3CJKA

Crystal structure of the adduct hah1-cd(ii)-mnk1.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
68
structure length
68
Chain Sequence
PKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper transport protein ATOX1
publication title Copper(I)-mediated protein-protein interactions result from suboptimal interaction surfaces.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport/hydrolase
total genus 18
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cjkA00
2RSQA 2XMJA 3I9ZA 5B0FA 2ROGA 2KT2A 2N4CA 3FGVA 3CJKA 3VTIA 4DPOA 1VQSA 4A47A 1Q8LA 4YDXA 2FHMA 2OKQA 3HX9A 2OAUA 3T9NA 5B0GA 4A46A 2IYGA 3LGMA 4ZA1A 5K9FA 1S6OA 1VQYA 1GXUA 1YJUA 1QUPA 3BGUA 4QOTA 2HFNA 4OJ1A 2XMTA 3IWXA 2BYCA 1IUJA 1S6UA 3HFKA 1MWYA 5T7LB 1AFIA 1JWWA 3DXSX 2W4CA 4DN9A 2ROEA 2FTRA 2K7JA 2W4DA 2GFFA 2G9OA 2AJ1A 1ULRA 2LDIA 1FD8A 1OSDA 3LGNA 2BUNA 5A6PA 1TL4A 4DL0C 4Q2LA 4EFAC 5F0UA 2KT3A 2PGCA 3TOQA 1FVSA 2ZDPA 3LO3A 1P8GA 4FNHA 2VH7A 3IWLA 1FVQA 3HHLB 5B09A 3HF5A 4OJGA 2IYIA 2IFXA 4A48A 2K7KA 3TNVA 2RU9A 1XBWA 1FE4A 3DCAA 2RMLA 2LQ9A 1X8DA 4Y2IA 1RJJA 3FRYA 1K0VA 3HHLD 3WDOA 4OJ3A 1N5TA 4YEAA 2HLUA 1MWZA 3BR8A 1SB6A 2VV5A 1YJVA 2AW0A 4NPOA 1N5SA 2BJEA 4ZOSA 3K7RA 2KKHA 1FE0A 2ZDOA 3QMQA 2XMKA 1KQKA 1Q4RA 4F67A 1N5VA 3HDSA 1OQ6A 2XMUA 1FEEA 1URRA 2ROPA 2EW9A 2L3MA 1U7LA 2QLWA 2XMWA 3CJKB 1KVJA 2K1RA 1CC7A 2GGPA 3UDCA 1Q8BA 2RILA 2BJDA 5B0AA 1V3ZA 4U9RA 2ASYA 2K2PA 4HL9A 2LXFA 1CC8A 3BB5A 4A4JA 5B0EA 3TRGA 3HHLC 3KG1A 2W4PA 3KG0A 1LQ9A 2HIQA 3KNGA 1Y9OA 1P6TA 3BDEA 3BF4A 4NL5A 5B0DA 2FB0A 1SQEA 2QIFA 1CPZA 3BM7A 1GXTA 5IXUA 1W2IA 2OP5A 2PD1A 1R6YA 3F44A 4Y2MA 2OD6A 2OFGX 3GZ7A 1Y3JA 1X0PA 5B0CA 2N4DA 2KYZA 4OJHA 5B0BA 5A6WA 5T7LA 1TUVA 5B08A 2OFHX 3QGPA 2QYCA 4Y2KA 4HI1A 1FESA 1N5QA 2JDJA 2OD4A 1Q53A 1KVIA 1TL5A 2GCFA 3E8OA 2HLTA 2ACYA 3BN7A 4Q2MA 3FMBA 1WD6A 2QLXA 2AP6A 1YG0A 4HH0A 1TZ0A 1AFJA 1YJTA 1AW0A 3MCSA 3MZIA 3HHLA 1X7VA 2Q3PA 2LQBA 1OQ3A 2GO8A 5KAKA 1YRXA 1TR0A 4HI2A 2FIUA 2HQIA 2BBEA 2CRLA 2AJ0A 1YJRA 1APSA 1OPZA 2GV1A 4HH1A 1JK9B 1Y3KA 2HFOA 2K1RB 3KKFA 5F0WA 2GA7A 1SI9A 1Y0HA 2GGPB 2N7YA 2XMMA 2OMOA 4FNIA 4OIXA 2XMVA
chains in the Genus database with same CATH superfamily
2MZSA 1KP6A 3N6NA 3VR1A 2ROGA 2KFZA 1U45A 1F3VA 3DLBA 1HNZJ 5KG3A 3IR7B 3Q0AA 4OHVA 4C4WA 2ZH5A 1EAYC 3EGWB 1AFIA 4QWCA 4WU2A 4LFBJ 3N9UC 3PYFA 1SC4B 4TYAA 1NHVA 2D69A 3FC9A 1UPMB 4LSNA 1E6YA 2D3OR 4FXWA 3MM6B 2YWFA 5AXNA 1FKAF 2L9DA 4J91A 3UCGA 2EXUA 3HDSA 4DZ6A 2E7WA 2ZHAA 4C8ZA 3V81A 2AZ1A 4URQU 1EP4B 1BC6A 4M95A 2CZ4A 3L7PA 1U1NA 2ZC4A 3UCUP 4NL5A 2OHDA 3GFHA 2N4DA 1G1XA 4FKYA 2E5HA 5CCMA 2YH0A 1RB0A 5A2QY 1UVKA 1FFSB 1HNXF 2H5JB 2YKMA 1YG0A 2F8MA 3D7SB 3M2UA 1RHUB 3CULA 2G2ZA 4N76A 3MPDA 4YP3A 5GMEA 4YB6A 5LMUF 4NLRA 5KOWA 4DV4J 3ITHA 4OI1A 4H4MB 3HVAA 4PRFA 4MK9A 5D3GA 3H7HB 3QO9B 1QAYA 3R27A 2YKAA 4DL0C 1VGYA 3ZZZA 4CQ1A 4DV7F 4YB1P 2DPJA 5E7OB 4EWTA 3OTBA 2DNPA 1DBDA 1YRUA 4WE1B 4IG0A 4CLUA 3W9JA 4LMZA 1X4BA 1WDDA 1L3VA 4K8RA 3BEGB 4FYYB 3T5LA 1CPZA 3HHDA 3EDRB 3RAMA 4D3GA 3AJ2A 1RHKB 1UVJA 3ENWA 2PFDA 3CCES 2XNRA 4ZVRB 1KS2A 1UW9A 1U1MA 2SXLA 2NYHA 2Y0BB 3PXGa 3W7BA 5KFXA 4K4SA 2RQ4A 4LVOP 4BWMA 2CKWA 5ETSA 3NMRA 1HQUA 1IM4A 2CWXA 1VQYA 5DG7A 1UZHA 3PJWA 1TTHB 2BZ2A 2BYCA 3G6ES 2E9ZA 1P27B 2GNKA 1IBLF 4DX5A 4YQWA 3H2VE 2KM8B 1J27A 4KFBB 2KZZA 1CS4A 3QIPB 4DWIA 2IVMA 3DLKB 4ECTA 3D0HE 4ECXA 4FP9A 4DPUA 1TL1A 3IA0A 1U2FA 4ITSA 5DM7Q 3NGUA 2HIYA 5B0CA 2Z30B 3J81Y 2RDIA 4X62F 4C3MA 2FGOA 4QW9A 4FBUA 2PN6A 5J1EB 1F0XA 1HA1A 1RXOB 1WHYA 4XDDA 3TR5A 1FKPB 2IDLA 3UNYA 2DRBA 4B02A 1WC3A 1X5PA 4S0MA 1BHNA 4Q8FA 4NA1A 3LP0B 4ZVFA 4J90A 3D2WA 1SC3B 3IR6B 2L08A 2NUHA 3V5RA 2NZCA 4WP3A 2VG6A 2JEGA 1C1BB 2PC6A 1SV5A 5K8PA 4P7VA 2C2EA 2RVJA 5K14A 1GQEA 4JOUA 3TZWA 4DCOB 4I2QA 4IQXA 1LNQA 3EJMA 2GJ2A 1UEKA 1KFSA 3N6MA 1RTDB 2MHEA 4ZVQB 5KG2A 1Y7PA 4USHA 4PQUB 1NRKA 4OYWA 2FJAB 2H9ZA 3ZZTA 2CQ4A 3CE8A 4UQTA 4NCGB 3W2WA 4DU7A 4ANCA 1UW4A 3KLEB 2ZH4A 2OTLS 4CYUA 2Q1LA 4FDFA 2E7VA 3MR3A 3RW6A 2G4BA 1FO1A 4KT0C 4DSLA 3M8WA 1PCAA 2RSQA 3CCWA 4YY3F 5IWAJ 4ZLJA 3KK2B 4KYZA 2MZQA 3GFXA 1NB2A 1JWWA 1N32F 4OZ2A 3QRPA 3OL8A 4CLYA 2P9CA 1IR2A 3S8SA 1I5OB 4IH5A 4IOBA 1ZTWA 2BX6A 2YKPA 2P5VA 5KFPA 4L76A 2JEFA 3CO9A 1RZMA 4DSEA 3PEHA 3UDLA 2LA6A 5J2QB 3I56S 3SXLA 4FS2A 4EUVA 1H6KX 4PUOB 3M8PA 3ZZYA 4O3SA 3L4BC 5DQIA 1IKYA 1RT6B 3VZHA 1L3KA 1BLUA 4LSZB 3NMAA 2CQCA 3QZ7A 2CJKA 2ERRA 2W8LA 1IBMJ 2CWKA 2ZEJA 2DGXA 8AT1B 1FK9B 4B3RF 2BKOA 2PIIA 4ZJQA 4KH1B 4NLYA 4A8KA 3EVMA 3M7VA 4DQQA 1IXKA 2WB1D 2UV8G 2CJAA 1ACMB 4I0WA 2HFOA 2M8DB 4FNIA 4M5KA 2X51A 2QE5A 2NUUG 5KFSA 4C9DA 5AE3A 3Q22A 4WZQA 2DY9A 3A3PB 5HBMA 5KG6A 2WSCC 5HK4A 4LR7A 1KONA 2HWTA 3EICA 2DIUA 4G6VB 3QLHB 1WOOA 2FZGB 4DQPA 3IS9A 4CLSA 1FE4A 2GIFA 4DR5J 4WFYA 2YPZA 1QAIA 1JLFA 3UQSA 3T9ZA 1S9FA 4DQSA 1KHWA 2XQCA 2CA9A 3IG1B 5B7WA 4ZK7M 3EZ5A 2OD6A 4IG0B 1LW0B 1WC5A 2NREA 5ETLA 4OJHA 5J1PA 1RTHA 2KXHA 3KUEA 1GK8A 2GHVC 1K73T 1S12A 1Y10A 3TO8A 1TFWA 1QDUB 3G6YA 1VK8A 2O66A 4FKXA 2D3ZA 3BBCA 4C97A 2HBZB 2Y1LB 2NYIA 2AF6A 4AFFA 