3CJKA

Crystal structure of the adduct hah1-cd(ii)-mnk1.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
68
structure length
68
Chain Sequence
PKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport/hydrolase
molecule keywords Copper transport protein ATOX1
publication title Copper(I)-mediated protein-protein interactions result from suboptimal interaction surfaces.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cjkA00
3BB5A 5B08A 2HIQA 2IYGA 1OQ3A 4NL5A 1X7VA 2W4PA 1WD6A 3TNVA 3LO3A 3MCSA 4ZOSA 1Y3KA 2OMOA 1TL5A 2FHMA 2XMKA 2OKQA 3F44A 4OJGA 2HQIA 1QUPA 1YRXA 2HLTA 4OIXA 1VQSA 2GO8A 2XMMA 2KT3A 1TR0A 4OJHA 1R6YA 5F0UA 1FEEA 2GA7A 2JDJA 1W2IA 1JWWA 2QYCA 5F0WA 2Q3PA 1Q53A 2RSQA 1X8DA 3FMBA 3IWXA 3KG0A 3TRGA 1FE0A 5B0EA 3FRYA 1S6OA 1KVIA 1Y0HA 2KYZA 5B0DA 4EFAC 2GFFA 3BM7A 1SB6A 1JK9B 1FVQA 1P6TA 3KNGA 4YDXA 1GXUA 2OFHX 5A6PA 1OPZA 3DXSX 5B0GA 3HX9A 4OJ1A 2OD4A 3LGNA 1KQKA 1FE4A 2W4DA 3GZ7A 4HL9A 1FESA 2BJEA 4A46A 1Q8LA 3K7RA 2GGPB 2GCFA 1YJUA 2HFNA 2K7KA 3T9NA 2KT2A 2BBEA 4DL0C 3BN7A 2HFOA 4Q2LA 2FTRA 3HFKA 1KVJA 1VQYA 2LXFA 2OD6A 1XBWA 2K1RB 2LQ9A 3BR8A 2XMVA 1MWZA 2QIFA 3VTIA 1AFJA 1CPZA 3LGMA 4YEAA 3CJKA 2AJ0A 2G9OA 1MWYA 1AFIA 2AP6A 4F67A 4HH1A 1OQ6A 3WDOA 1TL4A 5T7LB 4HH0A 4A47A 5B0BA 5B0CA 2GV1A 2RMLA 2VV5A 2CRLA 4Y2KA 2K2PA 2ROGA 1Q4RA 1X0PA 1CC7A 1V3ZA 2ZDPA 1SQEA 1APSA 1IUJA 1N5TA 1LQ9A 2BJDA 3TOQA 4NPOA 1CC8A 2RU9A 3BF4A 1ULRA 2QLWA 2HLUA 1YJVA 4HI1A 1YG0A 1TUVA 2AW0A 1FD8A 2L3MA 2IYIA 3HHLA 4Y2IA 2XMWA 3BDEA 5B0FA 4Y2MA 4U9RA 3QGPA 3QMQA 1TZ0A 2RILA 2W4CA 3I9ZA 4FNIA 2XMUA 4ZA1A 4DPOA 2QLXA 4FNHA 2PGCA 2ROPA 2BYCA 3E8OA 5IXUA 5KAKA 2ZDOA 1K0VA 2ACYA 1YJRA 3KG1A 3CJKB 4A48A 1URRA 2GGPA 1Q8BA 2IFXA 1N5SA 2FB0A 2OAUA 2LQBA 3DCAA 1YJTA 2EW9A 5K9FA 1AW0A 2K7JA 3HHLC 5B0AA 1N5VA 3FGVA 3KKFA 3HHLD 2K1RA 3HF5A 1FVSA 2ASYA 2BUNA 4OJ3A 4HI2A 1OSDA 2XMJA 2AJ1A 2N4CA 2VH7A 2PD1A 1Y9OA 1S6UA 1Y3JA 2N4DA 4A4JA 3BGUA 2OP5A 3MZIA 2OFGX 3IWLA 5A6WA 2LDIA 1P8GA 1N5QA 2KKHA 2FIUA 3HHLB 2N7YA 3UDCA 1GXTA 1RJJA 5B09A 1SI9A 2XMTA 3HDSA 5T7LA 4DN9A 1U7LA 2ROEA 4QOTA 4Q2MA
chains in the Genus database with same CATH superfamily
3KTQA 4DL2A 4NL5A 3C8YA 1IQTA 3CSKA 1HQEB 2FHMA 4TQRA 4NLVA 4YN3B 4JV5J 5J1EB 2UXCF 4X4RA 4B3RF 3LGNA 3LWMA 3IC1A 1VBYA 2HFOA 4WE1B 3BKTA 1VQYA 2DISA 3AJ1A 4LQ9A 1EZZB 4RNFA 5J2QA 2NLWA 3AH6A 1RCXB 2HQCA 3F56A 4X65J 4OFZA 3BJYA 1RXOB 2RHSB 1N5TA 3G2XA 2L9DA 4F26A 3TQ1A 2OJ3A 5HROA 1X5SA 3E3XA 3NOCA 4BWMA 4UUXA 4JI3J 1FX2A 3GJTB 4DUZJ 4U67Q 5FJ4A 3IS9A 4DBQA 4JI4J 3I5CA 1RHKB 2MQ8A 4ZHRB 2ROEA 4IH7A 3BEGB 2Z2YB 4CLSA 1U45A 2FLLA 1QUPA 3CDUA 1S1UB 2AJFE 3IN5A 4Y0FA 2RB7A 5I42B 3KG0A 3Q86A 3HPOA 3JTPA 1Q0NA 4ZDNA 1SV5B 2HNZA 2Y1RI 2I6WA 4F0KA 1YSJA 2OD4A 2HRUA 4P52A 1S9GA 1L5UA 5EHHA 2J5AA 4WIQA 1KFSA 4QIEA 4X4OA 2PI5A 1MROA 3G87A 4WCEQ 3CD7A 2C2EA 4K0KJ 3V6KA 3CO9A 2WONA 2KTQA 1X0PA 1HBOB 2DEIA 1MMDA 1NKBA 2RU9A 2HYIB 1EP4A 2PE8A 2ILZA 3IBFB 2FUG9 4NLDA 3KUHA 1HL6A 4M5JA 4IR1A 2M8HA 3NEKA 2FC9A 3G6ES 2ASYA 2IIHA 2N4CA 2KDOA 1SPBP 1RTHA 2BANB 3C14A 5KFUA 2E9TA 5T7LA 4OYZA 2DNGA 4P72A 5DG7A 3PYFA 1TVRB 3CW2C 1EETB 1Y3KA 2ZVSA 4IQMA 2BJ8A 4AE5A 2NZ4A 4ZN1A 3A3PB 3LPEA 1BXNA 1IBMJ 4C6AA 4DS5A 3W5ZA 2W7OA 3FBFA 3A3OB 1NSAA 3HP6A 1DJ0A 5K5MA 4DLGA 2K7KA 1WSRA 2AJ4A 4UW2A 4R5PB 3DRSA 5CHCB 4DR7J 1MN9A 2LEAA 2UVWA 3PRBA 3T6JA 3K8WA 2JLEA 5G4DA 3D0HE 1PBAA 1S6PA 1LNQA 2JOQA 1PYTA 2ATLA 4LBHA 4JV5F 1LK5A 1YVFA 3BDEA 3P5BP 4PXEA 2FVQA 2OHDA 4NZ0A 2RDJA 3OVBA 2VONA 4LF5J 2VQFF 1EQ0A 4FDFA 1XK8A 2M2BA 2A10A 2MZQA 3R6GB 3K5PA 4YMEA 4X65F 1EJ7L 3AD7C 2GQQA 2R8IA 4ELUA 2W2PP 3H4BA 3LO3A 2VPXB 3PEHA 2J9DE 2KT3A 1R8BA 1QVGR 3TA0A 4JI3F 2DTJA 2WSEC 3NBPB 3RRKA 4DUZF 2BKPA 4QCLA 1M5PC 1RB0A 1NKCA 2B9YA 4JI4F 3UCZP 3T9NA 2BBEA 2JRSA 1VQ7S 1S4FA 1WEXA 1XNQJ 4ZJQA 3W61A 4NLRA 3G6XA 4LT6A 1B7YB 3H2LA 3R8YA 3BKUA 1EHWA 1FK9A 1F5CA 3M8PA 2DCUB 1V5IB 2F8EX 1YJVA 2V0NA 1ZM9A 3FNNA 1XC9A 4TU9A 3N6NA 1BY9A 3EX7B 3I9ZA 4FNHA 4WFZA 2R8HA 2J8AA 3EUNA 4DL4A 3DCAA 2LQBA 3TJ9A 3CDBA 4BC7A 3JYTB 3VGTA 4XDDA 5EX0A 2YNHB 2MMYA 2EVZA 4K0KF 2LVWA 3P5TL 5M2PA 4F2RA 3QWUA 8AT1B 5L1JA 1YJ9S 1ZH5A 2ZNZA 4U96A 2KJWA 3C3LA 1FJCA 4WPAA 2XHCA 3LANA 4IFYB 1Q53A 3AB2B 4G1IA 3Q8SB 3UDVA 1PKUA 4P7TA 4L3KA 3PFOA 1AROP 3NMRA 3TP2A 3EPGA 5ITHA 3MM9A 1XBWA 4CTAA 5U47A 4YEAA 3B54A 1DTQA 5D77A 2V94A 1P1TA 5HP1A 2ZH6A 4HVZA 1S0NA 4PG6A 4EYIB 4F3QA 3GILA 1IBMF 3NCQA 2JVOA 1GT8A 4FNIA 3FFIA 4OHVA 2ZDOA 2CQ3A 3ZTOA 3VAGA 4NZ7A 4RBVA 3VR1A 2J7WA 1RISA 2IRYA 4L3NA 1A6LA 4F2SA 4DR7F 3RBDA 5AXLA 1YX2A 3PHEA 4DG1B 3CF5Q 2UVUA 2P6SA 5KG2A 1L3UA 1SKUB 4USJC 3T19A 3N0VA 4YFUA 1SQFA 4U7UD 4OIXA 1N5YA 1Q7YT 3T1HJ 2GJIA 3MCOA 1RYSA 1RT5B 2DRDA 2CZ4A 3W64A 2EPIA 4EFAC 1TKXB 2V67A 4LF5F 2C1EB 1WDTA 1LWEA 1TL7A 1N33J 3OL8A 2VZ9A 2FTRA 1X4HA 3PKYA 5KFWA 3I5BA 2BOAA 3THTA 4EYHB 4J9OA 5HQ8A 4ZCIA 1VQ4S 2ZBRA 4QBUA 3ADAC 4O3OA 3CNQP 2XLIA 3S01A 4C0BA 1EQMA 3A8KA 2IJRA 5KT2A 3AOBA 4KTQA 1ACMB 2EW9A 4YR2A 1XNQF 2F63A 7FDRA 3K5NA 3PHTA 5AJ3J 1S6UA 2N7YA 5M2RA 2DGTA 2GQ2A 2W24A 3FK4A 