R5PA 3BQ2A 1A9NB 3NGDA 4PCQA 1PYOB 1RB0A 3RUBL 3JAMY 3K59A 3M1VA 5IZHA 1XNRF 3NCRA 4L3KA 3A3NB 2HWTA 2PGCA 3KJFB 1JJCB 2CQCA 1KHWA 5AXKA 1N33J 2YWEA 3HD2A 5D0HA 1FT8A 2KO1A 1UJ5A 4KRWA 2UUAF 3CJTA 3MR2A 2XQCA 4MKYA 2Y1RI 5J1PA 1Y0HA 1RXOB 2HQCA 1TL7B 1HW9A 4EI2A 3U02A 3JQMA 1HMVB 1H7WA 4ZHRB 1OSDA 4ITSA 2P2CB 3HX9A 2CQ0A 3P5BP 5MLCV 2I0XA 1I3OB 4FXWA 1P9YA 4LFAJ 3OLBA 3C16B 5F8HA 1U24A 4LSZB 1APSA 3C66A 4V19X 1DLOB 1BC6A 4EYHB 1IQTA 1XEZA 2VG6B 1XMQF 1ZM4A 1XNQJ 1HMVA 5MAOA 4ZHRA 4TY8B 3DGPA 3E01B 5GMKa 3KLEA 4M5HA 3RG6A 2CPDA 3LGMA 3ILLA 3I87A 4X84A 4DR6F 3FCHA 4XIUA 2MZQA 4WZMA 3N79A 2R7TA 3Q8PB 2NREA 3OHAA 3PW2A 2DBBA 4ECZA 2V2ZA 4PG4A 4ID5B 3BQ1A 1S6PB 3PJWA 1I94F 3W60A 1IR2A 5G0RA 4K4UA 1YJRA 3OTOF 3Q86A 3UCUP 1NJIT 4CLLA 2RDJA 2FLLA 4QWAA 8AT1B 3J81j 2H51B 2HNYA 3W9HA 2XMVA 3M6VA 4ZVUB 1U8WA 4J9UE 5HMWA 1P8GA 1VR6A 4I64A 1X4EA 4RZRA 2HK3A 1UTAA 4IRDA 2FJBB 4DR3F 5HP1B 1UETA 1TKXA 1J5EF 3KDOA 1ZM3A 4RL1A 3R1LA 3V4MA 4L73A 2CRLA 2F8HA 2YNGB 1DAXA 3I55S 1ZZFA 2DGOA 2ZE2A 4MYUA 2DIVA 3ZTQA 3T5LA 5L1KA 3TX8A 1VBYA 2B8QA 4F26A 2WBRA 2ASYA 5K8OA 4USUA 4IO1A 2FHJA 4ZP8A 3MAHA 2GHPA 3GJTB 2MZRA 3GIKA 1FNOA 2DCLA 3H8YA 2KG1A 2IIHA 4KHPF 3CJ3A 2O66A 3AOBA 1JLBB 1FFSB 4LBIA 4KH1B 2JZ5A 2LXIA 2CDQA 4WIQA 3VZIA 4RKUC 2YWWA 1BQXA 1QAXA 3EE3A 2M2BA 2C3PA 1UEVA 3TOQA 5DQGA 4FS2A 1MWZA 4J37A 1DTQA 1EETA 2XSJB 3IWXA 1F9EB 4YHHJ 1JLBA 1JLFB 4OI6A 3U1MA 4F3OA 3TJ9A 2MQMA 1C4AA 5CABA 4O3PA 4F7VA 2ZD1B 3ZC4A 4GKKF 4O23A 2C3OA 4RBUA 2IM0A 1MWYA 4G1IA 1QUPA 5D8HB 2VUGA 3ONQA 2HNDB 1WHXA 5E7OB 4NE9C 2EEYA 5KFAA 3F41A 3H5SA 4X66J 3TVKA 4FBTA 4BBYA 3LANA 1FDNA 3CF5Q 2YWFA 2X3GA 4TXSA 3D54A 5FD1A 3CJ4A 2OPRA 3K2YA 2FJAB 4O4GA 5J2PA 4WJBA 1N5YB 3MFHA 1FRHA 1KVKA 5EGYA 2GNKA 2FVPA 2ROEA 2HVHA 1GNKA 2A6MA 3ET6A 4NX9A 1PG5B 1C0TB 4L74A 1N36J 3DU6A 2GFFA 4DX8H 2NXNA 1DZ5A 1R89A 1SC4B 1S9FA 4JI8F 1CJVB 2UXDF 3MR6A 3EICA 3ISZA 2HMIA 4RW9B 2HNZA 2QLXA 1UFKA 1CQMA 2RS2A 1HW8A 3RJMB 2IJFA 3JSMB 2DH7A 4S0MA 1M5KC 4FDFA 2XZDB 2HS4A 1SCJB 2I8EA 1MG7A 3H4DA 1PILA 4OI1A 4ZPBA 3Q2SC 1S7IA 1KOHA 2JFDA 4JI2F 1KBRA 3UD5A 2EXUA 3KMSA 2HZCA 1V5IB 3FBFA 2OJ3A 3T9NA 2Q6CA 1HNWJ 1RADB 2MQOA 3DU5A 4USMA 3O44A 5EDWA 2X1FA 1DQ9A 3DLEA 1K47A 2ZH2A 2VA3A 2HGLA 3MMAB 1RACB 4JOUA 4DSIA 3I32A 3BEGB 3K17A 1NJYA 1F9FA 2IVFB 2C3YA 2ZDOA 3UDCA 3Q22A 5KAKA 1UA0A 4G1QA 1H2VZ 2MQ8A 4RWXA 5E3PA 1C0UA 4X65F 1S0MA 2DT9A 1DJ0A 3T6JA 4L76A 3NNHA 4B3RJ 4O44A 3QLHA 4U95A 2KN4A 1RHUB 2RHSB 1OQ3A 3R7NB 2CJQA 4PYDA 4NI2B 3M8RA 1I51B 2DPIA 3BYRA 5F8IA 1SVDA 3I0RA 3TUZC 2DHGA 3NLCA 4KKOB 2OPPB 5LM7E 4M94A 4XAKA 2ZZTA 2KKHA 1RGVA 2KM8B 1WC5A 3B54A 3FKBA 4JV5J 1DY3A 2PMWA 1PCAA 2QA2A 2EKNA 2MB0B 4A8KA 5H9EJ 3J7YU 2HHHF 4IH5A 4TU8A 1V6HA 3UQSA 4UW2A 4LF2A 4AD6A 2J7KA 3LO3A 1ZZNA 2ATLA 3MFIA 2YKNA 3RAQA 4UF4A 1AFJA 1H73A 1J5OB 3G6ES 3NOGA 2KYXA 2HG4A 4CLPA 4BWJA 4DWIA 1NDCA 1EAYC 3H2UB 4CNYA 1JLEB 2HHPA 4RW7B 2QGFB 5F0UA 1WG1A 4AUKA 2G2OA 1WF1A 3G8SA 3OTEA 4GKJJ 4U7CA 2W9BA 2XY7A 4E0DA 2ZKUA 1J5OA 5T7LA 1QE1A 2RRBA 2VQEJ 3MM7B 2V8GA 3RRHA 2GQQA 4LF7J 3QZ7A 4ERDA 1X5PA 2KHCA 2A18A 4LSLB 4ZOSA 4H4MB 4PABA 3VF0B 3GLJA 1Y9OA 4YB1P 2DGSA 2XO7A 5HROA 1HNZJ 4ED6A 4CLUA 2OP5A 2ZVIA 1YRXA 2MDAA 4OJ3A 5GAHU 3BKUA 5DO2A 2IM2A 4RWWA 4FF4A 3JYTB 4JYAJ 2VJUA 2V94A 1OY6A 1LW0A 2BOPA 3LPYA 1HWLA 1JLGA 3OVSA 3S1TA 1LW2A 1MROB 1QAJA 2APOA 