2B8PA

Crystal structure of acanthamoeba polyphaga mimivirus ndk, the first viral nucleoside diphosphate kinase
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
134
structure length
129
Chain Sequence
YKKAGLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEYFNDNCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Mimivirus
molecule tags Transferase
total genus 38
structure length 129
sequence length 134
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2005-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2b8pA00
3EVOA 4C6AA 2CWKA 3FKBA 1VYAA 3VGUA 3EVWA 3Q8UA 5CAAA 1HIYA 4DUTA 3ZTOA 3FBFA 1NB2A 4UOFA 3FBCA 1LEOA 3FBBA 3GP9A 1JXVA 3ETMA 3ELHA 1EHWA 4DI6A 2BX6A 2DY9A 4HR2A 3ZTRA 3Q8YA 4WBFA 4W98A 1S57A 2DYAA 2NCKL 3DDIA 1WKKA 2AZ3A 3Q89A 1LWXA 1U8WA 3BH7B 5CABA 3BBCA 2HURA 1B4SA 1NDCA 4UOHA 3VGSA 3Q83A 4ANDA 4ENOA 2B8QA 5IOLA 1PAEX 4ANEA 5BXIA 1KDNA 2DXFA 2DXDA 2VU5A 4O0NA 1NSPA 3MPDA 1NDKA 3JS9A 1HLWA 1S5ZA 1XQIA 3BBFA 1HHQA 2B8PA 4DZ6A 1NDLA 1MN9A 3VGTA 3VGVA 1NSQA 3DKDA 3EE3A 3ZTSA 3EICA 4ANCA 1XIQA 2BEFA 3NGRA 3BH6B 3B6BA 3FBEA 2AZ1A 1MN7A 1WKJA 3Q86A 2DXEA 2HVDA 3WX8A 3ZTQA 1K44A 2HVEA 3FCVA 3G2XA 1NLKL 4F36A 3PJ9A 3EM1A 4CP5A 1NDPA 4EK2A 1NHKL 1NSKL 3VVTA 2ZUAA 4FKXA 3ZTPA 3ENAA 3L7UA 3B54A 3Q8VA 4KPCA 1BHNA 3VVUA 4FKYA 1F6TA 1NPKA 3BBBA 3EMTA 1B99A 3EJMA 3NGSA 1W7WA 3NGTA 1F3FA 4S0MA 1S59A 3R9LA 5C7PA 1UCNA 3FC9A 4F4AA 3NGUA 3PRVA 1BE4A 4UOGA 3FCWA 3GPAA 1NCLA 1ZS6A 1NUEA 3EVMA 1PKUA 1BUXA 1WKLA
chains in the Genus database with same CATH superfamily
4P74A 4DR2J 2XMTA 5IC6B 1X4HA 3J81j 3LW5C 3ETMA 2XC9A 4DFKA 4FPRA 4I1TA 4K5SA 2CZ9A 3WX4A 3A3OB 2MEWA 3MMBA 5KFJA 2IC3A 1NJXA 1C0UB 2L3MA 2XMVA 3R8YA 4PWUA 1FCAA 5IS2A 5A6PA 3E01A 3M8PA 4LR8A 3MEEB 4LRDA 4KYZA 4O0NA 1Q1KA 2PC6A 3T1HF 4CCHA 5HBMA 2RF2B 5HVFA 2BQUA 2VQEF 1RBOB 1VHFA 2WRMA 4AL7A 1TELA 3DKDA 4L75A 2CPHA 3OR1B 4JI5F 5HROA 1MNEA 1OYDA 4PXEA 1DBDA 3MEGA 2HBQB 1G6BA 3DYAB 3KHLA 3IXQA 4ES3A 3EM1A 1RTHB 2YBVA 1KHVA 5F3TA 1FK9B 3FNNA 2GFFA 3RB3A 2CPXA 4ZHRB 1O8BA 1C1CA 4ZDNA 2HQFA 4C8NA 4A8QA 1JJHA 1FRLA 5CHCB 1M5OC 2H9ZA 1TFYA 2C2EA 4C4WA 1BMQB 3WC0A 2NQPA 1SH0A 2BJ7A 2G1DA 2E5IA 5BYQA 1PC5A 1RI7A 3NGKA 4RNOA 3MMBB 1LW2A 2IC3B 4JV2A 1NM2A 4GKKF 1YGYA 3E01B 3OL8A 1VDHA 2HZVA 3M8PB 4DX6A 2E9TA 4QU7A 2OI2A 1SV5A 7FD1A 5HBMB 3K5MA 1FA0A 2HKEA 3KLIA 3N6LA 2BBEA 2QLXA 3ZZPA 3DRYA 4NMLA 5HROB 4MFBA 4QQBA 3CDBA 5E0OA 3OUYB 3MEGB 3RB0A 1HQUA 2HHUA 2B3TB 3TVZA 4DWIA 1FXLA 2XZDB 2GJFA 2GIRA 3SEOA 2H1YA 4TY9A 2OEKA 2F9DA 1C1CB 1GX6A 2BE7D 2NLWA 3A8IA 2ZJPQ 1WC4A 5DJBA 2A2CA 4IH6A 4I7FA 4PYAA 1FJCA 2RHSB 2C3YA 2E7WA 2VKZG 2W2OP 4DQQA 4R8UA 3S6EA 3ENVA 1LW2B 4DI6A 3JTPA 1M5VC 4W98A 5ETOA 5DM6Q 2UVWA 1S77D 4FXWA 4FYWB 4WU2A 4HHUA 2HIQA 4HI1A 1B4SA 1SV5B 5KFXA 1UW9A 3CO9A 1U09A 3KLIB 1NK4A 3TRGA 1U6FA 2CDQA 5LMNF 2QL7B 4KFBA 2YX7A 4DV7F 5F0UA 2ADCA 2B6AA 4MFBB 1UL3A 5I42A 5LT5A 3MUVP 4A48A 3CC7S 3C15A 2CVEA 3IO1A 3MMCA 3CWJA 4DX8H 4TU8A 4LF8F 2FZKB 1OY9A 2DT9A 3T5JA 2LA4A 2ZNYA 1RCXB 3CJ4A 3B78A 2V5HG 3IFEA 1GTHA 2RRBA 2DR9A 2VBWA 4C3KA 2LQ8A 2MQLA 1AFIA 1MWQA 3H2VE 4I7FB 1HBMA 5L1IA 4XDCA 5E7OB 4KGMA 2RU9A 1M5PC 2HQIA 1A7GE 5U47A 2FVRA 5KG3A 3C3LA 4ITSA 4R8UB 2VPZB 2WB1D 3WHIA 2W4DA 4IKAA 2V9WA 1WF0A 1FWLA 2CJKA 5IC4B 3VTIA 3HVRA 2VF3A 4OZ5A 1FVQA 2ASJA 3OVBA 1YIJS 5GMDA 2D9OA 3R3TA 4KFBB 2B0GA 1Q5YA 2B6AB 2XHWA 1VGYA 1W26A 1UJ5A 3QT8A 2HFOA 1VIOA 4NXNF 3C15B 4DXLA 3MMCB 3OFEA 1LK5A 4Q5VA 3MM8A 2DTJA 1VCTA 4FVCA 2KFYA 1MLAA 4ECRA 2AYMA 2ZZTA 3ZZZA 1YBUA 1WG1A 1WELA 2F8MA 4B9MA 1GMVA 3W3SA 2XO7A 1RDRA 2ZZNA 2CXEA 4DR3F 5CYMA 1HBMB 4F3OA 4ZIWA 1NCLA 2DJWA 5K14A 2HVHA 3JQJA 2J76E 3KJQB 4JYAF 4USKA 3K17A 2RDJA 3TARA 4B3MF 1S6PA 2DGVA 2D9PA 1JJCB 4A46A 4HLBA 5IZHA 4ZCMA 3FFIB 3W63A 5KFMA 2XGPA 4CLFA 3T5LA 1M1KT 2CQ0A 1EKRA 3BR9A 1FTRA 4ZP7A 3OTBA 3L09A 2KL8A 2HZAA 2B56A 4YB6A 4LF7J 3TI0A 1GXLA 4OZNA 4FP9A 4Q7AA 2ZOFA 2CRLA 3MM8B 3BKTA 4TU7A 1X4EA 2WB4A 1TL7A 3L3CA 3OHBA 1RB0A 1IBCB 1N8RT 3DOKA 3H4DA 1W2IA 2FHJD 3H2LA 2EBEA 2GVDA 1W7WA 5CYMB 2BANB 1IR0A 2R8JA 1T3OA 1TVRA 5K14B 4AUKA 4DR5F 2XY5A 2XCAA 1KWMA 3DU6A 3QRPA 3TUJC 4FXVA 2VV5A 1CPZA 1NKBA 2QX0A 1NK9A 3JQKA 1PYOB 2PEHA 3FBFA 1IKXA 3W5ZA 3SV4A 4OJ3A 4NOHA 1S6PB 1EJ7L 3HHLC 3PKMA 3FEZA 3Q8YA 2NXNA 4OYBA 2ZH4A 1H73A 2DCUB 3BQ1A 1N6QA 3RAMA 1WG4A 2RQ4A 5J2MA 2MQMA 4OYOA 2ZUGA 1TK5A 2VJUA 2WW4A 4M5HA 2BUNA 3J7AN 1LXNA 1KLMA 5F8NA 2P6SA 2HGLA 4MIWA 3IGNA 3EXCX 1KSPA 2QZ8A 2JFDA 1TL7B 3DCAA 2OUGA 1FNMA 3DOKB 2IAJA 4M1KA 1LQ9A 5BYRA 2WONA 5JVHQ 2XEXA 3OTEA 3PW5A 2FHJA 4WTOB 2GVDB 2L41A 4C0OC 2PFFB 2X3DA 2YKPA 5AJ3J 2FJAB 4B9TA 4M5JA 2HGMA 2Y0SD 2Z8QA 1S76D 4CH0S 2DHXA 3R7NB 3U1NA 4WP3A 2EFNA 4X2BA 1IKXB 2RT3A 2PI5A 1NMEB 4QIGA 2BX6A 3TVKA 4IG3A 2OEJA 1XN9A 4WBFA 1CVJA 2GNKA 3ONQA 5T41A 3T5KA 2ZBQA 5J2MB 2VDIA 4DSLA 4QYRA 3F0NA 4RW8A 2QLFB 1NRKA 3BR8A 2IBKA 1KLMB 4J9KA 1LWFA 4ZOSA 2C2NA 1CSJA 4A8XA 5CH7B 5KFKA 3J80Y 2FJXA 3N5FA 2J8AA 4MKVA 2Y8WA 2D7SA 1EAYC 4JI2J 2OAUA 2E66A 4IQXA 2IAJB 4U8YA 2FVPA 1QUPA 3W1YC 5E3CA 4M5IA 5HJYA 1WTFA 3C16A 2XGQA 1FI4A 5DLFA 4DZDA 2I0XA 1Z4UA 2UUCJ 3RGIA 1TL1B 4PG7A 1YVFA 1ZH5A 5SZTA 4P2SA 3P3DA 2RRAA 1JXLA 4CH1A 3NGDA 5ITHA 2ZKTA 2OPPB 4HVZA 5KG6A 3LP1A 2XLJA 3CMES 2YKOA 1Q5VA 2B43A 2DO4A 4JI8F 1FDAA 3WZ0A 4IG3B 1RTDA 1DARA 4P52A 2MB0B 2PDAA 2ZC3A 1YJ9S 3OVAA 5H1SV 3GJRB 3M30A 2VA2A 4LRFA 2ZVIA 4NLUA 4RW8B 2JX2A 1LWFB 3I9ZA 2A6MA 3H8YA 1WC3A 3LGHA 2QJ3A 4L3NA 2WSEC 2AGQA 2AGPA 1S6UA 5GADI 1HNZF 3CVKA 4IOBA 4EYIB 4ZCKA 1IBLJ 4LUBA 1OY8A 2DGTA 2RDDA 3C16B 3JSMA 4IQMA 3QT7A 3UO0A 3PYEA 1URRA 2AV5A 4TLRA 5SUHA 1G7CB 3CTRA 1SQGA 2YPZA 2Y3YA 2BJDA 2ZH9A 3KG4A 1M0SA 2XCPA 2M70A 3DLEA 4BLGA 4V19J 3LP1B 1H3DA 1PKUA 3VF0B 5IV4A 4DUYF 2FPHX 3BB5A 4WP9A 3CCUS 2HEKA 4ICLA 4MIAA 2Z4PA 1RTDB 5DG9A 3H40A 4DV4J 5D6GA 2J6UA 3DDIA 3POTB 3BGOP 3I5AA 4UF4A 5KFWA 1YG0A 2MGZA 3M30B 2XMAA 4ETXA 1KN6A 4KH0B 1NKCA 5EWEA 5GADU 2AGOA 2E5LJ 1DQ9A 4J9NA 1SJQA 3KDNA 2B9WA 2FC8A 2FD2A 5HANA 4F02A 4QIVA 3JSMB 1J5EF 1DRZA 3KTQA 1CLFA 1BGXT 4J5OA 1VQ5S 2FVSA 1ZBTA 2YNGA 3GIRA 2HK2A 2KG1A 3OV7A 1SC3B 4J9RA 1FWPA 3X1LB 3NRBA 5KFEA 1GXTA 4KY3A 4I69A 1ZPVA 2DHAA 4FYXB 4C6AA 4PWDA 4ICLB 1UJ4A 4UOFA 4X4SA 2HRYA 4A8YA 3US5A 2IRXA 1X4AA 1XTZA 4CO3A 3M9MB 3HP6A 3MD3A 2JHEA 4X4VA 1U8WA 3LP0A 1RBAA 1VQKS 2IMOA 1RAFB 3AH6A 3EPGA 3OTOF 3LP2A 3HHEA 5CZXA 5I3QA 4H4OA 3OL6A 1OPIA 3JAMU 3P49B 2BKOA 5ETNA 3G82A 2C2MB 3V2UC 3TEGA 4FNIA 1TUGB 3CD7A 1FJGJ 2F4VF 3O5TB 2YNGB 4QBUA 2J0SD 4PYDA 2E1CA 1NDPA 1WC1A 3FZBA 1X4GA 2MKYA 2JVOA 4C2MA 1XR5A 2GW8A 3JB9k 1MMDA 2CQHA 3PO5A 3CB4A 3M2UA 4X4QA 3K0JA 1UCNA 4F3QA 4B3RJ 3FDSA 1MW7A 1HBOA 3TQEA 4DL5A 2BABA 4PWDB 4FF2A 2I1RA 2ALYB 3AXKA 3VGUA 2ATLA 5G4DA 2HHVA 4Z7CA 2AJ1A 3NWRA 5F9NA 3H7HB 3D3CJ 1B7FA 3LP0B 4HHHA 3NP5A 5J2QA 4HTJA 4NLGA 1S7IA 3PW2A 4JI3J 3LP2B 2IM1A 5KG5A 1B3TA 1NSPA 3KG0A 3A1YG 4H4OB 2ERRA 4HT5A 3QJLA 2MQPA 5F0WA 2XMUA 3G82B 1R27B 3E2EA 4EEYA 4ZP8A 3FCVA 3RBXA 4YR0A 3IAM9 2QFIA 4CLKA 4CNZA 4OI1A 3T1YF 1AUDA 5HVHA 4HACA 1WC0A 3OTCA 3CCSS 3D28A 1R8PA 3ADAC 2Y8YA 2ZEJA 1RWPB 1S0OA 3BN4A 3M2UB 1YLXA 3PX0A 5KFZA 1HBOB 1VQ6S 3V81A 1RWKB 3L7PA 3CD5A 4F0MA 4A8KA 2GA7A 2JL9A 3MI7X 2QFJA 4G1QA 3D1OA 4GMKA 1TKXA 1VBXA 3QSYB 3M2RA 2EPIA 3HZGA 2I8EA 2FQQB 3O2IA 2UUBJ 5J2QB 1N33F 1H2UX 3GR0A 1QSLA 3KLEA 1ICEB 3KXDA 1K47A 4R5PA 2HQCA 4GVBB 2LQJA 5HQLA 4ZP9A 3TJ9A 3GILA 2B7BB 3EE3A 1SJFA 4RUHA 2NXEA 3PXGa 5A76A 1IWAA 4FYVB 1HQEA 5IV3A 1KLNA 4M5MA 2ABYA 3MUTP 4HACB 4OJGA 2LA6A 1MROA 3OJUA 1PCAA 4DV0F 1JWWA 5BR8J 2DNNA 1B99A 5EX3A 3D2WA 3V81B 1BQMB 2DISA 1L3TA 2B4VA 1SH2A 3MR5A 4OX9J 4ALZA 3HSDA 4G1QB 5KG1A 3LO3A 4KV8A 2MLZA 1TKXB 5HMXA 3M2RB 3NOGA 1FRXA 2H48B 2V67A 4DJBA 3KDOA 4M5DA 1N54B 2EG2A 1S57A 4W90B 4P2XA 3RRGA 4Y65A 1HARA 4LF2A 1F60B 1HD0A 4PPDA 2MMYA 3D1HA 4LF5J 3FK4A 2V4QA 4OI4A 3DN9A 4LFAJ 3CJ0A 3BSOA 4J9MA 1UVMA 4M8LA 2HFZA 3WX8A 1HQEB 3TZXA 2DGQA 2JC1A 2KYXA 2J9CA 2UUAF 1HNXF 2CJBA 4F36A 3FMWA 4PABA 4TLQA 2X1BA 4QWCA 4CP5A 1MROB 4PQAA 1U1RA 3ILOA 4ZVEA 1QE1A 3NBPB 4CIOA 4F2SA 4MKYA 4NPOA 1NZAA 2V2ZA 1VRUB 4GKJJ 4AE5A 4F4XA 4C97A 1URNA 1LWEB 3ITHA 4XO0A 4GC6A 4U7UK 2Z2ZA 1TMJA 1R31A 1P9QC 1WG5A 4KV8B 3MF5A 2XMMA 2M9KA 4ZN1A 2VIHA 1UPPA 5HMZA 3PCOB 2F9JA 2ZC4A 1ZTTA 2F65A 2OTLS 4RZRA 1FERA 1J5OA 4OL8A 1K1QA 1IKVB 4DR7J 5KOWA 2UVUA 1KVKA 2ZFHA 4KIAA 2XMJA 2MXYA 3SCIE 2QLJB 4ZLNA 2JOQA 3G6ES 4AXIA 1UWBB 2ROGA 2PMHA 5J2NA 2W01A 3CE8A 1QE1B 3BO3A 3AB2B 1CJVA 3ZXWA 1GH8A 3Q23A 4QPXA 5B08A 3S8SA 3FUYA 2KFZA 2GS8A 3ITHB 1RKIA 1CC7A 4DPTA 2F63A 3TWZA 1ZS6A 4ES2A 3U27A 2C2DA 4OI6A 2W4CA 1RJJA 4IDKA 2J6SA 1XR6A 4EU0A 3Q22A 2JDJA 5A0YB 2LQ5A 2W2QP 1S6QA 3NXZA 4PG4A 4KKOA 2CJAA 4N56A 4FF3A 4K50A 2YNIA 2FHOB 3BBCA 1NU4A 1J5OB 2I9SA 2WVDA 1FRMA 3D1QA 4I4BA 4X84A 4JV5J 3EXYA 1NBEB 5IM0A 2UXDJ 3PZPA 2IA0A 1RU2A 1YJ7A 4IOCQ 4JI0F 3K5LA 3GMGA 4EBDA 1FDDA 4NRTA 5J2NB 3WBZA 1T05A 1CJVB 2X1GA 3UCUP 2V6AA 5E41A 4A47A 3TVYA 4DV3J 2ZUAA 4RW7A 2GQCA 3NGSA 4L76A 2DHGA 4I0WA 2CADA 3UW1A 4RKUC 4WCEQ 1YRXA 4EGLA 3K5NA 3AD8C 1TK8A 4IDKB 2MKHA 3QO9A 4A4JA 1BUXA 4N8NA 4DV6J 3SCJE 2C3MA 1HQ2A 2XYGB 3FKBA 4X4RA 1RWNB 1S6QB 3GV5B 3ZNUA 2YQ1A 3PFEA 4ES1A 4O3NA 4KKOB 5CXTA 4I6YA 3DNCA 1HWLA 5D78A 2RKIA 4NLOA 1FNOA 4JI4J 3DRRA 1YI2S 1NDCA 2B8QA 2QA1A 1PAEX 5F8IA 1RWMB 5IM0B 4RU2A 2UUWA 2ZM6F 1P6TA 3JS9A 1RU1A 1OIAA 2WK4A 4MMOA 4Q2MA 5IT4A 5K8PA 3MR2A 1FTCA 2J7UA 2WBMA 3W8GA 4DMZA 4X66J 1Y5IB 3K57A 3EZ5A 3M9NB 1T05B 1SQEA 2EBGA 5KFAA 3PJ9A 4RW7B 2KJWA 2BOPA 4CLPA 3CCRS 4U96A 5LMUF 4X64J 1HNVB 1DTTA 3DDNA 2BVZA 4NLWA 3QO9B 4PUOA 2DCLA 2DHSA 2FB0A 2JEGA 3RR7A 4WE1A 4WF9Q 2MYFA 3M32A 4A8OA 4YB5A 4F25A 4LF9F 3SXLA 1SL1A 4K4XA 1I94F 2QRRA 2KHCA 2RKIB 2DGOA 3DRRB 5CCLA 4JI7J 2M88A 3OW2R 5KFSA 2XI2A 5KFFA 1GTEA 3I9V9 1XNQF 8ATCB 3CD6S 1M1GA 3OR2A 3N01A 2PE8A 3BF4A 1RHUB 2DNQA 2V63A 2F7VA 3SCLE 4ED5A 1E6VA 1FESA 2K06A 2XSFA 2ZHOA 4LF4J 1KP6A 1BWVA 2IY5B 5EWGA 1K9MT 3A3NB 4Z37A 4JI1F 4NZ7A 3BGRA 2F8HA 4TQRA 4N7TA 3Q8VA 1DTTB 3HK2A 1XMQF 1RWUA 2EWHA 3CPWR 1HA1A 4CM2A 3MPWA 4PUOB 2IBOA 1IJFB 4WE1B 1RAGB 2QE5A 3MDFA 4ZA1A 3M32B 4OX7A 2XS7A 4CYUA 3GONA 1EARA 2FVQA 3IM8A 2R7XA 2B5JB 4DS5A 3UPFA 3B8HA 1PJ7A 2J7KA 4DL7A 4KHPF 3DGPA 3ILIA 4KJIA 4LSLA 2MZRA 1NPPA 1DTQA 1BQNA 1VLOA 3JYTA 1XWLA 2W4PA 3UNGC 2CNOB 2DXDA 2QN6B 2UUTA 4RW4A 3GTYX 2EVZA 1MMNA 4WKYA 4ECUA 1TZ0A 4DLGA 2KJVA 3DC2A 4B9UA 2ZDPA 4A8FA 3L7OA 4P7TA 2DRBA 2CQBA 4GO5X 5E3RA 5C25A 3BGRB 2KN4A 1FKOA 2NREA 1IBMJ 3GLJA 