1P9QC 4DEZA 3DOLB 1ZETA 1UVNA 4DV1J 3M32B 3GV5B 1BGXT 4CP5A 2XTJP 3DHXA 4ED2A 3PW7A 2WSFC 3H40A 4PXDA 4ZLNA 1R0BG 2OI2A 2E44A 4B02A 4ZKAA 3CJRA 3PRVA 1F3VA 1XJWB 4ICLB 1WTFA 2G1HA 4U8YA 2Q66A 2FY8A 3SYZA 4Z2XA 3FVYA 3OLBA 3V6JA 3HHEA 1U4BA 2DGOA 3AQOA 4PEOA 4DV5J 5BR8J 2QL9B 4EBDA 2CJBA 2IYIA 2DYAA 3DLEA 1N6QA 1FKPA 3K0JA 1S0OA 4WBFA 3VVUA 4X4PA 3MECA 3DOMB 5DQIA 2WZ1A 2LU1A 1VIXA 4TLRA 3L7OA 4F0HA 2HFZA 1K47A 4D3HA 2QA2A 3HZEA 2XMAA 3ETMA 3FSIA 1IBCB 3LAKA 2LP4A 4OX6A 4QQBA 4F50A 5CCLA 1QY7A 2E1AA 2R8JA 3T1AA 3Q8VA 1OY9A 1T11A 4FYDA 2W4DA 4ZCLA 3SZ2A 4WJBA 4ETXA 3VAIA 1H7XA 2J9EA 4AUKA 2IM0A 2HHXA 1QD1A 1HYSA 3P3DA 4MIWA 4F4WA 5H9FK 3KK3B 2ZWOA 1UWBA 2AJ0A 4C8LA 5KG6A 1B70B 3G6VA 4Z37A 1HLWA 3T1HF 1X4GA 1YGYA 3RR8A 5HVFA 2VPYB 4ECUA 3RJMB 3SQGB 4CLUA 5CYJA 1VQ6S 3R9LA 1N33F 4I2QA 1B4SA 2KO1A 4NCAA 1ZBTA 4C4WA 3UQSA 1PAUB 2FIUA 2F4VJ 3M8ZA 1WOSA 2H65B 2HRTA 4PPDA 4QOTA 1HI8A 4TQSA 3EZUA 1KWMA 4BHQA 2UV8G 4TU8A 1SXLA 2V6AA 4ZVQB 3T9ZA 5A76A 1D9DA 2YX1A 1JJCB 1RE1B 1V6HA 2WSCC 4RLEA 2XY7A 1FVQA 3VF0B 1RCOB 5HMZA 5AJ3F 3O1LA 2G1DA 3D3CJ 2LA4A 1QAXA 3W8GA 4ED1A 1KOHA 5K20B 3M8RA 5AT1B 3PX0A 4DV1F 3NAHA 3D6MB 4U95A 4J9MA 4XO0A 4DL5A 4MKYA 1RT6B 2YKQA 2BJDA 3CUNA 4K4TA 2LQJA 5FLXY 2V34A 4AQYJ 1U0HB 3TZZA 5C42B 1UAWA 3KK1B 4DQRA 1MSWD 1S9EB 3LTOA 1NPPA 3DDKA 1RWXB 5KFMA 1GQEA 1SJFA 4KH1B 2ZBQA 4RW9B 1RZMA 2KRRA 1HNIB 3W60A 2UUCJ 1S0VA 3KJVA 5ETNA 4B08A 3JSRA 4URGA 2L9NA 3T5KA 4J9UE 4CLLA 3VAJA 1OY6A 2UVRA 1NB2A 4DV5F 4WFBQ 4O4RA 1X4FA 3IR5B 1GMWA 1WDDA 4OJGA 2EEYA 4GVBA 2YNGB 3D68A 3QRRA 2EXUA 3WQPA 4J9VA 4V1Ak 1B3TA 4FKYA 4ZIWA 3W9HA 4NMXA 3DLKA 3DN9A 5F8HA 5E0OA 4RBUA 5E41A 1SQGA 1WOPA 2XNQA 3MM7A 2B9WA 4UZBA 3K8VA 4EUVA 1B64A 4M5IA 1D0EA 2VV5A 2Z0GA 1SQEA 1IXKA 5CH7B 2DXEA 2V8DA 1OSCA 1H6KX 4DS4A 2J8SA 4NCGA 4PWDB 4NA3A 1R8AA 4TY8B 3D6HB 2M5YA 1A9NB 4R8UB 2CPJA 2Y8WA 2CPIA 2ZITA 3CXCR 3DLHA 2YWFA 3WC0A 1TL3B 4HTIA 4H4KC 1R89A 1AYEA 5KG3A 4B3OB 4IR9A 3J7AN 4NEYA 7FD1A 1C1BA 4NLWA 5KFBA 3D7SB 4G65A 2OFHX 5E3QA 3CDAA 4KR0B 2QFIA 5CZXA 3S1TA 3JSBA 3MAAA 1FESA 3KLEB 2VBWA 2F4VF 4I69A 1K1SA 3E51A 3KXDA 2I5JB 4K5RA 2VFUA 2UZAA 3AOAA 3V6HA 3ZZYA 4Y34A 4ED0A 2CWXA 2E5GA 1FXLA 4A47A 1MU2A 2ZDPA 1APSA 4ECRA 2D9OA 2E29A 1B0VA 2MQQA 2YKNB 2YH1A 4CYUB 3SDEA 3GYGA 5BYRA 2CKWA 3M6XA 1W7WA 5GAEU 3Q8YA 2BQUA 3OTCA 1YJ7A 4MKBA 1OO0B 1U1MA 4OYPA 4YOEA 2VH7A 2OP5A 3EZ5A 4WWSA 3GQCA 3TAMB 4RUBA 3VGUA 2KN4A 4WU3A 2J6SA 4RWWA 2DNQA 3HSZA 1Y4ZB 4TVAB 5KFEA 1RT3A 2KVQE 1HBUB 4CQ1A 1H73A 1RI7A 1N32J 1HR0J 4I6WA 4AD6A 5HAOA 2E7VA 4O44A 2UUCF 1KTVA 2HVZA 3QGIA 2MKJA 1SC1B 2ZE2A 2F5GA 4N76A 2YQ0A 1K0TA 4ED3A 1IM6A 2G9OA 3LW5C 2A6OA 1W2BR 2X1BA 3CB4A 3LF0A 1VQKS 4RUCA 3RAMA 2QLWA 2IVMA 5DS7A 1NPRA 2GW8A 5JXSA 4WZMA 4DV6J 5C2GA 4DPOA 1VLOA 2KFYA 2OTJS 2ACYA 2ZHAA 1SJ4P 2FJBB 2GGPA 2KM8B 2IFXA 5FDLA 4PWWA 2AX0A 1O8BA 1UP1A 5IC4B 3PIOQ 2V68A 1HQUA 1IWAA 3UDCA 1ZAXA 1SI9A 3GU0A 2C2KB 3UNGC 2NXNA 5G0RB 4ZOSA 4FKXA 5KFCA 2RQCA 3F44A 2GO8A 4OI0A 4J37A 3WBZA 4OZ1A 4LRDA 2VIHA 2ZD1A 1JLEA 3DMJA 2DRBA 5D6GA 1P6TA 4ZP8A 2BE7D 2XZDB 3U7JA 2DD8S 1UJ5A 5IV3A 3MF5A 1LWFB 4JI0J 2KXNB 4QJVA 4ALZA 1H2VZ 2D7SA 2AZ3A 3OTOJ 4P6QA 1KTQA 3DU5A 1S12A 3TZYA 1LXJA 1T9YA 2MKYA 3UPFA 3R5AA 2QX0A 6FDRA 5HANA 3OQ2A 5LXRA 5F3ZA 3M9MB 1B0PA 1BQNA 2J76E 3GCWP 4ID8A 2E5JA 1FTCA 2F8HA 1T05B 4C0HA 2NYIA 2VJVA 2RILA 2JNJA 1PJ7A 2ROPA 4HHHA 3TAPA 1E6VB 3Q89A 1T8EA 4ZVEA 4KHRA 3BGUA 2B6AB 2IHR1 1NMEB 1ZZFA 4CH7A 2RDDA 3MMCA 2CPZA 5D4OA 1RWPB 3MCSA 4ZVSB 3MEGB 1D09B 1S4EA 2NXJA 5GMDA 2DGUA 4BDPA 1HNVA 2XLJA 1T9VA 2B9EA 1WF0A 1RTDA 2GVDB 1TFWA 2HFUA 3OXLA 2GVZB 4Q2LA 4OHZA 2XZWA 3AJDA 1EX8A 3HM9A 2QG9B 3HD1A 4DDFA 3AA9A 4CO0A 5KG4A 1CG2A 3KLIB 1NH8A 2OIHA 2W2NP 4JYAJ 1QM9A 3TAQA 4KHPJ 1N32F 1HR0F 2C2NA 2HHWA 3KLGB 2FB0A 2JX2A 2OELA 2V2QA 2YKMA 1UEUA 2AJQA 5CYQA 4EZ6A 3HVAA 3KHLA 1JXLA 3DLGA 2PD1A 4LIWA 4O3PA 3GFYA 1JJ2R 5GAGU 1NU4A 3H42A 2F40A 1UA0A 1D9FA 3TR5A 4ECZA 3C15B 3NMAA 1KOOA 2CNOB 3BDPA 2IC3A 4DV6F 2C3UA 1N0UA 1CJUB 1MMNA 4P10A 4JUZA 1JLAA 3GV7B 3OR2A 3TA2A 4HL9A 2AYEA 1QE1A 1A0OB 3PKMA 2ASLA 1U1RA 2B56A 3G96A 1U26A 4KFBA 3DRYA 1T03A 5F3TA 4A8YA 3AJ2A 5LT5A 1UA1A 2CRLA 3BS9A 1DAXA 4URSA 2KXFA 2L41A 3GIKA 4KIAA 4CNZA 3MWBA 4P71A 5IM0A 5A8KB 4M8LA 4MMOA 4JI0F 3K58A 4QYRA 4ZJOA 3NWGA 3NAIA 1RT2B 3OTOF 2FPHX 4WK3A 3V81B 4BCAA 3NCPA 5DZ7A 4ZPVR 2VG7A 2LXIA 3PJ9A 1RJJA 1RBLA 2VD3A 1WG4A 4K4VA 2RRAA 3AXMA 4XAKA 2W01A 3IG1B 3I9V9 4TN2A 2OEMA 1R6YA 3OL7A 3L09A 2NXCA 2MQNA 2ZBPA 1FRIA 4MH8A 1VIOA 2Z30B 3MXHP 1WF1A 3KLHB 4P75A 3P6YC 3OVSA 3AY0A 3CDWA 4ED4A 3EM1A 3FQKA 2NUUG 1RWMB 3JQJA 1UWAA 4DFKA 1VC6A 2DNNA 5I3QA 4IG3B 2OD6A 2J0WA 3GG0A 2R7QA 3ZTQA 2PEBA 1LEOA 2JHEA 5GAGI 3MUVP 3TJ8A 3PXGa 4L6V3 3ZZ0A 5B0BA 2ZZMA 4MK8A 3K17A 2V8PA 4ETZA 3OUYB 4JI7J 4MTPA 1W25A 3IRXB 1UPPA 2IAJB 3AOCA 2R7UA 3M8QB 3TVYA 2MGZA 1TTHB 5J2MB 2XCPA 3WC2A 4KQZA 4ED8A 2HMIA 3FUYA 2F4FA 3MI7X 4NLYA 4PG7A 3JB9k 3POTB 1JXEA 3MMAA 2NSCA 1NK9A 4JYAF 3WIVA 4FYXB 1RAFB 1YBUA 4KV8A 4F4YA 4KHPF 5A8WB 3EXCX 3GR1A 3DLJA 3M6WA 4DV4J 