3CJKA

Crystal structure of the adduct hah1-cd(ii)-mnk1.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
68
structure length
68
Chain Sequence
PKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Copper(I)-mediated protein-protein interactions result from suboptimal interaction surfaces.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport/hydrolase
molecule keywords Copper transport protein ATOX1
total genus 18
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cjkA00
3FGVA 3FMBA 3MCSA 5B0FA 4DL0C 2OMOA 4U9RA 2VV5A 2RILA 1TUVA 2IFXA 2ZDOA 3CJKB 4ZOSA 3HDSA 3BGUA 2HIQA 2AP6A 2ASYA 3BDEA 4FNHA 5K9FA 1OPZA 4HI2A 3BB5A 4HH0A 3HFKA 3K7RA 1CC7A 2PD1A 1QUPA 1AFJA 5B0GA 1AW0A 1SQEA 3KKFA 1RJJA 1YJRA 3BN7A 1AFIA 1K0VA 2K7JA 4QOTA 1TZ0A 1KVIA 3QGPA 1Q4RA 1OSDA 1TL5A 2LXFA 2ROPA 3WDOA 1SB6A 2KYZA 3HHLD 2XMWA 2OAUA 5T7LA 1JWWA 2N4CA 2QLXA 1VQSA 3F44A 3LGMA 4A48A 2L3MA 3CJKA 2FB0A 2LDIA 1Y3KA 2W4CA 2HQIA 2XMUA 4DPOA 2N7YA 3FRYA 4NL5A 2BJEA 1N5QA 2BUNA 2HFOA 4HH1A 4OJ3A 5A6WA 1Y9OA 5B0DA 4Y2KA 2FIUA 2PGCA 2IYGA 1KQKA 1CPZA 1Q53A 2ZDPA 1ULRA 3IWXA 3HF5A 1FD8A 2AJ1A 1GXTA 2VH7A 4YEAA 1IUJA 1XBWA 1X8DA 3TOQA 1FVSA 2IYIA 2ROEA 1VQYA 4OIXA 1Y0HA 3DXSX 1MWYA 1V3ZA 1YJUA 2XMVA 2GGPB 3MZIA 1JK9B 1APSA 1N5SA 2RMLA 2W4DA 1R6YA 3GZ7A 2XMKA 2KT3A 2RU9A 1YJVA 1X0PA 2XMMA 3DCAA 1Q8BA 4DN9A 1U7LA 2XMTA 1URRA 4FNIA 2GO8A 5A6PA 1Q8LA 1X7VA 5B0AA 2GV1A 2EW9A 5B0CA 4OJHA 4Y2MA 3UDCA 1P6TA 4A47A 1TR0A 4HL9A 2GGPA 2AJ0A 2KKHA 3HHLA 4Q2LA 2OFHX 3LO3A 5T7LB 1FESA 2FHMA 4A4JA 4EFAC 5B09A 3IWLA 1YRXA 2JDJA 5F0UA 1FVQA 3BR8A 3T9NA 2HLUA 4F67A 5B0BA 2K7KA 5B0EA 2N4DA 1P8GA 1WD6A 2CRLA 2GCFA 1N5VA 1W2IA 2OD4A 2QIFA 1YJTA 2K1RB 2QLWA 5IXUA 1FEEA 2OP5A 4NPOA 3KG1A 4OJ1A 4Y2IA 1OQ6A 2BYCA 2RSQA 3HHLB 2QYCA 2HFNA 1S6OA 5F0WA 4HI1A 1TL4A 3TNVA 2OFGX 3HX9A 3QMQA 2XMJA 2LQ9A 3BM7A 4Q2MA 2FTRA 5B08A 2BBEA 3KNGA 1OQ3A 2K1RA 1FE4A 3TRGA 2ROGA 1SI9A 2HLTA 2ACYA 2Q3PA 1Y3JA 1LQ9A 5KAKA 2W4PA 4OJGA 1CC8A 1KVJA 4YDXA 1MWZA 3BF4A 2G9OA 3E8OA 1GXUA 2GA7A 1YG0A 4A46A 2OKQA 3I9ZA 1S6UA 3LGNA 2GFFA 4ZA1A 1N5TA 2LQBA 2K2PA 3VTIA 1FE0A 2AW0A 3HHLC 2KT2A 3KG0A 2OD6A 2BJDA
chains in the Genus database with same CATH superfamily
5I4MA 1S1WA 1O0PA 5KT3A 1RKJA 4LSLB 4DR6J 1S0OA 2V9WA 3NOGA 1YDLA 1DQ9A 3AAWB 3O5TB 2V69A 4DV0J 3N01A 3LPYA 3M8WA 2K3IA 5CCMA 1JLBB 4X65F 4OQJA 4OYOA 4DSFA 1T03B 4LF9J 3CDUA 4ZHRA 3Q8RB 2ZHOA 4ZPAA 3KJVB 2VQEJ 3WC0A 3O44A 3C15B 5F8HA 3J80U 2YQ0A 5HP1B 5KFGA 1O51A 5T14A 2H5JB 2XSJB 3HHEA 2CFXA 3RYLA 3D28A 4V1Ak 3E2EA 2C2OB 4F8RA 2F9JA 4DFJA 2HBQB 3B4DA 3T19A 1KLMA 1JLAA 2K7JA 4B9VA 1AT1B 4ZLJA 2ZE2A 1UVNA 3CCMS 3DLEA 5KG0A 2ROPA 2YKPA 3HFVA 4G6VB 2W2PP 3W66A 3OFFA 3W9JA 1U47A 4ILLA 5T7LA 2QLXA 1WG4A 2GJIA 4FYVB 5IM0B 1N33J 2EPIA 4HHJA 4USKA 3TVZA 2CADA 4DSEA 3KJQB 1NK5A 5CZVA 1Y3KA 4DQQA 4QIFA 3Q8QB 3K57A 4TNOA 2HQIA 1RSCA 1ZPVA 2DHXA 2MHEA 1MWQA 2ZD1A 4GMKA 2O67A 7FD1A 3TI0A 3ENQA 3M30B 4DL7A 3BPDA 1KP6A 2M3DA 4HHUA 3TJ8A 3V5RA 3OVBA 2B56A 4U7UD 2JZ5A 2RAQA 4I1TA 2CQGA 5A8KA 2XSJA 3TUZC 2DISA 2AX0A 3TOQA 4HKQA 1X8DA 1NZAA 1KSPA 1WC4A 3L3CA 2YY3A 5KFQA 5HSPA 1C1BB 1YBUA 1M1HA 4OIXA 5LJ5Y 3RRGA 2W24A 3X1LB 3DRPB 2F4VF 2DY9A 2P6SA 3R7BB 1N32J 3IC1A 2ZJRQ 3LALA 3LA0A 2RU9A 1CJTA 1CQMA 4LR9A 3G82A 2QC3A 3FRZA 3HD1A 4P74A 4UT4A 4F2SA 3QRRA 2E9RX 1VLOA 1H98A 1NH7A 1VQLS 3DLKA 3GYXB 3PJWA 5A6PA 3OVAA 2VFVA 1X7VA 4KC5A 4OHVA 3ENVA 3TANA 1WI8A 2H65B 1M1KT 4R8UA 4KTQA 1FRXA 3PRVA 2AYEA 2B5JA 2DIUA 2KB2A 4RWXA 2MQNA 4ZPTR 1I51B 4ZVOB 1AFJA 3UQSA 5ETQA 1K1QA 1YRXA 2DGQA 2W2OP 4H54A 1X5OA 5HATA 2BQ3A 1HHTP 2WONB 3C14A 3DRYA 2E5LJ 2PDAA 1UJ5A 1WG5A 4B3MJ 3EVOA 4I0WA 4JYAF 2UU9J 1U6BA 4NLWA 4J9PA 1QSLA 4CNYA 1OQ6A 2QSWA 4UOFA 3EE3A 2HFUA 3MURP 4O0NA 5AJ3J 4ZVFA 1HQUB 4C11B 2D3O1 4X4TA 4QIGA 3N6LA 5J2QB 2F9DA 2VF3A 2KG1A 1T3NA 4EZ6A 2Q66A 1ZM4A 1UVJA 1SI9A 3L7UA 1FRKA 3IS9A 1NDKA 4RX6A 3OHBA 1Z2ZA 3KG4A 2ZH9A 3JQMA 5KG3A 4MH8A 1TFYA 3BBBA 3US5A 2VJVA 4B9TA 4QCLA 4TY9A 4JOUA 5CCLA 1DJ0A 2GJ2A 1EIYB 4F0MA 2GFFA 3G96A 2DNPA 2LQBA 3GG1A 5BYSA 1I94J 4RU9A 3FZBA 4N41A 2AGPA 3MMBA 3CJSA 5GAHI 2XCAA 5K14B 4DR3F 3PACA 4C8NA 4WFYA 2KRBA 5GAEU 4UQTA 4URQU 1UPMB 4X4PA 3MFHA 2LMIA 3MCMA 5HVGA 3UVJB 3A4TA 4RNMA 3SSQA 4ECUA 4JI1F 3H4DA 1EP4B 2IFXA 2QA4S 1FJGJ 1CLFA 4LREA 2E5JA 2WVFA 4LF4J 3TAPA 3W7BA 4GKKJ 4I4BA 1DQAA 4CQ1A 1OY9A 4CYUA 5IT4A 3VAKA 1Q16B 4PQUB 1SJ3P 3DNCA 2XZDB 2J76E 2C2KB 3D6TB 2CUYA 2HFZA 2FJXA 1F1BB 4Q7AA 3W5XA 2AWZA 4ZVSB 1P1TA 2NPIA 2PO4A 4PG5A 4OLPA 3UO0A 4DFKA 5KT5A 1UVMA 1KVIA 2ZKTA 3QZ8A 2KZZA 1IBCB 4DV2J 2FGOA 4P7TA 5F41A 4PQUA 2HZVA 3MEDB 2QA1A 1IKVA 2MY8A 3HHLD 5D15A 3F44A 1FK9A 3ITHA 5DQIA 2W9CA 2MZQA 4CO5A 2VB6A 1HWKA 5E2QA 1FEHA 3AOBA 2OTLS 1LOUA 1SQFA 2ZOGA 3DI6B 4NASA 5KFXA 4A8WA 4XDDA 3R8YA 1ELOA 1FFSB 4ZHRB 2G0CA 3Q83A 3C19A 1NH8A 1FXLA 2Z8QA 4C0HA 3O8WA 4DCPB 4Q8EA 2QV6A 3H0PA 1KRPA 3TX8A 1B70B 2IYGA 5L39A 2CDQA 2M52A 1JLQA 3MEGB 3M9NB 4DR2J 4A8SA 2ZUGA 3JAMY 1SL1A 1X4DA 2J9DE 1XBWA 3TA1A 1TKZB 4M1KA 1GTEA 1VQ6S 2P9CA 2BVZA 2ROEA 1JLFB 3BGRB 4FVCA 3GIRA 