2IJRA

Crystal structure of a protein api92 from yersinia pseudotuberculosis, pfam duf1281
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
282
structure length
282
Chain Sequence
ALEWCKNRLEITGRSVFVDIMQQWVTGEEVPLYRHAIQQSIRLFLAGCAGILKPVKCMEYPPFPRLVSHGTGSAVASNLAFQHWLDLLLKDAVLDGDTIRQIDRIYLQSGIASVKWETIPEGARQIITQLMARQYPDWFGVASWSSHINGADCWTKLGVMQEHACNCDMLMIIPTRLAIELNGNSQLLTGVSTTHDLYSHLYGMAWPSGQNIIWQRDRINSLRLDFDSPSYPPSAELMGELSAVFDCEIRHWYQEPVNGIRGYDCYDRGDHVDSGEYGAGPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein api92
publication title Crystal structure of a hypothetical protein from Yersinia pseudotuberculosis
rcsb
source organism Yersinia pseudotuberculosis
molecule tags Structural genomics, unknown function
total genus 70
structure length 282
sequence length 282
ec nomenclature
pdb deposition date 2006-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06924 DUF1281 Protein of unknown function (DUF1281)
A PF18406 DUF1281_C Ferredoxin-like domain in Api92-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3530.10 Mainly Alpha Orthogonal Bundle Api92-like Api92-like 2ijrA02
3.30.70.1270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Api92-like domains 2ijrA01
2IJRA
chains in the Genus database with same CATH superfamily
2KH9A 2WB4A 2UUCJ 2G1DA 4KC5A 4MAKA 3I9V9 4DR7J 3T5KA 4WFXA 4NLWA 4ZPCA 4N77A 2L3MA 2R8JA 2BJ8A 4DR5F 3QJJA 2HRUA 1VC6A 5L1JA 3QATA 4WIIA 3RR7A 2KKHA 3FRZA 1KTQA 1YLXA 3MR7A 1NB2A 3V6DB 3O8WA 1RYSA 1TKDA 2KM8B 1HPZB 5SZTA 3EGNA 3G6YA 1F3VA 3W61A 4MK8A 3QGPA 3OLBA 4K8RA 4I64A 2BE7D 4Z37A 3TWZA 2CG4A 2EFVA 4FXVA 1SC4B 4DX7A 1NPRA 3UCUP 2XZTB 4KGXB 5DS7A 2B9EA 1NUEA 3H7HB 3PCOB 1KQKA 3CO9A 4WJBA 2FB0A 1EETB 3N4WA 1R0AA 2R42A 5KG0A 1ICEB 2XNRA 2K7KA 1DRZA 1LFPA 4U95A 2GVZA 3BBBA 4FXWA 3JYTA 5L1IA 4HI2A 1IKWB 2YWGA 2B56A 3T1AA 1N5SA 2IA0A 2F9JA 2EFPA 3SV4A 4WXOA 3MUVP 4LVNP 2AT1B 2FVCA 3IWLA 2H9ZA 1U0HB 3PR4A 1R8PA 1JKHB 3O2IA 4Z2XA 1IBCB 2P9CA 1HW8A 2Q6CA 5H1SV 2VKRA 1HD0A 3CDEA 1HQUA 2Y1LB 4MKYA 3PFEA 3AD7C 4L74A 4PUOA 1KFSA 4JI4J 4WYLA 3NWGA 2RVJA 2I5JA 4B3TJ 1WI8A 1FE4A 3DOKA 3I31A 2H51B 1N8RT 1I5OB 4KKOA 1JJHA 4CLZA 3FEZA 3JSBA 1I94F 4PQAA 2R7RA 1VQLS 2G2ZA 1QSSA 1EQ0A 1UEUA 2H3EB 1R0CB 1DTQB 4LFBJ 1FDNA 3FMBA 1QJHA 4JI7J 2U1AA 3OT9A 4KYZA 2E5LJ 1IR2A 1VHFA 3X3UA 2GJFA 1DZ5A 5IZHA 3N5FA 4NCBA 2XSJA 5I42A 1S49A 3EVMA 2JOQA 3I6PA 1UVLA 1YJ7A 5I3UB 4FYYB 3AY0A 3FCVA 7FD1A 2EBEA 2IDEA 4I2QB 1P1LA 2FIUA 5JVHQ 3Q0AA 4DL3A 2OSQA 3K7RA 5KFLA 5IM0B 4LF4J 5A0YA 1NNDA 2ZHBA 3IR6B 4K50A 4ZVFA 3KDNA 2AWZA 4OZJA 1YG0A 5E0OA 1RKIA 4J9RA 3BSAA 3QRPA 4P74A 1M1HA 4RW8A 3TA1A 2X1GA 2QX0A 5FDLA 4ITSA 2J9DE 1CQNA 4CM0A 3L3CA 1J2VA 2GVDA 3P8BB 2DNPA 4ID8A 1R6YA 1TKXB 3BYPA 1VBXA 3DN9A 1GTEA 1C1CB 4C3KA 2NUUG 2AU0A 3G9CA 3IWNC 3K5OA 4A8WA 1CULA 4J9LA 4B9UA 1C1BB 2VG6A 2BZ2A 1N32J 5I4MA 3R2DJ 1YZ6A 5AE1A 4QWBA 2W2MP 2QLWA 1UWBB 2JNJA 2Y8YA 3V4IB 3UVJA 1JLAB 3MD1A 2V4RA 4N5SA 4NLDA 1HBOB 3M2VA 4ZPDA 1W25A 2WVCA 2J8AA 1WOSA 2NXCA 3LQVA 4NLGA 3HPOA 2E1RA 4IQXA 2ZH2A 1PSDA 3QYYA 1X9WA 3QGGA 2DGUA 4LIRA 1VYAA 1LW2A 1DLOA 3WZ0A 2RD5C 3O44A 1YDLA 2RUGA 1EARA 2CJXB 4WE1A 1S79A 1VMBA 2B8QA 4URGA 1X4HA 3M2UB 3BPSP 4NLVA 3EMTA 4DQPA 4ZS6A 5D0HA 1M1GA 5B08A 3HVRA 4I56A 2WBMA 3H2VE 4I0WA 3W5YA 3SV3A 3GFYA 4UY8T 3QAEA 1PC5A 1YJ9S 1Q8LA 3IMQJ 2Q43A 1RI7A 2XGPA 3NG8A 4R0EA 3W9HA 4Q0BB 3IFEA 4TQSA 2WAQD 2LQBA 2UUWA 4P52A 1RWXB 1Q78A 3LP2B 3MEEA 4RLEA 2HHHJ 1U2FA 3PW2A 1T05B 4LBIA 3DKDA 2MZQA 2M2BA 2E1MC 3H98A 3HFKA 1ROFA 4NLOA 2WOMA 1VQYA 3M9MB 1QE1B 3CCES 4P2XA 1VOMA 4DHVA 2HHQA 3K89A 4ILLA 1HNZF 4USKA 1SKWA 2O1PA 3A12A 3AOCA 3MCMA 1W7WA 5IV3A 2LQ9A 2MSTA 2ZM6J 1H98A 2UU9J 3E2EA 3R1LA 3K2YA 2FLLA 3NNHA 1BQMB 2BX6A 4OYZA 3CJ3A 5F9LA 4I6YA 2Y9HA 1NCLA 1M0SA 3DHWC 1YX2A 3GZ7A 2GO9A 3C6TA 1UFKA 2R7WA 3GMGA 4X4VA 2LXUA 3MCOA 1NXIA 3DRSA 1U49A 1S1WA 5KFGA 5IWAF 5KFRA 1S72S 3C66A 3CC2S 4N8OA 4M5MA 1TKTB 3EVWA 2AGOA 4ECVA 2KO1A 1OSCA 1MN7A 3Q8VA 3ISZA 1U6ZA 5L39A 3MWBA 2HK2A 4DR3F 5CYMA 3BDEA 2JH3A 1RT5B 5THWA 3KWMA 2XHWA 1T9UA 1ELOA 4KTQA 4W4MA 2J7WA 3MEGB 3PYEA 2MQMA 3I0SB 1SUQA 2W7AA 3ZZUA 4RUCA 3RYLA 1RTJA 3UO0A 3UD3P 3TARA 4EK2A 2CZ9A 1Q7YT 5F8IA 3MMBB 4CLPA 4KQZA 4CLLA 2F7VA 4DR1F 4YFUA 1ZAWA 5KFNA 4QWEA 2DR9A 2BQUA 1HBUA 4NXMJ 3T1HF 4ECSA 1UTAA 2DHAA 3R5JB 1FCAA 3HVTB 3W8GA 1RA7A 3TVYA 2DH9A 4NLRA 5E3CA 1JNZB 1Y3KA 1S1UA 3FBEA 4ZPTR 3QGHA 2CPEA 1OSDA 3UCZP 2ZH1A 3DU6A 3FBCA 2UP1A 4B3RJ 2IMWP 2FHJD 1P9QC 1NHKL 5E5NA 4YP3A 2ZE2A 3N28A 4IRKA 4HT5A 2V34A 3J7AN 2HIYA 1D1UA 2MEWA 2GVZB 4L73A 3LP0B 1RADB 3HHDA 3DRRA 4DV7F 2BMBA 3DGPB 2VG5A 1KTVA 3K8VA 3WX4A 5D6GA 2QSFA 1HNVA 5DG8A 5A8RB 2YKPA 4B08A 2YQ0A 4QQBA 3EDRB 2FC9A 2J5AA 3QIPA 4K4ZA 5AE3A 5KT5A 3EDQB 3KLHA 3I4HX 2FLPA 2P6SA 3PJ9A 3A1YG 4HVZA 3KNAA 1RSCA 3OD2A 3NY0A 2AYEA 2L9DA 2GAGC 4Y28C 4LSZB 3E3XA 4DSLA 4N8NA 1S10A 3GR1A 2JFDA 1MLAA 2DIVA 2I5JB 5KFCA 3CSKA 5KFZA 1K47A 1SL1A 2ROPA 2OELA 3M9OB 2BYCA 4KKOB 5D0RA 1VS3A 2BA9A 3G71S 1CBKA 5DLFA 3US5A 3CCQS 3R8YA 5EX3A 4IG3A 5DDOC 1HBMA 3LAKA 1H2UX 2FGOA 2CPYA 4DZDA 3LUYA 4TY9A 2J7KA 1M5PC 5FLXU 2V8DA 2BE2A 2BKPA 4MFBA 1YI2S 2IAJB 2XY5A 4GKJJ 2YNIB 2GS8A 3LGMA 2RILA 4MK7A 4OI6A 1CC7A 1UVMA 3ULHA 3POTB 2LQ5A 1O5JA 5FD1A 1KS2A 3H42A 2ACMA 1Y3JA 3ITHA 4ED4A 3H4DA 1RYRA 4ID5B 3MMCB 1S6QB 1JMTA 2AX0A 5GAGI 4NCAA 1DQ9A 4OI1A 2J6SA 4GRSA 1P1TA 1JX4A 1ZM4A 1M5HA 1REVB 2J0WA 1A0OB 1N5YA 2DGSA 2YY3A 3MM9A 1H2VZ 2AJQA 1A6LA 4FXDA 1Q5YA 1T9TA 4OX8A 1HA1A 2V8GA 2CQGA 4OYPA 2CPXA 1AT1B 2QYGA 3TEHB 2GHWA 4ZLNA 1T9WA 3SEOA 1VGYA 4PR6A 2BXJA 2BR0A 1XERA 1J5OA 1CULB 1HWUA 3R5DA 3N0VA 5CCLA 4U67Q 2QGFB 2FC8A 1EAYC 1HQ2A 4K2JA 4LFCF 4FS1A 4LRCA 2QFIA 2KXFA 2VICA 1H73A 4ZIWA 1RT2A 5J2PB 5C24B 5KT3A 2PI4A 5D8HB 3SCKE 1T9YA 1YBTA 1T02A 1SJ3P 3ZNUA 1DLOB 2DNLA 3GV8B 4LBPA 2B7CB 2BOAA 1YIJS 5CD4H 4FYWB 4KJIA 2OMLA 5F3ZA 4NASA 3OBIA 2VZ9A 2LXIA 3UE2A 4YDXA 1TL3B 3S7RA 3KMSA 2HVEA 4YY3F 4WFBQ 2OGUA 1IM4A 4ZP9A 4ATNA 3HI9A 3UD4P 3QJLA 4ZITA 1T3OA 2BUNA 1VQ4S 5J1NA 5D0EA 1T3NA 2JC1A 1NZ8A 3O1LA 4B17A 3MMAB 3PXGa 4Q44A 5DGAA 2KJVA 3BSNA 1NDCA 4UT4A 5F8MA 3FQKA 1FD8A 1TELA 1RWPB 4UQTA 2PE8A 3VWSA 5IT9Y 2BJDA 2RDIA 2AJ4A 2HQGA 5KFWA 1IVZA 2FZGB 1UL3A 1HLWA 5AXKA 1FX2A 3IRWP 3VCDA 1U0SA 4LFAF 2AJ0A 4BHQA 4OMFG 3MAAA 4F0MA 2ZNZA 1BQNB 2ASYA 3QAUA 2B9YA 2RH3A 2K2PA 3AB4B 3K5LA 2IYIA 1FK9A 3BGOP 4EO8A 1HNXF 2DGWA 1M90T 4IFYA 4OZNA 4O3PA 1NK7A 4B3SJ 3BH7B 2I8EA 2EI5A 1XTZA 2OFHX 2ZWPA 3C6TB 3CF5Q 5L38A 5KT7A 1BY9A 2V0NA 2PMWA 1TKZA 1D3WA 1LFWA 4IG0A 2MTLA 2NREA 2RIJA 2V9WA 3QMQA 1S1WB 3AAWB 3NS5A 3TUPA 2ROGA 4BS2A 5J2MA 2LEAA 4UW2A 4I6AA 3PY8A 3KHHA 2CVEA 2J76E 1NHUA 3DLKB 1ZM3A 2JDJA 3EX7B 5KTQA 2HRYA 1WHYA 2B4PA 4DUZF 1FFSB 3MCNA 3K5MA 1ZBTA 4CTAB 4URSA 3GYNA 3VR1A 3JS9A 2F9DA 1VBYA 3HHLD 4DPYA 1VFJA 2C3YA 4PG4A 5ETTA 2QV6A 1L3UA 1KVJA 4DQQA 4QOTA 1FRMA 4ER8A 3CO0P 2AGPA 3G6ES 1N88A 2IVMA 1WEZA 2DVIA 1GMVA 2ADCA 2R7SA 3A8IA 2UUTA 1V6HA 1S1UB 2V8HA 1MU2A 4FBTA 2D1CA 1RT4A 4FYDA 3EZUA 4CT8A 4W90B 3CCUS 3GFZA 5CYQB 3LAMA 3QFWA 2XTJP 1QUVA 4XAKA 2W9BB 5ETOA 1YITS 2JX2A 5JMNA 4PWDB 2CQBA 2B5JB 1CJTB 1K8AT 1S7IA 5DRKA 3DDKA 5J2QA 1RQ0A 4OHXA 2KDOA 3MOZA 2E1CA 4EYHB 4LQ9A 3FJ2A 3PKMA 4DR4F 2D69A 1FXLA 1U2RA 1ZH5A 1VRUB 4C11A 3UI3A 3MI7X 1T11A 4USJC 3CCZA 4HACA 1KC8T 3ZZZA 1DARA 1DTTB 2I6WA 2RJZA 4HT7A 4PG6A 3QIPB 3G82B 3SDEA 5A6WA 3T5JA 4NXNF 1U25A 2RHSB 3TUIC 1BGXT 4DV4J 2P5VA 2DXFA 2DHXA 2WZ1A 3Q8RB 1MNEA 1N52B 4CLFA 2CA9A 4L72B 1NH7A 5JVGQ 2WVFA 2LYVA 3KK3B 1F5AA 1NPPA 2HS0A 1V3SA 4EO6A 3IAM9 2AW0A 2ZFHA 4LF7F 5BYRA 3GJRB 1RAFB 3R5CA 3AHPA 4ZKAA 4F25A 3FCHA 4DV3J 3RUBL 4TU7A 3HHKA 1T8EA 1NLKL 4IG3B 4WFAQ 4DLGA 1LWFB 2G4BA 4G65A 5LMUF 2R7XA 3IG1A 1RABB 1KBRA 2M52A 1D8ZA 3FK4A 2KYZA 2NYHA 3V81B 3DOLB 1ZM2A 4F7VA 4N47A 4CT9A 2XLKA 2HYIB 2QTWA 1IR0A 2F4FA 1REGX 3QFHA 3KFWX 1PJ6A 3JQJA 2GCFA 2ZJRQ 3D3CJ 2E44A 1EQMA 3HP6A 4ZVTB 4MT1A 2KJWA 2H5EA 1RTDB 3D0IE 4Q8EA 3GFXA 1LXNA 1N36J 2D3ZA 3ITHB 1Y10A 4LT6A 1FKPB 4M5IA 1P27B 2VFRA 4HH1A 5LM7E 4H4MB 4X64F 3CD6S 4KHMA 4QZVB 3IXQA 1X7VA 2X3DA 1FFGB 2XS5A 4DCPB 2H5IB 2WTFA 4YB7A 4PWWA 2QT7A 1HBNA 1ZZNA 1TL7B 1VJQA 2KZZA 2UV8A 3M9NB 5L1LA 3RB0A 3EGZA 3CCJS 1BD6A 2NQPA 4HHJA 1N5TA 2ZJPQ 1IN0A 1UVKA 1TMJA 4DFKA 3PZPA 3M7VA 4NOHA 1RWUA 5KFHA 1RHQB 5KFSA 3M2RA 2K1RA 3TX8A 3FFIA 3L9ZA 3LALA 1T7PA 2HQDA 2XYGB 3JXOA 1FRHA 2V8PA 1GXTA 1S77D 5L46A 4JOUA 5HLFA 2E7XA 4A47A 1RHKB 2I0XA 3DOMB 2GQ2A 2EKNA 4BWMA 4ICLA 3D3BJ 1RGVA 3OUYB 4L75A 2JVRA 2MLYA 2HHTA 4K59A 4X4OA 4BC7A 5GMKa 1RT2B 4MJKA 4X62J 5H9FJ 3DM2A 3OXGA 4DR7F 3OL7A 4KH1B 1HWIA 3TAMB 1QTNB 3CC4S 4F4XA 3KG4A 3VGVA 2V5HG 2HQ3A 4NMXA 5L8RC 2ZUGA 5HL7Q 3E01B 3AFGA 5G0RA 4IRDA 4DV1J 5HATA 3EGVA 5IQ6A 2GO8A 4RW6B 3OR2A 3AQOA 3G96A 3EXYA 4EZ9A 2V4JB 2MQLA 4C3MA 3LP1A 2DCUB 4IO9Q 2E9RX 1SXLA 5DGBA 2ZOFA 4KPCA 2IRUA 2MLZA 4YR3A 3GV7B 2DO4A 4UOCA 2MY7A 1S1XB 2XLIA 1HWKA 5DM6Q 2XB2D 2CWKA 2DH7A 3PR5B 2F4VJ 1XMQJ 4JP8A 4RW4B 1XQIA 4ZA1A 2HFNA 1CS4A 4B3OA 4NLUA 2C2KB 4FDFA 1JWWA 3BGLA 2YWWA 1QY7A 1YJNS 2GAHC 3M30B 2V2QA 3GILA 3HXMA 4ZLJA 3OXFA 2XO6A 3OXLA 4ECXA 2QC3A 1FNOA 3PW5A 2N7YA 2GQCA 3J7Z5 1CC8A 4NI2A 4S0MA 4OFZA 1AFJA 3QLHA 4J9PA 2CQCA 4DL0C 4NX9A 1URRA 3RBZA 1WSRA 2R3VA 3FBFA 4CP5A 2HLUA 1JLQA 3P5TL 4X2BA 1UMJA 4PAAA 4DSIA 4ECQA 2KL8A 4NLSA 4HHUA 2XC9A 2HZAA 3RZAA 3M8ZA 4LQ3A 3KLFA 1RWMB 1VR6A 5KG1A 5EDWA 4OIXA 4QIFA 2R8KA 4X66J 2AP6A 3DGVA 4IG0B 2GHVC 3G2XA 3CD0A 2FZCB 4L6V3 1YBAA 2B43A 1URNA 1N6QA 3UD5A 3V6KA 5CABA 2F5GA 4ZCLA 3PYFA 4PABA 4FVCA 1FDDA 2KVQE 4CNYA 3QT7A 2OPQA 2IA6A 3A8JA 1KQSR 1WD6A 4F3OA 2CPZA 1IBMJ 2AIRB 2D74B 3IS9B 3DLEB 1PO6A 1SKRA 4PG7A 3W2VB 4IQMA 2V69A 2C2DA 2CKWA 1WTBA 5K20B 2OPRA 2M5YA 1WTFA 2ZC4A 3AD9C 2RDDA 1NKEA 2H4WB 2LVWA 2RT3A 4U7UD 2AJ2A 4ZVEA 1VQPS 1ULRA 3G4SS 4YB6A 1KOHA 3GSDA 4C8NA 2WW8A 5FJ4A 4I2PB 4X65J 2HG4A 2FPHX 1QLNA 3OLAA 2F40A 1GT8A 2M7SA 6FD1A 4K2XA 1Q8IA 5J2NA 4G1QA 2FJVA 4F2SA 2V67A 4RBUA 1CJVA 1UW9A 2RS2A 4IOCQ 4QR0A 