3CJKA

Crystal structure of the adduct hah1-cd(ii)-mnk1.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
68
structure length
68
Chain Sequence
PKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Copper(I)-mediated protein-protein interactions result from suboptimal interaction surfaces.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport/hydrolase
molecule keywords Copper transport protein ATOX1
total genus 18
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cjkA00
1XBWA 3FMBA 1K0VA 1N5VA 1YG0A 3BB5A 3HDSA 1YJTA 2LXFA 4OJGA 3F44A 4Q2LA 1Q8BA 2IYIA 3HFKA 1URRA 3TRGA 2GCFA 1Y3KA 1AFIA 2ZDOA 1FE4A 1TZ0A 4DN9A 3TNVA 4Y2MA 3LGMA 5B08A 1ULRA 1YJUA 2OKQA 3IWXA 5A6WA 2KYZA 1CC8A 4HH1A 2ROPA 1VQSA 3UDCA 1KQKA 1FEEA 2EW9A 2HQIA 1MWZA 2RMLA 1V3ZA 4F67A 3DXSX 1KVJA 2PD1A 1GXUA 1Y0HA 3K7RA 4Y2IA 1N5QA 5B0AA 2OD4A 1AFJA 1Q53A 2RILA 5B09A 4A4JA 5T7LB 3HHLA 4YDXA 2OMOA 2LQ9A 2XMMA 2XMVA 2KT3A 2BBEA 3IWLA 2HIQA 2N4DA 3KNGA 3T9NA 1JK9B 2ASYA 2AJ1A 2OFGX 1FESA 1P8GA 1TL5A 3GZ7A 1FD8A 4HI1A 1N5SA 1OPZA 2BJEA 4NPOA 1Q4RA 2OD6A 2ZDPA 5B0FA 3BF4A 4EFAC 5B0CA 1AW0A 1R6YA 1SQEA 2QYCA 2W4CA 1S6UA 2K1RB 1IUJA 2KT2A 3BM7A 4A47A 4Q2MA 2HLTA 3BN7A 2BJDA 2FB0A 4NL5A 1LQ9A 2OP5A 1SB6A 1X0PA 2XMJA 3KG1A 4ZOSA 2LDIA 2HFNA 2KKHA 2G9OA 4OJHA 2HLUA 1P6TA 2CRLA 2Q3PA 2RSQA 1X8DA 2IYGA 1U7LA 2QIFA 3E8OA 3KG0A 1Q8LA 3I9ZA 1X7VA 1FVQA 5B0DA 2XMKA 2BUNA 3HHLD 2K7JA 3KKFA 4DPOA 5KAKA 1YRXA 1QUPA 2GGPB 5F0UA 1Y9OA 2PGCA 4OIXA 2AP6A 2FTRA 3HF5A 3HX9A 2GGPA 4HI2A 3CJKA 5B0EA 1CPZA 1JWWA 4HH0A 2XMWA 4U9RA 5T7LA 4DL0C 2AJ0A 4YEAA 4Y2KA 3QGPA 3QMQA 2OFHX 3VTIA 2LQBA 1FVSA 3LO3A 3BDEA 1TR0A 4FNIA 1OQ3A 4ZA1A 2QLWA 2N7YA 2ACYA 3FRYA 4HL9A 3HHLB 1S6OA 2FIUA 2VV5A 2GFFA 3FGVA 2IFXA 3DCAA 5B0GA 1TL4A 3CJKB 5B0BA 2VH7A 2GV1A 1CC7A 3BGUA 1FE0A 2XMUA 1MWYA 2ROGA 5K9FA 2FHMA 2N4CA 1YJRA 2GA7A 4OJ1A 2K7KA 4OJ3A 1RJJA 2QLXA 2L3MA 2RU9A 1KVIA 1VQYA 2GO8A 2W4PA 3LGNA 1WD6A 1OSDA 2JDJA 4FNHA 2K1RA 4A46A 1APSA 1TUVA 4A48A 3TOQA 3MCSA 2HFOA 2K2PA 2XMTA 2OAUA 5A6PA 2AW0A 5IXUA 1YJVA 1SI9A 1OQ6A 4QOTA 3BR8A 1N5TA 2BYCA 2ROEA 1W2IA 1GXTA 3HHLC 5F0WA 1Y3JA 3WDOA 2W4DA 3MZIA
chains in the Genus database with same CATH superfamily
1F5AA 3DRRA 2GMJA 1I1GA 2HVEA 1TU0B 3OFHA 4UTGA 1N56A 2XWYA 3ZXWA 1DLOB 4X65F 1JX4A 4UZBA 1AZSB 3LP2B 8AT1B 3NS6A 4L73A 2AJQA 5GAHU 1RI7A 2FVSA 3H7HB 4RBTA 3D28A 5L8RC 3K0JA 1YJUA 1VRTB 3LWLA 4ELUA 4HT7A 3ILIA 4MKVA 4DN0A 1QTMA 2VG6B 4FPRA 3CCUS 5LOQA 3MECB 2YBVA 2BW7A 2J9CA 3OBIA 5KFQA 1VI7A 1JKHB 1CJVB 1RWNB 5DDPC 1I6JA 1HD1A 2OMOA 1IJFB 3ENAA 1VIXA 3FEXB 3M2RA 4S0MA 4ZP6A 4CO4A 3KNGA 4FYYB 2MZTA 2MKKA 3M2RB 4YFUA 2AJ1A 2W2QP 2IVFB 1V5VA 3QFWA 4OJ1A 3AJ2A 3EVWA 2G0IA 4KR0B 3V4IB 2ZBRA 3M32A 1T95A 3P3DA 5C24B 5F8JA 3PXGa 2LQ8A 4DV2J 2IDEA 1SXLA 4O0IA 4YDDB 4AL7A 3QT7A 3VVTA 5C24A 3D1OA 4CLSA 2HGLA 1LWCB 2RJZA 1X5PA 3MPUB 4ZJOA 4EGLA 1IUJA 4O3RA 3CCLS 4CLTA 3FBFA 2UU9J 2KFZA 4D3GA 2AEJA 2UUCF 4YR3A 4PG7A 2FYXA 3U1MA 4K5RA 1JLQB 1K73T 2Y8WA 4DHVA 3BYRA 4DQPA 3PJWA 2L9DA 4DDFA 3R1LA 2PI4A 5I3UB 1UJ4A 5DM6Q 1Y10A 4MKYA 1ROFA 2IYGA 2PMZD 2R3VA 3QRRA 1S6PA 3NS5A 4I68A 1MW7A 1LK5A 2L48A 4ID5A 2IRUA 3T41A 3D68A 1U2FA 2J0SD 5KAKA 4TU8A 4URGA 1Y9OA 3V2UC 4DFJA 3JQJA 3W8PA 4P52A 3HX9A 3RBEA 4OHVA 2FHJA 4LMZA 1W25A 1IBMF 5KFHA 5DS7A 3QGPA 5KFOA 5HQLA 4Z2XA 3PYEA 2AGQA 3IBCB 4XDDA 1RT1A 2L08A 5DZ7A 3DGPA 3AJDA 1MMDA 2NZ4A 2VKZG 4JV0A 3PX6A 5E2QA 5D77A 1FA0A 1Y5IB 4MH8A 2UV8G 2BQUA 4IDKB 1TL4A 1VLYA 3OR1B 2G1HA 4F26A 2IAJB 4HDHA 3BGUA 3OR2B 5LMUF 4J9NA 2DR7A 3RR8A 3QRPA 2NPFA 1FE0A 2B9XA 1I94J 1IXKA 4FF1A 3OR1A 5GMDA 1XR5A 3G82A 1YJRA 1UPPA 2NUHA 3CJ5A 3AFGA 4J37A 4DU7A 2FGCA 2J8AA 1F2HA 3O44A 4O4RA 2HPUA 1M5SA 1VISA 5D6GA 3OSNA 1K1SA 2BA9A 2KU7A 3QT5A 5L1LA 1DY3A 4FNHA 2A6MA 2YKMA 2HS4A 2YKPA 2CZ9A 4LREA 1U0HB 2XWXA 2DPIA 2EFGA 2O1PA 5CYQA 5A6PA 4G1PA 4O4GA 3VALA 2EKNA 1BY9A 3CDEA 1QD1A 4JI4J 5JJBA 5GADU 1AA1B 1VRQC 4CH1A 1CBKA 4ED6A 4ZOSA 4DUTA 1B0VA 4K59A 4LF9F 2MZJA 1K0VA 3GR1A 3QLHA 1SL2A 3GTYX 3IXQA 3R27A 2YWGA 2GO9A 4A8YA 4KO0B 2NSCA 4OZ5A 4GKJF 2AYEA 1FE4A 1IQTA 2LXIA 2VOPA 1R8AA 3DN9A 4O44B 4B3OB 1VDHA 1S9GB 1VHFA 1S76D 2DYAA 2FJDB 4JI1F 1ZOTA 3FMWA 2VKRA 4RUHA 2ZH2A 1SQFA 2EW9A 4FS1A 3UD4P 3TI0A 1CEZA 2DNPA 4RLEA 1SUQB 2DNZA 2WB4A 5THWA 3UE2A 2RRBA 4DPYA 4N76A 2HFZA 2VBYA 3MM6A 2ZBIA 1X4BA 1RT6B 3EUNA 1RADB 1RBLA 3PNIA 3W60A 3D3BJ 1VQ6S 3U27A 1GFWB 1R8BA 2W7AA 2FJEB 1SJFA 4JV1A 2C3OA 4IG0B 3UR0A 2J9DE 3HHEA 3MPDA 5JMNA 3FC9A 2PEBA 4P72A 2RQMA 3DLJA 2QSFA 1L3VA 1VQ7S 4F4YA 3UN3A 4QPTA 1UEUA 3OL9A 1Z4UA 2UUCJ 1A7GE 1RWVB 1TL3B 2O01C 4KRWA 1SKWA 3M1VB 1J27A 2CADA 2OPPB 1S6UA 3MF5A 4J5OA 4DZ6A 2W01A 1S0OA 3DDNA 5KFIA 4LF4F 2MJUA 1H73A 1IKXA 1TL3A 4FP9A 3E01A 3AXKA 3WIVA 3DI6A 4TYBA 1UP1A 1FWLA 4MFBA 5EWGA 4DF4A 2DVIA 4JI6F 2CUYA 1IKXB 1NDLA 2CPFA 2E44A 3BSOA 1WHVA 3H25A 4OYOA 2LEBA 2ALZA 4KJIA 1TQLA 3K57A 1FWPA 2EWHA 2XC9A 3H4BA 1XK8A 4DQSA 1RTDA 2LLZA 2HLUA 4LR9A 1YJNS 2DNGA 2V8VA 3VF0B 3MFHA 1SJRA 1UFLA 2ALYB 4FYVB 1NSQA 1LWFB 4DOZA 2ZH9A 3I9ZA 5DM7Q 2GNKA 2J6TA 