5CYQB

Hiv-1 reverse transcriptase complexed with 4-bromopyrazole
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
424
structure length
415
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rapid experimental SAD phasing and hot-spot identification with halogenated fragments.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase
molecule keywords HIV-1 reverse transcriptase, p66 subunit
total genus 117
structure length 415
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5cyqB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cyqB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cyqB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cyqB03
1TL3B 4XO0A 4ECRA 1SH3A 5KFZA 5KFYA 3CJ3A 5KFFA 3SFGA 4RUCA 2YNIA 5HROA 1HARA 5KFWA 4ED6A 2WONB 2GIQA 3JSMA 1SV5A 4JV1A 1MMLA 5DGBA 1DLOB 1TKXB 3DI6B 1FKOA 3OLAA 2AQ4A 2BR0A 3DRRB 2XI3A 1SUQB 4FS1A 4NLSA 2C28A 3T5KA 3KMQA 3DRRA 4ZMMA 4URGA 5L1KA 1HNVA 4NLTA 2YKNA 5KG0A 3OL6A 3PW4A 4IOBA 5CYMA 2AGPA 5EUHA 5KFTA 3DRSB 2HMIA 2CKWA 2WK4A 5DQGA 4X2BA 1JLEA 4LSLB 1IKYB 3KLFB 4O3SA 2ASLA 5D3GB 5C5JA 3Q8PB 2W9BB 2OPRA 4YR2A 1RTHA 3T1AA 2V4QA 2W9BA 1JLBA 4I2QB 5KFBA 3KK1B 4ZHRA 4NLGA 1RTDA 3LP2B 3KK1A 4Q0BB 1TKZB 1EETA 3IG1B 3MF5A 5KFIA 4Q43A 3T5LA 3RBEA 4YR0A 5L1LA 2XC9A 4XPCA 1QAIA 1RT5A 3M9MB 3MTKA 3H4BA 3TAMB 2IJFA 4B3OB 3BQ0A 3PW7A 1UWBB 1HQEA 4IRDA 4B3OA 2O5DA 1Z4UA 5C25B 3I0RA 2R2RA 3V6DA 4IKAA 2YNFA 4IFVA 2IM1A 3G6VA 4ED0A 3GIIA 1BQNB 1QUVA 5EWEA 3M8PA 5K14B 2CJQA 4QWCA 2AX0A 4J9PA 5CYQA 2ATLA 3BQ2A 3M8PB 4MIAA 4Q8EA 3IGVA 5CYQB 1S1UA 1ZETA 3H5YA 2FVQA 1LW2A 1I6JA 1RA7A 4WFYA 2HWHA 3V81A 4U6PA 4ECWA 4KBIA 4TXSA 5DQIA 3DOLB 3BGRA 3N6LA 3GV5B 1SV5B 4RZRA 1S6PB 1N5YA 3GQCA 2FLNA 1JKHA 2OPSB 5C24B 3DOKA 1S6PA 3HVTB 3H4DA 2W9CA 3H98A 3E01B 3LAMA 3RB4A 3C6UB 1FK9A 4GC6A 3DI6A 4H4MB 3MECB 1HNVB 3LALA 3MR5A 3KLIB 1EP4A 1KLMB 1BQMB 1S6QB 4IG0A 2JEGA 3KLIA 3H59A 2HNZB 3JYTA 2RF2B 4QWAA 1S9GA 4O3PA 4LSLA 4M95A 3DRSA 2HMIB 4QWEA 4J9QA 1TQLA 3UDLA 3V6JA 2R8GA 2OPRB 4NLYA 4RNNA 2VG6B 1RDRA 4WFZA 1KHWA 3BSAA 5KFRA 2I5JA 2YNHA 5I3UA 3N6NA 3MEEB 2VA2A 4MFBA 3N6MA 3OL7A 2DPJA 2HAIA 2YNGB 1EETB 1RT7B 1IKVA 4I7FB 2IM2A 4YQWA 3DLEB 3H5XA 5FDLB 3QYYA 2IM3A 3V6KA 3PVXA 3KNAA 4ECTA 4H4OA 3LP1A 3QIDA 3V4IB 3GV8B 3BSCA 4ZP7A 3KLHA 1LWEA 4WYWA 4TLRA 4K4UA 4IG3B 3BR9A 3CO9A 1HQEB 2FVPA 5K14A 2AX1A 4WYLA 4IG3A 2BRLA 4ZP8A 2WOMB 1RTIA 4ZPCA 2YNFB 4O3QA 1WNEA 1HPZA 3DM2A 2B43A 5DQHA 3PJXA 1RT2A 4WFXA 5KFNA 1CSJA 4EYHB 4KSEB 2VG7A 1NNDA 4KB7A 3Q8RB 1HYSA 3RAXA 3EPIA 2VG7B 5KT2A 4DL2A 2B6AA 1N6QA 4XPEA 4NLPA 4J9NA 3OLBA 2RDIA 3BQ1A 1N5YB 4HKQA 4TN2A 2RKIB 4F50A 2W8LA 1TKXA 1C0UB 4ECVA 4IH5A 3C6UA 4ZPDA 1IKXB 2W8KA 5KFCA 4ED3A 4KKOA 5KFQA 1DTTB 3D5MA 4QWDA 1JLFB 2WRMA 3EPGA 3DDKA 5KFVA 4H4MA 5KT5A 2AU0A 3LP0A 3FRZA 4K4SA 2RF2A 1N56A 2FJVA 3CJ4A 4ZPBA 1VRTB 3DLGA 3KJVA 4RW8A 4K4ZA 1RT6A 2IAJA 4TYBA 5F8IA 2E9ZA 4Q45A 4K4YA 4KFBA 4FBUA 4NLDA 1XR5A 2FJWA 3KHGA 3DLKB 4JUZA 4MK8A 1S9EA 2W7PA 5HLFB 4Y2CA 3NGDA 4FBTA 3I0SA 2DPIA 2YNGA 5KFLA 4ECYA 1J5OA 2RDJA 3C6TB 4RW9A 2AWZA 4ECXA 3DLEA 4F4ZA 3PHEA 4RW9B 1JLGA 2B5JA 4EO6A 5KFKA 4TY8B 3IN5A 2D7SA 4TY8A 1JLQB 4NLRA 3RBDA 1LWFA 3DYAA 3KLVA 1LWFB 3DYAB 3CJ2A 1BQNA 3HHKA 4KO0A 4ZVGA 1W25A 5DG8A 5KT7A 1D0EA 3KHLA 2R8HA 4IRCA 2GC8A 3HVAA 4Y3CA 2C2RA 4NLXA 5KG6A 4ICLB 4JV0A 2ZE2A 4J9SA 3PW0A 4G1QB 1TL3A 3KK3A 4TQSA 1RT3A 3QZ8A 5KT4A 3KHHA 4J9LA 1K1SA 4LQ3A 1RT1A 4PWDB 1S48A 1TP7A 3FQKA 3MEDA 1RT4A 1SH2A 3MR2A 1FK9B 3ISND 2V4RA 3RB6A 4ZVEA 3BSOA 2C2DA 3MECA 1RT4B 2FLLA 3DOKB 3HVTA 3DRPB 5J2MA 2BRKA 4ZP9A 3OHBA 4IR1A 4O3RA 4KHMA 3VQSA 4RNOA 4PUOB 2WHOA 3PJWA 3UPFA 1TKTA 1T03A 4RNFA 1MU2A 4OL8A 3H5SA 3RAQA 4RW8B 2YKNB 1OS5A 5KFEA 5L1IA 2HNZA 2QV6A 2R8IA 4NCGA 3KK2B 5F8NA 1S1XB 3CDEA 3GIKA 5F9LA 3MEGB 1LW0B 4O44A 4ZP6A 2JLEA 1JLEB 2OPQA 2ZD1B 4ED8A 3BSNA 4NLUA 4Q8FA 5J1EA 1S1WB 1YVFA 4URSA 3I0SB 4ZVFA 1JLCB 4IFYA 5I3UB 3NAIA 2R8JA 1S9EB 3UQSA 3BJYA 1N4LA 3CJ5A 1RAJA 1RTDB 1R0AB 3G86A 5DGAA 4NZ0A 4WXOA 3NBPB 5DLGA 5DLFA 2IMWP 3V4IA 5F9NA 2OH2A 4Y2AA 1TKZA 3IG1A 1RTJA 2UVVA 1RA6A 4WZMA 4NLOA 3FSIA 4LQ9A 4ED1A 2XGPA 3MFIA 2YKMB 2HWIA 3TAMA 1C1CB 5J2NA 4QPXA 3M9NB 2ASJA 3CDUA 4R0EA 4RNMA 1FKPB 4NYZA 3IRXA 2HNYB 3GIMA 3QGIA 1JLAB 2ASDA 3LANA 2UUTA 4O4RA 2ZE2B 4EBEA 4KV8A 3V81B 3NMAA 3DMJB 4I2PB 4RW6B 1S0MA 4MK9A 1ZTTA 3NKYA 3T5HA 3QLHA 3DMJA 4WE1A 4FS2A 2JC1A 3MEDB 4YR3A 1SH0A 5KG2A 4WXWA 3QGGA 4Q44A 3HVWA 3KLGA 1DLOA 2E9TA 5JXSA 3Q8SB 3E01A 1QE1A 1T05A 3QO9B 1T94A 3OHAA 2JEFA 5KFHA 3CDWA 2OPPB 5KFOA 2FLPA 1D1UA 4LSNB 1HQUB 5KFGA 4J9KA 5CYMB 3UR0A 2R8KA 1LW0A 3BREA 5HBMB 5KFAA 1REVA 1TV6A 4IDKB 1DTQB 5I42A 4PQUB 5HBMA 1S1VA 3FFIB 4H54A 1S9FA 1C0TB 4MFBB 2E9RX 3G6XA 1KHVA 4NLVA 4YP3A 3DLKA 4MIBA 3TVKA 4TQRA 1RT7A 1S1WA 5EWGA 3I5BA 4R8UB 5HP1A 4HYKA 2EC0A 4ECSA 4J9OA 4O4GA 2JEJA 4O4GB 3I0RB 3V6DB 4F4WA 2IC3B 4DL4A 4NRTA 4K4WA 1UWBA 4RW7B 1TL1B 4DG1B 1C1CA 1IKWB 2D3UA 3GYNA 4RW7A 1S10A 1GX6A 3CJ0A 4DL6A 1S1UB 2HNYA 4KV8B 3MR3A 3QIPA 3FQLA 2XI2A 2B6AB 2J6SA 3KK3B 3DOLA 1XR6A 4IR9A 4WE1B 3H40A 