4R25A 3LP0A 3KUGA 3FSXA 5F3TA 1HNZF 3H5SA 4C0BA 1Q79A 1NK4A 2HWTA 3MPDA 2RMLA 1ZAWA 5HQ8A 3UWTA 3S8SA 1RAOA 1YJVA 2CJBA 2V94A 2K06A 3QSYB 3QRQA 1CJVA 3HHKA 3W2VB 4DN9A 3F56A 1N5YA 4KFBB 3GFYA 2E66A 4B3OA 5SZTA 1R0BG 3H2LA 3AODA 3HI9A 1HIYA 4LSNB 4GKJJ 3RU0A 2J6TA 1H6KX 1L3UA 1RT7B 2ZBIA 3CJ5A 3DM2B 3GJTB 3MAAA 3DGVA 4LIWA 3KHHA 1XN9A 2YPZA 3P5BP 5B09A 3I9V9 4E8UA 1EZZB 3BZQA 5F0UA 3D5MA 1KQSR 3IN5A 3JQJA 4F0HA 4ECSA 2QL5B 3W5ZA 5KG1A 4M95A 3SV3A 3AQOA 2FQQB 2XWYA 1W2IA 3LF0A 3Q24A 3KMQA 1ZZNA 2FLPA 2OP5A 3QLHA 1BD6A 1S76D 1QJHA 2AX1A 2NUUG 2BE9B 3IBCB 3IGVA 5F0WA 3CB4A 4NLQA 5L46A 2OFGX 3QJJA 4B3TJ 4NI2A 2HG4A 2LFVA 3V81A 4G1QB 5G0RA 5E41A 1N0VC 2ADCA 3IR5B 5KFJA 3C2PA 1B64A 3T6JA 4RBVA 4WPAA 4Q2MA 2AYGA 3M8PA 1T11A 2DNZA 4U7CA 2BW2A 4GC6A 5KFOA 3AD7C 2G2ZA 3VQSA 4J9QA 1JJHA 4KGKA 2XS7A 4UZCA 1WDTA 2ACYA 2Q3PA 3I31A 2BJ8A 2RQKA 2W4PA 4MK9A 4EU0A 4B3SJ 4Y3CA 4EBCA 2VDHA 1RHRB 3HVAA 3M2RB 4RNOA 1TK8A 2C2EA 3D9BA 2RH3A 4ZIWA 2DNOA 3IGNA 2YNHA 2DGOA 3C8YA 4LF8J 1BQMB 4KSEB 3CDBA 2IPOB 3KG0A 4I6WA 3Q8YA 4KT0C 3KJVA 4GO5X 5MLCV 2IIHA 4MJKA 1FI4A 4PYDA 4J7CA 4FXDA 1H7XA 4F3OA 3SMZA 2W8LA 4JI2J 3PYFA 1TUVA 2W9BB 3PX0A 5D0HA 2IM0A 4ZOSA 1FNXH 3HDSA 1WNEA 5AE1A 3GFHA 2HNDA 4Q8FA 2HIQA 1SH2A 3NAIA 2ASYA 4RW6A 1YZ6A 4LFCJ 5HK4A 3QFHA 5GMDA 2J0SD 3EDQB 4OZ5A 2I5JB 1R0AB 4FP9A 4HH0A 1R89A 3DLGB 1U1PA 2A18A 5B0GA 1KFSA 4A8FA 3R7NB 1WF0A 5CQGA 1Q86T 1I3OB 3LP1B 3NOCA 3FSIA 3MPWA 4DSKA 3CJRA 2LDYA 2ZD1B 4UY8T 3TVYA 1AYEA 3ZZUA 1LV5A 4ZPDA 1BQMA 1P9QC 2HEKA 2WTFA 5DG7A 4MYUA 3I0SB 4AXJA 1E6VB 5A8KB 2UXCF 2DXEA 2VBXA 3G82B 3R7SB 3GV8B 3UD4P 4QYRA 4A48A 1YITS 1DTQA 2MXYA 5I3UA 3FBCA 1ZS6A 2RT3A 4IG0B 2D9OA 3W1YC 4CTAB 1J5EJ 1BWEA 3OL9A 4ZPBA 3R5GA 2Z57B 2Y8WA 5DJBA 3R6LB 3K89A 3VF0B 1N5QA 1UKUA 4ZCKA 4P2SA 1CS4B 2LQ8A 2M0GB 3O2IA 4MIAA 4EMDA 2AGQA 4LFBJ 1EJ7L 2UUWA 5L8RC 1KQKA 4ED6A 1SL2A 2ASDA 3CEDA 1YRTA 1JLEA 2J0QD 1JXVA 2PE8A 2VH7A 1PGZA 4H4MB 1GT8A 2NXJA 3QYYA 2ACMA 3MUMP 4M5IA 5T41A 4O4RA 3L95X 2HKEA 3NCRA 3FBBA 4LSZB 3K0JA 3NGTA 4DG1B 2JL9A 4NZ0A 3GPAA 3T1AA 3LOUA 3PYEA 3G87A 4URSA 4OYMA 3W60A 5M2PA 4CH1A 4B3TF 3P49B 1HA1A 2GW8A 2RDIA 1R31A 5THWA 4CRJA 2KT3A 3OTOF 2OH2A 1IKWA 4CLLA 2FVRA 3WHIA 3GONA 1ICEB 4HTIA 2DNHA 1QE1A 2FPHX 3VALA 4DV1F 2L41A 1DTQB 5BR8F 5FDLB 4CLZA 3DI6A 1R6VA 5LSRA 2VL1A 1T0TV 2XULA 2EWHA 3TUIC 4Z2XA 5C42B 1HFEL 3C66A 5ETTA 5EWGA 2RRAA 1GEHA 2BACA 1CJUA 2BKPA 2DNMA 3BSAA 5KFFA 4AUKA 3M9MB 3GFXA 3ET6B 4DV5F 4FF2A 5B0BA 2HLUA 4JV0A 2UUAF 4BDPA 2I1RA 1KTVA 8ATCB 2H5IB 4OV1A 3I82A 5CXTA 4FS2A 1MROA 1IVZA 3EZ5A 4QIWD 1UVIA 2GIQA 1N5VA 1UJ4A 3KK1A 1YJTA 3OFEA 3I0RB 2LCWA 3NGDA 3T5KA 1FNOA 3ILIA 2MYFA 3P45B 1RAFB 3Q8VA 1RHQB 3HX9A 2BRLA 4A8OA 4C7QA 3KLHB 2WB4A 4FZVA 3T1HF 2DH8A 1T9VA 3BM7A 5DDOC 2B43A 3KHGA 3VHQA 2W01A 2CQ0A 4OYPA 1FO1A 3QATA 2G2OA 2JH3A 3NGUA 3T3FA 2L9DA 3DHWC 3ADAC 1FE4A 1RACB 1SBRA 3FUYA 1RWPB 5HP1A 4LF2A 3GFZA 2CXEA 3AA8A 3DGPB 4OX7A 2YWHA 4DUYJ 1VIOA 3HHDA 4ED4A 5FJ4A 3BF4A 1UEUA 4ZCMA 2DR8A 2KM8C 2GA7A 3B4MA 2MLZA 3NMAA 3VTIA 2W2QP 4M5GA 3UCUP 4DR7J 4KGZB 2RHQB 2KT2A 4NEYA 4LF7F 1VMBA 2Z56B 3I4PA 4OYWA 1Z4UA 3FMBA 2FZKB 4X62F 4P9SA 3MCSA 4DL0C 2VG6A 2XYGB 3DKDA 1NPKA 4X66J 5D4NA 4LFAF 2FUG9 5BJRA 4NRUA 2ZDOA 2XS2A 2ZH8A 4NMXA 1FJCA 4M8LA 4CO0A 2GO9A 4YDDB 3MUTP 2DEJA 4HT7A 3ZZOA 2BRKA 2OHDA 2MKIA 3WIUA 1OPZA 3OSNA 3TUJC 2HS3A 4L3NA 3BEGB 3DGPA 2BANB 4N8OA 1ZA1B 4LF4F 3RW7A 3M2RA 3UD5A 4DV7J 4DR1J 4AQYJ 2DR5A 5D78A 1JLFA 4OYBA 3D67A 2D3UA 4P6QA 3QT7A 2MJNA 4RKUC 4ZVUB 3IAS9 4ES1A 1D09B 1UZHA 2IHR1 2V4RA 1RTJA 2NYIA 1N34J 3BH6B 1S7IA 2IVMA 3KLEA 2OAUA 1DURA 3IR7B 4Y0FA 1ZM9A 1GMVA 4QR1A 1CJVB 3W2VA 3ZO7A 1I94F 1DRZA 3I55S 2ZVIA 1NBEB 1PYSB 2B9YA 4KFBA 2MZRA 4CLTA 3KWMA 3TR5A 1LWEA 3PKYA 1NK8A 3MM9A 4YN3B 4QQBA 4YB1P 1U0HB 1ZM3A 4WZMA 2LP4A 2DO4A 1N34F 3MAAB 4ZCLA 2ZUAA 2ASLA 4E0DA 1K9MT 2GHWA 2MKYA 4Y2KA 4ETZA 2BANA 4CLSA 3OLBA 1NRKA 5D0EA 2CNKB 2CWKA 1IBKF 1EKRA 3F0NA 5LSOA 4YHHF 3G9CA 4ERDA 2EFPA 3NY0A 3T6BA 1SJ1A 5J2PA 1ZYQA 3U1NA 4E2FB 3H98A 3O3LA 3UDLA 1M5HA 1B99A 1VK3A 3TUPA 1N5SA 3W9IA 2BQUA 4X84A 4ZDNA 1E6VA 3TAMA 4GKJF 2DH9A 1RT2A 4BCAA 1Q95G 1X4EA 3FZ2A 4G1QA 5G0RB 4HTJA 4ILMA 2N7CA 1WTFA 2M7SA 3RB6A 1JLAB 1JNRB 3DXBA 1VC6A 2E5LF 1G4CA 2XI3A 3MDFA 2FJVA 2QMUB 4NLYA 5HLFA 2KDOA 4I69A 5T7LB 3IWLA 5IM0A 4IYQA 1A7GE 2GMJA 3HKZD 1WSVA 1NJWA 1XMOF 5IC4B 2FZCB 1VBXA 1EARA 3SXLA 4AD6A 2DGWA 4H4MA 1CG2A 4RO0A 1Q81T 4JI5J 4F7VA 1VGYA 2N4DA 1T9WA 2A6MA 4DR2F 1HI8A 4G65A 3ZC4A 1RT5A 3DRSA 4KHMA 2W7OA 5HVHA 3MAQA 2WK4A 4NPOA 4OLOA 2C2RA 2CG4A 2RF2A 3DDIA 3VWSA 2IBOA 4EZ9A 3BQ1A 3G2XA 3J7ZT 3BJYA 3PYGA 1SH3A 5FDLA 1PAEX 3L4BC 3MMCA 2XTJP 2FC9A 4H4KC 1KQFB 4PG4A 4JI5F 2NQPA 2HNDB 1RQ0A 2CQHA 2GQCA 1GX6A 1FKPA 5KFLA 4QW9A 1NHUA 2HNYA 1L3KA 4DU7A 1EQ0A 1Q8IA 1MW7A 1ZA2B 2RQMA 1R7IA 1KFDA 1FDNA 1Y3JA 2LKZA 3ET6A 3MF5A 3CCSS 3NKYA 3CC4S 3DDKA 3TVKA 1CJKA 4MIWA 3LP1A 2C2ZB 1RAIB 4W98A 2ZH5A 2R7RA 7AT1B 1L5UA 1D8ZA 2RS8A 4RW6B 2HWHA 4ZA1A 4JI2F 4U6PA 1YSJA 2HNZA 4J37A 2ZZTA 2AW0A 1S0MA 2OIHA 3NCPA 1RAGB 1RBLA 4YUDA 