1XNQF 4IOAQ 3QIPB 4ZVQB 5F9LA 1JXEA 2R8KA 3RU0A 1IM4A 1CVJA 2O5DA 3F73A 2X1FA 3G6YA 4YB6A 2NYIA 5LJ3Y 4FYDA 3OTDA 2PO4A 1TFYA 1RQ0A 2F4FA 4LIWA 4X4VA 4E8UA 5ETKA 1H3DA 1RT2B 4QWCA 3PG9A 5T7LA 3VGUA 4XO0A 1DAXA 1IVZA 1U6ZA 4NCGA 4IQMA 3VAIA 1NMEB 3C66A 3FSYA 4JUZA 3GIIA 3AH6A 4FYWB 3BSNA 3MR6A 2D41A 3CEDA 1IKVB 2W9CB 2BANB 1UVNA 5EX0A 3R1HA 4EEYA 5G0RA 1HWUA 2PA8D 5GMKa 4KKOB 3GJRB 2ATLA 3HKZD 1T8EA 2A2CA 4LQ9A 4KKOA 4XAKA 2BE9B 3DKDA 3I0SB 2DH7A 4ZPDA 3UVJA 2ZOFA 1X4AA 2ROGA 3KLFA 3GFXA 3RW6A 3KHGA 2ZWOA 1OYEA 4ZPBA 3UVJB 4CM0A 1SL1A 1ZAWA 3LF0A 3DMJB 2WBRA 3C2PA 1F60B 3RB0A 5K5MA 3AY0A 4HEA9 5E5NA 1HI0P 1KFDA 2UUTA 1U1NA 4IDKA 3AAWB 2BOAA 3LPYA 2B0GA 4ZVHA 3Q8SB 1NK6A 3MCNA 2QFIA 3L4BC 4WF9Q 1R8PA 1OY8A 2GIRA 1S7IA 3PRBA 2AZ1A 4JI0F 1U1QA 3HMJG 4UUXA 3CCJS 1HLWA 2ZE2A 2LA4A 1BQXA 2MSTA 2ZITA 3C16B 4RW6A 2ADBA 1HR0F 2PE8A 2ZH4A 3EPIA 3K58A 1WDDA 3AA8A 3BB5A 5A2QU 4ZVOB 3HFKA 2E66A 2QTWA 3PHEA 1T03A 4DR3F 5CHCB 4CLPA 1Q95G 4G1IA 3U1LA 2OMLA 3R7SB 4ATNA 4PR6A 3HVWA 1G2EA 4RR5A 4Y2MA 4C8LA 5B08A 4KGKA 3I31A 1C4CA 2KO1A 3LP1B 5HQMA 5ITHA 1M90T 1FI4A 2HMIA 1DTTA 4WFYA 4J9VA 1KQSR 2DGQA 3KMSA 3M2UA 2KG0A 1ELOA 2C2NA 3BGLA 5KOWA 3OHBA 3KJVA 4KHPJ 4CNZA 1X9SA 1C1BA 1J5OB 2VFRA 3M2UB 3LGHA 1WOOA 4DV0F 1QSLA 3CMES 1HWJA 2GJFA 2XHCA 2AJ2A 1C1BB 3L09A 4X4SA 3G6ES 2HFUA 2I0XA 2XMMA 1RYSA 1WC1A 4CLUA 3PW5A 1U45A 1S0VA 4P10A 3CW2C 4M5DB 4C8KA 2VQEF 2GIFA 3IAM9 4ILMA 1QSYA 1UVJA 4DU8A 1CJUA 2HKEA 4ZS6A 3S6EA 4C11A 3RRGA 1U26A 1SIWB 4W90B 2J8SA 2R7XA 1RGVA 1TV6A 1R6YA 1C0UA 3IM9A 1HNWJ 3SEOA 5CA5A 3KTQA 3EZUA 2IRXA 1C0UB 2FJXA 1J5EJ 2MZSA 2LFVA 2QC3A 1FRMA 3MM8B 1YRUA 2A3JA 4F25A 4MT1A 2MKCA 4FZVA 4ED7A 1M5OC 2EC2A 2R8IA 2GIQA 3KWMA 2LDIA 3MWBA 2G9OA 4OJHA 2L41A 1BWVA 1P6TA 2CRLA 2JHEA 2Q3PA 2YX7A 1RBAA 1PJ5A 3CDBA 4KAIA 4V1Ak 4EU0A 5KT6A 3G8TA 1NEEA 2XB2D 5HQ8A 4BWJA 3OJUA 2ZC3A 1OWXA 1SV5A 1CQMA 1X7VA 4C0HA 2N3OA 1EIYB 3RBZA 2HRYA 1RHRB 1S1TA 5KT2A 1SV5B 2DO0A 2F63A 3SZ2A 1TAUA 4NEZA 3DM2B 3MTJA 4ZVSB 2ADCA 4B3RJ 4KV8B 1P1TA 3NBPB 4P6QA 3UN2A 2DXEA 3Q8PB 3KDOA 4CCHA 1YDLA 3MUTP 3IA0A 4IH5A 1VQ9S 4RW7A 1Q7YT 2DITA 1GTHA 2LQBA 2IDLA 2WVBA 2Z56B 2RDDA 3HZEA 3OFEA 2R7TA 4DEZA 3KLHA 3TAPA 4PG6A 5IC6B 3TYTA 4YQWA 3BEGB 1HW9A 3GIKA 2V69A 2JX2A 4FVCA 2XEXA 3M32B 4IG3A 5SZTA 1M5VC 3FBEA 5HAOA 1EETB 3NGTA 3CJKB 4DV0J 1H38A 1JLGA 1YWXA 4URSA 1HBMB 4TXSA 2XMUA 3RAQA 1FJGF 4ECYA 1S5ZA 4KHRA 4K7QA 2CQ4A 2DNMA 4AXJA 4DR7J 3NEKA 1N6QA 4LFBF 2ZOMA 2I38A 4A8OA 2DGWA 2W9CA 3R2DJ 1N5YA 3TW0A 1Z2LA 3D6FB 4X2BA 4J9OA 3OL8A 2JC1A 2W9BA 1FF2A 2ZVSA 3CDUA 4N41A 2XCAA 2HBRB 2JC0A 2JLEA 4HACA 4UZCA 4E98A 1ZS6A 2W9BB 4DS4A 1RZMA 3MCSA 3OVBA 5HMZA 2KVIA 3VAFA 2HK2A 2AW0A 1C0TB 2CYYA 4TYAA 5K8PA 2PFFB 2I8EA 5AE3A 5IT9U 5KT5A 2VPWB 1C0TA 1U8WA 3PRVA 4ZVUB 2HNYB 4M8LA 3MFIA 2P6TA 4FF2A 1N33J 3TANA 2ZFHA 3OXLA 2YNGB 1FRXA 4I2PB 3KLGB 2OPSA 3OTBA 2WOMA 3ZZZA 2IMWP 2E29A 5L1JA 3GIRA 2XBPA 1VOMA 1PILA 4QW9A 4ED5A 4PAAA 1B7FA 3V5RA 5IQQA 3C6TA 3DRSA 4HHJA 3OVAA 4EYIB 3TNVA 3W65A 2ZE2B 2AKWB 4I67A 4OLOA 1T3NA 1TK5A 3PYGA 5ETNA 2R7VA 4OYMA 1WF0A 2IM1A 1VQLS 1KSPA 3KNAA 2HHPA 1RSCA 2VDIA 2IAJA 4WP3A 1RT4B 2OD4A 3CCWA 3TA0A 1AFJA 2CQHA 2RILA 3NP5A 2AZ3A 4PPDA 1NJZA 1LV5A 2XLKA 1K0TA 1F9EB 3PJ9A 3OUYB 3WHIA 2ILZA 3G8SA 1K8AT 4YP3A 2GS8A 2AYBA 3MI7X 2OFGX 4PPZA 5LL6d 2HFSA 3KLEA 1SKRA 1HQEA 4A8XA 3ENQA 2R2SA 3RB6A 1TKZA 4ANCA 4ECTA 3KLEB 2CFXA 2JWNA 4J9RA 1NU4A 1SC1B 3KJNB 2IC3B 3TVKA 2W8KA 4RU9A 4JP8A 3CCRS 4EBEA 1RHQB 4USVA 2XY5A 4X4UA 1NKEA 2YKNA 3BM7A 1MMNA 4DR5J 2H51B 5H9EJ 1RTJB 2CQCA 4Q2MA 3MAQA 3TQ1A 4B9SA 3KLIB 1YZ7A 1IJEB 4GVLA 3SCLE 4WCEQ 3QJJA 2RHQB 3WIUA 4LF6F 3D67A 3FEYB 3R7NB 5LMUJ 3KG1A 1NPRA 4OI4A 3DNCA 2E1AA 2WW4A 1N36F 2A6OA 1WF2A 3R2CJ 1LFPA 2VFSA 1H72C 1HW8A 1L3KA 3AQOA 3M6UA 1U7LA 2KHDA 4LFCF 1XN9A 2ZOGA 2E1MC 3FJ2A 4RUCA 3EJMA 3NKYA 2XCPA 1OIAA 3OV7A 3GV5B 5K14B 2RDJA 1EQ0A 5LXYA 4RW9A 3HHLD 1X4HA 2OI2A 3D0IE 3KKFA 5KT3A 3BV8A 1UETA 2DGOA 2GGPB 3TARA 1UFKA 1SQGA 3MMBA 4DUZF 2E5LF 1NKCA 4F4KA 2DGVA 2HNDA 5CZXA 2GGPA 4U7UD 3JAMY 4IH7A 5F8NA 2RRAA 1HWLA 2VF3A 4JI8F 2OPQB 2PIIA 1VBXA 1S99A 4KGVB 2RF2A 5KFXA 3Q8RB 5IFMA 1WEXA 4CRJA 3EGNA 4OZ2A 1NB7A 2RVJA 4ZJLA 1NJIT 1S1TB 3PKYA 1AB8A 5CAAA 1X5TA 2QX0A 4LF1A 3PV8A 2LA6A 4BC9A 3K59A 4A8MP 3DCAA 3KXDA 2AEMA 2DXFA 4KV8A 1FNOA 4J9SA 2QGFB 4PUOB 1CC7A 3M9MB 4N8NA 2UUBF 2VJVA 4LR7A 1FKAF 1NDCA 3E01B 5E3AA 3J7ZT 1S72S 1U1OA 3EZ5A 3DLHA 4HTJA 1VQYA 3DU5A 3MEKA 4XTTA 3G6XA 2ZH3A 4B9TA 2WB1D 2KZZA 2MY8A 1R31A 4OHYA 3CVKA 2OTJS 4WK1A 1P9YA 2UXBJ 3DFEA 1NRKA 5F3TA 4A48A 5C5JA 4OHXA 4RUBA 5KFKA 4OX9F 3E3XA 2AYMA 3G2XA 4U67Q 4EMDA 1QE1B 3RRHA 4K5SA 2HK3A 2P9CA 1SI9A 4KIAA 3GYGA 4WFXA 1WELA 1X5SA 2WVDA 4M5HA 4BBYA 2DCUB 4RL1A 3JB9k 1JXLA 2UVRA 2CG4A 3H90A 4DV5J 1Y4ZB 1X4CA 1BE4A 3R5BA 4MYUA 5KFMA 2JEGA 1IKYB 3MR2A 1XBWA 5HJYA 3RAXA 2M2BA 4DR6J 1H7WA 1LWFA 3S01A 3HVAA 1WNEA 1U02A 4HKQA 5EX3A 2WTFA 3LW5C 2WVCA 4LR8A 3HM9A 1IQZA 1JJHA 2XO7A 2CQDA 4KGXB 2LQJA 4H4KA 3UDEA 1VRUB 2MKSA 2PSZA 2Q6CA 3LGMA 1LEOA 3SSQA 4RNFA 5KOXA 1RAEB 2ILYA 