2BRKA 4JI5J 1FKPB 3KJQB 3H98A 2CZ4A 2O01C 2HFSA 3A4TA 1NMEB 1VOMA 4IOBA 1OYDA 3DOMA 4M5JA 1T03B 1AA1B 1VC6A 3CCSS 1GXLA 4ZVEA 2G1HA 3CIZA 2GV1A 3L9ZA 2GJFA 3LP2A 3MEGB 1E6YB 2R42A 3CCWA 3UVJB 3PY8A 1W2BR 4LBPA 2RS8A 5GAEU 5ETKA 4LFCF 2H5JB 3KYLA 1X4GA 2R8JA 1D0EA 1ZPVA 1EQ0A 1H6KX 4C3LA 2CNNB 3C15B 5HLFA 2YWHA 4HYKA 2IC3B 4LF5F 2K2PA 1TKZA 4KBIA 4USIA 4ED1A 4BLGA 4YR0A 4DSEA 3MHYA 1TP7A 3HVAA 2DJWA 3HO1A 3NS5A 2CZVC 2D9PA 3G6YA 2D41A 4NXNJ 1VRQC 1X0FA 2KXFA 2X3DA 4TU7A 5A8WB 3B8HA 1IQZA 2RAQA 4CTAA 1KVIA 1VQLS 1NAQA 1S79A 2LQBA 3C19A 3I82A 1GXUA 1BQMB 2XMMA 1JB0C 1ROFA 5K8PA 3KK3B 4DFKA 1TMJA 2VG7A 5F9LA 4R0EA 2YPZA 2V34A 3M6XA 4N5SA 3V5RA 3HHLC 3D28A 2CYYA 1VQPS 4URSA 1H0HB 3LOUA 4PQUB 3DXSX 2XMUA 5CYMA 4BDPA 3GFYA 4J90A 3W2VB 2R8GA 2V4JA 2J6UA 1FRKA 2RF2B 1UVNA 3JTOA 1NPKA 1Q82T 1JXLA 2Q3PA 2XB2D 2EW9A 2WB1D 5KFLA 3FCVA 5CA5A 3CCLS 1TL5A 4ZKAA 3CCQS 4Q8FA 1GT8A 3T1HJ 2BJ3A 4MKAA 4DQRA 2C2ZB 3W2VA 4RNOA 1RAHB 2I9SA 1T02A 3KLGA 1KC8T 2CAJA 5D15A 3MR3A 2W9CA 5LXYA 3HHNB 4OHYA 1FJEB 4Y65A 1JLQB 2PI5A 3FJ2A 1HA1A 1KONA 2QL9B 4ECSA 2PN6A 2GQCA 2PO4A 3CNQP 3SI8A 4NEZA 1RBLA 4PEOA 2V68A 2V50A 2NXJA 2D74B 1IN0A 1T05B 4XO0A 4BC7A 3WHIA 4E98A 4CLYA 2VPXB 1VIXA 2HIYA 6FD1A 5HK4A 1HNXF 3HT3A 2XLIA 4OLOA 5BR8F 1HR0J 3B82A 3M4XA 3VVUA 2E7XA 4CH0S 2Z0GA 2W24A 1VQ5S 1CQNA 5KT3A 2K1RB 4P75A 4PUOB 4OI2A 1K1SA 1QSLA 3ISNC 3GQCA 3NGRA 3GV5B 2E66A 1OIAA 1RE1B 4A8QA 4W4MA 3RB6A 2FVRA 4WFYA 2KU7A 2IAJB 3D6FB 3NY0A 3MM6B 5KT6A 3P96A 4HACA 1RTZA 4J5OA 2COLA 2WVBA 1GK8A 2CPYA 1SL2A 3PCOB 1NK5A 1XNRJ 1HL6A 1RU1A 4CO0A 1NB2A 2WSCC 4KV8B 3CE8A 2QTWA 4F8RA 3CMQA 3V6DA 1DQ8A 1RCXB 1QSYA 4OV1A 3LH2S 5KFDA 4CLFA 2NPFA 1F5CA 2UUAJ 2PFDA 2PDAA 1G2EA 2OGUA 3FGVA 5F8GA 1FXLA 5F9NA 2HZAA 2KFZA 4DPUA 1D09B 1SC3B 4Z2XA 2BJEA 4XK8C 2RT3A 4AXJA 4NCGB 1TL3B 2E1MC 3W2WA 2NR0A 3OVBA 1VRUA 3Q83A 2XBPA 2CJYB 3P4UB 3RZAA 4IUFA 3VAKA 2F7VA 1Y4ZB 1XMQJ 3MTJA 4NLPA 3NBPA 2VKZG 2OPSB 4O3OA 5JMNA 4G6VB 4ZVQB 3I0SB 4C97A 3PEHA 3NS6A 4KGVB 2WK4A 3D1HA 3NAIA 2DR7A 2GVDA 4AL5A 3MM5B 3Q2TC 4EO6A 4DR6J 3CJSA 3BZQA 2F1FA 5CCMA 4H4OB 4BHQA 3FDSA 1TAQA 2NCKL 3I96A 4ZPWR 1YZ6A 4B3OA 3RAXA 2HRTA 6AT1B 5E3QA 3PYFA 5GAHI 3FBBA 1I94J 5DQHA 4ZVTB 1X0PA 3J81Y 4NA2A 1FI4A 5M2PA 4OX9F 2VBZA 1OY9A 2VU5A 4B9TA 3Q8YA 4J9MA 3OTOJ 4NYZA 4IO9Q 2YPYA 2CVIA 2IYGA 4PWWA 1HQ2A 4KSEB 3PACA 4WK1A 3HSDA 4N7TA 2YX7A 1RLCL 2FZKB 2E5HA 5GMEA 1YGYA 5HI7A 4CT8A 4DR3J 3SCKE 1J5EJ 4F36A 3EGZA 4QU6A 3IAM9 2H65B 5D4PA 4ETXA 4A8WA 2LEBA 1RT2B 2HIQA 4HH0A 3MMCB 4EWTA 1J27A 4DBQA 3BDEA 3R2CJ 5KG2A 1GTHA 1NB7A 4DL0C 2BUNA 1KSPA 2FJEB 3V4IA 2XYGB 3EGNA 3SSQA 2R2TA 1U0HB 2RDDA 3BN4A 2R8HA 2OPQB 2XM3A 2E7VA 3W3SA 3PX4A 2ALZA 1V5VA 3M9NB 2HGMA 3PYEA 4FYYB 4WKYA 4YR2A 4KHPJ 2AP6A 4DV4F 2ZC4A 1RT6A 4ZVOB 2J6SA 1WTBA 3NGTA 4KFBA 4ZJQA 3NS7B 3CC4S 3BB5A 1GX5A 1NHUA 2IMOA 1S99A 4HT7A 1HWIA 1FVQA 2X1AA 3KK2B 3ZZOA 1RWNB 2KT5A 1HNIB 4NRTA 3PZPA 4PG8A 1FRXA 2WOMA 1U0SA 1FRMA 1FE4A 2QFJA 2KFNA 2P9CA 3VAGA 2E1AA 3BH6B 1TVRA 1EHWA 3M8QA 2MYFA 4OYBA 4I6YA 3TUIC 4USJC 4KO0A 4ZIVA 2EWHA 4K4WA 1KDNA 1Y5IB 3M8ZA 3D1OA 4X4TA 4O3RA 3CCJS 2V69A 1GMWD 1KQGB 2JLFA 5EHHA 1E6VB 2C2RA 5U47A 1GMVA 3GG0A 2LP4A 3PJXA 4RBTA 5DS7A 4YMEA 5J2MB 3H25A 3G2XA 1ZM2A 3AXKA 4IRKA 4ZITA 1ZA2B 2P6TA 2G0JA 1V3SA 4NLRA 4M5MA 3MF5A 2Z30B 1JWWA 4ECRA 4IDKB 4A8FA 3BBFA 4QPTA 2BEFA 1S1UB 