3VVTA 3E3XA 3TA0A 2ZH5A 3K8WA 5LSLA 2HBYB 4AL6A 2QMWA 3BJYA 2F5GA 1CJKB 2BRLA 3R5JB 1N32F 2ZBCA 3JSYA 1P27B 1KVIA 3LOUA 3MFHA 2MLYA 2HHXA 3C19A 4ILRA 3TEHB 4LSLB 3MOZA 3O8WA 1DTQB 1BQNB 4LJMA 5EN1A 2ILYA 2NXUA 1KD1T 4X62F 2EFGA 2I38A 4RW4B 5F8GA 4OX8A 4UUWA 1GFWB 2EKNA 3N9UC 2UXBF 3MPDA 3D67A 5KFOA 3V6DA 1T94A 3AJ2A 5E3AA 3FMBA 2M8HA 2ZBIA 5HMWA 2XI3A 2E1MC 5K20B 5KG4A 2DEIA 1FKOB 2HNZA 1YJNS 3DRPA 4ZKAA 4FS2A 3QT6A 4USTA 2MDAA 1R6YA 2K2PA 3EMTA 4DHVA 2V0NA 5HMYA 3Q8PB 3RBEA 3DM2B 3IN5A 2D41A 2VFVA 4C8LA 2W8KA 4KC5A 2MZJA 1NXIA 2QYGA 3ZTOA 1RHRB 1Y00A 3FBCA 1C1BA 4IR1A 2HFUA 3MZIA 4OYMA 3U1MA 4P7VA 2CG8A 4TY8B 1Q16B 2R7QA 2UP1A 6FD1A 1VISA 1FDNA 2QMXA 2CVIA 2CJQA 3TUIC 2CYYA 5L9XA 3IBFB 3V6DB 2PMZD 4XDDA 1H98A 1RAAB 5IT9Y 4J9QA 4ECVA 5GVQA 2D3ZA 4URGA 1JNRB 5F3ZA 4NCGA 4FNHA 1Y4ZB 2QA2A 1HHTP 1VQ4S 4WIIA 3DRPB 1HNIA 2G1HA 1N56A 4YEAA 3VV2B 2XMKA 4A8WA 1S79A 1U8SA 2MKCA 3UVJA 2XS2A 3EJMA 1RT2A 8RUCA 4NLYA 3H0PA 3HHNB 4WK3A 3NLCA 5KFNA 1RAOA 5D3GA 1XMOF 1AYEA 4DV2F 1X31C 4MKBA 5F8HA 1IBKJ 4H4KC 4WXOA 1S1UA 4BC9A 3D6HB 1NJWA 1T9XA 3TJ8A 2AJFE 2QV6A 4RW9A 5DGAA 4DR4J 3WDOA 2OKQA 3VZIA 2D3UA 1HNWJ 1S5ZA 4BWMA 1O5JA 3BQ0A 2ZJRQ 4V1Ak 1RABB 1X7VA 4R25A 4UZBA 3Q8SB 5GAEU 4JV0A 2HHHF 4DV5J 5F8JA 4EWTA 1X4BA 1MG7A 5L1KA 3I0RB 4O3SA 3QIPA 4W92B 5ADZA 3ICLA 1VQMS 5GMEA 2MQOA 2Q79A 1V5VA 2BJEA 1P8GA 2J0QD 5E5NA 2JZ5A 3VWSA 4M5LA 5DM7Q 1RT2B 2CQ4A 4NLVA 1CQMA 2VUGA 3CJ5A 4ZIVA 2Y1JA 4B3TF 3G87A 4DPUA 2DRDA 4OJHA 5B0CA 1X9SA 2KM8B 1SBRA 5GMKa 1UAWA 5F8LA 2ZNZA 3MECA 1S1UB 1MU2A 2BACA 2GV1A 1M90T 1ULRA 2G0CA 2YXLA 4RW9B 4RPFA 2VG5B 4ETZA 1WNEA 1S1TA 3SQGA 5LM7E 4TYAA 2OPSA 3M05A 2CKWA 2RS2A 3EGWB 4M63A 4CLWA 4F4YA 3QNWB 3BSCA 1D9FA 3M6XA 2J9DE 3FBEA 4ZVQB 3QIPB 3GWCA 2EG1A 5HP1B 4F2RA 2MLXA 2O67A 4ELTA 1W2BR 2FGCA 3QAUA 3GJTB 2GMLA 1JNZB 2NR0A 4LSNA 2VQFJ 2Y1RI 2B4PA 1O6XA 2PSZA 2XY6A 2QL9B 3D0GE 4RR5A 4QYZK 4RWXA 2M2BA 2CQIA 4IRCA 2MHEA 3MECB 4M5KA 4WZQA 3MUMP 1MU2B 3CT9A 1GMUA 3LA0A 2KH9A 4XK8C 2YWGA 3GCWP 1YTYA 3BH7B 1XMBA 5IWAF 2RRNA 5EUHA 1S1TB 3SQGB 2KVIA 1IJEB 5E2QA 2OPSB 2YNHA 3GU0A 1HI8A 2ZBRA 3BEGB 1NKEA 2PIIA 2HNYA 1HMVB 2NSBA 3EDRB 2BDPA 3JSBA 4ZPTR 4JV1A 1R0BG 1N36F 3AXMA 2A0FB 1X0FA 1SKSA 4LREA 1KS2A 1E6YB 4HTIA 3NNCA 4I2PA 2NYIA 2JH3A 1IKYA 4I64A 1HW8A 1HWUA 2CG4A 2CDRB 4LSNB 2CQPA 1NPKA 2CQ1A 2P8IA 3BBBA 2IA6A 1EKSA 5KT6A 3D66A 1JLFA 1VRTB 2OH2A 4CNYA 3LAKA 3HD1A 1KQKA 4TQSA 2UU9J 1NZ8A 4EI2A 1U25A 5RUBA 5HVGA 4WIQA 4TN2A 2HQ3A 2CZVC 1T9VA 1RWXB 3K59A 2IJRA 4ENOA 2FLNA 4DPYA 2HNYB 5HLFA 2DR8A 3W2VA 2IDEA 1SQFA 3IMQJ 3M7VA 1Q8BA 1NSQA 4ZJLA 3EICA 2YQ0A 1Q79A 1YQHA 3EPIA 1WKJA 3AJDA 2QT7A 4I2PB 2JJ4D 5IT0A 3CIMA 3QPIA 1WJ9A 2MQQA 2VFUA 2HHWA 3ILJA 4H54A 4LFBJ 1UEUA 2CQ2A 2V34A 4FKXA 5THWA 1UA1A 3R6GB 4GVLA 4O0IA 1JLFB 3CC2S 1UJ6A 1R0AA 1WI6A 4F7VA 3PRVA 4RW6A 4F26A 5B0EA 4FF4A 2KKHA 4F4ZA 2NZCA 3H4BA 2IRUA 1RT7A 2K8GA 4NA1A 4KHRA 1DFDA 2OSRA 2IMWP 3OPKA 4KO0A 3GIMA 3HVWA 4B17A 4RU9A 3R5AA 4U7CA 4K0KJ 3AQOA 1F9EB 4ECZA 4OYWA 5HLFB 3W2VB 3K5OA 1RLCL 4MK8A 2AKWB 5ETMA 1BD6A 4B3SF 4IYQA 3CNQP 2GAHC 1KEKA 4YR3A 4NLPA 4KB7A 5DQIA 1RT3A 4I2QA 4DR1F 4QR1A 1WHWA 3J81Y 4DQIA 2PA3A 1YZ7A 3B4DA 3BQ2A 1NK7A 2O5DA 1YDLA 2QC3A 2JLGA 1GT8A 1RT4A 4Y00A 1R0AB 1LK7A 2VZ9A 5I3PA 1ACMB 4OZ2A 4F4AA 1Y7PA 4G1IA 2IFXA 4RW6B 2Y9HA 3TANA 2A6OA 4Y2AA 3NG8A 2M8DB 3CJRA 2ILZA 3ISNC 3TQ1A 1RT7B 1H74A 3E8OA 4JI6F 4KO0B 3M6VA 4P71A 1PBUA 1J27A 3PR5B 5CA5A 2P9CA 4X65J 3UCGA 2R8KA 1GMWD 1NO8A 2RS8A 4N41A 1V6HA 3PY8A 1Y9OA 1VQSA 3QYYA 2WOMA 2H65B 3AT1B 1V3ZA 3CJKB 1LWCA 1XNRF 2ZH1A 3MAQA 3DDKA 1TP7A 4AQYJ 2DB1A 2DXEA 4I2QB 4FPIA 1L5UA 2ZD1A 2BM1A 1F2HA 1SL0A 4WTYA 4LMZA 4NL5A 2K1RB 2A18A 2AYGA 4JB8B 1RT4B 1N34J 3WIVA 4NWBA 2Q43A 3DOLA 1VQPS 1Q8LA 2KG0A 1B70B 2G2YA 4CLSA 3T9ZA 4DR6F 3Q24A 3VAMA 1FNXH 1ZOTA 4DFMA 4C7QA 1Y3KA 1QTNB 2ZE2A 4Y0FA 1UP1A 3QZ7A 1RLDA 2RDIA 4O4GA 2IM0A 1M5HA 1K0TA 1TMMA 3RBDA 5KFQA 4CDIA 3N79A 4C11A 4N76A 1RHQB 2Q1LA 2WSFC 2P5VA 1S9FA 5JJBA 4DUZF 1SUQA 1L3SA 4MTPA 1GMWA 3QWPA 1QY7A 4YHHF 3SSSA 4PRFA 1M5SA 2WOMB 3P5BP 3QAEA 2C2RA 1LWCB 4DDFA 3W9JA 4IFYA 2OTJS 1RXOB 3B6BA 2VD3A 3T3FA 4X4NA 1ZAWA 4ZVRB 2R7VA 2ZD1B 4B9LA 4UUXA 3IG1A 2DPJA 2GMJA 3H5YA 1F9FA 1RA7A 4O3PA 2QYCA 1U1NA 4OI0A 4DL3A 3W5XA 3D3BJ 1DAXA 1Q8IA 3DOLB 3DXSX 1SJ3P 4LQ3A 1G4CA 2LYVA 3HKWA 1RT5A 2A10A 2IPOB 3GYNA 5HJXA 4USMA 2QO3A 1NUEA 3VAJA 3HT0A 2ZE2B 5GAHI 1N48A 5H9EJ 4O4GB 4RNHA 4DFJA 1BQXA 1S1WA 1WF2A 4LBIA 4U7UD 1FJEB 4FZVA 5HN0A 1N4LA 2EEYA 2Z30B 4J37A 3OHAA 4USVA 1SUQB 4OHZA 3VAIA 4FN5A 2AD9A 4NASA 1RACB 5D0EA 3KLFA 1N88A 4NXMF 3VHQA 1MN9A 1JJ4A 2E9RX 4IFYB 5G0RA 3RAXA 2DNOA 4KGKA 3J7A1 1KOOA 1C2PA 4DV1J 3C6TA 3IG1B 1DLOA 2GMHA 3M8ZA 2EXUA 3CCZA 2KT5A 2OP5A 4DCJB 3F44A 1IM6A 1RT5B 1PO6A 2VOOA 4YY3F 4LFCJ 3MFIA 2YKMA 1JLCA 4CLLA 4M5NA 3CCJS 1UVNA 2V8DA 1U1QA 1WKLA 3FEYB 1S1WB 1T9YA 4DFPA 4WKRA 1JK9B 3SSQA 4ZLPA 3SMZA 1ZAVA 4OZ0A 5KG7A 4J9PA 1KTVA 1L3KA 4CT8A 2GAGC 5T7LA 3HHLA 3TR5A 4OYPA 2H54B 1VJWA 4ANEA 2WSCC 1IQZA 1KDNA 1HWJA 4IO9Q 3KLFB 3A8JA 2DNKA 4H4MA 2NXJA 1RHJB 5G0RB 3K2YA 1IVZA 2W7OA 1N5QA 4NYZA 3RRHA 5EWFA 1BC6A 2FHKA 3CDWA 2N4DA 1SKRA 3HCXA 5C24A 3KHGA 1DLOB 3ZTQA 4PXDA 2CA9A 3IS9A 3G2XA 2YWWA 1U1PA 4ZVHA 2LECA 3UE2A 1WOSA 4ZS6A 3UFCX 2RAQA 3EZOA 1I5OB 1RP5A 1Y10A 3DLJA 2YTCA 2CNKB 4KPCA 3CCQS 1VC6A 4ED1A 8AT1B 1SJ4P 3MPUB 2J7WA 3BGUA 2KI2A 2EC0A 4LSZB 5JMNA 3QWUA 1JX4A 4HKQA 4P2MA 3QLHA 3SFGA 3Q8QB 2UXCF 4MIBA 1RSCA 2XWYA 5DGBA 1SJRA 5T7LB 3HHLB 4LIWA 1HQUB 3MR6A 3ULHA 4F8RA 3QIDA 2LEPA 1QTMA 2HAFA 4EBEA 2CNNB 1FHTA 1NK6A 5C24B 1YWXA 2WAQD 3PX6A 2AYEA 1AB8A 4G6VB 2I6WA 2X3GA 3I87A 3M4XA 4LF6F 1KONA 1WOOA 4ED7A 4AXJA 2GQ2A 5KFTA 2AWZA 1WWHA 2CQCA 1TKTA 1ZM2A 2OHDA 1HR0F 1S59A 4O23A 3UD4P 1MWZA 2CIMA 1NNDA 4NA3A 4BDPA 1FJ7A 4X4OA 1YKWA 5M2RA 2LEAA 3K89A 2R3VA 5K8OA 3IWLA 1FVSA 3QLHB 2DR6A 3HJFA 2K7JA 5I42B 1U7LA 3JTNA 3BDEA 2IM2A 2DYAA 1BXNA 5FLXY 4ATNA 4PPZA 5BXIA 3MEDA 1QVFR 4CM0A 2H5JB 5D4OA 3UR0A 2X7IA 1D3WA 2R8GA 4DL2A 3M9OB 4K4TA 1WEYA 4ERDA 3SI8A 1T9WA 1F0XA 2HVEA 1RAJA 3LUYA 3QGGA 3UDCA 2H51B 2DHHA 3CCLS 2HLTA 1J2VA 3CUNA 3W5YA 1Q78A 1UTAA 3RUBL 4R0JA 1RAEB 2CPFA 4FVMA 3KUEA 4LR7A 1QSYA 1Q82T 3W8PA 2RVJA 3D68A 4B08A 1RTJA 1OSCA 3ZZRA 2VICA 2K7KA 1TV6A 4FBUA 1WTBA 1U0HA 5IXUA 1SI9A 2FYXA 2HSEB 4IH5A 4Q8EA 2KRRA 5BYSA 1UW4A 2GHVC 2YX4A 2QA4S 4YN3B 3I82A 5EDWA 3EGZA 5LJ5Y 3A13A 5DDQC 3R97A 4YB1P 3TO8A 5DQGA 1DQAA 2PFDA 3MEDB 5KFUA 2U1AA 2G9OA 2HQDA 2HLUA 4DR2F 2FZCB 3HFZB 2FJWA 2GGPA 4ECYA 2CJ9A 2D3O1 1YHQS 2CQDA 4WZMA 1D1UA 5KT5A 5KOXA 3WC2A 3G8TA 2C2KB 3KMSA 2R7SA 2HVZA 4NLTA 4IRDA 2JLFA 1ROFA 3CEDA 3OLAA 5BJRA 3G96A 2KT3A 2VA3A 2FVCA 4J9LA 1CULA 1D8ZA 3G8QA 4F4KA 3M6UA 1T7PA 1TL4A 4LVOP 1VQYA 3NY0A 3OLBA 3UN3A 1I1GA 5AXMA 4NI2A 4RX6A 4F3MA 1RTJB 3ZC4A 2MZQA 1OQ6A 1U0SA 4CI0B 1UA0A 3NNHA 1U0HB 2PO4A 3J80U 4RUCA 4P9SA 3J7Z5 3Q8UA 3AOCA 3KLGA 4ED8A 4QR2A 3GIIA 3THTA 4ZPDA 4DCOB 1VIXA 4ZJOA 4ZVPB 5LL6d 3TX0A 1T3NA 5M2UA 1DHMA 2LXFA 4XAKA 3Q83A 1KRPA 1RWWB 2WTFA 3GFZA 2GGPB 3HF5A 3M8SA 1GAOA 1NK0A 4OI3A 3KHRA 3VGTA 2DD8S 3A8EA 3C6UA 4J91A 2BEFA 3NGRA 1S7HA 1QD1A 1TVRB 4NX9A 2UZAA 1X4DA 3PJXA 3HZEA 3OTDA 1CULB 2BW2A 3MAAA 1VR6A 1SL2A 4K4UA 1FD2A 2GO8A 3NNAA 3I5BA 2OD6A 3VQTA 4Q43A 3GZ7A 4NI2B 3BZQA 4LVNP 1F3FA 3RU0A 4YS2A 1N6QB 4KGVB 3BKFA 4KT0C 3T1HJ 3KLGB 1EQMA 3R5BA 2RUSA 4O3RA 2KFNA 3GIJA 2VQEJ 5DZ6A 2HS0A 1GQEA 3CULA 4JI5J 3EZUA 3OXFA 3Q8RB 4DPXA 1ZM4A 4RNMA 3Q2SC 2J5AA 3FSXA 2AEMA 2B4UA 2G13A 1S49A 1I6JA 3C46A 3RB6A 3KLVA 3D7SB 2WONB 2VFTA 4NYOA 1U48A 4KHMA 3C6UB 3HT3A 2YWKA 1S10A 2O01C 3ENQA 2MSSA 2G0IA 1Q81T 3SCKE 3MAAB 5KFLA 2R7TA 3EWGA 1RUSA 2RQKA 4ZPWR 4ZCLA 1FE4A 2RD5C 2QLWA 3O3LA 1BY9A 4HL9A 4LRAA 4Y2MA 4Y34A 4GKKJ 3R9LA 4Z7YA 2KXHA 1VQ9S 3ZZUA 3GPAA 3CDAA 2OD4A 2DNGA 4USWA 3GG0A 4MT1A 4YDDB 1FX2A 1ZYQA 3FSYA 2KM8C 4KGXB 5ETLA 3H5UA 1JXVA 5ETVA 1H2TZ 3OVSA 1RWVB 4FF1A 1F5CA 4DL6A 5CABA 2DH7A 2XG8A 4J7CA 1L3VA 3KJVA 2CWXA 4JOUA 4NCBA 4C0BA 4GO7X 3CW2C 2B51A 5HL7Q 2R2RA 1WSRA 2OMLA 4BCAA 4DCPB 3VGVA 2V8VA 2I5JA 4AL5A 4K5RA 3CIZA 3Q86A 1SKUB 2FJVA 1IR1A 5D4NA 4KSEB 3TZZA 5AXNA 4Y2IA 1WHXA 3TZYA 4I68A 5L9NA 1HWIA 3MM6A 4CO4A 3PW7A 2EW9A 2FY1A 4K4ZA 1F1BB 3T19A 4FDFA 1FXRA 2YNFA 2FTRA 4GRSA 2OELA 4ZVSB 3U1LA 2CPEA 3DLHA 5LMNJ 4UY85 4DV7J 3HSGA 1N0UA 2PMWA 3THPA 1FF2A 4DSEA 2V8PA 5F8MA 5E33A 5DG8A 1N5YA 4EMDA 2JNJA 4WXWA 3KJVB 4LF8J 1X4FA 4OMFG 2IYIA 5A6WA 4P2FA 3S01A 3W7BA 2I5JB 3I6PA 3TUZC 4LF1A 4ILLA 2JSXA 2ZZMA 4ZJQA 3A4TA 2R8HA 3T41A 2FDNA 4OYZA 3I56S 3DLEB 4OHXA 2A2DA 2FC9A 1QDUB 4Q45A 2NUUG 1R8HA 5LXRA 3MM6B 4EZ9A 4A8MP 1RGVA 4LF7F 3BS9A 4RBVA 3GSDA 3I4HX 1R6VA 2ZJQQ 2W9CA 2YNFB 3OL9A 1YZ6A 2P6TA 1AT1B 1GXUA 2MGZB 4X4UA 4NLXA 2CWKA 1WHYA 3HFKA 3AAWB 3TUPA 4QR0A 2KYZA 2DR7A 1LFPA 1S12A 4RNFA 1LEOA 5C5JA 3GP9A 2QSWA 4NXNJ 2WVFA 1DJ0A 1N5YB 2XULA 3DRXA 3OJSA 3KKFA 5DZ7A 3FCHA 3UR3C 1QAJA 2HWHA 1R0CB 4KAIA 3RG6A 5KTQA 1KC8T 3UN5A 2H5IB 2BKNA 4U95A 1FFSB 2GO9A 4MK7A 1I51B 1TL5A 4DR3J 1KR4A 2LDIA 3AY0A 4XIUA 1YJUA 2DEJA 1C0TA 3UWTA 5M2PA 4JYAJ 1RZMA 4EK2A 1UETA 2B9EA 2F40A 2RQMA 5C2CA 5I3UA 4O3OA 4U6PA 4B3MJ 1F6TA 4WFNQ 4HT7A 2W9CB 3PEJA 4C9DA 5B0GA 4YUDA 4ED4A 2NXCA 1LOUA 1U2FA 4C3MA 4B9SA 3DYAA 3LPEA 2WVBA 5AE3A 4ZVOB 3MD1A 4U8VA 1IKWA 2OFGX 4ZHRA 1W25A 2V68A 2C3OA 4DPOA 5AJ3F 1NPRA 4DQPA 1X5OA 4K4SA 3ENWA 1LFWA 3MCMA 2GQQA 2M0GB 3N4WA 3DFEA 5D77A 2BJ8A 4HEA9 4KRWA 4YR2A 1U02A 5MAOA 1VQ7S 5F41A 2M52A 1K0VA 4FBTA 4E2FB 4DR5J 1C0TB 2NYHA 5ETRA 2KZMA 2LKZA 4RUBA 5I3UB 2AF6A 4F0HA 4IO1A 4FKYA 1ELOA 3OUYA 2DRAA 3AODA 2X1FA 4WP8A 4JI2F 1FX4A 4RO0A 1F5BA 1B0PA 1ZM3A 3HHDA 4B02A 5EHHA 5H9EK 1IKWB 1DQ8A 3CSKA 4RJVA 2ASLA 2IM3A 2XYHB 3PV8A 4BHQA 1MMLA 4JUZA 2UUCF 5LXYA 4R0EA 2EKYA 4DPWA 3IP0A 2K3KA 1NJIT 2KO1A 2OEMA 3Q89A 3W60A 3TAQA 4C8OA 4UOHA 5K5MA 4PEOA 4P75A 2Z57B 4DX5A 4F0KA 2LFVA 1KNZA 3L95X 1CBKA 1H6KX 4RBUA 3MEKA 4UOCA 1U2RA 2L9DA 3I32A 2B9XA 4CO0A 4E8UA 1UFLA 3MHYA 2DNMA 4PCQA 1U24A 4TVAB 1Q95G 4URSA 1IBLF 3KLEB 1FD8A 1B0VA 4R5PB 2BJ3A 4C48A 1R3NA 5K9FA 3QGPA 1NHVA 1C4CA 4RUAA 2E1PA 2AP6A 1U1KA 1RT1A 1LWXA 2D74B 2QGFB 3OQ2A 4PQUA 3ETOA 2O1PA 5KFYA 3BKUA 1K73T 2F4FA 2PGCA 4WFBQ 3BGFA 1IUJA 3DLGA 4P6QA 1KBRA 3MM5A 1PAUB 4PG8A 4DV4F 1SH3A 2NS1B 2AZ1A 2V2QA 4CLYA 1NSAA 2AW0A 4EO8A 1YRTA 3QZ8A 3DLKA 1U45A 4I6AA 3HFVA 4JI8J 1NSKL 2E5LF 3F56A 2KXNB 5FD1A 3S7RA 5B0AA 4KBIA 1HHSA 4DQRA 3AQPA 4M5DB 1B64A 2CJYB 3FCWA 5H9FJ 2DO0A 2XO6A 2RUGA 1XR7A 3FEXB 1T9TA 2EFPA 2E5JA 2KDOA 1WDDA 1SCJB 3LGMA 