7AT1B 4F3QA 4MAKA 4Q43A 1U1LA 2ROEA 1HW9A 1VQNS 3BKFA 4LFCJ 1EKSA 4U96A 2KHCA 2FJXA 1U09A 1MMNA 3TNVA 2RMLA 4QYZJ 1K9MT 2V8PA 4GRSA 4BC7A 2LQJA 3MM5A 3CJTA 2YNFA 1KQKA 4M94A 2IBOA 1WSRA 3FCHA 1BWEA 5GAEU 2MKSA 3LH2S 1NMEB 5E2QA 2RQKA 2DH8A 2PMWA 4ID5A 2RDJA 1U1QA 1I94J 2HNDB 3B4DA 2YNIB 4DV6J 2R2TA 1I51B 3E3XA 4OZ1A 3I0SB 5CYQB 1BQNA 1DZ5A 4P73A 2HLTA 4K4VA 4Y2CA 4YHHJ 1AW0A 5KFTA 1S1TA 4BWJA 5BR8F 1LW2B 4J9KA 1PO6A 2Y0SD 5HQ8A 3G71S 3O6QA 1NM2A 2I38A 3ETOA 2R7WA 1ZM2A 2CJ9A 2HFNA 1TKXA 4I68A 4NXMF 4QQBA 3C15A 4Z7CA 2UXBF 3MAAA 2GVZA 1YDLA 2PSZA 1NK0A 1RHMB 4USUA 1UAWA 1C0TB 1RAFB 3FKBA 4FNHA 4TU7A 4W90B 3A13A 4HEA9 5ETOA 3M6VA 1YK9A 3WDOA 4OHZA 1FNMA 4I69A 2A0FB 1WNEA 3CJKB 2RJZA 4WTYA 2JNJA 2CG4A 1M1GA 1NK9A 4ZVEA 4I7FA 1EHWA 2IM0A 2POKA 3G9CA 2CPZA 2DIVA 1IM6A 1CSJA 1ZPVA 4HYKA 4QWEA 2EWHA 5B0BA 4M5LA 2BR0A 5T7LA 3PR4A 3IRWP 4B3TF 1VRUA 1VC6A 1FKOB 2ZKUA 1VK3A 3BBBA 1HBNA 2LYVA 1KRPA 4DV3J 1N56A 3T41A 3LWLA 4NX9A 4N41A 1RT5A 1GH8A 3PW5A 4R0EA 3CNQP 1RTIB 2DKOB 4WYWA 2GIRA 1RSCA 2HKEA 2QX0A 4F4XA 2ZFHA 2GFFA 3JQJA 1VRTB 2FVSA 2VDIA 4Q2LA 2BOAA 2RS2A 4DG1A 2ATCB 1SKSA 2B56A 3C66A 4NYPA 2RU9A 2R42A 2DXEA 1M1KT 2OTJS 2V4JA 2DCUB 2A2DA 4C98A 2IVFB 1FDBA 2RILA 4ZCLA 4ED8A 1HWLA 5KFNA 2W4PA 2E1MC 3NGDA 3LQVA 1SQEA 2HURA 4TQSA 3EUNA 3T1HF 3ISNC 1RGVA 5BJRA 4MJKA 1NK7A 3BQ2A 2GAHC 3W5YA 2D9PA 2D1CA 2UU9J 3IM9A 4OZNA 4RU9A 3TAPA 4OYMA 4HACB 2OJ3A 3OTEA 3UDVA 3BKUA 2XTJP 1SI9A 2IJNA 3PJ9A 2DGQA 4RBVA 2C42A 3KG4A 2G2OA 1TL3B 4M63A 2IMOA 3M8QA 1DARA 3GIIA 4LRAA 4CO1A 3MI7X 2A6OA 4CCHA 2MKYA 1S76D 3VCDA 1E6VA 4LVNP 3O3LA 2YX1A 3JSYA 2GIQA 1HNIA 4B17A 2MDAA 4F8RA 2OUGA 5FD1A 1ZPWX 5F9NA 1FRMA 2QEXS 2VG7B 3UD3P 3DNCA 1EQ0A 4QR2A 3H40A 4ER8A 1FXLA 4WF9Q 2F63A 3OFGA 5CZVA 3OTOJ 4DUYF 1UJ5A 2G0CA 4JI2J 4C8LA 5D15A 4F3MA 3PYGA 3M9OB 3R6LB 4NA2A 2B3TB 2LEPA 4K59A 3VGTA 4URGA 2E1AA 1KQSR 4USKA 3M9MB 2D3O1 1NHUA 4CH0S 5HANA 1FWPA 3AFGA 4K5SA 4ZVGA 1KQFB 2MTLA 2W2PP 2ZUGA 1OSCA 2VFVA 3ENAA 4ZLPA 3G6VA 4IO1A 4J9UE 4FF1A 2IAJA 5T14A 2FDNA 2RIJA 3SBMA 4Q7AA 2R9LA 5KFCA 2C22A 1JLEB 1N6QB 1EZZB 4WKRA 4F4AA 3Q8QB 3A1YG 4JI8J 4PQAA 5LSOA 1TKZB 4IKAA 1HQEB 2LQ8A 4LF2A 4NXNJ 3US5A 4A48A 3MMCB 3G8SA 5HROB 1WEZA 2CQHA 4H4KC 4M5DA 5C2CA 4JI0J 2ZH3A 2RE1A 2BJDA 4JV0A 1CC8A 5G0RB 1REGX 2VD3A 2M5YA 1D9FA 2V2ZA 2VL1A 2VICA 2KVIA 2VKRA 4YOEA 1HHTP 1JKHA 2BE7D 1F6TA 2DY1A 1SL0A 1RQ0A 1QAJA 2EFOA 4ECZA 2NPIA 5CD4H 5CA5A 4M5MA 1Q8KA 3GV5B 5DG9A 3ENQA 1YJRA 2J9CA 2VG5B 4CNZA 2QRRA 4OI2A 4OZLA 5D0HA 4I1TA 3H4BA 4TYBA 1IBKF 3Q24A 4Y28C 3OR1B 2YY3A 4PWUA 2DNKA 2W2MP 3QRRA 4DDFA 3TUPA 3ZC4A 2X3GA 3PRBA 4C8NA 3MUVP 4EFAC 4RW4A 4KGZB 3BQ0A 3AOCA 2YWKA 1DRZA 4Q45A 3C46A 2W2QP 1RADB 4RLEA 4DPTA 1SKUB 2NCKL 4K4ZA 2V2QA 1B99A 5LMUJ 4LQ3A 2P9EA 2Q6BA 3FUYA 3JSMB 3L3CA 2WVFA 5FIIA 1GNKA 1X4EA 3PW0A 4LR8A 4RBUA 1HNWF 3DOLB 4DF8A 5CD4A 4A8YA 1YBTA 1F60B 2EG2A 3GPAA 3M30A 4FS1A 2QLFB 4C8MA 3LF0A 3ZZPA 3ISZA 4DOZA 4DV7J 3V4IA 4UZBA 2JLFA 4UOCA 4YDDB 4ED6A 1M5KC 5DO2A 1MN7A 1WC0A 1NPPA 3OSNA 2CRLA 2Q6CA 1U1OA 2QO3A 2WBMA 3UNGC 4NLDA 2VONA 1W26A 2X1FA 1S6UA 2G1DA 1RWOB 3MUTP 3MUMP 1AUDA 3T19A 2KH9A 4RNNA 1TK0A 2BJ8A 1WI6A 1T11A 4LF9J 2J9DE 4FXVA 1U0HA 3IWLA 1WACA 2MQNA 3D6HB 1X8DA 1PAUB 4DF4A 1R0CB 2KT5A 1CJVA 4KV8A 4F67A 4KGKA 4PXDA 3OTDA 3KHHA 2XULA 2K2PA 4C11A 3CCSS 2WBRA 3I4HX 5SZTA 5LM7E 4ETXA 5GAHI 1KOOA 3M2RA 4W4MA 4KRWA 1AUSL 2QMWA 4IRDA 3MM8B 2XS5A 1IBLJ 3X1LB 1V5VA 5D0GA 5DGAA 2BJ7A 3FZBA 2HHTA 4HTJA 5ITHA 3PKYA 4PKDB 4KY3A 1WEYA 1C4AA 3OVBA 3JSBA 3FQKA 2GGPB 5DG8A 2CQBA 4CWBA 3MFHA 2VA3A 2PEBA 1F5AA 4U8YA 2BQRA 2L48A 1GXUA 1BE4A 3BPDA 4RX6A 1SH3A 3RUBL 3C14A 4KPYA 1N34F 1F9EB 4X62J 5E41A 4I67A 3GYNA 3AT1B 4TU8A 3O44A 5B09A 4CM0A 2NLWA 3W2VA 4MKAA 1QE1A 1QTMA 2CNLB 3I5CA 3GV8B 4NPOA 5T41A 3TAQA 3SV4A 3UE2A 5A8KA 1W7WA 2XY7A 4Y34A 1VQOS 2LP4A 1H7WA 4ETZA 4KAIA 3KNAA 2DEIA 2RKIB 2P2CB 3AJDA 1TVRB 1FDNA 3C3LA 1KQGB 1UVIA 1KD1T 3HHNB 4OYXA 1QLNA 4OV6A 3CJ2A 5KG7A 2VJVA 2WSFC 2W9BA 4OZ3A 2F5GA 5K20B 3G96A 3IRXA 4J9SA 1B3TA 3AQOA 3LGHA 4DHVA 4P2FA 2FHMA 1VC0A 1HBMA 5L9XA 5F3TA 1GT8A 2XHCA 2IRYA 2WOMA 3FK4A 5I3UB 2FVPA 1R3NA 4YB5A 3J7AN 2XM3A 3H5UA 1ULRA 4IR9A 2ZKTA 1XC9A 1TUWA 4DR2F 1S0OA 4B3MF 3GJSB 1A9NB 3HHKA 2LQ9A 4QW8A 3OLBA 4QYRA 3MFIA 3I31A 3U7JA 4PCQA 1TMMA 3KK3B 2XLJA 4ZDNA 3UD4P 1EB0A 3V6DB 3BH6B 3Q23A 3CCTA 3F44A 1DURA 1FTRA 3I4PA 5K8MA 4RWXA 2I5JB 5M2PA 1OS5A 4F0MA 3GR0A 4DMZA 2V8HA 5A8WA 1DLOA 1U25A 3EVOA 3ELHA 3JAMY 1S1VB 4ZCKA 4GVLA 1Z1ZA 3M05A 4DZDA 4JI1F 3MMBB 3DYAB 1DQAA 1TAQA 1VYAA 4I4BA 3SCIE 4F3OA 3WZ0A 2GO9A 2GJIA 4LRDA 4QR0A 5HO4A 3CD6S 4B9SA 2J0WA 1GXLA 3TUZC 4BCAA 4PWDA 2VASA 2OMLA 3DXBA 3PKMA 3NGRA 4B3RJ 3HFVA 4UT4A 2FVRA 2IRUA 1KFDA 4Y2IA 2IM1A 5THWA 3KLFA 4DFJA 4N5SA 1VCTA 3CJ5A 3AD9C 2RDDA 2CDQA 3D1OA 2MY7A 4KHMA 4YN3B 2AU0A 1NU4A 1RWWB 2WONA 3CMAS 5IXUA 4MYTA 1RAAB 2UXDF 3I96A 3SEOA 2KXNB 1A6LA 1H0HB 2DBBA 1K1SA 2Z8QA 3TJ8A 1R8CA 2MQQA 2HMIA 1R7IA 2BW7A 4RW6B 1R31A 3OL7A 2R8IA 3DRYA 3DM2A 2XLIA 4PPDA 3M4XA 4JV5J 3RAQA 2HYIB 1RT2A 2HFUA 3MTKA 3RGIA 2RAQA 