1TL1A 2QLXA 3I32A 4F26A 1RHRB 1Q4RA 1ZPWX 1U45A 2ZZTA 2ZH3A 2FLOA 2PFDA 3LPYA 1Q8BA 2YKNB 1TAUA 1RT4B 1NJXA 4YB5A 5ETLA 3JSRA 4ZOSA 5DDRC 4OI2A 4O3NA 3JTNA 1BC6A 4GKKF 1PYOB 3CXCR 2XMVA 3IM9A 1OQ6A 1B0PA 3D1OA 3WIVA 3M8QB 4JBCA 4C8MA 1RAEB 4CM2A 3RB4A 2OPPB 5J2QB 1VQNS 5HVGA 2QL9B 3Q22A 4NLXA 3H20A 3KG0A 3CNQP 2OIHA 1QUPA 2HVIA 3DMJB 2UUBJ 2XY7A 5CZVA 4TYBA 2WSCC 1JXLA 4I68A 2VQEF 3IRXA 2A6MA 3FQLA 2IRYA 4JI1F 4PXEA 4ED3A 2J6UA 4ZK7M 1IKVA 3I5BA 1JLFA 3NP5A 1SKSA 3W7BA 3BGFA 4N56A 4CLKA 4AL7A 3BR9A 4CH1A 2XWXA 2ZHOA 3MFHA 3JAMY 5HO4A 2CDRB 2L08A 1UEKA 2VBXA 5GADI 4OYIA 2R7VA 4HEA9 4CDIA 1U1KA 1W2BR 1HYSB 4ALZA 2KZMA 3RU0A 4ES1A 3MR2A 1FWLA 3GU0A 1BHNA 3OQ2A 3F56A 2WSFC 4EYIB 3UPFA 3C19A 3K8WA 2YH0A 3IG1B 1XR7A 4CNZA 1JJ2R 1AXQA 3W62A 1GAOA 2VPYB 1IQTA 1JXEA 2R8IA 3V6HA 1Q79A 3R9LA 1NHVA 4QCLA 1FNMA 4X4RA 2W2PP 3TJ8A 2WRMA 2DNHA 4MYUA 1X5OA 2P6TA 2PT0A 3S01A 2K8GA 3EJMA 3TI0A 1X0FA 1FA0A 1RP5A 3TZYA 2XWYA 1F1BB 5KOXA 1KVIA 3K57A 1RISA 1S0NA 1S9GB 4DPUA 1A7GE 3L7PA 3T9NA 1HMVB 2DNRA 4LR8A 1OY9A 1N54B 3HO1A 3CJ0A 3N6MA 3MUTP 1CJUA 2XMTA 3WBZA 4WF9Q 2J9DA 2BABA 4J5OA 4JYAF 2Z0GA 3B54A 4XIUA 4R5PB 3PW0A 1NSQA 3KJQB 2A18A 3N5BA 2ZM6F 3KDOA 1Q1KA 2FJDB 2D41A 3HSGA 3U27A 3DLHA 1RACB 2XG8A 1NAQA 1G6BA 3DLLQ 4RW9A 2JHEA 4DV2F 1CPZA 4OV6A 3TJ9A 5KT2A 2K1RB 2OLWA 3TX0A 2ZH5A 3BGUA 2Y1RI 3G8SA 5DO2A 4DV6F 3CJKA 2QO3A 1NK8A 4LF8J 4CYUA 5C2CA 1S1TB 1K1SA 2ZHAA 2OUGA 1S99A 5HANA 1Y00A 3W8PA 4K4SA 4F02A 4DG1A 1S6OA 4RNFA 3GFHA 2E5IA 2YNHB 3QZ7A 3DDNA 4LREA 1DJ0A 3I82A 4LSLA 1I6JA 3H2UB 4OZLA 3D9BA 4F4AA 4P7VA 3CCMS 2YNGA 2RS8A 4HI1A 2IVFB 1FKOB 1X31C 3AODA 3OL9A 1HHSA 2YQ3A 5B0GA 4KGKA 1RT7A 3CMAS 2MZTA 3BKUA 4UTGA 2VBYA 1RHJB 1K1QA 4K0KF 3CW2C 4OV1A 4U8VA 1F2GA 4NXMF 1HL6A 1XNRJ 3B4MA 4H54A 1JLGB 4JV0A 1Z4UA 2E5JA 5ETRA 3UDEA 1NK9A 1PCAA 3VF0B 2N4DA 3HHLB 4DS4A 5MAOA 3ADAC 4KGVB 3R3TA 3GCXP 3LOUA 1QAIA 2FVRA 1E6VB 1HQEA 1FDBA 4U96A 4DL7A 2L9NA 2BQRA 2LECA 3D7SB 3GV5B 3M1VB 4K7QA 4JI0J 2PMZD 3KNGA 3TVZA 1FHTA 2J9EA 2ZITA 3OR1B 1RAJA 2YX1A 5ITHA 3ISND 3C16A 1APSA 2DR6A 4JV5J 2GZOA 5M2PA 2OJ3A 3PRDA 3GSIA 4CWBA 2UVWA 1FJEB 2V68A 5M2UA 2VFTA 3M05A 4NA2A 5B0CA 3RBDA 4PQUA 2FJBB 1VK3A 3PDNA 4DUYF 2J8SA 1TK0A 2UXCF 3SIPB 1IJEB 3GIRA 3KLVA 5HMYA 1IKYA 4B3MF 3NXZA 3MAQA 2IM2A 2IVYA 3QO9A 2VFSA 3W9IA 4DU7A 5A2QY 4DR5J 4ZVPB 2FD2A 3OTOF 1WSVA 5JUMA 5HK4A 3IAS9 1X4BA 1S6PA 4QU7A 3PV8A 1L3SA 5D15A 5CQGA 4JI5F 1FRXA 2CDQA 1FX4A 3C15B 5L1KA 2MGZB 4KRWA 1N6QB 2LU1A 4CLWA 4CO3A 3R2CJ 2RUSA 2EG1A 3NCRA 1U1PA 2OSRA 4X4SA 1YBUA 2K3KA 1SQEA 3HULA 3KTQA 4HDGA 2JL9A 4DR6F 4ZJOA 1WHWA 5KG7A 4OX7A 2V6AA 5KFXA 2VG7A 4F3MA 3UFCX 4AQYF 2GIFA 2CVIA 5LL6d 2OPRB 4TNOA 1N56A 2XS7A 1DURA 2X1AA 1TV6A 4LMZA 2RF2B 3QZ8A 1VLOA 3M32A 3BN4A 4NYPA 2CPJA 1DFDA 4MMOA 3Q2TC 4G1PA 3BB5A 4QJVA 4PXBA 2M88A 3IGVA 2YNFB 2DNZA 4DV0F 3RAXA 1S4FA 1X8DA 1SL2A 3R5BA 4G1QB 4YR0A 4LIWA 2GJIA 3KUEA 3M8WA 2GIQA 2AYBA 3EWGA 3BBCA 2CJAA 3NGUA 5HROB 5C25A 2QEXS 2OHDA 1N33F 2DY1A 3JSMA 1FWKA 2HAIA 3T1YF 4CLUA 4DF4A 2OTJS 4KE5A 2FJAB 4DR2F 1W2IA 3LW5C 1I94J 4DQIA 2GGPB 4QIGA 4RW7A 1G1XA 2XY6A 1F5CA 3N6NA 2FJXA 1QM9A 2MYFA 1HI0P 3NGDA 1NJZA 3BBFA 2MXYA 4ZDNA 3BZQA 1VHIA 4QR1A 3VZHA 5LJ5Y 4IR1A 3IRXB 1FKAF 5FLXY 4BCAA 2CADA 2FJEB 3VAFA 4KR0B 2HZCA 4ZCMA 3KHRA 2K7JA 2HHXA 1SIWB 3MTJA 4R8UA 3QPIA 2W9CB 2IJRA 4LSNA 2VPXB 1N5QA 2BKOA 2CUYA 1T0TV 3IC1A 4FF2A 5GAGU 4M5LA 1ITPA 1Z2ZA 1WOOA 1VQ9S 4Z7CA 1RTIB 4AE5A 4C48A 4Q45A 1F3FA 2CPFA 3SZ2A 4IDKA 3CCVS 4RKUC 4Y2IA 4DX6A 5F3TA 3P49B 4ANEA 3ZC4A 3PTWA 3NS7B 1Q95G 1ZPVA 3BO3A 1JLBB 2E9TA 3NBPA 4FVMA 3KLIA 1HR0F 3W60A 3CGIA 1EKSA 2R4FA 1FRKA 2YH1A 1J5EF 3G87A 4FZVA 4RO0A 2Z2ZA 2LDYA 2BRLA 1FJCA 5C42A 3MEDA 1O6XA 3V6JA 2MKIA 4MIWA 2F8MA 1HWLA 3DI6A 4O3OA 1KLMB 2AV5A 1FF2A 3RGIA 2YWEA 1HFEL 3OTDA 2RKIB 2ZD1B 1CJUB 3RB6A 1AUDA 3E51A 1X4AA 3U1NA 2IJFA 2CQ0A 1HIYA 5ETNA 2M8DB 1RT1A 5D3GA 1RAGB 1U26A 4ZCKA 2YX7A 3EXCX 3T9ZA 5K9FA 4WWSA 3UDLA 2BE9B 4ETXA 4AXJA 4ENOA 5C5JA 4P71A 1V3RA 3GG1A 3RBEA 1FNXH 1KD1T 2NYIA 1S5ZA 5F8LA 1Q81T 1U09A 2GV1A 4O23A 2HVDA 5DZ7A 1U1LA 4P9SA 3MM7B 4KFBB 1TUGB 2HMIB 2QLBB 3ETOA 4QYRA 2OKQA 4USHA 3SSSA 4V1Ak 2ATLA 1NSKL 3B8HA 3KLEA 1Q8KA 1YJVA 4OX6A 3U7JA 3MPVA 2KHCA 1TK5A 2HVZA 3CJ2A 4GC6A 5KFVA 5KG5A 2PEBA 1U1RA 2FVQA 2ZZMA 3RW7A 2NS1B 5IXUA 3P5BP 5DQGA 1KHVA 3K5NA 1FWPA 2YNGB 3GIJA 3W63A 2RU9A 4Y2AA 1TK8A 4YHHF 2CYYA 3QWPA 1OQ3A 3PJWA 1IR1A 3CCRS 3TOQA 1RT7B 3I96A 2W01A 4RU2A 4ZN1A 1HHTP 5EX0A 4OL8A 1OS5A 1CLFA 2Z57B 2HNYA 3NCPA 1HNZJ 1LWXA 1S1VA 3KLGA 1RT3A 2Z8QA 4KHRA 4TLRA 1C0UA 3GP9A 4M5DA 2C2OB 1G4CA 1GK8A 4CLSA 2FUG9 1WKLA 4FN5A 3L7UA 3JTOA 2QZ8A 4K5SA 3CDBA 4TU9A 5B0DA 5JJBA 3GR0A 3GIMA 4LRDA 1D09B 2WVDA 1IBKF 1B7YB 1OYDA 2W8KA 3VGSA 1S0MA 3CEDA 2JEGA 1TVRA 4QU6A 4TY8B 1VCTA 4OJGA 5LSOA 3EM1A 2RMLA 4P75A 2O3DA 3PG9A 3C16B 5IWAJ 3CD7A 4I69A 4OYBA 3I0RA 5E3QA 4E0DA 1UZDA 3H5XA 4J90A 4I7FA 3B82A 3V4MA 1RAIB 3NGSA 5HBMB 2VASA 4IYQA 3MAHA 1KNZA 2CXEA 2YVSA 2GW8A 4OYXA 4KV8A 3M8RA 3AJDA 2VA2A 2GMJA 1VRTB 3CMES 3MPWA 4WP8A 3BN7A 2OO4A 2OEKA 3BV8A 2BANA 3HCXA 3AXKA 4DX5A 3CUNA 1K9MT 1UETA 3NMRA 1RK8A 4XO0A 3T41A 1SJQA 2VD3A 1S97A 1S6PB 3KKFA 4DR1J 4NE9C 5E2QA 4BWJA 3T1HJ 1UVNA 4IUFA 2ILZA 2EXUA 3D4JA 4BC9A 2GX8A 3FZBA 2MMYA 4WTYA 2R2TA 4LF9F 4DPXA 4JV2A 2D3OR 2MPUA 1RT6A 1UJ6A 3T5HA 1S4EA 2I1RA 4NYOA 1GH8A 1LWEA 2HSEB 2Y1JA 1RWWB 2EFNA 2OH2A 3FZ2A 2NR0A 2HNDB 5EHHA 2MKSA 3ZTSA 1TV6B 3MM5B 3QJPA 5B0AA 4USIA 1SL0A 4IOBA 4ZHRA 2UXBF 4PG8A 4UY85 2W4PA 3ZZTA 5BYQA 2EFGA 4DV7J 2YBVA 4DSKA 4R0JA 4ED8A 4Y0FA 4UZCA 2N7CA 1N0VC 5HJYA 3HHLC 3VAHA 3GIIA 2XYHB 4IFVA 1OYEA 3DRYA 4RNMA 3GYXB 2H4YB 2C2ZB 1EP4A 1IKXB 1FRIA 1JLCA 1XWLA 3EZOA 3U02A 2JWNA 3TZXA 4NA1A 1SBRA 2N3LA 3PKYA 3UN2A 2KT2A 3MECA 1KRPA 2QFJA 1C0TB 1KQGB 1QSLA 1E6YB 1YTYA 3LH2S 1R27B 3ET6A 1ZAXA 3JQMA 2HFZA 3SFUA 4DDFA 4FPIA 5T14A 3NCQA 2DGTA 1SH2A 2R7OA 2AD9A 1AW0A 3NAIA 4IR9A 3BGRB 3EVOA 2WONA 3TZWA 2AJFE 3R97A 5E7OB 4DJBA 4BDPA 4O44B 4CLTA 5GMEA 1X4GA 3IWXA 3M8PA 5J1EA 3DLBA 1S9FA 2FDNA 4NCGB 5SUHA 1Y0HA 3MD3A 4UUXA 2XCAA 3CT9A 4U7UK 3ELHA 4PXDA 3C6UA 4X4TA 1NJYA 4PKDB 4E8UA 1NBEB 3QT5A 3KK2B 3DNCA 4OYMA 4Q2LA 2BBEA 1R8CA 4WKRA 4ZPWR 1CG2A 1PBUA 1SV5B 2W9AA 1LWCA 1VQMS 1AFIA 1RTHB 1RUSA 4YB1P 4CO0A 2BKNA 3TO8A 1LXJA 3GONA 3Q8UA 5BR8F 1CSJA 4K4YA 2NPFA 2COLA 1DQ8A 4RJVA 1ZA1B 3TA2A 3MPYA 5B7WA 3SI8A 5K8NA 4F0KA 1S12A 1H0HB 1Y11A 4ETZA 5AJ3F 3J80Y 2UZAA 3MXHP 3C14A 3DLGB 4DOZA 5FIIA 4DU8A 3IR7B 4RUHA 4LF5F 1RWVB 4NPOA 4M95A 3W2WB 5IT9U 1B7FA 4I67A 2QMWA 3ZO7A 1H38A 4PCQA 5CH7B 3OHBA 1WI6A 4ZP8A 4OX9F 4ZJQA 3BQ0A 2HLTA 2C3OA 2BV3A 2Z56B 1HARA 4KT0C 2XNQA 4LFCJ 2VL1A 1BUXA 2OD4A 3BSOA 5A8KB 4N76A 5GMDA 5KFKA 3BM7A 4WTOB 4NZ6A 3OVAA 4GVBB 1N34J 3M6XA 2YPZA 1BQXA 5DDPC 5CHCB 3WC0A 3PHEA 2YXLA 4EUVA 3ILJA 2KTQA 2CQPA 1R43A 1UJ5A 3IR5B 1T03B 2MKYA 2R2UA 1M5VC 5D4OA 3P4UB 1H7WA 3QWUA 2CJYB 4A8YA 1QAYA 2PIIA 4LR9A 5D4PA 2CIMA 2CQ2A 2HVHA 4K4UA 4YUDA 2XMJA 4DSEA 4X66F 2WW4A 1HPZA 4ZVRB 4YY3J 2CFXA 4X4UA 4UOGA 5A8WB 2VBZA 5KFFA 2D9PA 4EGLA 4X4NA 2EW9A 2H65B 2IY5B 4HR2A 4WP3A 1WC1A 3NL0A 3OTCA 4O4GA 2HBZB 1JLEA 4RX6A 4WFZA 3DHXA 1EETA 4H4KA 2B4UA 2EVZA 1VQ5S 2LA6A 2NXJA 4KH0B 1OPZA 4WXWA 1K0VA 4CQ1A 1KSPA 4X65F 2CAJA 3W1YC 4JI2F 1IKWA 1RTZA 4LF6F 1QAXA 4EU0A 3MHYA 1GMWA 2BRKA 4LFAJ 1CVJA 3HZEA 1NJWA 4RWXA 2ZUAA 2LXFA 3VAGA 2HNYB 4C8LA 2AYMA 1U0HA 2BW7A 2MKCA 2ZH9A 4OYWA 4M5DB 4TQRA 1WELA 2M8HA 4WKYA 5D4LA 2IC3A 1QSYA 2DNOA 3S6EA 2DD8S 2HHVA 1VBZA 1NM2A 4C0BA 2YTCA 3A8KA 5EWGA 4EI2A 2F8EX 1GXLA 2AMCB 2EPIA 3GYGA 3W66A 4J9MA 3BSCA 3Q8PB 4JV1A 5DQHA 1I3OB 3PRBA 5K5MA 2CNLB 2MJNA 2HRTA 2W4CA 4KGMA 3J81j 5KFUA 1R0AB 1RDRA 3CB4A 3MTKA 4Q8FA 1MMNA 1DTQA 3JYTB 3CCLS 2H54B 1GQEA 5E3AA 4O4RA 3T3FA 3VAIA 4DL4A 4DUZJ 3AT1B 2KU7A 1ZA2B 1HNIA 5LJ3Y 1R8AA 1HI8A 4AYBD 2DITA 3MPUB 2ZH8A 1R7IA 3M8SA 1SH0A 1G7CB 1B0VA 1MWZA 2QIFA 5I3UA 4Q7AA 2DT9A 1HQUB 4DZ6A 4RNHA 5E3PA 2FHMA 4I2QA 1UPPA 2VU5A 3MMJA 2L48A 3WHIA 5D77A 2C2EA 4PUOB 5IM0A 3S1TA 3GLJA 3QT6A 1F2HA 2PO4A 2QLFB 3DOKB 2NPIA 1Q82T 4ZPBA 2VC1A 4NEZA 4YS2A 2HEKA 3NMAA 3R27A 5CD4A 2PC6A 3FEYB 3OJSA 3F41A 3M6WA 2C22A 3PX6A 3UNGC 1SC1B 1TKXA 2DNKA 2FHOB 3ILLA 1C1CA 3FKBA 1DHMA 3Q24A 1SVDA 2ADBA 4D3HA 5E3RA 1WDTA 3TP2A 1LW0A 4QWAA 1C1BA 3NLCA 5B0BA 2JC0A 2XSJB 5I42B 4M63A 4YR2A 2O66A 1C4CA 4K4VA 3THTA 1JXVA 4ANCA 3FDSA 1UWBA 3V4IA 1NB7A 2KM8C 1TP7A 1HBOA 2IRXA 4LRFA 3NWRA 2VQFJ 5MLCV 1EP4B 2ALYB 2NZ4A 1WHXA 2FQQB 2HBYB 5A0YB 2DRDA 2DR5A 1KONA 3RR8A 2ZDOA 2GC8A 3D66A 2ZBRA 2E5GA 4U7CA 2EC2A 5KG2A 5GADU 3F73A 4RW8B 3NGKA 5FDLB 4H4KC 3M2UA 2CQ1A 4KPYA 3ZZPA 3HJFA 2BJ3A 5LSLA 5KFMA 2GVDB 1XR5A 4LF8F 3BPDA 2MSSA 3L7OA 5GAEI 1EJ7L 2MQNA 4LVOP 3JQKA 2HFVA 2M9KA 3MURP 5LMUJ 5F9NA 1PBAA 5GAHI 1Q5VA 1I1GA 1SJ1A 4UZBA 4C8KA 4M5NA 3KHGA 2RE1A 5B09A 3VQSA 5CA5A 2VG6B 2Y1IA 1M5KC 2Z2YB 2AEFA 4YEAA 3FCWA 2LKZA 3UVJB 2O67A 5EGYA 2YWFA 2HS3A 3FSYA 2B8PA 2DXDA 1SB6A 3H8YA 2VODA 3M2VB 4PEOA 1KOOA 2G2YA 1M1KT 4NZ0A 1T05A 2I38A 3TANA 1TR0A 2J0QD 2ZEJA 2WB1D 1LW2B 2IM1A 4X64J 2B9WA 1QE1A 1S6UA 2X1BA 2K06A 1EHWA 2XGQA 2OMOA 4WE1B 4FP9A 1H7XA 4DQSA 4C98A 3WX8A 2B4VA 2W8LA 1DQAA 3J81Y 2BDPA 5B0EA 1VBKA 1R89A 3I87A 2O5DA 2GFFA 7AT1B 1BQMA 4Z7YA 4USUA 2AEMA 3PEJA 1RU2A 3H2LA 3GPAA 2FGCA 1GTHA 1VQSA 1FXDA 1X9MA 1BWEA 1Q53A 4JI0F 4EBDA 4QYZK 3MEKA 4CIOA 2KT5A 2FZKB 3F0NA 1MSWD 4DCJB 1TL5A 2ASLA 2DTJA 2DHSA 3MEEB 1RCOB 4LRAA 4JV5F 3I4PA 1D0EA 1TKTA 3OVSA 4C8YA 2IYGA 3CE8A 2EG2A 3QBCA 5EWEA 2JRSA 4MKAA 1KDNA 3VAMA 3OFEA 3TYTA 4J9QA 1RT5A 1SI9A 3SXLA 4QW8A 2WOMB 1BE4A 3JTPA 3GJTB 3NOGA 4QPXA 2B9XA 3NRBA 3MEGA 1V9OA 3TEGA 3BDPA 3I0SA 4FF1A 1XR6A 3MFIA 1XNQF 1UVIA 3OL6A 4BBYA 3QSIA 4V19X 2V4QA 1NEEA 3MMBA 1Y7PA 1TUVA 4O3RA 3HKZD 2LP4A 2QG9B 2DRAA 3IBWA 2FYXA 1YZ7A 2PD1A 1RAAB 1K0TA 2GNKA 1GX6A 2UUAF 1VRQC 5K8OA 3PW7A 3B4DA 1OY6A 3Q8YA 2ASJA 3HVTA 2KT3A 3GB0A 1GX5A 4RZRA 2KHDA 3DRSB 1FRJA 2XULA 2AX1A 5HQLA 4C0HA 1EIYB 4UUWA 1IBLJ 1B0TA 3GCWP 4O4GB 4A8MP 1JLEB 3CVKA 