2IJRA

Crystal structure of a protein api92 from yersinia pseudotuberculosis, pfam duf1281
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
282
structure length
282
Chain Sequence
b'ALEWCKNRLEITGRSVFVDIMQQWVTGEEVPLYRHAIQQSIRLFLAGCAGILKPVKCMEYPPFPRLVSHGTGSAVASNLAFQHWLDLLLKDAVLDGDTIRQIDRIYLQSGIASVKWETIPEGARQIITQLMARQYPDWFGVASWSSHINGADCWTKLGVMQEHACNCDMLMIIPTRLAIELNGNSQLLTGVSTTHDLYSHLYGMAWPSGQNIIWQRDRINSLRLDFDSPSYPPSAELMGELSAVFDCEIRHWYQEPVNGIRGYDCYDRGDHVDSGEYGAGPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein api92
publication title Crystal structure of a hypothetical protein from Yersinia pseudotuberculosis
rcsb
source organism Yersinia pseudotuberculosis
molecule tags Structural genomics, unknown function
total genus 70
structure length 282
sequence length 282
ec nomenclature
pdb deposition date 2006-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06924 DUF1281 Protein of unknown function (DUF1281)
A PF18406 DUF1281_C Ferredoxin-like domain in Api92-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3530.10 Mainly Alpha Orthogonal Bundle Api92-like Api92-like 2ijrA02
3.30.70.1270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Api92-like domains 2ijrA01
2IJRA
chains in the Genus database with same CATH superfamily
2WB4A 1N5SA 4F04B 3I5AA 1N5TA 3AA8A 2RNEA 3GG0A 3VTIA 1SJQA 3Q0AA 2XY6A 3CDBA 2BJEA 2BR0A 4DG1B 4FS1A 2C2RA 1IKVA 2B5JB 3CJTA 3WHIA 1OMSA 4N77A 1HL6A 4YHHJ 4M94A 1Y3KA 5KFVA 2OTLS 1N32F 4LQ9A 5F3TA 4LF7F 1S6QB 4LFBJ 1URNA 3H5XA 4PYAA 5IC6B 2ZBRA 2WVCA 2V69A 4HH0A 2QJ3A 2FPHX 2QFIA 5E0OA 4I64A 3TA2A 2QA4S 1CULA 2AU0A 4H4MB 3KLIB 3HJVA 1WC1A 2DXEA 2J0QD 2UXCF 3Q83A 4YR0A 3VWSA 3NKYA 5T7LA 4TU8A 2DVIA 2IJRA 3T41A 2BYCA 1TFYA 3QYYA 3M30B 3I5BA 4IRCA 2IA6A 1B70B 2K1RA 4LF8J 2VG5B 1QJHA 2QO3A 1VRQC 1X4BA 3MR3A 4C0HA 4ECQA 2FJVA 3L3CA 2OKQA 1XC9A 3R5JB 3N6LA 1LV5A 4JV2A 4GVBB 1XR7A 2YKOA 1LWFA 1N34F 4O44A 1IBLJ 5H9FK 2UUBF 1X5SA 4Z7CA 2UV8A 2OPQA 2CJAA 2ZBQA 3HVTB 2RJZA 3GFZA 2RRBA 1U25A 4ER8A 4DR4J 4CO0A 1F3VA 5JUMA 1FF2A 1UVIA 1ULRA 4AQYF 2ZH6A 4FXVA 2HWHA 5KFOA 1KQKA 2FJWA 4N56A 1T9VA 3OTEA 5FDLA 4RU2A 1VK3A 5E7OB 5KG0A 2F65A 3EPGA 4ZVTB 2I38A 1ZZFA 3DMJA 1T0TV 4KGVB 3I5CA 1VQOS 1H7WA 3ENWA 3C16B 2P2CB 3IP0A 3DRRA 1WNEA 4Q0BA 1S1XB 1N6QB 3ILOA 5L1JA 2W9CA 1VRTA 2D3O1 4K4YA 1CJUB 5F9LA 4F4KA 5D4PA 3NWRA 3DLJA 2F8MA 3PJXA 3PW4A 2EG2A 4JI6J 2XMMA 4DL5A 4F4WA 1TMJA 3D67A 4D3GA 5CHCB 5EWGA 3DCAA 2GAHC 1FXLA 4UY85 1HNWJ 2YWGA 4IG3A 1DTTB 4C8YA 2KXNB 3LP2A 4P52A 2AGQA 2DPIA 5IM0A 2I2YA 3ZZUA 2WOMA 2XYPB 4KKOA 1FRHA 4RW9B 3J7Z5 1HQ2A 3RBXA 3BQ1A 1N36J 3KJVB 3O5TB 3BO4A 2ZWOA 3VZIA 2H5JB 2WSFC 2KO1A 3VALA 3EGVA 4YUDA 1UEKA 3R7NB 3H40A 2XMAA 1LWCA 3FC9A 4MIBA 2IDEA 1FK9B 3MPDA 2A6MA 2BKOA 2QLWA 2H4YB 3OVBA 4ICLB 5J2NB 3SV4A 4FYVB 1I5OB 1RAJA 4DR2J 1PIEA 1U1KA 2GVZA 2CYYA 2ZFHA 2V5HG 3FCVA 3EYZA 2M9KA 3FEXB 3HVWA 3JXOA 5KT6A 3LP0A 3EX7B 2HS0A 4TKTA 3IWNC 4A8KA 4B3MF 2X1BA 1CQNA 1QAXA 5KFEA 4J9NA 2PIIA 5EWFA 1CVJA 2E7VA 1YTYA 1Q86T 3RU0A 1FRKA 2CPJA 3JQMA 3IFEA 3V81B 2R8GA 3QZ8A 3MCOA 3GIMA 2Y8WA 2VU5A 2ZZMA 2YQ0A 1UTAA 2DKOB 2FHKA 4AXJA 5H9FJ 2Z2ZA 4I2QB 5EX3A 3V6JA 3BBCA 3GJRB 2VPYB 2EFOA 3HSJA 5IXUA 1NO8A 3DN9A 3G96A 1TK0A 3D28A 2RDJA 1VHFA 3W2WB 4OX9J 2CPHA 3DOLB 4JI2F 5EUHA 1LXNA 1S4FA 3M8WA 5LMUJ 4URSA 3AOAA 4ELTA 3H59A 3RTVA 1R8HA 3LPYA 4A8SA 2HFVA 1SC1B 4PWDA 2OLWA 4G1QA 1VQMS 2WB1D 1RT7A 2Z4PA 2B8PA 2HZVA 5HBMB 1YRXA 4ZOSA 4LSNB 3ZTQA 2BRKA 4L3KA 4DSKA 3DLGB 2P9GA 1GQEA 5J2MA 3PRDA 3WZ0A 2LU2A 4RX6A 4L3NA 5H9EK 3GE9A 3I56S 4ZHRA 4JI4J 4F3OA 4NWBA 1FDBA 2DXDA 1O6XA 2CPIA 2FYXA 3MUMP 2WONA 2V4JA 4MKVA 2W1BA 1JKHB 5K20B 4EK2A 3EICA 1S1WA 3AODA 1VMBA 1HPZA 1NJXA 5LXRA 3THVA 2K3KA 2XHCA 4J9VA 4F8RA 2ZM6J 1WF0A 3VV2B 5CZXA 4F67A 3JSYA 5JVHQ 2D7SA 4KIAA 3BKFA 4ZJQA 3IAM9 1TL1B 2XYHB 3GFYA 3AB2B 4DN9A 2XGQA 3HMJG 1KBRA 2D3ZA 4TQSA 2VQFJ 4YR2A 3NGKA 3CTRA 3CCWA 3MFIA 4X4QA 3ITHB 3M8PB 5A8KB 4C3LA 2Y3YA 1VJWA 3KJNB 3NGDA 2NXNA 1BE4A 5KT4A 4RR5A 4DV1J 1FCAA 3ZNUA 4GRSA 2E5IA 3R8YA 1FJGJ 1YITS 4G1PA 2QMXA 1GMWA 2N7YA 4W4MA 4I6YA 3CCTA 2N3LA 2K2PA 1Q8KA 4P6QA 4ID5A 4YP3A 2R7WA 3HDSA 1RU1A 2MKSA 1H2VZ 4R5PB 4X4TA 5AT1B 3AHPA 2A1BA 5HP1B 3CWJA 4DR5J 1EHWA 1S0VA 1YHQS 1DLOA 3CSKA 2UUTA 3E2EA 3MURP 4ZCIA 3RB4A 3HHEA 2WBRA 2JZ5A 2BQRA 3BH6B 2MKJA 3JAMU 3QBCA 4DEZA 1FESA 1WF2A 3U7JA 2OSQA 2KJWA 3MM7B 3HT3A 2CAJA 3M9OB 3RAXA 1VC6A 1MMNA 1JWWA 1NDKA 4XO0A 4PYDA 1HBMB 1TAUA 1RLDA 1YJWS 2DO4A 4AFFA 3DGVA 3AXMA 2KG1A 2G13A 3BBFA 4NE9C 2HMIA 3JSMA 3UDVA 1Q7LB 2KRRA 4N47A 1RACB 7FD1A 3LWLA 2C1EB 1Y3JA 5K8PA 1NJZA 1CJVB 1Z4UA 4Q8FA 3D3BJ 2B9WA 2W4PA 4EZ9A 3QRPA 4K4TA 4MK9A 2XHWA 1V3ZA 1IKWB 1RWWB 4QJVA 4UW2A 2NZCA 1MROB 1GNKA 3CIMA 4YN3B 2LFVA 2ATCB 5KFJA 4K59A 1JLAB 2G0CA 4PUOB 3DOKB 2FC9A 3PHEA 5H9EJ 2WHOA 3BF4A 4OYBA 2YWHA 4CRJA 5KOXA 3MPUB 1JXVA 1VQ8S 1Y4ZB 3QGHA 2DXFA 4B02A 3BYRA 3UDCA 4ZJLA 4RNHA 1HWUA 4QIVA 2DGWA 3O8WA 4QOTA 4O3SA 2B7BB 3MCNA 1T8EA 2MDAA 2DNMA 3FMBA 2E9ZA 1RBOB 4Z37A 4MKYA 1I1GA 3EJMA 2KL8A 4F4AA 2ABYA 2ZITA 3EXCX 1DBDA 3VAJA 1TKTB 2HSEB 3CJ0A 2KHDA 4LR8A 1O51A 2DRAA 4JI8F 1DURA 2FUG9 3FZ2A 2IM0A 1S9EA 3QGIA 3M2UA 4PABA 5D4OA 2R7SA 3Q8QB 2PE8A 3SCIE 4OYXA 1BC6A 1QDUB 1VIOA 4WE1A 2E7XA 2DGQA 1RT2B 1KFDA 4USIA 4YB1P 3ZTSA 5LOQA 1IWAA 4RUBA 4C8LA 3W5ZA 4WIIA 4ED2A 3FRZA 4QWEA 3SDEB 3G82B 1XJWB 5D0EA 3M1VA 3CJ4A 1FXRA 2NQPA 2M0GB 3IWLA 4DR7J 2ATLA 3PFEA 3NBPB 3MAQA 1JJHA 4I1TA 4DN0A 2CUYA 5K14B 1LWEB 2F9JA 1G2EA 1S49A 1B0PA 2I1RA 1ITPA 2QTWA 1NU4A 3B82A 4IR1A 1PAEX 2R4FA 3JSBA 2YH1A 1OSDA 3CULA 4LBHA 2LQ9A 1SJ1A 4RUHA 2HURA 4JV1A 4PXDA 3VQTA 3HZGA 3GONA 3E01A 2A6OA 2VONA 2LEAA 1T9YA 2MLYA 3CJSA 4M63A 5DQIA 2IVMA 1HQEA 3DNCA 3J7YU 1ZTTA 1SH2A 2BJ9A 1OSCA 4YS2A 1U1MA 3TJ8A 4U7UK 3UDLA 4Y2KA 3W8GA 1WEXA 2ZJPQ 5HQ8A 5I3UA 2W2PP 3R9LA 1HR0F 3TA1A 5ADZA 2BANB 5C24A 3AH6A 2YQ1A 3TI0A 5DG9A 2JEFA 5DGBA 3MM8B 1K1SA 2HNYB 1VCTA 1C0TB 1RISA 2RU9A 1S7HA 1U09A 3D3CJ 3MHYA 3QLHA 3IM8A 2F8EX 2ACMA 2NREA 3NMRA 2EG1A 4NLOA 3SSRA 1WORA 3OXFA 4YB7A 2CQBA 2HHHJ 1SJRA 5FJ4A 1N88A 3PYDA 3QO9A 3CO9A 2JHEA 2ZHOA 3DLKB 3A4TA 1H7XA 4XPCA 2YX4A 3FBEA 3CDWA 1YRTA 3AAWB 4BLGA 4J9MA 4QR0A 1JLCB 2AW0A 3HPOA 3T5LA 1RYSA 4C8OA 1HW8A 2HRUA 1IKYA 3I96A 3HO1A 2QMUB 5T14A 4OHYA 2KM8B 4B3TF 1L3UA 4IYQA 2QL5B 2HK3A 4DR3F 1U2CA 5E3QA 4CLFA 4KSEB 3MM5B 1NB7A 3T6BA 3DOMA 5AJ3J 4ECVA 3ZZOA 1IM6A 1UFWA 1TP7A 4RW7B 1VQKS 3C6TB 3BEGB 2FB0A 3UD4P 3S8SA 1TKXA 2LEPA 3S1TA 3K5MA 2DNGA 3CCZA 4J9UE 3MOJB 4KT0C 1HHTP 4A47A 1C0UB 2MQLA 1VQLS 1LQ9A 4RW6A 4JB8B 2ZWPA 2MJNA 3G6VA 1RWMB 2QIFA 5K8NA 3OHAA 2ASJA 4F7VA 1OYDA 2J6UA 3HHKA 3BDPA 2DH8A 4MTPA 2E1RA 2XWXA 3QMQA 3K17A 3I0RB 2YNHB 4OLOA 2GNKA 3MD1A 3CJ2A 3GLJA 3AY0A 4RNFA 5KFKA 3AA9A 2JC0A 4RBTA 1JLFB 2RF2B 4OJGA 1Y5LB 2B3TB 4CWBA 5IQQA 3NOCA 3PR5B 4LF4F 3QJPA 2AYGA 4CNYA 2LXUA 1NK9A 2HQFA 3J81j 2AGOA 3SBMA 3O1LA 3MR6A 2NS1B 2JEGA 1REGX 2XZTB 3R7BB 2M4MA 2W9AA 1R27B 5HQLA 2DRDA 3OJSA 2V4RA 3LW5C 4DV2F 3H8YA 4KGXB 2HQ3A 3G6ES 2AHOB 4DSIA 1BQMB 4DXLA 2ZZTA 4IFYB 2WW8A 2CWXA 4Y2IA 8RUCA 4RZRA 2MZJA 4TU7A 2W8LA 4JI5J 1U47A 2UUAJ 1UKUA 4LVNP 4JI0J 3RG6A 1WC6A 2HPUA 1S12A 3GR1A 4HHHA 2RUSA 1DRZA 3US5A 2DR8A 7FDRA 1I94J 1CS4B 4OX7A 1M90T 1PYOB 1C2PA 2M52A 2NXJA 3MR2A 2B5JA 4YHHF 2YKAA 3CD0A 1FFWB 5KFSA 2Y1RI 4DV3J 2GJ2A 4QW9A 2WCXA 5GAGU 3CVKA 4LFBF 3NXZA 3E51A 3QPIA 2D3OR 1S6QA 5HI7A 3NG8A 3Q86A 1VIXA 2PMWA 4NMXA 1NKBA 2HWIA 3C8YA 2KFZA 4X4VA 1GT8A 5LM7E 3CDUA 2GIFA 2MKYA 5F0WA 3W61A 4H4MA 3PJWA 4C48A 2V8DA 3KLIA 1NDPA 1N56A 4B3SJ 5F41A 1RT4B 2WVDA 3MAAA 3C3LA 2DTJA 2XS7A 2VC0A 3GYNA 3G71S 1S79A 2F5GA 4CLWA 3MMCB 2E1MC 5F8JA 3HVRA 4LF8F 3QFHA 3M6WA 3W9HA 2GO8A 2IRYA 1UJ4A 3NL0A 3KK1B 2MJUA 2VDIA 2B6AB 4G3IA 1U45A 2Z57B 3W9JA 2IC3B 1JXLA 5HATA 4UTGA 4J9SA 1TR0A 1WOOA 4WZMA 2CKWA 2NUUG 2E29A 3OBIA 4GVBA 1HNXJ 4FP9A 1QM9A 5A2QU 4G1IA 1JMTA 1IBLF 4OFZA 4RNMA 4OHXA 1VFJA 2VG7B 2ADCA 2CQDA 4MAKA 4K7QA 4J9PA 1X31C 2DR7A 3VGVA 3AB4B 1P27B 3HVTA 3CGIA 2I0XA 1BMQB 1B7YB 3SSQA 2EFVA 4DSJA 4J5OA 4DR4F 4XDDA 1SL1A 1TUGB 4OZ0A 2VZ9A 2ZVIA 1Y7PA 1CPZA 1F9FA 2DEJA 2MLZA 2Z56B 3G8SA 3DI6B 3TNVA 1UEVA 1YBAA 3MXHP 1B0VA 1VC5A 2W9BA 3B4MA 1T3NA 2Z0GA 2WSEC 1PAUB 1HI8A 1SH0A 1HD1A 1KHWA 1NAQA 3KLEA 3H5YA 4RU9A 2HS3A 1WD6A 3C16A 1F2HA 4EGLA 3BS9A 1JLQA 3JAMY 1KP6A 1S1XA 4ZIWA 1N6QA 2DNPA 3THTA 5F8NA 1FA0A 1HLWA 1RAEB 3BKTA 3AD7C 2OD4A 4JI6F 3AXKA 4KHPF 2Z2YB 4MFBA 1VQ9S 1CJTB 4E2FB 3VAHA 4X4NA 3EM1A 5CXTA 3R7SB 2HZAA 2B56A 2UXDJ 4J9LA 1MWQA 2Y9HA 1OY6A 1HNWF 2RD5C 3NAHA 1S4EA 1F60B 4DV7J 4LFCJ 4L72B 2LQ8A 2LVWA 1LWXA 2QC3A 4RW4B 1IXKA 4EEYA 4B9SA 2YNIA 2AP6A 2EC0A 4ALZA 3FRYA 2M2BA 4FPIA 4K5RA 1TZ0A 1FJEB 1N36F 4K8RA 2QLBB 5GAEI 4RL1A 1RUSA 1M5KC 3KJVA 2B0GA 3V6KA 2VUGA 3N28A 3KNGA 5BYSA 2W7AA 2OP5A 2KT5A 4QYZK 4HLBA 1Y0HA 2Q79A 4DHVA 1RT5B 3TJ9A 1FK9A 2V34A 4F2SA 1VYAA 3D4JA 1NDCA 3RAMA 2G2ZA 2GS8A 1V3SA 5KFIA 2OGUA 4ICLA 3CEDA 5J2NA 2ZNZA 2GHVC 2DNOA 4DR2F 3BGFA 1SV5B 2AGPA 4KPYA 5IQ6A 4QU7A 2V8GA 3TUIC 4HACB 3WC0A 1QLNA 4DBQA 2FGCA 3PIPQ 3AD9C 4Q2MA 1JXEA 4ZPDA 2LCWA 2FHOB 5HVHA 4FBUA 2ZBIA 2H4WB 4NL5A 4WP3A 5KFLA 3UI3A 3GMGA 2LMIA 2B4UA 3NOGA 3M6XA 4AL6A 5T7LB 4IR9A 4ED7A 1PJ7A 2HQGA 3PW2A 4C98A 4M5MA 2VBWA 3CCES 3V81A 5G4DA 3QWUA 4Q45A 4ZVQB 2CJKA 3KHLA 3LO3A 3HFVA 2N4CA 1KOHA 4I2QA 3CD6S 3C19A 3R1LA 3WQPA 3CNQP 1U26A 2NXUA 2XULA 1VI7A 5E3RA 5B0AA 4ZVGA 4OZ1A 1JB0C 4OX9F 1U6BA 2HVHA 2V50A 2LU1A 3QJLA 3T5JA 5KT2A 2BKNA 2HVEA 3P3DA 4I2PA 2OFGX 3AD8C 4DLEA 5LMUF 3QFWA 2MKHA 5F8MA 1EQMA 2NZ4A 3OR1B 2XLIA 1WEZA 3M4XA 4JP8A 2DHSA 2YQ3A 2XMTA 1IQZA 3FEZA 2DNRA 2NPIA 4DPXA 2YNFA 3L9ZA 4ZK7M 2CQGA 1SKRA 1WSRA 3N9UC 4LBPA 3T1HJ 3DLGA 2P6TA 3W3SA 2LDIA 2AD9A 3EXYA 4GMKA 4JI4F 2KB2A 3DMJB 2BJDA 1VBYA 3I4HX 1N54B 1UW4A 2Q43A 4X2BA 1RBAA 4FVMA 4QR1A 1NHKL 3DRRB 2RHQB 4FYXB 4Q0BB 2VFSA 1WKJA 1JKHA 2MQ8A 3KLFA 3IS9A 5T41A 2P6SA 2W7PA 4RKUC 1X4AA 5B0EA 4GC6A 2JLEA 2RQKA 5I3QA 2HNDB 2ZM6F 2B9XA 1QY7A 1KKHA 4CIOA 1FNXH 