1CLFA 3C6UB 2OPRB 4J9MA 1R8PA 2DD8S 2JJ4D 1SPBP 4EYHB 2HBYB 4CLPA 3J81j 3RBXA 1RJJA 3CIZA 8RUCA 1RT1A 3DOMB 2B6AB 2LLZA 4A8OA 1QY7A 4PWWA 1FDAA 5FJ4A 3MEEA 3RB3A 2YQ3A 3UO0A 3OW2R 2J0XA 4JYAF 1Q81T 3UWTA 4IFYA 3R5CA 1G3OA 1SUQA 1XJWB 2RHQB 2B8PA 2CQ2A 3RRHA 1B4SA 1KWMA 3G87A 3OQ2A 1TKDA 1IKXA 3TQ1A 3DOKB 1JLCA 4HH1A 2YX4A 3CF5Q 2VFSA 1NHKL 3RB4A 4WP9A 4PZVA 2HVDA 3M6UA 1MROB 1IKWB 3KMSA 4EBDA 4YFUA 4F36A 1QUPA 4V19X 2GQ2A 3HPOA 4FF3A 1IVZA 1HKAA 4EK2A 2UVVA 2HNYA 3THPA 2ASDA 2DISA 2CPJA 2GVDB 2GJFA 4J5OA 2ZWOA 4J9OA 4RUCA 5DDPC 1S6PB 4Y0FA 4ICLA 2XY5A 5C25A 3IAM9 1UVLA 3FRYA 5BR8J 2BM1A 2AW0A 1GEHA 2OEJA 4DV0J 1Q4RA 4NI2B 3HZEA 3BPSP 4LF5F 2DNZA 3KLIB 1HNVB 3W66A 5IZHA 1RP5A 1U4BA 2Z0GA 2M52A 3NNCA 4NXMJ 5FDLB 2UXBJ 2RQCA 3CGIA 5IM0A 3MECB 2FJVA 2Y8YA 1OIAA 4FZVA 5HVHA 4RL1A 4Y00A 1WOSA 2AJ0A 4CLLA 1U1PA 3M8SA 3GG0A 1SJRA 2YNGA 5KFUA 3I82A 4O4GB 3G6XA 3EGNA 1S4FA 1RI7A 4PAAA 2IC3A 2QG9B 4OI6A 2BA9A 2DGSA 3R2CJ 3HJFA 3NAIA 4IOCQ 4UZCA 4KSEB 1L3TA 3MR6A 1LWCA 3LGNA 3FEYB 4HR2A 4K4UA 4AT1B 4RNFA 2CYYA 4K5RA 3FQLA 1NPRA 4ZOSA 5KFKA 3CC7S 3K7RA 4JV1A 1HIYA 3GJQB 3BGFA 1XWLA 3N5FA 1EETA 4RUBA 2R8JA 1SCJB 3MR7A 4IDKB 2NS1B 3VAJA 3SQOP 2B9WA 2W2OP 4ZN3A 2CJXB 3N0VA 2D41A 2MQ8A 1HYSB 2ZH2A 1EKRA 2FJWA 1KR4A 5IT9U 4ZCMA 2V50A 1MMDA 1XMOF 5LMNF 1N5YA 6FDRA 2FLPA 1W25A 4L72B 3DRXA 2C2MB 2MKHA 2G2YA 5U47A 5DDRC 1PIEA 2CXEA 3G4SS 5L46A 1XQIA 1HI0P 2FY8A 2EKNA 3FCWA 2MHNA 4OI4A 2OPPB 2DO4A 4DQRA 2QMXA 1VR6A 2F3JA 5KT2A 2QLBB 5J2NB 4LF4F 4WXWA 5HL7Q 4TY9A 5JJBA 1NPKA 2KI2A 2CPFA 1U1RA 5L1JA 3PV8A 2B51A 3FSIA 2UUAF 4W92B 4FXDA 1V3SA 1S9EA 4U7CA 1U48A 3R5JB 5B0DA 2FHJA 2VU5A 5KFMA 4ECWA 3MCNA 1S1XA 2M9KA 5F8NA 1RWUA 1N36F 3K59A 2C2ZB 4GVBA 3HVTB 1TFYA 1LWEA 1RUSA 4MFBB 1JK9B 4EBCA 2FUG9 3AXMA 3NXZA 1SIWB 2DNYA 4ZVSB 2ZM6F 1DTQB 4ILRA 3VAFA 2A10A 1NAQA 1FTCA 2AEFA 3THTA 1JLGB 4DUYJ 1LEOA 5CYMB 4DSFA 7FDRA 1X31C 1T9YA 3FMWA 4WKYA 3MTJA 3NL0A 3QPIA 2B43A 3TX8A 5HJYA 5HVFA 1RTJA 3DGPB 1K0TA 2QYGA 1HPZB 1FWKA 4KC5A 4P75A 4FYXB 4LBHA 3TVZA 2FHKA 2HBQB 5E33A 4ECVA 3HKZD 1Q8BA 5B0AA 3TRGA 3EXCX 3VQTA 2R7XA 2UP1A 4C3LA 5C42B 3QSYB 3SDEB 1PKUA 4DR7F 2W01A 1CJTA 3FZ2A 4IFVA 5EX3A 1B7FA 4ECSA 6FD1A 3DKDA 1VQKS 2DXDA 4DV5F 4ZN1A 1WWHA 3AOAA 4NRTA 3I0RB 1G6BA 2VA2A 3VZIA 1S9GB 1UWAA 4YS2A 1DY3A 5GADI 2H5EA 1C2PA 1TV6B 1FDDA 3CCMS 5FLXU 2EFVA 1U6ZA 3NGKA 1M5PC 1YBAA 3UN2A 3DMJA 2A3JA 4IR1A 3KHLA 2IIHA 2Z2LA 1XNRF 1WHXA 2DNLA 3PYEA 3HM9A 3KJVA 2HNYB 5D8HB 5IFMA 5JXSA 2BDPA 4RR5A 3DC2A 4ZPTR 3TW0A 3AODA 1S1WA 3OFFA 1IBKJ 4PXEA 4HLBA 3MEKA 4LRCA 1X4AA 2VHGA 3HLUA 5C24B 3K8VA 2MJNA 2UV8A 3BN4A 4C2MA 3WIVA 3H0PA 2F4FA 3CCVS 1VQ7S 4U7UD 2CQIA 4Y6IA 3Q8SB 3HHLA 5D0EA 2BBEA 2CPDA 4LRBA 3QYYA 4QU6A 1Y0HA 1U47A 4P72A 2KXFA 4J9RA 5KFFA 3SFGA 3HSZA 3O8WA 4ELTA 4U67Q 3R9LA 4A47A 2NSBA 2C3PA 4KJIA 4E8UA 1HD0A 5HMYA 1YGYA 2YWEA 3FBFA 2GC8A 2UVUA 1TL4A 3GLJA 4G1QB 2BEFA 2H3EB 2HPUA 1FWLA 5LXRA 3OFEA 1N5TA 1JLAA 2AX0A 1NB7A 1N5SA 4EGLA 2QFIA 2LECA 1HBUA 1B70B 1U1KA 1S48A 4DLGA 3T5HA 3DDIA 5KFAA 3DFEA 3PZPA 4OI3A 1I6JA 3ILLA 4E0DA 2CQ0A 3I6PA 1NKCA 3MPVA 4ZIWA 1GX6A 3FBBA 2UUCJ 1AA1B 2MPUA 4AL6A 3C16A 3MCSA 3MZIA 1VQLS 3TUIC 3MM6A 3GG1A 1C4CA 4LR9A 2X3DA 2EG1A 4NOHA 2ZE2B 1SL2A 3HHEA 3L9ZA 1EP4A 1T8EA 4C8KA 1EJ7L 4PR6A 4ZVTB 2DR7A 2DT9A 1NSAA 2XO7A 1ICEB 4QWAA 2PE8A 2GMLA 2RHSB 3CXCR 3M32B 1RWPB 3TAMB 3ILIA 1K0VA 3KHGA 2F9DA 3W65A 3QGGA 3PG9A 5KG1A 1UTAA 1B0TA 4PG5A 1TMJA 1ROFA 1DJ0A 2ASYA 2QLJB 1RISA 2AJQA 5D4LA 5ETTA 3SFUA 4B9VA 1UZDA 4WCEQ 4H4MA 1OY6A 1HWJA 1H7XA 2QJ3A 1WG4A 4ATNA 4JV2A 3A8EA 3OFHA 2ZH8A 5D78A 3LPYA 3AY0A 1UVMA 3QO9A 4K0KF 1WC4A 1VMBA 2ZHOA 3C19A 2RRAA 3MEDB 1OJ4A 2WVCA 2FIUA 1S1XB 1TKTB 1X9WA 4QZVB 2KL8A 2VDHA 3MD3A 2OMOA 4AXJA 4C8OA 1CG2A 1BUXA 2HK3A 2OEKA 4WE1A 4LUBA 4DPOA 1UPPA 2AYEA 2V5HG 5BYQA 2HVHA 4NZ7A 5KFHA 3TUJC 2DRDA 1QSSA 4F50A 3H2UB 3PEJA 1ZH5A 3AJ1A 1T9UA 2W24A 2IVYA 3NG8A 4ILLA 3VAKA 2CPIA 5DQGA 3VALA 4H4OB 4TLQA 1MWZA 3BH7B 3MMAB 1GAOA 3QJLA 4ELUA 3TVKA 4QCLA 2VOOA 2EPIA 3RR7A 2AYBA 2OPSB 3K5MA 1RWNB 3C6TB 3GFYA 2L9WA 4NCBA 1FEHA 4ZHRB 4PG6A 1NK6A 4B3MJ 2QLXA 4ES3A 1JXEA 2MGZB 4HH0A 2ABYA 2XZTB 3S6EA 2CVEA 4CO4A 3GWCA 2DNNA 1NDCA 1KVKA 2ZOGA 4B3OB 4KFBA 3QIPA 1Q86T 4OHYA 3KKFA 4Y3CA 3DLKA 2JL9A 2RF2B 3R3TA 1SQGA 2W8KA 1V3RA 3PIPQ 3M1VB 1M1HA 1LKZA 5F9LA 1NZAA 2UUWA 3LAMA 4P6QA 3W9HA 4EO6A 1ZTTA 3TVYA 5ETVA 2FPHX 4USMA 3X3UA 4LF1A 2E1RA 5J1EA 2YH1A 2WB4A 3S01A 3BREA 1FKPA 2QL5B 4JI1J 2F1FA 2WVBA 3PTWA 5HMZA 5DJBA 1Y5NB 2B5JB 2OP5A 4KQZA 5RUBA 2J6SA 5DM6Q 2W7OA 2JEIA 2OSQA 2V69A 4XAKA 1T9VA 3DLGB 3OBIA 1YZ7A 5GVQA 1C1BA 2EFNA 3CDEA 1SH0A 1FFGB 2FZKB 2HFVA 2P6SA 5I42B 1QAXA 3GONA 2PI4A 5HP1B 3AXKA 1RTDA 1VS3A 3T5KA 3IWXA 2BANB 3GYXB 4QPXA 4UUWA 2BQUA 4XIUA 3MAHA 4PQUA 2UZAA 4KKOB 2UXDJ 4NCGA 3NBPB 1U24A 3K2YA 4I2PB 3KLEA 2VV5A 4O3PA 4TXSA 4ENOA 3UR3C 1U8WA 3NOCA 3FEXB 4HHHA 2XWYA 2LQ5A 4RW9B 2EFQA 2HS4A 1S5ZA 2XC9A 1JLAB 1LWFB 3QFHA 2GX8A 2NXCA 5DLFA 3KK2A 2HBRB 1Y3JA 1RA7A 4UF4A 1AXQA 2C2RA 3D68A 3RRGA 3IR5B 1D9DA 2EFPA 1WKKA 4HT5A 3KHRA 3EZUA 2HZAA 