3CJKA

Crystal structure of the adduct hah1-cd(ii)-mnk1.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
68
structure length
68
Chain Sequence
PKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper transport protein ATOX1
publication title Copper(I)-mediated protein-protein interactions result from suboptimal interaction surfaces.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport/hydrolase
total genus 18
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cjkA00
1U7LA 1P8GA 1LQ9A 4FNHA 4OJ1A 5A6PA 1N5TA 2ACYA 4YEAA 2KYZA 2GA7A 2LDIA 1YRXA 1OPZA 5KAKA 2FB0A 2JDJA 4Q2LA 2LQBA 2W4PA 3KKFA 5T7LB 3HX9A 4Y2MA 1KVJA 4A46A 2K1RA 2W4CA 2W4DA 4HL9A 2BBEA 5A6WA 2HQIA 2KT3A 4NPOA 2QIFA 2XMUA 3VTIA 3KG0A 2ASYA 2GO8A 2HIQA 2HLTA 1TZ0A 3BR8A 2G9OA 2LXFA 2PD1A 4ZOSA 2RU9A 1X0PA 1WD6A 2GFFA 2OAUA 4A4JA 5B09A 2ROGA 1VQYA 1Y0HA 4QOTA 1TR0A 1FVSA 3FRYA 1FD8A 3HHLB 3CJKB 3LGNA 1YJTA 5B0DA 1CPZA 3BM7A 1W2IA 2QLWA 3TOQA 1S6OA 2FHMA 4A47A 3IWLA 1TUVA 2N7YA 1URRA 2ZDPA 3I9ZA 3QGPA 2XMWA 3HDSA 2VH7A 2HFOA 2N4CA 1IUJA 3LGMA 1Q8BA 3QMQA 1AW0A 3BN7A 1MWYA 3F44A 2GGPB 5IXUA 2GV1A 3HFKA 1P6TA 5F0UA 2HFNA 1CC8A 1GXTA 4HH0A 1YJUA 5T7LA 1KVIA 1VQSA 3HF5A 4FNIA 3MCSA 2GCFA 2AJ0A 4HI2A 4EFAC 3K7RA 5F0WA 3HHLD 1GXUA 3UDCA 1YJVA 2FTRA 2RMLA 4OJ3A 1XBWA 5B08A 4Y2KA 2K1RB 2ROPA 1Q4RA 2VV5A 1OSDA 2BJDA 1OQ6A 1ULRA 4DN9A 2XMKA 3KNGA 1FEEA 1AFJA 1APSA 1Y9OA 3CJKA 3TRGA 5B0GA 2K2PA 2L3MA 2XMTA 2K7JA 2RSQA 3IWXA 5K9FA 1SI9A 2EW9A 4DPOA 2N4DA 3HHLC 1Q53A 2K7KA 2AP6A 1YG0A 1S6UA 2BUNA 3DCAA 3KG1A 4HI1A 1N5VA 4Y2IA 2OFHX 1Y3KA 1KQKA 1V3ZA 2OMOA 4YDXA 4NL5A 2GGPA 2OD6A 3GZ7A 1Q8LA 3BF4A 3DXSX 1FVQA 1JK9B 3TNVA 1SB6A 4OIXA 2QLXA 4U9RA 5B0EA 2BYCA 4A48A 2RILA 1OQ3A 2KKHA 3BDEA 2BJEA 1TL4A 2PGCA 4ZA1A 3T9NA 1FESA 1YJRA 2XMMA 3BGUA 2KT2A 1N5SA 2IYIA 2XMVA 1SQEA 2IFXA 2XMJA 2ZDOA 2OFGX 3HHLA 1MWZA 1QUPA 3WDOA 2AW0A 1FE0A 2OD4A 2LQ9A 1AFIA 1JWWA 2Q3PA 3FMBA 2OP5A 3E8OA 1Y3JA 2AJ1A 2QYCA 5B0CA 3LO3A 2ROEA 2CRLA 3BB5A 4Q2MA 5B0BA 1K0VA 2FIUA 3FGVA 4F67A 1R6YA 1X7VA 5B0AA 2HLUA 4OJHA 1N5QA 1FE4A 1X8DA 4OJGA 3MZIA 2IYGA 4HH1A 1RJJA 5B0FA 4DL0C 1CC7A 2OKQA 1TL5A
chains in the Genus database with same CATH superfamily
4WCEQ 1FFWB 5A6PA 3Q8VA 4OQJA 2CQ0A 2V68A 4RNOA 1B99A 3Q2TC 3DFEA 1HQEB 1TZ0A 4EZ9A 4R5PB 3FZBA 2R2RA 1FKPA 5ETRA 3G9CA 1KEKA 1Y10A 4XTTA 2DH8A 4YR2A 2ZDPA 2R8GA 4B3RF 1JLCA 1HQ2A 2LYVA 2CJ9A 3M1VA 4IO9Q 2H5IB 4NXMJ 4NI2B 3DI6B 2CG4A 4LF4F 4DN9A 4USTA 2JL9A 3TX8A 3OHBA 3H2VE 2GC8A 4H4OA 3V6KA 5ITHA 3L4BC 3K2YA 2J0SD 5D6GA 3I82A 4OIXA 2BJEA 2KYXA 4RW4A 3SIPB 2ZD1B 2CAJA 2MY7A 2FLOA 4PG6A 4KH1B 2E44A 1CSJA 3T19A 2MLZA 5KG4A 2ZBCA 4OMFG 1T03B 4C3KA 3FEYB 4WIQA 3MPVA 5KFSA 3K58A 2Z2MA 1RKJA 5GAGI 2QSWA 1NKEA 2W9BB 2ACYA 4HHUA 2VOOA 3RAQA 5KFLA 1RWMB 2ZH5A 1M5VC 2ZBIA 5K20B 3GE9A 4KQZA 1YJTA 3M9OB 3GG0A 3NP5A 4WXWA 5KFYA 2XTJP 3P3DA 2D1CA 1LEOA 3POTB 3MOJB 5HROA 3W60A 2DCUB 5T7LA 1C1BA 4QPXA 3HF5A 1UVNA 2AJ2A 4IFYB 5CD4H 1S4FA 1HQUB 3AOCA 3C46A 3O6QA 4ECTA 2AP6A 2DY9A 1PBAA 2ZM6J 4C7QA 3ILOA 1DTQA 3PYEA 4J9MA 5A0YB 4R5PA 2A1BA 2VONA 2H54B 1WSRA 5IT9U 3DOKB 1N5YB 1GTHA 4NYZA 4WP3A 2N3OA 2RRAA 4Q44A 1SKRA 2GJFA 2FQQB 4NXNJ 3CJ4A 4IRKA 5E5NA 4ECQA 1R6YA 1X7VA 2LU1A 2MQNA 5LXYA 4I56A 3IBFB 3LANA 4NI2A 1QTMA 1LW0B 3QPIA 4WKYA 2DKOB 1ITPA 2VFSA 1BQNB 3TANA 2CUYA 3OVBA 2J9DE 5E3PA 3R5CA 2A2DA 3PW4A 3BBCA 2DRBA 3AD8C 2EFQA 1FRMA 2XY5A 2RS2A 2HS3A 2ZD1A 4FNIA 1Q86T 2LQJA 3CDAA 2C2DA 2GO9A 4DWIA 1B7YB 3M30B 1Q5VA 3N9UC 4GKJF 2W9BA 3GTYX 2E9RX 3DCAA 5KT6A 3RG6A 5CH7B 1WOOA 1QAXA 4CO3A 3HZEA 3H25A 2XNQA 2F8EX 1NSPA 5HVGA 2ZUGA 2OD4A 3MI7X 1LXJA 2LVWA 3IN5A 5HL7Q 2IA0A 2NXJA 3LWLA 3J81Y 1OS5A 5F9LA 3BSAA 1RTHB 2AV5A 4IFYA 4P74A 2ZH1A 1HQUA 2ASYA 2HIQA 2JEJA 2D3UA 2BEFA 1UFLA 2J7UA 4AE5A 2CJXB 3FUYA 5KFZA 3UE2A 4ZVOB 3OD2A 2VL1A 3E2EA 1VBZA 2JRSA 5A0YA 3QAEA 3EYZA 3QJPA 4FYWB 3NOGA 2HNYB 4NRUA 3JQKA 2V2VA 1N5YA 3TQEA 1R0AB 4L74A 4F4WA 1D9AA 1WHVA 4PG8A 5HQMA 4ZVSB 3KLIA 5B0GA 1Q53A 3K8WA 5I4MA 3IGNA 3FNNA 2QZ8A 2X1GA 1LW0A 2RJZA 4OZ0A 3S6EA 2EG1A 1BQNA 2E7WA 2DCLA 3CC7S 1FEHA 1RAOA 5CZXA 5HVHA 1ROFA 1H3DA 4NA3A 1RXOB 2HHXA 2R3VA 1YITS 2HWTA 4RUAA 3GR1A 3M30A 2DGOA 2AJ4A 4UUXA 2MQ8A 5L1LA 1GMWA 1HR0J 3D6MB 4OYAA 1S10A 4DG1B 4K5SA 1WACA 1NCLA 3HT3A 4XPCA 3HVTA 4V19J 2LEBA 1WNEA 5K14B 3VVUA 3HHKA 1SC6A 2PI4A 3MPUB 2B4UA 3Q0AA 1MW7A 4R0JA 1XC9A 1O5JA 3CCZA 2OPSB 1RT1B 2GVDB 3HKWA 1ZM4A 3LA0A 1KQFB 5D0HA 3JSYA 4ILRA 2VF3A 1F60B 3GYGA 4OHZA 3QZ7A 2K3IA 3MR2A 1X4EA 3NGRA 3RB4A 3HD2A 3AJ2A 1DAXA 3OHAA 4DSIA 5CZVA 2DGTA 3J81j 1C4CA 4QU7A 1AUSL 2B43A 3N5FA 5LSRA 4OZJA 4WYLA 3HD1A 3FSXA 5HMYA 1IKXA 2LA6A 2HNYA 1CC7A 1DFDA 1R0AA 4HACB 2RIJA 3EGZA 2HHUA 3G2XA 4YQWA 5ETQA 4KBIA 2DNHA 1U1KA 4QW9A 3I9V9 1L3KA 3Q89A 3MUTP 2O66A 1W2BR 1NK6A 3KDNA 3MHYA 1F9EB 4MKYA 3A3PB 3PRBA 4PR6A 4NA1A 1XR5A 4C9DA 2XMTA 4RWXA 2BUNA 2QGFB 4I0WA 3V2UC 4K4ZA 2CPXA 5A8KA 3OR1B 5HLFB 1PG5B 1WUUA 4B3OB 4DG1A 1M5HA 4I4BA 1BXNA 5KFFA 2YX4A 1Z2ZA 2QT7A 3UN3A 1R8PA 5K14A 2XGPA 3DLLQ 3D1QA 3R6GB 2G0CA 4DF8A 5KT4A 2OPSA 