5CYQB

Hiv-1 reverse transcriptase complexed with 4-bromopyrazole
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
424
structure length
415
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Rapid experimental SAD phasing and hot-spot identification with halogenated fragments.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase
total genus 117
structure length 415
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5cyqB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cyqB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cyqB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cyqB03
3MEDB 4KHMA 2HNDA 3MR6A 4K4ZA 3LP2A 1HMVB 2IAJA 4O4GB 4ZPAA 4EYIB 1JLFB 3SFGA 1REVB 2I5JB 2YNIB 2F8EX 4TY8A 1JLGB 3FQLA 4IFYA 1DTQA 1K1QA 2VA2A 4IRDA 2AU0A 1DTTB 1S1UA 4IG3B 2JEIA 3KHHA 1JLEA 1SV5B 2OPQB 1I6JA 3RB4A 1S6QA 5L1LA 2FVSA 3KLGA 2FJXA 4J9QA 3KMQA 1RTIA 3HVTB 5KG0A 2W9CA 4KV8A 3BGRA 2VG7A 1RYRA 1BQMB 1TVRA 3ISNC 4ED2A 3I0SA 4MFBA 4KE5A 4DL5A 2J6UA 3BSNA 4H54A 1C0UA 5HLFB 4M95A 4HKQA 1JKHB 3OLAA 2RKIA 1N5YB 3T5HA 3PR5B 4KHRA 1JLBB 4IFVB 3KK2A 3BSCA 4MKBA 2V4QA 3V6JA 5HBMA 1JLQA 1T03A 1RTJA 3LP1A 2HWIA 4URQU 4IH5A 1NHVA 2I1RA 2WK4A 4FS1A 1TKXA 1QE1B 1KHVA 1ZETA 4MH8A 5KFDA 1S9FA 3M8QB 3G6YA 4JV2A 1MU2B 4RUCA 4IR9A 3DLKB 2UVWA 4KAIA 5KFWA 3CDEA 4TYAA 5KFGA 2WRMA 3FFIA 2IM3A 4O3NA 3KLFB 1RTDB 4RW6A 5J2MA 1RAJA 3FSIA 1NNDA 4TN2A 5KFLA 4RUAA 4NLYA 2ZE2B 4J9MA 1C0TA 3IRXB 2E9TA 3QIDA 5CYMA 2R2TA 5F9LA 5KT5A 1HNIA 2FVCA 4ECWA 2B6AB 3I5BA 3TAMB 1RT6B 3DOKA 2XC9A 4J9KA 5KFFA 1S10A 1S0OA 2W7PA 2RDIA 3PZPA 3KHLA 1IKVB 5K14A 4NRTA 1S1VA 3QLHB 4J9NA 5KFTA 5KFBA 4K4XA 3KNAA 1IKYB 1RA6A 2HMIA 1TQLA 4F4WA 2ILZA 5KFKA 2XI2A 4NZ0A 3DRSA 4RNFA 4GC6A 2R8JA 3MFHA 3MEDA 3Q8QB 3CWJA 1TKTA 4O44B 3RAXA 3N6NA 1YVFA 4J9LA 1HMVA 4O4GA 2FVRA 3E51A 3GV7B 3UPFA 1REVA 4ID5B 1JLGA 1W25A 4KO0B 4ZPBA 1LWFB 3LP0B 2GIQA 3QZ7A 1FKPB 4Q43A 3ISND 1DTTA 3T5JA 4EEYA 4IG3A 4ZVGA 1S6PB 5KFRA 3BSOA 4EYHB 2HNYB 1SV5A 4XPEA 2OPQA 1RT2B 2R8HA 4K4SA 1RTIB 1BQNB 2R2UA 4PWDA 3ICLA 2UVRA 2VG7B 3HVTA 1ZTTA 1T05B 4WFZA 2XGPA 4ED3A 1OS5A 3H98A 4H4MA 1BQMA 1IM4A 2GIRA 4NRUA 1C2PA 1RT5B 4F4ZA 2W7OA 4M94A 5HLFA 2AX0A 2V9WA 2AGOA 1JKHA 1JX4A 1N5YA 2HAIA 4KB7A 4QPXA 1JLBA 4IFVA 4XPCA 1T03B 3H59A 4ED6A 3LP1B 4RW4B 4IOBA 2B5JB 1TKXB 2R8IA 2VG5A 4IH6A 5KFHA 1TKZA 1QE1A 1RT4B 4MK7A 5HP1B 3MF5A 3M8QA 3H2LA 4O3RA 2ZKUA 3DLKA 2IMWP 5KG3A 2QE5A 4ICLB 2UVVA 3C6TB 3NBPB 5C24B 4K4TA 3N6LA 4ECXA 1RTDA 2OPSB 1C0TB 4EBDA 2AWZA 5CYMB 4FBUA 4TLRA 3N6MA 3IRXA 1TP7A 2BQ3A 4WZMA 2B6AA 1RT6A 2YKMB 2YNGB 2W8LA 4Y2CA 3RB3A 3DLEB 3V6HA 1S1VB 3G86A 4Q8EA 2JEJA 3QLHA 2HMIB 4LQ9A 4ECUA 2C22A 1IKYA 3TQ1A 4RNNA 3BQ0A 1R0AB 5J2NA 3OHBA 4I7FB 1TKTB 2FJVA 2IM0A 5DLGA 5C42B 4RU9A 4Q44A 2J6TA 4J9OA 3KOAA 2ILYA 2ZD1B 4LSLB 4O44A 2RF2B 1S4FA 1HYSA 5KG4A 4ID5A 3CVKA 1QUVA 2E9ZA 3RBEA 4KO0A 5F8NA 1LWFA 3LP0A 1JIHA 3UDLA 1FKPA 3T5LA 5F8IA 1S6PA 4O3PA 1DLOA 2HNYA 4PWDB 4I2QB 1RT2A 5C5JA 1HQUB 2R8KA 1BQNA 3EZUA 2V0NA 2JEGA 4H4MB 1T05A 4ZVHA 3KHGA 1TV6B 3DYAA 4QW8A 2ASJA 4Y34A 4TQRA 3H5XA 3EPIA 1RT5A 4J9SA 2CJQA 3NKYA 4J9RA 1HNVB 1J5OB 2B43A 1SH2A 5KFOA 3LANA 3MEEB 1S1WA 1IKXB 5F9NA 4R5PB 5KT4A 3M9OB 1KHWA 4RW4A 1D1UA 2VG5B 2B5JA 4RNHA 2DPIA 4KKOA 1LW0B 1TKZB 3DOLB 4O4RA 2OPRB 4ZMMA 1HARA 4IR1A 4EO6A 3GIJA 5FDLB 1RT4A 3MEGB 3M8PA 1EP4B 5HP1A 5KFIA 5JUMA 3KLVA 1S48A 3BSAA 1LW2B 4MKAA 4ICLA 3T19A 4NYZA 4ZVEA 3C6TA 3NBPA 3PW2A 5C24A 2R2RA 2OPSA 4TY9A 1RTHB 1EETB 3V81B 3PJXA 3T5KA 4NCGB 4NLDA 3H4BA 3BR9A 2BQRA 3NAHA 2EC0A 2YKMA 2YNGA 2C2EA 3IGNA 3DLEA 5KFQA 5KG5A 5KFAA 3CJ2A 3M9NB 5J2NB 5KFCA 1IKWB 5HROB 1R0AA 3QGHA 4ZP6A 2W9AA 5DLFA 4ZHRB 3RAQA 4YR0A 4I7FA 5C42A 3KLIB 3PHEA 2VA3A 4HYKA 3D28A 2ZD1A 4LSLA 1HYSB 3OLBA 2RF2A 4Q45A 1S97A 2JC1A 4NLPA 1XR6A 4U6PA 3H4DA 1DLOB 3MECB 1SH3A 3IGVA 3QZ8A 4I2QA 1TL3B 1HQUA 1WNEA 1FK9A 4ECTA 2BR0A 5EWEA 3DYAB 2XWYA 5I42B 1U09A 4QW9A 4ED7A 4ED0A 2AQ4A 1TV6A 4WE1A 2HNZB 3DRRB 2QV6A 5KT6A 3PW4A 1N6QB 4H4OB 1RDRA 4RW9A 4K4VA 4J9PA 4RNOA 4EBCA 3BQ2A 1HNVA 1S1WB 1J5OA 3DLGA 5DQIA 3MEEA 4I2PB 1IKXA 4RW7B 3BREA 3KHRA 4R5PA 4KKOB 3Q8PB 2V4RA 1S0NA 1MMLA 3G6XA 3IS9B 3KLHB 2OPPB 1LW0A 3I5AA 3DOLA 3HVWA 2OPRA 3C6UB 3KMSA 3M8PB 2BANB 5FDLA 4ECSA 3CJ3A 3MEGA 1EP4A 3DDKA 1XR7A 3OSNA 2CKWA 4WXOA 1SUQB 5DG7A 4MIBA 1RT3B 1JLCB 1LW2A 5KFPA 3OL7A 5C25A 2BRKA 3MR5A 2BE2B 1S9GB 2D7SA 4NLRA 3MFIA 4RW8B 1S9EB 2DPJA 1RTHA 1EETA 3V81A 3Q8RB 3GV5B 5DQGA 5J2QB 5J2PB 1QAJA 2AGPA 4PQUB 4NCGA 1T94A 3NAIA 3I0RA 4NLQA 1N4LA 4NLTA 3QYYA 1C1CB 3DMJA 2XCPA 4DL2A 4DEZA 4IKAA 5DG8A 4IDKA 1RT1B 2IC3A 4O3SA 2IJFA 3QGIA 4IG0A 2YNFB 1XR5A 3KJVB 2UUTA 5EWGA 3PW5A 4DL6A 4WZQA 3FQKA 1IKWA 2HWHA 5HROA 4LQ3A 3HHKA 4ZP8A 4F4YA 4JV1A 4ZHRA 5F8MA 2JC0A 4R0EA 3DRPB 1HPZB 3DI6B 3CDWA 3KLIA 3PW0A 4FS2A 3V6DB 4MK8A 3BJYA 3UR0A 2ASDA 5L9XA 2YKNB 2XI3A 3RB6A 4KSEB 3GYNA 3IG1A 3HKWA 3CIZA 3MECA 1C1BB 4JUZA 4K4YA 1FK9B 1VRUB 5L1JA 4NLSA 5F8HA 1TL3A 4Q0BB 1KLMA 4DG1B 4YMEA 4WYLA 4WE1B 5KFSA 5I42A 3MTKA 1T3NA 3OL8A 1UWBB 1S1XA 4YR3A 3GILA 3Q8SB 2C2RA 