2IJRA

Crystal structure of a protein api92 from yersinia pseudotuberculosis, pfam duf1281
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
282
structure length
282
Chain Sequence
ALEWCKNRLEITGRSVFVDIMQQWVTGEEVPLYRHAIQQSIRLFLAGCAGILKPVKCMEYPPFPRLVSHGTGSAVASNLAFQHWLDLLLKDAVLDGDTIRQIDRIYLQSGIASVKWETIPEGARQIITQLMARQYPDWFGVASWSSHINGADCWTKLGVMQEHACNCDMLMIIPTRLAIELNGNSQLLTGVSTTHDLYSHLYGMAWPSGQNIIWQRDRINSLRLDFDSPSYPPSAELMGELSAVFDCEIRHWYQEPVNGIRGYDCYDRGDHVDSGEYGAGPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein api92
publication title Crystal structure of a hypothetical protein from Yersinia pseudotuberculosis
rcsb
source organism Yersinia pseudotuberculosis
total genus 70
structure length 282
sequence length 282
ec nomenclature
pdb deposition date 2006-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06924 DUF1281 Protein of unknown function (DUF1281)
A PF18406 DUF1281_C Ferredoxin-like domain in Api92-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3530.10 Mainly Alpha Orthogonal Bundle Api92-like Api92-like 2ijrA02
3.30.70.1270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Api92-like domains 2ijrA01
2IJRA
chains in the Genus database with same CATH superfamily
3R7SB 4PWUA 4WK1A 3H20A 1HL6A 3HULA 2YQ3A 4JI2F 4WCEQ 4NLTA 4GC6A 1LW0B 2L9WA 1SKUB 1Y9OA 2RJZA 3EVMA 4CT9A 4TY8B 5T14A 5D0RA 2G13A 4MKBA 4IFYA 2FZGB 1T9TA 3Q8PB 3NEKA 2IJFA 4L76A 4WPAA 3MI7X 3BEGB 1HPZB 1QVFR 5K8MA 5D77A 1U49A 1EP4B 4X62F 4JI5F 2ASDA 3GR0A 1HBOA 5A0YB 4DSFA 5IM0A 3BQ2A 1RBAA 3AA9A 1TL1B 4LF8J 2WHOA 3EDRB 3BGRB 1EJ7L 1CC8A 4ZVQB 2E5HA 1TVRA 3M9NB 2Y9HA 4WK3A 4AXIA 3DOMB 1IJFB 3T5KA 2QZ8A 1OQ3A 2I5JB 5E0OA 4CO3A 1VQ5S 3DOKB 1ULRA 4TLQA 2MZJA 2ADBA 1VJWA 3DGVA 3VGTA 3FQLA 1DQ9A 5CZVA 3NRBA 1FXDA 3JAMY 4DR3F 4LFBF 4CLKA 1U1RA 5LMNJ 1TL5A 1RTJB 2ZZNA 4B9NA 3CCES 4ECUA 2EPIA 5KFMA 1RYSA 2ILZA 5LM7E 1WSRA 4O3SA 1YJWS 5D15A 3TUJC 2DBBA 3D54A 4JI7F 1KHVA 5B0BA 3EZOA 2ACYA 5E41A 1VQ8S 4NOHA 2P8IA 3KK2B 1QUPA 4K4ZA 5L46A 1FCAA 2XMKA 4MYTA 2UXCF 2WCXA 2AGQA 1K9MT 4RU2A 1SL1A 2KVIA 3D68A 3S7RA 2E5JA 5EWFA 1FJEB 3LAMA 1BWEA 3T6BA 1NPRA 4IYQA 4KHPF 2HBZB 3KHRA 2BM0A 2EC2A 4C98A 1X4HA 4QWDA 2HS4A 1TKXB 4WBFA 2W9BA 1S77D 5GMDA 3NG8A 1E6VB 1VDHA 4ILMA 3QIPA 4QPTA 2F8EX 2O5DA 6FDRA 1Y5NB 4M5JA 1VI7A 2LQ5A 2B0GA 2PE8A 3IN5A 2IY5B 1T94A 1TV6B 4J9VA 1R0BG 5T41A 3WIVA 3DLEA 2DY1A 4MFBB 4Q2LA 1X8DA 2B6AA 3Q89A 5DS7A 2L41A 4C48A 4MK7A 2QX0A 1XEZA 2K1RA 2IMOA 3NNAA 2BJDA 2MKSA 3QQCD 1PCAA 4NLRA 4RJVA 4Z2XA 5FIIA 4ED7A 4LF4J 2Q1LA 3J80U 3R1HA 5FDLA 5CABA 1OYDA 4OX8A 4OZLA 3HM9A 2BANB 1E6YB 4M95A 3WC2A 3B6BA 1ZA1B 5GAHI 3LQVA 2KH9A 1X9SA 3KHGA 1EIYB 4ECVA 4NLXA 3QGGA 4DZDA 1RT3B 2W01A 5BR8F 1XQIA 2VPXB 5A8RA 1FKOA 3PW5A 1FXLA 3DRRB 1T9WA 2VBWA 1NDLA 4P9SA 3M6UA 4RLEA 3IRXA 3VAJA 2MQ8A 3CVKA 4A8OA 3MR3A 1RBOB 4RNHA 3V6DA 2F1FA 1QJHA 3LPYA 1SUQA 4ZPAA 5HJYA 4UUWA 4DQPA 4USHA 4EZ6A 2ZDOA 4EEYA 5KT2A 2M9KA 2OEJA 4F50A 4BWMA 3MEGA 3UD3P 2QFIA 3Q8SB 4OZ0A 2QTWA 1N6QA 4JI2J 3K2YA 1XK8A 5C2GA 4WFZA 2LQ8A 1EHWA 2R2UA 4J9MA 2Z0GA 1Y0HA 3KK3B 3G6ES 1VFJA 4O3OA 2FJAB 1M1KT 1D9DA 1V3ZA 2RRBA 4NLOA 2MKJA 1LFWA 4CH1A 3EPIA 4DL2A 2GO8A 3OR1B 3DLHA 3MXHP 2QGFB 1X7VA 3BJYA 1WC3A 3P3DA 1AFJA 5H9FK 5J2PA 3G8TA 4RWXA 3R2CJ 3QWPA 1ZM9A 1FKPA 2AJFE 4X62J 3IS9B 4OJ3A 1RTDB 4JI5J 3KG0A 1S1WB 3H8YA 2YX4A 2A2DA 2P9CA 1V3SA 3X1LB 5ETQA 2UZAA 4LSNA 2QLJB 4I2QB 3SCIE 2OAUA 3MM9B 1GXLA 1X31C 2EVZA 4UY85 4CTAB 3SZ2A 2E44A 2QL5B 3SI8A 4OHYA 4I2PA 3CCSS 3BH7B 1PYSB 1U24A 2HMIB 3H2UB 1YZ7A 4OHWA 3OTDA 2PMZD 2E9TA 4DR3J 3UCUP 1RZMA 2HVEA 4DV2F 4DFMA 4YS2A 4LFBJ 1TKZA 1OIAA 1PC4A 3KDNA 4H4KA 2ZHOA 1NB7A 5J1NA 3GFHA 3FZ2A 3R5GA 2GHWA 4TU7A 4JI7J 3HSZA 2V68A 3FC9A 2BR0A 3D6FB 1FWPA 2B9XA 3D9BA 3DGPB 3BGUA 2FJEB 2BOAA 1Q53A 3D7SB 3ZZTA 3V4IA 2BE2B 2B4OA 4FYVB 1WWHA 3K57A 2XSJB 2UXCJ 4JI4F 2OPSA 2RKIB 3R1LA 1OYEA 2BRKA 3GMGA 3CD0A 4A8YA 1YJNS 4YB5A 4EYIB 2V8VA 1RJJA 1Z4UA 3M1VB 1NNDA 4DN0A 1N36J 3TANA 2MQLA 1MROA 4YB6A 1XWLA 2YNFB 3MD1A 4Y00A 2ALZA 2GQQA 4U96A 2EFVA 3ZTPA 1HI8A 1XMQF 1S1UB 2IVFB 1AYEA 3IM8A 4I7FA 4C3LA 4Q7AA 3OVSA 1HBUB 4C8LA 4PUOB 4NLDA 3POTA 1RKJA 2Z2LA 4P6QA 1NJWA 2QLBB 2FJDB 3H2VE 3TP2A 5B0AA 1U1MA 3E01B 5HBMB 1NJZA 1FKAF 4PG6A 1C1CB 2P5VA 3I82A 5ETNA 1S0MA 3CUNA 1IR2A 2XLIA 2KZMA 3TZZA 2X1FA 3DFEA 3RW6A 2YNIA 3K59A 3QZ8A 5KFXA 1GH8A 1GX5A 3UD4P 2BE7D 1MG7A 2KM8C 2DGVA 3DU5A 3D1OA 1H38A 1JMTA 3NOCA 3A12A 4NMXA 5CQGA 4BS2A 2FHKA 1UW4A 5L1IA 1U6FA 2D3O1 5D4LA 3W7BA 3EWGA 2XLKA 1NK7A 3GONA 1VBKA 3SDEB 3KUHA 3W9JA 3PHTA 4LRAA 1YDLA 1HMVB 3I96A 4A8QA 1HBMB 1RTHB 3AT1B 2CZVC 3I4HX 3Q22A 2ZKUA 2LXFA 1B70B 4JV5F 2XZWA 1C4AA 3UPFA 2GV1A 1NZAA 1R6YA 1OJ4A 3ETMA 2B4UA 5IC6B 1SC6A 3M8ZA 3SBMA 4O3RA 4R8UA 5KFEA 2KRBA 3FZBA 4G6VB 2XY7A 2R42A 1SQEA 2RRNA 4CH7A 2AGOA 1BUXA 4IR9A 1VQLS 4OLOA 3MM7A 4K4SA 1B4SA 4PQAA 3A4TA 4F26A 1RAIB 3TJ8A 1S4EA 2IC3A 3NBPA 1Y10A 1NCLA 4U7CA 2VG5B 3DN9A 3KYLA 3HJVA 5J2NB 4NCGA 1MSWD 3CB4A 1TL4A 4AL6A 4DV0F 2LEPA 3PYFA 3HPOA 3QLHB 4OYZA 2OMLA 4USVA 3R3TA 2CG8A 1Q81T 1BQNA 2FZKB 4C11A 2DGOA 1CEZA 1HBNB 3NS6A 4CP5A 1X9WA 3TVYA 4IRCA 2XM3A 1LWEA 4OI0A 2IRXA 4IDKB 2M2BA 4ZHRA 4OQJA 1HNWF 4IFVB 4EBCA 4PEOA 5KFOA 5BYQA 4A8SA 3SXLA 2R3VA 4CM0A 4JI8F 1C1BA 5GMEA 3VZIA 2MLXA 4DV2J 3TX8A 2XGQA 3BPDA 2NPIA 2Z2ZA 2V63A 4MKVA 3M30B 2HNYB 3N0VA 2NS1B 4I67A 1RT5A 3CJ5A 2E66A 2R7UA 4TY9A 3LO3A 3NGDA 3CSKA 2BM1A 2HS3A 3AD7C 2OMOA 2CNNB 2M7SA 1JJ2R 1Q5VA 2YNGA 2ZNYA 2BRLA 1RCXB 5J1PA 1YZ6A 1IXKA 3MM6A 3K89A 1J5EF 3FSXA 3GCXP 4LF6F 4KBIA 1H2TZ 4B9TA 5CCMA 2M52A 2B5JA 4U95A 4E2FB 1FRXA 3T1YF 1KEKA 4DL3A 5CYMA 2WZ1A 4DEZA 2DIVA 3ZNUA 3JSMA 4B3OA 5A8KB 1XMQJ 1NSPA 1DTTA 2W4CA 2XCAA 2HBRB 4QJVA 1AROP 3DXSX 1EZZB 4FS2A 2RHSB 4AL5A 1C0UB 2HGLA 2DNGA 3GLJA 5E2QA 2QSFA 2YWEA 3MEKA 1R7IA 4CLTA 3VAFA 2DPIA 2VICA 1UVKA 1SJRA 2MYFA 2PN6A 2B9WA 4M5MA 5U47A 4ES2A 1AUSL 4NLQA 1FTRA 1U7LA 2VUGA 4WU2A 5ADZA 1P1LA 2VKZG 2NR0A 2G4BA 2V67A 3BSOA 3J81Y 3TVZA 2EG1A 1KOHA 4L3KA 5C25B 2KG0A 1Q0NA 3E2EA 6FD1A 2VPWB 1V5VA 2LMIA 2HQGA 3H5YA 4YP3A 3CEDA 3IGNA 2YX7A 5BYRA 5T7LB 3FMWA 1VQSA 3D28A 5AJ3F 2RU3A 1G3OA 1D09B 3Q8VA 1O6XA 3IAS9 1NXIA 2HLUA 1R27B 4A48A 4U8YA 2BE9B 3KG1A 3VQTA 2XS2A 1VQ6S 4PG8A 3AA8A 2E9RX 2N3LA 5J1EB 2ZOFA 3RBZA 3M2RA 2MJNA 4ZA1A 1YVFA 5HP1B 1VIXA 1KQKA 3AD8C 3SCLE 1YJ9S 4DU7A 5J2QB 3O1LA 2FJWA 4JV5J 4HHHA 4ELUA 4LT6A 4U6PA 2EK6A 2K3IA 4NWBA 3NGTA 1T7PA 3TNVA 3M8QB 3QJPA 3Q83A 2Z2YB 1Y3JA 3AJ1A 3PO4A 1D0EA 3SCJE 4UY8T 1EETA 4N8OA 1PJ7A 4F2RA 3RB3A 2MZQA 2VONA 4A8KA 3D67A 1DQAA 3RGIA 4IG0A 5SUHA 1KNZA 2BXJA 2XQCA 4EWTA 1D3WA 3HVWA 4ZK7M 4G1QA 3DLGB 2I38A 4RX6A 3QAEA 4ZVUB 3EPGA 2A3JA 3BM7A 1URNA 3IWNC 2BJEA 4RUCA 4DQQA 1S9FA 3AY0A 4DV0J 2HGMA 1TL7A 4B02A 1JLBB 1EB0A 1AXQA 1T9UA 2DO0A 1EX8A 3G9CA 2QA4G 3QGIA 4DCPB 2DNLA 2DEJA 3ZTRA 1RT2A 1KTVA 2CRLA 2WBMA 1D8YA 2H51B 3WX4A 5C2CA 5C42A 2RH3A 3GIMA 1HNWJ 1ZZFA 4M94A 1CJTB 4I6WA 2ZD1A 1FRHA 4F04B 1YRXA 3C66A 5KFFA 1S97A 4JI8J 2HBQB 2NXCA 2J7UA 4ZLPA 4QWAA 3QFHA 4FKXA 1JLQB 4K50A 4IG3B 2XMMA 4L75A 1S48A 1M5OC 1F60B 1JQGA 2ZHAA 3PYEA 3MMAB 3OQ2A 4KO0A 1UPMB 3AAWB 3KLHB 1UWBB 3TRGA 3KLIA 3P45B 1BQMB 1R31A 3NCQA 2IYGA 5IT9Y 2CKWA 4LR8A 4KFBA 1Y11A 3HHLB 2GMLA 2WVCA 1BD6A 1YGYA 2Z8QA 1S59A 2EFPA 4IO1A 2Z2MA 3GZ7A 3MTKA 4NLWA 1RE1B 3T1YJ 4ED5A 3MWBA 1L3UA 1HQEA 4WZMA 3ENAA 3L4BC 3CJ2A 2HK3A 2QYGA 2VFSA 2B8QA 4LF5J 1YKWA 2GMHA 3KLFB 2D41A 2C2RA 2IJNA 4JBCA 4H54A 1ZM3A 4KHMA 4QR0A 4DV1J 1G7CB 2MJUA 3MUTP 1K47A 2H3EB 2FC9A 4D3GA 1ZYQA 1SJ1A 1R0AB 1CULA 4YB7A 4DLGA 2FY8A 2W2MP 3R6LB 2YKMB 1LW2A 3VWSA 3WHIA 3HKWA 4FYWB 1WI8A 2CPXA 5K8OA 2XHCA 3W2VA 2RT3A 4P2FA 3FNNA 3C16B 2AJ1A 2HSEB 3EE3A 5LJ3Y 2EI5A 1DLOA 2UUWA 5K20B 3H7HB 2CUYA 3H25A 4RKUC 2YWHA 2X51A 5F0UA 4GRSA 1GMWA 1B3TA 4KHRA 5D78A 1DRZA 3PIPQ 1VC6A 3LW5C 2HQIA 5HLFA 4O3PA 1RTIA 4JYAF 2NZ4A 1YX2A 3MDFA 1I6JA 2M70A 3MR7A 5LOQA 4O0IA 4H4OA 1YBTA 4G65A 2ZM6J 2EXUA 3DU6A 2E5GA 2M0GB 3R97A 5ETLA 1RT1A 2KJWA 3Q2SC 5KG0A 3D6TB 3TVKA 3HKZD 5GAGU 1OPZA 3EGVA 3MPVA 5CHCB 5M2PA 2DR6A 1EARA 4NPOA 2IM1A 3I5AA 4P7VA 2WW8A 2B4VA 3W2WA 4USUA 3SQOP 4RO0A 4JP8A 1FRKA 3DYAB 3CXCR 2R4FA 2KHCA 4YN3B 3OVAA 5B09A 2ZJPQ 3CC4S 4ZN3A 2HHPA 2B3TB 1ROFA 2YWWA 2DH7A 3UN3A 4ZP6A 4LR9A 2BZ2A 3PCOB 1U2RA 2YH1A 5DZ6A 1U1KA 4ZCLA 1NKEA 4USWA 1VC5A 4WE1B 3TJ9A 1P1TA 4ZPCA 2KL8A 4DL0C 1VLYA 1FJCA 4DR6F 3G96A 2J8AA 3J7Z5 3DI6A 3TOQA 3ZXWA 3AOBA 3JAMU 1X5TA 2HKEA 4F3MA 2YNHA 4CDIA 4F4AA 1U47A 3DMJA 4J9RA 2CJKA 2D69A 2YWGA 1WELA 3O3LA 2ZBRA 3KMQA 3FBFA 1H2VZ 1KLMA 1YJTA 4X64F 2Y3YA 1JJHA 4PPDA 2CXEA 3V2UC 2O66A 5DM6Q 3HD1A 3MTJA 3I0RA 2RNEA 1WC0A 2R8JA 1WG5A 4CQ1A 1SXLA 4ATNA 3HI9A 3NWRA 2UVVA 4ZP8A 2X1GA 2APOA 4MK9A 1ZTWA 4XK8C 4EU0A 4F3QA 2B9YA 2DRBA 3OXFA 3HO1A 4OV6A 1P6TA 2Z56B 4MAKA 3H42A 2HFUA 4OYOA 4N56A 5G0RA 3N79A 4OX7A 1SJFA 3PW0A 4L3NA 1HWKA 1HQUA 1KN6A 4WFXA 2PSZA 1NDPA 1CJUB 5EN1A 3QT5A 2F4VJ 3U1MA 3KLGB 2J0QD 2QSWA 3B54A 3THVA 2BJ3A 4WTYA 2JZ5A 3OL6A 1JWWA 5GMKa 1SCJB 3QSYB 5HMWA 3VGSA 1SV5A 1B0PA 2HHHF 4DS5A 4RW6A 2HWTA 4UQGA 2E1RA 3H98A 2JEFA 2QN6B 4E0DA 1OO0B 1NK9A 2VFVA 5RUBA 3PACA 1J5OA 3BREA 4NLPA 3LALA 4DJBA 3JQKA 5EUHA 4ECQA 3AJDA 4O23A 3D0GE 3PO5A 4R0EA 2MHNA 1PC5A 2CJXB 1TAQA 4J37A 1FEHA 4ZVPB 1JLEA 2WW4A 2HYIB 3UVJB 2UV8G 4IH6A 4X84A 4KV8B 1CS4B 2A18A 1KWMA 3AJ2A 4ANEA 4DX7A 1FDNA 4QU6A 5D3GB 3QFWA 3BV8A 3VAHA 3G71S 5GAEU 4HT7A 2I8EA 2NQPA 4PG4A 4CLUA 3HCXA 3MECB 1W26A 1R8HA 4TN2A 3JQMA 4C6AA 2VIHA 2R8HA 3TI0A 1M5VC 3PX0A 3MF5A 3LGMA 1TELA 3K5OA 2BX6A 5C24A 1HFEL 3GIRA 2LLZA 4HL9A 2IRUA 3TUPA 4JYAJ 3ZZUA 3FFIB 2FLPA 3OTOF 1KKHA 1VR6A 2A6OA 1RISA 5GADI 1WOOA 4LMZA 3SQGA 1S99A 2AJ2A 3CO9A 2P2CB 5GVQA 5E33A 4N77A 3I5CA 3H90A 3TW0A 1IBMF 2NXJA 3ET6B 2ZWPA 1RT6B 2OUGA 2RF2B 4WFYA 5ETSA 4Q0BA 3FQKA 3HF5A 3NNCA 2G2OA 4FDFA 4P2SA 2ZFHA 1WD6A 1F2GA 1JLGA 2Y1IA 1H6KX 5EWGA 4JV0A 3OXGA 3LWMA 3KJVB 4TXSA 2W9CB 2LA6A 2AMCB 1IKYB 4EO6A 4Q43A 2EFQA 1HI0P 2HHXA 4IRDA 4AFFA 3DLKB 