3M6VA 3PEJA 3THTA 8RUCA 5JUMA 2M7SA 3OL6A 1V3ZA 2WOMB 3VQTA 2DHHA 3DOKB 2HW3A 2BX6A 4QPXA 3K2YA 4Q5VA 3I0SA 2BANA 3JQMA 4KHMA 3FQKA 2HEKA 3V6JA 1FDDA 3AD9C 4FBTA 5B09A 2R4FA 2DRBA 2AEFA 4OI1A 2MQNA 2XGPA 3GQCA 4QR2A 1Q5VA 1HNIA 2DT9A 1IKWB 1RT1B 4MK7A 2HRUA 3IS9A 2ZJQQ 4Y34A 2HHVA 3FSXA 2LXUA 2RHSB 4ZJQA 2VFVA 1HNIB 3H8YA 3ILLA 4I7FB 4ZVTB 5K8OA 2PN6A 2U1AA 1PG5B 5BR8J 4HI1A 4LF2A 4B3TJ 2MXYA 3CJQA 1YK9A 2UXDJ 1AW0A 2HBQB 3GLJA 2C2MB 4ZKAA 2VJUA 3CCZA 2V67A 3ZZRA 2EKYA 4NXNJ 2R7QA 3OUYA 1VJWA 2OO4A 2R8JA 5A2QY 3LANA 2DO4A 3HT3A 4UOFA 2J0XA 4J9UE 4P9SA 4JI2F 4D3HA 4ZVPB 2FC9A 2Z58B 2RAQA 4KT0C 5F8MA 4O0NA 4ED8A 1Q5YA 2BABA 1RE1B 2DNOA 1PC4A 3BBCA 4OV1A 1SC3B 4DQRA 5KG2A 5D0RA 5ETSA 4Z7CA 4IR1A 1RT5A 1KEKA 4DQQA 3AD8C 3NCPA 5IV3A 5KFCA 2MZQA 1FO1A 1S1VA 2JRSA 5DZ6A 5DG9A 3KOAA 3ZTPA 2Y0SD 3VV2B 3ZZYA 1Y11A 1B4SA 4KSEB 4LFAF 5A8WB 1V3SA 1DQ8A 2CNNB 2CWKA 1I51B 2NZCA 2WONA 4OZLA 1UEKA 4UOCA 1CSJA 4A8QA 4U9RA 5D0EA 3FCHA 3OXGA 5H9EK 1WI8A 3ZTQA 5KFRA 2CZVC 4GKKJ 5GAHI 4Y3CA 4RW9B 2YNIA 4DPTA 3G86A 3L95X 4XIUA 2FLLA 2RNEA 4ENOA 4USHA 5B0GA 1RLDA 1UZHA 3C6UB 5A8KB 4F4ZA 2PDAA 4O3QA 1WOPA 4DI6A 4F3QA 3AOCA 3VHQA 4YOEA 2RUSA 5CQGA 3POTA 4C11B 1AXQA 1HWKA 1TELA 1YLXA 1CJTA 2GA7A 2DNKA 3C15A 4NX9A 3ZTOA 2V4RA 2FJVA 3NWGA 4DSLA 2L3MA 2R2TA 2OGUA 4OX9J 2CWXA 1M1KT 1SJQA 2XNQA 1YJ7A 3P96A 3TX0A 3HJFA 1APSA 1FFWB 4F2SA 1S57A 1TMJA 4CLKA 2FHJD 2OSQA 2RU3A 3CMAS 3DOLA 4GMKA 4JI1J 1CULA 3P5BP 2HS0A 3CJ4A 3O8WA 1WKKA 4GRSA 2FY8A 4I2QA 1CQNA 4R0JA 4X66J 4YS2A 4PWDA 1V3RA 3VGSA 3N5FA 2C42A 1RLCL 4PWDB 2FY1A 3NMRA 4DX8H 1PJ7A 4CO1A 4YMEA 2GVDB 5KTQA 4MKBA 3EXCX 1LFWA 3UDVA 4CI0B 3V6DB 3D0GE 3FEZA 4BS2A 2U2FA 2CNOB 3MECA 4M5KA 3PTWA 4UF4A 4LF5F 2CDQA 4U6PA 1JKHA 1NSKL 4M5IA 4F0MA 4DR3J 4KTQA 5DRKA 1RAHB 4F4AA 3K5MA 4IUFA 3IAS9 5ETTA 2ROPA 4PWUA 3SV4A 3CJRA 4RW7B 4X66F 4ICLA 3HXMA 2VB6A 3HP6A 1EHWA 1Y7PA 4C4WA 3EE3A 5KG4A 4DL6A 1ITPA 2PA3A 2RB7A 3A8IA 2WVFA 4WTOB 2JZ5A 4JI5F 4JOUA 3V4MA 1S1WB 4A4JA 2DD8S 2MLYA 1Z1ZA 2GMLA 4ETZA 3Q23A 1LWCA 1MSWD 1GT8A 3LOUA 2BBEA 3GG0A 4F4WA 2HIQA 2ZJRQ 4LF5J 1HBMA 2GX8A 3ZC4A 4Q44A 1VQPS 2C3YA 1ZA1B 3CIZA 1NSAA 1WTFA 1X4FA 3L9ZA 3Q2SC 4HVZA 5ADZA 1UVLA 2XYPB 3TA2A 4RNHA 2C2DA 4ZLLA 3BN4A 4DX6A 4DF8A 1Q4RA 2KH9A 2IJNA 3IR5B 2JLFA 2NXEA 4DSIA 2VFTA 2P2CB 3BREA 2W4CA 2XTJP 3NGSA 1N34F 5GAGU 4QIGA 2CPIA 3VZHA 3W9JA 2B6AA 5D4OA 1VC6A 2CJQA 1QJHA 3HSGA 1HKAA 3D66A 2F65A 4JBCA 9ATCB 5D8HB 1WF1A 3ENVA 3LUYA 1VLOA 3PDNA 5F41A 5H9FJ 5KFYA 1X0PA 4DG1B 4EO6A 3OLAA 3MUVP 2D3OR 4U8VA 4U8YA 1J5EF 2XS7A 1ZYQA 3QGIA 2JFDA 2YY3A 4RNOA 4BWMA 1TKDA 2KL8A 1U48A 2V2ZA 2RD5C 3PFEA 1X4EA 2ABYA 4QZVB 2KVQE 3DRPA 3ZTRA 1PIEA 3QAUA 2VPXB 3JTNA 4DXLA 2R7SA 1WJ9A 4CM2A 2WHOA 4KB7A 2IJRA 5GAEU 4JYAF 4F36A 4X4TA 1HPZB 2QRRA 3K5NA 1GMUA 1XMQF 3SMZA 1FKOB 3R5JB 4C0OC 4PKDB 3FNNA 2F8EX 4HH0A 1HMVB 1RT7A 4OYPA 1RTIA 4DL0C 3SXLA 4NRTA 2HGMA 1MN7A 3UR3C 3KK3B 3FCVA 3W62A 2DR9A 2YPZA 3B54A 4JB8B 4DUYJ 1T7PA 1MNEA 1UL3A 5HK4A 3X3UA 2C1EB 4NMXA 1NLKL 2DCLA 1RTHB 3IRXA 4P2SA 3ZZTA 4HL9A 2K06A 1JWWA 5G4DA 2JLGA 1AYEA 1OY9A 4P71A 4ZVRB 2UUAF 1RTHA 4ED1A 4JI0J 1J5OA 4CYUA 1NPKA 2AX1A 3BR9A 4X4PA 4WTYA 4K4UA 4GVBB 3M9NB 1XIQA 1UWAA 1XJWB 1UFWA 2AX0A 3DLEA 3FVYA 3IBFB 1RABB 3MM7B 3PHTA 1NXIA 3UD3P 1Z2ZA 3DU6A 1DRZA 4JI7J 2X3DA 4M5DA 4DBQA 3SQOP 1WI6A 5MLCV 5ETRA 2AWZA 4B9VA 2E5HA 2V68A 3M4XA 1TUVA 1RTJA 5FIIA 3H40A 2ERRA 4NCBA 2IPOB 4CNYA 1RAOA 3P4UB 2YH1A 1FNXH 2VA3A 2HHQA 4QWAA 1BHNA 1OQ6A 2RH3A 3C15B 5DJBA 5D3GA 3V81B 1VGYA 3R9LA 1WUUA 5AXNA 4PXEA 1C2PA 2ZJPQ 2BMBA 3OL7A 4G3IA 5D3GB 1YI2S 5J1EA 3HDSA 1N8RT 3MPVA 1M5PC 4R5PA 2L9WA 1KWMA 3CSKA 4JV5F 4CQ1A 4DN9A 4N56A 4I2QB 1HHSA 2FLPA 4ZIWA 4Y2AA 2JNJA 2OIHA 2HQIA 2MQ8A 2RMLA 3NCRA 1XQIA 3D1HA 1XMQJ 3DXSX 1JXVA 2GHPA 5I3PA 1KVJA 3A13A 1QM9A 4IO9Q 1IN0A 2RIJA 5GAGI 1TUWA 2PMWA 2FJWA 3OFFA 2KYXA 2IVYA 3NRBA 4B17A 5D0HA 2MHNA 3P6YC 2CPEA 2Z2MA 4U96A 2MB0B 1X9MA 2H9ZA 5D0GA 1D9DA 4PUOA 1T3OA 1OO0B 2ATCB 3IWLA 3MHYA 4ZHRA 2KG1A 4WE1A 4KBIA 2ZBQA 4ZP8A 2DBBA 1UW9A 3M8SA 2V0NA 1NK4A 4NCAA 2R7UA 4NXMF 4ALZA 2VG7A 1NH8A 1XWLA 3MTKA 3GP9A 2IRYA 1R43A 2L9NA 3FBCA 3U02A 2YWFA 1WC3A 2GJIA 2OELA 3GYXB 3M6XA 3N0VA 4KPCA 5FDLA 3QJPA 5SUHA 3GWCA 3QWUA 1N6QB 2MY7A 3X1LB 3BZQA 2CJYB 5HJXA 4ZLNA 3BN7A 1G7CB 2NXUA 1N5YB 3OTEA 4RBUA 3L7OA 4ZCKA 3MR3A 2C2EA 4RW4A 1R8HA 2CKWA 3ADAC 4DL3A 2YKAA 2HFNA 3HKWA 3LTOA 3JTOA 2KKHA 5J2MB 2AGOA 1NK9A 2Z2ZA 2HHUA 1HQUB 3M30A 3DOMB 4NCGB 1PJ6A 1V9OA 4OI6A 1AROP 2Z4PA 3AB4B 2NXNA 3T19A 2EBEA 4DPOA 1YRXA 3AJ1A 1WG1A 2DHAA 3OQ2A 3QT6A 3DOKA 1LW0A 3E51A 4NYOA 2ZUAA 4I2PA 5HVGA 2FTRA 2PC6A 1EKSA 3HF5A 4Z7YA 4DUYF 4EZ9A 4X64F 1B64A 4DV1J 3LA0A 4OZ1A 1KHWA 4ZVFA 4CH7A 2DK2A 2OFHX 1TKXA 1F1BB 3C6TB 4DV5F 5J2QA 1R27B 3H2LA 3GSIA 3PYDA 1JLBA 1B3TA 1B0PA 3IS9B 3SSSA 5AJ3F 1VIOA 1I3OB 3ZNUA 2MQLA 4CP5A 5ETMA 4I7FA 2KZMA 2EG2A 1ZM9A 4EBCA 3D9BA 2UUWA 4P7VA 3HHLB 4O3NA 2OSRA 3R5CA 1S97A 3W64A 2CZ4A 4DR1J 1HBUA 2FPHX 1HMVA 4P7TA 4M94A 4OL8A 2GHWA 4N77A 1RWOB 1MWYA 1WKLA 2KJVA 5HVHA 1RT4A 1HBUB 4ZLJA 2HHHF 2QMUB 