2B8PA

Crystal structure of acanthamoeba polyphaga mimivirus ndk, the first viral nucleoside diphosphate kinase
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
134
structure length
129
Chain Sequence
YKKAGLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEYFNDNCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Probable nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Mimivirus
total genus 38
structure length 129
sequence length 134
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2005-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2b8pA00
3BBCA 3BBFA 4DUTA 4ENOA 3BH7B 2BX6A 1NPKA 1U8WA 1B99A 3B6BA 2HURA 1WKKA 1NDPA 3NGSA 1MN7A 3R9LA 3VGVA 4UOHA 1S5ZA 3Q83A 2DXDA 1WKLA 1LWXA 3FBEA 3VGSA 3VGUA 3Q8YA 4EK2A 3ZTPA 3B54A 4WBFA 1PAEX 1BHNA 3EE3A 3EMTA 5CABA 3EM1A 2AZ1A 2NCKL 1NDKA 5CAAA 4ANEA 2ZUAA 4ANDA 1NUEA 1F6TA 3ZTOA 1WKJA 1NB2A 4DI6A 3VVTA 3ZTQA 3PRVA 3FC9A 3FBBA 4S0MA 3FKBA 3ZTRA 4F4AA 4UOFA 3NGRA 3Q8VA 1NCLA 3DDIA 1HLWA 3FBFA 1B4SA 3Q89A 3GPAA 1F3FA 3BBBA 3GP9A 3ELHA 3ETMA 1KDNA 2HVDA 1W7WA 1NHKL 2CWKA 3Q8UA 1K44A 1HIYA 1S59A 2DY9A 3G2XA 3VVUA 3WX8A 3ENAA 3FCWA 1XIQA 1NDCA 5BXIA 1NDLA 2DYAA 3EVOA 3EVMA 3NGTA 3L7UA 3BH6B 3EJMA 3EICA 2AZ3A 4UOGA 1NSQA 1HHQA 3FBCA 4C6AA 2VU5A 3MPDA 4W98A 1LEOA 1NSKL 1S57A 1UCNA 1PKUA 1NSPA 2HVEA 4DZ6A 3FCVA 3JS9A 1BUXA 1NLKL 2B8PA 1XQIA 3ZTSA 1BE4A 4FKXA 4O0NA 1MN9A 4FKYA 1JXVA 3PJ9A 4HR2A 1EHWA 1ZS6A 5IOLA 2BEFA 3DKDA 4KPCA 5C7PA 2DXFA 2B8QA 4ANCA 3Q86A 3NGUA 4F36A 2DXEA 3VGTA 1VYAA 3EVWA 4CP5A
chains in the Genus database with same CATH superfamily
2Q1LA 1N6QB 3A3PB 2EFQA 4EYHB 3M8SA 2GMHA 4KKOB 5IZHA 2VQFF 5EWEA 2DH9A 2M0GB 3EMTA 3W9JA 3IG1A 2LEAA 5I3UB 1PC4A 2RT3A 1IKVA 1G4CA 2MKKA 2HLTA 4URQU 1KHWA 3A8JA 1YJRA 4MKVA 2NXCA 5J1EA 4B9NA 1YX2A 4IYQA 2VIHA 4HDGA 4HT5A 3T6JA 1UFWA 3QT6A 2AGPA 3BKUA 1U49A 1PKUA 3HVAA 2JOQA 2AGOA 3EGNA 2IIHA 3CDUA 4L6V3 2DNYA 4H54A 1JXVA 5T41A 1S7HA 2NREA 2GO8A 4EEYA 3OTEA 1CBKA 4UY8T 1Y4ZB 1R8AA 3FMWA 2W1BA 3FRZA 2B0GA 5G4DA 2JLGA 4OV6A 4YR0A 4JI8J 2XZTB 4F0MA 4OV1A 3LGNA 1Q7YT 1SJ4P 3VCDA 2BXJA 2V8PA 4LRDA 4NXMJ 3GFZA 2IDEA 4BHQA 3KK2B 3HI9A 1S6PA 4EFAC 5HVGA 1LK5A 2NZ4A 2CPDA 5HO4A 1RAIB 1DQ8A 4KY3A 2B9EA 3KLVA 1QAJA 3I5AA 1VRUA 1ZAWA 3CJ5A 1HHQA 1K1QA 1C0TA 3CCWA 4DLGA 1H6KX 2ZZNA 2C2NA 1KSPA 1T9VA 3DHWC 1WACA 2F63A 2F40A 1SH3A 2MKJA 4QWAA 2KZZA 3PCOB 2DXFA 2HMIB 3U1MA 4E8UA 3JSMA 3PRDA 4O3SA 3N5FA 4K4TA 2MYFA 3US5A 3J81U 1HBNA 1KONA 5ETRA 4K4XA 1NDPA 3RW6A 2IA6A 1FDAA 4F0KA 2DXDA 3DLKB 2XMJA 3KMQA 4RW8B 4GO5X 2MQQA 1Q82T 2QMXA 1LV5A 3N6LA 3OTOF 4A4JA 1PGZA 4ZVPB 4H4MA 3MM8B 2C3YA 1N8RT 1ZA1B 3BGRB 4JI6F 5IS2A 2E5JA 2JEGA 3D6TB 2YVSA 4KYZA 2E7WA 4EBDA 3JQMA 1RTJB 3I87A 3FCWA 4EWTA 2MPUA 4ELVA 4KHPF 1ZPWX 4ZLLA 1O0PA 2YNHA 4QIGA 2N3OA 4NCGA 1J2VA 2VJVA 2MQPA 4C11A 4PXCA 3V6DB 4B3SF 2HQCA 2C3MA 1WSVA 3GYGA 4DQRA 4NEYA 1U45A 1NKCA 1UVMA 5DDPC 1EP4B 5AE1A 4ZOSA 1I51B 1ELOA 3D1QA 3W3SA 3D1HA 3OXLA 2BJ8A 3G6VA 4ZKAA 4XK8C 4EK2A 2WW8A 4M5NA 3FCHA 5IM0B 1QAIA 2HQ3A 1EQMA 2YNIB 1JK9B 4K4SA 4K2XA 5D0GA 4C0HA 4PR6A 2KO1A 3FBBA 4OYWA 1CVJA 4FYVB 3SMZA 1WG4A 2RS8A 1KLNA 4QR2A 3ZZTA 3KNAA 3PHEA 2ZHAA 3K5LA 2EK6A 4TVAB 1VFJA 4J9LA 4LF9F 4N56A 3IBCB 2VQEF 1PAUB 3MI7X 4JI1J 1D8YA 3TEHB 1NH7A 1YK9A 4LF6J 5HQMA 2DGQA 1VCTA 1RXOB 3SSRA 2KU7A 1FWLA 3MECB 1SUQA 4ITSA 2XMKA 2Z4PA 4N7TA 1V3SA 1QSLA 2NYIA 3BGLA 4KO0A 4DV0J 3BH7B 4TY8A 1P9YA 3QWUA 2HK2A 3SSSA 3V4IB 4P7VA 2BANA 4O23A 2DHAA 3K17A 3J7ZT 3OVBA 1YRUA 3J7YU 1HNXF 1RLDA 5CH7B 1BHNA 2HQIA 3MCOA 2GGPA 3CSKA 4DV1J 2XMVA 2YWWA 2HFOA 2OGUA 4IG3B 3QRRA 3PEJA 2KM8B 1RZMA 1TQLA 4QYZJ 4NOHA 2KFZA 4NRUA 3BQ2A 1SQGA 2YX7A 2MZJA 3ENAA 2XTJP 5KFRA 3UR3C 2CRLA 2W9BB 2AGQA 1QAYA 3BSOA 3W2VA 1MMNA 2XCAA 1P8GA 1JLEB 4LSLA 4K50A 1U02A 2H9ZA 3FCVA 3JS9A 2XQCA 1H38A 4OLPA 1S1TB 2K3KA 2ZBCA 1BQNA 1A9NB 4ER8A 1VQ4S 5D15A 2RB7A 3WZ0A 1F5AA 2CPXA 2CWXA 5EGYA 4MT1A 2J9EA 2NUHA 1HI1A 1NZAA 2ZWPA 2CADA 4EZ6A 1MWYA 4DX6A 4PRFA 2ZBPA 3I31A 1A0OB 4P52A 4HKQA 2A6MA 2OPSA 5F8IA 4AL5A 3MFIA 4A8YA 4J9RA 5IC4B 2DNPA 5AXMA 3MR3A 3QJPA 1RT7A 3G4SS 1M1KT 4XIUA 1S10A 5IT4A 1F9HA 2ZVIA 4OZ0A 3J81Y 2PI4A 3ET6B 2RKIA 4F4XA 1YJWS 1HD1A 1D1UA 5K8OA 3IA0A 3LW5C 3VQTA 4K8RA 3M8YA 4WK1A 1VRUB 1HYSA 4DL5A 3PY8A 1HQEA 3KUGA 1F60B 2YNGA 2LDIA 3TOQA 1U1QA 2AYBA 2XY6A 3BEGB 4ZVSB 4ECUA 4NLOA 2RDDA 3QGGA 3PG9A 1N32F 2M88A 5EUHA 2DTJA 2QA4S 4RZRA 4ZPWR 1TMMA 2KRRA 4JI2F 3V2UC 4CQ1A 2VBZA 2CVIA 2R42A 4H4KA 3V81B 2HAIA 1RTZA 1WC3A 1OSCA 1U2RA 3RG6A 1RT2B 3OD2A 5F8GA 1UKUA 2XO6A 1XR5A 1P27B 3BYPA 5KFEA 2RQ4A 2CDQA 3E01A 4LFBF 4ICLB 2W9AA 4RW7A 2G4BA 3DI6A 1IBMF 1LEOA 4DV6F 2AIRB 3RB0A 4A8MP 1G3OA 3GG0A 3KXDA 1VR6A 1X9SA 2X1AA 3GMGA 1X4DA 2WBMA 1KQFB 4WZQA 2OPRB 2Z2YB 3CNQP 4YP3A 3P6YC 2WVFA 3KHGA 1Y9OA 2ZJQQ 4J9QA 3CEDA 1M1HA 2HLUA 2K8GA 4RUAA 2HNDA 3BZQA 5IT9Y 3HT0A 3DRPA 3NXZA 2BJ3A 3MUTP 2ZBQA 5HMXA 1CJVB 4LRCA 2LP4A 4AQYF 1WTFA 1FVQA 1F6TA 1X9WA 1CS4B 2DGWA 2I1RA 1V6HA 2XO7A 2XMUA 3M32B 2VODA 1S1WB 1B0VA 2KVIA 3ENVA 1GXLA 2CJAA 2Q6BA 4FF1A 4RBTA 4IG0A 3TJAA 3WX4A 4OX9J 4U9RA 1NK7A 4PKDB 3RB4A 1RT3A 4LUBA 4IO9Q 3EDRB 4QIVA 2QSWA 1IBLJ 2KH9A 3EZOA 3MWBA 4WFBQ 5EN1A 3RBXA 2EC2A 3QBCA 5I3QA 2WAQD 4CP5A 3TWZA 5A8RA 2XC9A 2UUWA 2V68A 2HBQB 3Q22A 3PYDA 1BD6A 2YWKA 4WP8A 1HQ2A 5KFWA 4DSEA 4WU2A 4GKJJ 4J37A 2K7KA 1BGXT 4KO0B 4ED7A 4N8OA 2KG1A 4TY8B 3GJQB 1CC8A 2IRUA 4CO4A 3AT1B 3OHBA 2EG2A 3S8SA 2AT1B 1JLAB 4DSLA 5F9NA 1MG7A 4FBTA 1T95A 4M95A 5HVHA 3NAIA 2QLBB 1R0BG 3ZZOA 1HBOA 2XY7A 2FLLA 4IRDA 3OFFA 4L74A 3IR5B 2V8VA 1QLNA 4DV2J 5KFCA 3HHLA 5F0WA 3OLBA 5IXUA 3VAFA 5EWFA 4MIAA 3T1HF 2ZKUA 4OJHA 1CSJA 4CYUA 4WKYA 1IBKJ 2E1AA 2LA6A 3CCRS 4LFAF 1FRIA 3VGTA 1XMBA 3MAAA 4C8ZA 3RR7A 4WPAA 3SBMA 5D0HA 4M5MA 4O3QA 3UDCA 3DOLA 1U6BA 3IO1A 1TL4A 1CULA 3EXYA 3HSZA 5E3RA 4JI7J 1FA0A 2VFSA 3R5GA 2BKPA 3IRWP 2ZH7A 2C2OB 1Q86T 2RQCA 5IWAJ 1TFWA 1JLCB 4RNHA 4KTQA 2B6AB 1PAEX 2BYCA 3EM1A 5BR8J 1NXIA 4Y2MA 3I4HX 2YWGA 4I64A 3GIRA 4C97A 3W61A 3M6UA 1Q8LA 3G82B 3RB6A 3KG4A 4ECWA 1LWFA 1QVFR 3M8QB 2HKEA 1RA7A 1X60A 5KTQA 3W65A 1RT7B 1AZSB 2IFXA 2J6TA 4LF7J 1DHMA 5CYQA 3MM9A 1FXDA 3A3OB 3W5XA 3NBPA 1UVNA 2RKIB 3D9BA 4O0NA 1HNVB 5IC6B 4LT6A 3DOKB 3BPDA 1IM6A 4GVBA 4AE5A 1XMQJ 5AE3A 1CJKB 2PMHA 1T9XA 2XM3A 3UCZP 2VDIA 1VQ9S 2RSQA 1TL3B 1RLCL 4CTAA 3O1LA 4NLVA 3TO8A 2UXBJ 3R2DJ 4OZJA 1B3TA 1Y0HA 2OFGX 1RTDB 3OHAA 2H4WB 1JJ4A 1DLOB 3RAQA 3CCUS 2IM1A 3RRHA 3PO5A 4FXWA 1UL3A 1QJHA 3V5RA 3TA2A 2BBEA 1SJ3P 3QMQA 2OSRA 4KGMA 2NZCA 4OZ5A 1RSCA 4IFVA 2C3OA 1Z2ZA 3IWLA 4X4SA 3AJ1A 1NAQA 2VL1A 2MZTA 3DMJA 1HIYA 3K5NA 2CQHA 2Z2ZA 4DPWA 2FJVA 2UUBF 3OL9A 3HHDA 2B5JB 5F8JA 5A76A 2E44A 3Q2SC 3ZZRA 5HQ8A 2VC0A 4USVA 3SV3A 5F3TA 4DL7A 3CTRA 3MTKA 1OQ6A 1JNRB 2DNMA 3U1LA 3GYXB 3IM9A 2Y8YA 1RT4B 4OI6A 3N01A 4QBUA 4J9OA 1Q5YA 4NLDA 3UE2A 4I2PB 5KG7A 2XG8A 3CD5A 2VONA 2F4VJ 1TR0A 3ITHA 1PO6A 2V2KA 3DM2B 1C0UB 3HCXA 2EBEA 3CMAS 2UXCJ 5E5NA 4DN9A 1RGVA 1WG5A 3GR0A 1PJ5A 1TV6A 1R8HA 4DSJA 2JNJA 2R4FA 4ZCKA 1V3ZA 3OTBA 2CA9A 2QV6A 1WWHA 1WF1A 5CCLA 3LQVA 2HNDB 3LGMA 3Q8VA 1EX8A 3DRPB 1D8ZA 3HKWA 2DNKA 2MSTA 5B0GA 2FVSA 4C98A 1UVKA 2PMZD 1QVGR 3HD2A 2KXNB 2AW0A 1ZH5A 1GQEA 2Y1IA 2D3OR 2MKSA 2LXUA 3MPUB 4Y6IA 4DS5A 1N5TA 2VG6A 1X4GA 3BF4A 4ECQA 1IQTA 2CQ1A 1T11A 2OIHA 1RAFB 4EMDA 3NKYA 1UJ5A 2RQKA 1HARA 4KH1B 2VKZG 4PZVA 3AB2B 2LQBA 2B4PA 1QUPA 5E3PA 5H9FK 2J0SD 2BR0A 3HK2A 4WCEQ 2CQIA 3KJVA 3GB0A 1XR6A 3GU0A 5KG5A 1YJ7A 1NZ8A 3W7BA 2Z30B 2XMTA 1GMVA 3CT9A 4JUZA 3R27A 1FWKA 1SI9A 3UI3A 4QWCA 5KFJA 5GAGI 4X4RA 4UQGA 3MF5A 1YDLA 3PO4A 4EYIB 1S99A 1UW9A 4RNOA 1MROA 1HLWA 1S6OA 2R7WA 3ZZ0A 3EPIA 5DM7Q 1B7FA 3TRGA 1E6YA 1FKOA 2V67A 3OBIA 2QLJB 3NGKA 2ADCA 3EX7B 3FK4A 4RW4B 4ED1A 2HFNA 1HNZJ 2O3DA 1OYDA 1YZ6A 5LMUJ 1HBOB 3DRXA 5I42B 3C16B 3PR4A 2WBRA 1WNEA 4XPCA 2Y9HA 2ZDPA 2EC0A 4ZHRB 2NXJA 3HHEA 3DCAA 3RU0A 2HG4A 2HFZA 3MCSA 4ZJOA 2RHQB 2W9CA 3CCSS 2AP6A 2RMLA 4LSNA 1XTZA 1IUJA 4XPEA 7FD1A 1ITPA 4YDDB 2F8HA 4QPXA 4JI3F 2ZEJA 1XK8A 2RDIA 2VDHA 3MEGB 1IBCB 5J1NA 2ZH8A 1HQUA 1TTHB 2FVQA 3MAAB 4V1Ak 3B54A 4CLTA 3CCLS 1UZDA 2I5JA 4ANDA 3C14B 1Q53A 2DHGA 4USHA 3W2WB 1N34F 1HNWF 1TK0A 3M6XA 4JV5J 3PW5A 4DWIA 2K1RA 1F3FA 1N36J 3C46A 2J7UA 1E6VA 4M5GA 1SPBP 1ULRA 1NDCA 3RTVA 4TLRA 2Y0SD 5J2QB 2P9CA 1LWFB 1RUSA 1RYSA 1T8EA 1WC5A 1WF2A 2OH2A 2PD1A 1T3OA 4K0KJ 4UY85 1BY9A 2LU1A 5CYQB 3MM9B 1RJJA 2ACYA 2ZKTA 3ISZA 3NBPB 1RADB 4DPUA 1F9FA 4DQQA 5SUHA 4LIRA 3DLHA 2HURA 1PYOB 3DLJA 2FC9A 3DLGB 4O44A 1RISA 3JTPA 1VQ5S 3PFOA 2ZC4A 3Q8YA 4ETXA 4RJVA 4N8NA 1YLXA 5KG0A 3JB9k 2JEFA 4FBUA 3FDSA 1CG2A 1X4EA 2F9DA 2JFDA 4ERDA 5GADU 4DBQA 2OO4A 1VLYA 2XI3A 5HP1A 2OPPB 5GMDA 2V94A 4UUXA 3G86A 3IWNC 3VAKA 4FYDA 2L41A 2MQLA 1HBMB 4EBEA 4ZVRB 3W9HA 4C8LA 1OSDA 3HFKA 1YI2S 4YR3A 4LJMA 1TKTA 5CYMA 4B9LA 2WTFA 1DTTB 2CYYA 2V34A 1UVIA 2YNFB 3FVYA 1QDUB 4NLTA 4C3MA 3H7HB 4Q7AA 4ED0A 3IAS9 1MN9A 1LW2A 3IMQJ 4OYPA 1I94F 2IVFB 2PDAA 3J80Y 2JVOA 3LPEA 2Q43A 3AY0A 3F44A 4HH1A 1OY8A 2YKMA 3GSDA 4OHZA 2GJIA 2GJFA 3G6ES 1WEZA 4CO0A 3SSQA 1JKHB 4ILRA 2BW7A 4QPTA 4X4PA 3GV8B 1B70B 1DBDA 2ALYB 1RTIB 1FX2A 3T5LA 4OJ1A 2EKNA 1PCAA 1DTQB 5L8RC 4B9TA 3P4UB 1RBOB 3AJDA 2EFOA 1DFDA 3FKBA 4UOFA 3QAEA 2EEYA 5KT5A 2AD9A 1ZAXA 4HI1A 1ICEB 2XSJB 5K14B 2DRAA 1S1XB 3IBFB 1FRMA 2CG4A 1VI7A 2D3UA 5LJ5Y 4F67A 4ZVGA 2PSZA 5C25B 3EVMA 3NNAA 3I5BA 3K5OA 4X4TA 3GZ7A 4PUOA 2W8LA 4C6AA 1OIAA 5E3CA 4M1KA 1LFPA 3AXKA 3OSPA 3WQPA 2G13A 1Q8IA 3R6LB 4DR6F 1S9FA 4QCLA 2ROPA 3D5MA 2VQFJ 3N6MA 5DZ6A 2HIYA 2J7KA 3MCMA 2F65A 1F1BB 4F36A 3UPFA 3BBFA 3FFIB 4I6WA 4DUTA 3UO0A 1R8BA 5M2RA 5KFQA 2R7XA 5LMNF 5HROA 5L1IA 1QE1A 1K8AT 3R9LA 3MMBB 2V6AA 2I2YA 2LQJA 3CVKA 2XLKA 2P8IA 1XNRF 5C5JA 4GMKA 3G6YA 1ZETA 3JYTA 4KR0B 1R0AA 3HMJG 3C6TA 2DNNA 5B0BA 4UZBA 1EQ0A 2VH7A 4KSEB 5LXYA 4P2MA 3B4MA 3ZZPA 2FLNA 4DR3F 1U7LA 2RUSA 3S01A 3TNVA 1BMQB 5D8HB 2CUYA 1PG5B 2I9SA 4E0DA 3IGNA 4A8WA 2HNZA 4OFZA 1P1TA 1IN0A 4W4MA 5C24A 1HHTP 1U1RA 4HLBA 1Q81T 3MPYA 5G0RB 1WC6A 3D3CJ 3ZTSA 1E6YB 3CO9A 1NJWA 3M30B 4ZPTR 2EXUA 1VQLS 4NYZA 1PILA 1FJCA 3U1NA 5HK4A 2KYXA 2DXEA 4WXWA 1ZTWA 2RS2A 2XYGB 4PXDA 1WDTA 4IRKA 4KBIA 2E9TA 1B99A 4LBPA 2FB0A 1R8CA 2J76E 3LTOA 5DO2A 3AD7C 4DR1F 1ZA2B 3O5TB 4J9SA 1VC5A 1TKZA 2C28A 1WD6A 3UVJA 4U6PA 3PYGA 5J2PA 3B82A 3E2EA 3DOMB 4WE1B 3GYNA 3IN5A 4FS1A 3MM5B 1H2UX 3DNCA 1VISA 4J9KA 3CJ2A 5KFSA 3QZ8A 1T05A 2YWFA 4OYIA 3CDEA 3CGIA 2CXEA 1HNIA 1SJRA 2RF2A 1NSQA 4X2BA 5HI7A 4MFBA 3KKFA 4WP9A 3VAJA 3BS9A 5AXLA 2CIMA 2L08A 3BSCA 4MMOA 