2W2MP 2EFVA 1RT1B 1HNZJ 2C2OB 3NEKA 4ZCIA 2VDHA 4PQUB 4M95A 4P10A 3FZ2A 3BO4A 3CXCR 5LSRA 4L6V3 3DLGB 3NS7B 2R4FA 1HHQA 4NA2A 3MM5B 3P8BB 3HJVA 2BE9B 2MQNA 2A3JA 3FFIA 2AJ4A 2OLWA 3TP2A 3DLKB 2LXIA 4RWWA 2N7YA 2J6TA 4ZVGA 3QMQA 4DUYJ 2E29A 5DO2A 2QA4G 1UZHA 1JB0C 2N3LA 3PKYA 2YH1A 3OXLA 4BBYA 2VL1A 4KTQA 4CRJA 5CQGA 2GCFA 1QAIA 3WQPA 1UZDA 2L48A 1TAUA 3CJSA 3GJSB 2W7AA 1FJGF 2MTLA 5K8NA 5ETSA 2BANA 1A6LA 4B3RF 3P45B 1J5EJ 3RTVA 2ZBPA 4DSFA 2GJ2A 2VU5A 3VCDA 1PJ6A 3RBZA 1ZA1B 1R7IA 1BLUA 3G6YA 1L3UA 5AT1B 3TOQA 3SFUA 2BE2A 4JI3F 5FDLA 3TNVA 2WZ1A 3H2UB 5JXSA 1VQOS 3D0HE 1UPMB 2Z2YB 1FO1A 2M7SA 2MJUA 3IA0A 3QFWA 1H38A 2HWIA 2J0XA 1NK5A 2YNIB 3OTOJ 3EGNA 2CQGA 2ZH2A 4CO1A 3TW0A 2ZITA 2VKRA 4LRBA 1PGZA 1JLEA 4HHJA 4Q8FA 3R5GA 2ZHAA 3R2DJ 4WWSA 3ELHA 1VK8A 3SYZA 1D9DA 3U7JA 1APSA 4ZMMA 3HO1A 4DL0C 5DDRC 4ZP6A 1ZZNA 2F4VJ 2ZHBA 3IAS9 1HPZA 1OY6A 3PHEA 3BGLA 3BDPA 4TXSA 1JKHA 4ZVTB 3GV7B 3BPSP 3UCZP 4YOEA 4QZVB 2UUBF 3EDQB 3PRDA 9RUBA 1T9UA 2BE2B 2LU1A 5FDLB 1ZPWX 1PC4A 4QCLA 4ZITA 1WHVA 3PR4A 1NH8A 2QSFA 2HAIA 1UMJA 3TA2A 1FRKA 4OYAA 2N3OA 3VVUA 4C8KA 2D69A 1WUUA 5C7PA 2HHPA 2DNPA 1ZA2B 5CD4H 3C14A 2DPIA 1LV5A 2MZSA 1JLEB 2HS3A 3H5SA 1WI8A 1F9HA 2G0JA 3P96A 3C66A 2EK6A 5BR8F 1TL1A 4I56A 4KE5A 5HI7A 3FRYA 4D3HA 1PBAA 3IBWA 4C3LA 4CT9A 2OPPA 2HIYA 1CC8A 4H4KA 3DLLQ 3M8RA 2DXFA 1HPZB 3T1YJ 4OX9F 1TAQA 1TL3A 1RA6A 2C3UA 1X5TA 1NB7A 1JKHB 2NZ4A 3Q0AA 4OQJA 2APOA 2VPWB 3LTOA 1SJ1A 2ZDOA 1MN7A 3V6KA 1FWKA 4I67A 4QOTA 2C2ZB 1GX5A 4QIFA 2P2CB 2ZWPA 4LRCA 2DKOB 3FVYA 4NZ0A 2R8IA 3BSNA 2CPDA 2HRUA 2UV8G 1NJYA 2K3IA 1S48A 3HLUA 4LF5F 2RJZA 2R2TA 4L3KA 1OO0B 3RW7A 3ISZA 3VQSA 3JSRA 3QGIA 4LFAF 1N33J 2C42A 3ZO7A 1ZTWA 1GNKA 3C14B 3PYFA 4QWAA 1H7XA 1VYAA 2BMBA 3OR2B 1S0NA 3V4IA 5KG2A 3FBBA 3W9IA 3D6FB 1QJHA 1PSDA 4GKJF 1ZETA 3OFFA 3W9HA 1KQGB 1S9EA 4FS1A 1E6VB 4IR9A 4USJC 3SZ2A 3HDSA 3KUGA 4UQTA 3HD2A 3N6MA 2NUHA 1TL3B 5LJ3Y 1F3VA 4DV0J 3ZZYA 1UEVA 3PJWA 4Q0BA 3THVA 4ED3A 4F04B 2LU2A 3ZTSA 2HHSA 5KFRA 4KGZB 3LWLA 1S4EA 3POTA 4YQWA 3Q2TC 3V6HA 2YWHA 3MPYA 3CMAS 3BM7A 4RNNA 2XNQA 3HI9A 4MYTA 4CYUB 4ECQA 2COLA 4DR7F 2WBRA 5B09A 1TQLA 2BRKA 3DGPB 1IXKA 1FDBA 3OFGA 1KTQA 4DSKA 4E98A 3JYTB 3B4MA 5IT9U 1H2VZ 3C2PA 3V4IB 3IR6B 1X60A 4RL1A 1G1XA 2FIUA 3IWXA 3AHPA 3LQVA 5KT7A 1S9EB 2L08A 2AZ3A 4N8OA 1T02A 2UUAJ 1XERA 1HNXJ 4C0HA 1SB6A 3CJ3A 5C25B 4Q0BB 1NDKA 4CLTA 3J7ZT 3BYRA 2XHCA 1WOPA 2E1AA 3KHHA 2VH7A 3NWGA 1D09B 3MURP 2HYIB 2DNZA 4DSIA 2V2KA 3MTKA 3DLBA 1NLKL 1ZAXA 2HFSA 4ECTA 4JV5F 2ROPA 4NEZA 3ZTPA 2XQCA 2UXDF 1U1LA 1VI7A 3KUHA 1WACA 3G6VA 2LEBA 2AEFA 2MKSA 3GB0A 2C28A 2L9WA 7FDRA 2BR0A 2G2ZA 4ECXA 3AOAA 3WIUA 2BQ3A 3R27A 2OIHA 3T1AA 3RR8A 4N77A 2IJFA 3UD5A 4F50A 3DGVA 2AJ2A 4IRKA 4OLPA 3IR7B 3DXBA 3PNIA 5J1PA 4YFUA 4DV3F 1H72C 1U26A 2VJVA 4OZ1A 3UDLA 2BZ2A 2HHQA 4CQ1A 4TYBA 1CS4A 2KZZA 2LMIA 3GYXB 5J1NA 3SDEA 1ZM9A 2AIRB 4DV6F 2R7OA 3VAGA 1GEHA 2HNZB 2R42A 2CPJA 2D1CA 2FGOA 3GQCA 3T5HA 1HI1A 3DU5A 4ELVA 4ZVUB 4ID8A 3CGIA 4USHA 4DF8A 1CJTA 4DX7A 1FFWB 2P9EA 7AT1B 5KFPA 1FFGB 3IWNC 3CDUA 4JI4F 1IWGA 4LBPA 3B82A 2PD1A 2DVIA 5JUMA 1C1BB 2VC0A 1X9WA 1ZZFA 1Z2ZA 3JTOA 3MWBA 4X66F 3N6NA 2ZWOA 1YBTA 2V4JA 2XYPB 1Y0HA 4ELUA 2EC2A 2HWTA 1NH7A 3H25A 1UVIA 2C3PA 2XS5A 1FRIA 5EGYA 2DGWA 2VFRA 1GK8A 5D4PA 1S97A 1EHWA 4JI0J 1IN0A 3CCTA 1CS4B 4X64F 2ZOGA 1G3OA 2H4YB 2YQ3A 3SDEB 3ISND 4NCGB 4CH7A 1X0PA 2BYCA 1AA1B 5D0RA 4ANDA 4O4RA 5KFCA 2YY3A 4TU9A 1REVA 3AOBA 1HNIB 2XWXA 4IH7A 4OZLA 1P1LA 3EGVA 4EBCA 2DR5A 3GSIA 1CJTB 3DMJA 2CPZA 5DETA 3UVJB 4YDXA 4TKTA 4URQU 4JI7F 2JRSA 4GVBA 3ZZOA 1AW0A 3GJQB 2BA9A 5IQ6A 2FLPA 3HKZD 1KVJA 3AB4B 5D3GB 1U1MA 3BYPA 2YKQA 3TJAA 2YWFA 5FIIA 1T8EA 2ADBA 2G4BA 2MHNA 3M8QA 3KG1A 3M8WA 1R43A 3RZAA 1K1SA 2V4JB 3T6JA 3JAMY 4LF4F 3EVOA 3MMAA 2ZM6J 2DGXA 3HMJG 3UDEA 4CWBA 4ID5A 3KK1A 4NRUA 4NE9C 3R7SB 3NCQA 2EFOA 3LGNA 3PRBA 4IUFA 2LQ9A 3UN2A 4X4TA 4X4PA 2MPUA 2NSCA 4QIWD 1BQMA 4QYZJ 3IR5B 1TKDA 4FXDA 4XTTA 2U2FA 1S72S 1Q0NA 3LAMA 4QWEA 1REVB 4C8YA 5T14A 4EUVA 1YITS 1U2CA 4PG5A 5LMUJ 3DMJB 3PDNA 4OV1A 2HBRB 4UY8T 1X5SA 1D9AA 3MTJA 4BC7A 3G86A 1VBKA 2H5EA 4CTAA 1S9GA 2JFKA 4K4WA 1AROP 1TTHB 2DNLA 1UEKA 1VFJA 2VG6A 2V94A 4OZJA 4LF9J 2DNRA 1U6ZA 3PACA 1UWAA 2IRYA 3M8QB 1I94J 4ZPAA 3KNGA 1SPBP 2N4CA 3RAQA 4ZN3A 4IOAQ 1BE4A 2VG7A 4UOGA 1S1VA 4NMXA 3MMAB 3CDEA 2X1AA 1XNQJ 5HK4A 3KK1B 4ID5B 4PZVA 5DG7A 3NBPA 5E3PA 3IBCB 1IBMF 5AE2A 2E7XA 1VRUA 5MLCV 1T0TV 3U02A 4DG1A 4WPAA 1LWEA 5DS7A 4E0DA 5A8WA 3RRKA 4Y2CA 1CG2A 3UNYA 4YP3A 3GFYA 5D15A 4OYIA 4PG6A 1VC0A 3VZHA 4JI1J 4J9VA 2YH0A 3FRZA 2MY7A 2B8PA 3CCWA 1XMQJ 5B7WA 2HFNA 2FLLA 1VBYA 4CTAB 4UW2A 1S9GB 2IYGA 3W62A 4DLEA 5HATA 1WORA 2VG6B 1XJWB 1IKVA 4C8ZA 1JLBA 4A8SA 1X4CA 2CUYA 2OJ3A 1B0TA 3H59A 3M2VA 3LALA 4KHPJ 6AT1B 1IR2A 3G71S 4Y3CA 3N28A 4LT6A 4OIXA 2ZH3A 2VG7B 1S1VB 1CQNA 3CCVS 1UWBA 2HRTA 2BW7A 2PEBA 3M1VA 4B9NA 1OSDA 2B7CB 4WK1A 2YNHB 3GIKA 2W9BA 1OWXA 3S1TA 1FEHA 3P4UB 4DG1B 1YJTA 2JLEA 3CJ2A 1QAYA 2DGUA 3QQCD 2RNEA 4D3GA 5A8WB 3J81U 1WKKA 1NAQA 1JJ2R 3OBIA 2HZCA 2RU3A 4K59A 3VGSA 5A0YA 3MCOA 1IKYB 1WDTA 1F5AA 3I96A 5ETKA 1S1XA 3DOMA 4DZ6A 2HQGA 2Q6CA 4K2XA 1OPZA 2DIVA 5IQQA 4AYBD 3HVAA 4G1PA 1DZ5A 3VAFA 2VONA 1N32J 3FQLA 4QW9A 1JLBB 5C42A 3M2VB 2KRBA 1H0HB 1S6OA 2GJIA 5A8KA 5A2QU 4S0MA 2HMIA 2YX1A 3R2CJ 3MMJA 1LKZA 3M1VB 4QIEA 3QJPA 4X62J 2BJ9A 1FRJA 3SV3A 1M1HA 5H9FK 2FUG9 4CO2A 5DDPC 2UXBJ 2DIUA 2W9BB 3R6LB 4LIRA 1FRHA 1F2GA 4F4WA 3PEHA 2AU0A 1HI0P 3V5RA 3D54A 2AHOB 2UV8A 2AYBA 2VPXB 1TR0A 3AFGA 2WVEA 5CYQA 1M5KC 5HO4A 1NK8A 3GG1A 3CMQA 2DGSA 3C8YA 1S1XB 2HS4A 3DOMB 4P72A 1Q7LB 1UVLA 1LXJA 2FHMA 1IBKF 3KNAA 3UQSA 4HDGA 4EO6A 2GVZA 3F41A 1R8CA 4QPTA 5J1EA 2DH9A 5C42B 3CO0P 4DR4F 2AJ0A 3RYLA 1YX2A 1SC4B 5D8HB 1HNWF 4ZPBA 1VRQC 4DL4A 1H7WA 5A8KB 1HFEL 5KFDA 2HMIB 3NGTA 2W9AA 4DV5F 3IGVA 2O3DA 1A0OB 2NPFA 2MJNA 2V8GA 5KFBA 3UI3A 2C22A 3KLHA 2L9NA 1OYEA 2N82B 4PWWA 1HBNA 1SXLA 5CZVA 2O66A 2N7CA 4G65A 2W24A 3QBCA 1HNVA 3BV8A 2KU7A 1HWKA 1REGX 1VC5A 4ED2A 5CYQB 4K8RA 1KKHA 3O44A 1RT3B 4QU6A 2VPYB 2EK1A 3I31A 3ZZ0A 3TA1A 2ACMA 2YKNA 2BKPA 3OSNA 2IVFB 2F1FA 3DRSA 1Z2LA 2GVZB 2M4MA 1YBAA 1AFJA 3CC4S 5J1EB 2W8LA 2DITA 2V8HA 1Y5LB 5CYJA 3W64A 2E44A 1XMOJ 4DV2J 1XK8A 5J2PA 4PR6A 5L46A 3QGHA 3R5CA 4DSJA 2EFQA 1O51A 3T9NA 1PIEA 2MZ1A 2ZH6A 1G2EA 1KQFB 3PHTA 3KLHB 1VBZA 1EQ0A 3EVMA 3G4SS 2V2VA 3IRWP 1HBNB 2RILA 1JIHA 4UZCA 2ASYA 1AXQA 1YJWS 2DY1A 3H20A 2HHHJ 4PXBA 2VQFF 1JLAA 1I3OB 1PYTA 2KHDA 3A3PB 2MZTA 3NKYA 1R8AA 3D9BA 3PG9A 2XBPA 3KWMA 1UVKA 2YKNB 3P6YC 2R7UA 4K7QA 2RIJA 4WFXA 4AT1B 2B5JA 3MM7A 3DRSB 4B3OA 2RMLA 2HBZB 4Q2LA 4HH1A 4U67Q 3IRXA 1XC9A 4B3TJ 3CJQA 4HDHA 3K5PA 2AX1A 3MCSA 1SIZA 4BS2A 1T03A 1T11A 5J2PB 1AZSA 4OZ3A 2V50A 2HHTA 4WFZA 1Q4RA 2OGUA 3FQKA 5L8RC 1X9MA 3I5CA 1K8AT 4HH0A 4IG0A 4C11B 3F73A 1MWYA 3ET6A 5KT4A 1V3SA 3HX9A 3VR1A 3HHLD 3NMRA 1FKPA 2C1EB 2ZH8A 4Z2XA 1JLAB 1CJKA 2J9EA 3EYZA 2YWEA 1TUVA 3R1HA 3CJ8A 3I4PA 1OMSA 2UU9F 3NCPA 1KFDA 3MM7B 4KR0B 3KFWX 4B3OB 2W7PA 4L74A 4NLSA 3ZZTA 1FT8A 1NDLA 4FYDA 3IRXB 4B9VA 5L1LA 4MYUA 2UVRA 2VBZA 1NHUA 3A8KA 4G3IA 1T03B 5GAHU 5KG0A 2LP4A 4OHWA 5L1JA 2WW8A 1HBUA 5I4MA 1AZSB 1YSJA 3LH2S 2BJ1A 1UFKA 3CF5Q 3PTWA 3VAHA 1NJZA 1KFSA 2IVYA 2Z56B 4K4VA 1S99A 3FGVA 2LQBA 1A9NB 4IG0B 1VQLS 1PYSB 2IIHA 2IVMA 3ET6B 3NGUA 1S0VA 5IWAJ 5LOQA 2MY8A 3EX7B 2AMCB 4P73A 2RHQB 1RT6A 4CLZA 2OSQA 1FKPB 3R5DA 3HSZA 4LFBF 5EX0A 5D0HA 3MR3A 3MOJB 1N36J 3BN7A 4NLRA 2Y1LB 4HYKA 4HI2A 3DM2A 4TNOA 2FY8A 3OD2A 3RB4A 1U49A 3MXHP 2W2PP 3C6TB 1SC1B 2ZH7A 5KFHA 4UQGA 2JEFA 2HVIA 3HVTA 2P9GA 2ALZA 4TY8A 3GYGA 2MKIA 3TYTA 4QWBA 1HBUB 4ZVFA 2YKMB 3KMQA 1JLCB 4ECWA 4K0KF 1NHKL 2RSQA 4N47A 5FLXU 3G8SA 4XPCA 1U4BA 3HSJA 2POKA 2OMOA 2CFXA 2CPIA 2AQ4A 1N5SA 5C2GA 1Q86T 1RT6B 5DLGA 4WYLA 2AEJA 2E9ZA 2GZOA 2RE1A 3BO2A 1WF1A 2FZGB 4DUTA 1R8BA 3NMAA 4MKAA 4H4MB 2E1RA 3CCMS 3FJ2A 1QSSA 4YB7A 2F8EX 4HR2A 5D4LA 2OO4A 2NCKL 2YVSA 2LXUA 1RBLA 3IS9B 3PIPQ 5HAOA 3TX8A 2HK3A 1P9YA 1SC6A 5GAGI 1XQIA 4DEZA 3BBFA 4DS4A 3HVTB 1VJQA 2XB2D 3KK2A 2QLBB 4M5GA 5DQHA 1PG5B 2HW3A 1XIQA 4K4YA 3GCXP 4OFZA 1DY3A 2ATCB 2J8SA 2FLOA 4DN9A 2KTQA 3PW0A 4X65F 2Z2MA 1RAHB 3ENAA 2FJDB 2HNDA 5ETPA 4DU8A 1VOMA 3H98A 2OFHX 3NS5A 2QEXS 3I0RA 3OXGA 1RWOB 4OYXA 4AQYF 1N0VC 4NLQA 2JWNA 4WFYA 4CZCA 5GAEI 4J9UE 2ZOMA 1TU0B 5FJ4A 2Y0BB 4FYYB 1QAXA 1N5TA 3CD0A 4B3SJ 2H4WB 3AA8A 3PFOA 1N34F 3SSRA 3O1LA 3LANA 4EZ6A 3PX4A 3D6MB 3PIOQ 1IQTA 5GAGU 1LW0A 4DR1J 5AXLA 2LLZA 5DRKA 5IOLA 4RBTA 3GR1A 3BREA 5DDOC 2PN6A 1DURA 3KK2B 1RADB 3TAMA 5D0GA 1Z1ZA 4KH1B 1R89A 1U6BA 3CJTA 2IHR1 3PM9A 5CCMA 1XEZA 1FXDA 1EETA 1TKTB 3IC1A 1UKUA 2G2OA 2WCXA 2HGNA 2WVCA 1RE1B 2VG5A 2CZ4A 1RHKB 5ETQA 4DF4A 2W2NP 2XMWA 4KQZA 1RQ0A 2HNDB 3W65A 3D6TB 2CQ3A 3HM9A 4JI6J 4WFAQ 1WC6A 1V3RA 3JXOA 2VC1A 2XM3A 3NOCA 4J90A 4ZK7M 3PYDA 1QM9A 3FC9A 4Y6IA 3RW6A 2BM0A 4QJVA 1RTIA 5HP1A 5L38A 1VK3A 2DK2A 3KJNB 1SKWA 3JQMA 3MAHA 2DNHA 1YRUA 2JEIA 3I55S 1XNRJ 3LWMA 2DBBA 3NAHA 3ZTRA 2X51A 1LW0B 2RH3A 3MPVA 2XNRA 2HURA 3N5BA 3ILLA 4USUA 4USIA 2OPRA 5HQ8A 2R7WA 3TAMB 2OPQA 3MR7A 1Y11A 2QMUB 1WD6A 2DNYA 2PT0A 1EETB 4WU3A 2ZVSA 4ANCA 1NEEA 4BWJA 4OHVA 2M3DA 3BH6B 2AX0A 1YK9A 1T95A 4MAKA 2A1BA 3V6JA 2MKKA 3TAPA 1K44A 1HW9A 2B9YA 3DI6A 4DR6J 1TV6B 4ZLLA 5AXKA 2ASDA 1O0PA 5B0FA 4NCAA 2CJXB 4ER8A 2W25A 2W1BA 1HMVA 4NEYA 4ZPCA 3B54A 4OHYA 4KPYA 3AA9A 1X8DA 2B4OA 1RTIB 1D8YA 4ZLJA 1E6YA 2UVVA 1WEZA 4DUZJ 4DV1F 3L9ZA 1RAIB 2EI5A 4YHHJ 3GV8B 1LNQA 3L4BC 4C8MA 1JXEA 4NZ6A 3AD9C 3QJJA 4O3QA 1P1TA 3KK3A 3K8VA 3RJMB 2GIFA 2RQCA 4ECSA 1VRTA 1UVJA 4DU7A 4U9RA 1WSVA 4LFCF 3ZFVA 2M5YA 4WJBA 2OPRB 4XPEA 4Y28C 2GIQA 2OPQB 1IM4A 1HYSA 2CNLB 2V9KA 3AD7C 1ITPA 3V4MA 5KFIA 5ETTA 1QUVA 2KXFA 3D5MA 4UTGA 1Y5NB 3DI6B 2BQRA 1VMBA 5KFGA 2XLKA 1N5VA 1S0MA 5K8MA 4W4MA 2ROEA 5KFVA 2JEJA 2R9LA 2Z2LA 4YMEA 2VFSA 3X3UA 4ZPVR 3PVXA 3W2WA 2E7VA 1B7YB 2KT2A 1EX8A 5KT2A 1KQSR 1Q8KA 3K58A 2KVQE 2MQ8A 3BPDA 3PO4A 3D4JA 2R7RA 2VB6A 3CCES 3T6BA 2ACYA 1EZZB 2XLIA 1RTZA 2YPYA 4PKDB 3KK3B 3OT9A 4Q44A 4NXMJ 1KHWA 3R7BB 2YKAA 3G6XA 3NS6A 4C98A 1N52B 4JBCA 1FEEA 1EP4A 1AUSL 4OV6A 2JVRA 6FDRA 3H42A 1HKAA 2IJNA 1HYSB 5JVGQ 1RK8A 1FE0A 2BXJA 4F67A 2Z0GA 3QRRA 2JC0A 4K2JA 1VQNS 1S4FA 4OX6A 4YY3J 2GX8A 1HL6A 2AJQA 3A12A 2CAJA 2Q6BA 2RB7A 3LPYA 4DOZA 3AJ1A 4MJKA 2XSJA 2AT1B 3I0SA 3FSIA 3P5TL 1EIYB 1U47A 3W2WB 1OQ3A 3L7UA 4J9SA 2XY7A 3PW4A 3UDVA 2PA8D 4WYWA 3J7YI 1D0EA 2V4RA 2GC8A 3TZWA 1OJ4A 1RISA 1WC5A 3EVWA 2F3JA 3ZNJ1 1NB2A 5E3QA 3MCNA 3M8YA 1RYRA 3BSAA 1Y3JA 1SVDA 4V19X 4JP8A 1EP4B 2VASA 4ED6A 5HSPA 2VBYA 3VALA 1OS5A 1YJVA 3HXMA 3QATA 2DH8A 3SBMA 3KOAA 2LDYA 4Y2KA 2VBXA 2R2UA 1VS3A 4L73A 3W66A 4IFVA 2Q66A 3GFHA 2MSTA 2QL5B 1WEXA 3H90A 1RHMB 2E5HA 1VLYA 2XTJP 2H3EB 1TKZA 3MM9A 2I2YA 2XSJB 1EB0A 3QFHA 3I0SB 2IDLA 1U1OA 4CO5A 2MKJA 2GHPA 3J7YU 1JQGA 3M6WA 3CJKA 1SIWB 1UFWA 5L39A 9ATCB 1TUWA 2UXCJ 2SXLA 1FKAF 2LVWA 1CEZA 1PILA 3E51A 4J9OA 4ED0A 4ILMA 2K1RA 3SIPB 2Z58B 5HQMA 4NYPA 5CAAA 4OI2A 1V9OA 2Y1IA 3W61A 3HPOA 2FJEB 1JLQA 2PI4A 4CLUA 2VODA 2V69A 1C4AA 1TK0A 4QW8A 3IM9A 3OL7A 3VAKA 1Q7YT 3QT5A 4NLDA 5A8RA 4LF6J 4EYHB 3NCRA 3EUNA 1CJUA 1JLGA 1HLWA 4IFVB 2BOAA 4AFFA 4LBHA 1JMTA 3PYGA 4AD6A 2LCWA 1HR0J 1MSWD 5IFMA 2ZKUA 4MH8A 1TKZB 3MM9B 5A2QY 3UD3P 1RCOB 1BWEA 5KAKA 3MGJA 1TFWA 3KJFB 5KT3A 3NL0A 4DBQA 3DHWC 3GE9A 3D0IE 2VHGA 4RLEA 4UT4A 3LF0A 4EFAC 3GFXA 4O44A 4PAAA 2QG9B 2QIFA 3N0VA 2J9DA 1VQ8S 2Q3PA 3HHKA 4DQSA 4GC7A 2VOPA 1X5PA 3KYLA 1RYSA 3DHXA 5CD4A 1YJRA 3OFHA 2QTWA 2KB2A 4N5SA 2R2SA 1HIYA 3K7RA 2NPIA 3NAIA 5AE1A 1JLQB 2HPUA 2E5GA 3QSIA 2DY9A 2BV3A 4DN0A 4LQ9A 4OJ1A 1V5IB 4QWDA 5A8RB 1C0UA 5B0DA 1CJUB 2HFVA 1QVGR 1JLGB 4I6WA 5F9LA 3MEEA 4MK9A 5LSOA 3H5XA 1VHIA 1Q53A 2RF2A 2D3OR 1QLNA 3OR1A 1HD1A 2HVDA 4LR9A 2HG4A 2GHWA 4OLOA 1KOHA 2J0WA 5B0BA 4M94A 3R1LA 2XZTB 3SQOP 3G9CA 4O44B 3QRQA 1XBWA 1RTHA 1BHNA 2CPYA 1FK9A 4PXCA 3O6QA 2WHOA 3HULA 2FJBB 4L72B 3OSPA 1PJ5A 2XZWA 1RKJA