1RT1A 4L3NA 2WBRA 3HM9A 4EI2A 1IR2A 2GVDA 2YKQA 4FP9A 2LXFA 3V4IB 4O0NA 1K1QA 1ZM9A 3NGSA 4HT5A 2U1AA 1ZTTA 1SKUB 2DRAA 4QIFA 1RISA 1XNRF 2HFNA 3BGRB 1U2RA 5J2QB 4G65A 5J1EB 2HKEA 4I7FB 4FKYA 4DFKA 1X5OA 4DUZF 3G82B 2G1HA 2HHVA 2K3KA 1KDNA 1QY7A 3JSRA 2HEKA 2K8GA 3D5MA 4TNOA 4HACA 1P9YA 1LWCB 4URSA 2J0WA 2HVHA 2X3GA 3EDRB 4C3MA 1PJ7A 2PGCA 4D3HA 1H6KX 4NE9C 2IBKA 4YY3J 2QJ3A 3OTDA 3OUYB 4YMEA 1U24A 2IC3B 3BKTA 3CCMS 3BSNA 4J91A 3BEGB 3H5YA 4BC9A 3HX9A 2MEWA 3KG0A 4YDDB 2YNHB 5KT2A 1FVSA 1UMJA 1FDNA 3BN7A 4J9VA 2C3PA 1RHUB 4AL7A 3OR1A 5HLFA 3HMJG 2KRBA 1QAIA 1ICEB 4B3OA 4MYUA 1CBKA 5G0RB 5ETOA 2HRUA 5HQLA 1RLCL 1YTYA 1FKAF 1OQ6A 1BGXT 2L3MA 1N34F 2EW9A 1UTAA 5D78A 2F9DA 4WFNQ 5KFIA 2JC0A 2FYXA 2DNQA 3W5ZA 2PIIA 4GKJJ 3V4IA 3IC1A 2HZVA 2IYIA 4DR1J 5KOXA 1VQMS 2FY8A 2BX6A 2PMWA 1I94F 1Y00A 4C8KA 2W7PA 4JB8B 2FLPA 2MZSA 3K59A 5J2QA 5J1EA 5DS7A 3G4SS 1DTTB 4ID8A 4I7FA 2BM0A 2CZVC 4NX9A 4OLPA 4GC7A 4RPFA 3A8KA 3D4JA 4LF9F 1RAHB 2C2RA 3G82A 1NK8A 2XM3A 1WD6A 1FT8A 5K8PA 1GX5A 4A47A 1LWCA 5KFEA 3OVSA 1Q8BA 3KJQB 2VG7B 4ELUA 1BWEA 1U1PA 1N0UA 1PC5A 4GMKA 1QAJA 1G1XA 3MEEB 2HZAA 4CLUA 1Q8IA 2KVQE 3CD0A 2EEYA 3T5JA 1ULRA 2W1BA 3OUYA 1GTEA 4NLWA 2IC3A 2BOAA 5DLFA 1I1GA 3H90A 3NGTA 2KZMA 2B8QA 2KVIA 1T9YA 5DG8A 4W90B 4DX7A 4U7CA 1FXLA 3PW0A 2DGSA 3AD7C 4LFAJ 1WG1A 3P8BB 3CCES 1D8YA 1AFIA 5FD1A 1Q16B 4CM2A 4LBHA 2FIUA 2GHWA 2A0FB 3M2VB 1JXVA 3GSDA 1S6PB 3TARA 5G0RA 2RT3A 4DJBA 3PW5A 4YB1P 5D15A 4AQYF 2ASJA 5E33A 2Y1JA 4E98A 3AA8A 4C8NA 3ZZOA 1B0TA 2PFFB 3TOQA 3W9HA 1VQ7S 4ZCMA 4BDPA 1ELOA 2GGPB 2DHHA 1RT3B 4DL2A 2ZNYA 2HBYB 2PE8A 3GJTB 4X4RA 3I96A 2W7OA 3MFIA 1GFWB 2RMLA 4NLDA 4IFVA 5I42B 1YZ6A 3HXMA 1B3TA 4ALZA 2ZH8A 4XDDA 4LR7A 2D9PA 1DTTA 2BJ9A 4LR8A 2WW4A 1SJ1A 3QAUA 2MKCA 5ETMA 4HT7A 3TAPA 1VQKS 3FMBA 2HHHF 2DNLA 2VICA 1NSQA 4CLPA 1JXLA 2E29A 2VG7A 1KLMB 5J2MA 2IY5B 1U7LA 4NEYA 4P9SA 3MEEA 3MFHA 4OFZA 2XZWA 3OTOJ 5HJYA 5A6WA 3MM6B 1RBAA 4PXBA 2AX0A 2LFVA 1U4BA 1FDBA 4LIRA 1Y4ZB 3DC2A 2MKJA 1RTZA 1HBNB 1RK8A 4NA2A 2R7VA 1HL6A 1PYSB 3K8VA 4U6PA 1F6TA 2RHQB 3GIRA 2XGQA 1T7PA 1IM4A 3Q86A 3MM7B 1VBKA 3K5NA 4IG3B 4P71A 2PMZD 3M2VA 5GAHI 1S6PA 1EZZB 3PKYA 1H73A 4ZPAA 3A3OB 4J9SA 2Y1IA 1XERA 1TQLA 4OYBA 2DPJA 2NXUA 1UZDA 2CJBA 4DS4A 4LF7F 2BQRA 1KOOA 5H9EK 1S12A 2IJFA 4C6AA 5AE3A 5DGAA 3LAKA 3W9IA 2RQ4A 1F3FA 2RDDA 4ECZA 2NXNA 2QA4G 1RT3A 3IAS9 3GLJA 4CLLA 2D9OA 5E0OA 4ES2A 4OZ1A 2W4DA 4H4MB 5I42A 1L3SA 1O8BA 4B9NA 1U02A 1T11A 1ZS6A 3JTPA 2DR9A 1FRKA 2N7YA 3FBFA 2DNOA 2JOQA 4ED2A 5KFXA 2W9CB 4C8OA 4DL7A 3V5RA 1N52B 1RWPB 2ZWOA 4P72A 3P6YC 5ETKA 4Q8FA 5F0WA 3GFHA 4DV6F 4OI3A 3H40A 4A8SA 2G13A 2VA2A 1KLMA 4X2BA 3NMRA 1S6UA 1F0XA 1V3ZA 2HFSA 1NDLA 1UEKA 4LIWA 3MM6A 2POKA 1S1WB 1K47A 1IBMJ 2ADBA 3A3NB 3CT9A 1NK7A 1QUPA 5IQ6A 2AGQA 3KLFB 2MQMA 1FRHA 3TA2A 4EK2A 1U25A 4PXCA 1HBNA 5JXSA 1RTJB 4A8XA 4HH1A 2AJQA 5D4LA 3TAQA 1ZOTA 4EU0A 1NDPA 1RAJA 3MM7A 2B5JB 1NEEA 4AUKA 4HHJA 4EWTA 4IG3A 2UUCJ 4RUBA 1LNQA 3BR9A 1BD6A 2RD5C 5L1JA 3T1YF 2ZC3A 2MHNA 3QMQA 1IWAA 4K8RA 1T8EA 5LM7E 4J9PA 1FWKA 1J5OB 3H98A 3O44A 1R0CB 2GAGC 4KSEB 3BO2A 3N01A 2GIFA 2W2OP 1NB7A 1FCAA 1A7GE 3DLEB 3V6DB 2HK3A 3ZFVA 2YXLA 1HWJA 2XMKA 4USVA 1A6LA 1F5BA 2CQBA 4CM0A 2F8HA 3HHLC 2MY8A 4DU8A 1WDDA 3RR7A 2J6SA 2P9EA 4H4MA 4OYWA 2GAHC 2GHPA 4LF6F 2QLBB 4ZCKA 2H1YA 1EHWA 5L1IA 4C11A 4ED1A 3D1OA 4RNMA 3H2UB 3ZZPA 2W9CA 1VLOA 5J1PA 2J9EA 4L3KA 1V6HA 1AUDA 1U1OA 4LSNA 1FRLA 4V1Ak 5KOWA 2G9OA 2LEPA 2A6MA 3G8QA 2ZE2B 3GU0A 1JLQB 4FKXA 3V81B 3RBXA 3DM2A 1S1WA 1WC0A 1M1HA 2LCWA 4URGA 2OPPB 1NSAA 5CYMB 2WTFA 1AT1B 4PAAA 4O3SA 2BW2A 1GX6A 4ZLJA 1RTJA 2XULA 2EC0A 2C2MB 2VPXB 3F56A 4Y00A 2FY1A 2JSXA 3NS7B 2OJ3A 3RW7A 4TN2A 2C1EB 5AXMA 5DDQC 1W25A 3PFOA 4P7VA 3CCLS 2OH2A 3K17A 4ZVGA 1RI7A 2VG5B 1OY9A 3DLEA 3V6DA 4DL3A 2P9GA 3PM9A 2V2KA 1CPZA 2N3LA 2EXUA 1WG5A 3IRXB 4QYZK 3EUNA 1SXLA 3TJ8A 1ZYQA 3DRRA 3QT5A 4OV6A 3TUPA 3M6XA 2G2OA 4HDGA 1KS2A 4QBUA 2R8KA 4ZCLA 4KRWA 4LF5F 3L3CA 3BYRA 3MGJA 1IR0A 2QRRA 1FHTA 2BACA 4DS5A 1MWQA 4FF1A 1UEVA 3HFVA 3KJVA 1RZMA 4I6YA 3DGPB 3GMGA 1RWXB 3GB0A 3GJRB 3CDEA 1FVQA 1TELA 3OXLA 2ZE2A 3M6VA 1GQEA 1JLQA 3CEDA 1X4DA 5A2QU 4ER8A 3V81A 2CRLA 1R31A 1X4HA 3UFCX 2HQ3A 1XIQA 2OPPA 2ZZNA 1KLNA 4DCPB 3NXZA 4DV4J 3PKMA 3A12A 4Z7CA 1EP4B 2CA9A 4LREA 3MCOA 3LGNA 3H5SA 3QGHA 2UUTA 3L9ZA 2BJ3A 2FHKA 1X4FA 3H7HB 4J5OA 2XSJB 4J9UE 4F7VA 2VQEJ 1SJQA 2AJ0A 4EFAC 3QFWA 2R4FA 4ZITA 2HFVA 3HVRA 3N5BA 2WSFC 2CNOB 3P45B 4ZVFA 4EUVA 4K0KJ 4H4KC 2VG5A 4ZPVR 5DG9A 2XG8A 4U8YA 2Q66A 2VFUA 1HNZF 1I5OB 4N7TA 4GKKJ 4DV0J 4ZVUB 4X4SA 4RO0A 3CCTA 1ZM2A 1WKLA 3H4BA 4Y65A 2VBYA 2CQGA 2EG2A 2J8AA 5B0FA 2AGPA 2E5GA 4G1QB 2ZOGA 4U7UD 2I1RA 1I3OB 4NASA 3IGVA 2W4CA 2EFVA 1H2VZ 3HVWA 2DXFA 2P5VA 3DLGA 5FLXY 4ZVQB 3SCLE 3DGPA 4ECVA 4ES3A 2YNIB 4RL1A 1HNXF 1HBUB 2Z2ZA 5EN1A 4KHRA 1Y5NB 5BYRA 5DZ7A 3OW2R 1N36F 1RU2A 1VIOA 2V4RA 2NPIA 4HR2A 1SH3A 2O1PA 3GYXB 2LECA 4KB7A 2G0IA 2O5DA 2EBGA 3RBZA 2JH3A 4K2JA 3SBMA 1D9DA 1SL1A 1EP4A 4ED0A 2IA6A 1U6ZA 1I6JA 3DGVA 3W2VB 3R5DA 1S59A 3C3LA 1TK8A 2AYGA 4RBTA 1IJEB 1ZETA 