4I2PA 4RW6A 2IM0A 3JSMB 5KFMA 3OL8A 4O3NA 5KG5A 1C0UA 1RT3B 2YNIB 3BGRB 5HROB 3GV7B 4ED7A 1JIHA 1DTTA 5KFSA 2OPSA 5KFJA 4K50A 2IBKA 2UVWA 3KLGB 1T05B 4DL7A 1RYRA 1HNIA 2BE2A 2C2EA 2V9WA 3TQ1A 1MU2B 1HNIB 2BE2B 3JYTB 1QAJA 1VRTA 4GC7A 1HQUA 4IQXA 1KLMA 3KLEA 1U09A 4EBDA 1IKYA 1S9GB 2VG6A 5J2PB 3CWJA 1C0TA 1RT6B 2IAJB 3KK2A 2R2TA 5J1EB 1DTQA 5I42B 4PQUA 4KFBB 2XCAA 4F4XA 4IFYB 2FVCA 2FVRA 2QE5A 2OPQB 5KG7A 4Y34A 2VG5B 3PW2A 2I5JB 3T5JA 4I7FA 1IKVB 1HMVB 2R2SA 5EDWA 3QZ7A 2JEIA 3C6TA 1ZTWA 1RTJB 1GX5A 3LP1B 4K4XA 1S1TB 3M8QB 4ID5A 5FDLA 2IA6A 1LWCA 2J6TA 5J2NB 4O3OA 4R5PA 4EO8A 3RB0A 4R5PB 4RUAA 4M94A 4U7CA 2WB4A 4KO0B 4DG1A 3D28A 3I5AA 1JXLA 1HYSB 1XR7A 3PW5A 4RW4A 2AGOA 5T14A 1N6QB 4RW4B 4ZVHA 2GIRA 1TVRB 3CVKA 3CIZA 4QW8A 4EBCA 2R2UA 4G1QA 4TYAA 5F8GA 3NAHA 1JKHB 5C24A 2ALZA 3ITHB 3RB3A 5L1JA 2WONA 3PR5B 3E51A 3ISNC 3DRPA 5J2MB 4DL3A 2BANA 2HNDB 4NLWA 5KG1A 2BANB 2HNDA 4PUOA 4QWBA 4KKOB 1BQMA 1S6QA 4RNHA 3I5CA 3MR6A 3KHRA 4ECZA 3NL0A 1QE1B 3EZUA 5KFXA 5KFPA 4IG0B 1TKTB 3SI8A 4NCGB 2OPPA 2V0NA 2W7OA 4JV2A 5J2QB 3KLEB 3OSPA 2ILZA 4IRKA 2VA3A 5D3GA 5F8MA 2ZD1A 1RTHB 4QW9A 2BQ3A 4G3IA 3PZPA 3MEGA 4O44B 4J9MA 3SFUA 5HLFA 1S1VB 3OL9A 4R8UA 4Q0BA 1K1QA 2D41A 2D3ZA 3IGNA 4ZHRB 3FDSA 1HMVA 1S1TA 3M8QA 1T3NA 3LP2A 1RT5B 1LWCB 5C42A 4NLQA 4KHRA 1J5OB 5C42B 3IS9B 2ZKUA 1TL1A 1N48A 2B5JB 5KFDA 5F8LA 1IKWA 3IS9A 2YKMA 2IC3A 4MK7A 2AGQA 2UVRA 1HPZB 1S0OA 5C25A 2F8EX 1S0NA 1FKPA 1JX4A 1RTIB 5F8HA 1C1BB 2IJNA 4ICLA 2XWYA 1TVRA 1IM4A 2ILYA 3QLHB 3QIPB 5KFUA 2UUWA 5KT3A 1RT1B 4PWDA 5JUMA 3ITHA 5DG7A 1S4FA 2C22A 4MKBA 2W9AA 1FKOB 2FVSA 2RKIA 2W9CB 2UVUA 1VRUB 1NHVA 3KMSA 3MFHA 1SUQA 1VRUA 3V6HA 1IKXA 2BQRA 3QO9A 3G6YA 4DEZA 4F4YA 3LP0B 2XGQA 1T03B 4ED2A 1JLFA 1S49A 3QGHA 3DLGB 3KJVB 1NHUA 4URQU 1EP4B 3M9OB 3LAKA 1S97A 5J2PA 2XCPA 4LSNA 3KLFA 4KE5A 5EWFA 4RU9A 5KG3A 3FFIA 4ZPAA 5J2QA 3Q8QB 3OSNA 3GIJA 1S1XA 4K4VA 1REVB 1TV6B 3MEEA 4IDKA 5L9XA 5F8JA 4IH7A 2YNHB 3ICLA 4TY9A 1JLBB 4I2QA 2VG5A 4K4TA 4EEYA 1JLCA 2J6UA 3NBPA 3KOAA 4KAIA 5KT6A 5KG4A 4MH8A 3PR4A 4NRUA 1JLGB 1R0AA 2JC0A 4MKAA 2FJXA 3KLHB 5HP1B 1RYSA 1LWEB 3HKWA 4EYIB 4ID5B 4H4OB 5DG9A 1JLQA 3T19A 4WZQA 4IFVB 3IRXB 3H2LA 2WOMA 4ECQA 1C2PA 4DL5A 2BQUA 4YMEA 4J9RA 1JLAA 2I1RA 1RT2B 1C1BA 4ECUA 3GILA 3H5UA 1LW2B 4IH6A 3DM2B 2WCXA 2WTFA
chains in the Genus database with same CATH superfamily
4P72A 3US5A 1TL3B 5AE1A 5KFYA 2GQCA 1UZDA 4ZOSA 3NXZA 5M2UA 4NA2A 2YNIA 1ZAVA 2RHQB 2GMJA 1JMTA 5KFWA 2J0XA 2QLBB 2WONB 2F8MA 5E0OA 1SIZA 2DNMA 3NRBA 2VIHA 2Q66A 4IQMA 3VV2B 1TR0A 2R7OA 3DI6B 2QA4S 4WCEQ 3OLAA 1RBLA 1TL7B 4BC9A 1EQ0A 3N9UC 3DRRB 2K06A 1ICEB 2CG8A 3TVYA 9RUBA 2ZH8A 2C28A 3KMQA 4ZMMA 4URGA 4CH0S 4YS2A 2IY5B 3J80U 5KG0A 3OL6A 1KP6A 1X4CA 5CYMA 2AT1B 4IOBA 4OYIA 1NJIT 2A6MA 3CMQA 1SCJB 3DRSB 1MROA 1VC5A 4B9MA 2XMKA 1EB0A 4X2BA 2OP5A 3K58A 1VQ8S 1YG0A 3GYGA 3HXMA 1NLKL 2IRXA 2E5LJ 1RTHA 3T1AA 4LF6F 2ZVIA 4FKYA 4OX7A 3SBMA 4ZCIA 4ZHRA 4AL5A 3OUYA 1WF0A 2B7CB 3M2RA 2DGTA 3IG1B 1EETA 2VFTA 2MHNA 3IBWA 3MF5A 1YJNS 5L1LA 1CJKB 2FHJA 1QAIA 4CM2A 4LR7A 1O5JA 3H4BA 1GFWB 2DCUB 2KJVA 3GPAA 1HNWJ 4IRDA 4B3OA 4ES3A 1NDPA 3FKBA 2ZBPA 2YNFA 4ED0A 3OPKA 1RAIB 1HWJA 2COLA 3Q8VA 4QIWD 2KG0A 3RJMB 2XYGB 2XMMA 5K14B 5EWEA 2DR8A 4J9PA 4B3SJ 4Q8EA 3MUMP 4FNIA 5CYQB 3WZ0A 3C66A 2MZQA 4LJMA 5IM0B 2XS5A 1RA7A 3MOJB 2BJEA 3G82B 4K8RA 2NXCA 5L38A 5LT5A 3A4TA 1FDNA 4ECWA 1XK8A 4TXSA 1VQMS 1HW8A 5THWA 1T9YA 1URNA 3BGRA 1PYOB 1CS4A 1VLYA 3K89A 5T41A 3PO4A 2HEKA 1JKHA 2OGUA 3HX9A 3VGTA 3HVTB 1S6PA 1VQYA 4CO2A 5HQMA 3H98A 2W9CA 2YKAA 4GC6A 4CH7A 2OJ3A 1OPZA 4ENOA 2HVIA 1SQFA 5DS7A 3CD0A 1EP4A 2RE1A 1F60B 2CQCA 1S6QB 2JZ5A 4IG0A 3EXYA 4WFBQ 3KLIA 4C8MA 4DL0C 3J81U 5CZVA 2HGMA 3HSDA 1WWHA 4LSLA 1H7WA 4J9QA 1NU4A 1A6LA 3UDEA 2HIYA 1TQLA 3V6JA 4TU7A 2OPRB 3TZZA 2R8GA 3FCHA 4NLYA 4RNNA 2VG6B 3BBBA 1X5TA 2I5JA 1HBUA 2J0WA 3TA2A 3TX0A 3N6NA 2UXCJ 3MEEB 1SKUB 4MFBA 2VA2A 2OLWA 2DR6A 2LQ9A 5DRKA 4DV3F 2N4DA 2QJ3A 1KRPA 4V19J 4DPYA 2KVIA 1EETB 3VTIA 1U49A 5K5MA 1IKVA 2RHSB 1SC4B 2DXFA 3H5XA 4HTIA 5FDLB 4NI2B 1DRZA 3IWNC 4WF9Q 1HWIA 2DH8A 3KNAA 1X5PA 4HACB 3TYTA 4ECTA 3LP1A 3QIDA 3V4IB 2KHCA 4M5JA 4RWWA 3BSCA 4ZP7A 5ETOA 3AXMA 3GV8B 1A9NB 2HBZB 2SXLA 3CCZA 1LWEA 1TKDA 4TLRA 2OIHA 4DX5A 3EZ5A 1XC9A 5K14A 2IDEA 1L3SA 2XMJA 3HJVA 4IG3A 4ZPCA 4RJVA 2BW7A 1UMJA 3CCTA 2NCKL 2JX2A 2NXJA 4WFXA 5D0HA 1CSJA 4LIRA 1LXNA 1NNDA 2G1DA 3QAEA 4KB7A 4YUDA 3T6BA 4DV0J 3LPEA 5D77A 4OYZA 4HI1A 2HSEB 3NY0A 4NLPA 3UN3A 4N5SA 3D4JA 1PO6A 2AEFA 1SKWA 1IJFB 3MMAB 4HKQA 4ZPVR 1Q0NA 3UCUP 2IIHA 1L5UA 5IQQA 2E7XA 2YX1A 2BA9A 3TO8A 2PFFB 1NSPA 3GWCA 3N01A 3TX8A 1Q79A 4IH5A 5A76A 2B8QA 5DDRC 1IR2A 4Q2LA 4AXJA 5LMNJ 1TMMA 1RWMB 5D4NA 4ED3A 4YB5A 4KKOA 1NUEA 4DPTA 3M32B 3N4WA 4QWDA 2WRMA 1IBKF 2AV5A 1J27A 2EKYA 3DDKA 3CMAS 3UDCA 1OY8A 2KHDA 4DS5A 1GXLA 1V3SA 4F4XA 1U0SA 2H48B 2UV8G 1VRTB 2OUGA 3CGIA 3N79A 4ILRA 1E6VA 4GVBA 1KDNA 2K7JA 2VC0A 2NS1B 2FJEB 4JI8F 5F8IA 2E9ZA 3ZZ0A 1I3OB 4C9DA 4FBUA 1XR5A 2I0XA 1UW4A 3N28A 4ZLNA 1N32F 3HPOA 2QFIA 5IQ6A 3NGDA 3W3SA 4JI1F 4C3KA 2Z57B 