1IBLF

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1iblF00
4JI2F 4GKKF 4JV5F 2UXDF 4NXNF 5LMUF 4DR2F 1GH8A 4LF4F 1N32F 2KJWA 4JYAF 1FJGF 4X62F 4LFAF 1HNWF 2F4VF 1B64A 2BVZA 1N34F 1XNQF 2UXCF 4DV1F 4K0KF 4DV2F 4DV7F 4LF9F 5IWAF 4LF6F 4DV6F 4DUZF 4KHPF 2UU9F 2J5AA 4AQYF 2VQFF 4LF7F 4LF8F 1QJHA 2E5LF 1N36F 1XNRF 4DV4F 4YHHF 4LFCF 4OX9F 4B3MF 4DR3F 4DR1F 2UUCF 4B3RF 2ZM6F 2UUAF 4JI3F 2RJZA 4X65F 1IBLF 2UXBF 4JI0F 1HNZF 4DR7F 5AJ3F 1F60B 3OTOF 1XMOF 1I94F 1IJEB 2B7CB 4X66F 4LFBF 4LF5F 4JI8F 4X64F 4JI5F 5BR8F 3T1HF 1N33F 1G1XA 1IBKF 2KJVA 1XMQF 1IJFB 4DR4F 1CQMA 2HHHF 4B3TF 1RISA 3ZZPA 4GKJF 1VMBA 4DV3F 1FKAF 4JI6F 2YY3A 2BXJA 1CQNA 1G7CB 3R3TA 4DR5F 4JI1F 4DV5F 1IBMF 4DR6F 5LMNF 4NXMF 1HR0F 2UUBF 3T1YF 4DUYF 4YY3F 4JI7F 4JI4F 2B7BB 1HNXF 1LOUA 1J5EF 4B3SF 2VQEF 4DV0F
chains in the Genus database with same CATH superfamily
3TW0A 1SC4B 4NA3A 2HMIB 4EBDA 5IM0A 2QIFA 5A8WA 4RJVA 1RT3B 2B3TB 2XSJA 3HT0A 2GJFA 2QV6A 2OLWA 4USTA 4FNIA 1R31A 3Q2TC 3A3NB 4WP3A 4ES2A 4AL7A 2WOMB 3KK1B 3MUVP 1IXKA 4DPWA 2ZBRA 3EGWB 1HNVB 3R8YA 2KFZA 2CADA 4DL5A 1NJYA 1OO0B 3R7BB 3VAGA 3D3BJ 4LFCJ 1U02A 2M2BA 3TARA 1QTMA 2ZWPA 2FPHX 2O1PA 2V5HG 4OI4A 3W2VB 1P9QC 4PUOA 4P75A 2JDJA 3OXGA 3VHQA 2AKWB 3IA0A 4LQ3A 1CQNA 2HZCA 3NAHA 2K1RA 2MQOA 1KS2A 2B56A 1O51A 1VQPS 4NXMF 3RRGA 3AOAA 4L3NA 3B6BA 1PYSB 1MWQA 3FBBA 2W4PA 4CTAA 1S10A 1AUSL 5HANA 2MKKA 1VDHA 2EBEA 4X62F 4J5OA 1HNIA 1UVLA 3DNCA 5BYSA 2BYCA 4MKYA 2UXCF 2RD5C 1L3KA 4O44B 5LM7E 1FKPB 2LEBA 2HIYA 2NSBA 2GC8A 1VK8A 5C24B 2JWNA 4U6PA 4DR3F 2VBWA 4GMKA 2ZM6F 1N34J 2LLZA 4X4SA 1FNMA 3V81A 1F9HA 3TZWA 2WZ1A 2IVYA 3G6VA 2W4CA 3R7NB 3GPAA 4WKRA 5C25B 2QMWA 1AW0A 1B0VA 2U1AA 1QE1B 1TKZB 1NMEB 3IWLA 4JI0J 2ZKTA 3OVSA 4UUWA 3NNCA 4Y3CA 2DNRA 2DR6A 3OFFA 1NB7A 3AA8A 2UUBF 2F9JA 4OI2A 2AJ0A 2QLJB 1X4BA 5G0RB 2NZCA 3EYZA 4HKQA 1FEHA 1Q8BA 5ETRA 3LQVA 4WZMA 4I67A 4DV5J 2HHXA 1VRUB 3ZC4A 3R7SB 3FCVA 1RT7A 3HX9A 1B64A 3GE9A 1IKVB 1SI9A 3WX4A 1HYSB 3DU6A 3NXZA 1ZPWX 4DUZF 1SKSA 4KGKA 1H7WA 3OLBA 3WZ0A 2NQPA 4MJKA 4M5KA 3BZQA 4DV4F 2GVDB 5SZTA 4Y0FA 1BGXT 2V8HA 1K1QA 5CYMB 2WTFA 4K7QA 2C1EB 1WDTA 1HLWA 4FS1A 3AJ1A 2ZFHA 2E5LJ 3CC4S 3MFHA 4ED1A 1EAYC 4ERDA 4LR9A 1S6QB 2D74B 3M2RB 5J1EA 2PT0A 5K8NA 4A8WA 3CCWA 2UUAJ 4B3OA 3IFEA 2J0QD 2D9PA 1IBLJ 2MHNA 2B6AB 1NK8A 4JI6F 1C0UA 4QZVB 4DU7A 3D54A 4J9VA 1HFEL 2IC3A 1I5OB 3EVWA 1NUEA 1D9FA 1N8RT 2CZVC 4P72A 2EFGA 2B4OA 1XMQJ 4RNNA 4C9DA 4KV8A 3CCQS 5IC4B 2R7RA 3J7AN 4UUXA 3T9ZA 5DQGA 4RU2A 3LW5C 5A8KA 4ZVRB 3QZ8A 4O4GB 4P73A 1GH8A 1HWUA 4EU0A 3H25A 4NYOA 3THPA 3UQSA 4HR2A 2A0FB 4PXEA 3LGMA 3LP2B 2BJ3A 1WEZA 2R8JA 2BE2A 2FYXA 1LEOA 2BW2A 3PYDA 2ZZMA 3M30B 1XNRF 2H5EA 2JC1A 3TX0A 3JQJA 3OJSA 4ZDNA 4M63A 3JSBA 3EGZA 2RQKA 2HBYB 3MPVA 1UA0A 1HWLA 2CKWA 1RBOB 2ASDA 3I6PA 1JJ2R 3QRQA 5U47A 4PAAA 4DPXA 1KDNA 1SJRA 2HG4A 1GMWD 1F2GA 3FGVA 4NZ0A 4NL5A 1E6YA 4E2FB 5D8HB 4AYBD 5L9NA 2OELA 2HS0A 3PRDA 2QE5A 3IS9B 1EIYB 1S1UA 1LWEA 1FXDA 1K8AT 3FBEA 5B0CA 5H9FJ 4DFMA 1AFIA 2DR7A 4G6VB 1S1WB 3ULHA 4M94A 3JQKA 2B9XA 3PHTA 4JI2F 4CLYA 2PIIA 3CJ5A 5AT1B 4DPOA 3T19A 4WU2A 5DS7A 1RI7A 3PNIA 3GYXB 1QAJA 