4XO0A 3RRHA 4LF8J 1QM9A 1TK5A 2XWYA 1PIEA 1JB0C 5IQQA 2XSJA 3M8SA 2CQ1A 2VD3A 2HYIB 2JNJA 5EWFA 3IR6B 5H9FK 3W2WB 2MKYA 2IBOA 2GMJA 3WZ0A 1SH0A 2XLKA 1T9VA 2HRTA 1YJNS 3CJ8A 1HMVB 1FWLA 4RR5A 2BDPA 3LWMA 4EO8A 4LRCA 5GAEU 2Y1RI 4TYAA 1TKDA 5DM7Q 2GNKA 2YKMB 3MR6A 1YHQS 1RT7B 1NO8A 1M5KC 2KFYA 2CQ2A 2W24A 1QJHA 3NGUA 3VZIA 2QL5B 5GMDA 4C48A 3SYZA 2FZCB 2IMWP 4RWWA 1UA0A 3A13A 9RUBA 2UVRA 2XS2A 4IO1A 1Z2LA 2YNIA 1Z4UA 1JJ4A 2IM2A 1K9MT 4LF6J 1HBUA 2AYBA 3MD3A 3HLUA 4OJHA 1S4EA 3JS9A 2KXHA 3GFXA 5HI7A 3JXOA 2KXNB 1SL2A 2CWKA 1PSDA 2VDHA 3BGLA 1HNVB 1TL1B 5E3CA 5CAAA 3HHLB 4PEOA 1TKZA 2ZHAA 2OO4A 2L48A 2BR0A 3I6PA 3QWPA 3AHPA 2FHJA 2DVIA 3W2VA 3SQGA 5KG7A 2M7SA 4MK7A 4DR6F 1YJWS 3T1HF 3CIZA 2QL7B 2E5LF 3TX0A 4OX7A 4ZVTB 2LP4A 2UXCJ 4DDFA 3MEGB 4MFBA 4YDXA 4O3NA 2AKWB 3D0IE 1Q8LA 4K4XA 4WK3A 1PYTA 4Q43A 2W2NP 4KHPJ 2OMLA 2AJFE 4JI4F 2UVVA 2WCXA 1WELA 2V8PA 1HMVA 5JVGQ 3RAMA 1Q7YT 4ELVA 1HPZB 2ZH7A 3NAIA 3THTA 2IM1A 2YKMA 2U2FA 3R6LB 2HW3A 1NB2A 1RT7A 1V9OA 1VQNS 1KC8T 3RZAA 3Q2SC 1XTZA 1DARA 1UP1A 2R7UA 3PEHA 1TK0A 2WVDA 4X65J 3CUNA 5ADZA 2AEMA 2F3JA 1DLOB 4FXDA 2C22A 4NEZA 2GZOA 1FJCA 2PA3A 4M5MA 3JAMU 3D6FB 2NS1B 3O5TB 2MGZB 3N0VA 2X1BA 3TJ9A 1CG2A 3S7RA 4LF5J 2OSQA 4RW7A 3SFUA 5KFRA 4RU2A 4P7TA 3T9ZA 4LRFA 3Q8YA 3TA0A 1HNVA 2FC8A 1TL1A 2R9LA 2ZC4A 3HHLA 3TZWA 1WKJA 3GIJA 3J7AN 3CIMA 2LA4A 1ZH5A 3BPSP 4OI4A 2HURA 3V4MA 3B8HA 3QRPA 3NGDA 2MKIA 3GIIA 4HYKA 3W65A 1V5VA 5IV3A 2XQCA 1AA1B 1NHUA 1D8ZA 3C19A 3M2RB 2QLWA 2QEXS 3MEGA 1S49A 4RBUA 2Z58B 5LMNJ 2KHDA 3CC4S 1FD2A 4IKAA 3CCWA 1UKUA 2CPHA 3HT0A 2J9CA 1N54B 4DR2J 1HPZA 4DR5F 4DFMA 1J5EJ 4AXIA 2X1AA 1B4SA 1BY9A 1PAEX 5CYJA 1QSYA 3CSKA 4WK1A 3CGIA 2WONA 2YKNB 4GO7X 3GILA 4G1IA 3UW1A 1AB8A 1JKHB 1HNZJ 4F0KA 2NPFA 3AOBA 4M5DA 2W8LA 1Q7LB 3P96A 3MZIA 1DLOA 3UQSA 1RYRA 2V0NA 3Q83A 1FO1A 4DSEA 1MROB 1S76D 4OX6A 1VRUB 5C25B 2IJRA 4USUA 2AYMA 4CLWA 5B0DA 3MURP 2FC9A 3DRPA 3J80U 3QGIA 2KFZA 4CLFA 2AEFA 4ICLB 3I5BA 3CDWA 4Q8EA 4N8NA 1X4CA 1FDAA 2HFZA 3C16B 1KNZA 4DV5F 3D54A 5KFAA 2R42A 4YHHF 4IOBA 2D3ZA 1RT6A 3R8YA 1U8SA 1HNXJ 1IWGA 1U09A 4ZIWA 4NLUA 2R7XA 3M8QB 4DV2J 1S72S 4RNFA 4ECRA 1B0VA 4O3RA 2I8EA 4ZIVA 1IKWA 2CJAA 1RABB 3IP0A 3M2RA 3OFEA 2GQ2A 1EETB 3E8OA 3PCOB 5IC4B 3PX0A 1VHFA 4ED7A 2IYGA 3HSJA 3BO4A 4QIEA 3MAHA 4DSKA 3BZQA 1U26A 2HQDA 2D3O1 2ZBQA 2F63A 2VFVA 3ETOA 3VGTA 1WOPA 2UXDJ 2JJ4D 2RE1A 4G1PA 1RYSA 3PG9A 2KRRA 4E8UA 1TKXB 1TV6B 5C5JA 3NS5A 2YKNA 4NLRA 4ECYA 4IG0B 1VYAA 1RAGB 3V6HA 2R8JA 1URNA 1FEEA 2GX8A 3OTBA 1SJRA 1VIXA 5CD4A 3KG1A 5LXRA 3GONA 2UP1A 2GS8A 4CH0S 1TL4A 1CJVB 1VRUA 4H4KA 3EZ5A 2DHXA 3ZZTA 4YS2A 4M5GA 3LO3A 3ISZA 1RUSA 4JI8F 2CG8A 3B4DA 1D09B 3C16A 4DZDA 2ZOMA 4UQTA 1LK7A 4LUBA 1HI1A 3JTNA 3TVYA 4I69A 3M8QA 3FRYA 3VZHA 1BQMB 3OFFA 4ITSA 2H5EA 3BBBA 2ZM6F 5KFHA 3EVWA 1YIJS 3CJSA 4MMOA 2FGCA 1V5IB 3HFKA 2KM8C 3EICA 4F2RA 1EQMA 1L3TA 3EE3A 1EETA 5KT7A 5B08A 3OT9A 4NXNF 2ROPA 4LVNP 3CF5Q 2QA1A 4B08A 4DEZA 2QL9B 4UQGA 4NLGA 5M2PA 2EPIA 4DR6J 2YX7A 2DD8S 1IM6A 1F9FA 1UWAA 4UT4A 1N8RT 1OSCA 5EUHA 2J7KA 3PO4A 4OI6A 1S6QB 1NDCA 4LFCJ 1HI8A 3RGIA 2HSEB 1S48A 5LSOA 4OJGA 1TV6A 2V4QA 1EKSA 2I38A 1VS3A 2X3DA 3HHEA 4U96A 1RHQB 4IG0A 1OPZA 3MM8B 1G7CB 3TYTA 4PWUA 2HLTA 1UJ6A 3VHQA 3R1HA 2B56A 4EEYA 4BWJA 3WIVA 3LALA 4NOHA 1YJ7A 1YI2S 3B54A 3P4UB 4U8VA 2B7BB 1C1CB 1J2VA 2HWHA 1PYOB 1CJVA 1N6QA 5IS2A 2UUBJ 2JLGA 3AH6A 3CVKA 2ZKUA 5A8RB 1EKRA 2XZDB 5E3QA 2C3OA 3VCDA 2D41A 1NBEB 2P6TA 1NK0A 2QMXA 4K4YA 4LRAA 1K73T 4OYMA 2V5HG 3L7PA 4IQMA 1VK3A 1RACB 2FVRA 2MB0B 3K5LA 4KGXB 2MSTA 3M8YA 1BQMA 3SV3A 3QGGA 3W1YC 3BQ2A 2B9XA 3BGOP 3M9MB 4KGMA 2KB2A 2ILYA 2M5YA 1BLUA 4N8OA 4OYZA 1S0VA 3LP2B 3QLHB 3BQ0A 3FKBA 4NLXA 3KG4A 5GADU 2CVEA 2XMUA 1Y11A 2V8VA 2AD9A 2V63A 2NREA 1R6VA 2B0GA 1R8BA 3O2IA 3O1LA 4AD6A 1YDLA 3LAMA 4CWBA 1VQSA 1RTDB 4K4VA 1S6QA 5GAHU 2DIVA 2BQ3A 3HP6A 1KQGB 5DRKA 3MM8A 3CWJA 2KG1A 4A48A 3KFWX 4PQUB 4B3SJ 1AZSB 3FQKA 2IDLA 2B51A 1PO6A 3QSIA 1HI0P 1C1CA 4Q2MA 2RNEA 1SC1B 2OUGA 1RP5A 2UUAF 1XK8A 1HBMB 2YX1A 3NY0A 3GJQB 1R27B 3MMBB 5U47A 2HGMA 4NPOA 5A8RA 3QWUA 4OI1A 4N76A 1LFWA 4NWBA 2MSSA 4QOTA 4JI1F 1TR0A 1S1VB 1ZAWA 5T41A 3SQOP 5EHHA 2WVCA 3IM9A 4ZVRB 2Z8QA 3WBZA 1XNQJ 2F4FA 5IM0B 2VA3A 2NXEA 4O3QA 4JI2J 5BXIA 2HNZB 3BDPA 3OXGA 2HMIB 2MZTA 1RWNB 5HMZA 4NYPA 2JLFA 3DDKA 1IKYB 2YPZA 2OFHX 4ZVPB 3LP2A 4PUOB 5C42B 1NNDA 4ID5A 4IOCQ 2MJUA 1VC5A 3SFGA 1RHKB 2MTLA 2XBPA 2ERRA 3TZXA 3SSSA 1RBLA 1K0VA 1RAFB 2GJIA 2Z4PA 1RTDA 3CJQA 4N56A 1YGYA 4P73A 3NWRA 1T3NA 5F9NA 1XJWB 3J81U 1RE1B 1HW8A 1X0PA 1REGX 1KOHA 2CQDA 1FD8A 2KU7A 1B64A 4JOUA 4NLOA 2R7WA 4IRCA 4U7UK 2YWFA 3THVA 4PQUA 1OIAA 4CO4A 1NLKL 1R0BG 1AXQA 3T3FA 2LU2A 3A1YG 5A76A 3IWNC 2F7VA 4YFUA 5KFJA 2BJ1A 1T9XA 2C2KB 1YBAA 3K5MA 3CCJS 3TR5A 4N47A 4CLKA 3IAM9 4N41A 3GQCA 1HBMA 4LMZA 3CJ2A 3LF0A 2OD6A 4CH7A 2MQLA 2KT5A 3RB0A 3HK2A 5LMUJ 3MMBA 4O3OA 3EPGA 3OPKA 1TL3A 2D3OR 2EFGA 2VQFJ 4OZLA 3H0PA 5AJ3F 1ACMB 3Q8UA 5L38A 5ETSA 1T9UA 4WBFA 1HHTP 4PPZA 1RDRA 4ZKAA 2R2SA 2PMHA 3UD3P 2YVSA 2IM0A 4ETXA 4LT6A 1C0TB 1YX2A 5IM0A 3C14A 4KGVB 