4NZ0A 4J9QA 3Q0AA 3LGHA 1YG0A 2J9CA 2C2OB 3AHPA 5I4MA 3KG4A 4RW9A 1SBRA 2CJAA 1NK5A 3BF4A 4C7QA 4FYYB 2VG6A 1PYTA 1S6QB 4CO5A 1NK8A 1K1SA 1CJKA 1WC6A 3HP6A 3RB4A 1UTAA 4CO1A 4A47A 1ZS6A 3CJKB 2DNHA 2XI3A 3OL9A 5FJ4A 4DQRA 2F8MA 4ER8A 2H5JB 1RU2A 1UAWA 2DNRA 3H2LA 2VODA 4DR6J 3FRYA 1TL3B 4X2BA 1UJ4A 4HH0A 2A10A 3G87A 4ZIWA 1IQTA 1MWZA 2UUTA 3OPKA 3BO3A 1NZ8A 1G2EA 4TVAB 1RT4A 2IDEA 2ZZTA 1B99A 4OHXA 3M9OB 3I55S 2R7XA 3EZ5A 3P49B 2V0NA 4DSLA 1W2BR 5KFUA 1JJ4A 4WWSA 3HVTB 4ED4A 3ZZZA 2DNMA 3TAMB 4C0BA 1S9GA 1Q86T 3GWCA 2HBYB 1U26A 1A7GE 4Z7CA 5JMNA 2HWHA 2ROPA 2OD6A 4Y2KA 2RQMA 4WKRA 2RS8A 1S9EB 5J2MB 4ZPWR 1X9MA 1DBDA 4WP3A 5EX0A 4PWDB 4NE9C 2UVUA 1RWWB 3M8RA 4DSJA 4NRTA 2JHEA 1VRTB 4UF4A 2YTCA 2RVJA 3IRWP 5D0EA 3B4MA 2AEFA 5A8WB 1SH3A 3ICLA 2LEBA 3NMRA 4DX5A 1O51A 1P9QC 2QYCA 2CQHA 5ETMA 4WF9Q 5E3RA 3HFZB 2I1RA 2G9OA 3M8YA 2NXEA 1VHIA 1YQHA 1EQ0A 2PMHA 1T11A 4DR1J 1JLCA 2IDLA 4HT5A 5A6WA 3DCAA 2OTLS 3M05A 4OZ2A 4C3MA 3T3FA 4QZVB 2LCWA 1VYAA 1QAIA 3T9NA 4EUVA 2MZ1A 2L9NA 2HHHJ 1PSDA 1UVMA 1JLAA 1T9YA 1U25A 5KFGA 4Q8FA 1DARA 5F3ZA 5KFJA 2N82B 4X4NA 2OO4A 1VCTA 4NI2A 2HWIA 4ZCMA 2BVZA 1KP6A 5IV3A 4P72A 1VQ4S 1LFPA 2OLWA 3ZO7A 3PFOA 1YJVA 5HATA 3UDEA 4FXDA 1JLFA 4DUZF 2KXNB 1NHUA 3M8WA 2R8GA 1F5AA 4C97A 4FPIA 2EKNA 1V5IB 3QAUA 1XR7A 3QYYA 3QIDA 4IOAQ 2DGSA 3GJTB 4IO9Q 1TKDA 1LV5A 2GVDA 1UETA 1DURA 3LP2B 1KSPA 1HW9A 2UP1A 4RUAA 2XY5A 3OVBA 3C6UA 3RBDA 4WIQA 1VQKS 2BUNA 3N4WA 2JVOA 4ZVFA 4DOZA 3OUYA 1YHQS 4LREA 5DZ7A 9RUBA 3DRSA 2UXBJ 3GSDA 3OTOJ 2JSXA 2LQJA 4CLLA 4EMDA 4QWBA 3CCRS 4O4RA 1U1LA 4Y6IA 1YJUA 1H2UX 3WBZA 4RW7A 1RLCL 4NXMJ 1U45A 1GEHA 5KFLA 4MH8A 4H4KC 3GJSB 2DRDA 1IBMJ 4KGKA 2C2EA 2WTFA 2VDHA 2FQQB 4YY3F 1QAYA 3KHHA 4DR5F 1SJ3P 3I5BA 5JXSA 3KDOA 2VOOA 2HLTA 5F8HA 2U2FA 1HWIA 2VQFJ 4XDCA 2XNRA 2AJ0A 1F9EB 4ZOSA 1X4FA 3MURP 3D5MA 3FBEA 2KU7A 3MOJB 1WKLA 1WSVA 4C8ZA 3VVTA 1B7YB 1HR0F 3QJJA 1R89A 3M32B 4ED3A 1X4AA 2XMVA 2C28A 2IJRA 3GR1A 2HEKA 2XG8A 4B9UA 2ABYA 1Q7LB 3FSYA 1HNVA 2BA9A 2DR9A 3VALA 4K59A 4JV1A 5AT1B 1UFKA 3M8PB 2HG4A 2AYMA 2DNKA 4DUYF 2VBYA 5CYQA 4ANCA 2OPQA 4F4ZA 2MHEA 4FPRA 5I3UB 2QMUB 1N5VA 3ENQA 5F9NA 4ED0A 3GYXB 4XDDA 3G86A 2DO4A 3A13A 4C4WA 3H5XA 1ZA2B 2YKAA 4DR2F 1LWFA 3KLEA 5F9LA 3ZTSA 4YDDB 4NLYA 4JI0J 3H4DA 3CD5A 4UQTA 2PT0A 2HIYA 1N5YA 2CVIA 4W92B 1FX4A 4FF4A 1XNRJ 1NO8A 3RAXA 4NEZA 5K9FA 4LSZB 3PX4A 2IYIA 1T9XA 1REVB 3GG0A 1PAEX 5HQLA 4OFZA 3DM2B 2C1EB 4JI6F 1X4EA 2P9EA 3H40A 2R2RA 3OJUA 8ATCB 1Q7YT 2W8KA 4KKOA 3BYPA 1QTMA 1IKVA 1WF1A 5D0HA 3N28A 4IR1A 3W64A 1OQ6A 5DO2A 7FD1A 3LP0A 2CAJA 3KLVA 1GMVA 1CQNA 2Y1LB 2ZE2A 2HHQA 1IKXA 1LK5A 2L48A 3MMBB 4X65F 4R5PA 4IH5A 5IQ6A 5ETOA 3M2VA 2WONB 2CPIA 3ZTOA 4OX6A 4A8MP 3IXQA 2VL1A 2XZDB 1VMBA 3PXGa 4JUZA 2DXFA 3BZQA 2GAGC 1G1XA 2XYPB 4ZVOB 2V4JB 3CW2C 3ZZOA 1K1QA 2XMWA 1RAEB 2Z57B 1U0HB 5I42B 3GJRB 2HVHA 4CRJA 3J81U 2DIUA 4NYZA 3Q8YA 4I6AA 3E3XA 2V69A 1QLNA 1RT7B 1IR0A 1TUWA 3HFVA 3KOAA 2MGZA 1A0OB 2DISA 2BJ7A 2XC9A 1R43A 1S6PA 1YLXA 2FLNA 1QSLA 2AT1B 2MQQA 3NGUA 2RQKA 3PKYA 3EDQB 1YITS 2DNNA 5HMYA 2KB2A 1VHFA 1WOPA 3DDKA 4PQUB 4JI1J 3ZTQA 1ZZNA 2M3DA 2VG7A 1KS2A 3U27A 2J6TA 5L9NA 3MPUB 5K14A 5CCLA 2EK1A 1RAGB 1HNIA 2OPPA 1OSCA 2XTJP 3L7UA 2DH9A 4C0HA 2ZH1A 1U1OA 3B4DA 3ZZRA 4KC5A 4O4GB 1FTCA 1RHRB 3N5BA 1RKIA 4OYXA 4I0WA 2X1AA 2EFNA 3GU0A 1KC8T 3OL7A 1M5KC 2OHDA 1RBLA 2OGUA 1S6OA 4ZP7A 3MAHA 3UWTA 4RBVA 2JH3A 2ZBIA 4UZBA 4YY3J 4R0JA 4HACA 2VDIA 3M6WA 2ALYB 3T5LA 1CSJA 5B0FA 2IVYA 2CDQA 2HNZA 5DM7Q 3HHKA 2AX1A 5HMZA 2ZUGA 1TAUA 2GMJA 1K0VA 4H4MB 3GYNA 3RAMA 3EXYA 3AH6A 3QO9A 1HR0J 2V34A 2V9WA 1D9AA 1NJXA 2HFSA 5KT3A 4DL4A 2MY8A 4LIRA 3D2WA 2KYZA 2VFTA 3D3BJ 3PY8A 5B08A 5KT6A 3H59A 4HLBA 5E7OB 3WC0A 4ECYA 3C2PA 3IBWA 4NL5A 2R7WA 2PI5A 3V6HA 5DQHA 3MD3A 2J9DE 2J9DA 5E3CA 4KGVB 4UUXA 2YQ1A 3QT7A 4ZVEA 4DUYJ 3UR3C 4W4MA 3C15B 2XMAA 5K8NA 1FNXH 1FVQA 1XBWA 1EKSA 3W66A 1TQLA 2Y1JA 3NS7B 1S4FA 4P73A 1OWXA 1PG5B 1SJQA 1JJCB 1CJVA 4N7TA 4P2MA 3CO0P 1S1TA 2DHSA 2A6MA 1I94F 3VZHA 4QU7A 1ZTTA 4QIWD 1RK8A 4V1Ak 2AD9A 1FXRA 1I5OB 2V2ZA 1WHYA 4ZCIA 3LANA 5IT9U 3ISNC 3ISND 4IFYB 4Z7YA 2CQDA 3A1YG 1RYRA 3SSRA 2ASYA 1LWXA 4ZJQA 2F9DA 4DG1A 1U1NA 1K8AT 5AXKA 3IG1A 3GV7B 3AQOA 3CCVS 2GFFA 4NZ7A 4YDXA 2MEWA 1NBEB 1UA1A 3PRDA 4QW9A 2DTJA 4QCLA 3K17A 2UUBF 3CDUA 2H1YA 3WIUA 3CCTA 1NEEA 4OI3A 3QGHA 1HBOB 2DXEA 4YR2A 1VK3A 2QMWA 3ELHA 3NMAA 5KFHA 5IM0B 1U4BA 2HFOA 2BOPA 4X65J 4EBEA 2RHQB 1TVRB 1S0OA 4A46A 4OL8A 1KHWA 3RG6A 3AOAA 4PRFA 1T03A 1W25A 2IM0A 2UXDF 3IMQJ 1N56A 2AQ4A 2CWXA 1HNXF 2CYYA 2HZAA 1QTNB 4NLSA 3MCSA 4M5HA 2FYXA 3SEOA 3IFEA 2FLOA 4MKAA 2G0CA 3NNHA 2PEBA 3BB5A 3F73A 4DR7J 2EBGA 7AT1B 3SSQA 4KAIA 3EZUA 4DZ6A 1PBAA 1UW9A 3L09A 1IM6A 4F3OA 3CGIA 4R25A 3ILJA 5LMUJ 3UNYA 4DR4J 3D1HA 2K7KA 5IXUA 2XYHB 2J9EA 1R6VA 2DY9A 2M5YA 4NLGA 4ZVSB 1UPPA 4QYZJ 3PEHA 4CLYA 2AYEA 4OJHA 3UNGC 2Y8WA 2QC3A 3UR0A 1PJ5A 3MAAA 3CTRA 4LFAJ 1BLUA 4X4TA 2GC8A 1RP5A 2BABA 2WAQD 4YR0A 1NLKL 2PIIA 2C3MA 2HNDA 3CDBA 4FBUA 3HLUA 3TJAA 4ZCKA 3BKUA 5MLCV 2LFVA 3UDLA 4DV7J 2YKNA 2W9BB 2W1BA 4DU8A 1HA1A 2HHWA 2W2QP 3UDVA 3QIPB 2KFYA 2IFXA 1YJRA 1FWKA 3MZIA 2R8KA 4ETXA 2ZEJA 2AIRB 1B64A 3QT6A 2CJYB 4DDFA 3RB6A 2I2YA 1M5PC 1IN0A 3DLEB 1LWCA 2B6AB 4DPTA 2LQ9A 2J8SA 2G1HA 1RAOA 3G8QA 2QA2A 1KLNA 2K1RB 2ZH7A 1MU2A 1F0XA 2HS0A 3FEXB 3QPIA 1UEKA 2XMUA 4QW8A 1F6TA 4ALZA 1ZBTA 4F0MA 1RGVA 5FDLB 1T3NA 2XS7A 3OBIA 1FDAA 2HRYA 4G3IA 1FE0A 1JXLA 1TP7A 1DJ0A 4OZ3A 1N36F 3NAHA 4M5DB 4ZIVA 3GCWP 4DI6A 2DYAA 1SL2A 3QRQA 3FBBA 2HFVA 5BXIA 3OTEA 2W7OA 1YRTA 5A8RB 3BH6B 1FKOB 3OJSA 5IQQA 2JC0A 3PHEA 1CLFA 4J90A 1NM2A 5HAOA 1R8PA 1PKUA 3IRXB 1NKCA 1HD1A 3TA0A 1KD1T 2FC8A 3V6DB 3A8KA 4PZVA 3GSIA 2FB0A 5JUMA 1SUQB 1TK5A 1SVDA 4F8RA 4D3HA 4OLPA 2DGXA 1KVKA 4Y65A 2OSQA 4P75A 4KQZA 5E3QA 1N5TA 4OYWA 3BN4A 4MTPA 2JLFA 3MEGB 1UCNA 3TUZC 3HHLC 3HHLD 3E51A 1S1XA 1I94J 1N6QB 4I1TA 2YKOA 4WP8A 4F25A 3PIOQ 3DC2A 2ACMA 4M5DA 2LU2A 3RB0A 4NZ6A 1FNMA 4I4BA 3HMJG 4ES1A 1N32J 2E1PA 5AE1A 2I6WA 2JEGA 3BPSP 5LSRA 1S1VA 3GIIA 2NSBA 4RWWA 4J5OA 4CO4A 1WF2A 2DPJA 1VQNS 5J2PB 5SZTA 1FKPB 1KQFB 1MN9A 3IWLA 3DOLA 1WTBA 4ZPVR 3NY0A 2C2MB 2UUBJ 4J9PA 1YK9A 2JLEA 4IH7A 8AT1B 3R5DA 4UOGA 2JNJA 3C14A 2E1MC 1WOSA 1N33F 3CMAS 3VAIA 4LSNB 1O5JA 4AL7A 3RR8A 1Y5LB 2FJXA 4BHQA 1X4GA 3R5CA 1IWAA 3LAKA 1F9FA 5HI7A 1QE1A 2BJ1A 1F3VA 4FP9A 3HSGA 1KR4A 4W98A 4RW8A 4RW4A 2UXDJ 1Y7PA 3JTPA 4I2PB 3GG1A 1CPZA 1HNXJ 3PR4A 5ETTA 1G6BA 2FIUA 4KGZB 3I4PA 1GTEA 3RRGA 3MR6A 5IFMA 2IA0A 3I9ZA 3QRRA 3CDAA 1VRUA 1AZSA 1TKZB 4F4WA 4CCHA 2VHGA 3PZPA 2XO7A 4ILRA 3CCMS 3AFGA 3MPWA 3ZZYA 5CXTA 2ILYA 3C6TA 4ZDNA 2NUHA 3ILLA 2GVZA 3K5NA 4DF8A 2RRAA 4Y0FA 3BBCA 2V8DA 1SH2A 4JB8B 3V6JA 5KFTA 3V4IB 2E29A 3U02A 3UFCX 3RRKA 4K2JA 1HD0A 4LF7J 1GNKA 2KYXA 1PYOB 4LF9F 1DQ8A 2OPSB 1DTQA 3MEEA 1FRIA 4K7QA 2N3OA 1R8CA 4HH1A 5HK4A 3GV8B 4I69A 5L8RC 2COLA 2RDJA 1RUSA 4KTQA 3M2UA 2ZJQQ 3EGNA 1RAFB 2HGNA 1MROB 3N6LA 1N34J 4I7FB 3RU0A 3TQ1A 3C46A 4FS1A 2Y1RI 3BGFA 2O1PA 1M0SA 5IWAJ 1ZAVA 1SQGA 3RUBL 3TAPA 2F40A 5F8NA 3POTB 1YJ7A 3JYTA 1C0TA 2W4PA 3PNIA 1IM4A 3DRPA 4C0OC 2V2KA 4Y2MA 4DL5A 5LXRA 2VB6A 2ZKTA 4GC7A 1PIEA 3ITHA 4DX6A 4LVOP 1NPKA 1NRKA 4LSLA 1X5OA 1RA6A 3NXZA 3J81j 1TFWA 4QQBA 2YNIB 5BYSA 3MM5A 2L3MA 1TTHB 3D6MB 5AE2A 1H3DA 1IR1A 2XMTA 1BC6A 4LRCA 3NCPA 3PR5B 1MW7A 4AT1B 2JFDA 1PGZA 2J0WA 1M1HA 1RACB 3K5LA 1Q82T 5DGAA 2WOMA 2NUUG 3CDEA 1QSYA 1F5CA 1UVNA 2JDJA 2D7SA 4DV6J 2K06A 3GILA 2JRSA 2LYVA 2UVRA 2MKCA 4EI2A 3MMCA 2H48B 4N8NA 2PC6A 5DDOC 3G6YA 2JFKA 1FD8A 1MMNA 1DY3A 4Y28C 4LQ9A 4IKAA 4PXDA 4ELTA 1F3FA 3W63A 1NB2A 4RNMA 3NLCA 3BBFA 4NXNJ 4WXWA 3Q23A 3LTOA 1LOUA 2HFZA 2RU9A 1NMEB 1REGX 1UVLA 2HAIA 4LBHA 4R8UB 1ZAWA 4KGXB 1FK9A 3FRZA 3Q2TC 2V9KA 1YSJA 2XCPA 4L73A 3GFZA 2F65A 4IOCQ 5LSLA 4ZJOA 1XC9A 1WC1A 3UN2A 4LQ3A 3UN5A 2KFZA 5ETKA 3MM7B 3RJMB 4ICLA 3NP5A 2DD8S 1LKZA 2XB2D 2IC3B 3NBPB 3PX6A 1MWQA 1RSCA 1RWNB 3CULA 4DCJB 1HNZF 4GO7X 4NCGB 4HDGA 2BEFA 3MM8A 3N6NA 5DG8A 1BQNB 1N33J 4C11B 3IP0A 3GPAA 4P10A 1RHKB 2AJQA 2GNKA 2QG9B 4CNYA 2IAJA 1FDBA 2HVZA 3OFEA 2M8HA 4KJIA 5GADU 2AGPA 3K0JA 1T02A 5HO4A 1HW8A 1T05A 3J7YI 2C22A 1LWEB 2B7BB 4ZHRB 4EBDA 3KK1A 4KH1B 3KUEA 3P5BP 2MSTA 4F4KA 1RAJA 2J5AA 1B0VA 1WUUA 4C8MA 1C1BB 2CDRB 2CQ0A 3JQJA 1S79A 3KJQB 1NK4A 2MSSA 2AW0A 4CYUA 5HROA 1V3RA 3M7VA 2CVEA 1XR5A 2GIFA 2BMBA 4QYRA 3KFWX 5DQGA 4U7UK 1RT5B 4L6V3 4OV1A 3TARA 1A9NB 4M5IA 2PMWA 3CMQA 4OI4A 2YNGB 4LF9J 1W7WA 2DCLA 4HTJA 3CJ0A 3MM6B 3GJQB 1VQYA 4X4UA 5KFCA 5KOXA 3LUYA 2VFUA 1RHJB 5C7PA 2V2VA 2F5GA 2B5JB 5FLXY 1JXEA 3KNGA 3EMTA 3NAIA 1SKWA 2VPYB 1ZOTA 5CYMB 2X1BA 3ILOA 1J27A 1HHSA 2HIQA 2VC0A 3B8HA 3JSMB 5HN0A 4B3OB 4NX9A 3OSNA 2YWKA 1RWOB 4QIGA 2MZTA 1IUJA 1DTTB 3DNCA 3U1NA 1HYSA 4OHVA 3DLBA 2K3KA 3PW2A 2BJ8A 2HK2A 2FY1A 2MTLA 3RBEA 2GQ2A 2MKYA 4DF4A 2GHPA 2DGTA 1ZAXA 4P2XA 2DHGA 5D8HB 2JVRA 5KG4A 4ZMMA 2GCFA 1IKWA 4ZVGA 3LP1A 1S7HA 5KOWA 2ERRA 1KBRA 1AB8A 3O44A 3L95X 4O44A 3V4MA 4K0KF 4WFBQ 2LDYA 4ENOA 1KFDA 3OHAA 3KWMA 3ONQA 2GJIA 3QGPA 5DG9A 2GQCA 1M5HA 4I64A 4LF5F 2VOPA 2XEXA 4CI0B 2GAHC 4KGMA 4ZP9A 4ID5A 4DV1F 2BKOA 2VBXA 3CJSA 2OI2A 1TMMA 4X4RA 3TA2A 2CADA 3NCRA 3F56A 4ELVA 1GX6A 1VK8A 4QPXA 1S6UA 3US5A 3IR7B 2ZWOA 1EAYC 1FE4A 1TR0A 2D1CA 3M2RB 3NGKA 2PO4A 4PXBA 3G4SS 2HHSA 2BW7A 3EGZA 4QWEA 2L08A 4J9NA 4K5SA 4GVBA 3I0SA 4Z37A 2HHTA 4CNZA 3G82A 2C3OA 4J9OA 2FD2A 3I31A 4U9RA 3R7NB 3A3OB 4YHHJ 4GKJF 4NASA 3AOCA 4DV4F 4IRKA 1Q95G 2CPHA 2O67A 2POKA 3MEDA 1JKHA 5JVGQ 2GIQA 5D6GA 4ZPBA 1EETB 2HHUA 2DHAA 1NJIT 2IIHA 2M4MA 3TZWA 5DGBA 2W2NP 2B4PA 1V6HA 4IG0B 2KG1A 3WX8A 2CPYA 1UVJA 3EVWA 1CBKA 2HVIA 2CNLB 1I1GA 2LP4A 4G1QB 2NYIA 3QT8A 2P9GA 1HNZJ 2QO3A 2ZH6A 4ZLJA 4X4PA 1RWVB 2ZM6F 1TL7B 4PCQA 1H73A 2R7VA 4Q5VA 3D0HE 5CD4H 1F9HA 4CM2A 2OPRA 4JI3J 2R7TA 3RW7A 2PD1A 4HHUA 1RT2B 4DV5F 4USJC 1SQFA 2HPUA 3OR2A 2IBKA 4DSIA 5DDPC 5C42B 3CJRA 2BACA 1F2HA 2HRUA 2D3ZA 4GKKJ 5HMXA 2ZD1B 3H5UA 2NPFA 3RR7A 2QLFB 3IR6B 4HVZA 4UTGA 2VKRA 3W61A 4HI1A 2CQIA 5GAEI 5KFNA 