1P6TA 3NCQA 4AUKA 2VQFF 4AQYF 5I3UA 2G4BA 3VGTA 2V4JB 3ICLA 2F7VA 3F41A 2CQHA 3AOCA 1XNQJ 2B5JA 3D6FB 3EMTA 2FY1A 2MZ1A 4PQUB 4Y2KA 1G2EA 2MQ8A 2OHDA 2V34A 3P4UB 1LWCB 4ZJLA 2LEPA 2QLWA 3IRXA 4C3KA 2RNEA 4IRDA 5E3RA 4ZK7M 2VFSA 2LECA 3ISNC 4ATNA 4RR5A 5J2NA 1KWMA 4LRFA 4EMDA 5A8RA 2Y0SD 1MROA 3CJQA 1JNZB 4LRCA 3T9NA 1AYEA 1HW9A 4PWDB 1M1GA 2UUTA 4PG8A 4C11A 5B0GA 3ZZTA 4O3PA 3T5HA 3TAPA 3RB4A 2DBBA 2DNQA 4JI4J 2HNZA 1CBKA 4K5RA 2VODA 4JYAJ 2V9KA 4LBIA 4CT9A 1PYOB 1RAHB 5AXKA 3MM5A 2B51A 2YQ3A 3OTEA 4C97A 4YR0A 2DIVA 4ZVSB 4DV7J 4K2XA 3DMJB 3QJLA 4KIAA 2DPIA 4ETZA 2UU9J 3G4SS 1IJEB 4L75A 5LSRA 1HI0P 3SSSA 1F6TA 4DS4A 2ZBCA 1T11A 3NGSA 4ECTA 3ENQA 4B3RJ 3V4IB 5KFWA 2E1MC 2H65B 2HGMA 1GTHA 1NK5A 1VGYA 2I5JA 3BO3A 2VPYB 2OAUA 1BD6A 3RG6A 5KFMA 4EUVA 4MIWA 2QSFA 4ZP8A 4Z37A 3KG0A 4FYYB 3TX8A 2B7BB 1JJ4A 1R3NA 2UXDF 1N5YB 2ZH3A 1MU2B 3QWPA 4QR0A 3M8ZA 5KT3A 3FJ2A 1HNXJ 4EFAC 4NMXA 3R9LA 2GIQA 4JV5J 1YBUA 2WSCC 3P5TL 2HK2A 3CDEA 3ETOA 3K57A 3DYAB 4DV2J 2F4FA 2WVEA 4HI1A 4PABA 3HZEA 2QLFB 4ECVA 5F3TA 1FTCA 1TL5A 2LEAA 1TL3A 3DI6B 1YDLA 1PC4A 1V5VA 3PJXA 1T3OA 1VC6A 3QGGA 2UXBJ 2KN4A 2BJ7A 4C48A 2ZOFA 2EC2A 4R5PB 2QT7A 5ETVA 3DLKB 5E3CA 2R8KA 3KG4A 4F0MA 2PMZD 3QFHA 1JQGA 1IQZA 2IBOA 3KYLA 1T9WA 3VAMA 4L6V3 4A8XA 3HF5A 3ZZRA 3BKFA 2V9WA 3K7RA 2DNOA 3DOKA 3IMQJ 1IKWA 3DLJA 3BGRB 3I5BA 2XI3A 2MXYA 1DLOA 2F8MA 2HQDA 1UVKA 3I9ZA 1RWPB 3OVAA 2ADBA 4DV6F 4FNHA 1XNRJ 2BBEA 3AH6A 1ZOTA 2ZOMA 1KD1T 1K1SA 4ECZA 3OHAA 2JLGA 2XGQA 4X65F 2BJEA 2OPRB 4FVMA 4P2SA 2XB2D 3I9V9 4N8OA 1SIWB 4CWBA 2GV1A 2Q1LA 1B3TA 1T9VA 1L3VA 2VPWB 3M05A 1XERA 2A2CA 2GFFA 3L9ZA 4P2MA 1NM2A 3MEKA 1UVNA 2PA3A 2Y1RI 2DNPA 2FGCA 3M8SA 1VQYA 1EKSA 1TK8A 1WDDA 4A8MP 4Z7CA 4NE9C 1AZSB 1NKEA 3ZTQA 3VGSA 2WAQD 1V3RA 1R0AB 3MM8A 2RS2A 1NSKL 2YKAA 5A2QY 1FE0A 4H4OB 5EWGA 2J0SD 5D78A 4YMEA 2RF2B 1IKYB 1N32F 1YLXA 3SDEB 2NPIA 3K8WA 1DTQB 2X1FA 1SC1B 2Z57B 1ULRA 4AQYJ 2OUGA 1HA1A 1VQ9S 3MWBA 1SV5A 2J7KA 1M5SA 5CYJA 4CNYA 3ZZOA 1D9AA 2MLZA 2ZHBA 1L5UA 3BSAA 2KXNB 2DNMA 2B4UA 4KKOA 1EX8A 2W9BB 2DH7A 2HVHA 4RPFA 3NLCA 3G86A 4JI5F 3K5OA 5DO2A 2CJQA 3HHEA 1CQMA 3A3PB 3R6LB 6AT1B 1TFWA 2FLOA 2V6AA 2YY3A 3JB9k 2OH2A 2XZDB 4OYOA 3GJTB 4NLOA 2Y0BB 3TZYA 3RB3A 2VUGA 3I31A 2JZ5A 4CO3A 2ZVIA 5DG7A 1S9EB 2DCUB 3ZTSA 1T9UA 5DETA 1S1VB 3V6DA 4FXDA 4ICLB 4ZVFA 2YNFA 4LMZA 1KQSR 2CJ9A 4FYXB 1Y3JA 3BEGB 3CC7S 5E7OB 5DLFA 3IM8A 2LCWA 4RLEA 2AZ3A 3B78A 1CJTA 2GAGC 1Q4RA 4P74A 2QA4S 2OPPB 1ZAVA 3EGNA 3IR6B 2ZJRQ 1N0UA 2X3GA 4RW6B 1Y5LB 1GMWA 3FK4A 4O3RA 2VL1A 5EN1A 3IWXA 4ECSA 3QPIA 1SKUB 2N7CA 5KT2A 1VRTA 1IM4A 1M5VC 1NKCA 4HH1A 1N33J 5F8MA 2MJNA 2AMCB 3NGRA 1QSYA 2IA6A 1O6XA 1O5JA 3GJQB 3UR0A 2KL8A 4GVLA 4YY3F 1FF2A 1X4CA 3C6UB 2LVWA 1RHJB 5GAHI 4CYUA 4XTTA 4DR5J 5KT4A 3VTIA 3QNWB 3L7OA 2COLA 1RAOA 5L46A 1E6VA 5D4PA 1RDRA 4GC7A 3HULA 4ID8A 3BBFA 1T7PA 4OFZA 4LVNP 3OR1A 1PIEA 4U7UK 3M8PA 1S7HA 2FQQB 3EZOA 3L7PA 2XI2A 4G3IA 3PEHA 1R8CA 5DDQC 3CCJS 5DM6Q 1X4DA 4K0KJ 2OTLS 2XO7A 5DLGA 4A46A 3EVMA 3SV3A 3B54A 4URQU 4ETXA 3WQPA 1VISA 1RA7A 1UAWA 2F8HA 2OI2A 4JI3J 1WKKA 2UV8G 2KJVA 3NGDA 2G2ZA 3FEZA 2W9CB 4ZCKA 4FF2A 