5CYMB 3NS6A 5HQ8A 4ZP7A 2Z30B 2PEHA 1FE0A 4FBUA 1SQGA 2P8IA 1FJGF 1SUQB 3LP0A 3TQ1A 2UXDF 2KG0A 2HHUA 3DGPA 4ZVSB 1RTJB 3V5RA 1X4DA 5A8RA 1M5SA 1SC6A 4JI6F 3HSJA 4KHPJ 2DJWA 3PO5A 1KQFB 1PGZA 1WF2A 3GE9A 2X7IA 1HBUB 3HZGA 4CH0S 2OPSA 2IC3B 4X84A 4CI0B 4P7TA 1UA0A 2X51A 1HNWF 2RQKA 4LBHA 4A8OA 1B4SA 2MB0B 4PYAA 3M4XA 2MKKA 4USVA 4ZJLA 2CJ9A 4WPAA 1XMOF 3CJ8A 3OTEA 3AOAA 2VJVA 2G0CA 2HIQA 4CH7A 4YN3B 1M5OC 4P6QA 4UF4A 2V50A 5ETKA 1OWXA 2XQCA 3NEKA 3O5TB 4H4OA 1CQMA 3OPKA 2YWHA 1KLNA 2AJ1A 4DPOA 2ZE2B 3R6LB 2KFZA 3ISNC 2B3TB 1B70B 2IM3A 2CJQA 3DRRB 1FTRA 3SQGA 2XS2A 2VG5B 2IAJA 2YNIA 1HNVB 2J6TA 1HNIB 3HVAA 3POTA 2ZDPA 1W26A 1IWAA 3JAMU 3MF5A 3GQCA 2CPDA 1WKKA 3KLHB 3THVA 2D7SA 3TUJC 1WUUA 4ID5A 3MMCA 4I1TA 3UQSA 1U1NA 4GO7X 1U4BA 3ETMA 1S6QA 3ILOA 2Y3YA 5IS2A 1X0PA 3KJVA 4EFAC 3BO2A 4ANDA 2HKEA 2OD6A 3CJRA 3A8EA 4USMA 1RU1A 1XEZA 2HK3A 3LO3A 3R6GB 4G6VB 4L3NA 1QDUB 1O8BA 1REVA 3BS9A 2FY1A 3IA0A 2POKA 2W2OP 1HBMB 5C2GA 2ZVIA 1N0UA 4ECWA 4P10A 2DNGA 4GKKJ 2HFUA 3A3OB 3BQ1A 2OAUA 2BE2B 3M8YA 2V2KA 4MFBB 4DX8H 3HKWA 4DPTA 2GMLA 1YSJA 3D5MA 2V94A 3UNYA 3FSIA 2CZ4A 1LW0B 5ETSA 1U1QA 5DZ6A 1XC9A 1RE1B 4DMZA 4DV5F 4YOEA 1VQOS 1NJIT 1LK7A 3OSPA 2XMKA 1FVQA 4F4YA 4JI3F 2GJ2A 2VQEJ 4OQJA 4JI1J 4G3IA 1IUJA 5J2PA 4WYWA 5C24A 5CAAA 4B9VA 8RUCA 1Q16B 2PI5A 4FNIA 2A6OA 4Q43A 3L09A 2V63A 5HMWA 2DNNA 3LWLA 1NRKA 1OIAA 1U02A 1PJ7A 4ZCIA 4XPCA 1N5YB 2OFGX 1PAEX 3T5LA 3MM9B 4TXSA 4WZQA 1RB0A 4JI8F 2IJNA 2VOPA 3CCTA 2BVZA 4HLBA 5LMNF 3FMWA 1TL3A 1P8GA 4OHZA 1Y4ZB 1TFYA 3R5GA 4OHYA 4DFPA 2XM3A 1OY8A 2CNOB 4HDHA 2UVRA 3UDCA 4DBQA 1ZTTA 1AA1B 1J5OB 3IBFB 1SCJB 4DCOB 1UP1A 1SJFA 3BR8A 2KB2A 2W25A 1FEHA 2DR7A 1EZZB 5LT5A 2HQCA 1RCXB 4MTPA 3D0HE 3G86A 2YQ1A 1AYEA 4QYZJ 3MMAA 1KKHA 5HN0A 2Y0SD 2UUCF 4DN9A 1R0BG 4F36A 4X4QA 4OJ1A 2GA7A 5LSRA 3BO4A 1JB0C 2MZRA 1GNKA 4J7CA 2DY9A 3E8OA 2MQOA 1Z2LA 4FYXB 2V2VA 4RNNA 3LANA 5KFTA 2KVIA 2ZVSA 4JYAJ 2C3MA 1BQNA 2VF3A 2X1FA 4Y2MA 5LXRA 2VPZB 3H59A 4NMLA 1V5IB 3GIKA 1U7LA 4ECUA 2EK6A 3AQPA 2EC0A 3KK1A 4DV2J 3DYAA 3AB2B 5F8HA 5EWFA 2LEBA 3D68A 2CPHA 1SPBP 2ATCB 4YDDB 5KFJA 3Q8SB 4DV6J 4M5KA 2G2OA 4C2MA 5KFEA 5D0GA 1ZETA 1LK5A 2PFFB 5I3QA 2NSBA 2ERRA 3ZNJ1 4AL6A 4XDDA 2HURA 3I9ZA 1NDPA 2LQJA 3LPEA 3DLKA 1YVFA 4AXIA 3JB9k 2ZNYA 3WC2A 3NAHA 3MPDA 2JSXA 2QLJB 3QQCD 2EFQA 3SQOP 3SSRA 4C97A 3HDSA 5A2QU 4XK8C 2PN6A 3CD5A 1UEVA 3HFVA 2D3O1 4CTAA 3MAAB 4NYZA 2IFXA 2BQ3A 3ICLA 1PC4A 1RZMA 4CLYA 1PJ5A 1S0VA 5DQIA 1FK9B 1T9XA 2E1AA 4IFYB 2A2DA 2XHCA 3PYGA 4K0KJ 1RWKB 4JI4F 2KFNA 4QBUA 2R7UA 2R7TA 4B3TF 4OYAA 3QT8A 2H48B 1DY3A 4WFNQ 1TKZB 5DETA 4E2FB 4WK1A 1BLUA 2VH7A 1ZAVA 2E29A 2IDLA 1ACMB 4J91A 1X9SA 2V9KA 1RLDA 5J2MB 2AYGA 4DUTA 1N48A 1K73T 2K3IA 5CYQA 3D2WA 2VOOA 3U1MA 5HAOA 3U1LA 2W1BA 2W9BA 2W24A 4ERDA 4LFBF 2Q1LA 3GG0A 2QYCA 4PWDA 2B5JA 4JI7F 4FKYA 1CJTA 1V3ZA 3CCSS 2E5LF 2V8VA 1KP6A 3MOJB 1WEYA 4MIBA 4ED7A 3ZXWA 1AB8A 4Q5VA 3UWTA 3AA8A 1GXUA 3H0PA 1VRUA 4DI6A 4NZ7A 1S9EA 4RNOA 4LR7A 3P45B 1F6TA 1DTTA 4DUYJ 3TRGA 2UXCJ 3G82A 2XYPB 4B3MJ 2CRLA 4DF8A 4NL5A 2HBQB 3RB3A 4F8RA 3C46A 3UR3C 1HW9A 4LF4F 3NNAA 2RQ4A 2OPSB 2VB6A 3J7YI 3CDAA 3IM8A 3OTOJ 1T94A 4LF1A 3ENWA 4K5RA 3RTVA 3KK3A 1MN9A 1NSPA 2HQFA 2ZWOA 3N01A 3ILIA 4LF2A 3DLJA 3RBXA 1S59A 2IHR1 5HP1A 4ELVA 1B99A 4JI5J 3H5UA 1MU2B 3UDVA 3MM6A 1S0OA 2ZJQQ 3DCAA 3HD1A 4H4OB 2F3JA 3SCJE 5K8PA 4V19J 3H25A 1LWFA 1UWAA 4WZMA 2OEMA 5E41A 5KFBA 4ES3A 3RRGA 1YJRA 1TAQA 5KFIA 1UCNA 2RRBA 1ZTWA 2PDAA 2DH8A 4DR6J 4O0IA 3V81A 3DOLA 1X4EA 3SQGB 1N32F 4PXCA 1IWGA 4AQYJ 4C11B 5EN1A 3HM9A 4HACB 5DG7A 2HGMA 2CQHA 1PIEA 4EEYA 4UOHA 1SKUB 3SDEB 2ZKUA 3N9UC 4CO4A 2LDIA 3D0GE 2DHGA 1RTDA 5T41A 4F4WA 2UVVA 4PPZA 1FKPA 3QSYB 4TKTA 2BJ1A 3W9JA 4DV0J 4H4MA 4EBCA 1R8BA 3KJVB 5IT0A 3ZZOA 4DLEA 4NLTA 4G1IA 3WDOA 1SH3A 3MZIA 1WKJA 1KN6A 4A8QA 5AXMA 3PRVA 4C7QA 3PVXA 1VDHA 1VC0A 2DPIA 1DBDA 4URQU 2V2ZA 2ZOMA 1TL7A 1AZSA 3TVKA 2L9WA 3MDFA 2QA1A 1N33J 2M0GB 3OTBA 3PYDA 3DFEA 4R25A 5BYSA 3T1YJ 2BJ7A 4E98A 5A6PA 5F8NA 1F60B 1YRXA 5LXYA 4DR2J 1RKJA 2DISA 1IXKA 2B7BB 4A8FA 4J9OA 5DLGA 1PAUB 3DOMA 1FTCA 1IJFB 2DGXA 2HHHF 2C28A 4ZPAA 3QNWB 1ZYQA 3OUYA 1F9HA 1D9AA 2A1BA 4DFMA 3AJ1A 4Y6IA 2Z58B 1N34F 4M94A 1U6BA 3VQTA 3TAMA 1U48A 2DCLA 3K17A 3IGNA 4CRJA 4DN0A 2A0FB 3CMQA 3E01A 1HBNB 3VVUA 3VHQA 2UU9F 1O0PA 4WU2A 4EBEA 1KWMA 4RW6A 4GMKA 2PSZA 2V4JA 4Y2KA 3BREA 3M2RB 3OL8A 3K59A 1S57A 2WK4A 4J9KA 1R31A 4X4PA 3FFIB 1P6TA 4EMDA 4O0NA 3UW1A 3OSNA 1WC4A 4DL5A 4OI0A 1S1XA 1HR0J 2VHGA 1FRLA 3CJQA 5HLFB 2P9EA 3W5XA 4ICLB 4RW4A 1J5EJ 2C2RA 5IV4A 3CPWR 1QVGR 2QL5B 4AFFA 2RNEA 3LTOA 4CO5A 3HX9A 2QSWA 4OJHA 5H9FK 4C3LA 4ZMMA 2NXUA 5CYJA 5ADZA 1JJCB 4NLYA 3DM2B 3M30A 2HBRB 4W92B 5ETMA 4NRTA 3NNCA 2MQPA 3MCSA 2R2SA 2OI2A 2CZVC 2XMUA 5G0RB 2AF6A 1YRTA 4RR5A 1F0XA 2KI2A 1BXNA 1C2PA 3ZTOA 2FHJA 1YGYA 3OR2B 3IN5A 3PNIA 3C2PA 2WVEA 4DL6A 2RU3A 3VALA 1U1OA 2B4OA 3D28A 1I51B 3LP1B 1X4FA 4Y34A 1PKUA 4KO0A 3W64A 4ED1A 1RWOB 3KK1B 3DYAB 5HVHA 3OJUA 1N4LA 4F4KA 3KHLA 3UN3A 2CNKB 2B6AA 3MM8A 2VPWB 4J37A 3EPIA 4B3RF 1CS4B 2IBKA 4B3OB 2DNYA 2CJKA 3KJNB 4GVLA 4ELTA 3LF0A 2VIHA 4ZLLA 4B9NA 2KFYA 5IFMA 3IS9A 3DLEA 4HTIA 2C3PA 2LU2A 3KYLA 3W2VA 1HD1A 4NI2B 3EZ5A 1O51A 2XI3A 3QLHB 3BQ2A 1RHMB 3H5SA 4RPFA 1NZAA 3ONQA 4YHHJ 1JLQB 4K4WA 4FPRA 4I2PA 1FD2A 4FS2A 2CWXA 1QVFR 2E7WA 3ZTQA 2QMXA 2W7OA 3RJMB 2G1HA 2ZH4A 3Q83A 2ALZA 2JVOA 5F41A 2CJBA 2NLWA 4QIEA 2IBOA 4L3KA 2QL7B 4ED0A 2YKQA 3KLFB 2DRBA 3OHAA 5J1PA 5K14A 2CPIA 2WHOA 2MKHA 3IO1A 3T19A 4FNHA 1UFLA 4W98A 3OVBA 1X5TA 3HFZB 1S7HA 1JJ4A 1RAHB 1VIOA 3R7NB 1D9DA 2CQ4A 4DWIA 3VVTA 2JEJA 2VFVA 2HWIA 2YKNA 4GC7A 4OZ0A 2OPQB 1WEXA 5F0WA 1IBKJ 3DXBA 3MR3A 3VAJA 1TUWA 4KB7A 2RQMA 3H90A 3PIOQ 1UFWA 2HFSA 3PM9A 3M8QA 4GKJF 2APOA 1X4CA 2ABYA 2LEPA 2OPPA 3M6VA 3I55S 3EYZA 3AXMA 1NK5A 2XZDB 2NXNA 2ZZNA 4TVAB 1IQZA 2F65A 3DMJA 3FRYA 2CNNB 1S9EB 2LCWA 5CZXA 3VV2B 4ZPVR 4M8LA 2AQ4A 1NSAA 2VQFF 1CJKA 5J2NB 1CJVB 3AOBA 5AT1B 2ZC3A 1H6KX 3CDUA 3BH6B 1D9FA 3HHNB 1TL1B 2BEFA 2I2YA 3D6FB 3HJVA 1MROA 3KUGA 1J27A 1XN9A 3DRXA 4QW9A 1H74A 2BJ9A 5HP1B 2R2RA 2X3GA 2OP5A 1WC6A 3MM6B 5KAKA 4MKVA 1HYSA 1NU4A 4WK3A 1ZZFA 3UR0A 4LF9J 1KVKA 4RBVA 3D1HA 1WC5A 2Y0BB 2EEYA 2XBPA 1A9NB 4OJ3A 1RBOB 2IIHA 4AT1B 1YJTA 2WCXA 3G8QA 2E66A 3R7SB 3TAPA 3ENQA 1EX8A 5HI7A 3FSXA 2H5JB 2QRRA 1IKVB 2UXBJ 1JLFB 4WBFA 4UQGA 4HKQA 4EWTA 4QIWD 2VFUA 2C2NA 1LEOA 1S9GA 5IC6B 9ATCB 3BF4A 1HMVA 5RUBA 3CDWA 4C8ZA 3EICA 5GVQA 2VA3A 1F9FA 2E1PA 1FFWB 3FC9A 3LWMA 4R5PA 1YQHA 3ZZ0A 2MKJA 5KFPA 5I3PA 3TAQA 1WWHA 1AZSB 3PIPQ 1YRUA 2DGQA 2MLXA 3FNNA 3K0JA 2Q66A 3J80U 5E33A 3T6JA 2LLZA 2A3JA 3QRRA 5ETPA 4P72A 1SIZA 4RWWA 3FEXB 2FY8A 2KRRA 1WF0A 1WG4A 2FHKA 4P2SA 4M5GA 1VQ8S 2G0JA 1HWJA 3Q89A 1FT8A 4F04B 1JNRB 3UCGA 2VDHA 5KFDA 1NPKA 1S1TA 3TNVA 3WIUA 5GAEU 4B9MA 3SCIE 2YKMA 2JLEA 2QA4S 1G3OA 4OI3A 2ZBCA 3R5AA 5GAHU 3FBBA 4A4JA 3VZIA 1RA6A 1RLCL 1H2TZ 1MW7A 2YNHA 2RHQB 3D6HB 4KIAA 1NDKA 1R6VA 4YMEA 2DK2A 3O6QA 4ECZA 1L3KA 2RSQA 4M5JA 1NDLA 4C8OA 1FESA 3J7A1 2N4CA 4RU9A 3C8YA 5KT6A 4F4ZA 4ZVQB 2MHNA 2EKYA 3WQPA 4Q2MA 5AXLA 1FKOA 2JEIA 2VC0A 4LUBA 3PX4A 1FO1A 2MZJA 2M4MA 1WC0A 3ZTRA 2D9OA 1NK0A 3TZZA 1VQKS 3PFOA 4B3SF 4RW9B 2BM0A 2RDJA 3CULA 4NLPA 2RRAA 3GTYX 4Y65A 1JLGA 1EB0A 2M3DA 1JQGA 1OO0B 5BR8J 1R8HA 4TN2A 3CJKB 2XMAA 3PX0A 2CG8A 4CYUB 2A2CA 1NMEB 3HHLA 2N3OA 4ILMA 4GO5X 2DR8A 2FVSA 3Q8QB 4PPDA 2DHHA 4DG1B 1E6VA 1X5PA 3VAKA 1NK6A 3OFGA 4NWBA 1UZHA 4HTJA 3A4TA 5AJ3J 2C3UA 4TU8A 2CQDA 1CEZA 3F44A 3HD2A 3AA9A 2DO0A 4B9TA 4LF5J 1F5BA 1S48A 3P3DA 1IBLF 1VQ6S 3M1VA 1KEKA 2DYAA 4QR2A 2VUGA 4OX9J 3KUHA 3GWCA 4LSLB 3K5PA 3OR1A 3DC2A 1XBWA 4F0HA 4JUZA 3DDIA 4JB8B 1B3TA 4XTTA 2MZSA 2HGNA 3QGIA 4XPEA 4OLOA 1TQLA 3IBCB 1TZ0A 4KAIA 3DXSX 4WCEQ 2ZBPA 2HWHA 4KHPF 5ETVA 2ZKTA 1NO8A 3PO4A 3FGVA 5L9NA 2QJ3A 1Q7LB 4CCHA 2BM1A 3MUMP 3A13A 4HL9A 3TR5A 3HT0A 2ZBQA 2XCPA 4KO0B 4A8XA 2OTLS 5KG6A 3CJ4A 1KFDA 4ZP6A 2BACA 2DGVA 4FYVB 1YKWA 3N79A 2XO7A 1HQEB 2B6AB 3MM8B 4TYAA 1VI7A 3KXDA 4F2RA 4DL2A 3C15A 2MGZA 2P9GA 2MQ8A 3PW4A 3NOCA 2PA8D 3IP0A 1QAJA 5IOLA 5U47A 2AHOB 4ILRA 3TW0A 4ED6A 1B64A 1U6FA 1Y5NB 4OHWA 4C9DA 3JSYA 5HQMA 1MG7A 2HHSA 3DU5A 5KFYA 4J9UE 5LOQA 2KXHA 2NXEA 3LGNA 3M6UA 2HGLA 3R7BB 4DR3J 4PQUB 2FTRA 1UKUA 3HVWA 2PMHA 2RF2A 4Y00A 1IKYB 3ENAA 3QO9B 4DV4F 4JI2J 3SSQA 1FI4A 4LF6J 2KYXA 4QWCA 2MDAA 2YNFA 2RAQA 2UV8G 1WDDA 3HK2A 3HMJG 4LJMA 3D6MB 1DAXA 4A8SA 5K14B 4QWDA 4RUBA 3R1HA 2NZCA 3C3LA 4YQWA 2RRNA 4MYTA 2E5HA 4N7TA 3QIDA 2Q3PA 4DV3F 1U8SA 4ZVGA 4UOFA 5HROA 4FF3A 2WVBA 2JLFA 2DXEA 2VBWA 4IH5A 1H3DA 1RAOA 1G2EA 3J7ZT 1SC3B 3MGJA 1YHQS 2ACYA 3S8SA 1LV5A 4K4XA 1GMWD 1FVSA 3CIZA 2VG7B 2RQCA 2GGPA 3EGWB 4USWA 2IPOB 4ES2A 2J0XA 5A76A 4DS5A 4ELUA 3HT3A 5T7LA 3M32B 1WOPA 4USTA 4IO1A 1HI1A 4B9SA 3W5ZA 1L3VA 3OV7A 2XZWA 4TLQA 1N36F 2JJ4D 3HF5A 1ZOTA 1TU0B 3KG1A 1VJWA 4ECYA 3BKFA 1CJKB 3A3PB 2QE5A 1RWNB 1LQ9A 4J9NA 2ROEA 4ZIVA 2FJWA 3DRPA 3G6VA 4QPTA 3HSZA 3Q2SC 1XK8A 3D54A 2W9CA 1MROB 2JEFA 3P96A 1LNQA 1Z1ZA 3HHEA 2DIUA 2WSEC 2XLJA 5C25B 1UVJA 8AT1B 3JSMB 2ZH6A 4F50A 1RTIA 1QTMA 3Q23A 4HHHA 1FEEA 4PWUA 5L9XA 4IKAA 2AZ3A 2C1EB 3VGTA 4OYOA 2W2QP 1SJRA 2KG1A 2VONA 4ZVUB 4ZVHA 2R9LA 2DKOB 1JLBA 4RW7B 1MMDA 4OI4A 5DM7Q 5B0FA 2Z2MA 4NRUA 5BXIA 2XMWA 2C2MB 4X62F 1VQ7S 2W2NP 1KLMA 1WF1A 4XDCA 1WACA 2A10A 4Y3CA 4R8UB 3TUZC 4ZLPA 3A3NB 1FJ7A 4WU3A 1F9EB 4LSNB 2RKIA 1PILA 2ZD1A 4DEZA 4DV1F 2KRBA 2AZ1A 3J81U 2GMHA 5CCMA 3NGRA 1Q86T 5H9EK 3I5AA 2DEJA 4O3SA 4IDKB 2G9OA 3RG6A 5ETQA 3T6BA 2NCKL 2EBGA 2AKWB 1ZS6A 5KFOA 1XJWB 2MQQA 4I4BA 1WG1A 1UW4A 5G4DA 3NBPB 3KLIB 2HNZA 4J9SA 5M2RA 1LOUA 2HQIA 1NKBA 3MM7A 5HMXA 2RB7A 2F4VF 4KFBA 1XMQF 1FXRA 3CC7S 1GEHA 4DSFA 2HMIA 3H5YA 3GJQB 1BWVA 3CJTA 4NA3A 2HWTA 3SBMA 3LA0A 2YKMB 3B78A 5C42B 4U9RA 3MEDB 5D78A 2HZVA 3BKTA 3RRHA 2U2FA 2LQ8A 3DI6B 2GHPA 1C4AA 4EZ6A 1UPMB 2QA2A 2I9SA 2UVUA 4C6AA 4KSEB 2BOPA 2ZH7A 3KMQA 3CTRA 2VKZG 2Y8WA 4OZ5A 1PG5B 2DGOA 3G8TA 6FDRA 3RW6A 1RT1B 5D3GB 1JK9B 4AD6A 3V2UC 5F8GA 1YWXA 1JIHA 1RBAA 5EUHA 