5K8OA 3GV5B 2BJDA 5D3GB 1R0AA 2XCPA 1U49A 4CH0S 2RF2B 3PNIA 2XC9A 3QIDA 4Q45A 4CP5A 3OL8A 1UWBB 3M6XA 4N5SA 1C1CA 2KT5A 2R7QA 3MMCB 1REVB 3OL6A 3BGUA 3N6NA 2LEBA 3TJAA 3TZWA 3UN2A 1WTBA 4WK1A 4DPTA 4OI4A 4DZDA 4DZ6A 3MPYA 3AB2B 3OVSA 1LWXA 1QUPA 3SSRA 3ZTOA 2F8HA 4B3RJ 3HZEA 4FYDA 2IVYA 5ETNA 5DM7Q 3SDEB 4IR1A 4DUTA 1QSYA 4QOTA 2YNFA 2X1BA 3DOKA 4WJBA 1RXOB 4IO1A 4OZ2A 4DG1A 5DGAA 2LXFA 3KNAA 3N6MA 2XO6A 3GU0A 3PJXA 2JHEA 2YX7A 1I1GA 4OHXA 4F3MA 1TUWA 1X9MA 3C46A 2XNQA 1HBOB 3JYTA 4F36A 4PUOA 5KFSA 1S1TA 1M5KC 4K0KF 4KJIA 4J90A 4XTTA 4OZLA 3BO2A 1MNEA 3A8KA 4DJBA 2W4CA 3M7VA 5CYQA 1QVGR 2YNIB 4NLPA 2YX1A 4FN5A 2QMWA 5HMYA 1WC6A 2BABA 1HWLA 1T9YA 2EVZA 4IFVA 4AE5A 2HFOA 1N36J 4IUFA 2NR0A 2QO3A 2GMHA 2MSSA 1TL1A 1RAAB 2P6TA 3HVTA 8RUCA 2JX2A 1N6QB 4O0IA 4WTYA 3A8IA 4RUCA 2P8IA 1UP1A 4CWBA 1FD8A 5KFWA 2ZNZA 2WVDA 2IC3A 3BSCA 3W2WA 4ECZA 2A1BA 3FEZA 2IA6A 3UDEA 1G6BA 4KAIA 3IFEA 4DUZJ 3DXSX 1T02A 1H7WA 4CYUB 2CIMA 3MZIA 4X62J 1CJUB 3S1TA 2W4DA 3P96A 2BZ2A 2YWGA 2Y3YA 1IR1A 4I2PB 4W92B 3EXCX 3CJ8A 1RKIA 2MPUA 2DVIA 2NZ4A 1NUEA 4FNIA 3BGLA 2GO8A 4DX6A 3GWCA 3R5DA 1YHQS 1S77D 2WSEC 5AE2A 4OJHA 3M9OB 4R5PB 2Y1RI 3GYGA 1P6TA 1WDDA 4I7FA 2P2CB 4RR5A 3W9HA 3BYPA 2F4VJ 2GX8A 4IQMA 2J9CA 3TA2A 4CO4A 2J7WA 2QSFA 2L08A 1TUGB 2G1HA 1V5VA 3FBFA 4ELTA 3RBZA 2IC3B 3W2WB 1QAIA 3FSYA 1P8GA 3CD7A 4OFZA 5M2RA 1XC9A 3T5LA 1QTNB 4RU2A 2HGNA 1U48A 2VFSA 1UFLA 1G3OA 2Q6CA 1FJEB 2DNYA 1WHYA 1XWLA 2KL8A 4LQ9A 2MHNA 1UTAA 4I68A 2JLEA 5EGYA 1RI7A 5GAHU 2DPJA 2XQCA 4PG6A 2W9BA 4NA2A 2GIRA 3MPVA 3BDPA 2LXUA 2MQMA 1HBMA 4CZCA 3N5BA 1N33F 2FTRA 2HVEA 1UL3A 2BBEA 4V19J 3V6KA 5E3PA 4FBUA 1PJ7A 3T5JA 4FF1A 2JVRA 4J91A 1W26A 1TV6A 2GVDB 4EWTA 1KN6A 3D3CJ 4ZCIA 3WQPA 2CG8A 5E0OA 1U09A 2RHSB 3N9UC 3R5AA 2QT7A 1KVJA 4OMFG 5KFRA 4F25A 4IRDA 1FTRA 4K8RA 1RT5B 1Y10A 5LMNJ 2APOA 5J2NA 1Q7LB 3KK3B 2BE7D 3I96A 2Q43A 2V50A 1S57A 3C15A 1RTJB 3H4BA 3BH7B 2EFGA 3I0SA 4ZP9A 4ZPVR 1SC1B 5B0FA 4ZP8A 3HHNB 5LMUJ 1NB7A 1F3VA 4NA3A 3DLLQ 4PABA 3G8QA 3V4MA 1IQZA 3D7SB 1S59A 4WZQA 1HQEB 3OUYB 4JI3F 1QD1A 2C1EB 3M2UA 1HBNB 2MQ8A 2AYBA 1U2FA 1VQKS 1HNZJ 2GQQA 2D9PA 3MD3A 4TU7A 3D1HA 4QWCA 4Q44A 1N48A 4NCAA 3RBXA 2U2FA 4USWA 3RJMB 1JLEB 1UWAA 1SQEA 2EBEA 2VC0A 5HAOA 2MQPA 1F9HA 2A2CA 2AJ4A 3VR1A 1X9SA 2HVHA 3ILJA 1NSPA 1GQEA 3DU5A 3QZ7A 3QGPA 2AV5A 3VAGA 4WP3A 4C8LA 1IM6A 1RADB 3I6PA 5HBMA 3VGTA 1IKWB 5HJYA 1RT2B 2KO1A 1FRJA 1HNWJ 2J7KA 1LW0B 2V2QA 1V6HA 2FGCA 2LDIA 4KV8A 2NZCA 3ULHA 4ZKAA 1YZ7A 2MTLA 2DEIA 2VFUA 4C98A 1C1BA 2OSRA 4ZLPA 5EN1A 2HZAA 3FRYA 2DXFA 3MHYA 3NGSA 2HK2A 5FIIA 3IR6B 2ZKUA 1XR5A 3QWPA 5DG9A 3Q2SC 1M5SA 1CPZA 2IDLA 4NLVA 5H1SV 3SDEA 2PI5A 3LAKA 4KQZA 2JC1A 3RB4A 3C3LA 4LFCF 4NCGB 2RS2A 2HS0A 4DQRA 1WWHA 2E1CA 2QA4G 2IYIA 5K8PA 3IM8A 1VQYA 4NLXA 1YJ9S 1VQ4S 3HJFA 3MM6B 4PWDB 3VZHA 4MKBA 2E7XA 4M5NA 3HT3A 3UCZP 2UXDJ 4RNNA 3QJLA 1REGX 2F65A 3LP2A 2YQ3A 1HD0A 3R1HA 4FVMA 2PIIA 2UUBJ 3QRPA 2HHQA 1SJQA 2B7CB 2NS1B 1XNQJ 4KV8B 4C8YA 2LLZA 2HQFA 3G6YA 5B0AA 3S01A 1F9EB 2YNIA 1HPZA 1VJWA 4NRTA 3MEEB 3UDCA 4A47A 4B3SF 1X4HA 2CNLB 1TTHB 3C16B 3VCDA 2R8JA 4KHPF 1IWAA 1TL1B 3LUYA 3PO4A 1R27B 2MKHA 1N36F 3UR0A 3GJRB 1GMWA 4LRDA 3SFGA 4WTOB 2MKKA 2WCXA 1RB0A 3OD2A 1YGYA 3WBZA 3OV7A 3DDNA 2B0GA 3T1YJ 3PW2A 1S0VA 1X60A 2QIFA 1QM9A 1A9NB 1FXRA 1J5OA 3OTBA 4KKOB 1GFWB 4RUHA 4XO0A 1PKUA 1PILA 3NBPA 3V81B 1VS3A 4PEOA 2VG6B 3CT9A 5HO4A 2B7BB 4USUA 1VBKA 2V0NA 4LUBA 4NYPA 5F8GA 2CWXA 2B9XA 1D9DA 4OX9J 1ACMB 1SKRA 4DCOB 2UUBF 5KFTA 1YIJS 1XTZA 3Q8SB 1TKTA 2EG1A 2LXIA 4UF4A 1QAJA 2VOOA 2FLNA 1YBTA 4LR7A 2HZCA 1VOMA 3B8HA 4OJGA 4PWWA 3CULA 4USVA 4J9MA 2QX0A 4OHZA 3MPUB 2BV3A 2UXBF 2ZH1A 3M2VB 5L1LA 1ZETA 4R0EA 4DR6F 3CCQS 1RCXB 4F4ZA 1RBOB 3KLEB 1FDAA 1S1UB 4CLYA 1SL0A 2HHVA 1UAWA 3AOAA 3DOMB 1SPBP 3EGVA 3MCNA 4P52A 5IFMA 1KS2A 1UETA 4YB7A 1GK8A 1TELA 4C0OC 1OO0B 2HHHJ 4IRKA 3IBFB 3PKMA 1S1TB 2RILA 3RRKA 2J8SA 3AXKA 2H3EB 5IQQA 2HSEB 1F60B 4ZJLA 4JUZA 1UEVA 3KK1B 3IWNC 3BDEA 5KFAA 3I0RA 4RUBA 4LF1A 4ED8A 2ZM6F 1WUUA 3R27A 2DRDA 1YQHA 4QPXA 3ZZ0A 2FJEB 4ECQA 5KFZA 2HRTA 3K2YA 1YTYA 2A0FB 3MM5B 5CYMA 2BKNA 3HD2A 3KJNB 3KKFA 2XMAA 2DRBA 4W4MA 4JV2A 3G71S 2ZH2A 3RAQA 1AFIA 1K0VA 1LWCA 4M5DA 2DT9A 3VQTA 2MZJA 3PEJA 3CWJA 1KHVA 1R8HA 3TYTA 3D4JA 4EI2A 3VAMA 2FVPA 3NNHA 1PAUB 2IJFA 2DNLA 2N4CA 5D0RA 5JVHQ 2C3PA 2V2VA 5DDRC 3RTVA 2VQFF 1WEZA 3UN5A 3MUVP 3E51A 5DM6Q 2W7AA 4G1PA 4LJMA 1G7CB 4BC7A 2V8VA 4ZP7A 4O3PA 1BY9A 3H2UB 1FFWB 5LMUF 1RTHB 5A8WB 2VONA 3SIPB 1HBNA 4OI0A 4F04B 2R8HA 3I5BA 4HR2A 3GIMA 1P9YA 2R7TA 2D3ZA 1SC3B 3MM7A 2GQ2A 5HROA 3NWGA 4MIBA 4ECVA 5E5NA 4LRCA 4MK8A 1FRLA 1JIHA 1ULRA 4OHWA 1IUJA 1RK8A 2L9NA 4JI3J 5DRKA 3THVA 1JLBA 1D1UA 5F8IA 1T03A 1P1LA 2FHKA 1RT7A 5DLGA 1WC1A 3K5PA 2FZGB 3FCWA 3VGUA 1IKYB 4QU7A 4LBHA 2XMKA 4WK3A 4B02A 5F8MA 2VG5A 3CD5A 4HDHA 3Q86A 4PG7A 5F8JA 1RWXB 3WC2A 4DV0F 1VQ7S 1M5VC 1UA1A 1F0XA 1URRA 1TK0A 1T9XA 1L3SA 3A3NB 2R4FA 5CAAA 2KXFA 3AXMA 1Q5YA 1SJ4P 3QT6A 3MM8B 1TR0A 3QLHB 5JXSA 1UEKA 5HL7Q 1XIQA 2GGPA 1R8PA 3VAJA 1D9FA 5KOXA 3K8WA 1FESA 1WKLA 1GMWD 1OSCA 