2HNZA 3DRRA 4RW9B 1CSJA 4QWEA 1N6QA 4H4OA 5D3GB 4NLOA 4B3OB 4NLVA 4MK9A 5EDWA 4K4UA 2JEFA 3VQSA 2XCAA 4O3QA 3DLGB 3OHAA 4F50A 4KBIA 3CJ5A 1TL1A 2XGQA 2UVUA 3QGGA 5KFUA 4I2PA 3I5CA 4RW7A 3RBDA 3V4IA 5EUHA 2WB4A 3H40A 3IN5A 3V6KA 3IS9A 3KLHA 2OPPA 3RB0A 2R8GA 2UUWA 4JV0A 3C6UA 2IBKA 3PR4A 4ED1A 2BANA 3KK1B 4K4WA 1LWEA 3H5SA 1GX6A 3H5UA 3JSMA 4G1QB 4OL8A 5DG9A 5KFYA 1FKOB 3OSPA 3QIPB 5C25B 5EWFA 2ASLA 1SUQA 4XO0A 2BQUA 1RT3A 1JLCA 3ITHB 3GV8B 2C28A 4GC7A 4X2BA 2BE2A 1S9GA 2W9BB 1ZTWA 3QO9B 4PUOA 4RW8A 1S9EA 5I3UB 1VRTB 3I0RB 5J2QA 5J2PA 1JLAA 3DMJB 4PQUA 2C2DA 1LWCB 2D3ZA 2GC8A 2ATLA 2FVPA 1C1CA 4IDKB 4YR2A 3PW7A 2IC3B 4ZPDA 2VG6B 3FDSA 3PJWA 4KFBB 4IG0B 4EO8A 5J1EB 3KLEB 1RT1A 3CJ0A 5DGBA 3GIIA 2RDJA 5L1KA 3CO9A 2YNFA 3KJVA 1HQEA 3D5MA 1RT7B 3MR2A 5KFMA 2FJWA 4ECVA 2AGQA 3DM2B 2D41A 3SFUA 3E01B 4ZPCA 5CYQB 4FBTA 2W8KA 5KG2A 4YP3A 3KK3B 5JXSA 4RNMA 3LAMA 1QAIA 3HVAA 4ZP9A 2IA6A 4ECRA 3DRPA 1HPZA 3DI6A 3CJ4A 3FRZA 3V6DA 3CDUA 4ECQA 3IG1B 5DGAA 2YKNA 4MIAA 3JYTB 4RZRA 4IQXA 4TQSA 2WONB 5L1IA 2AX1A 2FVQA 3OL6A 4QWDA 4R8UB 3GIMA 5KFJA 5DQHA 1C1BA 2O5DA 2YNHA 1KLMB 1VRUA 1RA7A 1RYSA 4NLGA 1S1TB 3NL0A 4LSNB 4Q0BA 4DG1A 4YQWA 3H5YA 4Y3CA 1S1XB 3GQCA 4ZP7A 2WOMA 2HNDB 5KG7A 3GIKA 1N56A 3LP2B 1UWBA 2IAJB 4WFYA 4ECZA 4EBEA 3NGDA 4TY8B 5D3GA 1JLFA 5KG1A 3G6VA 4IFYB 4B3OA 1DTQB 2FLLA 2I5JA 2YNIA 4ZVFA 1TL1B 3TVKA 2WTFA 1S1UB 5KFVA 1JLEB 3V4IB 5KT2A 2E9RX 1S6QB 5KT3A 3EPGA 3PVXA 4Q8FA 3KLGB 5KFXA 4F4XA 2WCXA 4QWBA 2W9CB 4KV8B 3BGRB 4K50A 5T14A 1LWEB 4DL4A 2WHOA 3JSMB 1TVRB 3KK1A 3I0SB 4MFBB 1SH0A 4G3IA 4G1QA 1C0UB 1FKOA 3QIPA 2RKIB 2D3UA 4TXSA 3ITHA 5F8LA 5KG6A 5KFEA 4PUOB 1GX5A 4QWAA 3KK2B 4WFXA 2W9BA 2J6SA 3QO9A 5HBMB 2IM1A 1JLQB 5I3UA 1RTJB 1JLAB 1VRTA 4Y2AA 5F8JA 1Z4UA 4IRKA 4O3OA 1LWCA 5KT7A 2JLEA 3LALA 4ECYA 2VG6A 3M9MB 4KFBA 5J1EA 3KLEA 2ALZA 4IRCA 1HQEB 1MU2A 4U7CA 2IM2A 4WXWA 4URGA 2FLPA 2OH2A 3FFIB 1RT7A 4NLUA 3NMAA 4RW6B 5J2MB 3DM2A 1NHUA 3E01A 2FLNA 5CYQA 1JXLA 3KLFA 3MR3A 4IH7A 1D0EA 4DL3A 1N48A 3KK3A 1K1SA 4WYWA 1HNIB 2ZE2A 4ED8A 2IJNA 4NLWA 5KFNA 3DOKB 4QWCA 2R2SA 3UQSA 1S49A 3SI8A 3TAMA 3OL9A 5K14B 3LAKA 5F8GA 3JYTA 2WONA 1IKVA 3T1AA 4DL7A 5KFZA 4R8UA 2YNHB 4URSA 4TYBA 4NLXA 3DRSB 1S1TA 2WOMB 3BQ1A 4LSNA 1S0MA 2BRLA
chains in the Genus database with same CATH superfamily
3EUNA 3IR6B 4O4GB 3BN7A 3SFGA 4DQIA 1X9SA 5DO2A 4LR8A 1S1UA 1S6QA 2K3KA 2FVSA 3D1OA 3GP9A 3OFHA 4QBUA 2K3IA 4L73A 1U6ZA 5DM7Q 1JKHB 3GJSB 5F0WA 5HMZA 1DARA 4C3KA 2DY9A 1T03A 1HBOA 3LP1A 3I4PA 1HWIA 1QAYA 4UOHA 3W8PA 5F9LA 2CQPA 4ID8A 2IRXA 1XIQA 5KFBA 3BGFA 1XMQJ 2DRBA 3RTVA 2HURA 3ZO7A 2H1YA 1LFPA 1YSJA 1KTVA 3DCAA 2OMLA 3H2UB 1TU0B 1R7IA 2OEKA 4JYAJ 2W7OA 4DV6F 3T9ZA 3M6VA 1K44A 3T1YF 2XULA 3MURP 1UTAA 5KFHA 1G2EA 3NS5A 2I9SA 2MYFA 2AF6A 4ECXA 5M2PA 3M32B 3HCXA 1O6XA 4X4UA 3T1HF 3TAPA 4ZOSA 2DNMA 2QL5B 3IAM9 2KRBA 4LQ9A 3IWLA 2J0SD 3OHBA 2AHOB 3K59A 4RBUA 2RQKA 1KONA 3GMGA 3BZQA 3MMBB 4DR6J 1QSYA 5IT9U 1SH2A 4WU2A 3NNHA 3K58A 2VG5B 4IO1A 2CQIA 4LBHA 3IO1A 2V2KA 3MEGB 3M8PA 5HP1A 4GVBB 2FJBB 5IXUA 3T19A 5ETMA 3PW2A 2R2RA 1NKCA 3TAQA 1T9VA 3NS7B 4NCGB 4ZVOB 3UD4P 3BR9A 5A76A 2IJRA 3A8EA 1H7XA 1SJ1A 4FXVA 2JLGA 2POKA 4QQBA 1X7VA 1ZM3A 4WU3A 1UJ6A 2DEJA 4ZP6A 4ZHRB 2XMKA 4YR0A 4ZITA 2XMWA 4OMFG 4YY3F 4NZ6A 2YH0A 3PX6A 3HT3A 5I42B 3A3OB 2GHVC 2W25A 4JI8F 4K4VA 4CH7A 3MM8B 3MM9A 2HQDA 3VHQA 1JJHA 3I5AA 1NH7A 1VBYA 1L3UA 2QSWA 2R7SA 3DDKA 3OTCA 2CQ0A 2NZ4A 1SCJB 5ETLA 2UUCF 1G6BA 1RT1B 1F6TA 2FTRA 1UVLA 4DV7J 3PKMA 3QSYB 1NZ8A 3LGNA 4DSFA 2R7TA 3CT9A 4JI3F 4NCAA 3ZZRA 4FS2A 1RAHB 4KSEB 3LUYA 3J7Z5 2YKOA 2BEFA 1RAAB 3R1HA 2HBYB 4LF5J 2E7VA 2WSCC 3LPYA 2ZHBA 1VQ6S 1WELA 3Q8SB 1CSJA 4QWEA 3QATA 1N6QA 1FFGB 5G0RA 2IDEA 2XCAA 1RCXB 4R25A 2J7KA 2XGQA 4F0MA 2B7CB 2OEMA 4P74A 2R8GA 4LIRA 5AXNA 2DIUA 4AFFA 2BQUA 3OPKA 1NJIT 2W9BB 4QIWD 1UEUA 1W7WA 4YDDB 2CUYA 2D3ZA 1C1CA 1T7PA 4RUHA 1T9TA 2VG6B 1TFYA 7AT1B 2IA0A 3I96A 3D5MA 1VQSA 3MI7X 2AGQA 5CYQB 2GGPA 5LOQA 2AJ4A 1VQ8S 2M52A 3GZ7A 1NPKA 1MW7A 3M30A 2EFNA 1Q8KA 1B70B 2PI4A 1RA7A 5HVGA 3T41A 2O66A 2CVEA 1DZ5A 2QRRA 4F3QA 2YWFA 3UDEA 2M88A 3M1VA 4TY8B 1SBRA 2WTFA 3VF0B 2V34A 1YZ7A 3SBMA 1FNOA 1TVRB 3RRHA 2RKIB 2X7IA 4TU7A 3ITHA 2RU3A 1NJYA 3SIPB 2IM1A 4JOUA 4OHZA 2UXDJ 3NS6A 4FYYB 2HRYA 2JLEA 3HX9A 1PIEA 3MPVA 2FLNA 2EFQA 3D6HB 1HNIB 4KGXB 2DY1A 1N88A 3TZWA 1XMQF 5BR8J 4DJBA 3GWCA 5MAOA 1HL6A 1RAIB 1FRMA 3MEDB 1HLWA 2Z4PA 2V8VA 2YNIB 2DNYA 3FQLA 1NSAA 3HSJA 4QIEA 2LDYA 1FNMA 1MMDA 4Q7AA 2XYHB 5A0YB 4JYAF 1YJRA 1CJTA 3TWZA 1R8BA 2QA1A 3DXBA 3M8YA 3T5HA 3M2RA 4NE9C 1FNXH 2ZH8A 1ZETA 4L6V3 3KUGA 3M8QB 1SKUB 1RGVA 2ZHOA 4QZVB 2W2OP 3W60A 4KPYA 1I94J 1U24A 4DR3J 4OHVA 1WKLA 3I5BA 2XC9A 2EVZA 4J9NA 2PA8D 2QN6B 4USJC 4GC6A 1V5VA 1JB0C 4OIXA 1NAQA 2XMVA 1NJWA 4DR6F 1LWFB 1S6PB 4DZDA 4QJVA 3CB4A 2A10A 4Y2KA 3Q8UA 1A9NB 2RE1A 1PAEX 1YKWA 2AGOA 1KC8T 4KB7A 5H9FK 4IOBA 4CO0A 2I8EA 2VG5A 4KT0C 3EZ5A 3H2LA 4M5NA 2XSJB 4HR2A 4ES1A 3D4JA 5CYMB 2Y0BB 2BQ3A 1BC6A 4BDPA 2YNGB 3KKFA 2OJ3A 4CM2A 2NZCA 4DZ6A 1TUWA 2A1BA 3G4SS 3W8GA 3CC4S 4DN9A 4B02A 