4IRCA 2YX4A 3MR5A 2ZBIA 5DDQC 2O01C 4NEYA 2FLNA 3ZZRA 3V6DA 1MMLA 1WORA 4IH6A 2KN4A 3G6XA 4ED5A 2HHWA 3EPGA 3ZTPA 2JZ5A 2NUHA 2MJUA 3KLEB 1PYTA 1U47A 1L3TA 3NGTA 2HFOA 3FUYA 1TFWA 4PZVA 3THPA 1IBMF 4RUAA 3SCLE 4TY8A 3BJYA 5C7PA 3TJAA 3NKYA 3BYRA 2P2CB 3UN5A 3CWJA 1BMQB 1FDAA 6AT1B 3O3LA 4MH8A 1D8YA 2VV5A 1OJ4A 5BJRA 2OEJA 1U1MA 3GJSB 1NK4A 1R3NA 3PHTA 5HBMA 4ED2A 3MR6A 1VK8A 1AUSL 2HW3A 1LKZA 4L76A 9RUBA 1RBLA 1EKRA 1VRTA 2DB1A 2H1YA 3KOAA 4DFJA 3CCWA 2N82B 4ZN3A 5KG4A 3RAMA 3EE3A 2L41A 2FVPA 5IQQA 1S1VB 1XNQJ 4C0OC 4O3QA 3KLGB 2Q79A 1RT3B 1JKHA 2XMMA 3W65A 1C0UB 1HNXJ 1U2CA 1TTHB 5DG9A 1VISA 1IM6A 4RBTA 4OZ3A 3HSDA 4KY3A 4ZVOB 1SJ4P 3Q86A 3AD8C 2E7VA 2UUAJ 2BW2A 1YJWS 2EK1A 4M5HA 3D67A 2F63A 3N6LA 1TVRB 3RRKA 2R8GA 5IC4B 1FERA 4FKXA 5F0UA 2HS4A 2F8HA 2M70A 4KGZB 4DQRA 4C4WA 2W7PA 1L5UA 1HHQA 4NLQA 3I0RB 4CO1A 2XSFA 4I7FB 5HJXA 3EUNA 1RHUB 2GQQA 3L4BC 2UUBF 4KV8B 2R8HA 1U8WA 2HNDA 3VGUA 2VDIA 4OLPA 2Z4PA 3KJFB 4Y2CA 3I5CA 2LFVA 3MM5A 5KFAA 4I6WA 1N5VA 2HHPA 1FJGJ 2SXLA 2UXDJ 2BANB 4RL1A 2MY8A 4N41A 3SYZA 2NSCA 2GIRA 4IOAQ 3I56S 4JI6J 7FDRA 1WNEA 1GMUA 1T95A 4HYKA 5KT4A 4KBIA 2ZOGA 1T9VA 4DPWA 4F67A 4DSJA 2F1FA 2VJUA 1Y9OA 2JFKA 1IKXA 5KFQA 4HH0A 2DNMA 3J7YU 4DXLA 2G0IA 1Q0NA 1WG5A 3W3SA 2PGCA 1OMSA 1H72C 4A46A 2QN6B 1HNWJ 1Y5IB 5CXTA 1P9YA 4B02A 1X5SA 1C0TA 2ASDA 1E6YA 4P73A 1RT6B 1XMOJ 2ILYA 2IM0A 4K4TA 3BEGB 1U24A 2C42A 2G13A 2W4DA 1LWEB 3P6YC 3HLUA 2EWHA 4MK9A 4U8YA 4CZCA 2LMIA 2E9ZA 3SFGA 3AJ2A 2B51A 3BGRA 3RAQA 1XIQA 5F8JA 5HVFA 4MIAA 1ZM9A 5T7LB 5KOWA 4ZHRB 4O44A 4DR4J 4NCGA 2DPJA 3FVYA 1NKCA 4PRFA 3LGHA 1JLAA 4IH7A 4IFVB 4MKBA 2QMUB 1V5VA 4NXNJ 3DRPB 5D4NA 1MWQA 3PACA 2YPYA 1JLCB 5AE2A 3CJSA 1NH8A 2B0GA 2AEJA 3KK2A 2HAFA 3PEHA 4P2FA 4LRBA 4F3QA 1VLYA 4PG5A 3AH6A 4P2MA 3MECB 2YKAA 1SQFA 4A48A 1SV5A 1TL4A 4AL5A 4WIQA 1RTHA 1QD1A 3ET6B 4LF7J 4U6PA 5H9EJ 2J0SD 4WFYA 1S76D 8ATCB 2WBRA 3OFFA 1UJ4A 2MHEA 1K44A 4A8KA 2WONB 2MZ1A 3ZFVA 4OHVA 2CQ3A 3DLGA 3M8PB 5J1EB 3CIMA 5DJBA 3TA0A 3CJ5A 3D6TB 2BJEA 3W2WA 4Q0BA 1UAWA 4WP9A 5K8MA 4QIVA 5HMZA 3X1LB 3LP2A 4B9LA 3OW2R 3K58A 4DV5J 2J7UA 1MWYA 2EFOA 1PYSB 2D3UA 3C6UB 5IT4A 1HKAA 2HPUA 4JI3J 2Q6BA 1KHWA 2Z2LA 2CQIA 5A8KA 1TMMA 4OZ2A 4ECRA 4FF4A 4GVBA 2PA3A 2XEXA 2XI2A 1WJ9A 3PJXA 1AROP 5AXNA 1LWCB 1Y5LB 2IMOA 2JLGA 1WHVA 5KG3A 1XNRF 4BLGA 3D1QA 3B6BA 1X60A 1T03A 3OFHA 4M1KA 1YJUA 2KXNB 2DNQA 2HNZB 4PYDA 1OPIA 4JI8J 4AUKA 1GFWB 4J9VA 3QRQA 2YWKA 4D3GA 5LMNJ 1RXOB 2QA4G 3VTIA 2LA4A 3H40A 3L95X 1VC5A 3C14B 3ZZYA 5JXSA 4ECTA 5A8WA 1UA1A 1KR4A 1YK9A 1WC3A 5HSPA 2AGQA 1XMBA 3SMZA 2R7QA 3H4BA 2J9CA 4OZ1A 1VIXA 2YKOA 2DBBA 3ENVA 4CO2A 1RJJA 2DEIA 3TQEA
chains in the Genus database with same CATH topology
2IJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IJR A; 
#chains in the Genus database with same CATH topology
 2KH9 A;  2WB4 A;  2UUC J;  2G1D A;  4KC5 A;  4MAK A;  3I9V 9;  4DR7 J;  3T5K A;  4WFX A;  4NLW A;  4ZPC A;  4N77 A;  2L3M A;  2R8J A;  2BJ8 A;  4DR5 F;  3QJJ A;  2HRU A;  1VC6 A;  5L1J A;  3QAT A;  4WII A;  3RR7 A;  2KKH A;  3FRZ A;  1KTQ A;  1YLX A;  3MR7 A;  1NB2 A;  3V6D B;  3O8W A;  1RYS A;  1TKD A;  2KM8 B;  1HPZ B;  5SZT A;  3EGN A;  3G6Y A;  1F3V A;  3W61 A;  4MK8 A;  3QGP A;  3OLB A;  4K8R A;  4I64 A;  2BE7 D;  4Z37 A;  3TWZ A;  2CG4 A;  2EFV A;  4FXV A;  1SC4 B;  4DX7 A;  1NPR A;  3UCU P;  2XZT B;  4KGX B;  5DS7 A;  2B9E A;  1NUE A;  3H7H B;  3PCO B;  1KQK A;  3CO9 A;  4WJB A;  2FB0 A;  1EET B;  3N4W A;  1R0A A;  2R42 A;  5KG0 A;  1ICE B;  2XNR A;  2K7K A;  1DRZ A;  1LFP A;  4U95 A;  2GVZ A;  3BBB A;  4FXW A;  3JYT A;  5L1I A;  4HI2 A;  1IKW B;  2YWG A;  2B56 A;  3T1A A;  1N5S A;  2IA0 A;  2F9J A;  2EFP A;  3SV4 A;  4WXO A;  3MUV P;  4LVN P;  2AT1 B;  2FVC A;  3IWL A;  2H9Z A;  1U0H B;  3PR4 A;  1R8P A;  1JKH B;  3O2I A;  4Z2X A;  1IBC B;  2P9C A;  1HW8 A;  2Q6C A;  5H1S V;  2VKR A;  1HD0 A;  3CDE A;  1HQU A;  2Y1L B;  4MKY A;  3PFE A;  3AD7 C;  4L74 A;  4PUO A;  1KFS A;  4JI4 J;  4WYL A;  3NWG A;  2RVJ A;  2I5J A;  4B3T J;  1WI8 A;  1FE4 A;  3DOK A;  3I31 A;  2H51 B;  1N8R T;  1I5O B;  4KKO A;  1JJH A;  4CLZ A;  3FEZ A;  3JSB A;  1I94 F;  4PQA A;  2R7R A;  1VQL S;  2G2Z A;  1QSS A;  1EQ0 A;  1UEU A;  2H3E B;  1R0C B;  1DTQ B;  4LFB J;  1FDN A;  3FMB A;  1QJH A;  4JI7 J;  2U1A A;  3OT9 A;  4KYZ A;  2E5L J;  1IR2 A;  1VHF A;  3X3U A;  2GJF A;  1DZ5 A;  5IZH A;  3N5F A;  4NCB A;  2XSJ A;  5I42 A;  1S49 A;  3EVM A;  2JOQ A;  3I6P A;  1UVL A;  1YJ7 A;  5I3U B;  4FYY B;  3AY0 A;  3FCV A;  7FD1 A;  2EBE A;  2IDE A;  4I2Q B;  1P1L A;  2FIU A;  5JVH Q;  3Q0A A;  4DL3 A;  2OSQ A;  3K7R A;  5KFL A;  5IM0 B;  4LF4 J;  5A0Y A;  1NND A;  2ZHB A;  3IR6 B;  4K50 A;  4ZVF A;  3KDN A;  2AWZ A;  4OZJ A;  1YG0 A;  5E0O A;  1RKI A;  4J9R A;  3BSA A;  3QRP A;  4P74 A;  1M1H A;  4RW8 A;  3TA1 A;  2X1G A;  2QX0 A;  5FDL A;  4ITS A;  2J9D E;  1CQN A;  4CM0 A;  3L3C A;  1J2V A;  2GVD A;  3P8B B;  2DNP A;  4ID8 A;  1R6Y A;  1TKX B;  3BYP A;  1VBX A;  3DN9 A;  1GTE A;  1C1C B;  4C3K A;  2NUU G;  2AU0 A;  3G9C A;  3IWN C;  3K5O A;  4A8W A;  1CUL A;  4J9L A;  4B9U A;  1C1B B;  2VG6 A;  2BZ2 A;  1N32 J;  5I4M A;  3R2D J;  1YZ6 A;  5AE1 A;  4QWB A;  2W2M P;  2QLW A;  1UWB B;  2JNJ A;  2Y8Y A;  3V4I B;  3UVJ A;  1JLA B;  3MD1 A;  2V4R A;  4N5S A;  4NLD A;  1HBO B;  3M2V A;  4ZPD A;  1W25 A;  2WVC A;  2J8A A;  1WOS A;  2NXC A;  3LQV A;  4NLG A;  3HPO A;  2E1R A;  4IQX A;  2ZH2 A;  1PSD A;  3QYY A;  1X9W A;  3QGG A;  2DGU A;  4LIR A;  1VYA A;  1LW2 A;  1DLO A;  3WZ0 A;  2RD5 C;  3O44 A;  1YDL A;  2RUG A;  1EAR A;  2CJX B;  4WE1 A;  1S79 A;  1VMB A;  2B8Q A;  4URG A;  1X4H A;  3M2U B;  3BPS P;  4NLV A;  3EMT A;  4DQP A;  4ZS6 A;  5D0H A;  1M1G A;  5B08 A;  3HVR A;  4I56 A;  2WBM A;  3H2V E;  4I0W A;  3W5Y A;  3SV3 A;  3GFY A;  4UY8 T;  3QAE A;  1PC5 A;  1YJ9 S;  1Q8L A;  3IMQ J;  2Q43 A;  1RI7 A;  2XGP A;  3NG8 A;  4R0E A;  3W9H A;  4Q0B B;  3IFE A;  4TQS A;  2WAQ D;  2LQB A;  2UUW A;  4P52 A;  1RWX B;  1Q78 A;  3LP2 B;  3MEE A;  4RLE A;  2HHH J;  1U2F A;  3PW2 A;  1T05 B;  4LBI A;  3DKD A;  2MZQ A;  2M2B A;  2E1M C;  3H98 A;  3HFK A;  1ROF A;  4NLO A;  2WOM A;  1VQY A;  3M9M B;  1QE1 B;  3CCE S;  4P2X A;  1VOM A;  4DHV A;  2HHQ A;  3K89 A;  4ILL A;  1HNZ F;  4USK A;  1SKW A;  2O1P A;  3A12 A;  3AOC A;  3MCM A;  1W7W A;  5IV3 A;  2LQ9 A;  2MST A;  2ZM6 J;  1H98 A;  2UU9 J;  3E2E A;  3R1L A;  3K2Y A;  2FLL A;  3NNH A;  1BQM B;  2BX6 A;  4OYZ A;  3CJ3 A;  5F9L A;  4I6Y A;  2Y9H A;  1NCL A;  1M0S A;  3DHW C;  1YX2 A;  3GZ7 A;  2GO9 A;  3C6T A;  1UFK A;  2R7W A;  3GMG A;  4X4V A;  2LXU A;  3MCO A;  1NXI A;  3DRS A;  1U49 A;  1S1W A;  5KFG A;  5IWA F;  5KFR A;  1S72 S;  3C66 A;  3CC2 S;  4N8O A;  4M5M A;  1TKT B;  3EVW A;  2AGO A;  4ECV A;  2KO1 A;  1OSC A;  1MN7 A;  3Q8V A;  3ISZ A;  1U6Z A;  5L39 A;  3MWB A;  2HK2 A;  4DR3 F;  5CYM A;  3BDE A;  2JH3 A;  1RT5 B;  5THW A;  3KWM A;  2XHW A;  1T9U A;  1ELO A;  4KTQ A;  4W4M A;  2J7W A;  3MEG B;  3PYE A;  2MQM A;  3I0S B;  1SUQ A;  2W7A A;  3ZZU A;  4RUC A;  3RYL A;  1RTJ A;  3UO0 A;  3UD3 P;  3TAR A;  4EK2 A;  2CZ9 A;  1Q7Y T;  5F8I A;  3MMB B;  4CLP A;  4KQZ A;  4CLL A;  2F7V A;  4DR1 F;  4YFU A;  1ZAW A;  5KFN A;  4QWE A;  2DR9 A;  2BQU A;  1HBU A;  4NXM J;  3T1H F;  4ECS A;  1UTA A;  2DHA A;  3R5J B;  1FCA A;  3HVT B;  3W8G A;  1RA7 A;  3TVY A;  2DH9 A;  4NLR A;  5E3C A;  1JNZ B;  1Y3K A;  1S1U A;  3FBE A;  4ZPT R;  3QGH A;  2CPE A;  1OSD A;  3UCZ P;  2ZH1 A;  3DU6 A;  3FBC A;  2UP1 A;  4B3R J;  2IMW P;  2FHJ D;  1P9Q C;  1NHK L;  5E5N A;  4YP3 A;  2ZE2 A;  3N28 A;  4IRK A;  4HT5 A;  2V34 A;  3J7A N;  2HIY A;  1D1U A;  2MEW A;  2GVZ B;  4L73 A;  3LP0 B;  1RAD B;  3HHD A;  3DRR A;  4DV7 F;  2BMB A;  3DGP B;  2VG5 A;  1KTV A;  3K8V A;  3WX4 A;  5D6G A;  2QSF A;  1HNV A;  5DG8 A;  5A8R B;  2YKP A;  4B08 A;  2YQ0 A;  4QQB A;  3EDR B;  2FC9 A;  2J5A A;  3QIP A;  4K4Z A;  5AE3 A;  5KT5 A;  3EDQ B;  3KLH A;  3I4H X;  2FLP A;  2P6S A;  3PJ9 A;  3A1Y G;  4HVZ A;  3KNA A;  1RSC A;  3OD2 A;  3NY0 A;  2AYE A;  2L9D A;  2GAG C;  4Y28 C;  4LSZ B;  3E3X A;  4DSL A;  4N8N A;  1S10 A;  3GR1 A;  2JFD A;  1MLA A;  2DIV A;  2I5J B;  5KFC A;  3CSK A;  5KFZ A;  1K47 A;  1SL1 A;  2ROP A;  2OEL A;  3M9O B;  2BYC A;  4KKO B;  5D0R A;  1VS3 A;  2BA9 A;  3G71 S;  1CBK A;  5DLF A;  3US5 A;  3CCQ S;  3R8Y A;  5EX3 A;  4IG3 A;  5DDO C;  1HBM A;  3LAK A;  1H2U X;  2FGO A;  2CPY A;  4DZD A;  3LUY A;  4TY9 A;  2J7K A;  1M5P C;  5FLX U;  2V8D A;  2BE2 A;  2BKP A;  4MFB A;  1YI2 S;  2IAJ B;  2XY5 A;  4GKJ J;  2YNI B;  2GS8 A;  3LGM A;  2RIL A;  4MK7 A;  4OI6 A;  1CC7 A;  1UVM A;  3ULH A;  3POT B;  2LQ5 A;  1O5J A;  5FD1 A;  1KS2 A;  3H42 A;  2ACM A;  1Y3J A;  3ITH A;  4ED4 A;  3H4D A;  1RYR A;  4ID5 B;  3MMC B;  1S6Q B;  1JMT A;  2AX0 A;  5GAG I;  4NCA A;  1DQ9 A;  4OI1 A;  2J6S A;  4GRS A;  1P1T A;  1JX4 A;  1ZM4 A;  1M5H A;  1REV B;  2J0W A;  1A0O B;  1N5Y A;  2DGS A;  2YY3 A;  3MM9 A;  1H2V Z;  2AJQ A;  1A6L A;  4FXD A;  1Q5Y A;  1T9T A;  4OX8 A;  1HA1 A;  2V8G A;  2CQG A;  4OYP A;  2CPX A;  1AT1 B;  2QYG A;  3TEH B;  2GHW A;  4ZLN A;  1T9W A;  3SEO A;  1VGY A;  4PR6 A;  2BXJ A;  2BR0 A;  1XER A;  1J5O A;  1CUL B;  1HWU A;  3R5D A;  3N0V A;  5CCL A;  4U67 Q;  2QGF B;  2FC8 A;  1EAY C;  1HQ2 A;  4K2J A;  4LFC F;  4FS1 A;  4LRC A;  2QFI A;  2KXF A;  2VIC A;  1H73 A;  4ZIW A;  1RT2 A;  5J2P B;  5C24 B;  5KT3 A;  2PI4 A;  5D8H B;  3SCK E;  1T9Y A;  1YBT A;  1T02 A;  1SJ3 P;  3ZNU A;  1DLO B;  2DNL A;  3GV8 B;  4LBP A;  2B7C B;  2BOA A;  1YIJ S;  5CD4 H;  4FYW B;  4KJI A;  2OML A;  5F3Z A;  4NAS A;  3OBI A;  2VZ9 A;  2LXI A;  3UE2 A;  4YDX A;  1TL3 B;  3S7R A;  3KMS A;  2HVE A;  4YY3 F;  4WFB Q;  2OGU A;  1IM4 A;  4ZP9 A;  4ATN A;  3HI9 A;  3UD4 P;  3QJL A;  4ZIT A;  1T3O A;  2BUN A;  1VQ4 S;  5J1N A;  5D0E A;  1T3N A;  2JC1 A;  1NZ8 A;  3O1L A;  4B17 A;  