1EKRA 1FWLA 4A8XA 2RE1A 3V81A 2FDNA 2AV5A 4YUDA 3TZYA 2NZCA 2OH2A 1TZ0A 3CD6S 2ZVIA 1SPBP 5LSOA 1HI1A 2MPUA 4KO0B 1TKTA 2JJ4D 3KLIB 2LEAA 2ZH9A 3FCHA 2F3JA 2ZDPA 2DT9A 4KFBB 5E3PA 1LW0A 4URSA 4NLUA 3EVOA 3HZGA 1GMUA 2MLZA 1WI6A 2AHOB 4NYOA 2JOQA 4TY8A 3OW2R 4RZRA 3D66A 1FDDA 4TYAA 1GK8A 9ATCB 3BO4A 1UEUA 2BYCA 2I9SA 1HQEB 3PW4A 2FHMA 1UZHA 4L72B 4DX8H 2EWHA 1HPZA 1RXOB 3PM9A 2C3YA 4EK2A 1EP4A 1HLWA 2AZ1A 3AXMA 4ECWA 5A0YA 3FSIA 1WTFA 4DQIA 2GJ2A 1CULB 3IC1A 3IWXA 1I3OB 1TL1A 2ZOGA 1Q4RA 2ZH2A 1KFSA 3BGRA 5L1KA 4LJMA 3N6MA 2QL9B 1LW2B 3GP9A 3JXOA 4RUHA 1BE4A 3SSSA 3DOMA 1JIHA 1FVSA 2XULA 2V6AA 3W2VB 2LU1A 3OLBA 3Q8UA 1S10A 3FCWA 2I5JA 3PKMA 4F7VA 1LXNA 3DOKA 5CH7B 4K0KJ 5EWEA 3I6PA 1TU0B 1DLOB 1TFYA 1OY6A 3C19A 2OFHX 2F4VF 1B7FA 1FFSB 1RTJA 1U8WA 2Q66A 1NH8A 4ECXA 1NK6A 1NDCA 1WDDA 3IM9A 2QLWA 2GS8A 5KFQA 5HLFB 1RTIB 4TNOA 1SC1B 3T1AA 3CNQP 3PYDA 3KHLA 1X4BA 1NSKL 3KK2A 4ECRA 4TLRA 4HHJA 1QAXA 3A8JA 4H4OB 1N52B 3AODA 1R8AA 1NU4A 1RT1B 4CLPA 5CA5A 1N0VC 4RL1A 1Y3KA 4B3RJ 2KKHA 3SFGA 4PAAA 5A2QY 4GKJJ 3KXDA 1UWAA 3ILIA 2H65B 4DV4J 4C8KA 1TKXA 3FK4A 1E6VA 1U2FA 1IBCB 2Z58B 1KVJA 3R8YA 3W2WB 2CQGA 1CG2A 4Q45A 3BGOP 2QA1A 1TV6A 4BC7A 1JX4A 2MZSA 3OTCA 4MFBA 2QEXS 4NLVA 2UUAF 5D4PA 3OFHA 4P74A 3GQCA 4F2SA 5M2RA 2F7VA 3H4BA 1VQ7S 2IA6A 1Q8BA 2C2KB 4OYPA 3N9UC 3JSYA 2H4YB 3MCMA 1H0HB 2DHHA 4LR7A 5ETVA 3DHXA 4PPZA 2BANA 1E6YA 2H5IB 2RUGA 2V2QA 3DI6B 2GZOA 4YOEA 4DV5J 2K7JA 5A76A 4GMKA 1L3KA 2J0SD 3DDIA 1PJ6A 2YNHB 4F02A 1KDNA 4KIAA 3DMJB 1ZM4A 2ASLA 1RT3A 5CD4A 2ZZMA 4M1KA 4BDPA 1XR6A 5DLGA 3C3LA 5IT4A 4XPEA 3DRRA 1KLMB 4M5LA 3CIMA 1TK0A 4OMFG 3MMJA 4MJKA 2GA7A 5DRKA 3I0RB 3KNAA 4QYZK 4WKYA 3TUIC 4ZPTR 4DPWA 4GO5X 3LF0A 4YFUA 3D6HB 2MQMA 5DLFA 2D74B 2MQPA 3J7AN 1J2VA 3VAKA 1CC7A 1Z2LA 2JX2A 2CQ1A 1WG4A 3DHWC 3DXBA 5L1JA 4QOTA 1Q5YA 3KK3A 1UJ6A 1RU1A 5G0RB 1T8EA 2MKHA 2J0XA 1HQUB 4OIXA 3RAQA 5HSPA 2B56A 4TU8A 3R2DJ 3OR1A 2ZJRQ 2YVSA 1XMBA 2LXIA 2KO1A 1U8SA 2ZH5A 1WHVA 2AYBA 3HT0A 5L38A 2XI2A 1SL0A 3P8BB 2B51A 3VQSA 4TQRA 4EGLA 2VC1A 2J6UA 3A8IA 2XMJA 3IS9A 1RTDA 1DFDA 1WEZA 2VU5A 1S1WA 1SV5B 3MOZA 3R27A 3H5SA 4RW6B 3PJXA 2Y0SD 5HVGA 4K4YA 4ANDA 1ZM2A 1VS3A 1YBUA 4HDHA 1J5OB 3TA1A 3T41A 4I2QA 1KRPA 4Y3CA 3MGJA 2CPFA 2B43A 3MM9A 4O3NA 2R7SA 3OFFA 1VQOS 1RDRA 1JLEB 4CTAA 5M2UA 5CZXA 1XNQF 2BBEA 4XPCA 4K4UA 2HMIA 4KHPJ 5L9XA 4DR1F 3F44A 3N01A 3JSRA 3CC2S 4WTOB 4USKA 3EYZA 2FHJD 1R8BA 2DCUB 3I56S 5LT5A 2R2TA 5KG2A 2PDAA 2DNPA 1WEXA 1RAHB 2F63A 2XHWA 3QZ7A 2EFGA 1L5UA 4IOBA 3SV4A 3HK2A 5C24B 3WDOA 3OFGA 3DGPA 2CWKA 2Q43A 5KFIA 2BE2A 1X0PA 5EHHA 5KG7A 1X60A 2XSJA 1FRMA 3PTWA 3SQGB 3WZ0A 2RKIA 4ERDA 2ZHBA 2EC0A 5F8GA 4DQSA 3PJ9A 3UO0A 1KOOA 1RWMB 4RNFA 3FKBA 3M1VA 4Q0BB 4WJBA 2CFXA 2HQCA 3NS5A 3PYGA 1JLGB 1JXVA 5HL7Q 4RU9A 4DLEA 5KT4A 2YNFA 3JSBA 4WYWA 4M5KA 2V50A 3THTA 5BR8J 1S1UA 1RHQB 2QA4S 4ZITA 4K8RA 3EUNA 1HBUA 1BWVA 1TK8A 4PUOA 5HQ8A 3TWZA 1FESA 1WC5A 2UUAJ 2RMLA 3FBCA 3CE8A 4LF1A 2UXBF 2XNQA 3MCNA 3E01A 5HBMA 4U7UD 2XGPA 4UZCA 4RW9B 1NHVA 2Z30B 2VG6B 1H7WA 2M88A 1CJKB 1C1CA 3UW1A 1T0TV 4NXMF 4DPUA 4FF3A 2FGOA 4MK8A 4WFNQ 4K4VA 2IMWP 4LF2A 4LBPA 3ISZA 5LJ5Y 3QJLA 2ZOMA 2RUSA 2ZBQA 1AW0A 4FNHA 1RT4B 4K4WA 5IOLA 2XSFA 2VQFF 3BSAA 4WYLA 2RB7A 2OFGX 1OSDA 3K5PA 4KPCA 2VF3A 1RI7A 3JS9A 1AUDA 2EW9A 3UCZP 3SDEA 2WRMA 1FEEA 1S9GB 4DBQA 3HJFA 4HYKA 2CPDA 1HMVA 2EKYA 1P8GA 1PAUB 3AXKA 2WSCC 1HBMA 2DVIA 1RTHA 4USMA 3FVYA 5AXLA 1MWYA 4B9SA 3OSPA 4J91A 2H5EA 3QATA 3K5MA 1VQPS 3GIJA 4OJGA 2V5HG 1RCOB 2N4DA 3QBCA 3KTQA 1IBKF 3OT9A 3M6VA 3EX7B 4NA2A 1JLCB 1P27B 4F0HA 1RAAB 1UZDA 1UKUA 2LVWA 2Q79A 4LRDA 3GIKA 5F8LA 4JI0F 1HARA 3JTOA 4OYBA 1KVIA 2MDAA 4CLWA 3P6YC 3S1TA 2CQ2A 1XNRF 2VG5A 2F8HA 4K5RA 1U02A 5J2NA 4AUKA 5H9EJ 1SI9A 1JLAB 3QLHA 3VHQA 4HI2A 2G0JA 3M6XA 4ETZA 3CMES 2N7CA 1XTZA 1HBNA 5GAHU 4JI4J 1HQ2A 4NI2B 2V4RA 1R3NA 3EICA 5F3TA 2B7CB 4QIVA 3IA0A 4IDKA 2ZNZA 4UOFA 1XNQJ 4IFVA 1S0VA 1JLFB 4ZLLA 3HX9A 2WK4A 2XO6A 2KI2A 1X4CA 2VPZB 2ROGA 1MMLA 1VQMS 1VGYA 4QIFA 4ED6A 3BS9A 1GFWB 7FDRA 5IZHA 1URRA 2GVDB 2WVBA 2Z4PA 3S8SA 1JK9B 3C6UB 3U1LA 5KTQA 3M30A 5ETRA 4B3MF 2HNYA 2FJVA 5KFDA 3OUYB 3TR5A 3CJTA 3ETOA 3DRSB 5KFBA 2D9PA 4WXOA 4EZ9A 2VJUA 3WQPA 4YQWA 3LA0A 1SKSA 1FX2A 3F0NA 2D3UA 4TU9A 4RW7B 2V4QA 2AF6A 1T9VA 2ATLA 2AZ3A 2A0FB 2CA9A 2NREA 3T1HF 3CJ4A 3MR5A 3GFXA 2GHVC 1WG1A 5K8PA 1F1BB 4KY3A 5A8KA 4PXCA 4XAKA 1HIYA 2KZZA 3D1QA 4KH0B 2KJVA 4CLZA 1Q16B 3ZZ0A 1UA0A 3LGNA 1OS5A 4JI1F 3AB4B 3GTYX 1C0UA 3IBFB 3QNWB 2BV3A 1AT1B 1VBYA 2HQ3A 1HNVB 2MQOA 1X0FA 1O0PA 1N4LA 2FLLA 5ETPA 2UV8A 2HHVA 2I0XA 5CYQB 6AT1B 2OPQB 5KFRA 3TEGA 3LPEA 1NJYA 1SJ4P 2CNOB 2HZVA 3UE2A 2MXYA 3UCGA 3J7ZT 2K8GA 3B82A 5C25A 1VRQC 3NWGA 2W25A 1NPPA 1LWFB 3KLEB 3A3NB 3PDNA 1Q79A 5T7LA 5F0WA 1S5ZA 4FYXB 2YXLA 1H72C 2VBZA 1N5YB 4EYHB 4X4SA 3CT9A 4OI2A 1YBAA 4I68A 4X4QA 5J1EA 3W60A 1WKJA 1K73T 5B0GA 3CJ8A 5HP1A 1IBLF 1AA1B 2GW8A 4DV3F 3QWUA 4USIA 2MQNA 3R7BB 3HHDA 5J2QA 3DRXA 1X5SA 1RWPB 2D9OA 4TQSA 4KKOB 1XJWB 5FLXU 2RSQA 4F67A 2DEIA 4M63A 1IKVB 2IVMA 3M8QA 2PFFB 3LP0B 1TUVA 2BQ3A 5KG1A 1NDKA 1B0TA 2ZE2B 1IBKJ 3C8YA 4E98A 2OJ3A 1IKXB 2G0IA 2PFDA 2XS5A 3VGUA 4YEAA 4PR6A 4R5PB 2G1DA 4KYZA 3M2VB 4WP9A 1N5QA 2F9JA 4DFKA 3DLGA 4OI6A 4EFAC 4S0MA 1FFWB 1N48A 4QR2A 2C3UA 3MUVP 3HT3A 4YR3A 1BY9A 3R5JB 4V19X 2XLJA 1JLBA 2OKQA 3O6QA 2SXLA 5F8JA 2QIFA 2LA4A 1BQXA 5KAKA 2PEHA 1RABB 4A8WA 4ECSA 1ZETA 4B17A 3HHNB 1M5SA 1L3SA 1J5EJ 3QMQA 5B7WA 2NSCA 2MGZB 2HURA 4LF6J 2AJ4A 2BQUA 2WB1D 5KT5A 2BDPA 1CJTA 1S6PB 2W8LA 3M9MB 3NGSA 3CCWA 4QBUA 2VV5A 1FI4A 2H4WB 1IQZA 2E1AA 4M5NA 3QSIA 2HW3A 2CIMA 1JLQA 2IHR1 2ZBCA 2OIHA 4RBUA 3H0PA 3NOGA 4FXVA 4IG3A 1IVZA 1O8BA 4DSEA 2ROEA 2LKZA 1N54B 2BKPA 4B3MJ 4DS4A 3W62A 3MMAA 3P5TL 2VG7B 3KLHA 5MAOA 1UWBA 1NH7A 5AXNA 1BQMA 1S7IA 5K14B 2NYHA 1HNIB 3MAQA 2DJWA 2EFOA 2OPPB 2XY6A 3R5AA 3W1YC 2E7VA 3J7YU 1N8RT 3HHLA 3CCQS 3GE9A 4DR7F 4ECZA 1U6ZA 3CD7A 3VV2B 4IQMA 2R7QA 5IS2A 1W2IA 2R7OA 3KUGA 4AQYF 2E7XA 5KFAA 2CQPA 5LMUF 2Y0BB 3HVRA 4DR4F 3T1HJ 4NCBA 4HACB 2AU0A 3FMBA 4DCOB 2CG4A 1IWGA 3ENWA 2HNZB 1Y00A 2HQFA 1VC0A 1FRLA 2RQCA 4ZLNA 3VF0B 2V8GA 3KLFA 4LFAF 1FF2A 2J7WA 5AJ3J 2DXDA 3GB0A 4FVCA 3QO9B 4PG7A 4NMLA 1S49A 2XBPA 3CDWA 2E5LF 3CJ3A 2G2YA 1S12A 1VBZA 1R0AA 1L3VA 1VISA 3PG9A 2OD4A 4DV7F 3GFYA 4CT8A 2YKMA 2FVRA 1FO1A 3BKFA 1GTHA 2VH7A 3MCOA 3MFHA 4ED8A 1VLOA 1RQ0A 4ZVRB 3C16A 1ZH5A 4HKQA 3M4XA 3HXMA 4JOUA 4URGA 3T5HA 3UQSA 4ES3A 1N88A 4ILLA 2ZC4A 1N0UA 3UD5A 3HFKA 3O8WA 4KT0C 5KT7A 3MR2A 3IR5B 4CLSA 3BYRA 1WF0A 2R2SA 1C4CA 1FT8A 1MMDA 4CIOA 3IGVA 4X4VA 2KRRA 4USTA 3S6EA 3D3CJ 2ZH8A 1CJVB 2OTJS 1LEOA 2ZH3A 2QMXA 2RD5C 3X3UA 1S1TB 4ZPDA 3V5RA 5IC4B 1QSSA 4C8OA 3Q8QB 1ICEB 2CJQA 4J9LA 5F8IA 2X3DA 1F5BA 4X66F 3T5JA 4CO2A 1RWKB 3B78A 1IBLJ 2DGWA 4DV3J 1RHUB 4NRUA 4DPOA 1XIQA 4PG5A 1SC3B 4DG1B 3OL8A 1GT8A 4B3TF 2W2PP 3FEYB 3IG1B 4MIWA 3I87A 1BMQB 4DPYA 4ZN1A 3F41A 5EDWA 2H54B 5DDRC 4C8YA 4DHVA 1YWXA 3UI3A 4PYAA 4OX9F 3O2IA 1ACMB 3DYAA 2AEMA 3QRPA 1D9FA 4Y34A 4XIUA 3BDEA 2AEJA 4P52A 2FPHX 4FBTA 2CPEA 3MUMP 3J80Y 3L3CA 2VD3A 4MT1A 2RS2A 4DL6A 4OJ1A 1PO6A 2ASJA 1U09A 1T03B 4WE1A 4RR5A 3NGRA 1N32F 4LRBA 3R6GB 4U8VA 4E8UA 3OXLA 4NA3A 1Z2ZA 3ADAC 3NKYA 3HHEA 4OYAA 4G1PA 2B8PA 4DL7A 1H98A 4OYIA 2OEKA 3OD2A 8RUCA 2XWYA 1LXJA 2KM8B 2EG2A 3BSNA 4FN5A 1WACA 5JJBA 4DMZA 2D3OR 3DDNA 3O5TB 1JNZB 2NXNA 4DFJA 2DITA 3G6XA 3PJWA 3W8GA 3MAAB 5KFPA 3K7RA 4N47A 2PGCA 4DUTA 1KQGB 2C2DA 2DNQA 3N5FA 2YKQA 2HNDB 4A4JA 4WU3A 1T95A 4K4TA 2ZUAA 1RLDA 3HSJA 2P6TA 2R9LA 4HTIA 3BR8A 2YKNB 2MZRA 3EGWB 3R5BA 2JLGA 2DKOB 3FGVA 5A2QU 2A1BA 4FZVA 1QVGR 4DPXA 2JC1A 1UMJA 2Q6CA 3SYZA 1U48A 2DR7A 1H7XA 2IM3A 1LWCB 4AQYJ 3L9ZA 2RIJA 5H9FJ 1VBXA 3W9HA 1G4CA 1CJUA 1MU2B 2N4CA 2YKPA 3KLGA 2QFJA 3PVXA 4LF7F 1UFWA 4MKYA 2UU9F 4KR0B 5HVHA 2HAFA 4OZ5A 2PA3A 2LXUA 2E5LJ 2CQCA 5KFSA 3ZC4A 2JWNA 1RB0A 4B9MA 2FVPA 2KXFA 3HDSA 3U7JA 3OTBA 1N34F 2PI4A 2KT3A 1FNOA 1ITPA 3UVJA 5IWAF 1OMSA 2NXUA 4KV8A 4URQU 1CS4A 1UP1A 3Q86A 3OHBA 2YY3A 2HFNA 5D3GA 5EX3A 2VZ9A 2O3DA 3PRVA 2G2ZA 2A2CA 4IQXA 1HHQA 2J6SA 2WVFA 4X4OA 2C3PA 2QJ3A 3JB9k 4OZNA 2U1AA 3AQPA 3MECA 5D0GA 4J9SA 3J7A1 2DNYA 1M1GA 1Q1KA 4QWCA 1VQ9S 2QLXA 4KSEB 2YPYA 4BC9A 2UUCF 5HANA 2KT2A 4CO0A 3LH2S 2QRRA 3HVAA 1S1XB 4OZJA 2LECA 4FXWA 1QDUB 3FFIA 4BBYA 4Q44A 1KQSR 5IT0A 2DNZA 3PRBA 3PV8A 4X66J 4UOCA 4CH0S 1M90T 1U1PA 5HJXA 3CJQA 1D8ZA 4ZJLA 1S1VB 3ET6A 2JEIA 4B3TJ 1RT6A 3TX0A 5KFWA 1IJEB 2DB1A 2BJ9A 2RF2A 1BXNA 3SIPB 4ZVHA 2JEJA 3DOLB 3W8PA 3S01A 4G1IA 4DV6F 4J7CA 1CVJA 4N41A 2BW2A 1XMOF 3ZFVA 3KJVA 4AXJA 1HWUA 1BHNA 2W9CA 1IKYA 4OX9J 4BWJA 3C14B 1U2CA 4X64J 5JVHQ 1SH0A 1WC4A 1ZPVA 1LQ9A 4HEA9 3DLKA 2VJVA 1C2PA 4DN9A 4NXNF 3W3SA 2FHOB 2YBVA 1FERA 2GO9A 5KFVA 3TAQA 4FKYA 1QE1B 2VA2A 1WKKA 1S6QA 4RW8B 4RW4B 3PFEA 3FCVA 2FTRA 1GQEA 4Y2CA 2MB0B 4QIEA 3PW7A 5B0DA 3VAGA 3CJKA 4WIIA 2CZ9A 3TEHB 5DJBA 2ZH4A 5B0EA 3RRHA 4LIWA 3W5ZA 1UL3A 4F4YA 1GMWD 3TZXA 1TL3A 1VRUB 4MIAA 2WB4A 1AZSB 3L7OA 3BN7A 2FJBB 3CCUS 1UJ5A 4OHZA 2IM2A 3IBCB 3EM1A 3E8OA 1HKAA 3C6TB 1S57A 5HVFA 2WVDA 5DG7A 2GVZB 4NYPA 1X4DA 3OLAA 3BGLA 1HHTP 1SKRA 3D4JA 3HVTA 1U1QA 2V8HA 1WHXA 1JNRB 3TAMA 4PXEA 3G6VA 3L7PA 2K2PA 4ITSA 2KTQA 1DTQB 3MEEB 2CNKB 2W4DA 1OY8A 4B9VA 2J7KA 3MPDA 4KPYA 1QM9A 1S9EA 5J2MA 1UEVA 4MIBA 4PWDA 4NEYA 3M2UB 1PBUA 1VRTA 2XZTB 4A8FA 3BBBA 3R9LA 1MNEA 4I56A 1NHKL 1S0NA 1SB6A 1LK7A 1UFLA 5A8WA 1OY9A 2WSEC 1QY7A 2AP6A 4RNOA 4FYDA 2KHDA 1Q78A 3P96A 2HVDA 1QD1A 3D0IE 3W5XA 2QT7A 4V19J 3BQ1A 3JYTB 4AD6A 1C0TB 2CQ3A 2E5IA 3DRPB 3Q24A 3OV7A 3BO2A 1NSQA 4J9UE 1T3OA 4LUBA 2EEYA 3T9ZA 3ITHB 1LNQA 2B9EA 3W9IA 2X7IA 2ZC3A 4LSLB 1QAJA 1Q8KA 2UU9J 5CAAA 2MKIA 3KJNB 3CCZA 5F8MA 4CZCA 2IBOA 4YB1P 5LXYA 1APSA 1CQMA 2X3GA 3MM5B 2RQ4A 1X5PA 5KG6A 2IRYA 4P71A 5BJRA 1AFIA 3KMSA 2V94A 5KFKA 3CC7S 4Y2AA 1TUGB 1Q8LA 3K58A 1VOMA 1UVIA 2RDDA 1Y4ZB 1K0TA 5I3QA 1JB0C 5B0CA 1YRUA 2NCKL 2WOMB 3GV5B 3CPWR 3BDPA 2VA3A 1GXUA 4N76A 1FD2A 4K4XA 2VQEF 3VCDA 2DK2A 1FHTA 4NCAA 3T6JA 1KONA 3IO1A 