2RF2B 5F8IA 3IXQA 1RT2A 4B3SJ 2DGVA 2CADA 3EZUA 2NXJA 5CZXA 2ZH7A 3KHGA 2HK2A 4ZPVR 3MM8A 3HULA 5F9NA 4R5PB 4C8MA 3MAHA 4LF6J 3C66A 1FI4A 1HARA 1QY7A 5FDLB 1EP4B 3B4DA 5MLCV 1NSPA 4FF2A 1NDPA 4DV7F 5CAAA 3OFGA 5E3AA 2ZNYA 1O51A 5KFCA 1Y5IB 4MMOA 1Q0NA 2GNKA 3C46A 1T95A 4Q45A 4LF5F 1HWJA 1H38A 2NSCA 5D4OA 3EWGA 1OYDA 4I0WA 4BC7A 4ED5A 2SXLA 2M3DA 1LK5A 2HNZB 3G71S 2N4CA 2HWTA 1R8CA 3KFWX 3HF5A 1MMLA 3KLHB 1F3FA 3DU5A 2DIVA 5KFPA 4TNOA 4ZLLA 4I67A 3BBBA 4I56A 2Z2MA 4N8NA 5J2QB 1VI7A 5I3QA 2ZUAA 1WOPA 1KBRA 2X1BA 4OZ0A 5EWGA 4OJGA 1RXOB 2BJEA 2VPYB 2VOPA 5A8RB 4W90B 4MK8A 2DNNA 3BBCA 1TL3A 1T3NA 3SDEB 4H4OA 2EG2A 4DFPA 3HHLB 4I2PA 2ZH5A 5EUHA 2LU2A 4M5DA 3J81Y 1TR0A 1EQMA 4PPDA 3MMAA 5E2QA 2UXDF 5CXTA 3OR1A 3R97A 3EGZA 1GMVA 5IS2A 5J1PA 2K7KA 2K7JA 4HH0A 1H98A 2MZTA 1MROB 4ECVA 1VMBA 5BR8F 2HVEA 4HHUA 5DM6Q 4YN3B 5A8WA 3CJ4A 2YKPA 4TQSA 3AFGA 4QWDA 5KFJA 4KIAA 4W98A 3N0VA 1GXTA 4ZP7A 2XB2D 2B3TB 3W2VB 2YNIA 1B0VA 3D54A 2NUHA 3PVXA 4Q8FA 4NASA 3OW2R 4EFAC 3KK1A 4Z37A 1FDAA 4N41A 2FJEB 4MYTA 1N5TA 3MUMP 3LTOA 3EDRB 4ZCIA 5I3UA 5F8JA 2ALYB 3QFWA 1I94F 4ECYA 3MPYA 4DR3F 1QTNB 2MB0B 2W4PA 5D4LA 4NLWA 2Z0GA 1S49A 1SIWB 3AJDA 3WZ0A 5BXIA 4DFMA 4WTYA 4FYXB 1WG1A 2Z2LA 1RADB 3WC0A 4WBFA 2IAJA 1S12A 2D9PA 2XNRA 2I5JB 1X4HA 3ZNUA 1LK7A 3GR0A 1SV5B 3NXZA 2LEAA 5KG0A 4DPXA 2HGMA 3DGVA 3I0SA 4DL5A 3BSNA 1W2IA 1CPZA 2OLWA 2VB6A 3R6LB 5KAKA 3HMJG 2DR9A 1YZ6A 1R6YA 4U95A 3RYLA 3IA0A 2MLYA 4L74A 1H72C 4NLYA 2ZVSA 5CYMA 5E3PA 1SJ3P 2K8GA 1FHTA 1IBLJ 5F3TA 4K4XA 3HFZB 4F4WA 4DPWA 3DRSA 4MKVA 1FE0A 1P9YA 3AY0A 1HMVA 3MTJA 4B3SF 3VQTA 5KFRA 2R2UA 2QL9B 3J81U 1IJEB 1ZTTA 4DPTA 4DSEA 4LF6F 2VHGA 5D8HB 2KXHA 2W2PP 1MG7A 3CIMA 1O0PA 2RILA 4FBUA 1ZPWX 3N6MA 4WZMA 2J9DE 4HI2A 1U2FA 2JEJA 4DDFA 2C22A 1IKYA 4RNNA 3GU0A 3AXKA 1GXLA 2A6OA 3I55S 5K5MA 1GAOA 1FD8A 1I5OB 4ID5A 4O3PA 2XLJA 2FD2A 4K2XA 3F0NA 5I4MA 4USVA 5IC6B 4ZPTR 2J76E 5GMEA 1HNVB 1IUJA 5KFOA 3BKFA 4RW4A 1D1UA 3H8YA 1HI1A 4OYOA 4OX6A 2MGZA 4N56A 1UP1A 2ZJPQ 4PG5A 4CO3A 2J9CA 4OZNA 4PEOA 3CD0A 4QR1A 1D9DA 5DS7A 1VK3A 4B9NA 3I4HX 3VCDA 3QMQA 1T9WA 2KXNB 4I6YA 3FEXB 1SH3A 2OUGA 3BR8A 4JI6J 3FRYA 3JQKA 3KG4A 4P2FA 1IVZA 1U1KA 4L72B 2L9DA 3G6XA 3IS9B 3QAUA 3C6UB 2M0GB 1VFJA 1VS3A 3FBBA 1X60A 2QJ3A 2BE2B 2UUBJ 2DPJA 4K7QA 2XNQA 2RAQA 2UXCJ 4UZCA 1C4AA 5BYRA 4LQ3A 1S99A 3EGNA 2CWXA 1IQZA 4LRAA 2GO9A 1TELA 4B9VA 2FJAB 3I9ZA 1FK9B 3AODA 1M0SA 3NWGA 4Q0BB 4YMEA 4GKKF 2PEBA 5KFSA 1FWPA 4RW9B 3VQSA 2FY1A 3I5CA 3DNCA 2IBKA 2PC6A 1GX6A 2J7WA 1HBNB 4ZJLA 1RHKB 2J9DA 3VGUA 2KT3A 4QCLA 2U1AA 4ZIVA 2PDAA 2ATLA 4N7TA 4IDKB 3POTA 3E01B 3M2UA 3UDVA 4M5IA 3HT0A 1A7GE 2K1RA 3L7UA 3FUYA 1SL1A 2KFZA 2QFJA 3FRZA 4WIQA 3BH6B 2E7XA 3WIVA 3ZTRA 1KLMB 3CCTA 4B3MJ 1HWUA 1RI7A 2BE9B 1NK0A 2X51A 4WFYA 1RK8A 3MMJA 1X5OA 1FWKA 2I5JA 4KV8B 2P9EA 2WHOA 2KM8B 2CQCA 1FD2A 1P6TA 2PN6A 1QDUB 4YOEA 1V3SA 3GYGA 1JLQB 1L5UA 3VWSA 3OV7A 5GMDA 2AJ2A 2VFUA 1VDHA 2WB1D 2IIHA 2MY7A 1N48A 2IJNA 1VBZA 2Y0SD 4NX9A 2DGWA 1TZ0A 4ZJOA 4ZPWR 5KFZA 1GEHA 3PYDA 2HNDA 2F8EX 3SQGA 2VA2A 1YRTA 3SYZA 4W4MA 1GFWB 1U0HB 3KMQA 3HPOA 1KFSA 2N4DA 1RYRA 2A2DA 4QIVA 2VKZG 2G13A 4H54A 2LEPA 3HLUA 4DSKA 4A48A 2BX6A 4L3KA 2DTJA 3OXFA 3P4UB 1S9FA 1U1LA 3HXMA 4LJMA 2F40A 4I4BA 4TN2A 5J2MA 3FSIA 2CPXA 2W01A 3JTPA 3QJPA 3IBFB 1DBDA 4C48A 2E5HA 2CJ9A 4OZ2A 2KVQE 2IBOA 2ILZA 5KFKA 3G2XA 4B9UA 2CPZA 4O44B 2QFIA 3R5BA 4AD6A 2ZKTA 4EYHB 2HNYB 5AJ3J 2OPQA 1BQNB 3H98A 3R7NB 2E29A 2GIRA 2LP4A 4NPOA 1UMJA 5AE1A 3RRGA 1FJCA 2AX0A 5H1SV 3CULA 2N3OA 2KFNA 2XY5A 5B0GA 4C8NA 1QM9A 5HMYA 3SCJE 2ZJRQ 5KG3A 2M8DB 5B0EA 5C24B 2ZC4A 4OX8A 4CO4A 2W8LA 1S1VB 2HBQB 2B4OA 3U7JA 2VDIA 4GRSA 4I7FB 1TKTB 2MXYA 2RRNA 1S4FA 4HDHA 4JI6F 4ALZA 1BHNA 3CVKA 1VC0A 2E9ZA 3M2VA 2FPHX 1OWXA 2B8QA 1P27B 3AB2B 3MHYA 2HLUA 3W2WB 1N36J 4WFBQ 2G1HA 1RE1B 2QYCA 3M6XA 3K8WA 1VQMS 4EO6A 1SC1B 2UUBF 4J7CA 2CXEA 4DPUA 3W64A 1FESA 1QSLA 3E2EA 2UXCF 2EK1A 1TL7A 4U7UK 3DKDA 4MT1A 2C2EA 1PCAA 1LFWA 1VQPS 2JZ5A 2CPDA 5HJYA 2BJ3A 1NEEA 2AW0A 1VRQC 1NMEB 1AUSL 2BJ9A 3WDOA 1S97A 4A8YA 3VGTA 3WHIA 1DLOB 3UCGA 1HI0P 2C2MB 2YWHA 2EFOA 3ETMA 1FK9A 2M9KA 2B4UA 4CO1A 3DYAB 2BJDA 1TV6A 2XQCA 3FVYA 1RDRA 4RW9A 2MTLA 1VR6A 1UFWA 1AB8A 4RW7B 4KKOB 3Q8PB 5FLXU 4QU7A 3BKUA 5HVHA 3OSNA 1LW2A 2MHNA 3MR5A 5ETTA 2NREA 2QMUB 5D78A 3G96A 4CZCA 2V2QA 4NLQA 2HFZA 2HBRB 4IDKA 3MM6B 1X5SA 4RL1A 3D66A 2EKNA 3DRPB 1L3SA 3DI6B 4EZ6A 3V6DB 2FZKB 4CT8A 3UR0A 4B3MF 3NGUA 4O0NA 2XS2A 1W2BR 1KLMA 2MDAA 3RR8A 5DJBA 1UWBB 3RW7A 4FVCA 5EDWA 3D6FB 5B08A 5GAHU 3CJ5A 5GAEI 5IOLA 3ZZPA 3H5UA 4QYZJ 3QIPB 3UNYA 3QO9B 1OQ6A 3N28A 4CNYA 1NK5A 5E3CA 3DMJB 2C2DA 2FC8A 4CLLA 3UWTA 1T8EA 4KFBB 4EMDA 4CIOA 3CO9A 3KJVA 5A2QY 1CS4B 4FBTA 5HMWA 2W8KA 3MUTP 3HK2A 3UN5A 2ROEA 3UO0A 4HACB 4MIAA 1GNKA 3IM9A 1RJJA 4YQWA 3MR7A 2NSBA 3LP2B 1CC8A 4UQTA 3E3XA 4ECZA 1PG5B 4XIUA 1LKZA 2QL7B 2C2ZB 4ELTA 2J7UA 4LFBJ 1I1GA 1U0HA 3FCHA 4M1KA 2CFXA 4MJKA 2CA9A 2KL8A 2ZFHA 2ZWPA 4MFBB 2EBEA 1TK8A 4WFXA 5GAHI 2J6SA 5HBMB 5ITHA 1AZSA 3JQMA 3GFYA 5IT4A 4UW2A 3NMAA 3FFIB 5AT1B 1FT8A 3MR3A 4DL3A 