5IS2A 1RHJB 2RDJA 1P1TA 3C6TB 1NSKL 4RW9A 2W4DA 5CCMA 5JVGQ 2UUCJ 3A12A 2VJUA 3CD6S 2KFZA 3IR6B 2BJ7A 2NPFA 2WW8A 2XG8A 2JFKA 4TY8A 4Y2KA 3RBDA 2HHTA 3C15B 2DVIA 5F0UA 1QLNA 2CPYA 3D6FB 5L39A 1DQ8A 4KT0C 3DYAB 2QC3A 3KLVA 3R7SB 3KHLA 3AOAA 2R8HA 1W25A 5IV4A 5KT7A 2NSCA 2LU2A 4LR9A 4DSKA 1JJ4A 2C3PA 2CQIA 4ANEA 1U0HA 2C2RA 5H9FK 4NLXA 3HFZB 4ICLB 4J9SA 4DLGA 2EBGA 1RHQB 3QZ8A 4J9LA 1HBOA 1K1SA 3M6UA 2JVOA 4X64F 2HZCA 4DSJA 1S48A 3MR2A 3MEDA 1H73A 1RAGB 3H0PA 1FK9B 4U96A 1GMUA 2A2CA 4JP8A 4PABA 4C0BA 3MECA 4OX9J 3AJ1A 4W98A 2XLJA 3HVTA 3CJRA 3OHBA 1XNQF 3PRDA 4IR1A 1NKBA 3MM6A 2ZUGA 2C3OA 2ACMA 2V8VA 2WHOA 2BEFA 3IO1A 1RXOB 1T03A 2V68A 1MU2A 4ZDNA 2MB0B 3C2PA 2Y1LB 2L48A 3IWXA 4L6V3 2CQ2A 2J7WA 1S76D 3HK2A 2QV6A 3SYZA 1ZZFA 1EIYB 1RAHB 2EK1A 2RJZA 3CDEA 3KXDA 2XMAA 3GIKA 2KO1A 3EX7B 2F63A 1FHTA 3OTOF 3POTB 1JLEB 2OPQA 3IWLA 1F5BA 4Q8FA 3TW0A 2N4CA 3HHLA 3I0SB 4ZVPB 3VWSA 4IFYA 5I3UB 3HCXA 4DUTA 2HWTA 3EE3A 3QATA 1MWZA 1Q8KA 2P2CB 1MN7A 2IA0A 2MZSA 2Z2YB 1RTDB 2Z56B 3BKUA 3CJ5A 3MM5A 2IMWP 3PEHA 3VVUA 5DDPC 1FJGF 5EX3A 1KKHA 3P49B 1RTJA 1FRIA 3NWGA 4M5MA 4JI0J 3SSQA 1WHVA 4I67A 1X8DA 3LQVA 4ED1A 4JI6J 4B17A 2HRUA 2E7WA 4DPWA 4I4BA 2H54B 2PGCA 2HGNA 3CD5A 4NL5A 1FKPB 4NYZA 4UOCA 4DBQA 4RNMA 1K9MT 2Z2LA 4USWA 1UTAA 1O51A 3H8YA 3KYLA 5DDOC 1QY7A 5AE2A 3FEXB 3D2WA 3PKMA 2RMLA 3CJTA 3MUVP 3A8EA 1S0MA 4MK9A 4JBCA 5LMNF 3O1LA 2PMHA 3QLHA 2XMWA 3PRVA 1PBAA 1G4CA 3CJQA 3HT3A 1UVIA 2UXDF 3I6PA 4WE1A 3UD5A 2JC1A 4HH0A 1SXLA 4ZJLA 2KXNB 1KSPA 2HAFA 4WXWA 3IP0A 3V2UC 2HG4A 2HS3A 4QQBA 1XERA 3L4BC 1RWPB 1DLOA 2EFNA 2Z8QA 2FJBB 4LREA 5C2GA 1IBLF 2F4FA 1QE1A 2NYHA 3HF5A 1T05A 1JQGA 4AYBD 2JEFA 1ZPWX 3UQSA 3J7YU 2FLPA 5KFGA 4FPIA 3AQOA 2CPFA 3UR0A 4YHHJ 2KXFA 1MMNA 2ZH4A 4B3MJ 1REVA 1TV6A 2I38A 5I42A 1UWAA 4PQUB 5HBMA 2XZTB 4IUFA 1CC7A 4H54A 1C0TB 3GP9A 2E9RX 2WBMA 1I1GA 2BM1A 1TAQA 1JJCB 2QLXA 1S5ZA 3DLKA 1M5SA 1EZZB 2ZBIA 1RT7A 4RPFA 3T1HF 2CNLB 4FVCA 5ETLA 2NZ4A 5HMXA 2ZUAA 2OEJA 3S01A 1T7PA 3W9HA 2HRYA 4Q2MA 5MLCV 4HYKA 2EC0A 4ECSA 2KN4A 1UAWA 5EHHA 2UXBF 4OHZA 3TVZA 2ZJPQ 2B9YA 4O4GB 1B70B 1FFSB 2IC3B 1KFDA 1VK3A 4EGLA 4F0KA 2KM8C 4RW7B 4DG1B 1C1CA 2ABYA 3BS9A 2O66A 3Q0AA 1IKWB 3RGIA 2OO4A 2HFOA 1DQAA 1PKUA 5CHCB 4DCPB 2OMOA 2B6AB 3RRGA 4TLQA 4FF3A 4ELTA 4QR2A 1XR6A 3C16B 4FXVA 1PCAA 2CQHA 4LRBA 3H40A 2W1BA 2LP4A 5ETRA 4N41A 1YRXA 1WELA 2BE9B 3OL8A 1C0UA 2YNIB 3FZBA 3E2EA 2HFNA 2DNLA 3A1YG 3GV7B 2BBEA 1XQIA 1JIHA 1RB0A 3L3CA 2VPWB 2MQMA 3AB2B 1OIAA 3IMQJ 1T05B 4DX6A 4UOFA 2IBKA 4N8NA 2C2EA 5L8RC 4NXNF 1H74A 3HHNB 3PX0A 4FF1A 2EG2A 1NJYA 1HQUA 4A8YA 4UZBA 4XIUA 1T3OA 3FSXA 1S9GB 1OPIA 2VG6A 1C0TA 1F5AA 3D3CJ 3P5TL 3CT9A 5MAOA 1KVIA 2BJ3A 3F44A 5J1EB 1DTQA 2O67A 4MKVA 3SCLE 3HZGA 3CCLS 5HI7A 8ATCB 2VFSA 3LGMA 2OPQB 1FNMA 3CF5Q 1HHTP 1M1GA 5T7LA 5HATA 4I7FA 4JYAF 1HMVB 1U6ZA 3DXSX 3MMBA 4CWBA 3R5JB 2AP6A 1C4CA 3LP1B 1EJ7L 3M8QB 3AODA 1M5HA 4BBYA 1KEKA 4DUYJ 4DCOB 1VI7A 4R5PA 2BKOA 1NK6A 3RB0A 1HNZF 2ZM6J 1T95A 4LF9F 1XMOF 4U7CA 2DRDA 4ID8A 4WKYA 2WB4A 3RR8A 4KO0B 3QJLA 1FCAA 3D28A 4HT7A 1QTNB 2YX4A 4F04B 1VS3A 2E5HA 3LWLA 1VHFA 2ZH3A 4LRFA 1NHKL 3OR2A 3W2WA 5M2PA 1NRKA 3NNAA 2GIRA 1V3ZA 5HJXA 2J0SD 2NPIA 1FFGB 2VHGA 2MGZA 1VISA 4G1QA 5C24A 2ALZA 4X4UA 2ZOMA 3RB3A 1PYTA 1CJUA 5L1JA 1MNEA 2HIQA 1WC0A 2CPZA 2PA8D 1NB2A 2PA3A 1URRA 3E51A 4S0MA 3HP6A 4PG5A 2VQEJ 1TU0B 3K5PA 4KQZA 1U1PA 1JB0C 4C8LA 2EXUA 2HNDA 4PUOA 1KD1T 4ECZA 4KGKA 3MR6A 2ZFHA 1L3VA 1QE1B 3DFEA 1N5VA 3DLLQ 2MQLA 4PEOA 1FTRA 1S6UA 3RAMA 3ZO7A 4X4VA 2W7OA 4FP9A 2AZ3A 3KLEB 2P8IA 1RWWB 1BQXA 3KUHA 4UF4A 4J9MA 2WAQD 4C8YA 4C4WA 3BF4A 3SCJE 3NGTA 4JOUA 4L3KA 4RBVA 3GCWP 2MLZA 3UDVA 3CC7S 3GR1A 3QT6A 2CADA 2DEIA 4ED5A 2BYCA 2GAGC 5HO4A 3FDSA 4K2XA 3LP2A 3DOMA 2ZVSA 3JTNA 1J2VA 3T41A 4DWIA 3M8SA 1NB7A 1RWVB 5C42B 2IYIA 2OHDA 3R1HA 2F9JA 4QOTA 4FNHA 2RIJA 5KFDA 4DR1J 2CA9A 2DITA 3WC0A 1H2TZ 3BBCA 2IC3A 4OJGA 7FD1A 1GNKA 3BKFA 1S0OA 2F8EX 2B0GA 3VAMA 5GADI 2KL8A 3BYPA 4CDIA 5F8HA 2GMLA 4KH0B 4ICLA 2P6SA 5KFUA 2LEBA 3N0VA 2LLZA 5JUMA 1WOSA 2QL5B 2YWHA 3ITHA 2DHXA 1S4FA 2OEMA 4J37A 2B4UA 2C22A 3KG4A 1FEEA 1VGYA 1R43A 5C7PA 3QQCD 3MXHP 1NCLA 1CBKA 1HFEL 1DQ9A 3H42A 3PFOA 3V6HA 3EVOA 2BQRA 2FLOA 4PYAA 2DHGA 3IAS9 2YXLA 4NXMF 4CO1A 1NHUA 2AD9A 4URQU 3PNIA 3LAKA 3A13A 1RU1A 1S97A 2XCPA 2PO4A 2B9EA 1ZM9A 3V5RA 2DJWA 4HI2A 1NKCA 2JLFA 5G0RA 4ZPAA 4AQYF 4X4SA 1Q82T 4OZ5A 3GIJA 2CPHA 1QUPA 1S1XA 1K73T 4RU2A 2HHXA 5EGYA 5AT1B 1FXDA 1XMBA 3FEZA 2UU9F 2FJDB 4K4TA 2GW8A 1HNWF 1AW0A 2J76E 5I3QA 2LXUA 3SQOP 2IDLA 1JLGB 2JC0A 1YSJA 2LA4A 1RWNB 2CJ9A 2LU1A 2LDYA 1CJKA 1S12A 3MCNA 2GV1A 3T19A 4IFVB 1WC6A 1E6YA 5IT4A 3OFHA 5K9FA 1UCNA 2MQNA 3CD7A 3Q8UA 4YMEA 4J9RA 4JI7J 1NDKA 1RT2B 2D69A 1C1BA 2JJ4D 3P3DA 5HVGA 4ECUA 1IBMJ 3QJJA 3PX4A 5IT9U 2DR9A 1SVDA 4IH6A 3GJQB 2XYPB 3JSRA 1NJXA 5KFZA 2HW3A 2IVMA 1VQKS 3SFGA 5HROA 1DHMA 4FVMA 4NCBA 3MMCA 3D0HE 4TU8A 3JSMA 4QIGA 3JTPA 4Q7AA 1MMLA 1WI8A 3T9NA 1WOOA 2V4JB 1FKOA 2HK3A 3FVYA 5K8PA 4C8OA 2OSQA 4DQSA 1Y0HA 4QZVB 2CRLA 5CCLA 1SUQB 4FS1A 4CLLA 3ILJA 1VJQA 2XNQA 3T5KA 1B0PA 3DRRA 