2KVQE 4C9DA 3MMCB 2GGPB 3LP2A 2DR8A 1GXTA 5LL6d 4PKDB 1S76D 4LBIA 3FUYA 5G4DA 2UUCJ 2FVSA 2IPOB 3PEJA 2CJBA 5E3AA 1NUEA 3A8EA 3LWLA 1NKBA 2GJFA 3VGVA 3BKTA 4XO0A 1NK0A 1D1UA 5DETA 5HQMA 4FNIA 3ENVA 3SFUA 5KG3A 3CIZA 4WZQA 5L39A 4CWBA 2RAQA 1A6LA 2CPZA 3THPA 1FK9B 4N5SA 1K44A 1ELOA 3SV3A 5KG5A 2GX8A 5C5JA 2FVQA 2J76E 3BQ0A 4LFCF 4ICLB 3LOUA 3FJ2A 1QUVA 2YH0A 2WBRA 1R0CB 1XMOJ 2W7AA 4FF2A 2MMYA 3TQEA 3MPYA 2GGPA 3MM8B 3VR1A 5D4NA 4Q8EA 5H9EK 2UVWA 3IAM9 4B3SF 3VTIA 4EO8A 3M32A 4O3QA 2IAJB 3HSDA 2YQ0A 5E5NA 1FJ7A 4YHHF 3P4UB 4C2MA 2VFRA 1WEYA 1T05B 4BLGA 2RDIA 2YWFA 4DSKA 2E7WA 5IV4A 3MHYA 1WORA 2ZITA 2W24A 4J9KA 2MLYA 3KK1B 5DQIA 1RADB 2Y8YA 4KB7A 1FRJA 3M8PA 2C2NA 1P9YA 4IUFA 5DDQC 4LRFA 1BGXT 1SIZA 5I3UA 1WDTA 3T19A 2W7PA 3BSCA 4KRWA 4PWWA 5AXMA 1FJGF 2PA8D 4CYUB 5HROB 3KJFB 2HRTA 2DRAA 4O0NA 1KTQA 3TYTA 1Q8IA 4RNNA 3JTNA 1MN7A 3AD9C 1OPIA 3GYGA 2AX0A 4FF1A 5D4OA 4JI3F 2F4FA 2KDOA 3ZZPA 3UDCA 1WJ9A 2HZCA 3DRYA 5ITHA 2QE5A 4Q2MA 4BCAA 1PILA 1WHWA 2ZBPA 1GAOA 3A3PB 4RPFA 1REVA 1HWJA 2YPZA 2E9ZA 4KE5A 2V8PA 4GKKF 5I3PA 4ED2A 3DM2A 2GIRA 2KFNA 5F41A 3ZNJ1 4M5GA 4OZ1A 4GVLA 2QL7B 1YI2S 1RWXB 2KXHA 1RTZA 3V6KA 2R7RA 2DGUA 2KT5A 4MMOA 4P7TA 3VAMA 4WFAQ 4I6YA 1HYSB 4M8LA 1XERA 3DKDA 2CJ9A 1S72S 5K5MA 4UOHA 2QV6A 4DUZJ 3BR9A 5KFZA 2OELA 1RHMB 4OYMA 4LF8F 2FZCB 3MMBA 4TKTA 2CQBA 4MYUA 4F4XA 5CYJA 2WONA 1U6BA 2N7YA 4Y2IA 2ZVSA 4ZVTB 5THWA 3CCLS 1WNEA 5A6PA 2EBEA 4B08A 3DLLQ 1IKWB 4FVMA 3LP1B 1ZPWX 2CPJA 2AWZA 2FGCA 1SIWB 2VASA 4O44B 4CLFA 1U0SA 2DR5A 1RA7A 2V4JA 3CCJS 2HQDA 1I51B 5GAGI 5FD1A 1U0HA 3AB2B 4LVNP 5I42A 1VIOA 2L9DA 2LQBA 4C8NA 2Q6BA 3SMZA 5LMNF 4W90B 2DH8A 1DHMA 4L74A 1RT7A 4ID8A 4ID5B 5AE3A 2W2OP 3K8VA 3EJMA 1DAXA 2MKKA 1VJQA 2P6SA 4DR5J 2VQEJ 2FVCA 1NSAA 1L3TA 3EXCX 2AKWB 3VVUA 3CF5Q 3W65A 4ECTA 1MLAA 4DXLA 4AYBD 4F0KA 4GVBB 3I0SB 4PABA 3FDSA 2CQ4A 3G82B 4PQUA 1SC4B 4XTTA 1NAQA 2DNOA 3HD2A 2RILA 4ZS6A 2M8DB 1FFGB 2C2ZB 4PYDA 5L1LA 3DLJA 4DFPA 3MEDB 1JKHB 2DHXA 2OSRA 4O4GA 1FA0A 2KN4A 2O01C 1YTYA 2WVEA 4K2XA 2XWXA 3M8SA 4RUBA 1EQMA 3G2XA 3I9V9 4LFCJ 1H74A 1DZ5A 3HZEA 4JV2A 2Q3PA 4UW2A 1HWLA 4U67Q 3CWJA 4QR1A 5EGYA 4LF4F 4F36A 4DR2J 1YIJS 2FUG9 2LDIA 4H4MA 3K8WA 3NL0A 2ATCB 4B3SJ 1Y5IB 1RWUA 2H9ZA 4TYBA 4B3RF 2OPRB 2AYGA 2BKNA 4B9LA 4C3KA 2XYGB 2OEMA 1TMJA 2W9AA 3RTVA 4AE5A 4RBTA 4ED1A 3OR2B 1XN9A 2NLWA 3RYLA 2CZ4A 4HR2A 2WSFC 3MFIA 3RZAA 3Q8RB 2C42A 2JL9A 2YX1A 4OI1A 2BQRA 4JI6J 1N5SA 5KFYA 3FEZA 4DWIA 3I32A 4YMEA 2E1CA 3C15A 4UT4A 3RBXA 3ULHA 2R8IA 3W5YA 3V81B 2DGQA 1FJGJ 3TO8A 5H1SV 1Z1ZA 2MY7A 4ZKAA 4NA1A 1V9OA 2FHJA 3SCKE 2OP5A 3G8SA 2ADCA 1TKTB 3KKFA
chains in the Genus database with same CATH topology
2IJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IJR A; 
#chains in the Genus database with same CATH topology
 3R7S B;  4PWU A;  4WK1 A;  3H20 A;  1HL6 A;  3HUL A;  2YQ3 A;  4JI2 F;  4WCE Q;  4NLT A;  4GC6 A;  1LW0 B;  2L9W A;  1SKU B;  1Y9O A;  2RJZ A;  3EVM A;  4CT9 A;  4TY8 B;  5T14 A;  5D0R A;  2G13 A;  4MKB A;  4IFY A;  2FZG B;  1T9T A;  3Q8P B;  3NEK A;  2IJF A;  4L76 A;  4WPA A;  3MI7 X;  3BEG B;  1HPZ B;  1QVF R;  5K8M A;  5D77 A;  1U49 A;  1EP4 B;  4X62 F;  4JI5 F;  2ASD A;  3GR0 A;  1HBO A;  5A0Y B;  4DSF A;  5IM0 A;  3BQ2 A;  1RBA A;  3AA9 A;  1TL1 B;  4LF8 J;  2WHO A;  3EDR B;  3BGR B;  1EJ7 L;  1CC8 A;  4ZVQ B;  2E5H A;  1TVR A;  3M9N B;  2Y9H A;  4WK3 A;  4AXI A;  3DOM B;  1IJF B;  3T5K A;  2QZ8 A;  1OQ3 A;  2I5J B;  5E0O A;  4CO3 A;  1VQ5 S;  3DOK B;  1ULR A;  4TLQ A;  2MZJ A;  2ADB A;  1VJW A;  3DGV A;  3VGT A;  3FQL A;  1DQ9 A;  5CZV A;  3NRB A;  1FXD A;  3JAM Y;  4DR3 F;  4LFB F;  4CLK A;  1U1R A;  5LMN J;  1TL5 A;  1RTJ B;  2ZZN A;  4B9N A;  3CCE S;  4ECU A;  2EPI A;  5KFM A;  1RYS A;  2ILZ A;  5LM7 E;  1WSR A;  4O3S A;  1YJW S;  5D15 A;  3TUJ C;  2DBB A;  3D54 A;  4JI7 F;  1KHV A;  5B0B A;  3EZO A;  2ACY A;  5E41 A;  1VQ8 S;  4NOH A;  2P8I A;  3KK2 B;  1QUP A;  4K4Z A;  5L46 A;  1FCA A;  2XMK A;  4MYT A;  2UXC F;  2WCX A;  2AGQ A;  1K9M T;  4RU2 A;  1SL1 A;  2KVI A;  3D68 A;  3S7R A;  2E5J A;  5EWF A;  1FJE B;  3LAM A;  1BWE A;  3T6B A;  1NPR A;  4IYQ A;  4KHP F;  2HBZ B;  3KHR A;  2BM0 A;  2EC2 A;  4C98 A;  1X4H A;  4QWD A;  2HS4 A;  1TKX B;  4WBF A;  2W9B A;  1S77 D;  5GMD A;  3NG8 A;  1E6V B;  1VDH A;  4ILM A;  3QIP A;  4QPT A;  2F8E X;  2O5D A;  6FDR A;  1Y5N B;  4M5J A;  1VI7 A;  2LQ5 A;  2B0G A;  2PE8 A;  3IN5 A;  2IY5 B;  1T94 A;  1TV6 B;  4J9V A;  1R0B G;  5T41 A;  3WIV A;  3DLE A;  2DY1 A;  4MFB B;  4Q2L A;  1X8D A;  2B6A A;  3Q89 A;  5DS7 A;  2L41 A;  4C48 A;  4MK7 A;  2QX0 A;  1XEZ A;  2K1R A;  2IMO A;  3NNA A;  2BJD A;  2MKS A;  3QQC D;  1PCA A;  4NLR A;  4RJV A;  4Z2X A;  5FII A;  4ED7 A;  4LF4 J;  2Q1L A;  3J80 U;  3R1H A;  5FDL A;  5CAB A;  1OYD A;  4OX8 A;  4OZL A;  3HM9 A;  2BAN B;  1E6Y B;  4M95 A;  3WC2 A;  3B6B A;  1ZA1 B;  5GAH I;  3LQV A;  2KH9 A;  1X9S A;  3KHG A;  1EIY B;  4ECV A;  4NLX A;  3QGG A;  4DZD A;  1RT3 B;  2W01 A;  5BR8 F;  1XQI A;  2VPX B;  5A8R A;  1FKO A;  3PW5 A;  1FXL A;  3DRR B;  1T9W A;  2VBW A;  1NDL A;  4P9S A;  3M6U A;  4RLE A;  3IRX A;  3VAJ A;  2MQ8 A;  3CVK A;  4A8O A;  3MR3 A;  1RBO B;  4RNH A;  3V6D A;  2F1F A;  1QJH A;  3LPY A;  1SUQ A;  4ZPA A;  5HJY A;  4UUW A;  4DQP A;  4USH A;  4EZ6 A;  2ZDO A;  4EEY A;  5KT2 A;  2M9K A;  2OEJ A;  4F50 A;  4BWM A;  3MEG A;  3UD3 P;  2QFI A;  3Q8S B;  4OZ0 A;  2QTW A;  1N6Q A;  4JI2 J;  3K2Y A;  1XK8 A;  5C2G A;  4WFZ A;  2LQ8 A;  1EHW A;  2R2U A;  4J9M A;  2Z0G A;  1Y0H A;  3KK3 B;  3G6E S;  1VFJ A;  4O3O A;  2FJA B;  1M1K T;  1D9D A;  1V3Z A;  2RRB A;  4NLO A;  2MKJ A;  1LFW A;  4CH1 A;  3EPI A;  4DL2 A;  2GO8 A;  3OR1 B;  3DLH A;  3MXH P;  2QGF B;  1X7V A;  3BJY A;  1WC3 A;  3P3D A;  1AFJ A;  5H9F K;  5J2P A;  3G8T A;  4RWX A;  3R2C J;  3QWP A;  1ZM9 A;  1FKP A;  2AJF E;  4X62 J;  3IS9 B;  4OJ3 A;  1RTD B;  4JI5 J;  3KG0 A;  1S1W B;  3H8Y A;  2YX4 A;  2A2D A;  2P9C A;  1V3S A;  3X1L B;  5ETQ A;  2UZA A;  4LSN A;  2QLJ B;  4I2Q B;  3SCI E;  2OAU A;  3MM9 B;  1GXL A;  1X31 C;  2EVZ A;  4UY8 5;  4CTA B;  3SZ2 A;  2E44 A;  2QL5 B;  3SI8 A;  4OHY A;  4I2P A;  3CCS S;  3BH7 B;  1PYS B;  1U24 A;  2HMI B;  3H2U B;  1YZ7 A;  4OHW A;  3OTD A;  2PMZ D;  2E9T A;  4DR3 J;  3UCU P;  1RZM A;  2HVE A;  4DV2 F;  4DFM A;  4YS2 A;  4LFB J;  1TKZ A;  1OIA A;  1PC4 A;  3KDN A;  4H4K A;  2ZHO A;  1NB7 A;  5J1N A;  3GFH A;  3FZ2 A;  3R5G A;  2GHW A;  4TU7 A;  4JI7 J;  3HSZ A;  2V68 A;  3FC9 A;  2BR0 A;  3D6F B;  1FWP A;  2B9X A;  3D9B A;  3DGP B;  3BGU A;  2FJE B;  2BOA A;  1Q53 A;  3D7S B;  3ZZT A;  3V4I A;  2BE2 B;  2B4O A;  4FYV B;  1WWH A;  3K57 A;  2XSJ B;  2UXC J;  4JI4 F;  2OPS A;  2RKI B;  3R1L A;  1OYE A;  2BRK A;  3GMG A;  3CD0 A;  4A8Y A;  1YJN S;  4YB5 A;  4EYI B;  2V8V A;  1RJJ A;  1Z4U A;  3M1V B;  1NND A;  4DN0 A;  1N36 J;  3TAN A;  2MQL A;  1MRO A;  4YB6 A;  1XWL A;  2YNF B;  3MD1 A;  4Y00 A;  2ALZ A;  2GQQ A;  4U96 A;  2EFV A;  3ZTP A;  1HI8 A;  1XMQ F;  1S1U B;  2IVF B;  1AYE A;  3IM8 A;  4I7F A;  4C3L A;  4Q7A A;  3OVS A;  1HBU B;  4C8L A;  4PUO B;  4NLD A;  3POT A;  1RKJ A;  2Z2L A;  4P6Q A;  1NJW A;  2QLB B;  2FJD B;  3H2V E;  3TP2 A;  5B0A A;  1U1M A;  3E01 B;  5HBM B;  1NJZ A;  1FKA F;  4PG6 A;  1C1C B;  2P5V A;  3I82 A;  5ETN A;  1S0M A;  3CUN A;  1IR2 A;  2XLI A;  2KZM A;  3TZZ A;  2X1F A;  3DFE A;  3RW6 A;  2YNI A;  3K59 A;  3QZ8 A;  5KFX A;  1GH8 A;  1GX5 A;  3UD4 P;  2BE7 D;  1MG7 A;  2KM8 C;  2DGV A;  3DU5 A;  3D1O A;  1H38 A;  1JMT A;  3NOC A;  3A12 A;  4NMX A;  5CQG A;  4BS2 A;  2FHK A;  1UW4 A;  5L1I A;  1U6F A;  2D3O 1;  5D4L A;  3W7B A;  3EWG A;  2XLK A;  1NK7 A;  3GON A;  1VBK A;  3SDE B;  3KUH A;  3W9J A;  3PHT A;  4LRA A;  1YDL A;  1HMV B;  3I96 A;  4A8Q A;  1HBM B;  1RTH B;  3AT1 B;  2CZV C;  3I4H X;  3Q22 A;  2ZKU A;  2LXF A;  1B70 B;  4JV5 F;  2XZW A;  1C4A A;  3UPF A;  2GV1 A;  1NZA A;  1R6Y A;  1OJ4 A;  3ETM A;  2B4U A;  5IC6 B;  1SC6 A;  3M8Z A;  3SBM A;  4O3R A;  4R8U A;  5KFE A;  2KRB A;  3FZB A;  4G6V B;  2XY7 A;  2R42 A;  1SQE A;  2RRN A;  4CH7 A;  2AGO A;  1BUX A;  4IR9 A;  1VQL S;  4OLO A;  3MM7 A;  4K4S A;  1B4S A;  4PQA A;  3A4T A;  4F26 A;  1RAI B;  3TJ8 A;  1S4E A;  2IC3 A;  3NBP A;  1Y10 A;  1NCL A;  4U7C A;  2VG5 B;  3DN9 A;  3KYL A;  3HJV A;  5J2N B;  4NCG A;  1MSW D;  3CB4 A;  1TL4 A;  4AL6 A;  4DV0 F;  2LEP A;  3PYF A;  3HPO A;  3QLH B;  4OYZ A;  2OML A;  4USV A;  3R3T A;  2CG8 A;  1Q81 T;  1BQN A;  2FZK B;  4C11 A;  2DGO A;  1CEZ A;  1HBN B;  3NS6 A;  4CP5 A;  1X9W A;  3TVY A;  4IRC A;  2XM3 A;  1LWE A;  4OI0 A;  2IRX A;  4IDK B;  2M2B A;  4ZHR A;  4OQJ A;  1HNW F;  4IFV B;  4EBC A;  4PEO A;  5KFO A;  5BYQ A;  4A8S A;  3SXL A;  2R3V A;  4CM0 A;  4JI8 F;  1C1B A;  5GME A;  3VZI A;  2MLX A;  4DV2 J;  3TX8 A;  2XGQ A;  3BPD A;  2NPI A;  2Z2Z A;  2V63 A;  4MKV A;  3M30 B;  2HNY B;  3N0V A;  2NS1 B;  4I67 A;  1RT5 A;  3CJ5 A;  2E66 A;  2R7U A;  4TY9 A;  3LO3 A;  3NGD A;  3CSK A;  2BM1 A;  2HS3 A;  3AD7 C;  2OMO A;  2CNN B;  2M7S A;  1JJ2 R;  1Q5V A;  2YNG A;  2ZNY A;  2BRL A;  1RCX B;  5J1P A;  1YZ6 A;  1IXK A;  3MM6 A;  3K89 A;  1J5E F;  3FSX A;  3GCX P;  4LF6 F;  4KBI A;  1H2T Z;  4B9T A;  5CCM A;  2M52 A;  2B5J A;  4U95 A;  4E2F B;  1FRX A;  3T1Y F;  1KEK A;  4DL3 A;  5CYM A;  2WZ1 A;  4DEZ A;  2DIV A;  3ZNU A;  3JSM A;  4B3O A;  5A8K B;  1XMQ J;  1NSP A;  1DTT A;  2W4C A;  2XCA A;  2HBR B;  4QJV A;  1ARO P;  3DXS X;  1EZZ B;  4FS2 A;  2RHS B;  4AL5 A;  1C0U B;  2HGL A;  2DNG A;  3GLJ A;  5E2Q A;  2QSF A;  2YWE A;  3MEK A;  1R7I A;  4CLT A;  3VAF A;  2DPI A;  2VIC A;  1UVK A;  1SJR A;  2MYF A;  2PN6 A;  2B9W A;  4M5M A;  5U47 A;  4ES2 A;  1AUS L;  4NLQ A;  1FTR A;  1U7L A;  2VUG A;  4WU2 A;  5ADZ A;  1P1L A;  2VKZ G;  2NR0 A;  2G4B A;  2V67 A;  3BSO A;  3J81 Y;  3TVZ A;  2EG1 A;  1KOH A;  4L3K A;  5C25 B;  2KG0 A;  1Q0N A;  3E2E A;  