2MQPA 3D3CJ 1YQHA 3GG0A 1CQMA 3BN4A 2FHJA 3CCQS 4F02A 2ZDOA 1LV5A 1KVJA 3S6EA 5AJ3F 1XTZA 3MCOA 2HGLA 3HFVA 2JSXA 1NPRA 2HFVA 3I9V9 4DUZJ 3G82B 5AE2A 5CA5A 5L9NA 2GJ2A 3CJSA 3BGRA 3W62A 3TYTA 3OLAA 4F0KA 4CQ1A 1RTJA 4AUKA 3PEHA 5CHCB 1KHVA 2GQCA 4DFKA 5KFGA 2IM3A 5E7OB 4CYUB 5IQQA 2CQ1A 1RHRB 4DOZA 3OR2B 1OPZA 2CZVC 4LR9A 2E1AA 1WC6A 3P5BP 3US5A 4NRTA 5K14A 1RZMA 1S1VA 2PO4A 3RAXA 1TKTA 2BBEA 1N52B 3MGJA 1RTIB 2EI5A 5K8NA 1N36F 5HLFA 3RAMA 2F4VJ 1JLBA 1TK0A 4ED6A 1TMMA 2DR6A 1QE1A 2KDOA 3C6TB 3OTBA 2QZ8A 2LCWA 3IRXA 1ZAVA 1H2UX 4N47A 3C14B 4DV3J 2V50A 2V8DA 3G86A 4LRCA 4U9RA 2CYYA 4E0DA 2J6TA 4OYPA 4LF8J 2ZD1B 1ICEB 1YI2S 5EN1A 1DLOA 4ZLJA 2RJZA 3DYAA 4DBQA 2NQPA 3TZYA 2ZZTA 3PIPQ 4KKOA 3DOLB 4ZMMA 1VBXA 3CCSS 1X4FA 1FRHA 2C42A 5HAOA 1S48A 4B9LA 3NBPA 5IFMA 2OPSA 1RTHB 5LJ3Y 4B9MA 2KRRA 3BPDA 1NSQA 4FF4A 1GH8A 4WK3A 5J2NB 2NXEA 1IKWB 4ZVPB 5DLFA 2ZH1A 2XS7A 1HBMB 2L08A 3T3FA 5C42A 4HYKA 1XNQJ 3GFXA 3HHLC 3H4DA 1GMWD 1HQUA 2BKPA 5SUHA 1U09A 4ES3A 2H4WB 2GJFA 3AD9C 2JH3A 3A3PB 4AYBD 1S0NA 4QYRA 2BV3A 1LW0A 2OPRA 2HZAA 3PYGA 2O67A 1GMUA 1S9EB 1S77D 1D8ZA 1EETA 4OHWA 5DQGA 3GV5B 3WQPA 3KJFB 3DMJA 1HKAA 2H51B 3MD3A 4MIWA 3HHLD 4OYXA 1CS4A 1FTRA 3CJKB 3C8YA 3CE8A 3HSGA 5F8MA 1NM2A 1HPZB 3KLIA 2VPWB 4OJHA 3BJYA 4B9SA 1OY9A 2AMCB 4X4OA 2Z30B 4LUBA 5EHHA 2CG8A 1KQFB 1SKSA 1NB7A 4JI7J 1BMQB 2ZBPA 3VALA 4ILRA 3U1LA 4DHVA 3GILA 4LFBF 1GT8A 3IFEA 5D3GB 2JEFA 4U96A 3TUZC 2Y8YA 4RO0A 2LQJA 4ED1A 2BANA 4QU6A 1NUEA 1LWXA 3PNIA 1Z1ZA 4XK8C 4NA1A 4B17A 1VOMA 3TEHB 3R7BB 4EO8A 3JAMY 3GIIA 3KLEB 4DR4J 1DY3A 1M5KC 2IHR1 2FJWA 1VQ5S 2D41A 1ZZNA 4OYZA 2D3OR 1PYSB 3EVWA 5K20B 1QAIA 1YLXA 3BO3A 5DZ7A 2H5EA 1RWOB 4ANCA 2MZQA 4RZRA 3EXCX 4OLPA 4C6AA 2F8MA 3NRBA 3RW6A 3GONA 3GIKA 4DUZF 2RU9A 1DQ9A 1CULA 3OUYA 2W2NP 4X4NA 5LMUJ 2IMOA 1ZYQA 2HZVA 2BACA 4GKJJ 2AT1B 4LMZA 2D3UA 4HH1A 2WZ1A 1L3VA 1UEKA 2YX7A 2JX2A 1LWCA 2CWKA 1WSRA 2DGQA 1Q8LA 2IM2A 1RT7A 4UUWA 4LRFA 1JXLA 4IH7A 5LSLA 3KK3A 4K5RA 4H4KA 1CJUB 5K8PA 2WONA 2X3DA 4URSA 1YRXA 2H65B 3THPA 2B8PA 4JI5J 1BGXT 4DS5A 5A6PA 5ETQA 1UEVA 4ILMA 3ENWA 1RTIA 3H2VE 2F4VF 5D6GA 2VFSA 1N5YB 4DUYJ 3V6JA 5M2RA 2GS8A 3V2UC 1E6VB 3QT7A 3TUPA 1U1QA 4HLBA 1NHVA 4D3GA 2ASYA 3PRDA 1CJVB 3HFKA 4Q2LA 1RBLA 2C3UA 4KAIA 4WJBA 2NUUG 2WRMA 4O3NA 4DV3F 4RUAA 3TRGA 1WDTA 4DU7A 5KT5A 1Y00A 3NGSA 1GQEA 4ILLA 3NEKA 3PX4A 3QLHB 2QA4S 4LF8F 3TQEA 1UW9A 2OAUA 5J1NA 3LOUA 2VJUA 5K8MA 1EQ0A 3CEDA 3EYZA 3UPFA 4N77A 4ZPBA 3T5JA 4IG3A 5GAGU 2UVRA 3HVTA 2K06A 1FEEA 2YXLA 1P1LA 4IFVA 2CQHA 4S0MA 3MCMA 4OYMA 5A8KA 4MYUA 2ZVIA 3DLKA 2ZOFA 1MLAA 1OY6A 2M5YA 2QT7A 4C8KA 1HNZJ 2B6AA 1Y9OA 1RT6A 3LWMA 3DLEB 4NL5A 3P3DA 4ZN3A 4J37A 2MZSA 1XNQF 5J2NA 1WI6A 2QG9B 2JL9A 4LSLB 4N8OA 4ZVTB 4D3HA 1O5JA 2B9WA 4NA3A 4OZJA 2MZRA 1NCLA 4IO9Q 3MM5A 2FJDB 2OGUA 1SXLA 1K8AT 1I3OB 4DX7A 4NXMJ 1N34J 1RT5A 4J9SA 4UOGA 5T7LA 3NKYA 2BJ1A 1JJCB 3LANA 2HFSA 2HGNA 5GAGI 2CPEA 1E6YB 3N4WA 1OSCA 3GTYX 3DOMB 1HIYA 2M2BA 2CAJA 1H2VZ 4X4SA 2YBVA 2IRUA 4QIFA 2R7WA 3P5TL 1OO0B 2LXIA 2JFKA 1Y5LB 3TZZA 2KHDA 2VPZB 3G6ES 4U67Q 2L3MA 1HYSB 3ILLA 4JI7F 2LKZA 3MECB 2AZ3A 1OY8A 5LSRA 4RWWA 2AJFE 2HBZB 2DITA 3ZTSA 2GVZB 4KTQA 3KDOA 4A8WA 1BLUA 3BQ2A 4F8RA 1J5OA 4XAKA 2PMWA 1Q4RA 1CBKA 1N0VC 3IWNC 4HI1A 2YKAA 4RW8B 1HFEL 4DR4F 2AGPA 3RG6A 3C15B 1ZM2A 3F73A 3MAAB 1Q5YA 3SSRA 4DUTA 4DX8H 3UCZP 2E5LJ 4ZP8A 3MUVP 4JV1A 2O1PA 4J5OA 5IM0B 4O0IA 1M5VC 5FIIA 2FDNA 1JJ4A 5DETA 2HAFA 1YBAA 2KM8C 3ZTQA 2HIQA 4WYLA 3MTKA 3FEYB 2VODA 4UQGA 4UOFA 4F50A 2KT2A 2C3PA 4GKJF 2Q43A 3BGLA 2ACYA 1YHQS 2MKSA 1YBTA 3FSXA 1DAXA 1SUQA 2VF3A 3DRYA 2MQQA 2Y9HA 5B0BA 1VRTB 1C4CA 1LQ9A 5J2PA 3JTNA 4FYWB 4ZPDA 3E8OA 3O44A 5JXSA 3HVAA 2KZMA 1KN6A 2RHQB 2HQGA 2OFGX 4ECQA 5DGAA 3JYTB 4RBVA 3D0HE 1Q78A 1IBKJ 3QQCD 5DQHA 2HKEA 1KS2A 1N54B 4JI5F 3L9ZA 3ENVA 2DD8S 1Q1KA 3W9IA 1MMNA 4WIIA 2YX4A 1WWHA 1VHIA 3TZXA 3QBCA 1S1UB 5GADI 1S6QB 5KT3A 3JSYA 2HLTA 5ETOA 3GFZA 4DUYF 3J7AN 3JSMB 4P10A 4PCQA 1YJUA 4G1QA 3FBEA 3NWRA 1F1BB 1AROP 1W26A 4Z7CA 2KKHA 1HBOB 3HSZA 1FTCA 2RB7A 1PO6A 2BM1A 1H6KX 1EIYB 2DT9A 3GJQB 4RBTA 1VQNS 2DVIA 5U47A 4DN0A 4ETXA 3T1AA 1D09B 1M1KT 2V67A 5IV4A 3AA9A 2LYVA 4K4ZA 4ZPAA 3A3NB 1RWVB 1JLEA 3TX0A 5JMNA 2HFOA 4DL0C 1WEZA 2APOA 1FDBA 3W66A 2LMIA 4PXBA 2LA4A 6AT1B 2A0FB 4Y00A 3TANA 5AXMA 3AQPA 2IPOB 2C1EB 4ZLNA 1HNZF 3BV8A 5KFWA 3CMES 3ISZA 5KFLA 3C2PA 3QIDA 3TP2A 2ACMA 2MJUA 3GIRA 2Y8WA 5B09A 1OMSA 2V4JA 3HO1A 3KHLA 1IKVB 2RUSA 3O1LA 4CP5A 5D0HA 1RA6A 4PG8A 2EG1A 3Q8QB 1ROFA 4DS4A 1X4CA 1REVA 1JLGA 3AQOA 1DTTA 1N34F 3BF4A 1QVGR 4LRBA 2HAIA 2YPYA 3H59A 4ZVUB 2YVSA 3B6BA 5HP1B 3JS9A 3DOMA 3FK4A 1RTDA 2AWZA 1Q95G 4Y2CA 3RB3A 3CCJS 4DQSA 4ZA1A 1R0CB 3PX0A 1HYSA 3MWBA 4KH1B 5KG4A 2VH7A 5F8NA 3LP0A 4PWDB 3UD5A 4OYBA 3T6BA 3MOJB 1RACB 3OVAA 4ZVHA 4J9RA 1N0UA 2F8HA 2A6MA 1N8RT 4MKYA 5KT4A 4DV5J 3MDFA 4DSIA 4F7VA 3SEOA 1Q8BA 5FD1A 5F3ZA 3VZHA 1NKEA 5ADZA 2VQEJ 3NOCA 4FZVA 2DHGA 2YKMA 2E5LF 4V19J 3MAAA 3M9NB 2M70A 2I2YA 1R0AA 3VAJA 2H54B 4BS2A 1Q7LB 1F3VA 1JQGA 2DH8A 1WOOA 2UU9J 2VD3A 3SMZA 3Q24A 2B4VA 2R4FA 2BMBA 