1DJ0A 5DM6Q 4UQGA 5DJBA 5GMDA 2ADBA 3S01A 2Z58B 4C97A 3OW2R 3HT0A 2HHSA 4ZN1A 2F3JA 3CD7A 1TL1A 4F4YA 2YKQA 2GCFA 3KFWX 3PW5A 2RVJA 2VQFF 1D3WA 2KJVA 4ZLNA 3LP2B 2BJ8A 1FFGB 2H48B 2VH7A 4QYZJ 5DQGA 4MKBA 3ITHA 3M8PA 4KGZB 4KKOB 5I4MA 4DV1F 4WFZA 3HK2A 2UU9J 1RZMA 2D9OA 1RAHB 3IG1B 4AE5A 1RWKB 2QV6A 2R7RA 1HWJA 2XZDB 1LWCB 3UD5A 5DDPC 2PEHA 2PN6A 4R5PA 1VBXA 4KHMA 2H65B 4DR5F 5HP1A 2P8IA 3QNWB 2R8HA 1U8SA 2HHVA 4ECUA 1NH7A 2GVZB 2XYGB 2J6TA 2OEKA 3NRBA 2GVDB 1NK6A 4OYIA 5DDRC 3FNNA 1PKUA 2GC8A 2BOAA 4IH7A 4ERDA 2KXHA 2HKEA 3KHGA 2NPFA 2XSJA 4LRBA 3H90A 4K50A 5KFQA 3MM7A 1VISA 1GMWD 3M8YA 3EZOA 3N4WA 5EWEA 2BBEA 4OYOA 1UZDA 1UFLA 2WVBA 1HMVA 5LMNJ 4HI1A 1QE1A 5A8RB 5LSOA 3GB0A 7AT1B 5KFPA 5J2PB 2CQHA 5K9FA 3MI7X 3CB4A 4ZPBA 2JEIA 1BY9A 2DNYA 2L3MA 3NWGA 1A6LA 4ZPTR 4IG0A 2EFPA 2QMWA 3V4IA 1Q5YA 5EX0A 2CADA 4DL3A 1CJVA 3BO3A 2R8IA 2V8PA 3ZZYA 5I42B 3G6XA 3CMQA 1RWPB 1QAYA 3QAUA 2HHPA 2ZNYA 1D09B 3OVSA 1L5UA 4OZJA 1WKKA 2WW4A 4QWAA 4P2FA 1JLAA 2QL7B 4LIRA 4ZA1A 4PUOA 4PWDB 1TL5A 5KAKA 1JX4A 2HBQB 3PRVA 3KLGB 1FWLA 4G1QB 4WFAQ 4DOZA 5L38A 2EFQA 4NI2B 1UVLA 3QIPB 4QWDA 4OV6A 1NDLA 1MWYA 4ETZA 3KMQA 2OI2A 2V63A 4K2JA 3CO0P 1FRJA 2DNZA 5A76A 3GIKA 4K4SA 1XNQF 3UPFA 3MDFA 1PGZA 3PZPA 4NRTA 4NA1A 3BGLA 4IOBA 3DU6A 4FYWB 5GAHI 1S99A 4BC9A 3TO8A 2EKNA 4FZVA 1RABB 2Y1LB 2BJ3A 4KTQA 1S6PA 1S1WB 1TU0B 2FQQB 3FQLA 5HL7Q 2XGPA 2J8SA 2FJDB 1RT2A 5AXNA 1JIHA 1IVZA 2M70A 3T19A 1Q78A 2PD1A 3SDEA 1H74A 2CPXA 1PYSB 4DR7F 2F63A 4HTJA 5DZ7A 2HFSA 4M5IA 4M5KA 3RYLA 1LWEA 3W63A 5A2QY 5C25B 1RT1A 3N6MA 4ZVOB 2AEJA 1PJ6A 4Z7YA 1BQXA 4BHQA 3MOZA 1WUUA 4I6AA 4QIFA 4ED8A 1D9AA 4P73A 4ZP9A 4N41A 1D8ZA 1AW0A 4ZKAA 1QVFR 3NMAA 1SIZA 3OV7A 2AEMA 2BW2A 1RHKB 1ZM9A 3OVAA 5MAOA 4HT5A 2C2EA 1XMOJ 3N0VA 2E5LJ 1BD6A 1DQAA 3U27A 3OFFA 1AFJA 2BANA 1SH3A 2YNGB 2AYMA 3MM8A 1KLMB 2F4FA 1NKEA 2MSTA 2NLWA 1WJ9A 3QJJA 1DLOB 2U2FA 3G4SS 2VPWB 1HWKA 5ETKA 4USWA 3KKFA 1Y11A 4PWUA 2Y0SD 5HANA 5K8OA 4LMZA 1U24A 2B9YA 1GX6A 1U0HB 4USHA 2HHHF 5KG3A 1UW9A 2MZSA 4R25A 1S1VB 3Q8YA 4HHUA 1RKJA 1FD8A 4J9OA 4ZVUB 2QEXS 1RHRB 1ZAWA 2M5YA 3Q24A 4EMDA 3QSIA 2Z30B 3DU5A 3W9IA 1R0CB 3EE3A 1F9EB 1JLCA 3L09A 1BLUA 2YPZA 3ZZZA 2GMJA 5L1KA 4FXDA 1NPPA 4OJHA 3IN5A 2RU3A 4NCAA 3FVYA 4WFBQ 1QSYA 4EUVA 4MMOA 1NSAA 5DLFA 3OL9A 5RUBA 3OQ2A 5AJ3F 1RT3B 4HTIA 3U02A 2J5AA 1H2UX 2IRXA 4RW7A 3MECB 3HM9A 2UUCJ 2FY8A 2VJVA 1ZYQA 2CQCA 4LQ3A 4DR1J 4U6PA 2Z8QA 3HFKA 4QYRA 4ZIVA 1FRXA 1C0UA 5CH7B 4A48A 3B54A 3Q22A 3ET6A 5IV4A 4OYWA 4WKYA 3AQPA 3V6HA 4WIQA 5F3ZA 4F4ZA 4CLTA 4GKJJ 1JJCB 2YNHA 2H54B 2NYHA 1U1OA 1N5YB 3OR2A 2E44A 1YJVA 2BACA 2APOA 3NP5A 3X1LB 1T3OA 4M5JA 2OAUA 2RF2A 2LP4A 3ZFVA 3ZNJ1 5KFWA 2QGFB 4W90B 4NYZA 2XO6A 2G1HA 1YIJS 3BV8A 4UF4A 2LECA 2DK2A 1S9EB 4OI6A 1RHQB 2DIUA 1R7IA 2POKA 1PG5B 4B9NA 1NXIA 5GVQA 3KJFB 3VAIA 2OELA 3C46A 3H4DA 4CP5A 2D69A 2KFYA 1JNZB 3W65A 2QRRA 2XCPA 3BSCA 3K5NA 3I31A 1M1GA 1ZS6A 2OSRA 1U4BA 3JTNA 3TAMB 2JLGA 3HSDA 1AUSL 4M95A 1I51B 2MSSA 3H4BA 2LDYA 2BEFA 2HBZB 1BWVA 3D0IE 1OQ3A 2MY8A 5K5MA 1NBEB 2VOOA 4ZVHA 4JI5F 2XC9A 2UUAF 1C4AA 4JI0F 2MZTA 1EARA 4NLYA 3MM9B 2X51A 4ECZA 3M8QB 4H4KA 5KFNA 3OXGA 4B9VA 3Q8SB 2RAQA 3V5RA 2GQ2A 4H4OA 1I94F 3DLBA 1KTQA 3CC7S 4DS4A 4ECWA 2IDLA 3KK2A 2OTJS 4PR6A 4OHWA 4DV3F 3K8VA 1NJYA 4DSLA 1FX4A 1GXUA 1SI9A 2RQMA 3IRXB 1KQFB 2DGSA 4LUBA 3K8WA 2X1AA 1TMMA 4K4XA 1F5BA 1VBKA 3ZTPA 2FZCB 5IC4B 5CCMA 3LF0A 3CCVS 3BB5A 2IM2A 3HKZD 1KONA 3C6UA 5C24B 3VR1A 2W24A 1VQSA 4CLLA 3IR5B 1YZ7A 2RSQA 4DV0F 4B3SF 1XN9A 3FSIA 1RTJB 3VGUA 1RT4A 4CTAA 1TL7A 1WKLA 3QLHB 3P96A 4CNZA 4UY8T 1SL0A 2CJ9A 2G9OA 1Y5NB 3PYEA 3IXQA 3TA0A 3SQGA 2VBXA 1MSWD 4A8FA 3MMCA 2Z2MA 3QO9B 1AB8A 3D66A 2VFRA 1UL3A 2XM3A 4ZVFA 5IT0A 3KK1A 3U1LA 1F5AA 2IAJB 4LREA 3G2XA 5LT5A 1K1QA 5KG7A 1T03B 3W64A 3T3FA 1IKYB 3TX0A 3D2WA 1HNXF 3KDOA 1U8WA 2FHJA 1FRMA 3T5KA 1H98A 1N5QA 3M8RA 1SC3B 5HAOA 1RDRA 4DU7A 1FO1A 2YKNB 5FIIA 2VG7A 3N6NA 1XTZA 4WZQA 3HFZB 1HNZJ 4BWMA 5LL6d 3OJUA 1WC3A 2KZZA 5IZHA 2FHMA 2CPDA 1RB0A 4D3HA 1FWPA 5J1EB 5ETOA 1FNMA 3C14B 3FCWA 3NNHA 4RBUA 1EB0A 2FIUA 4AT1B 1RYRA 2LKZA 2SXLA 3CC2S 2KI2A 2CPEA 4O3OA 5JMNA 1K9MT 2W7OA 2CA9A 1WC5A 4RJVA 3UD3P 4X66J 1J27A 1HQUA 4FNIA 3S7RA 2FJAB 1Z1ZA 2JVOA 2G2OA 4X64J 2PEBA 2QX0A 3GCWP 3GV5B 1B7FA 3R2CJ 2ZH5A 3UCZP 2VFUA 1ROFA 4C3KA 2JH3A 2MB0B 3CCRS 1O0PA 3M9MB 2EFGA 2XMKA 4X62F 2OPRB 5HVGA 5ETMA 2BW7A 1RAOA 2DGUA 1EX8A 4ZP8A 2HFOA 4FN5A 3KWMA 3W5YA 2OUGA 3UQSA 1V5VA 4YY3J 3HX9A 2VIHA 2DR5A 2W2MP 2AYEA 5E3AA 3K57A 2UXDF 3GCXP 2LXIA 2AT1B 3D6HB 5AXKA 1U7LA 4DV7F 4LFCF 3V6DB 3IWXA 4QW8A 2CZ9A 4X4OA 3JB9k 1RTDB 2AX0A 3TVZA 4FF3A 1GTHA 3WBZA 2J0XA 3GFXA 1RU2A 3HVAA 4LJMA 5KG6A 3K5LA 1XMBA 4EBDA 2BKPA 2R2UA 1YJ9S 3CCMS 3HCXA 5F0UA 1XIQA 2V9KA 4V19X 2YKPA 5KFYA 2DY1A 5JXSA 1IJFB 3T1AA 4ZITA 5LXYA 5DDQC 1FEHA 1R8PA 1LK5A 1SQGA 4FYYB 2GGPB 4BDPA 1S0OA 1RT5A 2XB2D 3TJAA 1TELA 3SYZA 2V68A 1Y9OA 3IR6B 4UQTA 1KQSR 4O0NA 4NZ7A 1SV5A 5EGYA 4QWCA 3D1HA 1PBAA 4B3OB 4CCHA 2IRUA 4HACA 2DT9A 4TLQA 1ZM4A 3KNAA 1AA1B 1VRUA 1H73A 1HD0A 1R89A 4HHJA 3SCJE 4AL5A 2J8AA 2HLUA 2J0SD 3BREA 1FWKA 4ANDA 3MAAB 1AXQA 2DB1A 5AE2A 4WXWA 1FKOB 3DDKA 2PA8D 5CQGA 2EVZA 2PO4A 1FX2A 1K47A 5BJRA 3KLHB 4M1KA 1T05A 1N4LA 3FQKA 1Q79A 4CLPA 1YJRA 5KTQA 1X7VA 1RHMB 1JJ4A 4I67A 3G6YA 4NA2A 1RCOB 4IDKB 1OWXA 5J1PA 2IYGA 3IGVA 4IRKA 1M5SA 2X3GA 4JYAF 3EDRB 1HBOB 1FD2A 1YRUA 4X84A 4B9UA 3TWZA 1FJ7A 2XMUA 3VVTA 1T9UA 3OR1A 1Z2ZA 3I0SA 1KVJA 2FLPA 1HHQA 2CNLB 1S77D 2IJNA 1UJ5A 5M2PA 2DJWA 2IBKA 2COLA 2W4DA 1YJNS 2W9BB 3R6LB 3T1HF 1L3TA 1KDNA 2G0JA 4XPEA 3JS9A 5E3PA 1LFPA 4DPOA 3Q8PB 4MJKA 4USTA 1KRPA 4F36A 1U49A 2DYAA 4USMA 5EDWA 3KLEB 3T9NA 3BGOP 3SZ2A 5KFUA 2Y0BB 1ZOTA 5F8HA 3AQOA 3UDEA 2XCAA 4DFJA 2HRYA 2MYFA 2W2OP 4DL2A 1AUDA 1JLQB 2CNOB 3CPWR 1RTHB 3RAQA 4Y2CA 4DV6J 1I3OB 2MQPA 2HAFA 3H20A 2DBBA 2BV3A 1ZZNA 1SUQA 2HZCA 2GAGC 2HNDA 4MFBB 4KHPJ 1RA7A 2UVWA 3PTWA 4JV0A 4ELVA 2RB7A 2AEFA 2DISA 3T5HA 3A8KA 3KOAA 1DZ5A 1ICEB 3H5SA 4OHVA 3K0JA 2VA2A 2JL9A 4ZMMA 1MMDA 5GMKa 2X3DA 2CZ4A 4J9QA 3F73A 3W7BA 1FT8A 1UFKA 2X7IA 2YNIB 1X0FA 5DQHA 5KFCA 3CDAA 3PV8A 4WK3A 4EZ6A 1FJCA 5GMEA 2HFUA 1NK5A 1IR0A 1VOMA 2UU9F 2ZH8A 5DDOC 1NPRA 5M2RA 4WF9Q 3GU0A 3IG1A 2HRTA 1D9FA 1REVA 4CDIA 3OL7A 3D1QA 4DQIA 2AJQA 1MMLA 2CQ2A 4U8YA 3EVOA 3BBBA 2C2MB 3O2IA 4EBEA 2A18A 2XTJP 2XEXA 4Q5VA 3PKMA 2LQ5A 4CYUA 2KT3A 3CUNA 1NMEB 4NPOA 4OI4A 3FEYB 1NNDA 2UXBJ 4DL6A 3A8JA 3I32A 4ES1A 3N01A 5MLCV 1SCJB 4B9MA 2F4VF 1RHUB 3BDEA 3HHDA 2GVDA 4P72A 3ZTOA 2KKHA 2DGTA 3QAEA 2YWWA 3SIPB 3RGIA 1DARA 5A6WA 2GFFA 2G0IA 2HGMA 4GC7A 3KK3B 2VFTA 3WX4A 5KG5A 5D0GA 3QT7A 4DUYJ 3X3UA 1UEUA 2D41A 5DO2A 5LMNF 3ISZA 3EUNA 1HHSA 1NB2A 5ETQA 4DU8A 2DH9A 1Q53A 2MKKA 4DPWA 5A8RA 1YZ6A 4NXNJ 2ZC4A 4O4RA 5J2PA 2W8KA 1DQ8A 4PEOA 1D0EA 1S9GB 2WSCC 4Y3CA 4OZLA 4C0BA 5E33A 2YKMB 4DQPA 2YX1A 3GWCA 2GA7A 2KYZA 3RRKA 2C42A 5I42A 2C3PA 4I2PB 3ONQA 4BC7A 3PW0A 2ILZA 4LF6J 5HQMA 4PG6A 3IBFB 2XLKA 1YK9A 2R7VA 2YVSA 1LFWA 3OTBA 4M8LA 5U47A 3KLGA 4HEA9 4XTTA 2LXFA 3O6QA 2RIJA 2XNQA 2YNFB 2XO7A 2DGVA 4NI2A 3QIPA 3PEHA 1Q82T 2D3UA 3QRQA 4HT7A 4CLSA 2QYGA 3H25A 5G0RA 4OX8A 4CT8A 3E8OA 4B9TA 2ZE2B 2GIQA 4USVA 4Q8EA 1EKRA 4MIAA 3DRSB 4NRUA 4KFBB 1J5OB 2VPZB 4NZ6A 1UAWA 3KLFB 3IS9B 4Q43A 5L8RC 5KFBA 4DCPB 4HI2A 1S59A 1PBUA 3PXGa 2HNZB 3TVYA 1NSQA 4MK8A 4OYAA 4ILMA 3MPYA 2GQCA 2FGOA 2L9NA 4FF1A 3MUTP 3UN2A 5LSLA 1P6TA 5B0BA 8AT1B 1YX2A 2WTFA 5D3GB 1FNOA 4PXCA 3UVJB 3BYPA 2FLLA 3OD2A 3KG4A 4DR6J 1AROP 2ROGA 2H1YA 4XIUA 3CJKB 2L9DA 1S6UA 3DYAA 1QUPA 2KZMA 4KH0B 4NLVA 3ETOA 5L39A 1WTFA 3MTJA 5C25A 3OFGA 2AJ4A 3DFEA 2DY9A 1JLBB 2HHUA 1TL3A 4BWJA 3HF5A 2M7SA 1RWNB 1YSJA 1E6VA 1F1BB 2YTCA 2MTLA 2EWHA 5IS2A 3WIVA 2M3DA 3VZHA 4YMEA 4S0MA 5ETPA 2HG4A 2PMZD 3B78A 6AT1B 3D68A 1XMOF 1XR5A 1RT6A 2E5LF 4M5GA 1HNIB 4ZLLA 4A8XA 2E66A 5I3PA 4HYKA 3OLBA 2YNGA 1UVNA 3C66A 1KLMA 2WVEA 4DPUA 2HBYB 4YQWA 4F0HA 2YBVA 3KUEA 3M32B 4URQU 2E1PA 3K58A 1R0AB 1EP4A 4DFMA 2ZD1A 3RBZA 1TFWA 4OZNA 1HKAA 3MGJA 4OI0A 2IA0A 4WU2A 1U0HA 1WG4A 1V9OA 3O3LA 1BHNA 1S1VA 4DV5J 2XSJB 3LQVA 4DV4J 4OX6A 4Q2LA 5HSPA 3MD3A 3KYLA 5ITHA 5GAEU 1E6YA 5THWA 1G4CA 1Q7YT 1HMVB 1QE1B 5EN1A 2KU7A 4OYZA 1HWLA 2CQ3A 4EYIB 3W62A 2DHGA 1X4GA 3RBDA 2U1AA 1C4CA 4N8OA 3RW7A 1XEZA 3MPWA 4IG0B 1RT3A 2V8VA 3V4IB 2G1DA 5M2UA 4O4GB 4U7UD 2B4VA 1G6BA 1Q4RA 2UUCF 3MECA 4N8NA 1TKZB 4DR1F 5C5JA 2HK2A 1X9SA 4UZCA 1Q95G 3FUYA 3FFIB 2KFNA 2OPPB 3D7SB 3VAMA 2XMWA 5HO4A 1PILA 3M6UA 1NM2A 1YWXA 4LBIA 5J1NA 2AYBA 2DCUB 4HDHA 1HIYA 4W98A 5B0DA 1RA6A 4I69A 4GKJF 5CCLA 1GFWB 2P5VA 5HLFB 3QRRA 2O66A 2EEYA 2ZH9A 2A3JA 1N5YA 3L4BC 3JQKA 2AF6A 3GTYX 2I8EA 2CJQA 4YDXA 2JJ4D 1XNQJ 3GR0A 4ZVEA 1X4EA 4WXOA 1RGVA 2QLFB 3WX8A 1IJEB 3D6FB 4IUFA 1EQ0A 5JJBA 2DNNA 3G87A 2OEMA 1S6PB 2KXFA 3PO5A 4K4WA 2ZEJA 1W2BR 4RBVA 4F25A 1CJKB 3M2RB 2PDAA 2NXEA 4P10A 4WTOB 3QATA 3BQ2A 2FD2A 5CYJA 4OIXA 2UP1A 4QIGA 3LH2S 4XDCA 3MEDA 3TAMA 2VV5A 2A10A 3J81U 4JI3J 2CQ1A 2IMOA 3FJ2A 4FPRA 4KJIA 1RT1B 2F9DA 3MEGB 1MLAA 3MM9A 3M8QA 2ZH7A 2V2QA 4OZ2A 2XNRA 1FKAF 1W2IA 4C11B 1NJIT 2WVFA 2BDPA 3DLEB 2PSZA 2J76E 2J7UA 4O3RA 1OYEA 4AD6A 2D74B 1MU2B 4CO5A 3W2VB 3HXMA 2MMYA 3LTOA 4OI3A 2ZDPA 2R7XA 3J80U 4NLWA 3IRXA 5L9NA 3HJFA 3HD2A 3BPDA 2C2NA 2FVQA 1L3SA 4NEYA 3SSSA 1RP5A 5KFTA 2MLXA 1YBTA 4EO8A 4TVAB 2O3DA 4PRFA 3CXCR 1KN6A 3RW6A 2K7KA 3V2UC 1RTJA 3I9V9 3UR3C 4ZVSB 1KWMA 2FVCA 5CYMB 1S1TA 1WI6A 2O5DA 4ZPAA 1Q0NA 1FE0A 2RS2A 2ZBPA 2R42A 4ECTA 1HNVB 1AT1B 1KSPA 2OH2A 4P74A 4OJ3A 2QL9B 3VHQA 4CO1A 1YJ7A 2IAJA 4DUZJ 1UWBB 1BQNB 1Q1KA 1P1LA 4P2SA 1T03A 4GO7X 1UA0A 3CMES 2W01A 4WYLA 1XK8A 2GMLA 1YJUA 1C1CB 3BSAA 5E2QA 3Q23A 3SI8A 2RRNA 5J2QA 1RTZA 3TUJC 5B0CA 2YKNA 1IN0A 1HNZF 4F3MA 3ZO7A 4A8YA 1VQNS 3R5CA 4ZPCA 4KO0A 3HP6A 1V5IB 3JYTB 1VQ7S 2NXCA 4XK8C 3LANA 4J7CA 1LW0B 2ZKTA 5J1EA 4NLGA 5F8LA 1NUEA 3C14A 2M88A 2PGCA 4R8UB 3ELHA 3VAFA 4U8VA 2BM1A 3ET6B 1XMQJ 3SV3A 5E3CA 1NKCA 3KG1A 4K0KJ 2HHXA 4X66F 1T95A 2CJXB 2VKZG 2J7KA 3AFGA 1K73T 4X64F 2RHSB 1KTVA 