3MMA B;  3PXG a;  4Q44 A;  5DGA A;  2KJV A;  3BSN A;  1NDC A;  4UT4 A;  5F8M A;  3FQK A;  1FD8 A;  1TEL A;  1RWP B;  4UQT A;  2PE8 A;  3VWS A;  5IT9 Y;  2BJD A;  2RDI A;  2AJ4 A;  2HQG A;  5KFW A;  1IVZ A;  2FZG B;  1UL3 A;  1HLW A;  5AXK A;  1FX2 A;  3IRW P;  3VCD A;  1U0S A;  4LFA F;  2AJ0 A;  4BHQ A;  4OMF G;  3MAA A;  4F0M A;  2ZNZ A;  1BQN B;  2ASY A;  3QAU A;  2B9Y A;  2RH3 A;  2K2P A;  3AB4 B;  3K5L A;  2IYI A;  1FK9 A;  3BGO P;  4EO8 A;  1HNX F;  2DGW A;  1M90 T;  4IFY A;  4OZN A;  4O3P A;  1NK7 A;  4B3S J;  3BH7 B;  2I8E A;  2EI5 A;  1XTZ A;  2OFH X;  2ZWP A;  3C6T B;  3CF5 Q;  5L38 A;  5KT7 A;  1BY9 A;  2V0N A;  2PMW A;  1TKZ A;  1D3W A;  1LFW A;  4IG0 A;  2MTL A;  2NRE A;  2RIJ A;  2V9W A;  3QMQ A;  1S1W B;  3AAW B;  3NS5 A;  3TUP A;  2ROG A;  4BS2 A;  5J2M A;  2LEA A;  4UW2 A;  4I6A A;  3PY8 A;  3KHH A;  2CVE A;  2J76 E;  1NHU A;  3DLK B;  1ZM3 A;  2JDJ A;  3EX7 B;  5KTQ A;  2HRY A;  1WHY A;  2B4P A;  4DUZ F;  1FFS B;  3MCN A;  3K5M A;  1ZBT A;  4CTA B;  4URS A;  3GYN A;  3VR1 A;  3JS9 A;  2F9D A;  1VBY A;  3HHL D;  4DPY A;  1VFJ A;  2C3Y A;  4PG4 A;  5ETT A;  2QV6 A;  1L3U A;  1KVJ A;  4DQQ A;  4QOT A;  1FRM A;  4ER8 A;  3CO0 P;  2AGP A;  3G6E S;  1N88 A;  2IVM A;  1WEZ A;  2DVI A;  1GMV A;  2ADC A;  2R7S A;  3A8I A;  2UUT A;  1V6H A;  1S1U B;  2V8H A;  1MU2 A;  4FBT A;  2D1C A;  1RT4 A;  4FYD A;  3EZU A;  4CT8 A;  4W90 B;  3CCU S;  3GFZ A;  5CYQ B;  3LAM A;  3QFW A;  2XTJ P;  1QUV A;  4XAK A;  2W9B B;  5ETO A;  1YIT S;  2JX2 A;  5JMN A;  4PWD B;  2CQB A;  2B5J B;  1CJT B;  1K8A T;  1S7I A;  5DRK A;  3DDK A;  5J2Q A;  1RQ0 A;  4OHX A;  2KDO A;  3MOZ A;  2E1C A;  4EYH B;  4LQ9 A;  3FJ2 A;  3PKM A;  4DR4 F;  2D69 A;  1FXL A;  1U2R A;  1ZH5 A;  1VRU B;  4C11 A;  3UI3 A;  3MI7 X;  1T11 A;  4USJ C;  3CCZ A;  4HAC A;  1KC8 T;  3ZZZ A;  1DAR A;  1DTT B;  2I6W A;  2RJZ A;  4HT7 A;  4PG6 A;  3QIP B;  3G82 B;  3SDE A;  5A6W A;  3T5J A;  4NXN F;  1U25 A;  2RHS B;  3TUI C;  1BGX T;  4DV4 J;  2P5V A;  2DXF A;  2DHX A;  2WZ1 A;  3Q8R B;  1MNE A;  1N52 B;  4CLF A;  2CA9 A;  4L72 B;  1NH7 A;  5JVG Q;  2WVF A;  2LYV A;  3KK3 B;  1F5A A;  1NPP A;  2HS0 A;  1V3S A;  4EO6 A;  3IAM 9;  2AW0 A;  2ZFH A;  4LF7 F;  5BYR A;  3GJR B;  1RAF B;  3R5C A;  3AHP A;  4ZKA A;  4F25 A;  3FCH A;  4DV3 J;  3RUB L;  4TU7 A;  3HHK A;  1T8E A;  1NLK L;  4IG3 B;  4WFA Q;  4DLG A;  1LWF B;  2G4B A;  4G65 A;  5LMU F;  2R7X A;  3IG1 A;  1RAB B;  1KBR A;  2M52 A;  1D8Z A;  3FK4 A;  2KYZ A;  2NYH A;  3V81 B;  3DOL B;  1ZM2 A;  4F7V A;  4N47 A;  4CT9 A;  2XLK A;  2HYI B;  2QTW A;  1IR0 A;  2F4F A;  1REG X;  3QFH A;  3KFW X;  1PJ6 A;  3JQJ A;  2GCF A;  2ZJR Q;  3D3C J;  2E44 A;  1EQM A;  3HP6 A;  4ZVT B;  4MT1 A;  2KJW A;  2H5E A;  1RTD B;  3D0I E;  4Q8E A;  3GFX A;  1LXN A;  1N36 J;  2D3Z A;  3ITH B;  1Y10 A;  4LT6 A;  1FKP B;  4M5I A;  1P27 B;  2VFR A;  4HH1 A;  5LM7 E;  4H4M B;  4X64 F;  3CD6 S;  4KHM A;  4QZV B;  3IXQ A;  1X7V A;  2X3D A;  1FFG B;  2XS5 A;  4DCP B;  2H5I B;  2WTF A;  4YB7 A;  4PWW A;  2QT7 A;  1HBN A;  1ZZN A;  1TL7 B;  1VJQ A;  2KZZ A;  2UV8 A;  3M9N B;  5L1L A;  3RB0 A;  3EGZ A;  3CCJ S;  1BD6 A;  2NQP A;  4HHJ A;  1N5T A;  2ZJP Q;  1IN0 A;  1UVK A;  1TMJ A;  4DFK A;  3PZP A;  3M7V A;  4NOH A;  1RWU A;  5KFH A;  1RHQ B;  5KFS A;  3M2R A;  2K1R A;  3TX8 A;  3FFI A;  3L9Z A;  3LAL A;  1T7P A;  2HQD A;  2XYG B;  3JXO A;  1FRH A;  2V8P A;  1GXT A;  1S77 D;  5L46 A;  4JOU A;  5HLF A;  2E7X A;  4A47 A;  1RHK B;  2I0X A;  3DOM B;  2GQ2 A;  2EKN A;  4BWM A;  4ICL A;  3D3B J;  1RGV A;  3OUY B;  4L75 A;  2JVR A;  2MLY A;  2HHT A;  4K59 A;  4X4O A;  4BC7 A;  5GMK a;  1RT2 B;  4MJK A;  4X62 J;  5H9F J;  3DM2 A;  3OXG A;  4DR7 F;  3OL7 A;  4KH1 B;  1HWI A;  3TAM B;  1QTN B;  3CC4 S;  4F4X A;  3KG4 A;  3VGV A;  2V5H G;  2HQ3 A;  4NMX A;  5L8R C;  2ZUG A;  5HL7 Q;  3E01 B;  3AFG A;  5G0R A;  4IRD A;  4DV1 J;  5HAT A;  3EGV A;  5IQ6 A;  2GO8 A;  4RW6 B;  3OR2 A;  3AQO A;  3G96 A;  3EXY A;  4EZ9 A;  2V4J B;  2MQL A;  4C3M A;  3LP1 A;  2DCU B;  4IO9 Q;  2E9R X;  1SXL A;  5DGB A;  2ZOF A;  4KPC A;  2IRU A;  2MLZ A;  4YR3 A;  3GV7 B;  2DO4 A;  4UOC A;  2MY7 A;  1S1X B;  2XLI A;  1HWK A;  5DM6 Q;  2XB2 D;  2CWK A;  2DH7 A;  3PR5 B;  2F4V J;  1XMQ J;  4JP8 A;  4RW4 B;  1XQI A;  4ZA1 A;  2HFN A;  1CS4 A;  4B3O A;  4NLU A;  2C2K B;  4FDF A;  1JWW A;  3BGL A;  2YWW A;  1QY7 A;  1YJN S;  2GAH C;  3M30 B;  2V2Q A;  3GIL A;  3HXM A;  4ZLJ A;  3OXF A;  2XO6 A;  3OXL A;  4ECX A;  2QC3 A;  1FNO A;  3PW5 A;  2N7Y A;  2GQC A;  3J7Z 5;  1CC8 A;  4NI2 A;  4S0M A;  4OFZ A;  1AFJ A;  3QLH A;  4J9P A;  2CQC A;  4DL0 C;  4NX9 A;  1URR A;  3RBZ A;  1WSR A;  2R3V A;  3FBF A;  4CP5 A;  2HLU A;  1JLQ A;  3P5T L;  4X2B A;  1UMJ A;  4PAA A;  4DSI A;  4ECQ A;  2KL8 A;  4NLS A;  4HHU A;  2XC9 A;  2HZA A;  3RZA A;  3M8Z A;  4LQ3 A;  3KLF A;  1RWM B;  1VR6 A;  5KG1 A;  5EDW A;  4OIX A;  4QIF A;  2R8K A;  4X66 J;  2AP6 A;  3DGV A;  4IG0 B;  2GHV C;  3G2X A;  3CD0 A;  2FZC B;  4L6V 3;  1YBA A;  2B43 A;  1URN A;  1N6Q A;  3UD5 A;  3V6K A;  5CAB A;  2F5G A;  4ZCL A;  3PYF A;  4PAB A;  4FVC A;  1FDD A;  2KVQ E;  4CNY A;  3QT7 A;  2OPQ A;  2IA6 A;  3A8J A;  1KQS R;  1WD6 A;  4F3O A;  2CPZ A;  1IBM J;  2AIR B;  2D74 B;  3IS9 B;  3DLE B;  1PO6 A;  1SKR A;  4PG7 A;  3W2V B;  4IQM A;  2V69 A;  2C2D A;  2CKW A;  1WTB A;  5K20 B;  2OPR A;  2M5Y A;  1WTF A;  2ZC4 A;  3AD9 C;  2RDD A;  1NKE A;  2H4W B;  2LVW A;  2RT3 A;  4U7U D;  2AJ2 A;  4ZVE A;  1VQP S;  1ULR A;  3G4S S;  4YB6 A;  1KOH A;  3GSD A;  4C8N A;  2WW8 A;  5FJ4 A;  4I2P B;  4X65 J;  2HG4 A;  2FPH X;  1QLN A;  3OLA A;  2F40 A;  1GT8 A;  2M7S A;  6FD1 A;  4K2X A;  1Q8I A;  5J2N A;  4G1Q A;  2FJV A;  4F2S A;  2V67 A;  4RBU A;  1CJV A;  1UW9 A;  2RS2 A;  4IOC Q;  4QR0 A;  1TL1 A;  2QLX A;  3I32 A;  4F26 A;  1RHR B;  1Q4R A;  1ZPW X;  1U45 A;  2ZZT A;  2ZH3 A;  2FLO A;  2PFD A;  3LPY A;  1Q8B A;  2YKN B;  1TAU A;  1RT4 B;  1NJX A;  4YB5 A;  5ETL A;  3JSR A;  4ZOS A;  5DDR C;  4OI2 A;  4O3N A;  3JTN A;  1BC6 A;  4GKK F;  1PYO B;  3CXC R;  2XMV A;  3IM9 A;  1OQ6 A;  1B0P A;  3D1O A;  3WIV A;  3M8Q B;  4JBC A;  4C8M A;  1RAE B;  4CM2 A;  3RB4 A;  2OPP B;  5J2Q B;  1VQN S;  5HVG A;  2QL9 B;  3Q22 A;  4NLX A;  3H20 A;  3KG0 A;  3CNQ P;  2OIH A;  1QUP A;  2HVI A;  3DMJ B;  2UUB J;  2XY7 A;  5CZV A;  4TYB A;  2WSC C;  1JXL A;  4I68 A;  2VQE F;  3IRX A;  2A6M A;  3FQL A;  2IRY A;  4JI1 F;  4PXE A;  4ED3 A;  2J6U A;  4ZK7 M;  1IKV A;  3I5B A;  1JLF A;  3NP5 A;  1SKS A;  3W7B A;  3BGF A;  4N56 A;  4CLK A;  4AL7 A;  3BR9 A;  4CH1 A;  2XWX A;  2ZHO A;  3MFH A;  3JAM Y;  5HO4 A;  2CDR B;  2L08 A;  1UEK A;  2VBX A;  5GAD I;  4OYI A;  2R7V A;  4HEA 9;  4CDI A;  1U1K A;  1W2B R;  1HYS B;  4ALZ A;  2KZM A;  3RU0 A;  4ES1 A;  3MR2 A;  1FWL A;  3GU0 A;  1BHN A;  3OQ2 A;  3F56 A;  2WSF C;  4EYI B;  3UPF A;  3C19 A;  3K8W A;  2YH0 A;  3IG1 B;  1XR7 A;  4CNZ A;  1JJ2 R;  1AXQ A;  3W62 A;  1GAO A;  2VPY B;  1IQT A;  1JXE A;  2R8I A;  3V6H A;  1Q79 A;  3R9L A;  1NHV A;  4QCL A;  1FNM A;  4X4R A;  2W2P P;  3TJ8 A;  2WRM A;  2DNH A;  4MYU A;  1X5O A;  2P6T A;  2PT0 A;  3S01 A;  2K8G A;  3EJM A;  3TI0 A;  1X0F A;  1FA0 A;  1RP5 A;  3TZY A;  2XWY A;  1F1B B;  5KOX A;  1KVI A;  3K57 A;  1RIS A;  1S0N A;  1S9G B;  4DPU A;  1A7G E;  3L7P A;  3T9N A;  1HMV B;  2DNR A;  4LR8 A;  1OY9 A;  1N54 B;  3HO1 A;  3CJ0 A;  3N6M A;  3MUT P;  1CJU A;  2XMT A;  3WBZ A;  4WF9 Q;  2J9D A;  2BAB A;  4J5O A;  4JYA F;  2Z0G A;  3B54 A;  4XIU A;  4R5P B;  3PW0 A;  1NSQ A;  3KJQ B;  2A18 A;  3N5B A;  2ZM6 F;  3KDO A;  1Q1K A;  2FJD B;  2D41 A;  3HSG A;  3U27 A;  3DLH A;  1RAC B;  2XG8 A;  1NAQ A;  1G6B A;  3DLL Q;  4RW9 A;  2JHE A;  4DV2 F;  1CPZ A;  4OV6 A;  3TJ9 A;  5KT2 A;  2K1R B;  2OLW A;  3TX0 A;  2ZH5 A;  3BGU A;  2Y1R I;  3G8S A;  5DO2 A;  4DV6 F;  3CJK A;  2QO3 A;  1NK8 A;  4LF8 J;  4CYU A;  5C2C A;  1S1T B;  1K1S A;  2ZHA A;  2OUG A;  1S99 A;  5HAN A;  1Y00 A;  3W8P A;  4K4S A;  4F02 A;  4DG1 A;  1S6O A;  4RNF A;  3GFH A;  2E5I A;  2YNH B;  3QZ7 A;  3DDN A;  4LRE A;  1DJ0 A;  3I82 A;  4LSL A;  1I6J A;  3H2U B;  4OZL A;  3D9B A;  4F4A A;  4P7V A;  3CCM S;  2YNG A;  2RS8 A;  4HI1 A;  2IVF B;  1FKO B;  1X31 C;  3AOD A;  3OL9 A;  1HHS A;  2YQ3 A;  5B0G A;  4KGK A;  1RT7 A;  3CMA S;  2MZT A;  3BKU A;  4UTG A;  2VBY A;  1RHJ B;  1K1Q A;  4K0K F;  3CW2 C;  4OV1 A;  4U8V A;  1F2G A;  4NXM F;  1HL6 A;  1XNR J;  3B4M A;  4H54 A;  1JLG B;  4JV0 A;  1Z4U A;  2E5J A;  5ETR A;  3UDE A;  1NK9 A;  1PCA A;  3VF0 B;  2N4D A;  3HHL B;  4DS4 A;  5MAO A;  3ADA C;  4KGV B;  3R3T A;  3GCX P;  3LOU A;  1QAI A;  2FVR A;  1E6V B;  1HQE A;  1FDB A;  4U96 A;  4DL7 A;  2L9N A;  2BQR A;  2LEC A;  3D7S B;  3GV5 B;  3M1V B;  4K7Q A;  4JI0 J;  2PMZ D;  3KNG A;  3TVZ A;  1FHT A;  2J9E A;  2ZIT A;  3OR1 B;  1RAJ A;  2YX1 A;  5ITH A;  3ISN D;  3C16 A;  1APS A;  2DR6 A;  4JV5 J;  2GZO A;  5M2P A;  2OJ3 A;  3PRD A;  3GSI A;  4CWB A;  2UVW A;  1FJE B;  2V68 A;  5M2U A;  2VFT A;  3M05 A;  4NA2 A;  5B0C A;  3RBD A;  4PQU A;  2FJB B;  1VK3 A;  3PDN A;  4DUY F;  2J8S A;  1TK0 A;  2UXC F;  3SIP B;  1IJE B;  3GIR A;  3KLV A;  5HMY A;  1IKY A;  4B3M F;  3NXZ A;  3MAQ A;  2IM2 A;  2IVY A;  3QO9 A;  2VFS A;  3W9I A;  4DU7 A;  5A2Q Y;  4DR5 J;  4ZVP B;  2FD2 A;  3OTO F;  1WSV A;  5JUM A;  5HK4 A;  3IAS 9;  1X4B A;  1S6P A;  4QU7 A;  3PV8 A;  1L3S A;  5D15 A;  5CQG A;  4JI5 F;  1FRX A;  2CDQ A;  1FX4 A;  3C15 B;  5L1K A;  2MGZ B;  4KRW A;  1N6Q B;  2LU1 A;  4CLW A;  4CO3 A;  3R2C J;  2RUS A;  2EG1 A;  3NCR A;  1U1P A;  2OSR A;  4X4S A;  1YBU A;  2K3K A;  1SQE A;  3HUL A;  3KTQ A;  4HDG A;  2JL9 A;  4DR6 F;  4ZJO A;  1WHW A;  5KG7 A;  4OX7 A;  2V6A A;  5KFX A;  2VG7 A;  4F3M A;  3UFC X;  4AQY F;  2GIF A;  2CVI A;  5LL6 d;  2OPR B;  4TNO A;  1N56 A;  2XS7 A;  1DUR A;  2X1A A;  1TV6 A;  4LMZ A;  2RF2 