2DGTA 2FHMA 3D3CJ 3OR2A 1JNRB 3JYTA 1MROA 3O3LA 2UXCF 3CIMA 1RJJA 4NLSA 1NKBA 4IFVB 1FWKA 3LGNA 1ZPVA 2FZKB 3LWMA 1NM2A 2J6SA 3FFIA 2C3UA 1NBEB 2HSEB 2K1RA 3BGOP 3ET6A 3DRYA 3PZPA 1U4BA 2BDPA 5J1NA 4H4MB 3J7YI 1T03B 1OSCA 2HURA 1NHKL 2YKMB 3ENWA 2OEKA 4HLBA 1NB2A 1KONA 1YJVA 2GAGC 3FZBA 2W24A 4NLOA 4QIVA 4YN3B 4FN5A 4EBDA 3GMGA 1KLNA 2ROEA 3MM7A 1S1VB 4USIA 4WFBQ 2FZCB 4M5LA 2DR5A 1IM6A 2F9DA 1X5OA 1RT5B 2H5IB 2V9KA 4I6AA 4ES1A 1PBAA 4ANEA 1ICEB 3FKBA 3M9OB 3PW7A 4O23A 2ZD1B 4HHHA 4Q8FA 1N32J 4JV5J 2YXLA 2E5LJ 3Q22A 2GVZB 1GMWA 3SCIE 2HHSA 1KFSA 3AB2B 2VU5A 1YGYA 3N9UC 3Q86A 1E6VB 1T94A 1J2VA 2VASA 3BS9A 4PG4A 5KFVA 4QQBA 2AHOB 2M3DA 1E6VA 3CB4A 1VQSA 2NYHA 2F8HA 4F3OA 2CJAA 2C3MA 3OJSA 1EAYC 1LOUA 4LBHA 1N5QA 4YHHJ 4U7CA 4RNMA 2DISA 2R7WA 3PX0A 2ZHOA 2JFKA 1S49A 2AT1B 3FBBA 5HMWA 5KFDA 1S7HA 2QMWA 3L3CA 4LF6J 3EDRB 1JB0C 1U1MA 1F0XA 5EDWA 3BJYA 3T3FA 9RUBA 2LP4A 3GZ7A 4B02A 4A8FA 5E41A 5FJ4A 5GVQA 2G1DA 2BJEA 3I32A 2Z2LA 7FD1A 1FJEB 4DLGA 2P5VA 3Q24A 4E0DA 2YQ1A 1G1XA 1PGZA 3ZZPA 5KFEA 1ZTWA 3DHWC 1PYSB 2C2RA 2M0GB 3BBFA 3JSRA 2N82B 1RYRA 2HVIA 2OPPA 4ZHRB 1W2BR 1YJ9S 1JJ4A 4RJVA 2UXDF 2BJDA 2ZC4A 4NL5A 4NI2A 3AOBA 4C8NA 2VICA 1T9VA 2B7CB 2Q43A 2W25A 1TKTA 4MFBB 5L9NA 3BQ2A 2BKOA 4B3MF 3HHNB 1NDKA 4WU2A 8ATCB 2ZWPA 1V6HA 1ZA2B 4LRCA 4ED0A 2JEIA 1LW2B 3DDKA 3OTOJ 2KTQA 1FD2A 3HJVA 1U47A 1WORA 3P49B 4EI2A 2DGSA 3UI3A 1YBUA 4M63A 3UCUP 3A1YG 1VK8A 4X62J 1UZDA 3IO1A 5LMNJ 4C8OA 2FHOB 2CPYA 3QIPA 2AP6A 2Y8YA 4C98A 3PX4A 4USKA 4QIEA 1QVFR 1EETA 1WSRA 3CJKA 3MMCB 4F7VA 3CE8A 1S1WA 2IBOA 4ICLB 3GIJA 3R8YA 3UN5A 3R3TA 3DLGA 4H4OB 1RT2A 1VRUA 3NS7B 2VA2A 1OQ3A 1BQNB 4W4MA 5J2PA 1KRPA 5MAOA 1QAJA 1BWEA 1LW0B 1QAYA 4N8OA 5IQ6A 4MTPA 3BO3A 2LQ5A 5HLFA 2YX1A 1T02A 2IFXA 5DDOC 3KYLA 2VPYB 4K2XA 1IR0A 4OX8A 2HAIA 3HCXA 3NWRA 3GV8B 4DSEA 4LF8J 1NCLA 3N5BA 1FRJA 1SVDA 2MTLA 4DV7F 2CQ2A 4HHUA 1RA6A 1CJKB 1IBCB 4IO1A 1ZZFA 3I4HX 1VFJA 2Z57B 1JLBB 4NLTA 4DWIA 2K7KA 5EHHA 2BR0A 3C19A 4ZP7A 2HVZA 3IR7B 3VAMA 1WD6A 4ZVGA 5IWAF 1XR6A 1IWAA 1TL7A 4B9LA 3OXFA 4N47A 3D54A 3H4DA 3LALA 4USUA 3CD6S 2MHEA 2QE5A 2XS5A 4HYKA 2AV5A 3UNYA 2XULA 3JS9A 4AE5A 5F9NA 3TUPA 4DL7A 2Y9HA 3BPSP 2RDIA 5RUBA 4BHQA 1E6YA 1N32F 3M8YA 4QIWD 1OPIA 4K4WA 1UCNA 2VC1A 3K8VA 2QL9B 2B4OA 3HT0A 1YITS 1QAXA 1IBLJ 1Q0NA 4C3KA 2ZEJA 1ZAVA 2EXUA 2KN4A 4G1QB 3M8RA 4CO0A 4Y00A 2UZAA 5FLXU 1FRHA 2VONA 1R6VA 3J80Y 2BM1A 1HNVB 4K0KJ 5F8IA 1R0CB 2HZAA 1RTIB 3MUMP 1XC9A 2QMXA 3MM9B 1N34J 1BUXA 1D9AA 3HFZB 1AFIA 1T11A 2ZDOA 5KFWA 3CD0A 4IFYA 2HQGA 4X84A 5I42B 1S79A 4CO5A 1IBMJ 2RUGA 1A6LA 3EPGA 1Q78A 1HFEL 4QCLA 2HIYA 2WVEA 1FX4A 1RAFB 1RT7B 4I69A 1NK5A 4DR7F 3B4MA 2FDNA 2LYVA 4NA3A 2FC8A 4ZN3A 5F3ZA 5CD4A 4TQSA 1DQAA 4AQYJ 3LP1A 2HMIB 3GFHA 1UW4A 4F67A 3CCMS 3M8PB 1DTTB 1EQMA 3T1YJ 2IA6A 1GXUA 4NXNF 1YIJS 1EB0A 5A8WA 3BSAA 3TP2A 2OJ3A 1S1UA 4WKYA 4X65J 3OSPA 2AYGA 4OZ3A 4L76A 1PCAA 3OLBA 5KG0A 1TVRA 4OI2A 2IM0A 5I3QA 3OPKA 4DL4A 4B9NA 2X1BA 5L38A 2ZVIA 2CJKA 3K5OA 4Q43A 1RAJA 1P8GA 3UWTA 3JSMB 1YQHA 2KI2A 1UKUA 4NOHA 4PABA 1GX5A 3DLEB 1NO8A 1RACB 4DR5F 3JSMA 1DJ0A 3ZZOA 4DV3J 4A8WA 2HNZB 1A0OB 4LQ3A 5D78A 5L39A 3MR7A 4ECQA 4K4TA 4B3MJ 2PI5A 1CJTB 2H5JB 1OS5A 1U0HA 5CD4H 2MGZB 5C25B 3H2UB 1RWWB 2EK6A 2OHDA 1N88A 3ZTSA 4Q0BB 2D9OA 4MK9A 4XPCA 2OP5A 4ZITA 5C25A 1SB6A 4OZNA 1GH8A 3D6TB 4X4NA 3ILJA 1TK0A 1LNQA 4OYBA 5BR8F 5KFLA 4QU7A 4ZPCA 1JLFB 2DNQA 5DQGA 4CTAB 5M2UA 5HMXA 4R5PB 3LPEA 4MK8A 3W5XA 2V5HG 3RBXA 2OEJA 1S0MA 3HZGA 4OMFG 5AE1A 2VIHA 4Y2CA 4CZCA 1NH7A 1U1LA 1VQNS 4DZDA 4RPFA 2FVCA 5JXSA 4LBPA 4UOHA 3I5AA 4HTIA 2B8PA 2XMWA 4EZ6A 4RWXA 3T1HF 3QSIA 5KFTA 5D4NA 4DS5A 4PXBA 1IBKF 5DGAA 1N0VC 1KKHA 2R42A 5LSOA 2QLWA 2N7YA 5EWEA 5DG7A 3T6BA 4WZMA 3QBCA 1RWXB 2UUBJ 1FRKA 2WRMA 4U7UK 3FQLA 3JTPA 5B7WA 3H5YA 5B0BA 3KLHB 2AF6A 1RWKB 4J9MA 1DBDA 2G13A 1SH0A 2MDAA 3QYYA 3KK2A 2GQQA 2CAJA 1KQFB 3MEEB 3QRQA 3KK2B 4O3PA 1RU1A 2YQ0A 4L3KA 1M5HA 1JLGB 2V50A 3R5GA 2I5JA 4NASA 3DDIA 4DFMA 1ZTTA 4RU2A 3M8ZA 4CLLA 2JEJA 2MQOA 2DTJA 4WWSA 1RKJA 3NLCA 3WC0A 1KVIA 6AT1B 1HBNA 4RW4B 2HVHA 2VDHA 4G6VB 4C3LA 2RQ4A 4FKXA 3S8SA 5L1IA 4DUZJ 1DURA 2K2PA 3CNQP 3R6GB 2D3O1 1T9XA 4ILRA 3DOMA 1JLQA 4CO2A 2EPIA 3DLKB 1W2IA 3VAGA 3GPAA 2QA4S 1VQOS 2DNYA 1EJ7L 1RTZA 2F1FA 2YKQA 2W4DA 5KFPA 4USJC 3PO4A 3MZIA 3FMBA 1TL7B 2LCWA 2ZH7A 1ZM2A 2NS1B 4GC7A 1IR2A 2LXFA 3EZOA 3K17A 2J6UA 2MKYA 1RP5A 3K5PA 3W5ZA 2M4MA 2YNGA 3HD2A 3H5SA 2BE7D 3KLGA 1WOSA 4NEYA 2C2KB 3BPDA 5KFFA 1T9WA 2M5YA 2FVQA 2CDRB 1LWEB 1K44A 3TUZC 4DV7J 3LQVA 2XS2A 2CXEA 1NJXA 1CC8A 1IKWA 3Q0AA 2IM3A 2QL5B 3EVOA 4G1QA 1LWXA 2EFNA 1WHWA 4LSLA 2IJFA 3HHDA 1KQKA 4ANDA 2H65B 3HPOA 4IRCA 1SJ4P 4AUKA 1D3WA 3Q2TC 2Y1RI 1Y0HA 4Y2IA 3TZZA 3H5UA 3MM9A 2ZH6A 1R0AB 4NZ0A 4HDGA 2JJ4D 3QPIA 1MROB 3WX8A 2CNKB 5AT1B 1R0AA 2WSFC 2V6AA 4TLRA 2KT3A 1BC6A 1L3TA 2Y1LB 4KGZB 3Q8YA 4DV2F 2C2OB 4FVMA 3W8GA 2OTLS 1FESA 3GG1A 3J80U 3THVA 2QJ3A 3UFCX 1NZAA 4B3SJ 3IBWA 3TJ8A 4LRAA 2M8HA 5K20B 1N5SA 4NPOA 3PW2A 1URNA 1HQEB 1SJ1A 2OD6A 3H98A 5HN0A 3QIDA 3CUNA 3BO4A 1HYSB 3CCES 3BGFA 5HANA 4DPXA 2K1RB 