3IXQA 1X4CA 2ZZMA 3DDNA 1SH2A 3FCWA 4IG0B 1WDDA 1S1TA 5CH7B 5H9FJ 2EBEA 5ETQA 4JI8J 2WHOA 2UXDJ 2YX4A 3AJ2A 3EX7B 1Q78A 5KFVA 3LWLA 4UOGA 3ENQA 3KTQA 4L6V3 4YN3B 4X4VA 5BXIA 3KJVB 4WFAQ 1RWVB 3CDBA 2XI3A 2VJVA 4A47A 1IJFB 5JUMA 1ZTWA 4AXIA 2ZBPA 4CLKA 4X62F 1S9GB 1JX4A 4JI2J 3IRXA 2OELA 1RWPB 1BLUA 5KFPA 4TVAB 4RUHA 1LWCB 4A48A 1WF2A 4JV0A 2ABYA 1ZBTA 4PWDA 2N4CA 1RTIB 4GVBA 1BQNA 2B4UA 3AD7C 4LR9A 2HS0A 2FC8A 4MYTA 1GXTA 1O5JA 1CBKA 3UD4P 3HD1A 5HBMB 4DS5A 3M8PB 4RUBA 4ZCIA 2Y1JA 3KNAA 4ZS6A 4LIWA 5E3AA 2IM3A 2OSRA 1P9QC 5D0GA 4X65J 3VHQA 2ZBRA 5T14A 4CO1A 3NL0A 1S0VA 4M5DA 2UXBF 1AFIA 1UPMB 1RAFB 4HHHA 3FC9A 2GJIA 1HD1A 2VDIA 1EKSA 2NZ4A 1FHTA 3A8KA 1FK9B 1YX2A 3TQ1A 2HVDA 1REGX 3AJ1A 3IP0A 4ZK7M 1ZS6A 4ZCMA 2ILYA 3LPEA 3BSNA 4HTIA 2O3DA 1VLOA 3QFWA 4KE5A 3KHHA 4QR1A 3G71S 1SPBP 3AB2B 2HHHJ 2C2NA 3EZOA 5L1JA 2DNYA 3Q0AA 1WC4A 2K06A 1VQSA 3BSCA 5DDQC 1WC6A 3LF0A 1KVJA 2GVZA 1WI6A 1RAJA 1EP4B 1BMQB 2GHWA 2XEXA 3CDWA 3P8BB 3TYTA 1GMWA 3UR3C 1M90T 1OPZA 3RAMA 1PJ7A 3V2UC 4JI3F 3KLFB 2CQBA 3KLHB 1QSSA 1OMSA 2FVSA 2KZMA 3MCMA 2BM1A 1LWFA 1HHSA 1TL1A 2J76E 3HP6A 1WF0A 4HR2A 1REVB 4ZPAA 3HSJA 2RKIA 4ELUA 5C25B 3E8OA 3SEOA 1NKCA 5LMNF 4UUWA 2V9KA 4DL4A 1XTZA 4NLGA 3CVKA 3C6UB 4K4VA 3POTA 3PJ9A 3DI6B 3K8WA 2DEIA 5CXTA 2YXLA 1KD1T 5F8JA 3DRRA 1JIHA 2R9LA 4B9VA 4HVZA 5GMDA 3GYNA 2KDOA 2HWIA 3O8WA 3D1QA 1JQGA 4ZJLA 3RBZA 1IKVA 4QYZJ 2D3UA 3DI6A 1Y10A 3PW7A 4DJBA 4U7UD 4RW4B 4O0IA 1M0SA 2I38A 3ETOA 2C42A 4NXMF 3AXMA 2OAUA 2GAGC 3DRSB 4EZ6A 2DHSA 4M5GA 4CWBA 3BKFA 4BWMA 3QO9B 5C24B 4TQSA 4FN5A 2LVWA 5IM0A 1WI8A 1SJ3P 4P72A 4CYUB 3H2LA 3PFOA 4A4JA 3QJPA 1N56A 3EPIA 3MMJA 2IJNA 1PSDA 3M8SA 2F4VJ 2BANA 4LFCJ 3SV4A 1LKZA 2AX1A 4DFMA 1MNEA 2Z58B 1QDUB 2HYIB 2QRRA 1HARA 2AF6A 2VV5A 4FVCA 3K5MA 3R5JB 2AKWB 1SL1A 3MCNA 2KXNB 3N6LA 2DR9A 2J9DE 1VJQA 4OZNA 3CCVS 4LF5J 3KG4A 4CRJA 4U6PA 2O67A 3R3TA 2KM8C 3OW2R 3IWNC 3OFHA 4B9UA 5CQGA 3TAMA 4DUYF 4TU9A 3C6TA 2A2CA 3SDEB 2YKOA 1F5BA 4U7UK 2X1GA 1UP1A 1X5TA 2BW2A 1Q7YT 5AXNA 4DR1F 4CDIA 2LDIA 3FNNA 2R7RA 3G6VA 3NWRA 1MWQA 4QIWD 4K4SA 3LTOA 1QAIA 4ILMA 3TEHB 1H98A 3HULA 2DXFA 1NSKL 1TK5A 2J9DA 4IFVB 1RWXB 3PNIA 4HLBA 5F3TA 3CTRA 2QLBB 3MMBB 1RHKB 3DLGA 4NLVA 2UUBF 2FC9A 1MN9A 2LXUA 2ZITA 1PIEA 1FDBA 3FEZA 2AJQA 2VPZB 2NQPA 3GTYX 4OZ3A 4I7FB 5KT4A 3ITHA 3KHLA 4WP8A 3NXZA 4IG3B 2QLWA 1NDKA 4IFYB 1QVFR 1FD8A 3H2VE 1VLYA 4DU7A 2CPEA 3NWGA 2ZC3A 3SCLE 4Q5VA 1U4BA 2QE5A 2XGPA 3OR1A 2FVQA 1N54B 4Y2IA 3KK1B 3DKDA 3IR5B 1TKDA 4DDFA 3T6BA 4IRCA 2EK6A 5LJ3Y 1R0AA 5KG5A 1QJHA 2ZH5A 4Q45A 1FO1A 4Y2MA 2ZOMA 2V2QA 3M2UB 4HHJA 4AYBD 1YG0A 3M30B 5J2NB 3TAPA 4LF9F 3FVYA 4Z37A 2UU9F 4Q44A 2HBRB 4QYZK 3M2VA 5HVGA 1R6VA 2MZJA 4C11B 5EWGA 4OYWA 1YZ7A 1TV6B 3PG9A 2R7XA 1EB0A 3SFUA 1HHQA 5HJYA 4RBVA 4I67A 3IA0A 4MIBA 1RWMB 3M2UA 2VQFF 1N6QA 2BX6A 3QPIA 4OZ1A 3QGHA 1KQKA 2YNHA 4F50A 4QR0A 1HNXJ 3AB4B 1EZZB 5E2QA 4EBEA 5BR8J 3T5HA 1HLWA 1JJHA 2LA4A 3F44A 3N01A 1RA6A 2MHNA 3LP1A 3FFIA 3BGRB 2B9WA 1KQSR 4OI4A 3CCMS 1AZSA 3QT5A 4K0KF 3S7RA 1PKUA 1U1RA 5K8MA 3O3LA 5HVFA 2XS7A 2MQQA 1WWHA 1N88A 3K58A 2EC2A 4ES3A 2VG5B 3T41A 2MSTA 3R5CA 3HHLD 5KFMA 4ED4A 5L1LA 1FFWB 4N77A 3LALA 3LW5C 1CULB 1U45A 3M32B 3MEEB 3SBMA 2OH2A 2G9OA 3ZTPA 4ZCLA 2DB1A 2AGPA 4WXOA 1F0XA 1WEYA 3TARA 4OX8A 2LU1A 4CO5A 2DNZA 4M5KA 2J0QD 2RSQA 2CQ3A 2FLNA 1VDHA 4A46A 1H38A 1FVSA 1RTJA 