5HROB 2R42A 1LW2B 1RWWB 1GNKA 1S4EA 1V9OA 4LVNP 4QZVB 4O3QA 4IG3B 4DR1F 3M32A 4EO6A 3M8PB 7FDRA 5KT2A 4AL7A 4C6AA 2Y8YA 1X4BA 2H51B 3AJ2A 3CCWA 5I42B 3GIKA 4G1IA 2IMWP 1GMUA 2H4WB 4I6AA 2CNNB 3LWLA 1X31C 1NPRA 2DJWA 4J9VA 1Q1KA 1BMQB 4O3NA 3LWMA 1UWBA 4ED2A 2FHJA 2YKMA 1NJXA 4UTGA 4CLKA 1C1CB 1PBAA 2JFKA 2Z2MA 4KRWA 4WBFA 2CVEA 1HQEA 3GCXP 5DG8A 2VHGA 1CBKA 2BJ3A 2GJFA 4M5LA 3KNGA 2I6WA 2XLIA 4K4XA 1G1XA 1HW8A 4MFBA 3ZZYA 3HSJA 3MM8A 2JEGA 3DRXA 2OUGA 2Z2LA 1YRUA 1UFKA 1K1SA 1XNRJ 2CPFA 3Q2TC 3Q89A 2C2DA 4K4UA 2YNFB 4RPFA 3TWZA 3I9ZA 2OEJA 4ZVEA 2H4YB 1OWXA 2IM2A 5LT5A 2EC2A 2R3VA 3I32A 3FEYB 1U26A 3ZZPA 3ZNUA 3TZZA 3SSSA 3JTPA 2E29A 1SC6A 1WACA 1RT6A 2OPSB 4Q5VA 1H2VZ 4X64F 1HBOA 3JYTB 1TL7A 1WEYA 3K5NA 4DR7F 3PX6A 4ZVQB 4K0KJ 1HW9A 3EZUA 2CVIA 4MAKA 2B3TB 1FT8A 1YK9A 2C3YA 1IQTA 2VDIA 1H74A 4ZPWR 4F26A 3AQPA 5K9FA 3CCRS 1NDCA 2HIYA 5K20B 1KBRA 1KHWA 3FNNA 4TN2A 1XQIA 2E5IA 2XNRA 1JKHA 1PO6A 3OR1A 3CJ4A 1T94A 2V34A 5GAGU 4LF6J 1S72S 4K4YA 4ANCA 4IDKA 1DZ5A 2JSXA 2A10A 2V8GA 4O3SA 4MKVA 1QAYA 3ISZA 2D3OR 2DNQA 3U7JA 5CH7B 4DV5J 5KT7A 2EKNA 2KH9A 4DQSA 3PZPA 1TL3A 2PFFB 1WI6A 4JB8B 5E3CA 3QQCD 1VRUB 1AUDA 1FTCA 1S1UA 2RVJA 2J9DA 4KPCA 3OHAA 1HMVB 2HFSA 4WP8A 4ES3A 3LP2B 4AFFA 4JV5J 1R3NA 3UPFA 3GB0A 5J2MB 4DLGA 2J6SA 1JLCB 2L3MA 3H90A 2CQDA 5D4PA 4K5SA 2PC6A 2R8KA 3MM6A 2HNZB 1IM4A 4W90B 4USMA 2V8DA 3PW5A 4FF4A 3QPIA 4Q0BB 2HQDA 2R7OA 3C16A 1S1XA 5C25A 4DV3J 3OR1B 1U1RA 2AEJA 2XM3A 2E7VA 2DD8S 3NS7B 5CYMB 3RRHA 4LF9F 3R5CA 4J9KA 3EPGA 1KDNA 3NWRA 2HFVA 3BO4A 1H38A 1FVSA 5J1PA 2X1AA 2AEMA 4X4QA 4DV1J 3EMTA 2MZ1A 1TFWA 2KTQA 1MWYA 3HSZA 3BYRA 3PHEA 2V9KA 4USJC 4N76A 3D0GE 3ISNC 4IH5A 1APSA 2OI2A 1U2RA 1IBLF 2XG8A 2ZBCA 4CLPA 5KOWA 2HMIB 4L75A 3E01B 2C3UA 4PUOB 3MR6A 2N3LA 5HMWA 1LK7A 1VQ9S 2XMTA 3NL0A 1GAOA 4A8MP 2RRBA 1WHWA 3EM1A 3SCKE 3W63A 2GV1A 5AXMA 1FRIA 4IH6A 5IV4A 4YFUA 3KMSA 4KKOA 2VODA 2FJWA 3BSOA 2CZ4A 3LQVA 4DI6A 2BE2B 4PXCA 4Q0BA 3MOZA 1Y7PA 2V2ZA 1SKUB 3EZOA 4LIRA 4EFAC 2OPQB 3PJ9A 4X4RA 2DCLA 2V63A 3VGSA 1FVQA 2GHPA 4RW9B 4LR8A 4ATNA 4B9SA 3GQCA 2IRUA 3IRXA 1WKKA 3FKBA 4CO1A 1B0TA 1V3RA 4IH7A 2KM8B 3W64A 2O5DA 4M5KA 2FD2A 3KK3A 3GR1A 4Y00A 1TMJA 2V4JB 3M05A 4IFVB 3U27A 2HHTA 2CPZA 4BLGA 1VR6A 2F40A 2RSQA 3HHLB 3KFWX 3W8PA 2HFNA 1RT1B 2HMIA 1T3OA 2LEAA 3DOMA 4P2FA 4ED0A 4FKYA 4QYZJ 2CQBA 4FPRA 3FVYA 2OO4A 4M94A 3TP2A 2XLJA 1B7YB 1X4AA 3RW6A 2FC8A 4ZK7M 5B08A 2H5EA 2NREA 2BM1A 3LP0B 1RU1A 3QGGA 3ISND 5L9XA 3WX8A 1U25A 1YJ7A 2J0WA 2UZAA 1HARA 4ICLA 6FDRA 1FRMA 2K3KA 2ZBQA 1NKBA 1XJWB 3X3UA 1QLNA 3PTWA 4HACA 1TAUA 4RW9A 2ZH6A 1N5YB 2LU2A 4QR2A 1H73A 3B82A 3G4SS 2VICA 1IBKJ 2AHOB 4Y2CA 2GNKA 5I42A 1YI2S 3TA0A 4JI4J 4LVOP 4JV1A 4FS1A 2K2PA 2MEWA 1NSAA 1FE0A 3HFZB 3H8YA 3ILLA 1HHQA 4K7QA 4L74A 4PWUA 4C8ZA 2AQ4A 4DF8A 2MZSA 2Z2YB 5IS2A 2HRYA 2MKCA 5EX0A 3SQOP 1DQ8A 1EB0A 2YKMB 1XERA 3OLAA 1Y11A 2P5VA 2VV5A 3MXHP 4DL5A 3EGZA 3CPWR 1OY6A 2DIVA 2WBMA 1QY7A 3KLIB 3NRBA 4ID5B 1IWGA 3QGIA 3GR0A 4K4TA 4HI2A 2DHSA 3E3XA 3L7OA 2CNOB 3D0HE 3MM7B 3DLBA 2KG0A 5IT9Y 1FFGB 3T1YF 1HNIA 2QLBB 1AW0A 3CIZA 4PXBA 2IRYA 2JEIA 1O8BA 2ILYA 3OBIA 2FVCA 1FRHA 3BN7A 1HBMB 4PQAA 4BWMA 5GMEA 3SCJE 1HD1A 1RTHA 2Q79A 5A8WA 4ECWA 1WC3A 5AT1B 4CM0A 3PW7A 1U0HA 4QYZK 3RGIA 1OSDA 4EEYA 3WDOA 3ZNJ1 1P27B 1TV6B 2GVDA 5HN0A 2QJ3A 3KJFB 2RRNA 1RT6B 2YH1A 1CEZA 3CCVS 2UUTA 1HI1A 1TL7B 1R43A 2BEFA 4BWJA 2ZJQQ 3GTYX 3R2DJ 4ZN3A 4C8MA 2CAJA 1WSRA 2AF6A 2FB0A 3RG6A 1XNQF 4K4SA 4LBPA 3OXGA 1XR7A 4AQYF 5C5JA 4YP3A 5KFNA 1TQLA 3VZIA 4J9LA 3I4HX 1GH8A 4NL5A 2I38A 2UXDF 2OSQA 4CM2A 2VD3A 3HJVA 4U67Q 3CGIA 4AYBD 4K4VA 3P8BB 3TAMB 3PVXA 5B0DA 4K59A 4K5RA 1HNIB 2ZDPA 2ZJPQ 4ED7A 2VG7A 2IY5B 2AJ1A 1GXTA 2ZBRA 3M8RA 2RD5C 3EUNA 3M32B 1PG5B 3TZXA 4YY3J 4ELVA 1VHIA 2CQPA 3THPA 4ER8A 4MYTA 5JVGQ 2BDPA 3AFGA 3PHTA 4P72A 5F9LA 1VHFA 3CSKA 1R6YA 1AROP 3GZ7A 1HMVA 5ITHA 2J8AA 5L1IA 1K8AT 1QAXA 4F50A 2OEMA 3IG1B 2XY6A 1S0NA 4RUAA 3PDNA 3DRRB 5ETLA 1HNXJ 2CYYA 1FF2A 1SCJB 3J80Y 1RYSA 4OYIA 2AZ1A 2A6OA 3CCTA 4DV4J 4B9NA 4ZIVA 4J9SA 3UE2A 3D3BJ 5D8HB 2HVDA 5KFMA 4U96A 2ZH3A 3CC7S 2JDJA 4DSIA 1NAQA 2F8MA 2AYMA 2EI5A 3BKUA 4JI7J 1F2GA 1TKDA 2HGLA 4D3HA 2GCFA 3J81Y 4GVBB 4MFBB 3T1HJ 3ZXWA 1IXKA 3PY8A 2B8PA 2FY1A 4OJ1A 3D6HB 1Q0NA 4ETXA 4K4WA 5AXNA 1ZZFA 5D0GA 3P4UB 1WORA 3TEGA 4CNZA 4DL2A 1CJKB 1NU4A 4RW4B 4RW8A 3VGVA 2J7UA 2DY1A 4WIIA 4NCGA 4JI1J 3JB9k 1FJGF 4ANEA 2YH0A 2KJVA 3A3PB 3TQEA 2HBZB 4WXWA 2RQCA 1LXNA 1IBMF 3OT9A 2EKYA 4DR3J 2ROGA 1RWOB 1XR6A 3HLUA 3O1LA 3H40A 2HLTA 1QTMA 2OPSA 2VASA 2YKNB 4QWEA 5LMNF 4L72B 4DV3F 3PYDA 3SZ2A 5HQMA 1KNZA 2KYXA 1MWZA 2DBBA 1KQGB 4O4GA 4ZVPB 5GADI 2PSZA 2FVQA 2IM1A 2R2SA 2EG2A 2M70A 2P9GA 2WSFC 3MMAB 3B54A 5I3PA 2RUSA 2MKSA 3CDEA 4LT6A 4OX9F 4D3GA 3JAMU 2VBYA 1V3SA 2PN6A 4GRSA 4N7TA 4DPWA 5C42A 4JV5F 1FKOA 2CZ9A 3J81U 3FGVA 1DAXA 2RNEA 1HI0P 4ED5A 3H2VE 2KHDA 1NMEB 4S0MA 3HXMA 4RL1A 1UJ6A 2Z30B 3GSDA 4J9NA 1JLCA 4L6V3 3R2CJ 2B9WA 1MROB 1RTZA 2I0XA 2G0JA 4JI0J 3G86A 2DHGA 3HKWA 4U95A 3AJDA 4WP9A 2ZHBA 3ENAA 1DBDA 4I56A 3SI8A 1VRUA 2ZITA 4XIUA 1J5OB 2HW3A 