3ET6B 3CD5A 3N6LA 2NPIA 4A47A 2CJ9A 3BQ0A 1ZM4A 4F3MA 2QA2A 3SV3A 2HLTA 1H74A 2K3KA 3MPYA 4QWDA 3ZZ0A 3HO1A 2XMJA 1REVB 1SC6A 1S6QB 4IH6A 3RYLA 1B7YB 2YVSA 1R0BG 5ETVA 3C16A 5KG5A 4B3SF 2YWHA 4JV2A 4LFBJ 1S6QA 2XZDB 4XK8C 4JI4F 2V2KA 2C3PA 1PAEX 2QIFA 3K89A 3KG0A 3M8QB 3OD2A 4RW8A 1RWUA 2EEYA 4RX6A 3A3NB 4Q0BA 5DLGA 3RW7A 5B0DA 2UUAJ 2B4VA 3MEGA 5J1EB 1K9MT 5K14A 3T1HJ 1UAWA 1MWQA 2NLWA 3BGRB 4TVAB 3JAMU 3D2WA 2HBYB 4HI2A 5A8KA 5B0EA 1S9FA 1F3VA 1YBTA 3D1QA 1JLFA 2FVRA 3IWNC 4LF7J 1FXRA 2XMAA 1D8YA 5BYSA 4JI7F 1SUQA 3D7SB 3GU0A 3WBZA 4DCJB 5CABA 2E9TA 5LSRA 1H6KX 2MMYA 3BDEA 4ECSA 3UCZP 2Y1IA 3C46A 1PC5A 2NQPA 2DRAA 1U1PA 3UD5A 3CC4S 1UA1A 1SIZA 4ECWA 2VV5A 4O3OA 3BDPA 2KB2A 2GV1A 4K2JA 5CZVA 2B9EA 1NNDA 3I87A 1ZM3A 2KRBA 1EKRA 2CPDA 3MOJB 5HP1B 2LU2A 1WEZA 3H2VE 2N4CA 3I9V9 4DFKA 5KFZA 1SL0A 4M5MA 2QLXA 4I0WA 4AXIA 3CJ3A 3NY0A 1GQEA 4OFZA 3RG6A 5KFGA 3UCGA 5JVHQ 4DFPA 2E9ZA 4NLQA 3TUIC 4PQAA 3A8JA 3IGNA 1U6FA 3I6PA 3V6DA 2VG7B 1NK8A 4IRDA 4LF9J 4ECZA 4OHZA 4QOTA 2P8IA 3BR8A 1N5TA 1S1XB 4PYDA 3DRRB 1QE1A 3HHLC 4RWWA 1EX8A 2J7UA 4NYPA 2XY6A 1XMOJ 3AODA 3O2IA 5GAEI 4NYZA 5A76A 4TQRA 3VWSA 2QEXS 1HI8A 2M8DB 2ZHAA 4YR0A 1VQ4S 1URRA 2PFDA 2AU0A 1FNMA 3BYPA 3G9CA 5IT9Y 1Y3KA 2YTCA 3PY8A 2BE2B 4NLYA 1MN9A 2XLJA 4YB7A 4UUWA 2OKQA 2BE2A 2DY9A 4K4ZA 2GJ2A 2VBXA 4LBIA 3PEHA 5DG8A 4ED2A 5KFSA 3KFWX 5EUHA 1FEEA 4CT8A 4OYIA 2V2QA 3DLGB 3HFVA 4H4OA 5ETQA 1N36J 5L1KA 2M70A 4DMZA 2RQKA 1X4DA 3I4PA 2W2PP 3OTOF 2BOPA 3U1NA 1JLEA 1M0SA 1MMLA 1O5JA 1S59A 1Q53A 1S10A 1RHUB 3Q89A 4LF7F 4YDXA 3R5DA 2XGQA 4GC6A 1R8CA 5AXLA 2BJ9A 5C2GA 2FLOA 3B8HA 1MLAA 3GJSB 4WBFA 5AE2A 1NHVA 5KG6A 1QDUB 1RAGB 7FDRA 1FKPB 4YHHF 3V4IA 4JI8J 2XI3A 2ZZTA 2CPZA 2ZUGA 1ZH5A 1F5BA 1K47A 1N52B 2MZRA 4M5GA 2CPJA 4ECXA 2F9JA 1U25A 2X7IA 1E6YB 5B0CA 2VQFF 4W92B 2QYCA 2DNLA 3MAAA 3VQSA 4WIIA 4AYBD 4ZLPA 2DHSA 1KTQA 4HACB 2KXHA 1O6XA 4UY8T 5J2NA 3DRPB 4LJMA 3ONQA 3W9HA 4C9DA 2RRNA 3UW1A 3HLUA 2FB0A 3H0PA 3O1LA 2ZH5A 4IFVA 5C42A 1CS4A 4UQGA 1T05A 2HWTA 4TN2A 4DL5A 1W7WA 3J81Y 4UY85 4C6AA 5EWFA 3GIMA 3MGJA 3TZYA 3T1AA 1FKOA 3TEHB 1CG2A 1NJYA 1HNXF 3FSIA 2BJ8A 3ZO7A 3PJXA 5I42A 4J9KA 3HI9A 4ID5B 4JYAJ 2I9SA 2HWHA 3E8OA 3NGRA 5IC4B 3WZ0A 3KK3A 2OPSB 1HWIA 2X1GA 2UVWA 2RQCA 1FK9B 1C4AA 5DETA 1RA7A 4OZ0A 1L3UA 1HD0A 2K7JA 2VHGA 1QUPA 2GW8A 3M8PA 5HMYA 5J1PA 1K1QA 2XO6A 2Y3YA 1RU2A 2ZD1A 3NOGA 4RKUC 4ECUA 4DR4F 3M05A 1KLMA 4C8YA 1U2RA 1QTNB 2ZHBA 4AT1B 4IR9A 1RWPB 3DGPB 4TY8A 4PQUB 4CO3A 1FFGB 1KLMB 3QMQA 2HVDA 2V4JB 3EM1A 1H2TZ 1HBOA 2FUG9 4ZMMA 3SCJE 3J81U 4F0KA 4ZA1A 5M2RA 3T5JA 4LF4J 4L3NA 2V4JA 2FVPA 1TVRB 1S6OA 3FGVA 5E3PA 2QT7A 1KP6A 2QA1A 3CJTA 4ES2A 1YHQS 4QYZJ 1KS2A 4WJBA 1BD6A 3I56S 2BACA 2HFVA 2DNNA 3CDAA 4QYRA 3SDEB 3I5CA 3KUHA 5KFUA 3PO5A 2POKA 4NA1A 4PYAA 2J9DA 2AMCB 2WBMA 4FXVA 3IP0A 4NLRA 3TAMA 3MXHP 3JSBA 4DV1F 3POTB 2GO8A 4DR2J 1TV6B 1HARA 2X3GA 4AD6A 1OSDA 2IC3A 3UO0A 4USMA 3P5TL 4NXMJ 2YKNB 4MJKA 4IRKA 4V19X 3MD1A 4ED4A 1YZ6A 2V8PA 4OYXA 1HA1A 2LDYA 1DHMA 4CTAA 5K8MA 4RNNA 2AIRB 2GMHA 3TA1A 4LFCJ 4W98A 1KQGB 3HVTB 3QGHA 5KG3A 3QZ7A 1JMTA 1TAQA 2R7RA 1FTRA 1CULB 2BVZA 1X4GA 2V8HA 3HSDA 3HULA 3PR5B 3OVSA 1VK3A 5C2CA 4OJGA 4Q2LA 2ZM6F 3CCSS 3MMAA 2B5JB 4DV3F 2KFYA 2BQ3A 2KXFA 4B9MA 1H0HB 3TRGA 2GCFA 3CO9A 1MU2A 2UVUA 3W7BA 2EFPA 4DV4J 1VR6A 5K8NA 3WC2A 4FPIA 1S9GA 2F40A 2MQMA 1LW2A 3DRXA 1TZ0A 1LKZA 1MU2B 1VBKA 3AXMA 3BH7B 2IHR1 3ILOA 3ISNC 5HI7A 4F4XA 2EG1A 4CT9A 1OYDA 3IG1A 1EP4A 4HH1A 4K8RA 1VC0A 3IGVA 3C8YA 4WXWA 3BSCA 2F7VA 1AUSL 3IG1B 2RF2B 1KOOA 2DB1A 2Q6BA 3I55S 3WX4A 4ELTA 3OFGA 2NSBA 5I4MA 5L46A 1JJCB 2X51A 1UTAA 2O67A 4KY3A 1N48A 2D3UA 4C8ZA 4R8UA 4IG3B 2BEFA 4OLPA 5E33A 4DV4F 1YTYA 1U49A 2AJFE 1U1KA 1WACA 4P73A 1Q8KA 4ZK7M 1YSJA 2QL7B 4C3MA 4NWBA 3SYZA 2VG6A 3PIOQ 3BKFA 3HSZA 3F56A 4PXCA 4PXDA 3M1VA 1G3OA 2JEFA 3OHAA 2ZDPA 2ZH1A 4N5SA 4KH1B 5J2MA 1CJVA 3DI6B 1P1LA 2HS3A 3DLKA 3DXBA 3N4WA 3I82A 3H59A 1WWHA 1NJWA 1CJKA 2IIHA 2I2YA 1TL1A 4I6WA 2G4BA 4WFNQ 2XSJB 1R89A 5KT7A 1TL1B 3CJ2A 3TUJC 1HNZJ 3A8KA 4QU6A 2E1RA 4IKAA 2KFNA 2XSJA 2K3IA 3QATA 4KHPF 2J7KA 2OLWA 5LJ5Y 2CQPA 4G65A 1NPPA 4CLFA 3H5XA 3MAAB 4WZQA 2JSXA 2DR6A 2G0JA 2PMHA 4GO7X 4KGMA 1KNZA 5E3RA 1SBRA 2E7WA 3FZ2A 4BC7A 3QFHA 1HHTP 1Y00A 1NDPA 2CJXB 2NCKL 5J2QB 3NNHA 4WP8A 4F2RA 2MKHA 3NL0A 3BKTA 5C42B 3BKUA 5F0UA 2H54B 3VR1A 2GZOA 2PGCA 2VBZA 5GADI 2R9LA 1P27B 1S48A 4K4VA 3PW0A 1AUDA 3L7UA 3MD3A 1NK0A 4BLGA 4J91A 4I56A 5I3UA 1QVGR 1D0EA 5EN1A 2JH3A 3D5MA 2D9PA 2XHWA 4KQZA 2R7OA 2KT5A 2CPHA 3AQPA 2VQFJ 1VJQA 2BRKA 1FK9A 1FVSA 2HWIA 3C3LA 5F8HA 3JYTB 2F5GA 3B6BA 2MKJA 3RJMB 5HBMB 2DY1A 4NLGA 2XYHB 4X62F 4P2XA 1TK8A 4ELVA 4WIQA 3VGTA 4DJBA 3KLFB 2MLZA 4ECRA 1KTVA 3MEDA 4DR1F 1GEHA 2WSEC 1BLUA 3DMJA 4EUVA 4UOGA 2AGPA 2KJWA 5E7OB 2B7BB 3R6LB 2MQQA 1HBOB 3VAHA 3JSYA 2FLNA 4DR6F 3AD7C 1WC5A 2N7CA 4CIOA 5H9FK 2DGXA 2BW2A 3US5A 1CLFA 3KJFB 3TO8A 3PCOB 3VVUA 2MPUA 3W9IA 2Z30B 3DYAB 2WSCC 5KT4A 3EX7B 4A46A 2YNFA 2YWKA 1O51A 1WSVA 1YRTA 1YVFA 2CQ1A 1OMSA 2DXDA 2YWWA 3D0HE 3DYAA 3KLIA 2M9KA 1XNRF 3RTVA 3J7AN 5M2PA 