1HQEA 1SXLA 4NX9A 1DTTA 4KGXB 2ALZA 4A8KA 2X1BA 2QLXA 3MEGA 1URRA 5RUBA 3OT9A 1FK9A 1IKXA 1LWFA 5F8LA 4C8LA 3R5BA 4ANCA 4NCGA 4TXSA 3POTB 2CDRB 1AUDA 4KGZB 5AE2A 5GADU 1WF1A 1RAAB 4DL2A 1R43A 1OSDA 1RA6A 5H9EJ 4AT1B 5JVHQ 4F2SA 3VAFA 4ZVGA 3PTWA 5KFXA 4P2XA 3JYTB 5BYRA 4YR2A 3SCJE 3ADAC 3J7ZT 2C2NA 2H4YB 2DH8A 2HFOA 2ZJPQ 3SI8A 4M5HA 4A8OA 2ASLA 1FI4A 5HBMB 3G8TA 3P3DA 2D1CA 3RR8A 4RWXA 2DR9A 4J9KA 4LRDA 2R7UA 3HHDA 1F0XA 1FWPA 5CD4A 2OTJS 3L3CA 3HP6A 3PV8A 3HHNB 3AXKA 4JI8J 4X4RA 1JLGB 4AXJA 3PIPQ 5JMNA 4LR7A 1JLEA 1FRJA 2RILA 2E7XA 2KVIA 5HQLA 3GFYA 1ZETA 2WW8A 3H5SA 3OBIA 5KFBA 1HR0J 1RJJA 2F4VF 1PJ6A 1RT2B 4F4YA 2HLUA 5FLXU 4LJMA 3TQ1A 1RTHA 3MEEB 4LF6F 3WC2A 3D3CJ 4KH0B 3TA2A 2ZBQA 1NDCA 1YQHA 3I5AA 2DHHA 2R7XA 2IMWP 3HVRA 2UUCF 1Y7PA 1UL3A 3GONA 3C19A 4H4KC 1REVA 4H4MA 1Z4UA 4BS2A 3R2DJ 2AYGA 2YNIB 5HK4A 2AEMA 4KPCA 3DLGB 5GMKa 1YGYA 1WC3A 1X5SA 3LWLA 1U8SA 2AU0A 1MN7A 3IG1A 4NLGA 2WSEC 3VV2B 1VBKA 4QQBA 1YX2A 2JH3A 4NLPA 4UOCA 3CCSS 2ZH7A 1B70B 1SL2A 2OD6A 1Q1KA 2ZC3A 4CLPA 1X4FA 5F8JA 4X4PA 2B4PA 1WG4A 1CULB 2XLKA 4RNFA 3PM9A 1CVJA 4TVAB 2YNHA 4YQWA 1QLNA 1TFYA 4MAKA 3PRVA 2D3OR 2QTWA 3Q8RB 1OYEA 4QIVA 5AXNA 3MM7B 4I4BA 1IBMJ 1JLCB 4N8NA 1FJGF 5LMNJ 2DXFA 4C4WA 1NPRA 2E5JA 3CO9A 4IH5A 5LXYA 2BABA 1S77D 3BDPA 4DV0J 2HLTA 2XLIA 3RBZA 1I51B 4ANEA 2MHEA 1X9WA 4X84A 4QW8A 3R5DA 1NSAA 4WP9A 2ZH1A 5E0OA 2QYGA 4LBPA 1U0HA 2GHVC 4PUOB 3MAAA 3NNAA 2YVSA 2YWHA 2HEKA 3ITHA 4USMA 2VG6A 5ETSA 5KFUA 3KUGA 1RT6B 5BR8J 3ZTPA 3MMJA 3OJUA 1VC5A 1JLBA 4DQPA 2FVQA 1FKOA 1OJ4A 3M6VA 2B9YA 4JI1J 3VAJA 2VPXB 3TRGA 5F0WA 3DHXA 2MYFA 5A6WA 4LF2A 3KDOA 2J7UA 2GGPB 2R4FA 2VQEJ 4OZ3A 4I1TA 1X9SA 3LP0A 4OI6A 2OJ3A 4ECUA 2ERRA 4B3MF 4CIOA 4RW7A 2CJAA 3MFIA 2VFUA 4S0MA 3MPWA 3UNGC 1FDDA 1BQMA 1WNEA 1RQ0A 4NI2A 2FGOA 2Z2MA 1FX4A 2BQ3A 4K4XA 5FJ4A 1A6LA 1RBLA 4MT1A 2VIHA 2N82B 3KKFA 4V1Ak 1Q7YT 1NJIT 3Q8YA 4B3TF 2RDDA 2DHXA 3D28A 4KSEB 4TLRA 1G7CB 4LREA 2QL7B 3TUZC 1WOPA 3QATA 2GW8A 2M52A 1X4AA 1EARA 2VG7A 2G1HA 3VR1A 1NLKL 3K5PA 2XC9A 1WG1A 2JEGA 4IOAQ 2OEKA 1CG2A 5DZ6A 4DSFA 2NPFA 1HWKA 4WFXA 3PFEA 1P1LA 1CJKA 3H4BA 2RQCA 3KLEA 3EVOA 3FCWA 1YBTA 9ATCB 4IDKB 3FBFA 3DGPB 2GCFA 2JJ4D 4PWWA 3VAKA 4QYZJ 2AX0A 4GKKJ 3FMWA 4DI6A 2BE7D 3OTDA 3DLLQ 4NLXA 2CFXA 2PDAA 2I6WA 1WG5A 3KG1A 2UUWA 3ZO7A 1MMDA 2HZVA 2R7TA 2H3EB 3SCIE 4M8LA 4RL1A 4B3OB 3ELHA 3IWNC 2OSRA 2VFTA 3M8WA 2M9KA 1WF2A 1X60A 1RU1A 2IM3A 2GMHA 5KT6A 4Y2AA 3BB5A 4WKYA 1PBAA 4IRCA 5SUHA 2FIUA 3QYYA 2Q6BA 1SJ3P 2Q3PA 4ECXA 1BWEA 4NLWA 5MLCV 3PR5B 3DOMA 2XS7A 5F9LA 2OFGX 3M2UA 2CA9A 2N3OA 1YRTA 5G4DA 2FJEB 2LU2A 4ZN1A 1U25A 3DOLB 2U2FA 2HWHA 3HZGA 3GV7B 4L73A 2XMTA 1BMQB 4ZIWA 5H1SV 3CCVS 4M95A 1YBAA 4KFBA 4ZP9A 3HM9A 2VDIA 4QIGA 4W92B 1OSCA 1QTNB 1M1HA 1ZA2B 4QBUA 4ZLPA 1TAQA 4M5LA 4ZPWR 1D9DA 3NBPA 3PYFA 2W2NP 4QCLA 4X66F 1B7YB 3DRPA 3PIOQ 1X5OA 4HT7A 5I42B 1JKHB 2PO4A 4C8OA 3MEDB 3NMAA 3L95X 2CQ3A 2ZD1B 3VAIA 2F8EX 5AXLA 3MMBA 4XPEA 3W1YC 4Q8EA 1Q79A 2XYHB 2CWXA 2HHHJ 4OJGA 4JI7F 4ZKAA 1QUVA 4YEAA 3TNVA 5IQQA 4R25A 3MM6B 1RP5A 4RU9A 2HSEB 2NXEA 4RW9B 1FDBA 4DUYJ 1RT4A 4M5DA 1R8PA 3FVYA 2X3DA 3BKTA 2EWHA 1Y3KA 