1RAEB 3M8SA 4PRFA 1N88A 2GHVC 2PFDA 1S1XB 3HFKA 4KY3A 3JSMA 4DSLA 4DX5A 2UVRA 4H4OA 4K2JA 1D8YA 2B4PA 4GVLA 1RJJA 1Q82T 2R2TA 1ZOTA 4RBTA 5KFDA 3B78A 1U1QA 4OHYA 2QFIA 4DL6A 3IBWA 2KYZA 2WW8A 3D68A 1FWPA 1BGXT 1HR0J 4TU8A 2VG5B 3QSIA 3JS9A 3E01A 2R9LA 3MOJB 1HLWA 5HJXA 3PR5B 1N8RT 2YPYA 1H3DA 3PCOB 4F4KA 2HHHF 4B3MF 3EICA 2CA9A 3M2VA 4ID5A 1BQNB 2XWXA 5GMKa 5GAGI 2OJ3A 1XNRF 3AT1B 2BUNA 2R7UA 3NXZA 2HS4A 1LWFB 1SXLA 2V5HG 3HVWA 4I2PA 1Y9OA 3UR3C 5CA5A 3QBCA 4DR5F 2HWIA 4YMEA 2GS8A 3R3TA 4IG3A 1PYTA 3CCZA 3F73A 1RE1B 3J7AN 4X4NA 4IRCA 2LQJA 1SKSA 2RKIA 1FXDA 2ATCB 5KT4A 4KHRA 2QE5A 3CJQA 4I7FB 1RZMA 2XMVA 3ZTSA 4UY85 3CW2C 2PMWA 4C3MA 1VCTA 4M5HA 2U1AA 3GSIA 4N77A 1RT1A 1OYDA 1X0PA 5A76A 5LXYA 3DCAA 2BJ7A 4DS5A 2DCUB 1PSDA 3S6EA 3ICLA 2QGFB 2WB1D 1LWCB 2ERRA 2AJQA 2OGUA 3BBCA 4M5DB 4EGLA 4IQXA 2ALZA 3KDOA 2YKOA 4OI2A 4ITSA 1W2BR 4Y2MA 3C6TA 3KK2B 2G13A 3N28A 2AT1B 3POTB 4NLOA 3QAEA 2KKHA 4NOHA 4ZLLA 3G6ES 1OS5A 2OFHX 1LWFA 1ZBTA 3Q8UA 3R5JB 3W65A 4ANDA 3SCLE 4ECYA 4DPYA 2VG7B 4HACB 2AEFA 3HZGA 2K7KA 3QO9A 1UCNA 1ZM2A 2W1BA 3GJQB 2D74B 1WF2A 3NGKA 3DYAB 2LQ5A 2VUGA 2WW4A 3ZTRA 3B6BA 2YQ1A 2B9EA 3PFEA 3PRDA 4KHPJ 2ABYA 3HP6A 2W25A 3M6WA 1B4SA 3ZTPA 4CLFA 2JFDA 1ZTTA 2GVZA 4X4VA 1RHMB 2QYCA 3MTJA 4X65J 2NXUA 3FQLA 4RNHA 2XMJA 3CD0A 3FK4A 4NLDA 4Y2AA 2MDAA 3N5FA 4JI6J 1FDDA 1LK5A 1R8AA 8AT1B 3L7PA 4TLQA 4NXMJ 3OL7A 5J2PB 2R7VA 3MTKA 1LFPA 1RA6A 2OEKA 4XK8C 2JLFA 4CLUA 4YR0A 1C4AA 1VQ5S 1QVFR 1IKYA 2NXNA 3M1VB 5E33A 2H48B 2KN4A 2MSTA 3DU6A 3T9ZA 2W7PA 4OI1A 4ECXA 3JTOA 2DRAA 3P6YC 1S6PA 5KG4A 3QNWB 4U8VA 4ZVTB 5KFUA 2E1PA 2VBWA 1URNA 3OUYA 4EYIB 4RW7B 3THTA 2NSCA 4YR2A 1VBYA 3KLIA 5RUBA 2RDJA 2VQFJ 5A8RA 2Z58B 2M4MA 1S6QB 3KYLA 4TYAA 1H2UX 4DPUA 2UV8A 1NK0A 4JI8J 2E9TA 3BBFA 1RISA 2ZH4A 1LW2A 3H5YA 1ZTWA 1WEXA 5JJBA 4E98A 1BQXA 4RW8B 4RW4A 4CT8A 4WFAQ 2M5YA 4DV6F 2MJUA 1S48A 2FLLA 3GMGA 3SEOA 2DGVA 4MMOA 4DOZA 3AD9C 4FYYB 1S9EB 5G4DA 4DEZA 3R1LA 1NNDA 2Q1LA 1S97A 3F41A 5CD4H 4F4YA 1U1NA 2YKNA 1PC5A 3K7RA 2DNRA 5ADZA 2MQOA 1M0SA 1VC5A 1JJ2R 1NSQA 4YOEA 2PEBA 3IXQA 1LW0A 1Q8KA 1S6PB 2DNNA 4KE5A 1K73T 3VVTA 4C97A 4O23A 1JLGB 1VQOS 1YVFA 4M5JA 4DWIA 4GO7X 3CMES 2EK1A 1Y4ZB 4ZP6A 2ASJA 1KONA 2HNYB 1KR4A 1Q4RA 6FD1A 1S6QA 1NK6A 3D6MB 1RWKB 2CJQA 5DZ6A 3EVMA 1TAQA 3KDNA 5KTQA 4JI8F 1XMQF 2QLFB 3IG1A 2KFYA 4OI3A 1I5OB 2FLOA 5U47A 3DRRA 4DR5J 4YY3F 2XMUA 1X9WA 2DGTA 2AKWB 2VOPA 1U6FA 2KFNA 1Q5VA 1T9TA 3MGJA 5CYJA 5D3GA 3L09A 5KFHA 1FJ7A 1WF1A 3M6VA 4HH1A 5A6WA 2OPQA 5KFVA 2CJKA 3JQKA 2FIUA 1N0UA 2WBRA 3Q8PB 3FFIB 4LRBA 4FYWB 4Y6IA 5EX3A 1SJFA 1JMTA 4XPEA 4RWWA 1K44A 2J9EA 5IV3A 5EWEA 2ZWPA 3NS5A 4H4KA 1D9AA 3ETOA 1Y0HA 3DOLA 5CD4A 3OW2R 2QZ8A 3CMQA 1OPIA 5AXKA 3P3DA 1VQMS 3EYZA 2DNKA 4KGVB 5F8NA 4U7UK 1Y5IB 5DDQC 3VAFA 1U1MA 1U1KA 2LA4A 1U7LA 3KHRA 3CNQP 1MG7A 1RUSA 5AJ3F 4IOCQ 1FA0A 1SV5A 5KFYA 2BW7A 5L9NA 2MGZA 2XO7A 5H9FK 3DOKB 5A0YA 4GVBA 4P75A 3NAHA 1AB8A 1S1VB 4GC7A 2HAFA 4NLTA 3EXYA 1MU2A 2C2NA 2I8EA 4Q2LA 1DLOB 1NM2A 4NMLA 3OTDA 3RBEA 4B3RF 3HPOA 4DQPA 1TVRA 4P71A 3EX7B 3CJ2A 3NGRA 3LPEA 1EX8A 1VK8A 2O66A 3BQ2A 3PW4A 3ZZRA 4BC9A 2RU3A 1F3FA 2DR9A 2OD4A 2L48A 4HHHA 3CCLS 1D3WA 4I6YA 1NB2A 4IOAQ 2HQGA 1ZH5A 2EK6A 2BYCA 3LW5C 2IMOA 3CIMA 3HVTB 3ILOA 3ETMA 5KG5A 1V5IB 2KJWA 1BXNA 1TL4A 3TNVA 3M6UA 3QMQA 3G6VA 2RDDA 3M4XA 1RHUB 2CPEA 4ECTA 1SJRA 4B9UA 4JYAJ 1YJNS 4WYWA 3D2WA 3MMAA 1YLXA 4PXEA 1FERA 1VRQC 2X51A 4C8OA 2K1RA 1QUVA 4LF7J 1S1VA 3HK2A 3T41A 4DXLA 2MLYA 3MEDA 1UVLA 3FCHA 3EPIA 5ETRA 4WWSA 2MKJA 2RJZA 3PIOQ 2V8HA 4WE1A 2HHWA 4H4OB 4YB6A 5DO2A 3MECA 2Q6BA 1ZPWX 3PG9A 1U1OA 1DARA 1GXUA 3U1LA 3J7A1 1S4FA 2QL7B 4UUWA 3AY0A 2F63A 2AMCB 2IBKA 1NHKL 4LF5J 1HNWF 4OZ3A 4HI1A 2UVVA 2OMLA 5CZXA 1ITPA 3J7YI 3N79A 3CF5Q 4OZ1A 1NDPA 1TP7A 2DXDA 2RUGA 1PCAA 3TZYA 4DF4A 4LF5F 4Y28C 3SYZA 4WXOA 3LANA 3EGWB 1VI7A 3CDWA 4PZVA 5B7WA 2WAQD 2MLXA 3BGRA 3MR2A 1GTHA 2AP6A 1AA1B 4KYZA 2V4JA 5KFCA 1RTDA 4Z7CA 1NSKL 5E3QA 2XGQA 4O44B 2JNJA 4AT1B 3BGFA 4NE9C 1S5ZA 2PD1A 1S1WB 4OZJA 3VAIA 1HKAA 2BMBA 4KB7A 4QIVA 3MECB 1NZ8A 4JI0F 4L3KA 1VJQA 3OFGA 1T05B 5KFEA 2XYHB 1TZ0A 2ADBA 4C4WA 4ILRA 1RLDA 1TL5A 3K8VA 4USHA 1SB6A 3DM2A 4ICLB 1IBLJ 5J1EB 1TK5A 4LQ3A 2YVSA 2HYIB 3BSNA 4B08A 2CQ2A 2Y1JA 1U2CA 1VQSA 4ED3A 2CPYA 2VKRA 1HNVA 2LA6A 3LGMA 1W7WA 2R8IA 3GJSB 4TVAB 3A8EA 4JI6F 3V6HA 4K50A 2AGOA 3IA0A 2D1CA 4YHHJ 1S9FA 2XZWA 2N7YA 4QWDA 2OTJS 2VFTA 1S9EA 3G6XA 3DLEB 4WFXA 2DTJA 4WFZA 4QW8A 5LJ3Y 2HBYB 1YKWA 2E9ZA 3DMJA 3CVKA 1BE4A 3ZTQA 2R7WA 2AZ3A 3CMAS 4ED1A 2QA2A 2PA8D 1R0CB 1IR0A 4EBDA 1X0FA 2CJ9A 3SQGA 1JXLA 3V6JA 2ZFHA 2CKWA 1JXEA 2HPUA 4G3IA 2IJRA 2GMLA 3M2UB 3SFUA 2N82B 4RBUA 5FLXY 1T8EA 9ATCB 2GGPB 3A1YG 4EUVA 2Y1LB 3I87A 3K5OA 1VRTA 1VFJA 4NXNJ 4ZMMA 4TQRA 1K0TA 3UFCX 2AJ2A 1HNVB 1Z2LA 3BV8A 4TXSA 1NDLA 3UNYA 2R2RA 2IAJA 3DYAA 4N8NA 1UFWA 4USTA 5DQGA 4FF3A 2HQ3A 3N4WA 4V19X 5B0CA 5L1KA 2F7VA 2YNHB 3NP5A 4LF6F 4A4JA 1SIWB 4CLWA 3BR9A 3GIIA 3QIPA 9RUBA 4LRFA 4A8KA 3FFIA 5FD1A 2WVCA 2ZC3A 3AB4B 3BPSP 3D54A 4QIEA 3D6FB 2C2MB 2RQ4A 4Z7YA 2VA2A 1PIEA 1U6ZA 2ZVSA 