5CYQB

Hiv-1 reverse transcriptase complexed with 4-bromopyrazole
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
424
structure length
415
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Rapid experimental SAD phasing and hot-spot identification with halogenated fragments.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
total genus 117
structure length 415
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5cyqB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cyqB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cyqB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cyqB03
5I42B 2BQ3A 3NAIA 4ZP9A 5DG8A 2GIQA 4O44A 3DLGB 5I42A 2RDJA 4IDKB 1SV5B 3DLGA 5J2PB 2IC3B 3GYNA 2B43A 2UVRA 1LWCB 1N5YB 5KFMA 4IDKA 1SV5A 4WXOA 5J2PA 2IC3A 1Z4UA 4J9QA 4J9PA 3ISNC 1K1QA 3M8QB 1N5YA 4EBEA 3NAHA 4MIAA 3OLBA 4XO0A 4ED2A 1N4LA 4ECYA 2HNYB 3M8QA 4NLWA 1S10A 2HNYA 1S1UB 5C24B 1FKPB 5KT7A 3KLEB 2QE5A 3KLFB 1ZETA 1S1UA 5C24A 1FKPA 3GILA 5KT5A 3KLEA 4ED3A 3KLFA 4QWDA 4EBDA 1T3NA 2IJNA 5DQGA 5KFBA 1NHVA 2FVSA 1HQEB 1LW0B 3RBDA 4DEZA 5F9LA 4NYZA 2R8GA 2D7SA 1HQEA 1LW0A 1MU2B 1HMVB 1TL1B 3CDEA 3M9NB 4RW8B 4LSNB 3EPIA 5C42B 1MU2A 1TL1A 4NLQA 1HMVA 1LW2B 3T5HA 3DLEB 2BQUA 2I5JB 4RW8A 5HP1B 4LSNA 3BSNA 5EWEA 4O3SA 1C2PA 1LW2A 2ZE2B 3DLEA 2I5JA 3KHLA 5HP1A 4Q43A 5F8JA 3GIJA 4WE1B 2ZE2A 4J9NA 3LP0B 2IJFA 4J9RA 2AQ4A 5KFYA 3IGNA 4IRKA 4WE1A 2BQRA 5J1EB 3KJVB 2C2RA 3LP0A 3QLHB 4O3QA 5F8NA 5EWFA 5L1IA 2YNIB 5J1EA 2ZD1B 3ITHB 3KJVA 1ZTWA 2ILZA 2XI2A 4QWEA 4DL2A 1U09A 2HNDB 4MK7A 5KFLA 1JXLA 2YNIA 3OSNA 2ZD1A 4ED1A 4IRCA 3GV7B 2HNDA 4KKOB 3H2LA 3TVKA 2E9ZA 4QWCA 4WZQA 2HWHA 1RYSA 2VG7B 4RUCA 4KKOA 1RTJB 3OL8A 3RB6A 4ZPBA 2VG7A 2WB4A 3FQLA 1RTJA 3T19A 4R8UB 1RYRA 5EDWA 4KHRA 1D1UA 1DTQB 2D3ZA 4R8UA 2W8KA 3FSIA 3C6TB 1DTQA 4F4WA 1QAIA 3RBEA 4EO8A 4LSLB 3N6NA 4R0EA 3C6TA 1CSJA 1MMLA 1LWFB 4IH6A 4O4GB 3MR3A 4LSLA 5JXSA 4FS2A 2XGPA 4FBTA 1LWFA 4QWAA 4O4GA 1S9FA 4NLRA 2W9AA 4MKBA 4ECSA 1TKXB 4H4OB 4QWBA 2OH2A 4K4VA 4J9KA 3QO9B 4RW4B 5HROB 1TP7A 1TL3B 1VRTB 1TKXA 4H4OA 1I6JA 3I5AA 3QO9A 4RW4A 5HROA 4U6PA 1XR5A 2IMWP 1TL3A 1VRTA 1RT7B 4G3IA 1N56A 1KLMB 3H4DA 2YKMB 1RT2B 1RT7A 1SUQB 1XR6A 3CO9A 3CWJA 1KLMA 5KFJA 4M95A 4JV0A 2YKMA 1RT2A 1S1WA 1SUQA 3BQ2A 4GC6A 4NLYA 4K50A 3UQSA 4URSA 2ILYA 4FS1A 3OL7A 2D3UA 1S9EB 5DGAA 4K4SA 1RT1B 4J9OA 1S9EA 3CDUA 4IRDA 1C1BB 1RT1A 4H54A 1C1BA 3EPGA 5KG3A 5L1LA 2UUTA 3M9MB 4DL5A 2J6SA 1C0UB 4LQ3A 3KK2A 3QYYA 3PW4A 3GV5B 4DL4A 4J9MA 3SFUA 3MR2A 1C0UA 4IOBA 4QPXA 4IH5A 3OL9A 2FJVA 3NKYA 3HVAA 4EO6A 1IKYB 4YQWA 1HARA 4ED8A 3H98A 1IKYA 3QGIA 4IR9A 3OHBA 2BRKA 5KFIA 2AU0A 1NHUA 4EEYA 3TAMB 2XCPA 1JIHA 2BANB 2FLLA 2AGQA 4ZP7A 3I5BA 3TAMA 4IG3B 3DOLB 4PQUB 2BANA 3CJ5A 3OLAA 4K4ZA 5KG4A 4URGA 2AX0A 2IM2A 4ZVHA 4IG3A 3DOLA 4PQUA 1SH2A 3MF5A 2B5JB 3G86A 4WXWA 5F9NA 4F50A 2W7OA 2B5JA 2D41A 2C22A 4RNMA 3T5KA 5F8IA 3RB4A 1VRUB 1RT6A 3N6LA 5KG1A 1S4FA 3MTKA 1VRUA 2BE2B 4JUZA 3M9OB 4B3OB 1KHVA 4ICLB 2QV6A 5KFGA 3LAMA 1RT5B 1RDRA 3KHHA 1REVB 4Q8EA 2BE2A 4MH8A 3DDKA 4B3OA 3PR4A 1S0NA 4ICLA 3MECB 1RT5A 3JYTB 4MIBA 1JLFB 1REVA 3E51A 5KT3A 2AWZA 3KHGA 4Y2CA 2XC9A 2C2EA 2R2RA 3MECA 3KLGB 1JLEB 1JLFA 3JYTA 3MR6A 5C25B 4WFYA 4KHMA 3BJYA 3KLGA 1JLEA 5KFSA 5C25A 2FVQA 2ZKUA 3IRXB 3BSOA 3PVXA 2RF2B 4ZP6A 3N6MA 3CJ2A 1RA7A 4YMEA 1TVRB 3IRXA 3CVKA 4KFBB 1W25A 2FVPA 2RF2A 4U7CA 4NLTA 3DM2B 4ZPCA 4IQXA 1S9GB 3GQCA 1TVRA 4ZPAA 2FVRA 2IBKA 4KFBA 3QGHA 2J6TA 3BSAA 3DM2A 1BQMB 4ECTA 1S9GA 5DQHA 2JEJA 4WZMA 5KG7A 4ZVGA 1BQMA 2R8IA 2C2DA 4RZRA 3QZ8A 3T5JA 2CJQA 3D5MA 1R0AB 3D28A 1T03B 1IKVB 2HAIA 1C1CB 1S0MA 4Y2AA 1R0AA 2YNGB 1TKTB 1T03A 3BREA 1IKVA 4TYBA 1C1CA 3QGGA 2YNGA 1TKTA 3GIIA 3DRPB 3VQSA 4TXSA 1JLAB 2BR0A 4IKAA 2R8HA 1S48A 4J9SA 3DRPA 1JLAA 1RAJA 1DTTB 3HVTB 2VG5B 3CJ4A 2VA3A 5DQIA 3KMSA 1QE1B 1T05B 1DTTA 1JLGB 2VG5A 3HVTA 4I2PB 4HYKA 3DRSB 1QE1A 1T05A 3BGRB 1JLGA 4I2PA 4NLVA 5KFEA 3CJ3A 4RNOA 4RW9B 5HBMB 3DRSA 3BGRA 1S6PB 3LANA 4PUOB 4RW9A 5HBMA 1QUVA 2E9RX 1N48A 3V6HA 1S6PA 4PUOA 1IM4A 2WONB 2J6UA 1FKOB 5EUHA 2WOMB 4ZPDA 2W9BB 3H59A 2WONA 2GIRA 4WFXA 4NCGB 4H4MB 1QAJA 1IKXB 4OL8A 1FKOA 3QZ7A 2WOMA 2W9BA 1RT3B 4WYLA 4NCGA 4H4MA 4O4RA 1IKXA 2JEGA 1TKZB 5HLFA 1RT3A 2R2UA 1LWEB 1S1WB 4K4YA 4O3RA 5KFUA 4KBIA 3V81B 1TKZA 3ISND 1RA6A 1LWEA 3H4BA 5KFNA 2WHOA 3V81A 3PW5A 3V6JA 2RKIB 4HKQA 3HKWA 4YP3A 3DI6B 3RB3A 4PWDB 2AGOA 1JLQB 3GIMA 1S0OA 4ZVFA 2RKIA 4JV2A 3DI6A 3OL6A 4PWDA 2IAJB 1JLQA 4I2QB 3KLHB 4URQU 3V4IB 5KFPA 1HNVB 2IAJA 2ASDA 4YR0A 3KLIB 4I2QA 3KLHA 2W7PA 5L1KA 3V4IA 2ALZA 3KNAA 2IA6A 1HNVA 3KK2B 5C5JA 4WYWA 5KFWA 1RTHB 3KLIA 3Q8RB 3PZPA 2WTFA 4TQRA 3NBPB 1RTHA 2HNZA 5KG0A 3BQ0A 4NLDA 3G6VA 5DG9A 3NBPA 3V6KA 2V9WA 4QW8A 1FK9B 2IM1A 1OS5A 5KFHA 4LQ9A 4TLRA 2DPJA 4YR2A 1FK9A 4O3NA 5KT4A 3RB0A 5FDLB 4KAIA 4KSEB 4DG1B 2JEFA 1S1VB 5FDLA 4MKAA 4ED6A 4ED7A 4DG1A 1BQNB 3DLKB 4KV8B 2V0NA 1HQUB 4QW9A 1S1VA 1BQNA 3DLKA 4KV8A 3C6UB 1HQUA 5F8LA 3KHRA 4MK9A 3NGDA 3KK1B 3C6UA 4RNNA 3CJ0A 5K14B 3IG1B 3BR9A 4KO0B 3Q8QB 4TY8B 4F4YA 3KK1A 3QIDA 5K14A 4Y34A 