chains in the Genus database with same CATH topology
3EVOA 4C6AA 2CWKA 3FKBA 1VYAA 3VGUA 3EVWA 3Q8UA 5CAAA 1HIYA 4DUTA 3ZTOA 3FBFA 1NB2A 4UOFA 3FBCA 1LEOA 3FBBA 3GP9A 1JXVA 3ETMA 3ELHA 1EHWA 4DI6A 2BX6A 2DY9A 4HR2A 3ZTRA 3Q8YA 4WBFA 4W98A 1S57A 2DYAA 2NCKL 3DDIA 1WKKA 2AZ3A 3Q89A 1LWXA 1U8WA 3BH7B 5CABA 3BBCA 2HURA 1B4SA 1NDCA 4UOHA 3VGSA 3Q83A 4ANDA 4ENOA 2B8QA 5IOLA 1PAEX 4ANEA 5BXIA 1KDNA 2DXFA 2DXDA 2VU5A 4O0NA 1NSPA 3MPDA 1NDKA 3JS9A 1HLWA 1S5ZA 1XQIA 3BBFA 1HHQA 2B8PA 4DZ6A 1NDLA 1MN9A 3VGTA 3VGVA 1NSQA 3DKDA 3EE3A 3ZTSA 3EICA 4ANCA 1XIQA 2BEFA 3NGRA 3BH6B 3B6BA 3FBEA 2AZ1A 1MN7A 1WKJA 3Q86A 2DXEA 2HVDA 3WX8A 3ZTQA 1K44A 2HVEA 3FCVA 3G2XA 1NLKL 4F36A 3PJ9A 3EM1A 4CP5A 1NDPA 4EK2A 1NHKL 1NSKL 3VVTA 2ZUAA 4FKXA 3ZTPA 3ENAA 3L7UA 3B54A 3Q8VA 4KPCA 1BHNA 3VVUA 4FKYA 1F6TA 1NPKA 3BBBA 3EMTA 1B99A 3EJMA 3NGSA 1W7WA 3NGTA 1F3FA 4S0MA 1S59A 3R9LA 5C7PA 1UCNA 3FC9A 4F4AA 3NGUA 3PRVA 1BE4A 4UOGA 3FCWA 3GPAA 1NCLA 1ZS6A 1NUEA 3EVMA 1PKUA 1BUXA 1WKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EVO A;  4C6A A;  2CWK A;  3FKB A;  1VYA A;  3VGU A;  3EVW A;  3Q8U A;  5CAA A;  1HIY A;  4DUT A;  3ZTO A;  3FBF A;  1NB2 A;  4UOF A;  3FBC A;  1LEO A;  3FBB A;  3GP9 A;  1JXV A;  3ETM A;  3ELH A;  1EHW A;  4DI6 A;  2BX6 A;  2DY9 A;  4HR2 A;  3ZTR A;  3Q8Y A;  4WBF A;  4W98 A;  1S57 A;  2DYA A;  2NCK L;  3DDI A;  1WKK A;  2AZ3 A;  3Q89 A;  1LWX A;  1U8W A;  3BH7 B;  5CAB A;  3BBC A;  2HUR A;  1B4S A;  1NDC A;  4UOH A;  3VGS A;  3Q83 A;  4AND A;  4ENO A;  2B8Q A;  5IOL A;  1PAE X;  4ANE A;  5BXI A;  1KDN A;  2DXF A;  2DXD A;  2VU5 A;  4O0N A;  1NSP A;  3MPD A;  1NDK A;  3JS9 A;  1HLW A;  1S5Z A;  1XQI A;  3BBF A;  1HHQ A;  2B8P A;  4DZ6 A;  1NDL A;  1MN9 A;  3VGT A;  3VGV A;  1NSQ A;  3DKD A;  3EE3 A;  3ZTS A;  3EIC A;  4ANC A;  1XIQ A;  2BEF A;  3NGR A;  3BH6 B;  3B6B A;  3FBE A;  2AZ1 A;  1MN7 A;  1WKJ A;  3Q86 A;  2DXE A;  2HVD A;  3WX8 A;  3ZTQ A;  1K44 A;  2HVE A;  3FCV A;  3G2X A;  1NLK L;  4F36 A;  3PJ9 A;  3EM1 A;  4CP5 A;  1NDP A;  4EK2 A;  1NHK L;  1NSK L;  3VVT A;  2ZUA A;  4FKX A;  3ZTP A;  3ENA A;  3L7U A;  3B54 A;  3Q8V A;  4KPC A;  1BHN A;  3VVU A;  4FKY A;  1F6T A;  1NPK A;  3BBB A;  3EMT A;  1B99 A;  3EJM A;  3NGS A;  1W7W A;  3NGT A;  1F3F A;  4S0M A;  1S59 A;  3R9L A;  5C7P A;  1UCN A;  3FC9 A;  4F4A A;  3NGU A;  3PRV A;  1BE4 A;  4UOG A;  3FCW A;  3GPA A;  1NCL A;  1ZS6 A;  1NUE A;  3EVM A;  1PKU A;  1BUX A;  1WKL A; 
#chains in the Genus database with same CATH topology
 4P74 A;  4DR2 J;  2XMT A;  5IC6 B;  1X4H A;  3J81 j;  3LW5 C;  3ETM A;  2XC9 A;  4DFK A;  4FPR A;  4I1T A;  4K5S A;  2CZ9 A;  3WX4 A;  3A3O B;  2MEW A;  3MMB A;  5KFJ A;  2IC3 A;  1NJX A;  1C0U B;  2L3M A;  2XMV A;  3R8Y A;  4PWU A;  1FCA A;  5IS2 A;  5A6P A;  3E01 A;  3M8P A;  4LR8 A;  3MEE B;  4LRD A;  4KYZ A;  4O0N A;  1Q1K A;  2PC6 A;  3T1H F;  4CCH A;  5HBM A;  2RF2 B;  5HVF A;  2BQU A;  2VQE F;  1RBO B;  1VHF A;  2WRM A;  4AL7 A;  1TEL A;  3DKD A;  4L75 A;  2CPH A;  3OR1 B;  4JI5 F;  5HRO A;  1MNE A;  1OYD A;  4PXE A;  1DBD A;  3MEG A;  2HBQ B;  1G6B A;  3DYA B;  3KHL A;  3IXQ A;  4ES3 A;  3EM1 A;  1RTH B;  2YBV A;  1KHV A;  5F3T A;  1FK9 B;  3FNN A;  2GFF A;  3RB3 A;  2CPX A;  4ZHR B;  1O8B A;  1C1C A;  4ZDN A;  2HQF A;  4C8N A;  4A8Q A;  1JJH A;  1FRL A;  5CHC B;  1M5O C;  2H9Z A;  1TFY A;  2C2E A;  4C4W A;  1BMQ B;  3WC0 A;  2NQP A;  1SH0 A;  2BJ7 A;  2G1D A;  2E5I A;  5BYQ A;  1PC5 A;  1RI7 A;  3NGK A;  4RNO A;  3MMB B;  1LW2 A;  2IC3 B;  4JV2 A;  1NM2 A;  4GKK F;  1YGY A;  3E01 B;  3OL8 A;  1VDH A;  2HZV A;  3M8P B;  4DX6 A;  2E9T A;  4QU7 A;  2OI2 A;  1SV5 A;  7FD1 A;  5HBM B;  3K5M A;  1FA0 A;  2HKE A;  3KLI A;  3N6L A;  2BBE A;  2QLX A;  3ZZP A;  3DRY A;  4NML A;  5HRO B;  4MFB A;  4QQB A;  3CDB A;  5E0O A;  3OUY B;  3MEG B;  3RB0 A;  1HQU A;  2HHU A;  2B3T B;  3TVZ A;  4DWI A;  1FXL A;  2XZD B;  2GJF A;  2GIR A;  3SEO A;  2H1Y A;  4TY9 A;  2OEK A;  2F9D A;  1C1C B;  1GX6 A;  2BE7 D;  2NLW A;  3A8I A;  2ZJP Q;  1WC4 A;  5DJB A;  2A2C A;  4IH6 A;  4I7F A;  4PYA A;  1FJC A;  2RHS B;  2C3Y A;  2E7W A;  2VKZ G;  2W2O P;  4DQQ A;  4R8U A;  3S6E A;  3ENV A;  1LW2 B;  4DI6 A;  3JTP A;  1M5V C;  4W98 A;  5ETO A;  5DM6 Q;  2UVW A;  1S77 D;  4FXW A;  4FYW B;  4WU2 A;  4HHU A;  2HIQ A;  4HI1 A;  1B4S A;  1SV5 B;  5KFX A;  1UW9 A;  3CO9 A;  1U09 A;  3KLI B;  1NK4 A;  3TRG A;  1U6F A;  2CDQ A;  5LMN F;  2QL7 B;  4KFB A;  2YX7 A;  4DV7 F;  5F0U A;  2ADC A;  2B6A A;  4MFB B;  1UL3 A;  5I42 A;  5LT5 A;  3MUV P;  4A48 A;  3CC7 S;  3C15 A;  2CVE A;  3IO1 A;  3MMC A;  3CWJ A;  4DX8 H;  4TU8 A;  4LF8 F;  2FZK B;  1OY9 A;  2DT9 A;  3T5J A;  2LA4 A;  2ZNY A;  1RCX B;  3CJ4 A;  3B78 A;  2V5H G;  3IFE A;  1GTH A;  2RRB A;  2DR9 A;  2VBW A;  4C3K A;  2LQ8 A;  2MQL A;  1AFI A;  1MWQ A;  3H2V E;  4I7F B;  1HBM A;  5L1I A;  4XDC A;  5E7O B;  4KGM A;  2RU9 A;  1M5P C;  2HQI A;  1A7G E;  5U47 A;  2FVR A;  5KG3 A;  3C3L A;  4ITS A;  4R8U B;  2VPZ B;  2WB1 D;  3WHI A;  2W4D A;  4IKA A;  2V9W A;  1WF0 A;  1FWL A;  2CJK A;  5IC4 B;  3VTI A;  3HVR A;  2VF3 A;  4OZ5 A;  1FVQ A;  2ASJ A;  3OVB A;  1YIJ S;  5GMD A;  2D9O A;  3R3T A;  4KFB B;  2B0G A;  1Q5Y A;  2B6A B;  2XHW A;  1VGY A;  1W26 A;  1UJ5 A;  3QT8 A;  2HFO A;  1VIO A;  4NXN F;  3C15 B;  4DXL A;  3MMC B;  3OFE A;  1LK5 A;  4Q5V A;  3MM8 A;  2DTJ A;  1VCT A;  4FVC A;  2KFY A;  1MLA A;  4ECR A;  2AYM A;  2ZZT A;  3ZZZ A;  1YBU A;  1WG1 A;  1WEL A;  2F8M A;  4B9M A;  1GMV A;  3W3S A;  2XO7 A;  1RDR A;  2ZZN A;  2CXE A;  4DR3 F;  5CYM A;  1HBM B;  4F3O A;  4ZIW A;  1NCL A;  2DJW A;  5K14 A;  2HVH A;  3JQJ A;  2J76 E;  3KJQ B;  4JYA F;  4USK A;  3K17 A;  2RDJ A;  3TAR A;  4B3M F;  1S6P A;  2DGV A;  2D9P A;  1JJC B;  4A46 A;  4HLB A;  5IZH A;  4ZCM A;  3FFI B;  3W63 A;  5KFM A;  2XGP A;  4CLF A;  3T5L A;  1M1K T;  2CQ0 A;  1EKR A;  3BR9 A;  1FTR A;  4ZP7 A;  3OTB A;  3L09 A;  2KL8 A;  2HZA A;  2B56 A;  4YB6 A;  4LF7 J;  3TI0 A;  1GXL A;  4OZN A;  4FP9 A;  4Q7A A;  2ZOF A;  2CRL A;  3MM8 B;  3BKT A;  4TU7 A;  1X4E A;  2WB4 A;  1TL7 A;  3L3C A;  3OHB A;  1RB0 A;  1IBC B;  1N8R T;  3DOK A;  3H4D A;  1W2I A;  2FHJ D;  3H2L A;  2EBE A;  2GVD A;  1W7W A;  5CYM B;  2BAN B;  1IR0 A;  2R8J A;  1T3O A;  1TVR A;  5K14 B;  4AUK A;  4DR5 F;  2XY5 A;  2XCA A;  1KWM A;  3DU6 A;  3QRP A;  3TUJ C;  4FXV A;  2VV5 A;  1CPZ A;  1NKB A;  2QX0 A;  1NK9 A;  3JQK A;  1PYO B;  2PEH A;  3FBF A;  1IKX A;  3W5Z A;  3SV4 A;  4OJ3 A;  4NOH A;  1S6P B;  1EJ7 L;  3HHL C;  3PKM A;  3FEZ A;  3Q8Y A;  2NXN A;  4OYB A;  2ZH4 A;  1H73 A;  2DCU B;  3BQ1 A;  1N6Q A;  3RAM A;  1WG4 A;  2RQ4 A;  5J2M A;  2MQM A;  4OYO A;  2ZUG A;  1TK5 A;  2VJU A;  2WW4 A;  4M5H A;  2BUN A;  3J7A N;  1LXN A;  1KLM A;  5F8N A;  2P6S A;  2HGL A;  4MIW A;  3IGN A;  3EXC X;  1KSP A;  2QZ8 A;  2JFD A;  1TL7 B;  3DCA A;  2OUG A;  1FNM A;  3DOK B;  2IAJ A;  4M1K A;  1LQ9 A;  5BYR A;  2WON A;  5JVH Q;  2XEX A;  3OTE A;  3PW5 A;  2FHJ A;  4WTO B;  2GVD B;  2L41 A;  4C0O C;  2PFF B;  2X3D A;  2YKP A;  5AJ3 J;  2FJA B;  4B9T A;  4M5J A;  2HGM A;  2Y0S D;  2Z8Q A;  1S76 D;  4CH0 S;  2DHX A;  3R7N B;  3U1N A;  4WP3 A;  2EFN A;  4X2B A;  1IKX B;  2RT3 A;  2PI5 A;  1NME B;  4QIG A;  2BX6 A;  3TVK A;  4IG3 A;  2OEJ A;  1XN9 A;  4WBF A;  1CVJ A;  2GNK A;  3ONQ A;  5T41 A;  3T5K A;  2ZBQ A;  5J2M B;  2VDI A;  4DSL A;  4QYR A;  3F0N A;  4RW8 A;  2QLF B;  1NRK A;  3BR8 A;  2IBK A;  1KLM B;  4J9K A;  1LWF A;  4ZOS A;  2C2N A;  1CSJ A;  4A8X A;  5CH7 B;  5KFK A;  3J80 Y;  2FJX A;  3N5F A;  2J8A A;  4MKV A;  2Y8W A;  2D7S A;  1EAY C;  4JI2 J;  2OAU A;  2E66 A;  4IQX A;  2IAJ B;  4U8Y A;  2FVP A;  1QUP A;  3W1Y C;  5E3C A;  4M5I A;  5HJY A;  1WTF A;  3C16 A;  2XGQ A;  1FI4 A;  5DLF A;  4DZD A;  2I0X A;  1Z4U A;  2UUC J;  3RGI A;  1TL1 B;  4PG7 A;  1YVF A;  1ZH5 A;  5SZT A;  4P2S A;  3P3D A;  2RRA A;  1JXL A;  4CH1 A;  3NGD A;  5ITH A;  2ZKT A;  2OPP B;  4HVZ A;  5KG6 A;  3LP1 A;  2XLJ A;  3CME S;  2YKO A;  1Q5V A;  2B43 A;  2DO4 A;  4JI8 F;  1FDA A;  3WZ0 A;  4IG3 B;  1RTD A;  1DAR A;  4P52 A;  2MB0 B;  2PDA A;  2ZC3 A;  1YJ9 S;  3OVA A;  5H1S V;  3GJR B;  3M30 A;  2VA2 A;  4LRF A;  2ZVI A;  4NLU A;  4RW8 B;  2JX2 A;  1LWF B;  3I9Z A;  2A6M A;  3H8Y A;  1WC3 A;  3LGH A;  2QJ3 A;  4L3N A;  2WSE C;  2AGQ A;  2AGP A;  1S6U A;  5GAD I;  1HNZ F;  3CVK A;  4IOB A;  4EYI B;  4ZCK A;  1IBL J;  4LUB A;  1OY8 A;  2DGT A;  2RDD A;  3C16 B;  3JSM A;  4IQM A;  3QT7 A;  3UO0 A;  3PYE A;  1URR A;  2AV5 A;  4TLR A;  5SUH A;  1G7C B;  3CTR A;  1SQG A;  2YPZ A;  2Y3Y A;  2BJD A;  2ZH9 A;  3KG4 A;  1M0S A;  2XCP A;  2M70 A;  3DLE A;  4BLG A;  4V19 J;  3LP1 B;  1H3D A;  1PKU A;  3VF0 B;  5IV4 A;  4DUY F;  2FPH X;  3BB5 A;  4WP9 A;  3CCU S;  2HEK A;  4ICL A;  4MIA A;  2Z4P A;  1RTD B;  5DG9 A;  3H40 A;  4DV4 J;  5D6G A;  2J6U A;  3DDI A;  3POT B;  3BGO P;  3I5A A;  4UF4 A;  5KFW A;  1YG0 A;  2MGZ A;  3M30 B;  2XMA A;  4ETX A;  1KN6 A;  4KH0 B;  1NKC