3PY8A 3TA0A 3G82B 4ED0A 2QFJA 3RBZA 4ZP6A 5HMXA 5J2QA 4UOHA 4LF8F 3C16B 1RT4B 4PUOA 4ZCIA 2W7PA 1AZSB 2DB1A 2DO0A 4ZPVR 3DDNA 2HGNA 4DS4A 1RT6A 1RAOA 3MR5A 2E7XA 4DX7A 2QGFB 3NNAA 3GYGA 2K8GA 2IYIA 1FK9A 1R0AB 3MHYA 2KJVA 4DL6A 2ATLA 2B4PA 1F2GA 1RHRB 1F5BA 3K0JA 2ROPA 1VQ4S 3EPIA 4DX8H 4BS2A 2WHOA 2IJRA 4EZ6A 4ZS6A 4H54A 3CC4S 3TARA 3MDFA 3WX8A 3I5AA 3ZTQA 2KYZA 4OMFG 3CJ0A 4HI1A 2CIMA 1FJEB 1WOPA 5KT5A 4I64A 5AE1A 3UCZP 3QLHA 4ED7A 4PYDA 3EMTA 3NOGA 1NDPA 2HW3A 2CJYB 4QIEA 2KHDA 4LF5J 5GMKa 1FNXH 4ED2A 4YR3A 1VQSA 3ZZOA 3MCOA 2FY1A 3IG1A 3LP1B 2AKWB 3O1LA 4FF2A 3M2VB 3EM1A 4USJC 1LW0A 5G4DA 3TYTA 3GIMA 3EGZA 1RU2A 4X4PA 5L1LA 3IP0A 1HW8A 3JXOA 4Z2XA 1Q7LB 2Q79A 5DLGA 1CULA 4USVA 2CFXA 2WK4A 3CD5A 4KGMA 3OT9A 1T03B 1EQMA 1XK8A 4BC9A 2XB2D 2PD1A 3D4JA 4O4RA 5M2UA 4DR3F 2VBYA 3GSIA 2UVWA 5KFIA 1J5OB 1FJGF 1SC6A 4KB7A 3PNIA 1RCOB 1G4CA 2Q3PA 4K4XA 4P74A 4ECRA 1JXLA 2ZVIA 1ZM3A 1MNEA 5EHHA 5DZ6A 2XMVA 3BR9A 1VC5A 2Z2YB 1W2BR 3UPFA 2E5GA 5CZXA 2LKZA 4ALZA 2BE2B 2DGWA 3FFIB 2M88A 2G9OA 2HNDA 2YNIA 3GILA 2YVSA 3GSDA 3I0SA 5H1SV 4MMOA 2VZ9A 5CYQA 3MPUB 4PG7A 4N77A 1JJCB 2PT0A 3CCUS 4Y65A 4WFZA 3OXFA 2FGCA 5L1IA 4F4WA 1VQ8S 2XMAA 3CC2S 1LW2A 2NQPA 1KSPA 2EK1A 1EX8A 2HS3A 2E9TA 3AB2B 2CQDA 2J7KA 4F2SA 3WBZA 4JI4F 1IJFB 1Z4UA 4K4TA 3GCXP 4PG8A 4CTAB 1C0TA 3D0GE 2XEXA 3P5TL 3I9V9 1LK7A 4PPZA 4LF4J 4NEZA 5HSPA 2EBEA 4Q0BB 2UUAJ 2MZJA 1MU2B 3CJKA 3VQSA 4F4YA 1HHSA 3D1HA 4J9PA 3F41A 1WSVA 4PXCA 1JQGA 1S6OA 2HQDA 3L95X 1MWYA 4LBIA 5IQQA 5J1NA 1X5OA 2QL7B 4B9NA 2BUNA 4C0HA 1QTNB 4HDHA 2ALZA 1FJ7A 1N36J 3P45B 1PSDA 4WFXA 1FKOA 4DL5A 1SVDA 4DLEA 1PJ7A 5KT4A 1M0SA 1XR6A 2MKIA 2LXIA 2KKHA 4NRUA 1DFDA 3UDCA 2CG8A 2ZM6J 2O3DA 3TZYA 4HVZA 2HQCA 4B9MA 3D54A 3G2XA 1RTIA 4EBEA 1WTBA 3GR1A 5A8RB 3NCRA 4RU2A 3QWUA 2KVQE 4AD6A 1YKWA 4TY8A 1KVIA 2AJFE 1NH8A 1VRTA 1EIYB 2AV5A 1OY8A 4QIFA 3QQCD 4M5NA 3DI6B 2L9NA 3B6BA 2DHHA 1S97A 2P9GA 3W63A 1FFWB 2GV1A 2XMMA 3PR5B 4OL8A 2KT2A 3FGVA 4U95A 1NNDA 3M9NB 4J37A 1A7GE 1SH2A 2DK2A 3GFZA 2BM0A 2V9KA 3GMGA 3SI8A 1CJUB 1JIHA 1FF2A 5KFQA 4DV5J 3TI0A 1T05B 2HHQA 2Q66A 2J76E 4EI2A 4R8UB 2BJEA 2W7AA 4HACA 2R8GA 3KUGA 3HULA 1ZAXA 2AMCB 3RJMB 1TP7A 1RCXB 2DGVA 3RU0A 2IY5B 3CDUA 2XY6A 2YNHB 1P9YA 1TL3A 3ADAC 1CEZA 3CJSA 1VISA 3LWMA 3D6FB 4CH1A 5HJXA 5KOXA 1XNRJ 2AX1A 3P4UB 4X4NA 1KLMB 1P1LA 3LUYA 1RWKB 1RT3B 1OQ3A 2MLZA 3DRRB 2J6UA 5E5NA 2OPQB 1RT7B 3N5BA 2PA3A 5GAEI 2VG7A 1PYOB 1UJ6A 3Q8UA 4RNHA 2V0NA 1ZAVA 1IR1A 4DR5F 2DGUA 2MB0B 4ECQA 2Y1JA 1D09B 1X9SA 4WIQA 4KTQA 2OEMA 4CIOA 3RAXA 4GMKA 3V6KA 3FEZA 1FE0A 3CD0A 3OV7A 1OYEA 4KHRA 4QJVA 1OYDA 3PHTA 2JLGA 3QFWA 3KLHB 4MKBA 2ZBRA 1S1UB 4KIAA 1CULB 2QMUB 1JLEA 3AD7C 2W1BA 2HNZB 3VHQA 1N6QA 5DQHA 2DCLA 3P5BP 1TKZA 1HQEA 4AYBD 3IN5A 4DPWA 4X64F 3R5AA 4ZVPB 5DGBA 2BMBA 3MMCA 5GMDA 4AUKA 5HROA 2K1RB 2DNGA 1HI1A 1X0FA 1NK4A 1SJQA 3DGVA 1YJ7A 4K7QA 3TEHB 5G0RA 4HHJA 4MIBA 3H90A 1I3OB 1U2CA 1T94A 4M8LA 4YR0A 2HZVA 4RW7B 4BLGA 3CIMA 2HLUA 2U1AA 1NCLA 3C8YA 4ZMMA 4DV6F 2VG5A 3HD2A 2MJUA 1ZZNA 2LVWA 1NZ8A 4HL9A 5F8JA 4XK8C 2EC2A 2ZJRQ 2M2BA 3B54A 1U6BA 1Q5VA 3OR1A 3L09A 4XPEA 2M8HA 5A6WA 4AXIA 3A4TA 4J9LA 1UVNA 2JDJA 1U8SA 4U6PA 2CADA 1K44A 4NLVA 3MXHP 1FXRA 2X1BA 2DEJA 2ZD1B 3TZXA 1VQ5S 3CWJA 1YIJS 4EYIB 1SKRA 3NP5A 3MEGB 5EDWA 1HR0F 2Y1IA 4IH7A 3ZZUA 3H98A 2MMYA 1UWBB 5CQGA 2AJ2A 3JSMA 4YDXA 3FDSA 1S0NA 1H74A 3DOLA 3K17A 4OZJA 2YXLA 1SQFA 4K0KJ 5F0UA 2YQ1A 3N01A 1R8BA 2ZDPA 3LO3A 1RKIA 4CO0A 2CAJA 1BXNA 4X2BA 1T0TV 4CLFA 1IWAA 3Q83A 2KO1A 4WWSA 1NJZA 1H2VZ 1X4HA 2QLWA 1VHIA 4NYOA 3OR2B 2ZJPQ 1SBRA 3SSQA 1KN6A 3J80U 3HP6A 5DRKA 2DNHA 2GZOA 1N0UA 3OD2A 5KFJA 1F3FA 2DNRA 3DLEB 1QM9A 3LW5C 3S7RA 5KFLA 2AHOB 3A8JA 2YKOA 1ZOTA 4Z7YA 2FVQA 3K5OA 4O44B 3FMBA 1CQNA 2HVZA 4M5GA 1FERA 3VAHA 1VFJA 3UDEA 3O2IA 5J2PB 3M8ZA 1Q5YA 3S1TA 4TY8B 1XMQF 4ZPWR 1RLDA 5L9NA 2VF3A 2V9WA 2IDEA 2XHWA 3MOJB 2HZCA 2RNEA 3HX9A 4A8SA 1NKBA 5B0GA 2YTCA 1YJUA 3BGUA 3EX7B 3PW7A 2DR9A 1WF0A 5LJ3Y 4K4WA 1REVB 3MM8A 5KFBA 1MSWD 3RRKA 1S7HA 3TOQA 3OXGA 3IGNA 2RD5C 3PO4A 4YEAA 3DRPB 2V34A 1RACB 1VOMA 4JI5F 2F8HA 3ET6B 2GGPA 2R7SA 3LP2B 1BQMB 4X66F 4LQ9A 4OX7A 4L73A 1Q79A 4CT8A 5JMNA 3CD7A 2RB7A 3ILOA 2O5DA 5DETA 5LJ5Y 2B8QA 4B9UA 3EGVA 4RUHA 3N6LA 3OJUA 2KRRA 2E29A 2Y1RI 2ILZA 2RUGA 3DLHA 3JS9A 2ZZTA 5HLFA 1Q8IA 3QGIA 4P10A 3M8RA 4A46A 4N8OA 5L39A 1JLBB 2AJ1A 3D66A 1C0UB 3TA1A 5IT4A 1CVJA 3FRZA 1F9HA 1S77D 2RKIA 4NLUA 1MLAA 5A0YB 2C28A 4DFMA 1TVRA 2V68A 2KB2A 4AL5A 3DRSB 4JB8B 2FLNA 5E3AA 3PW4A 1YX2A 3QAEA 2WAQD 1ZYQA 3NS6A 1Q95G 2XYPB 2D74B 2BRKA 2W9CB 3CCLS 3KFWX 1VBKA 3BYRA 3OUYB 5I3UA 2OD4A 4F25A 4QWDA 3HVRA 1T3OA 2BOPA 1B64A 1S7IA 3JTPA 3UFCX 4C3KA 1BY9A 2ZUAA 4G1IA 3U1NA 2MKCA 1VBYA 3QT8A 1YVFA 4B3SJ 1XR7A 2U2FA 3UVJB 2DNMA 3VAMA 4R5PB 3KK3A 2C2OB 5K8OA 3CDBA 3V6DA 2J9DA 1O5JA 2FHJD 4IG3B 2LXUA 1PILA 1TK8A 1BD6A 2I5JA 4GO5X 1TK5A 1T9WA 1Q0NA 1ITPA 2OIHA 1UMJA 3EDQB 2Y8WA 3PFEA 4IYQA 1YJVA 4Q5VA 3RB6A 1D3WA 4LF7F 2DNQA 2H48B 1S1VA 3QT6A 4LF8J 2CZVC 3POTB 1JJ2R 3MMBA 3DYAA 2MSSA 4RW8B 3Q8RB 3I55S 1L3SA 3CO0P 3BZQA 2GAGC 