2VG6B 3IG1A 4RW6B 4KO0A 2UVVA 4TY8A 3UPFA 2YKNB 1RT6B 5D3GB 2WRMA 2VG6A 4O3PA 4RW6A 4K4XA 2YKNA 2UVUA 5D3GA 2F8EX 4O3OA 1JLBB 1XR7A 3GV8B 1T94A 4ECRA 4ECXA 4ZHRB 1K1SA 3Q8PB 1JLBA 3IGVA 4ZMMA 3PR5B 5I3UB 4RW7B 3SI8A 5KFOA 4ZHRA 3LALA 4IG0A 2W8LA 1NNDA 2OPRB 5KFZA 5I3UA 4RW7A 2XGQA 3PW2A 5JUMA 2OPRA 5CYQB 2FJXA 2ASLA 2OPSB 1S1XB 3PW7A 2JEIA 1LWCA 5CYQA 5KT2A 4DL7A 2OPSA 1S1XA 2HWIA 4Q0BB 3UR0A 5KFCA 3PJXA 5KT6A 1YVFA 2R8JA 3H5UA 3BQ1A 4Q0BA 5KFQA 3E01B 4FBUA 1J5OB 3FDSA 3GIKA 4MK8A 4NLSA 2IM0A 3E01A 4IFYB 4R5PB 1J5OA 1GX5A 4ZP8A 3HHKA 1EETB 2FVCA 4DL3A 4R5PA 4IFYA 1EP4B 3FRZA 4RUAA 2XWYA 4I7FB 1D0EA 4JV1A 1EETA 4Y3CA 1S49A 1EP4A 2OPQB 4I7FA 2BRLA 4NZ0A 3H40A 2C28A 5KG5A 2JLEA 3I5CA 2OPQA 2R2TA 5EWGA 4G1QB 5L1JA 5C42A 3RAXA 2UUWA 5KG2A 4G1QA 3DOKB 3KMQA 4NLPA 2OPPB 3DOKA 4XPEA 3RAQA 1S1TB 2B6AB 2O5DA 3LP1B 2OPPA 4IR1A 1RTIB 3EZUA 1S1TA 2B6AA 4Q44A 3I0RB 3G6XA 2FLPA 3QLHA 2R2SA 3LP1A 1N6QB 1RTIA 4MFBB 2V4QA 3ITHA 4ED0A 3I0RA 1HPZB 3FQKA 4TN2A 3DYAB 1N6QA 4EYIB 4MFBA 1UWBB 1HPZA 3DYAA 2UVWA 4RNHA 1RTDB 1UWBA 1IKWB 3QIPB 4XPCA 2JC0A 4YR3A 4KB7A 1RTDA 3BSCA 1IKWA 3QIPA 3LAKA 2EC0A 5HLFB 2VA2A 4Q45A 5KFRA 3H5SA 2YNFB 3OHAA 2I1RA 3SFGA 3CDWA 4ECUA 2CKWA 3IN5A 2YNFA 4DL6A 4NLXA 3MEDB 3MEGB 5J2NB 4WFZA 4M94A 2XI3A 1JKHB 5DLFA 5KFKA 4IFVB 3MEDA 3MEGA 1HYSB 4NLUA 5J2NA 2HMIB 5KFXA 2WK4A 4ZVEA 2V4RA 1JKHA 3JSMB 1SH3A 4IFVA 3MFHA 1HYSA 3OSPA 2HMIA 1S6QB 3JSMA 2JC1A 5KFDA 3MR5A 1TV6B 5L9XA 1HNIB 1S6QA 2IM3A 4NLOA 3Q8SB 5J2MB 1ZTTA 5F8GA 2AGPA 4Q8FA 3CIZA 2GC8A 1DLOB 1TV6A 3MFIA 1HNIA 3UDLA 5J2MA 1RT4B 3V6DB 2HNZB 1DLOA 1JLCB 5F8MA 2RDIA 5DGBA 2FJWA 4TY9A 5KG6A 1RT4A 3V6DA 2YNHB 1JLCA 4NRTA 3T1AA 3H5XA 1GX6A 4KE5A 5J2QB 4EBCA 3DMJB 2YNHA 3M8PB 3PJWA 4GC7A 5KFTA 2ATLA 5J2QA 2R8KA 4ID5B 3I0SB 5KFVA 3LP2B 3DMJA 3M8PA 1KHWA 3HVWA 4RNFA 3G6YA 4NLGA 3MEEB 1S97A 4ID5A 3I0SA 5KFFA 3LP2A 2W9CB 4ECVA 5CYMB 4X2BA 4K4UA 3DRRB 3MEEA 3ICLA 4ECWA 5KFAA 3IS9B 2W9CA 5CYMA 4ECZA 2DPIA 3DRRA 3FFIB 3IS9A 4ECQA 3T5LA 1SH0A 5DG7A 3FFIA 3PHEA 3H5YA 3NL0A 5F8HA 4K4WA 2FLNA 4TYAA 4IH7A 1C0TB 4F4XA 4EYHB 3TQ1A 2E9TA 5T14A 4F4ZA 1C0TA 3KK3B 3NMAA 1TQLA 2ASJA 3KK3A 2XCAA 1WNEA 4TQSA 3PW0A 5DLGA 3KOAA 2WCXA 4J9LA 4RU9A 2AX1A 1JX4A 3KLVA 4O44B 4IG0B 4K4TA 4NRUA
chains in the Genus database with same CATH superfamily
3P45B 1O0PA 5CCMA 3J7ZT 3HO1A 1WF1A 1M1GA 1KR4A 4UUXA 4LR9A 2LVWA 2M5YA 4OHVA 2QE5A 1ZM9A 1DQ8A 3KLEA 5MLCV 4C11A 4B9MA 5ETSA 2IJNA 1NHVA 4J7CA 4CRJA 2CPHA 3AOAA 1CJKA 1VBKA 4U9RA 3U1MA 1FJEB 1D9AA 3ILIA 1LWXA 3LOUA 1IJFB 4DV5F 5F8NA 2FLOA 3KG4A 4Z7CA 1U0HA 1HWJA 1M0SA 4WP3A 2RVJA 2BZ2A 4QYZK 3GG0A 5E5NA 3JQKA 2NPIA 1TKDA 3M6UA 1CC7A 2MYFA 3GYXB 1QAIA 3RBEA 1FRMA 3N6NA 4O4GB 4LSLA 4CLZA 2W9AA 2F1FA 2ZH5A 1SB6A 1UZHA 2JFKA 2D3OR 1FWPA 4Y6IA 3UD4P 1FRXA 1X5OA 1FDDA 3MR2A 2CXEA 2NYHA 3JAMU 3Q83A 1L3KA 3H98A 3OHBA 1NHUA 4EEYA 1Y5IB 1OPIA 1HHQA 1SH2A 4OHZA 4CLWA 3HZEA 1P1LA 5E7OB 5BJRA 2N3OA 3C2PA 4ZN3A 1MMDA 4L3KA 2EVZA 2R2RA 3PKMA 2IYGA 1UEUA 2DHHA 4UF4A 4OMFG 1SKWA 5G4DA 4IQXA 3M05A 4KY3A 2ZZNA 4OZ2A 1CJTA 4J90A 2HAIA 3CJSA 4LR8A 4UQGA 4OI3A 2DO4A 3VALA 4DSJA 1DTTB 3HVTB 2VICA 1JLGB 3VAKA 4HYKA 1QE1A 5BXIA 3NGRA 3L95X 5CZXA 1XTZA 2RJZA 1N5SA 1S0VA 1RT3A 4K4YA 4AFFA 1CS4A 1NJIT 1S0OA 3ET6B 2W7PA 3POTB 4LR7A 4NX9A 1YRXA 4C9DA 3V6KA 1OS5A 4EZ9A 1IQZA 2UXCF 3OTOF 1FVSA 1WACA 2VPYB 1U45A 3OR1B 4UQTA 3K89A 2GVZB 2V9KA 2QLXA 2CPEA 3SDEA 3D2WA 4MJKA 4F4YA 3CUNA 3AA8A 5K14A 1N5TA 4RW6B 2W24A 2YKNB 2H65B 2SXLA 3SQOP 3E3XA 3G9CA 1WEZA 4DSKA 5HVFA 2KFNA 3GJTB 4TU7A 4BS2A 4USHA 1NJZA 1RHMB 2ZHBA 3LUYA 5I3UA 1YRUA 4B3RF 1R8AA 5HL7Q 3VCDA 5K8PA 4IFYB 5H9FJ 4BWMA 1H3DA 3DGVA 1TK8A 3WX4A 2FQQB 3W5ZA 1VQ4S 2Z2LA 4DR7J 4U7UK 3LP1A 3R5AA 3DLHA 4DR1J 2GZOA 2YVSA 1HPZA 5B0BA 4PQAA 3DXSX 2BKPA 1IKWA 5HLFB 1F9EB 5BYQA 1OQ6A 1Q82T 4AYBD 4NLUA 5J2NA 2KHCA 4L3NA 4KJIA 5ETPA 1JQGA 2KG0A 5F8MA 3T9NA 1FFWB 1ZZNA 2RDDA 5KOXA 4QIVA 5J2QA 3THPA 2DEJA 4HACB 2XHCA 1AZSB 1RHQB 5CYMB 4YB6A 2GNKA 3CCLS 4ECWA 3C16B 1FD8A 4F25A 2Z2ZA 3MPUB 3CDAA 2ZJQQ 1PBUA 5DJBA 2CDRB 3TQ1A 2DNOA 2ZNYA 3BYPA 1F5CA 5F0UA 1JX4A 4DX6A 3N79A 1FRKA 4O44A 1HBOB 4OJGA 3CNQP 3HSZA 1E6VA 5KFMA 1TL7B 3PYDA 1S77D 2OD4A 1B99A 1NMEB 1T3NA 3RBDA 3D3BJ 1Q95G 3BDPA 3HFKA 1HQEA 3UW1A 5IT9Y 1NZ8A 1LW2B 2IYIA 1WOOA 3FZ2A 1RBAA 2I5JA 2YQ1A 4J9NA 2W2PP 3DLBA 3GCWP 1EX8A 2C2RA 4I6AA 1YITS 1CJUB 4I68A 4IRCA 1IWAA 3C19A 2EFVA 3OL8A 2XQCA 3IA0A 2AV5A 1F3FA 4R8UA 3FCHA 2B0GA 4ZPVR 3FSIA 1FESA 1HWIA 4KPCA 4X4RA 4LT6A 4QWAA 1RHRB 3I5AA 3F0NA 2HQFA 4A47A 5CCLA 4U96A 2Y9HA 3CO9A 2YX7A 3MURP 4ZIVA 1MNEA 4A8WA 2QEXS 2KG1A 1E6YB 4X4VA 4IRDA 3D0HE 3PRVA 3KJNB 1R6YA 3GV5B 1NBEB 2I6WA 3LPEA 4F7VA 2DGSA 4GVLA 4A46A 3SV3A 4ZITA 2EK6A 3OR1A 4TVAB 1U47A 3TAMA 2KYXA 3UCUP 3VGTA 3ZTSA 1U48A 3BGUA 4CDIA 2D41A 2ZH2A 4L73A 1ZH5A 2XMAA 2VFRA 1UJ4A 3M9OB 1KHVA 1HA1A 5AXNA 3LAMA 2VHGA 2VZ9A 2HHQA 2AWZA 2DRAA 4IO9Q 4QZVB 1BUXA 2F8HA 4N8NA 1XEZA 1F2GA 2L08A 1TK5A 5AXKA 4NEYA 4KFBB 2XMMA 3GQCA 3QGHA 2AYEA 2QLJB 5MAOA 4WZMA 5KG7A 1IBMJ 2R8IA 2E1CA 3HVRA 3QT7A 5K8NA 1D3WA 