6FD1 A;  2VPW B;  1V5V A;  2LMI A;  2HQG A;  3H5Y A;  4YP3 A;  3CED A;  3IGN A;  2YX7 A;  5BYR A;  5T7L B;  3FMW A;  1VQS A;  3D28 A;  5AJ3 F;  2RU3 A;  1G3O A;  1D09 B;  3Q8V A;  1O6X A;  3IAS 9;  1NXI A;  2HLU A;  1R27 B;  4A48 A;  4U8Y A;  2BE9 B;  3KG1 A;  3VQT A;  2XS2 A;  1VQ6 S;  4PG8 A;  3AA8 A;  2E9R X;  2N3L A;  5J1E B;  2ZOF A;  3RBZ A;  3M2R A;  2MJN A;  4ZA1 A;  1YVF A;  5HP1 B;  1VIX A;  1KQK A;  3AD8 C;  3SCL E;  1YJ9 S;  4DU7 A;  5J2Q B;  3O1L A;  2FJW A;  4JV5 J;  4HHH A;  4ELU A;  4LT6 A;  4U6P A;  2EK6 A;  2K3I A;  4NWB A;  3NGT A;  1T7P A;  3TNV A;  3M8Q B;  3QJP A;  3Q83 A;  2Z2Y B;  1Y3J A;  3AJ1 A;  3PO4 A;  1D0E A;  3SCJ E;  4UY8 T;  1EET A;  4N8O A;  1PJ7 A;  4F2R A;  3RB3 A;  2MZQ A;  2VON A;  4A8K A;  3D67 A;  1DQA A;  3RGI A;  4IG0 A;  5SUH A;  1KNZ A;  2BXJ A;  2XQC A;  4EWT A;  1D3W A;  3HVW A;  4ZK7 M;  4G1Q A;  3DLG B;  2I38 A;  4RX6 A;  3QAE A;  4ZVU B;  3EPG A;  2A3J A;  3BM7 A;  1URN A;  3IWN C;  2BJE A;  4RUC A;  4DQQ A;  1S9F A;  3AY0 A;  4DV0 J;  2HGM A;  1TL7 A;  4B02 A;  1JLB B;  1EB0 A;  1AXQ A;  1T9U A;  2DO0 A;  1EX8 A;  3G9C A;  2QA4 G;  3QGI A;  4DCP B;  2DNL A;  2DEJ A;  3ZTR A;  1RT2 A;  1KTV A;  2CRL A;  2WBM A;  1D8Y A;  2H51 B;  3WX4 A;  5C2C A;  5C42 A;  2RH3 A;  3GIM A;  1HNW J;  1ZZF A;  4M94 A;  1CJT B;  4I6W A;  2ZD1 A;  1FRH A;  4F04 B;  1YRX A;  3C66 A;  5KFF A;  1S97 A;  4JI8 J;  2HBQ B;  2NXC A;  2J7U A;  4ZLP A;  4QWA A;  3QFH A;  4FKX A;  1JLQ B;  4K50 A;  4IG3 B;  2XMM A;  4L75 A;  1S48 A;  1M5O C;  1F60 B;  1JQG A;  2ZHA A;  3PYE A;  3MMA B;  3OQ2 A;  4KO0 A;  1UPM B;  3AAW B;  3KLH B;  1UWB B;  3TRG A;  3KLI A;  3P45 B;  1BQM B;  1R31 A;  3NCQ A;  2IYG A;  5IT9 Y;  2CKW A;  4LR8 A;  4KFB A;  1Y11 A;  3HHL B;  2GML A;  2WVC A;  1BD6 A;  1YGY A;  2Z8Q A;  1S59 A;  2EFP A;  4IO1 A;  2Z2M A;  3GZ7 A;  3MTK A;  4NLW A;  1RE1 B;  3T1Y J;  4ED5 A;  3MWB A;  1L3U A;  1HQE A;  4WZM A;  3ENA A;  3L4B C;  3CJ2 A;  2HK3 A;  2QYG A;  2VFS A;  2B8Q A;  4LF5 J;  1YKW A;  2GMH A;  3KLF B;  2D41 A;  2C2R A;  2IJN A;  4JBC A;  4H54 A;  1ZM3 A;  4KHM A;  4QR0 A;  4DV1 J;  1G7C B;  2MJU A;  3MUT P;  1K47 A;  2H3E B;  2FC9 A;  4D3G A;  1ZYQ A;  1SJ1 A;  1R0A B;  1CUL A;  4YB7 A;  4DLG A;  2FY8 A;  2W2M P;  3R6L B;  2YKM B;  1LW2 A;  3VWS A;  3WHI A;  3HKW A;  4FYW B;  1WI8 A;  2CPX A;  5K8O A;  2XHC A;  3W2V A;  2RT3 A;  4P2F A;  3FNN A;  3C16 B;  2AJ1 A;  2HSE B;  3EE3 A;  5LJ3 Y;  2EI5 A;  1DLO A;  2UUW A;  5K20 B;  3H7H B;  2CUY A;  3H25 A;  4RKU C;  2YWH A;  2X51 A;  5F0U A;  4GRS A;  1GMW A;  1B3T A;  4KHR A;  5D78 A;  1DRZ A;  3PIP Q;  1VC6 A;  3LW5 C;  2HQI A;  5HLF A;  4O3P A;  1RTI A;  4JYA F;  2NZ4 A;  1YX2 A;  3MDF A;  1I6J A;  2M70 A;  3MR7 A;  5LOQ A;  4O0I A;  4H4O A;  1YBT A;  4G65 A;  2ZM6 J;  2EXU A;  3DU6 A;  2E5G A;  2M0G B;  3R97 A;  5ETL A;  1RT1 A;  2KJW A;  3Q2S C;  5KG0 A;  3D6T B;  3TVK A;  3HKZ D;  5GAG U;  1OPZ A;  3EGV A;  3MPV A;  5CHC B;  5M2P A;  2DR6 A;  1EAR A;  4NPO A;  2IM1 A;  3I5A A;  4P7V A;  2WW8 A;  2B4V A;  3W2W A;  4USU A;  3SQO P;  4RO0 A;  4JP8 A;  1FRK A;  3DYA B;  3CXC R;  2R4F A;  2KHC A;  4YN3 B;  3OVA A;  5B09 A;  2ZJP Q;  3CC4 S;  4ZN3 A;  2HHP A;  2B3T B;  1ROF A;  2YWW A;  2DH7 A;  3UN3 A;  4ZP6 A;  4LR9 A;  2BZ2 A;  3PCO B;  1U2R A;  2YH1 A;  5DZ6 A;  1U1K A;  4ZCL A;  1NKE A;  4USW A;  1VC5 A;  4WE1 B;  3TJ9 A;  1P1T A;  4ZPC A;  2KL8 A;  4DL0 C;  1VLY A;  1FJC A;  4DR6 F;  3G96 A;  2J8A A;  3J7Z 5;  3DI6 A;  3TOQ A;  3ZXW A;  3AOB A;  3JAM U;  1X5T A;  2HKE A;  4F3M A;  2YNH A;  4CDI A;  4F4A A;  1U47 A;  3DMJ A;  4J9R A;  2CJK A;  2D69 A;  2YWG A;  1WEL A;  3O3L A;  2ZBR A;  3KMQ A;  3FBF A;  1H2V Z;  1KLM A;  1YJT A;  4X64 F;  2Y3Y A;  1JJH A;  4PPD A;  2CXE A;  3V2U C;  2O66 A;  5DM6 Q;  3HD1 A;  3MTJ A;  3I0R A;  2RNE A;  1WC0 A;  2R8J A;  1WG5 A;  4CQ1 A;  1SXL A;  4ATN A;  3HI9 A;  3NWR A;  2UVV A;  4ZP8 A;  2X1G A;  2APO A;  4MK9 A;  1ZTW A;  4XK8 C;  4EU0 A;  4F3Q A;  2B9Y A;  2DRB A;  3OXF A;  3HO1 A;  4OV6 A;  1P6T A;  2Z56 B;  4MAK A;  3H42 A;  2HFU A;  4OYO A;  4N56 A;  5G0R A;  3N79 A;  4OX7 A;  1SJF A;  3PW0 A;  4L3N A;  1HWK A;  1HQU A;  1KN6 A;  4WFX A;  2PSZ A;  1NDP A;  1CJU B;  5EN1 A;  3QT5 A;  2F4V J;  3U1M A;  3KLG B;  2J0Q D;  2QSW A;  3B54 A;  3THV A;  2BJ3 A;  4WTY A;  2JZ5 A;  3OL6 A;  1JWW A;  5GMK a;  1SCJ B;  3QSY B;  5HMW A;  3VGS A;  1SV5 A;  1B0P A;  2HHH F;  4DS5 A;  4RW6 A;  2HWT A;  4UQG A;  2E1R A;  3H98 A;  2JEF A;  2QN6 B;  4E0D A;  1OO0 B;  1NK9 A;  2VFV A;  5RUB A;  3PAC A;  1J5O A;  3BRE A;  4NLP A;  3LAL A;  4DJB A;  3JQK A;  5EUH A;  4ECQ A;  3AJD A;  4O23 A;  3D0G E;  3PO5 A;  4R0E A;  2MHN A;  1PC5 A;  2CJX B;  1TAQ A;  4J37 A;  1FEH A;  4ZVP B;  1JLE A;  2WW4 A;  2HYI B;  3UVJ B;  2UV8 G;  4IH6 A;  4X84 A;  4KV8 B;  1CS4 B;  2A18 A;  1KWM A;  3AJ2 A;  4ANE A;  4DX7 A;  1FDN A;  4QU6 A;  5D3G B;  3QFW A;  3BV8 A;  3VAH A;  3G71 S;  5GAE U;  4HT7 A;  2I8E A;  2NQP A;  4PG4 A;  4CLU A;  3HCX A;  3MEC B;  1W26 A;  1R8H A;  4TN2 A;  3JQM A;  4C6A A;  2VIH A;  2R8H A;  3TI0 A;  1M5V C;  3PX0 A;  3MF5 A;  3LGM A;  1TEL A;  3K5O A;  2BX6 A;  5C24 A;  1HFE L;  3GIR A;  2LLZ A;  4HL9 A;  2IRU A;  3TUP A;  4JYA J;  3ZZU A;  3FFI B;  2FLP A;  3OTO F;  1KKH A;  1VR6 A;  2A6O A;  1RIS A;  5GAD I;  1WOO A;  4LMZ A;  3SQG A;  1S99 A;  2AJ2 A;  3CO9 A;  2P2C B;  5GVQ A;  5E33 A;  4N77 A;  3I5C A;  3H90 A;  3TW0 A;  1IBM F;  2NXJ A;  3ET6 B;  2ZWP A;  1RT6 B;  2OUG A;  2RF2 B;  4WFY A;  5ETS A;  4Q0B A;  3FQK A;  3HF5 A;  3NNC A;  2G2O A;  4FDF A;  4P2S A;  2ZFH A;  1WD6 A;  1F2G A;  1JLG A;  2Y1I A;  1H6K X;  5EWG A;  4JV0 A;  3OXG A;  3LWM A;  3KJV B;  4TXS A;  2W9C B;  2LA6 A;  2AMC B;  1IKY B;  4EO6 A;  4Q43 A;  2EFQ A;  1HI0 P;  2HHX A;  4IRD A;  4AFF A;  3DLK B;  4NZ0 A;  4J9Q A;  3Q0A A;  3LGH A;  1YG0 A;  2J9C A;  2C2O B;  3AHP A;  5I4M A;  3KG4 A;  4RW9 A;  1SBR A;  2CJA A;  1NK5 A;  3BF4 A;  4C7Q A;  4FYY B;  2VG6 A;  1PYT A;  1S6Q B;  4CO5 A;  1NK8 A;  1K1S A;  1CJK A;  1WC6 A;  3HP6 A;  3RB4 A;  1UTA A;  4CO1 A;  4A47 A;  1ZS6 A;  3CJK B;  2DNH A;  2XI3 A;  3OL9 A;  5FJ4 A;  4DQR A;  2F8M A;  4ER8 A;  2H5J B;  1RU2 A;  1UAW A;  2DNR A;  3H2L A;  2VOD A;  4DR6 J;  3FRY A;  1TL3 B;  4X2B A;  1UJ4 A;  4HH0 A;  2A10 A;  3G87 A;  4ZIW A;  1IQT A;  1MWZ A;  2UUT A;  3OPK A;  3BO3 A;  1NZ8 A;  1G2E A;  4TVA B;  1RT4 A;  2IDE A;  2ZZT A;  1B99 A;  4OHX A;  3M9O B;  3I55 S;  2R7X A;  3EZ5 A;  3P49 B;  2V0N A;  4DSL A;  1W2B R;  5KFU A;  1JJ4 A;  4WWS A;  3HVT B;  4ED4 A;  3ZZZ A;  2DNM A;  3TAM B;  4C0B A;  1S9G A;  1Q86 T;  3GWC A;  2HBY B;  1U26 A;  1A7G E;  4Z7C A;  5JMN A;  2HWH A;  2ROP A;  2OD6 A;  4Y2K A;  2RQM A;  4WKR A;  2RS8 A;  1S9E B;  5J2M B;  4ZPW R;  1X9M A;  1DBD A;  4WP3 A;  5EX0 A;  4PWD B;  4NE9 C;  2UVU A;  1RWW B;  3M8R A;  4DSJ A;  4NRT A;  2JHE A;  1VRT B;  4UF4 A;  2YTC A;  2RVJ A;  3IRW P;  5D0E A;  3B4M A;  2AEF A;  5A8W B;  1SH3 A;  3ICL A;  2LEB A;  3NMR A;  4DX5 A;  1O51 A;  1P9Q C;  2QYC A;  2CQH A;  5ETM A;  4WF9 Q;  5E3R A;  3HFZ B;  2I1R A;  2G9O A;  3M8Y A;  2NXE A;  1VHI A;  1YQH A;  1EQ0 A;  2PMH A;  1T11 A;  4DR1 J;  1JLC A;  2IDL A;  4HT5 A;  5A6W A;  3DCA A;  2OTL S;  3M05 A;  4OZ2 A;  4C3M A;  3T3F A;  4QZV B;  2LCW A;  1VYA A;  1QAI A;  3T9N A;  4EUV A;  2MZ1 A;  2L9N A;  2HHH J;  1PSD A;  1UVM A;  1JLA A;  1T9Y A;  1U25 A;  5KFG A;  4Q8F A;  1DAR A;  5F3Z A;  5KFJ A;  2N82 B;  4X4N A;  2OO4 A;  1VCT A;  4NI2 A;  2HWI A;  4ZCM A;  2BVZ A;  1KP6 A;  5IV3 A;  4P72 A;  1VQ4 S;  1LFP A;  2OLW A;  3ZO7 A;  3PFO A;  1YJV A;  5HAT A;  3UDE A;  4FXD A;  1JLF A;  4DUZ F;  2KXN B;  1NHU A;  3M8W A;  2R8G A;  1F5A A;  4C97 A;  4FPI A;  2EKN A;  1V5I B;  3QAU A;  1XR7 A;  3QYY A;  3QID A;  4IOA Q;  2DGS A;  3GJT B;  4IO9 Q;  1TKD A;  1LV5 A;  2GVD A;  1UET A;  1DUR A;  3LP2 B;  1KSP A;  1HW9 A;  2UP1 A;  4RUA A;  2XY5 A;  3OVB A;  3C6U A;  3RBD A;  4WIQ A;  1VQK S;  2BUN A;  3N4W A;  2JVO A;  4ZVF A;  4DOZ A;  3OUY A;  1YHQ S;  4LRE A;  5DZ7 A;  9RUB A;  3DRS A;  2UXB J;  3GSD A;  3OTO J;  2JSX A;  2LQJ A;  4CLL A;  4EMD A;  4QWB A;  3CCR S;  4O4R A;  1U1L A;  4Y6I A;  1YJU A;  1H2U X;  3WBZ A;  4RW7 A;  1RLC L;  4NXM J;  1U45 A;  1GEH A;  5KFL A;  4MH8 A;  4H4K C;  3GJS B;  2DRD A;  1IBM J;  4KGK A;  2C2E A;  2WTF A;  2VDH A;  2FQQ B;  4YY3 F;  1QAY A;  3KHH A;  4DR5 F;  1SJ3 P;  3I5B A;  5JXS A;  3KDO A;  2VOO A;  2HLT A;  5F8H A;  2U2F A;  1HWI A;  2VQF J;  4XDC A;  2XNR A;  2AJ0 A;  1F9E B;  4ZOS A;  1X4F A;  3MUR P;  3D5M A;  3FBE A;  2KU7 A;  3MOJ B;  1WKL A;  1WSV A;  4C8Z A;  3VVT A;  1B7Y B;  1HR0 F;  3QJJ A;  1R89 A;  3M32 B;  4ED3 A;  1X4A A;  2XMV A;  2C28 A;  2IJR A;  3GR1 A;  2HEK A;  2XG8 A;  4B9U A;  2ABY A;  1Q7L B;  3FSY A;  1HNV A;  2BA9 A;  2DR9 A;  3VAL A;  4K59 A;  4JV1 A;  5AT1 B;  1UFK A;  3M8P B;  2HG4 A;  2AYM A;  2DNK A;  4DUY F;  2VBY A;  5CYQ A;  4ANC A;  2OPQ A;  4F4Z A;  2MHE A;  4FPR A;  5I3U B;  2QMU B;  1N5V A;  3ENQ A;  5F9N A;  4ED0 A;  3GYX B;  4XDD A;  3G86 A;  2DO4 A;  3A13 A;  4C4W A;  3H5X A;  1ZA2 B;  2YKA A;  4DR2 F;  1LWF A;  3KLE A;  5F9L A;  3ZTS A;  4YDD B;  4NLY A;  4JI0 J;  3H4D A;  3CD5 A;  4UQT A;  2PT0 A;  2HIY A;  1N5Y A;  2CVI A;  4W92 B;  1FX4 A;  4FF4 A;  1XNR J;  1NO8 A;  3RAX A;  4NEZ A;  5K9F A;  4LSZ B;  3PX4 A;  2IYI A;  1T9X A;  1REV B;  3GG0 A;  1PAE X;  5HQL A;  4OFZ A;  3DM2 B;  2C1E B;  4JI6 F;  1X4E A;  2P9E A;  3H40 A;  2R2R A;  3OJU A;  8ATC B;  1Q7Y T;  2W8K A;  4KKO A;  3BYP A;  1QTM A;  1IKV A;  1WF1 A;  5D0H A;  3N28 A;  4IR1 A;  3W64 A;  1OQ6 A;  5DO2 A;  7FD1 A;  3LP0 A;  2CAJ A;  3KLV A;  1GMV A;  1CQN A;  2Y1L B;  2ZE2 A;  2HHQ A;  1IKX A;  1LK5 A;  2L48 A;  3MMB B;  4X65 F;  4R5P A;  4IH5 A;  5IQ6 A;  5ETO A;  3M2V A;  2WON B;  2CPI A;  3ZTO A;  4OX6 A;  