A;  5EWE A;  5GAD U;  2AGO A;  2E5L J;  1DQ9 A;  4J9N A;  1SJQ A;  3KDN A;  2B9W A;  2FC8 A;  2FD2 A;  5HAN A;  4F02 A;  4QIV A;  3JSM B;  1J5E F;  1DRZ A;  3KTQ A;  1CLF A;  1BGX T;  4J5O A;  1VQ5 S;  2FVS A;  1ZBT A;  2YNG A;  3GIR A;  2HK2 A;  2KG1 A;  3OV7 A;  1SC3 B;  4J9R A;  1FWP A;  3X1L B;  3NRB A;  5KFE A;  1GXT A;  4KY3 A;  4I69 A;  1ZPV A;  2DHA A;  4FYX B;  4C6A A;  4PWD A;  4ICL B;  1UJ4 A;  4UOF A;  4X4S A;  2HRY A;  4A8Y A;  3US5 A;  2IRX A;  1X4A A;  1XTZ A;  4CO3 A;  3M9M B;  3HP6 A;  3MD3 A;  2JHE A;  4X4V A;  1U8W A;  3LP0 A;  1RBA A;  1VQK S;  2IMO A;  1RAF B;  3AH6 A;  3EPG A;  3OTO F;  3LP2 A;  3HHE A;  5CZX A;  5I3Q A;  4H4O A;  3OL6 A;  1OPI A;  3JAM U;  3P49 B;  2BKO A;  5ETN A;  3G82 A;  2C2M B;  3V2U C;  3TEG A;  4FNI A;  1TUG B;  3CD7 A;  1FJG J;  2F4V F;  3O5T B;  2YNG B;  4QBU A;  2J0S D;  4PYD A;  2E1C A;  1NDP A;  1WC1 A;  3FZB A;  1X4G A;  2MKY A;  2JVO A;  4C2M A;  1XR5 A;  2GW8 A;  3JB9 k;  1MMD A;  2CQH A;  3PO5 A;  3CB4 A;  3M2U A;  4X4Q A;  3K0J A;  1UCN A;  4F3Q A;  4B3R J;  3FDS A;  1MW7 A;  1HBO A;  3TQE A;  4DL5 A;  2BAB A;  4PWD B;  4FF2 A;  2I1R A;  2ALY B;  3AXK A;  3VGU A;  2ATL A;  5G4D A;  2HHV A;  4Z7C A;  2AJ1 A;  3NWR A;  5F9N A;  3H7H B;  3D3C J;  1B7F A;  3LP0 B;  4HHH A;  3NP5 A;  5J2Q A;  4HTJ A;  4NLG A;  1S7I A;  3PW2 A;  4JI3 J;  3LP2 B;  2IM1 A;  5KG5 A;  1B3T A;  1NSP A;  3KG0 A;  3A1Y G;  4H4O B;  2ERR A;  4HT5 A;  3QJL A;  2MQP A;  5F0W A;  2XMU A;  3G82 B;  1R27 B;  3E2E A;  4EEY A;  4ZP8 A;  3FCV A;  3RBX A;  4YR0 A;  3IAM 9;  2QFI A;  4CLK A;  4CNZ A;  4OI1 A;  3T1Y F;  1AUD A;  5HVH A;  4HAC A;  1WC0 A;  3OTC A;  3CCS S;  3D28 A;  1R8P A;  3ADA C;  2Y8Y A;  2ZEJ A;  1RWP B;  1S0O A;  3BN4 A;  3M2U B;  1YLX A;  3PX0 A;  5KFZ A;  1HBO B;  1VQ6 S;  3V81 A;  1RWK B;  3L7P A;  3CD5 A;  4F0M A;  4A8K A;  2GA7 A;  2JL9 A;  3MI7 X;  2QFJ A;  4G1Q A;  3D1O A;  4GMK A;  1TKX A;  1VBX A;  3QSY B;  3M2R A;  2EPI A;  3HZG A;  2I8E A;  2FQQ B;  3O2I A;  2UUB J;  5J2Q B;  1N33 F;  1H2U X;  3GR0 A;  1QSL A;  3KLE A;  1ICE B;  3KXD A;  1K47 A;  4R5P A;  2HQC A;  4GVB B;  2LQJ A;  5HQL A;  4ZP9 A;  3TJ9 A;  3GIL A;  2B7B B;  3EE3 A;  1SJF A;  4RUH A;  2NXE A;  3PXG a;  5A76 A;  1IWA A;  4FYV B;  1HQE A;  5IV3 A;  1KLN A;  4M5M A;  2ABY A;  3MUT P;  4HAC B;  4OJG A;  2LA6 A;  1MRO A;  3OJU A;  1PCA A;  4DV0 F;  1JWW A;  5BR8 J;  2DNN A;  1B99 A;  5EX3 A;  3D2W A;  3V81 B;  1BQM B;  2DIS A;  1L3T A;  2B4V A;  1SH2 A;  3MR5 A;  4OX9 J;  4ALZ A;  3HSD A;  4G1Q B;  5KG1 A;  3LO3 A;  4KV8 A;  2MLZ A;  1TKX B;  5HMX A;  3M2R B;  3NOG A;  1FRX A;  2H48 B;  2V67 A;  4DJB A;  3KDO A;  4M5D A;  1N54 B;  2EG2 A;  1S57 A;  4W90 B;  4P2X A;  3RRG A;  4Y65 A;  1HAR A;  4LF2 A;  1F60 B;  1HD0 A;  4PPD A;  2MMY A;  3D1H A;  4LF5 J;  3FK4 A;  2V4Q A;  4OI4 A;  3DN9 A;  4LFA J;  3CJ0 A;  3BSO A;  4J9M A;  1UVM A;  4M8L A;  2HFZ A;  3WX8 A;  1HQE B;  3TZX A;  2DGQ A;  2JC1 A;  2KYX A;  2J9C A;  2UUA F;  1HNX F;  2CJB A;  4F36 A;  3FMW A;  4PAB A;  4TLQ A;  2X1B A;  4QWC A;  4CP5 A;  1MRO B;  4PQA A;  1U1R A;  3ILO A;  4ZVE A;  1QE1 A;  3NBP B;  4CIO A;  4F2S A;  4MKY A;  4NPO A;  1NZA A;  2V2Z A;  1VRU B;  4GKJ J;  4AE5 A;  4F4X A;  4C97 A;  1URN A;  1LWE B;  3ITH A;  4XO0 A;  4GC6 A;  4U7U K;  2Z2Z A;  1TMJ A;  1R31 A;  1P9Q C;  1WG5 A;  4KV8 B;  3MF5 A;  2XMM A;  2M9K A;  4ZN1 A;  2VIH A;  1UPP A;  5HMZ A;  3PCO B;  2F9J A;  2ZC4 A;  1ZTT A;  2F65 A;  2OTL S;  4RZR A;  1FER A;  1J5O A;  4OL8 A;  1K1Q A;  1IKV B;  4DR7 J;  5KOW A;  2UVU A;  1KVK A;  2ZFH A;  4KIA A;  2XMJ A;  2MXY A;  3SCI E;  2QLJ B;  4ZLN A;  2JOQ A;  3G6E S;  4AXI A;  1UWB B;  2ROG A;  2PMH A;  5J2N A;  2W01 A;  3CE8 A;  1QE1 B;  3BO3 A;  3AB2 B;  1CJV A;  3ZXW A;  1GH8 A;  3Q23 A;  4QPX A;  5B08 A;  3S8S A;  3FUY A;  2KFZ A;  2GS8 A;  3ITH B;  1RKI A;  1CC7 A;  4DPT A;  2F63 A;  3TWZ A;  1ZS6 A;  4ES2 A;  3U27 A;  2C2D A;  4OI6 A;  2W4C A;  1RJJ A;  4IDK A;  2J6S A;  1XR6 A;  4EU0 A;  3Q22 A;  2JDJ A;  5A0Y B;  2LQ5 A;  2W2Q P;  1S6Q A;  3NXZ A;  4PG4 A;  4KKO A;  2CJA A;  4N56 A;  4FF3 A;  4K50 A;  2YNI A;  2FHO B;  3BBC A;  1NU4 A;  1J5O B;  2I9S A;  2WVD A;  1FRM A;  3D1Q A;  4I4B A;  4X84 A;  4JV5 J;  3EXY A;  1NBE B;  5IM0 A;  2UXD J;  3PZP A;  2IA0 A;  1RU2 A;  1YJ7 A;  4IOC Q;  4JI0 F;  3K5L A;  3GMG A;  4EBD A;  1FDD A;  4NRT A;  5J2N B;  3WBZ A;  1T05 A;  1CJV B;  2X1G A;  3UCU P;  2V6A A;  5E41 A;  4A47 A;  3TVY A;  4DV3 J;  2ZUA A;  4RW7 A;  2GQC A;  3NGS A;  4L76 A;  2DHG A;  4I0W A;  2CAD A;  3UW1 A;  4RKU C;  4WCE Q;  1YRX A;  4EGL A;  3K5N A;  3AD8 C;  1TK8 A;  4IDK B;  2MKH A;  3QO9 A;  4A4J A;  1BUX A;  4N8N A;  4DV6 J;  3SCJ E;  2C3M A;  1HQ2 A;  2XYG B;  3FKB A;  4X4R A;  1RWN B;  1S6Q B;  3GV5 B;  3ZNU A;  2YQ1 A;  3PFE A;  4ES1 A;  4O3N A;  4KKO B;  5CXT A;  4I6Y A;  3DNC A;  1HWL A;  5D78 A;  2RKI A;  4NLO A;  1FNO A;  4JI4 J;  3DRR A;  1YI2 S;  1NDC A;  2B8Q A;  2QA1 A;  1PAE X;  5F8I A;  1RWM B;  5IM0 B;  4RU2 A;  2UUW A;  2ZM6 F;  1P6T A;  3JS9 A;  1RU1 A;  1OIA A;  2WK4 A;  4MMO A;  4Q2M A;  5IT4 A;  5K8P A;  3MR2 A;  1FTC A;  2J7U A;  2WBM A;  3W8G A;  4DMZ A;  4X66 J;  1Y5I B;  3K57 A;  3EZ5 A;  3M9N B;  1T05 B;  1SQE A;  2EBG A;  5KFA A;  3PJ9 A;  4RW7 B;  2KJW A;  2BOP A;  4CLP A;  3CCR S;  4U96 A;  5LMU F;  4X64 J;  1HNV B;  1DTT A;  3DDN A;  2BVZ A;  4NLW A;  3QO9 B;  4PUO A;  2DCL A;  2DHS A;  2FB0 A;  2JEG A;  3RR7 A;  4WE1 A;  4WF9 Q;  2MYF A;  3M32 A;  4A8O A;  4YB5 A;  4F25 A;  4LF9 F;  3SXL A;  1SL1 A;  4K4X A;  1I94 F;  2QRR A;  2KHC A;  2RKI B;  2DGO A;  3DRR B;  5CCL A;  4JI7 J;  2M88 A;  3OW2 R;  5KFS A;  2XI2 A;  5KFF A;  1GTE A;  3I9V 9;  1XNQ F;  8ATC B;  3CD6 S;  1M1G A;  3OR2 A;  3N01 A;  2PE8 A;  3BF4 A;  1RHU B;  2DNQ A;  2V63 A;  2F7V A;  3SCL E;  4ED5 A;  1E6V A;  1FES A;  2K06 A;  2XSF A;  2ZHO A;  4LF4 J;  1KP6 A;  1BWV A;  2IY5 B;  5EWG A;  1K9M T;  3A3N B;  4Z37 A;  4JI1 F;  4NZ7 A;  3BGR A;  2F8H A;  4TQR A;  4N7T A;  3Q8V A;  1DTT B;  3HK2 A;  1XMQ F;  1RWU A;  2EWH A;  3CPW R;  1HA1 A;  4CM2 A;  3MPW A;  4PUO B;  2IBO A;  1IJF B;  4WE1 B;  1RAG B;  2QE5 A;  3MDF A;  4ZA1 A;  3M32 B;  4OX7 A;  2XS7 A;  4CYU A;  3GON A;  1EAR A;  2FVQ A;  3IM8 A;  2R7X A;  2B5J B;  4DS5 A;  3UPF A;  3B8H A;  1PJ7 A;  2J7K A;  4DL7 A;  4KHP F;  3DGP A;  3ILI A;  4KJI A;  4LSL A;  2MZR A;  1NPP A;  1DTQ A;  1BQN A;  1VLO A;  3JYT A;  1XWL A;  2W4P A;  3UNG C;  2CNO B;  2DXD A;  2QN6 B;  2UUT A;  4RW4 A;  3GTY X;  2EVZ A;  1MMN A;  4WKY A;  4ECU A;  1TZ0 A;  4DLG A;  2KJV A;  3DC2 A;  4B9U A;  2ZDP A;  4A8F A;  3L7O A;  4P7T A;  2DRB A;  2CQB A;  4GO5 X;  5E3R A;  5C25 A;  3BGR B;  2KN4 A;  1FKO A;  2NRE A;  1IBM J;  3GLJ A;  3VVT A;  3E3X A;  3TA0 A;  2ZH5 A;  3K8W A;  5LSL A;  2HBY B;  4AL6 A;  2QMW A;  3BJY A;  2F5G A;  1CJK B;  2BRL A;  3R5J B;  1N32 F;  2ZBC A;  3JSY A;  1P27 B;  1KVI A;  3LOU A;  3MFH A;  2MLY A;  2HHX A;  3C19 A;  4ILR A;  3TEH B;  4LSL B;  3MOZ A;  3O8W A;  1DTQ B;  1BQN B;  4LJM A;  5EN1 A;  2ILY A;  2NXU A;  1KD1 T;  4X62 F;  2EFG A;  2I38 A;  4RW4 B;  5F8G A;  4OX8 A;  4UUW A;  1GFW B;  2EKN A;  3N9U C;  2UXB F;  3MPD A;  3D67 A;  5KFO A;  3V6D A;  1T94 A;  3AJ2 A;  5E3A A;  3FMB A;  2M8H A;  2ZBI A;  5HMW A;  2XI3 A;  2E1M C;  5K20 B;  5KG4 A;  2DEI A;  1FKO B;  2HNZ A;  1YJN S;  3DRP A;  4ZKA A;  4FS2 A;  3QT6 A;  4UST A;  2MDA A;  1R6Y A;  2K2P A;  3EMT A;  4DHV A;  2V0N A;  5HMY A;  3Q8P B;  3RBE A;  3DM2 B;  3IN5 A;  2D41 A;  2VFV A;  4C8L A;  2W8K A;  4KC5 A;  2MZJ A;  1NXI A;  2QYG A;  3ZTO A;  1RHR B;  1Y00 A;  3FBC A;  1C1B A;  4IR1 A;  2HFU A;  3MZI A;  4OYM A;  3U1M A;  4P7V A;  2CG8 A;  4TY8 B;  1Q16 B;  2R7Q A;  2UP1 A;  6FD1 A;  1VIS A;  1FDN A;  2QMX A;  2CVI A;  2CJQ A;  3TUI C;  2CYY A;  5L9X A;  3IBF B;  3V6D B;  2PMZ D;  4XDD A;  1H98 A;  1RAA B;  5IT9 Y;  4J9Q A;  4ECV A;  5GVQ A;  2D3Z A;  4URG A;  1JNR B;  5F3Z A;  4NCG A;  4FNH A;  1Y4Z B;  2QA2 A;  1HHT P;  1VQ4 S;  4WII A;  3DRP B;  1HNI A;  2G1H A;  1N56 A;  4YEA A;  3VV2 B;  2XMK A;  4A8W A;  1S79 A;  1U8S A;  2MKC A;  3UVJ A;  2XS2 A;  3EJM A;  1RT2 A;  8RUC A;  4NLY A;  3H0P A;  3HHN B;  4WK3 A;  3NLC A;  5KFN A;  1RAO A;  5D3G A;  1XMO F;  1AYE A;  4DV2 F;  1X31 C;  4MKB A;  5F8H A;  1IBK J;  4H4K C;  4WXO A;  1S1U A;  4BC9 A;  3D6H B;  1NJW A;  1T9X A;  3TJ8 A;  2AJF E;  2QV6 A;  4RW9 A;  5DGA A;  4DR4 J;  3WDO A;  2OKQ A;  3VZI A;  2D3U A;  1HNW J;  1S5Z A;  4BWM A;  1O5J A;  3BQ0 A;  2ZJR Q;  4V1A k;  1RAB B;  1X7V A;  4R25 A;  4UZB A;  3Q8S B;  5GAE U;  4JV0 A;  2HHH F;  4DV5 J;  5F8J A;  4EWT A;  1X4B A;  1MG7 A;  5L1K A;  3I0R B;  4O3S A;  3QIP A;  4W92 B;  5ADZ A;  3ICL A;  1VQM S;  5GME A;  2MQO A;  2Q79 A;  1V5V A;  2BJE A;  1P8G A;  2J0Q D;  5E5N A;  2JZ5 A;  3VWS A;  4M5L A;  5DM7 Q;  1RT2 B;  2CQ4 A;  4NLV A;  1CQM A;  2VUG A;  3CJ5 A;  4ZIV A;  2Y1J A;  4B3T F;  3G87 A;  4DPU A;  2DRD A;  4OJH A;  5B0C A;  1X9S A;  2KM8 B;  1SBR A;  5GMK a;  1UAW A;  5F8L A;  2ZNZ A;  3MEC A;  1S1U B;  1MU2 A;  2BAC A;  2GV1 A;  1M90 T;  1ULR A;  2G0C A;  2YXL A;  4RW9 B;  4RPF A;  2VG5 B;  4ETZ A;  1WNE A;  1S1T A;  3SQG A;  5LM7 E;  4TYA A;  2OPS A;  3M05 A;  2CKW A;  2RS2 A;  3EGW B;  4M63 A;  4CLW A;  4F4Y A;  3QNW B;  3BSC A;  1D9F A;  3M6X A;  2J9D E;  3FBE A;  4ZVQ B;  3QIP B;  3GWC A;  2EG1 A;  5HP1 B;  4F2R A;  2MLX A;  2O67 A;  4ELT A;  1W2B R;  2FGC A;  3QAU A;  3GJT B;  2GML A;  1JNZ B;  2NR0 A;  4LSN A;  2VQF J;  2Y1R I;  2B4P A;  1O6X A;  2PSZ A;  2XY6 A;  2QL9 B;  3D0G E;  4RR5 A;  4QYZ K;  4RWX A;  2M2B A;  2CQI A;  4IRC A;  2MHE A;  3MEC B;  4M5K A;  4WZQ A;  3MUM P;  1MU2 B;  3CT9 A;  1GMU A;  3LA0 A;  2KH9 A;  4XK8 C;  2YWG A;  3GCW P;  1YTY A;  3BH7 B;  1XMB A;  5IWA F;  2RRN A;  5EUH A;  1S1T B;  3SQG B;  2KVI A;  1IJE B;  5E2Q A;  2OPS B;  2YNH A;  3GU0 A;  1HI8 A;  2ZBR A;  3BEG B;  1NKE A;  2PII A;  2HNY A;  1HMV B;  2NSB A;  3EDR B;  2BDP A;  3JSB A;  4ZPT R;  4JV1 A;  1R0B G;  1N36 F;  3AXM A;  2A0F B;  1X0F A;  1SKS A;  4LRE A;  1KS2 A;  1E6Y B;  4HTI A;  3NNC A;  4I2P A;  2NYI A;  2JH3 A;  1IKY A;  4I64 A;  1HW8 A;  1HWU A;  2CG4 A;  2CDR B;  4LSN B;  2CQP A;  1NPK A;  2CQ1 A;  2P8I A;  3BBB A;  2IA6 A;  1EKS A;  5KT6 A;  3D66 A;  1JLF A;  1VRT B;  2OH2 A;  4CNY A;  3LAK A;  3HD1 A;  1KQK A;  4TQS