1W2BR 3L9ZA 1DZ5A 2YNGA 4TXSA 3SSRA 1SQEA 4J9SA 1T05A 2EW9A 2DHSA 6FDRA 4KTQA 2DVIA 1U4BA 2M52A 2W4DA 1IKXB 2X7IA 1WHVA 5HLFA 2JVOA 5CYJA 1RA6A 1TAUA 1N54B 2AGOA 4M5LA 3DI6A 1JLQA 3R5GA 5GAGI 2IAJA 2ASDA 1WTFA 2HQIA 3N9UC 1DARA 2AEJA 2HQ3A 2V2QA 2QFIA 1TMMA 3JSRA 1Y9OA 4YB7A 3AT1B 2YXLA 5FLXU 3RB0A 2V34A 4DG1B 4HDGA 1S1VA 3TWZA 1YHQS 4KV8A 4Y00A 1FRHA 3NXZA 2BJDA 3C6UA 3BR9A 3Q8QB 1FHTA 4USUA 1FDAA 2O1PA 1NJYA 4I56A 2KFZA 4RW7B 2AYMA 5KFOA 4ZHRA 1RZMA 9RUBA 4R0JA 3VGVA 4CTAB 1V6HA 1FE0A 4JI3J 1ZAVA 4DL3A 3TEGA 4RUAA 4GKJJ 1R31A 4KPYA 4A8QA 2R2TA 5L9NA 4XAKA 3KMQA 4XPEA 4AXIA 5IV4A 2O5DA 2ZZMA 1NUEA 3W9HA 2B6AA 4ZCIA 5B7WA 3L4BC 4ED0A 3GR1A 5AJ3J 4NZ6A 3QIPB 1EQMA 2NCKL 3RZAA 2MZ1A 1TL5A 4OZLA 2YWHA 1WHYA 4ENOA 1BD6A 5HQ8A 4IFVB 4ATNA 3OXFA 2WK4A 1JKHA 2E1AA 2FPHX 1U1MA 3MFHA 2B4UA 3B4MA 4JB8B 2HBRB 2IM3A 2C2OB 3UO0A 1CULB 5HANA 4QR1A 1GQEA 2RDIA 2FJWA 5CABA 4DOZA 3K8VA 1HBNB 3D66A 4ZS6A 3M8PA 3CJKA 2MSTA 1NEEA 4JI1F 1DAXA 1HWLA 2CRLA 3AD8C 1L3VA 1Z2ZA 2BJ9A 3H5YA 1NDKA 4DPYA 2I2YA 5T14A 1CVJA 1MN9A 1UETA 4NRUA 3MD1A 3J7A1 1LWCB 1NDLA 1U25A 3NAHA 3V5RA 1X8DA 4O0IA 5C24A 1FKPA 1VFJA 2R8GA 2AJQA 3CDEA 1HMVB 3F56A 4RW8B 1TL1A 1D8ZA 3N5FA 1L5UA 4LF6J 2ZE2B 4FKXA 2X1FA 3LP0B 3O44A 1NKCA 1NH7A 4LRBA 5DDPC 5J1EB 1OY8A 2QSWA 5EWFA 1UKUA 1RB0A 3KJVA 4DL2A 5KFLA 3D6FB 2HHVA 4AL5A 1QSSA 3B4DA 1RTJA 1HKAA 3VVTA 1K44A 4F4WA 3US5A 5GADU 3AJ2A 3QAEA 1LWFA 1V5VA 5SUHA 4L6V3 1TKXB 1VK3A 2CNKB 4F3OA 2MY7A 4ZLJA 2YKMB 1PG5B 2LMIA 4ETZA 1O8BA 2EBEA 5EX3A 4BC7A 1V9OA 2M4MA 2UV8A 1MWZA 3VQTA 4DFJA 1VR6A 5HO4A 4OZJA 5L1LA 1VYAA 5DRKA 4OX8A 1RWMB 2X51A 2VOOA 2ZUAA 3JTNA 4EO6A 4F2RA 1J27A 1CG2A 2RS8A 3JTPA 2LEAA 4CM2A 4URGA 4NL5A 1FXRA 2C22A 5HQLA 2R7XA 1YLXA 3BEGB 3K5OA 2F4VJ 2E66A 3RTVA 2E5JA 1G1XA 5KT3A 2VQFJ 1KBRA 1KOOA 4K2JA 2K1RB 4USJC 5HJXA 4DLGA 2MQPA 5HN0A 3CJ2A 4CTAA 5ETKA 2FVPA 4ZPCA 1BQMB 1O51A 1S9GA 2BJ1A 2JEJA 3NRBA 4WKYA 4CLSA 3D5MA 1UWAA 2LQJA 1T03A 3CC4S 4WBFA 3MAHA 1NZAA 4GMKA 2XYGB 2BW2A 1F2HA 1KKHA 5DQIA 4ZK7M 4I2PB 4JI3F 4W92B 1M5PC 1BHNA 3LANA 2XMJA 3UCGA 4RW9A 2F4FA 3CGIA 1YBUA 3VAGA 4GKJF 2W9BA 2WOMA 1NRKA 4HEA9 2JEGA 4C48A 1WKLA 1LWEB 2RQKA 2HGMA 4AXJA 4HKQA 2FC9A 2YKAA 2HVZA 2ZZTA 3KLHB 4URQU 2G0JA 5KFPA 1OSCA 2VKZG 4WYWA 2VF3A 5AJ3F 3BQ0A 2RD5C 4E0DA 4OYAA 3MD3A 1Q81T 3CCSS 2X3DA 3LQVA 5D6GA 2UVVA 4TY8A 1RT6B 4ZLPA 4CH1A 2KM8B 4NA3A 3G8SA 4Q2MA 2QGFB 1NNDA 1CEZA 1Q86T 1UFKA 2FJXA 4UUWA 1LWCA 3Q22A 2VV5A 5HMWA 3J7AN 4UY8T 3GIKA 2OELA 1GX5A 2FVCA 5GAEU 3MUMP 4I7FB 4Y2KA 1KQKA 4JV1A 3DRXA 3ZNUA 1NKEA 3PV8A 4WFAQ 1KNZA 1FJ7A 5IWAJ 4PZVA 4A48A 5KG2A 2DT9A 1LV5A 1CJVA 2NS1B 2KTQA 1S1TB 1WDDA 5LXYA 3I0RB 4MFBB 1S7HA 1X4GA 2V5HG 5IQ6A 4KB7A 5JVGQ 5AXLA 2DIVA 3LGHA 2ZC3A 1ULRA 3BKFA 3LA0A 4LF6F 3DFEA 5ETQA 2HMIB 4IQMA 4NLOA 1DLOB 1P1TA 3DOMA 3MFIA 1TFWA 1JLCB 3RBZA 2YNHB 4C8MA 5LOQA 4X2BA 5DDOC 4F0HA 1KQSR 2KN4A 4XDCA 1SH0A 5DG7A 2UXBJ 2EFQA 1HI1A 3PJ9A 1U1NA 1AYEA 3OVBA 3LF0A 3KK3A 1X9MA 4RU9A 4USWA 3KLVA 4IG0B 3DLGB 1EARA 4X64J 1V5IB 1N5YA 3KUGA 4ILLA 2EC2A 2HK3A 5BYSA 2HNYB 5KT7A 2VODA 2YTCA 5F9LA 2LU1A 2V68A 5HI7A 1HBUB 4DR2J 1C2PA 2J7WA 1C4CA 1JXLA 2M88A 5IC4B 2DR5A 4QWCA 2H5EA 1PYOB 2OP5A 2VQFF 3BO2A 4YUDA 3SQGB 3OXGA 5LMNF 3PM9A 2R7SA 4FS2A 3ELHA 2AKWB 1O6XA 4ECSA 2OH2A 2FTRA 3QO9B 4B08A 2KXFA 1DJ0A 1TL3B 1I6JA 2MEWA 1RLDA 3P4UB 1QAXA 1WC1A 1A7GE 2E5LJ 4C8YA 1SUQA 5B0AA 3H20A 5CHCB 2COLA 2CQDA 4LF5J 5FIIA 1WUUA 1XJWB 1QJHA 5E3AA 4J9MA 3SCIE 3PYFA 3OL9A 2FJVA 1WF0A 1GXTA 4F36A 3M32A 1LXJA 2HGLA 2EI5A 4QU7A 1PAUB 3DOLB 1VCTA 1U1OA 3NCRA 4ZVHA 4C2MA 4PQUA 2B5JB 4IOCQ 5F0WA 1RT6A 3TI0A 3MECB 2MKIA 4OHXA 3VV2B 2M8HA 4ZP6A 4OYWA 3BSAA 5A8RA 3TA1A 3QPIA 3BO4A 3TZXA 5T7LA 1R0AB 2V2KA 4MKVA 1UFLA 2XB2D 1TKTB 1VC6A 4CH0S 3GIIA 2VOPA 2GAGC 1F0XA 2DHGA 2EFPA 3NEKA 4NLVA 2DJWA 4ETXA 1VBZA 5HBMB 3T1YJ 3BGRA 1S6PB 3D3CJ 3UD5A 2WONB 1U6BA 1FKOB 5LXRA 1A6LA 3Q89A 1VI7A 1RWXB 5IWAF 3ISND 2JWNA 4DV2F 3HKWA 1VDHA 4YDDB 2C2ZB 4QIEA 4I2QB 3HXMA 2U2FA 3QATA 3ZTRA 1HNVA 3Q8RB 2J9DA 2WTFA 4DV6J 2QA2A 1IBLJ 2H4WB 4TLRA 5KT4A 5D0HA 1S6OA 4LFAJ 3CMQA 1IBCB 3DLKB 2V0NA 3DGPB 3O3LA 1T9TA 1N0VC 2GMLA 4PEOA 3KK1B 3IG1B 2ZUGA 4CZCA 3DDNA 2L9DA 2WRMA 5D3GB 3BN7A 3DN9A 1H2TZ 3PACA 4ZDNA 4FF3A 1UEKA 3KXDA 2XYPB 3W64A 4B02A 4IG0A 1SXLA 5KFZA 4X65F 2LU2A 4FF4A 2OPRA 3GCXP 2CQ4A 4A8FA 2UXBF 4P7VA 3M6XA 2RU9A 1J5OB 2NSCA 3AODA 3E01A 4R5PA 1Y10A 2GW8A 2R7UA 1SBRA 2XY6A 4NWBA 1KC8T 1KVIA 3MM5B 4X64F 1MWQA 2CADA 2OPPB 2RRBA 3IR7B 3EE3A 3HSDA 1IBKJ 2Z58B 2FLPA 3HD2A 2HWTA 1RTIA 4RR5A 1SJQA 2GQCA 5HMYA 2VDHA 5BYRA 4DR2F 2QO3A 1M1KT 2WAQD 1FVQA 2AJFE 2MXYA 3MEDA 3OSPA 1S6QB 1FX4A 2N7YA 2NPFA 1RXOB 1HNIA 3TQEA 4OYOA 3W2VA 3M2VA 2HHXA 4KE5A 3W65A 1F1BB 4F02A 3MM8B 4I67A 4NLGA 2J5AA 3LP2B 1WOPA 3MTJA 1KHWA 3MEEB 4ID5A 1R7IA 2W9CB 4K4UA 2RILA 2QL9B 4UZCA 1GNKA 2NLWA 3EICA 1UPPA 4RLEA 1FT8A 1YX2A 1C0TB 2EK1A 1MROA 2ADCA 3OXLA 1QDUB 1JXEA 4OX7A 2E5LF 2VPXB 1WSVA 2YQ0A 1URNA 4J9LA 3AJDA 4QR2A 5A2QY 3EGNA 3HD1A 2GIQA 2G1HA 2ACYA 2BKNA 5J2PB 3IBCB 4LF5F 4J9PA 3NWGA 2VU5A 5A6PA 3M8QA 