4LFAJ 3VAHA 3VV2B 5IXUA 4X64J 2HURA 3AD8C 3OTCA 4R8UB 4WFNQ 3MR3A 2B5JB 3GYNA 1S6OA 1U0SA 3DLGA 1VRTB 5DQHA 5C7PA 4NWBA 2PMZD 2RB7A 2CQIA 2LQ9A 1WG1A 2EC0A 1OYEA 2C22A 1X5TA 4F4WA 1RAJA 4RW7A 4PWDA 1UW4A 2CPHA 1XEZA 1JJCB 4PXDA 4DX8H 2XBPA 4DUYF 5IT9U 2UP1A 2J5AA 3W61A 3OR2B 1LFWA 2GC8A 4IKAA 3HSGA 2UUCF 1FNMA 3R5BA 1RTIB 3TARA 4YDXA 1FX4A 2G9OA 3DN9A 4EK2A 5I3UB 2Z4PA 1YG0A 2OKQA 1S6UA 5J2QA 1N5TA 4ELUA 1U1LA 3G8SA 2OPPB 5L1JA 2XYPB 2SXLA 2ATLA 2OD6A 1OIAA 1JKHB 4OYXA 4UW2A 1CS4A 4OV6A 3BO3A 2EBGA 2HRUA 3JXOA 4OZNA 4AL6A 2VZ9A 1VISA 1S7HA 1GXLA 1KKHA 1KLNA 1WC5A 3KLFB 2VJUA 1C0TB 4U9RA 2G4BA 4WU2A 3HULA 1TKXA 1UW9A 2DNGA 3M8YA 3MD1A 4NYOA 4PYAA 2KXNB 4B9MA 3QJPA 3GP9A 4OL8A 1TL3B 1BQNA 4FNHA 2DH7A 3RAMA 3S7RA 1F5AA 3BB5A 2X3DA 5K14A 4KR0B 3TEHB 3NBPB 1NK7A 3V6DB 1XMBA 3ONQA 4EO8A 4ZN1A 1SKWA 2DKOB 5J2MA 2ZZMA 3NMRA 1RTIA 2A3JA 2JJ4D 4CT9A 1N54B 3MMJA 2B4VA 1OY8A 1YJRA 3TO8A 2E5GA 5KT6A 2M9KA 4F02A 1IN0A 3CO9A 1S99A 1TKTB 1ZAXA 1R8BA 2ILZA 2NCKL 2CQCA 3DOLB 6AT1B 1LEOA 4RJVA 4YQWA 2FDNA 1RHJB 2ZHAA 1IJFB 5L38A 4MKAA 1WHXA 2NXCA 5GADU 4NLGA 2JOQA 1RWUA 1ZAVA 3A3OB 3C6UB 4WU3A 4CO2A 3FCVA 3LGHA 1NLKL 3CJKA 1UZDA 1C0TA 3I5AA 2QYGA 3ZZTA 2L9WA 2KZMA 1JB0C 1NEEA 1TKXB 2F8EX 4X66F 2QLJB 3FMWA 4JBCA 1UMJA 2JEJA 1K47A 2Y9HA 3EWGA 2R7XA 2BJEA 3L9ZA 1PC4A 3OJSA 2ZZNA 3MCOA 1CQNA 1DLOA 1PYOB 1YX2A 3HCXA 4P10A 2PGCA 2VPYB 2W8KA 2BR0A 2POKA 2D7SA 2MZTA 1Z1ZA 2IVFB 2J0XA 3QO9B 3NCQA 3IWXA 2G2YA 3K58A 4JI7F 4FPIA 5E7OB 3ENWA 3RAXA 3G8TA 2VA3A 2MGZB 3UNGC 4LRAA 2IRXA 4C48A 2YWKA 1HL6A 4URGA 4F0KA 4KBIA 5LSLA 5JMNA 5IZHA 4WFBQ 4DSJA 4UOGA 4M63A 3PR4A 1S12A 2BE2A 4NZ6A 4OYZA 4QR0A 4DV4F 2Y1IA 1J2VA 3OPKA 1M90T 3A12A 3CCES 4RNFA 2H54B 1U02A 3MM5A 2BQRA 3OXLA 5SUHA 3IRXB 2DPIA 4QBUA 1E6YA 1S49A 2XZTB 3K17A 4K2XA 2B8QA 1XMOJ 5HI7A 2AJ0A 3HHLA 3CUNA 3LO3A 2BOPA 1HWUA 1RWVB 1RT3B 2G1DA 2C3OA 1KVKA 3QFWA 3AOCA 2DITA 1F9FA 5CHCB 1AXQA 3RZAA 3SQGB 1MMNA 3CJTA 1WJ9A 2JC0A 5ETKA 5M2UA 2CPXA 2ZOFA 3M8QB 3NLCA 5B0EA 4A8XA 1Y00A 2CRLA 2DYAA 5AE3A 1NHVA 2K1RB 3A13A 1FEEA 1EAYC 3R97A 3M8ZA 4JP8A 2RE1A 2B6AA 2AJFE 3OTEA 4ZVHA 3MR5A 4MT1A 5C24B 3KLGB 3TQ1A 1YJWS 3P5TL 2LEPA 2M2BA 2E1RA 3UCGA 4NX9A 2PI4A 3H42A 3PEHA 4X4OA 2UXBJ 1KLMB 3R6GB 2DGSA 4OI6A 2JWNA 5ETPA 4ES2A 5IQ6A 4AL5A 1JJ4A 3CC2S 2KVIA 5MAOA 4DR4J 2XEXA 1HQ2A 2H9ZA 2OLWA 2R8GA 3UI3A 2DO0A 1F5CA 2ZBPA 2QFJA 2B51A 3MEKA 1WOSA 4OX6A 2MB0B 4NI2B 4LBIA 4J9OA 3PX4A 1FKAF 4KH0B 1NJYA 2E1AA 4WKYA 4TYBA 1GX5A 2IM3A 3H5UA 1RTDB 1QSSA 1VIXA 4M5MA 2CPDA 5DZ7A 1B0PA 2B4OA 2CJAA 4YB5A 3TAQA 2B6AB 2YKAA 4Y65A 1J5EF 1JX4A 1U24A 1XK8A 2KU7A 2OMOA 5EDWA 1FWLA 4Z37A 3JSYA 3TJ9A 1OJ4A 5EWFA 2C3MA 1Y5NB 2BM0A 2V4QA 2BKOA 2QL9B 2WHOA 4HDGA 2HBRB 1UVKA 4PKDB 3R9LA 3NEKA 1MN9A 1A0OB 1JQGA 3BREA 5C2CA 5J1EA 4J9UE 4YR3A 3K5LA 2YX4A 3A8JA 3DMJB 4WKRA 5IT0A 5DDPC 1UPPA 1SUQA 2QEXS 4BS2A 4HVZA 3JSRA 1X4FA 3I5CA 2OELA 4N47A 1O5JA 1VLYA 2LYVA 2NPFA 3TW0A 4ZVRB 2MQLA 3CXCR 1RYRA 1MMDA 3HT0A 3AJ1A 3M1VA 2PMHA 1BHNA 2EFNA 3DLJA 1JWWA 2JVOA 5HVFA 2C42A 1MSWD 4BBYA 4F4XA 3HO1A 3CCUS 2QMXA 3U1MA 2P9EA 3IRWP 4DPOA 1HBUA 1SC4B 2E1MC 5A0YB 5A8RB 1HR0F 2HVZA 2PEHA 5IWAJ 3FDSA 4X2BA 4F4AA 2IDEA 2COLA 5BYQA 1AZSB 1BUXA 1TVRB 4UQGA 5F8LA 4J9RA 4NLRA 1LXJA 2Z2ZA 3PXGa 1UA0A 2IAJB 1CSJA 3DC2A 3V4IB 2FJDB 4NLUA 1LKZA 2BOAA 3AHPA 3IO1A 4PCQA 2NUHA 1SH0A 3CE8A 4CIOA 1V3ZA 3T5HA 2WSCC 4DV6J 5E3RA 2D69A 1WHVA 2DHAA 5F9NA 3QIPB 4DQIA 1Y5LB 2XMMA 4IDKB 1C2PA 2XHCA 1WC0A 1IKXA 4KIAA 4UOHA 2YTCA 5IC6B 1N4LA 4C8KA 4O3RA 4C9DA 1KEKA 4LMZA 1JLGA 4XDCA 1KTQA 2A2DA 3D1OA 2BA9A 2EW9A 1NKCA 4C2MA 1BWVA 3QT8A 4U8YA 1CVJA 1F5BA 2AU0A 1S79A 3BS9A 4WE1B 1EQMA 1DY3A 1S9GA 2ZNYA 5KFPA 3T9NA 1DTTA 4F67A 3IAM9 1MLAA 3AA9A 1NPPA 3O6QA 2F5GA 3V4IA 4NXMF 4ZJOA 1RT4B 1FWKA 5BR8J 2R7SA 4A8YA 4TQSA 1REVA 2KRRA 5A2QY 1EETA 3DRPA 4Y2IA 5C25B 1IBMJ 2HVIA 5H9FJ 3DFEA 4XAKA 4KPYA 5FLXU 5DS7A 1YBAA 2YWFA 1WOOA 3RR8A 2QTWA 5C2GA 1IKXB 3PRBA 3J7YU 3RB0A 1E6YB 3PV8A 5GVQA 4QWBA 3ZZZA 4BHQA 4K4ZA 4P7VA 3FBEA 3CO0P 4ECRA 3UN3A 3K5MA 1U4BA 4IO9Q 4DFPA 3FJ2A 2QN6B 1FKOB 1PJ5A 4KO0A 3ZFVA 5EHHA 1U8WA 2UVUA 1IKVB 1RBAA 2CJXB 2CZVC 2WOMA 2WRMA 4OYAA 4QJVA 4EYHB 3V6DA 3J7Z5 3WZ0A 2XY7A 2CQ4A 2GAHC 2YBVA 3KLHA 4I2QA 4DV7F 4FXWA 4QPTA 1HWIA 1SV5B 1HYSB 1T05A 5DLFA 3UDVA 2O3DA 1NJIT 2NSBA 5JUMA 2UUCJ 3KTQA 4CCHA 2H1YA 1RWMB 4IFYA 3HHLC 2IJNA 2F1FA 5IWAF 5A2QU 2F3JA 3JSMB 3HVRA 4I64A 2DR6A 5BXIA 1WELA 5C24A 3KLGA 5AXLA 1JLQB 3MEGA 5LM7E 1HNXF 4JI4F 3CJKB 1X5SA 2W2MP 2V6AA 2XSFA 3DHXA 2XLKA 4UZBA 2HQCA 3PM9A 2HAIA 2V2KA 2BXJA 3QWUA 1L3TA 2QG9B 3RUBL 4DV2F 1CC7A 1RU2A 2DB1A 4DUZF 3MWBA 1VBZA 3CJ0A 2EFVA 2Y0SD 1IR2A 5KG7A 4HEA9 4XPCA 4TU9A 3MI7X 1NJZA 2CJYB 2KVQE 3N0VA 1I6JA 1ROFA 4FBTA 3OSPA 3LTOA 2GAGC 3CD6S 4R5PA 5KFBA 4IFYB 1RDRA 2NYHA 2VPXB 3KUEA 4MTPA 3EDRB 2XMWA 4UOCA 4C3KA 1B7FA 5F3ZA 3SCIE 2YNGB 2LVWA 2DGUA 1MMLA 3BGOP 3LAMA 2M8DB 2HHUA 4LF8F 1SIZA 4R0JA 3UVJA 2HHXA 2F4FA 4UUXA 4J5OA 4NZ7A 2RKIB 4DDFA 4RLEA 3KHLA 2V67A 5HMXA 2E44A 2ZE2B 2EFQA 2IA0A 2K8GA 2M8HA 3BKFA 4ZPCA 2FY8A 1PBUA 4NYZA 