4DSFA 4JI8J 4M5JA 2HNZA 4DHVA 3UNGC 4CO0A 2RU9A 2PFDA 2RRBA 3I87A 4WU2A 2NSCA 1IKYA 3G8TA 4A8FA 2QFJA 1TUVA 3TQ1A 3VQSA 3TP2A 4QZVB 2OI2A 3IBCB 4J9QA 2BKOA 5IC6B 2NXCA 3BREA 4YY3F 3FRZA 2WK4A 2O01C 3QRQA 1HQEA 4DPXA 4M5NA 2DHGA 3D0GE 1RADB 4NCGB 1WI6A 4CO2A 2R7RA 2F40A 4O3PA 3JB9k 5I3PA 1S0OA 1U2CA 3C6UB 1Z1ZA 4ZS6A 2XMJA 2ALZA 3DI6A 3ZNJ1 4TXSA 3PXGa 3OLAA 1HWUA 2H65B 2IVFB 2KM8B 2OKQA 3RTVA 1NHKL 4OI0A 2GA7A 2EK6A 1OO0B 2JFDA 1NJZA 1N32F 5GVQA 1XMBA 2DXDA 3X3UA 4FS1A 1IBCB 2BANB 4X62J 4KKOB 1O6XA 2X1FA 1KWMA 4WE1B 2JEGA 1S9GB 1T03A 5GAEI 3MUMP 4DR3J 2DR5A 2IRYA 2Q43A 3BS9A 2Q1LA 3KOAA 1DZ5A 2C3UA 2F1FA 1ZA1B 1N33J 3NWGA 4FF3A 4PYDA 4DR1F 3HHNB 3VV2B 2J9DA 5DQGA 1IQZA 1S9FA 4Y2KA 5ETTA 1BE4A 5KT3A 1U47A 1NKBA 1C0TA 2G2YA 2OMOA 2CKWA 5F3TA 3CJ5A 3POTA 1SC3B 2MKKA 2QA4S 4BBYA 3BBFA 4AL5A 1WHYA 2ZH4A 4PG5A 1NH8A 3PW2A 3PV8A 1JJ2R 1HD1A 1T94A 1UVMA 1K1SA 3CNQP 4A46A 1NUEA 4PPDA 1MMDA 3A4TA 3DOKA 2HBQB 3EPIA 5B09A 4IR1A 2VZ9A 4NCGA 2FVSA 4CZCA 3TZYA 2ZH2A 4CYUB 3PNIA 3IWLA 1GXLA 2CWXA 3ZZRA 2ZUAA 1CQMA 4EBCA 3DDIA 2L41A 3C6UA 2DNGA 4A8KA 4LFAF 3B4MA 5IV4A 2OEMA 1FJGF 5KFUA 2LEAA 3SDEB 4OZNA 5K8MA 4OX8A 1GH8A 2K2PA 2RSQA 1RB0A 2N4DA 3BQ1A 4C8ZA 2C42A 2ATLA 1SJ4P 3C6TB 2HFUA 3QT6A 3GFYA 5HMWA 2YH1A 4XIUA 3TNVA 4MJKA 1OQ3A 2BANA 4KKOA 4WJBA 4X66J 3BGUA 4L75A 4WE1A 5B0CA 2V94A 5K8NA 3OLBA 4QQBA 3VAFA 4F67A 1HKAA 2BE9B 5BJRA 3KLGB 2BOPA 5DLGA 1DQ8A 2I5JB 3D1HA 2LQBA 2RQMA 4QIVA 3K57A 2GO8A 5KFMA 2UUAJ 2X7IA 2OAUA 3H4DA 4USKA 3IS9B 5D3GB 2VKZG 5FDLB 2CNLB 2QX0A 2A6OA 2QN6B 3O8WA 1VQ4S 4WKRA 4FXVA 3QGPA 2WVFA 2IJNA 2OTJS 2W9AA 2ATCB 4LSZB 4JI1J 1RTHA 3KLEB 1FKOB 4X4OA 4CCHA 3DXBA 1S0MA 2BM1A 1QLNA 3NCRA 1PCAA 3L7UA 2FJEB 4DL4A 2GQQA 3OTOF 2A10A 4UOGA 4PWDB 3CDBA 4UTGA 2C2NA 4NMXA 2BYCA 2HZCA 2J76E 2X51A 2V8DA 3OQ2A 2B8PA 4RZRA 2BJ7A 4CYUA 2HVIA 2JEIA 2HQGA 4P6QA 1U48A 5EX0A 4MIWA 4KO0B 3SI8A 2V67A 5L46A 8ATCB 3PYGA 1LQ9A 4WWSA 5K8OA 5LL6d 4M5IA 4BS2A 2JDJA 1TMMA 2Q6BA 3H2LA 1RGVA 3SDEA 3K5OA 4PWWA 1OPIA 3G6VA 1VCTA 4P2XA 4Q0BB 3C6TA 4Y2AA 3ET6B 5ETPA 2N4CA 1K44A 4BWMA 2ZKTA 1R89A 5HJXA 1HWKA 4TY8B 4ZHRB 5CYQB 2M52A 4DX8H 2M3DA 2HHTA 2J5AA 2UXBJ 3AJ1A 3VALA 3K5PA 3M8ZA 2XYGB 3SXLA 3KLGA 3FFIB 2I9SA 4HHHA 2YNFB 2I5JA 1RBOB 3CJ3A 3T5KA 4K4TA 3GZ7A 5DO2A 3QJJA 2QSFA 1U1QA 2XMMA 3TUZC 2R2TA 5D3GA 5FDLA 1IQTA 2Y8YA 3HJFA 3LP0B 1UCNA 4I67A 1RAIB 3FBBA 4CTAB 1XR7A 3KHLA 4MKAA 3FGVA 1P9QC 4PG7A 3KLEA 4Z7YA 2BE7D 2WVEA 5AJ3J 5FIIA 4F0HA 1NJXA 2UV8G 4RLEA 1OY6A 4UUWA 5C7PA 4P2FA 2NYHA 1RKIA 3LUYA 7AT1B 3ENQA 1VQYA 1JNZB 4TU9A 5H1SV 3FEZA 4ZLNA 2P9CA 1UEUA 1TFWA 4PWDA 2EBEA 2WHOA 1IBMF 3W63A 1G4CA 4CLYA 4ATNA 3NKYA 1EB0A 2KZZA 2HBRB 3RAXA 4C0OC 3ETMA 4KTQA 4A8WA 2AWZA 3MPDA 1AFJA 1HYSB 3AODA 1VC6A 5KFVA 4KO0A 5K9FA 1IN0A 3ZTOA 4Y3CA 2DGUA 1JLBB 3VVTA 3M2UB 1K8AT 5KFCA 3BF4A 3KK1B 2UUCF 2DK2A 1YJRA 3EGWB 1KTQA 3D6TB 3OXFA 5DQHA 1UW9A 4DLGA 1FE0A 3ET6A 5SZTA 1PJ5A 4WU3A 2BA9A 2ZNZA 2HNDB 1SUQB 3OL7A 2GHVC 3KK2B 4TY8A 4ZHRA 2PC6A 5CYQA 2CADA 1NJWA 3PIOQ 4OLOA 4MYTA 5LOQA 4HEA9 3KKFA 2KTQA 1KVJA 5E3RA 1TL7B 3CXCR 5KFGA 2EI5A 2Y1LB 4L72B 2KL8A 1LWXA 3FFIA 2B9WA 3PTWA 4MTPA 1N32J 2YNFA 3DNCA 2G4BA 5CHCB 1MN9A 1RCOB 4WFAQ 2XMWA 4DFJA 1XR6A 3KMQA 4ECXA 1CLFA 3P5TL 1PJ6A 2H3EB 1XN9A 3Q22A 2E1PA 2V2ZA 4RKUC 1X4BA 3KTQA 3E51A 4F2SA 2VFTA 3ZC4A 2I0XA 1Q4RA 4CTAA 1RQ0A 4H54A 3BH6B 2QLFB 5L9NA 3DRSB 1S1UB 4JI7J 2DEJA 3NNCA 1RAAB 3AFGA 5HSPA 3Q24A 3BGRA 2G2ZA 3M32B 5JUMA 2CNNB 1FESA 2XCPA 4DPUA 2FLLA 4ZPWR 3WDOA 4FVCA 3DYAB 1NSKL 2I6WA 4Y2CA 4RW6B 4A8YA 4ES1A 2WSCC 3DLKB 4DL0C 3GP9A 3EX7B 5DDPC 1NJYA 4DL5A 1SPBP 4X4UA 2AZ3A 4ZVHA 3AY0A 3R97A 2I2YA 3CB4A 4XAKA 3LPEA 1Y0HA 2HG4A 2R7TA 4J9LA 2EKNA 1RTIB 1JLBA 3M8RA 3M2UA 2RUGA 3KK1A 4ZDNA 2FHOB 2RKIB 1NK4A 1OWXA 3IO1A 3UDCA 4LQ9A 2YNHA 2HNDA 3OFHA 1SUQA 3JSBA 3NBPB 1MU2B 3KK2A 4ENOA 1FJGJ 5RUBA 1HNIB 1YSJA 1UL3A 4XPEA 4YB6A 5D4PA 1TL7A 4ED3A 2HVZA 2KKHA 3QRRA 4PRFA 1FK9B 2H4WB 3J7ZT 4M95A 2DXEA 5HP1B 2LXIA 2XS7A 1FKPB 2CZ4A 4IYQA 2V69A 1HHSA 2YWEA 4FYDA 3V6JA 5B0AA 1S7HA 4DUYJ 1KRPA 1YJ9S 5HBMB 3FBCA 3VF0B 1EIYB 3BJYA 4ZP7A 3KXDA 1QDUB 1BWVA 3ZO7A 1RA6A 3HSZA 4RX6A 3ZZUA 1SV5B 2LDYA 3DRSA 1S1UA 2XB2D 3I9ZA 3PRVA 2CNKB 4USWA 2RQCA 2COLA 3M32A 3DRYA 4MK8A 2H48B 2J0XA 4KE5A 4KPYA 1L5UA 2CQCA 4ZN1A 3MCSA 1EQ0A 1FXRA 2IVYA 3DYAA 1UFWA 3ISND 3UPFA 2CPJA 4ED6A 2ZBPA 4KC5A 2ZVIA 4JV5J 4OYXA 1IBKJ 4F4KA 4RW6A 1U45A 3FEXB 3DLKA 2A3JA 2ADCA 3MMAB 3JQJA 1M5PC 4B9TA 1N5VA 2PDAA 4Y2IA 4WFZA 4D3GA 2PN6A 4DV4F 2YWGA 3GG1A 4USHA 3JSMB 4B9MA 4JI0J 1YZ7A 2CQ4A 5IOLA 1FWPA 2DT9A 4RBVA 2ZHBA 4EZ6A 5D4NA 3IR7B 2OP5A 1GNKA 1RHJB 2UU9F 4WTYA 5GADI 2RKIA 3C8YA 4ZP8A 2VQEF 2CPZA 3ULHA 2XHCA 3U1LA 3ZTQA 5D77A 2ZITA 4KAIA 5T7LB 1C1BB 3NBPA 4FF2A 3Q23A 4K0KF 1S9EB 3UCUP 1HNIA 1YQHA 4JI5J 3EWGA 2QE5A 5KFNA 2AMCB 4OX9F 2WB4A 1IUJA 1TKTB 2XO6A 4L6V3 4GKKF 2E9TA 4DV0F 1DTQB 5T14A 4P75A 1FK9A 1YJUA 1FRXA 2DNMA 3CMQA 5HP1A 1EAYC 2YQ0A 4EO6A 2LKZA 1WTFA 4OL8A 2CDRB 2DO4A 3IA0A 2MMYA 3MWBA 4DQRA 4HI1A 4J9KA 5HBMA 2GGPA 4ETZA 5AXKA 1SL0A 5K5MA 1SV5A 4CDIA 