1Q95G 1CC7A 3KWMA 4B02A 2F8EX 4OJHA 2E1CA 3Q8SB 1Y3JA 3NG8A 1N34J 1NK0A 4QJVA 1HQEB 1BE4A 2M8DB 3M05A 2OUGA 3PV8A 3KMQA 5IT9U 2ASDA 2CADA 1FTRA 2JC0A 5HQMA 5KFKA 1TAUA 3G4SS 4ZLJA 2GGPB 3X3UA 3A12A 4ELTA 4F4ZA 1U09A 3JSRA 2WW4A 3FQKA 3CCUS 2OFHX 2E5GA 2ACYA 3P6YC 3B4MA 1B99A 4CH1A 2C2MB 1JKHA 3UN5A 2ZH3A 4YB7A 3MECB 2B7BB 2MGZB 4FF3A 1WKJA 2HHVA 3VGVA 2L3MA 2YTCA 2F63A 3EDRB 4DF4A 1S1VB 4OYXA 2CZ9A 2JLGA 3CD7A 3JTNA 5EN1A 2OTJS 4F4WA 1U1LA 4IH7A 1SQFA 2DR8A 4AE5A 3QRRA 3EZUA 1RT5B 2CNLB 1HYSB 4CIOA 1HPZA 1RT7A 3IR7B 4WFXA 1ZYQA 1RI7A 2V5HG 2XMTA 1SJQA 1R8PA 3DNCA 4FP9A 2Q1LA 2BE2B 1CJTA 5A0YA 1RAOA 1O51A 2WVFA 1B0PA 1R7IA 3CJ8A 2XHCA 4OFZA 4DV7F 5D3GB 4HT5A 5KG4A 5THWA 1LXJA 4GO7X 5KFYA 4EUVA 3CJKA 4JI4F 2J0WA 1NUEA 2BJ1A 4DV4J 4ZLLA 4DX6A 1YDLA 1IKYB 3Q8RB 3GU0A 3AA9A 1SKWA 2RD5C 2QC3A 4F25A 2AJ2A 1IKWA 3D3BJ 1RBAA 2CPIA 5HMYA 2A6OA 1JXEA 2DD8S 5LSOA 3BO2A 1LWEB 1FCAA 1U1OA 4R8UB 1RWUA 2CG8A 3EVWA 2M0GB 2ZH8A 4G3IA 1R8BA 4ED8A 1WHWA 1CEZA 3GR1A 2HWHA 3N6NA 1N5SA 4G1PA 1UWBB 3GB0A 2CDRB 3TWZA 2BJ7A 2MMYA 1KNZA 2XYHB 2E7WA 4EEYA 3M6WA 4EFAC 2NXEA 4BC9A 2VPYB 5JVHQ 4WTOB 4WU3A 4K2JA 3BPSP 4F3QA 1HBNB 2FHKA 2RJZA 4LSNB 4K2XA 2YH1A 3IWLA 2AQ4A 3G82A 3PYGA 1YBUA 4DFPA 2I5JB 4UOHA 4AFFA 2QZ8A 4DPWA 1RWOB 1NH8A 3AH6A 5J1EA 3TAQA 2DEJA 1RHMB 4ZPDA 2RIJA 3HVRA 1X4FA 1N32F 1SKUB 1RTHB 5AXLA 4M5LA 1F60B 4OX6A 1AUSL 5A2QY 3PDNA 2KZZA 1DFDA 3RTVA 1MU2A 2N4DA 5AE2A 1VRTA 1GAOA 1T3NA 2NUHA 2K7JA 4RW8A 1WHYA 4KGXB 1MMDA 1NHKL 3PX0A 1TFWA 2JRSA 5J2QB 2AZ1A 4M8LA 3ADAC 2I6WA 4FNHA 2XLJA 3DLKB 4FYDA 2CQDA 3QMQA 2DKOB 1ZETA 3V6JA 1X4BA 3PKYA 1NRKA 1B4SA 2G1DA 2J0SD 5FDLB 2VC0A 2BRLA 3MEDA 2CNOB 4X62J 4DV3F 1U8SA 4FBUA 3KUEA 1G3OA 3R27A 1C1CA 1Y3KA 4U67Q 2IDLA 3H7HB 1NSQA 1NDLA 3FBEA 1IBKF 2DRBA 1WSVA 3P3DA 1FRIA 3OHBA 3CJQA 4ZVHA 4WXWA 4ZVGA 5GVQA 2L9DA 2VOOA 4TY9A 2V4QA 2FGOA 1DTTB 2G2ZA 1WORA 1S72S 5EUHA 1KN6A 3GFXA 3IM8A 2CPXA 2HVEA 4FYWB 3RGIA 1WC1A 4QIVA 5ETPA 3BKTA 2ZKTA 4ICLA 1NNDA 4FF2A 2BR0A 2UXBJ 2AW0A 4NLYA 4MKVA 1VHIA 1H7XA 2EPIA 4YY3F 1IWAA 7FD1A 1NKBA 1U49A 3CCES 2OHDA 5K14B 2WONA 1VC5A 3BPDA 5ETMA 3JXOA 1C1BB 2W2PP 4DV1F 4DG1B 3CD6S 3KHGA 3GYGA 3DM2B 1UJ4A 5GAGI 2OI2A 1S1XA 4YS2A 1T8EA 4H4KC 3Q8QB 3SZ2A 3MPWA 1SH3A 1K44A 1WACA 1F1BB 5ETTA 2EBGA 4Q2LA 1VQ4S 2AYMA 1C1BA 3CJ0A 5CYQB 3BR8A 3RW6A 4EO8A 4JUZA 2MKKA 5DG7A 1XBWA 3BN7A 3Q89A 3SV3A 2W2QP 1CJKA 3FEXB 1QUVA 5H1SV 2B5JA 2VKRA 1FRJA 2HHSA 3G8QA 3J80U 3CJRA 3S6EA 2E5LF 4JI3J 3KDNA 1RT4B 4DPTA 2HLTA 2ZUGA 2W8KA 2HK2A 1U1PA 2GIRA 4HDGA 2RRAA 5F8MA 2DCUB 3THVA 2B51A 1X60A 2AV5A 2XCPA 5HATA 1VS3A 4OZ5A 4MJKA 3J7Z5 2D7SA 4U8YA 5LMNJ 2FTRA 4NYOA 4UT4A 5I3UA 2HRUA 4I2QA 2HSEB 4C9DA 1NKEA 4RNMA 4QZVB 3DRPB 2Y1IA 4B17A 3A8IA 4W92B 2DRAA 1GX6A 1TELA 3C14A 2EI5A 4PXBA 3LP0B 1WC0A 2PT0A 1S48A 3ETMA 8RUCA 1IVZA 1S6OA 1SIZA 1TKTA 3HCXA 2B6AA 3K5OA 2YKMA 3D67A 4C98A 3CEDA 3M2RA 5CZXA 2XHWA 1JK9B 4EMDA 4WFZA 1UVKA 1UPPA 2DNMA 4F04B 5B0GA 1SJRA 5C2GA 1WJ9A 4OX7A 3M8WA 1CJUA 4DR7F 1RAEB 1RT3B 3QATA 4NXMJ 1D9DA 1F6TA 3DOKB 4K4XA 1UMJA 3MD1A 4RPFA 2WTFA 5IQ6A 4LQ3A 1HNVA 2NSBA 1RTDB 5KFOA 5C42B 2ZH9A 3CDAA 1N52B 4C48A 3DLJA 2KL8A 3EWGA 2BA9A 5D0EA 3TNVA 3P49B 3TJ8A 2XNQA 2N7CA 3WZ0A 3M9MB 2X51A 3H59A 4ES2A 1F5AA 2LDYA 1KLMB 1RTDA 2KJWA 1X31C 2RE1A 4Y2KA 2E1PA 2P6SA 1RYRA 2IRUA 2XZWA 1NLKL 2IFXA 3GCWP 1IBLF 2WVDA 2DR5A 