1RCOB 2J0SD 4DUZJ 2C3MA 1KDNA 1P9QC 2CG4A 1SQGA 2HQDA 3GSIA 3GYGA 1U2FA 3MMAB 3X3UA 4PAAA 2LQ5A 1MU2A 3A3OB 2CVIA 1KN6A 3FBFA 2ZD1B 3EYZA 4MK7A 2HNDB 4OI1A 5EX0A 1UFWA 3H2VE 5DM6Q 2XY5A 4E2FB 2HWHA 2GO8A 2VG7A 2POKA 4FPRA 2D3ZA 1X4BA 3RAMA 2DH9A 4IH6A 4KGKA 1ZYQA 3CCQS 3OFEA 1X4AA 4J9KA 1I3OB 2MPUA 1TP7A 2CWXA 2AZ1A 3IR6B 1VRTA 1RT7B 3BO3A 3R5BA 3CWJA 5A0YA 1KLMA 4MYUA 3G82B 3UQSA 4ZJLA 4FS1A 3OW2R 1YJTA 3OFGA 3IWLA 1EB0A 4PR6A 1S9EA 3CD0A 3VGUA 4JP8A 3R5DA 2RU3A 1N36F 2XEXA 1C0UA 4OI2A 1RGVA 4KT0C 4NI2A 3D4JA 2EXUA 3MM7A 2MHNA 1VQSA 2XSJA 3H90A 2J0WA 1W7WA 1HBMB 2PIIA 4P7TA 1U8SA 2DBBA 4KQZA 3QNWB 4DV6F 2QL5B 1VK8A 1RT5B 1IBLF 2EEYA 3OR2A 4ICLA 2W2QP 1WC0A 4LFAF 3UDVA 1VQYA 2FVQA 3IRXB 2IVYA 2ROGA 2RF2A 1SC1B 2YWFA 4M8LA 4ZPAA 1EZZB 3RYLA 3N4WA 2C2DA 1U2RA 4U8YA 2Y3YA 3IAM9 3ZTOA 1GXUA 1S0MA 1C1CB 3IM9A 5K8OA 3BREA 1KQGB 5CXTA 2NUHA 1IWGA 1VLOA 2BR0A 2D9PA 1M5VC 3DRPA 2RUGA 1Y0HA 3T1HJ 4QYRA 2CQBA 4X4UA 2FHJA 3TAPA 2NYIA 3EJMA 4DR3J 3TUPA 3JTOA 3HSGA 4PUOA 4CO1A 4IO1A 5EUHA 4NCGB 1QAJA 2HBYB 3GE9A 1ZAWA 4O4RA 1KEKA 5IT0A 1JB0C 3V81B 1TKZA 3WC2A 3FEYB 2XS7A 3PW5A 4PWDB 1IBKF 2YBVA 2XHWA 1WELA 3KLIA 1GTEA 4D3GA 3R7SB 1SL1A 1GMWA 2QYCA 2V9WA 1X5SA 2CPYA 2RH3A 4DSIA 1TR0A 4O3NA 4TLQA 5FDLA 2JLGA 4O23A 2MHEA 3ZFVA 1SKRA 1TU0B 3QIDA 1VQMS 2ZBIA 2VJUA 2C2MB 3B8HA 1DQ9A 3HLUA 3NGKA 2PFDA 2OSQA 2W8LA 2LDYA 6FD1A 4OZNA 4P2XA 5CYQB 1KFSA 2OPSB 4DU7A 4GO7X 1WF2A 3PW7A 3CJTA 2MB0B 4V19J 4CLPA 3H5UA 1CC8A 4KGMA 3FDSA 2WB1D 4ZP8A 2DEIA 3MEKA 4AL6A 1EETA 2ZKTA 2CPFA 4CT8A 2HRUA 3BS9A 2B7BB 1BQXA 1N32J 2LQ9A 3W1YC 3DOKB 3ZXWA 4EFAC 5DZ7A 2AZ3A 4K7QA 4PKDB 4DUZF 2V4QA 3NNHA 2D1CA 4EYIB 5SZTA 1QTNB 2Y1LB 4YR3A 4HL9A 1SJFA 2CZVC 2VA2A 4Q45A 3H5SA 3QRPA 3IN5A 2V8HA 4NCBA 1LEOA 5KTQA 1UVKA 2OJ3A 3M1VB 2KDOA 5I3PA 5T41A 1NK5A 4C3MA 3L09A 2U1AA 1NKBA 2PN6A 1RT4B 2HNZB 3TAQA 3PXGa 1SC3B 2OTJS 5KFTA 1KVJA 4RNFA 3I0SA 1TTHB 4BLGA 4LF1A 1X4CA 2JH3A 1ZA1B 7AT1B 3TX8A 3MGJA 4EYHB 1PJ6A 4F4ZA 5CD4H 1RAFB 2KVQE 4A8KA 2WCXA 1FRJA 5A8WB 3CC2S 5DG8A 4X4SA 3THVA 1KFDA 2UVRA 2HKEA 4WXOA 2BJ7A 4J9QA 4NYPA 4CQ1A 3LTOA 4DN9A 4X62J 2APOA 1S1UB 2DH8A 1RABB 3IXQA 1ZETA 3JSBA 1FDNA 3RR8A 3KLFA 1ZS6A 4EBDA 3A8KA 3EPIA 4S0MA 4KHPJ 3QJJA 5HP1A 2RRNA 4WE1B 4TKTA 4J9RA 2HIYA 1RWOB 5KFYA 4DV3J 2C2KB 3TZWA 3R27A 2X1GA 3M30B 1OY6A 2V2ZA 1EAYC 1DTQB 2HAFA 3C6TB 2PDAA 4EUVA 2Z8QA 2XGPA 1YJRA 2PEBA 4WWSA 2WZ1A 2UV8G 2HBZB 3KFWX 4K4VA 2CQ2A 3TX0A 3IMQJ 4U6PA 2WSEC 1WG5A 1SKSA 1N56A 3BQ2A 3H8YA 4DN0A 1UJ5A 3L7PA 1RT1B 3J81j 4JI0J 3TZYA 3W8GA 3E8OA 4DCJB 5IM0A 1C1BA 2BDPA 2JJ4D 2Q43A 5GMDA 4DR3F 2J6SA 5A76A 3CXCR 2OGUA 5JMNA 4XIUA 2CPXA 3QGIA 4UTGA 4L75A 1Y11A 2CZ4A 2BRKA 3D67A 4IG3B 2AX0A 2ZH7A 2XZWA 2CQCA 3M6WA 3Q8VA 3N6LA 2VH7A 1VRUA 2BE2B 3FSYA 1FJCA 4MH8A 3CCRS 2DNMA 4H4KC 2MQQA 4C3LA 4LIWA 4FDFA 2DCUB 3JYTA 3HFVA 1RA7A 4U7CA 2VFTA 2XG8A 4NLTA 4HI2A 2RS2A 3M2RA 2MY8A 3DM2A 5DQHA 2W01A 3HDSA 3QZ8A 3O5TB 4WK1A 3M7VA 1QD1A 1FX2A 2DR9A 3H2UB 3NS5A 1B0VA 1NJWA 3MAQA 4LVOP 2VG5B 4DLEA 3JAMY 1XMOJ 2J9DE 2R7OA 4ANEA 3CJ3A 4RNOA 4JYAJ 3MMBB 1IM4A 2IFXA 3BGFA 3H59A 2GIRA 4OJHA 2VFUA 4L74A 3A12A 1OYDA 2JLFA 1N32F 3WC0A 1N34J 1G6BA 3K59A 1Y5NB 2XMVA 2V8DA 1LFWA 2DTJA 4C97A 3V4IA 1MWYA 1NB2A 1WG1A 2G2YA 4FZVA 1RCXB 4TQRA 3NBPB 2HNZA 3R97A 5LJ3Y 5D4LA 2HLUA 4E98A 4YR2A 4BBYA 3O6QA 3NGSA 1L3TA 4ED7A 1KTVA 4M5NA 5L39A 1Q0NA 4RNNA 3I55S 2MZRA 4Y34A 2HVIA 3H7HB 2VG6A 4DUTA 2UUAJ 1X4FA 4K2XA 3LGNA 5HJYA 5D4OA 2QL7B 3PW2A 2LXFA 3FNNA 2KH9A 3AHPA 4CLFA 1JJHA 1VQOS 2GHWA 1B70B 2FUG9 3V4MA 3CSKA 2ZOGA 3A1YG 2XYHB 3CCUS 3BBBA 3MM9B 2OPQA 2VBXA 3VGSA 1H72C 4G1QA 1TELA 1PAEX 4NLPA 1D9DA 4X62F 2DKOB 2KYZA 4IR1A 2DNQA 2R2SA 5A8KA 1N6QB 3VWSA 3I31A 1UW4A 3OTBA 2KT5A 4ZVPB 4DV1J 3BSCA 4A8XA 3ZTPA 4KHPF 3D1HA 2YNFA 1TK0A 4DPXA 4N8OA 1U1QA 4DV3F 1HYSA 3ENVA 3CIZA 4GVBB 3V6DB 2EFNA 2WVBA 4NRTA 3H5XA 3ZZZA 2B9EA 1VISA 5G0RB 3PJWA 2MQLA 2MQ8A 5KFVA 2UP1A 4JOUA 3PEHA 1S97A 4RKUC 5KFFA 3C15B 3Q0AA 2CJKA 4ECZA 1W26A 2MKSA 2MLYA 2QRRA 3QSIA 4RJVA 2GGPA 3TRGA 1A0OB 4QBUA 1RWNB 4ZP9A 4ZN1A 2LQBA 4JI0F 1GXLA 2ZBRA 3I4PA 3TUZC 1SV5A 5ETVA 2IC3A 3FEZA 1B4SA 2ABYA 2WSCC 1N4LA 1RAHB 3FJ2A 4Z37A 3KLEB 1EKRA 4C11B 2BXJA 1CJKB 5GADI 4NYZA 1NSAA 1APSA 1LW0A 4O3SA 1WI6A 3DLEA 4ZVOB 3TVZA 1U0HB 3OT9A 1H2UX 5EGYA 1RYRA 4CLLA 3FSXA 4USMA 3PIOQ 4O0NA 2Q3PA 4LSLB 4ZA1A 1RQ0A 2DB1A 4A8YA 1SJ4P 3OVSA 2MGZA 4G3IA 2L48A 4NPOA 2MQNA 3HHLC 4M95A 4DX7A 2DGOA 4LREA 3U7JA 4M5HA 1XMOF 2PA8D 4M5JA 5H9EK 5HVHA 3MDFA 2JL9A 1HLWA 2MZJA 5B0CA 2RE1A 2DXDA 3G8QA 2FHOB 1FWKA 2QN6B 5LMUJ 3UDCA 5ETTA 4F4KA 3T5KA 3IC1A 4PXDA 3TR5A 4HH1A 1VQKS 4HT7A 5KG1A 2E1PA 3HJVA 4C0HA 1JJ4A 4MIBA 1YZ6A 5IXUA 2XC9A 3MR6A 1JLFA 4UOHA 3FEXB 3TW0A 4WFYA 1NSKL 2ZKUA 2OSRA 4PXBA 1HI0P 2HHHJ 1QM9A 1CJTB 2JRSA 4JV5J 4USIA 2PMZD 4CO4A 2UUAF 4LBIA 3CO0P 1AB8A 1XWLA 2IBOA 3G2XA 1IKVA 1RBLA 3VQSA 4B17A 2UU9J 2CNOB 3GG1A 1QVFR 1QE1B 3D9BA 2R42A 1VOMA 2J6UA 1GAOA 3FBCA 2KRRA 4WFXA 1RT3B 2ATCB 1CS4B 5KFNA 2J7KA 1KSPA 1RE1B 2ZWPA 1FTRA 1RP5A 1YIJS 4EK2A 4FYDA 2KKHA 4NLDA 1Y3KA 4DV1F 2DNGA 