3R7SB 3EDQB 2AJ1A 5HVFA 3BB5A 3D66A 7FDRA 3W5YA 1WHWA 2Z56B 2W01A 4WYWA 1HW9A 2CJKA 4B9VA 2YKPA 1WEZA 2MPUA 4OHVA 3VAJA 2RDJA 3MMAA 4KH0B 3TEHB 4X4NA 3HZGA 2B7CB 3UNYA 3J7YU 2VBXA 3JSMA 3UI3A 1E6YB 2UVUA 5F0UA 3U1MA 3JYTB 2DGXA 4O4RA 1NHVA 3IRWP 3TEGA 4DR7J 4YB7A 3CO9A 1VGYA 2ZH6A 1S77D 4LF8F 4CNYA 3IWXA 3D7SB 5DGBA 1WI8A 5AXNA 4QR2A 2ZH9A 3PY8A 1JLFB 2MQQA 5D0GA 1UVLA 4WPAA 4GVBB 3HCXA 1D3WA 2QFIA 1S9EA 4M94A 4CO5A 4WXOA 2XYPB 3UR3C 4MKBA 2E7VA 3OTEA 2DB1A 1TKTA 1N5QA 2VKRA 4JUZA 5EGYA 5BYQA 5KAKA 3GR0A 5EX3A 3D2WA 2RS8A 2ZH3A 2DO0A 3CCSS 5L1KA 1QTNB 1CS4B 4J37A 1RWKB 4X64J 2C28A 3KLIB 1M5SA 2HGNA 2MKHA 1S6OA 1N0VC 5DDRC 3ELHA 2L9NA 2WB1D 3S1TA 3KK3B 2EFPA 4IDKB 1GXTA 1H98A 1YRUA 4K50A 3NS6A 4RNNA 4KGZB 4LF1A 3QZ8A 5BR8J 4JBCA 5KTQA 3ILIA 2OPQB 2LQ8A 3IXQA 4DV1J 5F8MA 2C2OB 2GMLA 1APSA 1YBTA 3T6JA 2O67A 3HVAA 1QE1B 3SCKE 4M5KA 1DBDA 2UV8A 1Q81T 1RWUA 2YWKA 4ZLPA 1R3NA 2V4JB 4MIAA 3DU5A 1FNMA 3K0JA 1JNRB 5KT5A 4MK9A 1DHMA 4M8LA 4KHMA 2H5JB 1WG4A 2EC2A 1XMQJ 3R7BB 1E6YA 4ZLLA 2HLUA 3JYTA 5F41A 3HVTB 4F3OA 1U1NA 4UY85 4JI3F 2ZHOA 3EZOA 1H72C 1Q78A 4B3MJ 3MR5A 1DY3A 2HVEA 2E5IA 2NZ4A 4BHQA 3KLFA 4UZCA 2UXCF 1FX4A 4EGLA 1JLFA 5FLXU 1BUXA 4JYAJ 1YLXA 4YP3A 1KD1T 4JI6J 4GVBA 3EM1A 2ZWPA 5IXUA 4KHPF 1H7WA 4HH0A 2RUSA 3DOLB 3TAMB 4FDFA 2B5JA 3PR4A 2CVIA 4V19X 2K1RB 3CCUS 4TYBA 2DIUA 4O44B 5J2PB 3P5BP 2OHDA 4F4XA 1VQ5S 3SEOA 4ZVEA 2YKOA 1IKXB 3PYDA 5JJBA 3PHTA 1Q82T 4RU9A 3NNHA 3TI0A 1J5OA 2EFNA 3UN2A 4QWAA 4USIA 4DQSA 1XMOJ 1CS4A 4ZP9A 3MDFA 4IOAQ 1WTBA 1VMBA 2KN4A 2B6AB 4X65F 1QVGR 3KK3A 3T1AA 1WORA 4IDKA 2OPQA 2LLZA 1LK5A 3H20A 1WF2A 4RJVA 2BKNA 4LF2A 1QE1A 3R2CJ 1T9WA 4ZN3A 4PZVA 2VH7A 2W2MP 4CT9A 1MWYA 4YUDA 2V4JA 5B7WA 3W8GA 3IBWA 5CABA 3TW0A 3H5XA 3RBDA 2WOMB 3D68A 5A8KB 3CMAS 3FVYA 1ZM3A 3PJWA 1F3VA 2E1AA 2BZ2A 3JQMA 2VJUA 4IH5A 3MXHP 2DH7A 1YKWA 2C3MA 2C2ZB 1NPPA 2XO7A 1RSCA 4YB5A 3CD6S 5D0EA 4X4VA 3F41A 5IT9Y 4X4TA 2BW7A 1KHVA 3DKDA 2NQPA 2CJYB 1RAEB 5CYMA 4ANEA 3I4HX 2BE2B 5LMNF 3WQPA 2UVWA 1G6BA 1M5OC 3I5CA 2FJBB 2MZ1A 1MG7A 1RT4B 2L08A 3DMJB 3DOLA 3KLHB 4XDCA 3TAMA 2E1MC 4QU6A 2VBWA 2UU9J 2IHR1 2K1RA 3W9JA 3A8IA 4O44A 3QBCA 5J2PA 2R7OA 1KONA 4F4YA 4DR2F 2JVOA 4CNZA 4DSJA 2QYGA 4P2MA 1J5EF 5FJ4A 2CQPA 2V50A 3LGMA 3FBEA 2JVRA 4UF4A 4RW9B 4NCAA 2MLXA 4OX9J 1UFKA 3ILLA 2VIHA 1KFSA 2B6AA 1YJVA 3MM9B 1QUVA 2GW8A 2DGVA 2F4VF 2M70A 3OR2B 3W8PA 3IRXA 1KFDA 2AF6A 3LPYA 1AYEA 3D67A 3R3TA 5AE2A 1UPPA 2AHOB 4X4PA 2RAQA 4B3RJ 2SXLA 4B02A 2DJWA 2VC1A 4ZP6A 3SSRA 1GEHA 3VAKA 2H4YB 3BKFA 2Y0SD 1GMWD 3HO1A 2Z57B 1U49A 8AT1B 4AFFA 2J7WA 4LF4J 2IDEA 2OEKA 1WF0A 4FVMA 3TVZA 4ECUA 2WOMA 3BYPA 4FNHA 1N5TA 2VBZA 4QIGA 4ZPCA 2E1CA 4NLSA 1XQIA 1U1MA 3CD5A 5EWGA 1QAYA 2AZ1A 1FXDA 1S7IA 3RU0A 3E3XA 4DV2F 6FD1A 1VRTB 3CJTA 2C2EA 1RCXB 3NLCA 1WWHA 1GAOA 2J8SA 2ZOFA 2Z30B 4DUTA 1VQ8S 3D28A 2BE2A 2JC1A 4PG4A 3X1LB 4L73A 2IIHA 4DQIA 4QWCA 1NXIA 1RT4A 3G96A 4CRJA 3DMJA 3KLHA 3CDUA 4O23A 1FRIA 3CTRA 3KLVA 1CJUB 3UDLA 2BKPA 4NRTA 2UXDF 5CXTA 2R8HA 1LW2B 2Z0GA 5KG3A 3GWCA 3WX4A 2QYCA 1KQSR 5ETLA 5DM6Q 1HNWF 1TAUA 1HHQA 3ONQA 4IRDA 1X60A 4ZCIA 1SVDA 3CJKB 4RW9A 5D8HB 3F73A 2AU0A 1Q1KA 1G2EA 3PX4A 1A0OB 2KYZA 2W4PA 3MM9A 3GV7B 4HLBA 4IQXA 3G6ES 3QSYB 5F8JA 3OR2A 3EZUA 4TLRA 1SIWB 2HGLA 3EVOA 4ILMA 4I64A 4G1QA 2XI3A 4F3MA 4PXDA 3SCIE 1TUWA 2EVZA 1L3VA 2E5JA 3K7RA 4C98A 1NM2A 2BJDA 4PKDB 4UOHA 1WOSA 3FQLA 3FCVA 3A8EA 2FLNA 4TU8A 1CJKB 4P10A 2IM3A 1WC4A 1SKWA 1NK9A 2GIRA 1WC1A 1WC6A 2ZBRA 3PJ9A 2MZQA 2DR8A 2XI2A 4EYIB 3NEKA 3Q8PB 5I3QA 3U02A 4DPWA 1VJWA 3MTJA 3I56S 1JMTA 1YRTA 2HHQA 1VRTA 3VQTA 3M4XA 5LJ5Y 4LBIA 4WP9A 4DPYA 3QNWB 5M2UA 2ZJQQ 4F3QA 2CPYA 3MEKA 3SCJE 3GFZA 5F8IA 1TUGB 2QO3A 1KR4A 2HPUA 2KT3A 2DYAA 2MYFA 4JI3J 4IFVB 1WEYA 4WTOB 4ANDA 4LRBA 4KR0B 3CO0P 1EARA 4C8MA 1CJUA 1SJ3P 3KMSA 3S8SA 1UAWA 5F8LA 4AT1B 4YR3A 1LW2A 4LQ3A 2YQ1A 3HJVA 4LFCF 5E41A 1NPRA 4FYXB 3EVMA 3TUIC 3W2WA 3CJKA 4Q5VA 2NCKL 5J2MB 2XLIA 1VDHA 3GSIA 3IG1B 5EDWA 2VJVA 4I68A 2YH0A 4OZ5A 3NMAA 2D7SA 3MAQA 3T9NA 1SJFA 1B70B 4F02A 2ZDOA 2MDAA 2EKYA 5HO4A 1B0PA 5DZ6A 3KUGA 4HVZA 4F4ZA 3QIPB 2YWWA 2XZTB 2P8IA 4ILLA 2AQ4A 4NLQA 1CULB 3OJSA 2UUBF 2DITA 4CH1A 1WSVA 1F5AA 4KJIA 3DLJA 1OYDA 5AT1B 3IR5B 3FSIA 4J9OA 2PD1A 5DDOC 3GYNA 1CJKA 4WIIA 4NCBA 1T95A 2IRXA 4DXLA 3PDNA 4EBDA 1VBXA 2EFOA 2VPZB 3VGSA 3T5HA 3D3CJ 4BLGA 5KFBA 2DNKA 2KJWA 4ED8A 3DN9A 1LV5A 3M6UA 1LWEB 4NL5A 4Y0FA 3N6NA 2DNRA 4J9NA 2BQUA 3U7JA 1FF2A 1MWZA 2PA8D 4IH6A 5BYSA 3SMZA 1M90T 3FSYA 3E01B 1UVJA 4YOEA 5J2NB 1KTVA 3MUVP 4ZJOA 1RJJA 4I1TA 4MIBA 2MZJA 4YEAA 4G3IA 1UVKA 3AQPA 4Q2LA 1Q5YA 1UJ4A 3EMTA 3PJXA 1X31C 3UD4P 2RDIA 1SKSA 1M1GA 4I6AA 4M5LA 1JQGA 4OHXA 4DX6A 3W7BA 5F8GA 2NSBA 3IG1A 3SSQA 3ENWA 4B3SF 4U95A 3A8JA 2AX1A 3WIUA 1TAQA 4HTJA 2M88A 2M8HA 3QIPA 5M2RA 3KJNB 4K4WA 3WHIA 1CULA 4CQ1A 1C2PA 1J27A 3PVXA 4QIWD 2F4VJ 1LKZA 4NMLA 1LOUA 3AT1B 3VGUA 4YN3B 3TJAA 2XMAA 1YWXA 2HHWA 3R27A 2ZZMA 2ASDA 2OGUA 3I4PA 2HIYA 2PEHA 2MGZA 3PIPQ 2UUWA 4F50A 3PX6A 4FPRA 4QWEA 2D69A 3W5XA 2HAFA 1P8GA 2W2QP 1FNXH 1XNQF 3QYYA 4JI2F 1HA1A 4FS2A 