1N8RT 4TU9A 4UT4A 1NPKA 3OR2B 1FHTA 1UZHA 2FHJD 2FDNA 2JNJA 2D1CA 3GPAA 1HARA 2ZKUA 2BOPA 1YLXA 1X60A 3WIUA 2OPRA 3DGPB 1VHIA 4LF2A 3JQJA 3JTOA 5KFMA 4A8WA 4O3PA 4QPXA 2HVZA 4YY3F 1X5TA 5HK4A 5A0YB 3GJQB 1SJ4P 3PJ9A 2MEWA 1GX5A 4V1Ak 3LAKA 3TZYA 4X4UA 1HYSA 2V67A 1OY9A 3AJDA 3POTA 4YEAA 3V6DA 1NK7A 1FERA 4AUKA 4JI1J 1CSJA 1RQ0A 1RTDA 1O5JA 1WC4A 3W5XA 4DWIA 1RBLA 2Q1LA 1OJ4A 1CLFA 4EI2A 3PHTA 2C2KB 3DRPA 2KDOA 4ZLJA 5B0GA 1FVQA 1TAQA 4PQUB 2XMJA 4H4OB 4PKDB 4P75A 4BS2A 1T9TA 3KK2B 1FDAA 1WELA 3M8SA 2GGPA 3BGRA 3A1YG 3F41A 2BM0A 5SUHA 5GAHU 5ETTA 4F50A 4MKAA 4QQBA 2BVZA 1J5EJ 1FKPB 2AIRB 4KGKA 1UP1A 3NLCA 1X0PA 8ATCB 1TK8A 2AJ2A 4DCOB 2RKIA 3P4UB 3TEGA 3IAS9 1YGYA 3W8PA 3HULA 4B3OA 3KJQB 3C6UB 5CAAA 2F1FA 2JOQA 3IA0A 1KLNA 4LRFA 2R3VA 2DR6A 1RE1B 2CIMA 3NGSA 3TUZC 3K5PA 4WFYA 4DV0J 1SXLA 2XZWA 3GJTB 1WHWA 4CTAB 1TL7B 4O23A 1XR6A 3EZUA 4R0EA 2CXEA 1FKOA 2C28A 3SQGB 3BZQA 2FVSA 2ZHBA 2BE2B 3S6EA 2V9WA 4LF9J 3ZZPA 2DNLA 2UUWA 3KLHA 3LWMA 2Q6CA 2F8HA 1JLGA 2B43A 4OQJA 1JK9B 3HHLD 2ASLA 2I5JB 3OT9A 2AKWB 5EHHA 2VD3A 4LSLA 1LW2B 4IDKA 1WC0A 2IVFB 2GMHA 4NXMJ 2NCKL 1ZH5A 2C3YA 1HBOA 1Y5IB 4NYPA 2ROPA 4MYTA 2DHAA 3DHXA 3MF5A 4AXIA 1ZPVA 1U2RA 2R7UA 3VAKA 3EZ5A 1MG7A 1WOPA 4L76A 2OD6A 2QA2A 1LKZA 1SKUB 3KMSA 3NNCA 2RQ4A 1VR6A 1VC0A 3GIRA 1ELOA 2V8HA 1EZZB 4DPTA 4U67Q 2X1FA 1W7WA 3G8TA 3EVMA 1HQUB 2HGNA 2ERRA 4CH0S 3R3TA 4PQAA 1CEZA 3M05A 5FD1A 2ALZA 4NLSA 3NGRA 4WJBA 1U1RA 5KG1A 4RWWA 3R2DJ 3CJRA 3B8HA 2V6AA 3NY0A 4IQXA 3EGZA 1W25A 3G8QA 2L48A 3HSZA 5C2CA 1RTHA 2CPFA 4DV6F 3TYTA 1KD1T 4DX6A 4ELUA 4X62J 1B0TA 2LQBA 1M0SA 2AZ3A 5HROB 3RRGA 4DF8A 3D6MB 4USUA 2GHPA 2ZJQQ 4B17A 1PJ5A 4YFUA 2EC2A 1RWVB 2ILYA 3L7UA 3K2YA 4YB6A 3HSGA 3ISND 1FTCA 4PG5A 3VGTA 3RBEA 3DHWC 4FBTA 3F56A 4MK7A 3KXDA 1UVMA 2P9CA 1GAOA 2GHWA 1X5OA 1IR2A 4DZDA 3FBCA 4WBFA 4JBCA 2ZH2A 4GO5X 4CM0A 1URRA 4QZVB 4WFNQ 4ECRA 2GV1A 1AZSA 2HFNA 2ZUAA 2VASA 3PACA 2B4OA 2RS8A 2QSFA 3B4DA 1FI4A 4ZS6A 2MHNA 4F4XA 1VQ6S 3KHRA 2OO4A 4LF5J 5ETVA 4CLKA 3QSYB 3ULHA 1X9WA 1KS2A 1WTBA 3HHLB 3M8ZA 3BN4A 2DO0A 3H5UA 3TW0A 1RJJA 2VICA 1U6ZA 2FVRA 3H0PA 2UXBF 3GFHA 1NSPA 1TUWA 2AJFE 1GH8A 3LALA 3MUVP 3QT5A 1VRUB 1DTQB 1QSLA 4CLYA 9ATCB 2CQ0A 3RJMB 3OL8A 3CCSS 1QAIA 3KK3A 4L75A 1KFSA 4U96A 4DUYF 1RTIB 1FTRA 2L9WA 3MMBB 1VLYA 1BUXA 1IBKJ 1T05B 3AJ2A 4NXNF 3Q2TC 3OLAA 3J81Y 2J7WA 4FF2A 4Q44A 3PEJA 1S9GA 5IWAJ 3NGTA 2YKMA 2IVYA 4P7VA 3THPA 3PFOA 1IR1A 1QSSA 2R7OA 4CLUA 3DXSX 3GZ7A 1KVKA 2QE5A 1WF1A 5HMWA 1FXDA 4EBCA 4LSZB 4JYAJ 2AJ1A 1A0OB 5KFHA 4LF6F 1VQPS 3CW2C 1HWIA 3BGUA 5KFZA 2B9EA 3GIJA 3PW7A 1PCAA 4TYAA 4YOEA 3I0SB 4KPCA 2CNKB 2MZQA 2ZOMA 5D6GA 3J80Y 2JC1A 5B09A 2VBZA 4TNOA 4RW8B 4LVOP 2C3OA 3JTPA 2CG4A 5B0FA 2HFZA 2ZZNA 1N48A 2PI5A 4LFAJ 1EIYB 4JV5J 3UO0A 4YR3A 1N33J 4Y00A 3FBFA 1EJ7L 4F0MA 2K7JA 4M5LA 4ZCMA 1GEHA 4CQ1A 3C2PA 3BKUA 1ACMB 3PDNA 3R6GB 2BMBA 2ZE2A 3CCLS 3UNGC 3GIIA 2WBMA 3DRSA 4KFBA 1J5OA 2HIYA 5AE1A 1QTMA 2QFJA 5BR8J 1EETB 5D4LA 2MZ1A 2HNZA 1UPMB 1T11A 3D0HE 2R7TA 1DFDA 1SUQB 2V2VA 3IBCB 2RDDA 5D3GA 1H2TZ 1YI2S 4UUWA 1Z2LA 4DR6F 3UVJA 4BCAA 3QT6A 4U9RA 4DS5A 1F0XA 2BQUA 3W66A 2K3IA 4P71A 3OHBA 3A3PB 1YQHA 3RUBL 4NYOA 3CJKA 1NHVA 2MZRA 5C42B 3TANA 1LOUA 4P7TA 1F9HA 4KB7A 4CI0B 1R8CA 1P9QC 4RWXA 1WHXA 3Q8VA 1SQFA 3FGVA 3SFUA 2VF3A 1JLBA 5DGAA 1B4SA 5GADI 1WDTA 4C4WA 3QZ7A 3DM2B 2N4DA 3MEEB 2KRBA 3ICLA 1C1BA 2O1PA 1UETA 1CBKA 3HZEA 2RDIA 2GZOA 3NAIA 4KE5A 1REVB 3OSPA 2ZBCA 4X4SA 4DFKA 4WP9A 2YY3A 3KTQA 4OI1A 1NRKA 1JLEA 4ED4A 1HNIA 1NJWA 2GO9A 4ZVPB 1RWXB 2CDRB 2GIRA 5JVGQ 4CYUB 4OZ3A 1IBCB 3CT9A 4X65J 1IBMJ 2GX8A 4AYBD 3Q8UA 3A3OB 1ZM2A 3M32A 4DQSA 3FCHA 1R0AA 4RNNA 2R8JA 2F4VJ 3MZIA 4ECXA 1J2VA 3IMQJ 2ZUGA 1VDHA 2I9SA 1Q8LA 4DV5F 4G6VB 4I7FA 4DV4F 1TKDA 1A9NB 1QTNB 2HHQA 4QR2A 5A8WA 4KAIA 2AZ1A 2ACYA 3AOBA 3ZZRA 5CYQA 1SPBP 4TLRA 6FDRA 2ZH1A 5DG8A 3IR7B 5IT4A 2RUGA 2CDQA 3LGNA 4WWSA 2QN6B 4I0WA 4WK1A 3OL6A 4CO3A 4Y28C 5KG2A 2BX6A 2VG6B 1PYTA 4LT6A 3CE8A 2Y1IA 1U1LA 4FKYA 1K8AT 1VLOA 1Q81T 2K8GA 4O4GA 4EU0A 1OO0B 1TKZA 2W2NP 1S1UB 1YJTA 3FFIA 2OPPA 1KOOA 3AOCA 1KQGB 4U7CA 2OFHX 4QPTA 3H98A 2DIVA 3VF0B 4K2XA 4DZ6A 1KHVA 1IKXB 1X4HA 4F26A 2AQ4A 3ENVA 2BRLA 3Q89A 2DR9A 4OJ1A 4PCQA 3ILLA 4C8NA 2JEJA 4DFPA 2RE1A 2XWYA 2KTQA 5HLFA 3TQ1A 5BYQA 1NZ8A 1BGXT 1K0TA 2JFKA 1WEYA 4OI2A 3R5AA 5KT5A 5G0RB 3TVKA 2HQDA 5DG7A 1R8AA 2DRBA 3LUYA 1UCNA 3DC2A 2MGZA 1T9WA 4F02A 4RUCA 4KH1B 2E7WA 3NEKA 1U1NA 1HBUA 6FD1A 3R5DA 1YDLA 1TV6B 1CJKA 3M2RA 5CZVA 1WSVA 2RILA 5CABA 1MWZA 2KH9A 2KM8C 2JX2A 2Q66A 3PX4A 3NS7B 4KV8B 4JI3F 2FLNA 1JNRB 1GMVA 3DYAB 4B9LA 3VCDA 2YWFA 1TVRA 2HS4A 2R2TA 1N0UA 4NMLA 4OLPA 4F3QA 3MEGA 2ZH4A 1TL3B 4XAKA 3D6TB 3CCJS 3EGWB 1NEEA 2LYVA 4M5DA 3OTOJ 4RPFA 3NS6A 4C11A 5E41A 3BSNA 4ENOA 1NK8A 3DLEA 4PXBA 3R97A 1E6VB 4C3MA 1ZPWX 2DHHA 2FZKB 3TR5A 1IWGA 1MU2A 3W2VA 4CM2A 1VBZA 2ZOFA 2VQEJ 4P2XA 1YBUA 5FLXU 4KBIA 3QWPA 3NS5A 3VQSA 3OUYB 3MM6B 4X4PA 1RADB 1RT6B 1T7PA 1OPZA 4KYZA 1RSCA 2D9PA 1NLKL 4DX8H 4NZ0A 3QIDA 4W92B 2BE9B 2C2DA 3VVUA 4ITSA 3ZZTA 3L95X 1JJ2R 3CIZA 3G9CA 4UOFA 2CJBA 5CYMA 1TL4A 1EP4B 2ZD1B 5L46A 3HD1A 4NLDA 4LR9A 3D9BA 2QZ8A 1HNVA 4DJBA 2HIQA 4OZ5A 2QA4G 3C15B 1K44A 4DUZF 2ROEA 4ZCKA 1D9DA 1E6YB 1UWBA 1BQNA 2AV5A 2HGLA 1DHMA 4FNHA 4TY8B 1DQ9A 3GG1A 3DRXA 4NCGB 4Y2MA 4TQRA 4WYWA 5HJYA 2FJEB 2NR0A 4FKXA 2PMHA 1D1UA 4H4KC 4IFVA 2E9TA 3D5MA 1C1CA 2WRMA 2HHTA 3QT8A 1F2GA 2EKYA 1M5OC 2XY7A 2XLJA 1M5HA 3V4MA 2IBOA 2OPSA 3JYTA 1FFSB 2KHCA 3BQ0A 3BR9A 3RRHA 1LW0A 2LA6A 4HH1A 2MKIA 4ED6A 3D1OA 2Q6BA 2BE7D 5HVFA 1OY8A 4R8UA 1XMQF 4MIWA 4A46A 2FVPA 1T94A 5ETNA 3EPIA 4K0KF 4DG1A 1KC8T 2VJUA 2J9DA 4PZVA 1S6OA 5KFAA 4P2MA 4FYDA 3EDQB 4CO4A 1TQLA 1SQEA 1YVFA 3DLHA 3SCKE 2MY7A 4EWTA 3PYGA 5DZ6A 2BABA 3GSIA 2EXUA 1F3FA 1VJQA 2CQIA 4I68A 4ES3A 5KFGA 2VOPA 3DGPA 1U6FA 4ZCLA 4B3RJ 1X4CA 1X5PA 5A0YA 2EBGA 5BXIA 4ED0A 5IT9U 4RNOA 1B99A 1KEKA 1PSDA 3M30A 3IBWA 3PY8A 3N79A 5D4NA 3MTKA 1M1HA 3NGUA 2VG5A 3MWBA 3MEDB 4JI1F 2BJ1A 2ASYA 2E1AA 3RZAA 3A8EA 2A2DA 1CQMA 2CRLA 3AJ1A 1GTEA 3UCGA 2VBYA 4I56A 2HYIB 2B51A 5KT3A 4ZP7A 4DI6A 3TZZA 1Y00A 1U02A 4PQUA 4M5NA 4GKKJ 3MMAB 3MR7A 4FS2A 2H9ZA 2IJFA 3PR4A 4ECSA 4IO9Q 1BXNA 4ATNA 4A8QA 2DPJA 3CJ5A 1J5EF 2CWKA 4UOCA 5CD4H 3ZTRA 3IGNA 1FKPA 3PG9A 5L1LA 2PI4A 2C3MA 1LXJA 1KVIA 4ZJOA 1XBWA 4ANEA 3P6YC 3KUGA 3ENQA 3BPSP 4JI7J 4N5SA 2LA4A 3LP1B 4RO0A 3M2VB 3T1YJ 1XERA 2C2ZB 4CO2A 1HBNB 3RR7A 1WHYA 3FBBA 1SJ3P 1S1TB 4DQRA 1MNEA 1GMUA 2E5JA 4K4UA 3IRWP 3EGNA 4QIWD 2BE2A 1H38A 4LF9F 3MPVA 1CJUA 1LEOA 1QVGR 3ZC4A 4FF4A 4LRCA 2V4QA 1ZTWA 1RK8A 4I6WA 2DGOA 3HHNB 2XG8A 4NLXA 1RAFB 5LSRA 4ETXA 4FDFA 1GK8A 2W25A 1RAGB 2VL1A 2FZGB 3GP9A 1TTHB 2I5JA 4KC5A 1UVJA 3G86A 5LJ3Y 3MFHA 3FZBA 5F8IA 3RB3A 3OPKA 4V19J 1LW2A 4NXMF 3FKBA 3MAHA 2HQIA 1XNRJ 1AFIA 3GJSB 2QA1A 2B4PA 1B3TA 3SMZA 2DD8S 3GV7B 5J2QB 1YKWA 3FDSA 1DTTA 2YH0A 2XQCA 1M5PC 4L73A 4KO0B 2H3EB 4A4JA 3WC2A 3J7AN 2X1GA 1F5CA 4TY9A 4NCBA 1S97A 4H54A 3HHLC 2O67A 1SC4B 1AYEA 4EFAC 3Q8RB 4NLTA 2QT7A 4RW9A 1SKWA 3FK4A 4KY3A 1U2FA 2NSBA 5B08A 4A8OA 3L7PA 3I82A 2YXLA 2CQ4A 1RCXB 2YPYA 2CZVC 1IKVB 2EW9A 4DF4A 4HR2A 4ZN3A 3LGHA 3OTDA 1S9FA 4IH5A 1N32J 2R9LA 1SIWB 4LF7J 3MEKA 4KQZA 5AXLA 1X8DA 2J9EA 2NUHA 1P8GA 2WK4A 2JWNA 3FSYA 4ZP6A 5D15A 3A8IA 2B8QA 1CULB 3F0NA 4M5HA 2VA3A 4ILRA 4JUZA 3MCMA 3TAQA 2LQJA 4USKA 5ETRA 5KT7A 3M9NB 5HROA 2UXCJ 2ALYB 1RWOB 3NCPA 4IOCQ 3A3NB 2VDHA 2IM3A 4C8KA 2C22A 3MMJA 1M1KT 1HYSB 4UOGA 4ED5A 4IKAA 3ZXWA 2K1RB 3POTB 2DHXA 2BQ3A 4I4BA 1U1QA 1H0HB 4NLUA 4ID8A 4CT9A 1L3KA 4DUTA 1WWHA 3I55S 3U1NA 2ZVSA 3JSRA 3HKWA 2CG8A 3DRPB 4LF5F 2BA9A 5BYRA 1SC6A 1LWFB 5C7PA 1CC7A 2V2ZA 3W2WA 3DOLA 3ISNC 1V6HA 2M8HA 1N34J 4O44B 1FVSA 1HI0P 2GW8A 3PYFA 4USJC 2OPQB 2UUBJ 1VQ4S 2Y8YA 3BGRB 3TQEA 3DDNA 1VS3A 2V94A 3HHLA 4LR7A 2OMOA 4NA3A 2FTRA 4DSEA 1ZETA 3RR8A 1VQ5S 2RKIB 2EBEA 4OV1A 2NYIA 1N5VA 4NLRA 3SEOA 5HBMA 3QQCD 4AQYJ 4QU6A 5DLGA 5HMYA 1G7CB 4LSNA 1B64A 2GQQA 1PO6A 2PT0A 5AE3A 2OEJA 3CJQA 1DTQA 5FDLB 4E98A 3HI9A 4HKQA 3CF5Q 4J9KA 5C2GA 4WCEQ 2J6SA 3CCUS 4MH8A 2JSXA 9RUBA 1FRIA 2MKCA 1X9MA 2A0FB 2J9DE 2BXJA 3BN7A 4O3QA 1RTIA 2FLOA 3K5OA 3J7YI 4N76A 2W9CB 1VRTB 4ZPVR 1RKIA 2GJIA 1OIAA 3MMBA 1IBKF 3UR0A 2Y1JA 1JLGB 3CMAS 1OPIA 1YG0A 4DX5A 1UWAA 3UNYA 1I6JA 1NHUA 3B6BA 3TOQA 5IWAF 4J37A 2C2OB 4LSLB 2DEIA 1S10A 4TYBA 4WPAA 4IG3B 2E5GA 3OSNA 4MYUA 2OJ3A 2XS2A 1L3VA 5LJ5Y 4E8UA 3GYXB 2IY5B 5IM0B 5IOLA 3GV8B 2WOMB 5A8KA 5FLXY 4DSFA 3ETMA 1SBRA 2K06A 2IMWP 2CNNB 2HEKA 1FJGF 1VGYA 4RW8A 5H1SV 2KVQE 2R8KA 4DX7A 2RMLA 1S76D 4LFAF 1H6KX 5HMZA 2ZOGA 3BSOA 3UN5A 4JV5F 3K89A 2AMCB 3I4PA 4L74A 4QCLA 1N33F 5KOWA 2IM1A 5HJXA 3VGSA 2VC1A 4ANCA 3GSDA 2WZ1A 2W4CA 3LA0A 3SCLE 5F9NA 2UZAA 4QWBA 3NCRA 1FE4A 3N5BA 2MXYA 4EO6A 4WTYA 2BUNA 5BR8F 2W2QP 4LIWA 1R43A 1PC5A 5E5NA 3LPEA 2G4BA 3LP0B 1EETA 2EK6A 4TXSA 2N82B 4ILLA 2L41A 5KFRA 1FRLA 2QLJB 4J90A 5K8MA 4B3MJ 3PNIA 5DRKA 4ZPWR 1MN7A 3QGPA 1WG1A 2NSCA 4LF1A 4OHZA 4IO1A 4KHRA 3HLUA 1K0VA 1FEEA 3ILJA 5C42A 3W60A 1DAXA 1S0NA 4KGMA 1T02A 3OFHA 3T6JA 3ADAC 1ZM3A 1HBMA 4ZDNA 3CCQS 1AZSB 1S48A 2M8DB 3DM2A 2HQCA 3WDOA 3MEEA 1QUVA 2XS5A 3KUHA 2N7CA 2HVDA 4DMZA 2I6WA 2KVIA 2OIHA 2HAIA 1RAIB 1S57A 4EYHB 2LEBA 2DGXA 3KHHA 1RXOB 4JI2J 1IKWA 1TK5A 3SQOP 3P49B 3O44A 4C0OC 4DPYA 1MROA 3IO1A 3P5TL 2KN4A 1FDNA 2FY1A 1NSKL 3IM9A 3D0GE 3PM9A 1GXLA 3DOKA 1RLCL 3I6PA 1O8BA 4K4ZA 3LGMA 4LRDA 2ASDA 2JDJA 4X65F 4NX9A 1RT7B 1IBMF 1R31A 2O01C 4PXEA 5IFMA 2AX1A 1SJFA 4R0JA 4KRWA 1RWUA 5J2MB 1R6YA 4ZHRB 3RB0A 5D78A 3TRGA 1CG2A 1R8BA 4BBYA 1KNZA 1TKTA 4J9RA 2Z2LA 4Q7AA 4X4RA 1UVKA 2WONB 4YDDB 2LLZA 2V4JB 1TUVA 3PO4A 3ZZ0A 3EWGA 5B7WA 3W1YC 5IT9Y 1LK7A 3BH7B 2Q3PA 1ZAVA 4PWWA 5GAGI 2UVVA 1MN9A 2HBRB 2IYIA 3A13A 4RUAA 4Y34A 2B7CB 1HPZB 3TARA 1ZA2B 2WAQD 1GXTA 1NCLA 1U0SA 2XI3A 3H2LA 3TZWA 3TAPA 2H51B 3G82A 2VG6A 2ZH3A 1IUJA 2MQNA 5KFDA 5KFFA 3MCSA 1NZAA 2CPYA 3NBPA 3KG0A 1WOSA 1FDDA 2N3OA 2XMVA 5K14A 4PPZA 2GJFA 1M5VC 1N52B 2BJ7A 3DDIA 1S1UA 1V3RA 4K4VA 2CVEA 2H5IB 1Y10A 3OFEA 