2LFVA 3CJ3A 3BSAA 3CJTA 2UVWA 1HW8A 3OTOJ 1UA0A 2ZE2A 4LVNP 4CLKA 2EVZA 4X84A 3LUYA 4JI6J 2OTJS 1YBTA 1UEVA 2RUGA 4F2SA 3PX0A 1U8SA 4Q5VA 4B9MA 1WKLA 1C2PA 2FHKA 3K8WA 4DR5F 2N7YA 4OJ3A 3I55S 3NP5A 4EZ9A 5E33A 5IV4A 2RE1A 1L3UA 3I82A 2CJBA 2JLFA 2P6TA 2X1BA 2A1BA 3FZBA 4ETZA 4DPTA 4B3SJ 4YQWA 1F2HA 2HNYB 4U7UD 1LXJA 3RBEA 3M1VA 5EHHA 3TYTA 4F02A 3H90A 2QEXS 1U2CA 2LDYA 1OWXA 4OX9F 4G3IA 4ZJQA 3QJJA 4Q0BA 5K20B 3PX4A 1S4EA 2C2MB 2F3JA 3HFZB 4DUZF 2KFNA 5DJBA 3TZXA 1RTHB 4OI0A 4NYOA 1NK8A 2OEJA 1FNOA 2CKWA 2IDLA 3RBDA 1B64A 3OT9A 4GC7A 4ZS6A 4XO0A 3S7RA 2QJ3A 1S5ZA 2B4UA 2DJWA 2UUAF 2FUG9 1JWWA 1SQFA 1WI6A 1FO1A 3SIPB 1WEYA 1ZM3A 4LF9J 3VF0B 5FDLA 2CQ4A 3EGVA 1Y5LB 1TUVA 4LF5F 2OHDA 1RAHB 1UETA 3SDEB 3DDIA 3MMCA 5KT4A 1WI8A 3PW7A 2UXDF 3SCLE 2V4JB 3R1HA 4J9UE 4USKA 2DNQA 4YB5A 3UW1A 5KT6A 2F9JA 1L3SA 3DGVA 1YG0A 3NCPA 4NRTA 2KTQA 4ZJLA 1U1MA 1PSDA 2E1MC 5ETOA 4JB8B 4PPDA 3E8OA 2H3EB 3NMAA 1HNXJ 3EGWB 4ZVTB 2EFGA 4PUOB 3PNIA 4B9UA 4XAKA 4PG8A 2GC8A 3H20A 4NL5A 2AYMA 4LVOP 1ACMB 1T94A 1G6BA 1R3NA 4PWDB 2QL5B 4PYDA 1JLBB 2NSBA 4UOHA 2NR0A 5DGBA 2XEXA 1N88A 3WDOA 2MKCA 3MAQA 3MGJA 4JI7F 2BJ1A 3OLAA 2DPJA 1Q0NA 3QJLA 1LKZA 5HROB 4NLXA 3FSXA 1XMOJ 2GVDB 5HBMA 1TUWA 1NJXA 1FD2A 4LR8A 1MSWD 2W7PA 1U09A 1IVZA 1JLFB 3GONA 3C6TB 1VBZA 2FGOA 3LAKA 4C8OA 2BE9B 2H65B 5AXKA 1UVLA 2LXFA 1S6QA 3V6HA 3NAHA 2IC3B 1HA1A 4ID8A 4WF9Q 4KV8B 3ULHA 4WKRA 2WONB 2HNZB 1G1XA 5DS7A 3K5MA 2IPOB 3KLFA 1S79A 1I5OB 1M90T 4HACA 3EGZA 2R7TA 4JOUA 1KFSA 2QGFB 3M8WA 3C6UB 1NKBA 5L46A 1OPIA 5J2NB 1HHSA 1X5OA 2YKPA 2CNOB 2EKYA 3CJKA 3LP1A 3NNCA 4WZMA 2FVRA 3D66A 4NZ6A 2ZUAA 2KXHA 2VC1A 3PJWA 3SI8A 5HANA 3GJTB 2DR5A 1FT8A 1TKZB 1Y7PA 5D4LA 1KLMA 1UZHA 2DNHA 1S4FA 2GAGC 2QA1A 2IJNA 5LL6d 3RUBL 4KFBA 3KUHA 3I0SB 3NGTA 4JI0F 4UOGA 3AJ2A 4OQJA 4U7CA 2Q6CA 3I4PA 3DYAA 4M5HA 3W64A 1N32J 2HVEA 1F3VA 1P1LA 2DGVA 3V4MA 5M2PA 4DFMA 4JI2J 1AB8A 5DG9A 4WU3A 2H51B 3ETOA 5CYJA 1HW9A 4OHWA 3ZXWA 2OAUA 2CQPA 4F7VA 1FEEA 3AA8A 1K73T 2FDNA 3O8WA 2MKIA 5F0UA 2YKNA 5KFNA 5J2MB 2OJ3A 1DRZA 1IR2A 4K2JA 2XS7A 3SYZA 2UXCF 2DGTA 5GAGU 1IBMJ 3NRBA 3VV2B 4DV6J 1PJ7A 1G2EA 4CH7A 4O4GB 3PJXA 2X1FA 2D9PA 5HATA 3CCTA 1DAXA 1OJ4A 1A7GE 2W8KA 3FJ2A 4BC9A 1XWLA 5ETNA 3V6KA 1SC6A 1RT5B 1YRXA 4GRSA 2N3LA 4LFCF 1FESA 2E9ZA 3X1LB 2HRUA 3IRXA 1RYRA 5A6PA 1KNZA 2L3MA 2V4QA 1OQ3A 1N48A 4ZPDA 2HBRB 1H7WA 4FF4A 1FCAA 1J5OA 1TVRA 4P2SA 4AQYJ 4OHVA 5C42A 1ZZNA 2VUGA 3PW0A 4P75A 5A8KA 1M5SA 1VK3A 3VAMA 1YJUA 4K4VA 3C2PA 1FRHA 5KFBA 1YSJA 2O01C 4DPYA 1QSSA 4IFYB 3RZAA 4B9VA 3BKFA 1MNEA 1U0SA 3WBZA 4I69A 2YX1A 2RDJA 3PRVA 1N5SA 1S0VA 3NGRA 1U24A 4TYAA 3TANA 2ZZMA 3KK1B 4ZP8A 4B08A 4A8FA 1HPZB 2U2FA 3THPA 4KRWA 2C2EA 4R8UB 2PC6A 4YB7A 3LP0A 1S1UA 3G2XA 3MM7A 2EFVA 4U8VA 2BE2B 2WOMB 3AD9C 3AOAA 3N28A 1VJWA 1S76D 3HXMA 3MMCB 1S57A 3M2VB 2IM3A 1JJCB 1FHTA 1M1GA 2QSFA 4LF4J 4URSA 3EUNA 4A8KA 2ZUGA 3TAMA 2A3JA 2LA4A 3M7VA 3MEEB 1BWVA 3TA0A 1HKAA 4ED3A 1MMLA 1RB0A 1TL7B 2B4VA 1GTHA 5A8WA 2NS1B 2AJ2A 1RACB 2HW3A 1U6FA 1X0FA 4OX8A 3R7BB 4PG7A 2M70A 4OZ1A 2DITA 4KQZA 4BLGA 3KK3B 5L1LA 3NS7B 2OTLS 3NS5A 5D4OA 2GMLA 3FEZA 2FLOA 2ZH5A 3QPIA 4PG5A 3KG1A 4CO3A 1FK9A 4I4BA 1PJ6A 3F41A 4LFAJ 4Y2AA 5F9LA 3EVOA 3HHKA 1N36F 2ZD1A 2AJ4A 5HMYA 4IDKA 3G96A 5LSLA 2V8DA 1Y11A 2QC3A 2FY8A 2BABA 2VFRA 1RHMB 3MXHP 4PWWA 2RD5C 4DL0C 4BBYA 4DFKA 1S6QB 3LALA 3FSIA 3S1TA 2JX2A 4ILMA 2GIFA 2HQDA 1RCXB 4DCJB 1QUVA 1U25A 3CULA 1MU2A 3AA9A 4M94A 2DNGA 3CJSA 3LWLA 4Y2KA 3DXSX 4PEOA 1NPPA 3ZTPA 1O8BA 1J5EF 1W2BR 3MDFA 2JRSA 1I1GA 2R3VA 2VG7A 3W66A 1GMWD 4ALZA 5HJYA 3H5YA 1KOOA 3NGDA 3ETMA 3HZEA 1T3NA 2J9DA 2EFNA 3K58A 4QWEA 3OPKA 4C8YA 3H42A 1KVJA 1BQXA 4LR7A 3N4WA 1EIYB 3EICA 5KFOA 2ZVSA 5HSPA 1I6JA 3ZZZA 5SZTA 4USIA 2FGCA 3CMES 4YHHF 3C15A 1YITS 4YN3B 4KFBB 4DG1A 1WUUA 5ADZA 1RHQB 2V50A 1RQ0A 3FGVA 2EPIA 3KJQB 4KGXB 3NCQA 3MM6A 2CPEA 2XLIA 3KDNA 4M5KA 2V4RA 4KAIA 3CIZA 3CCQS 2QFJA 5T7LA 4RPFA 2QLXA 4QIEA 4I7FA 4J7CA 3CF5Q 2ZH4A 2PA8D 1JLGA 4QW8A 2AZ1A 2W2PP 4ES3A 3CCES 1SC3B 2J5AA 1KS2A 1IKYA 2Z57B 1NUEA 3HLUA 4EI2A 3RAXA 1F0XA 1KTVA 1FFGB 2ZH6A 1AFJA 1FXLA 2GVZB 5CA5A 2XS5A 4RNMA 2YH1A 2HK3A 3THVA 4NX9A 3IS9B 4ZMMA 4DR7F 3H4DA 1RI7A 1WC4A 4FF2A 1NKEA 1MMDA 3P5TL 1FD8A 2G2YA 1MW7A 1S7IA 4EGLA 4P6QA 3H59A 3MEKA 1FKPB 1S0NA 2YKQA 3MMJA 1YJ9S 1H73A 1RWWB 3QRQA 3G87A 1RAEB 1GEHA 1LK7A 5T14A 3OJUA 2GAHC 3MZIA 3AXMA 2V2VA 4FYYB 1D09B 1O51A 3W9IA 4LR9A 5ETTA 1TL1A 2HFVA 4MIBA 2MHNA 5FIIA 1C1CB 2IY5B 1NJYA 2IJRA 1X4BA 1VRTB 3CC4S 3VQSA 5K8PA 2OD6A 1TVRB 3ZO7A 3UDEA 2VG5A 5DGAA 2ZC3A 3Q23A 1IKWA 1X4AA 3U27A 4R5PA 1X31C 1W2IA 1SV5A 3BR8A 3ZTOA 1FFSB 2DISA 2GCFA 4NZ7A 2MZRA 2DIVA 1KWMA 3QNWB 4KHMA 1TP7A 2ZM6F 4ED2A 2CPYA 2WHOA 1RWMB 4YMEA 3PYEA 5GMEA 2ZNZA 4ZVQB 4I2QA 4DHVA 4DMZA 2AU0A 3FBCA 4PQAA 4YY3F 2HHTA 4W98A 1ZM2A 4WK3A 4NA3A 4DL3A 2DGSA 4L3NA 4ZPAA 1DARA 3DKDA 2HHHJ 1FRLA 2B56A 4B3TF 3DLBA 2L9WA 3OFEA 2O66A 3SQGA 5D6GA 4NLSA 4CI0B 3R5BA 1MN7A 1HMVA 5D3GB 2WSCC 2IA0A 3AOCA 3CCZA 2N4CA 3CE8A 3T9ZA 2V2QA 1EZZB 1VQOS 2FJEB 2MGZB 3PTWA 2D41A 2CFXA 3A1YG 4JV2A 2FHJD 3VVTA 4YB1P 1V5VA 4X65F 1FRJA 1WC1A 3D7SB 4RWWA 4DQPA 1LWEA 2MZQA 2H4YB 5A2QU 3M2RA 2DGUA 4OYZA 2EBGA 2CQBA 1SC4B 1Y10A 4RW9A 3KLGA 3DGPA 2G1HA 2VV5A 1REVB 1S9GB 1C1BB 3T5KA 3MOZA 3TUPA 1NDLA 1Q95G 3L7UA 1S9EA 1KFDA 3G8QA 1WORA 2PEHA 4JI3J 1C4AA 1AUDA 1LW0A 2MSSA 3HVTB 3KLIA 3D3BJ 5GMKa 4TU8A 1SKSA 1OO0B 2MLXA 1WDDA 2G2ZA 3UDVA 2QRRA 1LXNA 4ZCIA 3CPWR 2Y8WA 4YFUA 4CLZA 2HFUA 2W24A 4MYTA 2DHXA 4ZCLA 5AE2A 1JXLA 3H5SA 4AT1B 1N34J 4Q43A 1HNWJ 3VGVA 1URRA 2KT5A 4MK8A 2P2CB 1T9WA 3MFHA 4FN5A 4RUCA 4Y00A 1MU2B 1XERA 1ZPVA 2LLZA 2DBBA 2M2BA 2BKNA 3AAWB 3TUJC 4DR4F 3MPWA 5L1JA 2KG0A 1KVKA 2Y3YA 3FQKA 5DLFA 3ICLA 2DY9A 3MPVA 2QN6B 1XIQA 1NO8A 1WC0A 2ZZTA 3CO0P 2AJQA 1FI4A 3RB3A 4PXEA 3AH6A 2VU5A 2A2CA 2WB1D 1PBUA 3MURP 5HN0A 5KT3A 5BYRA 4A8QA 2GQCA 3MEDB 2DIUA 3BN4A 2QA4G 4O3RA 3A8EA 2YKAA 4J9NA 2M4MA 1UA1A 4B9SA 5KFLA 4KGZB 4NLRA 3M2UB 5IV3A 2P9EA 2ZJPQ 2DRBA 2PT0A 3TVKA 2YH0A 1T03A 3HX9A 4RNFA 5F3ZA 1N0UA 2FHMA 1L3TA 3Q83A 1Y00A 2E29A 4PQUA 3H5UA 3MR7A 5E7OB 3OR2B 3FRYA 5CAAA 3UD5A 4RLEA 2GJ2A 3TAQA 2A0FB 1NEEA 1CQMA 2ILZA 3NCRA 1O6XA 2AEMA 2CNKB 3LGHA 1JLGB 2AMCB 2NXUA 2DGOA 1U48A 1O5JA 1IKYB 1W7WA 1I94J 5KT2A 5HAOA 4LSZB 3LO3A 1YQHA 1HBUA 2H1YA 2KRBA 1VQPS 4ECZA 4U67Q 4UT4A 5KG3A 4PXBA 3OVAA 3OXFA 3LP2A 2V63A 2M7SA 3TVYA 1VQKS 2NLWA 1XR7A 2OKQA 5D77A 3M8RA 2PN6A 1IWAA 3TZWA 2C1EB 2OEMA 1RT1B 2BACA 1JMTA 2K7JA 4F50A 2ZOMA 3ISNC 3CB4A 3GTYX 4FNIA 3DRSB 2JEJA 5JXSA 3NOGA 5B0AA 4NCAA 2W4CA 3B6BA 3ENWA 4X4UA 2ZITA 3DRRA 5GADI 5F8HA 3PW4A 1VC0A 3MD3A 1EJ7L 4CDIA 5M2UA 2ATLA 4KHRA 2GIRA 4MK7A 4G1IA 1TKXA 1TL1B 3H4BA 4ZN1A 4QQBA 5LSRA 3IG1B 1EKRA 2AWZA 1IKVB 4WFZA 3W63A 4DV7J 4DR6J 4CT9A 2G2OA 5K8MA 1XMOF 4NYPA 5J1EB 1FKAF 5D78A 4ZLPA 2N7CA 4H4OA 4WYWA 3OUYA 2QMWA 3O2IA 2AZ3A 3I0RA 3MMAA 1UCNA 5LMNJ 3R7SB 3IAM9 3M9NB 4DV4F 1FNXH 2FVCA 3QIDA 4OYMA 1XNRJ 1AT1B 2ASJA 4ZDNA 5C7PA 3ILOA 5A2QY 1VQSA 4QYZK 4I6YA 4ECXA 3RYLA 3SCIE 4M5LA 3R3TA 4UUWA 1DZ5A 3H8YA 2HSEB 3IR6B 4DR3J 5GAHI 5B7WA 2DHSA 2J0XA 2HRYA 2K2PA 3SQGB 2C22A 2ATCB 4Q45A 1U0HA 2PE8A 1HWUA 1HMVB 3RBZA 2DEJA 2LYVA 5KOXA 3OQ2A 3L95X 2XZDB 2NSCA 2R2SA 1L3VA 2NYHA 3PKYA 1S6PB 5IT0A 2OPQA 2O67A 3C8YA 4OI3A 3QATA 2LECA 2K3IA 4CO2A 3VHQA 2BVZA 5EX0A 2ROEA 1C0TB 5KFZA 2GO9A 2C2ZB 1UPMB 4DR1J 5ETKA 5F41A 2HBYB 2QL7B 3DGPB 4JP8A 1U47A 2HVHA 1VGYA 2QX0A 3CWJA 3JSMB 4LF8J 2QLFB 4OYOA 1SH0A 2CZ4A 3Q86A 2QTWA 4OZLA 1YKWA 2JFKA 2XB2D 4NLWA 2BZ2A 1W25A 2U1AA 1N5QA 4Z2XA 3KLIB 2QO3A 1HBNB 5KFMA 3E3XA 2HHUA 5C2GA 4N41A 3AHPA 2XZWA 4KKOA 1RK8A 1TMJA 4KE5A 1URNA 4MKAA 4GKKF 2NCKL 5FLXU 3PKMA 4JV0A 2LVWA 4H4MB 4DDFA 4DJBA 1JB0C 3PV8A 2N82B 2BMBA 3BGOP 3KHRA 1HWLA 1RHKB 4ECVA 4LBIA 4LRFA 3SCJE 7AT1B 4A48A 4RX6A 4NPOA 3A13A 2BRLA 2HBZB 1B4SA 1RBAA 1TKDA 2VA3A 5GAEI 4WFXA 1FVSA 4MKYA 2NQPA 3B78A 5F8NA 5DQHA 2WVEA 2AEJA 4CO5A 2YNHB 1LNQA 4NCGB 4C11B 3CCJS 4WTYA 2AQ4A 2A18A 2RVJA 4DR5J 5J1PA 2D9OA 4QIFA 1QTMA 2POKA 3BPSP 2GHPA 5K9FA 3MR6A 2EWHA 3HM9A 4LBHA 1OPZA 4JYAF 2J0WA 2R8IA 1RE1B 1OS5A 1B7YB 3N79A 2WZ1A 3CJRA 3MUMP 2AHOB 2KB2A 2LQ9A 1XEZA 2ERRA 2FJXA 2EG1A 1HR0F 4DCPB 4F3MA 1SIZA 4JI4J 5KFIA 2H48B 3BV8A 4RO0A 1FRKA 4K4YA 3AB4B 1D9DA 4ED6A 1EETA 4Y34A 5LT5A 1SKWA 4RBVA 2XBPA 3GLJA 2IBOA 4YUDA 2BV3A 3KK2A 4BDPA 4DUZJ 4HL9A 2LEPA 1I3OB 3H98A 4NLPA 1WG1A 1WSRA 3DRYA 2ILYA 1HWIA 3QGHA 4OJGA 1NLKL 4ECRA 1SUQB 2UUAJ 3WIVA 5JVGQ 4M5DA 4LF4F 2B8QA 2GV1A 3NGUA 2HMIA 2BQ3A 1NSAA 2A10A 3DU5A 4LF5J 4HTJA 3KMSA 1GAOA 3PVXA 2BANB 1CJUA 1Z4UA 2Y1JA 2AEFA 4YEAA 1WF0A 2YY3A 4M63A 2UXDJ 3K57A 2Z56B 4F4YA 2KI2A 3HJVA 1MLAA 2GGPB 2DT9A 4RBUA 4GVLA 4DR2F 3R2CJ 4Q8EA 4HHUA 3MM8A 3BGRA 3QFHA 2ZNYA 4G1PA 5ETQA 4DLEA 2O5DA 3R5JB 2IRYA 4HEA9 1EARA 4F04B 1RTJA 3G6XA 2CJYB 3HDSA 3W2VB 2HGLA 4C4WA 1M5VC 4LSLB 4NLQA 1R7IA 4EUVA 4ZLJA 3BGUA 4P73A 1TL5A 2E7XA 1BQNB 5KG6A 3I0RB 3MMAB 2BJ7A 2XMWA 1T9TA 5I3PA 3L3CA 1Y5IB 4HH0A 1EP4A 4USMA 4KPYA 2WSFC 2NUUG 4E98A 3QT5A 1Q7LB 2OPSB 2W4DA 5HLFA 4FYXB 3T5JA 2FPHX 1KQSR 4P2FA 4CNYA 1N5YA 3IFEA 4CZCA 4FP9A 1RAAB 5IM0A 4ANEA 1FDDA 4FF3A 5DZ7A 3KDOA 2RIJA 4WJBA 2COLA 1SL2A 4LMZA 4NXNF 2M8DB 3VALA 2LMIA 3CW2C 3QSIA 2M52A 2W2QP 4DS4A 5BJRA 4QOTA 1WHVA 3SV4A 4ZP9A 4DL4A 4I1TA 3R8YA 5AJ3F 3ADAC 4GC6A 2OPQB 4C9DA 3VWSA 3CD6S 1KQGB 2JL9A 4L76A 1KP6A 1HYSB 2DO4A 1HQEB 2YKOA 2VJUA 1RAOA 2HGMA 2YNGB 4D3HA 1JJ2R 3TJ9A 2VBYA 2R8GA 1NPKA 3OV7A 3FEYB 3V4IA 3TQ1A 2BM1A 5KFKA 3BB5A 1CLFA 2IM2A 3NY0A 2PO4A 3LWMA 1M5HA 3JSYA 1GX6A 1OY6A 2UUTA 1S1VA 4JI0J 1K1SA 2MTLA 5KFVA 2M8HA 2CPHA 4IG3A 1Q4RA 3Q8SB 2ALZA 3TR5A 3UR0A 3IC1A 3MD1A 2B43A 2QYCA 2UU9F 1MWZA 3NEKA 3E01B 5MAOA 4HVZA 4RW7B 3JTOA 2N4DA 3DI6B 2W9BA 4LRBA 4DFPA 5CZVA 2M5YA 1JLEA 2VFUA 1X5TA 3KOAA 2X3GA 4HI2A 1S1TA 1TAQA 3KUEA 3H0PA 2CJQA 2UUCF 3R5CA 2AX1A 1N0VC 4L73A 4RKUC 2VPXB 3UNGC 2YQ1A 2BUNA 3FQLA 2ABYA 3H2VE 3U7JA 1YJTA 3UNYA 5CD4H 4U7UK 4DPOA 2FZCB 1H0HB 3EPGA 3GWCA 2G0JA 4Z37A 3PIOQ 3D28A 4FVCA 4ECSA 1RCOB 4LFCJ 4FS2A 3V6JA 3SFGA 1Y3JA 2CPJA 2XMMA 1YTYA 2MEWA 3P96A 1FJEB 3ET6A 4QWBA 3TP2A 4B3MF 4IG0B 1Q5VA 1D9FA 1EETB 3M4XA 2HHWA 1IJEB 1YJVA 3LPYA 4HYKA 1RT3B 5DM6Q 1RWUA 3TZZA 1FRXA 3OL8A 3BQ0A 4X62J 4QJVA 2H5EA 4BWMA 3T41A 1QAXA 2GMJA 2MMYA 2OSQA 1AXQA 2R8KA 5A8RB 2HHHF 1N5VA 1VOMA 1GNKA 2V8GA 3P5BP 4M5DB 4F8RA 3PFEA 1DQ9A 3KNGA 3VGSA 1RU2A 2RU3A 2HZCA 4IH6A 1V3RA 1CC7A 4LREA 1ZZFA 1CJUB 3FSYA 3TI0A 2LU2A 5DDRC 2QFIA 2RRNA 2HAFA 2CZVC 4QIWD 2L9DA 2IM0A 2VOPA 