4DQQA 2GFFA 1VLYA 4ECWA 1ZZNA 1W2IA 5D0RA 2FHMA 1LWEA 2OSRA 1UWBB 3ZZZA 3BPDA 1P1LA 1SQFA 1UPMB 2VASA 5L8RC 2VPYB 4KFBB 1P27B 3CCVS 2H9ZA 1LFPA 5IZHA 3VWSA 2XS5A 3E01A 4DF4A 3R2DJ 2FJXA 1SIZA 2L9DA 1GK8A 1LWFB 1S57A 4ZJLA 4C11B 5J2NA 2BMBA 1ZTWA 3M9NB 2YQ3A 5ETNA 3HULA 2G1DA 2N82B 5LJ3Y 1VOMA 4U9RA 1XNRJ 4ZA1A 4LSNB 2IFXA 2P6SA 4ZJQA 3PFEA 4UZBA 1YVFA 2YBVA 2LXUA 4QYRA 3ZXWA 4DUZJ 4DCOB 2DNZA 5KG6A 2KH9A 1IVZA 2DTJA 5DETA 3BH7B 3DM2B 3HSGA 4AXJA 3AA9A 2IMOA 1S1XB 3ZTPA 4JV0A 1W26A 5ETVA 1HNWJ 4FZVA 3RYLA 2VHGA 1M1KT 3CC2S 2C3YA 3T5LA 2E5HA 1RWOB 5CQGA 2XWXA 4A4JA 1SBRA 1JKHA 1RHMB 4DOZA 5LMUF 3FMWA 3I55S 5LT5A 2YPYA 3AJDA 1CVJA 2CJQA 2VQFF 4A8MP 3GPAA 1MROA 2FJAB 4KIAA 1FX2A 4HDHA 5HAOA 2JLEA 3FJ2A 5C25A 3J7Z5 2K7JA 2M4MA 3MOZA 1YG0A 2PEBA 5THWA 4ICLA 3OJUA 3GJSB 1FFSB 1VI7A 4CIOA 1A9NB 2Z2LA 2MZRA 1FRJA 1ZAVA 3VAGA 1B7FA 2DH9A 3LH2S 3KUEA 3U1NA 2PI5A 4OZ2A 3ICLA 1UWBA 2ROEA 3ILJA 1RWVB 2ZJPQ 2DNYA 2JWNA 4Q45A 4KFBA 3T6BA 3DRRB 2VOPA 1N34J 3K89A 4ECSA 1ZA2B 3N28A 4ZK7M 3J7YI 2XY7A 3CE8A 2QIFA 1T9TA 1KSPA 1LWFA 2VU5A 5AE1A 1DRZA 3FK4A 1AROP 1DJ0A 3KJVB 3HDSA 4AL6A 2HFOA 2H51B 4FF4A 4E0DA 1DQ9A 1I94J 1F9HA 1CC8A 3CPWR 5F3ZA 4A8QA 2BJ8A 1JLGB 3KDOA 3NOCA 1NH7A 5L9XA 1R8HA 2NYIA 4FYYB 4LF9J 2VV5A 2ACMA 3KNGA 3TRGA 1W7WA 1TP7A 2FJVA 3L09A 2CXEA 3I32A 1S1XA 3C66A 4F04B 1FI4A 3AOAA 1TKXA 4WP8A 3DXSX 4K7QA 2UZAA 4X62F 3BDEA 4QR1A 4ZPTR 5MLCV 4WF9Q 4BCAA 1R7IA 5H9EJ 4DR3F 4DQPA 4NZ0A 2Q3PA 2FVPA 2YKAA 4TQRA 3CMES 1NJIT 4DI6A 3RW6A 2F9JA 1N33F 3I31A 2JHEA 1VJQA 3US5A 4U67Q 2XC9A 2PT0A 4NLTA 3EXYA 2FDNA 5L39A 1RWWB 3MMJA 4ELTA 5KFOA 1O0PA 4NLPA 4LVOP 1M0SA 2OEJA 2J0QD 4EBEA 1JLEB 2VUGA 1URRA 4M1KA 1R43A 4F26A 4K5RA 3G87A 4ZMMA 4LRDA 4PCQA 3RUBL 2P2CB 2QC3A 3WC0A 4DL6A 2B4OA 4B9UA 2R8IA 2XEXA 1KKHA 4I6WA 5GMKa 5KFWA 3KWMA 5F8HA 1OSDA 3PHEA 2MQOA 1V3SA 4AQYJ 3ZNUA 2RRNA 2IPOB 3DU6A 1KQKA 1F2GA 1ZBTA 5KFPA 4ZPBA 2ZJRQ 5HANA 3OSPA 1Q8KA 3LGHA 1X4AA 2QLXA 1EX8A 4OYIA 3ITHB 2BABA 4K4UA 1F1BB 3DLGB 3C15B 4GVLA 1SCJB 1VRQC 2HHPA 1BQXA 1OJ4A 1RLDA 2D74B 2ZFHA 1H0HB 1QVFR 3WX8A 1JLGA 4WFXA 3CW2C 1NZAA 2FZGB 4QW8A 4X4QA 5KFDA 1Q0NA 4S0MA 3FZ2A 4HTIA 2FUG9 2DEIA 3PO5A 3EGNA 3DOMB 4EMDA 2HHHJ 2HRYA 3AAWB 2CYYA 4FBTA 1U6BA 3ZTRA 2V9WA 1UW4A 1R8AA 3QT8A 3F44A 1L3UA 1GT8A 2VDIA 4X66F 2VFRA 3NG8A 5AXLA 2F8MA 3I0SB 4N5SA 1HWIA 4Q7AA 2GCFA 2JZ5A 3HHDA 2OTLS 3W61A 3FCWA 2IRUA 2LQ5A 3OL6A 1TVRB 3MPWA 2V34A 3B6BA 2HAIA 3M05A 3BN4A 2AGOA 2RILA 3ZZYA 1I51B 2B4VA 2GJ2A 5E2QA 2VB6A 2F65A 2L9WA 1JLEA 4I2PB 4C2MA 4W98A 3KYLA 3MR7A 4USJC 3IFEA 2CFXA 4NYOA 4WZQA 3H5UA 3SV4A 4JV2A 2DBBA 4UY8T 3RRGA 4O0IA 4LJMA 2GMHA 4DN0A 2FVCA 2XNRA 4OHYA 2MLYA 1NZ8A 2KJVA 5GAGU 1FFGB 3GV5B 4LF7J 3DHWC 2NZCA 4J9RA 2CZ9A 2FVQA 2NLWA 5IT4A 2LMIA 3ITHA 2HS4A 4OI2A 3QLHA 1VK8A 3QT7A 3C15A 4TKTA 4CLTA 3KHHA 1GXUA 1JJCB 1NPKA 5HQ8A 1D0EA 1QD1A 4XK8C 1X4GA 2QMWA 2MJNA 1WC3A 3TUJC 3NCQA 4NLVA 7FD1A 1IKVB 4CP5A 3CCRS 3UCZP 3M8WA 3DOMA 3HKZD 1TKZB 3L95X 1NK5A 3CCQS 4DV6J 5LSLA 2ABYA 3NNAA 2DGWA 3QQCD 1MLAA 3GIKA 3MCNA 3I0SA 3RB3A 4TY9A 2RH3A 3UWTA 4B3TF 1TFYA 3G8SA 4K4SA 2UXBF 1AZSA 5HK4A 3SQGB 2AIRB 1UZHA 2ROGA 3I5AA 2KFNA 1TVRA 3DRXA 4UOFA 5HATA 4QYZJ 4N77A 1HD0A 4MFBB 2NUHA 4HKQA 4FPIA 1NAQA 5A8WB 2OIHA 5KFTA 2RF2B 1VQ6S 5IWAF 4M5HA 2VODA 4I2PA 1O51A 1WDTA 2WW8A 2E9ZA 1X5PA 5JMNA 3Q8QB 1S1VA 3MEDB 3W3SA 4DPOA 3Q8SB 3ISNC 4FN5A 3D0HE 2ALYB 4Y34A 1WKKA 3T1YJ 3PACA 5B0EA 2ZZTA 1T05B 3R5GA 5A2QY 4LFBF 2FJDB 3MECB 1JWWA 2HMIA 4WZMA 1IBLF 1S1TB 5HN0A 4BC7A 4F4AA 2IAJB 1X0FA 4URQU 1FE4A 3FC9A 1RU1A 2W2PP 4PUOA 5C42A 2RVJA 1IXKA 4GRSA 2CPIA 2XHWA 2APOA 3QO9B 3QFHA 4TVAB 1DQAA 3PZPA 4DBQA 4KV8B 1Q95G 4DR4F 4CO1A 2MXYA 1U8WA 3S01A 1IKVA 4RW7B 1SC4B 1Q79A 5SUHA 1VHIA 1P6TA 2M9KA 4LSLB 2Y0BB 2DY1A 3AB2B 3UDVA 2FTRA 2OELA 4ANCA 8RUCA 4F25A 4A8OA 1FTCA 2JFKA 2K7KA 4DZ6A 1Y3KA 4MAKA 1NMEB 2DNPA 5KFQA 2JEFA 4C3LA 3CD7A 2Y8WA 1VC0A 2NUUG 4QPTA 5DQIA 3D6HB 3QATA 1T3OA 5GMEA 2RB7A 2O3DA 5A8WA 2AYEA 1Y7PA 2RF2A 3N6LA 5DJBA 2HVDA 4WFBQ 3D3BJ 4P52A 4DV7F 3MEDA 3TVKA 2PO4A 2QLJB 4JI7F 3KHGA 2FGOA 3W62A 5F8NA 4F0MA 1HWLA 1H7XA 1HFEL 4Z2XA 1T05A 1N56A 3NL0A 3MECA 2WONB 2WZ1A 4USMA 1HBOB 1S1TA 3C2PA 2IAJA 3AD9C 1FJEB 4KPCA 1MMNA 4M5DB 3T41A 3I0RB 3GCXP 3U27A 1QSSA 3EGVA 2W25A 3QO9A 3VR1A 5G4DA 2XYHB 4DV3F 4PXEA 2HWIA 2BXJA 3UO0A 4KV8A 1C0UB 2EK1A 1VQLS 3DRPB 2M8DB 2CPDA 1NU4A 2EWHA 4I2QB 3BO3A 1PILA 2CDQA 3FDSA 4LSLA 4QCLA 4LBPA 1X9SA 2QG9B 2FHJD 1BMQB 4ED4A 4Y2MA 3VAIA 2J6UA 1JJHA 3VTIA 1RT6B 4L76A 2OLWA 2Y9HA 3PEJA 1C4AA 1OY8A 5H9FJ 1FDDA 1ZZFA 2M0GB 1UJ5A 1S79A 2E7XA 4Z37A 3HI9A 2KHCA 3Q8RB 2GV1A 2Q6CA 3N79A 5KG5A 4KYZA 2HQCA 1CEZA 1IKWB 2A18A 2V9KA 3BSOA 2BV3A 4OJ3A 1VQ9S 3OL8A 2FZKB 1DURA 4PQAA 1TU0B 1N88A 1H2UX 1S9GA 3B82A 4DUYF 2CIMA 4DCJB 5I3UB 2GVZB 1D9FA 2Z2YB 4KY3A 1RHRB 5E3AA 2QMUB 4C4WA 1G3OA 1X9WA 2BVZA 1WF1A 3RRKA 4W92B 3PR5B 4QWBA 4OV1A 2VC0A 2FD2A 4WFYA 1NRKA 1Y3JA 2R7SA 3TWZA 5B0BA 1BHNA 1TL5A 1KVKA 2E1RA 4DMZA 1ZPVA 2FPHX 4IH7A 3DLHA 3CJRA 4JV5F 2YWHA 1IBKF 3AQOA 1HBOA 3THPA 1JLAB 4OHWA 1CJTB 3UR0A 