4OV6A 4CDIA 1Q8IA 3D4JA 2Y0BB 5DDRC 2HHTA 3TR5A 2FD2A 2HNZA 5DO2A 2RS2A 1GXTA 2HBZB 1GMWD 1FTCA 3NAIA 4I64A 4DPWA 4I1TA 5IZHA 4TU9A 3KDNA 2QSWA 3CWJA 3F44A 2IYIA 2XLIA 3RUBL 4TU7A 5LM7E 3VAJA 3GYNA 4LVOP 4AL5A 1H2VZ 2B51A 1R7IA 1AT1B 4V19J 3FCWA 2HNDB 3B78A 5HROB 4NE9C 3KJVB 1V5IB 3KHLA 3GONA 2BV3A 2BQRA 3QWPA 4OYZA 3UDCA 5HROA 3AT1B 1PSDA 4EYHB 3MMAB 3W5YA 2XSFA 1IBLF 2BJ3A 3W2VA 2PD1A 2V8DA 4KO0A 2ZKUA 1FCAA 4Y28C 2J0QD 2BRLA 1M1GA 4MKAA 4CLZA 3LH2S 2UU9F 2PEHA 4WXOA 1GXLA 2VBWA 4F04B 1NK7A 1U09A 2BJ7A 1U24A 2A18A 2XMVA 3V6HA 2ZZMA 3TX8A 2N4DA 1CJUB 2RKIA 3SIPB 2JOQA 3BQ1A 4FXWA 4WFZA 3J7A1 1T9TA 1TL5A 4I4BA 1JLAA 3AA9A 1G4CA 3IR6B 3MM6B 4FYXB 4WE1B 5B0FA 1WG5A 2G2ZA 2HGNA 5IS2A 3HK2A 1ZZNA 2DEJA 1VCTA 3T5KA 1SQEA 2W8LA 1FDBA 3R5AA 3BO2A 4Q8EA 5LSLA 1FERA 2W2NP 3W3SA 3DLLQ 4KYZA 2I5JB 1QY7A 2W2MP 4DX7A 4DQIA 1JQGA 1KN6A 4NLWA 3CDWA 2WZ1A 3I5BA 3JXOA 2DIUA 2B43A 3GV7B 4ETXA 2UXBF 1Q86T 1B70B 1UMJA 1KDNA 2DKOB 1DQ9A 2GQCA 1H2UX 2XZWA 2YNHB 2LEPA 3KHRA 2ZBCA 4ZVEA 1UJ5A 2NR0A 3HVRA 4MIWA 3QJLA 4GKKF 3EDQB 3UDLA 5DQHA 2WCXA 2V9WA 1UVKA 4DCOB 1RISA 2GVDA 5IOLA 4LT6A 2YH0A 2EK1A 1M5KC 1VC5A 1BQNA 5J2PB 2KXNB 2X1AA 5CH7B 3M2VB 1BQMB 4QR0A 1IWGA 1TUGB 1JLCA 1I94F 1Q7LB 5ETPA 1REGX 3ELHA 2DEIA 2D69A 1JLEB 1NSPA 1CPZA 1JLCB 2DH8A 2HYIB 2IVMA 3P45B 2FQQB 4FDFA 4ZCMA 2OUGA 3NMAA 1HR0J 1H98A 3ZZUA 3I0RA 3MPWA 4YUDA 2C22A 1FKPA 5ETOA 4ZPTR 3U7JA 3J81j 3CXCR 4F50A 2FZGB 1D9FA 2CIMA 3FRYA 1PKUA 3CJ8A 2G0CA 5KFAA 2UVVA 4F8RA 1S12A 2RS8A 2QV6A 4H4KC 1VMBA 2GFFA 1F9FA 3NGKA 4YB5A 2EBGA 2JVOA 3SFGA 3KLVA 4U95A 1QAIA 1JJ2R 4MMOA 4JI3F 4QWBA 5IWAJ 2QO3A 1TP7A 4L72B 2LECA 4K50A 2R2RA 1XEZA 3MURP 1WHYA 2CG8A 2BKPA 1NUEA 1RT3A 2YPYA 3OT9A 1U8SA 2RU9A 3CJ0A 5HBMA 4YY3F 3N79A 3PM9A 5G0RB 3PACA 3RB3A 1XNRJ 1RT3B 2VZ9A 1G6BA 4AL6A 5LMNF 4KPYA 2F4VJ 4RBVA 2ACMA 4DX5A 3EXYA 2B6AB 2HFOA 3FFIB 1GX6A 2XMTA 3Q83A 2OAUA 3SFUA 3SQGB 1NZ8A 4NMLA 4RUAA 1CS4B 2CNLB 2BM0A 2YX4A 2FGOA 5KFBA 5J2NB 4XPEA 2XYGB 2BZ2A 2KRRA 2VOOA 2B3TB 1ZBTA 2OEMA 1HI1A 1GTEA 1F5CA 1O0PA 4KC5A 4MIAA 5F0WA 5L9XA 1Y5LB 2LEAA 4P75A 3ETOA 4OI0A 1UVIA 2QLJB 1WEYA 1Q79A 1N5VA 1YG0A 2R8HA 3KUEA 3G6VA 1Q16B 1SC4B 5FD1A 3GFYA 3RAMA 3CCQS 1L5UA 1DZ5A 4JI5J 2HZCA 1REVA 4WKRA 4C8MA 1ZPWX 4DLEA 1F3FA 2E1PA 3IM8A 1WC0A 1FEHA 3QQCD 4TNOA 4AQYF 4Y0FA 3LP0B 1HQ2A 3M8QA 2MYFA 3QT8A 5E3QA 1M1HA 3CD7A 5A6WA 4LUBA 2GQ2A 5IT4A 5D4LA 4TY8B 1RHJB 2MKIA 4PQUA 5DGBA 4M5JA 3EGWB 2H4WB 1XTZA 4LFAJ 4HT5A 2EFQA 3CJSA 4Y6IA 2HQFA 4USTA 2YNIB 3N01A 5D15A 5AXKA 1GNKA 4KE5A 1TTHB 3CCTA 2QLFB 4FS2A 2Q79A 1SH2A 2F3JA 5F8LA 3KK1B 1S0NA 1QUVA 2DHGA 2J9EA 4H54A 4QW8A 3CPWR 4JI6J 2C2ZB 4C0BA 4OX7A 1VHIA 2P9GA 3SDEA 2ASYA 1GK8A 3RZAA 5BYRA 3VCDA 2MGZA 3TQEA 4QYZK 1FD8A 1QLNA 1JNZB 2QYGA 3RGIA 2J76E 3VAKA 4K4YA 2VQEJ 2DH9A 4CWBA 3GCXP 2J7WA 4C97A 2DGUA 1SH3A 4J9PA 2Y1JA 5KFJA 4ZCLA 3TWZA 4ZPWR 1SKUB 3M7VA 3AOAA 3PYFA 2W2OP 5KG1A 5HVFA 2CQ0A 1FT8A 3J7Z5 4IOCQ 2E5GA 4EWTA 5KFNA 2CA9A 4K4SA 2XZTB 3W2WA 2WW8A 3DOLB 3QLHB 1LQ9A 1UPMB 2ZBPA 5A8RB 1FDNA 2M52A 3TEGA 4M1KA 1RBOB 4WK3A 1GMVA 3W2WB 4RZRA 3ICLA 4ER8A 1QSSA 1NHUA 2E7VA 1TKTB 3CULA 3EWGA 4Q7AA 4DPUA 2RSQA 1DTQA 1WTBA 2QLBB 3CGIA 6FDRA 3V6KA 2B5JA 1HNXJ 1GAOA 1DTQB 4LSZB 1FVQA 3MMBB 4P2MA 3KHHA 1SCJB 2UP1A 3E2EA 3HSJA 1KVKA 2O66A 3NGDA 2F8MA 2KHCA 3N28A 3N6MA 4OIXA 2HG4A 1WC6A 5T41A 2OPQA 3SI8A 2COLA 1H7XA 1RT6A 4QBUA 3MDFA 3A3OB 4R8UB 4OI3A 5CYMB 4YEAA 3IN5A 1N0UA 1PYTA 3MEEA 4Y2KA 1S4EA 2VUGA 2M88A 2ZNYA 1RHMB 1TR0A 5CYMA 2XQCA 1FHTA 3CCVS 1S4FA 1RDRA 2A1BA 3M2VA 3NOCA 3S7RA 3LAKA 3NG8A 2QA4G 2XY7A 3R97A 3SSRA 1XNQJ 2ZZNA 4J9QA 2B8QA 2Q66A 1UWBA 2LMIA 1HIYA 5AJ3J 3NBPA 4NLDA 1I5OB 2KM8C 5GMEA 2B4PA 4KH0B 4YY3J 2IY5B 1Q81T 3Q8VA 1X60A 3ISZA 2HZVA 2EC0A 4LRFA 1RHKB 3AHPA 1X0FA 2F4VF 3H20A 1O8BA 2YKOA 5H1SV 2PT0A 2YWEA 2AD9A 3HD1A 2DHXA 2W4PA 2HAFA 3EYZA 3NGUA 3J7YU 2FHKA 2HHHJ 4FBUA 3PW4A 3UQSA 5LT5A 1PBUA 1TFWA 3CC7S 3MR5A 2V4QA 3TOQA 2GAHC 5BXIA 1D09B 3RRKA 2LU1A 3GILA 3FRZA 1RCOB 3KG4A 2DNRA 3RR7A 5IM0A 2BYCA 2BXJA 2KDOA 4NA2A 1LWEA 4C2MA 4ILLA 2E5IA 4O3SA 1Y3JA 3Q8UA 2DIVA 5CXTA 1NAQA 5IM0B 4IYQA 3D6MB 5BYQA 1IBKJ 2J5AA 1C1CB 2D3ZA 2YQ3A 4MAKA 4ID8A 2NXJA 3GCWP 1HQUA 3M30B 1FXDA 3PIPQ 3OTCA 1Q8BA 2Z2YB 2CJBA 4I6YA 1SKSA 2P6SA 2E1CA 3SCKE 1S6PB 4BCAA 4FF4A 3SQGA 3R7BB 3ITHB 3TJAA 3TZXA 3GJTB 4NLUA 2LVWA 4Q45A 4OHWA 1LK7A 3IMQJ 4TLQA 1JIHA 2IMOA 5EGYA 5JVGQ 2HNYA 5HATA 1IKVA 1X31C 3IWXA 2RT3A 4IFYB 3MOZA 4L6V3 3DC2A 1FDAA 3B82A 4DSJA 5CCLA 2I1RA 4URQU 4OQJA 3CF5Q 4KFBA 3TVYA 3G96A 3GB0A 3K7RA 3O5TB 4A8SA 4EO8A 3K5LA 5B0AA 1VQ8S 1ZAXA 4KFBB 4PG8A 2J0WA 3DRSB 1UVMA 1WC4A 2V8GA 2B9WA 2LQ9A 3GE9A 4R0EA 2ZH8A 3NNAA 3MMJA 4M5NA 4CYUB 2XNRA 5DQIA 5CYJA 4ECVA 2ASDA 3T9NA 1JK9B 1RAIB 2GC8A 2V63A 4ZPVR 5HSPA 1HL6A 4X4QA 4GVBA 1YX2A 2OPRB 3G82B 2IBKA 2MEWA 4P2FA 1OPZA 2APOA 2MLXA 4ZDNA 3IRWP 3UPFA 1T9YA 2FJAB 4YR2A 3G4SS 4IOBA 3DGVA 1Q1KA 2V2VA 2KT2A 1RXOB 2RE1A 4CH0S 5IT0A 3TAMB 4H4MA 2IA0A 5FLXY 4DR4J 5CYQB 4WFAQ 3OW2R 1PO6A 3MCMA 3F0NA 3EGVA 3MEGB 1LXJA 1T9UA 3BGRA 1HYSA 4AFFA 1FXLA 