5A6PA 3GILA 4CZCA 2KG0A 3P8BB 1SB6A 2R7QA 2VB6A 5HMXA 4NEZA 5L1IA 1U48A 1IM4A 4DLGA 1IKXA 2XSFA 2CPZA 2RT3A 3R5BA 2ZDOA 1RAAB 1SL2A 4ECYA 5ETSA 1QD1A 4C6AA 1SKSA 2MHEA 1ZBTA 4ID5B 2G2YA 2ZJRQ 4UZBA 3DKDA 2H5EA 2PC6A 1Q16B 3TX8A 2DNQA 4JOUA 5SZTA 2HNYA 3Q2SC 3KDNA 3UW1A 1C0TA 2QLXA 4LRAA 5L9XA 2PFFB 1HI1A 2J0WA 3A12A 2QYCA 2V2KA 3PKYA 1F6TA 2JRSA 4HL9A 4FXWA 3T9ZA 5HN0A 1TV6A 3MR5A 3KLVA 3DLKA 2XBPA 4OL8A 1Q5VA 4KV8A 5D0HA 2IIHA 2J9CA 4F2RA 2VODA 3AT1B 1XWLA 3I9ZA 4UUXA 4ES2A 2RH3A 3CDEA 2HWTA 3H2VE 1LNQA 3P5BP 3TP2A 3BR8A 2AJ0A 2MQMA 4U95A 2V0NA 4ED3A 3OTOF 4FVCA 2HMIB 3JSMB 2F7VA 4OMFG 3TUPA 5KG4A 3MM5A 2ZC3A 4N7TA 1C1BB 5DETA 5D8HB 4GVLA 4URGA 2VQEF 1UA1A 3C6TA 1D8YA 4C9DA 2CJYB 3CJ3A 1MW7A 3OXLA 4TN2A 3UWTA 1P1TA 3OUYA 5DS7A 3MM6A 3DRYA 3R5GA 1JLEB 2DCLA 2KT2A 5CA5A 3R1HA 2DH7A 2E5HA 1ZAXA 2PA3A 1RHJB 1APSA 1UJ6A 1A7GE 4PG4A 3L7OA 4Y0FA 2QSWA 1W26A 1S5ZA 3I0RA 2DITA 1WI8A 4DDFA 5CD4A 1OS5A 3CD5A 4F0KA 1JLFA 2RRAA 2P9EA 2ZHAA 1NK4A 1UPPA 4I7FB 1WG5A 5ETLA 3UN3A 2R2RA 5KFXA 2OMLA 5A8WB 5F8GA 3ILIA 4ED1A 3C15A 2EFNA 4OYPA 1R0BG 5CYQB 4JI8J 3M2UB 2F40A 2EPIA 4A8MP 4TY8A 4NASA 4WFXA 4G65A 4WE1B 4NCGA 3E3XA 3UFCX 4IQMA 4DCJB 3I87A 4O0IA 1H72C 1Q8BA 3M1VB 2JVRA 1BQMA 1Q8IA 4PG7A 4IFYA 1X4DA 4IOAQ 2FC8A 2MQQA 3K59A 4KR0B 4Y65A 3FMWA 3F44A 1HFEL 4B08A 4WU3A 2DNHA 4PG8A 3R27A 4ZLPA 4HDGA 1CS4A 2AWZA 4NLPA 4DL0C 2A2CA 2XI2A 3CJ8A 4IRDA 1R6VA 1HW9A 4DQQA 3E01B 3BM7A 4QBUA 3J7A1 2HW3A 1HQEB 4AL7A 4C8ZA 1NH8A 2OHDA 1S72S 3K7RA 1NK0A 2FJBB 1DY3A 5I3UB 3UE2A 4PAAA 1HR0J 2VKRA 2DNKA 3LAMA 2RQCA 1WACA 2MGZB 3EMTA 1WHVA 1G1XA 5D0RA 1EKSA 3TEHB 3BO2A 1RI7A 3VAGA 4B3RF 1VQYA 4QIEA 2HLTA 4K5SA 4IH6A 1HBUB 2YWKA 3U1MA 3H2UB 1VK8A 4WKRA 1QAJA 1X4FA 3H7HB 1N0VC 4DL7A 2E1CA 4E0DA 2EK1A 4MT1A 3J7ZT 4Y2AA 1H3DA 2B6AA 1PC4A 3CC4S 4ZVRB 5AXMA 2C3UA 2IC3A 3FSXA 1TVRB 3M7VA 4C2MA 3P45B 2JFDA 4GKKF 1UMJA 4OYMA 3M6VA 4YB5A 3MMAA 1S0MA 3UCUP 4M5DB 4NOHA 1P9YA 2CFXA 4B3TJ 1CC8A 3DOMB 1T9XA 2E9RX 1BWEA 4DR3J 2UV8G 1SVDA 5IV3A 4L6V3 4WP8A 3RB6A 4P9SA 4C8MA 1TKXB 4RLEA 1OQ6A 1EAYC 3PCOB 2VPXB 3GQCA 1U1PA 2QG9B 4HVZA 4CH7A 5DM7Q 2KYXA 4RW6B 1JQGA 3IC1A 2HHWA 3PIOQ 3DI6A 4JI7F 3DXBA 2R2SA 3T1YF 4UOHA 3LP1A 3M2VA 2MPUA 2JLFA 1HBNA 2MQOA 3SXLA 3PX6A 2CQPA 3PX0A 3PRBA 2FJXA 2IHR1 4O3NA 4CLZA 2VHGA 4Z2XA 2YX7A 3OTCA 4CH1A 3DLLQ 3SFGA 4C7QA 3ENAA 4NLQA 2YWEA 3H42A 2EI5A 3BJYA 1WDDA 3NCQA 5GADU 1KR4A 4LF4J 2XY5A 3PVXA 2IFXA 3D54A 2PFDA 3LOUA 3N5FA 2HVIA 3EVWA 1CJTA 4PPDA 4DL4A 5D77A 1HA1A 3TZXA 1R3NA 1S7IA 4Y6IA 1XNRF 1IQTA 2IPOB 4IFVB 4J91A 1G3OA 1XQIA 4DV2J 2UVUA 2BZ2A 1ZA1B 3NNAA 2UVRA 2L08A 4RW4A 2VFVA 3GYGA 2CVIA 2OPSB 3QGGA
chains in the Genus database with same CATH topology
2IJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IJR A; 
#chains in the Genus database with same CATH topology
 2WB4 A;  1N5S A;  4F04 B;  3I5A A;  1N5T A;  3AA8 A;  2RNE A;  3GG0 A;  3VTI A;  1SJQ A;  3Q0A A;  2XY6 A;  3CDB A;  2BJE A;  2BR0 A;  4DG1 B;  4FS1 A;  2C2R A;  1IKV A;  2B5J B;  3CJT A;  3WHI A;  1OMS A;  4N77 A;  1HL6 A;  4YHH J;  4M94 A;  1Y3K A;  5KFV A;  2OTL S;  1N32 F;  4LQ9 A;  5F3T A;  4LF7 F;  1S6Q B;  4LFB J;  1URN A;  3H5X A;  4PYA A;  5IC6 B;  2ZBR A;  2WVC A;  2V69 A;  4HH0 A;  2QJ3 A;  2FPH X;  2QFI A;  5E0O A;  4I64 A;  3TA2 A;  2QA4 S;  1CUL A;  2AU0 A;  4H4M B;  3KLI B;  3HJV A;  1WC1 A;  2DXE A;  2J0Q D;  2UXC F;  3Q83 A;  4YR0 A;  3VWS A;  3NKY A;  5T7L A;  4TU8 A;  2DVI A;  2IJR A;  3T41 A;  2BYC A;  1TFY A;  3QYY A;  3M30 B;  3I5B A;  4IRC A;  2IA6 A;  1B70 B;  2K1R A;  4LF8 J;  2VG5 B;  1QJH A;  2QO3 A;  1VRQ C;  1X4B A;  3MR3 A;  4C0H A;  4ECQ A;  2FJV A;  3L3C A;  2OKQ A;  1XC9 A;  3R5J B;  3N6L A;  1LV5 A;  4JV2 A;  4GVB B;  1XR7 A;  2YKO A;  1LWF A;  1N34 F;  4O44 A;  1IBL J;  5H9F K;  2UUB F;  1X5S A;  4Z7C A;  2UV8 A;  2OPQ A;  2CJA A;  2ZBQ A;  3HVT B;  2RJZ A;  3GFZ A;  2RRB A;  1U25 A;  4ER8 A;  4DR4 J;  4CO0 A;  1F3V A;  5JUM A;  1FF2 A;  1UVI A;  1ULR A;  4AQY F;  2ZH6 A;  4FXV A;  2HWH A;  5KFO A;  1KQK A;  2FJW A;  4N56 A;  1T9V A;  3OTE A;  5FDL A;  4RU2 A;  1VK3 A;  5E7O B;  5KG0 A;  2F65 A;  3EPG A;  4ZVT B;  2I38 A;  1ZZF A;  3DMJ A;  1T0T V;  4KGV B;  3I5C A;  1VQO S;  1H7W A;  3ENW A;  3C16 B;  2P2C B;  3IP0 A;  3DRR A;  1WNE A;  4Q0B A;  1S1X B;  1N6Q B;  3ILO A;  5L1J A;  2W9C A;  1VRT A;  2D3O 1;  4K4Y A;  1CJU B;  5F9L A;  4F4K A;  5D4P A;  3NWR A;  3DLJ A;  2F8M A;  3PJX A;  3PW4 A;  2EG2 A;  4JI6 J;  2XMM A;  4DL5 A;  4F4W A;  1TMJ A;  3D67 A;  4D3G A;  5CHC B;  5EWG A;  3DCA A;  2GAH C;  1FXL A;  4UY8 5;  1HNW J;  2YWG A;  4IG3 A;  1DTT B;  4C8Y A;  2KXN B;  3LP2 A;  4P52 A;  2AGQ A;  2DPI A;  5IM0 A;  2I2Y A;  3ZZU A;  2WOM A;  2XYP B;  4KKO A;  1FRH A;  4RW9 B;  3J7Z 5;  1HQ2 A;  3RBX A;  3BQ1 A;  1N36 J;  3KJV B;  3O5T B;  3BO4 A;  2ZWO A;  3VZI A;  2H5J B;  2WSF C;  2KO1 A;  3VAL A;  3EGV A;  4YUD A;  1UEK A;  3R7N B;  3H40 A;  2XMA A;  1LWC A;  3FC9 A;  4MIB A;  2IDE A;  1FK9 B;  3MPD A;  2A6M A;  2BKO A;  2QLW A;  2H4Y B;  3OVB A;  4ICL B;  5J2N B;  3SV4 A;  4FYV B;  1I5O B;  1RAJ A;  4DR2 J;  1PIE A;  1U1K A;  2GVZ A;  2CYY A;  2ZFH A;  2V5H G;  3FCV A;  3EYZ A;  2M9K A;  3FEX B;  3HVW A;  3JXO A;  5KT6 A;  3LP0 A;  3EX7 B;  2HS0 A;  4TKT A;  3IWN C;  4A8K A;  4B3M F;  2X1B A;  1CQN A;  1QAX A;  5KFE A;  4J9N A;  2PII A;  5EWF A;  1CVJ A;  2E7V A;  1YTY A;  1Q86 T;  3RU0 A;  1FRK A;  2CPJ A;  3JQM A;  3IFE A;  3V81 B;  2R8G A;  3QZ8 A;  3MCO A;  3GIM A;  2Y8W A;  2VU5 A;  2ZZM A;  2YQ0 A;  1UTA A;  2DKO B;  2FHK A;  4AXJ A;  5H9F J;  2Z2Z A;  4I2Q B;  5EX3 A;  3V6J A;  3BBC A;  3GJR B;  2VPY B;  2EFO A;  3HSJ A;  5IXU A;  1NO8 A;  3DN9 A;  3G96 A;  1TK0 A;  3D28 A;  2RDJ A;  1VHF A;  3W2W B;  4OX9 J;  2CPH A;  3DOL B;  4JI2 F;  5EUH A;  1LXN A;  1S4F A;  3M8W A;  5LMU J;  4URS A;  3AOA A;  4ELT A;  3H59 A;  3RTV A;  1R8H A;  3LPY A;  4A8S A;  2HFV A;  1SC1 B;  4PWD A;  2OLW A;  4G1Q A;  1VQM S;  2WB1 D;  1RT7 A;  2Z4P A;  2B8P A;  2HZV A;  5HBM B;  1YRX A;  4ZOS A;  4LSN B;  3ZTQ A;  2BRK A;  4L3K A;  4DSK A;  3DLG B;  2P9G A;  1GQE A;  5J2M A;  3PRD A;  3WZ0 A;  2LU2 A;  4RX6 A;  4L3N A;  5H9E K;  3GE9 A;  3I56 S;  4ZHR A;  4JI4 J;  4F3O A;  4NWB A;  1FDB A;  2DXD A;  1O6X A;  2CPI A;  2FYX A;  3MUM P;  2WON A;  2V4J A;  4MKV A;  2W1B A;  1JKH B;  5K20 B;  4EK2 A;  3EIC A;  1S1W A;  3AOD A;  1VMB A;  1HPZ A;  1NJX A;  5LXR A;  3THV A;  2K3K A;  2XHC A;  4J9V A;  4F8R A;  2ZM6 J;  1WF0 A;  3VV2 B;  5CZX A;  4F67 A;  3JSY A;  5JVH Q;  2D7S A;  4KIA A;  3BKF A;  4ZJQ A;  3IAM 9;  1TL1 B;  2XYH B;  3GFY A;  3AB2 B;  4DN9 A;  2XGQ A;  3HMJ G;  1KBR A;  2D3Z A;  4TQS A;  2VQF J;  4YR2 A;  3NGK A;  3CTR A;  3CCW A;  3MFI A;  4X4Q A;  3ITH B;  3M8P B;  5A8K B;  4C3L A;  2Y3Y A;  1VJW A;  3KJN B;  3NGD A;  2NXN A;  1BE4 A;  5KT4 A;  4RR5 A;  4DV1 J;  1FCA A;  3ZNU A;  4GRS A;  2E5I A;  3R8Y A;  1FJG J;  1YIT S;  4G1P A;  2QMX A;  1GMW A;  2N7Y A;  4W4M A;  4I6Y A;  3CCT A;  2N3L A;  2K2P A;  1Q8K A;  4P6Q A;  4ID5 A;  4YP3 A;  2R7W A;  3HDS A;  1RU1 A;  2MKS A;  1H2V Z;  4R5P B;  4X4T A;  5AT1 B;  3AHP A;  2A1B A;  5HP1 B;  3CWJ A;  4DR5 J;  1EHW A;  1S0V A;  1YHQ S;  1DLO A;  3CSK A;  2UUT A;  3E2E A;  3MUR P;  4ZCI A;  3RB4 A;  3HHE A;  2WBR A;  2JZ5 A;  2BQR A;  3BH6 B;  2MKJ A;  3JAM U;  3QBC A;  4DEZ A;  1FES A;  1WF2 A;  3U7J A;  2OSQ A;  2KJW A;  3MM7 B;  3HT3 A;  2CAJ A;  3M9O B;  3RAX A;  1VC6 A;  1MMN A;  1JWW A;  1NDK A;  4XO0 A;  4PYD A;  1HBM B;  1TAU A;  1RLD A;  1YJW S;  2DO4 A;  4AFF A;  3DGV A;  3AXM A;  2KG1 A;  2G13 A;  3BBF A;  4NE9 C;  2HMI A;  3JSM A;  3UDV A;  1Q7L B;  2KRR A;  4N47 A;  1RAC B;  7FD1 A;  3LWL A;  2C1E B;  1Y3J A;  5K8P A;  1NJZ A;  1CJV B;  1Z4U A;  4Q8F A;  3D3B J;  2B9W A;  2W4P A;  4EZ9 A;  3QRP A;  4K4T A;  4MK9 A;  2XHW A;  1V3Z A;  1IKW B;  1RWW B;  4QJV A;  4UW2 A;  2NZC A;  1MRO B;  1GNK A;  3CIM A;  4YN3 B;  2LFV A;  2ATC B;  5KFJ A;  4K59 A;  1JLA B;  2G0C A;  4PUO B;  3DOK B;  2FC9 A;  3PHE A;  5H9E J;  2WHO A;  3BF4 A;  4OYB A;  2YWH A;  4CRJ A;  5KOX A;  3MPU B;  1JXV A;  1VQ8 S;  1Y4Z B;  3QGH A;  2DXF A;  4B02 A;  3BYR A;  3UDC A;  4ZJL A;  4RNH A;  1HWU A;  4QIV A;  2DGW A;  3O8W A;  4QOT A;  4O3S A;  2B7B B;  3MCN A;  1T8E A;  2MDA A;  2DNM A;  3FMB A;  2E9Z A;  1RBO B;  4Z37 A;  4MKY A;  1I1G A;  3EJM A;  2KL8 A;  4F4A A;  2ABY A;  2ZIT A;  3EXC X;  1DBD A;  3VAJ A;  1TKT B;  2HSE B;  3CJ0 A;  2KHD A;  4LR8 A;  1O51 A;  2DRA A;  4JI8 F;  1DUR A;  2FUG 9;  3FZ2 A;  2IM0 A;  1S9E A;  3QGI A;  3M2U A;  4PAB A;  5D4O A;  2R7S A;  3Q8Q B;  2PE8 A;  3SCI E;  4OYX A;  1BC6 A;  1QDU B;  1VIO A;  4WE1 A;  2E7X A;  2DGQ A;  1RT2 B;  1KFD A;  4USI A;  4YB1 P;  3ZTS A;  5LOQ A;  1IWA A;  4RUB A;  4C8L A;  3W5Z A;  4WII A;  4ED2 A;  3FRZ A;  4QWE A;  3SDE B;  3G82 B;  1XJW B;  5D0E A;  3M1V A;  3CJ4 A;  1FXR A;  2NQP A;  2M0G B;  3IWL A;  4DR7 J;  2ATL A;  3PFE A;  3NBP B;  3MAQ A;  1JJH A;  4I1T A;  4DN0 A;  2CUY A;  5K14 B;  1LWE B;  2F9J A;  1G2E A;  1S49 A;  1B0P A;  2I1R A;  1ITP A;  2QTW A;  1NU4 A;  3B82 A;  4IR1 A;  1PAE X;  2R4F A;  3JSB A;  2YH1 A;  1OSD A;  3CUL A;  4LBH A;  2LQ9 A;  1SJ1 A;  4RUH A;  2HUR A;  4JV1 A;  4PXD A;  3VQT A;  3HZG A;  3GON A;  3E01 A;  2A6O A;  2VON A;  2LEA A;  1T9Y A;  2MLY A;  3CJS A;  4M63 A;  5DQI A;  2IVM A;  1HQE A;  3DNC A;  3J7Y U;  1ZTT A;  1SH2 A;  2BJ9 A;  1OSC A;  4YS2 A;  1U1M A;  3TJ8 A;  4U7U K;  3UDL A;  4Y2K A;  3W8G A;  1WEX A;  2ZJP Q;  5HQ8 A;  5I3U A;  2W2P P;  3R9L A;  1HR0 F;  3TA1 A;  5ADZ A;  2BAN B;  5C24 A;  3AH6 A;  2YQ1 A;  3TI0 A;  5DG9 A;  2JEF A;  5DGB A;  3MM8 B;  1K1S A;  2HNY B;  1VCT A;  1C0T B;  1RIS A;  2RU9 A;  1S7H A;  1U09 A;  3D3C J;  3MHY A;  3QLH A;  3IM8 A;  2F8E X;  2ACM A;  2NRE A;  3NMR A;  2EG1 A;  4NLO A;  3SSR A;  1WOR A;  3OXF A;  4YB7 A;  2CQB A;  2HHH J;  