3KHLA 1KTQA 4V19J 5K20B 4RO0A 1DBDA 3IXQA 1RHUB 3VQSA 3ZZZA 2Y3YA 1V6HA 3H59A 1K9MT 1FD8A 3DN9A 3M8YA 3MR2A 3A1YG 2NZ4A 5KFLA 2IPOB 3BJYA 1B99A 2NXCA 2DEJA 2YBVA 3HKWA 3CSKA 3R5GA 4Q8FA 2KG1A 1SC6A 2X1AA 3CJ0A 3PY8A 2IYIA 3T5JA 1FRIA 1C1CB 2H51B 2P6SA 4O23A 1X4EA 3G82B 3NWRA 4IKAA 4TQSA 5K8OA 4DL4A 1S59A 1MWZA 3IR5B 3AHPA 4X4VA 3MR6A 2E1AA 2M70A 5KOXA 3K8VA 3K17A 2XY6A 4LF4J 2KXHA 2GVZB 3FUYA 4Y2MA 1H73A 4D3GA 1HBOA 3K58A 4J9RA 2RJZA 2D69A 5DZ7A 3W5YA 4IH6A 3IR7B 4BHQA 2I8EA 4NLSA 1U0SA 2YKPA 3RW6A 1RHRB 4B02A 2LQ9A 3AOBA 2UVRA 4DQSA 5JXSA 4A8SA 2QSWA 4WWSA 1LXJA 4NLUA 1RCOB 1VMBA 3OTOJ 1NHVA 3R5JB 2QJ3A 3H2LA 1HIYA 1BHNA 2SXLA 4I2QB 1OMSA 3FKBA 3QT7A 3EICA 1CJVA 3I4HX 4X4TA 1F5CA 3KLHA 2CJYB 5KFDA 3N0VA 1WSVA 4MIBA 3EE3A 4J90A 2MQNA 4I69A 2MLXA 1HNWF 2NCKL 1TUGB 2HQGA 4IG3B 1KHWA 3QFWA 2BVZA 4N47A 2W2QP 2UVUA 1ZM3A 2XMVA 2RMLA 2MZJA 4F02A 1EZZB 1RYRA 2GJIA 5DGBA 2HNYA 3KLFB 5AE3A 4R0JA 1FNXH 5HQMA 3J80Y 4TY9A 3G2XA 7FDRA 5HLFB 1XMOF 2JEJA 4B17A 4F3QA 4ZLNA 2MSSA 2EK1A 1UWBA 2ILZA 4U95A 3PEJA 1NB2A 3I0SB 2VA2A 3Q22A 3G9CA 4NEZA 1O8BA 3U02A 3KHHA 1NDKA 3JTPA 5KG5A 3M8QB 3UD5A 5B0FA 4DSJA 3T5LA 3G6YA 4XDCA 2R7OA 5DJBA 4A8YA 3NCRA 2HFVA 1U1OA 3W61A 1WI8A 3CUNA 1CJUA 1DY3A 2G9OA 3MGJA 3JSRA 1WHVA 3MMAA 1LKZA 3TOQA 4N76A 2CAJA 3H2VE 2WBMA 2XMMA 2XMAA 4EO8A 1N4LA 4USWA 1YTYA 2YTCA 1YVFA 1JLQA 1VQ5S 1S4EA 2FY8A 2GQQA 3NS7B 4IFYB 3KK2B 2DVIA 1SPBP 2QO3A 3E2EA 3RZAA 4YHHJ 3IRWP 1R8HA 1T9XA 4IG0B 2HZAA 4I2PB 1T03B 2BANB 2AX1A 2K3KA 3AT1B 1UVMA 3A13A 2R42A 2XS2A 3CJ4A 2E9RX 2OKQA 3NL0A 1C1BA 9RUBA 3FFIA 2OSQA 1S72S 1YZ7A 7FD1A 2PFFB 4PPZA 4CM2A 1M90T 2P9CA 2R7WA 2C2OB 4LVOP 4O3SA 5GVQA 1RKJA 2P6TA 4B3SF 2CRLA 1KRPA 2XYPB 2KXFA 2LYVA 2LKZA 4DFJA 3DLEA 3PRBA 4TY8A 2ABYA 2AP6A 3CW2C 3A4TA 2DHSA 3CCLS 3GV8B 2HW3A 4M5IA 4F4WA 4KHPF 1DARA 1SQGA 2EG2A 2ZH6A 1KEKA 4DCOB 1U1RA 1VRQC 1KC8T 2V8GA 4UZBA 2MGZB 2A6OA 2KO1A 3N01A 2R8HA 3S6EA 4O0IA 2DHAA 4F50A 2OPQB 5H9EK 4OX9J 1LW2B 4DR1J 1RLCL 3PR4A 3J81U 4ZPAA 1ZTWA 2DGWA 2YWGA 1GX6A 1KLMA 4X4NA 4QIFA 3D5MA 1D0EA 1GQEA 5E33A 4AD6A 1TL7B 3OFGA 1FXRA 2PMHA 4DLGA 1IWAA 2K7KA 3CTRA 3H5XA 4EK2A 1S79A 4NZ7A 4Y28C 1CS4B 4BC7A 2IAJB 2W2OP 3F0NA 2ZHAA 1H6KX 5KFNA 3W62A 3MPYA 4QWBA 2NYHA 3AB4B 2KFYA 3N6NA 4HACA 1CJTB 2J9DA 3GYGA 2BV3A 1H2TZ 1UZDA 3UNYA 4A47A 3DRRA 4NLDA 4WK1A 3D7SB 3LOUA 5C42A 1SL1A 1LW0B 1KLNA 1EB0A 4ZVEA 4CO2A 3QIPA 3WBZA 3V4MA 5EUHA 5FDLB 2AEJA 4ANDA 4LF7J 2BDPA 2RDIA 4LSNA 2FHKA 1NBEB 1ZPVA 5K9FA 5KAKA 4WJBA 4C2MA 4XO0A 1KHVA 5J2QA 5IT9U 4OYIA 2D3ZA 1HNZJ 4ZHRA 4WE1A 4YB7A 2LQBA 4LRAA 3P96A 2L48A 3ZZUA 3NGKA 2CQ0A 3JSMB 4CO5A 2ROGA 4W90B 2FLPA 5LJ5Y 4OV1A 2XMKA 5IXUA 1HD0A 5KG6A 2XSFA 1FFWB 2VBXA 2ZITA 4P71A 4CO1A 1E6VB 5HROB 3QLHA 3QT5A 1ZZNA 2OPSB 4KPYA 1Z1ZA 3UVJB 2HAIA 3H2UB 3LP1B 4IFVA 3SCLE 2RKIB 2W8KA 2F5GA 1BUXA 1C2PA 2C2MB 3T5KA 1RAIB 4WIIA 5T7LA 1LNQA 4LFCF 3KLGA 2VICA 2RSQA 3LGNA 2QMUB 4Q45A 4YS2A 3UFCX 1XMOJ 3BKUA 2HNDA 2ZHOA 3TA1A 1YI2S 3V6KA 3OXLA 2CPJA 4FPIA 5EWFA 2YKMB 3WHIA 1DTTB 4FXVA 3HMJG 3ENVA 4PPDA 2WSFC 2KM8C 2LA6A 2XNRA 3H5YA 2BX6A 2XEXA 3M1VB 3MR7A 4WP8A 5HN0A 1HWJA 1NSPA 