4UQGA 1HQ2A 2JWNA 2LEAA 4O3RA 2QYCA 1F2HA 3EPGA 2LMIA 4A8XA 3W64A 3V4MA 4LSLB 4C8YA 2XSJA 1OMSA 1Z2LA 4MIWA 1FA0A 1HMVB 1M5VC 4DUTA 1RAGB 1JNRB 4CLWA 1HNXJ 2N4CA 1ZA2B 2OKQA 3VV2B 3MOZA 1S6QB 2RS8A 3HFKA 3DU6A 2GHPA 3CB4A 4OZ0A 1Y5IB 2NXUA 5A2QU 1RDRA 4NLPA 2MQMA 4OHWA 1ZM4A 3OHBA 2FQQB 3ZFVA 4RW6A 1V3ZA 1MMLA 3QATA 4OZ5A 2E5LF 3FVYA 4NCAA 1NK5A 3KK1B 2P8IA 4QIVA 4ES1A 1RAIB 2QIFA 2QA1A 3W8GA 4L74A 4F02A 3ONQA 2J5AA 1YSJA 2IA0A 4TLRA 5IC6B 2AD9A 2J8AA 3D28A 4IUFA 3C6UA 4RBTA 2OPRA 2ZBCA 1XTZA 5L1KA 2R2SA 3HJVA 4O3OA 4WU3A 3H42A 3VF0B 1KTVA 2MKJA 1LWXA 2K3KA 4GKKF 3NCPA 2HQFA 3R2DJ 1DTTB 1ZETA 2V8GA 3BDPA 2W25A 1IKVB 3DOMA 2B6AA 1D9AA 1QJHA 2KDOA 3FNNA 3R8YA 2V4QA 1SIZA 5IV3A 2ADBA 1X4FA 3E01B 4LF9F 3LGMA 4ZA1A 2RU3A 4DR3J 3BBFA 2NSCA 3PW2A 1FJGJ 3CJQA 5EX0A 3M6XA 1QVGR 4DFPA 2XYGB 2VBXA 4WTOB 3HI9A 3HHLD 2DGOA 3JYTB 3MGJA 2A2CA 3DOKA 1WJ9A 1K8AT 2EW9A 2MZRA 4U9RA 3CCJS 1FRJA 3BGRB 4N7TA 1QSYA 3MM7B 4NZ6A 4X65F 1MROA 3FSXA 1IKWA 1GXTA 2WW4A 2UXCF 4IQMA 5DZ7A 5J2MB 4WK1A 1YITS 1JLQB 3R97A 4H4KA 2JEJA 4AL7A 1GMVA 2GVDA 5AJ3F 2Z56B 1UJ4A 1YJ9S 5KFGA 5KT6A 1S6PA 3D5MA 2VQEF 2LDYA 2XI2A 1GMWA 1SJ3P 4EU0A 3GB0A 3J7A1 4NI2A 2YWHA 4FYWB 2AGPA 2AJ4A 5H9EK 3KLIA 1HNVA 4C0BA 3NGSA 3BYPA 3QIDA 2XGPA 5FDLA 5HLFB 1KKHA 2VIHA 3NEKA 2FYXA 4K2XA 3J81U 4JI4J 2F4VF 4N47A 3MECA 5ETPA 1YTYA 2PEHA 5CXTA 1HWIA 1TL7B 3SQGB 4X4TA 2C2DA 5JVGQ 3ZO7A 2YKNB 3QGHA 2X1GA 4O4GA 5D4OA 1P6TA 1N52B 2HWIA 2BV3A 2CZ9A 2QA2A 3CVKA 3KLGB 1TU0B 2MYFA 1C1CB 1YI2S 2V63A 1HHQA 4OHXA 2HRUA 1HBOB 3HSGA 2C3OA 1M5SA 2GS8A 2LQBA 3W5XA 5EUHA 3UN5A 1OPZA 3A8KA 3B8HA 3CCZA 2N7YA 2F9JA 4DUZF 2OSRA 3HT0A 2V67A 2KG1A 3R7SB 4EMDA 3HT3A 4IDKA 4OYBA 2XCPA 2XMTA 4AQYF 3K5NA 4OLPA 1KHVA 2BACA 1CJKB 2R7TA 4HT7A 2HWHA 4O3QA 3CJRA 4YY3J 1R43A 1HYSA 2B4UA 3HF5A 3RW7A 2IFXA 3B82A 1N32J 4CLZA 2G0JA 3MM9B 4CNYA 3QMQA 3SCKE 1JJHA 3PJXA 1OPIA 4ECYA 1S4EA 3SSRA 2XS2A 4DS5A 1HL6A 3UI3A 1VJQA 2OI2A 4DSIA 1Q53A 3PYDA 3PIOQ 1H2TZ 2HFZA 3WIUA 2GCFA 2I6WA 4LSNB 2MQLA 1E6YB 2HSEB 2W9AA 2OPPA 5C2GA 4DPXA 4QU7A 3OHAA 1Q82T 3CDWA 2E9RX 2QA4S 4HI2A 4PG4A 3MAQA 4Y2AA 1YWXA 5J2NA 3V81B 3LA0A 4KE5A 2OLWA 5KFDA 4BBYA 5D6GA 1R0BG 2NPFA 2CUYA 4OX6A 4A8WA 4GC7A 2XSJB 2WRMA 3H5XA 1V5IB 4DBQA 3A8IA 2ZBQA 4F0HA 4UW2A 2YKMB 2PMZD 4ELVA 3M2UB 5HN0A 4RJVA 1IQTA 3IO1A 2D9OA 1T7PA 2Z57B 1B0VA 3F73A 1LXNA 4YR2A 3HVTA 3ITHB 4MFBA 2GHWA 2EVZA 2BVZA 4C48A 4KO0A 5EN1A 1HARA 1ZS6A 1WELA 1YQHA 2QZ8A 3BGLA 1DTQA 2HRTA 4CO5A 5D3GB 1JLGA 2VB6A 5CYMA 3ZNUA 4CO2A 2B9XA 3HSDA 5BYRA 3D67A 4FBTA 4WPAA 1H72C 1XR5A 2M7SA 1YJTA 3DGPA 1WKJA 3IAS9 4JV5F 1HPZA 2LEBA 2DH7A 1X5SA 3PX4A 3BO3A 3TA2A 4YUDA 3SSSA 3JQMA 3L7UA 4U8VA 2JHEA 3J7YI 5C42A 2OGUA 3SDEA 2H65B 2ALYB 2LU1A 2DHXA 1ELOA 1WHVA 2J7UA 2H54B 2OELA 1F1BB 2CPXA 2MZ1A 4X64J 1VQMS 2CQPA 2COLA 3I0RA 1S9GA 4LREA 1RLCL 3AD8C 1HQUB 4X4RA 3H59A 2J0SD 1NSKL 1TV6A 5HAOA 2WVEA 5CCLA 1VJWA 3D3CJ 4C0OC 2VPWB 3ZZ0A 2J9EA 4IH6A 5HQMA 4J7CA 2ZH1A 2JOQA 2JSXA 3QGPA 1FESA 1JB0C 4WFAQ 3GU0A 4QBUA 1K47A 3NAHA 5E3CA 1AYEA 1CS4B 3GJTB 1RYSA 4M5IA 3NWGA 4CP5A 2XGQA 2MLYA 2H1YA 3K89A 2AYGA 3HZGA 5AXLA 3R5GA 1TL1B 4JI7F 4OV1A 3K57A 5HQLA 5C24A 3DXSX 2VPYB 1FD8A 4DV0F 3AHPA 1PBAA 1DHMA 3MPYA 5CABA 3MWBA 2R2UA 1AT1B 1Q78A 3UR0A 3T1YF 2ZC3A 3QT5A 1NK8A 1H98A 1HR0J 3J7ZT 4ZIVA 1FNOA 4ZVHA 5KFVA 4NA3A 2RT3A 4QIWD 5KG5A 3JSRA 3CDAA 1SJFA 2ZNZA 1HWUA 1J2VA 1R8AA 2VC0A 3GIRA 3E8OA 2VG6B 2ACYA 4G1QA 4NMXA 1SV5B 4WIIA 1PC5A 5K14B 3M8YA 4RZRA 4I2QB 3V6JA 3PDNA 2VQFF 2FC9A 5EGYA 4B3TJ 2KFNA 2BE9B 2O01C 4RNMA 4OI0A 9RUBA 4X4QA 1T95A 5F8GA 2ZVSA 5CYJA 4F0KA 3U27A 3GIJA 4JP8A 3QWPA 2EBGA 4QR1A 4DN9A 3W2WB 5LSRA 2EK6A 3WC2A 7FD1A 5IT9Y 3CPWR 4CYUB 1BWVA 5HATA 3RTVA 2Z4PA 1LV5A 3HSJA 2CQ1A 1XMQJ 3U1MA 1WTFA 2VKZG 1KC8T 1FEEA 4USWA 1HI8A 5E3QA 2X7IA 2Z58B 3NCQA 2O1PA 2ZE2A 3UN3A 1RK8A 1RTZA 3BDEA 1DAXA 2R8KA 2E1PA 4PYAA 5L8RC 2ZITA 4PXBA 3SCLE 2QL9B 3DU5A 5KFOA 5F8HA 2WCXA 1NH7A 1KEKA 3HXMA 3WC0A 1U49A 1LXJA 3SYZA 2HQGA 3TJAA 3RYLA 2AP6A 3M32A 3BKTA 3T1HJ 3TAMA 2O67A 3W1YC 2DYAA 1NSQA 2UUBF 4ZP7A 1YJWS 4NLTA 4JI5J 4KHPF 2JLEA 3M8PB 4CDIA 2XSFA 4P52A 4X66J 2DNOA 1IKYB 2HHSA 1RABB 4J9QA 2P6TA 2BJ1A 3OXLA 2W4CA 5GAGI 4TU9A 3TJ9A 5KG4A 4C6AA 1NJXA 1U2RA 1T3NA 4A8FA 1SL1A 4L3NA 1D8YA 1WDTA 2B7CB 3MEDA 4UOGA 1TKTA 4L3KA 1NUEA 4WP8A 1RE1B 5JUMA 1LQ9A 4OX9F 3BO4A 2KRBA 4P9SA 3K8WA 3HKWA 5HBMB 1WC6A 4WFNQ 2XWXA 2OFGX 2RRBA 2WSEC 4ED3A 4KO0B 3J7Z5 3AA8A 1TAUA 3NGTA 3QJPA 3IC1A 3OVAA 1KLNA 4OYZA 4LJMA 3IS9B 1VLOA 4WK3A 2XLKA 4HKQA 1JLFB 4K50A 4H4OA 2IPOB 5KFYA 2VJUA 1APSA 2DR5A 4JUZA 2FLOA 3MMAA 3B4MA 2MKKA 1YRTA 2KJWA 1R8HA 4I6WA 1LFPA 2JVRA 3AAWB 1UEUA 1N0VC 4DL4A 2OPSA 3FBEA 1NJYA 1RTHB 2K7JA 3WQPA 3C6TA 3KDNA 3GIKA 2JX2A 4ZHRA 1BGXT 2ZBPA 2A6MA 4FF4A 3UW1A 4OJGA 2MGZA 3HCXA 3QAUA 3KJFB 3OLAA 2ZDOA 3RZAA 4B3OA 5H9FJ 4NLWA 4DU8A 5FLXY 5E3PA 2BXJA 2LXFA 3F0NA 4LIRA 2PI5A 2RF2A 2HIQA 1NDLA 2EC0A 4FVCA 4DSJA 2KTQA 3CW2C 4KBIA 3M1VA 4IO9Q 2HEKA 2XG8A 2AEJA 2XBPA 3BO2A 3BSNA 3MM5B 2OO4A 1AB8A 3Q2SC 1V9OA 2YNFB 4U7UK 1YBUA 4LF7J 3TP2A 5B0FA 