4A8M P;  3IXQ A;  2VL1 A;  2XZD B;  1VMB A;  3PXG a;  4JUZ A;  2DXF A;  3BZQ A;  2GAG C;  1G1X A;  2XYP B;  4ZVO B;  2V4J B;  3CW2 C;  3ZZO A;  1K1Q A;  2XMW A;  1RAE B;  2Z57 B;  1U0H B;  5I42 B;  3GJR B;  2HVH A;  4CRJ A;  3J81 U;  2DIU A;  4NYZ A;  3Q8Y A;  4I6A A;  3E3X A;  2V69 A;  1QLN A;  1RT7 B;  1IR0 A;  1TUW A;  3HFV A;  3KOA A;  2MGZ A;  1A0O B;  2DIS A;  2BJ7 A;  2XC9 A;  1R43 A;  1S6P A;  1YLX A;  2FLN A;  1QSL A;  2AT1 B;  2MQQ A;  3NGU A;  2RQK A;  3PKY A;  3EDQ B;  1YIT S;  2DNN A;  5HMY A;  2KB2 A;  1VHF A;  1WOP A;  3DDK A;  4PQU B;  4JI1 J;  3ZTQ A;  1ZZN A;  2M3D A;  2VG7 A;  1KS2 A;  3U27 A;  2J6T A;  5L9N A;  3MPU B;  5K14 A;  5CCL A;  2EK1 A;  1RAG B;  1HNI A;  2OPP A;  1OSC A;  2XTJ P;  3L7U A;  2DH9 A;  4C0H A;  2ZH1 A;  1U1O A;  3B4D A;  3ZZR A;  4KC5 A;  4O4G B;  1FTC A;  1RHR B;  3N5B A;  1RKI A;  4OYX A;  4I0W A;  2X1A A;  2EFN A;  3GU0 A;  1KC8 T;  3OL7 A;  1M5K C;  2OHD A;  1RBL A;  2OGU A;  1S6O A;  4ZP7 A;  3MAH A;  3UWT A;  4RBV A;  2JH3 A;  2ZBI A;  4UZB A;  4YY3 J;  4R0J A;  4HAC A;  2VDI A;  3M6W A;  2ALY B;  3T5L A;  1CSJ A;  5B0F A;  2IVY A;  2CDQ A;  2HNZ A;  5DM7 Q;  3HHK A;  2AX1 A;  5HMZ A;  2ZUG A;  1TAU A;  2GMJ A;  1K0V A;  4H4M B;  3GYN A;  3RAM A;  3EXY A;  3AH6 A;  3QO9 A;  1HR0 J;  2V34 A;  2V9W A;  1D9A A;  1NJX A;  2HFS A;  5KT3 A;  4DL4 A;  2MY8 A;  4LIR A;  3D2W A;  2KYZ A;  2VFT A;  3D3B J;  3PY8 A;  5B08 A;  5KT6 A;  3H59 A;  4HLB A;  5E7O B;  3WC0 A;  4ECY A;  3C2P A;  3IBW A;  4NL5 A;  2R7W A;  2PI5 A;  3V6H A;  5DQH A;  3MD3 A;  2J9D E;  2J9D A;  5E3C A;  4KGV B;  4UUX A;  2YQ1 A;  3QT7 A;  4ZVE A;  4DUY J;  3UR3 C;  4W4M A;  3C15 B;  2XMA A;  5K8N A;  1FNX H;  1FVQ A;  1XBW A;  1EKS A;  3W66 A;  1TQL A;  2Y1J A;  3NS7 B;  1S4F A;  4P73 A;  1OWX A;  1PG5 B;  1SJQ A;  1JJC B;  1CJV A;  4N7T A;  4P2M A;  3CO0 P;  1S1T A;  2DHS A;  2A6M A;  1I94 F;  3VZH A;  4QU7 A;  1ZTT A;  4QIW D;  1RK8 A;  4V1A k;  2AD9 A;  1FXR A;  1I5O B;  2V2Z A;  1WHY A;  4ZCI A;  3LAN A;  5IT9 U;  3ISN C;  3ISN D;  4IFY B;  4Z7Y A;  2CQD A;  3A1Y G;  1RYR A;  3SSR A;  2ASY A;  1LWX A;  4ZJQ A;  2F9D A;  4DG1 A;  1U1N A;  1K8A T;  5AXK A;  3IG1 A;  3GV7 B;  3AQO A;  3CCV S;  2GFF A;  4NZ7 A;  4YDX A;  2MEW A;  1NBE B;  1UA1 A;  3PRD A;  4QW9 A;  2DTJ A;  4QCL A;  3K17 A;  2UUB F;  3CDU A;  2H1Y A;  3WIU A;  3CCT A;  1NEE A;  4OI3 A;  3QGH A;  1HBO B;  2DXE A;  4YR2 A;  1VK3 A;  2QMW A;  3ELH A;  3NMA A;  5KFH A;  5IM0 B;  1U4B A;  2HFO A;  2BOP A;  4X65 J;  4EBE A;  2RHQ B;  1TVR B;  1S0O A;  4A46 A;  4OL8 A;  1KHW A;  3RG6 A;  3AOA A;  4PRF A;  1T03 A;  1W25 A;  2IM0 A;  2UXD F;  3IMQ J;  1N56 A;  2AQ4 A;  2CWX A;  1HNX F;  2CYY A;  2HZA A;  1QTN B;  4NLS A;  3MCS A;  4M5H A;  2FYX A;  3SEO A;  3IFE A;  2FLO A;  4MKA A;  2G0C A;  3NNH A;  2PEB A;  3BB5 A;  3F73 A;  4DR7 J;  2EBG A;  7AT1 B;  3SSQ A;  4KAI A;  3EZU A;  4DZ6 A;  1PBA A;  1UW9 A;  3L09 A;  1IM6 A;  4F3O A;  3CGI A;  4R25 A;  3ILJ A;  5LMU J;  3UNY A;  4DR4 J;  3D1H A;  2K7K A;  5IXU A;  2XYH B;  2J9E A;  1R6V A;  2DY9 A;  2M5Y A;  4NLG A;  4ZVS B;  1UPP A;  4QYZ J;  3PEH A;  4CLY A;  2AYE A;  4OJH A;  3UNG C;  2Y8W A;  2QC3 A;  3UR0 A;  1PJ5 A;  3MAA A;  3CTR A;  4LFA J;  1BLU A;  4X4T A;  2GC8 A;  1RP5 A;  2BAB A;  2WAQ D;  4YR0 A;  1NLK L;  2PII A;  2C3M A;  2HND A;  3CDB A;  4FBU A;  3HLU A;  3TJA A;  4ZCK A;  3BKU A;  5MLC V;  2LFV A;  3UDL A;  4DV7 J;  2YKN A;  2W9B B;  2W1B A;  4DU8 A;  1HA1 A;  2HHW A;  2W2Q P;  3UDV A;  3QIP B;  2KFY A;  2IFX A;  1YJR A;  1FWK A;  3MZI A;  2R8K A;  4ETX A;  2ZEJ A;  2AIR B;  1B64 A;  3QT6 A;  2CJY B;  4DDF A;  3RB6 A;  2I2Y A;  1M5P C;  1IN0 A;  3DLE B;  1LWC A;  2B6A B;  4DPT A;  2LQ9 A;  2J8S A;  2G1H A;  1RAO A;  3G8Q A;  2QA2 A;  1KLN A;  2K1R B;  2ZH7 A;  1MU2 A;  1F0X A;  2HS0 A;  3FEX B;  3QPI A;  1UEK A;  2XMU A;  4QW8 A;  1F6T A;  4ALZ A;  1ZBT A;  4F0M A;  1RGV A;  5FDL B;  1T3N A;  2XS7 A;  3OBI A;  1FDA A;  2HRY A;  4G3I A;  1FE0 A;  1JXL A;  1TP7 A;  1DJ0 A;  4OZ3 A;  1N36 F;  3NAH A;  4M5D B;  4ZIV A;  3GCW P;  4DI6 A;  2DYA A;  1SL2 A;  3QRQ A;  3FBB A;  2HFV A;  5BXI A;  3OTE A;  2W7O A;  1YRT A;  5A8R B;  3BH6 B;  1FKO B;  3OJS A;  5IQQ A;  2JC0 A;  3PHE A;  1CLF A;  4J90 A;  1NM2 A;  5HAO A;  1R8P A;  1PKU A;  3IRX B;  1NKC A;  1HD1 A;  3TA0 A;  1KD1 T;  2FC8 A;  3V6D B;  3A8K A;  4PZV A;  3GSI A;  2FB0 A;  5JUM A;  1SUQ B;  1TK5 A;  1SVD A;  4F8R A;  4D3H A;  4OLP A;  2DGX A;  1KVK A;  4Y65 A;  2OSQ A;  4P75 A;  4KQZ A;  5E3Q A;  1N5T A;  4OYW A;  3BN4 A;  4MTP A;  2JLF A;  3MEG B;  1UCN A;  3TUZ C;  3HHL C;  3HHL D;  3E51 A;  1S1X A;  1I94 J;  1N6Q B;  4I1T A;  2YKO A;  4WP8 A;  4F25 A;  3PIO Q;  3DC2 A;  2ACM A;  4M5D A;  2LU2 A;  3RB0 A;  4NZ6 A;  1FNM A;  4I4B A;  3HMJ G;  4ES1 A;  1N32 J;  2E1P A;  5AE1 A;  2I6W A;  2JEG A;  3BPS P;  5LSR A;  1S1V A;  3GII A;  2NSB A;  4RWW A;  4J5O A;  4CO4 A;  1WF2 A;  2DPJ A;  1VQN S;  5J2P B;  5SZT A;  1FKP B;  1KQF B;  1MN9 A;  3IWL A;  3DOL A;  1WTB A;  4ZPV R;  3NY0 A;  2C2M B;  2UUB J;  4J9P A;  1YK9 A;  2JLE A;  4IH7 A;  8AT1 B;  3R5D A;  4UOG A;  2JNJ A;  3C14 A;  2E1M C;  1WOS A;  1N33 F;  3CMA S;  3VAI A;  4LSN B;  1O5J A;  4AL7 A;  3RR8 A;  1Y5L B;  2FJX A;  4BHQ A;  1X4G A;  3R5C A;  1IWA A;  3LAK A;  1F9F A;  5HI7 A;  1QE1 A;  2BJ1 A;  1F3V A;  4FP9 A;  3HSG A;  1KR4 A;  4W98 A;  4RW8 A;  4RW4 A;  2UXD J;  1Y7P A;  3JTP A;  4I2P B;  3GG1 A;  1CPZ A;  1HNX J;  3PR4 A;  5ETT A;  1G6B A;  2FIU A;  4KGZ B;  3I4P A;  1GTE A;  3RRG A;  3MR6 A;  5IFM A;  2IA0 A;  3I9Z A;  3QRR A;  3CDA A;  1VRU A;  1AZS A;  1TKZ B;  4F4W A;  4CCH A;  2VHG A;  3PZP A;  2XO7 A;  4ILR A;  3CCM S;  3AFG A;  3MPW A;  3ZZY A;  5CXT A;  2ILY A;  3C6T A;  4ZDN A;  2NUH A;  3ILL A;  2GVZ A;  3K5N A;  4DF8 A;  2RRA A;  4Y0F A;  3BBC A;  2V8D A;  1SH2 A;  4JB8 B;  3V6J A;  5KFT A;  3V4I B;  2E29 A;  3U02 A;  3UFC X;  3RRK A;  4K2J A;  1HD0 A;  4LF7 J;  1GNK A;  2KYX A;  1PYO B;  4LF9 F;  1DQ8 A;  2OPS B;  1DTQ A;  3MEE A;  1FRI A;  4K7Q A;  2N3O A;  1R8C A;  4HH1 A;  5HK4 A;  3GV8 B;  4I69 A;  5L8R C;  2COL A;  2RDJ A;  1RUS A;  4KTQ A;  3M2U A;  2ZJQ Q;  3EGN A;  1RAF B;  2HGN A;  1MRO B;  3N6L A;  1N34 J;  4I7F B;  3RU0 A;  3TQ1 A;  3C46 A;  4FS1 A;  2Y1R I;  3BGF A;  2O1P A;  1M0S A;  5IWA J;  1ZAV A;  1SQG A;  3RUB L;  3TAP A;  2F40 A;  5F8N A;  3POT B;  1YJ7 A;  3JYT A;  1C0T A;  2W4P A;  3PNI A;  1IM4 A;  3DRP A;  4C0O C;  2V2K A;  4Y2M A;  4DL5 A;  5LXR A;  2VB6 A;  2ZKT A;  4GC7 A;  1PIE A;  3ITH A;  4DX6 A;  4LVO P;  1NPK A;  1NRK A;  4LSL A;  1X5O A;  1RA6 A;  3NXZ A;  3J81 j;  1TFW A;  4QQB A;  2YNI B;  5BYS A;  3MM5 A;  2L3M A;  1TTH B;  3D6M B;  5AE2 A;  1H3D A;  1IR1 A;  2XMT A;  1BC6 A;  4LRC A;  3NCP A;  3PR5 B;  1MW7 A;  4AT1 B;  2JFD A;  1PGZ A;  2J0W A;  1M1H A;  1RAC B;  3K5L A;  1Q82 T;  5DGA A;  2WOM A;  2NUU G;  3CDE A;  1QSY A;  1F5C A;  1UVN A;  2JDJ A;  2D7S A;  4DV6 J;  2K06 A;  3GIL A;  2JRS A;  2LYV A;  2UVR A;  2MKC A;  4EI2 A;  3MMC A;  2H48 B;  4N8N A;  2PC6 A;  5DDO C;  3G6Y A;  2JFK A;  1FD8 A;  1MMN A;  1DY3 A;  4Y28 C;  4LQ9 A;  4IKA A;  4PXD A;  4ELT A;  1F3F A;  3W63 A;  1NB2 A;  4RNM A;  3NLC A;  3BBF A;  4NXN J;  4WXW A;  3Q23 A;  3LTO A;  1LOU A;  2HFZ A;  2RU9 A;  1NME B;  1REG X;  1UVL A;  2HAI A;  4LBH A;  4R8U B;  1ZAW A;  4KGX B;  1FK9 A;  3FRZ A;  3Q2T C;  2V9K A;  1YSJ A;  2XCP A;  4L73 A;  3GFZ A;  2F65 A;  4IOC Q;  5LSL A;  4ZJO A;  1XC9 A;  1WC1 A;  3UN2 A;  4LQ3 A;  3UN5 A;  2KFZ A;  5ETK A;  3MM7 B;  3RJM B;  4ICL A;  3NP5 A;  2DD8 S;  1LKZ A;  2XB2 D;  2IC3 B;  3NBP B;  3PX6 A;  1MWQ A;  1RSC A;  1RWN B;  3CUL A;  4DCJ B;  1HNZ F;  4GO7 X;  4NCG B;  4HDG A;  2BEF A;  3MM8 A;  3N6N A;  5DG8 A;  1BQN B;  1N33 J;  4C11 B;  3IP0 A;  3GPA A;  4P10 A;  1RHK B;  2AJQ A;  2GNK A;  2QG9 B;  4CNY A;  2IAJ A;  1FDB A;  2HVZ A;  3OFE A;  2M8H A;  4KJI A;  5GAD U;  2AGP A;  3K0J A;  1T02 A;  5HO4 A;  1HW8 A;  1T05 A;  3J7Y I;  2C22 A;  1LWE B;  2B7B B;  4ZHR B;  4EBD A;  3KK1 A;  4KH1 B;  3KUE A;  3P5B P;  2MST A;  4F4K A;  1RAJ A;  2J5A A;  1B0V A;  1WUU A;  4C8M A;  1C1B B;  2CDR B;  2CQ0 A;  3JQJ A;  1S79 A;  3KJQ B;  1NK4 A;  2MSS A;  2AW0 A;  4CYU A;  5HRO A;  1V3R A;  3M7V A;  2CVE A;  1XR5 A;  2GIF A;  2BMB A;  4QYR A;  3KFW X;  5DQG A;  4U7U K;  1RT5 B;  4L6V 3;  4OV1 A;  3TAR A;  1A9N B;  4M5I A;  2PMW A;  3CMQ A;  4OI4 A;  2YNG B;  4LF9 J;  1W7W A;  2DCL A;  4HTJ A;  3CJ0 A;  3MM6 B;  3GJQ B;  1VQY A;  4X4U A;  5KFC A;  5KOX A;  3LUY A;  2VFU A;  1RHJ B;  5C7P A;  2V2V A;  2F5G A;  2B5J B;  5FLX Y;  1JXE A;  3KNG A;  3EMT A;  3NAI A;  1SKW A;  2VPY B;  1ZOT A;  5CYM B;  2X1B A;  3ILO A;  1J27 A;  1HHS A;  2HIQ A;  2VC0 A;  3B8H A;  3JSM B;  5HN0 A;  4B3O B;  4NX9 A;  3OSN A;  2YWK A;  1RWO B;  4QIG A;  2MZT A;  1IUJ A;  1DTT B;  3DNC A;  3U1N A;  1HYS A;  4OHV A;  3DLB A;  2K3K A;  3PW2 A;  2BJ8 A;  2HK2 A;  2FY1 A;  2MTL A;  3RBE A;  2GQ2 A;  2MKY A;  4DF4 A;  2GHP A;  2DGT A;  1ZAX A;  4P2X A;  2DHG A;  5D8H B;  2JVR A;  5KG4 A;  4ZMM A;  2GCF A;  1IKW A;  4ZVG A;  3LP1 A;  1S7H A;  5KOW A;  2ERR A;  1KBR A;  1AB8 A;  3O44 A;  3L95 X;  4O44 A;  3V4M A;  4K0K F;  4WFB Q;  2LDY A;  4ENO A;  1KFD A;  3OHA A;  3KWM A;  3ONQ A;  2GJI A;  3QGP A;  5DG9 A;  2GQC A;  1M5H A;  4I64 A;  4LF5 F;  2VOP A;  2XEX A;  4CI0 B;  2GAH C;  4KGM A;  4ZP9 A;  4ID5 A;  4DV1 F;  2BKO A;  2VBX A;  3CJS A;  2OI2 A;  1TMM A;  4X4R A;  3TA2 A;  2CAD A;  3NCR A;  3F56 A;  4ELV A;  1GX6 A;  1VK8 A;  4QPX A;  1S6U A;  3US5 A;  3IR7 B;  2ZWO A;  1EAY C;  1FE4 A;  1TR0 A;  2D1C A;  3M2R B;  3NGK A;  2PO4 A;  4PXB A;  3G4S S;  2HHS A;  2BW7 A;  3EGZ A;  4QWE A;  2L08 A;  4J9N A;  4K5S A;  4GVB A;  3I0S A;  4Z37 A;  2HHT A;  4CNZ A;  3G82 A;  2C3O A;  4J9O A;  2FD2 A;  3I31 A;  4U9R A;  3R7N B;  