3V81A 4FZVA 1RT2A 1UFLA 2KHCA 4PWUA 4PPZA 2FHOB 3NL0A 4WIQA 2IRXA 4RU2A 5KFUA 1T9UA 2GZOA 2UV8G 2R7RA 1SXLA 4ICLA 4YR2A 3HHLB 2CQGA 3TJ8A 5DQIA 6FDRA 2B8PA 4HHHA 2LKZA 4WWSA 4CYUB 2OFHX 4ECTA 3N9UC 5IOLA 1U1NA 3QIPA 2CJ9A 3WIUA 4Z7YA 1SKUB 4TY9A 2OPRA 2H5IB 4K4UA 1XNQJ 3BDEA 4PG6A 2Q66A 3DOLB 3QGPA 2F1FA 1CULB 3POTA 2EW9A 1VHIA 2VPZB 2HWHA 1LWXA 4NI2A 3CDWA 3HSGA 3D0IE 3JSBA 3BO2A 3UCGA 2X3DA 4CIOA 1CJVA 4MKBA 3QFWA 3PXGa 1M5PC 5HLFB 2W2MP 7FDRA 3D67A 3R5DA 1CS4A 2CQDA 2KXFA 2LXIA 1VC6A 1N5YB 1U2FA 2BW2A 4LF2A 3ZZUA 3M32A 4OX6A 1Y5NB 1S1WA 2HVDA 2GX8A 3CC2S 2FLPA 1VK8A 2QYGA 4X66F 1R6YA 2ASLA 1APSA 3C3LA 2ZH2A 1YJNS 4GO7X 3QLHA 1FJGF 5EWGA 5B0FA 4CM0A 4GVBB 4HR2A 2IJFA 2XYPB 1SL1A 3HD1A 4IO1A 4AL7A 4CWBA 1SVDA 3CJQA 4DFJA 2W4PA 3BBCA 3A4TA 1J5EJ 4CTAB 1UVJA 3GG1A 5IT9U 2Z2LA 4L3KA 4TQRA 1WKKA 2XWYA 1GFWB 2FY1A 2DNOA 4ED8A 1KD1T 1S0OA 1FJ7A 4OIXA 2CVEA 3EE3A 1VQ8S 1NK0A 3D54A 2MLYA 2DVIA 5KG2A 4N77A 3TQEA 2DHHA 4LF1A 4DSKA 2Y1RI 2CPZA 4IFVB 2F7VA 5CD4A 1D9AA 3EYZA 1JLAA 3ZTRA 4YHHJ 1UEKA 2A6OA 4DX5A 2HYIB 1S1VB 3DMJB 1FDNA 1QM9A 1Q79A 3HULA 3CDAA 4QWDA 3RRKA 3W8PA 2W2OP 3EZ5A 3HSJA 1Q1KA 4KIAA 3F0NA 3HP6A 4RR5A 2E66A 1D0EA 3MTJA 4HTIA 4UOCA 4O3OA 4OI1A 2APOA 3R5AA 3K5PA 1QD1A 1B0TA 3ITHB 1JNZB 3T6BA 5GAHU 1WOPA 3PEHA 4FVMA 4QR1A 3RW7A 1YBAA 4KT0C 2DR7A 4DR7J 2GW8A 2ZBRA 1TV6B 4O3NA 4A8XA 1JLCA 2B6AA 2WK4A 1KC8T 2HFSA 4ES2A 3RRGA 4ZCMA 2QLWA 1S48A 2PI5A 5ETLA 3ZTQA 3AODA 1NK4A 3FC9A 4MK9A 3G82A 4M5IA 3MUVP 1SL0A 2Q79A 2E1RA 4DV7F 3M8QA 3UFCX 3W5ZA 2J8AA 1K9MT 4A46A 3IP0A 3KYLA 1AZSA 5L9XA 1WHXA 1VBXA 1QY7A 4USJC 4RUHA 1RKIA 2VG6B 2B9XA 3SXLA 2GHVC 2IYIA 4YB6A 1RT6A 3AQOA 2P6SA 1HNVA 1N33F 4CNZA 3DOKA 2PMWA 1WELA 4ANCA 4DU7A 1CJKA 4XDDA 3J81j 1RWPB 2XMAA 1VHFA 1TL3A 1N4LA 1FXRA 3CD7A 4AD6A 3KJVB 3N0VA 4G6VB 1RTDA 1QSYA 5A0YA 2C3UA 2KKHA 1IXKA 2ZM6J 4KJIA 1DLOA 4RU9A 4K7QA 3ZZYA 4IR1A 1VQNS 1KHVA 4NLGA 4YOEA 4NMLA 4IOBA 4YY3J 2AYEA 1GK8A 2CJKA 1ZM9A 2IBKA 1UW4A 2B9WA 1VJQA 2MLZA 1TUGB 1MROB 2CJXB 1AYEA 5GAEU 3Q89A 2FC8A 5KAKA 2QIFA 2J9CA 1FKOB 2YWEA 3GIMA 4B3TJ 1IKXA 5ETPA 4I0WA 2YQ0A 1RA6A 2B5JA 3MPDA 3W62A 2F8MA 1S97A 3T1YJ 1FE0A 2MY8A 2F5GA 1X0PA 2XGPA 3QAUA 1JQGA 1WTBA 4ZITA 2WCXA 2C3PA 1DURA 1GXTA 2VB6A 4EU0A 2FD2A 1K0TA 2W9CB 1KTQA 2HZAA 2J7WA 1RT4A 2G0IA 4LSNB 3UN2A 2Y0BB 4LF8F 1NBEB 2J8SA 4IR9A 1REGX 3PYFA 4CH1A 4X65J 4I2PA 2VFVA 1G7CB 3I9ZA 3O44A 1SH2A 1HQUB 3L7OA 3NNHA 4NLUA 3QIPB 3DM2A 3VGUA 1C0UA 2DB1A 2I5JB 1SJFA 3POTB 3O3LA 4OYXA 5KFDA 3NWRA 2FYXA 4NI2B 3FZ2A 8RUCA 2K1RB 4DQIA 4C7QA 2ZH1A 2SXLA 1AW0A 1OYEA 1HD0A 1V9OA 4DOZA 4OYBA 1E6VB 4V19J 1R43A 2OI2A 2FQQB 5DQGA 5CQGA 2KL8A 1FDBA 4KH0B 4FNHA 4I56A 3DU6A 2DK2A 4NEZA 4TQSA 5K8NA 3HHNB 3ZNUA 3D6FB 3X3UA 4AL6A 5L39A 2V0NA 3EVWA 4FXDA 3QLHB 2CQ2A 4A8SA 3MOJB 1NPRA 1LFWA 2RNEA 4O44B 3IXQA 3GIKA 3NGSA 4DR4J 3M9OB 1F9EB 5KT7A 1Q8KA 5LOQA 4NZ0A 5HP1B 4JI4F 2R9LA 2NPFA 4DI6A 1KOHA 4R0EA 2R7OA 1UP1A 3GILA 4RNNA 2CDRB 3OFGA 1KRPA 1UPPA 2IAJA 3M9MB 4ZA1A 1TKTB 4DF8A 5CYMB 4F26A 2MDAA 6AT1B 2EFPA 2EI5A 4RW4A 1XQIA 3W5YA 1LW2B 1KVIA 1AROP 4IH7A 5I42A 3C16A 2ZOFA 4E2FB 2BEFA 3A8IA 4DV5F 4ZHRA 4ZPCA 2NXNA 1ZBTA 1PC5A 4C0OC 1PYSB 5ETVA 4O3PA 3N5BA 4DPXA 5IQQA 5KFHA 2YKMB 2OD4A 3TAPA 3NOCA 1BQMA 3IGVA 3MEGA 4O4RA 3CJ0A 1NMEB 3DDKA 2GIQA 2IVMA 3HHLD 4NE9C 5CHCB 4URGA 4CLSA 2B3TB 4J9VA 4JI5F 1X4FA 1NB2A 3C14A 3OSNA 5B0EA 3JAMU 3T3FA 3G9CA 3W2WA 1R89A 2BOPA 3FBFA 1K0VA 2GQ2A 2ZHOA 1KDNA 1NHKL 1K44A 1CQNA 2G1DA 3MHYA 2DYAA 4ILLA 4NASA 4K4ZA 1WOOA 3BREA 5J2QA 1NSPA 2PFDA 4RWXA 1R31A 2ZBIA 3Q24A 1UTAA 2E5IA 2UVRA 3QZ7A 3RAMA 4KPCA 4DSFA 2D3ZA 2YXLA 3OW2R 1HI8A 2KT2A 1RT6B 1QE1B 3ONQA 3KLHA 3RR8A 3DLGA 5EDWA 3OR1A 1YZ7A 4X4NA 3JYTB 1R0AB 1SBRA 4K5SA 3KJFB 1JJHA 2B4OA 3T5HA 3HSDA 5A0YB 4DV4J 2OPPA 3AQPA 4CT8A 2RRBA 4PABA 2HWIA 4ES1A 4EO6A 1HBMA 1KEKA 5C24B 3L4BC 2XNRA 3EXCX 3CCMS 4PG4A 3J7A1 4AFFA 4OLOA 1FX4A 2W25A 4LQ3A 1DTTA 2QMUB 3GFXA 2YNFA 4FKXA 1IKXB 3DLLQ 1VQMS 5EX3A 2Q3PA 2CG8A 4ZVOB 4N5SA 3BYRA 4DCOB 2FJWA 4ED4A 3K8VA 3BQ1A 2D74B 1VMBA 2BX6A 2DY1A 5RUBA 5DLGA 2CNLB 3AOBA 2X1GA 1DJ0A 1Z2LA 4Q2MA 3KTQA 2HHVA 1JKHA 3ZNJ1 1AFIA 1FTCA 2HWTA 4ZIWA 1RTIA 2PA3A 3UVJB 2KJVA 3UQSA 1DTQA 5J2PB 3QT8A 3D68A 4WXOA 2ACMA 4TKTA 4TYBA 3D2WA 1Q16B 4ELUA 9RUBA 4F4AA 4Z7CA 2XLJA 4L75A 4C8KA 1OMSA 3A8KA 3GP9A 2XSJA 5K14A 1T05B 1S1XA 2BJDA 2W7OA 5H9FJ 2E5LJ 1HNIB 3CC7S 2FJBB 4TU7A 2RF2B 4DU8A 4CM2A 2BA9A 5C25A 2GFFA 2RAQA 4YDXA 4MFBB 2NXEA 3GV5B 3PX6A 3KFWX 4DSIA 2CNNB 3TZYA 1NJIT 5AXNA 3J80U 3AD8C 1H3DA 1VBYA 3H5XA 4DL6A 3PW2A 4GKKJ 4DX8H 1X7VA 3CDBA 2VHGA 2ZE2B 3JXOA 5D4PA 2HS3A 4OYAA 2JHEA 3FFIA 2VD3A 2P9GA 4DEZA 1WEXA 2CPIA 3EZUA 4Q2LA 4A47A 3MMBA 2V9KA 4ID5A 1FWPA 2HHXA 5L1KA 3W60A 2QL9B 2HS4A 1GMUA 1RAGB 3CJ4A 1WKJA 3D1OA 4IH5A 3Q8QB 1HL6A 2Y1LB 3SQOP 3M1VB 4MYUA 1C4CA 2XHWA 1KQKA 5JUMA 3NS6A 1NHVA 5ITHA 3VAGA 2C42A 4JI8F 3TEGA 2ASYA 4DV3J 2WVBA 4HDHA 4JYAJ 3GCXP 2OMOA 2DR9A 2ZHBA 4Q0BB 5G0RA 2IAJB 2D7SA 2R7SA 5HVFA 1S77D 4NXMF 4OZ2A 3M05A 5KFFA 3JAMY 2AKWB 1HR0J 2HS0A 3M30A 4QW9A 2FTRA 4WTOB 4R0JA 4X62F 1LOUA 3VZHA 1AUSL 1U8WA 4USTA 1CEZA 2QG9B 2NPIA 4CLLA 1NH8A 2AJFE 3I32A 1RABB 1GT8A 4F4ZA 4DUYJ 1UAWA 3P45B 3F73A 4ECYA 3IBWA 5FDLB 3G71S 3DC2A 4QU7A 1BQMB 3DOMA 1RWOB 4WE1A 2YBVA 4CLYA 4S0MA 2JH3A 4TN2A 3MM5A 4OZ3A 2AF6A 2XCPA 1NHUA 5ETMA 2I8EA 3BO4A 3PDNA 3VZIA 3Q8UA 4OL8A 3CCVS 3HPOA 1GXUA 2FJDB 3A12A 5HMWA 1KN6A 3OVSA 2BQRA 2KT3A 2PEBA 1RHRB 1HWKA 2KYZA 1VLOA 1RWVB 3I5CA 2YWHA 1X5SA 3U02A 4JBCA 2VPWB 2UVVA 4DXLA 2V2ZA 2Z2MA 3GJRB 5KFXA 4DR2J 4DL2A 1GX5A 5D0EA 3TX0A 3TUZC 1VQYA 3HF5A 4ZVFA 3L7PA 2BDPA 1XNQF 2V9WA 3HFVA 2ASDA 5DG8A 3KHLA 1X5PA 4P10A 4F4KA 4IOAQ 4X4QA 2DKOB 4FDFA 3UDLA 3H2UB 2RHSB 3ISND 3KLHB 4ZPVR 5HBMB 2LEBA 1NK5A 1JLQA 5ETSA 3UWTA 3HT3A 3OR1B 4B3RJ 2V5HG 1M0SA 2DNZA 5L38A 4O0IA 1YBUA 2CQ3A 3A3NB 2HNYA 2QZ8A 2F8EX 2DD8S 4K59A 1T0TV 1H2VZ 2KJWA 3D0GE 2J9DE 3GR1A 4Q44A 1NB7A 2BE7D 1BLUA 5DDOC 1B0PA 3LH2S 3JQJA 1JXEA 3KLFB 3KHHA 4TLQA 4X64J 3R6GB 1FNMA 2E1PA 4HACB 2OLWA 4G65A 1GMWA 1RTHA 2RQMA 4ZK7M 2MQNA 3WC0A 3LOUA 4RUBA 2GQQA 4JI1F 4NXNJ 4LF6F 5HL7Q 3THTA 8ATCB 4J9PA 4I67A 3DFEA 4B3OA 3CJKB 1Q78A 1BWEA 1TK8A 3LP1B 5JVHQ 2KN4A 3WC2A 2D3O1 1NDKA 3BDPA 3L9ZA 2IMWP 4N47A 5AJ3J 1WHWA 4ATNA 3CXCR 2IVYA 4WFYA 3UN5A 4DV0F 2DNLA 3QRPA 1KLMB 1BXNA 2DRDA 1SJ1A 3SDEA 4ZVHA 1VRQC 2HQGA 4N76A 5MLCV 5HJXA 3FNNA 1XC9A 1ZAVA 2V4JA 1S49A 1T7PA 4DV1F 2C2DA 2HZVA 1F5BA 2PIIA 2B7BB 6FD1A 1R6VA 2Z8QA 3DYAB 2HEKA 3K59A 4AXIA 3MR2A 1F2GA 3RGIA 2E5HA 4KB7A 2VF3A 3ILIA 3P8BB 1KKHA 2MZ1A 1NK6A 3PRBA 4CLWA 3OL6A 1RAJA 3Q8RB 1R27B 3SCKE 3BKTA 4X4VA 1VDHA 2Z0GA 2R2TA 3K2YA 5LM7E 3PIPQ 1HWJA 3I56S 3M6VA 4OX7A 4PWDA 3HJFA 1JLBA 2MB0B 4IQMA 2YKNB 2R7QA 3EWGA 2ZFHA 2UU9J 5K5MA 3Q8PB 2RRAA 2BKOA 4Y65A 4IOCQ 2A2DA 4C2MA 3GFHA 1KR4A 1YWXA 4V19X 2G9OA 4ZPBA 1X9MA 2YX4A 2GVDA 4ID5B 1WHYA 3GV7B 1ZOTA 4XTTA 3MAHA 4BCAA 2J6SA 4F2RA 2CPFA 5DRKA 3EDQB 2UV8A 1JLFA 3GIIA 1PIEA 1S72S 1NU4A 2UUCJ 5KFAA 4Y28C 4Y2CA 2R8HA 4YS2A 1YVFA 5B0DA 3LF0A 4P74A 2MZSA 1FF2A 2E5GA 4R25A 2O1PA 2IC3A 2HHSA 3IRXB 3NLCA 4X4OA 1H72C 3M6WA 2UZAA 4KV8A 4IKAA 2WONA 3ZC4A 1H2TZ 5E2QA 2JWNA 1J5OB 1T02A 1T9YA 4ELTA 4ZN3A 3K89A 4AXJA 5C42B 2XSFA 3QSYB 3Q2TC 5A6WA 3JTNA 5A8KB 3C6UA 1YRTA 3O6QA 2DR6A 5J2NA 3K7RA 4B3MJ 1CPZA 3J7Z5 4HHJA 1SIWB 3K0JA 2Z58B 2DH7A 4MAKA 4WFAQ 2MXYA 2AYGA 2GHWA 2ROGA 1WOSA 1SCJB 2KM8C 4LRAA 3GPAA 2VICA 5THWA 3LP0B 1S1UB 3MM7B 4OI4A 2CWKA 4LQ9A 2FJAB 4B02A 3L09A 1N56A 3D6MB 3I0SA 1M5OC 2XNQA 2DEIA 4USUA 1IR1A 2B9YA 2R7UA 3HVRA 3FUYA 3BO3A 2M3DA 3TAMB 3T1YF 5CZXA 5KOWA 5F8MA 2FHJA 3G8SA 1U1LA 5AT1B 3LA0A 3CMQA 1H7XA 1L3KA 1W26A 4ENOA 3H25A 4C0BA 4Q8FA 5A8WB 1UEUA 4OZNA 4UTGA 3QO9A 5DDQC 4RL1A 4UW2A 3J7AN 5B08A 2IHR1 2B7CB 4BC7A 3BN7A 4NA1A 2ZOGA 1VIOA 5J2MA 4C8NA 5DETA 2RU9A 4MJKA 3SZ2A 3H40A 4C8MA 1NK9A 2HGNA 4IQXA 2VOOA 1ZYQA 4EO8A 4TU9A 5LSOA 4MIWA 1VS3A 4O4GA 1UFKA 3NG8A 5E41A 1FK9B 3UD4P 3ELHA 5E0OA 2FZGB 4F3QA 4KHPJ 1S59A 3D0HE 2QA2A 1SKRA 2AV5A 2ZD1B 1JLQB 3N6NA 2XGQA 2JC0A 4IDKB 1RT5A 2HHPA 3GJSB 4I68A 2HHQA 4LIWA 2FIUA 1YIJS 3R97A 3OJSA 2HQFA 1U1PA 1TZ0A 5KFTA 3GSIA 4DF4A 1ZS6A 5KG1A 3AFGA 4WYLA 2R2UA 1EB0A 2YPYA 1VBKA 1PYTA 1IWGA 1UWBA 1IBLF 2XHCA 4QZVB 3ZFVA 3RJMB 2AX0A 3ENQA 1PBAA 5H1SV 3PM9A 4RW6A 2W2NP 4X66J 2JC1A 2VZ9A 4IFYA 4Y0FA 3CD0A 3D6HB 4M5JA 2MQOA 3B8HA 2DO0A 2VG7B 4B3OB 1FJGJ 5IFMA 2XS2A 3NWGA 3KK1A 4L72B 4GKJF 4BS2A 1LWCA 1XN9A 4OHXA 1HPZA 4R8UA 2L9NA 2X7IA 2VQEJ 2DGXA 3FEXB 4P7TA 3BH6B 2BE2A 2WOMA 1FFWB 2MHEA 5B0CA 2XY5A 5FJ4A 2ZJRQ 4DZ6A 3WHIA 3C15B 3M2VA 2CQCA 4HT7A 2DNRA 3R7NB 4DG1B 4QYRA 4FKYA 3B4DA 3IWXA 2LCWA 2WB4A 5JJBA 1GH8A 3I9V9 3MEEA 4P2XA 3BJYA 3MM6B 1JX4A 2VKRA 4M8LA 1VYAA 4G1QA 1TL7A 4DV2F 3S6EA 5IQ6A 4KGKA 5T7LB 4I7FB 1Z1ZA 2BM0A 1JIHA 1RP5A 4FPIA 1IBKF 4F3OA 5KFYA 4P72A 1YHQS 3TARA 1FTRA 3OFHA 3KK3A 4ZVUB 3QGIA 1SC1B 2CAJA 3QQCD 3BSNA 3F56A 3NMRA 4B17A 1RHUB 1IJFB 2XYHB 3E51A 2JEIA 3C66A 3VTIA 1NCLA 2OMLA 1HFEL 2R7VA 1IQZA 4Y3CA 3VAIA 2GA7A 5IWAF 4AYBD 1H74A 2JZ5A 5BR8F 1UJ6A 1P9QC 3JSRA 1U26A 1L5UA 1EKSA 4EBCA 1KBRA 4ZVEA 3DDNA 1EAYC 3KLEA 3DLEA 2VA2A 4WP3A 1BE4A 1RKJA 3PJ9A 2VBWA 4OMFG 4U8YA 2R2RA 2I6WA 4P71A 4A8OA 4LF7F 2CZ9A 3W1YC 2I38A 3OTCA 2K06A 1RU1A 2QE5A 1AA1B 1MWQA 2PGCA 4DZDA 4FXVA 1UWAA 2I0XA 4PYAA 2VG5B 3J7YI 1IKWB 4WBFA 2YTCA 1XMQF 4R5PB 2HVZA 1SV5B 4FYWB 5CXTA 5I4MA 1OY9A 1RBLA 5JMNA 2UXBF 2LQ5A 3DN9A 1CJTA 4JV1A 4C3LA 3PR5B 1N33J 5D4NA 2UP1A 3M8PA 2CQ0A 2MJNA 4U95A 1S12A 2MKHA 2YQ3A 3VVUA 1BC6A 2W7AA 5KFPA 2M9KA 4CLPA 4I2QB 2GS8A 2VBXA 1NSKL 3QWPA 1UJ4A 1D3WA 3TA1A 1TFYA 2E7VA 5L9NA 3DHXA 2J6UA 3I96A 3HKZD 2DPIA 4OHYA 2R8JA 3TX8A 3GFYA 1X8DA 9ATCB 2OUGA 4KC5A 2D1CA 3OXGA 4FPRA 3ILLA 2ZH3A 5B09A 2VASA 2P5VA 1M5KC 3T9NA 3UN3A 2JLEA 5CABA 2JVRA 4ZIVA 3QO9B 2RH3A 2UVUA 2C2RA 1ZTTA 4CLFA 1WJ9A 1S6UA 1LWEB 2F4VF 3M2RB 2DCUB 2GVZA 2X51A 4RW9B 3KLGB 1U4BA 3IS9A 4LFBJ 1J27A 4DN0A 3WX8A 4WFNQ 1S9EB 5GVQA 3VAHA 4K4WA 2E5LF 3G8TA 1VQ7S 1TELA 1LW0B 3SFUA 2LQ8A 1VIXA 1N6QA 2BJ9A 3BGFA 1FKPA 2OP5A 3HZGA 1EHWA 1FEHA 5HQLA 2KHDA 2JJ4D 2MKYA 2EK1A 4OI2A 4ED5A 3KG0A 4NA2A 3GIJA 1C1CA 5I3UA 1QTNB 2RJZA 4F0HA 3D4JA 1VRTA 1RWKB 2ZDOA 1RWXB 4CO1A 1SQEA 3CJ8A 2F4FA 3T19A 1UWBB 2KDOA 3DXBA 3CUNA 3IM8A 1HI0P 5KFGA 3FMBA 4C3KA 4RW6B 2DH8A 3KWMA 2MQ8A 2IYGA 3JQKA 3GQCA 3OL7A 5E3AA 5DG7A 5D0RA 4PAAA 2MQMA 4H4KC 4MH8A 4DV3F 1ZM4A 3UCUP 1DQAA 1XBWA 4DX7A 1LWCB 4F4WA 4NLYA 3GE9A 4ZLNA 2MJUA 1LQ9A 4BWJA 5H9EJ 3HO1A 2VFTA 1H98A 4TNOA 1T03B 4ZP6A 3PZPA 2B51A 4NWBA 5BYQA 1HNZF 4PQUB 5LMUF 5D3GA 3QYYA 2BQUA 5FD1A 2V8HA 4G1QB 2KFYA 1K47A 3ILJA 2DCLA 1R0CB 4PCQA 2MGZA 4DUYF 2QT7A 3OTDA 3P49B 1TAUA 1N52B 1R8PA 3PHTA 4DV5J 4W90B 1HBUB 1REVA 2VPYB 1S9GA 1C1BA 5H9EK 4J91A 1VQ6S 1RWNB 3LP2B 4USWA 4NMXA 2GNKA 2E1CA 3T1HJ 3MCNA 1IM4A 4CCHA 4QR0A 3VR1A 4JV5F 3HVTA 1Y3KA 1U1OA 5KG4A 4QU6A 4J90A 1P6TA 4UQTA 4CH0S 2WRMA 3DLKA 4RW8A 1SJQA 1SB6A 4JI5J 3KLEB 3DLEB 2V69A 3IR7B 5LXRA 3DRRB 3SEOA 3H2LA 1ROFA 4IRCA 2W01A 1DY3A 3FBEA 2OELA 4K0KF 2PFFB 4AUKA 1TKXB 2KVQE 2HVIA 4D3GA 3P3DA 2L48A 4CLUA 2AJ1A 1NNDA 3LAMA 1RHJB 4IUFA 2ZWOA 3M8ZA 2E9RX 3LANA 2J0QD 2OEKA 2IMOA 3BBBA 3T1AA 1NJZA 2H5JB 2XWXA 4B3RF 3V6DA 4DQSA 4H4OB 1U6ZA 1TK5A 3OUYB 2WW4A 4K5RA 2HIQA 1CJTB 2WVDA 5HMZA 3BR9A 3M8PB 1A6LA 3TW0A 1UMJA 3MEDA 3TVZA 2H54B 1RDRA 2HPUA 5E3QA 4C48A 1NRKA 4U96A 4X64F 1GTEA 3M2UA 4F25A 2FZKB 4UF4A 1XJWB 3C19A 2YNIA 4MTPA 4TXSA 5U47A 2ADBA 3HHLC 1FE4A 2D69A 1S0MA 3QT7A 2MY7A 2AJ0A 3W8GA 2WVCA 2WSEC 8AT1B 4J9MA 1U0HB 1X4HA 5LJ3Y 3OR2A 1N54B 2BOAA 4Y2IA 3TUIC 3HVWA 2ZH9A 1FERA 2XI2A 4I6AA 2RILA 4P9SA 1IR0A 5FLXY 3I6PA 5CCMA 2DR8A 2G0CA 3GCWP 2UUBJ 2KZMA 3MR5A 4W92B 3BM7A 4CRJA 4NCBA 3MECA 2YPZA 5BXIA 1X4CA 4KGVB 3EJMA 3CIMA 1F5CA 2HRTA 3Q0AA 1NM2A 3UD3P 1YGYA 4UZCA 5BYSA 2JDJA 1Q8BA 2XULA 3PACA 1BUXA 1TU0B 4J5OA 4XDCA 4WIIA 5C2CA 2C2KB 2BRKA 4ZP7A 1RT1A 2JSXA 2BJEA 5F8LA 3KJNB 2FVPA 3R1LA 1V5IB 1U1KA 3DRSA