5HVHA 1SUQA 4XDDA 3SQGA 2ZJQQ 2E1RA 4UQTA 2N7YA 2KH9A 2IM0A 1YG0A 1EP4A 4RW8A 4OJ1A 1N34F 3AD9C 5HMZA 1FWKA 2JL9A 3QSYB 3QO9A 1RAJA 4B9NA 1C4AA 1TL1B 2GS8A 3Q86A 1NK4A 2C3MA 3TEGA 2WVCA 4USVA 5LL6d 4HHJA 2HMIA 4FXWA 3JAMY 4R0EA 2C3OA 5A2QU 3QSIA 1ZM4A 4JI0F 3GLJA 3PACA 1RT3A 2IJFA 1SJ1A 2OIHA 1TR0A 3LPEA 1FHTA 3RB0A 3OL9A 3TUJC 2NSCA 2WOMA 2FVCA 2BRLA 3KK1A 5KFKA 1D1UA 2CJBA 3PO5A 7AT1B 1UKUA 5J1PA 4PQAA 4DL6A 1HNVA 3MMCB 2WB4A 2V69A 4OZ0A 3D2WA 4DV5F 1RHQB 5CD4H 4DR4J 1W26A 3D67A 2CZ4A 1RWWB 3W2VA 3PJWA 2E5HA 4OZ5A 2OP5A 1N5QA 4QIEA 1F1BB 5ETTA 3TA0A 2FD2A 3MD1A 4CLZA 1RTHB 1FRKA 1X4GA 4FYWB 3NWGA 2EVZA 3OV7A 4HDHA 4HHHA 5B0BA 3ETMA 4KY3A 2R7VA 2E5LF 1YJRA 1RUSA 1W7WA 1FD2A 4IOBA 2FZKB 2QZ8A 3SYZA 4DN0A 1RWVB 1Q0NA 3B4DA 2UUAF 1QUPA 1IBLF 3KK3B 4F4ZA 2E5IA 2X51A 3KHGA 4Q44A 4QYZK 1MN9A 1N36J 1GX5A 4O44A 3L7UA 1FRHA 3IG1B 5ETOA 1FKPA 3Q0AA 5C24A 4DDFA 1XMQF 2JVRA 1NSQA 2IIHA 5DDOC 4Y00A 3PG9A 1GTEA 2MJUA 4AL6A 1V3SA 2I38A 5I3QA 3CJKA 5C25A 2YWKA 3P49B 3OUYB 4QIWD 1QE1A 5CXTA 3T6JA 1TKZA 3FZBA 2C22A 5CA5A 3HSJA 4EEYA 4ZLLA 1RT1A 2O3DA 1RAGB 2ZVSA 2M7SA 3I82A 2AV5A 4CLUA 4FYVB 4OMFG 1Y5IB 4P9SA 3VQTA 3BQ2A 1HHSA 1RTZA 3UD4P 1HPZB 2GQCA 1TUVA 2V8PA 1LWXA 4CI0B 3EGVA 3KNAA 3GIMA 3PW2A 5AE1A 1MNEA 2D41A 5G0RA 1DZ5A 1XMBA 1UP1A 2VC1A 2HQ3A 2ATLA 1Q7LB 1RWXB 1CLFA 2VFRA 4GO7X 1VRUA 2B0GA 1JIHA 4Q0BB 3GILA 1U6FA 1IKVA 4DSKA 4J9LA 4LF8J 2CPYA 1HYSA 3OPKA 3VF0B 3UN2A 2OGUA 2GVDA 3NGUA 4DL0C 2Y8WA 2XS5A 3NAIA 1XR6A 1RWNB 3ISZA 1JLBB 3DRYA 5A0YB 5KOWA 2DH9A 1IBKJ 1S6QA 1X7VA 3TI0A 8AT1B 1NCLA 3UN3A 4ED8A 4B9TA 2B6AA 1SB6A 3RJMB 2ZH8A 1TV6B 5KG4A 3ISND 2FUG9 2MKIA 3QT8A 2V67A 4QW9A 4F3OA 1XNQF 3GU0A 1HBMB 1KOHA 5ETKA 3CGIA 1ROFA 4ECRA 3F56A 5K5MA 1I3OB 4F4AA 4QJVA 4AFFA 4WCEQ 1UPMB 1S6PB 2VJVA 5M2PA 4A8QA 1Q5VA 4M5MA 5DG9A 2JNJA 2C2RA 3R2CJ 2PN6A 4NI2B 2J6SA 2GJ2A 3LP2A 3MTKA 4OLPA 4E98A 3DC2A 5KFRA 1AROP 2OMLA 3CDWA 4URSA 3FEXB 2MQQA 2AJFE 3NRBA 2MEWA 2KM8B 4ZVQB 2EFQA 5AJ3J 1WTFA 1HD1A 4B9SA 4DN9A 5D6GA 5B08A 1WD6A 1YHQS 2BKNA 5ADZA 4CM0A 3PDNA 3PW4A 2Q66A 4CRJA 3BN7A 4JI4F 5MAOA 1UFWA 1A9NB 3FSYA 1PKUA 4ED4A 3MM9B 1KTVA 3DLBA 4JYAF 3EDQB 3HLUA 1NJXA 3IS9A 2BW7A 1SQEA 4P2FA 5BJRA 2JEIA 3D1QA 4M1KA 3JXOA 2E7WA 3TAMB 3HHLC 4DV7F 2UU9F 1S1WA 4NASA 3DFEA 1RWKB 4KO0B 3HO1A 4ES3A 3LGHA 1QAXA 5GAHU 2XZWA 4TQRA 2C2DA 2AHOB 4B3RF 4UY8T 1N0VC 2NXJA 3NG8A 1DQ8A 2ZNZA 1L3UA 2N4CA 2Z58B 1FERA 2FJXA 4HTIA 2KKHA 2FJVA 4HYKA 4F7VA 5D0RA 5KFVA 1ICEB 5D3GB 5L1KA 3PKMA 4QR2A 1OPIA 2V4JA 1TMJA 5M2UA 4OLOA 1M5KC 2O66A 2MQLA 2DRBA 4ZOSA 2E9TA 2IRXA 4LT6A 2PE8A 4PQUA 5DRKA 3HT3A 1LWCA 3LPYA 1RHKB 2EKYA 3UPFA 3I0RB 1DQAA 1HNXF 1LOUA 4JV5F 3D6MB 2A6MA 1DURA 4B08A 3PVXA 2L9WA 1M1KT 4RUBA 3HSGA 3W2WB 4KB7A 1EJ7L 2YXLA 3O44A 3SQOP 4DV2F 4U96A 3G6ES 4PWDA 5T14A 3I56S 1NH8A 2RHQB 4N77A 1MG7A 1OQ3A 1WSRA 2EG1A 2UXBF 3F44A 1U26A 3CIMA 1YZ6A 1F9EB 2R7QA 2R2TA 1VQ4S 1S1TB 2ZZNA 2RE1A 2RB7A 1TKDA 3OR2B 5J2PB 2CNNB 5JVGQ 2P2CB 3DM2B 1K44A 3D9BA 2K7JA 3DMJA 3R3TA 2N4DA 4LFBJ 2EFNA 3C46A 5ETNA 2AJ4A 3CD6S 1N56A 2KRRA 4ZVHA 3V4IA 2IMOA 4DOZA 3GTYX 5DG8A 4RBVA 3CB4A 2IJRA 5GADI 3HVTB 