1SJR A;  5FJ4 A;  1N88 A;  3PYD A;  3QO9 A;  3CO9 A;  2JHE A;  2ZHO A;  3DLK B;  3A4T A;  1H7X A;  4XPC A;  2YX4 A;  3FBE A;  3CDW A;  1YRT A;  3AAW B;  4BLG A;  4J9M A;  4QR0 A;  1JLC B;  2AW0 A;  3HPO A;  3T5L A;  1RYS A;  4C8O A;  1HW8 A;  2HRU A;  1IKY A;  3I96 A;  3HO1 A;  2QMU B;  5T14 A;  4OHY A;  2KM8 B;  4B3T F;  1L3U A;  4IYQ A;  2QL5 B;  2HK3 A;  4DR3 F;  1U2C A;  5E3Q A;  4CLF A;  4KSE B;  3MM5 B;  1NB7 A;  3T6B A;  3DOM A;  5AJ3 J;  4ECV A;  3ZZO A;  1IM6 A;  1UFW A;  1TP7 A;  4RW7 B;  1VQK S;  3C6T B;  3BEG B;  2FB0 A;  3UD4 P;  3S8S A;  1TKX A;  2LEP A;  3S1T A;  3K5M A;  2DNG A;  3CCZ A;  4J9U E;  3MOJ B;  4KT0 C;  1HHT P;  4A47 A;  1C0U B;  2MQL A;  1VQL S;  1LQ9 A;  4RW6 A;  4JB8 B;  2ZWP A;  2MJN A;  3G6V A;  1RWM B;  2QIF A;  5K8N A;  3OHA A;  2ASJ A;  4F7V A;  1OYD A;  2J6U A;  3HHK A;  3BDP A;  2DH8 A;  4MTP A;  2E1R A;  2XWX A;  3QMQ A;  3K17 A;  3I0R B;  2YNH B;  4OLO A;  2GNK A;  3MD1 A;  3CJ2 A;  3GLJ A;  3AY0 A;  4RNF A;  5KFK A;  3AA9 A;  2JC0 A;  4RBT A;  1JLF B;  2RF2 B;  4OJG A;  1Y5L B;  2B3T B;  4CWB A;  5IQQ A;  3NOC A;  3PR5 B;  4LF4 F;  3QJP A;  2AYG A;  4CNY A;  2LXU A;  1NK9 A;  2HQF A;  3J81 j;  2AGO A;  3SBM A;  3O1L A;  3MR6 A;  2NS1 B;  2JEG A;  1REG X;  2XZT B;  3R7B B;  2M4M A;  2W9A A;  1R27 B;  5HQL A;  2DRD A;  3OJS A;  2V4R A;  3LW5 C;  4DV2 F;  3H8Y A;  4KGX B;  2HQ3 A;  3G6E S;  2AHO B;  4DSI A;  1BQM B;  4DXL A;  2ZZT A;  4IFY B;  2WW8 A;  2CWX A;  4Y2I A;  8RUC A;  4RZR A;  2MZJ A;  4TU7 A;  2W8L A;  4JI5 J;  1U47 A;  2UUA J;  1UKU A;  4LVN P;  4JI0 J;  3RG6 A;  1WC6 A;  2HPU A;  1S12 A;  3GR1 A;  4HHH A;  2RUS A;  1DRZ A;  3US5 A;  2DR8 A;  7FDR A;  1I94 J;  1CS4 B;  4OX7 A;  1M90 T;  1PYO B;  1C2P A;  2M52 A;  2NXJ A;  3MR2 A;  2B5J A;  4YHH F;  2YKA A;  3CD0 A;  1FFW B;  5KFS A;  2Y1R I;  4DV3 J;  2GJ2 A;  4QW9 A;  2WCX A;  5GAG U;  3CVK A;  4LFB F;  3NXZ A;  3E51 A;  3QPI A;  2D3O R;  1S6Q A;  5HI7 A;  3NG8 A;  3Q86 A;  1VIX A;  2PMW A;  4NMX A;  1NKB A;  2HWI A;  3C8Y A;  2KFZ A;  4X4V A;  1GT8 A;  5LM7 E;  3CDU A;  2GIF A;  2MKY A;  5F0W A;  3W61 A;  4H4M A;  3PJW A;  4C48 A;  2V8D A;  3KLI A;  1NDP A;  1N56 A;  4B3S J;  5F41 A;  1RT4 B;  2WVD A;  3MAA A;  3C3L A;  2DTJ A;  2XS7 A;  2VC0 A;  3GYN A;  3G71 S;  1S79 A;  2F5G A;  4CLW A;  3MMC B;  2E1M C;  5F8J A;  3HVR A;  4LF8 F;  3QFH A;  3M6W A;  3W9H A;  2GO8 A;  2IRY A;  1UJ4 A;  3NL0 A;  3KK1 B;  2MJU A;  2VDI A;  2B6A B;  4G3I A;  1U45 A;  2Z57 B;  3W9J A;  2IC3 B;  1JXL A;  5HAT A;  4UTG A;  4J9S A;  1TR0 A;  1WOO A;  4WZM A;  2CKW A;  2NUU G;  2E29 A;  3OBI A;  4GVB A;  1HNX J;  4FP9 A;  1QM9 A;  5A2Q U;  4G1I A;  1JMT A;  1IBL F;  4OFZ A;  4RNM A;  4OHX A;  1VFJ A;  2VG7 B;  2ADC A;  2CQD A;  4MAK A;  4K7Q A;  4J9P A;  1X31 C;  2DR7 A;  3VGV A;  3AB4 B;  1P27 B;  3HVT A;  3CGI A;  2I0X A;  1BMQ B;  1B7Y B;  3SSQ A;  2EFV A;  4DSJ A;  4J5O A;  4DR4 F;  4XDD A;  1SL1 A;  1TUG B;  4OZ0 A;  2VZ9 A;  2ZVI A;  1Y7P A;  1CPZ A;  1F9F A;  2DEJ A;  2MLZ A;  2Z56 B;  3G8S A;  3DI6 B;  3TNV A;  1UEV A;  1YBA A;  3MXH P;  1B0V A;  1VC5 A;  2W9B A;  3B4M A;  1T3N A;  2Z0G A;  2WSE C;  1PAU B;  1HI8 A;  1SH0 A;  1HD1 A;  1KHW A;  1NAQ A;  3KLE A;  3H5Y A;  4RU9 A;  2HS3 A;  1WD6 A;  3C16 A;  1F2H A;  4EGL A;  3BS9 A;  1JLQ A;  3JAM Y;  1KP6 A;  1S1X A;  4ZIW A;  1N6Q A;  2DNP A;  3THT A;  5F8N A;  1FA0 A;  1HLW A;  1RAE B;  3BKT A;  3AD7 C;  2OD4 A;  4JI6 F;  3AXK A;  4KHP F;  2Z2Y B;  4MFB A;  1VQ9 S;  1CJT B;  4E2F B;  3VAH A;  4X4N A;  3EM1 A;  5CXT A;  3R7S B;  2HZA A;  2B56 A;  2UXD J;  4J9L A;  1MWQ A;  2Y9H A;  1OY6 A;  1HNW F;  2RD5 C;  3NAH A;  1S4E A;  1F60 B;  4DV7 J;  4LFC J;  4L72 B;  2LQ8 A;  2LVW A;  1LWX A;  2QC3 A;  4RW4 B;  1IXK A;  4EEY A;  4B9S A;  2YNI A;  2AP6 A;  2EC0 A;  4ALZ A;  3FRY A;  2M2B A;  4FPI A;  4K5R A;  1TZ0 A;  1FJE B;  1N36 F;  4K8R A;  2QLB B;  5GAE I;  4RL1 A;  1RUS A;  1M5K C;  3KJV A;  2B0G A;  3V6K A;  2VUG A;  3N28 A;  3KNG A;  5BYS A;  2W7A A;  2OP5 A;  2KT5 A;  4QYZ K;  4HLB A;  1Y0H A;  2Q79 A;  4DHV A;  1RT5 B;  3TJ9 A;  1FK9 A;  2V34 A;  4F2S A;  1VYA A;  3D4J A;  1NDC A;  3RAM A;  2G2Z A;  2GS8 A;  1V3S A;  5KFI A;  2OGU A;  4ICL A;  3CED A;  5J2N A;  2ZNZ A;  2GHV C;  2DNO A;  4DR2 F;  3BGF A;  1SV5 B;  2AGP A;  4KPY A;  5IQ6 A;  4QU7 A;  2V8G A;  3TUI C;  4HAC B;  3WC0 A;  1QLN A;  4DBQ A;  2FGC A;  3PIP Q;  3AD9 C;  4Q2M A;  1JXE A;  4ZPD A;  2LCW A;  2FHO B;  5HVH A;  4FBU A;  2ZBI A;  2H4W B;  4NL5 A;  4WP3 A;  5KFL A;  3UI3 A;  3GMG A;  2LMI A;  2B4U A;  3NOG A;  3M6X A;  4AL6 A;  5T7L B;  4IR9 A;  4ED7 A;  1PJ7 A;  2HQG A;  3PW2 A;  4C98 A;  4M5M A;  2VBW A;  3CCE S;  3V81 A;  5G4D A;  3QWU A;  4Q45 A;  4ZVQ B;  2CJK A;  3KHL A;  3LO3 A;  3HFV A;  2N4C A;  1KOH A;  4I2Q A;  3CD6 S;  3C19 A;  3R1L A;  3WQP A;  3CNQ P;  1U26 A;  2NXU A;  2XUL A;  1VI7 A;  5E3R A;  5B0A A;  4ZVG A;  4OZ1 A;  1JB0 C;  4OX9 F;  1U6B A;  2HVH A;  2V50 A;  2LU1 A;  3QJL A;  3T5J A;  5KT2 A;  2BKN A;  2HVE A;  3P3D A;  4I2P A;  2OFG X;  3AD8 C;  4DLE A;  5LMU F;  3QFW A;  2MKH A;  5F8M A;  1EQM A;  2NZ4 A;  3OR1 B;  2XLI A;  1WEZ A;  3M4X A;  4JP8 A;  2DHS A;  2YQ3 A;  2XMT A;  1IQZ A;  3FEZ A;  2DNR A;  2NPI A;  4DPX A;  2YNF A;  3L9Z A;  4ZK7 M;  2CQG A;  1SKR A;  1WSR A;  3N9U C;  4LBP A;  3T1H J;  3DLG A;  2P6T A;  3W3S A;  2LDI A;  2AD9 A;  3EXY A;  4GMK A;  4JI4 F;  2KB2 A;  3DMJ B;  2BJD A;  1VBY A;  3I4H X;  1N54 B;  1UW4 A;  2Q43 A;  4X2B A;  1RBA A;  4FVM A;  4QR1 A;  1NHK L;  3DRR B;  2RHQ B;  4FYX B;  4Q0B B;  2VFS A;  1WKJ A;  1JKH A;  2MQ8 A;  3KLF A;  3IS9 A;  5T41 A;  2P6S A;  2W7P A;  4RKU C;  1X4A A;  5B0E A;  4GC6 A;  2JLE A;  2RQK A;  5I3Q A;  2HND B;  2ZM6 F;  2B9X A;  1QY7 A;  1KKH A;  4CIO A;  1FNX H;  1DJ0 A;  5DM6 Q;  4UQG A;  5DJB A;  5GMD A;  2ADB A;  3S01 A;  2Z58 B;  4C97 A;  3OW2 R;  3HT0 A;  2HHS A;  4ZN1 A;  2F3J A;  3CD7 A;  1TL1 A;  4F4Y A;  2YKQ A;  2GCF A;  3KFW X;  3PW5 A;  2RVJ A;  2VQF F;  1D3W A;  2KJV A;  4ZLN A;  3LP2 B;  2BJ8 A;  1FFG B;  2H48 B;  2VH7 A;  4QYZ J;  5DQG A;  4MKB A;  3ITH A;  3M8P A;  4KGZ B;  4KKO B;  5I4M A;  4DV1 F;  4WFZ A;  3HK2 A;  2UU9 J;  1RZM A;  2D9O A;  1RAH B;  3IG1 B;  4AE5 A;  1RWK B;  2QV6 A;  2R7R A;  1HWJ A;  2XZD B;  1LWC B;  3UD5 A;  5DDP C;  2PEH A;  2PN6 A;  4R5P A;  1VBX A;  4KHM A;  2H65 B;  4DR5 F;  5HP1 A;  2P8I A;  3QNW B;  2R8H A;  1U8S A;  2HHV A;  4ECU A;  1NH7 A;  2GVZ B;  2XYG B;  2J6T A;  2OEK A;  3NRB A;  2GVD B;  1NK6 A;  4OYI A;  5DDR C;  3FNN A;  1PKU A;  2GC8 A;  2BOA A;  4IH7 A;  4ERD A;  2KXH A;  2HKE A;  3KHG A;  2NPF A;  2XSJ A;  4LRB A;  3H90 A;  4K50 A;  5KFQ A;  3MM7 A;  1VIS A;  1GMW D;  3M8Y A;  3EZO A;  3N4W A;  5EWE A;  2BBE A;  4OYO A;  1UZD A;  1UFL A;  2WVB A;  1HMV A;  5LMN J;  4HI1 A;  1QE1 A;  5A8R B;  5LSO A;  3GB0 A;  7AT1 B;  5KFP A;  5J2P B;  2CQH A;  5K9F A;  3MI7 X;  3CB4 A;  4ZPB A;  2JEI A;  1BY9 A;  2DNY A;  2L3M A;  3NWG A;  1A6L A;  4ZPT R;  4IG0 A;  2EFP A;  2QMW A;  3V4I A;  1Q5Y A;  5EX0 A;  2CAD A;  4DL3 A;  1CJV A;  3BO3 A;  2R8I A;  2V8P A;  3ZZY A;  5I42 B;  3G6X A;  3CMQ A;  1RWP B;  1QAY A;  3QAU A;  2HHP A;  2ZNY A;  1D09 B;  3OVS A;  1L5U A;  4OZJ A;  1WKK A;  2WW4 A;  4QWA A;  4P2F A;  1JLA A;  2QL7 B;  4LIR A;  4ZA1 A;  4PUO A;  4PWD B;  1TL5 A;  5KAK A;  1JX4 A;  2HBQ B;  3PRV A;  3KLG B;  1FWL A;  4G1Q B;  4WFA Q;  4DOZ A;  5L38 A;  2EFQ A;  4NI2 B;  1UVL A;  3QIP B;  4QWD A;  4OV6 A;  1NDL A;  1MWY A;  4ETZ A;  3KMQ A;  2OI2 A;  2V63 A;  4K2J A;  3CO0 P;  1FRJ A;  2DNZ A;  5A76 A;  3GIK A;  4K4S A;  1XNQ F;  3UPF A;  3MDF A;  1PGZ A;  3PZP A;  4NRT A;  4NA1 A;  3BGL A;  4IOB A;  3DU6 A;  4FYW B;  5GAH I;  1S99 A;  4BC9 A;  3TO8 A;  2EKN A;  4FZV A;  1RAB B;  2Y1L B;  2BJ3 A;  4KTQ A;  1S6P A;  1S1W B;  1TU0 B;  2FQQ B;  3FQL A;  5HL7 Q;  2XGP A;  2J8S A;  2FJD B;  1RT2 A;  5AXN A;  1JIH A;  1IVZ A;  2M70 A;  3T19 A;  1Q78 A;  2PD1 A;  3SDE A;  1H74 A;  2CPX A;  1PYS B;  4DR7 F;  2F63 A;  4HTJ A;  5DZ7 A;  2HFS A;  4M5I A;  4M5K A;  3RYL A;  1LWE A;  3W63 A;  5A2Q Y;  5C25 B;  1RT1 A;  3N6M A;  4ZVO B;  2AEJ A;  1PJ6 A;  4Z7Y A;  1BQX A;  4BHQ A;  3MOZ A;  1WUU A;  4I6A A;  4QIF A;  4ED8 A;  1D9A A;  4P73 A;  4ZP9 A;  4N41 A;  1D8Z A;  1AW0 A;  4ZKA A;  1QVF R;  3NMA A;  1SIZ A;  3OV7 A;  2AEM A;  2BW2 A;  1RHK B;  1ZM9 A;  3OVA A;  5MAO A;  4HT5 A;  2C2E A;  1XMO J;  3N0V A;  2E5L J;  1BD6 A;  1DQA A;  3U27 A;  3OFF A;  1AFJ A;  2BAN A;  1SH3 A;  2YNG B;  2AYM A;  3MM8 A;  1KLM B;  2F4F A;  1NKE A;  2MST A;  2NLW A;  1WJ9 A;  3QJJ A;  1DLO B;  2U2F A;  3G4S S;  2VPW B;  1HWK A;  5ETK A;  4USW A;  3KKF A;  1Y11 A;  4PWU A;  2Y0S D;  5HAN A;  5K8O A;  4LMZ A;  1U24 A;  2B9Y A;  1GX6 A;  1U0H B;  4USH A;  2HHH F;  5KG3 A;  1UW9 A;  2MZS A;  4R25 A;  1S1V B;  3Q8Y A;  4HHU A;  1RKJ A;  1FD8 A;  4J9O A;  4ZVU B;  2QEX S;  1RHR B;  1ZAW A;  2M5Y A;  3Q24 A;  4EMD A;  3QSI A;  2Z30 B;  3DU5 A;  3W9I A;  1R0C B;  3EE3 A;  1F9E B;  1JLC A;  3L09 A;  1BLU A;  2YPZ A;  3ZZZ A;  2GMJ A;  5L1K A;  4FXD A;  1NPP A;  4OJH A;  3IN5 A;  2RU3 A;  4NCA A;  3FVY A;  4WFB Q;  1QSY A;  4EUV A;  4MMO A;  1NSA A;  5DLF A;  3OL9 A;  5RUB A;  3OQ2 A;  5AJ3 F;  1RT3 B;  4HTI A;  3U02 A;  2J5A A;  1H2U X;  2IRX A;  4RW7 A;  3MEC B;  3HM9 A;  2UUC J;  2FY8 A;  2VJV A;  1ZYQ A;  2CQC A;  4LQ3 A;  4DR1 J;  4U6P A;  2Z8Q A;  3HFK A;  4QYR A;  4ZIV A;  1FRX A;  1C0U A;  5CH7 B;  4A48 A;  3B54 A;  3Q22 A;  3ET6 A;  5IV4 A;  4OYW A;  4WKY A;  3AQP A;  3V6H A;  4WIQ A;  5F3Z A;  4F4Z A;  4CLT A;  4GKJ J;  1JJC B;  2YNH A;  2H54 B;  2NYH A;  1U1O A;  1N5Y B;  3OR2 A;  2E44 A;  1YJV A;  2BAC A;  2APO A;  3NP5 A;  3X1L B;  1T3O A;  4M5J A;  2OAU A;  2RF2 A;  2LP4 A;  3ZFV A;  3ZNJ 1;  5KFW A;  2QGF B;  4W90 B;  4NYZ A;  2XO6 A;  2G1H A;  1YIJ S;  3BV8 A;  4UF4 