1M5OC 3OXFA 4DX7A 2FHOB 1C4CA 4OZ0A 1O6XA 2FJAB 2WVBA 1Q53A 1F2HA 3HSDA 4EBEA 3HF5A 1SUQB 1S10A 1U8SA 3M8QA 1LWEB 2CQ3A 3FEXB 3KK2A 3FQKA 3KOAA 2DGXA 4O44A 4DR4F 3CTRA 2XI2A 5KG6A 2ZC4A 1VQ8S 2KFZA 3QGHA 4AXIA 1Q8BA 2PA3A 1N52B 1W25A 3ELHA 1KOOA 2MMYA 2NXEA 1Q8LA 5DETA 4CI0B 2HHSA 3OFHA 3D1QA 3PFOA 3H20A 2ALYB 3OTOJ 1X4CA 2WZ1A 5J2NB 5HQLA 1T9UA 5ETMA 1TMMA 2GVZB 5J1NA 4PG8A 2VU5A 2C28A 2FHMA 5ETVA 4DMZA 4CO3A 2UU9F 1HWJA 4WCEQ 3PO5A 3CCJS 4OX8A 2R2UA 4PPZA 3W5YA 3BN4A 4HLBA 5K5MA 2Y0BB 3MFIA 3DLKB 4FYXB 1WD6A 1TU0B 5ETOA 2ZEJA 4ZS6A 4LFBF 2EXUA 2I5JA 3I56S 2Z0GA 3OQ2A 5HLFB 3OJUA 1CJTB 4TLRA 2UVWA 4X4SA 3KLFA 4A8QA 4LSLA 1VDHA 4DCJB 2E7WA 5LOQA 2I9SA 4HT5A 3RB3A 3AH6A 4NCBA 3H5XA 4B3OB 4YS2A 2N3OA 3GIJA 2XY5A 2LECA 1N56A 2UXCJ 3Q22A 4B9LA 3DRSB 3HMJG 3Q23A 2KI2A 1N32F 3TRGA 2X1FA 5HBMB 2VPZB 4WIQA 2W2NP 1RHKB 2YWEA 4DPXA 4I67A 5HANA 1S9GB 2JRSA 5HMZA 4MKYA 1CULA 2UV8G 1DTTB 1CC8A 1RA7A 4DHVA 3W8GA 3C14B 3EGNA 3E8OA 2EFOA 1BLUA 3QT5A 4IG0A 1RCOB 2V68A 1M5PC 2NLWA 1U45A 4CTAA 5GAEI 1DHMA 3GG0A 3MAHA 4KH1B 3NNAA 1EETB 5CABA 1FKPB 4NA1A 1X4GA 3GCWP 4WYLA 2ZM6J 3DLHA 2GIFA 2CPJA 4DN0A 3RBDA 2VIHA 3IS9B 2BX6A 1YWXA 1PJ6A 1R8CA 2XGPA 2XB2D 4MK7A 2G0IA 2X1GA 1BC6A 2V8PA 2FJBB 2HGMA 2YKQA 4FXVA 3VVUA 2ZOMA 3EVWA 5LXRA 3PIPQ 2GZOA 1T7PA 3WIVA 3WX4A 4DU8A 2W9AA 2LU1A 3IMQJ 3JTNA 3M30A 4DS4A 3PW0A 1DFDA 1X5PA 2WOMB 1AZSA 5KFIA 4X4UA 2O01C 3U02A 2PT0A 4TY8A 1CULB 4KGMA 4DL3A 5H9EK 4PPDA 4GKKF 1RLCL 2VKZG 1AUSL 1HYSA 1EP4A 1Q7YT 3NNCA 5I3QA 4ENOA 1H0HB 1HBUB 4IR9A 5DGBA 2JEFA 1J27A 1HPZB 1KC8T 3W62A 3MEEA 1RABB 3MMBB 1EHWA 4N56A 2VQEF 4P73A 3NG8A 2X3GA 3OR2A 4ZVGA 3H7HB 5KFKA 4CH7A 1VQNS 3H59A 1WOPA 3LH2S 5D77A 1RGVA 3EJMA 4O4GB 1IJEB 2EEYA 1HHSA 4WF9Q 5BYRA 1QDUB 4P2MA 4TKTA 3K59A 1D0EA 3BKTA 1M1GA 1FCAA 4HYKA 3KUHA 1VYAA 2XHWA 4PR6A 3BQ0A 2OPPA 4FDFA 5IOLA 2AD9A 3UD3P 2O1PA 1H2TZ 1H72C 4OJ3A 5D4LA 2DK2A 1RT3A 2WVEA 4F2RA 1A6LA 1NKEA 4TY8B 3UW1A 1LNQA 1VC0A 2AIRB 4QU6A 2CQ1A 4YEAA 2WONA 4ZLNA 3IP0A 3CJ3A 1RT4A 4DBQA 4P2XA 5CYQB 3KXDA 4C3LA 1YJUA 5E3AA 1Q78A 1EKSA 2B4UA 2CDRB 5D4OA 5KG2A 1MU2B 1KOHA 2XS5A 1JK9B 5LL6d 2X7IA 2YNGA 3IM9A 4KGXB 5ETSA 1FK9B 3ITHB 4ALZA 2W9CB 1N6QA 1WKJA 1RWNB 2CPIA 2VBZA 4DFMA 2KXHA 5K8NA 4NLSA 1HQUA 4O3OA 4C11A 2VFRA 1TKZA 4DL4A 1B0VA 4ID8A 3W3SA 1NXIA 5H9EJ 3GLJA 2YXLA 4HL9A 1RAHB 2J6UA 3CDAA 1NK9A 4USIA 3C6UA 4ZJQA 2JLGA 2BJ1A 2D41A 2ZWOA 3BR8A 2MY7A 1C0UA 2HK3A 2OPRA 4I2QB 1T95A 4QWAA 2FYXA 2I2YA 4IOBA 4B17A 1KD1T 4LSNA 3MR7A 4CDIA 3D0IE 3Q0AA 3SBMA 1RP5A 1FDBA 2QLWA 1XMQJ 2FVSA 4RZRA 4KO0B 3J81j 3JSBA 4L73A 3KG1A 1SVDA 3FC9A 4FKXA 2YWWA 2VC1A 3GE9A 3GV7B 3RR7A 1OMSA 1F6TA 3H25A 1FX2A 5K8MA 1QE1B 5EUHA 4F3QA 2FHJD 1B3TA 2VPWB 3QAUA 4Y34A 1VQPS 1NCLA 2HHPA 1OQ3A 1G2EA 3KLVA 1KWMA 1MN7A 2RIJA 4NEZA 2E5HA 5D6GA 1FHTA 1FD2A 1LQ9A 5KAKA 3TX0A 3GILA 1L3VA 2KHCA 1C0UB 1JNZB 2DHHA 2OPRB 3D66A 3NS6A 2MQQA 4DLEA 4A46A 3HM9A 2UUAJ 4NXNF 2BJ9A 4Q43A 2M88A 3LGNA 3V2UC 4L76A 1NO8A 3MM9B 3C6TB 4ZITA 3SV4A 3POTA 4PAAA 2DR7A 1SQGA 2ZH7A 2QRRA
chains in the Genus database with same CATH topology
5I4MA 1S1WA 1O0PA 5KT3A 1RKJA 4LSLB 1S0OA 2V9WA 1DQ9A 3AAWB 3O5TB 3N01A 3LPYA 2K3IA 5CCMA 1JLBB 4X65F 4OQJA 4DSFA 1T03B 3CDUA 4ZHRA 3Q8RB 2ZHOA 4ZPAA 3KJVB 3WC0A 3O44A 5F8HA 5HP1B 5KFGA 1O51A 5T14A 3RYLA 2XSJB 3HHEA 2CFXA 3E2EA 3D28A 4F8RA 2F9JA 4DFJA 3B4DA 3T19A 1KLMA 1JLAA 2K7JA 4B9VA 1UVNA 2ZE2A 3CCMS 3DLEA 5KG0A 2ROPA 2YKPA 4G6VB 3OFFA 1U47A 4ILLA 5T7LA 2QLXA 1WG4A 2GJIA 5IM0B 2EPIA 4HHJA 3TVZA 4DSEA 1NK5A 5CZVA 1Y3KA 4DQQA 4QIFA 3Q8QB 3K57A 4TNOA 2HQIA 4GMKA 2ZD1A 1ZPVA 2DHXA 2MHEA 7FD1A 3TI0A 2O67A 3ENQA 3M30B 4DL7A 2M3DA 3V5RA 3OVBA 2B56A 2JZ5A 4I1TA 5A8KA 2CQGA 2XSJA 3TUZC 2DISA 2AX0A 3TOQA 4HKQA 1X8DA 1NZAA 1KSPA 3L3CA 2YY3A 5KFQA 5LJ5Y 1C1BB 3NNHA 3RRGA 4OIXA 2W24A 3X1LB 3DRPB 2F4VF 2P6SA 3IC1A 2ZJRQ 3LALA 2RU9A 1CQMA 3FRZA 4F2SA 2E9RX 1H98A 1NH7A 1VQLS 3DLKA 3GYXB 3PJWA 5A6PA 3OVAA 2VFVA 1X7VA 4KC5A 4OHVA 3ENVA 3TANA 1WI8A 1M1KT 4R8UA 4KTQA 1FRXA 3UDCA 2AYEA 2B5JA 2DIUA 2KB2A 4RWXA 2MQNA 4ZPTR 1AFJA 3UQSA 1K1QA 1YRXA 2DGQA 4H54A 1HHTP 1X5OA 2BQ3A 2WONB 3DRYA 2PDAA 1UJ5A 1WG5A 4I0WA 4JYAF 1U6BA 4NLWA 4J9PA 1QSLA 4CNYA 1OQ6A 2QSWA 3MURP 4ZVFA 1HQUB 4C11B 4X4TA 4QIGA 3N6LA 5J2QB 2F9DA 2KG1A 1T3NA 4EZ6A 2Q66A 1ZM4A 1UVJA 1SI9A 1FRKA 3IS9A 4RX6A 3OHBA 1Z2ZA 3KG4A 2ZH9A 5KG3A 4MH8A 1TFYA 3US5A 4B9TA 4QCLA 4TY9A 4JOUA 5CCLA 1DJ0A 2GJ2A 2GFFA 3G96A 2DNPA 2LQBA 3GG1A 5BYSA 4RU9A 3FZBA 4N41A 2AGPA 3MMBA 5GAHI 2XCAA 5K14B 4DR3F 3PACA 4C8NA 4WFYA 2KRBA 5GAEU 4UQTA 4URQU 4X4PA 3MFHA 2LMIA 4RNMA 4ECUA 3SSQA 4JI1F 3H4DA 1EP4B 2IFXA 2QA4S 1CLFA 2E5JA 3TAPA 3W7BA 4I4BA 1DQAA 4CQ1A 3VAKA 5IT4A 1Q16B 1SJ3P 3DNCA 2J76E 2HFZA 2FJXA 4Q7AA 2AWZA 2XS5A 1P1TA 2NPIA 2PO4A 4PG5A 4OLPA 4DFKA 1UVMA 5KT5A 1KVIA 2ZKTA 3QZ8A 2KZZA 4PQUA 2FGOA 4P7TA 5F41A 3MEDB 2QA1A 1IKVA 2MY8A 3HHLD 3F44A 1FK9A 3ITHA 5DQIA 2W9CA 2MZQA 4CO5A 2VB6A 1HWKA 5E2QA 1FEHA 2OTLS 1LOUA 2ZOGA 3DI6B 4A8WA 5KFXA 4XDDA 1ELOA 4ZHRB 2G0CA 1FXLA 1NH8A 2Z8QA 4C0HA 3O8WA 4Q8EA 2QV6A 1KRPA 3TX8A 