2V4RA 4LIWA 1Q8LA 3K5PA 3CEDA 4ID5B 1D0EA 2BKPA 3OL6A 4PEOA 2B5JA 2FTRA 1BQNB 1UFLA 3W8PA 1RKJA 2AQ4A 1N33F 2MQPA 2FJBB 4E98A 4GC6A 2HS0A 2NZ4A 4MKYA 1M90T 3OSPA 1S1TB 3W3SA 3Q8PB 1WORA 4ED5A 3DLGA 2GW8A 2ZBIA 2VPZB 1YHQS 2L3MA 3H4DA 1FXDA 1TKXB 4GKJF 3G8QA 2FB0A 3DN9A 2XCAA 5I42A 3C15B 2BRLA 3MAAB 5HP1A 2GVZB 5IT0A 4XTTA 1YZ6A 2BANA 4DR4F 1X9MA 3R1HA 5KTQA 3EWGA 2VOPA 1NBEB 2Z2MA 3LALA 4KKOA 4ILMA 1T9TA 3NBPA 1IN0A 4I2PA 2VFUA 1HWKA 1HNWJ 4M5HA 4NLSA 4ID8A 5AXKA 3CUNA 5EWGA 1S49A 4XPCA 4I7FB 2E5LJ 3P96A 4RW9A 3HFZB 1IR0A 3R7NB 3JTOA 1WKLA 1LWFA 5T7LB 1TELA 1O51A 1X60A 1VRUB 1IBCB 1V6HA 5AE2A 5A6PA 2PA8D 1QD1A 3IFEA 1HBNB 3LPEA 2H51B 4O3NA 4GKKJ 1RT5B 2OH2A 4OJ3A 3IM8A 2KU7A 3G82A 3CMES 1U7LA 4ZJOA 4MTPA 5D77A 3VGVA 2GQQA 2C1EB 3CCRS 4F04B 1UA1A 1Y9OA 4QPTA 2UUCF 4Q8EA 1RT4A 1PBUA 1AZSA 1HD1A 4FYDA 2MY8A 1VHFA 4LF6F 3LAKA 4Y2KA 2Q43A 4DG1B 4Q2MA 3KTQA 2JFKA 2MLXA 2R2RA 2VBZA 3NS5A 1O6XA 2IJFA 2ASLA 2BW2A 1FX4A 2FHOB 4B9LA 2V4JB 4M1KA 3G86A 1R0AA 5CAAA 3SCJE 3W62A 1SKWA 1RWVB 2GA7A 4LFAF 1NXIA 5LT5A 5D4PA 3W61A 3WHIA 3HD1A 1PGZA 4X65J 2YWGA 5KT3A 2UXCJ 3NKYA 1OO0B 3CCQS 4JI6F 3SMZA 1Y4ZB 5AJ3J 3THVA 2N3LA 1NLKL 4ANEA 2JVOA 5DS7A 3AQPA 2CJQA 2CPHA 2ADCA 3P6YC 2HHXA 4NLXA 2QSWA 2VQEJ 3I32A 1N34J 1D8ZA 5EWFA 3ULHA 2DVIA 2D7SA 3P8BB 1CC7A 4A4JA 4V19J 2F7VA 2LU2A 3M8QB 2QC3A 3LP1A 1PJ6A 1E6VB 4YMEA 4ZPBA 1NSPA 3M2VA 4X4VA 1HFEL 2V8VA 2XO6A 2F4VJ 1XEZA 1HNIB 1TZ0A 3MPWA 1LOUA 3LOUA 2HHHF 1UFWA 3A12A 4WJBA 1J5EF 1T03A 5F41A 2HAIA 3CSKA 2GMHA 5GAHU 3G8TA 4JI3F 4WFBQ 1PC4A 2AWZA 1J5OA 8ATCB 1WHWA 3MF5A 1Y5LB 5IQ6A 3IBCB 5KFWA 2Y9HA 3P49B 4RWWA 3OVSA 4UUXA 2LFVA 4DUZJ 2XMUA 1XNQF 4DR2J 2XMWA 2RUSA 4LT6A 3L7OA 3SZ2A 2IAJB 1UCNA 5IOLA 3Q2TC 4CM2A 1G7CB 2KN4A 4A8MP 4X84A 4AQYJ 2CPEA 1W2IA 5H9EJ 1VLYA 1FT8A 3K5LA 2BE2A 1RYRA 3FFIA 1WG5A 3OPKA 1FX2A 3CMQA 3BSOA 2M0GB 3MMJA 4MT1A 4BHQA 2YPYA 4F26A 4DV2F 4XO0A 4M5DB 5LOQA 1YRXA 2HRYA 3M6WA 4A8QA 2E66A 2ZH7A 2V6AA 4UTGA 1IWGA 2J7WA 3H25A 1NJIT 2IYGA 5K9FA 2DXFA 4DR6F 1JKHB 1ZBTA 3CJ8A 4DFKA 2DR6A 1P9QC 4DV1F 3H5SA 3FJ2A 4KH0B 1FJCA 4CTAA 4P2SA 2H5IB 3IGVA 4ZVUB 4ZP8A 4O0NA 3JAMU 2V2VA 1RA6A 1QUVA 3QBCA 4Q0BA 2QTWA 1MU2A 1NO8A 2BQ3A 1S0MA 1JX4A 3BF4A 3KDOA 3EXYA 1X0PA 5DDQC 4RW4B 2PO4A 3RB0A 4ERDA 2ZOFA 2K3IA 4F4ZA 2HVEA 3I87A 4RKUC 1VIXA 4NWBA 2ZJQQ 1SC1B 3BJYA 2EI5A 2XMJA 4I6YA 3PRDA 2HHPA 1X4CA 3EVWA 1IQZA 1NDKA 1GMUA 2QN6B 4MK8A 2J0QD 5A8RA 3UD5A 3M30B 3KMQA 5M2RA 2N3OA 2BKNA 3E51A 3HK2A 1UFKA 2NR0A 4OX8A 3V4IB 2BABA 3TQEA 1FHTA 1P8GA 2RRNA 2FVCA 2I8EA 2IM3A 4V1Ak 4JBCA 4TQRA 3DI6A 3H20A 1MW7A 1SB6A 1MG7A 2A1BA 3N79A 1N5VA 2ILYA 1RAHB 2JC1A 4DR1F 1U02A 3KLVA 1PYSB 3BB5A 4TNOA 5ETQA 1HNZF 2R3VA 3VGSA 3D0IE 4LFBF 5E0OA 3CT9A 2Y3YA 1U0HB 2WVDA 2NXJA 1Q7YT 1CJUA 3LTOA 3OJSA 1KOHA 1AFJA 2B7BB 2DGTA 2JH3A 1XN9A 1T05A 1CJVB 4KV8B 4JYAJ 4NYZA 4R8UA 1WF1A 2JZ5A 2J6TA 3U1LA 3TX0A 1CBKA 2WW8A 1D1UA 3BV8A 4C11B 3TEGA 1SXLA 2DR8A 3VTIA 1WG1A 4CRJA 2MXYA 5BXIA 3M2RB 3N4WA 1DQ9A 2OAUA 2XZWA 3R1LA 5LSLA 2YNHA 2AGQA 5ETMA 2X1AA 4OLOA 1VDHA 2DH9A 4O23A 1FVSA 3VVUA 3HMJG 4CH7A 1KLMA 3GCWP 2RH3A 2AT1B 1VQ6S 2C2NA 2R7QA 3BR8A 3H2LA 1RT3A 2HHWA 3DRRA 1KBRA 1R89A 2OPQA 3BSAA 1RT7A 1KVJA 1OWXA 4DQIA 5ADZA 1K1QA 4DV4F 4JI7J 5MAOA 4UOFA 1F5CA 3T3FA 3P3DA 2IBKA 1L5UA 1JMTA 1S99A 3C14B 4E2FB 2HAFA 1U6FA 1R6YA 4ZLLA 5K5MA 2L41A 4OYPA 1PG5B 2HFSA 2GMJA 4NLOA 1S10A 3W2VB 1QE1B 2H4YB 3T1YJ 4F4KA 2VFTA 3AA9A 2APOA 2HQIA 3J7YU 4MKVA 5A8KB 2DHGA 1R27B 2YWWA 4MYUA 3PHEA 5K8NA 1FD2A 3AOBA 2ZWPA 3KLHA 1O8BA 1S1UA 1Q1KA 5IS2A 2MEWA 2VBWA 4M5JA 5AXMA 2HNZA 2MZTA 1X4DA 1ZAWA 2B9YA 3DDKA 1VBZA 1FRKA 3Q8YA 2N82B 3KWMA 2PGCA 2AYMA 4Z37A 2R7OA 3IXQA 2CJBA 1WUUA 3N28A 4ZLNA 2W9BB 2VQFJ 3ISND 3VWSA 2ACMA 1FRXA 2HHUA 2K1RA 2ZOMA 3IRXB 1DQ8A 1NJWA 3VGUA 2AIRB 1HBMB 4X4SA 4ZKAA 2WOMB 1IJEB 1RHQB 3IBFB 3GZ7A 4P71A 2ZZMA 4ZJLA 2FJDB 4OYAA 1QVFR 1TUVA 3TANA 5ETKA 3NY0A 4IRKA 2B9EA 3RR8A 1LK5A 2ZHBA 3QZ8A 4RW7A 3DLLQ 3MURP 1CQMA 1VIOA 3V2UC 3HO1A 3MCMA 4OIXA 4ED4A 5D0RA 5F8LA 1RBAA 4ANDA 4NLQA 2HK2A 3IWNC 1T9XA 4KGVB 2CDRB 2NXNA 5KG0A 4J9VA 2KZMA 4TN2A 3NLCA 3PM9A 3Q8VA 4GO7X 1XMOJ 5LMNJ 2F8EX 2RQMA 3HVWA 5A8WB 1B7YB 1DLOB 3R6GB 2ZD1A 2UUBJ 4DPYA 2BJ3A 4KHPJ 1Q16B 4Q44A 1NEEA 4B9TA 3ZTSA 3MEGA 5ETRA 5B0EA 4MK7A 3HHLC 4CO3A 1UWBA 3KNGA 2D3UA 4DJBA 2CQGA 4N8NA 4MH8A 2JRSA 4TVAB 2DTJA 3SV3A 3H8YA 1G2EA 4PWDB 3KOAA 1FRHA 1TL5A 4L75A 2KG0A 1WD6A 4DN0A 2E44A 4OYOA 3KLFB 4ECUA 1TR0A 3TZZA 3RBEA 5JVHQ 2QA4G 3R5BA 3D6MB 3OR2A 4CZCA 3KYLA 4OX9J 2WONB 5LL6d 1RWMB 3D1QA 3ZTPA 3NWRA 2EEYA 4WXOA 1N4LA 3DLEA 3RG6A 3NS7B 1OSDA 1Y11A 3TWZA 2VODA 1I1GA 1WI8A 4DL7A 4O44A 3DHWC 1FCAA 2R8HA 1VRQC 4OQJA 2HMIB 4USTA 2M3DA 1GMWD 5J2PA 3OTCA 3BS9A 1OQ6A 2HGMA 3DM2B 4PABA 2E5JA 4W98A 4D3HA 1S72S 3V6HA 1PJ5A 2KYXA 4DXLA 1RT2B 2N7CA 3GE9A 5IWAF 5SUHA 4Y2MA 4EO8A 5EWEA 2V94A 1REVA 4P2MA 3WX4A 3PFOA 4ZPCA 2R7UA 4G65A 3KJQB 3SIPB 4DR7J 1RT1B 1VI7A 1GTHA 3ZNJ1 4WYLA 3DRPA 5GAGU 2I1RA 2R4FA 3ET6A 3MEEB 4FVMA 3LP2A 4USIA 1BQMA 3W5ZA 3FSYA 4NLGA 3B78A 2ASJA 2CNKB 2MQOA 4IFYB 4X4OA 