4JBCA 2ZH3A 4I2QA 1UPMB 2MKJA 1EKRA 2BJ8A 3QJJA 4F0HA 2AQ4A 3QT5A 1N6QB 5G0RB 3PCOB 3MEEA 4F4KA 4C98A 1T0TV 4ECSA 3F44A 4LRDA 4DMZA 4CLPA 3OL7A 2Z56B 3VAMA 4CM0A 1XN9A 3Q8RB 1ZM4A 1B0PA 2L41A 1ZM9A 1C1CB 2V8PA 1JMTA 1RWWB 5ETPA 2BW2A 1WOSA 2GGPB 2RD5C 1Z2ZA 2HWHA 1G4CA 2PIIA 1IBKF 4R0EA 4OI4A 3PW0A 2ASDA 3M30B 3DLHA 2OD4A 3BB5A 4GO7X 3SSSA 4F67A 4Y28C 5SZTA 3VVUA 3M1VB 4NLVA 4MK9A 1WHYA 2GMHA 3EVOA 5HVFA 1YTYA 4A4JA 3SCIE 3UNGC 3JSMA 2MZJA 2DO0A 5EWFA 5C25B 2D9OA 3ITHB 3GV8B 2ZBRA 1S9GA 1WTBA 2DGXA 1D9FA 2I38A 3C16B 3PW7A 3D0IE 5DDPC 4CRJA 5DGBA 2CDQA 2F9JA 2DR8A 3P6YC 1HW9A 3QAEA 4I6AA 3LAMA 1YWXA 1SB6A 3LW5C 2MJNA 4P2MA 2HQ3A 2YKNA 2C3MA 2YTCA 1C1BA 1VRUA 4YB5A 4DCPB 4M5GA 5KG7A 1SC3B 2DCLA 3UVJA 5KG1A 4B3OA 1QUPA 4HHHA 3DLJA 4ZLPA 4A46A 1F60B 1X0FA 3A8JA 1CJTB 3R5JB 2J0QD 1FKOA 1FRXA 2BABA 1WG5A 1KEKA 3M2RB 2HHTA 3OFFA 2GQ2A 3LALA 5HATA 3M9MB 5J1EA 2VPXB 5ETSA 2FLPA 2GV1A 3DM2A 1D0EA 4YS2A 2B56A 1IKVA 4JI0J 3NCPA 3BQ1A 5L38A 1L3KA 3P45B 4IYQA 3HM9A 2XZDB 3I32A 4IFYA 1WDDA 4NEZA 2EPIA 1YITS 5CYJA 3IWXA 2YWWA 3F56A 4CLZA 3VAFA 3HP6A 2MKHA 4CT9A 4HHJA 2YX1A 1RLDA 2I1RA 3CJRA 4MH8A 3G6YA 1TMJA 3AT1B 1FEHA 3NG8A 2WW4A 3JSRA 4OLOA 1KSPA 1Q5VA 4DWIA 3B4MA 1S76D 1IJFB 2DGOA 4RNFA 1FX4A 3E51A 3GV7B 4C0BA 2GIQA 1R31A 3BM7A 4Q43A 1HHTP 3D3BJ 1RT2B 4PWDA 1VQLS 2P6TA 1BQMA 4DV5F 4EUVA 3PM9A 4LVOP 3PJ9A 3WIUA 1NXIA 1UZDA 2R9LA 2VQEF 4LSZB 5E5NA 4A8XA 1SIZA 2IMWP 4Q2MA 1UWAA 3ULHA 4TLRA 1TP7A 5K8OA 2UU9F 3GG1A 5DLGA 2IM0A 1NJZA 4LR7A 3N5BA 2DCUB 2PE8A 3JB9k 3R5DA 4DQPA 1U25A 1S72S 1I51B 3FBFA 2XZWA 1FRIA 1OJ4A 3EPIA 2MY8A 3CO0P 1V9OA 5HK4A 3KG0A 3H7HB 3CNQP 1TKZB 4O4RA 1PYTA 1HNWJ 4DCJB 4DV1J 3UW1A 4ICLA 1CC7A 4DXLA 3HKZD 3T5KA 2XMJA 2ROGA 4LFAJ 1Q7YT 1AFIA 1Q8IA 3IGNA 3ZZTA 2W9AA 4CH1A 2JC1A 2C2NA 2XTJP 4V1Ak 3QZ8A 2ZZNA 1TL3B 2NS1B 1SKWA 1U47A 3AA8A 5HQMA 4H4OB 3FCVA 4ENOA 4P9SA 4RNOA 4LBIA 2Q66A 4CO5A 4I2PB 2CVIA 3ADAC 2MSTA 4M5DB 3J81j 4K59A 1WF1A 3MMAB 3TA1A 3AOCA 4CCHA 2LDIA 4WXOA 2VBYA 4J91A 5C25A 2V94A 2Z8QA 1HHSA 1VISA 4LREA 3OR1B 3L3CA 3C16A 4F2SA 2DRAA 1TL5A 2UUTA 1CJKA 4V19X 3AD7C 2HHSA 3FQKA 2WVBA 2D74B 3DXSX 5A8WB 2BM0A 3FC9A 5FJ4A 4RU2A 3DDNA 3MCSA 3A12A 2V69A 1KOOA 3W61A 5C2GA 3J80Y 4K4UA 2RRAA 4CLYA 4USWA 3QJLA 2XEXA 4CI0B 1RKIA 2XO6A 4KR0B 3ONQA 3NMRA 2OPPA 3BS9A 3PY8A 3KK1B 3TA2A 2AEMA 5I3UB 1JXVA 4YB7A 3I0RB 3MAQA 4PQUA 2GC8A 2ZBCA 1U48A 2CIMA 2E1CA 4RNMA 4C11A 4JI0F 2OO4A 4P52A 1Q16B 3NL0A 4DG1A 2IAJB 4N5SA 1KKHA 1SQEA 3NGDA 2RVJA 5KFVA 2ZEJA 5KT2A 3I0SB 1NK8A 1NPPA 4IUFA 4PUOB 2BXJA 2CZ9A 4AE5A 1SPBP 3ZZ0A 5B0CA 5IC4B 1WEYA 4URGA 2EBGA 1VQOS 1RWPB 3BEGB 1FFSB 1K1SA 1P8GA 1BQXA 2FLOA 3OL9A 4X65J 2M7SA 4R8UA 2YNHB 3TA0A 4HT5A 3DRSB 1S1TA 4LSNA 3A4TA 1HMVB 4ZIWA 2ZH4A 3NLCA 4C4WA 1IR0A 2CNNB 4CWBA 1F5CA 2W4CA 4ZVQB 3DRXA 2C2OB 4DLGA 4MKBA 3KK2A 3PV8A 3ZFVA 2I6WA 2EFPA 4IH5A 1R27B 3K8VA 2MKCA 1UETA 3K7RA 5D4NA 3UN2A 2CPIA 3W5ZA 4FDFA 4J9MA 4M5JA 4ECWA 3SV4A 2WAQD 3VGSA 5KFTA 3ZXWA 2Z57B 1XERA 1IKYB 3M6WA 2DEIA 3FSYA 5H9FJ 1HI8A 3CWJA 3IC1A 2M4MA 3J80U 4ID5B 3QZ7A 1J2VA 4OZLA 2N82B 3MPUB 4F36A 4ED3A 3X1LB 1QVFR 3K57A 4WTOB 4QPXA 2Z58B 1HNWF 1FCAA 4DV1F 1YK9A 4RW4B 2B4PA 2MGZB 1TKZA 2D3O1 3OVSA 2VFVA 1S7HA 5K9FA 4LFAF 3RZAA 1UVNA 4ZDNA 5CQGA 1H7WA 2JJ4D 3AJ1A 3CDAA 5CD4H 2FB0A 3T5LA 4WPAA 5C5JA 1SL2A 1T05A 4OZ1A 2KZZA 3RU0A 3H5XA 3O2IA 2CG4A 2B9EA 4DX6A 2DPIA 1NLKL 1PBAA 5D0EA 3KLVA 3ZZOA 1OPIA 4NYZA 1JWWA 3G8TA 2P6SA 3NAHA 1FXRA 1AXQA 2XYPB 1FRLA 5KFAA 4P2XA 3BPSP 4KPCA 1H3DA 7FDRA 2XMTA 5H9EK 4PWUA 4J9VA 1T02A 1ZH5A 1UL3A 1XR6A 2DNQA 2CJAA 2RH3A 1CEZA 2H5JB 3IGVA 2NPFA 1LXNA 2MEWA 5IV3A 2DXEA 3EJMA 1UVJA 4J9PA 2HHVA 2JHEA 4FNHA 1R6VA 3U02A 5DG7A 4MIBA 4PYDA 4WP9A 2R7UA 4E8UA 3V81A 3SCLE 1KOHA 3I0RA 3PO4A 2ZHAA 3POTB 3Q2TC 3M2UB 1F2HA 3RJMB 2QMWA 3MXHP 1UFLA 5HROA 2K1RB 1GTHA 1RKJA 2FIUA 4OI3A 2HZCA 4CLTA 3HKWA 2RUGA 1B7FA 9RUBA 5L1JA 2P9GA 2MLXA 2GJIA 1YJ7A 1WG4A 2PI5A 3OL8A 4YUDA 1UVKA 4JI4J 4TKTA 3PYFA 3RBDA 5JVGQ 3RB0A 4HVZA 2AP6A 1RT3A 4AL5A 4PUOA 5BYQA 2PFFB 3M8ZA 2HQFA 2YNFA 2AYBA 1HNXJ 3VAGA 2W7AA 3CCZA 4ZPCA 4X65F 1S6OA 2LLZA 2DH9A 4LF9J 2NYHA 3LH2S 5B0DA 2F9DA 2W2QP 2YNHA 1U1OA 1S1XB 1U1NA 2HNDB 4I6WA 4EBEA 1XNRJ 3SQGB 4WCEQ 4RLEA 1TL1B 2R7RA 3S1TA 2ABYA 2AKWB 3V4MA 4K50A 2VIHA 1F5BA 2OSQA 1YRUA 5KFEA 5KG6A 3ZZZA 1R89A 4OX7A 1JLAB 3G8SA 5B0AA 1U1MA 4IRKA 3KWMA 1VQ9S 1GTEA 3GJRB 4XTTA 1TAQA 4F26A 4ELUA 1KDNA 8ATCB 3G9CA 3OXLA 3X3UA 1NDLA 1YIJS 5J2MB 2L48A 3UQSA 1Y7PA 2Q79A 4Y6IA 8AT1B 5EX0A 4DL7A 2F65A 3NCRA 2JNJA 2WOMB 3N79A 4EYIB 2KYZA 2GZOA 2IRYA 1DTQA 3S01A 2AU0A 2KG0A 4LVNP 3KHHA 2OPQB 2G0JA 3KLGA 1RHMB 4PXCA 3ILIA 4DPOA 5B0FA 5B7WA 2R7OA 1WKJA 1C0UA 2AYEA 3QRQA 3CCRS 3KTQA 3QFHA 4FKYA 2WK4A 2GQQA 2UUCJ 2H3EB 3Q2SC 3VZIA 3CD5A 1NNDA 5CABA 2AV5A 2AEJA 1QD1A 2XHCA 1S0OA 1TL4A 1NRKA 4JI3J 3W5YA 1HHQA 2CJBA 4NZ0A 3N6NA 5LXYA 3PG9A 3M2VB 3CC7S 1WTFA 5DDRC 4PWWA 4X4RA 3ICLA 1HD1A 3BO4A 4WFZA 2XGPA 2JWNA 1XK8A 3VAKA 2LEBA 2LFVA 3KJQB 1FA0A 2LXUA 4IH6A 4O3RA 1DQ8A 2QE5A 2CQGA 1BY9A 4CLSA 2QTWA 5HQ8A 1TL7B 1Q79A 2XO7A 1N5VA 