1Z2LA 2I0XA 1Q16B 1G4CA 1XEZA 3PX0A 1SH0A 2L41A 3CD5A 3C14B 2GO9A 4K4ZA 1VIOA 3X3UA 2YKQA 1JLFB 2AT1B 1OS5A 3TZXA 1HQ2A 2VH7A 2DNKA 1N5YA 1MU2A 3LO3A 4RZRA 5E2QA 1VQMS 3R1HA 2POKA 1HBNB 3W9IA 3UCUP 4RKUC 3RB6A 4IR1A 3N6MA 2KVQE 2Y9HA 2PD1A 1FRLA 3LAKA 3QRPA 2L08A 3U27A 3LTOA 4DWIA 3R5CA 2MDAA 1FJ7A 5EHHA 1R0BG 2G0CA 3U1NA 3DYAA 5GMDA 5HVGA 4U8YA 4X64J 2DGTA 3OTBA 3HPOA 3J7A1 4K8RA 3ZZYA 2UZAA 5ETMA 3DI6A 3KTQA 1BQXA 4ED0A 4MYUA 2VKZG 5IQ6A 4ZCMA 3J7YU 4R5PA 2KTQA 4WIQA 4ZVUB 3DLKA 3T1YJ 1YJVA 3H20A 1SBRA 2J5AA 4FP9A 4OI3A 1RTJB 1F5AA 2V2QA 2YNGA 1ZBTA 4RW4B 3AD7C 4JV0A 4G65A 2MZSA 3BGRA 1RKIA 4WBFA 2ZE2B 2J0XA 2ACMA 2R2RA 2C2EA 1UMJA 4NLTA 4GVBB 1IJFB 1PG5B 1VQ8S 2XHCA 2OPRA 2VBYA 2W9AA 2CJKA 2MKJA 2K8GA 2ZZTA 2CJXB 1WC0A 3BBBA 2O67A 1UA1A 2BOPA 1X5PA 4JB8B 2CWKA 2FC8A 3K5LA 3ENWA 3GSDA 5K14B 3BYRA 2K2PA 1VBZA 5KFHA 1S48A 3MPDA 3HHLB 4KGMA 3QJJA 1S9GA 4ZN3A 3CXCR 5J1NA 2QA4G 1I6JA 5HJYA 3ET6B 2CQPA 3W60A 4FYDA 2IYGA 4DR2J 1R0AA 2HNYB 4DUTA 3D6HB 3QGIA 4IO1A 1NHUA 3ILIA 3M4XA 2HHTA 2RF2A 3TEHB 1IKYA 3VGVA 3NOCA 4Z7YA 3SDEA 1DTQA 4MIAA 1RWUA 2AGPA 4ILLA 4PZVA 1GAOA 1BE4A 2B7CB 3W8GA 1KQGB 4QWEA 2J6UA 3VALA 1N33F 2WONB 1XWLA 5KFSA 2IRYA 2AD9A 4IR9A 2OEMA 2HHPA 2BE9B 1VS3A 4N56A 2AW0A 3Q8PB 4C6AA 4CCHA 1WKJA 4DR5F 3FCHA 3T1HJ 4U8VA 4OHZA 4YDXA 1CEZA 5EX0A 2XG8A 3WDOA 4PG4A 1KQKA 3EPGA 3TWZA 4X4QA 5FLXY 3R6GB 4DG1B 4FF1A 2RQMA 3MXHP 3BSNA 2WB1D 5HMXA 4KR0B 2BUNA 3GJRB 1S9EA 1FFGB 1W2BR 4K0KF 1RWMB 5CCMA 1EKRA 4Y65A 2P5VA 4CLTA 1LFWA 2F40A 4ICLA 2M5YA 1HQUB 2MQPA 1R6YA 1GT8A 3MR3A 1X0PA 2BJ8A 2HRUA 4MFBB 3Q24A 4JI3F 5F0UA 2DK2A 2XULA 1KBRA 3CDBA 2KI2A 1C0TB 1J27A 1T9TA 4RBTA 2QMXA 5CAAA 2MY8A 2OPPA 2CPXA 2F1FA 4GRSA 4XAKA 1KVKA 4I0WA 4Q2MA 4RW6A 4U7CA 4R8UB 1VCTA 1D8ZA 3HD2A 3U1LA 1H2UX 1YK9A 4NA1A 4WFYA 4DLEA 3E8OA 1U1QA 2AYEA 5KG1A 3TQEA 3EXYA 5HP1B 4PXDA 2ZC4A 5KTQA 4ENOA 3RUBL 3DGVA 5CQGA 4ZITA 4WYLA 1TKXA 2V4QA 2ZWOA 3MZIA 2B43A 4MK7A 1JLAB 2RHSB 3E3XA 3LAMA 4PKDB 4F2RA 1FXLA 3BQ0A 3U7JA 3VCDA 3C6UA 1FJCA 2DITA 3AXMA 2GMJA 2DGQA 2H48B 4OZLA 4KH1B 3RRHA 5B0DA 1XQIA 1EETA 2BMBA 2FVSA 4LF9J 3OXFA 1J5OB 4C0OC 2CPEA 3TAQA 1LK7A 4U9RA 1KOOA 1D3WA 2EI5A 4JI8F 2HQFA 1FVQA 2DEIA 2J7WA 1OQ6A 2HVDA 3GFHA 1KLMB 2XTJP 4ZPVR 4B9LA 1FKAF 2DO0A 1RABB 3H5UA 2KHDA 2AJQA 1S9FA 1S0OA 2BJ1A 1NRKA 4K4VA 2EFOA 1NU4A 1HR0F 3O6QA 3ILLA 2RUGA 4PYAA 4ZJQA 1RBAA 2JSXA 2YKNB 2NXNA 1T02A 4KAIA 2GA7A 2IY5B 1QAYA 2LQ8A 4CH1A 1WJ9A 1RTIB 1V5IB 3ZTRA 3QRRA 5ITHA 4YFUA 4WYWA 3KFWX 3DRRB 3GFXA 1SH3A 1QAIA 4EO6A 4NXNJ 1PGZA 2JLFA 2VBZA 1LK5A 4OL8A 3R27A 3C6TB 2JHEA 3POTA 6FDRA 2B9EA 3M32B 3VGUA 2XWXA 4WFAQ 3VVTA 4UOFA 3PW7A 5L39A 3DRXA 1JMTA 5LXRA 5KFTA 3BDEA 2RRNA 3OL8A 3MOJB 2W4DA 4MYTA 1U47A 1FDNA 3BSCA 3JYTA 5D4OA 2QRRA 4LF5J 3VWSA 1ELOA 1IBMF 2FJAB 3J80U 4HLBA 1N5VA 2V2VA 1YJUA 5LMNF 3QMQA 2KT3A 1T3NA 5HBMA 2M8DB 1M5PC 1IQTA 4ID5A 4DV0F 3C15B 4C98A 3D1OA 1X0FA 1QVGR 3NS6A 2QG9B 2PI4A 5CZVA 5JJBA 3SSQA 2IM2A 2V94A 5IS2A 1T05B 2LDYA 4F26A 3G87A 2HS3A 4HEA9 4NRTA 5LMUJ 3ONQA 2DY1A 2MKYA 1MW7A 1VI7A 5GAEI 4PCQA 4J9SA 3IBCB 4DV1J 1RT2A 4TNOA 1BQNB 5CYQB 3A8EA 3MEEA 3FQKA 3TANA 