B;  3QZ8 A;  1VLO A;  3M32 A;  3BN4 A;  4NYP A;  2CPJ A;  1DFD A;  4MMO A;  3Q2T C;  4G1P A;  3BB5 A;  4QJV A;  4PXB A;  2M88 A;  3IGV A;  2YNF B;  2DNZ A;  4DV0 F;  3RAX A;  1S4F A;  1X8D A;  1SL2 A;  3R5B A;  4G1Q B;  4YR0 A;  4LIW A;  2GJI A;  3KUE A;  3M8W A;  2GIQ A;  2AYB A;  3EWG A;  3BBC A;  2CJA A;  3NGU A;  5HRO B;  5C25 A;  2QEX S;  2OHD A;  1N33 F;  2DY1 A;  3JSM A;  1FWK A;  2HAI A;  3T1Y F;  4CLU A;  4DF4 A;  2OTJ S;  4KE5 A;  2FJA B;  4DR2 F;  1W2I A;  3LW5 C;  1I94 J;  4DQI A;  2GGP B;  4QIG A;  4RW7 A;  1G1X A;  2XY6 A;  1F5C A;  3N6N A;  2FJX A;  1QM9 A;  2MYF A;  1HI0 P;  3NGD A;  1NJZ A;  3BBF A;  2MXY A;  4ZDN A;  3BZQ A;  1VHI A;  4QR1 A;  3VZH A;  5LJ5 Y;  4IR1 A;  3IRX B;  1FKA F;  5FLX Y;  4BCA A;  2CAD A;  2FJE B;  3VAF A;  4KR0 B;  2HZC A;  4ZCM A;  3KHR A;  2K7J A;  2HHX A;  1SIW B;  3MTJ A;  4R8U A;  3QPI A;  2W9C B;  2IJR A;  4LSN A;  2VPX B;  1N5Q A;  2BKO A;  2CUY A;  1T0T V;  3IC1 A;  4FF2 A;  5GAG U;  4M5L A;  1ITP A;  1Z2Z A;  1WOO A;  1VQ9 S;  4Z7C A;  1RTI B;  4AE5 A;  4C48 A;  4Q45 A;  1F3F A;  2CPF A;  3SZ2 A;  4IDK A;  3CCV S;  4RKU C;  4Y2I A;  4DX6 A;  5F3T A;  3P49 B;  4ANE A;  3ZC4 A;  3PTW A;  3NS7 B;  1Q95 G;  1ZPV A;  3BO3 A;  1JLB B;  2E9T A;  3NBP A;  4FVM A;  3KLI A;  1HR0 F;  3W60 A;  3CGI A;  1EKS A;  2R4F A;  1FRK A;  2YH1 A;  1J5E F;  3G87 A;  4FZV A;  4RO0 A;  2Z2Z A;  2LDY A;  2BRL A;  1FJC A;  5C42 A;  3MED A;  1O6X A;  3V6J A;  2MKI A;  4MIW A;  2F8M A;  1HWL A;  3DI6 A;  4O3O A;  1KLM B;  2AV5 A;  1FF2 A;  3RGI A;  2YWE A;  1HFE L;  3OTD A;  2RKI B;  2ZD1 B;  1CJU B;  3RB6 A;  1AUD A;  3E51 A;  1X4A A;  3U1N A;  2IJF A;  2CQ0 A;  1HIY A;  5ETN A;  2M8D B;  1RT1 A;  5D3G A;  1RAG B;  1U26 A;  4ZCK A;  2YX7 A;  3EXC X;  3T9Z A;  5K9F A;  4WWS A;  3UDL A;  2BE9 B;  4ETX A;  4AXJ A;  4ENO A;  5C5J A;  4P71 A;  1V3R A;  3GG1 A;  3RBE A;  1FNX H;  1KD1 T;  2NYI A;  1S5Z A;  5F8L A;  1Q81 T;  1U09 A;  2GV1 A;  4O23 A;  2HVD A;  5DZ7 A;  1U1L A;  4P9S A;  3MM7 B;  4KFB B;  1TUG B;  2HMI B;  2QLB B;  3ETO A;  4QYR A;  2OKQ A;  4USH A;  3SSS A;  4V1A k;  2ATL A;  1NSK L;  3B8H A;  3KLE A;  1Q8K A;  1YJV A;  4OX6 A;  3U7J A;  3MPV A;  2KHC A;  1TK5 A;  2HVZ A;  3CJ2 A;  4GC6 A;  5KFV A;  5KG5 A;  2PEB A;  1U1R A;  2FVQ A;  2ZZM A;  3RW7 A;  2NS1 B;  5IXU A;  3P5B P;  5DQG A;  1KHV A;  3K5N A;  1FWP A;  2YNG B;  3GIJ A;  3W63 A;  2RU9 A;  4Y2A A;  1TK8 A;  4YHH F;  2CYY A;  3QWP A;  1OQ3 A;  3PJW A;  1IR1 A;  3CCR S;  3TOQ A;  1RT7 B;  3I96 A;  2W01 A;  4RU2 A;  4ZN1 A;  1HHT P;  5EX0 A;  4OL8 A;  1OS5 A;  1CLF A;  2Z57 B;  2HNY A;  3NCP A;  1HNZ J;  1LWX A;  1S1V A;  3KLG A;  1RT3 A;  2Z8Q A;  4KHR A;  4TLR A;  1C0U A;  3GP9 A;  4M5D A;  2C2O B;  1G4C A;  1GK8 A;  4CLS A;  2FUG 9;  1WKL A;  4FN5 A;  3L7U A;  3JTO A;  2QZ8 A;  4K5S A;  3CDB A;  4TU9 A;  5B0D A;  5JJB A;  3GR0 A;  3GIM A;  4LRD A;  1D09 B;  2WVD A;  1IBK F;  1B7Y B;  1OYD A;  2W8K A;  3VGS A;  1S0M A;  3CED A;  2JEG A;  1TVR A;  4QU6 A;  4TY8 B;  1VCT A;  4OJG A;  5LSO A;  3EM1 A;  2RML A;  4P75 A;  2O3D A;  3PG9 A;  3C16 B;  5IWA J;  3CD7 A;  4I69 A;  4OYB A;  3I0R A;  5E3Q A;  4E0D A;  1UZD A;  3H5X A;  4J90 A;  4I7F A;  3B82 A;  3V4M A;  1RAI B;  3NGS A;  5HBM B;  2VAS A;  4IYQ A;  3MAH A;  1KNZ A;  2CXE A;  2YVS A;  2GW8 A;  4OYX A;  4KV8 A;  3M8R A;  3AJD A;  2VA2 A;  2GMJ A;  1VRT B;  3CME S;  3MPW A;  4WP8 A;  3BN7 A;  2OO4 A;  2OEK A;  3BV8 A;  2BAN A;  3HCX A;  3AXK A;  4DX5 A;  3CUN A;  1K9M T;  1UET A;  3NMR A;  1RK8 A;  4XO0 A;  3T41 A;  1SJQ A;  2VD3 A;  1S97 A;  1S6P B;  3KKF A;  4DR1 J;  4NE9 C;  5E2Q A;  4BWJ A;  3T1H J;  1UVN A;  4IUF A;  2ILZ A;  2EXU A;  3D4J A;  4BC9 A;  2GX8 A;  3FZB A;  2MMY A;  4WTY A;  2R2T A;  4LF9 F;  4DPX A;  4JV2 A;  2D3O R;  2MPU A;  1RT6 A;  1UJ6 A;  3T5H A;  1S4E A;  2I1R A;  4NYO A;  1GH8 A;  1LWE A;  2HSE B;  2Y1J A;  1RWW B;  2EFN A;  2OH2 A;  3FZ2 A;  2NR0 A;  2HND B;  5EHH A;  2MKS A;  3ZTS A;  1TV6 B;  3MM5 B;  3QJP A;  5B0A A;  4USI A;  1SL0 A;  4IOB A;  4ZHR A;  2UXB F;  4PG8 A;  4UY8 5;  2W4P A;  3ZZT A;  5BYQ A;  2EFG A;  4DV7 J;  2YBV A;  4DSK A;  4R0J A;  4ED8 A;  4Y0F A;  4UZC A;  2N7C A;  1N0V C;  5HJY A;  3HHL C;  3VAH A;  3GII A;  2XYH B;  4IFV A;  1OYE A;  3DRY A;  4RNM A;  3GYX B;  2H4Y B;  2C2Z B;  1EP4 A;  1IKX B;  1FRI A;  1JLC A;  1XWL A;  3EZO A;  3U02 A;  2JWN A;  3TZX A;  4NA1 A;  1SBR A;  2N3L A;  3PKY A;  3UN2 A;  2KT2 A;  3MEC A;  1KRP A;  2QFJ A;  1C0T B;  1KQG B;  1QSL A;  1E6Y B;  1YTY A;  3LH2 S;  1R27 B;  3ET6 A;  1ZAX A;  3JQM A;  2HFZ A;  3SFU A;  4DDF A;  4FPI A;  5T14 A;  3NCQ A;  2DGT A;  1SH2 A;  2R7O A;  2AD9 A;  1AW0 A;  3NAI A;  4IR9 A;  3BGR B;  3EVO A;  2WON A;  3TZW A;  2AJF E;  3R97 A;  5E7O B;  4DJB A;  4BDP A;  4O44 B;  4CLT A;  5GME A;  1X4G A;  3IWX A;  3M8P A;  5J1E A;  3DLB A;  1S9F A;  2FDN A;  4NCG B;  5SUH A;  1Y0H A;  3MD3 A;  4UUX A;  2XCA A;  3CT9 A;  4U7U K;  3ELH A;  4PXD A;  3C6U A;  4X4T A;  1NJY A;  4PKD B;  4E8U A;  1NBE B;  3QT5 A;  3KK2 B;  3DNC A;  4OYM A;  4Q2L A;  2BBE A;  1R8C A;  4WKR A;  4ZPW R;  1CG2 A;  1PBU A;  1SV5 B;  2W9A A;  1LWC A;  1VQM S;  1AFI A;  1RTH B;  1RUS A;  4YB1 P;  4CO0 A;  2BKN A;  3TO8 A;  1LXJ A;  3GON A;  3Q8U A;  5BR8 F;  1CSJ A;  4K4Y A;  2NPF A;  2COL A;  1DQ8 A;  4RJV A;  1ZA1 B;  3TA2 A;  3MPY A;  5B7W A;  3SI8 A;  5K8N A;  4F0K A;  1S12 A;  1H0H B;  1Y11 A;  4ETZ A;  5AJ3 F;  3J80 Y;  2UZA A;  3MXH P;  3C14 A;  3DLG B;  4DOZ A;  5FII A;  4DU8 A;  3IR7 B;  4RUH A;  4LF5 F;  1RWV B;  4NPO A;  4M95 A;  3W2W B;  5IT9 U;  1B7F A;  4I67 A;  2QMW A;  3ZO7 A;  1H38 A;  4PCQ A;  5CH7 B;  3OHB A;  1WI6 A;  4ZP8 A;  4OX9 F;  4ZJQ A;  3BQ0 A;  2HLT A;  2C3O A;  2BV3 A;  2Z56 B;  1HAR A;  4KT0 C;  2XNQ A;  4LFC J;  2VL1 A;  1BUX A;  2OD4 A;  3BSO A;  5A8K B;  4N76 A;  5GMD A;  5KFK A;  3BM7 A;  4WTO B;  4NZ6 A;  3OVA A;  4GVB B;  1N34 J;  3M6X A;  2YPZ A;  1BQX A;  5DDP C;  5CHC B;  3WC0 A;  3PHE A;  2YXL A;  4EUV A;  3ILJ A;  2KTQ A;  2CQP A;  1R43 A;  1UJ5 A;  3IR5 B;  1T03 B;  2MKY A;  2R2U A;  1M5V C;  5D4O A;  3P4U B;  1H7W A;  3QWU A;  2CJY B;  4A8Y A;  1QAY A;  2PII A;  4LR9 A;  5D4P A;  2CIM A;  2CQ2 A;  2HVH A;  4K4U A;  4YUD A;  2XMJ A;  4DSE A;  4X66 F;  2WW4 A;  1HPZ A;  4ZVR B;  4YY3 J;  2CFX A;  4X4U A;  4UOG A;  5A8W B;  2VBZ A;  5KFF A;  2D9P A;  4EGL A;  4X4N A;  2EW9 A;  2H65 B;  2IY5 B;  4HR2 A;  4WP3 A;  1WC1 A;  3NL0 A;  3OTC A;  4O4G A;  2HBZ B;  1JLE A;  4RX6 A;  4WFZ A;  3DHX A;  1EET A;  4H4K A;  2B4U A;  2EVZ A;  1VQ5 S;  2LA6 A;  2NXJ A;  4KH0 B;  1OPZ A;  4WXW A;  1K0V A;  4CQ1 A;  1KSP A;  4X65 F;  2CAJ A;  3W1Y C;  4JI2 F;  1IKW A;  1RTZ A;  4LF6 F;  1QAX A;  4EU0 A;  3MHY A;  1GMW A;  2BRK A;  4LFA J;  1CVJ A;  3HZE A;  1NJW A;  4RWX A;  2ZUA A;  2LXF A;  3VAG A;  2HNY B;  4C8L A;  2AYM A;  1U0H A;  2BW7 A;  2MKC A;  2ZH9 A;  4OYW A;  4M5D B;  4TQR A;  1WEL A;  2M8H A;  4WKY A;  5D4L A;  2IC3 A;  1QSY A;  2DNO A;  3S6E A;  2DD8 S;  2HHV A;  1VBZ A;  1NM2 A;  4C0B A;  2YTC A;  3A8K A;  5EWG A;  4EI2 A;  2F8E X;  1GXL A;  2AMC B;  2EPI A;  3GYG A;  3W66 A;  4J9M A;  3BSC A;  3Q8P B;  4JV1 A;  5DQH A;  1I3O B;  3PRB A;  5K5M A;  2CNL B;  2MJN A;  2HRT A;  2W4C A;  4KGM A;  3J81 j;  5KFU A;  1R0A B;  1RDR A;  3CB4 A;  3MTK A;  4Q8F A;  1MMN A;  1DTQ A;  3JYT B;  3CCL S;  2H54 B;  1GQE A;  5E3A A;  4O4R A;  3T3F A;  3VAI A;  4DL4 A;  4DUZ J;  3AT1 B;  2KU7 A;  1ZA2 B;  1HNI A;  5LJ3 Y;  1R8A A;  1HI8 A;  4AYB D;  2DIT A;  3MPU B;  2ZH8 A;  1R7I A;  3M8S A;  1SH0 A;  1G7C B;  1B0V A;  1MWZ A;  2QIF A;  5I3U A;  4Q7A A;  2DT9 A;  1HQU B;  4DZ6 A;  4RNH A;  5E3P A;  2FHM A;  4I2Q A;  1UPP A;  2VU5 A;  3MMJ A;  2L48 A;  3WHI A;  5D77 A;  2C2E A;  4PUO B;  5IM0 A;  3S1T A;  3GLJ A;  3QT6 A;  1F2H A;  2PO4 A;  2QLF B;  3DOK B;  2NPI A;  1Q82 T;  4ZPB A;  2VC1 A;  4NEZ A;  4YS2 A;  2HEK A;  3NMA A;  3R27 A;  5CD4 A;  2PC6 A;  3FEY B;  3OJS A;  3F41 A;  3M6W A;  2C22 A;  3PX6 A;  3UNG C;  1SC1 B;  1TKX A;  2DNK A;  2FHO B;  3ILL A;  1C1C A;  3FKB A;  1DHM A;  3Q24 A;  1SVD A;  2ADB A;  4D3H A;  5E3R A;  1WDT A;  3TP2 A;  1LW0 A;  4QWA A;  1C1B A;  3NLC A;  5B0B A;  2JC0 A;  2XSJ B;  5I42 B;  4M63 A;  4YR2 A;  2O66 A;  1C4C A;  4K4V A;  3THT A;  1JXV A;  4ANC A;  3FDS A;  1UWB A;  3V4I A;  1NB7 A;  2KM8 C;  1TP7 A;  1HBO A;  2IRX A;  4LRF A;  3NWR A;  2VQF J;  5MLC V;  1EP4 B;  2ALY B;  2NZ4 A;  1WHX A;  2FQQ B;  2HBY B;  5A0Y B;  2DRD A;  2DR5 A;  1KON A;  3RR8 A;  2ZDO A;  2GC8 A;  3D66 A;  2ZBR A;  2E5G A;  4U7C A;  2EC2 A;  5KG2 A;  5GAD U;  3F73 A;  4RW8 B;  3NGK A;  5FDL B;  4H4K C;  3M2U A;  2CQ1 A;  4KPY A;  3ZZP A;  3HJF A;  2BJ3 A;  5LSL A;  5KFM A;  2GVD B;  1XR5 A;  4LF8 F;  3BPD A;  2MSS A;  3L7O A;  5GAE I;  1EJ7 L;  2MQN A;  4LVO P;  3JQK A;  2HFV A;  2M9K A;  3MUR P;  5LMU J;  5F9N A;  1PBA A;  5GAH I;  1Q5V A;  1I1G A;  1SJ1 A;  4UZB A;  4C8K A;  4M5N A;  3KHG A;  2RE1 A;  5B09 A;  3VQS A;  5CA5 A;  2VG6 B;  2Y1I A;  1M5K C;  2Z2Y B;  2AEF A;  4YEA A;  3FCW A;  2LKZ A;  3UVJ B;  2O67 A;  5EGY A;  2YWF A;  2HS3 A;  3FSY A;  2B8P A;  2DXD A;  1SB6 A;  3H8Y A;  2VOD A;  3M2V B;  4PEO A;  1KOO A;  2G2Y A;  1M1K T;  4NZ0 A;  1T05 A;  2I38 A;  3TAN A;  1TR0 A;  2J0Q D;  2ZEJ A;  2WB1 D;  1LW2 B;  2IM1 A;  4X64 J;  2B9W A;  1QE1 A;  1S6U A;  2X1B A;  2K06 A;  1EHW A;  2XGQ A;  2OMO A;  4WE1 B;  4FP9 A;  1H7X A;  4DQS A;  4C98 A;  3WX8 A;  2B4V A;  2W8L A;  1DQA A;  3J81 Y;  2BDP A;  5B0E A;  1VBK A;  1R89 A;  3I87 A;  2O5D A;  2GFF A;  7AT1 B;  1BQM A;  4Z7Y A;  4USU A;  2AEM A;  3PEJ A;  1RU2 A;  3H2L A;  3GPA A;  2FGC A;  1GTH A;  1VQS A;  1FXD A;  1X9M A;  1BWE A;  1Q53 A;  4JI0 F;  4EBD A;  4QYZ K;  3MEK A;  4CIO A;  2KT5 A;  2FZK B;  3F0N A;  1MSW D;  4DCJ B;  1TL5 A;  2ASL A;  2DTJ A;  2DHS A;  3MEE B;  1RCO B;  4LRA