1NSAA 3ZZYA 1ZTTA 2CWKA 1TL7A 4DCOB 1X8DA 3R7SB 2YNFB 3LGNA 3WX4A 5A8RB 2HAIA 4DUYJ 2H48B 5KFNA 5B0DA 5HSPA 4CT9A 3C16A 2VFSA 1YJTA 4C8LA 2C3MA 1PYSB 1OY8A 4DR1J 4NA1A 1DLOA 4C7QA 2RHQB 2ZNYA 2MLYA 2VG6A 3PX6A 4MK9A 3RBDA 1GEHA 4WKRA 3IC1A 2VIHA 4TY8A 3EXCX 3V6KA 2YQ3A 3E01A 3MUVP 3EDQB 3K8VA 1UKUA 2UUCF 1YJUA 4KIAA 2XG8A 1U2RA 4NASA 4HKQA 4B3SF 4RJVA 2E1RA 3CDUA 3V81B 1W7WA 1CG2A 3H20A 3EZ5A 2HHWA 2DYAA 5CHCB 4I1TA 4LT6A 2UUBJ 2ZEJA 1U6BA 2JL9A 4ID5A 4KHRA 2V67A 1S6PA 4OYAA 3VTIA 3RYLA 2F3JA 3K5LA 2A3JA 2ZHOA 1TL4A 3GSIA 4ZPCA 2DH8A 2FJWA 3OR2B 2W9AA 4CLSA 2EKYA 3EUNA 2AHOB 2R7QA 1F3FA 1M1GA 2ZBQA 2OKQA 1V3RA 1Y00A 2MKIA 5EX3A 5DQIA 1Q8IA 1K8AT 4I6AA 5HP1A 4CNZA 2YBVA 5HANA 5DDOC 1VMBA 1FFGB 3UDLA 2Y8YA 4ED0A 3HHKA 2YNGA 4IOCQ 2HFUA 4NCAA 1T9WA 5D4OA 3HZGA 3CT9A 4K5SA 5IXUA 2RILA 4LF9J 2UU9J 4K7QA 5C7PA 2DVIA 3H42A 1VI7A 4FXDA 4LF4F 3FUYA 3VAHA 3QIPB 1N0VC 1OJ4A 2DGQA 4USVA 2JH3A 4YFUA 4ECTA 4AL6A 3CO9A 3R7BB 3QSIA 2D9OA 2CQ4A 2V63A 3GFZA 1RA7A 4USTA 2E9ZA 2VQFJ 4TLQA 3W9JA 1L3KA 1Q8BA 1Y5LB 3ICLA 4NRUA 1NDPA 2W2MP 2DNPA 4P9SA 4ILLA 2HQFA 3M9OB 2R7SA 4P10A 4RNFA 1TTHB 3SQGB 2XSJA 3AY0A 4IOAQ 4R25A 2EFNA 4YQWA 1JLFA 2BYCA 4QWBA 2ZD1A 2Y8WA 1IM6A 1EIYB 1X9WA 2J5AA 5K9FA 2BQRA 4F4AA 4J9PA 2W7AA 2HNDA 5JVGQ 4K0KJ 4P73A 1Q8KA 1FE0A 2C1EB 4C2MA 2BKNA 1KEKA 2OD4A 4KH0B 3CJ2A 4B08A 3CMAS 1S4EA 2RQ4A 3QIDA 1WOPA 2A0FB 1VYAA 1N5YA 3R5GA 5DJBA 1R27B 5DDPC 5BYRA 2VDHA 2F9DA 4QPXA 4Y00A 1YVFA 3ZTOA 4KGKA 2W01A 2JOQA 1XR7A 3RBEA 4URQU 2YNIB 4ZA1A 4ED2A 4RNHA 1C0TA 2XLKA 1NK9A 3IS9B 1YIJS 2LFVA 4DU8A 2NUUG 3WQPA 1CJVA 4XPEA 3JQJA 2NPIA 2MLZA 4FVMA 4NLWA 4RW9A 2E5JA 4G65A 2QMUB 3IBCB 5E41A 1S57A 5AT1B 2J6TA 5KT5A 3QRQA 3JSMA 1IM4A 3DDKA 3NRBA 1TK0A 3GR0A 4YEAA 2E9RX 3CXCR 1LFPA 3K7RA 3AD8C 4GRSA 2DXEA 5KFSA 4P7VA 1JLCB 2L41A 5IV3A 3PTWA 1Q7LB 3MM9B 2FQQB 4N76A 1PC5A 4X4UA 4ANEA 5KG6A 1UVJA 2ZUAA 1NXIA 1M5VC 3NNCA 3MMAA 2YWKA 2H9ZA 3R8YA 2CJ9A 2B7CB 4OZ0A 2FZGB 3TZZA 1JLCA 5I4MA 2EFGA 1PJ6A 3DMJB 1RT1B 2FHOB 4QIFA 3OBIA 3EJMA 3FSIA 3O5TB 3VAIA 1BXNA 4ATNA 3OTCA 1SKSA 2BZ2A 3RB0A 2ZBCA 1S6QB 4UOCA 4I0WA 3KUHA 4NI2A 3KKFA 1RABB 2V8HA 3MTKA 4DV7J 2FLPA 2HBQB 4DQSA 3C3LA 2HFNA 2EFQA 4KKOA 3J7ZT 2OPPA 4DR4F 1QLNA 4JI4J 3A3OB 4NLSA 3MAAB 4L72B 2M5YA 2GHVC 2YX1A 3IO1A 1UJ6A 2DIUA 4DSKA 1S9EB 5IC4B 3LGHA 3CGIA 3GCXP 4CLTA 3HHDA 4RO0A 2U2FA 1WOSA 1SQGA 3FZBA 3UI3A 1Y7PA 1CS4B 3MI7X 3OFEA 2RMLA 2X7IA 3QJJA 2VFUA 2K3KA 3QGPA 1QY7A 2JEIA 2UXCF 2IY5B 2UVUA 1Q81T 2VD3A 4LR8A 1V9OA 2J9CA 3UCGA 1RAAB 1VBZA 1YJ9S 3MPDA 4NZ7A 3I56S 1NSPA 4X4RA 3QFHA 1JLEA 3H5XA 3MM8B 2A10A 5CZVA 4RW7A 2H4YB 2V8VA 1Q0NA 2YH0A 1BWVA 3MM7A 4B9NA 2FB0A 2M3DA 5KFCA 1SH0A 5HMXA 5A8KB 3VZHA 3GFHA 4ZVRB 4OYIA 2DO0A 1K73T 2DGWA 4LMZA 4LSLA 4H4MA 2J7WA 3MR5A 2M8HA 1N32J 5E0OA 1CSJA 2H5IB 2C28A 2W7PA 2JX2A 5A8KA 4AQYF 4FYVB 2F40A 3HI9A 2CXEA 1SUQB 1YJ7A 3KLVA 3JYTA 1XR6A 5FLXU 2WSEC 3BF4A 5DZ6A 2BW7A 1MROA 1FF2A 2AYBA 4W90B 2ERRA 5EWFA 4FKYA 4X64F 2ZFHA 3IG1B 3W5XA 1FKPA 2W4CA 1HQUB 2YQ1A 1FEEA 1UWAA 2F4VF 5I42B 5L1IA 1JLAB 1T03A 3UWTA 4DV3J 2LQ8A 1FX4A 4MFBB 2IHR1 3MEGA 1OS5A 3GJQB 1E6YA 1IBKJ 2PE8A 1T7PA 1S76D 2C2EA 2B9YA 1FXDA 4I2PB 2M4MA 3UVJA 1WHVA 4CI0B 1HD0A 2GQ2A 3VALA 1M1HA 3R5BA 4FNIA 1SJFA 4Y2AA 3WC2A 4JI0F 1Z1ZA 4OZLA 3J7AN 1YJNS 3GSDA 3CULA 3C15A 3DLHA 1B7YB 3WIVA 2IC3A 5B7WA 3HVTB 3RW7A 4NZ6A 