1K9MT 4F25A 4K0KJ 2Q1LA 5DDQC 2RSQA 4C8LA 2YH1A 4ED4A 2J0WA 1ZA1B 3N9UC 2DNZA 3SXLA 3ZC4A 5E0OA 4KO0A 2MPUA 1JIHA 3UDLA 1FKPA 2HVDA 2VUGA 1DURA 2V0NA 1KP6A 1TV6B 2FHOB 1YDLA 2MQLA 2MSSA 4DSJA 3DGPA 1AUDA 1KHWA 4RNHA 2B5JA 4LIWA 3GIJA 1RT4A 1HA1A 5JUMA 1LW2B 2DH7A 2EEYA 3UE2A 5C7PA 4B3TJ 2UV8G 3R1LA 2E5GA 5KFQA 5BJRA 2CPYA 3NOGA 4YDXA 4ZK7M 2XLIA 2GHWA 3HJFA 4NLPA 1YGYA 5G4DA 4U6PA 1FVQA 2BR0A 4JI4F 3M05A 4OFZA 4ED0A 2QV6A 1ITPA 3D2WA 1X9WA 3EICA 4U8YA 2MQMA 4X66J 2HHUA 1IKXA 2LA6A 2VICA 9ATCB 2VFRA 3WX8A 2GIFA 2P8IA 3ELHA 1DRZA 1XR7A 2WVDA 4PRFA 5CD4A 3PACA 3A8KA 1XMOJ 4PXEA 1MN7A 2HVHA 1RBAA 4PAAA 4A47A 1HNXF 2MZ1A 1Z2LA 3KJVB 1T9XA 1ZAWA 2ADBA 3PW5A 3ENQA 2UUAJ 4LF9F 4ITSA 4F4YA 1IBLF 1M90T 3GYNA 4USMA 1K47A 4PABA 1XNRF 2E1RA 5F8HA 3IMQJ 4WKRA 4Q5VA 1RAOA 4WE1B 1FJGJ 1S1XA 1HWLA 3DRRA 3BGOP 1S79A 1TL1A 2ATCB 2UVUA 4WK1A 1S59A 2UUWA 1CVJA 2DGUA 1F9FA 4P6QA 1S0VA 2KFYA 1JLCA 4F4AA 1HBUB 4X2BA 3AXMA 1FX2A 3MM7A 5FLXY 3MMCA 1JLAA 3D9BA 2FGOA 2FVPA 1TUGB 2GVDA 1AZSB 2GAGC 4WFAQ 4HT7A 2JOQA 4P7VA 2OI2A 1RU2A 5D4PA 2G2YA 1F2GA 1KNZA 2BJ7A 1U8WA 1YJ9S 1PJ6A 3ILOA 3GIMA 2XHWA 2ZJQQ 4OQJA 1KTQA 3M4XA 2WOMA 3TUIC 3AHPA 2ZOGA 4UT4A 4IQMA 1HQ2A 3TVKA 2NXUA 1IXKA 4C8ZA 1H74A 4ZCKA 2WCXA 3BGRB 2JVOA 2UP1A 3IAS9 2N7YA 1NU4A 4C3LA 2IVFB 5F8LA 4USIA 1T3OA 1RTJB 4O3OA 1A6LA 1N32J 1H73A 1PAUB 2MLZA 5JVHQ 4WXWA 5LXRA 3GYXB 3K2YA 1M5OC 3HD2A 1RAGB 2R2SA 1UZHA 5K14B 2HG4A 2YKQA 3RBZA 2Q6BA 1M1GA 4G1PA 4NLXA 3B82A 4KHMA 3MR6A 2QIFA 2BOAA 3C3LA 1K1QA 1MSWD 2JEIA 4B9TA 2FJXA 1T9YA 2W9CA 3AAWB 3IRWP 4ED2A 1U6BA 5LJ5Y 2PFDA 2HIYA 5HLFB 3PKYA 4HDGA 1JLBB 3FMWA 1VQYA 3CXCR 1MWYA 4C9DA 3D68A 2HWIA 4URQU 4L3NA 2ZBQA 1QE1B 2E1PA 2HS4A 3PFOA 4JV2A 1MU2B 4IR9A 4FVMA 1U8SA 3IBWA 3KLFB 3PFEA 4RW6A 4MAKA 3EZOA 3Q89A 3BDPA 4K0KF 3IRXB 3DOKA 2VOOA 3PZPA 2JVRA 1EJ7L 3M7VA 2KJVA 6FD1A 1U45A 2XI2A 2KO1A 4O4GA 3TARA 4K2JA 1VK8A 4HTJA 2C2KB 2XG8A 3MPWA 3H0PA 1YJWS 4GC7A 4FP9A 2MQNA 2A3JA 4Z7YA 1WHXA 2X3GA 2V9WA 1JKHA 4RX6A 4DX5A 2HK3A 4XPCA 3R5CA 2NPIA 1SC4B 3LQVA 3I56S 3NBPB 3N6LA 2BW7A 2OPSB 1FDNA 3H25A 4B3TF 4M5KA 2AYMA 2AYGA 2CPJA 5HN0A 4B08A 2ZC3A 5AE3A 4Q8EA 2HFUA 4DV2J 4TU8A 3HHDA 3GB0A 2WBRA 2FJVA 5C42B 2WVEA 3RRKA 1EARA 2LU1A 3RBEA 2HFNA 1HQUB 1X31C 4X66F 1T11A 1ZS6A 2F1FA 1VHFA 4FXDA 3BGUA 1BD6A 2CZ4A 5LSOA 3K17A 1LW0B 1FWLA 1XMOF 2OPRB 5ETNA 3AOBA 1U7LA 1KFDA 1OIAA 1EETB 3M32A 2UUAF 2HVIA 1D3WA 4ER8A 4QR2A 1U49A 3OJUA 4DI6A 1PYOB 2RS2A 3QGHA 1LEOA 2I0XA 2XSFA 3KLIB 3PHEA 2VA3A 3IR7B 3CJQA 2ZH2A 2RRBA 5KOXA 1FJGF 3T9NA 3MMBA 4ECTA 2DNGA 4WE1A 2YQ3A 3OVBA 1B0TA 1S1WB 2H48B 3DU6A 3BREA 5CCLA 2CQ2A 2BANB 3MEGA 4GVBA 1K0VA 1NZAA 1HBUA 2VZ9A 1UJ4A 1K73T 1B64A 4NCGA 3GCWP 1N4LA 3FGVA 2LQ5A 2XM3A 1S57A 1XR5A 1J27A 3IM8A 4OI0A 3DHXA 3O3LA 4ZHRA 1RHQB 2JC0A 1WC4A 1VQ7S 4ZKAA 2RQMA 5L9XA 3RB6A 4FKXA 1WI8A 3NP5A 4OI2A 4KGMA 5I42A 4NI2B 1RP5A 2KHCA 1SJ4P 1WUUA 3MD1A 2XMUA 1CULB 2VKRA 3LO3A 4NLOA 2V2VA 1V3RA 3OUYB 3SZ2A 1RHJB 4LF7J 1RWMB 5KFUA 3KYLA 2VQFJ 1ZOTA 3AJ2A 1NBEB 2C28A 1VC6A 1N32F 3EXYA 1EHWA 2Y1IA 2ZNZA 3DHWC 2GMLA 4PZVA 1LWCB 1U1RA 1UFKA 2KT5A 2QA4G 1XEZA 3PJWA 3RB4A 4C8OA 1RT1A 3DLLQ 4L76A 1RT7B 4NMXA 2VBXA 3KK3B 1D8YA 4ZP9A 3UI3A 3CDUA 3GJTB 2C3OA 4IQXA 2WONB 2Z2YB 3GSIA 3Q0AA 3FZ2A 3R3TA 3Q86A 3TI0A 3H5YA 3GQCA 4DQQA 2V68A 4PQAA 3FMBA 3P96A 3M8WA 3EPGA 3RUBL 2VFTA 1REGX 4OJ3A 5T14A 3DFEA 4F2RA 1JXEA 2XY6A 3GSDA 4G3IA 1VIOA 4PPZA 5DRKA 2W9BA 2HYIB 3SV3A 4JI2J 1KR4A 4OV6A 2VG6A 4LFCJ 3CCWA 4IRCA 1MU2A 3JQJA 4G65A 4NLUA 2CNLB 1F5AA 5CYQA 3KLFA 1AFJA 4WYWA 4ZCMA 3QT8A 2Q6CA 2VBZA 3K5MA 2RQ4A 3PTWA 1U4BA 1X4AA 4TY8A 4IRDA 4IG3B 2OELA 5L1LA 3HVTB 1IWGA 2G0CA 4A8MP 1TVRA 4FN5A 2RKIA 4J9UE 1FXDA 4KHRA 3PR5B 4IFVB 4C8YA 1RHUB 3THVA 5A8KB 4C7QA 3DLKB 1RWXB 3TR5A 2OD6A 4TLQA 1PJ5A 4AXIA 1UPPA 1G7CB 1HNIA 4DV2F 1NH8A 4NOHA 5BYSA 2B6AB 4J9KA 1RT6B 6FDRA 2RDIA 1RISA 4USKA 4NCBA 4JI1J 1NO8A 2R8JA 3QRPA 3MFHA 3MEDA 1Y0HA 2DR7A 2HQIA 5HANA 1WKKA 3IBCB 1KQSR 4GKKJ 4ZVGA 4XPEA 3MM5B 5A0YA 4EK2A 2ZUGA 4DSLA 4I1TA 3EMTA 1RT5B 3O5TB 5T7LB 1JX4A 1K0TA 3B8HA 4DFJA 3I31A 2GA7A 3VTIA 3MCNA 1ULRA 3M8QA 4LF4J 1G3OA 1C0TB 4EBDA 4RWXA 2VONA 1PILA 3V6HA 2XMAA 3QGPA 4ECUA 3R9LA 3EE3A 2X1AA 5AXKA 4Y65A 5ETKA 3LPEA 2DNKA 1TFWA 1VBKA 1FVSA 1LWFA 1Y5NB 2GMJA 1S6PA 3OTEA 2EW9A 2GFFA 3CCUS 2ASJA 3TEGA 2CJQA 3ZTOA 1XWLA 3UFCX 3K5LA 1EX8A 3DLBA 1J5OB 4NWBA 1H2TZ 1S1WA 4AQYJ 4KY3A 1JK9B 2DNRA 3TW0A 1U6FA 2XSJA 4XDCA 2P9CA 2DNOA 3ZZUA 4Y0FA 1N5QA 4X4QA 4NLDA 1FFWB 3H4BA 5L46A 2EC0A 2YNGA 2Y1LB 4GMKA 2B7BB 3M8SA 3CJ2A 4BBYA 3RAQA 5GVQA 8RUCA 4EZ9A 4FYVB 2IFXA 2RF2A 2RS8A 2RHSB 2C3YA 5EWEA 3U1MA 3F41A 4QW9A 4ED7A 4LF7F 2FUG9 3HHNB 4NI2A 2G9OA 2HS0A 2VQFF 4UZBA 2FY8A 4R5PA 2V4RA 1XMBA 2W2MP 1FXLA 1XQIA 4FF1A 4DR2J 3D1HA 5FDLA 1EP4A 1SUQB 2BZ2A 4LF1A 4DPYA 1X0PA 5J2PB 4A8FA 2XCPA 2UZAA 5DG8A 4IKAA 1KQKA 3W1YC 2PD1A 2ZWOA 4ATNA 1KRPA 4YB6A 3HHKA 1G1XA 2IYIA 2MMYA 3ENAA 2DGSA 3VAIA 1WACA 1UW4A 1YJNS 2Q3PA 1WJ9A 2HNZA 2DXFA 4UTGA 1TKDA 4X64J 4ETZA 4O3QA 3DLGB 3AB4B 3QGGA 4USTA 2WB4A 3CF5Q 2AZ1A 4OZ5A 3V6KA 