3UI3A 5IT0A 5D15A 4NOHA 2G0IA 1IWGA 5BR8F 2G13A 2HGLA 2KT2A 2GMLA 2QEXS 4NLVA 3BQ1A 4EYHB 3AAWB 2X1GA 4DR7J 3GR1A 1WC1A 1IR1A 1SVDA 3QT6A 4DX6A 2VB6A 4EBCA 1GFWB 4JI1F 4KBIA 1N52B 5F8GA 1S6OA 2C28A 1GMUA 3HXMA 1WC4A 2FTRA 3OSNA 2CPZA 1R7IA 5AXMA 1DFDA 2VQEF 4AL5A 4USJC 2JX2A 3KLIB 4K5SA 1NEEA 4PXBA 1N48A 1YRXA 2MZQA 3O3LA 1CULA 5EWEA 1KFSA 1U1KA 1RAEB 4OHWA 3DRSB 1RT5B 3CMQA 1P27B 2QX0A 2WCXA 4J9UE 3ZZ0A 3MM7A 2I9SA 1JLCA 3OSPA 1FRMA 1SIZA 5B7WA 4QU7A 1JJCB 3EXCX 2BKOA 4LSLB 2AGOA 1Y0HA 1RTDB 5E3AA 4URGA 1S1XB 1SL0A 2P9GA 4Y2IA 4MKBA 1GK8A 1HBUB 1MWYA 5HAOA 2YX1A 2XY5A 5DM7Q 2OD4A 4B9MA 2W24A 3M2VA 1TQLA 4YDDB 1RSCA 4K59A 1FDAA 5D4NA 4OJHA 1OY6A 4ZP6A 3GIRA 4WXOA 4KT0C 4XPCA 4GKJJ 4MK9A 3CCES 1R89A 8RUCA 3HKZD 3I5CA 1S97A 4GKKF 3PW0A 3R1LA 4JV2A 1RT6A 2GO8A 1LXNA 4J7CA 1T0TV 5ETQA 2E1CA 4HT5A 3SZ2A 1FA0A 2JLEA 2C3UA 4P6QA 2J9EA 2Z56B 3Q8QB 3AA9A 4WF9Q 3W3SA 3H90A 3BPSP 4WFNQ 4L3KA 1HI1A 3RYLA 3TP2A 2GGPA 1VQNS 3KJVB 1NXIA 5K8MA 3E01B 3BV8A 2F9DA 1N88A 4J9QA 5KG3A 1S0NA 2KU7A 3KDNA 4F4XA 1U6ZA 3D0IE 4Y6IA 3CJKB 3HJVA 3Q23A 4F8RA 3BR8A 1G6BA 1NK6A 4F3MA 2CVIA 1FT8A 1RT1B 4CQ1A 1TVRB 4UY85 4EZ6A 2CQ2A 3OFHA 3CMES 1HMVB 4ZA1A 2HQCA 3F73A 5F9NA 1S99A 2R8GA 2PGCA 4YB1P 2CXEA 3QAUA 2PA8D 3PYGA 4DPTA 1APSA 5KFJA 5GAGU 2MZTA 5DDRC 2OO4A 1EQMA 3EWGA 2QLBB 5B0EA 3GCXP 3DKDA 2CQBA 1N6QB 4IDKA 4PYDA 3DGPA 1Z2ZA 4RUAA 1F5BA 2DKOB 3N5BA 3BSOA 2WVDA 1QVFR 3FQLA 1HHQA 2RAQA 4NWBA 2HHHF 1C4CA 2IA0A 1I94J 3FZ2A 3UDLA 2VOPA 2IDLA 2YWFA 2ATCB 1TTHB 2VZ9A 5IM0B 5A8WB 3KWMA 2DB1A 2XSJB 1UETA 3BH7B 4DUYF 2NXUA 1U8WA 4C7QA 2GZOA 1U6BA 1YIJS 5KT7A 2XLJA 3CO0P 1NH7A 2MZRA 5HL7Q 3HSZA 3FMBA 2DGXA 2J76E 2CPDA 1BXNA 2WHOA 1M5OC 4P10A 1S4FA 1QJHA 3I55S 1RAFB 1UW4A 5IT4A 4M5NA 3CJRA 4X2BA 3KHRA 4OX7A 2DJWA 3DOLA 1IVZA 2AJ1A 2PEBA 2JRSA 3C66A 2K1RB 3CULA 2YPZA 2IDEA 4H4KA 3RAQA 2BA9A 1VK3A 4CTAB 1X8DA 4OHXA 1ZS6A 4ZCLA 1HNIB 2E29A 2VPZB 5KG2A 1XR5A 3I4PA 1U09A 4BWJA 4DBQA 4ILRA 4C8KA 3OW2R 2JEFA 3JAMU 1I1GA 2HK3A 1QM9A 3HI9A 1HWIA 4DV3J 4IO9Q 1VIXA 5I42A 2V4RA 1JKHA 1SJFA 3UDVA 2HHWA 4MH8A 3UCGA 4WTOB 4LF4F 3MEDA 2MLYA 4DR6J 1CSJA 3V81B 2ZD1A 1PAUB 2HIQA 1DAXA 3UCZP 4C8YA 4RNHA 2FZGB 4BWMA 4FKYA 3HHKA 1S6UA 2EBGA 4EZ9A 2A3JA 3S8SA 3KMSA 2R8IA 3MM6A 5E5NA 1OY9A 1ZZFA 4IOCQ 3W9HA 4YUDA 4RW9A 3OTOF 4EWTA 1U2CA 3CJ2A 5KFEA 1VBXA 4F0HA 1U1LA 3QGPA 3IN5A 3PX6A 4I64A 3A8IA 3GG0A 2EC0A 2V63A 5I3PA 1LV5A 3UDEA 1RT7B 2UP1A 1TMMA 2ASJA 2CQGA 3V6HA 1QD1A 2GHWA 1V3ZA 2VHGA 1PC5A 4NCBA 1HARA 3ZTOA 2J0WA 4NXMJ 4FKXA 3G71S 1S12A 2FZCB 5E3QA 2E5GA 1WC5A 4PXCA 2H5IB 1KVJA 1C1CA 4DCJB 5J1EB 1O0PA 2UV8A 1BC6A 1RK8A 4X62J 1TZ0A 4KGVB 3G82A 2CIMA 4Z2XA 1H38A 2NR0A 2DD8S 2UXCJ 1C0UB 3N9UC 3J81Y 2IC3B 1KKHA 3KLVA 3M6XA 3TUIC 1B0PA 2HYIB 4KV8B 5KFGA 4DR3J 2ZM6J 3BREA 3C3LA 1BWVA 2GVZA 1F2HA 5HATA 1U7LA 2XHWA 1MMNA 4DFPA 5A8KB 3PHEA 1GXTA 2XBPA 3MOZA 3GIKA 3I96A 4BC9A 2RU9A 4IYQA 5HO4A 4LR8A 1LFPA 4WFBQ 1X5TA 2BE2B 1K0VA 2PMWA 2DY9A 1YWXA 4HTJA 5C2CA 4ZVPB 4EGLA 1AT1B 1Y5NB 2UUBJ 1XC9A 4I2QA 4HL9A 4DZ6A 5HMWA 1NO8A 4KC5A 3TUPA 5IWAF 1EQ0A 2ZH9A 4OYMA 4YHHF 3HFVA 2AWZA 4RX6A 1E6YB 4U67Q 3OLAA 