1NBEB 2PC6A 5H9EK 1W25A 3L09A 2E5IA 3UN2A 3WC0A 3QAEA 2DNOA 3PKMA 2PSZA 2JHEA 1HBMB 4YY3J 1NZAA 3HSZA 2DNKA 1T94A 3MURP 2ATCB 4J9KA 2B56A 2VZ9A 2L48A 3GJSB 5A8WA 3W5YA 3UE2A 3QAUA 3KG0A 4DQIA 4MAKA 1BQMA 4DZDA 3DYAB 2NS1B 3QWPA 4DV1J 2WRMA 4V1Ak 2C2DA 3AOAA 4DN9A 3KK3A 2P5VA 4LRDA 1FKAF 5LOQA 4PG6A 2MJUA 1VQ7S 1S10A 4K8RA 1VQ9S 2Q6BA 2A1BA 1RKJA 3OJSA 2QMWA 3D0GE 4Y34A 1HBOB 1WKLA 5CAAA 4WE1B 2KT2A 3HHEA 1UAWA 1HBUB 2EG1A 2Z4PA 3TZYA 4PQUA 3DYAA 2FPHX 4C3KA 2WBMA 1EKRA 2DXDA 5BJRA 5F41A 4JB8B 1PYTA 2VOPA 1TU0B 5IC6B 2RNEA 2RF2A 1VK3A 3UDVA 2QLJB 1VQ8S 3OL7A 1VJWA 3OT9A 4ILRA 4OYOA 2BDPA 4OHVA 1S1WB 1N4LA 3GV7B 2FGCA 2E5LJ 2RUGA 1B7FA 2BKPA 3QT6A 4CLZA 5KFBA 5D6GA 2CFXA 3ZZUA 4GC7A 5DZ7A 3OUYB 5KOXA 3KFWX 4PPDA 2R8KA 3NMAA 5ETNA 3D2WA 2Z56B 3QT7A 1JLQA 4YUDA 5KFIA 4TN2A 1X5OA 3F73A 3C2PA 4WZQA 3D9BA 4ED7A 1HI1A 2FLOA 1VBXA 3B6BA 4OZJA 1IKXB 2RQKA 5ETOA 5ETLA 1T05A 2Z2MA 1XWLA 3BBCA 4YP3A 2VC1A 1OYEA 5LMUJ 2OIHA 1L3UA 1TMMA 1F9HA 2QSFA 2FJVA 4RW6B 5A6PA 4WP9A 1ZM9A 3AQPA 4DFJA 2JSXA 3NGSA 4AT1B 1VQOS 1B0VA 3LAKA 3L7PA 4YDDB 3BS9A 5ADZA 4DR7J 2K1RA 2MEWA 4PUOA 5D0RA 2JC1A 3CCZA 4R5PB 3W61A 5L9NA 5FIIA 2YKPA 4PXDA 3CUNA 3PHTA 4OMFG 5L39A 3M1VB 1KWMA 3PO5A 2CG4A 5T41A 1L3VA 4ENOA 4TLRA 2IAJA 2QL5B 3MM6A 5IQQA 1RCOB 3SFGA 3L7UA 3IBFB 3R6GB 2XMKA 3RB4A 3KOAA 3OSNA 3ULHA 2ZH1A 3HK2A 4KPYA 3TP2A 4KV8A 4H54A 2IPOB 4Y0FA 2O1PA 4FPIA 1N34F 1UCNA 3D68A 3GJRB 4EK2A 2DNLA 3G8TA 3JAMU 4PG5A 3KNGA 3BH7B 1PBAA 3K5NA 1IBLJ 3B4DA 4JI1F 2WW8A 3PW5A 3T5JA 2QLFB 1VFJA 1R8HA 2N3OA 3M6UA 2LECA 2DY1A 1ZAWA 4NCGA 1TL3A 5KFHA 4C0BA 4C8OA 1Y11A 4B3MF 3EGWB 2R7UA 3D4JA 3DGPB 5SZTA 2ASJA 3UD3P 3KLEB 2PMHA 1LWXA 2DHHA 2XGQA 2W4DA 2MHEA 5DETA 2OPSA 5GADU 2QA4S 2YKQA 3I0SA 1FNMA 4OHWA 2UUCJ 4PR6A 4K4YA 4B3SJ 3MM5A 5HN0A 2M9KA 5RUBA 4DL7A 1GMUA 2FY8A 3I6PA 3L4BC 2PD1A 1FEHA 4H4OA 3ZZRA 2ZZNA 5G0RB 5IT4A 2V2VA 2KB2A 1V3ZA 2YWGA 4OHXA 3SXLA 3VV2B 4YOEA 2FYXA 4QYRA 4KPCA 2HNYB 2OSQA 2HZVA 4JV2A 1Q1KA 2XY6A 3PO4A 2QFIA 1TKXB 2VFVA 1CLFA 4E8UA 1X4DA 3DCAA 1KRPA 3JQKA 1FKOB 3H4BA 3KUGA 4DV6F 3IR6B 2ZE2B 1UVMA
chains in the Genus database with same CATH topology
2HWHA 2KJVA 2GIQA 3GYXB 3H98A 2CZ4A 3N6NA 1Z2ZA 5KFGA 4B9LA 1N5SA 2O01C 2F9JA 1XNQF 1VOMA 5J1NA 5KFJA 4G1PA 3MPYA 1RT2A 1UWBB 4IOBA 2FVCA 2Z2LA 3MMCA 3JSBA 3PXGa 3DOMA 3GB0A 1T03B 2WCXA 1VC6A 4URGA 3PHEA 3CCSS 2PA8D 2MMYA 1KNZA 2E7WA 1GXLA 3HM9A 4EEYA 2GC8A 3M6WA 4EFAC 4CH7A 4ZVEA 3CIZA 4BC9A 2VPYB 2GV1A 1FKOA 5JVHQ 4UY8T 1BWEA 2D3ZA 2OPQA 4WU3A 3LP2A 3DLGB 3MEGB 2AGQA 4F3QA 4TYBA 1HBNB 2FHKA 1L5UA 1E6YB 4A8SA 2KTQA 2RJZA 4OL8A 4DN0A 4LSNB 3CCWA 4K2XA 5L8RC 3IWLA 2YH1A 2VL1A 5KG3A 2Q66A 2AQ4A 3V81A 4O3NA 2HHXA 3PY8A 1URRA 1W2BR 1BY9A 3FMWA 2RS8A 3US5A 5GAEU 2FDNA 4ZCKA 4LFCF 2CPHA 4WFNQ 3KYLA 2I5JB 4DFPA 2QO3A 4ECUA 1X4GA 3ITHB 1R8AA 2R8JA 4AFFA 2QZ8A 2R4FA 1NH8A 3AH6A 1DTQB 1EETB 4P2SA 5J1EA 2EFOA 3TAQA 1D0EA 1ZPVA 2DGUA 2KRRA 2D3OR 4ZPDA 2RIJA 3HVRA 1X4FA 3R1HA 3QGIA 1SXLA 1H6KX 4C3LA 2R7OA 1N32F 3VWSA 4ECYA 4ZPTR 5HLFA 2YWHA 4CO2A 1S0NA 4HYKA 4IQXA 4X2BA 2IC3B 4LF5F 1VK8A 2JFKA 2K2PA 2CQHA 3KK2A 1RTHB 1TKZA 4KBIA 4USIA 5AXLA 1F60B 4OX6A 3Q24A 3ENWA 2CJBA 4FZVA 4ED1A 5A2QY 1HNIA 3OR2A 3PDNA 4M63A 2KZZA 1NH7A 2XC9A 5KFRA 3RTVA 2VODA 4YR0A 1DFDA 3OR1B 1MU2A 2N4DA 2UVWA 4WK3A 3O6QA 5AE2A 3SSSA 1VRTA 1GAOA 1T3NA 2NUHA 2HHQA 5LSLA 4DSEA 