A;  2LEC A;  2DK2 A;  1S9E B;  4OI6 A;  1RHQ B;  2DIU A;  1R7I A;  2POK A;  1PG5 B;  4B9N A;  1NXI A;  5GVQ A;  3KJF B;  3VAI A;  2OEL A;  3C46 A;  3H4D A;  4CP5 A;  2D69 A;  2KFY A;  1JNZ B;  3W65 A;  2QRR A;  2XCP A;  3BSC A;  3K5N A;  3I31 A;  1M1G A;  1ZS6 A;  2OSR A;  1U4B A;  3JTN A;  3TAM B;  2JLG A;  3HSD A;  1AUS L;  4M95 A;  1I51 B;  2MSS A;  3H4B A;  2LDY A;  2BEF A;  2HBZ B;  1BWV A;  3D0I E;  1OQ3 A;  2MY8 A;  5K5M A;  1NBE B;  2VOO A;  4ZVH A;  4JI5 F;  2XC9 A;  2UUA F;  1C4A A;  4JI0 F;  2MZT A;  1EAR A;  4NLY A;  3MM9 B;  2X51 A;  4ECZ A;  3M8Q B;  4H4K A;  5KFN A;  3OXG A;  4B9V A;  3Q8S B;  2RAQ A;  3V5R A;  2GQ2 A;  4H4O A;  1I94 F;  3DLB A;  1KTQ A;  3CC7 S;  4DS4 A;  4ECW A;  2IDL A;  3KK2 A;  2OTJ S;  4PR6 A;  4OHW A;  4DV3 F;  3K8V A;  1NJY A;  4DSL A;  1FX4 A;  1GXU A;  1SI9 A;  2RQM A;  3IRX B;  1KQF B;  2DGS A;  4LUB A;  3K8W A;  2X1A A;  1TMM A;  4K4X A;  1F5B A;  1VBK A;  3ZTP A;  2FZC B;  5IC4 B;  5CCM A;  3LF0 A;  3CCV S;  3BB5 A;  2IM2 A;  3HKZ D;  1KON A;  3C6U A;  5C24 B;  3VR1 A;  2W24 A;  1VQS A;  4CLL A;  3IR5 B;  1YZ7 A;  2RSQ A;  4DV0 F;  4B3S F;  1XN9 A;  3FSI A;  1RTJ B;  3VGU A;  1RT4 A;  4CTA A;  1TL7 A;  1WKL A;  3QLH B;  3P96 A;  4CNZ A;  4UY8 T;  1SL0 A;  2CJ9 A;  2G9O A;  1Y5N B;  3PYE A;  3IXQ A;  3TA0 A;  3SQG A;  2VBX A;  1MSW D;  4A8F A;  3MMC A;  2Z2M A;  3QO9 B;  1AB8 A;  3D66 A;  2VFR A;  1UL3 A;  2XM3 A;  4ZVF A;  5IT0 A;  3KK1 A;  3U1L A;  1F5A A;  2IAJ B;  4LRE A;  3G2X A;  5LT5 A;  1K1Q A;  5KG7 A;  1T03 B;  3W64 A;  3T3F A;  1IKY B;  3TX0 A;  3D2W A;  1HNX F;  3KDO A;  1U8W A;  2FHJ A;  1FRM A;  3T5K A;  1H98 A;  1N5Q A;  3M8R A;  1SC3 B;  5HAO A;  1RDR A;  4DU7 A;  1FO1 A;  2YKN B;  5FII A;  2VG7 A;  3N6N A;  1XTZ A;  4WZQ A;  3HFZ B;  1HNZ J;  4BWM A;  5LL6 d;  3OJU A;  1WC3 A;  2KZZ A;  5IZH A;  2FHM A;  2CPD A;  1RB0 A;  4D3H A;  1FWP A;  5J1E B;  5ETO A;  1FNM A;  3C14 B;  3FCW A;  3NNH A;  4RBU A;  1EB0 A;  2FIU A;  4AT1 B;  1RYR A;  2LKZ A;  2SXL A;  3CC2 S;  2KI2 A;  2CPE A;  4O3O A;  5JMN A;  1K9M T;  2W7O A;  2CA9 A;  1WC5 A;  4RJV A;  3UD3 P;  4X66 J;  1J27 A;  1HQU A;  4FNI A;  3S7R A;  2FJA B;  1Z1Z A;  2JVO A;  2G2O A;  4X64 J;  2PEB A;  2QX0 A;  3GCW P;  3GV5 B;  1B7F A;  3R2C J;  2ZH5 A;  3UCZ P;  2VFU A;  1ROF A;  4C3K A;  2JH3 A;  2MB0 B;  3CCR S;  1O0P A;  3M9M B;  2EFG A;  2XMK A;  4X62 F;  2OPR B;  5HVG A;  5ETM A;  2BW7 A;  1RAO A;  2DGU A;  1EX8 A;  4ZP8 A;  2HFO A;  4FN5 A;  3KWM A;  3W5Y A;  2OUG A;  3UQS A;  1V5V A;  4YY3 J;  3HX9 A;  2VIH A;  2DR5 A;  2W2M P;  2AYE A;  5E3A A;  3K57 A;  2UXD F;  3GCX P;  2LXI A;  2AT1 B;  3D6H B;  5AXK A;  1U7L A;  4DV7 F;  4LFC F;  3V6D B;  3IWX A;  4QW8 A;  2CZ9 A;  4X4O A;  3JB9 k;  1RTD B;  2AX0 A;  3TVZ A;  4FF3 A;  1GTH A;  3WBZ A;  2J0X A;  3GFX A;  1RU2 A;  3HVA A;  4LJM A;  5KG6 A;  3K5L A;  1XMB A;  4EBD A;  2BKP A;  2R2U A;  1YJ9 S;  3CCM S;  3HCX A;  5F0U A;  1XIQ A;  2V9K A;  4V19 X;  2YKP A;  5KFY A;  2DY1 A;  5JXS A;  1IJF B;  3T1A A;  4ZIT A;  5LXY A;  5DDQ C;  1FEH A;  1R8P A;  1LK5 A;  1SQG A;  4FYY B;  2GGP B;  4BDP A;  1S0O A;  1RT5 A;  2XB2 D;  3TJA A;  1TEL A;  3SYZ A;  2V68 A;  1Y9O A;  3IR6 B;  4UQT A;  1KQS R;  4O0N A;  4NZ7 A;  1SV5 A;  5EGY A;  4QWC A;  3D1H A;  1PBA A;  4B3O B;  4CCH A;  2IRU A;  4HAC A;  2DT9 A;  4TLQ A;  1ZM4 A;  3KNA A;  1AA1 B;  1VRU A;  1H73 A;  1HD0 A;  1R89 A;  4HHJ A;  3SCJ E;  4AL5 A;  2J8A A;  2HLU A;  2J0S D;  3BRE A;  1FWK A;  4AND A;  3MAA B;  1AXQ A;  2DB1 A;  5AE2 A;  4WXW A;  1FKO B;  3DDK A;  2PA8 D;  5CQG A;  2EVZ A;  2PO4 A;  1FX2 A;  1K47 A;  5BJR A;  3KLH B;  4M1K A;  1T05 A;  1N4L A;  3FQK A;  1Q79 A;  4CLP A;  1YJR A;  5KTQ A;  1X7V A;  1RHM B;  1JJ4 A;  4I67 A;  3G6Y A;  4NA2 A;  1RCO B;  4IDK B;  1OWX A;  5J1P A;  2IYG A;  3IGV A;  4IRK A;  1M5S A;  2X3G A;  4JYA F;  3EDR B;  1HBO B;  1FD2 A;  1YRU A;  4X84 A;  4B9U A;  3TWZ A;  1FJ7 A;  2XMU A;  3VVT A;  1T9U A;  3OR1 A;  1Z2Z A;  3I0S A;  1KVJ A;  2FLP A;  1HHQ A;  2CNL B;  1S77 D;  2IJN A;  1UJ5 A;  5M2P A;  2DJW A;  2IBK A;  2COL A;  2W4D A;  1YJN S;  2W9B B;  3R6L B;  3T1H F;  1L3T A;  1KDN A;  2G0J A;  4XPE A;  3JS9 A;  5E3P A;  1LFP A;  4DPO A;  3Q8P B;  4MJK A;  4UST A;  1KRP A;  4F36 A;  1U49 A;  2DYA A;  4USM A;  5EDW A;  3KLE B;  3T9N A;  3BGO P;  3SZ2 A;  5KFU A;  2Y0B B;  1ZOT A;  5F8H A;  3AQO A;  3UDE A;  2XCA A;  4DFJ A;  2HRY A;  2MYF A;  2W2O P;  4DL2 A;  1AUD A;  1JLQ B;  2CNO B;  3CPW R;  1RTH B;  3RAQ A;  4Y2C A;  4DV6 J;  1I3O B;  2MQP A;  2HAF A;  3H20 A;  2DBB A;  2BV3 A;  1ZZN A;  1SUQ A;  2HZC A;  2GAG C;  2HND A;  4MFB B;  4KHP J;  1RA7 A;  2UVW A;  3PTW A;  4JV0 A;  4ELV A;  2RB7 A;  2AEF A;  2DIS A;  3T5H A;  3A8K A;  3KOA A;  1DZ5 A;  1ICE B;  3H5S A;  4OHV A;  3K0J A;  2VA2 A;  2JL9 A;  4ZMM A;  1MMD A;  5GMK a;  2X3D A;  2CZ4 A;  4J9Q A;  3F73 A;  3W7B A;  1FT8 A;  1UFK A;  2X7I A;  2YNI B;  1X0F A;  5DQH A;  5KFC A;  3CDA A;  3PV8 A;  4WK3 A;  4EZ6 A;  1FJC A;  5GME A;  2HFU A;  1NK5 A;  1IR0 A;  1VOM A;  2UU9 F;  2ZH8 A;  5DDO C;  1NPR A;  5M2R A;  4WF9 Q;  3GU0 A;  3IG1 A;  2HRT A;  1D9F A;  1REV A;  4CDI A;  3OL7 A;  3D1Q A;  4DQI A;  2AJQ A;  1MML A;  2CQ2 A;  4U8Y A;  3EVO A;  3BBB A;  2C2M B;  3O2I A;  4EBE A;  2A18 A;  2XTJ P;  2XEX A;  4Q5V A;  3PKM A;  2LQ5 A;  4CYU A;  2KT3 A;  3CUN A;  1NME B;  4NPO A;  4OI4 A;  3FEY B;  1NND A;  2UXB J;  4DL6 A;  3A8J A;  3I32 A;  4ES1 A;  3N01 A;  5MLC V;  1SCJ B;  4B9M A;  2F4V F;  1RHU B;  3BDE A;  3HHD A;  2GVD A;  4P72 A;  3ZTO A;  2KKH A;  2DGT A;  3QAE A;  2YWW A;  3SIP B;  3RGI A;  1DAR A;  5A6W A;  2GFF A;  2G0I A;  2HGM A;  4GC7 A;  3KK3 B;  2VFT A;  3WX4 A;  5KG5 A;  5D0G A;  3QT7 A;  4DUY J;  3X3U A;  1UEU A;  2D41 A;  5DO2 A;  5LMN F;  3ISZ A;  3EUN A;  1HHS A;  1NB2 A;  5ETQ A;  4DU8 A;  2DH9 A;  1Q53 A;  2MKK A;  4DPW A;  5A8R A;  1YZ6 A;  4NXN J;  2ZC4 A;  4O4R A;  5J2P A;  2W8K A;  1DQ8 A;  4PEO A;  1D0E A;  1S9G B;  2WSC C;  4Y3C A;  4OZL A;  4C0B A;  5E33 A;  2YKM B;  4DQP A;  2YX1 A;  3GWC A;  2GA7 A;  2KYZ A;  3RRK A;  2C42 A;  5I42 A;  2C3P A;  4I2P B;  3ONQ A;  4BC7 A;  3PW0 A;  2ILZ A;  4LF6 J;  5HQM A;  4PG6 A;  3IBF B;  2XLK A;  1YK9 A;  2R7V A;  2YVS A;  1LFW A;  3OTB A;  4M8L A;  5U47 A;  3KLG A;  4HEA 9;  4XTT A;  2LXF A;  3O6Q A;  2RIJ A;  2XNQ A;  2YNF B;  2XO7 A;  2DGV A;  4NI2 A;  3QIP A;  3PEH A;  1Q82 T;  2D3U A;  3QRQ A;  4HT7 A;  4CLS A;  2QYG A;  3H25 A;  5G0R A;  4OX8 A;  4CT8 A;  3E8O A;  4B9T A;  2ZE2 B;  2GIQ A;  4USV A;  4Q8E A;  1EKR A;  4MIA A;  3DRS B;  4NRU A;  4KFB B;  1J5O B;  2VPZ B;  4NZ6 A;  1UAW A;  3KLF B;  3IS9 B;  4Q43 A;  5L8R C;  5KFB A;  4DCP B;  4HI2 A;  1S59 A;  1PBU A;  3PXG a;  2HNZ B;  3TVY A;  1NSQ A;  4MK8 A;  4OYA A;  4ILM A;  3MPY A;  2GQC A;  2FGO A;  2L9N A;  4FF1 A;  3MUT P;  3UN2 A;  5LSL A;  1P6T A;  5B0B A;  8AT1 B;  1YX2 A;  2WTF A;  5D3G B;  1FNO A;  4PXC A;  3UVJ B;  3BYP A;  2FLL A;  3OD2 A;  3KG4 A;  4DR6 J;  1ARO P;  2ROG A;  2H1Y A;  4XIU A;  3CJK B;  2L9D A;  1S6U A;  3DYA A;  1QUP A;  2KZM A;  4KH0 B;  4NLV A;  3ETO A;  5L39 A;  1WTF A;  3MTJ A;  5C25 A;  3OFG A;  2AJ4 A;  3DFE A;  2DY9 A;  1JLB B;  2HHU A;  1TL3 A;  4BWJ A;  3HF5 A;  2M7S A;  1RWN B;  1YSJ A;  1E6V A;  1F1B B;  2YTC A;  2MTL A;  2EWH A;  5IS2 A;  3WIV A;  2M3D A;  3VZH A;  4YME A;  4S0M A;  5ETP A;  2HG4 A;  2PMZ D;  3B78 A;  6AT1 B;  3D68 A;  1XMO F;  1XR5 A;  1RT6 A;  2E5L F;  4M5G A;  1HNI B;  4ZLL A;  4A8X A;  2E66 A;  5I3P A;  4HYK A;  3OLB A;  2YNG A;  1UVN A;  3C66 A;  1KLM A;  2WVE A;  4DPU A;  2HBY B;  4YQW A;  4F0H A;  2YBV A;  3KUE A;  3M32 B;  4URQ U;  2E1P A;  3K58 A;  1R0A B;  1EP4 A;  4DFM A;  2ZD1 A;  3RBZ A;  1TFW A;  4OZN A;  1HKA A;  3MGJ A;  4OI0 A;  2IA0 A;  4WU2 A;  1U0H A;  1WG4 A;  1V9O A;  3O3L A;  1BHN A;  1S1V A;  4DV5 J;  2XSJ B;  3LQV A;  4DV4 J;  4OX6 A;  4Q2L A;  5HSP A;  3MD3 A;  3KYL A;  5ITH A;  5GAE U;  1E6Y A;  5THW A;  1G4C A;  1Q7Y T;  1HMV B;  1QE1 B;  5EN1 A;  2KU7 A;  4OYZ A;  1HWL A;  2CQ3 A;  4EYI B;  3W62 A;  2DHG A;  1X4G A;  3RBD A;  2U1A A;  1C4C A;  4N8O A;  3RW7 A;  1XEZ A;  3MPW A;  4IG0 B;  1RT3 A;  2V8V A;  3V4I B;  2G1D A;  5M2U A;  4O4G B;  4U7U D;  2B4V A;  1G6B A;  1Q4R A;  2UUC F;  3MEC A;  4N8N A;  1TKZ B;  4DR1 F;  5C5J A;  2HK2 A;  1X9S A;  4UZC A;  1Q95 G;  3FUY A;  3FFI B;  2KFN A;  2OPP B;  3D7S B;  3VAM A;  2XMW A;  5HO4 A;  1PIL A;  3M6U A;  1NM2 A;  1YWX A;  4LBI A;  5J1N A;  2AYB A;  2DCU B;  4HDH A;  1HIY A;  4W98 A;  5B0D A;  1RA6 A;  4I69 A;  4GKJ F;  5CCL A;  1GFW B;  2P5V A;  5HLF B;  3QRR A;  2O66 A;  2EEY A;  2ZH9 A;  2A3J A;  1N5Y A;  3L4B C;  3JQK A;  2AF6 A;  3GTY X;  2I8E A;  2CJQ A;  4YDX A;  2JJ4 D;  1XNQ J;  3GR0 A;  4ZVE A;  1X4E A;  4WXO A;  1RGV A;  2QLF B;  3WX8 A;  1IJE B;  3D6F B;  4IUF A;  1EQ0 A;  5JJB A;  2DNN A;  3G87 A;  2OEM A;  1S6P B;  2KXF A;  3PO5 A;  4K4W A;  2ZEJ A;  1W2B R;  4RBV A;  4F25 A;  1CJK B;  3M2R B;  2PDA A;  2NXE A;  4P10 A;  4WTO B;  3QAT A;  3BQ2 A;  2FD2 A;  5CYJ A;  4OIX A;  2UP1 A;  4QIG A;  3LH2 S;  4XDC A;  3MED A;  3TAM A;  2VV5 A;  2A10 A;  3J81 U;  4JI3 J;  2CQ1 A;  2IMO A;  3FJ2 A;  4FPR A;  4KJI A;  1RT1 B;  2F9D A;  3MEG B;  1MLA A;  3MM9 A;  3M8Q A;  2ZH7 A;  2V2Q A;  4OZ2 A;  2XNR A;  1FKA F;  1W2I A;  4C11 B;  1NJI T;  2WVF A;  2BDP A;  3DLE B;  2PSZ A;  2J76 E;  2J7U A;  4O3R A;  1OYE A;  4AD6 A;  2D74 B;  1MU2 B;  4CO5 A;  3W2V B;  3HXM A;  2MMY A;  3LTO A;  4OI3 A;  2ZDP A;  2R7X A;  3J80 U;  4NLW A;  3IRX A;  5L9N A;  3HJF A;  3HD2 A;  3BPD A;  2C2N A;  2FVQ A;  1L3S A;  4NEY A;  3SSS A;  1RP5 A;  5KFT A;  2MLX A;  1YBT A;  4EO8 A;  4TVA B;  2O3D A;  4PRF A;  3CXC R;  1KN6 A;  3RW6 A;  2K7K A;  3V2U C;  1RTJ A;  3I9V 9;  3UR3 C;  4ZVS B;  1KWM A;  2FVC A;  5CYM B;  1S1T A;  1WI6 A;  2O5D A;  4ZPA A;  1Q0N