A;  2UU9 J;  1NZ8 A;  4EI2 A;  1U25 A;  5RUB A;  5HVG A;  4WIQ A;  4TN2 A;  2HQ3 A;  2CZV C;  1T9V A;  1RWX B;  3K59 A;  2IJR A;  4ENO A;  2FLN A;  4DPY A;  2HNY B;  5HLF A;  2DR8 A;  3W2V A;  2IDE A;  1SQF A;  3IMQ J;  3M7V A;  1Q8B A;  1NSQ A;  4ZJL A;  3EIC A;  2YQ0 A;  1Q79 A;  1YQH A;  3EPI A;  1WKJ A;  3AJD A;  2QT7 A;  4I2P B;  2JJ4 D;  5IT0 A;  3CIM A;  3QPI A;  1WJ9 A;  2MQQ A;  2VFU A;  2HHW A;  3ILJ A;  4H54 A;  4LFB J;  1UEU A;  2CQ2 A;  2V34 A;  4FKX A;  5THW A;  1UA1 A;  3R6G B;  4GVL A;  4O0I A;  1JLF B;  3CC2 S;  1UJ6 A;  1R0A A;  1WI6 A;  4F7V A;  3PRV A;  4RW6 A;  4F26 A;  5B0E A;  4FF4 A;  2KKH A;  4F4Z A;  2NZC A;  3H4B A;  2IRU A;  1RT7 A;  2K8G A;  4NA1 A;  4KHR A;  1DFD A;  2OSR A;  2IMW P;  3OPK A;  4KO0 A;  3GIM A;  3HVW A;  4B17 A;  4RU9 A;  3R5A A;  4U7C A;  4K0K J;  3AQO A;  1F9E B;  4ECZ A;  4OYW A;  5HLF B;  3W2V B;  3K5O A;  1RLC L;  4MK8 A;  2AKW B;  5ETM A;  1BD6 A;  4B3S F;  4IYQ A;  3CNQ P;  2GAH C;  1KEK A;  4YR3 A;  4NLP A;  4KB7 A;  5DQI A;  1RT3 A;  4I2Q A;  4DR1 F;  4QR1 A;  1WHW A;  3J81 Y;  4DQI A;  2PA3 A;  1YZ7 A;  3B4D A;  3BQ2 A;  1NK7 A;  2O5D A;  1YDL A;  2QC3 A;  2JLG A;  1GT8 A;  1RT4 A;  4Y00 A;  1R0A B;  1LK7 A;  2VZ9 A;  5I3P A;  1ACM B;  4OZ2 A;  4F4A A;  1Y7P A;  4G1I A;  2IFX A;  4RW6 B;  2Y9H A;  3TAN A;  2A6O A;  4Y2A A;  3NG8 A;  2M8D B;  3CJR A;  2ILZ A;  3ISN C;  3TQ1 A;  1RT7 B;  1H74 A;  3E8O A;  4JI6 F;  4KO0 B;  3M6V A;  4P71 A;  1PBU A;  1J27 A;  3PR5 B;  5CA5 A;  2P9C A;  4X65 J;  3UCG A;  2R8K A;  1GMW D;  1NO8 A;  2RS8 A;  4N41 A;  1V6H A;  3PY8 A;  1Y9O A;  1VQS A;  3QYY A;  2WOM A;  2H65 B;  3AT1 B;  1V3Z A;  3CJK B;  1LWC A;  1XNR F;  2ZH1 A;  3MAQ A;  3DDK A;  1TP7 A;  4AQY J;  2DB1 A;  2DXE A;  4I2Q B;  4FPI A;  1L5U A;  2ZD1 A;  2BM1 A;  1F2H A;  1SL0 A;  4WTY A;  4LMZ A;  4NL5 A;  2K1R B;  2A18 A;  2AYG A;  4JB8 B;  1RT4 B;  1N34 J;  3WIV A;  4NWB A;  2Q43 A;  3DOL A;  1VQP S;  1Q8L A;  2KG0 A;  1B70 B;  2G2Y A;  4CLS A;  3T9Z A;  4DR6 F;  3Q24 A;  3VAM A;  1FNX H;  1ZOT A;  4DFM A;  4C7Q A;  1Y3K A;  1QTN B;  2ZE2 A;  4Y0F A;  1UP1 A;  3QZ7 A;  1RLD A;  2RDI A;  4O4G A;  2IM0 A;  1M5H A;  1K0T A;  1TMM A;  3RBD A;  5KFQ A;  4CDI A;  3N79 A;  4C11 A;  4N76 A;  1RHQ B;  2Q1L A;  2WSF C;  2P5V A;  1S9F A;  5JJB A;  4DUZ F;  1SUQ A;  1L3S A;  4MTP A;  1GMW A;  3QWP A;  1QY7 A;  4YHH F;  3SSS A;  4PRF A;  1M5S A;  2WOM B;  3P5B P;  3QAE A;  2C2R A;  1LWC B;  4DDF A;  3W9J A;  4IFY A;  2OTJ S;  1RXO B;  3B6B A;  2VD3 A;  3T3F A;  4X4N A;  1ZAW A;  4ZVR B;  2R7V A;  2ZD1 B;  4B9L A;  4UUX A;  3IG1 A;  2DPJ A;  2GMJ A;  3H5Y A;  1F9F A;  1RA7 A;  4O3P A;  2QYC A;  1U1N A;  4OI0 A;  4DL3 A;  3W5X A;  3D3B J;  1DAX A;  1Q8I A;  3DOL B;  3DXS X;  1SJ3 P;  4LQ3 A;  1G4C A;  2LYV A;  3HKW A;  1RT5 A;  2A10 A;  2IPO B;  3GYN A;  5HJX A;  4USM A;  2QO3 A;  1NUE A;  3VAJ A;  3HT0 A;  2ZE2 B;  5GAH I;  1N48 A;  5H9E J;  4O4G B;  4RNH A;  4DFJ A;  1BQX A;  1S1W A;  1WF2 A;  4LBI A;  4U7U D;  1FJE B;  4FZV A;  5HN0 A;  1N4L A;  2EEY A;  2Z30 B;  4J37 A;  3OHA A;  4USV A;  1SUQ B;  4OHZ A;  3VAI A;  4FN5 A;  2AD9 A;  4NAS A;  1RAC B;  5D0E A;  3KLF A;  1N88 A;  4NXM F;  3VHQ A;  1MN9 A;  1JJ4 A;  2E9R X;  4IFY B;  5G0R A;  3RAX A;  2DNO A;  4KGK A;  3J7A 1;  1KOO A;  1C2P A;  4DV1 J;  3C6T A;  3IG1 B;  1DLO A;  2GMH A;  3M8Z A;  2EXU A;  3CCZ A;  2KT5 A;  2OP5 A;  4DCJ B;  3F44 A;  1IM6 A;  1RT5 B;  1PO6 A;  2VOO A;  4YY3 F;  4LFC J;  3MFI A;  2YKM A;  1JLC A;  4CLL A;  4M5N A;  3CCJ S;  1UVN A;  2V8D A;  1U1Q A;  1WKL A;  3FEY B;  1S1W B;  1T9Y A;  4DFP A;  4WKR A;  1JK9 B;  3SSQ A;  4ZLP A;  3SMZ A;  1ZAV A;  4OZ0 A;  5KG7 A;  4J9P A;  1KTV A;  1L3K A;  4CT8 A;  2GAG C;  5T7L A;  3HHL A;  3TR5 A;  4OYP A;  2H54 B;  1VJW A;  4ANE A;  2WSC C;  1IQZ A;  1KDN A;  1HWJ A;  4IO9 Q;  3KLF B;  3A8J A;  2DNK A;  4H4M A;  2NXJ A;  1RHJ B;  5G0R B;  3K2Y A;  1IVZ A;  2W7O A;  1N5Q A;  4NYZ A;  3RRH A;  5EWF A;  1BC6 A;  2FHK A;  3CDW A;  2N4D A;  1SKR A;  3HCX A;  5C24 A;  3KHG A;  1DLO B;  3ZTQ A;  4PXD A;  2CA9 A;  3IS9 A;  3G2X A;  2YWW A;  1U1P A;  4ZVH A;  2LEC A;  3UE2 A;  1WOS A;  4ZS6 A;  3UFC X;  2RAQ A;  3EZO A;  1I5O B;  1RP5 A;  1Y10 A;  3DLJ A;  2YTC A;  2CNK B;  4KPC A;  3CCQ S;  1VC6 A;  4ED1 A;  8AT1 B;  1SJ4 P;  3MPU B;  2J7W A;  3BGU A;  2KI2 A;  2EC0 A;  4LSZ B;  5JMN A;  3QWU A;  1JX4 A;  4HKQ A;  4P2M A;  3QLH A;  3SFG A;  3Q8Q B;  2UXC F;  4MIB A;  1RSC A;  2XWY A;  5DGB A;  1SJR A;  5T7L B;  3HHL B;  4LIW A;  1HQU B;  3MR6 A;  3ULH A;  4F8R A;  3QID A;  2LEP A;  1QTM A;  2HAF A;  4EBE A;  2CNN B;  1FHT A;  1NK6 A;  5C24 B;  1YWX A;  2WAQ D;  3PX6 A;  2AYE A;  1AB8 A;  4G6V B;  2I6W A;  2X3G A;  3I87 A;  3M4X A;  4LF6 F;  1KON A;  1WOO A;  4ED7 A;  4AXJ A;  2GQ2 A;  5KFT A;  2AWZ A;  1WWH A;  2CQC A;  1TKT A;  1ZM2 A;  2OHD A;  1HR0 F;  1S59 A;  4O23 A;  3UD4 P;  1MWZ A;  2CIM A;  1NND A;  4NA3 A;  4BDP A;  1FJ7 A;  4X4O A;  1YKW A;  5M2R A;  2LEA A;  3K89 A;  2R3V A;  5K8O A;  3IWL A;  1FVS A;  3QLH B;  2DR6 A;  3HJF A;  2K7J A;  5I42 B;  1U7L A;  3JTN A;  3BDE A;  2IM2 A;  2DYA A;  1BXN A;  5FLX Y;  4ATN A;  4PPZ A;  5BXI A;  3MED A;  1QVF R;  4CM0 A;  2H5J B;  5D4O A;  3UR0 A;  2X7I A;  1D3W A;  2R8G A;  4DL2 A;  3M9O B;  4K4T A;  1WEY A;  4ERD A;  3SI8 A;  1T9W A;  1F0X A;  2HVE A;  1RAJ A;  3LUY A;  3QGG A;  3UDC A;  2H51 B;  2DHH A;  3CCL S;  2HLT A;  1J2V A;  3CUN A;  3W5Y A;  1Q78 A;  1UTA A;  3RUB L;  4R0J A;  1RAE B;  2CPF A;  4FVM A;  3KUE A;  4LR7 A;  1QSY A;  1Q82 T;  3W8P A;  2RVJ A;  3D68 A;  4B08 A;  1RTJ A;  1OSC A;  3ZZR A;  2VIC A;  2K7K A;  1TV6 A;  4FBU A;  1WTB A;  1U0H A;  5IXU A;  1SI9 A;  2FYX A;  2HSE B;  4IH5 A;  4Q8E A;  2KRR A;  5BYS A;  1UW4 A;  2GHV C;  2YX4 A;  2QA4 S;  4YN3 B;  3I82 A;  5EDW A;  3EGZ A;  5LJ5 Y;  3A13 A;  5DDQ C;  3R97 A;  4YB1 P;  3TO8 A;  5DQG A;  1DQA A;  2PFD A;  3MED B;  5KFU A;  2U1A A;  2G9O A;  2HQD A;  2HLU A;  4DR2 F;  2FZC B;  3HFZ B;  2FJW A;  2GGP A;  4ECY A;  2CJ9 A;  2D3O 1;  1YHQ S;  2CQD A;  4WZM A;  1D1U A;  5KT5 A;  5KOX A;  3WC2 A;  3G8T A;  2C2K B;  3KMS A;  2R7S A;  2HVZ A;  4NLT A;  4IRD A;  2JLF A;  1ROF A;  3CED A;  3OLA A;  5BJR A;  3G96 A;  2KT3 A;  2VA3 A;  2FVC A;  4J9L A;  1CUL A;  1D8Z A;  3G8Q A;  4F4K A;  3M6U A;  1T7P A;  1TL4 A;  4LVO P;  1VQY A;  3NY0 A;  3OLB A;  3UN3 A;  1I1G A;  5AXM A;  4NI2 A;  4RX6 A;  4F3M A;  1RTJ B;  3ZC4 A;  2MZQ A;  1OQ6 A;  1U0S A;  4CI0 B;  1UA0 A;  3NNH A;  1U0H B;  2PO4 A;  3J80 U;  4RUC A;  4P9S A;  3J7Z 5;  3Q8U A;  3AOC A;  3KLG A;  4ED8 A;  4QR2 A;  3GII A;  3THT A;  4ZPD A;  4DCO B;  1VIX A;  4ZJO A;  4ZVP B;  5LL6 d;  3TX0 A;  1T3N A;  5M2U A;  1DHM A;  2LXF A;  4XAK A;  3Q83 A;  1KRP A;  1RWW B;  2WTF A;  3GFZ A;  2GGP B;  3HF5 A;  3M8S A;  1GAO A;  1NK0 A;  4OI3 A;  3KHR A;  3VGT A;  2DD8 S;  3A8E A;  3C6U A;  4J91 A;  2BEF A;  3NGR A;  1S7H A;  1QD1 A;  1TVR B;  4NX9 A;  2UZA A;  1X4D A;  3PJX A;  3HZE A;  3OTD A;  1CUL B;  2BW2 A;  3MAA A;  1VR6 A;  1SL2 A;  4K4U A;  1FD2 A;  2GO8 A;  3NNA A;  3I5B A;  2OD6 A;  3VQT A;  4Q43 A;  3GZ7 A;  4NI2 B;  3BZQ A;  4LVN P;  1F3F A;  3RU0 A;  4YS2 A;  1N6Q B;  4KGV B;  3BKF A;  4KT0 C;  3T1H J;  3KLG B;  1EQM A;  3R5B A;  2RUS A;  4O3R A;  2KFN A;  3GIJ A;  2VQE J;  5DZ6 A;  2HS0 A;  1GQE A;  3CUL A;  4JI5 J;  3EZU A;  3OXF A;  3Q8R B;  4DPX A;  1ZM4 A;  4RNM A;  3Q2S C;  2J5A A;  3FSX A;  2AEM A;  2B4U A;  2G13 A;  1S49 A;  1I6J A;  3C46 A;  3RB6 A;  3KLV A;  3D7S B;  2WON B;  2VFT A;  4NYO A;  1U48 A;  4KHM A;  3C6U B;  3HT3 A;  2YWK A;  1S10 A;  2O01 C;  3ENQ A;  2MSS A;  2G0I A;  1Q81 T;  3SCK E;  3MAA B;  5KFL A;  2R7T A;  3EWG A;  1RUS A;  2RQK A;  4ZPW R;  4ZCL A;  1FE4 A;  2RD5 C;  2QLW A;  3O3L A;  1BY9 A;  4HL9 A;  4LRA A;  4Y2M A;  4Y34 A;  4GKK J;  3R9L A;  4Z7Y A;  2KXH A;  1VQ9 S;  3ZZU A;  3GPA A;  3CDA A;  2OD4 A;  2DNG A;  4USW A;  3GG0 A;  4MT1 A;  4YDD B;  1FX2 A;  1ZYQ A;  3FSY A;  2KM8 C;  4KGX B;  5ETL A;  3H5U A;  1JXV A;  5ETV A;  1H2T Z;  3OVS A;  1RWV B;  4FF1 A;  1F5C A;  4DL6 A;  5CAB A;  2DH7 A;  2XG8 A;  4J7C A;  1L3V A;  3KJV A;  2CWX A;  4JOU A;  4NCB A;  4C0B A;  4GO7 X;  3CW2 C;  2B51 A;  5HL7 Q;  2R2R A;  1WSR A;  2OML A;  4BCA A;  4DCP B;  3VGV A;  2V8V A;  2I5J A;  4AL5 A;  4K5R A;  3CIZ A;  3Q86 A;  1SKU B;  2FJV A;  1IR1 A;  5D4N A;  4KSE B;  3TZZ A;  5AXN A;  4Y2I A;  1WHX A;  3TZY A;  4I68 A;  5L9N A;  1HWI A;  3MM6 A;  4CO4 A;  3PW7 A;  2EW9 A;  2FY1 A;  4K4Z A;  1F1B B;  3T19 A;  4FDF A;  1FXR A;  2YNF A;  2FTR A;  4GRS A;  2OEL A;  4ZVS B;  3U1L A;  2CPE A;  3DLH A;  5LMN J;  4UY8 5;  4DV7 J;  3HSG A;  1N0U A;  2PMW A;  3THP A;  1FF2 A;  4DSE A;  2V8P A;  5F8M A;  5E33 A;  5DG8 A;  1N5Y A;  4EMD A;  2JNJ A;  4WXW A;  3KJV B;  4LF8 J;  1X4F A;  4OMF G;  2IYI A;  5A6W A;  4P2F A;  3S01 A;  3W7B A;  2I5J B;  3I6P A;  3TUZ C;  4LF1 A;  4ILL A;  2JSX A;  2ZZM A;  4ZJQ A;  3A4T A;  2R8H A;  3T41 A;  2FDN A;  4OYZ A;  3I56 S;  3DLE B;  4OHX A;  2A2D A;  2FC9 A;  1QDU B;  4Q45 A;  2NUU G;  1R8H A;  5LXR A;  3MM6 B;  4EZ9 A;  4A8M P;  1RGV A;  4LF7 F;  3BS9 A;  4RBV A;  3GSD A;  3I4H X;  1R6V A;  2ZJQ Q;  2W9C A;  2YNF B;  3OL9 A;  1YZ6 A;  2P6T A;  1AT1 B;  1GXU A;  2MGZ B;  4X4U A;  4NLX A;  2CWK A;  1WHY A;  3HFK A;  3AAW B;  3TUP A;  4QR0 A;  2KYZ A;  2DR7 A;  1LFP A;  1S12 A;  4RNF A;  1LEO A;  5C5J A;  3GP9 A;  2QSW A;  4NXN J;  2WVF A;  1DJ0 A;  1N5Y B;  2XUL A;  3DRX A;  3OJS A;  3KKF A;  5DZ7 A;  3FCH A;  3UR3 C;  1QAJ A;  2HWH A;  1R0C B;  4KAI A;  3RG6 A;  5KTQ A;  1KC8 T;  3UN5 A;  2H5I B;  2BKN A;  4U95 A;  1FFS B;  2GO9 A;  4MK7 A;  1I51 B;  1TL5 A;  4DR3 J;  1KR4 A;  2LDI A;  3AY0 A;  4XIU A;  1YJU A;  2DEJ A;  1C0T A;  3UWT A;  5M2P A;  4JYA J;  1RZM A;  4EK2 A;  1UET A;  2B9E A;  2F40 A;  2RQM A;  5C2C A;  5I3U A;  4O3O A;  4U6P A;  4B3M J;  1F6T A;  4WFN Q;  4HT7 A;  2W9C B;  3PEJ A;  4C9D A;  5B0G A;  4YUD A;  4ED4 A;  2NXC A;  1LOU A;  1U2F A;  4C3M A;  4B9S A;  3DYA A;  3LPE A;  2WVB A;  5AE3 A;  4ZVO B;  3MD1 A;  4U8V A;  1IKW A;  2OFG X;  4ZHR A;  1W25 A;  2V68 A;  2C3O A;  4DPO A;  5AJ3 F;  1NPR A;  4DQP A;  1X5O A;  4K4S A;  3ENW A;  1LFW A;  3MCM A;  2GQQ A;  2M0G B;  3N4W A;  3DFE A;  5D77 A;  2BJ8 A;  4HEA 9;  4KRW A;  4YR2 A;  1U02 A;  5MAO A;  1VQ7 S;  5F41 A;  2M52 