3A3O B;  4YHH J;  4GKJ F;  4NAS A;  3AOC A;  4DV4 F;  4IRK A;  1Q95 G;  2CPH A;  2O67 A;  2POK A;  3MED A;  1JKH A;  5JVG Q;  2GIQ A;  5D6G A;  4ZPB A;  1EET B;  2HHU A;  2DHA A;  1NJI T;  2IIH A;  2M4M A;  3TZW A;  5DGB A;  2W2N P;  2B4P A;  1V6H A;  4IG0 B;  2KG1 A;  3WX8 A;  2CPY A;  1UVJ A;  3EVW A;  1CBK A;  2HVI A;  2CNL B;  1I1G A;  2LP4 A;  4G1Q B;  2NYI A;  3QT8 A;  2P9G A;  1HNZ J;  2QO3 A;  2ZH6 A;  4ZLJ A;  4X4P A;  1RWV B;  2ZM6 F;  1TL7 B;  4PCQ A;  1H73 A;  2R7V A;  4Q5V A;  3D0H E;  5CD4 H;  1F9H A;  4CM2 A;  2OPR A;  4JI3 J;  2R7T A;  3RW7 A;  2PD1 A;  4HHU A;  1RT2 B;  4DV5 F;  4USJ C;  1SQF A;  2HPU A;  3OR2 A;  2IBK A;  4DSI A;  5DDP C;  5C42 B;  3CJR A;  2BAC A;  1F2H A;  2HRU A;  2D3Z A;  4GKK J;  5HMX A;  2ZD1 B;  3H5U A;  2NPF A;  3RR7 A;  2QLF B;  3IR6 B;  4HVZ A;  4UTG A;  2VKR A;  3W61 A;  4HI1 A;  2CQI A;  5GAE I;  5KFN A;  1EKR A;  1FWL A;  4A8X A;  2RE1 A;  3V81 A;  2FDN A;  2AV5 A;  4YUD A;  3TZY A;  2NZC A;  2OH2 A;  1TZ0 A;  3CD6 S;  2ZVI A;  1SPB P;  5LSO A;  1HI1 A;  2MPU A;  4KO0 B;  1TKT A;  2JJ4 D;  3KLI B;  2LEA A;  2ZH9 A;  3FCH A;  2F3J A;  2ZDP A;  2DT9 A;  4KFB B;  5E3P A;  1LW0 A;  4URS A;  4NLU A;  3EVO A;  3HZG A;  1GMU A;  2MLZ A;  1WI6 A;  2AHO B;  4NYO A;  2JOQ A;  4TY8 A;  3OW2 R;  4RZR A;  3D66 A;  1FDD A;  4TYA A;  1GK8 A;  9ATC B;  3BO4 A;  1UEU A;  2BYC A;  2I9S A;  1HQE B;  3PW4 A;  2FHM A;  1UZH A;  4L72 B;  4DX8 H;  2EWH A;  1HPZ A;  1RXO B;  3PM9 A;  2C3Y A;  4EK2 A;  1EP4 A;  1HLW A;  2AZ1 A;  3AXM A;  4ECW A;  5A0Y A;  3FSI A;  1WTF A;  4DQI A;  2GJ2 A;  1CUL B;  3IC1 A;  3IWX A;  1I3O B;  1TL1 A;  2ZOG A;  1Q4R A;  2ZH2 A;  1KFS A;  3BGR A;  5L1K A;  4LJM A;  3N6M A;  2QL9 B;  1LW2 B;  3GP9 A;  3JXO A;  4RUH A;  1BE4 A;  3SSS A;  3DOM A;  1JIH A;  1FVS A;  2XUL A;  2V6A A;  3W2V B;  2LU1 A;  3OLB A;  3Q8U A;  1S10 A;  3FCW A;  2I5J A;  3PKM A;  4F7V A;  1LXN A;  3DOK A;  5CH7 B;  4K0K J;  5EWE A;  3I6P A;  1TU0 B;  1DLO B;  1TFY A;  1OY6 A;  3C19 A;  2OFH X;  2F4V F;  1B7F A;  1FFS B;  1RTJ A;  1U8W A;  2Q66 A;  1NH8 A;  4ECX A;  1NK6 A;  1NDC A;  1WDD A;  3IM9 A;  2QLW A;  2GS8 A;  5KFQ A;  5HLF B;  1RTI B;  4TNO A;  1SC1 B;  3T1A A;  3CNQ P;  3PYD A;  3KHL A;  1X4B A;  1NSK L;  3KK2 A;  4ECR A;  4TLR A;  4HHJ A;  1QAX A;  3A8J A;  4H4O B;  1N52 B;  3AOD A;  1R8A A;  1NU4 A;  1RT1 B;  4CLP A;  5CA5 A;  1N0V C;  4RL1 A;  1Y3K A;  4B3R J;  2KKH A;  3SFG A;  4PAA A;  5A2Q Y;  4GKJ J;  3KXD A;  1UWA A;  3ILI A;  2H65 B;  4DV4 J;  4C8K A;  1TKX A;  3FK4 A;  1E6V A;  1U2F A;  1IBC B;  2Z58 B;  1KVJ A;  3R8Y A;  3W2W B;  2CQG A;  1CG2 A;  4Q45 A;  3BGO P;  2QA1 A;  1TV6 A;  4BC7 A;  1JX4 A;  2MZS A;  3OTC A;  4MFB A;  2QEX S;  4NLV A;  2UUA F;  5D4P A;  3OFH A;  4P74 A;  3GQC A;  4F2S A;  5M2R A;  2F7V A;  3H4B A;  1VQ7 S;  2IA6 A;  1Q8B A;  2C2K B;  4OYP A;  3N9U C;  3JSY A;  2H4Y B;  3MCM A;  1H0H B;  2DHH A;  4LR7 A;  5ETV A;  3DHX A;  4PPZ A;  2BAN A;  1E6Y A;  2H5I B;  2RUG A;  2V2Q A;  3DI6 B;  2GZO A;  4YOE A;  4DV5 J;  2K7J A;  5A76 A;  4GMK A;  1L3K A;  2J0S D;  3DDI A;  1PJ6 A;  2YNH B;  4F02 A;  1KDN A;  4KIA A;  3DMJ B;  1ZM4 A;  2ASL A;  1RT3 A;  5CD4 A;  2ZZM A;  4M1K A;  4BDP A;  1XR6 A;  5DLG A;  3C3L A;  5IT4 A;  4XPE A;  3DRR A;  1KLM B;  4M5L A;  3CIM A;  1TK0 A;  4OMF G;  3MMJ A;  4MJK A;  2GA7 A;  5DRK A;  3I0R B;  3KNA A;  4QYZ K;  4WKY A;  3TUI C;  4ZPT R;  4DPW A;  4GO5 X;  3LF0 A;  4YFU A;  3D6H B;  2MQM A;  5DLF A;  2D74 B;  2MQP A;  3J7A N;  1J2V A;  3VAK A;  1CC7 A;  1Z2L A;  2JX2 A;  2CQ1 A;  1WG4 A;  3DHW C;  3DXB A;  5L1J A;  4QOT A;  1Q5Y A;  3KK3 A;  1UJ6 A;  1RU1 A;  5G0R B;  1T8E A;  2MKH A;  2J0X A;  1HQU B;  4OIX A;  3RAQ A;  5HSP A;  2B56 A;  4TU8 A;  3R2D J;  3OR1 A;  2ZJR Q;  2YVS A;  1XMB A;  2LXI A;  2KO1 A;  1U8S A;  2ZH5 A;  1WHV A;  2AYB A;  3HT0 A;  5L38 A;  2XI2 A;  1SL0 A;  3P8B B;  2B51 A;  3VQS A;  4TQR A;  4EGL A;  2VC1 A;  2J6U A;  3A8I A;  2XMJ A;  3IS9 A;  1RTD A;  1DFD A;  1WEZ A;  2VU5 A;  1S1W A;  1SV5 B;  3MOZ A;  3R27 A;  3H5S A;  4RW6 B;  3PJX A;  2Y0S D;  5HVG A;  4K4Y A;  4AND A;  1ZM2 A;  1VS3 A;  1YBU A;  4HDH A;  1J5O B;  3TA1 A;  3T41 A;  4I2Q A;  1KRP A;  4Y3C A;  3MGJ A;  2CPF A;  2B43 A;  3MM9 A;  4O3N A;  2R7S A;  3OFF A;  1VQO S;  1RDR A;  1JLE B;  4CTA A;  5M2U A;  5CZX A;  1XNQ F;  2BBE A;  4XPC A;  4K4U A;  2HMI A;  4KHP J;  5L9X A;  4DR1 F;  3F44 A;  3N01 A;  3JSR A;  3CC2 S;  4WTO B;  4USK A;  3EYZ A;  2FHJ D;  1R8B A;  2DCU B;  3I56 S;  5LT5 A;  2R2T A;  5KG2 A;  2PDA A;  2DNP A;  1WEX A;  1RAH B;  2F63 A;  2XHW A;  3QZ7 A;  2EFG A;  1L5U A;  4IOB A;  3SV4 A;  3HK2 A;  5C24 B;  3WDO A;  3OFG A;  3DGP A;  2CWK A;  2Q43 A;  5KFI A;  2BE2 A;  1X0P A;  5EHH A;  5KG7 A;  1X60 A;  2XSJ A;  1FRM A;  3PTW A;  3SQG B;  3WZ0 A;  2RKI A;  4ERD A;  2ZHB A;  2EC0 A;  5F8G A;  4DQS A;  3PJ9 A;  3UO0 A;  1KOO A;  1RWM B;  4RNF A;  3FKB A;  3M1V A;  4Q0B B;  4WJB A;  2CFX A;  2HQC A;  3NS5 A;  3PYG A;  1JLG B;  1JXV A;  5HL7 Q;  4RU9 A;  4DLE A;  5KT4 A;  2YNF A;  3JSB A;  4WYW A;  4M5K A;  2V50 A;  3THT A;  5BR8 J;  1S1U A;  1RHQ B;  2QA4 S;  4ZIT A;  4K8R A;  3EUN A;  1HBU A;  1BWV A;  1TK8 A;  4PUO A;  5HQ8 A;  3TWZ A;  1FES A;  1WC5 A;  2UUA J;  2RML A;  3FBC A;  3CE8 A;  4LF1 A;  2UXB F;  2XNQ A;  3MCN A;  3E01 A;  5HBM A;  4U7U D;  2XGP A;  4UZC A;  4RW9 B;  1NHV A;  2Z30 B;  2VG6 B;  1H7W A;  2M88 A;  1CJK B;  1C1C A;  3UW1 A;  1T0T V;  4NXM F;  4DPU A;  4FF3 A;  2FGO A;  4MK8 A;  4WFN Q;  4K4V A;  2IMW P;  4LF2 A;  4LBP A;  3ISZ A;  5LJ5 Y;  3QJL A;  2ZOM A;  2RUS A;  2ZBQ A;  1AW0 A;  4FNH A;  1RT4 B;  4K4W A;  5IOL A;  2XSF A;  2VQF F;  3BSA A;  4WYL A;  2RB7 A;  2OFG X;  1OSD A;  3K5P A;  4KPC A;  2VF3 A;  1RI7 A;  3JS9 A;  1AUD A;  2EW9 A;  3UCZ P;  3SDE A;  2WRM A;  1FEE A;  1S9G B;  4DBQ A;  3HJF A;  4HYK A;  2CPD A;  1HMV A;  2EKY A;  1P8G A;  1PAU B;  3AXK A;  2WSC C;  1HBM A;  2DVI A;  1RTH A;  4USM A;  3FVY A;  5AXL A;  1MWY A;  4B9S A;  3OSP A;  4J91 A;  2H5E A;  3QAT A;  3K5M A;  1VQP S;  3GIJ A;  4OJG A;  2V5H G;  1RCO B;  2N4D A;  3QBC A;  3KTQ A;  1IBK F;  3OT9 A;  3M6V A;  3EX7 B;  4NA2 A;  1JLC B;  1P27 B;  4F0H A;  1RAA B;  1UZD A;  1UKU A;  2LVW A;  2Q79 A;  4LRD A;  3GIK A;  5F8L A;  4JI0 F;  1HAR A;  3JTO A;  4OYB A;  1KVI A;  2MDA A;  4CLW A;  3P6Y C;  3S1T A;  2CQ2 A;  1XNR F;  2VG5 A;  2F8H A;  4K5R A;  1U02 A;  5J2N A;  4AUK A;  5H9E J;  1SI9 A;  1JLA B;  3QLH A;  3VHQ A;  4HI2 A;  2G0J A;  3M6X A;  4ETZ A;  3CME S;  2N7C A;  1XTZ A;  1HBN A;  5GAH U;  4JI4 J;  1HQ2 A;  4NI2 B;  2V4R A;  1R3N A;  3EIC A;  5F3T A;  2B7C B;  4QIV A;  3IA0 A;  4IDK A;  2ZNZ A;  4UOF A;  1XNQ J;  4IFV A;  1S0V A;  1JLF B;  4ZLL A;  3HX9 A;  2WK4 A;  2XO6 A;  2KI2 A;  1X4C A;  2VPZ B;  2ROG A;  1MML A;  1VQM S;  1VGY A;  4QIF A;  4ED6 A;  3BS9 A;  1GFW B;  7FDR A;  5IZH A;  1URR A;  2GVD B;  2WVB A;  2Z4P A;  3S8S A;  1JK9 B;  3C6U B;  3U1L A;  5KTQ A;  3M30 A;  5ETR A;  4B3M F;  2HNY A;  2FJV A;  5KFD A;  3OUY B;  3TR5 A;  3CJT A;  3ETO A;  3DRS B;  5KFB A;  2D9P A;  4WXO A;  4EZ9 A;  2VJU A;  3WQP A;  4YQW A;  3LA0 A;  1SKS A;  1FX2 A;  3F0N A;  2D3U A;  4TU9 A;  4RW7 B;  2V4Q A;  2AF6 A;  1T9V A;  2ATL A;  2AZ3 A;  2A0F B;  2CA9 A;  2NRE A;  3T1H F;  3CJ4 A;  3MR5 A;  3GFX A;  2GHV C;  1WG1 A;  5K8P A;  1F1B B;  4KY3 A;  5A8K A;  4PXC A;  4XAK A;  1HIY A;  2KZZ A;  3D1Q A;  4KH0 B;  2KJV A;  4CLZ A;  1Q16 B;  3ZZ0 A;  1UA0 A;  3LGN A;  1OS5 A;  4JI1 F;  3AB4 B;  3GTY X;  1C0U A;  3IBF B;  3QNW B;  2BV3 A;  1AT1 B;  1VBY A;  2HQ3 A;  1HNV B;  2MQO A;  1X0F A;  1O0P A;  1N4L A;  2FLL A;  5ETP A;  2UV8 A;  2HHV A;  2I0X A;  5CYQ B;  6AT1 B;  2OPQ B;  5KFR A;  3TEG A;  3LPE A;  1NJY A;  1SJ4 P;  2CNO B;  2HZV A;  3UE2 A;  2MXY A;  3UCG A;  3J7Z T;  2K8G A;  3B82 A;  5C25 A;  1VRQ C;  3NWG A;  2W25 A;  1NPP A;  1LWF B;  3KLE B;  3A3N B;  3PDN A;  1Q79 A;  5T7L A;  5F0W A;  1S5Z A;  4FYX B;  2YXL A;  1H72 C;  2VBZ A;  1N5Y B;  4EYH B;  4X4S A;  3CT9 A;  4OI2 A;  1YBA A;  4I68 A;  4X4Q A;  5J1E A;  3W60 A;  1WKJ A;  1K73 T;  5B0G A;  3CJ8 A;  5HP1 A;  1IBL F;  1AA1 B;  2GW8 A;  4DV3 F;  3QWU A;  4USI A;  2MQN A;  3R7B B;  3HHD A;  5J2Q A;  3DRX A;  1X5S A;  1RWP B;  2D9O A;  4TQS A;  4KKO B;  1XJW B;  5FLX U;  2RSQ A;  4F67 A;  2DEI A;  4M63 A;  1IKV B;  2IVM A;  3M8Q A;  2PFF B;  3LP0 B;  1TUV A;  2BQ3 A;  5KG1 A;  1NDK A;  1B0T A;  2ZE2 B;  1IBK J;  3C8Y A;  4E98 A;  2OJ3 A;  1IKX B;  2G0I A;  2PFD A;  2XS5 A;  3VGU A;  4YEA A;  4PR6 A;  4R5P B;  2G1D A;  4KYZ A;  3M2V B;  4WP9 A;  1N5Q A;  2F9J A;  4DFK A;  3DLG A;  4OI6 A;  4EFA C;  4S0M A;  1FFW B;  1N48 A;  4QR2 A;  2C3U A;  3MUV P;  3HT3 A;  4YR3 A;  1BY9 A;  3R5J B;  4V19 X;  2XLJ A;  1JLB A;  2OKQ A;  3O6Q A;  2SXL A;  5F8J A;  2QIF A;  2LA4 A;  1BQX A;  5KAK A;  2PEH A;  1RAB B;  4A8W A;  4ECS A;  1ZET A;  4B17 A;  3HHN B;  1M5S A;  1L3S A;  1J5E J;  3QMQ A;  5B7W A;  2NSC A;  2MGZ B;  2HUR A;  4LF6 J;  2AJ4 A;  2BQU A;  2WB1 D;  5KT5 A;  2BDP A;  1CJT A;  1S6P B;  2W8L A;  3M9M B;  3NGS A;  3CCW A;  4QBU A;  2VV5 A;  1FI4 A;  2H4W B;  1IQZ A;  2E1A A;  4M5N A;  3QSI A;  2HW3 A;  2CIM A;  1JLQ A;  2IHR 1;  2ZBC A;  2OIH A;  4RBU A;  3H0P A;  3NOG A;  4FXV A;  4IG3 A;  1IVZ A;  1O8B A;  4DSE A;  2ROE A;  2LKZ A;  1N54 B;  2BKP A;  4B3M J;  4DS4 A;  3W62 A;  3MMA A;  3P5T L;  2VG7 B;  3KLH A;  5MAO A;  1UWB A;  1NH7 A;  5AXN A;  1BQM A;  1S7I A;  5K14 B;  2NYH A;  1HNI B;  3MAQ A;  2DJW A;  2EFO A;  2OPP B;  2XY6 A;  3R5A A;  3W1Y C;  2E7V A;  3J7Y U;  1N8R T;  3HHL A;  3CCQ S;  3GE9 A;  4DR7 F;  4ECZ A;  1U6Z A;  3CD7 A;  3VV2 B;  4IQM A;  2R7Q A;  5IS2 A;  1W2I A;  2R7O A;  3KUG A;  4AQY F;  2E7X A;  5KFA A;  2CQP A;  5LMU F;  2Y0B B;  3HVR A;  4DR4 F;  3T1H J;  4NCB A;  4HAC B;  2AU0 A;  3FMB A;  4DCO