1NB7A 2BJ9A 4ZS6A 2Y0BB 4P9SA 4CIOA 2VA3A 3PW4A 1D8YA 1Z2LA 4Q0BB 1NHUA 2KB2A 1XWLA 2XULA 1YLXA 2HSEB 2RUSA 1FDBA 1FNXH 4NASA 3IAS9 2M0GB 3VAMA 2BMBA 3MEEB 3Q22A 1KQFB 4DJBA 5A8RB 3J7A1 4O4GB 1Q8IA 2RQ4A 3FBCA 3NG8A 4NPOA 2ASDA 4OYMA 3HHLA 1PBUA 2FHJD 4LSNA 1SCJB 4G3IA 4TLQA 4CT8A 4X84A 4JOUA 2DNHA 3BGOP 2VG5A 1GX6A 1FVSA 1RBAA 1NNDA 2OPQB 4RW6B 1WNEA 4ER8A 5HATA 2B0GA 5HJYA 1N52B 3MCNA 2MKCA 4EZ9A 2YWGA 3FCVA 3PG9A 3GE9A 1REGX 4N8OA 3ENVA 2RS8A 1SUQA 2WOMB 3DOKB 1HBMA 4USWA 1YK9A 1TMMA 4NOHA 4UY85 1DQ8A 1K1QA 1RAEB 5BYSA 1M5OC 4M5DA 5KFGA 1G1XA 2G0CA 3DRRA 1T95A 2MZSA 3I55S 4DV2F 2K2PA 3TUZC 1TV6B 4C3LA 1RWWB 3EE3A 2JJ4D 2QLXA 4WFNQ 2AGQA 2ZHBA 3SEOA 2HQFA 4MAKA 1F1BB 1FDDA 5C2CA 1RAAB 3AD8C 4JI5J 4IRCA 3C6TB 1NAQA 1HHTP 1HWIA 3BH7B 2Z4PA 1N8RT 1UJ4A 1V9OA 3TNVA 4JI7F 1AT1B 5DM7Q 1HWLA 2YXLA 5D8HB 3D66A 2YNFA 2QYCA 1WG1A 3W65A 5L46A 2QSWA 4ELVA 4X4SA 4B3TF 4OZ5A 3L4BC 3MMBA 2FLNA 4IG0B 4LREA 1CS4B 4ZPCA 3MOZA 4BBYA 4LSZB 3HULA 3HFKA 1G6BA 4KY3A 4IOBA 5D4NA 2CQ4A 4C9DA 3PX4A 3T6BA 5H9EK 2I2YA 1FDNA 2MY7A 1TMJA 3DFEA 5KFJA 3SSQA 3THVA 2CNNB 4RW8A 4DV4F 4ZITA 1Y10A 4KAIA 4XPCA 3UD3P 1Q5VA 4DOZA 4UT4A 1TUVA 4ZVTB 4LRFA 3QFWA 2EKNA 2EC0A 1FCAA 2EFPA 1UFKA 2R2TA 2YQ1A 5K9FA 3D28A 2DNYA 3L95X 3IP0A 3L3CA 4USMA 2HHSA 2NPFA 3PACA 1SVDA 2GIQA 5EX3A 3B82A 4RW7A 3MTJA 4RX6A 3SIPB 2ZZTA 1U2CA 3UR3C 1TELA 5JVGQ 5J2QB 1MN7A 4YUDA 4MFBA 4LVOP 2UU9J 5F0UA 5E3PA 3QLHA 3MPYA 4H4OA 3T5HA 3FRYA 4GVLA 2QE5A 3BN4A 3ET6A 2V2ZA 2KT2A 3PJWA 5HMWA 3BN7A 2Z57B 3IS9B 3H25A 4F04B 3TUJC 2YX7A 4LVNP 1Q1KA 2UVVA 4B17A 4KPCA 1JXVA 2C42A 2WVFA 4Q7AA 2EI5A 2QZ8A 3MMJA 2XMWA 3V5RA 5B0FA 4PG8A 4FXDA 5J1NA 5JMNA 1NDLA 2HNZB 1RAHB 4JI6F 1S1UA 5GAHU 1S9GB 4ECQA 3AD9C 2HHTA 1FFSB 2LDYA 2QLFB 3QZ8A 1MROB 3JAMU 1GNKA 2XQCA 3NRBA 3UD4P 4F3MA 5KFIA 5E3CA 1DARA 2QSFA 2DBBA 3CJ0A 1JLQB 1WC1A 4IO9Q 2VFRA 1KN6A 1EP4B 3PW5A 2Z58B 1U6BA 3BV8A 4JI5F 1XR6A 4KE5A 1RKIA 3VQSA 3J7YI 3BGRA 3BKFA 1SL1A 1RHQB 4F8RA 4ED5A 4KGMA 2LQ9A 2QMWA 3H98A 4UOFA 1RTHB 3C14B 1OQ6A 5T7LB 2PA8D 4H4KA 3SCIE 4OYXA 3CIMA 3ENAA 3DLBA 2MKSA 2IM3A 2B7CB 3PEJA 4LQ3A 2I0XA 3EGZA 2VDHA 1KR4A 2AD9A 2NPIA 3RB4A 3EPIA 4OJ3A 2JC1A 2UXDJ 4A8XA 3DRSB 3NS5A 3QPIA 1IKYA 3CCRS 1ZS6A 2P6TA 3NCRA 2HURA 1UZDA 4IDKA 4R0JA 3HKZD 4NYZA 4R5PA 1Q79A 1S6PB 3M6VA 5CQGA 2F8MA 1F5BA 2XYHB 4F0MA 4Y00A 1RU1A 5AE2A 4ES3A 3M2VA 2WRMA 5GAHI 2CJKA 4E0DA 5KFVA 3AODA 2JH3A 1KLNA 2XYGB 4ZPDA 4PR6A 3DKDA 1NO8A 2XEXA 2PMHA 2UU9F 4J9LA 3PR5B 1U1LA 2C2MB 4OYOA 3TOQA 4LBIA 3FBEA 1I1GA 1X4DA 1AB8A 3R1LA 8RUCA 3R5GA 1Q8BA 3MR6A 4KO0B 2JEJA 3K5MA 4EBEA 1F0XA 3KKFA 4RW4B 4QWDA 1HBNA 2KHDA 2H4WB 5B09A 4AL7A 1O0PA 2MSTA 3JQMA 2COLA 5DM6Q 3OHBA 1KQGB 3CCTA 5H1SV 4K4XA 3EYZA 1FK9B 1WEZA 3M8PB 5ETPA 5F8NA 4NLXA 2DNKA 1FXRA 2V4RA 1QUVA 1NK5A 2UXBF 1SB6A 3I0SA 1DQ9A 5BYQA 1T02A 1IJFB 1J5OA 1VFJA 1RACB 4DU7A 1Q8KA 4R0EA 1U47A 5GADU 3KJQB 2GHVC 4HHJA 1NDPA 3IM8A 1S9FA 1AFJA 1H2UX 4IFVA 1SC3B 4HH0A 3RB6A 2EBGA 3ZZRA 3CJ3A 2D69A 4LF2A 3FEZA 2HVIA 1Y7PA 1UZHA 2BABA 2G2ZA 1YIJS 2KG1A 5KAKA 2W7AA 4QR1A 2CJXB 5IC6B 4K4UA 3SCJE 2M70A 5C5JA 2DNLA 1SC6A 4IOAQ 1X5PA 2DH9A 5I3PA 2DPIA 2O66A 1WKJA 1MLAA 4ECWA 3ZZTA 1CQNA 1VQLS 2D1CA 4O23A 4ZVFA 2VOPA 2C3MA 4ZCKA 2MZTA 4NYPA 1DTQB 1SJ3P 4DX6A 4W90B 5HP1B 3H90A 2B5JA 2HHHJ 3KJFB 4DI6A 1NJIT 3QGHA 3OXGA 2J0XA 2RT3A 2VUGA 5THWA 1VQOS 5KG1A 3UW1A 2QA4S 3FFIB 3GZ7A 4ZP9A 1QSLA 2LKZA 2UXDF 3OR1A 2IRXA 5KOWA 4V19X 4ZPTR 5E3RA 1U25A 4DPXA 2Z2ZA 2OH2A 1REVA 3Q0AA 5A0YA 1NK4A 2CPXA 1N5YB 4ED6A 1U8SA 1BE4A 3NNAA 4FVCA 1I51B 3KUEA 3KWMA 2OSRA 1C1CA 3HT3A 1YJTA 3DI6A 2XS5A 1VQ5S 2CPFA 2VFVA 1TL7B 1NJZA 2R8KA 1RT5A 2HS0A 2IJNA 5GADI 3D3BJ 4NA2A 2VPWB 4NA1A 2RU3A 2HQIA 2JL9A 2NZCA 3CIZA 2JFDA 2Q43A 5KG0A 2YPYA 2KYZA 3LWLA 3MAHA 4PZVA 3MM6A 1FJEB 4JI2J 1BUXA 5F8LA 3ENWA 4Y2AA 3ZXWA 2M3DA 3FCWA 3AB4B 4DL0C 2HVEA 5L9NA 4N77A 2V63A 3R7SB 4JP8A 4OI4A 4ZVUB 2IM1A 3W9IA 5IV4A 1S99A 2FVRA 2LEPA 2CQDA 2AJ2A 1WWHA 2QYGA 3M8YA 4HI1A 4C48A 2VKZG 4U7UK 3DGPA 2AHOB 1RBOB 2PSZA 2HBQB 2NCKL 3DOLA 4UUWA 5HQLA 4ILLA 2MLXA 1WC6A 2DNPA 1OYDA 3RW7A 2R3VA 1PSDA 3IWLA 4IUFA 2BXJA 2DGWA 2XMTA 2RHQB 2HNDA 1WEYA 1WUUA 3FZ2A 1VHIA 2W7PA 3DDIA 5HLFB 1TR0A 1NCLA 4C3MA 2W2QP 1KNZA 1JWWA 1WC3A 2NXEA 1JK9B 3D9BA 3DLEB 4I6AA 1N6QB 4N47A 1FKPB 2FJXA 5HI7A 4IRKA 3IO1A 3QIDA 3MECB 5D78A 3N6LA 3O2IA 3HFVA 2O3DA 4X4QA 3LPYA 2B4OA 1FRLA 1LW0A 1K9MT 4PPZA 2GV1A 2H4YB 5M2UA 2HHHF 2XB2D 1UW4A 3DU6A 2KVIA 3CCJS 3GONA 3MD3A 3HJVA 2BOPA 5AE3A 2CJQA 2ZJRQ 3BO2A 3QT7A 4ELTA 1Y5LB 2PMWA 2N7CA 3HSDA 4X2BA 2ZJQQ 2HS3A 4TYAA 3NGKA 1DRZA 1TKTB 5HBMB 1HYSB 1GXTA 2FLOA 1UWBB 1RABB 4P2SA 3W2VA 4DV0J 3RB0A 4Q8FA 1FA0A 2KHCA 2YNIA 2IVYA 5KFPA 4DR6F 2F7VA 4LF8J 4OJ1A 1OJ4A 2RRBA 3QSYB 1Q81T 2GJ2A 4HLBA 3PJXA 2HNYA 4C2MA 3DXBA 4I2QB 4ZPAA 4PUOA 3CVKA 3ZZZA 2HK2A 2KH9A 3SQGA 3A8IA 1IR1A 1C2PA 4OX8A 3ZFVA 2CJAA 2UUTA 2RQMA 6AT1B 3I32A 2H5IB 2V4JA 3GIRA 2XS2A 2PI4A 2BJ3A 4JI2F 2O01C 4Y65A 1X5TA 2X7IA 3NGTA 1XQIA 1R8HA 1FO1A 1M5HA 4HACB 5IXUA 2E1MC 3CJKB 4HYKA 3HK2A 2WVDA 4CRJA 4K50A 1JKHB 4GRSA 