A;  1K0V A;  4FBT A;  4E2F B;  4DR5 J;  1C0T B;  2NYH A;  5ETR A;  2KZM A;  2LKZ A;  4RUB A;  5I3U B;  2AF6 A;  4F0H A;  4IO1 A;  4FKY A;  1ELO A;  3OUY A;  2DRA A;  3AOD A;  2X1F A;  4WP8 A;  4JI2 F;  1FX4 A;  4RO0 A;  1F5B A;  1B0P A;  1ZM3 A;  3HHD A;  4B02 A;  5EHH A;  5H9E K;  1IKW B;  1DQ8 A;  3CSK A;  4RJV A;  2ASL A;  2IM3 A;  2XYH B;  3PV8 A;  4BHQ A;  1MML A;  4JUZ A;  2UUC F;  5LXY A;  4R0E A;  2EKY A;  4DPW A;  3IP0 A;  2K3K A;  1NJI T;  2KO1 A;  2OEM A;  3Q89 A;  3W60 A;  3TAQ A;  4C8O A;  4UOH A;  5K5M A;  4PEO A;  4P75 A;  2Z57 B;  4DX5 A;  4F0K A;  2LFV A;  1KNZ A;  3L95 X;  1CBK A;  1H6K X;  4RBU A;  3MEK A;  4UOC A;  1U2R A;  2L9D A;  3I32 A;  2B9X A;  4CO0 A;  4E8U A;  1UFL A;  3MHY A;  2DNM A;  4PCQ A;  1U24 A;  4TVA B;  1Q95 G;  4URS A;  1IBL F;  3KLE B;  1FD8 A;  1B0V A;  4R5P B;  2BJ3 A;  4C48 A;  1R3N A;  5K9F A;  3QGP A;  1NHV A;  1C4C A;  4RUA A;  2E1P A;  2AP6 A;  1U1K A;  1RT1 A;  1LWX A;  2D74 B;  2QGF B;  3OQ2 A;  4PQU A;  3ETO A;  2O1P A;  5KFY A;  3BKU A;  1K73 T;  2F4F A;  2PGC A;  4WFB Q;  3BGF A;  1IUJ A;  3DLG A;  4P6Q A;  1KBR A;  3MM5 A;  1PAU B;  4PG8 A;  4DV4 F;  1SH3 A;  2NS1 B;  2AZ1 A;  2V2Q A;  4CLY A;  1NSA A;  2AW0 A;  4EO8 A;  1YRT A;  3QZ8 A;  3DLK A;  1U45 A;  4I6A A;  3HFV A;  4JI8 J;  1NSK L;  2E5L F;  3F56 A;  2KXN B;  5FD1 A;  3S7R A;  5B0A A;  4KBI A;  1HHS A;  4DQR A;  3AQP A;  4M5D B;  1B64 A;  2CJY B;  3FCW A;  5H9F J;  2DO0 A;  2XO6 A;  2RUG A;  1XR7 A;  3FEX B;  1T9T A;  2EFP A;  2E5J A;  2KDO A;  1WDD A;  1SCJ B;  3LGM A;  2W2M P;  2EFV A;  1RT1 B;  1HNZ J;  2C2O B;  3NEK A;  4ZCI A;  2VDH A;  4PQU B;  4M95 A;  4P10 A;  3FZ2 A;  3BO4 A;  3CXC R;  5LSR A;  4L6V 3;  3DLG B;  3NS7 B;  2R4F A;  1HHQ A;  4NA2 A;  3MM5 B;  3P8B B;  3HJV A;  2BE9 B;  2MQN A;  2A3J A;  3FFI A;  2AJ4 A;  2OLW A;  3TP2 A;  3DLK B;  2LXI A;  4RWW A;  2N7Y A;  2J6T A;  4ZVG A;  3QMQ A;  4DUY J;  2E29 A;  5DO2 A;  2QA4 G;  1UZH A;  1JB0 C;  2N3L A;  3PKY A;  2YH1 A;  3OXL A;  4BBY A;  2VL1 A;  4KTQ A;  4CRJ A;  5CQG A;  2GCF A;  1QAI A;  3WQP A;  1UZD A;  2L48 A;  1TAU A;  3CJS A;  3GJS B;  2W7A A;  1FJG F;  2MTL A;  5K8N A;  5ETS A;  2BAN A;  1A6L A;  4B3R F;  3P45 B;  1J5E J;  3RTV A;  2ZBP A;  4DSF A;  2GJ2 A;  2VU5 A;  3VCD A;  1PJ6 A;  3RBZ A;  1ZA1 B;  1R7I A;  1BLU A;  3G6Y A;  1L3U A;  5AT1 B;  3TOQ A;  3SFU A;  2BE2 A;  4JI3 F;  5FDL A;  3TNV A;  2WZ1 A;  3H2U B;  5JXS A;  1VQO S;  3D0H E;  1UPM B;  2Z2Y B;  1FO1 A;  2M7S A;  2MJU A;  3IA0 A;  3QFW A;  1H38 A;  2HWI A;  2J0X A;  1NK5 A;  2YNI B;  3OTO J;  3EGN A;  2CQG A;  2ZH2 A;  4CO1 A;  3TW0 A;  2ZIT A;  2VKR A;  4LRB A;  1PGZ A;  1JLE A;  4HHJ A;  4Q8F A;  3R5G A;  2ZHA A;  3R2D J;  4WWS A;  3ELH A;  1VK8 A;  3SYZ A;  1D9D A;  3U7J A;  1APS A;  4ZMM A;  3HO1 A;  4DL0 C;  5DDR C;  4ZP6 A;  1ZZN A;  2F4V J;  2ZHB A;  3IAS 9;  1HPZ A;  1OY6 A;  3PHE A;  3BGL A;  3BDP A;  4TXS A;  1JKH A;  4ZVT B;  3GV7 B;  3BPS P;  3UCZ P;  4YOE A;  4QZV B;  2UUB F;  3EDQ B;  3PRD A;  9RUB A;  1T9U A;  2BE2 B;  2LU1 A;  5FDL B;  1ZPW X;  1PC4 A;  4QCL A;  4ZIT A;  1WHV A;  3PR4 A;  1NH8 A;  2QSF A;  2HAI A;  1UMJ A;  3TA2 A;  1FRK A;  4OYA A;  2N3O A;  3VVU A;  4C8K A;  2D69 A;  1WUU A;  5C7P A;  2HHP A;  2DNP A;  1ZA2 B;  5CD4 H;  3C14 A;  2DPI A;  1LV5 A;  2MZS A;  1JLE B;  2HS3 A;  3H5S A;  1WI8 A;  1F9H A;  2G0J A;  3P96 A;  3C66 A;  2EK6 A;  5BR8 F;  1TL1 A;  4I56 A;  4KE5 A;  5HI7 A;  3FRY A;  4D3H A;  1PBA A;  3IBW A;  4C3L A;  4CT9 A;  2OPP A;  2HIY A;  1CC8 A;  4H4K A;  3DLL Q;  3M8R A;  2DXF A;  1HPZ B;  3T1Y J;  4OX9 F;  1TAQ A;  1TL3 A;  1RA6 A;  2C3U A;  1X5T A;  1NB7 A;  1JKH B;  2NZ4 A;  3Q0A A;  4OQJ A;  2APO A;  2VPW B;  3LTO A;  1SJ1 A;  2ZDO A;  1MN7 A;  3V6K A;  1FWK A;  4I67 A;  4QOT A;  2C2Z B;  1GX5 A;  4QIF A;  2P2C B;  2ZWP A;  4LRC A;  2DKO B;  3FVY A;  4NZ0 A;  2R8I A;  3BSN A;  2CPD A;  2HRU A;  2UV8 G;  1NJY A;  2K3I A;  1S48 A;  3HLU A;  4LF5 F;  2RJZ A;  2R2T A;  4L3K A;  1OO0 B;  3RW7 A;  3ISZ A;  3VQS A;  3JSR A;  3QGI A;  4LFA F;  1N33 J;  2C42 A;  3ZO7 A;  1ZTW A;  1GNK A;  3C14 B;  3PYF A;  4QWA A;  1H7X A;  1VYA A;  2BMB A;  3OR2 B;  1S0N A;  3V4I A;  5KG2 A;  3FBB A;  3W9I A;  3D6F B;  1QJH A;  1PSD A;  4GKJ F;  1ZET A;  3OFF A;  3W9H A;  1KQG B;  1S9E A;  4FS1 A;  1E6V B;  4IR9 A;  4USJ C;  3SZ2 A;  3HDS A;  3KUG A;  4UQT A;  3HD2 A;  3N6M A;  2NUH A;  1TL3 B;  5LJ3 Y;  1F3V A;  4DV0 J;  3ZZY A;  1UEV A;  3PJW A;  4Q0B A;  3THV A;  4ED3 A;  4F04 B;  2LU2 A;  3ZTS A;  2HHS A;  5KFR A;  4KGZ B;  3LWL A;  1S4E A;  3POT A;  4YQW A;  3Q2T C;  3V6H A;  2YWH A;  3MPY A;  3CMA S;  3BM7 A;  4RNN A;  2XNQ A;  3HI9 A;  4MYT A;  4CYU B;  4ECQ A;  2COL A;  4DR7 F;  2WBR A;  5B09 A;  1TQL A;  2BRK A;  3DGP B;  1IXK A;  1FDB A;  3OFG A;  1KTQ A;  4DSK A;  4E98 A;  3JYT B;  3B4M A;  5IT9 U;  1H2V Z;  3C2P A;  3V4I B;  3IR6 B;  1X60 A;  4RL1 A;  1G1X A;  2FIU A;  3IWX A;  3AHP A;  3LQV A;  5KT7 A;  1S9E B;  2L08 A;  2AZ3 A;  4N8O A;  1T02 A;  2UUA J;  1XER A;  1HNX J;  4C0H A;  1SB6 A;  3CJ3 A;  5C25 B;  4Q0B B;  1NDK A;  4CLT A;  3J7Z T;  3BYR A;  2XHC A;  1WOP A;  2E1A A;  3KHH A;  2VH7 A;  3NWG A;  1D09 B;  3MUR P;  2HYI B;  2DNZ A;  4DSI A;  2V2K A;  3MTK A;  3DLB A;  1NLK L;  1ZAX A;  2HFS A;  4ECT A;  4JV5 F;  2ROP A;  4NEZ A;  3ZTP A;  2XQC A;  2UXD F;  1U1L A;  1VI7 A;  3KUH A;  1WAC A;  3G6V A;  2LEB A;  2AEF A;  2MKS A;  3GB0 A;  2C28 A;  2L9W A;  7FDR A;  2BR0 A;  2G2Z A;  4ECX A;  3AOA A;  3WIU A;  2BQ3 A;  3R27 A;  2OIH A;  3T1A A;  3RR8 A;  4N77 A;  2IJF A;  3UD5 A;  4F50 A;  3DGV A;  2AJ2 A;  4IRK A;  4OLP A;  3IR7 B;  3DXB A;  3PNI A;  5J1P A;  4YFU A;  4DV3 F;  1H72 C;  1U26 A;  2VJV A;  4OZ1 A;  3UDL A;  2BZ2 A;  2HHQ A;  4CQ1 A;  4TYB A;  1CS4 A;  2KZZ A;  2LMI A;  3GYX B;  5J1N A;  3SDE A;  1ZM9 A;  2AIR B;  4DV6 F;  2R7O A;  3VAG A;  1GEH A;  2HNZ B;  2R42 A;  2CPJ A;  2D1C A;  2FGO A;  3GQC A;  3T5H A;  1HI1 A;  3DU5 A;  4ELV A;  4ZVU B;  4ID8 A;  3CGI A;  4USH A;  4DF8 A;  1CJT A;  4DX7 A;  1FFW B;  2P9E A;  7AT1 B;  5KFP A;  1FFG B;  3IWN C;  3CDU A;  4JI4 F;  1IWG A;  4LBP A;  3B82 A;  2PD1 A;  2DVI A;  5JUM A;  1C1B B;  2VC0 A;  1X9W A;  1ZZF A;  1Z2Z A;  3JTO A;  3MWB A;  4X66 F;  3N6N A;  2ZWO A;  1YBT A;  2V4J A;  2XYP B;  1Y0H A;  4ELU A;  2EC2 A;  2HWT A;  1NH7 A;  3H25 A;  1UVI A;  2C3P A;  2XS5 A;  1FRI A;  5EGY A;  2DGW A;  2VFR A;  1GK8 A;  5D4P A;  1S97 A;  1EHW A;  4JI0 J;  1IN0 A;  3CCT A;  1CS4 B;  4X64 F;  2ZOG A;  1G3O A;  2H4Y B;  2YQ3 A;  3SDE B;  3ISN D;  4NCG B;  4CH7 A;  1X0P A;  2BYC A;  1AA1 B;  5D0R A;  4AND A;  4O4R A;  5KFC A;  2YY3 A;  4TU9 A;  1REV A;  3AOB A;  1HNI B;  2XWX A;  4IH7 A;  4OZL A;  1P1L A;  3EGV A;  4EBC A;  2DR5 A;  3GSI A;  1CJT B;  3DMJ A;  2CPZ A;  5DET A;  3UVJ B;  4YDX A;  4TKT A;  4URQ U;  4JI7 F;  2JRS A;  4GVB A;  3ZZO A;  1AW0 A;  3GJQ B;  2BA9 A;  5IQ6 A;  2FLP A;  3HKZ D;  1KVJ A;  3AB4 B;  5D3G B;  1U1M A;  3BYP A;  2YKQ A;  3TJA A;  2YWF A;  5FII A;  1T8E A;  2ADB A;  2G4B A;  2MHN A;  3M8Q A;  3KG1 A;  3M8W A;  1R43 A;  3RZA A;  1K1S A;  2V4J B;  3T6J A;  3JAM Y;  4LF4 F;  3EVO A;  3MMA A;  2ZM6 J;  2DGX A;  3HMJ G;  3UDE A;  4CWB A;  4ID5 A;  3KK1 A;  4NRU A;  4NE9 C;  3R7S B;  3NCQ A;  2EFO A;  3LGN A;  3PRB A;  4IUF A;  2LQ9 A;  3UN2 A;  4X4T A;  4X4P A;  2MPU A;  2NSC A;  4QIW D;  1BQM A;  4QYZ J;  3IR5 B;  1TKD A;  4FXD A;  4XTT A;  2U2F A;  1S72 S;  1Q0N A;  3LAM A;  4QWE A;  1REV B;  4C8Y A;  5T14 A;  4EUV A;  1YIT S;  1U2C A;  4PG5 A;  5LMU J;  3DMJ B;  3PDN A;  4OV1 A;  2HBR B;  4UY8 T;  1X5S A;  1D9A A;  3MTJ A;  4BC7 A;  3G86 A;  1VBK A;  2H5E A;  4CTA A;  1S9G A;  2JFK A;  4K4W A;  1ARO P;  1TTH B;  2DNL A;  1UEK A;  1VFJ A;  2VG6 A;  2V94 A;  4OZJ A;  4LF9 J;  2DNR A;  1U6Z A;  3PAC A;  1UWA A;  2IRY A;  3M8Q B;  1I94 J;  4ZPA A;  3KNG A;  1SPB P;  2N4C A;  3RAQ A;  4ZN3 A;  4IOA Q;  1BE4 A;  2VG7 A;  4UOG A;  1S1V A;  4NMX A;  3MMA B;  3CDE A;  2X1A A;  1XNQ J;  5HK4 A;  3KK1 B;  4ID5 B;  4PZV A;  5DG7 A;  3NBP A;  5E3P A;  3IBC B;  1IBM F;  5AE2 A;  2E7X A;  1VRU A;  5MLC V;  1T0T V;  3U02 A;  4DG1 A;  4WPA A;  1LWE A;  5DS7 A;  4E0D A;  5A8W A;  3RRK A;  4Y2C A;  1CG2 A;  3UNY A;  4YP3 A;  3GFY A;  5D15 A;  4OYI A;  4PG6 A;  1VC0 A;  3VZH A;  4JI1 J;  4J9V A;  2YH0 A;  3FRZ A;  2MY7 A;  2B8P A;  3CCW A;  1XMQ J;  5B7W A;  2HFN A;  2FLL A;  1VBY A;  4CTA B;  4UW2 A;  1S9G B;  2IYG A;  3W62 A;  4DLE A;  5HAT A;  1WOR A;  2VG6 B;  1XJW B;  1IKV A;  4C8Z A;  1JLB A;  4A8S A;  1X4C A;  2CUY A;  2OJ3 A;  1B0T A;  3H59 A;  3M2V A;  3LAL A;  4KHP J;  6AT1 B;  1IR2 A;  3G71 S;  4Y3C A;  3N28 A;  4LT6 A;  4OIX A;  2ZH3 A;  2VG7 B;  1S1V B;  1CQN A;  3CCV S;  1UWB A;  2HRT A;  2BW7 A;  2PEB A;  3M1V A;  4B9N A;  1OSD A;  2B7C B;  4WK1 A;  2YNH B;  3GIK A;  2W9B A;  1OWX A;  3S1T A;  1FEH A;  3P4U B;  4DG1 B;  1YJT A;  2JLE A;  3CJ2 A;  1QAY A;  2DGU A;  3QQC D;  2RNE A;  4D3G A;  5A8W B;  3J81 U;  1WKK A;  1NAQ A;  1JJ2 R;  3OBI A;  2HZC A;  2RU3 A;  4K59 A;  3VGS A;  5A0Y A;  3MCO A;  1IKY B;  1WDT A;  1F5A A;  3I96 A;  5ETK A;  1S1X A;  3DOM A;  4DZ6 A;  2HQG A;  2Q6C A;  4K2X A;  1OPZ A;  2DIV A;  5IQQ A;  4AYB D;  3HVA A;  4G1P A;  1DZ5 A;  3VAF A;  2VON A;  1N32 J;  3FQL A;  4QW9 A;  1JLB B;  5C42 A;  3M2V B;  2KRB A;  1H0H B;  1S6O A;  2GJI A;  5A8K A;  5A2Q U;  4S0M A;  2HMI A;  2YX1 A;  3R2C J;  3MMJ A;  1LKZ A;  3M1V B;  4QIE A;  3QJP A;  4X62 J;  2BJ9 A;  1FRJ A;  3SV3 A;  1M1H A;  5H9F K;  2FUG 9;  4CO2 A;  5DDP C;  2UXB J;  2DIU A;  2W9B B;  3R6L B;  4LIR A;  1FRH A;  1F2G A;  4F4W A;  3PEH A;  2AU0 A;  1HI0 P;  3V5R A;  3D54 A;  2AHO B;  2UV8 A;  2AYB A;  2VPX B;  1TR0 A;  3AFG A;  2WVE A;  5CYQ A;  1M5K C;  5HO4 A;  1NK8 A;  3GG1 A;  3CMQ A;  2DGS A;  3C8Y A;  1S1X B;  2HS4 A;  3DOM B;  4P72 A;  1Q7L B;  1UVL A;  1LXJ A;  2FHM A;  1IBK F;  3KNA A;  3UQS A;  4HDG A;  4EO6 A;  2GVZ A;  3F41 A;  1R8C A;  4QPT A;  5J1E A;  2DH9 A;  5C42 B;  3CO0 P;  4DR4 F;  2AJ0 A;  3RYL A;  1YX2 A;  1SC4 B;  5D8H B;  1HNW F;  4ZPB A;  1VRQ C;  4DL4 A;  1H7W A;  5A8K B;  1HFE L;  5KFD A;  2HMI B;  3NGT A;  2W9A A;  4DV5 F;  3IGV A;  2O3D A;  1A0O B;  2NPF A;  2MJN A;  2V8G A;  5KFB A;  3UI3 A;  2C22 A;  3KLH A;  2L9N A;  1OYE A;  2N82 B;  4PWW A;  1HBN A;  1SXL A;  5CZV A;  2O66 A;  2N7C