3KLHA 4JV0A 3H5SA 4F3OA 4G1QB 4JI2F 7FD1A 4L75A 1MWZA 1GMWA 4LFCF 4FF3A 5J2QA 2W1BA 4X4VA 2N3LA 4IG0B 3Q83A 3MR2A 2ZDPA 4YP3A 2BYCA 5C2CA 4ECRA 5A8RA 3W9JA 1M1HA 1UJ5A 3GFHA 3OL6A 4FPIA 2LQ8A 4TU9A 3WX4A 1WHVA 2CQBA 3N01A 3SDEA 3G6VA 3U1NA 1RAFB 1JLEB 3HHLA 3JTOA 3D7SB 4F4XA 2Z2ZA 3EDQB 1DFDA 5GMKa 1LWEB 4Y2MA 4QPTA 4KJIA 1SH0A 3L95X 1V5IB 3KXDA 2AJQA 4QWAA 4J90A 4Y2AA 3TO8A 2E5JA 1MROA 1WSVA 5HJXA 2XY7A 3C19A 3OQ2A 3H90A 4NA2A 4G6VB 4JI1F 1ZAXA 4QWCA 2V4JB 4P75A 3OTOJ 2R7XA 4CLKA 4K5SA 3BYRA 3M6UA 3RGIA 4E2FB 2BRLA 2QA2A 2PGCA 1MN9A 4CLWA 3W2VA 1REVB 1JLGB 4A8SA 1DTTB 3K5OA 3BBFA 1R0BG 2F63A 3ISNC 4NYPA 3LA0A 1N33J 4M95A 3UD3P 2V4QA 3BSCA 4LF4F 2DB1A 2FZCB 2QLWA 2UVWA 3KG1A 4MTPA 4TYAA 1RTDB 2YQ0A 2VV5A 1C0TA 3D6MB 3IR5B 1YJTA 2J5AA 5KTQA 1R8HA 1OSDA 1F9EB 4UY8T 4NEYA 4OHYA 2WVFA 2FVRA 3LGMA 4W92B 4CNZA 3LP0B 1EAYC 3ISND 1NK9A 1SV5A 1JNZB 2KI2A 4USUA 1X8DA 2OSRA 4NXNJ 5A6WA 2U2FA 5E41A 3UDCA 4AQYF 4UOCA 2QLJB 1DQAA 1VLOA 3MF5A 2CPFA 1RLCL 2RQCA 5IT0A 3S7RA 2UVVA 1YX2A 1IBCB 2YKMB 3PO5A 2HVZA 4OYWA 2CRLA 2KU7A 1R0AB 4ELVA 4RU9A 2OMOA 4J9OA 1NDKA 3WBZA 1Y10A 2ZOMA 2AEFA 4X4PA 1IQTA 1RTZA 1WHWA 2QC3A 4I2QB 1RUSA 1RWKB 1FO1A 1NKBA 5E33A 2CJKA 5LMUF 2DHHA 4DR2F 1SQGA 3PYEA 2B43A 3PXGa 4DR1J 3MEEB 1QAXA 1XJWB 1U0SA 4JP8A 2GO8A 1RB0A 3PRBA 2DBBA 3PJXA 4OV1A 4RJVA 2DXDA 3PIOQ 3ZZYA 1UCNA 1LXJA 1LNQA 2E7WA 3U27A 3B78A 1UKUA 4QR0A 3CMQA 1IR1A 2DHXA 2UV8A 1Q81T 4GVLA 3LWLA 3G87A 4X64F 5M2UA 1XBWA 2P2CB 1HNVA 4YB1P 3DLGA 1X4BA 1U2CA 3KHRA 4CLFA 1AYEA 3BYPA 3KMSA 3FEZA 3HVWA 2OIHA 4EI2A 3R7SB 1WC1A 5IWAJ 3KNGA 2OKQA 1S9GB 2D7SA 1AT1B 3QWPA 4DV4J 3HSDA 4TVAB 2WSEC 4NLTA 2EFVA 4C0HA 1J5EJ 1ZZFA 4DL2A 2QLBB 4DEZA 2VBWA 2VU5A 2IJFA 3QGIA 4IG0A 4AXJA 3B54A 2X1FA 4NMLA 3ETOA 5AXLA 3R2DJ 2HS3A 2CQ3A 2M8HA 3DDIA 4KYZA 2YKNB 2XI3A 3TUJC 1SL0A 5HI7A 3CIZA 2MKKA 3H20A 1C1BB 4M5MA 2FZGB 1VRUB 1PKUA 2HQCA 4YR3A 1L3TA 2C2RA 1JJ2R 3UVJB 4B3OB 3OHAA 1B99A 3AOAA 2KYXA 4PYAA 3IS9A 1EKSA 2HPUA 5LM7E 3C6UA 2WVCA 3PR4A 1LWEA 2VL1A 1NK4A 2FHJD 1FKOB 2CDRB 2ASLA 4XO0A 1EZZB 1SKRA 1DJ0A 4OYIA 1H0HB 2BE2A 2B9YA 1URNA 3EGVA 2J9EA 4YR2A 4PG7A 1UAWA 1FKAF 2RDJA 5J1EB 1U02A 2NYIA 1SQFA 4OX9J 3DM2B 1S4EA 5KG2A 2QLFB 3OT9A 2ERRA 2J8AA 3PDNA 3OTOF 2IA6A 4QYZK 2BA9A 5GAEU 2FVQA 3CD7A 2O5DA 1RYSA 1SJRA 4Q0BA 2P5VA 1Q86T 4Y3CA 2G2OA 2KJWA 3WC2A 3GCXP 2PMHA 4IFYB 4RUBA 2YWKA 4ZVFA 3D0GE 3CD6S 2E9RX 3PRVA 4NXMF 1DHMA 1N33F 5D0GA 1FDDA 2CNKB 1HBNA 4TXSA 1GX5A 2UXBJ 1KVKA 1X5PA 2BE7D 4WP3A 3ILJA 1HQEB 4HL9A 1NK7A 3E01A 4HTIA 1TTHB 2AJ1A 4IOCQ 3CDBA 1URRA 3I87A 4OJ1A 2J0XA 5F8GA 3EX7B 5KOWA 2Y1RI 1RAEB 2HRTA 1S0MA 1TAUA 2E5IA 4NXNF 2BDPA 3A8IA 3CJ8A 2BUNA 2DK2A 4KV8A 1BQMB 4HKQA 3G8QA 4GO5X 2GW8A 5EGYA 1JLQA 4BWMA 3O8WA 2V63A 4BCAA 4FS1A 4IOAQ 2RT3A 5KFDA 2HW3A 4WWSA 2ZE2B 2E9TA 3NGRA 2FVCA 3TJAA 4X84A 2JRSA 2ROPA 2MHEA 1AW0A 2YQ1A 1TQLA 1VYAA 3H42A 3GE9A 1X4DA 1YVFA 2G4BA 1HW8A 3FNNA 4EEYA 4CTAB 4CH0S 3K5PA 2B51A 2K2PA 1OS5A 4DR1F 4F4ZA 1C2PA 4BLGA 1PSDA 2FGCA 3CCES 1IBMJ 3DN9A 4OZ3A 1VGYA 1S5ZA 3O6QA 3HVRA 3KJNB 3VGVA 4ICLB 2LXFA 1NB2A 1SI9A 2ZM6J 2DJWA 3P49B 3K5NA 3R5AA 2COLA 1N5SA 3TQ1A 3BQ0A 1VJQA 1VQ4S 3FKBA 4Q44A 3KOAA 4O44A 4Y2IA 2LQBA 3K89A 1QUVA 2HEKA 4FXWA 4M5LA 2HNYA 1OQ3A 1BQNA 2ZITA 2DGTA 2WW8A 5T41A 1NHKL 1B3TA 2IVYA 3CPWR 5IWAF 2H4YB 3M9OB 3FJ2A 1QJHA 4IR1A 1PBUA 2F4FA 2KB2A 3A13A 4I69A 2RNEA 4DV4F 1FRJA 2OP5A 4ZVEA 1J5EF 5C24A 2R7VA 2PA3A 3OFEA 4WF9Q 3CSKA 1CJKB 4KH0B 3OJSA 5DZ6A 1D9AA 4YFUA 1Q82T 4I7FA 4KHPJ 3ET6B 1QTMA 5L8RC 3PHTA 2KTQA 4P72A 3R2CJ 2KXFA 1U26A 4ZVSB 3R8YA 4PR6A 2YPZA 3W2WA 5DQIA 2XZTB 3R27A 2BVZA 2OPPB 5E3RA 1RABB 4B3RJ 2ZZMA 5A2QU 4NLRA 3MFIA 2QGFB 1BXNA 4H4KC 4OX9F 4PQUB 1T94A 2BOPA 4YHHJ 1PGZA 1Y3KA 2NCKL 4WZQA 3MPDA 1VIXA 4C11B 3QT6A 3FBCA 2MKIA 4M5HA 2CJXB 4A8QA 1NDCA 4JUZA 2E66A 4NLSA 4DG1B 1ZBTA 4XDDA 3N5FA 3P8BB 3TOQA 4KBIA 3KUHA 4RW7A 1RU1A 2UXBF 4OL8A 4WKYA 2F7VA 3BH7B 1ZTWA 5LL6d 4DLEA 2OEJA 5HQLA 2IC3B 3FDSA 2FHMA 1S6UA 3MM6A 1HQEA 5E3QA 3MEKA 1Y3JA 4DR7J 2AD9A 3VR1A 2CJYB 3DRPA 4AL7A 3DI6A 3V6DA 3IG1B 2DO4A 5L1IA 4R8UB 3JXOA 1S1TB 4LSNB 1N56A 1UWBA 2J8SA 2HHHJ 2KN4A 2XBPA 3PEJA 5KFXA 2PMZD 1HR0J 1TUVA 1SJFA 4FNIA 2EK6A 1KD1T 2DKOB 3HJVA 3QIPA 2V6AA 3KK2B 1F0XA 3QRRA 3QO9A 3QSIA 1Z4UA 2QX0A 5KT7A 3D1QA 4KFBA 1HWKA 2ALZA 2OH2A 4KGZB 3UR3C 2ZE2A 4ED8A 2LQ9A 4DU8A 3SI8A 2YWGA 4HACA 2DNLA 2ZBIA 3R6GB 2EKYA 3LP2A 1JLFB 4HEA9 4DCOB 1CLFA 2V8HA 1I6JA 4CTAA 2G0IA 4BWJA 4J9QA 1IBMF 1NSKL 4MFBA 1WF0A 4K8RA 2J6UA 3KUEA 2DISA 4JV5J 1FRKA 5HBMA 2ZM6F 4RUCA 3CDEA 4PG4A 2X1GA 3FFIA 1RAJA 2R2TA 1X9MA 3TAMB 1O8BA 4EGLA 5L39A 2W4DA 4AT1B 3KNAA 1PC5A 2VDHA 4OI1A 1M5SA 4KRWA 3BSOA 3G82A 2CNOB 4K4SA 1IM6A 2VG7B 3EM1A 1T05B 1IM4A 4NRUA 4M94A 2V9KA 4BC9A 3NGKA 2OTJS 4UUXA 2FYXA 2L9WA 5THWA 1F9HA 5D0RA 4UY85 1TKXB 3GPAA 1Q53A 2ZKUA 2QEXS 2V8GA 2E44A 4CLUA 4K4TA 4CYUA 2ZH6A 1TK5A 2JFDA 4KGVB 3AD8C 3OR2A 2KH9A 2IDLA 1GK8A 4PKDB 2W24A 2HMIB 4KHPF 2V2ZA 2HSEB 3HZEA 5HSPA 3HZGA 1S7IA 1RQ0A 2A18A 3SQOP 3ET6A 1WC3A 4ANEA 1UA0A 2BKOA 2R8KA 3AH6A 2JEGA 4H4MB 1T9UA 