2JSXA 4PCQA 4X4QA 3DRYA 1O6XA 2CWKA 1I94F 1M1HA 2YKNA 3RRKA 3IFEA 2CNOB 2KFYA 3IRWP 4DV3J 2AGPA 1XMOJ 2Z2ZA 3BKTA 4U8YA 3NP5A 5KFTA 1JJHA 4CLWA 2WK4A 3QRPA 5DQGA 3G6ES 3WIVA 2MQPA 1T9XA 3G8SA 4LSLB 1IKYB 1RZMA 3KLFB 3MM7A 1YWXA 2GS8A 3VR1A 2JRSA 3R8YA 1UW9A 2OPRA 3Q8PB 2W9BB 1IBMF 3D0GE 4DCJB 2M88A 3EGZA 2V4QA 2HVHA 4B9SA 5KFBA 2X3GA 1WF2A 3KK1B 3GB0A 4A48A 3B4DA 1RHMB 4RUBA 3I4PA 4P2SA 2G1HA 4ZK7M 3K8VA 2ATCB 4LBHA 4YR0A 2VQEF 2E1CA 2XC9A 2G2OA 3ZZUA 1RT5A 3QFHA 3MTKA 3M9MB 3TAMB 2FZGB 2LXIA 5CYJA 3PKYA 3BQ0A 1Q7YT 1N36F 1D9FA 1HQEA 5ADZA 1RAAB 5C25B 3I0RA 3V6DA 1ZA2B 2V8HA 1B7YB 2IM1A 2QLJB 4L74A 3GIIA 1BQNB 5A0YA 1F3FA 2NREA 2CJQA 2UVVA 4DUZF 2AX0A 3JTOA 1OJ4A 3PTWA 1P6TA 3M8PB 3Q22A 2O3DA 3IGVA 4I6AA 4DI6A 3RR7A 2B51A 2FVQA 1LW2A 1I6JA 1IR1A 1YZ7A 1X4FA 2ZNYA 3UI3A 3M6XA 2KT2A 4KBIA 2GQ2A 3CXCR 1R0BG 2KT3A 3H2VE 3RBZA 4C7QA 2BKNA 4E2FB 3GV5B 1VC6A 5FLXU 2FLNA 3RUBL 1FXRA 2BJ1A 3GONA 4NXMJ 2OPSB 4U7UD 3KG0A 3DOKA 3MGJA 5CD4H 3KG1A 3LAMA 3RB4A 1SKRA 3C14B 3OJUA 4CLSA 3VAFA 4LRCA 3MPWA 1DFDA 5LJ3Y 1F9HA 4M5DB 1FE4A 2MLXA 2WVDA 4XDCA 2HNZB 3JYTA 1MSWD 2XSJB 2DXDA 1ZZNA 2VB6A 5E3RA 4GKJF 1DY3A 2HMIB 1KQSR 3I96A 3PV8A 1WTBA 1RDRA 5BYQA 3CDBA 2NUUG 2V8GA 2PI4A 1BWEA 2AYEA 5KFRA 2Y0SD 4UY85 4OJHA 4KJIA 5A2QY 3OL7A 2R42A 4HL9A 4CLYA 2HAIA 3MMBB 5KOWA 2DPJA 1BMQB 3PHTA 4X65J 4CLZA 3THTA 2ZZMA 2AJFE 3AA8A 3DLEB 4JI3J 3QYYA 2FZKB 2IM3A 3TUJC 2W2NP 4H4OA 4OI1A 3R6LB 4CTAB 4FYDA 4L75A 4LF7J 2YY3A 2D9OA 3CO9A 3AD7C 2Q3PA 4WYLA 3THPA 3I56S 1UVNA 2H4WB 1Z2LA 2C3YA 1RTIA 2Q6CA 1M90T 1HPZA 2B43A 1RT2A 3CCQS 4KSEB 2VG7A 1UPPA 3Q8RB 3ET6B 3MM9A 4G1IA 3SMZA 1WSVA 3OTDA 4DL2A 6AT1B 2B6AA 4P73A 1U0HB 5KTQA 4F3QA 2WVFA 3OLBA 1P27B 2RDIA 4F50A 3PIOQ 3MM8B 3W2VB 1TKXA 2K1RB 4DMZA 4DXLA 2W8LA 2M2BA 1ZH5A 1C0UB 4DSIA 3ONQA 2XO7A 4B9TA 1IKXB 4BS2A 1NM2A 4JV5F 2KYXA 5KFQA 1DTTB 3D5MA 3M4XA 4UTGA 2GIFA 4PXCA 2E1AA 3MPUB 2AU0A 1QD1A 1ZS6A 1IN0A 2HZAA 2QTWA 2JHEA 1FD2A 3EUNA 3M32A 3MAHA 1KNZA 1PC4A 3C8YA 3CJ4A 3FRYA 1N56A 1J5EF 2ZOGA 1UVMA 2DNGA 2ZDOA 2E5LF 3W5XA 4LF6J 1SKSA 4YY3J 2EKNA 1H3DA 3IR5B 4XK8C 3SIPB 3PX6A 4TYBA 2HQGA 1HIYA 5DZ6A 1LNQA 2P9EA 3OV7A 3JQJA 4I68A 1U25A 4DV0F 3NEKA 2FJWA 1WG4A 4N47A 4DV6J 3PDNA 1Y7PA 3J7A1 3U7JA 1T9UA 4MK8A 3BH6B 3K17A 4C98A 3I0SA 3IC1A 2WVBA 3I31A 3R5BA 2ASYA 3EGNA 2YNGA 1NZ8A 3VGUA 3B4MA 2HS0A 2ZBQA 2P5VA 2DR5A 3RW6A 2QIFA 1T02A 5CD4A 2C42A 3DLBA 3K0JA 4J9UE 4B9UA 2BJ8A 4P71A 4Q5VA 4RWXA 1GMVA 3P8BB 4NLRA 3PIPQ 1KWMA 1EKRA 1LWFA 3QWUA 1KBRA 5B08A 2OFHX 3OR1A 5DG8A 1BQNA 1P8GA 4K4SA 2QLFB 3G82A 1NSAA 3HVAA 2H5JB 1IUJA 4Y3CA 4F67A 3EDQB 3HFKA 2LVWA 1UPMB 3ENAA 2HVDA 2V50A 3PW0A 4LF8F 1WKJA 2XULA 5HMWA 1TL3A 3KK3A 4M5HA 1RT3A 1MW7A 1YJUA 3GCXP 3MM8A 3MTJA 4OX9F 3W2VA 4TQSA 1XMQF 3K59A 3NNCA 4HTJA 1HBOB 2Q6BA 2VV5A 1F9EB 2DD8S 2PMWA 4ELUA 1RT4A 1SH2A 2V4RA 3ISND 3P45B 1RCXB 3ULHA 4OFZA 2ZWPA 2BRKA 3DOKB 5J2MA 2V69A 4O0NA 1KOOA 2PSZA 4HDGA 4K2JA 4USVA 4DR5F 2XY6A 3Q2TC 3FJ2A 4KHMA 2HBQB 1Y3KA 3VQSA 3T1YF 1KS2A 1SC1B 4RNOA 4PUOB 1N5TA 3B6BA 3HD1A 3PJWA 4DR7F 1TKTA 2VFRA 5GAEU 2CPIA 3JQMA 5L1IA 4EWTA 2WSCC 1U2RA 2HNZA 4WU2A 3UCGA 2DNKA 5K8MA 2R8IA 2FB0A 2B9WA 4K7QA 4CNZA 1B64A 4O44A 1LW0B 1CJTA 4KPCA 4PXEA 1HBUB 4ANDA 2JLEA 4OLOA 1U1QA 1ACMB 1CC8A 2ZD1B 1RSCA 2HVZA 2DGVA 2VDHA 1S6OA 3OXGA 4NLUA 2Z30B 4DV5J 4ZVFA 2ROEA 1X4BA 5ETKA 3T6JA 4A46A 2HQFA 2YKQA 3F56A 3NAIA 1PYSB 3DHXA 2FC9A 1CG2A 4CT9A 1ZOTA 1HD0A 4PXDA 3UD3P 5DGAA 1R0AB 3Q8YA 5DLGA 1YX2A 3NBPB 2F8HA 4WXOA 2A0FB 4KC5A 4ZVQB 2ADCA 2PE8A 1TKZA 2OH2A 3CE8A 1VQSA 3I82A 4GVLA 3CCVS 3FSIA 4LQ9A 4WZMA 1TTHB 2MQOA 2KFNA 1APSA 3M1VA 1C1CB 3DC2A 3QSYB 3ZZRA 4R0EA 5ETQA 4GKKJ 3I9ZA 4P7VA 2GVZA 3IRXA 3LW5C 5FJ4A 1FJCA 2HNYB 4OI3A 3QGIA 2IRYA 4AE5A 2B9XA 3NG8A 4OHYA 1VC0A 3LANA 1OY6A 4O4RA 2ZE2B 4J5OA 4KV8A 2R3VA 4AD6A 4RW6B 2WSFC 3OVSA 1I51B 1ZTTA 3NKYA 3PEJA 5BR8F 5HVFA 3DCAA 1Q95G 5GVQA 3SSRA 3TUIC 5GAHI 2R7RA 2UUBJ 2HHQA 1VBKA 3ZZZA 1QSYA 4YR3A 1GXUA 1SH0A 1A7GE 2A10A 2H5IB 2JNJA 1SC3B 3A3PB 4N77A 3SSSA 3HVWA 3KNGA 4KGVB 1YLXA 3NS7B 2E29A 2E9TA 4ZVUB 1P1LA 1X60A 2XTJP 3E01A 3OTOJ 2ACYA 4Z7CA 2OKQA 1FWPA 2LFVA 4ZITA 3QO9B 4YHHF 3Q23A 3OHAA 1VQLS 3P4UB 1FRHA 4ZKAA 1HQUB 4B08A 1VYAA 3MPVA 2ZC3A 5B7WA 1HBNA 1XTZA 4DR4J 1LW0A 1RE1B 2AJ0A 2FGCA 4W4MA 1TK8A 4JI8J 1NEEA 5A6PA 4DFJA 1Q7LB 4LF5F 2EVZA 3ZTSA 2R7XA 3ENVA 1ZM4A 2XZDB 2M3DA 4NLVA 4YP3A 3JSBA 4UT4A 2ZH1A 5HJYA 2PC6A 5A8KA 1S1WA 2E44A 5EWGA 4OQJA 2IJRA 5BR8J 1PJ5A 2CPDA 3NGKA 4WK1A 2GFFA 5HP1A 5ETSA 1X9SA 2CQ4A 1G3OA 2R7WA 4B9LA 4ELVA 4NZ6A 5A8WB 3VGVA 1SPBP 2RUSA 4H4KC 2Z4PA 4Y65A 5HMYA 2HHWA 2VFVA 4IO9Q 1UWBA 1TL1B 3W8GA 3THVA 2D3UA 2JFDA 4RW7A 3N5BA 1S10A 5JMNA 4DL6A 1PJ6A 1SJFA 4KIAA 4C8KA 4KV8B 4B3TF 1AZSB 4HH1A 4FYVB 1RQ0A 4ES2A 5HQ8A 2DRBA 4AQYJ 3WQPA 2J6SA 2AJ2A 2I8EA 3CB4A 1HLWA 2WW4A 4LBPA 4DR3J 1YJVA 4EI2A 4I2PA 2KRRA 3TJ8A 4P74A 1YBAA 1UJ5A 2UU9J 5HROB 2XY7A 2ZEJA 3GZ7A 3VZIA 2A6OA 3HM9A 3FZ2A 4RR5A 1CJUB 1RU2A 3IR7B 3SDEB 4ILMA 2UVWA 3DHWC 3KLGB 3GE9A 4DL7A 1UFWA 4X65F 2BE2A 2V9WA 2QL7B 4Y2IA 3WIUA 3MAQA 4DFPA 3TZYA 