3MHYA 2K7JA 4RW8A 1WHYA 1KS2A 1TP7A 1UL3A 3HVAA 2DJWA 4QIEA 1MMDA 2BBEA 1R0AB 3NS5A 3HO1A 3S01A 4YR3A 1TFYA 3PX0A 2CZVC 1TFWA 2D9PA 3MOZA 3G6YA 1TZ0A 2D41A 2JRSA 5J2QB 4N8OA 4M8LA 1X0FA 4FNHA 2KXFA 3SCJE 2L08A 2XLJA 4TU7A 2N82B 5A8WB 3DLKB 4TNOA 4FYDA 2ZVSA 3B8HA 1TQLA 2CQDA 2HLUA 3QMQA 1IQZA 1ZETA 3V6JA 3LQVA 4CTAA 1VQLS 1KVIA 1NAQA 1R43A 1K1QA 1S79A 4H4KA 2LQBA 2IA6A 2FHMA 3ZZPA 1X4BA 3I82A 2WSFC 3PKYA 5CCLA 1NRKA 1GXUA 3P5TL 1BQMB 2G1DA 5KFXA 2J0SD 3M2VB 3X1LB 5FDLB 2XMMA 2VC0A 1N0UA 1N5TA 1JB0C 1E6VA 1I1GA 1ROFA 5KFQA 2BRLA 3IN5A 3MEDA 2OPRB 5K8PA 2AYGA 4DV3F 3KK3B 4DFKA 3T19A 4F2RA 1U8SA 2RU9A 4X4NA 2HQIA 4EYIB 4FBUA 4O4GB 2CKWA 5J2PB 2VG7A 1G3OA 4F2SA 5F9LA 4R0EA 2A2DA 3R27A 4LVNP 3M6XA 1C1CA 1Y3KA 3UPFA 3CSKA 1NEEA 4U67Q 4N5SA 3A1YG 3OXLA 1CVJA 3V5RA 3HHLC 5J2MA 3DHWC 3D28A 2CYYA 4KAIA 1IBKF 1O8BA 2DRBA 4C4WA 1N6QB 1VQPS 4URSA 3P3DA 2JWNA 1FRIA 2RB7A 4KT0C 3QIPA 1H0HB 2ZH7A 3OHBA 2BVZA 2YNHB 3LOUA 1RQ0A 4PQUB 4ZVHA 1QAYA 3ZFVA 5K8NA 3DXSX 2HFOA 2XMUA 5CYMA 4WXWA 1M5OC 4ZVGA 4PXCA 3GFYA 5GVQA 4BDPA 5KFTA 4IDKA 3QJLA 5HL7Q 3W2VB 3N9UC 2R8GA 2L9DA 2VOOA 2V4JA 4TY9A 2RQMA 2J6UA 3FSYA 2V4QA 3HLUA 1FRKA 4RX6A 1VIOA 2FGOA 2RF2B 1S1UA 1DTTB 1KQFB 2ADBA 1UVNA 3GWCA 4YHHF 3JTOA 1SI9A 3CD5A 1S72S 5EUHA 1KN6A 3GFXA 3MEKA 4YDXA 1Q82T 1MMLA 1JXLA 2CPXA 1FDAA 2KG0A 2ZOFA 2Q3PA 3GILA 1VQNS 3EYZA 2HMIB 2HNZB 4IG0A 2XNRA 1ZAVA 2KYZA 4QIVA 2XB2D 2EW9A 4HH1A 3SQGA 2EK1A 3LP1B 2DK2A 2WB1D 3NMRA 2DNHA 4PPZA 5KFLA 4LJMA 3FFIB 5CA5A 2ZKTA 3CCLS 1TL5A 4ZKAA 4ICLA 3CCQS 3HPOA 1NNDA 4Q8FA 2ZJRQ 1GT8A 4FF2A 2BR0A 2MKCA 2JEGA 3T3FA 1UVMA 3E3XA 4MKAA 4UQTA 2AW0A 1D8ZA 3W2VA 4DQRA 4RNOA 4NLYA 1H3DA 2I9SA 1H7XA 1T02A 2EPIA 4YY3F 3KLGA 2MZTA 7FD1A 1NKBA 1KC8T 2PFFB 2GMHA 1Z4UA 3MR3A 2JJ4D 1U49A 1RP5A 2W9CA 4YB6A 1QTMA 5LXYA 5JJBA 3CCES 3HHNB 4OHYA 5KOWA 1M5SA 4X66F 2AJ0A 1IXKA 4EBCA 1FJEB 4Y65A 1JLQB 1PGZA 3KJVA 2PI5A 5K14B 2WONA 3FJ2A 2J8AA 1FRLA 1VC5A 1HA1A 1KONA 4ECSA 3PW0A 5LJ5Y 2PN6A 2GQCA 1C1BB 2DGVA 2PO4A 1IUJA 3SI8A 4DV1F 1YI2S 4IKAA 5LL6d 4DG1B 3CD6S 3KHGA 3I4HX 1N48A 1S9GA 3DM2B 5D78A 3KLIB 3OXFA 2ASLA 1UJ4A 1VQMS 5GAGI 3C46A 4KTQA 1S1XA 2LQJA 4MH8A 1X5SA 2HFZA 2FD2A 5KFZA 2D74B 1FD2A 2BXJA 5M2RA 1IN0A 1T05B 4QWDA 1T8EA 4H4KC 4XO0A 2P9GA 3UNGC 1FA0A 1LWCA 4BC7A 3DLEB 3Q8QB 3SZ2A 3MPWA 4IR9A 1FJ7A 3NGKA 2ZH6A 1SH3A 4C8MA 3PVXA 1WACA 2B4PA 2GMJA 4E98A 4LFBF 4EZ9A 1RTJB 1OQ6A 3I9V9 1S7HA 2N3LA 2EBGA 2XI2A 4NLXA 4Q2LA 2VPXB 1VQ4S 1VIXA 2AYMA 1C1BA 2VPWB 3CJ0A 3BR8A 5CYQB 6FD1A 1HNXF 1RTIA 3HT3A 4DV0F 3RW6A 3BJYA 2XLIA 4EO8A 4JUZA 4OLOA 1N36F 3KLIA 4G1QB 2MKKA 5BR8F 5DG7A 1XBWA 3BN7A 4PXEA 2K7KA 3I5BA 3TVYA 4NCBA 3B82A 3M4XA 1C0UB 2E7XA 4CH0S 1VGYA 3SV3A 2Z0GA 1KTVA 2W24A 1VQ5S 2QEXS 1CQNA 3FEXB 2LA6A 1QUVA 1L3TA 2AJ4A 5H1SV 1C4CA 2B5JA 2K1RB 2VKRA 5HBMA 1FRJA 5KT3A 3G8QA 4WFBQ 1NK4A 2YNIA 2HHSA 3DXBA 2FY1A 3RR8A 3M8PA 4P6QA 4PUOB 4OI2A 1K1SA 5DRKA 3ISNC 3S6EA 2AJ1A 1FTCA 4O44B 3CC2S 2E5LF 1QSLA 2XS5A 3IS9A 1I6JA 1KHVA 4OQJA 3QLHB 3GQCA 3HDSA 1RT4B 1U2FA 3HVWA 2YKAA 2HLTA 2ZUGA 4MK7A 3GV5B 2W8KA 4OIXA 1U1MA 1U1PA 2GIRA 4HDGA 2E66A 1OIAA 2RRAA 4A8QA 5F8MA 3VQSA 1X7VA 1LQ9A 1MMNA 2DCUB 4WCEQ 3RB6A 3THVA 2B51A 3RR7A 4IR1A 2DNGA 2AV5A 2FVRA 4N41A 4WFYA 2KU7A 2EC0A 2XCPA 1HHTP 2IAJB 3I0RB 1VS3A 2MSSA 3MM6B 5KT6A 2KRBA 2JEFA 4OZ5A 5BYQA 3P96A 3IGVA 4MJKA 4J5OA 4CZCA 2COLA 