A;  1FE0 A;  2RS2 A;  2ZBP A;  2R42 A;  4ECT A;  1HNV B;  1AT1 B;  1KSP A;  2OH2 A;  4P74 A;  4OJ3 A;  2QL9 B;  3VHQ A;  4CO1 A;  1YJ7 A;  2IAJ A;  4DUZ J;  1UWB B;  1BQN B;  1Q1K A;  1P1L A;  4P2S A;  1T03 A;  4GO7 X;  1UA0 A;  3CME S;  2W01 A;  4WYL A;  1XK8 A;  2GML A;  1YJU A;  1C1C B;  3BSA A;  5E2Q A;  3Q23 A;  3SI8 A;  2RRN A;  5J2Q A;  1RTZ A;  3TUJ C;  5B0C A;  2YKN A;  1IN0 A;  1HNZ F;  4F3M A;  3ZO7 A;  4A8Y A;  1VQN S;  3R5C A;  4ZPC A;  4KO0 A;  3HP6 A;  1V5I B;  3JYT B;  1VQ7 S;  2NXC A;  4XK8 C;  3LAN A;  4J7C A;  1LW0 B;  2ZKT A;  5J1E A;  4NLG A;  5F8L A;  1NUE A;  3C14 A;  2M88 A;  2PGC A;  4R8U B;  3ELH A;  3VAF A;  4U8V A;  2BM1 A;  3ET6 B;  1XMQ J;  3SV3 A;  5E3C A;  1NKC A;  3KG1 A;  4K0K J;  2HHX A;  4X66 F;  1T95 A;  2CJX B;  2VKZ G;  2J7K A;  3AFG A;  1K73 T;  4X64 F;  2RHS B;  1KTV A;  1N8R T;  4TU9 A;  4UT4 A;  1NPK A;  3OR2 B;  1FHT A;  1UZH A;  2FHJ D;  2FDN A;  2JNJ A;  2D1C A;  3GPA A;  1HAR A;  2ZKU A;  2BOP A;  1YLX A;  1X60 A;  3WIU A;  2OPR A;  3DGP B;  1VHI A;  4LF2 A;  3JQJ A;  3JTO A;  5KFM A;  4A8W A;  4O3P A;  4QPX A;  2HVZ A;  4YY3 F;  1X5T A;  5HK4 A;  5A0Y B;  3GJQ B;  1SJ4 P;  3PJ9 A;  2MEW A;  1GX5 A;  4V1A k;  3LAK A;  3TZY A;  4X4U A;  1HYS A;  2V67 A;  1OY9 A;  3AJD A;  3POT A;  4YEA A;  3V6D A;  1NK7 A;  1FER A;  4AUK A;  4JI1 J;  1CSJ A;  1RQ0 A;  1RTD A;  1O5J A;  1WC4 A;  3W5X A;  4DWI A;  1RBL A;  2Q1L A;  1OJ4 A;  1CLF A;  4EI2 A;  3PHT A;  2C2K B;  3DRP A;  2KDO A;  4ZLJ A;  5B0G A;  1FVQ A;  1TAQ A;  4PQU B;  2XMJ A;  4H4O B;  4PKD B;  4P75 A;  4BS2 A;  1T9T A;  3KK2 B;  1FDA A;  1WEL A;  3M8S A;  2GGP A;  3BGR A;  3A1Y G;  3F41 A;  2BM0 A;  5SUH A;  5GAH U;  5ETT A;  4F50 A;  4MKA A;  4QQB A;  2BVZ A;  1J5E J;  1FKP B;  2AIR B;  4KGK A;  1UP1 A;  3NLC A;  1X0P A;  8ATC B;  1TK8 A;  2AJ2 A;  4DCO B;  2RKI A;  3P4U B;  3TEG A;  3IAS 9;  1YGY A;  3W8P A;  3HUL A;  4B3O A;  3KJQ B;  3C6U B;  5CAA A;  2F1F A;  2JOQ A;  3IA0 A;  1KLN A;  4LRF A;  2R3V A;  2DR6 A;  1RE1 B;  2CIM A;  3NGS A;  3TUZ C;  3K5P A;  4WFY A;  4DV0 J;  1SXL A;  2XZW A;  3GJT B;  1WHW A;  4CTA B;  1TL7 B;  4O23 A;  1XR6 A;  3EZU A;  4R0E A;  2CXE A;  1FKO A;  2C28 A;  3SQG B;  3BZQ A;  2FVS A;  2ZHB A;  2BE2 B;  3S6E A;  2V9W A;  4LF9 J;  3ZZP A;  2DNL A;  2UUW A;  3KLH A;  3LWM A;  2Q6C A;  2F8H A;  1JLG A;  2B43 A;  4OQJ A;  1JK9 B;  3HHL D;  2ASL A;  2I5J B;  3OT9 A;  2AKW B;  5EHH A;  2VD3 A;  4LSL A;  1LW2 B;  4IDK A;  1WC0 A;  2IVF B;  2GMH A;  4NXM J;  2NCK L;  1ZH5 A;  2C3Y A;  1HBO A;  1Y5I B;  4NYP A;  2ROP A;  4MYT A;  2DHA A;  3DHX A;  3MF5 A;  4AXI A;  1ZPV A;  1U2R A;  2R7U A;  3VAK A;  3EZ5 A;  1MG7 A;  1WOP A;  4L76 A;  2OD6 A;  2QA2 A;  1LKZ A;  1SKU B;  3KMS A;  3NNC A;  2RQ4 A;  1VR6 A;  1VC0 A;  3GIR A;  1ELO A;  2V8H A;  1EZZ B;  4DPT A;  4U67 Q;  2X1F A;  1W7W A;  3G8T A;  3EVM A;  1HQU B;  2HGN A;  2ERR A;  4CH0 S;  3R3T A;  4PQA A;  1CEZ A;  3M05 A;  5FD1 A;  2ALZ A;  4NLS A;  3NGR A;  4WJB A;  1U1R A;  5KG1 A;  4RWW A;  3R2D J;  3CJR A;  3B8H A;  2V6A A;  3NY0 A;  4IQX A;  3EGZ A;  1W25 A;  3G8Q A;  2L48 A;  3HSZ A;  5C2C A;  1RTH A;  2CPF A;  4DV6 F;  3TYT A;  1KD1 T;  4DX6 A;  4ELU A;  4X62 J;  1B0T A;  2LQB A;  1M0S A;  2AZ3 A;  5HRO B;  3RRG A;  4DF8 A;  3D6M B;  4USU A;  2GHP A;  2ZJQ Q;  4B17 A;  1PJ5 A;  4YFU A;  2EC2 A;  1RWV B;  2ILY A;  3L7U A;  3K2Y A;  4YB6 A;  3HSG A;  3ISN D;  1FTC A;  4PG5 A;  3VGT A;  3RBE A;  3DHW C;  4FBT A;  3F56 A;  4MK7 A;  3KXD A;  1UVM A;  2P9C A;  1GAO A;  2GHW A;  1X5O A;  1IR2 A;  4DZD A;  3FBC A;  4WBF A;  4JBC A;  2ZH2 A;  4GO5 X;  4CM0 A;  1URR A;  4QZV B;  4WFN Q;  4ECR A;  2GV1 A;  1AZS A;  2HFN A;  2ZUA A;  2VAS A;  3PAC A;  2B4O A;  2RS8 A;  2QSF A;  3B4D A;  1FI4 A;  4ZS6 A;  2MHN A;  4F4X A;  1VQ6 S;  3KHR A;  2OO4 A;  4LF5 J;  5ETV A;  4CLK A;  3QSY B;  3ULH A;  1X9W A;  1KS2 A;  1WTB A;  3HHL B;  3M8Z A;  3BN4 A;  2DO0 A;  3H5U A;  3TW0 A;  1RJJ A;  2VIC A;  1U6Z A;  2FVR A;  3H0P A;  2UXB F;  3GFH A;  1NSP A;  1TUW A;  2AJF E;  1GH8 A;  3LAL A;  3MUV P;  3QT5 A;  1VRU B;  1DTQ B;  1QSL A;  4CLY A;  9ATC B;  2CQ0 A;  3RJM B;  3OL8 A;  3CCS S;  1QAI A;  3KK3 A;  4L75 A;  1KFS A;  4U96 A;  4DUY F;  1RTI B;  1FTR A;  2L9W A;  3MMB B;  1VLY A;  1BUX A;  1IBK J;  1T05 B;  3AJ2 A;  4NXN F;  3Q2T C;  3OLA A;  3J81 Y;  2J7W A;  4FF2 A;  4Q44 A;  3PEJ A;  1S9G A;  5IWA J;  3NGT A;  2YKM A;  2IVY A;  4P7V A;  3THP A;  3PFO A;  1IR1 A;  1QSS A;  2R7O A;  4CLU A;  3DXS X;  3GZ7 A;  1KVK A;  2QE5 A;  1WF1 A;  5HMW A;  1FXD A;  4EBC A;  4LSZ B;  4JYA J;  2AJ1 A;  1A0O B;  5KFH A;  4LF6 F;  1VQP S;  3CW2 C;  1HWI A;  3BGU A;  5KFZ A;  2B9E A;  3GIJ A;  3PW7 A;  1PCA A;  4TYA A;  4YOE A;  3I0S B;  4KPC A;  2CNK B;  2MZQ A;  2ZOM A;  5D6G A;  3J80 Y;  2JC1 A;  5B09 A;  2VBZ A;  4TNO A;  4RW8 B;  4LVO P;  2C3O A;  3JTP A;  2CG4 A;  5B0F A;  2HFZ A;  2ZZN A;  1N48 A;  2PI5 A;  4LFA J;  1EIY B;  4JV5 J;  3UO0 A;  4YR3 A;  1N33 J;  4Y00 A;  3FBF A;  1EJ7 L;  4F0M A;  2K7J A;  4M5L A;  4ZCM A;  1GEH A;  4CQ1 A;  3C2P A;  3BKU A;  1ACM B;  3PDN A;  3R6G B;  2BMB A;  2ZE2 A;  3CCL S;  3UNG C;  3GII A;  2WBM A;  3DRS A;  4KFB A;  1J5O A;  2HIY A;  5AE1 A;  1QTM A;  2QFJ A;  5BR8 J;  1EET B;  5D4L A;  2MZ1 A;  2HNZ A;  1UPM B;  1T11 A;  3D0H E;  2R7T A;  1DFD A;  1SUQ B;  2V2V A;  3IBC B;  2RDD A;  5D3G A;  1H2T Z;  1YI2 S;  4UUW A;  1Z2L A;  4DR6 F;  3UVJ A;  4BCA A;  3QT6 A;  4U9R A;  4DS5 A;  1F0X A;  2BQU A;  3W66 A;  2K3I A;  4P71 A;  3OHB A;  3A3P B;  1YQH A;  3RUB L;  4NYO A;  3CJK A;  1NHV A;  2MZR A;  5C42 B;  3TAN A;  1LOU A;  4P7T A;  1F9H A;  4KB7 A;  4CI0 B;  1R8C A;  1P9Q C;  4RWX A;  1WHX A;  3Q8V A;  1SQF A;  3FGV A;  3SFU A;  2VF3 A;  1JLB A;  5DGA A;  1B4S A;  5GAD I;  1WDT A;  4C4W A;  3QZ7 A;  3DM2 B;  2N4D A;  3MEE B;  2KRB A;  3ICL A;  1C1B A;  2O1P A;  1UET A;  1CBK A;  3HZE A;  2RDI A;  2GZO A;  3NAI A;  4KE5 A;  1REV B;  3OSP A;  2ZBC A;  4X4S A;  4DFK A;  4WP9 A;  2YY3 A;  3KTQ A;  4OI1 A;  1NRK A;  1JLE A;  4ED4 A;  1HNI A;  1NJW A;  2GO9 A;  4ZVP B;  1RWX B;  2CDR B;  2GIR A;  5JVG Q;  4CYU B;  4OZ3 A;  1IBC B;  3CT9 A;  4X65 J;  1IBM J;  2GX8 A;  4AYB D;  3Q8U A;  3A3O B;  1ZM2 A;  3M32 A;  4DQS A;  3FCH A;  1R0A A;  4RNN A;  2R8J A;  2F4V J;  3MZI A;  4ECX A;  1J2V A;  3IMQ J;  2ZUG A;  1VDH A;  2I9S A;  1Q8L A;  4DV5 F;  4G6V B;  4I7F A;  4DV4 F;  1TKD A;  1A9N B;  1QTN B;  2HHQ A;  4QR2 A;  5A8W A;  4KAI A;  2AZ1 A;  2ACY A;  3AOB A;  3ZZR A;  5CYQ A;  1SPB P;  4TLR A;  6FDR A;  2ZH1 A;  5DG8 A;  3IR7 B;  5IT4 A;  2RUG A;  2CDQ A;  3LGN A;  4WWS A;  2QN6 B;  4I0W A;  4WK1 A;  3OL6 A;  4CO3 A;  4Y28 C;  5KG2 A;  2BX6 A;  2VG6 B;  1PYT A;  4LT6 A;  3CE8 A;  2Y1I A;  1U1L A;  4FKY A;  1K8A T;  1VLO A;  1Q81 T;  2K8G A;  4O4G A;  4EU0 A;  1OO0 B;  1TKZ A;  2W2N P;  1S1U B;  1YJT A;  3FFI A;  2OPP A;  1KOO A;  3AOC A;  1KQG B;  4U7C A;  2OFH X;  4QPT A;  3H98 A;  2DIV A;  3VF0 B;  4K2X A;  4DZ6 A;  1KHV A;  1IKX B;  1X4H A;  4F26 A;  2AQ4 A;  3ENV A;  2BRL A;  3Q89 A;  2DR9 A;  4OJ1 A;  4PCQ A;  3ILL A;  4C8N A;  2JEJ A;  4DFP A;  2RE1 A;  2XWY A;  2KTQ A;  5HLF A;  3TQ1 A;  5BYQ A;  1NZ8 A;  1BGX T;  1K0T A;  2JFK A;  1WEY A;  4OI2 A;  3R5A A;  5KT5 A;  5G0R B;  3TVK A;  2HQD A;  5DG7 A;  1R8A A;  2DRB A;  3LUY A;  1UCN A;  3DC2 A;  2MGZ A;  1T9W A;  4F02 A;  4RUC A;  4KH1 B;  2E7W A;  3NEK A;  1U1N A;  1HBU A;  6FD1 A;  3R5D A;  1YDL A;  1TV6 B;  1CJK A;  3M2R A;  5CZV A;  1WSV A;  2RIL A;  5CAB A;  1MWZ A;  2KH9 A;  2KM8 C;  2JX2 A;  2Q66 A;  3PX4 A;  3NS7 B;  4KV8 B;  4JI3 F;  2FLN A;  1JNR B;  1GMV A;  3DYA B;  4B9L A;  3VCD A;  2YWF A;  1TVR A;  2HS4 A;  2R2T A;  1N0U A;  4NML A;  4OLP A;  4F3Q A;  3MEG A;  2ZH4 A;  1TL3 B;  4XAK A;  3D6T B;  3CCJ S;  3EGW B;  1NEE A;  2LYV A;  4M5D A;  3OTO J;  4RPF A;  3NS6 A;  4C11 A;  5E41 A;  3BSN A;  4ENO A;  1NK8 A;  3DLE A;  4PXB A;  3R97 A;  1E6V B;  4C3M A;  1ZPW X;  2DHH A;  2FZK B;  3TR5 A;  1IWG A;  1MU2 A;  3W2V A;  4CM2 A;  1VBZ A;  2ZOF A;  2VQE J;  4P2X A;  1YBU A;  5FLX U;  4KBI A;  3QWP A;  3NS5 A;  3VQS A;  3OUY B;  3MM6 B;  4X4P A;  1RAD B;  1RT6 B;  1T7P A;  1OPZ A;  4KYZ A;  1RSC A;  2D9P A;  1NLK L;  4DX8 H;  4NZ0 A;  3QID A;  4W92 B;  2BE9 B;  2C2D A;  3VVU A;  4ITS A;  3ZZT A;  3L95 X;  1JJ2 R;  3CIZ A;  3G9C A;  4UOF A;  2CJB A;  5CYM A;  1TL4 A;  1EP4 B;  2ZD1 B;  5L46 A;  3HD1 A;  4NLD A;  4LR9 A;  3D9B A;  2QZ8 A;  1HNV A;  4DJB A;  2HIQ A;  4OZ5 A;  2QA4 G;  3C15 B;  1K44 A;  4DUZ F;  2ROE A;  4ZCK A;  1D9D A;  1E6Y B;  1UWB A;  1BQN A;  2AV5 A;  2HGL A;  1DHM A;  4FNH A;  4TY8 B;  1DQ9 A;  3GG1 A;  3DRX A;  4NCG B;  4Y2M A;  4TQR A;  4WYW A;  5HJY A;  2FJE B;  2NR0 A;  4FKX A;  2PMH A;  1D1U A;  4H4K C;  4IFV A;  2E9T A;  3D5M A;  1C1C A;  2WRM A;  2HHT A;  3QT8 A;  1F2G A;  2EKY A;  1M5O C;  2XY7 A;  2XLJ A;  1M5H A;  3V4M A;  2IBO A;  2OPS A;  3JYT A;  1FFS B;  2KHC A;  3BQ0 A;  3BR9 A;  3RRH A;  1LW0 A;  2LA6 A;  4HH1 A;  2MKI A;  4ED6 A;  3D1O A;  2Q6B A;  2BE7 D;  5HVF A;  1OY8 A;  4R8U A;  1XMQ F;  4MIW A;  4A46 A;  2FVP A;  1T94 A;  5ETN A;  3EPI A;  4K0K F;  4DG1 A;  1KC8 T;  2VJU A;  2J9D A;  4PZV A;  1S6O A;  5KFA A;  4P2M A;  4FYD A;  3EDQ B;  4CO4 A;  1TQL A;  1SQE A;  1YVF A;  3DLH A;  3SCK E;  2MY7 A;  4EWT A;  3PYG A;  5DZ6 A;  2BAB A;  3GSI A;  2EXU A;  1F3F A;  1VJQ A;  2CQI A;  4I68 A;  4ES3 A;  5KFG A;  2VOP A;  3DGP A;  1U6F A;  4ZCL A;  4B3R J;  1X4C A;  1X5P A;  5A0Y A;  2EBG A;  5BXI A;  4ED0 A;  5IT9 U;  4RNO A;  1B99 A;  1KEK A;  1PSD A;  3M30 A;  3IBW A;  3PY8 A;  3N79 A;  5D4N A;  3MTK A;  1M1H A;  3NGU A;  2VG5 A;  3MWB A;  3MED B;  4JI1 F;  2BJ1 A;  2ASY A;  2E1A A;  3RZA A;  3A8E A;  2A2D A;  1CQM A;  2CRL A;  3AJ1 A;  1GTE A;  3UCG A;  2VBY A;  4I56 A;  2HYI B;  2B51 A;  5KT3 A;  4ZP7 A;  