2VASA 1MU2B 3TQ1A 1HNIB 4A4JA 1QAJA 3LPYA 2CFXA 1KLMA 4ETZA 2M8DB 3KLEA 4EBDA 3EZOA 1NK5A 4LF8J 2DGUA 3J81Y 1BD6A 2YTCA 4N8OA 5J2PB 4I6YA 1RT6B 2IAJB 1F3VA 1AFIA 5E3QA 2EEYA 1DAXA 4DJBA 4KFBB 1KTQA 1MN9A 1YJRA 4IFYB 3G87A 5IC4B 2XCAA 5ETVA 2VG5B 5GMDA 4F0MA 1B0VA 4F0HA 4DR1F 1VCTA 1IKVB 2FYXA 3V4MA 3I32A 5EDWA 3QZ7A 3SV4A 2FPHX 3AHPA 1ZTWA 4P2XA 1JNZB 3M6WA 5DZ7A 5ETPA 1T11A 1XNRF 2HKEA 4OX8A 2HVEA 4CI0B 4CH1A 2DKOB 2AYGA 2J6TA 4K0KJ 4MTPA 1ZYQA 1K0VA 2AYBA 1V3RA 2GMHA 2W25A 2CPEA 3OVAA 4RUAA 4M94A 3W5YA 3OD2A 2CDRB 4UUWA 4Z2XA 1L3UA 1S77D 2R7QA 2CPXA 1HWLA 2YKPA 3ET6A 3M8RA 3PW5A 2MY8A 1RABB 5T14A 2ZBCA 1N33F 4RW4B 4ZVHA 4LVOP 1WORA 1Q8BA 1N0VC 1TVRB 5IM0A 3CCJS 3FUYA 2Q79A 5DM7Q 1KR4A 1EARA 3G2XA 4LSZB 1WC1A 1WOPA 2U2FA 5F8GA 1JKHB 2QMUB 1Y00A 3ITHB 3LO3A 5B09A 1FJEB 4GO5X 2G13A 4AL7A 4JYAJ 4FN5A 1S57A 1IBKJ 3DRPA 2E5JA 3M2UA 4O23A 3JS9A 1U45A 4P10A 1H2UX 1Y3JA 3TUZC 4NLWA 3GYXB 5KG1A 2BANB 3J7YI 1S6QA 3D1OA 2MJUA 1UA0A 3QT5A 4BWJA 1U6BA 3NL0A 3ELHA 3U1MA 4CT8A 3EZUA 1R3NA 1E6VB 3K2YA 5KFXA 3O6QA 4IG0B 1FRXA 3UN5A 4OI0A 4NCGB 4M1KA 4ZA1A 5IFMA 5CXTA 3NNHA 4OHVA 5AXKA 4ED6A 4B3MF 5D3GA 1VOMA 1FFWB 4QW9A 2BQ3A 3MEGA 2CJKA 2KTQA 4RO0A 2UUAJ 3EGVA 1FJGJ 1YDLA 2MKSA 1HNZJ 1ZAXA 2QGFB 2RVJA 3G4SS 2XMVA 1YHQS 2YBVA 1WDDA 3IGNA 4ZHRB 2XZWA 2VC1A 3B8HA 4FKXA 3QAUA 1D3WA 3O8WA 2JH3A 2B8PA 2IYGA 4KHRA 4NLQA 1J5OB 2N82B 3PRBA 2V67A 3TAQA 1NK7A 3CIMA 4I56A 2B5JB 4J90A 2DGWA 4B3TJ 1IKWA 2VU5A 3IS9A 2V63A 2YVSA 4MK7A 2XO6A 4KGMA 1IM6A 1FKPA 2LYVA 1LKZA 1LEOA 1FTCA 3GMGA 1RTIB 4JI2F 1JX4A 1C1BB 2RAQA 2H4YB 2IJNA 2Z0GA 3W66A 4DR2F 3G96A 1ZPVA 1TVRA 2F5GA 1VIXA 3OXFA 4B3RJ 1F0XA 3LH2S 3QWPA 1IWGA 5HANA 1S7IA 3R6GB 1RAFB 5B0GA 3TOQA 2VQFJ 3AFGA 4FZVA 4EZ6A 2DEJA 2W9AA 1ITPA 3HKZD 1FKOB 2FVSA 1FERA 3MI7X 1F1BB 4PWWA 1PJ7A 5HN0A 2UVUA 2J7UA 3KMSA 3MFHA 1SUQA 4OYAA 5LJ5Y 1Q8LA 2CQ0A 1IKXA 1FESA 1HKAA 1JWWA 2GGPA 2V8DA 3LWMA 4F4YA 3MCMA 2FC8A 1L3TA 1T03B 3QJPA 1BY9A 3BDEA 5SUHA 4AT1B 3M9OB 2FHOB 1EP4B 3CCUS 4ZIWA 3S8SA 2KU7A 1WHWA 3KLFA 3OXLA 3TP2A 3TARA 2W24A 3CJSA 5EWFA 4CCHA 3FFIA 3M2VB 5J2QA 4JB8B 4M5LA 4CQ1A 2DTJA 4OHWA 1QAXA 2X51A 5ITHA 4IDKA 5L9XA 5F8JA 4ES1A 2DXEA 1FDAA 4J91A 4EFAC 2FY1A 2RDDA 4UZCA 2DB1A 2D3OR 4DSLA 2X3DA 4PKDB 4TY9A 4I2QA 3G8TA 4JI1J 1JLCA 1RBOB 5GADU 3VAKA 1HR0J 1IXKA 2GVDB 1WEXA 1Y4ZB 3CUNA 3SV3A 4MH8A 4DF4A 5H9EJ 4MKAA 1HW9A 3KLHB 1XIQA 2Q1LA 1NK4A 2DNHA 2ZWOA 3DDIA 5D78A 4EYIB 1TK0A 1ULRA 1FX4A 1CJVA 2EC2A 1FO1A 1FWKA 2X7IA 1SIWB 3H2LA 3L7UA 1I5OB 4DF8A 2L08A 2VONA 2CXEA 4NCAA 5LXYA 3GILA 3GTYX 1LW2B 1R8BA 2FHKA 3DM2B 5CAAA 4I64A 2WTFA 3O5TB 1LK7A 4F26A 4ECRA 3M30B 3CJ3A 3GR0A 5H9EK 3VCDA 4RUCA 1HARA 1AFJA 3WHIA 5EN1A 3DU6A 4HHUA 1SV5A 3N5FA 5EX0A 2BX6A 4JV1A 4WKRA 2WZ1A 1DLOB 3MPYA 4CZCA 1RHRB 2G2YA 4HT5A 2AQ4A 5ETMA 3UW1A 1IQZA 1PC5A 4WFAQ 1NPPA 2XI3A 4AL6A 3TI0A 1NKEA 4NLSA 2RQKA 1NZAA 2DGQA 2U1AA 4KRWA 5L1KA 2BE7D 2Y9HA 4NLTA 3R5DA 3G8QA 3UO0A 7FDRA 2L41A 4ZIVA 4E0DA 5K8NA 5IT9Y 2VDIA 1RISA 2BDPA 3BEGB 2CKWA 3I55S 3CJ8A 3K5MA 4AUKA 2FQQB 5E3AA 2DISA 3ETOA 4C0HA 2V2QA 3W62A 2W9BA 4I2QB 2GZOA 1FKAF 2CQBA 4USHA 3Q86A 4OJ3A 3M2RB 4A8WA 1VFJA 2QMWA 8RUCA 1RTDA 5IWAJ 1VQNS 2DT9A 3LP2B 3DOMB 1VK8A 4F2RA 2GHPA 2A1BA 1M0SA 1X0PA 5KFIA 3T5LA 4DPOA 2MEWA 1QVFR 4LR8A 3X1LB 1AA1B 1AYEA 3MM5B 4A8MP 3OTEA 5ETNA 3ZZOA 1YRTA 2IJFA 4B3OB 2P6TA 3PW7A 4F3OA 2IVYA 1TUWA 1UWBB 5CQGA 2DY9A 3MEKA 2UP1A 2I2YA 3BO2A 2O5DA 1UP1A 4IKAA 3RU0A 4C11B 4HLBA 3X3UA 2J7KA 3IXQA 3W7BA 1QUVA 1PAUB 1UETA 2E1RA 2ATLA 4C8ZA 3H20A 4MIAA 2ZH9A 4YDXA 4DU7A 2PN6A 3H5YA 4UOGA 2Y1JA 3GLJA 1W2BR 2HGLA 3AQPA 2V94A 3DOLB 5DQIA 1RADB 1U4BA 2RQMA 4ANCA 1SV5B 2GJ2A 4R25A 3CCMS 4RZRA 3S6EA 1S6PB 1N5YA 3ADAC 1VQPS 1NO8A 1D9DA 2DNRA 3LTOA 5IXUA 5CH7B 1ZA1B 1FK9A 2MQ8A 4ZLLA 3DRXA 1YK9A 3IA0A 4L76A 4OZ1A 3MR5A 3KLIB 1Q5YA 3EVWA 4X4OA 1KLMB 1BQMB 2RS8A 2Z58B 3TNVA 3LA0A 2KI2A 3H59A 1KOHA 1K0TA 3T5HA 3W63A 2ZJQQ 3HD2A 1S9GA 1RUSA 4OI2A 4O3PA 1OSDA 1NAQA 5AJ3J 3DRSA 4P2FA 4QWEA 3TZWA 3UDLA 4JI2J 3QT7A 1WTFA 3J7Z5 1XNQJ 3KTQA 1RI7A 2V8PA 1FI4A 4WFZA 5I3PA 3QRQA 1FD8A 1YJ7A 2ALYB 3BSAA 3UWTA 2YNHA 4LFBJ 2PI5A 5E33A 3A8KA 3N6MA 4NMXA 1DBDA 2C2MB 5BYSA 1X4HA 3IM9A 3HHLB 5HVHA 1OQ6A 4YOEA 1X4AA 1RT7B 2IM2A 4QIVA 2KVQE 2LEAA 3D66A 1RBAA 2K8GA 4J7CA 4NMLA 3M6VA 3UVJB 2CJYB 2KKHA 4JI4J 1QM9A 1RAEB 3NGUA 4H4KA 1FA0A 4EK2A 4LQ3A 3DGPB 4QYZJ 2K2PA 2YKOA 4WYWA 4XDDA 4K4UA 4IG3B 1SJQA 1TUVA 2CUYA 1WEYA 2AX1A 3BR9A 5IT0A 1FRJA 4UW2A 1GH8A 1TMJA 2W2OP 2HK2A 3KKFA 4C3LA 4C97A 2YNFB 1TFWA 1VQ6S 1WNEA 2F3JA 4OZJA 3UE2A 2XLIA 3VAHA 4EYHB 1CQNA 4OYWA 4WP3A 4YB1P 1HYSA 5GMKa 4X62F 3EPIA 4OYBA 2VG7B 4ZLJA 4J9NA 1N6QA 4XPEA 3R7BB 1H38A 4A8KA 2YQ0A 3BQ1A 1N5YB 1Y11A 3D68A 2RKIB 1ZM2A 2EI5A 1YJ9S 3L9ZA 2ZH2A 4ECVA 1B3TA 2UXDJ 3C6UA 4ZPDA 3SCKE 1R31A 5C2CA 5D8HB 1BGXT 2C1EB 2XLKA 1JLFB 1YBUA 2W2QP 2DR7A 2DHAA 4HVZA 1DJ0A 4H4MA 4GO7X 5B0BA 4QU7A 5F8MA 3LP0A 1Q5VA 1FNOA 4UUXA 5K20B 1SJRA 1V6HA 4ZPBA 5DDQC 3DLGA 3KJVA 1YZ6A 5D4OA 1VBXA 1R0CB 2Y8WA 4K4ZA 3WDOA 1S99A 3D6TB 3HLUA 4GVBB 4Q45A 4TU9A 4G1PA 5IV3A 1GK8A 