5L39A 2IYGA 2CDQA 2M52A 1JLQA 3MEGB 3M9NB 4A8SA 2ZUGA 3JAMY 1SL1A 1X4DA 2J9DE 1XBWA 3TA1A 1TKZB 4M1KA 1GTEA 1VQ6S 2P9CA 2BVZA 2ROEA 1JLFB 3BGRB 4FVCA 4R25A 5F3TA 3LP0A 1HNZF 3FSXA 3H5SA 4C0BA 1Q79A 1NK4A 2HWTA 2RMLA 1ZAWA 5HQ8A 3UWTA 3S8SA 2CJBA 1YJVA 2V94A 3HHKA 3W2VB 4DN9A 3F56A 1N5YA 4KFBB 3GFYA 2E66A 4B3OA 5SZTA 3H2LA 4LSNB 3HI9A 3RU0A 2J6TA 1H6KX 1RT7B 2ZBIA 3CJ5A 3DM2B 4LIWA 3KHHA 1XN9A 5B09A 3I9V9 4E8UA 3BZQA 5F0UA 3D5MA 1KQSR 3IN5A 4ECSA 4M95A 5KG1A 3SV3A 3AQOA 2XWYA 1W2IA 3LF0A 3Q24A 3KMQA 1ZZNA 2FLPA 2OP5A 3QLHA 1BD6A 1S76D 1QJHA 2AX1A 2NUUG 3IGVA 5F0WA 3CB4A 4NLQA 2OFGX 3QJJA 2HG4A 2ADCA 3C2PA 4G1QB 5G0RA 5E41A 1N0VC 1B64A 3IR5B 5KFJA 3T6JA 4RBVA 2AYGA 4Q2MA 3M8PA 2DNZA 4U7CA 2BW2A 4GC6A 5KFOA 3VQSA 4J9QA 1JJHA 4KGKA 2XS7A 2ACYA 2Q3PA 3I31A 2RQKA 4MK9A 2W4PA 4EU0A 4Y3CA 4EBCA 3HVAA 3M2RB 4RNOA 1TK8A 2C2EA 2RH3A 2DNOA 3IGNA 2YNHA 2DGOA 3C8YA 1BQMB 4KSEB 3CDBA 4I6WA 3KG0A 4KT0C 3KJVA 4GO5X 5MLCV 4MJKA 4FXDA 1H7XA 4F3OA 3SMZA 2W8LA 1TUVA 2W9BB 3PX0A 1FNXH 2IM0A 4ZOSA 1WNEA 3HDSA 5AE1A 3GFHA 2HNDA 4Q8FA 2HIQA 1SH2A 3NAIA 2ASYA 4RW6A 2J0SD 4OZ5A 2I5JB 1R0AB 4FP9A 4HH0A 1R89A 3DLGB 1U1PA 2A18A 5B0GA 1KFSA 4A8FA 1Q86T 1WF0A 5CQGA 3LP1B 3FSIA 3MPWA 4DSKA 2LDYA 2ZD1B 4UY8T 3TVYA 3ZZUA 1LV5A 4ZPDA 1BQMA 1P9QC 2WTFA 5DG7A 4MYUA 3I0SB 4AXJA 1E6VB 5A8KB 2UXCF 2VBXA 3GV8B 3UD4P 4QYRA 4A48A 1YITS 1DTQA 2MXYA 5I3UA 4IG0B 2RT3A 2D9OA 4CTAB 1BWEA 3OL9A 4ZPBA 5DJBA 3VF0B 1N5QA 1UKUA 4ZCKA 4P2SA 2AGQA 2M0GB 3O2IA 4MIAA 5L8RC 2UUWA 1KQKA 4ED6A 1SL2A 2ASDA 3CEDA 1YRTA 1JLEA 2J0QD 2PE8A 2VH7A 1PGZA 4H4MB 1GT8A 3MUMP 3QYYA 5T41A 4O4RA 3L95X 3NCRA 3K0JA 4DG1B 2JL9A 4NZ0A 5M2PA 3T1AA 3LOUA 4CH1A 4URSA 4B3TF 3P49B 1HA1A 2GW8A 2RDIA 1R31A 5THWA 2OH2A 2KT3A 3OTOF 1IKWA 2FVRA 4HTIA 2DNHA 1QE1A 2FPHX 3VALA 4DV1F 2L41A 1DTQB 5BR8F 5FDLB 3DI6A 5LSRA 2VL1A 2XULA 2EWHA 3TUIC 4Z2XA 5C42B 1HFEL 3C66A 5EWGA 2RRAA 2BACA 2DNMA 3BSAA 3M9MB 5KFFA 4AUKA 3GFXA 4DV5F 4FF2A 5B0BA 2HLUA 4JV0A 2UUAF 4BDPA 2I1RA 1KTVA 4OV1A 3I82A 5CXTA 4FS2A 1MROA 3EZ5A 4QIWD 1UVIA 2GIQA 1N5VA 1UJ4A 3KK1A 1YJTA 3OFEA 3I0RB 2LCWA 3NGDA 3T5KA 1FNOA 2MYFA 3HX9A 2BRLA 4A8OA 4C7QA 3KLHB 2WB4A 4FZVA 3T1HF 2DH8A 3BM7A 5DDOC 2B43A 3KHGA 2CQ0A 1FO1A 2JH3A 3T3FA 2L9DA 3DHWC 1FE4A 1SBRA 5HP1A 3GFZA 3AA8A 4OX7A 2YWHA 5FJ4A 1VIOA 3HHDA 3BF4A 1UEUA 4ZCMA 2DR8A 2KM8C 2GA7A 3B4MA 3NMAA 3VTIA 3UCUP 2KT2A 4LF7F 1VMBA 3I4PA 1Z4UA 3FMBA 4X62F 3MCSA 4DL0C 2VG6A 4LFAF 5D4NA 2FUG9 5BJRA 4NRUA 2ZDOA 2XS2A 2ZH8A 1FJCA 4M8LA 4CO0A 2GO9A 4YDDB 3MUTP 4HT7A 3ZZOA 2BRKA 2MKIA 3OSNA 1OPZA 3TUJC 2HS3A 4L3NA 3BEGB 3DGPA 2BANB 4N8OA 4LF4F 3RW7A 3M2RA 2DR5A 5D78A 1JLFA 4P6QA 2D3UA 4RKUC 4ES1A 2MJNA 3NNCA 3IAS9 2IHR1 2V4RA 1RTJA 2NYIA 2IVMA 3KLEA 2OAUA 1DURA 3IR7B 4Y0FA 1ZM9A 4QR1A 1I94F 3W2VA 1DRZA 3I55S 4KFBA 2B9YA 2MZRA 1NK8A 3KWMA 3TR5A 1LWEA 3PKYA 3MM9A 4YB1P 4QQBA 1ZM3A 4WZMA 2DO4A 1N34F 4ZCLA 4E0DA 2ASLA 1K9MT 2GHWA 4Y2KA 4ETZA 2BANA 3OLBA 1NRKA 1IBKF 3G9CA 4ERDA 4YHHF 5LSOA 2EFPA 3T6BA 1SJ1A 5J2PA 1ZYQA 3U1NA 3H98A 3O3LA 3UDLA 1M5HA 1VK3A 1N5SA 2BQUA 4X84A 4ZDNA 1E6VA 3TAMA 4GKJF 2DH9A 1RT2A 4BCAA 1X4EA 3FZ2A 4G1QA 5G0RB 4HTJA 4ILMA 2N7CA 1WTFA 2M7SA 3RB6A 1JLAB 1JNRB 3DXBA 1VC6A 2E5LF 3MDFA 2XI3A 2FJVA 4NLYA 5HLFA 2KDOA 4I69A 5T7LB 3IWLA 5IM0A 4IYQA 1A7GE 2GMJA 3HKZD 1NJWA 1XMOF 1VBXA 3SXLA 2DGWA 4H4MA 1CG2A 1Q81T 1VGYA 2N4DA 4DR2F 1HI8A 3ZC4A 2W7OA 1RT5A 3DRSA 4KHMA 3MAQA 2WK4A 4NPOA 4OLOA 2C2RA 2CG4A 2RF2A 3VWSA 2IBOA 4EZ9A 3BQ1A 3J7ZT 3BJYA 1SH3A 5FDLA 3MMCA 4H4KC 1KQFB 2FC9A 4JI5F 2NQPA 4PG4A 2HNDB 1RQ0A 2CQHA 2GQCA 1GX6A 1FKPA 5KFLA 4QW9A 1NHUA 2HNYA 1L3KA 1Q8IA 1MW7A 2RQMA 3CCSS 1R7IA 1KFDA 1FDNA 1Y3JA 2LKZA 3CC4S 3MF5A 3NKYA 3DDKA 3TVKA 4MIWA 3LP1A 2ZH5A 2R7RA 1L5UA 1D8ZA 2RS8A 4RW6B 2HWHA 4ZA1A 4JI2F 4U6PA 1YSJA 2HNZA 4J37A 2AW0A 1S0MA 2OIHA 3NCPA 4YUDA 5K8OA 5D3GB 1R0AA 3GV5B 2BJDA 1U49A 2XCPA 4CH0S 2RF2B 3PNIA 2XC9A 3QIDA 4Q45A 3OL8A 1UWBB 3M6XA 4N5SA 1C1CA 2KT5A 2R7QA 3MMCB 1REVB 3OL6A 3BGUA 3N6NA 2LEBA 1WTBA 4WK1A 4OI4A 3MPYA 3AB2B 3OVSA 1QUPA 3SSRA 2F8HA 4FYDA 3HZEA 2IVYA 5DM7Q 3SDEB 4IR1A 1QSYA 4QOTA 2YNFA 2X1BA 3DOKA 4WJBA 4DG1A 4IO1A 5DGAA 2LXFA 3KNAA 3N6MA 3PJXA 2JHEA 2YX7A 1I1GA 4OHXA 4F3MA 3C46A 2XNQA 1HBOB 3JYTA 5KFSA 1S1TA 1M5KC 4K0KF 4KJIA 4OZLA 3BO2A 1MNEA 4DJBA 2W4CA 5CYQA 1QVGR 2YNIB 4NLPA 2YX1A 4FN5A 2QMWA 5HMYA 2BABA 4AE5A 1HWLA 2EVZA 4IFVA 4IUFA 2NR0A 2HFOA 2QO3A 2GMHA 2MSSA 1TL1A 2P6TA 3HVTA 1N6QB 2JX2A 4O0IA 4WTYA 4RUCA 1UP1A 1FD8A 5KFWA 2ZNZA 2IC3A 3BSCA 3W2WA 4ECZA 2A1BA 3FEZA 2IA6A 1G6BA 4KAIA 3IFEA 3DXSX 1T02A 1H7WA 2CIMA 3MZIA 3S1TA 2W4DA 3P96A 2BZ2A 2YWGA 4I2PB 4W92B 3EXCX 1RKIA 2MPUA 2DVIA 2NZ4A 4FNIA 3BGLA 2GO8A 3GWCA 3R5DA 1YHQS 1S77D 2WSEC 5AE2A 4OJHA 3M9OB 4R5PB 2Y1RI 1P6TA 4I7FA 2GX8A 4IQMA 2J9CA 3TA2A 4CO4A 2J7WA 2QSFA 2L08A 4ELTA 2IC3B 3W2WB 1QAIA 3FSYA 1P8GA 3CD7A 4OFZA 5M2RA 1XC9A 3T5LA 4RU2A 2HGNA 1U48A 2VFSA 1UFLA 1G3OA 2Q6CA 1FJEB 2DNYA 1WHYA 1XWLA 4LQ9A 2MHNA 4I68A 5GAHU 2JLEA 5EGYA 1RI7A 2DPJA 2W9BA 4PG6A 3BDPA 4NA2A 2GIRA 3MPVA 2LXUA 2MQMA 1HBMA 4CZCA 3N5BA