chains in the Genus database with same CATH topology
3BBCA 3BBFA 4DUTA 4ENOA 3BH7B 2BX6A 1NPKA 1U8WA 1B99A 3B6BA 2HURA 1WKKA 1NDPA 3NGSA 1MN7A 3R9LA 3VGVA 4UOHA 1S5ZA 3Q83A 2DXDA 1WKLA 1LWXA 3FBEA 3VGSA 3VGUA 3Q8YA 4EK2A 3ZTPA 3B54A 4WBFA 1PAEX 1BHNA 3EE3A 3EMTA 5CABA 3EM1A 2AZ1A 2NCKL 1NDKA 5CAAA 4ANEA 2ZUAA 4ANDA 1NUEA 1F6TA 3ZTOA 1WKJA 1NB2A 4DI6A 3VVTA 3ZTQA 3PRVA 3FC9A 3FBBA 4S0MA 3FKBA 3ZTRA 4F4AA 4UOFA 3NGRA 3Q8VA 1NCLA 3DDIA 1HLWA 3FBFA 1B4SA 3Q89A 3GPAA 1F3FA 3BBBA 3GP9A 3ELHA 3ETMA 1KDNA 2HVDA 1W7WA 1NHKL 2CWKA 3Q8UA 1K44A 1HIYA 1S59A 2DY9A 3G2XA 3VVUA 3WX8A 3ENAA 3FCWA 1XIQA 1NDCA 5BXIA 1NDLA 2DYAA 3EVOA 3EVMA 3NGTA 3L7UA 3BH6B 3EJMA 3EICA 2AZ3A 4UOGA 1NSQA 1HHQA 3FBCA 4C6AA 2VU5A 3MPDA 4W98A 1LEOA 1NSKL 1S57A 1UCNA 1PKUA 1NSPA 2HVEA 4DZ6A 3FCVA 3JS9A 1BUXA 1NLKL 2B8PA 1XQIA 3ZTSA 1BE4A 4FKXA 4O0NA 1MN9A 4FKYA 1JXVA 3PJ9A 4HR2A 1EHWA 1ZS6A 5IOLA 2BEFA 3DKDA 4KPCA 5C7PA 2DXFA 2B8QA 4ANCA 3Q86A 3NGUA 4F36A 2DXEA 3VGTA 1VYAA 3EVWA 4CP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BBC A;  3BBF A;  4DUT A;  4ENO A;  3BH7 B;  2BX6 A;  1NPK A;  1U8W A;  1B99 A;  3B6B A;  2HUR A;  1WKK A;  1NDP A;  3NGS A;  1MN7 A;  3R9L A;  3VGV A;  4UOH A;  1S5Z A;  3Q83 A;  2DXD A;  1WKL A;  1LWX A;  3FBE A;  3VGS A;  3VGU A;  3Q8Y A;  4EK2 A;  3ZTP A;  3B54 A;  4WBF A;  1PAE X;  1BHN A;  3EE3 A;  3EMT A;  5CAB A;  3EM1 A;  2AZ1 A;  2NCK L;  1NDK A;  5CAA A;  4ANE A;  2ZUA A;  4AND A;  1NUE A;  1F6T A;  3ZTO A;  1WKJ A;  1NB2 A;  4DI6 A;  3VVT A;  3ZTQ A;  3PRV A;  3FC9 A;  3FBB A;  4S0M A;  3FKB A;  3ZTR A;  4F4A A;  4UOF A;  3NGR A;  3Q8V A;  1NCL A;  3DDI A;  1HLW A;  3FBF A;  1B4S A;  3Q89 A;  3GPA A;  1F3F A;  3BBB A;  3GP9 A;  3ELH A;  3ETM A;  1KDN A;  2HVD A;  1W7W A;  1NHK L;  2CWK A;  3Q8U A;  1K44 A;  1HIY A;  1S59 A;  2DY9 A;  3G2X A;  3VVU A;  3WX8 A;  3ENA A;  3FCW A;  1XIQ A;  1NDC A;  5BXI A;  1NDL A;  2DYA A;  3EVO A;  3EVM A;  3NGT A;  3L7U A;  3BH6 B;  3EJM A;  3EIC A;  2AZ3 A;  4UOG A;  1NSQ A;  1HHQ A;  3FBC A;  4C6A A;  2VU5 A;  3MPD A;  4W98 A;  1LEO A;  1NSK L;  1S57 A;  1UCN A;  1PKU A;  1NSP A;  2HVE A;  4DZ6 A;  3FCV A;  3JS9 A;  1BUX A;  1NLK L;  2B8P A;  1XQI A;  3ZTS A;  1BE4 A;  4FKX A;  4O0N A;  1MN9 A;  4FKY A;  1JXV A;  3PJ9 A;  4HR2 A;  1EHW A;  1ZS6 A;  5IOL A;  2BEF A;  3DKD A;  4KPC A;  5C7P A;  2DXF A;  2B8Q A;  4ANC A;  3Q86 A;  3NGU A;  4F36 A;  2DXE A;  3VGT A;  1VYA A;  3EVW A;  4CP5 A; 
#chains in the Genus database with same CATH topology
 2Q1L A;  1N6Q B;  3A3P B;  2EFQ A;  4EYH B;  3M8S A;  2GMH A;  4KKO B;  5IZH A;  2VQF F;  5EWE A;  2DH9 A;  2M0G B;  3EMT A;  3W9J A;  3IG1 A;  2LEA A;  5I3U B;  1PC4 A;  2RT3 A;  1IKV A;  1G4C A;  2MKK A;  2HLT A;  4URQ U;  1KHW A;  3A8J A;  1YJR A;  4MKV A;  2NXC A;  5J1E A;  4B9N A;  1YX2 A;  4IYQ A;  2VIH A;  4HDG A;  4HT5 A;  3T6J A;  1UFW A;  3QT6 A;  2AGP A;  3BKU A;  1U49 A;  1PKU A;  3HVA A;  2JOQ A;  2AGO A;  3EGN A;  2IIH A;  3CDU A;  4L6V 3;  2DNY A;  4H54 A;  1JXV A;  5T41 A;  1S7H A;  2NRE A;  2GO8 A;  4EEY A;  3OTE A;  1CBK A;  4UY8 T;  1Y4Z B;  1R8A A;  3FMW A;  2W1B A;  3FRZ A;  2B0G A;  5G4D A;  2JLG A;  4OV6 A;  4YR0 A;  4JI8 J;  2XZT B;  4F0M A;  4OV1 A;  3LGN A;  1Q7Y T;  1SJ4 P;  3VCD A;  2BXJ A;  2V8P A;  4LRD A;  4NXM J;  3GFZ A;  2IDE A;  4BHQ A;  3KK2 B;  3HI9 A;  1S6P A;  4EFA C;  5HVG A;  1LK5 A;  2NZ4 A;  2CPD A;  5HO4 A;  1RAI B;  1DQ8 A;  4KY3 A;  2B9E A;  3KLV A;  1QAJ A;  3I5A A;  1VRU A;  1ZAW A;  3CJ5 A;  1HHQ A;  1K1Q A;  1C0T A;  3CCW A;  4DLG A;  1H6K X;  2ZZN A;  2C2N A;  1KSP A;  1T9V A;  3DHW C;  1WAC A;  2F63 A;  2F40 A;  1SH3 A;  2MKJ A;  4QWA A;  2KZZ A;  3PCO B;  2DXF A;  2HMI B;  3U1M A;  4E8U A;  3JSM A;  3PRD A;  4O3S A;  3N5F A;  4K4T A;  2MYF A;  3US5 A;  3J81 U;  1HBN A;  1KON A;  5ETR A;  4K4X A;  1NDP A;  3RW6 A;  2IA6 A;  1FDA A;  4F0K A;  2DXD A;  3DLK B;  2XMJ A;  3KMQ A;  4RW8 B;  4GO5 X;  2MQQ A;  1Q82 T;  2QMX A;  1LV5 A;  3N6L A;  3OTO F;  4A4J A;  1PGZ A;  4ZVP B;  4H4M A;  3MM8 B;  2C3Y A;  1N8R T;  1ZA1 B;  3BGR B;  4JI6 F;  5IS2 A;  2E5J A;  2JEG A;  3D6T B;  2YVS A;  4KYZ A;  2E7W A;  4EBD A;  3JQM A;  1RTJ B;  3I87 A;  3FCW A;  4EWT A;  2MPU A;  4ELV A;  4KHP F;  1ZPW X;  4ZLL A;  1O0P A;  2YNH A;  4QIG A;  2N3O A;  4NCG A;  1J2V A;  2VJV A;  2MQP A;  4C11 A;  4PXC A;  3V6D B;  4B3S F;  2HQC A;  2C3M A;  1WSV A;  3GYG A;  4DQR A;  4NEY A;  1U45 A;  1NKC A;  1UVM A;  5DDP C;  1EP4 B;  5AE1 A;  4ZOS A;  1I51 B;  1ELO A;  3D1Q A;  3W3S A;  3D1H A;  3OXL A;  2BJ8 A;  3G6V A;  4ZKA A;  4XK8 C;  4EK2 A;  2WW8 A;  4M5N A;  3FCH A;  5IM0 B;  1QAI A;  2HQ3 A;  1EQM A;  2YNI B;  1JK9 B;  4K4S A;  4K2X A;  5D0G A;  4C0H A;  4PR6 A;  2KO1 A;  3FBB A;  4OYW A;  1CVJ A;  4FYV B;  3SMZ A;  1WG4 A;  2RS8 A;  1KLN A;  4QR2 A;  3ZZT A;  3KNA A;  3PHE A;  2ZHA A;  3K5L A;  2EK6 A;  4TVA B;  1VFJ A;  4J9L A;  4LF9 F;  4N56 A;  3IBC B;  2VQE F;  1PAU B;  3MI7 X;  4JI1 J;  1D8Y A;  3TEH B;  1NH7 A;  1YK9 A;  4LF6 J;  5HQM A;  2DGQ A;  1VCT A;  1RXO B;  3SSR A;  2KU7 A;  1FWL A;  3MEC B;  1SUQ A;  4ITS A;  2XMK A;  2Z4P A;  4N7T A;  1V3S A;  1QSL A;  2NYI A;  3BGL A;  4KO0 A;  4DV0 J;  3BH7 B;  4TY8 A;  1P9Y A;  3QWU A;  2HK2 A;  3SSS A;  3V4I B;  4P7V A;  2BAN A;  4O23 A;  2DHA A;  3K17 A;  3J7Z T;  3OVB A;  1YRU A;  3J7Y U;  1HNX F;  1RLD A;  5CH7 B;  1BHN A;  2HQI A;  3MCO A;  2GGP A;  3CSK A;  4DV1 J;  2XMV A;  2YWW A;  2HFO A;  2OGU A;  4IG3 B;  3QRR A;  3PEJ A;  2KM8 B;  1RZM A;  1TQL A;  4QYZ J;  4NOH A;  2KFZ A;  4NRU A;  3BQ2 A;  1SQG A;  2YX7 A;  2MZJ A;  3ENA A;  2XTJ P;  5KFR A;  3UR3 C;  2CRL A;  2W9B B;  2AGQ A;  1QAY A;  3BSO A;  3W2V A;  1MMN A;  2XCA A;  1P8G A;  1JLE B;  4LSL A;  4K50 A;  1U02 A;  2H9Z A;  3FCV A;  3JS9 A;  2XQC A;  1H38 A;  4OLP A;  1S1T B;  2K3K A;  2ZBC A;  1BQN A;  1A9N B;  4ER8 A;  1VQ4 S;  5D15 A;  2RB7 A;  3WZ0 A;  1F5A A;  2CPX A;  2CWX A;  5EGY A;  4MT1 A;  2J9E A;  2NUH A;  1HI1 A;  1NZA A;  2ZWP A;  2CAD A;  4EZ6 A;  1MWY A;  4DX6 A;  4PRF A;  2ZBP A;  3I31 A;  1A0O B;  4P52 A;  4HKQ A;  2A6M A;  2OPS A;  5F8I A;  4AL5 A;  3MFI A;  4A8Y A;  4J9R A;  5IC4 B;  2DNP A;  5AXM A;  3MR3 A;  3QJP A;  1RT7 A;  3G4S S;  1M1K T;  4XIU A;  1S10 A;  5IT4 A;  1F9H A;  2ZVI A;  4OZ0 A;  3J81 Y;  2PI4 A;  3ET6 B;  2RKI A;  4F4X A;  1YJW S;  1HD1 A;  1D1U A;  5K8O A;  3IA0 A;  3LW5 C;  3VQT A;  4K8R A;  3M8Y A;  4WK1 A;  1VRU B;  1HYS A;  4DL5 A;  3PY8 A;  1HQE A;  3KUG A;  1F60 B;  2YNG A;  2LDI A;  3TOQ A;  1U1Q A;  2AYB A;  2XY6 A;  3BEG B;  4ZVS B;  4ECU A;  4NLO A;  2RDD A;  3QGG A;  3PG9 A;  1N32 F;  2M88 A;  5EUH A;  2DTJ A;  2QA4 S;  4RZR A;  4ZPW R;  1TMM A;  2KRR A;  4JI2 F;  3V2U C;  4CQ1 A;  2VBZ A;  2CVI A;  2R42 A;  4H4K A;  3V81 B;  2HAI A;  1RTZ A;  1WC3 A;  1OSC A;  1U2R A;  3RG6 A;  1RT2 B;  3OD2 A;  5F8G A;  1UKU A;  2XO6 A;  1XR5 A;  1P27 B;  3BYP A;  5KFE A;  2RQ4 A;  2CDQ A;  3E01 A;  4LFB F;  4ICL B;  2W9A A;  4RW7 A;  2G4B A;  3DI6 A;  1IBM F;  1LEO A;  4DV6 F;  2AIR B;  3RB0 A;  4A8M P;  1G3O A;  3GG0 A;  3KXD A;  1VR6 A;  1X9S A;  2X1A A;  3GMG A;  1X4D A;  2WBM A;  1KQF B;  4WZQ A;  2OPR B;  2Z2Y B;  3CNQ P;  4YP3 A;  3P6Y C;  2WVF A;  3KHG A;  1Y9O A;  2ZJQ Q;  4J9Q A;  3CED A;  1M1H A;  2HLU A;  2K8G A;  4RUA A;  2HND A;  3BZQ A;  5IT9 Y;  3HT0 A;  3DRP A;  3NXZ A;  2BJ3 A;  3MUT P;  2ZBQ A;  5HMX A;  1CJV B;  4LRC A;  2LP4 A;  4AQY F;  1WTF A;  1FVQ A;  1F6T A;  1X9W A;  1CS4 B;  2DGW A;  2I1R A;  1V6H A;  2XO7 A;  2XMU A;  3M32 B;  2VOD A;  1S1W B;  1B0V A;  2KVI A;  3ENV A;  1GXL A;  2CJA A;  2Q6B A;  4FF1 A;  4RBT A;  4IG0 A;  3TJA A;  3WX4 A;  4OX9 J;  4U9R A;  1NK7 A;  4PKD B;  3RB4 A;  1RT3 A;  4LUB A;  4IO9 Q;  3EDR B;  4QIV A;  2QSW A;  1IBL J;  2KH9 A;  3EZO A;  3MWB A;  4WFB Q;  5EN1 A;  3RBX A;  2EC2 A;  3QBC A;  5I3Q A;  2WAQ D;  4CP5 A;  3TWZ A;  5A8R A;  2XC9 A;  2UUW A;  2V68 A;  2HBQ B;  3Q22 A;  3PYD A;  1BD6 A;  2YWK A;  4WP8 A;  1HQ2 A;  5KFW A;  4DSE A;  4WU2 A;  4GKJ J;  4J37 A;  2K7K A;  1BGX T;  4KO0 B;  4ED7 A;  4N8O A;  2KG1 A;  4TY8 B;  3GJQ B;  1CC8 A;  2IRU A;  4CO4 A;  3AT1 B;  3OHB A;  2EG2 A;  3S8S A;  2AT1 B;  1JLA B;  4DSL A;  5F9N A;  1MG7 A;  4FBT A;  1T95 A;  4M95 A;  5HVH A;  3NAI A;  2QLB B;  1R0B G;  3ZZO A;  1HBO A;  2XY7 A;  2FLL A;  4IRD A;  3OFF A;  4L74 A;  3IR5 B;  2V8V A;  1QLN A;  4DV2 J;  5KFC A;  3HHL A;  5F0W A;  3OLB A;  5IXU A;  3VAF A;  5EWF A;  4MIA A;  3T1H F;  2ZKU A;  4OJH A;  1CSJ A;  4CYU A;  4WKY A;  1IBK J;  2E1A A;  2LA6 A;  3CCR S;  4LFA F;  1FRI A;  3VGT A;  1XMB A;  3MAA A;  4C8Z A;  3RR7 A;  4WPA A;  3SBM A;  5D0H A;  4M5M A;  4O3Q A;  3UDC A;  3DOL A;  1U6B A;  3IO1 A;  1TL4 A;  1CUL A;  3EXY A;  3HSZ A;  5E3R A;  4JI7 J;  1FA0 A;  2VFS A;  3R5G A;  2BKP A;  3IRW P;  2ZH7 A;  2C2O B;  1Q86 T;  2RQC A;  5IWA J;  1TFW A;  1JLC B;  4RNH A;  4KTQ A;  2B6A B;  1PAE X;  2BYC A;  3EM1 A;  5BR8 J;  1NXI