2MKIA 1VQOS 3KHGA 4USJC 1O8BA 5M2RA 3BYRA 4HHJA 2ERRA 1JXEA 5HLFB 2XYHB 4Y2CA 3OUYB 1GEHA 4GMKA 4FBTA 4LF9J 4JI5F 4K0KF 1GMWA 2E1PA 2QSFA 4MKYA 5KFLA 2N7CA 2E5IA 2J5AA 1B4SA 2F7VA 2VBXA 1XEZA 2NXUA 5E2QA 1AROP 1RTZA 3NCRA 3PHEA 4F4ZA 2HRTA 4RW9B 2MKCA 1JLGA 2B5JA 2G0JA 3AAWB 3E3XA 5E5NA 1NJWA 3ENWA 2L9WA 2MXYA 2D7SA 2GVZB 1GQEA 4FYWB 1JLQB 4YDDB 4WIQA 2FUG9 1BHNA 4EMDA 1IVZA 3DYAA 2GAHC 4C11A 3C19A 3HHKA 1AXQA 1LQ9A 4KO0A 2GJFA 2HHPA 3I9V9 4MYUA 1D0EA 5LMUF 3HO1A 1HHSA 3BN4A 3I87A 2C2OB 1Q53A 5KAKA 4I69A 1Y10A 1N5QA 2ZE2A 2BJ9A 1WKLA 5FLXY 1D09B 4NYPA 2RRAA 2ADBA 3FMWA 1RT1A 4PWDB 3MAAB 4MT1A 2R7VA 4X64J 2GO8A 1TP7A 1XBWA 2L9NA 1RHUB 1UEKA 2N7YA 2QN6B 2RILA 2AMCB 2WVEA 3RB6A 3TA0A 4OZLA 4L72B 3U1NA 3NMRA 4LVNP 4O3RA 4A8SA 4DV7J 1VLOA 1WUUA 2VBYA 3JAMY 3UNGC 2BV3A 1FVQA 3BZQA 4OL8A 2FY8A 3RAQA 3VVTA 1OS5A 2CQ1A 3DKDA 4NASA 2Y1RI 2V2KA 2RS2A 1U1KA 4OZ2A 5LXRA 2QA2A 4NCGA 3KK2B 2XMUA 1S1XB 2HLUA 3ZTQA 4CM0A 4UQGA 3UNYA 1HI8A 1TELA 2CPJA 2H1YA 2QSWA 4ZP6A 3OFFA 5D4LA 3OT9A 3PXGa 3BH7B 1CJTB 1Y9OA 3CPWR 1U2FA 4A8FA 5J1EA 1S1WB 1YVFA 3AJDA 4D3HA 4WP9A 1JLCB 5BJRA 2OTLS 3FC9A 1S9EB 2IBOA 3LGHA 4QYRA 4CYUB 1N36J 2XBPA 6FDRA 2JDJA 3G86A 4NZ0A 4B9NA 1N32J 2LKZA 3V4IA 3IG1A 1JJ2R 2MZTA 3BN7A 3S1TA 4NLOA 4DPXA 4RBTA 4Z37A 2XQCA 2XGPA 3VHQA 1HR0F 2YKMB 3RYLA 3TAMA 5IOLA 5J2NA 3VF0B 4QPXA 1NMEB 2KM8B 3CDUA 4CTAA 6FD1A 3M9NB 2ASJA 1NPRA 1R27B 2UXBJ 3AB4B 2MTLA 3D9BA 3MHYA 4DPUA 3GIMA 5FIIA 2KH9A 4NYOA 5D4PA 1VBYA 1Y5IB 1JLAB 4C48A 2NZCA 2XSFA 3EM1A 2ASDA 1BE4A 2UUTA 4MJKA 2VPYB 4BCAA 3V81B 3QMQA 3VALA 3DMJB 2RQCA 3R7NB 1G6BA 4JV5J 2JL9A 1ZBTA 1CS4B 3ZZPA 4CLTA 4EU0A 1T0TV 4FS2A 3HSGA 4OZ0A 4W90B 3R5GA 2QX0A 2DGXA 5KG2A 1L3KA 1UL3A 3BGOP 3QGGA 1YGYA 4Q44A 2M70A 2VL1A 1TL4A 1FXLA 3A3OB 2NUHA 3BPDA 2W01A 5JXSA 4JI4F 3Q8SB 5D0GA 3OBIA 1T94A 1U1OA 4M63A 4W92B 1QVGR 2BUNA 2OPPB 2X1GA 3CDWA 5F41A 1X0FA 4DV6F 5F8NA 4LSNB 3QT8A 3K8WA 3BPSP 4J9KA 1AB8A 5CYMB 2YWFA 3SCIE 2DH7A 3M8YA 2Y1IA 2R8KA 5HBMB 3ZNJ1 1FT8A 1MROB 1QAYA 1PILA 1DTQB 2KDOA 1YTYA 1UA1A 1U47A 1T9VA 3DDNA 4U7UK 1S1VA 1WC5A 1IQTA 1S9FA 4GKJJ 3HHEA 1W26A 4DLEA 1KHVA 2VICA 4OLPA 3O44A 4HHHA 4MIBA 3NGSA 1WC4A 2PD1A 2FTRA 4PWUA 4YB6A 3TVKA 4BHQA 2RU3A 1N34F 4DR6F 3A3NB 2KT5A 4R8UB 2DNQA 3J7ZT 2XHWA 4DU8A 1SL2A 2J8AA 3B82A 1NH7A 2UXCF 4M5GA 2GVDA 2J9CA 4FF2A 2AEJA 4O4GA 4J9OA 4UY8T 4WIIA 5BXIA 4X84A 4HR2A 4X4TA 3O3LA 3I0RB 3V6DB 2IHR1 4F4WA 4DS4A 2G2ZA 4NRTA 2EFPA 4C3MA 3MOZA 1QTMA 2DRAA 1CPZA 3MMJA 3CDAA 3S7RA 1WHXA 3ENQA 1GX6A 1RWXB 1WJ9A 1R8HA 4OZNA 2LQ5A 4TVAB 1GAOA 2HHHF 3BO4A 3EICA 3W2WB 3QIPA 1BWVA 2RRNA 3FQLA 1KC8T 1WHYA 1G2EA 4RL1A 3FBFA 3HDSA 3SEOA 3KK3B 3FCVA 1M5VC 4B3SF 3MM9B 4IR9A 2CIMA 1U48A 1UZHA 4F2SA 5KFMA 3RZAA 4PG4A 4O3NA 2I6WA 1RT3B 5B0AA 3T1YJ 2V9KA 3D6HB 3BO3A 4DV7F 1HA1A 4ED7A 4U67Q 1B99A 1K44A 1KVKA 1BXNA 5KFJA 4USMA 2EBEA 2GCFA 4EUVA 2DNZA 2DYAA 2ZH7A 4DSFA 1FF2A 2I9SA 2FHMA 3JYTB 2QO3A 5GAGI 3EJMA 4GC7A 4QCLA 1DURA 1HHQA 4U95A 4BWMA 2DNYA 3NLCA 2Y8YA 1RHKB 3ZZYA 3HJFA 2D3O1 4LF4F 3CWJA 1X4EA 1V5IB 3KK2A 3DXBA 3NCQA 2HS4A 3BV8A 5I42B 4PQUA 2B56A 1XWLA 3BGUA 4K5RA 2QE5A 2FVCA 4LRAA 2AEMA 3W5ZA 4AFFA 4Y34A 3PW2A 2CJXB 4Y6IA 2QFJA 1P9YA 1RWOB 3T5JA 4OHXA 2FD2A 4LF2A 2X1AA 3UVJA 2QT7A 5D0RA 3C6TA 2QYCA 3VZHA 4DFKA 2JEIA 1RKIA 1RTJB 4LUBA 2MPUA 1VQ7S 2RQ4A 4KH1B 2UUCF 5FDLA 4NI2A 1LWCA 4E98A 3PG9A 2IA6A 2VKRA 2NSBA 3GSIA 2PDAA 4ZPTR 2X1BA 1FE0A 2VOPA 5GAGU 1YITS 4LF7F 2BMBA 1RKJA 1HWKA 4R5PB 3W61A 2EK6A 4RLEA 1HYSB 3IBCB 5LOQA 1XR7A 2J9DE 2AGOA 1IBLJ 1N6QB 2LCWA 5B0DA 2XB2D 2F1FA 3ZXWA 3GJRB 4QW8A 2CNNB 3ZZTA 2JOQA 3DNCA 2KYZA 2B4VA 2WSEC 4OI6A 3FBCA 4TYAA 2E1MC 4N76A 2MJNA 2WONA 1X5OA 1TL7A 1RWUA 3ISNC 3AD8C 1U7LA 4X4RA 3PR5B 2NYIA 4QIFA 4DL3A 2HNDB 2W7AA 2LA6A 3BR8A 3UN2A 2J9EA 3VQTA 1HI0P 1BC6A 1EAYC 2VOOA 4QU6A 3R5CA 4QWBA 4KKOB 2OFGX 3KHRA 3I5CA 1SI9A 4FYYB 3H25A 4ZCLA 2XSJA 3LF0A 2BACA 4MAKA 1NH8A 2HFUA 5KFPA 1TKTB 3SI8A 1HBMB 2V0NA 4L73A 3J80Y 3CJKB 4ZCKA 1PGZA 5J2QB 1UFLA 1U8SA 3OSPA 4CLFA 4JV2A 2VA3A 4PPZA 1D8ZA 1FRLA 3IM8A 4P52A 2HZVA 3H7HB 4G3IA 3SZ2A 3L95X 3MM7B 4NA1A 3SFUA 1MG7A 4X4PA 3D67A 1S1VB 4Y28C 1LXJA 1Q16B 3HHLC 3FGVA 4Q0BA 1GTEA 1K1QA 4F8RA 2OD4A 5RUBA 2Q43A 1KQKA 2RNEA 1S1TA 1LFPA 2ROGA 1T9TA 3HHDA 2V5HG 1T3NA 1LWCB 1OYDA 3GJTB 3HMJG 1S59A 4KHPJ 4OZ3A 3QNWB 3RG6A 2AW0A 3EGWB 1RJJA 4NE9C 4ZPWR 1N48A 2DBBA 4F7VA 3R9LA 3R1LA 2OELA 3J7AN 1SB6A 2UVRA 1HPZB 2DHHA 1NK8A 5C25A 2IRUA 2PEHA 3PCOB 5CA5A 2VPXB 4HDHA 1HNXF 3K5LA 1Q1KA 2XMTA 3HSJA 3M7VA 3NOCA 2HPUA 5GAHU 3L7OA 4YEAA 4LFBF 2ILYA 4ZN1A 3QLHB 3QIPB 1AUSL 1Q4RA 1WG5A 1JK9B 2R4FA 2M8HA 2C3UA 2UUWA 3OR2B 5KT3A 3MZIA 4LFCF 1RK8A 9ATCB 5DG7A 1WSRA 3R3TA 1QSLA 2BXJA 3FBEA 4MKBA 3QBCA 3TEGA 2NR0A 2W9CB 3GFXA 1VRUB 2HYIB 2MHEA 3NWRA 5HQLA 3KJNB 4NXNJ 1AT1B 2CNKB 4ZVOB 2FZCB 3FCWA 4QYZK 1FRKA 3D54A 4X4NA 2HHUA 3G6YA 5GAEI 5K8OA 2RSQA 3P6YC 3KJFB 3Q83A 4K5SA 3FMBA 3VAJA 1HNXJ 2MQQA 2PIIA 2FHJD 3DGVA 3BJYA 3PFEA 3JB9k 3UCZP 1PSDA 1X7VA 5J2PA 4DQIA 1U8WA 2EG1A 4KE5A 4RU9A 1H6KX 3WC2A 4KYZA 2C2ZB 2QG9B 4YFUA 4CLPA 4K4VA 3BB5A 