4WPAA 3FUYA 4B08A 1S9EA 4K4XA 4L75A 4WU3A 4O4GB 2CQIA 1P9QC 4J7CA 4YB1P 3VZIA 2P9EA 3WQPA 1BXNA 2E7XA 3HVTA 2BUNA 1HNWF 1UJ6A 1U6BA 2XI2A 1DFDA 1XERA 2H1YA 2WONB 1VYAA 2VC0A 4ZCIA 1KD1T 1F6TA 3NXZA 2C28A 3DLBA 1RUSA 1A9NB 1FX2A 4O44A 3THPA 4F0HA 4B3OA 5HL7Q 3NCQA 2HQCA 3G87A 2AJ0A 2CQ3A 4NLXA 2E5JA 2ZNZA 4LRBA 3NAHA 4TY9A 3BBBA 1U0SA 4XDCA 3VTIA 3LO3A 1ACMB 5D4PA 3ISND 4CLYA 3MAHA 2QFJA 3W66A 1IR1A 1EP4B 2ACYA 6FD1A 2UV8A 2AJ4A 4EK2A 4DSKA 2HRTA 1JLAB 4NZ7A 2FIUA 3T9ZA 3EVMA 2SXLA 2DNHA 2RKIB 2VH7A 4J90A 2MQPA 4IG0A 3CO0P 2CPXA 2ASLA 1OJ4A 4J9LA 4ZN1A 3ULHA 5K9FA 2DR8A 2DRDA 4UQTA 4LVNP 1S1XA 3CT9A 4OJ3A 4LRDA 4LF8F 2ZM6J 1B99A 1T0TV 2K8GA 4PEOA 1Y5NB 4QJVA 4DSFA 1U1RA 2A0FB 2CVIA 2JVRA 4LIRA 3H42A 3QZ8A 5DLFA 2JDJA 5FDLB 1VBYA 4C48A 1UWBB 4B9UA 1FFSB 2W1BA 2YNHA 4FF3A 3PKMA 2HHXA 4OYAA 2EVZA 2QG9B 1HBNB 2OH2A 1RWMB 1AZSA 3LP2A 4M95A 5F8GA 3QNWB 1FJCA 4NI2B 5DDQC 1HHQA 4PG5A 3CTRA 1EZZB 3MCOA 3ZNJ1 5E3CA 1B0TA 4ERDA 3QSYB 3G71S 1FJGJ 4R25A 1S77D 4PWWA 2V94A 1VRTA 4CLWA 4PRFA 2QN6B 1RAAB 2DJWA 5C7PA 4B3TF 3DM2A 1YJTA 2IM2A 3HHKA 4NRUA 2UXCJ 2Q1LA 5E0OA 2CVEA 5KG7A 4BDPA 4DV6J 1KBRA 1DARA 4GKJJ 4P74A 1BQMA 1RTDB 4OZJA 2A10A 2G2YA 1UA0A 3KMQA 2NUUG 4LSNA 1PYOB 3I0RB 2GHVC 2XM3A 4ES3A 2ZKTA 1ULRA 4PZVA 7AT1B 4QWEA 2KYZA 1IKYA 1KHVA 4LSNB 3MMCA 4ZP9A 4F02A 1C1CA 3B4DA 2NXCA 2VFUA 1MWZA 1TKXB 4B3RF 2W9AA 2XG8A 1VQ5S 4LSLB 2D74B 2HHWA 2B4UA 3ITHA 4X64J 2CQGA 3LAMA 1N54B 1TMMA 1SPBP 2H4YB 1R3NA 2QZ8A 3DHXA 3Q8QB 2MZ1A 4ED3A 3EMTA 3HHLA 4NZ6A 5T7LB 3T1YF 2FJBB 2VODA 1WHXA 2D1CA 3A4TA 3BH6B 1BGXT 1F2GA 1HNZF 3PRDA 1YBAA 3T6JA 5A0YB 4A8KA 2CQBA 1VS3A 2H5EA 4Y65A 1XMOF 3PFOA 4OYWA 4RO0A 5A0YA 1T05B 4FXDA 2B56A 2WK4A 2H3EB 2Z8QA 3KJQB 2VG5B 4EFAC 3BF4A 4QIFA 3MEDB 4DCPB 3W61A 2EFOA 2BKNA 1F9HA 1Q82T 2VG5A 1EARA 3A12A 5ETLA 1N4LA 2KM8B 2VPZB 3MM5B 4C7QA 3GFZA 1X9WA 3IC1A 1L3SA 2ASJA 1VBZA 4DG1A 3W63A 1KOHA 1WKJA 3FDSA 3QO9A 4TKTA 3ZFVA 1RB0A 3MM5A 3QAEA 3CMQA 4USWA 4UT4A 2OPRA 5IV4A 2R2UA 3CC2S 3NNCA 1WG4A 3QO9B 4WP9A 2V34A 5T14A 3TVZA 1D8ZA 2YNFB 4JI3J 4MIBA 1MG7A 4PCQA 1YKWA 4ZPAA 1SJ3P 4JI2J 3EGZA 2MJNA 3A3PB 4FKYA 1X8DA 3A8EA 3F41A 1FRLA 3UNGC 1Q8LA 1XMBA 3D6HB 2AQ4A 2D7SA 2GVZA 3PR4A 1N33F 1KR4A 1HNVA 1HPZA 2Z0GA 3TAQA 2XMKA 1OY6A 4NLVA 3ETMA 4OX6A 2A2DA 1LXNA 4RW6B 4RW8B 5CCMA 3C14A 3O6QA 3QGGA 4X4RA 3T5HA 1YJWS 2E9RX 2LKZA 3FK4A 3LP0A 2HQDA 2R8GA 1KC8T 4WYLA 3SBMA 4DV6F 3C14B 2MSSA 3KUGA 3M6WA 3P8BB 4Z37A 1S9EB 2HQ3A 3KK1A 4E2FB 2H48B 2O3DA 3GSDA 5BJRA 4DL2A 1W26A 1UEVA 3N6NA 2VL1A 3G8QA 1VQKS 5LXRA 3IRXB 2BJ1A 2VD3A 4FNIA 5HLFB 2JL9A 1XR7A 4NLPA 3RB4A 1S1UB 1VQMS 1TKZB 1RCXB 4ZIVA 2EFVA 3VGVA 2W7OA 3IFEA 1PAUB 4N7TA 4WYWA 3W2VB 2NREA 4MYTA 3L7PA 3S1TA 2WAQD 1RK8A 4L74A 4DR2F 2G2OA 3PVXA 1WDTA 4GO5X 3EICA 5HO4A 2W7PA 1RKIA 5HP1A 4IQXA 4K0KF 3GJQB 3I96A 1BMQB 2B9YA 3TZWA 2EI5A 2N3LA 3C6UA 5U47A 5AXMA 3TJ9A 3T5LA 1D1UA 1FJ7A 1U2CA 4X4OA 1ZETA 2I6WA 3W1YC 3V81A 2DPJA 5IXUA 3MM8A 5A8RA 1FRIA 4ITSA 4QR1A 3RBDA 3JQKA 3GR0A 4HR2A 4UW2A 3WDOA 3M8WA 3K8WA 1DLOA
chains in the Genus database with same CATH topology
1F5AA 3DRRA 2GMJA 1I1GA 3OFHA 1N56A 1JX4A 2XWYA 4X65F 1DLOB 3LP2B 3NS6A 2AJQA 5GAHU 1RI7A 2FVSA 4RBTA 3D28A 5L8RC 3K0JA 1YJUA 1VRTB 3LWLA 4ELUA 4HT7A 4DN0A 1QTMA 2VG6B 4FPRA 3CCUS 3MECB 3OBIA 2J9CA 5KFQA 1VI7A 1JKHB 1HD1A 5DDPC 1I6JA 2OMOA 1IJFB 3FEXB 1VIXA 3M2RA 4ZP6A 4CO4A 3KNGA 2MKKA 2MZTA 3M2RB 4YFUA 2AJ1A 2IVFB 3AJ2A 4KR0B 3V4IB 3M32A 3P3DA 1T95A 5C24B 5F8JA 3PXGa 1SXLA 4O0IA 4YDDB 4AL7A 5C24A 3D1OA 4EGLA 2HGLA 1LWCB 2RJZA 1X5PA 4O3RA 1IUJA 3CCLS 2KFZA 4D3GA 2UUCF 4YR3A 4PG7A 3U1MA 4K5RA 1JLQB 1K73T 4DHVA 4DQPA 3PJWA 2L9DA 4DDFA 3R1LA 2PI4A 5I3UB 1UJ4A 5DM6Q 4MKYA 1ROFA 2IYGA 2PMZD 1S6PA 3NS5A 4I68A 1MW7A 1LK5A 2L48A 4ID5A 2IRUA 2J0SD 1U2FA 5KAKA 4TU8A 4URGA 1Y9OA 3V2UC 4DFJA 3HX9A 3RBEA 4OHVA 2FHJA 4LMZA 1W25A 1IBMF 5KFHA 5DS7A 3QGPA 5KFOA 2AGQA 4Z2XA 4XDDA 1RT1A 2L08A 2NZ4A 3DGPA 1MMDA 2VKZG 4JV0A 3PX6A 5E2QA 5D77A 1FA0A 1Y5IB 4MH8A 2UV8G 2BQUA 4IDKB 1TL4A 1VLYA 3OR1B 4F26A 2IAJB 4HDHA 3BGUA 3OR2B 5LMUF 4J9NA 2DR7A 3RR8A 2NPFA 1FE0A 2B9XA 4FF1A 1IXKA 3OR1A 1XR5A 1YJRA 3CJ5A 2NUHA 4J37A 2FGCA 2J8AA 3O44A 4O4RA 2HPUA 1M5SA 5D6GA 5L1LA 3OSNA 1K1SA 2BA9A 2KU7A 4FNHA 2YKMA 2HS4A 2YKPA 2XWXA 2DPIA 2EFGA 2O1PA 5CYQA 5A6PA 4G1PA 4O4GA 3VALA 1BY9A 3CDEA 5JJBA 5GADU 4CH1A 4ED6A 4ZOSA 1B0VA 4K59A 4LF9F 2MZJA 1K0VA 3GR1A 3QLHA 1SL2A 3IXQA 3R27A 2YWGA 2GO9A 4A8YA 4KO0B 2NSCA 4OZ5A 4GKJF 2AYEA 1FE4A 1IQTA 2LXIA 2VOPA 1R8AA 3DN9A 4O44B 4B3OB 1S9GB 1VHFA 1S76D 2FJDB 4JI1F 1ZOTA 3FMWA 2VKRA 4RUHA 2ZH2A 3UD4P 2EW9A 4FS1A 3TI0A 2DNPA 4RLEA 1SUQB 2DNZA 2WB4A 5THWA 3UE2A 2RRBA 4N76A 2HFZA 2VBYA 3MM6A 2ZBIA 1X4BA 1RT6B 3EUNA 3PNIA 1VQ6S 3U27A 1R8BA 2W7AA 2FJEB 1SJFA 4JV1A 2C3OA 4IG0B 3UR0A 2J9DE 3HHEA 2RQMA 3DLJA 2QSFA 1L3VA 1VQ7S 4F4YA 4QPTA 1UEUA 3OL9A 1Z4UA 1A7GE 2O01C 1TL3B 4KRWA 1SKWA 2FJVA 3M1VB 4J5OA 2OPPB 2BDPA 1S6UA 3MF5A 1S0OA 4LF4F 3DDNA 5KFIA 2MJUA 4FP9A 1IKXA 1TL3A 3E01A 3DI6A 4TYBA 1UP1A 4MFBA 5EWGA 4DF4A 4JI6F 1IKXB 2CPFA 2E44A 3BSOA 1WHVA 