A;  4Y2M A;  3I4H X;  2YWG A;  4I64 A;  3GIR A;  4C97 A;  3W61 A;  3M6U A;  1Q8L A;  3G82 B;  3RB6 A;  3KG4 A;  4ECW A;  1LWF A;  1QVF R;  3M8Q B;  2HKE A;  1RA7 A;  1X60 A;  5KTQ A;  3W65 A;  1RT7 B;  1AZS B;  2IFX A;  2J6T A;  4LF7 J;  1DHM A;  5CYQ A;  3MM9 A;  1FXD A;  3A3O B;  3W5X A;  3NBP A;  1UVN A;  2RKI B;  3D9B A;  4O0N A;  1HNV B;  5IC6 B;  4LT6 A;  3DOK B;  3BPD A;  1IM6 A;  4GVB A;  4AE5 A;  1XMQ J;  5AE3 A;  1CJK B;  2PMH A;  1T9X A;  2XM3 A;  3UCZ P;  2VDI A;  1VQ9 S;  2RSQ A;  1TL3 B;  1RLC L;  4CTA A;  3O1L A;  4NLV A;  3TO8 A;  2UXB J;  3R2D J;  4OZJ A;  1B3T A;  1Y0H A;  2OFG X;  1RTD B;  3OHA A;  2H4W B;  1JJ4 A;  1DLO B;  3RAQ A;  3CCU S;  2IM1 A;  3RRH A;  3PO5 A;  4FXW A;  1UL3 A;  1QJH A;  3V5R A;  3TA2 A;  2BBE A;  1SJ3 P;  3QMQ A;  2OSR A;  4KGM A;  2NZC A;  4OZ5 A;  1RSC A;  4IFV A;  2C3O A;  1Z2Z A;  3IWL A;  4X4S A;  3AJ1 A;  1NAQ A;  2VL1 A;  2MZT A;  3DMJ A;  1HIY A;  3K5N A;  2CQH A;  2Z2Z A;  4DPW A;  2FJV A;  2UUB F;  3OL9 A;  3HHD A;  2B5J B;  5F8J A;  5A76 A;  2E44 A;  3Q2S C;  3ZZR A;  5HQ8 A;  2VC0 A;  4USV A;  3SV3 A;  5F3T A;  4DL7 A;  3CTR A;  3MTK A;  1OQ6 A;  1JNR B;  2DNM A;  3U1L A;  3GYX B;  3IM9 A;  2Y8Y A;  1RT4 B;  4OI6 A;  3N01 A;  4QBU A;  4J9O A;  1Q5Y A;  4NLD A;  3UE2 A;  4I2P B;  5KG7 A;  2XG8 A;  3CD5 A;  2VON A;  2F4V J;  1TR0 A;  3ITH A;  1PO6 A;  2V2K A;  3DM2 B;  1C0U B;  3HCX A;  2EBE A;  3CMA S;  2UXC J;  5E5N A;  4DN9 A;  1RGV A;  1WG5 A;  3GR0 A;  1PJ5 A;  1TV6 A;  1R8H A;  4DSJ A;  2JNJ A;  2R4F A;  4ZCK A;  1V3Z A;  3OTB A;  2CA9 A;  2QV6 A;  1WWH A;  1WF1 A;  5CCL A;  3LQV A;  2HND B;  3LGM A;  3Q8V A;  1EX8 A;  3DRP B;  1D8Z A;  3HKW A;  2DNK A;  2MST A;  5B0G A;  2FVS A;  4C98 A;  1UVK A;  2PMZ D;  1QVG R;  3HD2 A;  2KXN B;  2AW0 A;  1ZH5 A;  1GQE A;  2Y1I A;  2D3O R;  2MKS A;  2LXU A;  3MPU B;  4Y6I A;  4DS5 A;  1N5T A;  2VG6 A;  1X4G A;  3BF4 A;  4ECQ A;  1IQT A;  2CQ1 A;  1T11 A;  2OIH A;  1RAF B;  4EMD A;  3NKY A;  1UJ5 A;  2RQK A;  1HAR A;  4KH1 B;  2VKZ G;  4PZV A;  3AB2 B;  2LQB A;  2B4P A;  1QUP A;  5E3P A;  5H9F K;  2J0S D;  2BR0 A;  3HK2 A;  4WCE Q;  2CQI A;  3KJV A;  3GB0 A;  1XR6 A;  3GU0 A;  5KG5 A;  1YJ7 A;  1NZ8 A;  3W7B A;  2Z30 B;  2XMT A;  1GMV A;  3CT9 A;  4JUZ A;  3R27 A;  1FWK A;  1SI9 A;  3UI3 A;  4QWC A;  5KFJ A;  5GAG I;  4X4R A;  4UQG A;  3MF5 A;  1YDL A;  3PO4 A;  4EYI B;  1S99 A;  1UW9 A;  4RNO A;  1MRO A;  1HLW A;  1S6O A;  2R7W A;  3ZZ0 A;  3EPI A;  5DM7 Q;  1B7F A;  3TRG A;  1E6Y A;  1FKO A;  2V67 A;  3OBI A;  2QLJ B;  3NGK A;  2ADC A;  3EX7 B;  3FK4 A;  4RW4 B;  4ED1 A;  2HFN A;  1HNZ J;  2O3D A;  1OYD A;  1YZ6 A;  5LMU J;  1HBO B;  3DRX A;  5I42 B;  3C16 B;  3PR4 A;  2WBR A;  1WNE A;  4XPC A;  2Y9H A;  2ZDP A;  2EC0 A;  4ZHR B;  2NXJ A;  3HHE A;  3DCA A;  3RU0 A;  2HG4 A;  2HFZ A;  3MCS A;  4ZJO A;  2RHQ B;  2W9C A;  3CCS S;  2AP6 A;  2RML A;  4LSN A;  1XTZ A;  1IUJ A;  4XPE A;  7FD1 A;  1ITP A;  4YDD B;  2F8H A;  4QPX A;  4JI3 F;  2ZEJ A;  1XK8 A;  2RDI A;  2VDH A;  3MEG B;  1IBC B;  5J1N A;  2ZH8 A;  1HQU A;  1TTH B;  2FVQ A;  3MAA B;  4V1A k;  3B54 A;  4CLT A;  3CCL S;  1UZD A;  2I5J A;  4AND A;  3C14 B;  1Q53 A;  2DHG A;  4USH A;  3W2W B;  1N34 F;  1HNW F;  1TK0 A;  3M6X A;  4JV5 J;  3PW5 A;  4DWI A;  2K1R A;  1F3F A;  1N36 J;  3C46 A;  2J7U A;  1E6V A;  4M5G A;  1SPB P;  1ULR A;  1NDC A;  3RTV A;  4TLR A;  2Y0S D;  5J2Q B;  2P9C A;  1LWF B;  1RUS A;  1RYS A;  1T8E A;  1WC5 A;  1WF2 A;  2OH2 A;  2PD1 A;  1T3O A;  4K0K J;  4UY8 5;  1BY9 A;  2LU1 A;  5CYQ B;  3MM9 B;  1RJJ A;  2ACY A;  2ZKT A;  3ISZ A;  3NBP B;  1RAD B;  4DPU A;  1F9F A;  4DQQ A;  5SUH A;  4LIR A;  3DLH A;  2HUR A;  1PYO B;  3DLJ A;  2FC9 A;  3DLG B;  4O44 A;  1RIS A;  3JTP A;  1VQ5 S;  3PFO A;  2ZC4 A;  3Q8Y A;  4ETX A;  4RJV A;  4N8N A;  1YLX A;  5KG0 A;  3JB9 k;  2JEF A;  4FBU A;  3FDS A;  1CG2 A;  1X4E A;  2F9D A;  2JFD A;  4ERD A;  5GAD U;  4DBQ A;  2OO4 A;  1VLY A;  2XI3 A;  5HP1 A;  2OPP B;  5GMD A;  2V94 A;  4UUX A;  3G86 A;  3IWN C;  3VAK A;  4FYD A;  2L41 A;  2MQL A;  1HBM B;  4EBE A;  4ZVR B;  3W9H A;  4C8L A;  1OSD A;  3HFK A;  1YI2 S;  4YR3 A;  4LJM A;  1TKT A;  5CYM A;  4B9L A;  2WTF A;  1DTT B;  2CYY A;  2V34 A;  1UVI A;  2YNF B;  3FVY A;  1QDU B;  4NLT A;  4C3M A;  3H7H B;  4Q7A A;  4ED0 A;  3IAS 9;  1MN9 A;  1LW2 A;  3IMQ J;  4OYP A;  1I94 F;  2IVF B;  2PDA A;  3J80 Y;  2JVO A;  3LPE A;  2Q43 A;  3AY0 A;  3F44 A;  4HH1 A;  1OY8 A;  2YKM A;  3GSD A;  4OHZ A;  2GJI A;  2GJF A;  3G6E S;  1WEZ A;  4CO0 A;  3SSQ A;  1JKH B;  4ILR A;  2BW7 A;  4QPT A;  4X4P A;  3GV8 B;  1B70 B;  1DBD A;  2ALY B;  1RTI B;  1FX2 A;  3T5L A;  4OJ1 A;  2EKN A;  1PCA A;  1DTQ B;  5L8R C;  4B9T A;  3P4U B;  1RBO B;  3AJD A;  2EFO A;  1DFD A;  3FKB A;  4UOF A;  3QAE A;  2EEY A;  5KT5 A;  2AD9 A;  1ZAX A;  4HI1 A;  1ICE B;  2XSJ B;  5K14 B;  2DRA A;  1S1X B;  3IBF B;  1FRM A;  2CG4 A;  1VI7 A;  2D3U A;  5LJ5 Y;  4F67 A;  4ZVG A;  2PSZ A;  5C25 B;  3EVM A;  3NNA A;  3I5B A;  3K5O A;  4X4T A;  3GZ7 A;  4PUO A;  2W8L A;  4C6A A;  1OIA A;  5E3C A;  4M1K A;  1LFP A;  3AXK A;  3OSP A;  3WQP A;  2G13 A;  1Q8I A;  3R6L B;  4DR6 F;  1S9F A;  4QCL A;  2ROP A;  3D5M A;  2VQF J;  3N6M A;  5DZ6 A;  2HIY A;  2J7K A;  3MCM A;  2F65 A;  1F1B B;  4F36 A;  3UPF A;  3BBF A;  3FFI B;  4I6W A;  4DUT A;  3UO0 A;  1R8B A;  5M2R A;  5KFQ A;  2R7X A;  5LMN F;  5HRO A;  5L1I A;  1QE1 A;  1K8A T;  3R9L A;  3MMB B;  2V6A A;  2I2Y A;  2LQJ A;  3CVK A;  2XLK A;  2P8I A;  1XNR F;  5C5J A;  4GMK A;  3G6Y A;  1ZET A;  3JYT A;  4KR0 B;  1R0A A;  3HMJ G;  3C6T A;  2DNN A;  5B0B A;  4UZB A;  1EQ0 A;  2VH7 A;  4KSE B;  5LXY A;  4P2M A;  3B4M A;  3ZZP A;  2FLN A;  4DR3 F;  1U7L A;  2RUS A;  3S01 A;  3TNV A;  1BMQ B;  5D8H B;  2CUY A;  1PG5 B;  2I9S A;  4E0D A;  3IGN A;  4A8W A;  2HNZ A;  4OFZ A;  1P1T A;  1IN0 A;  4W4M A;  5C24 A;  1HHT P;  1U1R A;  4HLB A;  1Q81 T;  3MPY A;  5G0R B;  1WC6 A;  3D3C J;  3ZTS A;  1E6Y B;  3CO9 A;  1NJW A;  3M30 B;  4ZPT R;  2EXU A;  1VQL S;  4NYZ A;  1PIL A;  1FJC A;  3U1N A;  5HK4 A;  2KYX A;  2DXE A;  4WXW A;  1ZTW A;  2RS2 A;  2XYG B;  4PXD A;  1WDT A;  4IRK A;  4KBI A;  2E9T A;  1B99 A;  4LBP A;  2FB0 A;  1R8C A;  2J76 E;  3LTO A;  5DO2 A;  3AD7 C;  4DR1 F;  1ZA2 B;  3O5T B;  4J9S A;  1VC5 A;  1TKZ A;  2C28 A;  1WD6 A;  3UVJ A;  4U6P A;  3PYG A;  5J2P A;  3B82 A;  3E2E A;  3DOM B;  4WE1 B;  3GYN A;  3IN5 A;  4FS1 A;  3MM5 B;  1H2U X;  3DNC A;  1VIS A;  4J9K A;  3CJ2 A;  5KFS A;  3QZ8 A;  1T05 A;  2YWF A;  4OYI A;  3CDE A;  3CGI A;  2CXE A;  1HNI A;  1SJR A;  2RF2 A;  1NSQ A;  4X2B A;  5HI7 A;  4MFB A;  3KKF A;  4WP9 A;  3VAJ A;  3BS9 A;  5AXL A;  2CIM A;  2L08 A;  3BSC A;  4MMO A;  2LFV A;  3CJ3 A;  3BSA A;  3CJT A;  2UVW A;  1HW8 A;  3OTO J;  1UA0 A;  2ZE2 A;  4LVN P;  4CLK A;  2EVZ A;  4X84 A;  3LUY A;  4JI6 J;  2OTJ S;  1YBT A;  1UEV A;  2RUG A;  4F2S A;  3PX0 A;  1U8S A;  4Q5V A;  4B9M A;  1WKL A;  1C2P A;  2FHK A;  3K8W A;  4DR5 F;  2N7Y A;  4OJ3 A;  3I55 S;  3NP5 A;  4EZ9 A;  5E33 A;  5IV4 A;  2RE1 A;  1L3U A;  3I82 A;  2CJB A;  2JLF A;  2P6T A;  2X1B A;  2A1B A;  3FZB A;  4ETZ A;  4DPT A;  4B3S J;  4YQW A;  1F2H A;  2HNY B;  4U7U D;  1LXJ A;  3RBE A;  3M1V A;  5EHH A;  3TYT A;  4F02 A;  3H90 A;  2QEX S;  1U2C A;  2LDY A;  1OWX A;  4OX9 F;  4G3I A;  4ZJQ A;  3QJJ A;  4Q0B A;  5K20 B;  3PX4 A;  1S4E A;  2C2M B;  2F3J A;  3HFZ B;  4DUZ F;  2KFN A;  5DJB A;  3TZX A;  1RTH B;  4OI0 A;  4NYO A;  1NK8 A;  2OEJ A;  1FNO A;  2CKW A;  2IDL A;  3RBD A;  1B64 A;  3OT9 A;  4GC7 A;  4ZS6 A;  4XO0 A;  3S7R A;  2QJ3 A;  1S5Z A;  2B4U A;  2DJW A;  2UUA F;  2FUG 9;  1JWW A;  1SQF A;  1WI6 A;  1FO1 A;  3SIP B;  1WEY A;  1ZM3 A;  4LF9 J;  3VF0 B;  5FDL A;  2CQ4 A;  3EGV A;  1Y5L B;  1TUV A;  4LF5 F;  2OHD A;  1RAH B;  1UET A;  3SDE B;  3DDI A;  3MMC A;  5KT4 A;  1WI8 A;  3PW7 A;  2UXD F;  3SCL E;  2V4J B;  3R1H A;  4J9U E;  4USK A;  2DNQ A;  4YB5 A;  3UW1 A;  5KT6 A;  2F9J A;  1L3S A;  3DGV A;  1YG0 A;  3NCP A;  4NRT A;  2KTQ A;  4ZJL A;  1U1M A;  1PSD A;  2E1M C;  5ETO A;  4JB8 B;  4PPD A;  3E8O A;  2H3E B;  3NMA A;  1HNX J;  3EGW B;  4ZVT B;  2EFG A;  4PUO B;  3PNI A;  4B9U A;  4XAK A;  4PG8 A;  2GC8 A;  3H20 A;  4NL5 A;  2AYM A;  4LVO P;  1ACM B;  1T94 A;  1G6B A;  1R3N A;  4PWD B;  2QL5 B;  4PYD A;  1JLB B;  2NSB A;  4UOH A;  2NR0 A;  5DGB A;  2XEX A;  1N88 A;  3WDO A;  2MKC A;  3MAQ A;  3MGJ A;  4JI7 F;  2BJ1 A;  3OLA A;  2DPJ A;  1Q0N A;  3QJL A;  1LKZ A;  5HRO B;  4NLX A;  3FSX A;  1XMO J;  2GVD B;  5HBM A;  1TUW A;  1NJX A;  1FD2 A;  4LR8 A;  1MSW D;  2W7P A;  1U09 A;  1IVZ A;  1JLF B;  3GON A;  3C6T B;  1VBZ A;  2FGO A;  3LAK A;  4C8O A;  2BE9 B;  2H65 B;  5AXK A;  1UVL A;  2LXF A;  1S6Q A;  3V6H A;  3NAH A;  2IC3 B;  1HA1 A;  4ID8 A;  4WF9 Q;  4KV8 B;  3ULH A;  4WKR A;  2WON B;  2HNZ B;  1G1X A;  5DS7 A;  3K5M A;  2IPO B;  3KLF A;  1S79 A;  1I5O B;  1M90 T;  4HAC A;  3EGZ A;  2R7T A;  4JOU A;  1KFS A;  2QGF B;  3M8W A;  3C6U B;  1NKB A;  5L46 A;  1OPI A;  5J2N B;  1HHS A;  1X5O A;  2YKP A;  2CNO B;  2EKY A;  3CJK A;  3LP1 A;  3NNC A;  4WZM A;  2FVR A;  3D66 A;  4NZ6 A;  2ZUA A;  2KXH A;  2VC1 A;  3PJW A;  3SI8 A;  5HAN A;  3GJT B;  2DR5 A;  1FT8 A;  1TKZ B;  1Y7P A;  5D4L A;  1KLM A;  1UZH A;  2DNH A;  1S4F A;  2GAG C;  2QA1 A;  2IJN A;  5LL6 d;  3RUB L;  4KFB A;  3KUH A;  3I0S B;  3NGT A;  4JI0 F;  4UOG A;  3AJ2 A;  4OQJ A;  4U7C A;  2Q6C A;  3I4P A;  3DYA A;  4M5H A;  3W64 A;  1N32 J;  2HVE A;  1F3V A;  1P1L A;  2DGV A;  3V4M A;  5M2P A;  4DFM A;  4JI2 J;  1AB8 A;  5DG9 A;  4WU3 A;  2H51 B;  3ETO A;  5CYJ A;  1HW9 A;  4OHW A;  3ZXW A;  2OAU A;  2CQP A;  4F7V A;  1FEE A;  3AA8 A;  1K73 T;  2FDN A;  3O8W A;  2MKI A;  5F0U A;  2YKN A;  5KFN A;  5J2M B;  2OJ3 A;  1DRZ A;  1IR2 A;  4K2J A;  2XS7 A;  3SYZ A;  2UXC F;  2DGT A;  5GAG U;  1IBM J;  3NRB A;  3VV2 B;  4DV6 J;  1PJ7 A;  1G2E A;  4CH7 A;  4O4G B;  3PJX A;  2X1F A;  2D9P A;  5HAT A;  3CCT A;  1DAX A;  1OJ4 A;  1A7G E;  2W8K A;  3FJ2 A;  4BC9 A;  1XWL A;  5ETN A;  3V6K A;  1SC6 A;  1RT5 B;  1YRX A;  4GRS A;  2N3L A;  4LFC F;  1FES A;  2E9Z A;  3X1L B;  2HRU A;  3IRX A;  1RYR A;  5A6P A;  1KNZ A;  2L3M A;  2V4Q A;  1OQ3 A;  1N48 A;  4ZPD A;  2HBR B;  1H7W A;  4FF4 A;  1FCA A;  1J5O A;  1TVR A;  4P2S A;  4AQY J;  4OHV A;  5C42 A;  1ZZN A;  2VUG A;  3PW0 A;  4P75 A;  