1REVB 1TV6B 3MEEA 4MMOA 4QPTA 5E3PA 3W65A 1UJ4A 4IH7A 5SZTA 1KFSA 3POTA 3JSYA 4V1Ak 1ZAWA 4ZVTB 3UD4P 3F0NA 2LEPA 4KGZB 2QL9B 4KGXB 1JLBB 1WDTA 2VG5A 4ZCMA 4EEYA 2J6UA 1Y5NB 3NBPA 1R8CA 2F4VJ 3VAGA 2POKA 5KT6A 4HACA 5KG4A 4NRUA 4DV4F 2LXFA 1SC6A 1WEZA 3QGPA 1VDHA 1RYSA 3HKWA 4M5KA 1E6YB 1XJWB 4PG8A 5DG9A 4WZQA 3U1LA 4DUZJ 3IRXB 3T1HJ 2WOMA 2HBYB 1C2PA 3TWZA 5J1NA 2V6AA 2BQUA 4LFAF 4TNOA 2BABA 3H5UA 1GTHA 3W1YC 4OIXA 2FLLA 4XO0A 3M05A 1SH3A 2MGZB 5IC6B 5KFFA 1VBZA 2PT0A 2G9OA 4KPYA 4WP8A 2G0CA 3GG1A 2GIQA 1YQHA 1Q81T 2DGSA 3HT0A 3TUPA 5DGBA 1TKXB 2JWNA 5GMEA 1O0PA 3NS6A 2BR0A 2C3MA 1OMSA 2MYFA 2IFXA 4CO4A 2AJ4A 1EHWA 1TZ0A 2ROPA 4P7TA 2MZRA 3K5OA 4LIWA 1HNVA 2WBRA 2YWKA 3PW4A 2EFGA 1FWLA 2M0GB 5EUHA 2PMZD 2HMIA 3GJSB 2WB1D 1RP5A 4DN9A 3SQGB 3AJ2A 5LM7E 1OO0B 1U2CA 1VIOA 3KWMA 1JLEA 4RBUA 3FNNA 4TKTA 7AT1B 3F73A 3BDPA 3R97A 5JVHQ 2ASLA 5D3GB 5C5JA 1NK9A 4ITSA 4O3SA 4YR2A 2X1FA 2CWXA 2MKKA 4M8LA 4O0IA 1JLBA 2K7KA 2H3EB 4A8XA 4DX8H 5B0EA 4NLGA 1U1RA 3D1QA 2EPIA 2VODA 4GKKF 3KK1A 1W2IA 1X4GA 4Q0BB 2B3TB 4DQQA 2DIUA 1TKZB 2P9CA 3RBEA 4Q43A 3EDRB 4WTYA 2L9DA 1XN9A 3DGPA 3HHLD 4XPCA 4CP5A 5LSRA 4DV1F 1H7XA 4CO0A 1UVLA 3AOCA 3WX8A 3NCPA 3OTBA 5HSPA 3K57A 1Z4UA 5KOXA 1GT8A 2R2RA 5A0YB 3G6VA 5DO2A 4IFVA 3Q8QB 3CC2S 5D6GA 3M8PA 4QWCA 3T3FA 2IMOA 1NK0A 5CYQA 2HHSA 3BQ2A 1YKWA 4ZLPA 2YWGA 2MY7A 2HURA 3KJQB 1S1UA 1ZETA 2MKYA 1SL1A 2AYMA 4WFYA 3K5NA 2CZVC 3I4HX 1PAEX 1RCOB 2HWHA 3CO0P 3MD3A 2LQ8A 3V81A 4JI6F 1WG1A 4U6PA 2QEXS 2XS7A 2R7TA 2HHVA 3N6LA 2K1RA 4MYTA 1KLNA 2CYYA 2G0IA 3FSYA 1ZM3A 3GQCA 1KN6A 5C24B 2BZ2A 3SDEA 3H4DA 1ELOA 3E01B 5CZXA 3C6UB 1BUXA 3R2DJ 3DI6A 2ZKTA 2JVRA 4H4MB 3MECB 1F2HA 4QBUA 1HNVB 3LALA 3VAIA 1FRMA 2MZ1A 3CNQP 3MM6B 2B7BB 2LECA 2GO9A 2PEBA 3TZXA 2JEGA 1WKKA 1RWKB 4NPOA 1RACB 2RF2B 2AJ1A 2G4BA 4QWAA 2Z2MA 3GFYA 3PYGA 4FXDA 4P2MA 4M95A 2BM0A 4L3NA 5HL7Q 1Y5LB 3BGLA 1X9MA 5L9NA 5A8RA 3JQKA 4DV2F 1MWYA 1KHWA 2EFVA 5I3UA 3R27A 1VHIA 3NS5A 4P9SA 2CAJA 4DDFA 4LMZA 4MIWA 2MKJA 2QA1A 1S79A 5FD1A 2YNGB 2CQDA 1B7FA 2V2ZA 4I7FB 5A8KB 4YQWA 1G1XA 1KTVA 4PG7A 3V6KA 3PVXA 2MZJA 3AT1B 2YWEA 3KLHA 1JXVA 3TAPA 3TRGA 3P5BP 4CLUA 3B78A 3HI9A 2DGOA 3ILIA 3KUGA 2VZ9A 1HQEB 2FVPA 4OYMA 4Y2MA 1U1NA 1M5KC 2BRLA 2KXHA 4ZP8A 2WOMB 4O3QA 4DR3F 1PG5B 3AA9A 4P6QA 2RU9A 2CQ3A 3DM2A 2DNOA 3FK4A 3BBFA 3PJXA 1LOUA 4YN3B 5DQHA 5KFNA 2ZM6F 2ZH6A 3RAXA 2B4OA 2OTJS 3H2UB 3HULA 3C16A 3M30A 1UFKA 2KG1A 2CVIA 2R7UA 4P75A 5KT2A 5I4MA 2D74B 2DNNA 3CULA 2BW2A 2A2DA 4DR4F 4M5IA 2KZMA 3OW2R 1UEUA 1IR0A 4TN2A 2AZ1A 1FX2A 2OI2A 2YQ1A 1F2GA 5F0WA 5D0EA 2N3OA 4R0JA 2K3KA 2W8KA 3TJ9A 1VJWA 4FDFA 5IZHA 5KFCA 1VQ5S 4ERDA 5AE3A 2VUGA 3QRRA 2MKHA 5AXMA 3PYEA 3EPGA 2CQPA 5KFVA 3UFCX 5KT5A 4BDPA 3FRZA 2RF2A 2H65B 3MDFA 4J9VA 3D3BJ 2FJVA 4ILLA 3L09A 4M5DA 5U47A 3TJAA 4LFAJ 2VJVA 1SBRA 3A8JA 1LWXA 1N0UA 4RW8A 1DARA 4I1TA 4PYDA 1RT6A 2IAJA 2C2KB 2QRRA 2CZ9A 4K4YA 4KFBA 1QJHA 1A0OB 4NLDA 4USTA 4WBFA 1FDBA 1TK5A 3DLKB 2CG4A 4JUZA 1S9EA 4CYUA 2W7PA 4U9RA 2CVEA 2EFQA 2PFDA 5LSOA 4F02A 2DPIA 2KB2A 2RB7A 4DUYF 4ECYA 1J5OA 3B54A 3C46A 1XNRJ 1X31C 4ECXA 2AWZA 2ZZTA 3DLEA 1D9AA 3OFEA 4X62J 2DY1A 2HQDA 3DN9A 4F3MA 4EO6A 4JI3F 4A8QA 3AH6A 4TY8B 2L3MA 5KFKA 1SJ1A 1H72C 4USIA 3ZFVA 3IN5A 3TANA 2ZC4A 4QJVA 1TFYA 4LF1A 4ZS6A 1XMQJ 4PAAA 1CQMA 4FPRA 3FEYB 4LFCJ 4OI4A 1LWFB 2VPZB 3CJ2A 4ZVGA 4IRCA 2H51B 1RAOA 2GC8A 4PPDA 3DU5A 5JJBA 1UKUA 2NXNA 5KG6A 4JV0A 4JI7F 3TQEA 4G1QB 1NPKA 5A6WA 4CNYA 3KHHA 1N88A 5KT4A 1VR6A 1NXIA 2HFZA 5E3CA 2R8JA 3FQKA 2MSSA 3D7SB 3QSIA 2LMIA 2C2DA 4PXBA 4NA3A 4ZVEA 3BSOA 1YJWS 1CVJA 1RT4B 5E7OB 1SQGA 1PBUA 3DRPB 1Q8IA 1VMBA 2E66A 2EWHA 2HFVA 1RLDA 3IAM9 2F40A 3M2UB 3AD9C 4ZP9A 1M1KT 5AJ3F 4F4KA 1OSCA 2A3JA 3UPFA 1SJ3P 2GA7A 2W4CA 3A8IA 3LOUA 4RNFA 3H5SA 1V5VA 4DV5F 1UVJA 4RW8B 2YKNB 5KFEA 2IVFB 3HFVA 2HBRB 2UUAF 3W9IA 3GSDA 3AY0A 2DHSA 1HBMA 4OYPA 1I94J 5F9LA 2VKZG 3MEGB 1MLAA 3M8ZA 2OAUA 4WK3A 4Y00A 2M7SA 1F9FA 2W2PP 4ED8A 3BSNA 5B0CA 4OMFG 4URSA 3CCES 1J5EJ 1S4EA 2YQ3A 4DZDA 2V2VA 3RRHA 2ZZNA 1N4LA 1S7HA 2VD3A 1H0HB 1RAJA 3F41A 5T7LB 4EZ9A 2RT3A 4XTTA 5DLFA 2BVZA 3QFWA 4IOCQ 3GG0A 5F9NA 1VQ4S 4Y2AA 4IQXA 3CCWA 4C2MA 1RA6A 1HD1A 5DM6Q 2HHHJ 3CC4S 4CLKA 3MFIA 2HWIA 2GNKA 2GX8A 1G7CB 8AT1B 2CQGA 1LV5A 1HQ2A 4WTOB 4B3RF 3DLJA 3KDOA 1T9WA 2JLGA 3CCSS 2DH9A 3PACA 1WI6A 5HMZA 4EBEA 1HI1A 4I6WA 2NXEA 3ZC4A 3NMAA 5A2QU 4I2PB 2J0QD 4UQTA 4A8OA 2J8SA 4ZJOA 3DMJA 3TA1A 3G9CA 5B0FA 2CJBA 2FGOA 3MEDB 1EQMA 1OWXA 3WX4A 3CW2C 2QLWA 5HK4A 2NLWA 2ZBRA 4PQAA 4M5NA 5D15A 3KLGA 5H1SV 2O01C 1VQ9S 3C14A 2V4JA 1YIJS 1U1LA 4USKA 1KQFB 1N33J 2AJQA 4NX9A 2OSRA 3GFZA 1YRUA 2GGPB 3MWBA 4Z7YA 3EYZA 2BOPA 2UUBF 2QA4G 4AXIA 5KFHA 1EKSA 4F4AA 5KFOA 3T9ZA 3RW7A 1D1UA 1BLUA 1NDCA 3P96A 4N56A 3IBFB 2ZDPA 4NZ7A 3BREA 3EMTA 5KFAA 1N54B 1X9WA 3HVRA 4IDKB 2RUGA 3TEHB 3H90A 1DZ5A 4DR5J 2HLTA 3FFIB 3M2VA 4LRDA 4ED4A 4MFBB 2ZNZA 3OTCA 4F25A 5DETA 2VBZA 3KFWX 3G6XA 2HQ3A 4I0WA 2M4MA 4TQRA 2DO0A 2VFUA 5AXLA 2OD6A 3I5BA 3TR5A 1YI2S 4X66F 4DN0A 4ZVRB 3CMES 1RLCL 3CSKA 2QZ8A 1U26A 1YBTA 3ISZA 1W7WA 2JEJA 1CJVB 2Y0BB 