4JBCA 3HX9A 4NMXA 3W5XA 2I0XA 3SDEB 1CBKA 4NXMF 5GAEI 1HQUA 3KHRA 2G0CA 2ZITA 5K14B 4WTOB 1B7YB 3GLJA 3HHLA 5M2RA 3VHQA 3Q2TC 1X5TA 4Y65A 3W61A 2F8EX 2G13A 1T94A 4QYZJ 5I3UB 3LWMA 1R0CB 3I4HX 2IRYA 2AEMA 3PJXA 3IP0A 1KONA 3AJ1A 1X60A 1H74A 4FBUA 4CLTA 1UP1A 2YWWA 5ETMA 3MOZA 3A4TA 3IBWA 4WF9Q 1FD2A 4DQSA 3BKUA 3LP1B 1QTMA 5FLXY 2YX4A 3FQKA 1HPZB 1LQ9A 2A10A 1PJ5A 5CD4A 2AW0A 1IKWB 4FN5A 1F3VA 3IAS9 5L46A 1B3TA 1DY3A 2VL1A 2VQEF 2DHAA 4NLXA 5J2NB 3P6YC 3MEGA 3DXBA 4P73A 2HS0A 2FYXA 4ZVQB 2PMWA 2IPOB 1HW9A 5F8GA 4LF9F 4RBVA 1FRLA 1NXIA 4TY9A 2DGVA 1CLFA 5J2QB 4EBCA 2A6MA 4QCLA 4X4OA 4PABA 2GVDA 1NK8A 4ED5A 2B56A 3DRRA 2B8PA 4ELUA 1NO8A 2M0GB 1HWUA 2QMXA 2E9TA 5DM7Q 2KT2A 4TQSA 5DLGA 5GAGU 4O44B 4DQRA 1KWMA 1M1HA 2FGOA 4LFBJ 1E6VB 5I42A 1U1KA 4IDKA 4F2SA 1K73T 1Y4ZB 2R7TA 2RUSA 1Q4RA 5KT5A 5LMUF 4DJBA 5DQGA 1HQEB 2NQPA 2N4DA 5C42B 2GA7A 4NLQA 3T5HA 2I5JB 2JVRA 4LSNA 3M8YA 3R7NB 1QVGR 2NXJA 1GTHA 2A18A 4IRKA 2VBWA 5LL6d 2M9KA 1CPZA 1BE4A 3UN3A 3P5TL 4RUCA 1DURA 3AB4B 1PCAA 2KO1A 3T19A 4R8UB 4KHRA 2AYBA 4K59A 2V94A 2PFFB 2HHHF 1MMLA 3P3DA 4JV5F 5CQGA 2B7CB 1VC5A 1WKKA 5HROA 2HZAA 2QA4G 1RT2A 2EBGA 4J9OA 4KYZA 2VD3A 3PW4A 2BEFA 3JQJA 4IOBA 4QPXA 4NA1A 4B3MF 1UVIA 1AT1B 1HQ2A 3QFHA 3TAMB 3WBZA 1JIHA 3EDRB 3UVJA 4ZP7A 4ANCA 4K4ZA 2BANA 4YN3B 5F8IA 2VBZA 3LO3A 4PXCA 5E3QA 1YDLA 1WI8A 3PFEA 4HT5A 2H48B 4P2MA 3RRGA 3KLGA 3QFWA 1K8AT 1XNQJ 5I3QA 7FD1A 1TVRA 3PHTA 5KAKA 4OZ5A 5D0GA 1AFIA 3B6BA 2KJVA 2VBYA 2YNGB 3QGGA 4ALZA 3MAAA 3ETMA 1ZPVA 5H1SV 1T05B 3SV4A 3HI9A 4G6VB 5LT5A 1RWWB 1R3NA 4ZPDA 2V67A 4YB1P 3EVMA 2MQMA 4Q7AA 3DI6B 1JLQB 5AXMA 3GIMA 3F73A 2RKIA 4F67A 2IAJB 3K0JA 1QSYA 2CPDA 1RTHA 4G1PA 1ZPWX 3J81U 4X84A 2BABA 1FRIA 1KRPA 4W98A 3RUBL 1S1VB 4KV8B 1SJ3P 4FKYA 3C6UB 1ZM4A 3CTRA 2V50A 3NY0A 2LLZA 4KO0A 3BBCA 2HS3A 3PX6A 1X9SA 4ZHRB 3Q8PB 2XS5A 3HCXA 4NA2A 2K3IA 3T41A 3C14B 8ATCB 2QA1A 1YJVA 4A8MP 3PX4A 5KT6A 3WIUA 4PG4A 2P9GA 2OEJA 3GJQB 4DR4J 3BM7A 1Y7PA 2DYAA 2C28A 4LFBF 5IZHA 5C42A 4RUBA 2Y0BB 3Q23A 2B6AB 3GP9A 3A3PB 2B9XA 3R5CA 3WZ0A 3A3NB 3DYAA 4XPCA 3QGPA 2MKJA 3HULA 3DLLQ 1N5QA 2QFJA 2CKWA 1Y3JA 3DC2A 2QG9B 1JKHB 1SH3A 3JSMA 2JC1A 2XO7A 1VS3A 4N7TA 4Q8FA 1TV6A 2WW4A 1WC3A 3W63A 1D8YA 2HIQA 3M8PB 3CJKB 1OJ4A 1MG7A 2XLIA 1LOUA 1PILA 2EG2A 4K0KJ 3ICLA 5LM7E 3LGMA 3JS9A 2C42A 1OPZA 2F9JA 1XMQJ 3ZO7A 4ECQA 3UCZP 3NL0A 5F8HA 4OV6A 4LF7J 2XY7A 1AUDA 4WK3A 5C7PA 5FD1A 3KOAA 1NK0A 2ZVSA 1RAOA 3NS7B 2EPIA 1UTAA 4N47A 5C24B 1FKPB 2E5HA 2YPYA 3GILA 1UEVA 4M5KA 2FZCB 1TL1B 1ELOA 4LBPA 3B82A 2YY3A 3JQMA 1UPMB 4DR5J 2BQRA 3KJVB 2CQIA 3QLHB 3DCAA 3I56S 2XNRA 3VAMA 2YNIA 5B09A 3A8JA 1BXNA 2Y0SD 1RTJB 4ZPBA 2HSEB 1S99A 1HD1A 5K8MA 4Z2XA 2I38A 1XNQF 3MUVP 3EUNA 4R0EA 1LWFB 3W7BA 2QIFA 4QWBA 1UMJA 3H42A 4H4OA 3RW7A 4CWBA 4RW4A 1XR5A 4HTJA 3HMJG 4JV0A 2BYCA 2W2NP 2XS2A 4URSA 4DR7F 1NPPA 2R7WA 2Y8YA 2ADBA 1T9XA 1B0PA 1RTZA 4EWTA 3FCWA 4DR1F 1U1RA 2OEMA 1RISA 2B8QA 3DHXA 4DL4A 3HVAA 3GSDA 2E7WA 2HFUA 4FVMA 1WDTA 3J80U 2AGQA 2VJVA 1UVMA 3CJ5A 2WVDA 3AXMA 1RI7A 2VUGA 3DU5A 4IOAQ 1P27B 4NZ7A 4KRWA 2GQ2A 3RG6A 2GMJA 1DBDA 4JUZA 5K20B 3DDKA 4B3OA 3QSYB 3KHGA 2DNYA 2VC1A 3C14A 4ZPWR 3F44A 2EFOA 1KQFB 1T0TV 1BY9A 4DR6J 1S9GB 2IBKA 2FVRA 4P2SA 4NCAA 1JNRB 4LFCJ 2RHSB 3WX8A 3T5JA 4X4QA 3D28A 1T03B 1HNZJ 3WIVA 2V8PA 4DQQA 3UNYA 4IKAA 2PD1A 3KKFA 1RAJA 2UUCJ 2ALYB 1RK8A 4RW9B 3DRSA 2ZDOA 2AIRB 2E9RX 4DR4F 5D77A 2W9BB 2WOMB 2XULA 3QZ7A 4BCAA 1S1WB 2LECA 1PYSB 4CM0A 2AT1B 3UFCX 1MSWD 3OL6A 1H98A 1ZM3A 2A6OA 2MZTA 1XMBA 4DPUA 2ZOMA 2GS8A 3M8WA 2FHJD 4I64A 3CJ8A 5KG0A 1NCLA 1X5PA 3HZGA 2KZZA 2PGCA 2BVZA 1WHWA 2YQ3A 4P74A 4W90B 5F8LA 1OMSA 2XNQA 4TY8B 1NLKL 3AA9A 2HYIB 4V19X 5HMZA 1GMWD 1JK9B 3G4SS 4OIXA 1S1XA 4N56A 2HWIA 2MTLA 3UR0A 1R8CA 3BQ1A 5KFQA 4LF7F 2BE9B 3CD5A 1FNOA 1XIQA 4CLKA 1GH8A 3RRHA 2GO9A 2RIJA 1VJQA 3M2UB 4F4AA 1CJVB 2MKKA 1Z2LA 5E41A 1G4CA 1YJNS 4AQYJ 2W7AA 2OMLA 4ILMA 4LMZA 2OD6A 3N28A 2FDNA 3QLHA 2GJIA 1OIAA 4LIRA 4Q2LA 3MUTP 1YG0A 2WVCA 4M5DA 4X66J 1EHWA 1X0PA 3TANA 3I9V9 4KH1B 2MJNA 2Z57B 1RTDA 2BX6A 1OQ3A 3ILOA 2C3PA 1T9YA 2XMWA 2XI3A 4CLUA 4DUYJ 1YQHA 4DR5F 1IBMF 3I82A 8AT1B 3MR5A 3DOMB 2LXUA 4HHUA 3UDLA 2N82B 3T1AA 2QMWA 3UN5A 3DMJA 3FGVA 1D9FA 4NYOA 2BM1A 3AXKA 4TU9A 1REGX 1H38A 3ZZOA 4WU2A 3IS9A 1RWPB 5IV3A 2BJEA 4CYUA 2EKNA 1RHUB 3OUYA 2K8GA 2EFGA 3KK3B 2ASJA 1WNEA 3MOJB 3IBFB 3SCJE 2ZJPQ 1GFWB 2V6AA 3TJAA 2RQCA 3VF0B 2B43A 3IR5B 1N5YB 2A3JA 4RUHA 4RX6A 4QQBA 5AT1B 1K9MT 1UW9A 2DR7A 1G7CB 8RUCA 4OZ1A 5DDQC 2FVSA 3WHIA 3Q2SC 3R2DJ 3M9NB 1IR0A 4J91A 3GIJA 3NGUA 4B9SA 3VR1A 3EVWA 2AQ4A 2LCWA 3ZC4A 3HM9A 2J0QD 4OI6A 1QSLA 4LRDA 1GMVA 3I9ZA 3FK4A 3H2LA 2HVEA 1VQ6S 3D0GE 4KKOA 5AE2A 2PEHA 3CC7S 2GAHC 2GV1A 1KD1T 1NDPA 1J5EJ 4JI5J 4DR6F 2X3GA 1CSJA 3MR3A 4LFCF 5LSRA 3K7RA 2PE8A 5KOWA 4FXVA 3ZTQA 1PBAA 2WVFA 1HNZF 2CNLB 4DZ6A 2CDQA 5B0DA 1SUQB 4DX8H 3CF5Q 1S1WA 4GC6A 2UUCF 1N0UA 5IFMA 1HFEL 1DRZA 3NWRA 2E1RA 4B3RJ 2W25A 2UUTA 4DL5A 2LYVA 4LQ3A 4W4MA 4IH5A 3M32B 2NZCA 2IVFB 1IKYA 4OX9J 1H2VZ 1W2IA 2X1BA 2XCPA 3I5BA 4OLPA 2KVIA 4PQUB 5KG4A 2IM2A 