5CCMA 4Y34A 4TQRA 4RKUC 2FC9A 1X5TA 5HO4A 2DHAA 3TJ8A 4ERDA 5JJBA 4B3RF 5KFIA 1FJ7A 5CZVA 1FF2A 4MKAA 4YHHF 4G1IA 3C6TA 3SSQA 3Q22A 1SVDA 4TY9A 3V81B 3TVZA 5DDOC 3C14A 2AJ0A 2BQRA 4CO2A 3LF0A 3MZIA 5KG5A 1X4EA 4I64A 2MQOA 5HROB 2O01C 2A2CA 3CW2C 2Y1JA 2ZD1A 2MQ8A 3W7BA 1IR2A 4DV0J 3V5RA 2Y3YA 2XYGB 4C3MA 2XWYA 3D67A 5ETRA 2RDDA 5KT6A 3GLJA 2CQDA 2QSFA 3FCWA 3W9HA 3I82A 3DOLA 3CJ3A 3JAMU 2HHPA 1RT3B 1A0OB 3J7ZT 2BRKA 4X4TA 4O23A 4CDIA 1RTHA 1QSSA 2XMMA 3QYYA 2YY3A 2IC3A 4DR7F 4O3SA 2YNFB 1V3ZA 4N76A 1FJEB 3THTA 1IKWA 2F3JA 1HBMA 2YWEA 4U8VA 3IG1A 3OD2A 3FZBA 2H9ZA 4X62J 2CQ4A 3CUNA 1Y4ZB 4WFNQ 4KC5A 2HHHF 3EGWB 1JNRB 1IWAA 4ES2A 1HR0F 1ELOA 4FYDA 4AL6A 2F5GA 2DNHA 4I68A 3IN5A 2FHKA 3NNAA 4K4WA 3J7A1 3SCKE 4BHQA 1S9EA 1RBOB 1WEXA 3Q8YA 1YJVA 2LECA 5EX3A 3CJ0A 5L1KA 1BUXA 3L4BC 4ZS6A 5KFMA 3SFUA 3M8RA 3CJKA 2XWXA 1HPZA 2QYGA 5IQ6A 4EU0A 1X4GA 1SC6A 4PG6A 1WORA 1KVIA 4DQRA 5D3GA 1JLFA 3A1YG 2O3DA 1DTQB 3TJ9A 3V4IB 4DR5J 3KLGB 4QWBA 2DNPA 4JV5F 2R42A 4A8OA 1C0UB 2RIJA 2XS5A 4QOTA 3UCUP 1VC5A 4LT6A 2E1MC 1VQKS 1QLNA 1KQGB 2OHDA 4Z2XA 3KLEA 2GHPA 3UN3A 1YBUA 4YEAA 3TAMA 2AIRB 2CPHA 4RR5A 2XLKA 3RBXA 3RR7A 5GADU 5I3PA 3W3SA 2PT0A 4TYBA 4USHA 2GAHC 4OHXA 4PXDA 3HDSA 3I6PA 1P1TA 3D6TB 3CMAS 1NJXA 2ZH9A 2VG7A 4OI6A 3J7YU 4ANDA 4KE5A 3EVMA 3R5GA 2HHQA 2NLWA 1WF2A 1SJQA 1FE4A 4JB8B 3BDEA 5HL7Q 1TKXA 4M8LA 2NXCA 5LMNJ 4P73A 1BE4A 1RWNB 4RPFA 4ZN1A 1UVMA 1CG2A 1VCTA 2GCFA 2D69A 1KWMA 1S10A 5KFFA 1U2RA 2JLFA 2G1DA 2PEHA 2W7PA 1PC4A 1CJUA 1WC5A 2HMIA 1CQNA 3KDNA 3Q23A 4EWTA 3QPIA 4J9LA 4WP8A 4U7UD 1W25A 4KO0B 2HHXA 1FKPB 2R8HA 1ZA2B 2MKYA 2G2ZA 4DF4A 4H4MA 3ZTPA 2BKNA 3W63A 1N5YA 2HHWA 3DGPB 4QIGA 1T03B 4ZVRB 3LP1B 1E6VA 1B4SA 3TVYA 2B5JB 2R8IA 3MOZA 4MK7A 1MWQA 1RT4B 2EC2A 4M63A 1CJVA 3J7YI 2PSZA 2DR5A 1VJWA 1VLYA 1MNEA 4P2SA 2NR0A 4F04B 5D15A 4C2MA 2RMLA 3QLHA 4KQZA 4DV0F 2ILYA 3CCVS 4ZCLA 3Q8VA 3CJTA 2N7CA 2D1CA 1ACMB 3CCMS 3CCLS 4QW8A 4E98A 1UVIA 4KGKA 5ETVA 4P7TA 1IKXB 1LOUA 4DV6J 1IN0A 2VC1A 5F41A 3CTRA 3LGHA 5H9EJ 2R7QA 3T1YJ 3NCQA 3BSAA 1APSA 1KLNA 2LVWA 4DF8A 3OBIA 2WSFC 5HMXA 4C0OC 4OYAA 3DLEA 1EB0A 1OYEA 3K0JA 1M5PC 2GX8A 3T1HJ 3OTDA 3L09A 1RCOB 3NY0A 2VASA 4X62F 3D28A 4LSLA 3OLBA 1XC9A 2OTLS 4R0JA 1WNEA 1WC0A 2B9XA 3PW4A 3DRRB 4EBCA 2IVMA 1RSCA 3W65A 3TX8A 3HD1A 1E6YA 3QWUA 3M8PB 3VVTA 2CKWA 4LBPA 1JLCB 3OXGA 3VAHA 3MM7B 3GR1A 1QAJA 3MMCB 3NAIA 2GVDB 4NZ7A 2VJVA 1UA1A 2KVIA 1U1PA 2H5IB 1RWUA 2EFGA 4DL6A 4LF2A 2QO3A 5F0UA 3ZNJ1 3L7OA 3BKTA 2EXUA 3CDWA 2VC0A 1HD0A 3MECA 4K4YA 4YY3J 4P71A 1PJ7A 4DR5F 2GVZA 3NGTA 3MM9B 3HI9A 3V4IA 2L9NA 1BWVA 4JI8J 3H40A 3TNVA 2FQQB 2QMXA 3JSBA 5DG9A 5KFYA 3OSPA 1ZPVA 4A8KA 1BWEA 2HRUA 3CC2S 3BO2A 4RW8A 3DC2A 1GXUA 1R3NA 2OFHX 3C15A 2DYAA 2WBMA 1M5HA 3QNWB 5LT5A 3NNCA 1Y11A 5IM0A 1FERA 2NXNA 2AX1A 1R43A 1YG0A 5CH7B 4F3MA 1V6HA 4NLGA 1P9QC 3W5XA 1AA1B 3HHEA 2FLLA 2KG1A 2W9CB 4DL4A 2QLXA 2DRDA 5IZHA 1R8AA 5IT9Y 2JDJA 4FPRA 5LMNF 4UF4A 1VRTA 2ADCA 1NK6A 1WD6A 4ZJQA 2IY5B 4C97A 4NYOA 4U7CA 1B7YB 2R3VA 4RW6B 1NHUA 5D77A 3IP0A 5RUBA 5KFNA 3CGIA 3T6JA 3VV2B 2B0GA 3DOKB 3LAKA 2IYGA 3JYTA 3L7PA 2EWHA 1R8PA 2V5HG 2DHSA 3S8SA
chains in the Genus database with same CATH topology
3S6EA 2PGCA 3EUNA 3IR6B 1HMVB 4O4GB 3BN7A 5AJ3F 3SFGA 1XTZA 3W2VA 4DQIA 2HGLA 1REVB 1X9SA 1JLGB 2JSXA 5DO2A 3I9V9 4A8SA 2ZH4A 1DTTB 3K5OA 1S1UA 3NLCA 4C4WA 1IR0A 5AE2A 1S6QA 2K3KA 2FVSA 3D1OA 5CA5A 3OFHA 5L9NA 4QBUA 2GJ2A 3BGRA 3TYTA 3ISNC 2K3IA 4NYPA 1F5CA 2W4CA 3DRXA 3OLAA 1U6ZA 4M95A 5DM7Q 1JKHB 3UD3P 4DLGA 5F0WA 4MKBA 2V4QA 3KK2A 3BSCA 1DARA 4C3KA 5HMZA 3PV8A 1T03A 4CQ1A 1RTJA 4AUKA 1HBOA 3PEHA 4LF4F 3ZFVA 3LP1A 5CHCB 2EFPA 4IH5A 1R27B 3K8VA 1KHVA 2MKCA 1UETA 3K7RA 2DB1A 2GQCA 5D4NA 4DFKA 2QLWA 3I4PA 1HWIA 2UVWA 3KG1A 4MTPA 4TYAA 5KFGA 2IM3A 5E7OB 2CPIA 1RTDB 1QAYA 5IQQA 2CQ1A 2VV5A 4J9MA 1C0TA 4DOZA 5F9LA 2CQPA 3OR2B 1OPZA 2CZVC 4ECWA 3IR5B 2E1AA 3SV4A 4ID8A 3US5A 2IRXA 4NRTA 5K14A 2WAQD 1S1VA 1YJTA 5KFTA 5KFBA 3BGFA 3M6WA 1XERA 1IKYB 2J5AA 5KTQA 3FSYA 2PO4A 5H9FJ 2DRBA 1HI8A 3RTVA 1R8HA 1OSDA 4UY8T 4OHYA 3RAXA 3CWJA 1TKTA 2BBEA 3IC1A 2M4MA 2FVRA 1LFPA 3LGMA 1YSJA 4W92B 4ID5B 1N52B 4CNZA 1KTVA 3LP0B 3QZ7A 3ISND 1NK9A 1SV5A 1J2VA 1JNZB 3DCAA 2OMLA 3H2UB 1RTIB 2EI5A 3MGJA 4OZLA 2N82B 2KI2A 1R7IA 1X8DA 2OSRA 4ED3A 3X1LB 5A6WA 1QVFR 5K8NA 3K57A 2U2FA 2W7OA 1N36F 4DV6F 3T9ZA 5E41A 3UDCA 5HLFA 3RAMA 4AQYF 3M6VA 4QPXA 4UOCA 1HNWF 1FCAA 1JLBA 3T1YF 1TK0A 4DV1F 4ED6A 4RW4B 2XULA 2B4PA 3MURP 2MGZB 5KFHA 1TKZA 1QE1A 1DQAA 3OVSA 1G2EA 2KDOA 2VFVA 3MF5A 1S7HA 2CPFA 3NS5A 2I9SA 2MYFA 5K9FA 2RQCA 5IT0A 3S7RA 2UVVA 4LFAF 3C6TB 3OTBA 2AF6A 3RZAA 2QZ8A 1UVNA 4ECXA 4ZDNA 5CQGA 5M2PA 2LCWA 3M32B 3IRXA 1ZAVA 1H2UX 4N47A 4X4UA 3T1HF 3PO5A 2YKMB 2HVZA 1H7WA 3TAPA 2V8DA 2JJ4D 3G86A 4ZOSA 2DNMA 3IAM9 4U9RA 2KRBA 4LQ9A 3IWLA 3AJ1A 2CRLA 2KU7A 1R0AB 2J0SD 2CYYA 4ELVA 3CDAA 3OHBA 4E0DA 4RU9A 2J6TA 2OMOA 4J9OA 5CD4H 3K59A 3WBZA 2ZD1B 4RBUA 2ZOMA 2RQKA 1KONA 1YI2S 2FB0A 5EN1A 3GMGA 4X4PA 3T5LA 1IQTA 3BZQA 1WHWA 1DLOA 3MMBB 4I2QB 5C5JA 1SL2A 2RJZA 1T05A 1FO1A 3DYAA 4OZ1A