A;  4JV5 F;  3I4P A;  1D0E A;  1TKT A;  3OVS A;  4C8Y A;  2IYG A;  3CE8 A;  2EG2 A;  3QBC A;  5EWE A;  2JRS A;  4MKA A;  1KDN A;  3VAM A;  3OFE A;  3TYT A;  4J9Q A;  1RT5 A;  1SI9 A;  3SXL A;  4QW8 A;  2WOM B;  1BE4 A;  3JTP A;  3GJT B;  3NOG A;  4QPX A;  2B9X A;  3NRB A;  3MEG A;  1V9O A;  3TEG A;  3BDP A;  3I0S A;  4FF1 A;  1XR6 A;  3MFI A;  1XNQ F;  1UVI A;  3OL6 A;  4BBY A;  3QSI A;  4V19 X;  2V4Q A;  1NEE A;  3MMB A;  1Y7P A;  1TUV A;  4O3R A;  3HKZ D;  2LP4 A;  2QG9 B;  2DRA A;  3IBW A;  2FYX A;  1YZ7 A;  2PD1 A;  1RAA B;  1K0T A;  2GNK A;  1GX6 A;  2UUA F;  1VRQ C;  5K8O A;  3PW7 A;  3B4D A;  1OY6 A;  3Q8Y A;  2ASJ A;  3HVT A;  2KT3 A;  3GB0 A;  1GX5 A;  4RZR A;  2KHD A;  3DRS B;  1FRJ A;  2XUL A;  2AX1 A;  5HQL A;  4C0H A;  1EIY B;  4UUW A;  1IBL J;  1B0T A;  3GCW P;  4O4G B;  4A8M P;  1JLE B;  3CVK A;  5CYM B;  3NS6 A;  5HQ8 A;  4ZP7 A;  2Z30 B;  2PEH A;  1FE0 A;  4FBU A;  1SQG A;  2P8I A;  1FJG F;  1SUQ B;  3LP0 A;  3TQ1 A;  2UXD F;  2KG0 A;  2HHU A;  3DGP A;  4ZVS B;  1RTJ B;  3V5R A;  1X4D A;  5A8R A;  1M5S A;  1SC6 A;  4JI6 F;  3HSJ A;  4KHP J;  2DJW A;  3PO5 A;  1KQF B;  1PGZ A;  1WF2 A;  3GE9 A;  2X7I A;  1HBU B;  3HZG A;  4CH0 S;  2OPS A;  2IC3 B;  4X84 A;  4CI0 B;  4P7T A;  1UA0 A;  2X51 A;  1HNW F;  2RQK A;  4LBH A;  4A8O A;  1B4S A;  2MB0 B;  4PYA A;  3M4X A;  2MKK A;  4USV A;  4ZJL A;  2CJ9 A;  4WPA A;  1XMO F;  3CJ8 A;  3OTE A;  3AOA A;  2VJV A;  2G0C A;  2HIQ A;  4CH7 A;  4YN3 B;  1M5O C;  4P6Q A;  4UF4 A;  2V50 A;  5ETK A;  1OWX A;  2XQC A;  3NEK A;  3O5T B;  4H4O A;  1CQM A;  3OPK A;  2YWH A;  1KLN A;  2AJ1 A;  4DPO A;  2ZE2 B;  3R6L B;  2KFZ A;  3ISN C;  2B3T B;  1B70 B;  2IM3 A;  2CJQ A;  3DRR B;  1FTR A;  3SQG A;  2XS2 A;  2VG5 B;  2IAJ A;  2YNI A;  1HNV B;  2J6T A;  1HNI B;  3HVA A;  3POT A;  2ZDP A;  1W26 A;  1IWA A;  3JAM U;  3MF5 A;  3GQC A;  2CPD A;  1WKK A;  3KLH B;  3THV A;  2D7S A;  3TUJ C;  1WUU A;  4ID5 A;  3MMC A;  4I1T A;  3UQS A;  1U1N A;  4GO7 X;  1U4B A;  3ETM A;  1S6Q A;  3ILO A;  2Y3Y A;  5IS2 A;  1X0P A;  3KJV A;  4EFA C;  3BO2 A;  4AND A;  2HKE A;  2OD6 A;  3CJR A;  3A8E A;  4USM A;  1RU1 A;  1XEZ A;  2HK3 A;  3LO3 A;  3R6G B;  4G6V B;  4L3N A;  1QDU B;  1O8B A;  1REV A;  3BS9 A;  2FY1 A;  3IA0 A;  2POK A;  2W2O P;  1HBM B;  5C2G A;  2ZVI A;  1N0U A;  4ECW A;  4P10 A;  2DNG A;  4GKK J;  2HFU A;  3A3O B;  3BQ1 A;  2OAU A;  2BE2 B;  3M8Y A;  2V2K A;  4MFB B;  4DX8 H;  3HKW A;  4DPT A;  2GML A;  1YSJ A;  3D5M A;  2V94 A;  3UNY A;  3FSI A;  2CZ4 A;  1LW0 B;  5ETS A;  1U1Q A;  5DZ6 A;  1XC9 A;  1RE1 B;  4DMZ A;  4DV5 F;  4YOE A;  1VQO S;  1NJI T;  1LK7 A;  3OSP A;  2XMK A;  1FVQ A;  4F4Y A;  4JI3 F;  2GJ2 A;  2VQE J;  4OQJ A;  4JI1 J;  4G3I A;  1IUJ A;  5J2P A;  4WYW A;  5C24 A;  5CAA A;  4B9V A;  8RUC A;  1Q16 B;  2PI5 A;  4FNI A;  2A6O A;  4Q43 A;  3L09 A;  2V63 A;  5HMW A;  2DNN A;  3LWL A;  1NRK A;  1OIA A;  1U02 A;  1PJ7 A;  4ZCI A;  4XPC A;  1N5Y B;  2OFG X;  1PAE X;  3T5L A;  3MM9 B;  4TXS A;  4WZQ A;  1RB0 A;  4JI8 F;  2IJN A;  2VOP A;  3CCT A;  2BVZ A;  4HLB A;  5LMN F;  3FMW A;  1TL3 A;  1P8G A;  4OHZ A;  1Y4Z B;  1TFY A;  3R5G A;  4OHY A;  4DFP A;  2XM3 A;  1OY8 A;  2CNO B;  4HDH A;  2UVR A;  3UDC A;  4DBQ A;  1ZTT A;  1AA1 B;  1J5O B;  3IBF B;  1SCJ B;  4DCO B;  1UP1 A;  1SJF A;  3BR8 A;  2KB2 A;  2W25 A;  1FEH A;  2DR7 A;  1EZZ B;  5LT5 A;  2HQC A;  1RCX B;  4MTP A;  3D0H E;  3G86 A;  2YQ1 A;  1AYE A;  4QYZ J;  3MMA A;  1KKH A;  5HN0 A;  2Y0S D;  2UUC F;  4DN9 A;  1R0B G;  4F36 A;  4X4Q A;  4OJ1 A;  2GA7 A;  5LSR A;  3BO4 A;  1JB0 C;  2MZR A;  1GNK A;  4J7C A;  2DY9 A;  3E8O A;  2MQO A;  1Z2L A;  4FYX B;  2V2V A;  4RNN A;  3LAN A;  5KFT A;  2KVI A;  2ZVS A;  4JYA J;  2C3M A;  1BQN A;  2VF3 A;  2X1F A;  4Y2M A;  5LXR A;  2VPZ B;  3H59 A;  4NML A;  1V5I B;  3GIK A;  1U7L A;  4ECU A;  2EK6 A;  3AQP A;  2EC0 A;  3KK1 A;  4DV2 J;  3DYA A;  3AB2 B;  5F8H A;  5EWF A;  2LEB A;  3D68 A;  2CPH A;  1SPB P;  2ATC B;  4YDD B;  5KFJ A;  3Q8S B;  4DV6 J;  4M5K A;  2G2O A;  4C2M A;  5KFE A;  5D0G A;  1ZET A;  1LK5 A;  2PFF B;  5I3Q A;  2NSB A;  2ERR A;  3ZNJ 1;  4AL6 A;  4XDD A;  2HUR A;  3I9Z A;  1NDP A;  2LQJ A;  3LPE A;  3DLK A;  1YVF A;  4AXI A;  3JB9 k;  2ZNY A;  3WC2 A;  3NAH A;  3MPD A;  2JSX A;  2QLJ B;  3QQC D;  2EFQ A;  3SQO P;  3SSR A;  4C97 A;  3HDS A;  5A2Q U;  4XK8 C;  2PN6 A;  3CD5 A;  1UEV A;  3HFV A;  2D3O 1;  4CTA A;  3MAA B;  4NYZ A;  2IFX A;  2BQ3 A;  3ICL A;  1PC4 A;  1RZM A;  4CLY A;  1PJ5 A;  1S0V A;  5DQI A;  1FK9 B;  1T9X A;  2E1A A;  4IFY B;  2A2D A;  2XHC A;  3PYG A;  4K0K J;  1RWK B;  4JI4 F;  2KFN A;  4QBU A;  2R7U A;  2R7T A;  4B3T F;  4OYA A;  3QT8 A;  2H48 B;  1DY3 A;  4WFN Q;  1TKZ B;  5DET A;  4E2F B;  4WK1 A;  1BLU A;  2VH7 A;  1ZAV A;  2E29 A;  2IDL A;  1ACM B;  4J91 A;  1X9S A;  2V9K A;  1RLD A;  5J2M B;  2AYG A;  4DUT A;  1N48 A;  1K73 T;  2K3I A;  5CYQ A;  3D2W A;  2VOO A;  3U1M A;  5HAO A;  3U1L A;  2W1B A;  2W9B A;  2W24 A;  4ERD A;  4LFB F;  2Q1L A;  3GG0 A;  2QYC A;  4PWD A;  2B5J A;  4JI7 F;  4FKY A;  1CJT A;  1V3Z A;  3CCS S;  2E5L F;  2V8V A;  1KP6 A;  3MOJ B;  1WEY A;  4MIB A;  4ED7 A;  3ZXW A;  1AB8 A;  4Q5V A;  3UWT A;  3AA8 A;  1GXU A;  3H0P A;  1VRU A;  4DI6 A;  4NZ7 A;  1S9E A;  4RNO A;  4LR7 A;  3P45 B;  1F6T A;  1DTT A;  4DUY J;  3TRG A;  2UXC J;  3G82 A;  2XYP B;  4B3M J;  2CRL A;  4DF8 A;  4NL5 A;  2HBQ B;  3RB3 A;  4F8R A;  3C46 A;  3UR3 C;  1HW9 A;  4LF4 F;  3NNA A;  2RQ4 A;  2OPS B;  2VB6 A;  3J7Y I;  3CDA A;  3IM8 A;  3OTO J;  1T94 A;  4LF1 A;  3ENW A;  4K5R A;  3RTV A;  3KK3 A;  1MN9 A;  1NSP A;  2HQF A;  2ZWO A;  3N01 A;  3ILI A;  4LF2 A;  3DLJ A;  3RBX A;  1S59 A;  2IHR 1;  5HP1 A;  4ELV A;  1B99 A;  4JI5 J;  3H5U A;  1MU2 B;  3UDV A;  3MM6 A;  1S0O A;  2ZJQ Q;  3DCA A;  3HD1 A;  4H4O B;  2F3J A;  3SCJ E;  5K8P A;  4V19 J;  3H25 A;  1LWF A;  1UWA A;  4WZM A;  2OEM A;  5E41 A;  5KFB A;  4ES3 A;  3RRG A;  1YJR A;  1TAQ A;  5KFI A;  1UCN A;  2RRB A;  1ZTW A;  2PDA A;  2DH8 A;  4DR6 J;  4O0I A;  3V81 A;  3DOL A;  1X4E A;  3SQG B;  1N32 F;  4PXC A;  1IWG A;  4AQY J;  4C11 B;  5EN1 A;  3HM9 A;  4HAC B;  5DG7 A;  2HGM A;  2CQH A;  1PIE A;  4EEY A;  4UOH A;  1SKU B;  3SDE B;  2ZKU A;  3N9U C;  4CO4 A;  2LDI A;  3D0G E;  2DHG A;  1RTD A;  5T41 A;  4F4W A;  2UVV A;  4PPZ A;  1FKP A;  3QSY B;  4TKT A;  2BJ1 A;  3W9J A;  4DV0 J;  4H4M A;  4EBC A;  1R8B A;  3KJV B;  5IT0 A;  3ZZO A;  4DLE A;  4NLT A;  4G1I A;  3WDO A;  1SH3 A;  3MZI A;  1WKJ A;  1KN6 A;  4A8Q A;  5AXM A;  3PRV A;  4C7Q A;  3PVX A;  1VDH A;  1VC0 A;  2DPI A;  1DBD A;  4URQ U;  2V2Z A;  2ZOM A;  1TL7 A;  1AZS A;  3TVK A;  2L9W A;  3MDF A;  2QA1 A;  1N33 J;  2M0G B;  3OTB A;  3PYD A;  3DFE A;  4R25 A;  5BYS A;  3T1Y J;  2BJ7 A;  4E98 A;  5A6P A;  5F8N A;  1F60 B;  1YRX A;  5LXY A;  4DR2 J;  1RKJ A;  2DIS A;  1IXK A;  2B7B B;  4A8F A;  4J9O A;  5DLG A;  1PAU B;  3DOM A;  1FTC A;  1IJF B;  2DGX A;  2HHH F;  2C28 A;  4ZPA A;  3QNW B;  1ZYQ A;  3OUY A;  1F9H A;  1D9A A;  2A1B A;  4DFM A;  3AJ1 A;  4Y6I A;  2Z58 B;  1N34 F;  4M94 A;  1U6B A;  3VQT A;  3TAM A;  1U48 A;  2DCL A;  3K17 A;  3IGN A;  4CRJ A;  4DN0 A;  2A0F B;  3CMQ A;  3E01 A;  1HBN B;  3VVU A;  3VHQ A;  2UU9 F;  1O0P A;  4WU2 A;  4EBE A;  1KWM A;  4RW6 A;  4GMK A;  2PSZ A;  2V4J A;  4Y2K A;  3BRE A;  3M2R B;  3OL8 A;  3K59 A;  1S57 A;  2WK4 A;  4J9K A;  1R31 A;  4X4P A;  3FFI B;  1P6T A;  4EMD A;  4O0N A;  3UW1 A;  3OSN A;  1WC4 A;  4DL5 A;  4OI0 A;  1S1X A;  1HR0 J;  2VHG A;  1FRL A;  3CJQ A;  5HLF B;  2P9E A;  3W5X A;  4ICL B;  4RW4 A;  1J5E J;  2C2R A;  5IV4 A;  3CPW R;  1QVG R;  2QL5 B;  4AFF A;  2RNE A;  3LTO A;  4CO5 A;  3HX9 A;  2QSW A;  4OJH A;  5H9F K;  4C3L A;  4ZMM A;  2NXU A;  5CYJ A;  5ADZ A;  1JJC B;  4NLY A;  3DM2 B;  3M30 A;  2HBR B;  4W92 B;  5ETM A;  4NRT A;  3NNC A;  2MQP A;  3MCS A;  2R2S A;  2OI2 A;  2CZV C;  2XMU A;  5G0R B;  2AF6 A;  1YRT A;  4RR5 A;  1F0X A;  2KI2 A;  1BXN A;  1C2P A;  3ZTO A;  2FHJ A;  1YGY A;  3OR2 B;  3IN5 A;  3PNI A;  3C2P A;  2WVE A;  4DL6 A;  2RU3 A;  3VAL A;  1U1O A;  2B4O A;  3D28 A;  1I51 B;  3LP1 B;  1X4F A;  4Y34 A;  1PKU A;  4KO0 A;  3W64 A;  4ED1 A;  1RWO B;  3KK1 B;  3DYA B;  5HVH A;  3OJU A;  1N4L A;  4F4K A;  3KHL A;  3UN3 A;  2CNK B;  2B6A A;  3MM8 A;  2VPW B;  4J37 A;  3EPI A;  4B3R F;  1CS4 B;  2IBK A;  4B3O B;  2DNY A;  2CJK A;  3KJN B;  4GVL A;  4ELT A;  3LF0 A;  2VIH A;  4ZLL A;  4B9N A;  2KFY A;  5IFM A;  3IS9 A;  3DLE A;  4HTI A;  2C3P A;  2LU2 A;  3KYL A;  3W2V A;  1HD1 A;  4NI2 B;  3EZ5 A;  1O51 A;  2XI3 A;  3QLH B;  3BQ2 A;  1RHM B;  3H5S A;  4RPF A;  1NZA A;  3ONQ A;  4YHH J;  1JLQ B;  4K4W A;  4FPR A;  4I2P A;  1FD2 A;  4FS2 A;  2CWX A;  1QVF R;  2E7W A;  3ZTQ A;  2QMX A;  2W7O A;  3RJM B;  2G1H A;  2ZH4 A;  3Q83 A;  2ALZ A;  2JVO A;  5F41 A;  2CJB A;  2NLW A;  4QIE A;  2IBO A;  4L3K A;  2QL7 B;  4ED0 A;  2YKQ A;  3KLF B;  2DRB A;  3OHA A;  5J1P A;  5K14 A;  2CPI A;  2WHO A;  2MKH A;  3IO1 A;  3T19 A;  4FNH A;  1UFL A;  4W98 A;  3OVB A;  1X5T A;  3HFZ B;  1S7H A;  1JJ4 A;  1RAH B;  1VIO A;  3R7N B;  1D9D A;  2CQ4 A;  4DWI A;  3VVT A;  2JEJ A;  2VFV A;  2HWI A;  2YKN A;  4GC7 A;  4OZ0 A;  2OPQ B;  1WEX A;  5F0W A;  1IBK J;  3DXB A;  3MR3 A;  3VAJ A;  1TUW A;  4KB7 A;  2RQM A;  3H90 A;  3PIO Q;  1UFW A;  2HFS A;  3PM9 A;  3M8Q A;  4GKJ F;  2APO A;  1X4C A;  2ABY A;  2LEP A;  2OPP A;  3M6V A;  3I55 S;  3EYZ A;  3AXM A;  1NK5 A;  2XZD B;  2NXN A;  2ZZN A;  4TVA B;  1IQZ A;  2F65 A;  3DMJ A;  3FRY A;  2CNN B;  1S9E B;  2LCW A;  5CZX A;  3VV2 B;  4ZPV R;  4M8L A;  2AQ4 A;  1NSA A;  2VQF F;  1CJK A;  5J2N B;  1CJV B;  3AOB A;  5AT1 B;  2ZC3 A;  1H6K X;  3CDU A;  3BH6 B;  1D9F A;  3HHN B;  1TL1 B;  2BEF A;  2I2Y A;  3D6F B;  3HJV A;  1MRO A;  3KUG A;  1J27 A;  1XN9 A;  3DRX A;  4QW9 A;  1H74 A;  2BJ9 A;  5HP1 B;  2R2R A;  