2KRBA 2XO7A 1YBAA 1VRUB 2FJEB 4X4TA 4ECSA 2A6MA 5J2NB 1UETA 1RA7A 3MR2A 3HMJG 1RHMB 4EI2A 4H4MB 4A8SA 2CQGA 2CVEA 3W7BA 1J27A 4PQAA 1U2FA 1JJ4A 2AIRB 4I1TA 2HQ3A 2QN6B 4QYZJ 4YS2A 2GO9A 5CZVA 1HWKA 3QJPA 3IR7B 2P9CA 1ZTTA 3K5OA 2PFFB 3QT5A 2U1AA 2W1BA 4KH0B 1NK8A 4QW8A 4E98A 3G4SS 4QR0A 1KONA 4DR2J 4Y2KA 3PR4A 2DT9A 3C16A 5LMUJ 5AXNA 4MKAA 3VAHA 4M5MA 1S1VA 3W62A 3B4DA 1AZSA 1URRA 3SFUA 1HI1A 4B9LA 2E7WA 1PILA 3M9NB 4I4BA 3VALA 3DLKB 1OS5A 1T3OA 5A2QU 3OJSA 3I6PA 1XMQF 3DDNA 3V6DA 1KP6A 5I4MA 2EWHA 5KT5A 1VGYA 1LWCB 2ZWPA 4L74A 3TA1A 5D0HA 3V4MA 3GIJA 1YQHA 4JV0A 4LSLB 1X9MA 2OPSA 1ZA2B 3MR7A 1S6OA 3NXZA 4NCGB 2XS7A 4F7VA 2V5HG 1ELOA 3OFHA 3H8YA 4YB5A 3A8EA 3V2UC 5D4PA 1TK5A 1VR6A 4PWDA 5K14A 2PN6A 5DLFA 5K8NA 3O44A 4R8UA 4DV0F 3I0RA 3DRXA 2GZOA 3LP1B 4LF8F 3HVWA 5JUMA 1EAYC 1FRHA 5HMXA 1R3NA 3CGIA 2W2MP 1U0SA 4MJKA 4B3OA 4USUA 5DDOC 4C97A 4UTGA 3DYAA 1WSVA 5DG8A 2CYYA 4URQU 3A12A 2ZFHA 3DGVA 4DR5J 4TNOA 2ADCA 2HK3A 5L8RC 3KLEA 1YTYA 1T9WA 2N82B 3FSXA 1MU2B 3ZC4A 3Q23A 1G4CA 3OV7A 1ITPA 1NDCA 3QGGA 1QAIA 1KVIA 1M1HA 1R0CB 3BM7A 2POKA 3CMAS 1FRXA 3SDEB 3JQKA 3J81j 2LMIA 1KVKA 2VICA 4LJMA 2C3YA 3K5LA 2YKNA 3Q83A 4ILRA 3Q24A 4PABA 2GAHC 3D5MA 4K4SA 4FS1A 4DPYA 2E9RX 4OX9J 1F9EB 5I3UA 5L9XA 1DTTB 3BQ0A 1RT3B 3TARA 2DR9A 1VDHA 4LFCJ 5F8GA 1PGZA 2VBZA 3SQOP 3ILJA 1KEKA 4O44B 3O6QA 3CULA 2ZE2B 2J9CA 4FF2A 4DR2F 1LKZA 5LMUF 5ETQA 5A6WA 3K57A 1TP7A 2OLWA 2W4PA 3LP2A 2BJ7A 4ECYA 1XNRJ 4FP9A 2P8IA 3MFHA 3N5FA 4QIWD 3PW0A 5IFMA 3CC7S 3S7RA 2YWWA 3PY8A 2RAQA 3BO3A 2GGPB 3MM8A 4CM0A 2HFNA 4ANCA 4DV7J 3ZNJ1 4Q8EA 2DGSA 1HQUB 4YP3A 3CWJA 4USIA 2OSQA 2HEKA 5HQMA 4QWEA 9ATCB 1N48A 3KOAA 1NRKA 4AYBD 3SI8A 2YQ3A 2ZKTA 1F2HA 4CH1A 5C25A 1KQSR 2HWIA 3J7Z5 4Y2MA 2E66A 3WX8A 5BJRA 2VHGA 4CLKA 4ECVA 4DCPB 2ZD1B 1JLEB 3DMJB 2HQDA 3PV8A 2J6UA 4PQUB 4J7CA 1FRKA 2LFVA 5EWGA 1IWGA 4DSEA 1UTAA 3Q8RB 1VQNS 3GFHA 1JMTA 2DY9A 5D0RA 3OLAA 1N5QA 2CXEA 2KI2A 2MZJA 1C0TB 3W3SA 4JI1J 1X7VA 1RHJB 2L48A 2FLPA 3O5TB 1WG5A 1N54B 1VC0A 1DLOA 5DDQC 2Q3PA 3RRHA 1UPMB 2LXUA 2DGXA 1FFWB 5A6PA 2DJWA 1VQ9S 1U6FA 3P96A 1L3TA 3MUMP 4UQTA 4DQQA 2IDLA 1XTZA 1NBEB 1HIYA 2K3IA 2LXFA 4L76A 4DR5F 3U1MA 1FKOA 2WW8A 3TX8A 1X4CA 4Q44A 4LFBJ 1CVJA 3MMCB 4NZ6A 3EDRB 2DH7A 4YHHJ 3JTNA 4ZLPA 4YY3J 1HNWJ 2CQPA 4PG4A 2HZAA 2NR0A 2HVHA 1PJ6A 5KFXA 3TVKA 1AW0A 3MEGA 2XSJA 5K8MA 1RTDB 1SJ1A 2WAQD 3D1OA 4A4JA 3R5BA 4LF7J 1NHVA 3S8SA 1T9UA 4QU6A 5C24B 2GVDA 4OX9F 4ZP6A 4XPEA 2OPRA 2GVZA 1SJQA 4NXNJ 4OJHA 1CJVB 5DGBA 4LFCF 1TL1A 1XERA 1EIYB 2DKOB 3FBBA 3C6UB 2VB6A 4Q5VA 1E6YA 1VRTA 3IAM9 2YKMB 4D3GA 2VF3A 5CYQB 2I1RA 2R8GA 3DLGB 1CPZA 1S49A 5CXTA 3MCMA 3ISND 1N36J 2QRRA 5KT6A 4FF1A 1XNRF 1X0FA 2L08A 3I96A 4ANEA 1P27B 2ROGA 1DHMA 4ID5B 2AX1A 4K7QA 4Z7CA 5C7PA 4ES2A 1MWQA 1H38A 2HKEA 1Q5YA 1TZ0A 2KL8A 4RKUC 3J80U 5T14A 5IOLA 2G0IA 4DF8A 1L3KA 2DB1A 2OGUA 4OHXA 2ZKUA 4G1QA 4RZRA 3HHLC 3OR2B 4DUYJ 3T1YJ 2RE1A 3HF5A 1QE1B 2MYFA 4KGZB 2JWNA 3H5XA 2ALYB 2E1PA 1Y00A 1LWXA 3CCSS 5KFAA 1O6XA 4DSFA 1OIAA 4KFBB 1VI7A 1T03B 2MTLA 3CD0A 2LLZA 4CI0B 2QMXA 3ENQA 1ZA1B 3PDNA 5HVHA 4ZLLA 2Y3YA 4ZN3A 3OVAA 2RS2A 4A8QA 3QZ7A 5IM0B 1FE4A 1GX5A 3NY0A 5D3GA 2Z8QA 2AEJA 1AUDA 4AL6A 4RNHA 3I87A 4JI1F 4Z7YA 5A8KA 1WACA 2N3OA 2VG7B 1G3OA 2KYXA 3JAMY 1RAIB 5KFTA 1V3ZA 4Y2CA 1YRUA 4C11A 4KBIA 1X9SA 2CQ2A 1HPZB 3AHPA 1JIHA 4NWBA 1JNZB 3IA0A 2VC1A 3RR7A 4RJVA 4NI2A 5KT3A 1GTHA 1LW2A 1HNZJ 4CNYA 2MHEA 1VJQA 1AUSL 3VAFA 1PYSB 3M2UA 4LFBF 4RNOA 1VISA 2CFXA 4YHHF 3T5LA 1CLFA 3BBBA 4YY3F 1HNWF 3OSNA 4DL7A 2GHWA 4RUAA 1LOUA 4FYYB 5DDRC 3GJSB 2ZVIA 4FBUA 4J9KA 4I2PA 1GXUA 3DXSX 1YHQS 1IQZA 1IVZA 5ETRA 1OPIA 3HI9A 2MGZB 4LF7F 3W5XA 4O3RA 1S1WB 5GMEA 2BJ1A 4CLWA 3MMAB 4BC9A 2HBYB 5B0CA 2GHPA 1AA1B 4NLQA 2LEBA 3BF4A 2A0FB 3QATA 4WYWA 4C8OA 3FKBA 3G8QA 4QR2A 4M5HA 2BYCA 4FVMA 2AV5A 3MR5A 4Y3CA 5ETKA 2ZEJA 1N4LA 2OPPB 3U27A 2GIRA 2UP1A 1HKAA 5KG7A 2HWTA 3ZZUA 3PVXA 2C2DA 3KLFA 4ENOA 1N36F 1H72C 2BW2A 3N4WA 1KC8T 1N0VC 4JV1A 2FC8A 1HWJA 2AYMA 5B08A 4RL1A 4FF3A 2D9PA 4QPXA 1PCAA 2XMMA 1LXNA 4J9RA 1ZM3A 3UI3A 1B99A 1RGVA 2V9WA 4HR2A 1SIWB 4LSNB 1CJTA 2P9EA 1YJWS 3T1YF 1BWEA 4W4MA 4A46A 2EFNA 2VG5B 3LAMA 5KFLA 1LV5A 3W2WB 2HQGA 4USVA 2RQKA 4P73A 2PT0A 3P49B 3OD2A 1K8AT 3N5BA 1ZPWX 5JJBA 2M7SA 3CJTA 2CPHA 1KRPA 2HZCA 4MYTA 4DL3A 2K06A 5MLCV 1X4EA 2A1BA 2J7UA 2OPQA 2QLJB 3QGPA 2CG8A 5KFHA 4J9PA 1SH0A 3I4HX 1QSYA 1SUQB 5BR8F 2H48B 1U1NA 1HBMB 3CT9A 1S0MA 4WU2A 2HAIA 4EK2A 4UOCA 1R0AB 1V3SA 1CULA 1VBZA 3M1VA 2PDAA 4CO1A 3QIPA 3PIPQ 1JLBB 3DRRB 3H5UA 2C2RA 3B4MA 1S48A 3IWXA 3U02A 2CWKA 4RWXA 3TW0A 1NDKA 5ETTA 4CLYA 1S1TA 1HNZF 4ZVOB 1FJGJ 4G1PA 1TV6A 3OTDA 2DHXA 1MW7A 2BW7A 4OYIA 1F5AA 3MUTP 1FX4A 2XY6A 3ZNUA 3UWTA 1AFIA 3Q8QB 1L3VA 3IRWP 5MAOA 2WVBA 1GH8A 4M5LA 4OZ0A 3HVTB 3G8TA 2M52A 3F41A 4OLOA 2YNFB 3EICA 3QMQA 2VJUA 3OSPA 3DLLQ 4C8ZA 3CC4S 4F4AA 3EXYA 1JLFA 3MMBB 4OI1A 1FT8A 2K1RA 1HMVA 2MLYA 4DCOB 2EFVA 2VPZB 6FD1A 1WC4A 4NCBA 2AZ1A 2Q1LA 3JSMA 1U8WA 2Q79A 3RZAA 1J5EJ 4RW8B 4P2MA 3QYYA 1YWXA 3IM9A 3NS6A 3GCXP 2RNEA 1RHRB 3G71S 2P5VA 3CCMS 