2CPYA 1SL2A 4QCLA 3J7Z5 4DV2F 2D7SA 1JKHB 1NK5A 3N0VA 1J2VA 2FTRA 2VBYA 4NYOA 2V8DA 1FK9A 5I3UA 2O5DA 3OL6A 2CJKA 1HL6A 2NLWA 2HRUA 4I2QA 4CO0A 4C9DA 3NP5A 2WSCC 3O1LA 4KV8B 1YRUA 3CE8A 2CVEA 2HW3A 1NKEA 3DFEA 4F8RA 3V6DA 5SUHA 4QZVB 1DQ8A 4RNMA 1QSYA 4OV1A 2UVVA 1HNWF 3LH2S 5KFDA 3DRPB 2Y1IA 4B17A 3BQ0A 2RDIA 2NPFA 2VB6A 4W92B 4NLOA 2DRAA 1F5CA 1KFDA 2V2KA 1GX6A 1PC4A 4Q0BB 2EI5A 2UZAA 2PDAA 4PXBA 1G2EA 1U26A 4LF6F 4IYQA 3FGVA 5F8GA 4RU2A 1FXLA 4QIGA 4KJIA 1IBMF 5F9NA 4K5RA 3LP0B 2PT0A 3HJFA 1S48A 2KFZA 1F2GA 1S6OA 1SIZA 2Z8QA 3BR9A 1TKTA 4Z2XA 2B6AA 3K5OA 3MM9A 3CJ5A 3D0HE 2R2RA 2BJEA 2B9XA 2YKNB 2YKMA 1SIWB 4XK8C 4C98A 2RT3A 3CEDA 4AXJA 4NCGB 1TL3B 3M2RA 5CZXA 2E1MC 1C2PA 2PA3A 2XHWA 1JK9B 1LFWA 3W2WA 2NR0A 1XC9A 2KVIA 1KLNA 3OVBA 1VRUA 2ILZA 3IBWA 3JTPA 4WFZA 2ROGA 1UVKA 1R31A 2DNMA 3BO4A 2XBPA 5B0GA 1SJRA 1HPZB 4KGMA 1RT7B 4Q0BA 4OX7A 1EP4A 1QVGR 3RZAA 4IUFA 4DS4A 4DR7F 5GADI 1U6ZA 2XMWA 3VAKA 3QGGA 1RT3B 2W25A 1D9DA 5A0YB 2F7VA 3DOKB 2HRYA 1U48A 2MZ1A 4B3RF 2VFTA 1Y4ZB 3MTJA 2MJNA 3NBPA 4NLPA 3KLFA 4K4XA 1UMJA 4F4XA 3MD1A 2VKZG 2WTFA 4Q7AA 2OPSB 5IQ6A 4LQ3A 2PMZD 1HNVA 3DMJA 4O3OA 1RT1A 1N5VA 2NSBA 5KFOA 1SV5B 3KLHA 4G6VB 3MAQA 1RTDB 5C42B 3PEJA 3I0SB 4C97A 3PEHA 2W9BB 3NS6A 2ZH9A 3CDAA 2WK4A 4OI0A 3D1HA 2LLZA 1N52B 5T7LB 3MWBA 1QE1B 3DLJA 5K5MA 3NAIA 2DR7A 5B0FA 2OD6A 2BA9A 3TRGA 2CJAA 4AL5A 3MM5B 5I3PA 3GIIA 2FJXA 5A6WA 2LEPA 3Q2TC 4NL5A 4EO6A 3TNVA 2KFYA 3P49B 1U6FA 2G0CA 2M7SA 3MD3A 1REVA 4BCAA 1JJ4A 3BZQA 3RRGA 2XNQA 5DM6Q 2N7CA 1S6QA 3WZ0A 5AXMA 3BO3A 3M9MB 3CJKB 2X51A 5C25A 1FXRA 2F1FA 5CCMA 4H4OB 4BHQA 3H59A 4C0HA 3N28A 3OFGA 4XDCA 4ES2A 3FDSA 1TAQA 3I96A 4ZPWR 4ECVA 3U1NA 1F5AA 2LDYA 2M70A 1NJXA 1KLMB 4B3OA 4JV5F 3RAXA 1LXNA 1RTDA 3MCSA 1SV5A 3C6UA 5E3QA 5HROB 4C8NA 5GAHI 4FXVA 2KJWA 3T1AA 2RE1A 5DQHA 1X0PA 4Y2KA 4NA2A 3J81Y 5M2PA 4OX9F 2VBZA 1D3WA 2P6SA 5IWAF 3BGFA 1IKWB 4FPRA 4B9TA 2B0GA 1RYRA 3PM9A 2NYIA 3I31A 2IRUA 2XZWA 4A8OA 5DG8A 4J9MA 2IFXA 1IBLF 1S9EA 2DR5A 4NYZA 5M2UA 4IO9Q 1G6BA 1LW0B 3ZZYA 1ZTTA 1K0TA 2IM1A 2CVIA 4C8KA 2IYGA 3WDOA 2V4RA 2VA2A 3DRYA 1X8DA 1JLGB 3U1LA 4KSEB 2OMLA 3HKZD 5AE3A 1BGXT 3PACA 4WK1A 1HI8A 2YX7A 1LW2B 4ZVFA 4Y28C 4RNNA 2YNFB 2OFGX 1OWXA 3LGNA 2E5HA 3WX4A 5A8RB 2V0NA 1YGYA 2HAIA 3NKYA 5HI7A 4B9SA 4CT8A 1P27B 3SCKE 5KFNA 3NCQA 3EGZA 3MDFA 5B0DA 4QU6A 2OMOA 2ZBIA 3IAM9 4RW4A 2X1BA 5D4PA 4CT9A 4ETXA 4A8WA 2LEBA 2OLWA 1XMBA 3K57A 4C0OC 3J7A1 2DO4A 2VFSA 1YJTA 4C8LA 2C3MA 1RT2B 2LKZA 3HHLB 3Q23A 2HIQA 3BM7A 4J9LA 4HH0A 5KG1A 3MMCB 2IYIA 3OFFA 4EWTA 4DBQA 4NA1A 5D4NA 3BDEA 1DLOA 4C7QA 2GX8A 5KG2A 1GTHA 2ZNYA 1NB7A 2VG6A 4DL0C 2BUNA 1KSPA 2ROPA 3PX6A 3DRSA 2FJEB 4MK9A 2FUG9 2ZNZA 3V4IA 4O3SA 3RBDA 3EGNA 3SSQA 2R2TA 4GKJF 1S4FA 4WKRA 2B3TB 2RRNA 3IC1A 4J9OA 3QO9A 5C24A 4TY8A 4MTPA 3EXCX 2YQ3A 3E01A 4ZP6A 3BN4A 3MUVP 2R8HA 4A8XA 2ZJQQ 3V6KA 2OPQB 4NLQA 3K8VA 1UKUA 3LP2B 1YJUA 3MM8A 1LK5A 4ZP9A 2VQEF 2UUCF 4KIAA 2ADCA 3OSPA 3W3SA 2XG8A 1U2RA 3PX4A 4HKQA 4B3SF 5E3RA 1U1QA 2ALZA 4DUZF 2ZOGA 2E1RA 3M9NB 2VONA 3CDUA 2HGMA 4LF7F 4DL3A 3V81B 3HHLA 3FEYB 1CG2A 3H20A 4WKYA 4YR2A 3EZ5A 2ZDPA 2BJDA 2W7OA 2HHWA 2AP6A 1KOOA 4DV4F 5CHCB 1D9FA 4CO3A 3VCDA 2ZC4A 4I1TA 4LT6A 1RT6A 1XERA 1URNA 2NXUA 1U6BA 2J6SA 1A7GE 2JL9A 4ID5A 4CCHA 4KHRA 1XR5A 3VAJA 5J1EB 4KFBA 1WTBA 4EGLA 4A8YA 3RB3A 4FS1A 4IH6A 4OJ1A 1S6PA 3CC4S 3U27A