5A8K A;  1M5S A;  1VK3 A;  3VAM A;  1YJU A;  4K4V A;  3C2P A;  1FRH A;  5KFB A;  1YSJ A;  2O01 C;  4DPY A;  1QSS A;  4IFY B;  3RZA A;  4B9V A;  3BKF A;  1MNE A;  1U0S A;  3WBZ A;  4I69 A;  2YX1 A;  2RDJ A;  3PRV A;  1N5S A;  1S0V A;  3NGR A;  1U24 A;  4TYA A;  3TAN A;  2ZZM A;  3KK1 B;  4ZP8 A;  4B08 A;  4A8F A;  1HPZ B;  2U2F A;  3THP A;  4KRW A;  2C2E A;  4R8U B;  2PC6 A;  4YB7 A;  3LP0 A;  1S1U A;  3G2X A;  3MM7 A;  2EFV A;  4U8V A;  2BE2 B;  2WOM B;  3AD9 C;  3AOA A;  3N28 A;  1VJW A;  1S76 D;  3HXM A;  3MMC B;  1S57 A;  3M2V B;  2IM3 A;  1JJC B;  1FHT A;  1M1G A;  2QSF A;  4LF4 J;  4URS A;  3EUN A;  4A8K A;  2ZUG A;  3TAM A;  2A3J A;  2LA4 A;  3M7V A;  3MEE B;  1BWV A;  3TA0 A;  1HKA A;  4ED3 A;  1MML A;  1RB0 A;  1TL7 B;  2B4V A;  1GTH A;  5A8W A;  2NS1 B;  2AJ2 A;  1RAC B;  2HW3 A;  1U6F A;  1X0F A;  4OX8 A;  3R7B B;  4PG7 A;  2M70 A;  4OZ1 A;  2DIT A;  4KQZ A;  4BLG A;  3KK3 B;  5L1L A;  3NS7 B;  2OTL S;  3NS5 A;  5D4O A;  2GML A;  3FEZ A;  2FLO A;  2ZH5 A;  3QPI A;  4PG5 A;  3KG1 A;  4CO3 A;  1FK9 A;  4I4B A;  1PJ6 A;  3F41 A;  4LFA J;  4Y2A A;  5F9L A;  3EVO A;  3HHK A;  1N36 F;  2ZD1 A;  2AJ4 A;  5HMY A;  4IDK A;  3G96 A;  5LSL A;  2V8D A;  1Y11 A;  2QC3 A;  2FY8 A;  2BAB A;  2VFR A;  1RHM B;  3MXH P;  4PWW A;  2RD5 C;  4DL0 C;  4BBY A;  4DFK A;  1S6Q B;  3LAL A;  3FSI A;  3S1T A;  2JX2 A;  4ILM A;  2GIF A;  2HQD A;  1RCX B;  4DCJ B;  1QUV A;  1U25 A;  3CUL A;  1MU2 A;  3AA9 A;  4M94 A;  2DNG A;  3CJS A;  3LWL A;  4Y2K A;  3DXS X;  4PEO A;  1NPP A;  3ZTP A;  1O8B A;  1J5E F;  1W2B R;  3MDF A;  2JRS A;  1I1G A;  2R3V A;  2VG7 A;  3W66 A;  1GMW D;  4ALZ A;  5HJY A;  3H5Y A;  1KOO A;  3NGD A;  3ETM A;  3HZE A;  1T3N A;  2J9D A;  2EFN A;  3K58 A;  4QWE A;  3OPK A;  4C8Y A;  3H42 A;  1KVJ A;  1BQX A;  4LR7 A;  3N4W A;  1EIY B;  3EIC A;  5KFO A;  2ZVS A;  5HSP A;  1I6J A;  3ZZZ A;  5SZT A;  4USI A;  2FGC A;  3CME S;  4YHH F;  3C15 A;  1YIT S;  4YN3 B;  4KFB B;  4DG1 A;  1WUU A;  5ADZ A;  1RHQ B;  2V50 A;  1RQ0 A;  3FGV A;  2EPI A;  3KJQ B;  4KGX B;  3NCQ A;  3MM6 A;  2CPE A;  2XLI A;  3KDN A;  4M5K A;  2V4R A;  4KAI A;  3CIZ A;  3CCQ S;  2QFJ A;  5T7L A;  4RPF A;  2QLX A;  4QIE A;  4I7F A;  4J7C A;  3CF5 Q;  2ZH4 A;  2PA8 D;  1JLG A;  4QW8 A;  2AZ1 A;  2W2P P;  4ES3 A;  3CCE S;  1SC3 B;  2J5A A;  1KS2 A;  1IKY A;  2Z57 B;  1NUE A;  3HLU A;  4EI2 A;  3RAX A;  1F0X A;  1KTV A;  1FFG B;  2ZH6 A;  1AFJ A;  1FXL A;  2GVZ B;  5CA5 A;  2XS5 A;  4RNM A;  2YH1 A;  2HK3 A;  3THV A;  4NX9 A;  3IS9 B;  4ZMM A;  4DR7 F;  3H4D A;  1RI7 A;  1WC4 A;  4FF2 A;  1NKE A;  1MMD A;  3P5T L;  1FD8 A;  2G2Y A;  1MW7 A;  1S7I A;  4EGL A;  4P6Q A;  3H59 A;  3MEK A;  1FKP B;  1S0N A;  2YKQ A;  3MMJ A;  1YJ9 S;  1H73 A;  1RWW B;  3QRQ A;  3G87 A;  1RAE B;  1GEH A;  1LK7 A;  5T14 A;  3OJU A;  2GAH C;  3MZI A;  3AXM A;  2V2V A;  4FYY B;  1D09 B;  1O51 A;  3W9I A;  4LR9 A;  5ETT A;  1TL1 A;  2HFV A;  4MIB A;  2MHN A;  5FII A;  1C1C B;  2IY5 B;  1NJY A;  2IJR A;  1X4B A;  1VRT B;  3CC4 S;  3VQS A;  5K8P A;  2OD6 A;  1TVR B;  3ZO7 A;  3UDE A;  2VG5 A;  5DGA A;  2ZC3 A;  3Q23 A;  1IKW A;  1X4A A;  3U27 A;  4R5P A;  1X31 C;  1W2I A;  1SV5 A;  3BR8 A;  3ZTO A;  1FFS B;  2DIS A;  2GCF A;  4NZ7 A;  2MZR A;  2DIV A;  1KWM A;  3QNW B;  4KHM A;  1TP7 A;  2ZM6 F;  4ED2 A;  2CPY A;  2WHO A;  1RWM B;  4YME A;  3PYE A;  5GME A;  2ZNZ A;  4ZVQ B;  4I2Q A;  4DHV A;  4DMZ A;  2AU0 A;  3FBC A;  4PQA A;  4YY3 F;  2HHT A;  4W98 A;  1ZM2 A;  4WK3 A;  4NA3 A;  4DL3 A;  2DGS A;  4L3N A;  4ZPA A;  1DAR A;  3DKD A;  2HHH J;  1FRL A;  2B56 A;  4B3T F;  3DLB A;  2L9W A;  3OFE A;  2O66 A;  3SQG A;  5D6G A;  4NLS A;  4CI0 B;  3R5B A;  1MN7 A;  1HMV A;  5D3G B;  2WSC C;  2IA0 A;  3AOC A;  3CCZ A;  2N4C A;  3CE8 A;  3T9Z A;  2V2Q A;  1EZZ B;  1VQO S;  2FJE B;  2MGZ B;  3PTW A;  2D41 A;  2CFX A;  3A1Y G;  4JV2 A;  2FHJ D;  3VVT A;  4YB1 P;  1V5V A;  4X65 F;  1FRJ A;  1WC1 A;  3D7S B;  4RWW A;  4DQP A;  1LWE A;  2MZQ A;  2H4Y B;  5A2Q U;  3M2R A;  2DGU A;  4OYZ A;  2EBG A;  2CQB A;  1SC4 B;  1Y10 A;  4RW9 A;  3KLG A;  3DGP A;  2G1H A;  2VV5 A;  1REV B;  1S9G B;  1C1B B;  3T5K A;  3MOZ A;  3TUP A;  1NDL A;  1Q95 G;  3L7U A;  1S9E A;  1KFD A;  3G8Q A;  1WOR A;  2PEH A;  4JI3 J;  1C4A A;  1AUD A;  1LW0 A;  2MSS A;  3HVT B;  3KLI A;  3D3B J;  5GMK a;  4TU8 A;  1SKS A;  1OO0 B;  2MLX A;  1WDD A;  2G2Z A;  3UDV A;  2QRR A;  1LXN A;  4ZCI A;  3CPW R;  2Y8W A;  4YFU A;  4CLZ A;  2HFU A;  2W24 A;  4MYT A;  2DHX A;  4ZCL A;  5AE2 A;  1JXL A;  3H5S A;  4AT1 B;  1N34 J;  4Q43 A;  1HNW J;  3VGV A;  1URR A;  2KT5 A;  4MK8 A;  2P2C B;  1T9W A;  3MFH A;  4FN5 A;  4RUC A;  4Y00 A;  1MU2 B;  1XER A;  1ZPV A;  2LLZ A;  2DBB A;  2M2B A;  2BKN A;  3AAW B;  3TUJ C;  4DR4 F;  3MPW A;  5L1J A;  2KG0 A;  1KVK A;  2Y3Y A;  3FQK A;  5DLF A;  3ICL A;  2DY9 A;  3MPV A;  2QN6 B;  1XIQ A;  1NO8 A;  1WC0 A;  2ZZT A;  3CO0 P;  2AJQ A;  1FI4 A;  3RB3 A;  4PXE A;  3AH6 A;  2VU5 A;  2A2C A;  2WB1 D;  1PBU A;  3MUR P;  5HN0 A;  5KT3 A;  5BYR A;  4A8Q A;  2GQC A;  3MED B;  2DIU A;  3BN4 A;  2QA4 G;  4O3R A;  3A8E A;  2YKA A;  4J9N A;  2M4M A;  1UA1 A;  4B9S A;  5KFL A;  4KGZ B;  4NLR A;  3M2U B;  5IV3 A;  2P9E A;  2ZJP Q;  2DRB A;  2PT0 A;  3TVK A;  2YH0 A;  1T03 A;  3HX9 A;  4RNF A;  5F3Z A;  1N0U A;  2FHM A;  1L3T A;  3Q83 A;  1Y00 A;  2E29 A;  4PQU A;  3H5U A;  3MR7 A;  5E7O B;  3OR2 B;  3FRY A;  5CAA A;  3UD5 A;  4RLE A;  2GJ2 A;  3TAQ A;  2A0F B;  1NEE A;  1CQM A;  2ILZ A;  3NCR A;  1O6X A;  2AEM A;  2CNK B;  3LGH A;  1JLG B;  2AMC B;  2NXU A;  2DGO A;  1U48 A;  1O5J A;  1IKY B;  1W7W A;  1I94 J;  5KT2 A;  5HAO A;  4LSZ B;  3LO3 A;  1YQH A;  1HBU A;  2H1Y A;  2KRB A;  1VQP S;  4ECZ A;  4U67 Q;  4UT4 A;  5KG3 A;  4PXB A;  3OVA A;  3OXF A;  3LP2 A;  2V63 A;  2M7S A;  3TVY A;  1VQK S;  2NLW A;  1XR7 A;  2OKQ A;  5D77 A;  3M8R A;  2PN6 A;  1IWA A;  3TZW A;  2C1E B;  2OEM A;  1RT1 B;  2BAC A;  1JMT A;  2K7J A;  4F50 A;  2ZOM A;  3ISN C;  3CB4 A;  3GTY X;  4FNI A;  3DRS B;  2JEJ A;  5JXS A;  3NOG A;  5B0A A;  4NCA A;  2W4C A;  3B6B A;  3ENW A;  4X4U A;  2ZIT A;  3DRR A;  5GAD I;  5F8H A;  3PW4 A;  1VC0 A;  3MD3 A;  1EJ7 L;  4CDI A;  5M2U A;  2ATL A;  4KHR A;  2GIR A;  4MK7 A;  4G1I A;  1TKX A;  1TL1 B;  3H4B A;  4ZN1 A;  4QQB A;  5LSR A;  3IG1 B;  1EKR A;  2AWZ A;  1IKV B;  4WFZ A;  3W63 A;  4DV7 J;  4DR6 J;  4CT9 A;  2G2O A;  5K8M A;  1XMO F;  4NYP A;  5J1E B;  1FKA F;  5D78 A;  4ZLP A;  2N7C A;  4H4O A;  4WYW A;  3OUY A;  2QMW A;  3O2I A;  2AZ3 A;  3I0R A;  3MMA A;  1UCN A;  5LMN J;  3R7S B;  3IAM 9;  3M9N B;  4DV4 F;  1FNX H;  2FVC A;  3QID A;  4OYM A;  1XNR J;  1AT1 B;  2ASJ A;  4ZDN A;  5C7P A;  3ILO A;  5A2Q Y;  1VQS A;  4QYZ K;  4I6Y A;  4ECX A;  3RYL A;  3SCI E;  4M5L A;  3R3T A;  4UUW A;  1DZ5 A;  3H8Y A;  2HSE B;  3IR6 B;  4DR3 J;  5GAH I;  5B7W A;  2DHS A;  2J0X A;  2HRY A;  2K2P A;  3SQG B;  2C22 A;  2ATC B;  4Q45 A;  1U0H A;  2PE8 A;  1HWU A;  1HMV B;  3RBZ A;  2DEJ A;  2LYV A;  5KOX A;  3OQ2 A;  3L95 X;  2XZD B;  2NSC A;  2R2S A;  1L3V A;  2NYH A;  3PKY A;  1S6P B;  5IT0 A;  2OPQ A;  2O67 A;  3C8Y A;  4OI3 A;  3QAT A;  2LEC A;  2K3I A;  4CO2 A;  3VHQ A;  2BVZ A;  5EX0 A;  2ROE A;  1C0T B;  5KFZ A;  2GO9 A;  2C2Z B;  1UPM B;  4DR1 J;  5ETK A;  5F41 A;  2HBY B;  2QL7 B;  3DGP B;  4JP8 A;  1U47 A;  2HVH A;  1VGY A;  2QX0 A;  3CWJ A;  3JSM B;  4LF8 J;  2QLF B;  4OYO A;  1SH0 A;  2CZ4 A;  3Q86 A;  2QTW A;  4OZL A;  1YKW A;  2JFK A;  2XB2 D;  4NLW A;  2BZ2 A;  1W25 A;  2U1A A;  1N5Q A;  4Z2X A;  3KLI B;  2QO3 A;  1HBN B;  5KFM A;  3E3X A;  2HHU A;  5C2G A;  4N41 A;  3AHP A;  2XZW A;  4KKO A;  1RK8 A;  1TMJ A;  4KE5 A;  1URN A;  4MKA A;  4GKK F;  2NCK L;  5FLX U;  3PKM A;  4JV0 A;  2LVW A;  4H4M B;  4DDF A;  4DJB A;  1JB0 C;  3PV8 A;  2N82 B;  2BMB A;  3BGO P;  3KHR A;  1HWL A;  1RHK B;  4ECV A;  4LBI A;  4LRF A;  3SCJ E;  7AT1 B;  4A48 A;  4RX6 A;  4NPO A;  3A13 A;  2BRL A;  2HBZ B;  1B4S A;  1RBA A;  1TKD A;  2VA3 A;  5GAE I;  4WFX A;  1FVS A;  4MKY A;  2NQP A;  3B78 A;  5F8N A;  5DQH A;  2WVE A;  2AEJ A;  4CO5 A;  2YNH B;  1LNQ A;  4NCG B;  4C11 B;  3CCJ S;  4WTY A;  2AQ4 A;  2A18 A;  2RVJ A;  4DR5 J;  5J1P A;  2D9O A;  4QIF A;  1QTM A;  2POK A;  3BPS P;  2GHP A;  5K9F A;  3MR6 A;  2EWH A;  3HM9 A;  4LBH A;  1OPZ A;  4JYA F;  2J0W A;  2R8I A;  1RE1 B;  1OS5 A;  1B7Y B;  3N79 A;  2WZ1 A;  3CJR A;  3MUM P;  2AHO B;  2KB2 A;  2LQ9 A;  1XEZ A;  2ERR A;  2FJX A;  2EG1 A;  1HR0 F;  4DCP B;  4F3M A;  1SIZ A;  4JI4 J;  5KFI A;  2H48 B;  3BV8 A;  4RO0 A;  1FRK A;  4K4Y A;  3AB4 B;  1D9D A;  4ED6 A;  1EET A;  4Y34 A;  5LT5 A;  1SKW A;  4RBV A;  2XBP A;  3GLJ A;  2IBO A;  4YUD A;  2BV3 A;  3KK2 A;  4BDP A;  4DUZ J;  4HL9 A;  2LEP A;  1I3O B;  3H98 A;  4NLP A;  1WG1 A;  1WSR A;  3DRY A;  2ILY A;  1HWI A;  3QGH A;  4OJG A;  1NLK L;  4ECR A;  1SUQ B;  2UUA J;  3WIV A;  5JVG Q;  4M5D A;  4LF4 F;  2B8Q A;  2GV1 A;  3NGU A;  2HMI A;  2BQ3 A;  1NSA A;  2A10 A;  3DU5 A;  4LF5 J;  4HTJ A;  3KMS A;  1GAO A;  3PVX A;  2BAN B;  1CJU A;  1Z4U A;  2Y1J A;  2AEF A;  4YEA A;  1WF0 A;  2YY3 A;  4M63 A;  2UXD J;  3K57 A;  2Z56 B;  4F4Y A;  2KI2 A;  3HJV A;  1MLA A;  2GGP B;  2DT9 A;  4RBU A;  4GVL A;  4DR2 F;  3R2C J;  4Q8E A;  4HHU A;  3MM8 A;  3BGR A;  3QFH A;  2ZNY A;  4G1P A;  5ETQ A;  4DLE A;  2O5D A;  3R5J B;  2IRY A;  4HEA 9;  1EAR A;  4F04 B;  1RTJ A;  3G6X A;  2CJY B;  3HDS A;  3W2V B;  2HGL A;  4C4W A;  1M5V C;  4LSL B;  4NLQ A;  1R7I A;  4EUV A;  4ZLJ A;  3BGU A;  4P73 A;  1TL5 A;  2E7X A;  1BQN B;  5KG6 A;  3I0R B;  3MMA B;  2BJ7 A;  2XMW A;  1T9T A;  5I3P A;  3L3C A;  1Y5I B;  4HH0 A;  1EP4 A;  4USM A;  4KPY A;  2WSF C;  2NUU G;  4E98 A;  3QT5 A;  1Q7L B;  2OPS B;  2W4D A;  5HLF A;  4FYX B;  3T5J A;  2FPH X;  1KQS R;  4P2F A;  4CNY A;  1N5Y A;  3IFE A;  4CZC A;  4FP9 A;  1RAA B;  5IM0 A;  4ANE A;  1FDD A;  4FF3 A;  5DZ7 A;  3KDO A;  2RIJ A;  4WJB A;  2COL A;  1SL2 A;  4LMZ A;  4NXN F;  2M8D B;  3VAL A;  2LMI A;  3CW2 C;  3QSI A;  2M52 A;  2W2Q P;  4DS4 A;  5BJR A;  4QOT A;  1WHV A;  3SV4 A;  4ZP9 A;  4DL4 A;  4I1T A;  3R8Y A;  5AJ3 F;  3ADA C;  4GC6 A;  2OPQ B;  4C9D A;  3VWS A;  3CD6 S;  1KQG B;  2JL9 A;  4L76 A;  1KP6 A;  1HYS B;  2DO4 A;  1HQE B;  2YKO A;  2VJU A;  1RAO A;  2HGM A;  2YNG B;  4D3H A;  1JJ2 R;  3TJ9 A;  2VBY A;  2R8G A;  1NPK A;  3OV7 A;  3FEY B;  3V4I