1SUQB 2M4MA 3EZOA 1IBMF 4I6AA 2V2KA 3T6JA 1MN9A 2YKQA 4FN5A 2W2NP 1JXVA 2WTFA 1IKXB 3D3BJ 1JLCB 1S0VA 3ILJA 3FBCA 5ETNA 2G1HA 3KXDA 2CVIA 4B08A 4N56A 5LXYA 4O0IA 2I0XA 3ZXWA 4EEYA 1T02A 2VUGA 2DRAA 2I2YA 4YB7A 4CT9A 3K58A 3FCVA 1N33J 5B08A 1JLBA 4DL3A 4AE5A 1C0UA 2VFRA 4ICLB 5C25B 3RBDA 4QYZK 1XERA 5A0YA 3Q86A 3PACA 1PYTA 5DDOC 1Y3KA 4UY8T 2Z2ZA 4K2JA 2MSTA 5HMWA 3DRSA 1UP1A 2DPIA 4GKJJ 3T9NA 4WBFA 2ZH6A 2PMHA 4OJ1A 4NEYA 2B0GA 1IUJA 3GV7B 1Z2ZA 2W4DA 4DR4J 5IM0B 1KTQA 2W9CA 4ES2A 3OUYA 1WEXA 5I3QA 4DL2A 4HTIA 5IC4B 1S57A 3U02A 3PRVA 2YBVA 2IM2A 2DHSA 2K7KA 2HQ3A 3VAGA 3DLJA 4NASA 3DCAA 2K06A 2DITA 1U0SA 3QRQA 4RUAA 2YNGB 2XMKA 4DX6A 3ZTRA 5GADU 2KM8C 1XIQA 1NKEA 2IC3B 3UVJA 4CLKA 4R5PA 3PVXA 4DCPB 1H38A 2QT7A 1RU1A 4R25A 1KDNA 1LWCB 3PCOB 4DI6A 4LBPA 3ICLA 3MR2A 4IG3A 1TUGB 4LFCF 3QNWB 2YQ0A 2YX7A 2PDAA 1N88A 1X7VA 2GO8A 3AB4B 1OY9A 4FPIA 3LANA 1EETB 3JTNA 5F0WA 5KFZA 1M5OC 1PAEX 2F40A 3POTA 4RW8A 2JFDA 4ZVOB 2AEMA 1JJ4A 1I94F 4ZITA 2F65A 4LF6J 4QWBA 4LRFA 1RWXB 2C2KB 2FC8A 2M70A 3GJRB 4TKTA 3VVTA 2VH7A 2DJWA 1FVQA 3BGOP 4YHHF 2IMWP 1EARA 1UA0A 4LSLA 3H5YA 1H2UX 1KNZA 1N5YB 4LFAJ 1HMVA 2QSFA 1UETA 2XZDB 3JQKA 3W9IA 4MIAA 1H73A 3CTRA 4J9NA 1S6QA 4JI6J 4EZ9A 5L38A 2QV6A 1S79A 3T5JA 2JC0A 3BSCA 4C7QA 2H4WB 1UL3A 1X4GA 1AROP 5KAKA 5KFRA 2AGOA 5C5JA 3KUHA 1BMQB 5MLCV 2IRXA 1S9EB 3J80Y 3E2EA 3R5DA 1UKUA 1H3DA 3IBWA 4F7VA 5I3PA 3ZZRA 1ZA1B 3KK1A 2HHVA 4HHUA 5I4MA 4UY85 3GP9A 3AH6A 2UVRA 3GTYX 1L3UA 4CLTA 4IOAQ 3BQ1A 4ZP9A 4BDPA 3QJJA 4GVBB 5A76A 2CNNB 2XNQA 4DV3F 1LWEB 1N48A 3QSIA 4I56A 2DHAA 1VBXA 2HHHJ 1GFWB 4K4YA 1A0OB 1DTTA 2C3UA 2GQCA 5F8MA 2ZH9A 1J5EJ 2VPXB 1IKVA 3KG0A 2EKYA 2R7VA 3E01A 3PO5A 3BM7A 4QIGA 4KR0B 2J8SA 1VQ9S 5C7PA 4JI3J 2A18A 2OFHX 3A3OB 1N5QA 5HVGA 1RTJB 5F8IA 2V8DA 3IMQJ 1FRLA 3CJ3A 4URSA 3KJNB 2KFYA 2VC1A 2LA4A 3A3NB 4DSKA 2G13A 1VQPS 4OFZA 4NE9C 3JYTA 1XNQJ 3VAIA 4ZPDA 4WZMA 1WC1A 5CHCB 4HDGA 1N8RT 3DHXA 3T1AA 3BGRA 1CJTB 2I9SA 4QOTA 5KFEA 3MM7A 2LCWA 3CJ4A 3R7BB 4IFVB 2PFFB 2LDIA 2HG4A 2XI3A 1B0PA 5J2MA 4G1PA 6AT1B 2R7RA 3EYZA 2UU9F 2KT3A 1RHJB 1JLQA 5F3ZA 2IHR1 1BQXA 4NZ0A 1M5HA 1S59A 2HGLA 4RPFA 4DV2J 5E3RA 4R0JA 1SJ4P 2C3MA 9ATCB 4IRCA 4NMLA 1MWQA 5HI7A 2E1CA 4CI0B 3D9BA 4FYVB 1URRA 4RNOA 3PX0A 1U26A 4FPRA 3F56A 1ZM9A 2NXEA 1HLWA 4DR6J 4DCJB 3DMJB 5H9FK 2B4VA 1N54B 2B4OA 4DV1J 4XDCA 3QT7A 3KJVB 1UEVA 2C3YA 1R6VA 4ED1A 1RAEB 1TL7A 3SQGA 1S1WB 5CH7B 2WZ1A 1SJ1A 1F9FA 3T6BA 3LP0A 1URNA 1WF2A 3MD1A 1RAJA 3I9ZA 3I5BA 3NRBA 3ETMA 2YKNA 1TQLA 4DEZA 2XS7A 2FZCB 3OTOF 3JB9k 2UUTA 3GQCA 4JI2F 2CQ3A 1XMBA 2G0IA 2EFGA 3ZTOA 1YLXA 3D6TB 2BJ9A 3KLGA 2E5IA 3W60A 2CPYA 4L6V3 1C1CA 1GTEA 5AT1B 3HHLB 1GX5A 1HBOA 4P7TA 2HVIA 1FRIA 1XBWA 3O5TB 2ZNYA 4KPCA 1JNZB 1RBLA 1O0PA 2IA6A 4F2RA 5KT7A 1LFWA 2FLLA 5BYSA 1FI4A 5IV4A 3KG1A 3OL9A 4P2XA 2FJEB 2CNOB 3NNHA 4KGXB 4RO0A 2XYHB 4JI8F 3EE3A 1Y00A 2FD2A 1YJNS 1CJKA 4OYIA 4ZPAA 1P1TA 4B3SF 3BN7A 1X5TA 3ENVA 4NXNF 3C2PA 1QSLA 5D4NA 3Q89A 1ZZFA 3PX6A 4G3IA 2ZZNA 1HBUB 1RBOB 2AZ3A 4JI0F 4DR1J 4X4UA 3MM9A
chains in the Genus database with same CATH topology
2MZSA 3OL7A 3VR1A 3N6NA 2R8IA 2VG7A 2ROGA 3DRYA 5B0FA 2KFZA 1UJ6A 3DM2A 2XLIA 4PPDA 2V0NA 4RNHA 2V4RA 1U45A 4LIWA 3M4XA 1Q8LA 3K5PA 3DLBA 3CEDA 4ID5B 1D0EA 5KG3A 3IR7B 1ZAVA 4OHVA 3Q0AA 4C4WA 3RAQA 2HYIB 1RT2A 2ZH5A 3MTKA 4DR5F 3EGWB 3OL6A 1AFIA 4QWCA 1CLFA 2DGUA 2B5JA 2FTRA 4WU2A 1BQNB 1UFLA 3C6UB 2OPRB 1RKJA 2AQ4A 4J9MA 1N33F 3N9UC 2MQPA 2MB0B 1R8PA 2FJBB 4ECQA 4E98A 4GC6A 2HS0A 2Y1JA 1X9SA 4TYAA 2NZ4A 2DD8S 2JJ4D 1NHVA 4MKYA 4EYHB 3OSPA 1M90T 1S1TB 4KTQA 4LSNA 1E6YA 4CIOA 2D3OR 3W3SA 3RAXA 4FXWA 3Q8PB 3MM6B 2YWFA 4GMKA 4ED5A 5AXNA 1FKAF 1RJJA 2L9DA 3CIZA 3DLGA 3V6KA 3FEZA 1RT1A 3UCGA 1FE0A 2GW8A 3CD0A 3OV7A 4KHRA 4QJVA 2B6AB 2LLZA 2VPZB 2ZBIA 3HDSA 2E7WA 2JLGA 2ZHAA 2L3MA 1YHQS 4C8ZA 3H4DA 3V81A 4A8OA 1FXDA 4URQU 1EP4B 1BC6A 4M95A 1QY7A 2CZ4A 3L7PA 1FDAA 3KLHB 5FJ4A 3MEEA 4MKBA 1U1NA 2ZC4A 1S1UB 1TKXB 3RB3A 4KIAA 3UCUP 4NL5A 4GKJF 3G8QA 2FB0A 2YQ3A 3DN9A 2XCAA 5I42A 2BRLA 1JLEA 5HP1A 2HNZB 1N6QA 3GFHA 5DQHA 2N4DA 2DCLA 5IT0A 2BANA 3OW2R 1G1XA 2E5HA 2J0XA 4JYAF 5CCMA 2YH0A 4DR4F 1Q81T 3UWTA 1X9MA 3R1HA 5KTQA 2VOPA 4IFYA 3R5CA 1UVKA 2Z2MA 5A2QY 3LALA 1G3OA 1SUQA 4KKOA 4ILMA 1HNXF 1TKZA 1HQEA 2CQ2A 1YG0A 2YKMA 4AYBD 3RRHA 3NBPA 1IN0A 2F8MA 4I2PA 2VFUA 3IN5A 1HWKA 3OQ2A 3M2UA 4X64F 1TKDA 3R5AA 1IKXA 4NLSA 3DOKB 4ID8A 5DGBA 3TQ1A 3CULA 3MMCA 5AXKA 1JLCA 4N76A 3CUNA 4AUKA 5HROA 4HH1A 2YX4A 2K1RB 4YP3A 3CF5Q 5EWGA 1S49A 2VFSA 4YB6A 3RB4A 5LMUF 2DNGA 4NLRA 5KOWA 1HI1A 1X0FA 4XPCA 4I7FB 3ITHA 3P96A 3M6UA 4OI1A 1NK4A 1SJQA 1MROB 1IKWB 4H4MB 4RW9A 5G0RA 3HVAA 4HHJA 3KMSA 4EBDA 4PRFA 4MIBA 4YFUA 4MK9A 1QUPA 4V19X 1IR0A 2GQ2A 3HPOA 4FF3A 3JTOA 1LWFA 5D3GA 5T7LB 2UVVA 1O51A 2HNYA 3THPA 2ASDA 1T94A 2DISA 2CPJA 1VRUB 3QO9B 1V6HA 4J5OA 1QAYA 3R27A 5AE2A 2YKAA 5A6PA 4DL0C 4J9OA 2PA8D 3IFEA 1HBNB 4RUCA 4M8LA 5DDPC 4YR0A 4RW7B 1VGYA 3ZZZA 4CQ1A 1S6PB 4DV7F 4Y0FA 4YB1P 4ICLA 2XY5A 5C25A 4O3NA 1RT5B 3IAM9 2DPJA 1UVLA 3FRYA 5E7OB 4EWTA 2OH2A 4OJ3A 2BM1A 3CIMA 