1I3OB 3RBEA 3Q2TC 3G82A 2Z2LA 1HI0P 2DY1A 2D3UA 4DSJA 4U7CA 1I6JA 1KLMA 1ZZNA 1KFDA 2QTWA 4WFXA 4ZVRB 4WFAQ 1FWPA 4DU8A 1UJ6A 3MEDA 1S10A 1WOOA 2LQ8A 4MK9A 4L73A 4RW7B 1NM2A 2ZOMA 1SL2A 4FPRA 4MFBB 4B9SA 2R7WA 3HKWA 4RNNA 1BWVA 2VQFJ 3QLHB 4H4OB 3P45B 4Y28C 1M1KT 1I94J 2R7VA 2ZH3A 1RLCL 3I31A 2WBRA 3ET6B 3CJ8A 3FGVA 1UVLA 4AQYF 3QT6A 4KGVB 1S1XA 3QQCD 4A8OA 4WTYA 4KHMA 3HLUA 1NK7A 3D1QA 2MKKA 2EKYA 5DQHA 1FHTA 1M90T 2V8HA 1HARA 2GNKA 1RT1B 1WC0A 4AXJA 4N41A 1O5JA 5ETVA 2ASJA 4IH6A 1TKDA 2GX8A 2BEFA 2BRKA 4C8NA 3NKYA 5EGYA 5EN1A 1PC5A 3UR0A 3NGSA 1FEHA 1RTIA 3BGFA 5F8MA 1FERA 1XR7A 4O0IA 4ED7A 2H51B 1MG7A 3DM2B 4I6YA 4YB7A 2FGOA 1S7IA 1RSCA 2HHUA 2XI3A 4R25A 2OO4A 1Q4RA 3UDLA 3AXKA 1Q95G 1RT4B 4OQJA 4O3QA 2NUHA 4USKA 1FJGF 3W8PA 1ZAWA 3R97A 1QVFR 5SZTA 5LJ3Y 1B0TA 4DX7A 1JLQA 2XY5A 2QV6A 1Y9OA 2N4DA 2WB1D 1CJKB 2HHVA 3BGRB 4ZPBA 1DQAA 1BHNA 4I7FB 2G2YA 1R8PA 2LU2A 5HSPA 3LH2S 3EWGA 3QRPA 1NLKL 5IWAJ 1RWNB 1JJHA 3LP0A 2V8GA 1YJNS 3CJSA 1FE0A 2E7XA 2ZHOA 2QT7A 4YDXA 1TUGB 3F73A 5CYMA 1KDNA 3EGNA 3GFZA 2XLKA 3RW6A 2AT1B 2MJNA 4GO5X 2RKIB 1J5EF 2YVSA 1IKYB 2G0JA 1WI8A 4DLEA 3UN3A 4IDKB 2DXFA 1KHVA 4FXVA 1JLCA 4DQSA 1FFGB 3JXOA 4NLUA 4GKJJ 2M8DB 2XI2A 3SXLA 3PW2A 1RWVB 4DX8H 1NHKL 3M2VB 5KFSA 2QC3A 2AJ1A 3E01A 1Z4UA 3JSYA 2WK4A 4M5NA 5KFQA 1I5OB 1DBDA 2FQQB 2LQ5A 4DXLA 2CJYB 5DO2A 3VCDA 4J9NA 1RUSA 3HXMA 2IVFB 1QSSA 3CCQS 4C8MA 4ITSA 3PYDA 3R1HA 1F6TA 1I94F 3BGLA 3V4IA 3A4TA 4KT0C 3SV4A 2HGMA 4NXMJ 3D0IE 3OT9A 5KFRA 2BA9A 2I38A 1C0UA 2YWKA 2CG4A 1IBLJ 2R7TA 1HBNB 3BBCA 3BPSP 4MIBA 4X4UA 4KO0A 2B3TB 3PYEA 4J90A 1SJRA 1TAQA 4RW4A 3GYNA 1N88A 3GV8B 2YKOA 3TEGA 3PO5A 5E3AA 1BMQB 2VKRA 4LR9A 3QAEA 2ZJPQ 4J9QA 2QJ3A 3GR0A 3I0SB 4ZVPB 1RWKB 3M2RA 3R7NB 1IKXA 5HN0A 2E5HA 3I4PA 2YH0A 1BQMA 2B4VA 1RT7A 1J5OB 1LFPA 2Y0SD 2DITA 2CQ1A 1RTJA 3BSNA 3SV3A 4PAAA 2MB0B 1A7GE 4I68A 1F3FA 3BBFA 1O51A 1RP5A 4IFVB 1RK8A 2D74B 3HJFA 4A8FA 5KFOA 4HDHA 3OFGA 2JEGA 3BPDA 1UKUA 3SSSA 3N6MA 1WI6A 4CLFA 3RGIA 1UMJA 2GS8A 2ERRA 4JI8J 4O3SA 2HS4A 4WIIA 1QDUB 4LF4J 3ZO7A 3M9OB 3RAXA 1NEEA 4Y6IA 2JC0A 1YRTA 2FHJA 5A2QY 4F67A 1X4BA 2W9CA 5IWAF 4DQIA 4ZVHA 1HHQA 5KFNA 3J81U 2PO4A 2B5JB 3TVZA 5LSLA 2RVJA 2W9BA 4QWBA 3L9ZA 2OEKA 1K0VA 1P1LA 2ATCB 2XO6A 2AGOA 2E5LJ 5HVGA 3EVMA 1VLYA 2K7JA 4LF9J 3ILOA 2NREA 3R7BB 2OEJA 3TWZA 3OR1B 2FZGB 3H7HB 3QRQA 1RHUB 2PIIA 5ADZA 3WZ0A 4WTOB 1WD6A 2XM3A 1U49A 1VRQC 1REVB 4ECXA 5A0YB 4GKJF 4NYOA 2RSQA 5F41A 2MQLA 4ERDA 2YKAA 1Q16B 2H5JB 1C1CB 2IBKA 1Z1ZA 4O3NA 3SFGA 4HT5A 3DI6B 3DC2A 4WP8A 1S97A 5IT9U 1S76D 3CEDA 4UQGA 5LXYA 2GIFA 1SC4B 1CEZA 2FHOB 1KSPA 4ZVGA 3PX6A 2AYGA 4CT9A 4N8NA 2VG6B 1Y5IB 4F36A 3FEXB 1IBKJ 3PYGA 1JLGB 3HHDA 1JNRB 2AYBA 3GJQB 1CC8A 2ZC3A 4P7VA 4K4ZA 2PMZD 4NXMF 2LYVA 1VBKA 2W4CA 3H4DA 2ZM6J 5L38A 2WW4A 3MM6B 1X31C 5FD1A 3HD2A 1IBLF 1S6QA 3RU0A 4X4VA 3TO8A 2DK2A 2HAFA 1OSDA 2ALZA 1S5ZA 1BD6A 4CM2A 4UY8T 1UEVA 5RUBA 1BQXA 3TUIC 3QO9A 5DG9A 1SKWA 2YTCA 4KKOB 4B3MJ 5IZHA 3BQ1A 3UCGA 4F4ZA 2AMCB 3A13A 5B0DA 4ZMMA 3DGPB 4RBTA 1GTEA 3N01A 1FRMA 2GCFA 4WK1A 2UUWA 2QL7B 3HO1A 4DN0A 3US5A 4EMDA 1ZM2A 1R7IA 1QTMA 2F1FA 4RNMA 2HHQA 3CJ5A 2W9AA 2UUBJ 4YDDB 2HNDB 4LIRA 2ZOFA 2YPZA 2IMWP 1WHXA 8ATCB 2MKHA 1SKRA 4A8WA 3VGVA 2CDQA 3CCVS 3M30A 4JI8F 5D15A 1RWOB 4LF4F 5HLFA 1WF2A 2N3LA 3MPVA 2VC0A 2CDRB 2CQHA 1WORA 4NE9C 2AQ4A 3CCZA 2OFGX 3T3FA 4GKKJ 1OMSA 3IGNA 4OHWA 1TFYA 2H3EB 3DRPA 4CZCA 1LW0B 2OKQA 3I5AA 2XCAA 3QWPA 2QGFB 1TKZA 1RQ0A 1UL3A 3KK2A 2J0QD 4B9UA 2E5LF 2YKPA 1FF2A 1HFEL 3KNGA 4LF9F 3T5JA 4YB1P 1Y11A 4C8KA 1L3SA 3KDOA 3OJUA 4KYZA 3AT1B 3AA8A 1FD2A 2XG8A 3HFZB 4OI3A 3G6YA 2D41A 3M4XA 4FZVA 2DR7A 4U8VA 4DQPA 2BE2B 2MJUA 1TAUA 3BR8A 3IBCB 3QNWB 4IKAA 4PG5A 3ISZA 4F02A 3BYRA 4A8KA 2ADBA 1Q86T 3MHYA 1YDLA 4ATNA 3NGRA 1IKVA 3PM9A 1FWKA 3SCLE 3W2VB 2VU5A 2EK1A 1TKTA 5HBMA 3WX4A 2BDPA 4AFFA 1QLNA 2YNIB 3ITHA 1PYOB 3QAUA 3R6LB 5J2PB 4DF4A 3UVJA 2DRAA 2RF2A 3MM5A 2IDEA 2XMJA 2HNYB 1WHWA 3D0GE 4PUOB 4PCQA 2EBEA 1IBKF 1UVIA 1S59A 2BKNA 2JFKA 4K4YA 4DFPA 1UW9A 2XMKA 2DGQA 3X1LB 3PO4A 4OL8A 2V4JB 4QZVB 2ZM6F 1PO6A 4ZJLA 2CQIA 1R43A 2NSBA 4AXIA 5IS2A 1KVJA 2XGPA 5E5NA 1IKWA 4EBCA 4HACA 1SH3A 3CJKA 1WELA 3IWNC 1HQEA 1JKHA 1VRUA 3CTRA 5F8JA 4B3MF 1CC7A 5J2NA 3J7YU 3BSOA 4KPYA 4L72B 2ZUAA 5J1EA 3DNCA 4H4MA 4WZQA 2Y1JA 3X3UA 3E8OA 2RH3A 1KD1T 1GAOA 2R2SA 5H9FJ 5L1KA 4OI2A 4PXCA 4WE1A 1FTRA 2XC9A 1NSQA 5HROB 2DHHA 2UUBF 3OTBA 3G8SA 4QW9A 2W2OP 2MQMA 3RBZA 9RUBA 2DXDA 1DZ5A 2O1PA 3ZTSA 4YQWA 1BC6A 3C16B 4F4XA 1FEEA 1NSKL 3FMBA 4ZLJA 3VHQA 5EWFA 3KUGA 2R4FA 1S1VB 1X4AA 1WKKA 2MQOA 2FJWA 3J80Y 1Q8LA 1AZSB 2BQ3A 3FEYB 4BS2A 4WF9Q 4RR5A 4CCHA 4GKKF 2HBZB 5AXMA 1WHYA 4ZHRA 2VDIA 2CQCA 2B4UA 3HHNB 3V6DB 5IT0A 1NKEA 5HMYA 3GIMA 2BACA 5AXKA 5I42A 3BR9A 1JQGA 2CZ9A 1XIQA 2KM8C 2AW0A 2ZNYA 5JVHQ 1SV5A 2HWHA 4UOHA 4LR8A 2XYPB 3ISNC 4OYBA 2AKWB 2OPSB 2B7BB 2LCWA 3NWRA 1LWCA 3N28A 1G2EA 2WONB 4LBPA 5ETSA 2RD5C 4LSLA 3AFGA 3RB3A 2GMLA 2CZVC 4ZIVA 2HW3A 5K14B 1U7LA 3ZZPA 4FN5A 3KHRA 1HBOA 4DV3J 2C3OA 3UE2A 4J91A 3I0RB 4OZLA 4MIAA 4FBTA 4N5SA 1RU2A 