A;  3TQ1 A;  2BM1 A;  5KFK A;  3BB5 A;  1CLF A;  2IM2 A;  3NY0 A;  2PO4 A;  3LWM A;  1M5H A;  3JSY A;  1GX6 A;  1OY6 A;  2UUT A;  1S1V A;  4JI0 J;  1K1S A;  2MTL A;  5KFV A;  2M8H A;  2CPH A;  4IG3 A;  1Q4R A;  3Q8S B;  2ALZ A;  3TR5 A;  3UR0 A;  3IC1 A;  3MD1 A;  2B43 A;  2QYC A;  2UU9 F;  1MWZ A;  3NEK A;  3E01 B;  5MAO A;  4HVZ A;  4RW7 B;  3JTO A;  2N4D A;  3DI6 B;  2W9B A;  4LRB A;  4DFP A;  5CZV A;  2M5Y A;  1JLE A;  2VFU A;  1X5T A;  3KOA A;  2X3G A;  4HI2 A;  1S1T A;  1TAQ A;  3KUE A;  3H0P A;  2CJQ A;  2UUC F;  3R5C A;  2AX1 A;  1N0V C;  4L73 A;  4RKU C;  2VPX B;  3UNG C;  2YQ1 A;  2BUN A;  3FQL A;  2ABY A;  3H2V E;  3U7J A;  1YJT A;  3UNY A;  5CD4 H;  4U7U K;  4DPO A;  2FZC B;  1H0H B;  3EPG A;  3GWC A;  2G0J A;  4Z37 A;  3PIO Q;  3D28 A;  4FVC A;  4ECS A;  1RCO B;  4LFC J;  4FS2 A;  3V6J A;  3SFG A;  1Y3J A;  2CPJ A;  2XMM A;  1YTY A;  2MEW A;  3P96 A;  1FJE B;  3ET6 A;  4QWB A;  3TP2 A;  4B3M F;  4IG0 B;  1Q5V A;  1D9F A;  1EET B;  3M4X A;  2HHW A;  1IJE B;  1YJV A;  3LPY A;  4HYK A;  1RT3 B;  5DM6 Q;  1RWU A;  3TZZ A;  1FRX A;  3OL8 A;  3BQ0 A;  4X62 J;  4QJV A;  2H5E A;  4BWM A;  3T41 A;  1QAX A;  2GMJ A;  2MMY A;  2OSQ A;  1AXQ A;  2R8K A;  5A8R B;  2HHH F;  1N5V A;  1VOM A;  1GNK A;  2V8G A;  3P5B P;  4M5D B;  4F8R A;  3PFE A;  1DQ9 A;  3KNG A;  3VGS A;  1RU2 A;  2RU3 A;  2HZC A;  4IH6 A;  1V3R A;  1CC7 A;  4LRE A;  1ZZF A;  1CJU B;  3FSY A;  3TI0 A;  2LU2 A;  5DDR C;  2QFI A;  2RRN A;  2HAF A;  2CZV C;  4QIW D;  2L9D A;  2IM0 A;  2VOP A;  3V81 A;  4FZV A;  1RT2 A;  1UFL A;  2KHC A;  4PWU A;  4PPZ A;  2FHO B;  3NL0 A;  4WIQ A;  2IRX A;  4RU2 A;  5KFU A;  1T9U A;  2GZO A;  2UV8 G;  2R7R A;  1SXL A;  4ICL A;  4YR2 A;  3HHL B;  2CQG A;  3TJ8 A;  5DQI A;  6FDR A;  2B8P A;  4HHH A;  2LKZ A;  4WWS A;  4CYU B;  2OFH X;  4ECT A;  3N9U C;  5IOL A;  1U1N A;  3QIP A;  2CJ9 A;  3WIU A;  4Z7Y A;  1SKU B;  4TY9 A;  2OPR A;  2H5I B;  4K4U A;  1XNQ J;  3BDE A;  4PG6 A;  2Q66 A;  3DOL B;  3QGP A;  2F1F A;  1CUL B;  3POT A;  2EW9 A;  1VHI A;  2VPZ B;  2HWH A;  1LWX A;  4NI2 A;  3CDW A;  3HSG A;  3D0I E;  3JSB A;  3BO2 A;  3UCG A;  2X3D A;  4CIO A;  1CJV A;  4MKB A;  3QFW A;  3PXG a;  1M5P C;  5HLF B;  2W2M P;  7FDR A;  3D67 A;  3R5D A;  1CS4 A;  2CQD A;  2KXF A;  2LXI A;  1VC6 A;  1N5Y B;  1U2F A;  2BW2 A;  4LF2 A;  3ZZU A;  3M32 A;  4OX6 A;  1Y5N B;  1S1W A;  2HVD A;  2GX8 A;  3CC2 S;  2FLP A;  1VK8 A;  2QYG A;  4X66 F;  1R6Y A;  2ASL A;  1APS A;  3C3L A;  2ZH2 A;  1YJN S;  4GO7 X;  3QLH A;  1FJG F;  5EWG A;  5B0F A;  4CM0 A;  4GVB B;  4HR2 A;  2IJF A;  2XYP B;  1SL1 A;  3HD1 A;  4IO1 A;  4AL7 A;  4CWB A;  1SVD A;  3CJQ A;  4DFJ A;  2W4P A;  3BBC A;  3A4T A;  1J5E J;  4CTA B;  1UVJ A;  3GG1 A;  5IT9 U;  2Z2L A;  4L3K A;  4TQR A;  1WKK A;  2XWY A;  1GFW B;  2FY1 A;  2DNO A;  4ED8 A;  1KD1 T;  1S0O A;  1FJ7 A;  4OIX A;  2CVE A;  3EE3 A;  1VQ8 S;  1NK0 A;  3D54 A;  2MLY A;  2DVI A;  5KG2 A;  4N77 A;  3TQE A;  2DHH A;  4LF1 A;  4DSK A;  2Y1R I;  2CPZ A;  4IFV B;  2F7V A;  5CD4 A;  1D9A A;  3EYZ A;  1JLA A;  3ZTR A;  4YHH J;  1UEK A;  2A6O A;  4DX5 A;  2HYI B;  1S1V B;  3DMJ B;  1FDN A;  1QM9 A;  1Q79 A;  3HUL A;  3CDA A;  4QWD A;  3RRK A;  3W8P A;  2W2O P;  3EZ5 A;  3HSJ A;  1Q1K A;  4KIA A;  3F0N A;  3HP6 A;  4RR5 A;  2E66 A;  1D0E A;  3MTJ A;  4HTI A;  4UOC A;  4O3O A;  4OI1 A;  2APO A;  3R5A A;  3K5P A;  1QD1 A;  1B0T A;  3ITH B;  1JNZ B;  3T6B A;  5GAH U;  1WOP A;  3PEH A;  4FVM A;  4QR1 A;  3RW7 A;  1YBA A;  4KT0 C;  2DR7 A;  4DR7 J;  2GW8 A;  2ZBR A;  1TV6 B;  4O3N A;  4A8X A;  1JLC A;  2B6A A;  2WK4 A;  1KC8 T;  2HFS A;  4ES2 A;  3RRG A;  4ZCM A;  2QLW A;  1S48 A;  2PI5 A;  5ETL A;  3ZTQ A;  3AOD A;  1NK4 A;  3FC9 A;  4MK9 A;  3G82 A;  4M5I A;  3MUV P;  1SL0 A;  2Q79 A;  2E1R A;  4DV7 F;  3M8Q A;  3UFC X;  3W5Z A;  2J8A A;  1K9M T;  4A46 A;  3IP0 A;  3KYL A;  1AZS A;  5L9X A;  1WHX A;  1VBX A;  1QY7 A;  4USJ C;  4RUH A;  1RKI A;  2VG6 B;  2B9X A;  3SXL A;  2GHV C;  2IYI A;  4YB6 A;  1RT6 A;  3AQO A;  2P6S A;  1HNV A;  1N33 F;  4CNZ A;  3DOK A;  2PMW A;  1WEL A;  4ANC A;  4DU7 A;  1CJK A;  4XDD A;  3J81 j;  1RWP B;  2XMA A;  1VHF A;  1TL3 A;  1N4L A;  1FXR A;  3CD7 A;  4AD6 A;  3KJV B;  3N0V A;  4G6V B;  1RTD A;  1QSY A;  5A0Y A;  2C3U A;  2KKH A;  1IXK A;  2ZM6 J;  4KJI A;  1DLO A;  4RU9 A;  4K7Q A;  3ZZY A;  4IR1 A;  1VQN S;  1KHV A;  4NLG A;  4YOE A;  4NML A;  4IOB A;  4YY3 J;  2AYE A;  1GK8 A;  2CJK A;  1ZM9 A;  2IBK A;  1UW4 A;  2B9W A;  1VJQ A;  2MLZ A;  1TUG B;  1MRO B;  2CJX B;  1AYE A;  5GAE U;  3Q89 A;  2FC8 A;  5KAK A;  2QIF A;  2J9C A;  1FKO B;  2YWE A;  3GIM A;  4B3T J;  1IKX A;  5ETP A;  4I0W A;  2YQ0 A;  1RA6 A;  2B5J A;  3MPD A;  3W62 A;  2F8M A;  1S97 A;  3T1Y J;  1FE0 A;  2MY8 A;  2F5G A;  1X0P A;  2XGP A;  3QAU A;  1JQG A;  1WTB A;  4ZIT A;  2WCX A;  2C3P A;  1DUR A;  1GXT A;  2VB6 A;  4EU0 A;  2FD2 A;  1K0T A;  2W9C B;  1KTQ A;  2HZA A;  2J7W A;  1RT4 A;  2G0I A;  4LSN B;  3UN2 A;  2Y0B B;  4LF8 F;  1NBE B;  2J8S A;  4IR9 A;  1REG X;  3PYF A;  4CH1 A;  4X65 J;  4I2P A;  2VFV A;  1G7C B;  3I9Z A;  3O44 A;  1SH2 A;  1HQU B;  3L7O A;  3NNH A;  4NLU A;  3QIP B;  3DM2 A;  3VGU A;  1C0U A;  2DB1 A;  2I5J B;  1SJF A;  3POT B;  3O3L A;  4OYX A;  5KFD A;  3NWR A;  2FYX A;  4NI2 B;  3FZ2 A;  8RUC A;  2K1R B;  4DQI A;  4C7Q A;  2ZH1 A;  2SXL A;  1AW0 A;  1OYE A;  1HD0 A;  1V9O A;  4DOZ A;  4OYB A;  1E6V B;  4V19 J;  1R43 A;  2OI2 A;  2FQQ B;  5DQG A;  5CQG A;  2KL8 A;  1FDB A;  4KH0 B;  4FNH A;  4I56 A;  3DU6 A;  2DK2 A;  4NEZ A;  4TQS A;  5K8N A;  3HHN B;  3ZNU A;  3D6F B;  3X3U A;  4AL6 A;  5L39 A;  2V0N A;  3EVW A;  4FXD A;  3QLH B;  2CQ2 A;  4A8S A;  3MOJ B;  1NPR A;  1LFW A;  2RNE A;  4O44 B;  3IXQ A;  3GIK A;  3NGS A;  4DR4 J;  3M9O B;  1F9E B;  5KT7 A;  1Q8K A;  5LOQ A;  4NZ0 A;  5HP1 B;  4JI4 F;  2R9L A;  2NPF A;  4DI6 A;  1KOH A;  4R0E A;  2R7O A;  1UP1 A;  3GIL A;  4RNN A;  2CDR B;  3OFG A;  1KRP A;  1UPP A;  2IAJ A;  3M9M B;  4ZA1 A;  1TKT B;  4DF8 A;  5CYM B;  4F26 A;  2MDA A;  6AT1 B;  2EFP A;  2EI5 A;  4RW4 A;  1XQI A;  3W5Y A;  1LW2 B;  1KVI A;  1ARO P;  4IH7 A;  5I42 A;  3C16 A;  2ZOF A;  4E2F B;  2BEF A;  3A8I A;  4DV5 F;  4ZHR A;  4ZPC A;  2NXN A;  1ZBT A;  1PC5 A;  4C0O C;  1PYS B;  5ETV A;  4O3P A;  3N5B A;  4DPX A;  5IQQ A;  5KFH A;  2YKM B;  2OD4 A;  3TAP A;  3NOC A;  1BQM A;  3IGV A;  3MEG A;  4O4R A;  3CJ0 A;  1NME B;  3DDK A;  2GIQ A;  2IVM A;  3HHL D;  4NE9 C;  5CHC B;  4URG A;  4CLS A;  2B3T B;  4J9V A;  4JI5 F;  1X4F A;  1NB2 A;  3C14 A;  3OSN A;  5B0E A;  3JAM U;  3T3F A;  3G9C A;  3W2W A;  1R89 A;  2BOP A;  3FBF A;  1K0V A;  2GQ2 A;  2ZHO A;  1KDN A;  1NHK L;  1K44 A;  1CQN A;  2G1D A;  3MHY A;  2DYA A;  4ILL A;  4NAS A;  4K4Z A;  1WOO A;  3BRE A;  5J2Q A;  1NSP A;  2PFD A;  4RWX A;  1R31 A;  2ZBI A;  3Q24 A;  1UTA A;  2E5I A;  2UVR A;  3QZ7 A;  3RAM A;  4KPC A;  4DSF A;  2D3Z A;  2YXL A;  3OW2 R;  1HI8 A;  2KT2 A;  1RT6 B;  1QE1 B;  3ONQ A;  3KLH A;  3RR8 A;  3DLG A;  5EDW A;  3OR1 A;  1YZ7 A;  4X4N A;  3JYT B;  1R0A B;  1SBR A;  4K5S A;  3KJF B;  1JJH A;  2B4O A;  3T5H A;  3HSD A;  5A0Y B;  4DV4 J;  2OPP A;  3AQP A;  4CT8 A;  2RRB A;  4PAB A;  2HWI A;  4ES1 A;  4EO6 A;  1HBM A;  1KEK A;  5C24 B;  3L4B C;  2XNR A;  3EXC X;  3CCM S;  4PG4 A;  3J7A 1;  4AFF A;  4OLO A;  1FX4 A;  2W25 A;  4LQ3 A;  1DTT A;  2QMU B;  3GFX A;  2YNF A;  4FKX A;  1IKX B;  3DLL Q;  1VQM S;  5EX3 A;  2Q3P A;  2CG8 A;  4ZVO B;  4N5S A;  3BYR A;  4DCO B;  2FJW A;  4ED4 A;  3K8V A;  3BQ1 A;  2D74 B;  1VMB A;  2BX6 A;  2DY1 A;  5RUB A;  5DLG A;  2CNL B;  3AOB A;  2X1G A;  1DJ0 A;  1Z2L A;  4Q2M A;  3KTQ A;  2HHV A;  1JKH A;  3ZNJ 1;  1AFI A;  1FTC A;  2HWT A;  4ZIW A;  1RTI A;  2PA3 A;  3UVJ B;  2KJV A;  3UQS A;  1DTQ A;  5J2P B;  3QT8 A;  3D68 A;  4WXO A;  2ACM A;  4TKT A;  4TYB A;  3D2W A;  1Q16 B;  4ELU A;  9RUB A;  4F4A A;  4Z7C A;  2XLJ A;  4L75 A;  4C8K A;  1OMS A;  3A8K A;  3GP9 A;  2XSJ A;  5K14 A;  1T05 B;  1S1X A;  2BJD A;  2W7O A;  5H9F J;  2E5L J;  1HNI B;  3CC7 S;  2FJB B;  4TU7 A;  2RF2 B;  4DU8 A;  4CM2 A;  2BA9 A;  5C25 A;  2GFF A;  2RAQ A;  4YDX A;  4MFB B;  2NXE A;  3GV5 B;  3PX6 A;  3KFW X;  4DSI A;  2CNN B;  3TZY A;  1NJI T;  5AXN A;  3J80 U;  3AD8 C;  1H3D A;  1VBY A;  3H5X A;  4DL6 A;  3PW2 A;  4GKK J;  4DX8 H;  1X7V A;  3CDB A;  2VHG A;  2ZE2 B;  3JXO A;  5D4P A;  2HS3 A;  4OYA A;  2JHE A;  3FFI A;  2VD3 A;  2P9G A;  4DEZ A;  1WEX A;  2CPI A;  3EZU A;  4Q2L A;  4A47 A;  3MMB A;  2V9K A;  4ID5 A;  1FWP A;  2HHX A;  5L1K A;  3W60 A;  2QL9 B;  2HS4 A;  1GMU A;  1RAG B;  3CJ4 A;  1WKJ A;  3D1O A;  4IH5 A;  3Q8Q B;  1HL6 A;  2Y1L B;  3SQO P;  3M1V B;  4MYU A;  1C4C A;  2XHW A;  1KQK A;  5JUM A;  3NS6 A;  1NHV A;  5ITH A;  3VAG A;  2C42 A;  4JI8 F;  3TEG A;  2ASY A;  4DV3 J;  2WVB A;  4HDH A;  4JYA J;  3GCX P;  2OMO A;  2DR9 A;  2ZHB A;  4Q0B B;  5G0R A;  2IAJ B;  2D7S A;  2R7S A;  5HVF A;  1S77 D;  4NXM F;  4OZ2 A;  3M05 A;  5KFF A;  3JAM Y;  2AKW B;  1HR0 J;  2HS0 A;  3M30 A;  4QW9 A;  2FTR A;  4WTO B;  4R0J A;  4X62 F;  1LOU A;  3VZH A;  1AUS L;  1U8W A;  4UST A;  1CEZ A;  2QG9 B;  2NPI A;  4CLL A;  1NH8 A;  2AJF E;  3I32 A;  1RAB B;  1GT8 A;  4F4Z A;  4DUY J;  1UAW A;  3P45 B;  3F73 A;  4ECY A;  3IBW A;  5FDL B;  3G71 S;  3DC2 A;  4QU7 A;  1BQM B;  3DOM A;  1RWO B;  4WE1 A;  2YBV A;  4CLY A;  4S0M A;  2JH3 A;  4TN2 A;  3MM5 A;  4OZ3 A;  2AF6 A;  2XCP A;  1NHU A;  5ETM A;  2I8E A;  3BO4 A;  3PDN A;  3VZI A;  3Q8U A;  4OL8 A;  3CCV S;  3HPO A;  1GXU A;  2FJD B;  3A12 A;  5HMW A;  1KN6 A;  3OVS A;  2BQR A;  2KT3 A;  2PEB A;  1RHR B;  1HWK A;  2KYZ A;  1VLO A;  1RWV B;  3I5C A;  2YWH A;  1X5S A;  3U02 A;  4JBC A;  2VPW B;  2UVV A;  4DXL A;  2V2Z A;  2Z2M A;  3GJR B;  5KFX A;  4DR2 J;  4DL2 A;  1GX5 A;  5D0E A;  3TX0 A;  3TUZ C;  1VQY A;  3HF5 A;  4ZVF A;  3L7P A;  2BDP A;  1XNQ F;  2V9W A;  3HFV A;  2ASD A;  5DG8 A;  3KHL A;  1X5P A;  4P10 A;  4F4K A;  4IOA Q;  4X4Q A;  2DKO B;  4FDF A;  3UDL A;  3H2U B;  2RHS B;  3ISN D;  3KLH B;  4ZPV R;  5HBM B;  2LEB A;  1NK5 A;  1JLQ A;  5ETS A;  3UWT A;  3HT3 A;  3OR1 B;  4B3R J;  2V5H G;  1M0S A;  2DNZ A;  5L38 A;  4O0I A;  1YBU A;  2CQ3 A;  3A3N B;  2HNY A;  2QZ8 A;  2F8E X;  2DD8 S;  4K59 A;  1T0T V;  1H2V Z;  2KJW A;  3D0G E;  2J9D E;  3GR1 A;  4Q44 A;  1NB7 A;  2BE7 D;  1BLU A;  5DDO C;  1B0P A;  