4DI6 A;  3TZZ A;  1Y00 A;  1U02 A;  4PQU A;  4M5N A;  4GKK J;  3MMA B;  3MR7 A;  4FS2 A;  2H9Z A;  2IJF A;  3PR4 A;  4ECS A;  4IO9 Q;  1BXN A;  4ATN A;  4A8Q A;  2DPJ A;  3CJ5 A;  1J5E F;  2CWK A;  4UOC A;  5CD4 H;  3ZTR A;  3IGN A;  1FKP A;  3PG9 A;  5L1L A;  2PI4 A;  2C3M A;  1LXJ A;  1KVI A;  4ZJO A;  1XBW A;  4ANE A;  3P6Y C;  3KUG A;  3ENQ A;  3BPS P;  4JI7 J;  4N5S A;  2LA4 A;  3LP1 B;  4RO0 A;  3M2V B;  3T1Y J;  1XER A;  2C2Z B;  4CO2 A;  1HBN B;  3RR7 A;  1WHY A;  3FBB A;  1SJ3 P;  1S1T B;  4DQR A;  1MNE A;  1GMU A;  2E5J A;  4K4U A;  3IRW P;  3EGN A;  4QIW D;  2BE2 A;  1H38 A;  4LF9 F;  3MPV A;  1CJU A;  1LEO A;  1QVG R;  3ZC4 A;  4FF4 A;  4LRC A;  2V4Q A;  1ZTW A;  1RK8 A;  4I6W A;  2DGO A;  3HHN B;  2XG8 A;  4NLX A;  1RAF B;  5LSR A;  4ETX A;  4FDF A;  1GK8 A;  2W25 A;  1RAG B;  2VL1 A;  2FZG B;  3GP9 A;  1TTH B;  2I5J A;  4KC5 A;  1UVJ A;  3G86 A;  5LJ3 Y;  3MFH A;  3FZB A;  5F8I A;  3RB3 A;  3OPK A;  4V19 J;  1LW2 A;  4NXM F;  3FKB A;  3MAH A;  2HQI A;  1XNR J;  1AFI A;  3GJS B;  2QA1 A;  2B4P A;  1B3T A;  3SMZ A;  2DD8 S;  3GV7 B;  5J2Q B;  1YKW A;  3FDS A;  1DTT A;  2YH0 A;  2XQC A;  1M5P C;  4L73 A;  4KO0 B;  2H3E B;  4A4J A;  3WC2 A;  3J7A N;  2X1G A;  1F5C A;  4TY9 A;  4NCB A;  1S97 A;  4H54 A;  3HHL C;  2O67 A;  1SC4 B;  1AYE A;  4EFA C;  3Q8R B;  4NLT A;  2QT7 A;  4RW9 A;  1SKW A;  3FK4 A;  4KY3 A;  1U2F A;  2NSB A;  5B08 A;  4A8O A;  3L7P A;  3I82 A;  2YXL A;  2CQ4 A;  1RCX B;  2YPY A;  2CZV C;  1IKV B;  2EW9 A;  4DF4 A;  4HR2 A;  4ZN3 A;  3LGH A;  3OTD A;  1S9F A;  4IH5 A;  1N32 J;  2R9L A;  1SIW B;  4LF7 J;  3MEK A;  4KQZ A;  5AXL A;  1X8D A;  2J9E A;  2NUH A;  1P8G A;  2WK4 A;  2JWN A;  3FSY A;  4ZP6 A;  5D15 A;  3A8I A;  2B8Q A;  1CUL B;  3F0N A;  4M5H A;  2VA3 A;  4ILR A;  4JUZ A;  3MCM A;  3TAQ A;  2LQJ A;  4USK A;  5ETR A;  5KT7 A;  3M9N B;  5HRO A;  2UXC J;  2ALY B;  1RWO B;  3NCP A;  4IOC Q;  3A3N B;  2VDH A;  2IM3 A;  4C8K A;  2C22 A;  3MMJ A;  1M1K T;  1HYS B;  4UOG A;  4ED5 A;  4IKA A;  3ZXW A;  2K1R B;  3POT B;  2DHX A;  2BQ3 A;  4I4B A;  1U1Q A;  1H0H B;  4NLU A;  4ID8 A;  4CT9 A;  1L3K A;  4DUT A;  1WWH A;  3I55 S;  3U1N A;  2ZVS A;  3JSR A;  3HKW A;  2CG8 A;  3DRP B;  4LF5 F;  2BA9 A;  5BYR A;  1SC6 A;  1LWF B;  5C7P A;  1CC7 A;  2V2Z A;  3W2W A;  3DOL A;  3ISN C;  1V6H A;  2M8H A;  1N34 J;  4O44 B;  1FVS A;  1HI0 P;  2GW8 A;  3PYF A;  4USJ C;  2OPQ B;  2UUB J;  1VQ4 S;  2Y8Y A;  3BGR B;  3TQE A;  3DDN A;  1VS3 A;  2V94 A;  3HHL A;  4LR7 A;  2OMO A;  4NA3 A;  2FTR A;  4DSE A;  1ZET A;  3RR8 A;  1VQ5 S;  2RKI B;  2EBE A;  4OV1 A;  2NYI A;  1N5V A;  4NLR A;  3SEO A;  5HBM A;  3QQC D;  4AQY J;  4QU6 A;  5DLG A;  5HMY A;  1G7C B;  4LSN A;  1B64 A;  2GQQ A;  1PO6 A;  2PT0 A;  5AE3 A;  2OEJ A;  3CJQ A;  1DTQ A;  5FDL B;  4E98 A;  3HI9 A;  4HKQ A;  3CF5 Q;  4J9K A;  5C2G A;  4WCE Q;  2J6S A;  3CCU S;  4MH8 A;  2JSX A;  9RUB A;  1FRI A;  2MKC A;  1X9M A;  2A0F B;  2J9D E;  2BXJ A;  3BN7 A;  4O3Q A;  1RTI A;  2FLO A;  3K5O A;  3J7Y I;  4N76 A;  2W9C B;  1VRT B;  4ZPV R;  1RKI A;  2GJI A;  1OIA A;  3MMB A;  1IBK F;  3UR0 A;  2Y1J A;  1JLG B;  3CMA S;  1OPI A;  1YG0 A;  4DX5 A;  1UWA A;  3UNY A;  1I6J A;  1NHU A;  3B6B A;  3TOQ A;  5IWA F;  4J37 A;  2C2O B;  4LSL B;  2DEI A;  1S10 A;  4TYB A;  4WPA A;  4IG3 B;  2E5G A;  3OSN A;  4MYU A;  2OJ3 A;  2XS2 A;  1L3V A;  5LJ5 Y;  4E8U A;  3GYX B;  2IY5 B;  5IM0 B;  5IOL A;  3GV8 B;  2WOM B;  5A8K A;  5FLX Y;  4DSF A;  3ETM A;  1SBR A;  2K06 A;  2IMW P;  2CNN B;  2HEK A;  1FJG F;  1VGY A;  4RW8 A;  5H1S V;  2KVQ E;  2R8K A;  4DX7 A;  2RML A;  1S76 D;  4LFA F;  1H6K X;  5HMZ A;  2ZOG A;  3BSO A;  3UN5 A;  4JV5 F;  3K89 A;  2AMC B;  3I4P A;  4L74 A;  4QCL A;  1N33 F;  5KOW A;  2IM1 A;  5HJX A;  3VGS A;  2VC1 A;  4ANC A;  3GSD A;  2WZ1 A;  2W4C A;  3LA0 A;  3SCL E;  5F9N A;  2UZA A;  4QWB A;  3NCR A;  1FE4 A;  3N5B A;  2MXY A;  4EO6 A;  4WTY A;  2BUN A;  5BR8 F;  2W2Q P;  4LIW A;  1R43 A;  1PC5 A;  5E5N A;  3LPE A;  2G4B A;  3LP0 B;  1EET A;  2EK6 A;  4TXS A;  2N82 B;  4ILL A;  2L41 A;  5KFR A;  1FRL A;  2QLJ B;  4J90 A;  5K8M A;  4B3M J;  3PNI A;  5DRK A;  4ZPW R;  1MN7 A;  3QGP A;  1WG1 A;  2NSC A;  4LF1 A;  4OHZ A;  4IO1 A;  4KHR A;  3HLU A;  1K0V A;  1FEE A;  3ILJ A;  5C42 A;  3W60 A;  1DAX A;  1S0N A;  4KGM A;  1T02 A;  3OFH A;  3T6J A;  3ADA C;  1ZM3 A;  1HBM A;  4ZDN A;  3CCQ S;  1AZS B;  1S48 A;  2M8D B;  3DM2 A;  2HQC A;  3WDO A;  3MEE A;  1QUV A;  2XS5 A;  3KUH A;  2N7C A;  2HVD A;  4DMZ A;  2I6W A;  2KVI A;  2OIH A;  2HAI A;  1RAI B;  1S57 A;  4EYH B;  2LEB A;  2DGX A;  3KHH A;  1RXO B;  4JI2 J;  1IKW A;  1TK5 A;  3SQO P;  3P49 B;  3O44 A;  4C0O C;  4DPY A;  1MRO A;  3IO1 A;  3P5T L;  2KN4 A;  1FDN A;  2FY1 A;  1NSK L;  3IM9 A;  3D0G E;  3PM9 A;  1GXL A;  3DOK A;  1RLC L;  3I6P A;  1O8B A;  4K4Z A;  3LGM A;  4LRD A;  2ASD A;  2JDJ A;  4X65 F;  4NX9 A;  1RT7 B;  1IBM F;  1R31 A;  2O01 C;  4PXE A;  5IFM A;  2AX1 A;  1SJF A;  4R0J A;  4KRW A;  1RWU A;  5J2M B;  1R6Y A;  4ZHR B;  3RB0 A;  5D78 A;  3TRG A;  1CG2 A;  1R8B A;  4BBY A;  1KNZ A;  1TKT A;  4J9R A;  2Z2L A;  4Q7A A;  4X4R A;  1UVK A;  2WON B;  4YDD B;  2LLZ A;  2V4J B;  1TUV A;  3PO4 A;  3ZZ0 A;  3EWG A;  5B7W A;  3W1Y C;  5IT9 Y;  1LK7 A;  3BH7 B;  2Q3P A;  1ZAV A;  4PWW A;  5GAG I;  2UVV A;  1MN9 A;  2HBR B;  2IYI A;  3A13 A;  4RUA A;  4Y34 A;  2B7C B;  1HPZ B;  3TAR A;  1ZA2 B;  2WAQ D;  1GXT A;  1NCL A;  1U0S A;  2XI3 A;  3H2L A;  3TZW A;  3TAP A;  2H51 B;  3G82 A;  2VG6 A;  2ZH3 A;  1IUJ A;  2MQN A;  5KFD A;  5KFF A;  3MCS A;  1NZA A;  2CPY A;  3NBP A;  3KG0 A;  1WOS A;  1FDD A;  2N3O A;  2XMV A;  5K14 A;  4PPZ A;  2GJF A;  1M5V C;  1N52 B;  2BJ7 A;  3DDI A;  1S1U A;  1V3R A;  4K4V A;  2CVE A;  2H5I B;  1Y10 A;  3OFE A;  5A6P A;  3GIL A;  4CZC A;  2KG0 A;  3P8B B;  1SB6 A;  2R7Q A;  2VB6 A;  5HMX A;  4NEZ A;  5L1I A;  1U48 A;  1IM4 A;  4DLG A;  1IKX A;  2XSF A;  2CPZ A;  2RT3 A;  3R5B A;  2ZDO A;  1RAA B;  1SL2 A;  4ECY A;  5ETS A;  1QD1 A;  4C6A A;  1SKS A;  2MHE A;  1ZBT A;  4ID5 B;  2G2Y A;  2ZJR Q;  4UZB A;  3DKD A;  2H5E A;  2PC6 A;  1Q16 B;  3TX8 A;  2DNQ A;  4JOU A;  5SZT A;  2HNY A;  3Q2S C;  3KDN A;  3UW1 A;  1C0T A;  2QLX A;  4LRA A;  5L9X A;  2PFF B;  1HI1 A;  2J0W A;  3A12 A;  2QYC A;  2V2K A;  3PKY A;  1F6T A;  2JRS A;  4HL9 A;  4FXW A;  3T9Z A;  5HN0 A;  1TV6 A;  3MR5 A;  3KLV A;  3DLK A;  2XBP A;  4OL8 A;  1Q5V A;  4KV8 A;  5D0H A;  2IIH A;  2J9C A;  4F2R A;  2VOD A;  3AT1 B;  1XWL A;  3I9Z A;  4UUX A;  4ES2 A;  2RH3 A;  3CDE A;  2HWT A;  3H2V E;  1LNQ A;  3P5B P;  3TP2 A;  3BR8 A;  2AJ0 A;  2MQM A;  4U95 A;  2V0N A;  4ED3 A;  3OTO F;  4FVC A;  2HMI B;  3JSM B;  2F7V A;  4OMF G;  3TUP A;  5KG4 A;  3MM5 A;  2ZC3 A;  4N7T A;  1C1B B;  5DET A;  5D8H B;  4GVL A;  4URG A;  2VQE F;  1UA1 A;  3C6T A;  1D8Y A;  4C9D A;  2CJY B;  3CJ3 A;  1MW7 A;  3OXL A;  4TN2 A;  3UWT A;  1P1T A;  3OUY A;  5DS7 A;  3MM6 A;  3DRY A;  3R5G A;  1JLE B;  2DCL A;  2KT2 A;  5CA5 A;  3R1H A;  2DH7 A;  2E5H A;  1ZAX A;  2PA3 A;  1RHJ B;  1APS A;  1UJ6 A;  1A7G E;  4PG4 A;  3L7O A;  4Y0F A;  2QSW A;  1W26 A;  1S5Z A;  3I0R A;  2DIT A;  1WI8 A;  4DDF A;  5CD4 A;  1OS5 A;  3CD5 A;  4F0K A;  1JLF A;  2RRA A;  2P9E A;  2ZHA A;  1NK4 A;  1UPP A;  4I7F B;  1WG5 A;  5ETL A;  3UN3 A;  2R2R A;  5KFX A;  2OML A;  5A8W B;  5F8G A;  3ILI A;  4ED1 A;  3C15 A;  2EFN A;  4OYP A;  1R0B G;  5CYQ B;  4JI8 J;  3M2U B;  2F40 A;  2EPI A;  4A8M P;  4TY8 A;  4NAS A;  4WFX A;  4G65 A;  4WE1 B;  4NCG A;  3E3X A;  3UFC X;  4IQM A;  4DCJ B;  3I87 A;  4O0I A;  1H72 C;  1Q8B A;  3M1V B;  2JVR A;  1BQM A;  1Q8I A;  4PG7 A;  4IFY A;  1X4D A;  4IOA Q;  2FC8 A;  2MQQ A;  3K59 A;  4KR0 B;  4Y65 A;  3FMW A;  3F44 A;  1HFE L;  4B08 A;  4WU3 A;  2DNH A;  4PG8 A;  3R27 A;  4ZLP A;  4HDG A;  1CS4 A;  2AWZ A;  4NLP A;  4DL0 C;  2A2C A;  2XI2 A;  3CJ8 A;  4IRD A;  1R6V A;  1HW9 A;  4DQQ A;  3E01 B;  3BM7 A;  4QBU A;  3J7A 1;  2HW3 A;  1HQE B;  4AL7 A;  4C8Z A;  1NH8 A;  2OHD A;  1S72 S;  3K7R A;  1NK0 A;  2FJB B;  1DY3 A;  5I3U B;  3UE2 A;  4PAA A;  1HR0 J;  2VKR A;  2DNK A;  3LAM A;  2RQC A;  1WAC A;  2MGZ B;  3EMT A;  1WHV A;  1G1X A;  5D0R A;  1EKS A;  3TEH B;  3BO2 A;  1RI7 A;  3VAG A;  4B3R F;  1VQY A;  4QIE A;  2HLT A;  4K5S A;  4IH6 A;  1HBU B;  2YWK A;  3U1M A;  3H2U B;  1VK8 A;  4WKR A;  1QAJ A;  1X4F A;  3H7H B;  1N0V C;  4DL7 A;  2E1C A;  4E0D A;  2EK1 A;  4MT1 A;  3J7Z T;  4Y2A A;  1H3D A;  2B6A A;  1PC4 A;  3CC4 S;  4ZVR B;  5AXM A;  2C3U A;  2IC3 A;  3FSX A;  1TVR B;  3M7V A;  4C2M A;  3P45 B;  2JFD A;  4GKK F;  1UMJ A;  4OYM A;  3M6V A;  4YB5 A;  3MMA A;  1S0M A;  3UCU P;  4M5D B;  4NOH A;  1P9Y A;  2CFX A;  4B3T J;  1CC8 A;  3DOM B;  1T9X A;  2E9R X;  1BWE A;  4DR3 J;  2UV8 G;  1SVD A;  5IV3 A;  4L6V 3;  4WP8 A;  3RB6 A;  4P9S A;  4C8M A;  1TKX B;  4RLE A;  1OQ6 A;  1EAY C;  3PCO B;  2VPX B;  3GQC A;  1U1P A;  2QG9 B;  4HVZ A;  4CH7 A;  5DM7 Q;  2KYX A;  4RW6 B;  1JQG A;  3IC1 A;  2HHW A;  3PIO Q;  3DI6 A;  4JI7 F;  3DXB A;  2R2S A;  3T1Y F;  4UOH A;  3LP1 A;  3M2V A;  2MPU A;  2JLF A;  1HBN A;  2MQO A;  3SXL A;  3PX6 A;  2CQP A;  3PX0 A;  3PRB A;  2FJX A;  2IHR 1;  4O3N A;  4CLZ A;  2VHG A;  4Z2X A;  2YX7 A;  3OTC A;  4CH1 A;  3DLL Q;  3SFG A;  4C7Q A;  3ENA A;  4NLQ A;  2YWE A;  3H42 A;  2EI5 A;  3BJY A;  1WDD A;  3NCQ A;  5GAD U;  1KR4 A;  4LF4 J;  2XY5 A;  3PVX A;  2IFX A;  3D54 A;  2PFD A;  3LOU A;  3N5F A;  2HVI A;  3EVW A;  1CJT A;  4PPD A;  4DL4 A;  5D77 A;  1HA1 A;  3TZX A;  1R3N A;  1S7I A;  4Y6I A;  1XNR F;  1IQT A;  2IPO B;  4IFV B;  4J91 A;  1G3O A;  1XQI A;  4DV2 J;  2UVU A;  2BZ2 A;  1ZA1 B;  3NNA A;  2UVR A;  2L08 A;  4RW4 A;  2VFV A;  3GYG A;  2CVI A;  2OPS B;  3QGG A; 
#chains in the Genus database with same CATH homology
 2IJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...