2X3G A;  2OP5 A;  1WC6 A;  3MM6 B;  5KAK A;  4MKV A;  1HYS A;  1NU4 A;  4WK3 A;  1ZZF A;  3UR0 A;  4LF9 J;  1KVK A;  4RBV A;  3D1H A;  1WC5 A;  2Y0B B;  2EEY A;  2XBP A;  1A9N B;  4OJ3 A;  1RBO B;  2IIH A;  4AT1 B;  1YJT A;  2WCX A;  3G8Q A;  2E66 A;  3R7S B;  3TAP A;  3ENQ A;  1EX8 A;  5HI7 A;  3FSX A;  2H5J B;  2QRR A;  1IKV B;  2UXB J;  1JLF B;  4WBF A;  4UQG A;  4HKQ A;  4EWT A;  4QIW D;  2VFU A;  2C2N A;  1LEO A;  1S9G A;  5IC6 B;  9ATC B;  3BF4 A;  1HMV A;  5RUB A;  3CDW A;  4C8Z A;  3EIC A;  5GVQ A;  2VA3 A;  1F9F A;  2E1P A;  1FFW B;  3FC9 A;  3LWM A;  4R5P A;  1YQH A;  3ZZ0 A;  2MKJ A;  5KFP A;  5I3P A;  3TAQ A;  1WWH A;  1AZS B;  3PIP Q;  1YRU A;  2DGQ A;  2MLX A;  3FNN A;  3K0J A;  2Q66 A;  3J80 U;  5E33 A;  3T6J A;  2LLZ A;  2A3J A;  3QRR A;  5ETP A;  4P72 A;  1SIZ A;  4RWW A;  3FEX B;  2FY8 A;  2KRR A;  1WF0 A;  1WG4 A;  2FHK A;  4P2S A;  4M5G A;  1VQ8 S;  2G0J A;  1HWJ A;  3Q89 A;  1FT8 A;  4F04 B;  1JNR B;  3UCG A;  2VDH A;  5KFD A;  1NPK A;  1S1T A;  3TNV A;  3WIU A;  5GAE U;  4B9M A;  3SCI E;  2YKM A;  2JLE A;  2QA4 S;  1G3O A;  4OI3 A;  2ZBC A;  3R5A A;  5GAH U;  3FBB A;  4A4J A;  3VZI A;  1RA6 A;  1RLC L;  1H2T Z;  1MW7 A;  2YNH A;  2RHQ B;  3D6H B;  4KIA A;  1NDK A;  1R6V A;  4YME A;  2DK2 A;  3O6Q A;  4ECZ A;  1L3K A;  2RSQ A;  4M5J A;  1NDL A;  4C8O A;  1FES A;  3J7A 1;  2N4C A;  4RU9 A;  3C8Y A;  5KT6 A;  4F4Z A;  4ZVQ B;  2MHN A;  2EKY A;  3WQP A;  4Q2M A;  5AXL A;  1FKO A;  2JEI A;  2VC0 A;  4LUB A;  3PX4 A;  1FO1 A;  2MZJ A;  2M4M A;  1WC0 A;  3ZTR A;  2D9O A;  1NK0 A;  3TZZ A;  1VQK S;  3PFO A;  4B3S F;  4RW9 B;  2BM0 A;  2RDJ A;  3CUL A;  4NLP A;  2RRA A;  3GTY X;  4Y65 A;  1JLG A;  1EB0 A;  2M3D A;  1JQG A;  1OO0 B;  5BR8 J;  1R8H A;  4TN2 A;  3CJK B;  2XMA A;  3PX0 A;  2CG8 A;  4CYU B;  2A2C A;  1NME B;  3HHL A;  2N3O A;  4ILM A;  4GO5 X;  2DR8 A;  2FVS A;  3Q8Q B;  4PPD A;  2DHH A;  4DG1 B;  1E6V A;  1X5P A;  3VAK A;  1NK6 A;  3OFG A;  4NWB A;  1UZH A;  4HTJ A;  3A4T A;  5AJ3 J;  2C3U A;  4TU8 A;  2CQD A;  1CEZ A;  3F44 A;  3HD2 A;  3AA9 A;  2DO0 A;  4B9T A;  4LF5 J;  1F5B A;  1S48 A;  3P3D A;  1IBL F;  1VQ6 S;  3M1V A;  1KEK A;  2DYA A;  4QR2 A;  2VUG A;  4OX9 J;  3KUH A;  3GWC A;  4LSL B;  3K5P A;  3OR1 A;  3DC2 A;  1XBW A;  4F0H A;  4JUZ A;  3DDI A;  4JB8 B;  1B3T A;  4XTT A;  2MZS A;  2HGN A;  3QGI A;  4XPE A;  4OLO A;  1TQL A;  3IBC B;  1TZ0 A;  4KAI A;  3DXS X;  4WCE Q;  2ZBP A;  2HWH A;  4KHP F;  5ETV A;  2ZKT A;  1NO8 A;  3PO4 A;  3FGV A;  5L9N A;  2QJ3 A;  1Q7L B;  4CCH A;  2BM1 A;  3MUM P;  3A13 A;  4HL9 A;  3TR5 A;  3HT0 A;  2ZBQ A;  2XCP A;  4KO0 B;  4A8X A;  2OTL S;  5KG6 A;  3CJ4 A;  1KFD A;  4ZP6 A;  2BAC A;  2DGV A;  4FYV B;  1YKW A;  3N79 A;  2XO7 A;  1HQE B;  2B6A B;  3MM8 B;  4TYA A;  1VI7 A;  3KXD A;  4F2R A;  4DL2 A;  3C15 A;  2MGZ A;  2P9G A;  2MQ8 A;  3PW4 A;  3NOC A;  2PA8 D;  3IP0 A;  1QAJ A;  5IOL A;  5U47 A;  2AHO B;  4ILR A;  3TW0 A;  4ED6 A;  1B64 A;  1U6F A;  1Y5N B;  4OHW A;  4C9D A;  3JSY A;  5HQM A;  1MG7 A;  2HHS A;  3DU5 A;  5KFY A;  4J9U E;  5LOQ A;  2KXH A;  2NXE A;  3LGN A;  3M6U A;  2HGL A;  3R7B B;  4DR3 J;  4PQU B;  2FTR A;  1UKU A;  3HVW A;  2PMH A;  2RF2 A;  4Y00 A;  1IKY B;  3ENA A;  3QO9 B;  4DV4 F;  4JI2 J;  3SSQ A;  1FI4 A;  4LF6 J;  2KYX A;  4QWC A;  2MDA A;  2YNF A;  2RAQ A;  2UV8 G;  1WDD A;  3HK2 A;  3HMJ G;  4LJM A;  3D6M B;  1DAX A;  4A8S A;  5K14 B;  4QWD A;  4RUB A;  3R1H A;  2NZC A;  3C3L A;  4YQW A;  2RRN A;  4MYT A;  2E5H A;  4N7T A;  3QID A;  2Q3P A;  4DV3 F;  1U8S A;  4ZVG A;  4UOF A;  5HRO A;  4FF3 A;  2WVB A;  2JLF A;  2DXE A;  2VBW A;  4IH5 A;  1H3D A;  1RAO A;  1G2E A;  3J7Z T;  1SC3 B;  3MGJ A;  1YHQ S;  2ACY A;  3S8S A;  1LV5 A;  4K4X A;  1GMW D;  1FVS A;  3CIZ A;  2VG7 B;  2RQC A;  2GGP A;  3EGW B;  4USW A;  2IPO B;  4ES2 A;  2J0X A;  5A76 A;  4DS5 A;  4ELU A;  3HT3 A;  5T7L A;  3M32 B;  1WOP A;  4UST A;  4IO1 A;  1HI1 A;  4B9S A;  3W5Z A;  1L3V A;  3OV7 A;  2XZW A;  4TLQ A;  1N36 F;  2JJ4 D;  3HF5 A;  1ZOT A;  1TU0 B;  3KG1 A;  1VJW A;  4ECY A;  3BKF A;  1CJK B;  3A3P B;  2QE5 A;  1RWN B;  1LQ9 A;  4J9N A;  2ROE A;  4ZIV A;  2FJW A;  3DRP A;  3G6V A;  4QPT A;  3HSZ A;  3Q2S C;  1XK8 A;  3D54 A;  2W9C A;  1MRO B;  2JEF A;  3P96 A;  1LNQ A;  1Z1Z A;  3HHE A;  2DIU A;  2WSE C;  2XLJ A;  5C25 B;  1UVJ A;  8AT1 B;  3JSM B;  2ZH6 A;  4F50 A;  1RTI A;  1QTM A;  3Q23 A;  4HHH A;  1FEE A;  4PWU A;  5L9X A;  4IKA A;  2AZ3 A;  2C1E B;  3VGT A;  4OYO A;  2W2Q P;  1SJR A;  2KG1 A;  2VON A;  4ZVU B;  4ZVH A;  2R9L A;  2DKO B;  1JLB A;  4RW7 B;  1MMD A;  4OI4 A;  5DM7 Q;  5B0F A;  2Z2M A;  4NRU A;  5BXI A;  2XMW A;  2C2M B;  4X62 F;  1VQ7 S;  2W2N P;  1KLM A;  1WF1 A;  4XDC A;  1WAC A;  2A10 A;  4Y3C A;  4R8U B;  3TUZ C;  4ZLP A;  3A3N B;  1FJ7 A;  4WU3 A;  1F9E B;  4LSN B;  2RKI A;  1PIL A;  2ZD1 A;  4DEZ A;  4DV1 F;  2KRB A;  2AZ1 A;  3J81 U;  2GMH A;  5CCM A;  3NGR A;  1Q86 T;  5H9E K;  3I5A A;  2DEJ A;  4O3S A;  4IDK B;  2G9O A;  3RG6 A;  5ETQ A;  3T6B A;  2NCK L;  2EBG A;  2AKW B;  1ZS6 A;  5KFO A;  1XJW B;  2MQQ A;  4I4B A;  1WG1 A;  1UW4 A;  5G4D A;  3NBP B;  3KLI B;  2HNZ A;  4J9S A;  5M2R A;  1LOU A;  2HQI A;  1NKB A;  3MM7 A;  5HMX A;  2RB7 A;  2F4V F;  4KFB A;  1XMQ F;  1FXR A;  3CC7 S;  1GEH A;  4DSF A;  2HMI A;  3H5Y A;  3GJQ B;  1BWV A;  3CJT A;  4NA3 A;  2HWT A;  3SBM A;  3LA0 A;  2YKM B;  3B78 A;  5C42 B;  4U9R A;  3MED B;  5D78 A;  2HZV A;  3BKT A;  3RRH A;  2U2F A;  2LQ8 A;  3DI6 B;  2GHP A;  1C4A A;  4EZ6 A;  1UPM B;  2QA2 A;  2I9S A;  2UVU A;  4C6A A;  4KSE B;  2BOP A;  2ZH7 A;  3KMQ A;  3CTR A;  2VKZ G;  2Y8W A;  4OZ5 A;  1PG5 B;  2DGO A;  3G8T A;  6FDR A;  3RW6 A;  1RT1 B;  5D3G B;  1JK9 B;  4AD6 A;  3V2U C;  5F8G A;  1YWX A;  1JIH A;  1RBA A;  5EUH A;  4IRC A;  2YX4 A;  3MR5 A;  2ZBI A;  5DDQ C;  2O01 C;  4NEY A;  2FLN A;  3ZZR A;  3V6D A;  1MML A;  1WOR A;  4IH6 A;  2KN4 A;  3G6X A;  4ED5 A;  2HHW A;  3EPG A;  3ZTP A;  2JZ5 A;  2NUH A;  2MJU A;  3KLE B;  1PYT A;  1U47 A;  1L3T A;  3NGT A;  2HFO A;  3FUY A;  1TFW A;  4PZV A;  3THP A;  1IBM F;  4RUA A;  3SCL E;  4TY8 A;  3BJY A;  5C7P A;  3TJA A;  3NKY A;  3BYR A;  2P2C B;  3UN5 A;  3CWJ A;  1BMQ B;  1FDA A;  6AT1 B;  3O3L A;  4MH8 A;  1D8Y A;  2VV5 A;  1OJ4 A;  5BJR A;  2OEJ A;  1U1M A;  3GJS B;  1NK4 A;  1R3N A;  3PHT A;  5HBM A;  4ED2 A;  3MR6 A;  1VK8 A;  1AUS L;  2HW3 A;  1LKZ A;  4L76 A;  9RUB A;  1RBL A;  1EKR A;  1VRT A;  2DB1 A;  2H1Y A;  3KOA A;  4DFJ A;  3CCW A;  2N82 B;  4ZN3 A;  5KG4 A;  3RAM A;  3EE3 A;  2L41 A;  2FVP A;  5IQQ A;  1S1V B;  1XNQ J;  4C0O C;  4O3Q A;  3KLG B;  2Q79 A;  1RT3 B;  1JKH A;  2XMM A;  3W65 A;  1C0U B;  1HNX J;  1U2C A;  1TTH B;  5DG9 A;  1VIS A;  1IM6 A;  4RBT A;  4OZ3 A;  3HSD A;  4KY3 A;  4ZVO B;  1SJ4 P;  3Q86 A;  3AD8 C;  2E7V A;  2UUA J;  2BW2 A;  1YJW S;  2EK1 A;  4M5H A;  3D67 A;  2F63 A;  3N6L A;  1TVR B;  3RRK A;  2R8G A;  5IC4 B;  1FER A;  4FKX A;  5F0U A;  2HS4 A;  2F8H A;  2M70 A;  4KGZ B;  4DQR A;  4C4W A;  2W7P A;  1L5U A;  1HHQ A;  4NLQ A;  3I0R B;  4CO1 A;  2XSF A;  4I7F B;  5HJX A;  3EUN A;  1RHU B;  2GQQ A;  3L4B C;  2UUB F;  4KV8 B;  2R8H A;  1U8W A;  2HND A;  3VGU A;  2VDI A;  4OLP A;  2Z4P A;  3KJF B;  4Y2C A;  3I5C A;  2LFV A;  3MM5 A;  5KFA A;  4I6W A;  1N5V A;  2HHP A;  1FJG J;  2SXL A;  2UXD J;  2BAN B;  4RL1 A;  2MY8 A;  4N41 A;  3SYZ A;  2NSC A;  2GIR A;  4IOA Q;  3I56 S;  4JI6 J;  7FDR A;  1WNE A;  1GMU A;  1T95 A;  4HYK A;  5KT4 A;  4KBI A;  2ZOG A;  1T9V A;  4DPW A;  4F67 A;  4DSJ A;  2F1F A;  2VJU A;  1Y9O A;  2JFK A;  1IKX A;  5KFQ A;  4HH0 A;  2DNM A;  3J7Y U;  4DXL A;  2G0I A;  1Q0N A;  1WG5 A;  3W3S A;  2PGC A;  1OMS A;  1H72 C;  4A46 A;  2QN6 B;  1HNW J;  1Y5I B;  5CXT A;  1P9Y A;  4B02 A;  1X5S A;  1C0T A;  2ASD A;  1E6Y A;  4P73 A;  1RT6 B;  1XMO J;  2ILY A;  2IM0 A;  4K4T A;  3BEG B;  1U24 A;  2C42 A;  2G13 A;  2W4D A;  1LWE B;  3P6Y C;  3HLU A;  2EWH A;  4MK9 A;  4U8Y A;  4CZC A;  2LMI A;  2E9Z A;  3SFG A;  3AJ2 A;  2B51 A;  3BGR A;  3RAQ A;  1XIQ A;  5F8J A;  5HVF A;  4MIA A;  1ZM9 A;  5T7L B;  5KOW A;  4ZHR B;  4O44 A;  4DR4 J;  4NCG A;  2DPJ A;  3FVY A;  1NKC A;  4PRF A;  3LGH A;  1JLA A;  4IH7 A;  4IFV B;  4MKB A;  2QMU B;  1V5V A;  4NXN J;  3DRP B;  5D4N A;  1MWQ A;  3PAC A;  2YPY A;  1JLC B;  5AE2 A;  3CJS A;  1NH8 A;  2B0G A;  2AEJ A;  3KK2 A;  2HAF A;  3PEH A;  4P2F A;  4LRB A;  4F3Q A;  1VLY A;  4PG5 A;  3AH6 A;  4P2M A;  3MEC B;  2YKA A;  1SQF A;  4A48 A;  1SV5 A;  1TL4 A;  4AL5 A;  4WIQ A;  1RTH A;  1QD1 A;  3ET6 B;  4LF7 J;  4U6P A;  5H9E J;  2J0S D;  4WFY A;  1S76 D;  8ATC B;  2WBR A;  3OFF A;  1UJ4 A;  2MHE A;  1K44 A;  4A8K A;  2WON B;  2MZ1 A;  3ZFV A;  4OHV A;  2CQ3 A;  3DLG A;  3M8P B;  5J1E B;  3CIM A;  5DJB A;  3TA0 A;  3CJ5 A;  3D6T B;  2BJE A;  3W2W A;  4Q0B A;  1UAW A;  4WP9 A;  5K8M A;  4QIV A;  5HMZ A;  3X1L B;  3LP2 A;  4B9L A;  3OW2 R;  3K58 A;  4DV5 J;  2J7U A;  1MWY A;  2EFO A;  1PYS B;  2D3U A;  3C6U B;  5IT4 A;  1HKA A;  2HPU A;  4JI3 J;  2Q6B A;  1KHW A;  2Z2L A;  2CQI A;  5A8K A;  1TMM A;  4OZ2 A;  4ECR A;  4FF4 A;  4GVB A;  2PA3 A;  2XEX A;  2XI2 A;  1WJ9 A;  3PJX A;  1ARO P;  5AXN A;  1LWC B;  1Y5L B;  2IMO A;  2JLG A;  1WHV A;  5KG3 A;  1XNR F;  4BLG A;  3D1Q A;  3B6B A;  1X60 A;  1T03 A;  3OFH A;  4M1K A;  1YJU A;  2KXN B;  2DNQ A;  2HNZ B;  4PYD A;  1OPI A;  4JI8 J;  4AUK A;  1GFW B;  4J9V A;  3QRQ A;  2YWK A;  4D3G A;  5LMN J;  1RXO B;  2QA4 G;  3VTI A;  2LA4 A;  3H40 A;  3L95 X;  1VC5 A;  3C14 B;  3ZZY A;  5JXS A;  4ECT A;  5A8W A;  1UA1 A;  1KR4 A;  1YK9 A;  1WC3 A;  5HSP A;  2AGQ A;  1XMB A;  3SMZ A;  2R7Q A;  3H4B A;  2J9C A;  4OZ1 A;  1VIX A;  2YKO A;  2DBB A;  3ENV A;  4CO2 A;  1RJJ A;  2DEI A;  3TQE A; 
#chains in the Genus database with same CATH homology
 2IJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...