3LH2 S;  3JQJ A;  1JXE A;  3KLF B;  3KHH A;  4TLQ A;  4X64 J;  3R6G B;  1FNM A;  2E1P A;  4HAC B;  2OLW A;  4G65 A;  1GMW A;  1RTH A;  2RQM A;  4ZK7 M;  2MQN A;  3WC0 A;  3LOU A;  4RUB A;  2GQQ A;  4JI1 F;  4NXN J;  4LF6 F;  5HL7 Q;  3THT A;  8ATC B;  4J9P A;  4I67 A;  3DFE A;  4B3O A;  3CJK B;  1Q78 A;  1BWE A;  1TK8 A;  3LP1 B;  5JVH Q;  2KN4 A;  3WC2 A;  2D3O 1;  1NDK A;  3BDP A;  3L9Z A;  2IMW P;  4N47 A;  5AJ3 J;  1WHW A;  4ATN A;  3CXC R;  2IVY A;  4WFY A;  3UN5 A;  4DV0 F;  2DNL A;  3QRP A;  1KLM B;  1BXN A;  2DRD A;  1SJ1 A;  3SDE A;  4ZVH A;  1VRQ C;  2HQG A;  4N76 A;  5MLC V;  5HJX A;  3FNN A;  1XC9 A;  1ZAV A;  2V4J A;  1S49 A;  1T7P A;  4DV1 F;  2C2D A;  2HZV A;  1F5B A;  2PII A;  2B7B B;  6FD1 A;  1R6V A;  2Z8Q A;  3DYA B;  2HEK A;  3K59 A;  4AXI A;  3MR2 A;  1F2G A;  3RGI A;  2E5H A;  4KB7 A;  2VF3 A;  3ILI A;  3P8B B;  1KKH A;  2MZ1 A;  1NK6 A;  3PRB A;  4CLW A;  3OL6 A;  1RAJ A;  3Q8R B;  1R27 B;  3SCK E;  3BKT A;  4X4V A;  1VDH A;  2Z0G A;  2R2T A;  3K2Y A;  5LM7 E;  3PIP Q;  1HWJ A;  3I56 S;  3M6V A;  4OX7 A;  4PWD A;  3HJF A;  1JLB A;  2MB0 B;  4IQM A;  2YKN B;  2R7Q A;  3EWG A;  2ZFH A;  2UU9 J;  5K5M A;  3Q8P B;  2RRA A;  2BKO A;  4Y65 A;  4IOC Q;  2A2D A;  4C2M A;  3GFH A;  1KR4 A;  1YWX A;  4V19 X;  2G9O A;  4ZPB A;  1X9M A;  2YX4 A;  2GVD A;  4ID5 B;  1WHY A;  3GV7 B;  1ZOT A;  4XTT A;  3MAH A;  4BCA A;  2J6S A;  4F2R A;  2CPF A;  5DRK A;  3EDQ B;  2UV8 A;  1JLF A;  3GII A;  1PIE A;  1S72 S;  1NU4 A;  2UUC J;  5KFA A;  4Y28 C;  4Y2C A;  2R8H A;  4YS2 A;  1YVF A;  5B0D A;  3LF0 A;  4P74 A;  2MZS A;  1FF2 A;  2E5G A;  4R25 A;  2O1P A;  2IC3 A;  2HHS A;  3IRX B;  3NLC A;  4X4O A;  1H72 C;  3M6W A;  2UZA A;  4KV8 A;  4IKA A;  2WON A;  3ZC4 A;  1H2T Z;  5E2Q A;  2JWN A;  1J5O B;  1T02 A;  1T9Y A;  4ELT A;  4ZN3 A;  3K89 A;  4AXJ A;  5C42 B;  2XSF A;  3QSY B;  3Q2T C;  5A6W A;  3JTN A;  5A8K B;  3C6U A;  1YRT A;  3O6Q A;  2DR6 A;  5J2N A;  3K7R A;  4B3M J;  1CPZ A;  3J7Z 5;  4HHJ A;  1SIW B;  3K0J A;  2Z58 B;  2DH7 A;  4MAK A;  4WFA Q;  2MXY A;  2AYG A;  2GHW A;  2ROG A;  1WOS A;  1SCJ B;  2KM8 C;  4LRA A;  3GPA A;  2VIC A;  5THW A;  3LP0 B;  1S1U B;  3MM7 B;  4OI4 A;  2CWK A;  4LQ9 A;  2FJA B;  4B02 A;  3L09 A;  1N56 A;  3D6M B;  3I0S A;  1M5O C;  2XNQ A;  2DEI A;  4USU A;  1IR1 A;  2B9Y A;  2R7U A;  3HVR A;  3FUY A;  3BO3 A;  2M3D A;  3TAM B;  3T1Y F;  5CZX A;  5KOW A;  5F8M A;  2FHJ A;  3G8S A;  1U1L A;  5AT1 B;  3LA0 A;  3CMQ A;  1H7X A;  1L3K A;  1W26 A;  4ENO A;  3H25 A;  4C0B A;  4Q8F A;  5A8W B;  1UEU A;  4OZN A;  4UTG A;  3QO9 A;  5DDQ C;  4RL1 A;  4UW2 A;  3J7A N;  5B08 A;  2IHR 1;  2B7C B;  4BC7 A;  3BN7 A;  4NA1 A;  2ZOG A;  1VIO A;  5J2M A;  4C8N A;  5DET A;  2RU9 A;  4MJK A;  3SZ2 A;  3H40 A;  4C8M A;  1NK9 A;  2HGN A;  4IQX A;  2VOO A;  1ZYQ A;  4EO8 A;  4TU9 A;  5LSO A;  4MIW A;  1VS3 A;  4O4G A;  1UFK A;  3NG8 A;  5E41 A;  1FK9 B;  3UD4 P;  3ELH A;  5E0O A;  2FZG B;  4F3Q A;  4KHP J;  1S59 A;  3D0H E;  2QA2 A;  1SKR A;  2AV5 A;  2ZD1 B;  1JLQ B;  3N6N A;  2XGQ A;  2JC0 A;  4IDK B;  1RT5 A;  2HHP A;  3GJS B;  4I68 A;  2HHQ A;  4LIW A;  2FIU A;  1YIJ S;  3R97 A;  3OJS A;  2HQF A;  1U1P A;  1TZ0 A;  5KFT A;  3GSI A;  4DF4 A;  1ZS6 A;  5KG1 A;  3AFG A;  4WYL A;  2R2U A;  1EB0 A;  2YPY A;  1VBK A;  1PYT A;  1IWG A;  1UWB A;  1IBL F;  2XHC A;  4QZV B;  3ZFV A;  3RJM B;  2AX0 A;  3ENQ A;  1PBA A;  5H1S V;  3PM9 A;  4RW6 A;  2W2N P;  4X66 J;  2JC1 A;  2VZ9 A;  4IFY A;  4Y0F A;  3CD0 A;  3D6H B;  4M5J A;  2MQO A;  3B8H A;  2DO0 A;  2VG7 B;  4B3O B;  1FJG J;  5IFM A;  2XS2 A;  3NWG A;  3KK1 A;  4L72 B;  4GKJ F;  4BS2 A;  1LWC A;  1XN9 A;  4OHX A;  1HPZ A;  4R8U A;  2L9N A;  2X7I A;  2VQE J;  2DGX A;  3FEX B;  4P7T A;  3BH6 B;  2BE2 A;  2WOM A;  1FFW B;  2MHE A;  5B0C A;  2XY5 A;  5FJ4 A;  2ZJR Q;  4DZ6 A;  3WHI A;  3C15 B;  3M2V A;  2CQC A;  4HT7 A;  2DNR A;  3R7N B;  4DG1 B;  4QYR A;  4FKY A;  3B4D A;  3IWX A;  2LCW A;  2WB4 A;  5JJB A;  1GH8 A;  3I9V 9;  3MEE A;  4P2X A;  3BJY A;  3MM6 B;  1JX4 A;  2VKR A;  4M8L A;  1VYA A;  4G1Q A;  1TL7 A;  4DV2 F;  3S6E A;  5IQ6 A;  4KGK A;  5T7L B;  4I7F B;  1Z1Z A;  2BM0 A;  1JIH A;  1RP5 A;  4FPI A;  1IBK F;  4F3O A;  5KFY A;  4P72 A;  1YHQ S;  3TAR A;  1FTR A;  3OFH A;  3KK3 A;  4ZVU B;  3QGI A;  1SC1 B;  2CAJ A;  3QQC D;  3BSN A;  3F56 A;  3NMR A;  4B17 A;  1RHU B;  1IJF B;  2XYH B;  3E51 A;  2JEI A;  3C66 A;  3VTI A;  1NCL A;  2OML A;  1HFE L;  2R7V A;  1IQZ A;  4Y3C A;  3VAI A;  2GA7 A;  5IWA F;  4AYB D;  1H74 A;  2JZ5 A;  5BR8 F;  1UJ6 A;  1P9Q C;  3JSR A;  1U26 A;  1L5U A;  1EKS A;  4EBC A;  1KBR A;  4ZVE A;  3DDN A;  1EAY C;  3KLE A;  3DLE A;  2VA2 A;  4WP3 A;  1BE4 A;  1RKJ A;  3PJ9 A;  2VBW A;  4OMF G;  4U8Y A;  2R2R A;  2I6W A;  4P71 A;  4A8O A;  4LF7 F;  2CZ9 A;  3W1Y C;  2I38 A;  3OTC A;  2K06 A;  1RU1 A;  2QE5 A;  1AA1 B;  1MWQ A;  2PGC A;  4DZD A;  4FXV A;  1UWA A;  2I0X A;  4PYA A;  2VG5 B;  3J7Y I;  1IKW B;  4WBF A;  2YTC A;  1XMQ F;  4R5P B;  2HVZ A;  1SV5 B;  4FYW B;  5CXT A;  5I4M A;  1OY9 A;  1RBL A;  5JMN A;  2UXB F;  2LQ5 A;  3DN9 A;  1CJT A;  4JV1 A;  4C3L A;  3PR5 B;  1N33 J;  5D4N A;  2UP1 A;  3M8P A;  2CQ0 A;  2MJN A;  4U95 A;  1S12 A;  2MKH A;  2YQ3 A;  3VVU A;  1BC6 A;  2W7A A;  5KFP A;  2M9K A;  4CLP A;  4I2Q B;  2GS8 A;  2VBX A;  1NSK L;  3QWP A;  1UJ4 A;  1D3W A;  3TA1 A;  1TFY A;  2E7V A;  5L9N A;  3DHX A;  2J6U A;  3I96 A;  3HKZ D;  2DPI A;  4OHY A;  2R8J A;  3TX8 A;  3GFY A;  1X8D A;  9ATC B;  2OUG A;  4KC5 A;  2D1C A;  3OXG A;  4FPR A;  3ILL A;  2ZH3 A;  5B09 A;  2VAS A;  2P5V A;  1M5K C;  3T9N A;  3UN3 A;  2JLE A;  5CAB A;  2JVR A;  4ZIV A;  3QO9 B;  2RH3 A;  2UVU A;  2C2R A;  1ZTT A;  4CLF A;  1WJ9 A;  1S6U A;  1LWE B;  2F4V F;  3M2R B;  2DCU B;  2GVZ A;  2X51 A;  4RW9 B;  3KLG B;  1U4B A;  3IS9 A;  4LFB J;  1J27 A;  4DN0 A;  3WX8 A;  4WFN Q;  1S9E B;  5GVQ A;  3VAH A;  4K4W A;  2E5L F;  3G8T A;  1VQ7 S;  1TEL A;  1LW0 B;  3SFU A;  2LQ8 A;  1VIX A;  1N6Q A;  2BJ9 A;  3BGF A;  1FKP A;  2OP5 A;  3HZG A;  1EHW A;  1FEH A;  5HQL A;  2KHD A;  2JJ4 D;  2MKY A;  2EK1 A;  4OI2 A;  4ED5 A;  3KG0 A;  4NA2 A;  3GIJ A;  1C1C A;  5I3U A;  1QTN B;  2RJZ A;  4F0H A;  3D4J A;  1VRT A;  1RWK B;  2ZDO A;  1RWX B;  4CO1 A;  1SQE A;  3CJ8 A;  2F4F A;  3T19 A;  1UWB B;  2KDO A;  3DXB A;  3CUN A;  3IM8 A;  1HI0 P;  5KFG A;  3FMB A;  4C3K A;  4RW6 B;  2DH8 A;  3KWM A;  2MQ8 A;  2IYG A;  3JQK A;  3GQC A;  3OL7 A;  5E3A A;  5DG7 A;  5D0R A;  4PAA A;  2MQM A;  4H4K C;  4MH8 A;  4DV3 F;  1ZM4 A;  3UCU P;  1DQA A;  1XBW A;  4DX7 A;  1LWC B;  4F4W A;  4NLY A;  3GE9 A;  4ZLN A;  2MJU A;  1LQ9 A;  4BWJ A;  5H9E J;  3HO1 A;  2VFT A;  1H98 A;  4TNO A;  1T03 B;  4ZP6 A;  3PZP A;  2B51 A;  4NWB A;  5BYQ A;  1HNZ F;  4PQU B;  5LMU F;  5D3G A;  3QYY A;  2BQU A;  5FD1 A;  2V8H A;  4G1Q B;  2KFY A;  1K47 A;  3ILJ A;  2DCL A;  1R0C B;  4PCQ A;  2MGZ A;  4DUY F;  2QT7 A;  3OTD A;  3P49 B;  1TAU A;  1N52 B;  1R8P A;  3PHT A;  4DV5 J;  4W90 B;  1HBU B;  1REV A;  2VPY B;  1S9G A;  1C1B A;  5H9E K;  4J91 A;  1VQ6 S;  1RWN B;  3LP2 B;  4USW A;  4NMX A;  2GNK A;  2E1C A;  3T1H J;  3MCN A;  1IM4 A;  4CCH A;  4QR0 A;  3VR1 A;  4JV5 F;  3HVT A;  1Y3K A;  1U1O A;  5KG4 A;  4QU6 A;  4J90 A;  1P6T A;  4UQT A;  4CH0 S;  2WRM A;  3DLK A;  4RW8 A;  1SJQ A;  1SB6 A;  4JI5 J;  3KLE B;  3DLE B;  2V69 A;  3IR7 B;  5LXR A;  3DRR B;  3SEO A;  3H2L A;  1ROF A;  4IRC A;  2W01 A;  1DY3 A;  3FBE A;  2OEL A;  4K0K F;  2PFF B;  4AUK A;  1TKX B;  2KVQ E;  2HVI A;  4D3G A;  3P3D A;  2L48 A;  4CLU A;  2AJ1 A;  1NND A;  3LAM A;  1RHJ B;  4IUF A;  2ZWO A;  3M8Z A;  2E9R X;  3LAN A;  2J0Q D;  2OEK A;  2IMO A;  3BBB A;  3T1A A;  1NJZ A;  2H5J B;  2XWX A;  4B3R F;  3V6D A;  4DQS A;  4H4O B;  1U6Z A;  1TK5 A;  3OUY B;  2WW4 A;  4K5R A;  2HIQ A;  1CJT B;  2WVD A;  5HMZ A;  3BR9 A;  3M8P B;  1A6L A;  3TW0 A;  1UMJ A;  3MED A;  3TVZ A;  2H54 B;  1RDR A;  2HPU A;  5E3Q A;  4C48 A;  1NRK A;  4U96 A;  4X64 F;  1GTE A;  3M2U A;  4F25 A;  2FZK B;  4UF4 A;  1XJW B;  3C19 A;  2YNI A;  4MTP A;  4TXS A;  5U47 A;  2ADB A;  3HHL C;  1FE4 A;  2D69 A;  1S0M A;  3QT7 A;  2MY7 A;  2AJ0 A;  3W8G A;  2WVC A;  2WSE C;  8AT1 B;  4J9M A;  1U0H B;  1X4H A;  5LJ3 Y;  3OR2 A;  1N54 B;  2BOA A;  4Y2I A;  3TUI C;  3HVW A;  2ZH9 A;  1FER A;  2XI2 A;  4I6A A;  2RIL A;  4P9S A;  1IR0 A;  5FLX Y;  3I6P A;  5CCM A;  2DR8 A;  2G0C A;  3GCW P;  2UUB J;  2KZM A;  3MR5 A;  4W92 B;  3BM7 A;  4CRJ A;  4NCB A;  3MEC A;  2YPZ A;  5BXI A;  1X4C A;  4KGV B;  3EJM A;  3CIM A;  1F5C A;  2HRT A;  3Q0A A;  1NM2 A;  3UD3 P;  1YGY A;  4UZC A;  5BYS A;  2JDJ A;  1Q8B A;  2XUL A;  3PAC A;  1BUX A;  1TU0 B;  4J5O A;  4XDC A;  4WII A;  5C2C A;  2C2K B;  2BRK A;  4ZP7 A;  1RT1 A;  2JSX A;  2BJE A;  5F8L A;  3KJN B;  2FVP A;  3R1L A;  1V5I B;  1U1K A;  3DRS A; 
#chains in the Genus database with same CATH homology
 3BBC A;  3BBF A;  4DUT A;  4ENO A;  3BH7 B;  2BX6 A;  1NPK A;  1U8W A;  1B99 A;  3B6B A;  2HUR A;  1WKK A;  1NDP A;  3NGS A;  1MN7 A;  3R9L A;  3VGV A;  4UOH A;  1S5Z A;  3Q83 A;  2DXD A;  1WKL A;  1LWX A;  3FBE A;  3VGS A;  3VGU A;  3Q8Y A;  4EK2 A;  3ZTP A;  3B54 A;  4WBF A;  1PAE X;  1BHN A;  3EE3 A;  3EMT A;  5CAB A;  3EM1 A;  2AZ1 A;  2NCK L;  1NDK A;  5CAA A;  4ANE A;  2ZUA A;  4AND A;  1NUE A;  1F6T A;  3ZTO A;  1WKJ A;  1NB2 A;  4DI6 A;  3VVT A;  3ZTQ A;  3PRV A;  3FC9 A;  3FBB A;  4S0M A;  3FKB A;  3ZTR A;  4F4A A;  4UOF A;  3NGR A;  3Q8V A;  1NCL A;  3DDI A;  1HLW A;  3FBF A;  1B4S A;  3Q89 A;  3GPA A;  1F3F A;  3BBB A;  3GP9 A;  3ELH A;  3ETM A;  1KDN A;  2HVD A;  1W7W A;  1NHK L;  2CWK A;  3Q8U A;  1K44 A;  1HIY A;  1S59 A;  2DY9 A;  3G2X A;  3VVU A;  3WX8 A;  3ENA A;  3FCW A;  1XIQ A;  1NDC A;  5BXI A;  1NDL A;  2DYA A;  3EVO A;  3EVM A;  3NGT A;  3L7U A;  3BH6 B;  3EJM A;  3EIC A;  2AZ3 A;  4UOG A;  1NSQ A;  1HHQ A;  3FBC A;  4C6A A;  2VU5 A;  3MPD A;  4W98 A;  1LEO A;  1NSK L;  1S57 A;  1UCN A;  1PKU A;  1NSP A;  2HVE A;  4DZ6 A;  3FCV A;  3JS9 A;  1BUX A;  1NLK L;  2B8P A;  1XQI A;  3ZTS A;  1BE4 A;  4FKX A;  4O0N A;  1MN9 A;  4FKY A;  1JXV A;  3PJ9 A;  4HR2 A;  1EHW A;  1ZS6 A;  5IOL A;  2BEF A;  3DKD A;  4KPC A;  5C7P A;  2DXF A;  2B8Q A;  4ANC A;  3Q86 A;  3NGU A;  4F36 A;  2DXE A;  3VGT A;  1VYA A;  3EVW A;  4CP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...