3I0RA 3LW5C 1AW0A 4JI0F 5C24B 3VAMA 4B17A 2FJWA 3G6YA 2B3TB 2AT1B 4ERDA 1JX4A 4RNHA 1C0UA 3M8PB 3HHLD 4CT8A 4DPTA 3UVJB 2RHSB 1S97A 1U1LA 2DPIA 3ZTSA 2GIQA 4I2QA 1HIYA 4Y28C 1N48A 3J7A1 3GCWP 3GIMA 4PABA 1MN7A 2JX2A 3KUHA 3NCPA 5IT0A 1E6VB 1SB6A 2XCAA 3MCMA 2N7CA 4JI5F 2ILZA 3LQVA 3VGVA 2B4PA 5C2GA 2WBMA 1N36J 4KGKA 3UDEA 2QV6A 4J7CA 4O4GB 4IUFA 2DR7A 1KN6A 4OZ3A 4F8RA 1VR6A 1VQOS 2K06A 4C97A 2BBEA 5C2CA 3KJFB 3BR8A 4OYOA 1VBYA 3MPYA 1LXNA 5I3UA 2GVZA 2MKSA 4DLEA 4B3TJ 1HARA 4QWDA 3AB4B 4QR0A 4NXMF 3G71S 4Y6IA 6FDRA 1VISA 1MSWD 1X5SA 3UN5A 4ZPDA 1U0HB 4GC6A 3JAMY 1KVIA 1RT5B 3VAHA 1H74A 2OPRB 4ED5A 1MNEA 2DRDA 3IS9A 3F0NA 3OSNA 3TO8A 1RT2B 4B9LA 5IWAJ 3ENVA 2KDOA 3IM8A 3TZZA 2DISA 1FTRA 3NGKA 1S99A 3KNAA 4R25A 1FKOA 1X5TA 4R0EA 1JLAA 2KO1A 1CJTA 3MM5B 4E2FB 1S0NA 1PGZA 1GMVA 3R5AA 3R5JB 5MAOA 1H38A 5CA5A 5C24A 1N4LA 3UD5A 3H59A 3MAAB 3LP1B 1JXEA 2DGQA 4OYPA 1X8DA 2HBZB 4LFBJ 2GQCA 3MMCB 2Q79A 4OJ1A 2XLJA 1IBLJ 5JVHQ 3M8PA 4DR7F 1N6QB 2FB0A 5D4OA 3OL9A 3UVJA 4HL9A 4EYHB 5IFMA 5CCLA 2KXFA 1YK9A 2E66A 3ADAC 1NDKA 2G0JA 2QTWA 2RU3A 3BM7A 3M7VA 5KG0A 5EWEA 2WAQD 1U2FA 2Y3YA 1E6VA 2WVBA 4AYBD 1KHWA 4DR4J 2CPFA 3D9BA 4CLZA 3H8YA 3LOUA 2R2UA 1RA7A 3PW7A 3G6XA 4O4GA 4NZ7A 1PAUB 3ENAA 2YY3A 4Q0BA 2B9YA 4GO5X 3RR8A 1BC6A 1YBUA 3IMQJ 4B9SA 2IVMA 2BRLA 3TA1A 3O3LA 2WSEC 1JK9B 1TMJA 4X64F 4C8YA 2XMVA 5KG2A 2VG6B 3OTCA 4K59A 1ZPWX 1WC5A 5DG7A 1FA0A 2V8GA 1KBRA 5HMXA 4MKVA 3T1HJ 1U0HA 2E5LJ 5BR8F 3AXKA 3MD1A 3R9LA 4X84A 1RT5A 3BKUA 3KHRA 4FXWA 1FERA 3DHXA 2OPRA 4DV1F 3WC2A 5KG1A 1QSLA 4MH8A 1RT2A 3M6WA 1PKUA 3J80Y 4J90A 3LP0A 4DV7J 4JI4J 3R1LA 1UETA 2V6AA 1REVB 1MMLA 2KI2A 2WRMA 4JP8A 2A2CA 3MM5A 6AT1B 3BV8A 3MR3A 5E7OB 1VQPS 1FJ7A 4FBUA 2DR6A 3L7OA 1WJ9A 3BGFA 3H42A 1XMQF 5KFKA 1P1TA 3NRBA 3HPOA 3PYFA 3MF5A 4CI0B 3G86A 3MAAA 3LP1A 3W64A 2W8KA 1SI9A 3MMCA 1T02A 1U6FA 4NZ6A 2HK2A 4B3MF 3OV7A 3RJMB 4DX5A 1H2TZ 3P49B 1N5SA 1PC4A 4P2SA 4QJVA 2AEJA 3R7NB 2OFGX 1WHXA 4JYAF 2DHAA 2AW0A 3R5BA 4JI6F 4IR9A 2MHEA 1IR1A 4NLYA 1HYSA 4MT1A 1T0TV 4FYVB 4DV3J 2HS0A 3SZ2A 2J6TA 3GV8B 4JV1A 3CJ0A 2XSFA 2HHSA 4TQSA 3W66A 1XEZA 2LDIA 1YRXA 2YNGB 3HSDA 4R8UB 2HQIA 1KP6A 3PRDA 1TTHB 2XY6A 3OBIA 4F36A 4RW8B 5CCMA 1JIHA 2MQPA 1HLWA 3QIDA 2QA2A 1XWLA 1XMOF 4RUCA 4C0HA 4M63A 4YR0A 4K2XA 2VG6A 2B9EA 4ID5B 1U1RA 3JTOA 4HI2A 2BRKA 2DNNA 1D1UA 2YTCA 3BSCA 1Y9OA 3ZZ0A 1SQGA 1X9MA 3AXMA 3N6MA 1OYEA 2DHSA 2R7QA 2CQ3A 4G6VB 2ZVSA 1CQNA 1JLCB 1SH2A 1F2HA 3M1VB 1PBUA 2KT2A 1SQEA 4TU7A 1K0TA 4DFPA 2LQ9A 4UOCA 2PSZA 3DDNA 4C8LA 3DLBA 1REVA 1R8CA 3NAHA 2V8HA 2V2QA 4H4OB 2CPEA 4TLQA 3HFZB 1HR0F 2F5GA 4DR5J 1WEXA 4ZOSA 2CQIA 9ATCB 4LR9A 4DSLA 4RW4B 4W4MA 3LTOA 3UCGA 3EJMA 1S5ZA 2M2BA 4CLSA 4PYAA 1V3RA 1VFJA 4RUHA 4UW2A 1UVIA 3OFGA 2CQHA 1TL3B 2NR0A 1XBWA 1EJ7L 2HQFA 2RQKA 4C0BA 2ASLA 3RBEA 1F5CA 1Y5IB 1FNOA 1RTIA 3RB6A 3QJLA 1OMSA 2ZEJA 1IJFB 3CULA 2YNGA 4R8UA 2KG0A 2W7AA 3EXCX 5J1NA 3C14B 3OVAA 4DU7A 5HROB 4DV5J 1Y5LB 4RW8A 4YHHJ 1U0SA 1NKCA 1GMUA 3FCHA 1MU2A 3MTKA 1ZAXA 2VPWB 3B78A 4KT0C 1UA1A 3N4WA
chains in the Genus database with same CATH topology
4WCEQ 1P8GA 1LQ9A 1FNXH 5A6PA 1XNQF 2I1RA 5K8OA 5LL6d 3QYYA 4OQJA 2CQ0A 4RNOA 4BS2A 2JDJA 4JI2F 2Q6BA 3IGVA 2W4CA 3H2LA 1RGVA 1HA1A 3Q2TC 4FS2A 2EFVA 4DQQA 3DFEA 1H2VZ 3HVWA 1HQEB 3SDEA 1TZ0A 4EZ9A 2P5VA 3DLGA 3K5OA 4R5PB 5FLXY 1OPIA 2GFFA 3FZBA 1VLYA 2R2RA 4ECWA 1FKPA 3G6VA 3G9CA 1KEKA 1ZZNA 3SCLE 3DGPA 4ECVA 4Q0BB 1W2IA 3C6TA 4ES3A 2FHMA 2DH8A 4Y2AA 2YNIB 1LWEA 2ZDPA 4YR2A 2R8GA 2OSRA 2N4CA 1UWBB 3ZZZA 4B3RF 1JLCA 4BWMA 2ZKTA 1HNXF 1P1LA 1R89A 2LYVA 1HBUB 2VASA 5L8RC 2VPYB 2CJ9A 5EN1A 4KFBB 1P27B 3M1VA 3CCVS 1HWKA 4KHRA 4TY8B 2H9ZA 4ZHRB 1LFPA 1Y5NB 4IO9Q 5CYQB 5BYRA 2M52A 5IZHA 4DX8H 2M3DA 3VWSA 3OW2R 2XS5A 3DI6B 1N36F 3E01A 4DF4A 2CG4A 2HHTA 1VIOA 4LF4F 2FJXA 2V4RA 1SIZA 2L9DA 2NPIA 1SH3A 2J5AA 2O1PA 3AJ1A 4DN9A 3VALA 1LWFB 3GYXB 3K5PA 2LECA 4C11B 2JL9A 3TX8A 5J2NA 3SXLA 3OHBA 4KB7A 1ZTWA 3M9NB 3KLGA 3FFIB 3H2VE 2GC8A 2I9SA 2YQ3A 4H4OA 3V6KA 2O5DA 2YNFB 2I5JA 2EBGA 5ITHA 2JH3A 2G1DA 3CJ3A 2N82B 3T5KA 4K4TA 3GZ7A 5LJ3Y 3K2YA 1VOMA 2J0SD 5D6GA 5DO2A 3I82A 1D9DA 4OIXA 4U9RA 1SL1A 1EP4A 4ED0A 3QJJA 2BJEA 2KYXA 2IA6A 2QSFA 4ZA1A 1U1QA 2XMMA 4LSNB 3TUZC 2R2TA 2IFXA 1U6ZA 4RW4A 1I6JA 5D3GA 3W2VB 2P6SA 5FDLA 2ZD1B 1IQTA 2MY7A 2FLOA 3PFEA 3R5DA 4PG6A 2E44A 3C3LA 3HJFA 1CSJA 3T19A 3LP0B 4I67A 5KG4A 1YVFA 2ZBCA 4OMFG 2LXUA 1T03B 4C3KA 3FEYB 4QYRA 4CTAB 2KH9A 2DNZA 5KG6A 1TK8A 1XR7A 2AYGA 3MPVA 4MKAA 5KFSA 3KHLA 3FGVA 4RBTA 1P9QC 1IJEB 2Z2MA 3K58A 2DTJA 5DETA 1ZETA 4XO0A 3RRHA 1RKJA 4PG7A 1QM9A 5GAGI 1TK5A 3DM2B 2XWYA 2QSWA 4AXJA 3AA9A 3KLEA 1JB0C 5IQQA 1NKEA 2XSJA 2IMOA 2W9BB 2ACYA 3M8SA 1S1XB 4JV0A 5FIIA 2CQ1A 2VOOA 4FZVA 3RYLA 1M1KT 3CC2S 1NJXA 2C3YA 2UV8G 3T5LA 3RAQA 2E5HA 2VD3A 2HYIB 4RLEA 5EWFA 4UUWA 5KFLA 3IR6B 5CQGA 2ZH5A 2XWXA 1RKIA 2ZBIA 4A4JA 1M5VC 3LUYA 3ENQA 1VQYA 3W2WB 3GE9A 1JNZB 4KQZA 2IBOA 4TU9A 1SBRA 1YJTA 2GMJA 1JKHA 3FEZA 3WZ0A 5H1SV 3M9OB 2P9CA 3GG0A 1SH0A 1UEUA 3NP5A 4DOZA 5LMUF 3FMWA 2XLKA 1TFWA 3I55S 4PWDA 4WXWA 5KFYA 2EBEA 