2DPJA 1NJYA 1RKJA 1RTZA 1NUEA 3CJ2A 3G86A 5E2QA 4G6VB 1SIZA 4I64A 3RBXA 3R3TA 2W8LA 3NGUA 3KFWX 3LP1A 1GMUA 4NLSA 3DYAB 2DNRA 2BANA 1VK8A 3HT0A 2C22A 4QU7A 2V8VA 4LRBA 2B4PA 2CQ0A 1TVRA 3K59A 1EETA 5AE1A 1D3WA 1RYRA 4QPTA 1W26A 4F25A 3CMES 2DEJA 2ZH9A 2C28A 1PJ5A 1KBRA 1FD8A 1OWXA 3C19A 4KJIA 2X3DA 3MOJB 3T41A 3CDEA 3QSIA 4EU0A 2OAUA 2J6TA 4PKDB 4OZNA 3HHKA 4PWUA 4ECTA 4QWCA 3CO0P 2G2OA 2RIJA 1UVMA 4YB6A 3QFHA 1SH2A 1ZM4A 2AEMA 4YR3A 3CCUS 1RLDA 4QIFA 4DZ6A 3F0NA 3CCLS 3B78A 1RA6A 3JS9A 3RRGA 2HGNA 5I3UB 1GMWD 5B0GA 3D1HA 4FYWB 4WXWA 3RUBL 1YJUA 1ZAVA 5LOQA 4P2XA 1DTTA 2VFSA 2P2CB 3LA0A 2IM2A 2QIFA 4EGLA 3FMWA 2DIVA 1U2RA 3MDFA 5F8IA 3KMSA 4BLGA 2MPUA 3LP2B 4OLPA 2ZOGA 2QO3A 3FRZA 2DHSA 2HLUA 3NBPA 2C2OB 4K5SA 1DY3A 4I0WA 1CBKA 1HNXJ 3KDNA 3GSIA 2W25A 1F2GA 1PC4A 5CAAA 3MM8B 4CO4A 2YX4A 4KGKA 1S72S 5KT7A 3ULHA 3GTYX 5CD4A 3OTEA 1VOMA 4P2FA 3SSRA 2EFOA 4PXBA 5DLGA 4QWAA 3NL0A 2OMOA 2A3JA 1RAGB 2R7XA 2XGQA 2J7KA 5F0WA 4LFAJ 3O8WA 5C25B 5DGAA 1Y0HA 1N34J 2M88A 4WP9A 4XDCA 4UZCA 3ELHA 4K2JA 3JYTA 1QAYA 4OZ3A 3K7RA 2YNHA 1U24A 3BYPA 2HPUA 5EDWA 5KT4A 4DV3F 4PQUA 4CO3A 3KLVA 3W1YC 5LMNJ 2RMLA 2BM1A 5GAEI 2QLBB 1S7HA 4IFYA 3SBMA 4ZCMA 2RRNA 1HW9A 1YITS 3MM9B 1DLOB 1C0TA 2VA2A 4CTAB 2MKIA 3S6EA 2MEWA 2E5IA 2XSFA 5ETLA 2NYHA 5HJXA 4DPUA 4BWJA 3CJ4A 3NS7B 4C7QA 2MZRA 4IH5A 5DETA 1F9FA 1FKOB 1ZPVA 1R8CA 1VQ8S 3MTKA 1TL5A 3H20A 2EFGA 4JB8B 1S57A 2AEFA 2MQPA 4LMZA 1T3NA 3GMGA 3VZIA 4NLOA 1Q82T 3R27A 4S0MA 2LA6A 1H3DA 2BV3A 2D3OR 4PYAA 3QJJA 5BXIA 1QTNB 2DHGA 5F9LA 4U6PA 4DG1A 2XSJB 2WCXA 3VTIA 4DWIA 1KS2A 2ZH2A 3LQVA 2R9LA 2U2FA 1LWEB 2JZ5A 2V4QA 2OPRB 1M1GA 3W63A 1ULRA 4NLGA 2H9ZA 1YG0A 3EDQB 1TKXA 4HEA9 2OMLA 3CD6S 5C24A 1TL1B 3ZTRA 4C3KA 2H5EA 3EJMA 3IXQA 1YJRA 5KG5A 3GWCA 4CDIA 3FSYA 4ZK7M 2BM0A 3MPWA 1CJVA 4X66J 2PC6A 1E6YB 3OFFA 2D3ZA 1LK7A 1VRTB 3MZIA 3PZPA 2LDIA 3N79A 1UVJA 3AQPA 1NK0A 5LSOA 3C6UA 1MMLA 4KB7A 2XHWA 3U1LA 3HVRA 3EMTA 1VCTA 4F3OA 2DCLA 1HNXF 4W98A 1U1PA 4DR4J 2IBOA 5L1IA 1HA1A 4ID5A 4ZPWR 1GXLA 4G1QB 2EG2A 2VBYA 1HD0A 3UCUP 2F3JA 2XMVA 1C4AA 4NRUA 3UN2A 1M0SA 1VC5A 3M32A 3WDOA 4MYUA 3R5DA 3LUYA 3RG6A 4LFAF 3NNCA 3D6TB 4DSKA 5HO4A 1LQ9A 1N34F 3UNYA 3BH6B 2NS1B 3GIIA 4FPIA 2ZH1A 4ICLA 1H74A 1VBXA 2Q6BA 5D3GB 2DVIA 1G7CB 3H2VE 4B9TA 5LMNF 3N9UC 1S77D 3HDSA 4EO6A 2A18A 4HDGA 1GEHA 2JLGA 3PRDA 1FNMA 1RAOA 3H5YA 2V50A 1YI2S 4C11B 5CABA 2B8QA 2CQBA 3H59A 3BSAA 2JLFA 4K4WA 1GK8A 3G9CA 3DOMA 2RUGA 4NI2B 5HK4A 2KU7A 4CLZA 4AT1B 1LW2B 1HPZA 4DV2J 1XMBA 2FDNA 3VWSA 3M2UB 5KFYA 3BQ2A 4TXSA 2X1GA 2RJZA 4H54A 1U1QA 4LRAA 3VQTA 1KKHA 1VJWA 2GC8A 4O0NA 3ZZOA 2R42A 2F9JA 1R27B 1FDAA 5CA5A 4QYZK 4I2PB 3Q8PB 3ETOA 4C0OC 3GPAA 1N5VA 2VQEJ 3IMQJ 1BLUA 3KK3A 3GLJA 2Y9HA 5KOXA 2HGLA 1NJWA 4NLPA 4TYBA 1P8GA 4OI6A 1T7PA 3UFCX 4EWTA 1TU0B 3B8HA 3PCOB 4CO5A 4B3TJ 2HLTA 3FZBA 3RTVA 1QJHA 1S1WA 2WVCA 2E9ZA 3W5YA 4K59A 1PAEX 3M6UA 5LJ5Y 4X66F 3TZXA 4E8UA 2JEFA 3D2WA 4KSEB 5DDPC 3M7VA 3KLFB 4L75A 2FJAB 2SXLA 5T41A 2OPPA 4DHVA 3OL9A 3MURP 3SCKE 3Q8UA 1H0HB 4DR4F 1S79A 3NGDA 3HZGA 2IPOB 2KZMA 1C4CA 2E1RA 2ZH7A 2PEHA 4A48A 4TY9A 1CJTB 2KFZA 3U1NA 2DR5A 2BR0A 4J9SA 4IQXA 4HTJA 2CNKB 2HIYA 3GJRB 5J1PA 5EUHA 3GB0A 2DH8A 3UDEA 4FF4A 1RT6A 3W2WA 4OYWA 2H54B 4DL6A 1U0HA 4K2XA 5C42A 3KK1A 3KJVB 1X60A 2Y8YA 2D3O1 2CADA 3P4UB 5CCMA 1S9EA 4DX5A 4YR0A 3TI0A 4B9NA 1ROFA 4RW9A 1H7WA 1HNIA 2AGPA 3KG4A 1B7FA 2KXHA 3TJAA 4GVBB 3L7PA 5FIIA 4DPTA 1MWYA 1CULB 5KFZA 2B9XA 3M1VB 1AXQA 2AWZA 3MPDA 1GFWB 3QIPB 2YNGA 4TKTA 4B3SJ 3LOUA 3OBIA 1R0AA 3MFIA 2PA3A 4JI6J 3VVTA 2CNLB 2M9KA 2JSXA 2B8PA 2MDAA 3JTOA 2K3KA 4U9RA 2DGVA 2YY3A 1JLBA 2VASA 2HFVA 2DO0A 1UVKA 2DR8A 1XN9A 1EARA 2MY8A 2AU0A 3MM7B 1S1TB 4M63A 1WKLA 4OMFG 4RU2A 2R7SA 4M94A 2IA6A 4OHYA 1T0TV 3HSJA 3KHGA 2IYGA 4X64J 2HHPA 4GC6A 1VQPS 5DJBA 4WKRA 3DHWC 2ZZNA 4TY8A 3ILLA 3J81Y 2VQEF 3HX9A 4XTTA 2X51A 3BSCA 4OV1A 2XWXA 1U1OA 3GYXB 4WXOA 3HVTA 2I9SA 1JLFB 1U48A 2WVEA 2GQCA 2K1RB 1WHVA 2R7RA 1KHWA 1T9TA 1C1BB 1HMVB 2CA9A 1TL3A 1D9AA 3KJNB 3I56S 1HQ2A 3C2PA 3MAAB 1JB0C 3JSMB 3K2YA 4DSIA 4ILMA 4N7TA 3PFEA 3TYTA 2VL1A 4OV6A 1N56A 3CD5A 2A2DA 4NX9A 2B51A 3M05A 4ZP7A 3G82B 3KYLA 4OX7A 1HD1A 3HHLD 4QIGA 1P9YA 1H98A 2C2ZB 4UOGA 2I5JA 1KLMB 4C98A 1IM4A 5GMKa 2IY5B 1D8ZA 5IT9Y 3MEDB 1WTBA 4NRTA 1YRXA 2FVSA 1VQMS 3MPUB 1DFDA 2FZKB 1YZ7A 4CYUA 4FYVB 2CIMA 2XWYA 5DZ6A 4PYDA 1OPZA 5DQGA 3CPWR 1Q7LB 1FNOA 2F9DA 1SKSA 4OZJA 2NXUA 1F9HA 4DZDA 2X1FA 3J7ZT 2DNOA 4QIVA 3UO0A 1U09A 2BKOA 5KFDA 1S1XB 3TAMA 5K8OA 1R31A 1QAJA 3FDSA 3AAWB 1NZAA 2RDIA 1ZOTA 4LRCA 3NP5A 1RADB 4WYLA 1IUJA 2WHOA 5L39A 3EVWA 1Q78A 2MHNA 4ANDA 1HBUA 2IMOA 4V19J 2C3PA 2BRLA 4RO0A 4NLTA 3VAKA 1RT1A 2P9GA 2FVCA 1RTIB 5LM7E 4CLPA 1NK6A 5H9EJ 1TK0A 2ILYA 2KJVA 1F60B 2VFTA 3CJQA 4DUTA 4B9VA 4B3SF 2UXBJ 2IJFA 5FDLB 3UD5A 2JDJA 4AL5A 3DM2A 3TX0A 5E33A 2FJVA 3UN5A 1EKRA 4EEYA 4WFYA 3GP9A 3FCHA 2MXYA 1K73T 2R7OA 1RT4A 1RDRA 2IRUA 2FVPA 3ZTPA 2FJDB 4GMKA 3RAQA 2GAGC 4ES1A 1M5KC 4X64F 2MZ1A 1TQLA 1VK3A 2DNZA 3IR6B 1D1UA 5G0RA 3IBWA 2VBXA 2CJ9A 4IRDA 1GMVA 3LALA 1V3RA 2ABYA 