4X4PA 1PKUA 1DFDA 1RKIA 4WFBQ 3UE2A 3LW5C 1T9UA 4LVNP 2CJXB 2OAUA 4I4BA 3VZHA 4LUBA 6AT1B 2QTWA 5AE1A 4Q8EA 1REVA 2OLWA 4Y2CA 3T6BA 2XMTA 1JLEA 5C25A 2ROPA 3MM6A 4USKA 4WP9A 3N6MA 4DCOB 2HQGA 1YJ9S 5A8RB 1HI8A 2V69A 1U02A 3G6ES 1KOHA 4G1IA 1V3ZA 2Z4PA 2M3DA 2MMYA 3D1OA 3MMCA 5T7LB 4I0WA 2DXEA 3D54A 1T11A 4TYBA 4BHQA 3M2UA 1JLAA 3FCVA 3CJ4A 3T9ZA 5F41A 2B4OA 3BGRB 4DSLA 3C66A 2IRUA 2R7VA 2DISA 3GB0A 4FF1A 1VHIA 3QQCD 2CQ3A 3R2CJ 4H4MA 5HMXA 1KVKA 2DGWA 3FMBA 1EIYB 2VPWB 1B7FA 3BPDA 4KR0B 4AQYF 2ZEJA 4ZIWA 2BMBA 3Q8UA 1HNVB 1VQ7S 4YR0A 4GRSA 4L76A 2ALZA 5JVHQ 5KFWA 4X66F 2QJ3A 4ZVUB 1T95A 4FYVB 4QW8A 3GTYX 4CIOA 3R1LA 3AD7C 2C1EB 1FK9A 2DHXA 4JI6J 3W66A 3ZZUA 2ZWOA 2JHEA 4UW2A 4NOHA 3ZZ0A 4DUYF 3EXCX 1BQNA 2CIMA 2HFVA 3NGDA 3L3CA 1S4EA 3W2WA 3DDIA 5ETLA 4F3QA 3CULA 5GMKa 4RU2A 2GMHA 4K4XA 3BBFA 1UA0A 1JLBA 2HPUA 2B3TB 2OPRB 3AQPA 4A8OA 4RWWA 2ZH4A 5JUMA 4KIAA 1ZOTA 4LJMA 2VB6A 5KT2A 1S12A 3OD2A 4Q0BA 1UCNA 3E01B 5GMEA 3HT3A 4R5PB 2ZJRQ 4OYXA 2FY1A 1XBWA 4Y3CA 1EP4A 2QX0A 4NZ0A 2VPZB 1HW8A 1Q8IA 1HWKA 5EWGA 2G2ZA 2UUWA 3ZZYA 4M5MA 3ULHA 3UD3P 1PSDA 2OIHA 1XNRJ 2HQCA 1RTIB 1Q16B 4PYDA 3DU6A 2F4VF 5CAAA 2NSBA 2XSFA 3DRYA 1UWBA 3BZQA 2JC0A 4HR2A 4PRFA 5GAHU 4LSZB 3MEDB 3QRQA 5DLFA 2BKOA 4LF2A 1HNIB 1ZTTA 1WC4A 4OZ3A 2HS4A 2RSQA 1R8BA 5J2MA 3W2VB 3M2VB 5DGBA 4U67Q 3PIPQ 2GX8A 4I1TA 2MSSA 2DD8S 3MCMA 4ID5B 3RRKA 1R6VA 2RRAA 1VQPS 1J5EF 4JI5F 2PC6A 1H0HB 4F8RA 1Y5LB 2BM0A 3FFIA 5J1NA 3PHEA 1MROB 4K4WA 1FXLA 2E44A 1ICEB 1TQLA 2DNPA 1H7XA 1YBTA 3PW0A 2AX1A 3G6XA 1YJ7A 1WWHA 2XTJP 3VZIA 3M8QB 3R7BB 3OLBA 3NCQA 2DITA 4C4WA 2AYGA 4ED3A 2OEKA 3O1LA 4OX9F 3VAJA 1MU2B 2D3O1 4WIIA 3NOCA 3NMRA 4OJ3A 2BQUA 2BJ8A 3J7Z5 1G2EA 4ZCKA 3QT6A 4DWIA 4ZVSB 1SIZA 4QWEA 1OWXA 4ZLLA 1M5KC 2VG7B 3KUHA 2Y1IA 2E7VA 2DY1A 2WB4A 3AY0A 4Y2MA 4YHHJ 2W8KA 2CG8A 5DS7A 5JXSA 5H9FK 4O4GA 3AOBA 4CO2A 2GHVC 2BACA 1VRTB 2ZBQA 2JZ5A 2IMWP 1I51B 1RU1A 5A0YB 1KLMB 4Y0FA 4ZPTR 2J9EA 1FI4A 3U1NA 1BLUA 2QSFA 1S9EB 2M8DB 2XM3A 5DGAA 3TARA 1S5ZA 2LP4A 1M5OC 3CDUA 3QAUA 2E7XA 2FGCA 3RBXA 1C0UB 1L3SA 3QYYA 2V4JB 1QLNA 4DV0J 2IDEA 4NI2B 2ACMA 1KP6A 1YSJA 3CD6S 2AU0A 1AXQA 2P9EA 3MM7B 2FLLA 2A2DA 3OLAA 2XSJB 1PO6A 3FC9A 3B78A 2W7OA 4B3TJ 3RB4A 5A6WA 3OR2B 2ZBCA 4ICLB 1RDRA 4RBTA 4JI6F 4MTPA 1Q5VA 4N5SA 1YRTA 3HJFA 1ZAXA 3PVXA 3BSOA 4RBUA 2RF2B 3SCLE 2HRTA 2FHKA 1SCJB 3W9IA 2MKHA 2B51A 4RZRA 3R5JB 2IJRA 2PT0A 1U1LA 3DRPB 2FD2A 1YJUA 1PGZA 2R8HA 4NE9C 4HI1A 1I5OB 3O8WA 3KMSA 2ZC4A 1DTTA 3HVTA 4JI1J 3MCSA 1JLGA 3R8YA 4PUOB 3VAFA 1SC4B 5E3PA 1GT8A 4TNOA 2N4CA 4TU8A 2AP6A 3VVUA 2ZHOA 1TKZB 4BWJA 4YP3A 3RB3A 3MZIA 1XNRF 4CT9A 3ISZA 2HBQB 1U49A 4DV4J 3KLIB 3TA2A 1PC4A 2F9DA 3ET6A 3POTA 3P8BB 3KYLA 3RW6A 4NASA 1U6ZA 2A2CA 1Q1KA 4QU6A 3TO8A 2CJ9A 5FDLB 1ITPA 2Z30B 2Q1LA 1U2CA 3M8RA 4OLOA 4DZDA 4DPWA 2GVZA 2EWHA 4U8VA 3UR3C 4MK9A 2FC8A 1I1GA 5U47A 4RW6A 2YKNA 3LWLA 1K1SA 5GVQA 3IM8A 4OJ1A 3CPWR 3SSSA 3QWPA 2JDJA 3CMES 2DY9A 2R8JA 1YWXA 5ETOA 3GONA 4MK8A 2RQMA 3HHLD 3K58A 1EETB 4IFYA 1WTBA 2Y1JA 3U02A 3I5CA 4WCEQ 3FBBA 5L1JA 1WC5A 1LK5A 1NSQA 2XLKA 3ILJA 1T9VA 3RAQA 3M8ZA 4CH7A 3EZUA 5IC6B 2W4CA 4TN2A 3DKDA 2UVWA 2CUYA 1ZM2A 2NREA 2VFSA 2QC3A 3CDWA 4ECUA 2RQ4A 3CW2C 4ZVEA 2MLXA 2YWEA 2IRXA 2AJ0A 2GC8A 5M2UA 2GHPA 1X31C 4DS4A 2AJ1A 4MIWA 2FJAB 3I0SB 4YHHF 3HVWA 4A4JA 4HACA 1AZSA 5KFAA 5CYMA 5L8RC 3T1YF 3C16A 3T5LA 2DGUA 1U1PA 3BYRA 2V4JA 2CNNB 4OYZA 3HP6A 5C2CA 2MQOA 4LRFA 2XCAA 3IO1A 4QPTA 1NJXA 4DSEA 2M2BA 3TOQA 4B9VA 4PPZA 4ZVTB 2CWKA 1HBOA 2C3OA 4C7QA 3UNGC 1Z4UA 4NEZA 1TL7A 4C8NA 3K5LA 4DV0F 5E33A 2IDLA 3PKYA 3KLFB 4DL0C 4YY3J 3VAHA 4EMDA 2K06A 4ZJQA 4YDXA 2MDAA 5HP1B 1FFSB 4AD6A 1LW2A 1XERA 4EI2A 3Q24A 3AAWB 4B3TF 3R3TA 1OYEA 1RJJA 4ITSA 4ES3A 2XI2A 1CJUA 2KJWA 1Q8LA 1BMQB 2E9ZA 4CNZA 1VHFA 1FDBA 1RWUA 1N5VA 1X4DA 2B9YA 1SJRA 4MYTA 4MAKA 1V3RA 4FBTA 1SPBP 2NR0A 4MKBA 1WKJA 4M5IA 1S57A 4C8LA 2VIHA 2G9OA 3K17A 2HGNA 2P8IA 3HHNB 1NDCA 5J1PA 5LSLA 2RNEA 5IM0B 1C1BB 1E6YA 5ETRA 4B9UA 2H3EB 1TL4A 1SC6A 5D0EA 3EPGA 1IVZA 2K2PA 5D15A 2Q66A 3SFUA 3R1HA 3NKYA 1UAWA 4YQWA 2YWGA 2D74B 1SQFA 3BGOP 4IR9A 2J0XA 4PWWA 1Q8BA 3BN4A 4RO0A 2C3YA 1X0FA 4FNHA 2HFNA 3PDNA 4CP5A 4WXWA 4DV4F 1WORA 3KUEA 4KGZB 1VRUB 5IS2A 1NAQA 4B3SJ 1U0SA 4C6AA 5KFGA 5HVGA 1S0NA 3TP2A 1WG4A 3JYTB 1TAQA 2C2EA 3ENWA 3CCZA 4YMEA 3M2RB 1M90T 3KTQA 1F5BA 3I32A 1VQNS 3DM2B 4KFBA 2J6TA 1WEYA 4FNIA 3OQ2A 3D7SB 3KJQB 1M5HA 4ELTA 4OYPA 2O3DA 4N76A 3MCOA 1WHXA 2YPZA 3GFHA 3S1TA 3IWXA 1S48A 4OYMA 5F3TA 2DNKA 1X4EA 5KFEA 1P8GA 2HVHA 4C8KA 1FFGB 1RBOB 3DHWC 3UDEA 5HQMA 1IKXA 5ADZA 5RUBA 3A8EA 5KFUA 2WBMA 3EMTA 4X4TA 1CQMA 3V6JA 1IM6A 3FMWA 2H5JB 1PIEA 1T8EA 3V4IB 2LEBA 3KNAA 5C5JA 3PZPA 5ITHA 2L3MA 3KNGA 5B0EA 2E1MC 5KFHA 2IM1A 3D6TB 4KSEB 3ONQA 4MKAA 2M7SA 4ED6A 2IY5B 4DG1A 4GO5X 2MZQA 2P9CA 3CEDA 2F7VA 2BBEA 2VG6B 3UPFA 1ZBTA 1IR2A 2FHMA 1JJCB 2VASA 2H4YB 1Z1ZA 4RW7A 2XGQA 2ASLA 2B4PA 4DL7A 2ZFHA 3D68A 3EX7B 1D09B 4XTTA 4ELVA 3BDEA 1YVFA 5LMNJ 2VC0A 3EWGA 3QBCA 5I4MA 4UZBA 1FKAF 3J7YU 1C4AA 3FRZA 1D0EA 1S49A 2OPQB 2Y8WA 3H40A 3MMJA 4G1QB 1YGYA 