2WHOA 5LT5A 1IBMF 1YJNS 3P3DA 4ATNA 1HMVB 2D1CA 2BDPA 1CVJA 2CJQA 3POTB 2VQFF 3NKYA 3MOJB 5HROA 3LWMA 2DCUB 5T7LA 1C1BA 4EO8A 2KZZA 4QPXA 4A8MP 3HF5A 1MROA 3RAXA 2FJAB 1UVNA 5GAEU 4C0OC 4KTQA 4A8WA 2Y1RI 4KIAA 4TYAA 2AWZA 4HDHA 4IFYB 2JLEA 1TKDA 5CD4H 5DM7Q 2GNKA 2YKMB 3MR6A 3FJ2A 5C25A 1S4FA 1HQUB 3J7Z5 1AFJA 1YHQS 1HYSB 1RT7B 1VC6A 5KFVA 4KO0A 1NO8A 2K7JA 5K9FA 1M5KC 2M4MA 2KFYA 1IN0A 2CQ2A 2W24A 1QJHA 3O6QA 4ECTA 2AP6A 3MOZA 1YG0A 3VZIA 5THWA 4ICLA 4Y3CA 3OJUA 2DGUA 1JLBB 1VI7A 3M2UB 5KFCA 1K8AT 4CIOA 3BF4A 3KK1B 1A9NB 2Z2LA 4C7QA 3SYZA 1DTQA 2MZRA 4J9MA 2IMWP 2UUCF 1FRJA 4RWWA 5A0YB 1ZAVA 4R5PA 2A1BA 3VAGA 1UA0A 2DK2A 2VONA 1YJRA 2DH9A 1B7FA 3LH2S 3EGWB 1KTQA 3U1NA 3DOKB 2UVRA 3OXFA 5DQHA 2PI5A 1N5YB 1GTHA 4DLGA 4NYZA 1FE0A 4IO1A 2XS2A 2N3OA 1Z2LA 2YNIA 2RRAA 5SZTA 1Z4UA 4WU3A 3ICLA 4Q44A 2BA9A 1JJ4A 1UWBA 2ZNZA 2ROEA 1SKRA 2IM2A 1K9MT 2HNDB 2ZJPQ 1SUQB 1HBUA 3CJ4A 4IRKA 2DNYA 3OL7A 2JWNA 5E5NA 4Q45A 4KFBA 1R6YA 1X7VA 4ECQA 3MD3A 2LU1A 3HLUA 4OJHA 2AYBA 3T6BA 2GHVC 3DRRB 3KK2B 2MQNA 4TY8A 5LXYA 2VOPA 2KXHA 4ZHRA 4I56A 3GFXA 2PC6A 5CYQA 1NJWA 3PIOQ 4ECSA 3LANA 4OLOA 4MYTA 5HI7A 3N28A 4HEA9 3KKFA 4ZK7M 1QTMA 2KTQA 1KVJA 1LW0B 3J7YI 3QPIA 2XY7A 3CE8A 2QIFA 4WKYA 5E3RA 2KXNB 1KSPA 1LWFA 2VFSA 1BQNB 3CXCR 1SL2A 5KFGA 3TANA 1PSDA 2EI5A 3BGLA 5AE1A 1DRZA 4L72B 1HNVB 1TL1B 5E3CA 3OVBA 2J9DE 3HHLB 3FFIA 3R5CA 5E3PA 1TKZA 2B9WA 2ZHAA 4MTPA 1AROP 1DJ0A 2YNFA 2A2DA 3DNCA 5CHCB 2G4BA 3PW4A 3KJVB 2OO4A 2XMWA 3HDSA 4WFAQ 4AL6A 2HFOA 4DFJA 2DRBA 1XR6A 2L48A 3KMQA 2BR0A 4FF4A 4ECXA 4E0DA 1DQ9A 3I6PA 3QWPA 1CLFA 3P5TL 2EFQA 1CC8A 3AHPA 2FHJA 5F3ZA 3CPWR 4A8QA 1FRMA 2XY5A 2RS2A 1JLGB 2DVIA 1XN9A 3Q22A 2HS3A 3W2VA 4RKUC 2ZD1A 4FNIA 1Q86T 2LQJA 1X4BA 1NH7A 3CDAA 5L9XA 3E51A 3KTQA 4F2SA 1R8HA 2VFTA 2C2DA 3SQGA 2NYIA 5KG7A 3ZC4A 2I0XA 1Q4RA 2VV5A 2M7SA 4CTAA 2GO9A 4MK7A 4DR6F 1YJWS 3T1HF 4DWIA 3KNGA 1RQ0A 3M30B 3TRGA 4H54A 3CIZA 3N9UC 2E5LF 1TP7A 4OX7A 2FJVA 3L09A 4GKJF 5L9NA 3DRSB 1S1UB 2W9BA 2E9RX 3DCAA 3I32A 1S1XA 3NNCA 3C66A 4DDFA 5KT6A 3MEGB 4MFBA 4YDXA 4O3NA 1TKXA 3Q24A 3D0IE 3BGRA 1Q8LA 3DXSX 2UZAA 5CH7B 4K4XA 4WK3A 1QAXA 3M32B 4X62F 4Q43A 4CO3A 5JUMA 3BDEA 3HZEA 4QR1A 4ZPTR 3H25A 2XNQA 1FESA 2F8EX 5MLCV 4WF9Q 2XCPA 2ZUGA 2OMLA 4BCAA 1R7IA 2AJFE 2FLLA 4ZPWR 3WDOA 5H9EJ 4DR3F 2OD4A 4DQPA 4FVCA 4NZ0A 4JI4F 2Q3PA 3DYAB 2FVPA 3MI7X 2YKAA 4TQRA 2UVVA 1LXJA 3CMES 2WCXA 2LVWA 1WELA 4Y2CA 4RW6B 4A8YA 4ES1A 3IN5A 1NJIT 3RW6A 2F9JA 1N33F 5HL7Q 2WSCC 1HMVA 3DLKB 4DL0C 2IA0A 3I31A 5JVGQ 2JHEA 3RAMA 3LWLA 3EX7B 5DDPC 1Q7YT 1NJYA 3J81Y 1OS5A 4DL5A 5F9LA 4ELVA 3US5A 4U67Q 1HPZB 2XC9A 3BSAA 2PT0A 1RTHB 2ZH7A 4X4UA 3NAIA 4ZVHA 3THTA 4NLTA 3EXYA 2FDNA 5L39A 2AV5A 3AY0A 2I2YA 4IFYA 2IM1A 3MMJA 2YKMA 2U2FA 4ELTA 5KFOA 1O0PA 2ZH1A 1HQUA 2ASYA 3CB4A 2HIQA 2HW3A 2JEJA 1RT7A 1V9OA 4XAKA 4NLPA 2D3UA 1VQNS 4LVOP 1M0SA 1KC8T 1Y0HA 2J0QD 3RZAA 2HG4A 3Q2SC 2R7TA 4J9LA 4EBEA 1UFLA 2J7UA 1XTZA 4AE5A 1DARA 1UP1A 3UE2A 5KFZA 1JLEB 3PEHA 2R7UA 1RTIB 2VUGA 1TK0A 1JLBA 1URRA 3M8RA 4M1KA 1R43A 3M2UA 2RUGA 4F26A 3KK1A 2VL1A 4K5RA 4ZDNA 3E2EA 3CUNA 4ZMMA 1VBZA 2JRSA 2FHOB 2RKIB 5ADZA 5A0YA 4PCQA 3QAEA 2F3JA 3EYZA 1DLOB 1NK4A 4NRUA 2HNYB 3QJPA 2C22A 1OWXA 3WC0A 4FXDA 4DL6A 2B4OA 4B9UA 2J6UA 3IO1A 1N5YA 2R8IA 1FJCA 2PA3A 2XEXA 1R0AB 4I6WA 4F4WA 5GMKa 1D9AA 1WHVA 3UDCA 5KFWA 3KWMA 4LQ9A 4PG8A 5F8HA 2YNHA 1OSDA 3PHEA 2HNDA 3OFHA 1SUQA 2NS1B 3JSBA 3NBPB 1V3SA 2MQOA 3KLIA 1MU2B 3O5TB 2MGZB 2RRNA 5B0GA 3N0VA 2X1BA 3KK2A 1Q53A 3K8WA 1CG2A 1HNIB 3S7RA 5I4MA 2OSQA 3IGNA 4RW7A 3SFUA 3FNNA 5KFRA 4RU2A 3DU6A 1YSJA 1UL3A 1ZBTA 2QZ8A 1KQKA 4P7TA 5KFPA 4XPEA 3T9ZA 2X1GA 4ZPBA 2ZJRQ 4YB6A 1LW0A 3OSPA 2RJZA 4OZ0A 5D4PA 1X4AA 3S6EA 2EG1A 2QLXA 3TA0A 1BQNA 4ED3A 2HVZA 2KKHA 3ITHB 4PRFA 2BABA 2E7WA 1FK9B 1HNVA 2DCLA 2FC8A 1TL1A 2R9LA 4K4UA 2ZC4A 3HHLA 3CC7S 3DLGB 3J7ZT 4M95A 1FEHA 5HP1B 2LXIA 2XS7A 3GIJA 1FKPB 3CIMA 2CZ4A 5CZXA 2HHPA 2LA4A 1BQXA 4IYQA 1HHSA 1ROFA 2YWEA 1H3DA 4FYDA 3V6JA 4NA3A 1ZH5A 4OI4A 2ZFHA 2D74B 5B0AA 1H0HB 1S7HA 1QVFR 1JLGA 3V4MA 1KRPA 3B8HA 4WFXA 1YJ9S 1NZAA 3NGDA 3C46A 5HBMB 2MKIA 3GIIA 4HYKA 3VF0B 4QW8A 3BJYA 2HHXA 4X4QA 4ZP7A 5KFDA 1YITS 2HWTA 4RUAA 1RA6A 3GR1A 1NHUA 1D8ZA 2DGOA 3FZ2A 3M30A 1SV5B 4HTIA 4RX6A 3ZZUA 2FUG9 2AJ4A 3M2RB 4UUXA 2LDYA 3PO5A 3EGNA 5L1LA 3DRSA 1S1UA 1S10A 2QLWA 4DG1B 4K5SA 3MEGA 2QEXS 1S49A 2XB2D 4RBUA 1WACA 3I9ZA 2HRYA 3HT3A 3AAWB 2CYYA 2RQCA 2KHDA 4FBTA 1U6BA 2V9WA 3CC4S 4XPCA 3HVTA 1UW4A 1R8AA 2COLA 3F44A 3M32A 2LEBA 3DRYA 4MK8A 1GT8A 1L3UA 1WNEA 1FD2A 4IKAA 2VFRA 4X66F 3NG8A 3CCWA 1UKUA 5AXLA 2J0XA 5K14B 2F8MA 3HHKA 1SC6A 2CPHA 4KE5A 2PI4A 4KPYA 3I0SB 4N5SA 2B4UA 1L5UA 3Q0AA 1HWIA 2J9CA 2CQCA 4Q7AA 1MW7A 2GCFA 3MCSA 1FXRA 4R0JA 2IVYA 2JZ5A 3DYAA 1UFWA 3ISND 3HHDA 1O5JA 3CCZA 3UPFA 1XC9A 2CPJA 2OPSB 1RT1B 4ED6A 4KC5A 2OTLS 3HKWA 1ZM4A 4F4KA 4RW6A 1U45A 3FEXB 1KQFB 3DLKA 2A3JA 2IRUA 2ADCA 2LQ5A 3JSYA 3MMAB 1N54B 3OL6A 1M5PC 1TVRB 4B9TA 3MPWA 4ILRA 1F60B 1HPZA 1N5VA 2PDAA 4Y2IA 4WFZA 4D3GA 2PN6A 4OHZA 3QZ7A 4DR5F 4DFMA 2K3IA 3MR2A 1X4EA 4DV4F 4AXIA