1J2VA 1CJKA 2Y1IA 3A8JA 4K8RA 2WBMA 3LP0B 1UFWA 3QBCA 4I7FA 2QA1A 4RPFA 3KG1A 1FI4A 1LWFA 5IQQA 4PRFA 1UEKA 3R5CA 4M1KA 5CYMB 1BQNB 3QT8A 2VOOA 2BE9B 2KKHA 2NQPA 4DFJA 4XIUA 3BB5A 2HIQA 1IR2A 3LGHA 5K8PA 4KC5A 2J9DA 1T05A 2RKIA 3CC2S 1RAJA 3TRGA 1EKSA 1JLCB 4IOCQ 2GFFA 5ETOA 2ZH4A 4LF6J 2X1AA 2ZH5A 4RUHA 1KQKA 2FZCB 1E6VA 2HBRB 2BJEA 1XMOJ 3WHIA 1CSJA 2B6AA 3TQEA 4X4NA 1MWZA 3R2DJ 3E01B 1HHSA 2QEXS 2AP6A 4Q43A 1HNVB 2FHKA 5SUHA 3FQLA 1UFLA 2OUGA 3SMZA 2ACMA 3O3LA 1RWUA 2V69A 5B7WA 2APOA 1FJ7A 4LUBA 3V4IB 2DIUA 5F9NA 1FXDA 3CMQA 1C0UB 4CO2A 2G4BA 1YZ6A 3KLIA 4DPWA 3TANA 1YBTA 1X5OA 2O5DA 5ETMA 5FLXU 5D0GA 1WC5A 3GFXA 2EFQA 2X3GA 2GA7A 3PNIA 1X8DA 3KLGA 3MEKA 3GG1A 5CD4H 4NMLA 2HVDA 5KTQA 1FRJA 2M4MA 4USTA 3BREA 2QMUB 4N56A 3H5SA 2CAJA 3M2RB 3OPKA 3BZQA 5LL6d 3A3NB 1IKXB 1SBRA 1URNA 2IC3B 4FXWA 2J0SD 1BQMB 1RT7B 3IFEA 4I67A 2V2VA 3EZOA 4DMZA 2KT5A 1RTJB 4DV7F 2Z56B 2EC2A 3C15A 3L7UA 3H0PA 1JLAB 3KNAA 1XR5A 5IT4A 4DSLA 3EGWB 1NJXA 4Y2IA 1U6ZA 1CJUA 4MT1A 5E7OB 2FD2A 3A1YG 2ZC4A 3THPA 3PTWA 2XNRA 1WJ9A 4IO1A 4GC7A 4NEZA 2Q6CA 4M5KA 4JBCA 2WB4A 3VZHA 1R6VA 2MSSA 4USHA 1OYEA 2O67A 1Z2ZA 5D4LA 2MLZA 2W9CB 2KZZA 2V2KA 3MAQA 2R2UA 2HZVA 4M95A 2GJFA 2QL5B 3OFEA 1W2IA 4X62J 5B0EA 3MR3A 3P8BB 2W9BB 2YWEA 1M5VC 1RT2A 3NNHA 3V81A 1PG5B 2A2CA 3R2CJ 3LGMA 2CPEA 2HFSA 2BX6A 2EG1A 3IG1A 2ZH8A 3BO4A 1NH7A 1M5SA 2AF6A 1HWUA 2L9WA 4LF6F 1ZYQA 3KLHA 3ONQA 1XMOF 2UUAJ 2JEIA 3D54A 1N5SA 2V9KA 5L1LA 4IG3A 4C8YA 4DR3J 2E1CA 5LSRA 2XBPA 1NZ8A 4CH0S 3C66A 3MGJA 1FWLA 4DR6J 2ZBIA 3W9JA 3OUYA 4JV2A 3EVOA 2HMIB 3CCES 4I56A 4F4KA 1YKWA 3IRXA 2BZ2A 2DO4A 3D67A 2IAJA 3Q2SC 3H2UB 3M8QA 1PIEA 4NXNF 5J2MA 2VG6A 5KFFA 2BQRA 1JLGA 3I82A 1VHFA 4KV8B 3MD1A 4MKVA 1TUWA 4M5GA 3POTA 4DR1J 1S6QB 3C46A 2YWHA 1VS3A 2ZUGA 2R2RA 2KFNA 5A8WA 1TL4A 2UV8A 1NPKA 5D0EA 1CQMA 4HT7A 1DURA 1ZTWA 3QO9B 2Y1LB 5EWEA 4Q0BA 3TEHB 2DR6A 3OW2R 2UXCJ 4B3RJ 2KG0A 7AT1B 4TU7A 3RYLA 1EB0A 1T9XA 1NSPA 3D6FB 2W8KA 4KKOA 3MEEA 4DCJB 4RU9A 4W92B 4HHUA 2F65A 2I8EA 3HHLB 5A8RA 2DHAA 4DUYF 4O4GA 4DFMA 1ICEB 1IN0A 5IQ6A 2GMJA 1MNEA 3ILIA 3K89A 4HKQA 1LFWA 2VODA 1IR0A 4Q45A 3VV2B 4A8MP 3M30B 4KRWA 2HG4A 3CE8A 2K8GA 1H2TZ 2XZTB 4RW6A 2CPDA 3QJLA 3NOGA 3OL6A 4HH1A 5DRKA 4WP3A 2OTLS 1HW8A 3DRPB 2LECA 4X62F 1U1KA 4XK8C 2ZBCA 2CPYA 2L3MA 1SL0A 3GSDA 1TKZB 4UF4A 2WOMA 1OY8A 3KK2B 4ZA1A 2PGCA 3DOKA 4M5DB 1XMQJ 2FY1A 4FS2A 4LF1A 5B0AA 2CUYA 2BUNA 2GMHA 4HI2A 3FC9A 3EGVA 4J5OA 1Y3JA 2CVIA 3WIUA 3M8SA 3OHAA 2FGCA 1V5VA 1TK8A 1VYAA 1VMBA 4DN9A 1JX4A 4Q2MA 1OQ3A 4CWBA 2BE2A 2QA4G 1VQSA 4WKYA 3R5JB 2IA0A 2UUAF 4IYQA 3HCXA 1IKVB 4OZ2A 3FJ2A 3NLCA 1FKAF 3OXFA 5HL7Q 3D4JA 3E2EA 4GO7X 1U02A 3ITHB 3M8WA 2HRYA 1T94A 4DR3F 2G13A 2DNMA 3UVJB 2FYXA 3C6TA 2EK6A 1XEZA 2JVRA 2RF2B 3MM5B 3KHHA 4EO8A 1X9WA 3TZWA 2Z2MA 3HSGA 5J2PA 1NXIA 1K44A 3KMQA 3CCWA 5GVQA 2B43A 4E2FB 3ICLA 2WTFA 3B6BA 4CLTA 4OYAA 2YBVA 2XMUA 3IGVA 4LR7A 4B9MA 4MK7A 4IG0A 4DR1F 1CS4A 3TUPA 2H1YA 5KFKA 3W66A 1IJEB 1UCNA 1Y5NB 2BVZA 4P74A 3VGSA 4KGXB 1IKWB 2PFDA 2QFJA
chains in the Genus database with same CATH topology
1SH2A 1ZM4A 3KTQA 4OX9F 4DL2A 4ZP6A 4KV8A 4NL5A 4F4YA 4XPEA 4KHPF 5A8WB 2OPRA 3C8YA 4YR3A 1IQTA 3CCUS 3CSKA 1HQEB 2FHMA 1SJQA 4QIFA 4TQRA 3EXCX 3GR1A 3DLJA 4NLVA 3CCLS 3B78A 3M6WA 4OJHA 1RA6A 5DGBA 3RRGA 4LFCF 1NB7A 1TL1A 2HGNA 4ZS6A 5I3UB 4CIOA 1XERA 5J1EB 2UXCF 4X4RA 2VA3A 4B3RF 3PW4A 1D8YA 5B0GA 3D1HA 1Z2LA 3LGNA 4Q0BB 4WXWA 1NHUA 3C6UB 2KB2A 1XWLA 2VB6A 4Q5VA 1YJUA 3LWMA 1E6YA 1ZAVA 2XULA 3IC1A 1VBYA 1FDBA 1VRTA 2HFOA 3IAM9 2YKMB 4WE1B 4D3GA 1DTTA 1VQYA 2VFSA 5CYQB 1FNXH 2I1RA 2R8GA 3IAS9 2DISA 2IM2A 2M0GB 3VAMA 3MEEB 3AJ1A 3DLGB 2QIFA 4EGLA 4LQ9A 3Q22A 1CPZA 1S49A 4RNFA 5CXTA 3FMWA 3ISND 1KQFB 5J2QA 2QRRA 4DJBA 2NLWA 5KT6A 2DIVA 5A8RB 3AH6A 4FF1A 1XNRF 3F56A 1X0FA 3J7A1 1U2RA 3MDFA 4OFZA 2L08A 4O4GB 3I96A 3BJYA 1P27B 5F8IA 3KMSA 2ROGA 1DHMA 4ID5B 2AX1A 2MPUA 1N5TA 1Q8IA 2RQ4A 3LP2B 2ZOGA 4OLPA 4ES2A 2QO3A 2L9DA 3NG8A 3FRZA 4NPOA 2DHSA 4F26A 3TQ1A 2ASDA 2HLUA 2OJ3A 3NBPA 5HROA 3HHLA 1X5SA 2FHJD 4LSNA 3E3XA 4BWMA 1H38A 4K5SA 4I0WA 4G3IA 1TZ0A 4TLQA 4RKUC 4CT8A 5T14A 4X84A 4JOUA 4DF8A 1L3KA 4UUXA 2DB1A 2DNHA 4OHXA 2VG5A 2ZKUA 2W25A 4G1QA 4RZRA 3HHLC 1F2GA 3OR2B 4U67Q 1PC4A 5FJ4A 1GX6A 1FVSA 2RE1A 1QE1B 3HF5A 3MM8B 4CO4A 2MYFA 2YX4A 3IS9A 4DBQA 2JWNA 3H5XA 4KGKA 1S72S 1NNDA 3ULHA 3I5CA 5KT7A 2OPQB 3OTEA 4RW6B 1Y00A 1VOMA 3CCSS 1WNEA 4ZHRB 5KFAA 2ROEA 3SSRA 4DSFA 1OIAA 2B0GA 2EFOA 4KFBB 4PXBA 1N52B 1VI7A 1T03B 4IH7A 3BEGB 2MKCA 3CD0A 5DLGA 4QWAA 2LLZA 4CI0B 2OMOA 3NL0A 4EZ9A 2YWGA 1U45A 2FLLA 1QUPA 3CDUA 1S1UB 2A3JA 2AJFE 3IN5A 2QMXA 4Y0FA 2RB7A 3ENQA 5I42B 2R7XA 2XGQA 3PDNA 2J7KA 3GE9A 5F0WA 3KG0A 3HPOA 3O8WA 5C25B 3JTPA 5DGAA 4N8OA 1Y0HA 4ZDNA 2M88A 3ENVA 3OVAA 2RS8A 1SUQA 4XDCA 1SV5B 2RS2A 2HNZA 2Y1RI 2WOMB 4A8QA 1YSJA 2OD4A 2HRUA 3QZ7A 5IM0B 1S9GA 1FE4A 3DOKB 1L5UA 3JYTA 1HBMA 2J5AA 5EHHA 1QAYA 1GX5A 3K7RA 2YNHA 1KFSA 1U24A 4NOHA 4QIEA 5D3GA 2Z8QA 4UY85 4X4OA 1AUDA 2HPUA 4AL6A 1DQ8A 4RNHA 1K1QA 5EDWA 3I87A 2PI5A 1MROA 4JI1F 5BYSA 5KT4A 1M5OC 