3H25A 2ALZA 2LEBA 4KJIA 1TQLA 3K57A 2EWHA 2XC9A 3H4BA 4DQSA 1XK8A 1RTDA 2LLZA 2HLUA 1YJNS 2DNGA 2V8VA 3VF0B 3MFHA 1SJRA 1UFLA 4DOZA 5DM7Q 1XNQF 1LWFB 2ZH9A 3I9ZA 2J6TA 2GNKA 4IOAQ 3QIPB 5F9LA 1JXEA 2R8KA 3RU0A 1IM4A 1CVJA 2O5DA 3F73A 2X1FA 3G6YA 4YB6A 2NYIA 5LJ3Y 4FYDA 3OTDA 2PO4A 1TFYA 1RQ0A 4LIWA 4X4VA 4E8UA 1H3DA 1RT2B 4QWCA 5T7LA 4XO0A 1DAXA 1U6ZA 4NCGA 4IQMA 3VAIA 3C66A 3FSYA 4JUZA 3GIIA 3AH6A 3BSNA 3JB9k 3MR6A 2D41A 3CEDA 1IKVB 2W9CB 2BANB 1UVNA 5EX0A 3R1HA 4EEYA 5G0RA 1HWUA 2PA8D 5GMKa 4KKOB 2ATLA 3HKZD 1T8EA 2A2CA 4LQ9A 4KKOA 4XAKA 3I0SB 1NK8A 2DH7A 4ZPDA 3KLFA 2ZOFA 1X4AA 2ROGA 3RW6A 3GFXA 3KHGA 4ZPBA 1SL1A 1ZAWA 3LF0A 3DMJB 2WBRA 3C2PA 1F60B 3RB0A 5K5MA 3AY0A 4HEA9 5E5NA 1HI0P 1KFDA 2UUTA 1U1NA 4IDKA 3AAWB 3LPYA 2B0GA 4ZVHA 3Q8SB 1NK6A 4WF9Q 1R8PA 2GIRA 3PRBA 4JI0F 1U1QA 3HMJG 4UUXA 3CCJS 2ZE2A 2ADBA 2LA4A 1BQXA 2MSTA 2ZITA 4RW6A 1HR0F 2PE8A 2ZH4A 3EPIA 3K58A 3AA8A 3BB5A 3HFKA 2E66A 3PHEA 1T03A 4DR3F 5CHCB 4G1IA 3U1LA 2OMLA 4ATNA 4PR6A 3HVWA 1G2EA 4Y2MA 4C8LA 5B08A 4KGKA 3I31A 1C4CA 2KO1A 3LP1B 5ITHA 1M90T 2HMIA 1DTTA 4WFYA 1KQSR 2DGQA 3KMSA 3M2UA 2KG0A 1ELOA 3BGLA 3KJVA 5KOWA 3OHBA 4CNZA 1X9SA 1C1BA 1J5OB 2VFRA 3M2UB 4DV0F 1QSLA 3CMES 1HWJA 3L09A 1C1BB 4X4SA 3G6ES 2XMMA 2I0XA 1RYSA 3PW5A 1S0VA 1U45A 4M5DB 4C8KA 2VQEF 3IAM9 4ILMA 1QSYA 1UVJA 3S6EA 4ZS6A 4C11A 3RRGA 1U26A 1SIWB 4W90B 1RGVA 1TV6A 1R6YA 1C0UA 3SEOA 5CA5A 3KTQA 3EZUA 2IRXA 1C0UB 2FJXA 2MZSA 1FRMA 3MM8B 1YRUA 2A3JA 4F25A 1M5OC 2MKCA 4FZVA 4ED7A 2R8IA 2GIQA 3KWMA 2LDIA 3MWBA 2G9OA 4OJHA 2L41A 1P6TA 2JHEA 2CRLA 2Q3PA 2YX7A 3CDBA 4KAIA 4EU0A 5KT6A 4X4RA 3G8TA 1NEEA 2XB2D 5HQ8A 4BWJA 3OJUA 2ZC3A 1OWXA 1SV5A 1CQMA 1X7VA 4C0HA 2N3OA 2HRYA 1TAUA 1S1TA 5KT2A 1SV5B 2DO0A 3SZ2A 3DM2B 3MTJA 2ADCA 4KV8B 1P1TA 3NBPB 4P6QA 3Q8PB 4CCHA 3MUTP 3IA0A 4IH5A 1VQ9S 4RW7A 1Q7YT 2DITA 1GTHA 2LQBA 3HZEA 3OFEA 2R7TA 4DEZA 3KLHA 3TAPA 4PG6A 3TYTA 4YQWA 3BEGB 1HW9A 3GIKA 2JX2A 4FVCA 2XEXA 3M32B 4IG3A 5SZTA 1M5VC 1EETB 3CJKB 1H38A 1JLGA 1YWXA 4URSA 1HBMB 4TXSA 2XMUA 3RAQA 1FJGF 4ECYA 4KHRA 2CQ4A 2DNMA 4AXJA 4LFBF 1N6QA 2ZOMA 2I38A 4A8OA 2DGWA 2W9CA 1N5YA 3TW0A 1Z2LA 4X2BA 4J9OA 3OL8A 2JC1A 2W9BA 1FF2A 2ZVSA 3CDUA 4N41A 2XCAA 2JC0A 2JLEA 4E98A 4DS4A 3OVBA 2W9BB 3MCSA 5HMZA 2KVIA 3VAFA 2AW0A 1C0TB 2CYYA 4TYAA 5K8PA 2PFFB 2I8EA 5AE3A 5KT5A 2VPWB 1C0TA 4FF2A 2HNYB 4M8LA 3MFIA 2P6TA 3TANA 2ZFHA 3OXLA 2YNGB 1FRXA 4I2PB 3KLGB 2OPSA 3OTBA 2WOMA 3ZZZA 2IMWP 2E29A 5L1JA 2XBPA 1VOMA 1PILA 4QW9A 1B7FA 3V5RA 5IQQA 3C6TA 3DRSA 4HHJA 3OVAA 4EYIB 3TNVA 2ZE2B 4I67A 4OLOA 1T3NA 1TK5A 2R7VA 1KSPA 1WF0A 2IM1A 1VQLS 3KNAA 2HHPA 2IAJA 1RT4B 3CCWA 2OD4A 3TA0A 1AFJA 2CQHA 2RILA 3NP5A 4PPDA 1NJZA 1LV5A 2XLKA 1K0TA 3OUYB 2ILZA 3G8SA 1K8AT 4YP3A 2AYBA 3MI7X 2OFGX 4PPZA 5LL6d 3KLEA 1SKRA 1HQEA 4A8XA 3ENQA 2R2SA 3RB6A 1TKZA 4ECTA 3KLEB 2CFXA 2JWNA 4J9RA 1NU4A 2W8KA 3TVKA 2IC3B 4EBEA 4RU9A 3CCRS 2XY5A 1NKEA 2YKNA 3BM7A 1MMNA 5H9EJ 1RTJB 2CQCA 4Q2MA 3MAQA 3TQ1A 4B9SA 3KLIB 1IJEB 3SCLE 4WCEQ 3QJJA 4LF6F 3FEYB 3KG1A 4OI4A 3DNCA 2E1AA 1N36F 1WF2A 1LFPA 2VFSA 1HW8A 1L3KA 3AQOA 3M6UA 1U7LA 2KHDA 4LFCF 1XN9A 2ZOGA 2E1MC 3FJ2A 4RUCA 2XCPA 3NKYA 3OV7A 1OIAA 2RDJA 3GV5B 5K14B 5LXYA 4RW9A 3HHLD 1X4HA 3D0IE 3KKFA 5KT3A 3TARA 1UETA 2DGOA 2GGPB 3MMBA 4DUZF 2E5LF 1NKCA 4F4KA 2DGVA 2HNDA 5CZXA 2GGPA 3JAMY 4IH7A 5F8NA 2RRAA 1HWLA 4JI8F 2OPQB 2PIIA 1VBXA 1S99A 2RF2A 5KFXA 3Q8RB 5IFMA 1WEXA 3EGNA 1NB7A 2RVJA 1NJIT 1S1TB 3PKYA 1X5TA 3PV8A 2LA6A 4BC9A 3K59A 4A8MP 3DCAA 4KV8A 4J9SA 4PUOB 4X4UA 1FNOA 1CC7A 3M9MB 4N8NA 2UUBF 1FKAF 3E01B 5E3AA 3J7ZT 1S72S 1U1OA 3EZ5A 3DLHA 4HTJA 1VQYA 3DU5A 3MEKA 3G6XA 2ZH3A 4B9TA 2WB1D 2KZZA 2MY8A 1R31A 4OHYA 3CVKA 2OTJS 4WK1A 3DFEA 1NRKA 5F3TA 4A48A 5C5JA 4OHXA 5KFKA 4OX9F 3E3XA 2AYMA 4U67Q 3RRHA 1QE1B 4K5SA 2P9CA 1SI9A 4KIAA 4WFXA 2Y1JA 1WELA 1X5SA 4BBYA 1JXLA 2DCUB 2UVRA 2CG4A 1Y4ZB 1X4CA 3R5BA 4MYUA 5KFMA 2JEGA 1IKYB 3MR2A 1XBWA 3RAXA 2M2BA 1H7WA 1LWFA 3S01A 3HVAA 1WNEA 4HKQA 5EX3A 2WTFA 3LW5C 3HM9A 1IQZA 1JJHA 2XO7A 2CQDA 2LQJA 4H4KA 1VRUB 2MKSA 2PSZA 2Q6CA 3LGMA 3SSQA 4RNFA 5KOXA 2ILYA 3M6VA 3THTA 3PEJA 5JUMA 2M7SA 3OL6A 1V3ZA 2WOMB 3VQTA 3DOKB 2HW3A 4QPXA 3K2YA 4Q5VA 3I0SA 2BANA 4KHMA 3FQKA 3V6JA 1FDDA 4FBTA 5B09A 2R4FA 2DRBA 4OI1A 2MQNA 2XGPA 3GQCA 4QR2A 1HNIA 2DT9A 1IKWB 1RT1B 4MK7A 2HRUA 3IS9A 2ZJQQ 4Y34A 2HHVA 3FSXA 2LXUA 2VFVA 1HNIB 3H8YA 4I7FB 5K8OA 2PN6A 2U1AA 4HI1A 2MXYA 1AW0A 4ZKAA 3CCZA 3ZZRA 2EKYA 2R7QA 3OUYA 1VJWA 2OO4A 2R8JA 5A2QY 3LANA 2DO4A 3HT3A 2J0XA 4JI2F 4D3HA 2FC9A 4ED8A 4KT0C 5F8MA 5J2NA 2BABA 4DQRA 2DNOA 1PC4A 4OV1A 5KG2A 4IR1A 1RT5A 1KEKA 4DQQA 3NCPA 5KFCA 2MZQA 1FO1A 1S1VA 2JRSA 5DG9A 3KOAA 2Y0SD 3ZZYA 4KSEB 4LFAF 5A8WB 1V3SA 1DQ8A 2WONA 4OZLA 4UOCA 5G4DA 2XY7A 1VQMS 2VODA 1JWWA 1CSJA 4A8QA 4U9RA 3FCHA 3OXGA 1WI8A 5KFRA 2CZVC 5GAHI 4Y3CA 4RW9B 2YNIA 3G86A 3L95X 4XIUA 2FLLA 2RNEA 4USHA 5B0GA 5A8KB 3C6UB 4F4ZA 2PDAA 4O3QA 4F3QA 4YOEA 5CQGA 3POTA 4C11B 1AXQA 1HWKA 4NX9A 2GA7A 2DNKA 2V4RA 3NWGA 4DSLA 2L3MA 2R2TA 1M1KT 1SJQA 2XNQA 3HJFA 3P96A 1APSA 4F2SA 2FHJD 2OSQA 2RU3A 3CMAS