A;  4G65 A;  2W24 A;  3QBC A;  1HNV A;  3BV8 A;  2KU7 A;  1HWK A;  1REG X;  1VC5 A;  4ED2 A;  5CYQ B;  4K8R A;  1KKH A;  3O44 A;  1RT3 B;  4QU6 A;  2VPY B;  2EK1 A;  3I31 A;  3ZZ0 A;  3TA1 A;  2ACM A;  2YKN A;  2BKP A;  3OSN A;  2IVF B;  2F1F A;  3DRS A;  1Z2L A;  2GVZ B;  2M4M A;  1YBA A;  1AFJ A;  3CC4 S;  5J1E B;  2W8L A;  2DIT A;  2V8H A;  1Y5L B;  5CYJ A;  3W64 A;  2E44 A;  1XMO J;  4DV2 J;  1XK8 A;  5J2P A;  4PR6 A;  5L46 A;  3QGH A;  3R5C A;  4DSJ A;  2EFQ A;  1O51 A;  3T9N A;  1PIE A;  2MZ1 A;  2ZH6 A;  1G2E A;  1KQF B;  3PHT A;  3KLH B;  1VBZ A;  1EQ0 A;  3EVM A;  3G4S S;  2V2V A;  3IRW P;  1HBN B;  2RIL A;  1JIH A;  4UZC A;  2ASY A;  1AXQ A;  1YJW S;  2DY1 A;  3H20 A;  2HHH J;  4PXB A;  2VQF F;  1JLA A;  1I3O B;  1PYT A;  2KHD A;  3A3P B;  2MZT A;  3NKY A;  1R8A A;  3D9B A;  3PG9 A;  2XBP A;  3KWM A;  1UVK A;  2YKN B;  3P6Y C;  2R7U A;  4K7Q A;  2RIJ A;  4WFX A;  4AT1 B;  2B5J A;  3MM7 A;  3DRS B;  4B3O A;  2RML A;  2HBZ B;  4Q2L A;  4HH1 A;  4U67 Q;  3IRX A;  1XC9 A;  4B3T J;  3CJQ A;  4HDH A;  3K5P A;  2AX1 A;  3MCS A;  1SIZ A;  4BS2 A;  1T03 A;  1T11 A;  5J2P B;  1AZS A;  4OZ3 A;  2V50 A;  2HHT A;  4WFZ A;  1Q4R A;  2OGU A;  3FQK A;  5L8R C;  1X9M A;  3I5C A;  1K8A T;  4HH0 A;  4IG0 A;  4C11 B;  3F73 A;  1MWY A;  3ET6 A;  5KT4 A;  1V3S A;  3HX9 A;  3VR1 A;  3HHL D;  3NMR A;  1FKP A;  2C1E B;  2ZH8 A;  4Z2X A;  1JLA B;  1CJK A;  2J9E A;  3EYZ A;  2YWE A;  1TUV A;  3R1H A;  3CJ8 A;  3I4P A;  1OMS A;  2UU9 F;  3NCP A;  1KFD A;  3MM7 B;  4KR0 B;  3KFW X;  4B3O B;  2W7P A;  4L74 A;  4NLS A;  3ZZT A;  1FT8 A;  1NDL A;  4FYD A;  3IRX B;  4B9V A;  5L1L A;  4MYU A;  2UVR A;  2VBZ A;  1NHU A;  3A8K A;  4G3I A;  1T03 B;  5GAH U;  5KG0 A;  2LP4 A;  4OHW A;  5L1J A;  2WW8 A;  1HBU A;  5I4M A;  1AZS B;  1YSJ A;  3LH2 S;  2BJ1 A;  1UFK A;  3CF5 Q;  3PTW A;  3VAH A;  1NJZ A;  1KFS A;  2IVY A;  2Z56 B;  4K4V A;  1S99 A;  3FGV A;  2LQB A;  1A9N B;  4IG0 B;  1VQL S;  1PYS B;  2IIH A;  2IVM A;  3ET6 B;  3NGU A;  1S0V A;  5IWA J;  5LOQ A;  2MY8 A;  3EX7 B;  2AMC B;  4P73 A;  2RHQ B;  1RT6 A;  4CLZ A;  2OSQ A;  1FKP B;  3R5D A;  3HSZ A;  4LFB F;  5EX0 A;  5D0H A;  3MR3 A;  3MOJ B;  1N36 J;  3BN7 A;  4NLR A;  2Y1L B;  4HYK A;  4HI2 A;  3DM2 A;  4TNO A;  2FY8 A;  3OD2 A;  3RB4 A;  1U49 A;  3MXH P;  2W2P P;  3C6T B;  1SC1 B;  2ZH7 A;  5KFH A;  4UQG A;  2JEF A;  2HVI A;  3HVT A;  2P9G A;  2ALZ A;  4TY8 A;  3GYG A;  2MKI A;  3TYT A;  4QWB A;  1HBU B;  4ZVF A;  2YKM B;  3KMQ A;  1JLC B;  4ECW A;  4K0K F;  1NHK L;  2RSQ A;  4N47 A;  5FLX U;  3G8S A;  4XPC A;  1U4B A;  3HSJ A;  2POK A;  2OMO A;  2CFX A;  2CPI A;  2AQ4 A;  1N5S A;  5C2G A;  1Q86 T;  1RT6 B;  5DLG A;  4WYL A;  2AEJ A;  2E9Z A;  2GZO A;  2RE1 A;  3BO2 A;  1WF1 A;  2FZG B;  4DUT A;  1R8B A;  3NMA A;  4MKA A;  4H4M B;  2E1R A;  3CCM S;  3FJ2 A;  1QSS A;  4YB7 A;  2F8E X;  4HR2 A;  5D4L A;  2OO4 A;  2NCK L;  2YVS A;  2LXU A;  1RBL A;  3IS9 B;  3PIP Q;  5HAO A;  3TX8 A;  2HK3 A;  1P9Y A;  1SC6 A;  5GAG I;  1XQI A;  4DEZ A;  3BBF A;  4DS4 A;  3HVT B;  1VJQ A;  2XB2 D;  3KK2 A;  2QLB B;  4M5G A;  5DQH A;  1PG5 B;  2HW3 A;  1XIQ A;  4K4Y A;  3GCX P;  4OFZ A;  1DY3 A;  2ATC B;  2J8S A;  2FLO A;  4DN9 A;  2KTQ A;  3PW0 A;  4X65 F;  2Z2M A;  1RAH B;  3ENA A;  2FJD B;  2HND A;  5ETP A;  4DU8 A;  1VOM A;  3H98 A;  2OFH X;  3NS5 A;  2QEX S;  3I0R A;  3OXG A;  1RWO B;  4OYX A;  4AQY F;  1N0V C;  4NLQ A;  2JWN A;  4WFY A;  4CZC A;  5GAE I;  4J9U E;  2ZOM A;  1TU0 B;  5FJ4 A;  2Y0B B;  4FYY B;  1QAX A;  1N5T A;  3CD0 A;  4B3S J;  2H4W B;  3AA8 A;  3PFO A;  1N34 F;  3SSR A;  3O1L A;  3LAN A;  4EZ6 A;  3PX4 A;  3D6M B;  3PIO Q;  1IQT A;  5GAG U;  1LW0 A;  4DR1 J;  5AXL A;  2LLZ A;  5DRK A;  5IOL A;  4RBT A;  3GR1 A;  3BRE A;  5DDO C;  2PN6 A;  1DUR A;  3KK2 B;  1RAD B;  3TAM A;  5D0G A;  1Z1Z A;  4KH1 B;  1R89 A;  1U6B A;  3CJT A;  2IHR 1;  3PM9 A;  5CCM A;  1XEZ A;  1FXD A;  1EET A;  1TKT B;  3IC1 A;  1UKU A;  2G2O A;  2WCX A;  2HGN A;  2WVC A;  1RE1 B;  2VG5 A;  2CZ4 A;  1RHK B;  5ETQ A;  4DF4 A;  2W2N P;  2XMW A;  4KQZ A;  1RQ0 A;  2HND B;  3W65 A;  3D6T B;  2CQ3 A;  3HM9 A;  4JI6 J;  4WFA Q;  1WC6 A;  1V3R A;  3JXO A;  2VC1 A;  2XM3 A;  3NOC A;  4J90 A;  4ZK7 M;  3PYD A;  1QM9 A;  3FC9 A;  4Y6I A;  3RW6 A;  2BM0 A;  4QJV A;  1RTI A;  5HP1 A;  5L38 A;  1VK3 A;  2DK2 A;  3KJN B;  1SKW A;  3JQM A;  3MAH A;  2DNH A;  1YRU A;  2JEI A;  3I55 S;  1XNR J;  3LWM A;  2DBB A;  3NAH A;  3ZTR A;  2X51 A;  1LW0 B;  2RH3 A;  3MPV A;  2XNR A;  2HUR A;  3N5B A;  3ILL A;  4USU A;  4USI A;  2OPR A;  5HQ8 A;  2R7W A;  3TAM B;  2OPQ A;  3MR7 A;  1Y11 A;  2QMU B;  1WD6 A;  2DNY A;  2PT0 A;  1EET B;  4WU3 A;  2ZVS A;  4ANC A;  1NEE A;  4BWJ A;  4OHV A;  2M3D A;  3BH6 B;  2AX0 A;  1YK9 A;  1T95 A;  4MAK A;  2A1B A;  3V6J A;  2MKK A;  3TAP A;  1K44 A;  1HW9 A;  2B9Y A;  3DI6 A;  4DR6 J;  1TV6 B;  4ZLL A;  5AXK A;  2ASD A;  1O0P A;  5B0F A;  4NCA A;  2CJX B;  4ER8 A;  2W25 A;  2W1B A;  1HMV A;  4NEY A;  4ZPC A;  3B54 A;  4OHY A;  4KPY A;  3AA9 A;  1X8D A;  2B4O A;  1RTI B;  1D8Y A;  4ZLJ A;  1E6Y A;  2UVV A;  1WEZ A;  4DUZ J;  4DV1 F;  3L9Z A;  1RAI B;  2EI5 A;  4YHH J;  3GV8 B;  1LNQ A;  3L4B C;  4C8M A;  1JXE A;  4NZ6 A;  3AD9 C;  3QJJ A;  4O3Q A;  1P1T A;  3KK3 A;  3K8V A;  3RJM B;  2GIF A;  2RQC A;  4ECS A;  1VRT A;  1UVJ A;  4DU7 A;  4U9R A;  1WSV A;  4LFC F;  3ZFV A;  2M5Y A;  4WJB A;  2OPR B;  4XPE A;  4Y28 C;  2GIQ A;  2OPQ B;  1IM4 A;  1HYS A;  2CNL B;  2V9K A;  3AD7 C;  1ITP A;  3V4M A;  5KFI A;  5ETT A;  1QUV A;  2KXF A;  3D5M A;  4UTG A;  1Y5N B;  3DI6 B;  2BQR A;  1VMB A;  5KFG A;  2XLK A;  1N5V A;  1S0M A;  5K8M A;  4W4M A;  2ROE A;  5KFV A;  2JEJ A;  2R9L A;  2Z2L A;  4YME A;  2VFS A;  3X3U A;  4ZPV R;  3PVX A;  3W2W A;  2E7V A;  1B7Y B;  2KT2 A;  1EX8 A;  5KT2 A;  1KQS R;  1Q8K A;  3K58 A;  2KVQ E;  2MQ8 A;  3BPD A;  3PO4 A;  3D4J A;  2R7R A;  2VB6 A;  3CCE S;  3T6B A;  2ACY A;  1EZZ B;  2XLI A;  1RTZ A;  2YPY A;  4PKD B;  3KK3 B;  3OT9 A;  4Q44 A;  4NXM J;  1KHW A;  3R7B B;  2YKA A;  3G6X A;  3NS6 A;  4C98 A;  1N52 B;  4JBC A;  1FEE A;  1EP4 A;  1AUS L;  4OV6 A;  2JVR A;  6FDR A;  3H42 A;  1HKA A;  2IJN A;  1HYS B;  5JVG Q;  1RK8 A;  1FE0 A;  2BXJ A;  4F67 A;  2Z0G A;  3QRR A;  2JC0 A;  4K2J A;  1VQN S;  1S4F A;  4OX6 A;  4YY3 J;  2GX8 A;  1HL6 A;  2AJQ A;  3A12 A;  2CAJ A;  2Q6B A;  2RB7 A;  3LPY A;  4DOZ A;  3AJ1 A;  4MJK A;  2XSJ A;  2AT1 B;  3I0S A;  3FSI A;  3P5T L;  1EIY B;  1U47 A;  3W2W B;  1OQ3 A;  3L7U A;  4J9S A;  2XY7 A;  3PW4 A;  3UDV A;  2PA8 D;  4WYW A;  3J7Y I;  1D0E A;  2V4R A;  2GC8 A;  3TZW A;  1OJ4 A;  1RIS A;  1WC5 A;  3EVW A;  2F3J A;  3ZNJ 1;  1NB2 A;  5E3Q A;  3MCN A;  3M8Y A;  1RYR A;  3BSA A;  1Y3J A;  1SVD A;  4V19 X;  4JP8 A;  1EP4 B;  2VAS A;  4ED6 A;  5HSP A;  2VBY A;  3VAL A;  1OS5 A;  1YJV A;  3HXM A;  3QAT A;  2DH8 A;  3SBM A;  3KOA A;  2LDY A;  4Y2K A;  2VBX A;  2R2U A;  1VS3 A;  4L73 A;  3W66 A;  4IFV A;  2Q66 A;  3GFH A;  2MST A;  2QL5 B;  1WEX A;  3H90 A;  1RHM B;  2E5H A;  1VLY A;  2XTJ P;  2H3E B;  1TKZ A;  3MM9 A;  2I2Y A;  2XSJ B;  1EB0 A;  3QFH A;  3I0S B;  2IDL A;  1U1O A;  4CO5 A;  2MKJ A;  2GHP A;  3J7Y U;  1JQG A;  3M6W A;  3CJK A;  1SIW B;  1UFW A;  5L39 A;  9ATC B;  1TUW A;  2UXC J;  2SXL A;  1FKA F;  2LVW A;  1CEZ A;  1PIL A;  3E51 A;  4J9O A;  4ED0 A;  4ILM A;  2K1R A;  3SIP B;  2Z58 B;  5HQM A;  4NYP A;  5CAA A;  4OI2 A;  1V9O A;  2Y1I A;  3W61 A;  3HPO A;  2FJE B;  1JLQ A;  2PI4 A;  4CLU A;  2VOD A;  2V69 A;  1C4A A;  1TK0 A;  4QW8 A;  3IM9 A;  3OL7 A;  3VAK A;  1Q7Y T;  3QT5 A;  4NLD A;  5A8R A;  4LF6 J;  4EYH B;  3NCR A;  3EUN A;  1CJU A;  1JLG A;  1HLW A;  4IFV B;  2BOA A;  4AFF A;  4LBH A;  1JMT A;  3PYG A;  4AD6 A;  2LCW A;  1HR0 J;  1MSW D;  5IFM A;  2ZKU A;  4MH8 A;  1TKZ B;  3MM9 B;  5A2Q Y;  3UD3 P;  1RCO B;  1BWE A;  5KAK A;  3MGJ A;  1TFW A;  3KJF B;  5KT3 A;  3NL0 A;  4DBQ A;  3DHW C;  3GE9 A;  3D0I E;  2VHG A;  4RLE A;  4UT4 A;  3LF0 A;  4EFA C;  3GFX A;  4O44 A;  4PAA A;  2QG9 B;  2QIF A;  3N0V A;  2J9D A;  1VQ8 S;  2Q3P A;  3HHK A;  4DQS A;  4GC7 A;  2VOP A;  1X5P A;  3KYL A;  1RYS A;  3DHX A;  5CD4 A;  1YJR A;  3OFH A;  2QTW A;  2KB2 A;  4N5S A;  2R2S A;  1HIY A;  3K7R A;  2NPI A;  3NAI A;  5AE1 A;  1JLQ B;  2HPU A;  2E5G A;  3QSI A;  2DY9 A;  2BV3 A;  4DN0 A;  4LQ9 A;  4OJ1 A;  1V5I B;  4QWD A;  5A8R B;  1C0U A;  5B0D A;  1CJU B;  2HFV A;  1QVG R;  1JLG B;  4I6W A;  5F9L A;  3MEE A;  4MK9 A;  5LSO A;  3H5X A;  1VHI A;  1Q53 A;  2RF2 A;  2D3O R;  1QLN A;  3OR1 A;  1HD1 A;  2HVD A;  4LR9 A;  2HG4 A;  2GHW A;  4OLO A;  1KOH A;  2J0W A;  5B0B A;  4M94 A;  3R1L A;  2XZT B;  3SQO P;  3G9C A;  4O44 B;  3QRQ A;  1XBW A;  1RTH A;  1BHN A;  2CPY A;  1FK9 A;  4PXC A;  3O6Q A;  2WHO A;  3HUL A;  2FJB B;  4L72 B;  3OSP A;  1PJ5 A;  2XZW A;  1RKJ A; 
#chains in the Genus database with same CATH homology
 3EVO A;  4C6A A;  2CWK A;  3FKB A;  1VYA A;  3VGU A;  3EVW A;  3Q8U A;  5CAA A;  1HIY A;  4DUT A;  3ZTO A;  3FBF A;  1NB2 A;  4UOF A;  3FBC A;  1LEO A;  3FBB A;  3GP9 A;  1JXV A;  3ETM A;  3ELH A;  1EHW A;  4DI6 A;  2BX6 A;  2DY9 A;  4HR2 A;  3ZTR A;  3Q8Y A;  4WBF A;  4W98 A;  1S57 A;  2DYA A;  2NCK L;  3DDI A;  1WKK A;  2AZ3 A;  3Q89 A;  1LWX A;  1U8W A;  3BH7 B;  5CAB A;  3BBC A;  2HUR A;  1B4S A;  1NDC A;  4UOH A;  3VGS A;  3Q83 A;  4AND A;  4ENO A;  2B8Q A;  5IOL A;  1PAE X;  4ANE A;  5BXI A;  1KDN A;  2DXF A;  2DXD A;  2VU5 A;  4O0N A;  1NSP A;  3MPD A;  1NDK A;  3JS9 A;  1HLW A;  1S5Z A;  1XQI A;  3BBF A;  1HHQ A;  2B8P A;  4DZ6 A;  1NDL A;  1MN9 A;  3VGT A;  3VGV A;  1NSQ A;  3DKD A;  3EE3 A;  3ZTS A;  3EIC A;  4ANC A;  1XIQ A;  2BEF A;  3NGR A;  3BH6 B;  3B6B A;  3FBE A;  2AZ1 A;  1MN7 A;  1WKJ A;  3Q86 A;  2DXE A;  2HVD A;  3WX8 A;  3ZTQ A;  1K44 A;  2HVE A;  3FCV A;  3G2X A;  1NLK L;  4F36 A;  3PJ9 A;  3EM1 A;  4CP5 A;  1NDP A;  4EK2 A;  1NHK L;  1NSK L;  3VVT A;  2ZUA A;  4FKX A;  3ZTP A;  3ENA A;  3L7U A;  3B54 A;  3Q8V A;  4KPC A;  1BHN A;  3VVU A;  4FKY A;  1F6T A;  1NPK A;  3BBB A;  3EMT A;  1B99 A;  3EJM A;  3NGS A;  1W7W A;  3NGT A;  1F3F A;  4S0M A;  1S59 A;  3R9L A;  5C7P A;  1UCN A;  3FC9 A;  4F4A A;  3NGU A;  3PRV A;  1BE4 A;  4UOG A;  3FCW A;  3GPA A;  1NCL A;  1ZS6 A;  1NUE A;  3EVM A;  1PKU A;  1BUX A;  1WKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...