4WCEQ 5A8KA 1WACA 2N3OA 3CD7A 2C2EA 2VG7B 4DV3F 4M5DA 5KFGA 3V6KA 1G1XA 1G3OA 2G0CA 3DRRA 4PQUA 2KYXA 1T95A 3CO9A 2WONA 4CO3A 2MZSA 3KLVA 3JAMY 3I55S 2KTQA 2RMLA 2BM1A 4DV2F 2K2PA 5KFTA 5GAEI 1X0PA 1V3ZA 3TUZC 4Y2CA 1HBOB 1TV6B 4C3LA 1YRUA 4C11A 1S7HA 4KBIA 4IFYA 1MMDA 1NKBA 4ZCMA 1X9SA 2RU9A 2RRNA 1HW9A 2CQ2A 1YITS 3MM9B 1DLOB 1HPZB 1C0TA 2VA2A 4CTAB 2HYIB 3AHPA 1EP4A 1JIHA 2MKIA 2PE8A 4NWBA 2ILZA 2JJ4D 2QLXA 3S6EA 2FUG9 4NLDA 1JNZB 1HL6A 4WFNQ 2AGQA 2ZHBA 3IA0A 2VC1A 3RR7A 3SEOA 4IR1A 4MAKA 5KT3A 1GTHA 2E5IA 2M8HA 2XSFA 1LW2A 1FDDA 4CNYA 2FC9A 3G6ES 2ASYA 4BWJA 2MHEA 2N4CA 2KDOA 4IRCA 3CJ4A 3C6TB 3VAFA 4C7QA 1RTHA 2BANB 1NAQA 2MZRA 3M2UA 5KFUA 4IH5A 1HHTP 4LFBF 4RNOA 5DETA 1F9FA 1HWIA 5T7LA 2E9TA 1FKOB 2DNGA 5DG7A 1ZPVA 2Z4PA 1R8CA 1UJ4A 1N8RT 2CFXA 1V9OA 4YHHF 1TVRB 3T5LA 1CLFA 3TNVA 4JI7F 5DM7Q 4YY3F 1HWLA 1HNWF 1VQ8S 1EETB 1Y3KA 3MTKA 1TL5A 3OSNA 5D8HB 3H20A 2ZVSA 2EFGA 4IQMA 4DL7A 2GHWA 4RUAA 1LOUA 5DDRC 2MQPA 4LMZA 2YNFA 2QYCA 1WG1A 4AE5A 1T3NA 3GMGA 3VZIA 4NLOA 4FBUA 2NZ4A 4J9KA 4I2PA 1Q82T 3R27A 2LA6A 2QSWA 4ELVA 4X4SA 1GXUA 1H3DA 3DXSX 2BV3A 2W7OA 4DS5A 1IQZA 2D3OR 1YHQS 4B3TF 4OZ5A 3HP6A 3QJJA 3MMBA 2FLNA 1DJ0A 5K5MA 4IG0B 4DLGA 2DHGA 1OPIA 2K7KA 3HI9A 5F9LA 2AJ4A 4U6PA 2MGZB 4UW2A 4ZPCA 3MOZA 4LF7F 4BBYA 4O3RA 4DG1A 2XSJB 3HFKA 1G6BA 2WCXA 4R5PB 3DRSA 4IOBA 5CHCB 4JYAF 5D4NA 1S1WB 3VTIA 4DWIA 2CQ4A 1KS2A 2LEAA 2UVWA 4C9DA 3PRBA 3PX4A 3T6BA 2ZH2A 3T6JA 2I2YA 3K8WA 3LQVA 1FDNA 3MMAB 2JLEA 2MY7A 3DFEA 5KFJA 2R9LA 4BC9A 5G4DA 3SSQA 5B0CA 3THVA 4RW8A 3D0HE 2GHPA 4DV4F 2U2FA 1S6PA 1LWEB 2JOQA 4KAIA 2JZ5A 2ATLA 4NLQA 4XPCA 4JV5F 1LK5A 2V4QA 2OPRB 3UD3P 2LEBA 3BF4A 1ULRA 1YVFA 4DOZA 4WYWA 2H9ZA 4NLGA 1YG0A 1TUVA 4C8OA 3BDEA 1TKXA 4PXEA 4HEA9 2OMLA 3CD6S 2FVQA 5C24A 3G8QA 1TL1B 4QR2A 2BYCA 2H5EA 4NZ0A 4C3KA 2EC0A 3IXQA 1YJRA 4FVMA 5KG5A 2AV5A 3MR5A 2RDJA 1FCAA 2EFPA 3GWCA 4Y3CA 1N4LA 4ZK7M 3FSYA 3OVBA 2R2TA 2BM0A 2OPPB 2GIRA 3MPWA 3U27A 5K9FA 2UP1A 3D28A 2DNYA 2VONA 3L95X 2VQFF 5KG7A 2HWTA 3ZZUA 1XK8A 2PC6A 2M2BA 3L3CA 1E6YB 2A10A 3PVXA 2C2DA 3OFFA 3KLFA 2D3ZA 1N36F 1LK7A 2NPFA 1VRTB 2HHSA 3MZIA 2BW2A 2MZQA 3PACA 3PZPA 2GIQA 2LDIA 3N4WA 3K5PA 5EX3A 3N79A 1KC8T 1N0VC 3B82A 4YMEA 4X65F 4JV1A 1UVJA 2FC8A 1HWJA 4RW7A 3AQPA 2GQQA 3MTJA 4RX6A 1NK0A 5LSOA 3C6UA 2R8IA 1MMLA 4KB7A 2AYMA 4ELUA 5B08A 3UR3C 5JVGQ 5J2QB 2XHWA 3H4BA 3U1LA 3LO3A 2VPXB 4YUDA 2D9PA 4MFBA 4FF3A 3HVRA 3PEHA 4F3OA 4LVOP 4QPXA 2J9DE 2XMMA 2KT3A 1LXNA 2DCLA 5F0UA 1HNXF 4J9RA 5E3PA 1R8BA 3QLHA 1QVGR 3MPYA 1U1PA 1ZM3A 4H4OA 3TA0A 3UI3A 3T5HA 3FRYA 2DTJA 2WSEC 3NBPB 1RGVA 2V9WA 4JI3F 2IBOA 1SIWB 3RRKA 4LSNB 4DUZF 4QCLA 5L1IA 2P9EA 1M5PC 2QE5A 1YJWS 3T1YF 1BWEA 3BN4A 1NKCA 1HA1A 4ID5A 4ZPWR 2B9YA 4A46A 4JI4F 2EFNA 1GXLA 2VG5B 3LAMA 3T9NA 3UCZP 5KFLA 2KT2A 2BBEA 3PJWA 5HMWA 1LV5A 4G1QB 3BN7A 2EG2A 2JRSA 3W2WB 2VBYA 1VQ7S 1S4FA 1HD0A 1WEXA 3UCUP 2F3JA 2RQKA 2XMVA 2PT0A 1C4AA 3IS9B 4NLRA 3P49B 3H25A 4NRUA 3TUJC 1K8AT 2YX7A 3N5BA 1ZPWX 5JJBA 2M7SA 3G6XA 4LVNP 1M0SA 1Q1KA 2CPHA 4B17A 4LT6A 1VC5A 1KRPA 2UVVA 2HZCA 3M32A 3WDOA 4MYUA 4MYTA 4DL3A 3R5DA 3H2LA 2C42A 3LUYA 1FK9A 1F5CA 3M8PA 2DCUB 4LFAF 5MLCV 3NNCA 2F8EX 4DSKA 1X4EA 5HO4A 1LQ9A 1N34F 2A1BA 4Q7AA 2EI5A 2J7UA 2QZ8A 1YJVA 2OPQA 3MMJA 2V0NA 1ZM9A 3FNNA 2XMWA 3V5RA 1XC9A 5B0FA 4TU9A 3N6NA 3QGPA 1BY9A 3EX7B 5KFHA 4PG8A 4J9PA 3I9ZA 2NS1B 4FXDA 1SH0A 5J1NA 3I4HX 4FNHA 4WFZA 3GIIA 1QSYA 2R8HA 2J8AA 3EUNA 2ZH1A 4DL4A 1SUQB 5BR8F 3DCAA 2HNZB 2LQBA 4JI6F 1S1UA 3CDBA 5GAHU 4ICLA 4BC7A 1S9GB 1U1NA 3JYTB 1HBMB 4ECQA 3CT9A 4XDDA 1VBXA 1S0MA 4WU2A 2Q6BA 5EX0A 2HAIA 2YNHB 2MMYA 2EVZA 5D3GB 4K0KF 2DVIA 1G7CB 4UOCA 1R0AB 3H2VE 2HHTA 2LDYA 2LVWA 3QZ8A 1V3SA 4B9TA 1MROB 3P5TL 1VBZA 3M1VA 5M2PA 5LMNF 2PDAA 4F2RA 3N9UC 1S77D 3HDSA 4CO1A 4EO6A 3QIPA 3QWUA 3PIPQ 1JLBB 2A18A 1GNKA 3NRBA 3DRRB 3UD4P 5L1JA 4F3MA 1YJ9S 4HDGA 5KFIA 1ZH5A 2ZNZA 2JLGA 5E3CA 3PRDA 1FNMA 2KJWA 3C3LA 1DARA 3H5YA 2QSFA 3H5UA 2C2RA 2DBBA 3CJ0A 3B4MA 1FJCA 1YI2S 1JLQB 1S48A 4C11B 3LANA 4IFYB 3IWXA 1Q53A 3U02A 4RWXA 3TW0A 3AB2B 4IO9Q 2CQBA 2VFRA 4G1IA 1KN6A 1EP4B 3H59A 1S1TA 3Q8SB 3BSAA 2JLFA 3PW5A 1HNZF 1U6BA 4P7TA 3PFOA 1AROP 4G1PA 4K4WA 3NMRA 3G9CA 1TV6A 3DOMA 3TP2A 2RUGA 2DHXA 1MW7A 3OTDA 3EPGA 4JI5F 5ITHA 1XR6A 4KE5A 2KU7A 1F5AA 1RKIA 3MM9A 3VQSA 3J7YI 1LW2B 3BGRA 1SL1A 1HPZA 4F8RA 1XBWA 4CTAA 4KGMA 2LQ9A 2QMWA 4ED5A 1XMBA 5U47A 2FDNA 3MUTP 3H98A 4YEAA 2XY6A 1DTQA 3UWTA 5D77A 1RTHB 2V94A 3VWSA 1AFIA 3M2UB 3Q8QB 5KFYA 1L3VA 1OQ6A 1P1TA 3IRWP 5MAOA 5T7LB 2PA8D 3BQ2A 5HP1A 2ZH6A 4TXSA 1GH8A 4OZ0A 4HVZA 1S0NA 2X1GA 2RJZA 4H4KA 4H54A 4PG6A 4EYIB 3SCIE 1U1QA 4F3QA 3HVTB 3G8TA 3VQTA 1VJWA 2M52A 3GILA 1IBMF 2GC8A 3CIMA 3ZZOA 3DLBA 3F41A 4OLOA 2MKSA 2IM3A 3NCQA 2YNFB 2JVOA 2B7CB 3QMQA 3PEJA 4LQ3A 1GT8A 2I0XA 2F9JA 4FNIA 3EGZA 1R27B 3FFIA 4OHVA 1FDAA 5CA5A 2ZDOA 3OSPA 3DLLQ 2CQ3A 4C8ZA 4I2PB 1KR4A 3VAGA 4NZ7A 4RBVA 3CC4S 2AD9A 3Q8PB 3EXYA 3VR1A 2NPIA 3ETOA 1JLFA 2J7WA 4C0OC 1RISA 1N5VA 3RB4A 2IRYA 3MMBB 1A6LA 4L3NA 1FT8A 4OI1A 4F2SA 4DR7F 3RBDA 3EPIA 2K1RA 5AXLA 1BLUA