5IQQA 1PYTA 3PO4A 2LQ8A 2CVEA 3ILLA 5A8KB 4Q44A 1H73A 2HHTA 3N0VA 4YY3F 3QT8A 2YH0A 1HHSA 1ACMB 2JFDA 1TZ0A 3QIPA 1VJWA 5KFRA 2FJEB 2YNFB 2DRBA 3SFGA 4WFZA 4DF4A 5KFKA 1HYSB 1X4HA 4WIQA 4IFVA 2HVDA 1NK9A 5B08A 5IT9U 2P6SA 2HEKA 1CULA 3GFZA 1GX6A 3T1HF 1HBNA 2E29A 2MZSA 3R6LB 3GR0A 1JNZB 1WC6A 2GGPB 4TYAA 1UVLA 4MT1A 3A13A 2JNJA 2CPIA 3G96A 3L7UA 4K4TA 3NAIA 1N88A 1JXVA 3KG1A 1SV5B 3I6PA 2CQPA 2IC3B 3GYNA 2FY8A 4U95A 1YKWA 2CAJA 2DCLA 4EBEA 1K1QA 3NNAA 4NMLA 2DRDA 4ZCMA 4NLWA 1RAAB 3PX0A 3PYEA 1LW0B 2RT3A 4HDHA 4YS2A 2D7SA 3P96A 5THWA 1HMVA 3DLEB 4RW8A 2AJ4A 5F8JA 1K0TA 2ZE2A 4DV2J 3IGNA 1U7LA 4OHYA 3LP0A 4JI2J 4O3QA 3V2UC 3CIMA 5L1IA 5J1EA 4B3SF 4JI7J 1U09A 2CQHA 1F5AA 4WZQA 1IJEB 1RYSA 4B9NA 4DPTA 2F40A 5HATA 5EDWA 3AB2B 4EO8A 3SXLA 2YKOA 2QLWA 4FYWB 4DBQA 2MGZB 1TKXA 1S76D 4PXEA 1XR6A 3IRWP 2YKMA 5E3RA 4KC5A 4X65J 2KM8C 1SL0A 4C0BA 4E8UA 4H54A 1F6TA 3NGTA 1U24A 4HH0A 1VQ9S 1HARA 4CI0B 4ED8A 1XQIA 1VQ8S 3THTA 4F26A 2RHQB 2JOQA 4F50A 1HHTP 3R9LA 4N41A 4ED4A 1NK7A 1RHJB 3GIRA 3CD7A 1S4FA 4C3KA 3GFYA 4PCQA 1JLFB 3F41A 3ZNJ1 3TYTA 2K1RA 1IUJA 2YX1A 1FXDA 3AD9C 3U1LA 1VBXA 2UZAA 4QIFA 1IXKA 4ZVGA 1BQMA 5AE3A 4BDPA 3PEJA 3D1QA 1IKVB 1KTQA 2I8EA 4YEAA 2Z56B 4RWXA 2VA3A 4HTIA 4ZVRB 4QR0A 4I2PA 2DIUA 5CH7B 3K57A 1FEHA 2QZ8A 2R9LA 2P2CB 1YTYA 2KL8A 4OL8A 1SVDA 1FCAA 2Y1RI 4D3HA 2QLBB 4KBIA 1LWEA 4DQPA 4RPFA 3G8TA 1T7PA 2FJBB 3NLCA 2G4BA 1XC9A 3KLHA 3CCTA 2UUBJ 1A9NB 2L9NA 4DXLA 5DG9A 1DQAA 3SMZA 3TJ9A 3M8SA 1KLNA 3EM1A 1O5JA 2BJ3A 4KAIA 4OQJA 3RR7A 2AMCB 3M6VA 3MPVA 1HQUB 4QW9A 2EKYA 1SJ1A 3CB4A 3FUYA 3HHLB 2YKPA 4OI4A 3ZZRA 4O3PA 1RU2A 3W60A 1IR1A 1UVNA 1LXNA 2LFVA 4ZMMA 3PR5B 3NG8A 2R7RA 1ZZFA 4AUKA 2Z2MA 3MPYA 4OYIA 4DFKA 4OFZA 2CFXA 4FPIA 4YFUA 4PG7A 3OTCA 2J8SA 5LJ5Y 4K8RA 2ASYA 2IM0A 4ZLNA 2I9SA 3HHKA 2ZNZA 1S79A 1B0TA 3QJPA 4UOGA 4I7FA 2BRLA 2JLEA 2CQGA 4DDFA 1WOSA 2N3LA 1YBAA 2J8AA 4C98A 1R8HA 4F0KA 3J81Y 1S1TA 1Q7YT 3I0RA 5H9EJ 2VONA 4MFBA 4UY85 2ZHAA 4RNHA 1N36J 1RAIB 2BW7A 3BF4A 2QLFB 4N77A 2E5GA 3LAKA 2EC0A 3OFFA 1QY7A 1K0VA 3MEGB 1X7VA 4M94A 2ZH8A 2V4RA 2KHDA 2HMIA 4JI2F 5KFDA 4PG8A 2ERRA 1QUPA 3PY8A 4ZJOA 5L9XA 4JI7F 3Q8SB 1WSRA 3D0IE 1DLOA 2KT3A 5KG6A 1JLCA 1MN7A 2YNHA 2GVDB 4GC7A 4DF8A 4WJBA 4YOEA 3ZZPA 3K5PA 3DRRB 4JYAF 2DPIA 1N52B 4PWUA 4J9VA 3CDBA 1VLYA 1NU4A 4F3MA 2HK2A 3B54A 3C46A 3K8WA 3BB5A 3NCPA 2FZGB 5I42B 1N34F 2BQ3A 4PYAA 2F63A 5M2PA 3NNCA 2RDJA 2WW8A 4IDKB 3MPWA 3DLGA 4ERDA 1F9FA 4K5RA 1VGYA 4HHHA 4FXWA 2EG1A 3FVYA 3HF5A 2HZVA 2HNYA 1FWLA 1PC5A 4FF2A 5KFBA 4DEZA 5CZVA 4LSNB 1HBUA 4Q43A 1UJ6A 4OX6A 1R27B 1NH8A 4ED1A 2G0IA 3GZ7A 3W5YA 3TVKA 2ZM6J 1TMJA 3RGIA 1XK8A 2NXCA 1R8PA 3SQGA 4DFMA 5D78A 4K5SA 2L41A 3CCWA 1NB7A 2OHDA 1Q7LB 5HROB 3QO9A 1TL3A 2OI2A 2PI4A 2WBRA 4MKYA 1RT2B 3N01A 1H7WA 3TA0A 3LPYA 4K50A 1YK9A 2IMOA 3PCOB 3TNVA 3OL7A 2D9OA 2D3UA 1AUSL 3Q86A 2B9WA 2HHWA 2VFVA 1L3UA 4L72B 3A8IA 1PJ7A 5CA5A 2R3VA 4CCHA 4P9SA 3UVJB 2BANB 4OZ0A 1U26A 3SBMA 1F60B 2XBPA 3DOLA 2D69A 2FB0A 2DNLA 2B5JA 4M5GA 2UUBF 2HFSA 2DNRA 3EGZA 3W62A 3MTKA 4CLYA 4Y2IA 3KHHA 1QAYA 2HHSA 2O67A 3E51A 3CMAS 2FZKB 3MECA 3KLGB 4PPDA 1HL6A 2DO0A 4A8SA 3BJYA 2W4PA 4NXNJ 5FJ4A 1TVRB 1W25A 1VBYA 4DHVA 4ER8A 2G2OA 1U6FA 2XZTB 1T9WA 1R0AA 1OY9A 3MAAB 1TKTA 5C2GA 3PO5A 2RB7A 3VTIA 2GFFA 2QYGA 4I6YA 4AL7A 1X9WA 1MLAA 5HBMA 1S6PA 3J80Y 3UI3A 2PO4A 3VAIA 2WONA 2IHR1 4M63A 4P52A 1FKOA 4O3RA 4ZKAA 2BOPA 1FEEA 2WHOA 2RKIB 4ZVFA 3R6GB 3EZOA 2DGQA 2DNZA 1JWWA 4I2QA 2IA6A 3KK2B 4PG5A 1RTHB 2LDIA 4C8ZA 5DO2A 4UOCA 3OV7A 3W9JA 4CO5A 5IOLA 4P71A 2K7JA 3TUJC 1EJ7L 3TUIC 1EQ0A 3DLKA 3DGPA 1RUSA 2CPJA 4KO0B 3KK1A 3IG1A 2L9WA 5D3GA 3OVAA 3GV8B 4ECXA 1P9YA 3IGVA 4LRCA 4EU0A 4C8OA 1HR0J 4LF8J 1J5OA 5GAHI 1NSPA 1TUVA 3X1LB 4OV1A 2X1AA 4DFPA 2PMHA 5KG5A 1NHKL 3HHDA 3ADAC 3HFZB 3RAXA 3ETOA 4UOFA 3QMQA 3FKBA 3MM5A 3FBEA 2KU7A 4CO0A 2ZVIA 2OPPA 3TJ8A 3SZ2A 2N7CA 3DYAB 1SKUB 4DCPB 3P5BP 1I94J 3OHAA 4JI4J 1UA1A 4DL6A 3UN2A 4DMZA 1IN0A 2IIHA 3JSMB 4FXDA 2WVEA 3T3FA 3EGWB 1TV6B 5D4NA 1S6QA 2AGPA 3FZBA 5D4PA 1FJGJ 1HIYA 4I6WA 2ZM6F 2UU9F 4I69A 2R8KA 3MM8A 2RMLA 4ECVA 3LP2A 1RADB 4USTA 3MEEA 2W9CA 3E2EA 2OTLS 2AF6A 2AD9A 3MPDA 3WDOA 4ZCLA 2J76E 4IYQA 4DQIA 1KS2A 1OSDA 3TVYA 2OFGX 1Q8KA 1C0TA 3CJQA 1NPKA 2KZMA 1FERA 2AHOB 2KXHA 1RWVB 2KB2A 1EKSA 4HLBA 2RAQA 5J2PA 2H54B 4LF4J 4MIAA 4XO0A 4XK8C 3MI7X 5HAOA 1AFJA 3IFEA 2QMUB 3AFGA 3BH6B 4GKKJ 2NXEA 1RSCA 3PYGA 3IWNC 2HLTA 1VQLS 3MMAA 3NOGA 3SIPB 2VDIA 1LK7A 3BSNA 1S7IA 5EWEA 4J37A 4AE5A 3KHLA 2NXNA 2IJFA 2PSZA 2J7UA 5HSPA 3OBIA 2YNIB 1ZTWA 4XDDA 3OSNA 2ZD1A 3N5BA 3G87A 2HNDA 3HT0A 2G1DA 2B4VA 4CO3A 3RB6A 3H25A 3FQLA 2LA6A 1FA0A 3JXOA 4NXNF 1D1UA 1URRA 2H1YA 3CJRA 2CJBA 1SIWB 2DNHA 1S9FA 4H4OB 2W2OP 4OYBA 4RW4B 4KH0B 4JI8J 3PRDA 1RT7A 1BGXT 2V8GA 4NLYA 2ILYA 3U27A 3G82A 4K4SA 2ZH9A 3BGLA 4U7UD 1B64A 5D8HB 2ZH6A 3KK2A 3H0PA 5ETNA 1HNWJ 1RKJA 2CJAA 2F3JA 3Q8YA 2H9ZA 4ES1A 4WU3A 2P5VA 1NPRA 2A0FB 3MF5A 5DETA 2XO6A 4DSFA 4FYYB 4RNMA 2HFZA 1HBMA 2M70A 2BA9A 2CJYB 4P72A 4B3OB 1DHMA 2QV6A 1V3SA 3PR4A 1Y00A 5F3ZA 3NP5A 1RT5A 1J2VA 4OI0A 