B;  2CG4 A;  1IWG A;  3ENW A;  2HNZ B;  1Y00 A;  2HQF A;  1VC0 A;  1FRL A;  2RQC A;  4ZLN A;  3VF0 B;  2V8G A;  3KLF A;  4LFA F;  1FF2 A;  2J7W A;  5AJ3 J;  2DXD A;  3GB0 A;  4FVC A;  3QO9 B;  4PG7 A;  4NML A;  1S49 A;  2XBP A;  3CDW A;  2E5L F;  3CJ3 A;  2G2Y A;  1S12 A;  1VBZ A;  1R0A A;  1L3V A;  1VIS A;  3PG9 A;  2OD4 A;  4DV7 F;  3GFY A;  4CT8 A;  2YKM A;  2FVR A;  1FO1 A;  3BKF A;  1GTH A;  2VH7 A;  3MCO A;  3MFH A;  4ED8 A;  1VLO A;  1RQ0 A;  4ZVR B;  3C16 A;  1ZH5 A;  4HKQ A;  3M4X A;  3HXM A;  4JOU A;  4URG A;  3T5H A;  3UQS A;  4ES3 A;  1N88 A;  4ILL A;  2ZC4 A;  1N0U A;  3UD5 A;  3HFK A;  3O8W A;  4KT0 C;  5KT7 A;  3MR2 A;  3IR5 B;  4CLS A;  3BYR A;  1WF0 A;  2R2S A;  1C4C A;  1FT8 A;  1MMD A;  4CIO A;  3IGV A;  4X4V A;  2KRR A;  4UST A;  3S6E A;  3D3C J;  2ZH8 A;  1CJV B;  2OTJ S;  1LEO A;  2ZH3 A;  2QMX A;  2RD5 C;  3X3U A;  1S1T B;  4ZPD A;  3V5R A;  5IC4 B;  1QSS A;  4C8O A;  3Q8Q B;  1ICE B;  2CJQ A;  4J9L A;  5F8I A;  2X3D A;  1F5B A;  4X66 F;  3T5J A;  4CO2 A;  1RWK B;  3B78 A;  1IBL J;  2DGW A;  4DV3 J;  1RHU B;  4NRU A;  4DPO A;  1XIQ A;  4PG5 A;  1SC3 B;  4DG1 B;  3OL8 A;  1GT8 A;  4B3T F;  2W2P P;  3FEY B;  3IG1 B;  4MIW A;  3I87 A;  1BMQ B;  4DPY A;  4ZN1 A;  3F41 A;  5EDW A;  2H54 B;  5DDR C;  4C8Y A;  4DHV A;  1YWX A;  3UI3 A;  4PYA A;  4OX9 F;  3O2I A;  1ACM B;  3DYA A;  2AEM A;  3QRP A;  1D9F A;  4Y34 A;  4XIU A;  3BDE A;  2AEJ A;  4P52 A;  2FPH X;  4FBT A;  2CPE A;  3MUM P;  3J80 Y;  3L3C A;  2VD3 A;  4MT1 A;  2RS2 A;  4DL6 A;  4OJ1 A;  1PO6 A;  2ASJ A;  1U09 A;  1T03 B;  4WE1 A;  4RR5 A;  3NGR A;  1N32 F;  4LRB A;  3R6G B;  4U8V A;  4E8U A;  3OXL A;  4NA3 A;  1Z2Z A;  3ADA C;  3NKY A;  3HHE A;  4OYA A;  4G1P A;  2B8P A;  4DL7 A;  1H98 A;  4OYI A;  2OEK A;  3OD2 A;  8RUC A;  2XWY A;  1LXJ A;  2KM8 B;  2EG2 A;  3BSN A;  4FN5 A;  1WAC A;  5JJB A;  4DMZ A;  2D3O R;  3DDN A;  3O5T B;  1JNZ B;  2NXN A;  4DFJ A;  2DIT A;  3G6X A;  3PJW A;  3W8G A;  3MAA B;  5KFP A;  3K7R A;  4N47 A;  2PGC A;  4DUT A;  1KQG B;  2C2D A;  2DNQ A;  3N5F A;  2YKQ A;  2HND B;  4A4J A;  4WU3 A;  1T95 A;  4K4T A;  2ZUA A;  1RLD A;  3HSJ A;  2P6T A;  2R9L A;  4HTI A;  3BR8 A;  2YKN B;  2MZR A;  3EGW B;  3R5B A;  2JLG A;  2DKO B;  3FGV A;  5A2Q U;  2A1B A;  4FZV A;  1QVG R;  4DPX A;  2JC1 A;  1UMJ A;  2Q6C A;  3SYZ A;  1U48 A;  2DR7 A;  1H7X A;  2IM3 A;  1LWC B;  4AQY J;  3L9Z A;  2RIJ A;  5H9F J;  1VBX A;  3W9H A;  1G4C A;  1CJU A;  1MU2 B;  2N4C A;  2YKP A;  3KLG A;  2QFJ A;  3PVX A;  4LF7 F;  1UFW A;  4MKY A;  2UU9 F;  4KR0 B;  5HVH A;  2HAF A;  4OZ5 A;  2PA3 A;  2LXU A;  2E5L J;  2CQC A;  5KFS A;  3ZC4 A;  2JWN A;  1RB0 A;  4B9M A;  2FVP A;  2KXF A;  3HDS A;  3U7J A;  3OTB A;  1N34 F;  2PI4 A;  2KT3 A;  1FNO A;  1ITP A;  3UVJ A;  5IWA F;  1OMS A;  2NXU A;  4KV8 A;  4URQ U;  1CS4 A;  1UP1 A;  3Q86 A;  3OHB A;  2YY3 A;  2HFN A;  5D3G A;  5EX3 A;  2VZ9 A;  2O3D A;  3PRV A;  2G2Z A;  2A2C A;  4IQX A;  1HHQ A;  2J6S A;  2WVF A;  4X4O A;  2C3P A;  2QJ3 A;  3JB9 k;  4OZN A;  2U1A A;  3AQP A;  3MEC A;  5D0G A;  4J9S A;  3J7A 1;  2DNY A;  1M1G A;  1Q1K A;  4QWC A;  1VQ9 S;  2QLX A;  4KSE B;  2YPY A;  4BC9 A;  2UUC F;  5HAN A;  2KT2 A;  4CO0 A;  3LH2 S;  2QRR A;  3HVA A;  1S1X B;  4OZJ A;  2LEC A;  4FXW A;  1QDU B;  3FFI A;  4BBY A;  4Q44 A;  1KQS R;  5IT0 A;  2DNZ A;  3PRB A;  3PV8 A;  4X66 J;  4UOC A;  4CH0 S;  1M90 T;  1U1P A;  5HJX A;  3CJQ A;  1D8Z A;  4ZJL A;  1S1V B;  3ET6 A;  2JEI A;  4B3T J;  1RT6 A;  3TX0 A;  5KFW A;  1IJE B;  2DB1 A;  2BJ9 A;  2RF2 A;  1BXN A;  3SIP B;  4ZVH A;  2JEJ A;  3DOL B;  3W8P A;  3S01 A;  4G1I A;  4DV6 F;  4J7C A;  1CVJ A;  4N41 A;  2BW2 A;  1XMO F;  3ZFV A;  3KJV A;  4AXJ A;  1HWU A;  1BHN A;  2W9C A;  1IKY A;  4OX9 J;  4BWJ A;  3C14 B;  1U2C A;  4X64 J;  5JVH Q;  1SH0 A;  1WC4 A;  1ZPV A;  1LQ9 A;  4HEA 9;  3DLK A;  2VJV A;  1C2P A;  4DN9 A;  4NXN F;  3W3S A;  2FHO B;  2YBV A;  1FER A;  2GO9 A;  5KFV A;  3TAQ A;  4FKY A;  1QE1 B;  2VA2 A;  1WKK A;  1S6Q A;  4RW8 B;  4RW4 B;  3PFE A;  3FCV A;  2FTR A;  1GQE A;  4Y2C A;  2MB0 B;  4QIE A;  3PW7 A;  5B0D A;  3VAG A;  3CJK A;  4WII A;  2CZ9 A;  3TEH B;  5DJB A;  2ZH4 A;  5B0E A;  3RRH A;  4LIW A;  3W5Z A;  1UL3 A;  4F4Y A;  1GMW D;  3TZX A;  1TL3 A;  1VRU B;  4MIA A;  2WB4 A;  1AZS B;  3L7O A;  3BN7 A;  2FJB B;  3CCU S;  1UJ5 A;  4OHZ A;  2IM2 A;  3IBC B;  3EM1 A;  3E8O A;  1HKA A;  3C6T B;  1S57 A;  5HVF A;  2WVD A;  5DG7 A;  2GVZ B;  4NYP A;  1X4D A;  3OLA A;  3BGL A;  1HHT P;  1SKR A;  3D4J A;  3HVT A;  1U1Q A;  2V8H A;  1WHX A;  1JNR B;  3TAM A;  4PXE A;  3G6V A;  3L7P A;  2K2P A;  4ITS A;  2KTQ A;  1DTQ B;  3MEE B;  2CNK B;  2W4D A;  1OY8 A;  4B9V A;  2J7K A;  3MPD A;  4KPY A;  1QM9 A;  1S9E A;  5J2M A;  1UEV A;  4MIB A;  4PWD A;  4NEY A;  3M2U B;  1PBU A;  1VRT A;  2XZT B;  4A8F A;  3BBB A;  3R9L A;  1MNE A;  4I56 A;  1NHK L;  1S0N A;  1SB6 A;  1LK7 A;  1UFL A;  5A8W A;  1OY9 A;  2WSE C;  1QY7 A;  2AP6 A;  4RNO A;  4FYD A;  2KHD A;  1Q78 A;  3P96 A;  2HVD A;  1QD1 A;  3D0I E;  3W5X A;  2QT7 A;  4V19 J;  3BQ1 A;  3JYT B;  4AD6 A;  1C0T B;  2CQ3 A;  2E5I A;  3DRP B;  3Q24 A;  3OV7 A;  3BO2 A;  1NSQ A;  4J9U E;  1T3O A;  4LUB A;  2EEY A;  3T9Z A;  3ITH B;  1LNQ A;  2B9E A;  3W9I A;  2X7I A;  2ZC3 A;  4LSL B;  1QAJ A;  1Q8K A;  2UU9 J;  5CAA A;  2MKI A;  3KJN B;  3CCZ A;  5F8M A;  4CZC A;  2IBO A;  4YB1 P;  5LXY A;  1APS A;  1CQM A;  2X3G A;  3MM5 B;  2RQ4 A;  1X5P A;  5KG6 A;  2IRY A;  4P71 A;  5BJR A;  1AFI A;  3KMS A;  2V94 A;  5KFK A;  3CC7 S;  4Y2A A;  1TUG B;  1Q8L A;  3K58 A;  1VOM A;  1UVI A;  2RDD A;  1Y4Z B;  1K0T A;  5I3Q A;  1JB0 C;  5B0C A;  1YRU A;  2NCK L;  2WOM B;  3GV5 B;  3CPW R;  3BDP A;  2VA3 A;  1GXU A;  4N76 A;  1FD2 A;  4K4X A;  2VQE F;  3VCD A;  2DK2 A;  1FHT A;  4NCA A;  3T6J A;  1KON A;  3IO1 A;  2KVQ E;  4C9D A;  3MMC B;  2GGP B;  3LP2 A;  2DR8 A;  1GXT A;  5LL6 d;  4PKD B;  1S76 D;  4LBI A;  3FUY A;  5G4D A;  2UUC J;  2FVS A;  2IPO B;  3PEJ A;  2CJB A;  5E3A A;  1NUE A;  3A8E A;  3LWL A;  1NKB A;  2GJF A;  3VGV A;  3BKT A;  4XO0 A;  1NK0 A;  1D1U A;  5DET A;  5HQM A;  4FNI A;  3ENV A;  3SFU A;  5KG3 A;  3CIZ A;  4WZQ A;  5L39 A;  4CWB A;  2RAQ A;  1A6L A;  2CPZ A;  3THP A;  1FK9 B;  4N5S A;  1K44 A;  1ELO A;  3SV3 A;  5KG5 A;  2GX8 A;  5C5J A;  2FVQ A;  2J76 E;  3BQ0 A;  4LFC F;  4ICL B;  3LOU A;  3FJ2 A;  1QUV A;  2YH0 A;  2WBR A;  1R0C B;  1XMO J;  2W7A A;  4FF2 A;  2MMY A;  3TQE A;  3MPY A;  2GGP A;  3MM8 B;  3VR1 A;  5D4N A;  4Q8E A;  5H9E K;  2UVW A;  3IAM 9;  4B3S F;  3VTI A;  4EO8 A;  3M32 A;  4O3Q A;  2IAJ B;  3HSD A;  2YQ0 A;  5E5N A;  1FJ7 A;  4YHH F;  3P4U B;  4C2M A;  2VFR A;  1WEY A;  1T05 B;  4BLG A;  2RDI A;  2YWF A;  4DSK A;  2E7W A;  5IV4 A;  3MHY A;  1WOR A;  2ZIT A;  2W24 A;  4J9K A;  2MLY A;  3KK1 B;  5DQI A;  1RAD B;  2Y8Y A;  4KB7 A;  1FRJ A;  3M8P A;  2C2N A;  1P9Y A;  4IUF A;  5DDQ C;  4LRF A;  1BGX T;  1SIZ A;  5I3U A;  1WDT A;  3T19 A;  2W7P A;  3BSC A;  4KRW A;  4PWW A;  5AXM A;  1FJG F;  2PA8 D;  4CYU B;  5HRO B;  3KJF B;  2HRT A;  2DRA A;  4O0N A;  1KTQ A;  3TYT A;  1Q8I A;  4RNN A;  3JTN A;  1MN7 A;  3AD9 C;  1OPI A;  3GYG A;  2AX0 A;  4FF1 A;  5D4O A;  4JI3 F;  2F4F A;  2KDO A;  3ZZP A;  3UDC A;  1WJ9 A;  2HZC A;  3DRY A;  5ITH A;  2QE5 A;  4Q2M A;  4BCA A;  1PIL A;  1WHW A;  2ZBP A;  1GAO A;  3A3P B;  4RPF A;  1REV A;  1HWJ A;  2YPZ A;  2E9Z A;  4KE5 A;  2V8P A;  4GKK F;  5I3P A;  4ED2 A;  3DM2 A;  2GIR A;  2KFN A;  5F41 A;  3ZNJ 1;  4M5G A;  4OZ1 A;  4GVL A;  2QL7 B;  1YI2 S;  1RWX B;  2KXH A;  1RTZ A;  3V6K A;  2R7R A;  2DGU A;  2KT5 A;  4MMO A;  4P7T A;  3VAM A;  4WFA Q;  4I6Y A;  1HYS B;  4M8L A;  1XER A;  3DKD A;  2CJ9 A;  1S72 S;  5K5M A;  4UOH A;  2QV6 A;  4DUZ J;  3BR9 A;  5KFZ A;  2OEL A;  1RHM B;  4OYM A;  4LF8 F;  2FZC B;  3MMB A;  4TKT A;  2CQB A;  4MYU A;  4F4X A;  5CYJ A;  2WON A;  1U6B A;  2N7Y A;  4Y2I A;  2ZVS A;  4ZVT B;  5THW A;  3CCL S;  1WNE A;  5A6P A;  2EBE A;  4B08 A;  3DLL Q;  1IKW B;  4FVM A;  3LP1 B;  1ZPW X;  2CPJ A;  2AWZ A;  2FGC A;  1SIW B;  2VAS A;  4O44 B;  4CLF A;  1U0S A;  2DR5 A;  1RA7 A;  2V4J A;  3CCJ S;  2HQD A;  1I51 B;  5GAG I;  5FD1 A;  1U0H A;  3AB2 B;  4LVN P;  5I42 A;  1VIO A;  2L9D A;  2LQB A;  4C8N A;  2Q6B A;  3SMZ A;  5LMN F;  4W90 B;  2DH8 A;  1DHM A;  4L74 A;  1RT7 A;  4ID8 A;  4ID5 B;  5AE3 A;  2W2O P;  3K8V A;  3EJM A;  1DAX A;  2MKK A;  1VJQ A;  2P6S A;  4DR5 J;  2VQE J;  2FVC A;  1NSA A;  1L3T A;  3EXC X;  2AKW B;  3VVU A;  3CF5 Q;  3W65 A;  4ECT A;  1MLA A;  4DXL A;  4AYB D;  4F0K A;  4GVB B;  3I0S B;  4PAB A;  3FDS A;  2CQ4 A;  3G82 B;  4PQU A;  1SC4 B;  4XTT A;  1NAQ A;  2DNO A;  3HD2 A;  2RIL A;  4ZS6 A;  2M8D B;  1FFG B;  2C2Z B;  4PYD A;  5L1L A;  3DLJ A;  4DFP A;  3MED B;  1JKH B;  2DHX A;  2OSR A;  4O4G A;  1FA0 A;  2KN4 A;  2O01 C;  1YTY A;  2WVE A;  4K2X A;  2XWX A;  3M8S A;  4RUB A;  1EQM A;  3G2X A;  3I9V 9;  4LFC J;  1H74 A;  1DZ5 A;  3HZE A;  4JV2 A;  2Q3P A;  4UW2 A;  1HWL A;  4U67 Q;  3CWJ A;  4QR1 A;  5EGY A;  4LF4 F;  4F36 A;  4DR2 J;  1YIJ S;  2FUG 9;  2LDI A;  4H4M A;  3K8W A;  3NL0 A;  2ATC B;  4B3S J;  1Y5I B;  1RWU A;  2H9Z A;  4TYB A;  4B3R F;  2OPR B;  2AYG A;  2BKN A;  4B9L A;  4C3K A;  2XYG B;  2OEM A;  1TMJ A;  2W9A A;  3RTV A;  4AE5 A;  4RBT A;  4ED1 A;  3OR2 B;  1XN9 A;  2NLW A;  3RYL A;  2CZ4 A;  4HR2 A;  2WSF C;  3MFI A;  3RZA A;  3Q8R B;  2C42 A;  2JL9 A;  2YX1 A;  4OI1 A;  2BQR A;  4JI6 J;  1N5S A;  5KFY A;  3FEZ A;  4DWI A;  3I32 A;  4YME A;  2E1C A;  3C15 A;  4UT4 A;  3RBX A;  3ULH A;  2R8I A;  3W5Y A;  3V81 B;  2DGQ A;  1FJG J;  3TO8 A;  5H1S V;  1Z1Z A;  2MY7 A;  4ZKA A;  4NA1 A;  1V9O A;  2FHJ A;  3SCK E;  2OP5 A;  3G8S A;  2ADC A;  1TKT B;  3KKF A; 
#chains in the Genus database with same CATH homology
 2IJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...