1RGVA 2ZH5A 5A8WA 3O2IA 4A47A 1IJEB 5LMUJ 1OY9A 4K4WA 1WACA 4PZVA 4DL4A 2GQQA 5CABA 3MD1A 3GYNA 3D6MB 1UVKA 2ZHAA 3R2CJ 1GMWD 1UJ6A 3CJ0A 1S1UB 1NBEB 2HNYA 2WVCA 2D9PA 1NSQA 3MR3A 1EX8A 1M5PC 2VH7A 2CDQA 2XI2A 3ETMA 5J1PA 3HZEA 3DOLA 1P9QC 3MMAA 4WE1B 4RW6A 1NJZA 2IM0A 3JSMB 4DR7J 1X4DA 2XWXA 3ZTRA 1R6VA 5KG5A 3J81j 4QR1A 1IWAA 3BGRB 3K7RA 1V9OA 1R6YA 4F36A 3PO5A 1DTTA 1UEVA 2EFOA 2OPSA 1LK5A 2CZ4A 2KJWA 3ILOA 5KFSA 4K50A 1RYRA 1HNIA 2XS2A 4D3GA 5G4DA 4X66J 1Q78A 1U1MA 1F6TA 2BE2B 1VRTA 3G71S 1CULB 1N34J 4FF4A 4DR6J 2Y3YA 1U09A 2KRBA 3EXCX 1WC3A 4NEZA 2MSTA 3M8WA 3MURP 1R8AA 3E8OA 4NOHA 1IKYA 5G0RB 4CRJA 4DQRA 3CEDA 2XY5A 5A8RB 4WJBA 1HBNB 1Z2ZA 4DHVA 2R2TA 3ZNUA 1T8EA 2J9DA 3JXOA 2DK2A 4U8VA 2IPOB 2FVRA 3AXKA 1FDDA 4CO5A 1U02A 5KG7A 1M5OC 2I5JB 2F65A 5E41A 5IWAF 4DOZA 2D1CA 3CTRA 2HQIA 2XNRA 2R2SA 4WWSA 5LL6d 5BYRA 3MCSA 1GX5A 3EWGA 3OFGA 1OQ3A 2V34A 5F3ZA 5L46A 4K4XA 1S1TB 2GHWA 4KHPF 4ID5A 2CJAA 3MPDA 1JNRB 5J2NB 2M52A 4GRSA 4O3OA 3DLHA 5LSLA 2W4PA 4B02A 3C15A 4FYXB 2R7SA 4EO8A 3HSZA 1D8YA 3CCRS 3W8PA 4DQPA 4DG1A 3GIRA 4DSEA 2BOAA 3I5AA 3KUEA 4USUA 1JXLA 3D1HA 3R5AA 4RW4A 2UZAA 2YPYA 1AZSA 2AHOB 3ZTPA 2BKPA 1SJ4P 4ZVSB 2DIVA 2YWWA 3Q89A 3CVKA 2M5YA 3CIZA 2MLYA 2ZHBA 1K8AT 1FVSA 4EBCA 2FDNA 3OVBA 2R2UA 3MR7A 4ATNA 4OYOA 1TAUA 3NAHA 3MAAA 1MWQA 2H5EA 3MMCB 3EVMA 5J2MB 4NWBA 1K47A 2H9ZA 2BANA 3UR3C 4JI0F 2R9LA 1N5SA 4PG6A 4BLGA 1BQMA 2ZHOA 4FXWA 4KR0B 4RNHA 1SQEA 1CULA 4C8NA 2RRBA 4CIOA 2QYGA 4RX6A 3NGRA 1OYEA 4ZN3A 3MCOA 3C3LA 2OPPA 2O1PA 1N8RT 2HFSA 4LF5J 1R7IA 2F9DA 5HAOA 2ILZA 1MMDA 4IRKA 2W2MP 3CJKA 3RBXA 2N3LA 1X5SA 2ZD1A 1TL5A 1RTHB 2P9GA 4LT6A 2YPZA 3VGSA 4DV4J 3PZPA 2GHVC 4O44B 3BGFA 2KZZA 1WD6A 2OEKA 3SXLA 5HLFA 4B9VA 2ZITA 4DFMA 3QPIA 1S72S 1YJTA 2LQBA 2LDIA 3PYFA 4R8UA 3OL9A 1WF1A 2F4VF 1VRQC 2D41A 2D3ZA 1IBCB 3GU0A 3PY8A 5H9FJ 1HMVA 4PRFA 3M8QA 1QSSA 2XM3A 1SL0A 1RT5B 4OYXA 1KVJA 5C42A 4OX6A 4YB7A 3W9JA 1PIEA 4PR6A 2AF6A 4RUHA 2FIUA 3PYDA 3IS9B 2ZKUA 3W64A 1TL1A 2M9KA 2B4PA 3NOGA 5F8LA 2XHCA 2UV8A 2XEXA 2YH1A 2YKMA 2DCLA 2AGQA 2YX7A 2HQCA 2EW9A 4DZ6A 4OV6A 1TUGB 4DV2J 4N7TA 4XAKA 3MUTP 1S0NA 1F5CA 1AUDA 2A18A 4WPAA 1FNXH 4WU3A 4IO1A 3OR1B 1HL6A 1H2VZ 5AXNA 4DR2J 2XWYA 1IM4A 4V19X 4KY3A 1RT1B 4PWDA 2LQJA 1HWUA 2ZJRQ 1C4AA 2VQFF 3ZTOA 2AKWB 2RKIA 2QMXA 4K59A 4OJ1A 4Y0FA 1NHVA 1U24A 4RKUC 2K3IA 1VRUA 4OV1A 4BC7A 1Q86T 1R8PA 3QO9A 4KTQA 4LF4J 4DEZA 3LP0B 3Q24A 2NQPA 2XGQA 1REGX 4ED2A 4NEYA 1JLFA 2VBWA 1S49A 2DO4A 1Z1ZA 3QGHA 3DLGB 3KJVB 2ZOFA 2AIRB 3JAMU 4WFNQ 3KDNA 1S0VA 4LSNA 1B0TA 3LGNA 5KG3A 3U02A 1FJ7A 3SQGA 3OSNA 3D0IE 3WBZA 4ETXA 1ROFA 1CLFA 2RD5C 1LFWA 3Q2SC 4HEA9 4QIEA 2APOA 5DJBA 3PM9A 4YY3F 1GXTA 3FBBA 1R89A 2VF3A 4ZJQA 2MMYA 1CEZA 1KONA 3GFHA 2GJIA 3U27A 2YNHB 3ICLA 1H98A 2YH0A 4UOHA 4JI5J 2C2NA 3KOAA 2FJAB 2OMLA 4KAIA 3W60A 2E7VA 5F3TA 2RH3A 3PR4A 3RTVA 1R0AA 4DV1J 4IOAQ 2FJXA 1U6FA 5HP1B 2MDAA 1LWEB 3LUYA 3OQ2A 3AOBA 4ID5B 4H4OB 4G65A 4LBIA 1JLQA 4CO3A 1N52B 1QDUB 2DNPA 3ILLA 3M1VB 4ECQA 4DL5A 3PJ9A 2BJDA 1KQGB 1NDLA 1JLAA 3L7PA 2I1RA 5ETTA 1FEHA 4G6VB 4ALZA 2E5GA 4C6AA 4DX7A 4C0OC 4QR0A 4E8UA 4ER8A 3OJSA 4IYQA 2WCXA 3BM7A
chains in the Genus database with same CATH topology
3US5A 1TL3B 5AE1A 5KFYA 2GQCA 4ZOSA 5M2UA 4NA2A 2YNIA 1ZAVA 5KFWA 2GMJA 1JMTA 4ED6A 2J0XA 5E0OA 2WONB 2F8MA 1SIZA 2DNMA 3NRBA 2Q66A 4IQMA 1TR0A 2R7OA 3DI6B 2QA4S 4WCEQ 3OLAA 4BC9A 3N9UC 3DRRB 3TVYA 2ZH8A 2C28A 3KMQA 4ZMMA 4URGA 4CH0S 5KG0A 3OL6A 1X4CA 5CYMA 4IOBA 1NJIT 3DRSB 1MROA 1VC5A 4B9MA 2XMKA 4X2BA 2OP5A 3K58A 1VQ8S 1YG0A 3HXMA 2IRXA 4LF6F 1RTHA 3T1AA 4OX7A 4ZCIA 4ZHRA 4AL5A 3OUYA 1WF0A 2B7CB 3M2RA 2DGTA 3IG1B 1EETA 2VFTA 2MHNA 3IBWA 3MF5A 1YJNS 5L1LA 2FHJA 1QAIA 1O5JA 3H4BA 2DCUB 2KJVA 4IRDA 4B3OA 4ES3A 3HHNB 3QJPA 2YNFA 4ED0A 3OPKA 1HWJA 2COLA 4QIWD 2KG0A 5EWEA 2XMMA 5K14B 2DR8A 4J9PA 4Q8EA 3MUMP 4FNIA 5CYQB 3WZ0A 3C66A 2MZQA 4LJMA 5IM0B 2XS5A 1RA7A 3MOJB 2BJEA 5L38A 5LT5A 4ECWA 1FDNA 1VQMS 1XK8A 4TXSA 1HW8A 5THWA 1URNA 3BGRA 1VLYA 5T41A 3PO4A 3HX9A 1JKHA 3HVTB 1S6PA 1VQYA 4CO2A 2W9CA 3H98A 2YKAA 4GC6A 4CH7A 2OJ3A 1OPZA 2HVIA 5DS7A 3CD0A 1EP4A 2RE1A 1F60B 2CQCA 1S6QB 2JZ5A 4IG0A 3EXYA 4WFBQ 3KLIA 4C8MA 4DL0C 5CZVA 2HGMA 1WWHA 4LSLA 1H7WA 4J9QA 1NU4A 1A6LA 1TQLA 3V6JA 4TU7A 2OPRB 2R8GA 3FCHA 4NLYA 4RNNA 2VG6B 1X5TA 2I5JA 1HBUA 2J0WA 3TA2A 3N6NA 3MEEB 2VA2A 4MFBA 2OLWA 4DV3F 2LQ9A 5DRKA 1KRPA 2N4DA 4V19J 2KVIA 1EETB 3VTIA 1U49A 5K5MA 1IKVA 3H5XA 4HTIA 5FDLB 3IWNC 1DRZA 4WF9Q 1HWIA 2DH8A 3KNAA 1X5PA 4ECTA 3TYTA 3LP1A 3QIDA 3V4IB 2KHCA 1A9NB 4RWWA 3BSCA 4ZP7A 3GV8B 3CCZA 2SXLA 1LWEA 1TKDA 4TLRA 2OIHA 3EZ5A 1XC9A 5K14A 1L3SA 2XMJA 4IG3A 4ZPCA 1UMJA 3CCTA 2JX2A 4WFXA 1N48A 3CC4S 1CSJA 4LIRA 1LXNA 1NNDA 2G1DA 3QAEA 4KB7A 4YUDA 3T6BA 5D77A 4HI1A 4NLPA 4N5SA 1SKWA 1PO6A 1IJFB 3MMAB 4HKQA 4ZPVR 3UCUP 1L5UA 5IQQA 2E7XA 2YX1A 2BA9A 3TO8A 2PFFB 3GWCA 3N01A 3TX8A 1Q79A 4IH5A 5DDRC 4Q2LA 4AXJA 4ED3A 5D4NA 4YB5A 4KKOA 3M32B 3N4WA 4QWDA 2WRMA 1IBKF 2AV5A 3DDKA 2EKYA 3CMAS 3UDCA 2KHDA 4DS5A 1GXLA 1V3SA 2UV8G 1VRTB 3CGIA 3N79A 4ILRA 1E6VA 2K7JA 2VC0A 2NS1B