4WTYA 1UL3A 4KHMA 5BR8J 3GU0A 3IRXA 3S7RA 5E0OA 3FRYA 4P75A 3PRBA 4ECTA 3QJLA 2J9CA 1RACB 3M4XA 2YWKA 4Y2AA 2OFHX 2NXUA 1C1CA 4ANDA 1P6TA 3ENAA 4ID8A 1HR0F 2CA9A 3MR7A 4LF8F 3DRSB 2H5IB 1NK4A 2YH1A 1RLCL 2Z0GA 3HKZD 1BWVA 2DK2A 3OTEA 1NK6A 4DX5A 4NCGA 1AROP 3GPAA 2R2UA 3JB9k 3S6EA 2HG4A 2KXNB 3V81A 2E5IA 2UXDJ 3CCVS 4JV2A 4PWDA 2XMKA 4WPAA 2F5GA 4PG6A 2H51B 2OMOA 3G6VA 1I94F 4J9UE 4JI4F 2DPJA 2DH7A 2MLZA 4ES2A 3EDQB 1BWEA 3PFOA 2ZOFA 3CJ0A 2O01C 1FJGF 4B9LA 4EZ6A 4LRAA 2UVUA 1GEHA 1XR7A 5K9FA 3MCNA 4ECRA 3C8YA 3LALA 1FO1A 7FDRA 3D6HB 5EN1A 4M1KA 1S1XB 5IT4A 5CYQA 2OPSA 3KDOA 1HNXJ 5KFCA 4F0MA 5EHHA 1OO0B 2W1BA 3OTDA 2CQ0A 3K5NA 2JX2A 2XWYA 2ZH1A 2XLJA 3T6JA 1CQNA 2KI2A 4Q5VA 4P2FA 4LF4F 3DOKA 4OHWA 2P6TA 2WSFC 5A2QU 3OPKA 4M5DB 4GKKF 2MKYA 5E2QA 2QT7A 2BOAA 1UVJA 2HHUA 1RTDB 1N33J 1MW7A 4QIGA 2HZCA 1LKZA 4FVCA 3ZZTA 2CQ1A 3CT9A 1NM2A 5KFXA 2HRYA 3M1VA 3BH7B 2BV3A 2FIUA 3OFHA 1RT4A 3SCKE 4P6QA 3MWBA 2DGXA 3DMJB 1FNXH 4V1Ak 3GFXA 5L1KA 3G6YA 4QIWD 3D6MB 2DXFA 3IS9B 3JSYA 4CYUB 3OUYB 1RWKB 2R4FA 2ZDPA 2OUGA 4IH7A 4F4XA 4JI8F 3RJMB 1U8WA 3SYZA 4QOTA 4HVZA 1VQ5S 1H6KX 3OJUA 1G3OA 5A8WA 4J5OA 1Q79A 2K3KA 2ROEA 2IA0A 2V2VA 4IUFA 3KG0A 3C3LA 3ISNC 2HW3A 5LSOA 4ED2A 4ECYA 4DV7J 3HK2A 1S10A 1SI9A 1T02A 1S1UA 1HNWF 4QWDA 1T3OA 3KWMA 2MKCA 5B0GA 1BC6A 2NUUG 4P10A 1R89A 4DU8A 4BC9A 2HURA 4WE1A 2MJUA 3GJRB 2ILZA 3ITHB 1GK8A 4H4KA 1K47A 3GV7B 2KRBA 4KKOB 5E3CA 1VMBA 2BE7D 3M30A 3ENQA 5BR8F 3G71S 1DTQA 2Q6BA 2BUNA 3C6TA 3TEHB 4NLRA 4NXMJ 5B0FA 1Q5YA 3UWTA 2CYYA 3HSJA 3H4DA 2JSXA 5KFJA 1FF2A 2AEFA 2V63A 2ZBPA 4WFNQ 1RT1A 1IQTA 2HFOA 1GMUA 5KG3A 4FYXB 3M9MB 1ROFA 1WD6A 1FNMA 4LBHA 2GJFA 1IKYB 2F8MA 1YJWS 2LKZA 3W3SA 5KFIA 3I87A 2UXDF 1WJ9A 4EGLA 4F04B 1VC0A 4IG3A 1TFYA 3G86A 1Q53A 2OO4A 5F9NA 2XZDB 5DZ6A 4KGVB 4DV5J 1LFPA 4R25A 1REVB 2BE2A 1JJ2R 4K0KF 5HK4A 1R0BG 1JLEB 5C25B 3KDNA 3MM6B 4G65A 2KFYA 5KFSA 1XMQF 3AOCA 5JJBA 2VQEJ 3CVKA 2ZH3A 4MMOA 2R7QA 3MMCB 2LEPA 3QT5A 2CJQA 3CCES 4Y28C 4ILRA 4LF9J 4DPOA 4FP9A 9ATCB 1M5SA 3AQOA 1JLAB 4WKRA 1WEXA 3L7OA 1LNQA 2PI5A 1HNXF 4X4NA 2VG5A 3BPSP 1AW0A 5D0RA 3P49B 1QUVA 1N48A 3V6HA 3CCJS 3MMBA 1HD0A 4QJVA 4H4MB 2DR6A 3W8PA 2O66A 4WYLA 2K7KA 3SEOA 4KGXB 4WP8A 3H4BA 1S72S 2Q79A 3CCMS 1AA1B 3QRRA 3K5MA 1TUGB 4Z7YA 3QWUA 2HHPA 3S8SA 1JMTA 2V8VA 1SL2A 3KJFB 1RAEB 4DS5A 1N33F 3NBPA 2CPZA 1FK9B 4LQ9A 3GJSB 4CNYA 3GWCA 2W2MP 2LA4A 4YB5A 2JEFA 5DDRC 1BQNB 2GCFA 3WQPA 3J7YI 1Q78A 1N8RT 2PA3A 2Q6CA 3W2WB 1RHKB 2DNNA 2C3UA 3BR8A 1YZ7A 1JLBB 4HHJA 4O3OA 3K2YA 2LXIA 2GIFA 3SI8A 3EGVA 1YI2S 2JEIA 2CZ9A 2YKQA 4Q0BB 1FE4A 3MXHP 4NLSA 1EP4B 2QA4S 1VIXA 2IVMA 4RL1A 3SSQA 2DR8A 1S6UA 5L38A 2AJ2A 1RAGB 3MM9A 2A1BA 1XN9A 2VKRA 3DLJA 4DV7F 2F65A 2DGTA 1TUWA 4USVA 2OKQA 3EVOA 4B9TA 3ITHA 4C0OC 1N6QA 1UWBB 3PG9A 2Z2YB 4AT1B 1R43A 1VRQC 3PNIA 3BKTA 4ZOSA 5K5MA 3LH2S 2GQQA 4B3MJ 2I1RA 2UXCJ 3OTOJ 2XWXA 4UT4A 3I96A 3S01A 1F9HA 5J2MB 1UZDA 4GVBA 2GJ2A 3V6DA 3AH6A 3BV8A 1VIOA 2ATLA 5G0RA 2FJDB 3GMGA 2XMUA 3MHYA 2NZ4A 3C15A 3PTWA 3RU0A 3FFIB 3EXYA 3TZZA 3EZ5A 1ZA2B 1FTCA 2FLNA 3HPOA 3HHEA 3O2IA 1S59A 3OJSA 3NMAA 3DNCA 3NS6A 2C2NA 1MMNA 4DI6A 3CE8A
chains in the Genus database with same CATH topology
3EGNA 1NK0A 3NAIA 1N88A 2GIQA 1O0PA 5CCMA 2ACYA 3J7ZT 3KG1A 1SV5B 3I6PA 1WF1A 3HO1A 2CQPA 2ZVSA 5J2PB 2IC3B 1KR4A 3GYNA 4UUXA 2DCLA 4LF5F 4J9PA 2EPIA 1K1QA 2LVWA 4EBEA 3NWGA 3NNAA 4NMLA 5A6PA 2M5YA 3M8QA 4ZCMA 4NLWA 4N47A 2J0SD 4OHVA 2C3MA 5C24B 1FKPB 3PX0A 2QE5A 2E5HA 1ZM9A 3GILA 1DQ8A 3KLEA 5MLCV 1P9QC 4C11A 2CG4A 4B9MA 2IJNA 1UEVA 1NHVA 1LW0B 2RT3A 4HDHA 3MMAB 1U2FA 2CPHA 2D7SA 3X3UA 1TL1B 1ELOA 3P96A 4U9RA 3U1MA 2LQ5A 5THWA 1FJEB 1MU2A 1HMVA 2CVIA 3DLEB 4RW8A 1D9AA 1KN6A 3B82A 2AJ4A 5F8JA 1K0TA 2ZE2A 2YY3A 3LOUA 3IGNA 1U7LA 4OHYA 2BQRA 3KJVB 1IJFB 2CQIA 4DV5F 3LP0A 3QLHB 3DCAA 4O3QA 3V2UC 5F8NA 3CIMA 5L1IA 3I56S 2FLOA 5J1EA 2ZD1B 3KG4A 3EYZA 4B3SF 2XNRA 1U09A 2HNDB 4MK7A 2CQHA 4OI1A 3VAMA 2YNIA 1F5AA 5B09A 1HWJA 1M0SA 5EX0A 2RVJA 1UFWA 2BZ2A 3H2VE 5DM6Q 2XY5A 4WZQA 1IJEB 3GG0A 2HWHA 2Y0SD 1RYSA 4B9NA 5E5NA 1RTJB 2GO8A 4ZPBA 2VG7A 1S99A 2F40A 2NPIA 1TKDA 5K8MA 1HD1A 3M6UA 2POKA 5EDWA 1CC7A 4FPRA 2D3ZA 4Z2XA 2MYFA 2I38A 1XNQF 1X4BA 3GYXB 3AB2B 3RAMA 3MUVP 1QAIA 3RBEA 4EO8A 1FRMA 3N6NA 2DH9A 3EUNA 4R0EA 4IH6A 1LWFB 4KGKA 4O4GB 4LSLA 3W7BA 1ZYQA 2QIFA 3SXLA 2YKOA 3CCQS 2W9AA 2QLWA 3OFEA 2F1FA 4QWBA 1UMJA 1X4AA 4J9KA 4DBQA 2MPUA 1TP7A 2MGZB 1TKXA 4H4OA 2ZH5A 3RW7A 4RW4A 1SB6A 3IR6B 1XR5A 1S76D 1VRTA 4PXEA 1RT7B 3BO3A 4HTJA 3HMJG 2JFKA 3R5BA 1XR6A 3CWJA 5A0YA 2D3OR 1KLMA 4JV0A 4MYUA 2BYCA 2YKMA 3IRWP 2XS2A 3UQSA 4URSA 4FS1A 4DR7F 3OW2R 1YJTA 3OFGA 3IWLA 5E3RA 2R7WA 4KC5A 4Y6IA 4PR6A 3UD4P 1S9EA 2ADBA 2KM8C 1B0PA 4EWTA 1SL0A 1FRXA 3CD0A 4C0BA 4E8UA 1X5OA 4H54A 4DR1F 3R5DA 1U1RA 2RU3A 1RISA 3DHXA 1FDDA 4DL4A 1N36F 1U24A 2XEXA 3MR2A 4HH0A 1C0UA 4OI2A 3HVAA 1RGVA 1VQ9S 1L3KA 1HARA 3GSDA 4KT0C 4CI0B 4ED8A 2E7WA 3H98A 1VQ8S 4FVMA 3OHBA 3THTA 4F26A 1NHUA 4EEYA 1Y5IB 2AGQA 1UVMA 1OPIA 3CJ5A 3MM7A 2MHNA 1RI7A 2JOQA 2VUGA 1SH2A 1VQSA 4OHZA 2XSJA 3DU5A 4IOAQ