2HLUA 3OTBA 2U1AA 2AW0A 2DNPA 1DBDA 3C8YA 4ZMMA 1YRUA 4DV6F 1Q4RA 2KU7A 4WE1B 4IG0A 2VG5A 2MJUA 1U7LA 3CMES 4LMZA 4MTPA 5D77A 1X4BA 3HZEA 1ZZNA 2GQQA 2LVWA 4LF5F 1L3VA 2DNZA 4HL9A 3CCRS 3KLIB 1HNVB 3BEGB 5F8JA 1UA1A 5IZHA 1Y9OA 4QPTA 1RP5A 1U4BA 2Z0GA 2UUCF 4Q8EA 3T5LA 2M52A 1CPZA 4XK8C 1RT4A 3HHDA 2ZJRQ 3NNCA 2M2BA 3RAMA 4D3GA 1U6BA 5FDLB 3AJ2A 1HD1A 3OR1A 4FYDA 3L09A 2MY8A 2M8HA 4XPEA 5A6WA 1VHFA 2RQCA 4LF6F 3LAKA 3CGIA 4AXIA 4J9LA 1UVNA 4Y2KA 2Q43A 2JDJA 1U8SA 5IM0A 4U6PA 4DG1B 1UVJA 3MECB 3ENWA 4NLVA 4Q2MA 2FJVA 3KTQA 2JFKA 3CCES 3MXHP 2R2RA 1FXRA 2XNRA 1KS2A 2X1BA 2VBZA 3NS5A 2IJFA 2ASLA 1U1MA 2BW2A 1OIAA 2FHOB 2SXLA 2ZD1B 4FZVA 4B9LA 1VQ5S 3CWJA 4Y00A 2V4JB 4M1KA 3G86A 1R0AA 3PXGa 1YIJS 3SCJE 3W7BA 5KFXA 2AJ0A 4EYIB 1SKRA 4K4SA 3NP5A 3MEGB 1U1PA 5EDWA 1SKWA 2GA7A 3M8SA 2RQ4A 1HR0F 4LFAF 2Y1IA 5LT5A 5D4PA 4IH7A 3GG0A 1SJRA 2YNGA 3ZZUA 5KFUA 3H98A 2MMYA 3I82A 4LVOP 4O4GB 4BWMA 2CKWA 3G6XA 3EGNA 1UWBB 5CQGA 1S4FA 1RI7A 1PGZA 3JSMA 3NMRA 4YDXA 2YWGA 1HQUA 2IC3A 1IM4A 5KT3A 1VQYA 4OI6A 5DG7A 3FDSA 3PJWA 2BA9A 2BZ2A 2BYCA 1S0NA 3G6ES 2DGSA 2E9ZA 3HJFA 1P27B 3NAIA 3NKYA 4IOCQ 1OO0B 3CCQS 2GNKA 4KSEB 1L3TA 4JI6F 3MR6A 1LWCA 3SMZA 3DOLA 1IBLF 1Y4ZB 3LGNA 3FEYB 4OZJA 3THVA 4YQWA 5F0UA 3N01A 2N3LA 1R8BA 4K4UA 2ZDPA 3H2VE 2KM8B 3LO3A 2JVOA 5DS7A 3AQPA 2CJQA 2CPHA 2ADCA 3P6YC 1RKIA 4RNFA 2CYYA 4CO0A 2HHXA 4NLXA 2QSWA 4K5RA 3FQLA 4KFBB 2KZZA 3QIPB 3I32A 4DWIA 4X2BA 2IVMA 4ZOSA 5KFKA 1D8ZA 3DLKB 4ECTA 3CC7S 3K7RA 2KO1A 3D0HE 4JV1A 5EWFA 3ULHA 1NJZA 1H2VZ 1X4HA 3BGFA 1XWLA 3N5FA 1EETA 2DVIA 2R8JA 2QLWA 2D7SA 4NYOA 3OR2B 2ZJPQ 1CC7A 1SBRA 3SSQA 4ECXA 1KN6A 4A4JA 3HP6A 4V19J 4FP9A 4IDKB 2NS1B 2F7VA 5DRKA 2DNHA 1TL1A 3VAJA 3IA0A 2LU2A 3M8QB 1N0UA 5KFJA 1U2FA 2B9WA 4ITSA 3LP1A 5DM7Q 2DNRA 3DLEB 1QM9A 3LW5C 3S7RA 5B0CA 1E6VB 5KFLA 4YMEA 4ZPBA 2YKOA 3N0VA 3M2VA 3J81Y 2RDIA 1ZOTA 2D41A 1HFEL 2V8VA 4X62F 4X4VA 1HYSB 4C3MA 2FGOA 2ZH2A 1XEZA 2FVQA 3K5OA 4O44B 2FJWA 4QW9A 4FBUA 1HNIB 3FMBA 1CQNA 2PN6A 2HVZA 1TZ0A 1FERA 1KR4A 5J1EB 1F0XA 3VAHA 1HA1A 1VFJA 3MPWA 4ZCMA 1WHYA 3O2IA 4XDDA 1LOUA 5J2PB 3TR5A 1FKPB 3LOUA 3S1TA 4TY8B 2DRBA 2HHHF 1MMDA 1UFWA 1XMQF 4ZPWR 1XMOF 5LMNF 4B02A 1N5YA 5L9NA 2V9WA 6FDRA 2FLPA 4WJBA 1J5EF 1X5PA 1W25A 4Q8FA 2XHWA 3MOJB 2HZCA 4L72B 3DRXA 2RNEA 3HX9A 2MKHA 4A8SA 5B0GA 1NKBA 1T03A 5F41A 2YTCA 1YJUA 2HAIA 3BGUA 3CSKA 3EX7B 2GMHA 5GAHU 5U47A 4NA1A 5DDRC 3PW7A 3LP0B 4ZVFA 2DR9A 3G8TA 3D2WA 3G4SS 1HI0P 1WF0A 5LJ3Y 4JI3F 4K4WA 1REVB 3MM8A 4WFBQ 1PC4A 2L08A 3IR6B 2MHNA 2AWZA 5KFBA 4OI4A 1MSWD 2NUHA 3RRKA 1S7HA 2OPPB 3OXGA 3TOQA 3V5RA 1J5OA 2DO4A 1WHWA 4DQRA 2VG6A 3MF5A 1Y5LB 2JEGA 3IGNA 1C1BB 2QMXA 5IQ6A 2PC6A 2RD5C 1SV5A 5K8PA 4P7VA 5KFWA 2C2EA 2F3JA 5KT2A 3P49B 3PO4A 4YEAA 2RVJA 5J2NB 5K14A 1GQEA 4LF4F 3DRPB 4JOUA 4RWWA 4WXWA 3OVSA 5HL7Q 1VOMA 4TY9A 5JJBA 4UUXA 4I2QA 2KI2A 2CPFA 4IQXA 2F8HA 4JI5F 2XMUA 5L1JA 1U1RA 1XNQF 3PV8A 2B51A 2XMWA 4LT6A 3L7OA 2GGPA 3FSIA 3SZ2A 2IAJB 2UUAF 2R7SA 3LP2B 4W92B 2GJ2A 1BQMB 4FXDA 1V3SA 4X66F 1S9EA 1KFSA 4U7CA 3Q2TC 3N6MA 1RTDB 2MHEA 4LQ9A 1U48A 4OX7A 1G7CB 5KG2A 5B0DA 2KN4A 1Y7PA 4USHA 4A8MP 4X84A 4PQUB 2CPEA 1W2IA 2FHJA 5H9EJ 1NRKA 1Q79A 4CT8A 2FJAB 2H9ZA 1VLYA 3ZZTA 2CQ4A 1FT8A 3K5LA 5KFMA 3CE8A 4ECWA 3CD7A 2BE2A 4UQTA 1RYRA 2RB7A 3FFIA 4NCGB 1S1XA 1WG5A 2M9KA 3W2WA 3OPKA 2O5DA 1RWUA 5F8NA 3BSOA 1UW4A 2M0GB 3MMJA 5DETA 1N36F 3KLEB 5LJ5Y 3K59A 4BHQA 4F26A 2ZH4A 4DV2F 4XO0A 2OTLS 4B9UA 4RUHA 4M5DB 2Q1LA 3N6LA 3OJUA 1YRXA 3HVTB 1TFYA 2KRRA 1LWEA 3MR3A 3RW6A 2G4BA 2E29A 1FO1A 2HRYA 2Y1RI 1JK9B 2ILZA 2RUGA 3M6WA 4MFBB 4A8QA 4EBCA 2E66A 3DLHA 2FUG9 3MM9A 4KT0C 2ZH7A 4DSLA 1SIWB 2DNYA 2RSQA 3CCWA 5HLFA 1Q8IA 2ZM6F 1DTQB 4ILRA 4YY3F 3VAFA 3QGIA 2A10A 1NAQA 1FTCA 3THTA 1JLGB 2J7WA 3H25A 5CYMB 3M8RA 1NJIT 4DSFA 7FDRA 4A46A 3KK2B 2IYGA 3FMWA 5K9FA 4WKYA 2MZQA 4N8OA 4DR6F 3GFXA 3MTJA 5L39A 1JKHB 1ZBTA 1JWWA 1JLBB 3NL0A 1N32F 3QPIA 2B43A 4DFKA 2AJ1A 3OL8A 1C0UB 2P9CA 3TA1A 1P9QC 3TX8A 3S8SA 5IT4A 1CVJA 3FRZA 3H5SA 4IH5A 4DV1F 4IOBA 1RTJA 1ZTWA 1S77D 2RKIA 4NLUA 5A0YB 1K0TA 2C28A 3FJ2A 4DFMA 1TVRA 2YKPA 2P5VA 5KFPA 1HPZB 2JEFA 1FJCA 4KC5A 4CTAA 4P2SA 3CO9A 3IGVA 4DSEA 3TVZA 4ZP8A 3PEHA 3UDLA 2KB2A 4AL5A 2LA6A 3DRSB 5J2QB 2FHKA 1RA6A 3I56S 3SXLA 5E33A 4ECVA 2FLNA 3HKZD 4FS2A 5E3AA 4EUVA 1QUVA 1Q8BA 3PW4A 4Q0BA 5B0AA 1H6KX 3QAEA 3M8PA 2WAQD 3ZZYA 1ZYQA 4PUOB 3TRGA 1MU2A 1NO8A 3EXCX 4O3SA 5DQIA 3VQTA 2BQ3A 1S0MA 1JX4A 3NS6A 3BF4A 2R7XA 1IKYA 4C3LA 2UP1A 5C42B 1RT6B 3VZHA 1L3KA 3EXYA 3SDEB 2D74B 4DR7F 2BRKA 1BLUA 1X0PA 2W9CB 3NMAA 2CQCA 3CCLS 3QZ7A 3KFWX 3FZ2A 2ERRA 5DDQC 2CJKA 3OUYB 4RW4B 5I3UA 2PO4A 2W8LA 4IFVA 2OD4A 5EX3A 1B7FA 4ECSA 4F25A 4QWDA 3RB0A 3HVRA 6FD1A 1T3OA 4ERDA 2BOPA 1B64A 1VQKS 2DGXA 2ZOFA 1FK9B 4B3RF 3JTPA 4DV5F 2K3IA 3UFCX 2PIIA 4F4ZA 4C3KA 1BY9A 1WWHA 4NRTA 3I0RB 1G6BA 2VA2A 4G1IA 4NLYA 3VZIA 3U1NA 4A8KA 1S9GB 4DQQA 2MKCA 1IXKA 2WB1D 3I87A 2UV8G 1VIXA 4RKUC 2CJAA 4I0WA 2HFOA 4NWBA 2M8DB 4FNIA 5GADI 2ZJQQ 3BJYA 1VBYA 1YVFA 2X51A 2H5EA 2QE5A 2EI5A 1XR7A 2U2FA 2NUUG 2XMJA 1C2PA 2DNMA 5KFSA