5J2MA 4IG3A 1ZM9A 4DUZJ 3DLHA 4ECWA 5IT9Y 1S1UB 1NK7A 3BH6B 1LWEB 4DV4J 4Y34A 1Y10A 1Q5YA 3MECA 3GB0A 3JQMA 3KJQB 3KLFA 4CLLA 2RRBA 1S0VA 1VR6A 5KFAA 5HLFA 1AB8A 3GR0A 2V8DA 2IM1A 4TKTA 4F67A 3CMAS 4BDPA 3HVWA 4G1QA 3S7RA 2CZ9A 4JI6J 5I3UB 2VU5A 2APOA 3I0SA 3CCMS 1AXQA 2AYBA 4F4KA 3HD1A 3CJTA 2B5JB 2A1BA 2AYMA 3Q89A 5D4LA 2X7IA 4FN5A 3AQOA 2J8AA 3N6LA 3M8QA 5LOQA 1AA1B 4OZ2A 1SQFA 2ZH2A 1TK0A 3CE8A 4ZIVA 2LDIA 3UO0A 2Z30B 3RAMA 2R7SA 1UW9A 2YNGB 3IRXB 1H3DA 4OX9F 4I68A 3WIUA 4DR1F 5J2NB 3CCRS 4KTQA 2XMWA 4FVCA 5A8RB 2F3JA 2HVEA 2PSZA 1MROB 1WWHA 2K06A 1FCAA 1OYDA 1GNKA 2Z8QA 2ZKUA 1KSPA 5CZXA 2CQIA 2BJDA 2XNQA 5EX3A 1VHIA 4CH0S 4C11B 4C0BA 5E41A 4IFYA 4JV1A 2BEFA 3KK2A 3NGTA 1R27B 2VOOA 4MKAA 3THVA 2HNZB 3UD3P 3J81j 4IG0A 4X4UA 4I2PA 2KYXA 3M9MB 1T03A 2K3IA 2BANA 4DXLA 4TYBA 2DTJA 3MM5B 1S9GB 1RYSA 2BOAA 2FJDB 4RNOA 3W63A 4ELTA 3TO8A 4NPOA 4JI2J 1UZHA 4OYBA 4ER8A 5IV4A 4LF7F 5IFMA 2HRTA 2DO4A 1VQOS 3DU5A 2MQMA 3KUHA 1HNZF 3UR3C 2I5JB 1A0OB 2W1BA 2VQFJ 1HI8A 3D1HA 3GIIA 4A4JA 1F3FA 3M9OB 2CPHA 2EK6A 5HSPA 4TU7A 2JVOA 3V6JA 2BR0A 3RBEA 1U2RA 2MGZA 3Q8VA 2HHVA 3CJ3A 4DSLA 2LMIA 3CCZA 1GXUA 4OJ3A 4PRFA 2HKEA 4XIUA 3R5AA 2HFZA 1RHMB 2V68A 2OPQA 1LW2A 3W65A 5A76A 3TJ8A 1REGX 4WU3A 3US5A 3TYTA 2VDHA 2DCLA 2FC9A 2MB0B 3HVAA 1VLOA 3K0JA 1JNRB 1TL7A 4LFAF 1NAQA 1UJ4A 2RH3A 1VQSA 3KXDA 3IO1A 1CS4A 2IHR1 4YOEA 1TL3B 2IAJA 4OYXA 2VASA 4QPXA 3Q83A 3RGIA 1LQ9A 2V2KA 1GXLA 3C2PA 2D3UA 4K2JA 3E51A 1JXVA 1F60B 1DRZA 3GIJA 4OYWA 4P52A 1BY9A 3GQCA 4N7TA 3PJ9A 5A6PA 4Q43A 1IUJA 3ZNJ1 5HVFA 2V0NA 1LW0A 3LA0A 1HW8A 2LP4A 4C3LA 3DOKB 4RWWA 1IKWB 4OYAA 5FDLA 3K5NA 2R2UA 1VQKS 3HDSA 3ILJA 4ELUA 2E44A 4ALZA 5EGYA 4LUBA 1DLOB 4UF4A 2BZ2A 3U1MA 3AODA 4USHA 2CNKB 2AZ1A 2NUUG 4ECQA 2C3PA 3VAHA 2LU1A 1YJTA 2ALYB 1TKXB 4UOHA 4OX8A 3AD8C 2BM1A 2EPIA 4C0HA 2RDJA 4Q2LA 3JSMA 2KZMA 4WZQA 5HQ8A 4NMLA 5IWAJ 1PSDA 3CD0A 1ZAXA 2VG5A 4L76A 2UXDJ 3BS9A 1S76D 4QR1A 1U1MA 1RGVA 3D0GE 3W9JA 1EETB 3I32A 1VOMA 2CVEA 2QFIA 3MTJA 4DJBA 5HROA 1FEEA 4HI2A 2OPSA 3ZFVA 3UVJA 3EX7B 3LP1A 1BLUA 2ZBIA 2RKIA 3VVUA 2HFNA 3PX4A 4ZPTR 1L3TA 2GIRA 2VD3A 1TK5A 1WHWA 2AEFA 5IC6B 3MM8B 2CQ4A 4DR4F 4B9UA 2YWWA 1H98A 3NNHA 1WHXA 2H1YA 2FDNA 5FIIA 3W7BA 2XCAA 3QGHA 4YB5A 5L9XA 3TVKA 1U4BA 5D0EA 4PEOA 2CQDA 3JS9A 2BQRA 5C5JA 1X4HA 2YKMA 1SV5B 3SFGA 3S1TA 1T95A 1RWOB 2KJWA 1NHKL 2OEJA 4KKOB 2F65A 3M1VA 2JFKA 4LQ9A 2VFVA 2CNLB 3C16A 2CDQA 4G1IA 4ITSA 3GSIA 1N36F 5ETLA 3G6XA 2B9WA 2KB2A 2AGQA 2PEHA 2V8VA 4J91A 3ILOA 3NP5A 1TUWA 1PAEX 4DV6J 2OFHX 5KG7A 4Q5VA 3VZIA 2V50A 1TL1A 3IAM9 3TZZA 1R0CB 3V6DB 4E0DA 2A10A 1JXLA 3KNGA 4DCPB 4X65J 2YNFB 3T1AA 3EJMA 4C3MA 3IP0A 3KJFB 2YQ0A 4DPUA 2C2ZB 1YJNS 1NDLA 1TKTA 1U45A 4WTYA 2A18A 3J7Z5 3KUEA 4M5JA 1DJ0A 1RZMA 3GZ7A 4ID5B 3CDUA 2E7VA 1DHMA 2HVZA 1N5TA 3A8KA 4OYPA 1Y11A 4DL3A 2FVRA 3MMCA 2M3DA 3BO2A 4FF4A 3QJPA 2ACYA 4KRWA 2YX7A 3FSXA 4I7FA 2YWEA 2RUSA 5ETPA 4LF8F 4OIXA 1N32J 5FD1A 4OYZA 4NLRA 1VRTB 3IGNA 2Y1JA 4RNMA 1H74A 2R2SA 1ACMB 2KT5A 4UQGA 3K89A 3GMGA 4HH0A 4NA2A 2XYGB 4KHRA 1PILA 1IBKF 4OQJA 5KFIA 2V2ZA 4CYUB 1XK8A 1TL4A 4TYAA 1NZAA 3MDFA 2FJBB 1D8YA 4Y2CA 3BGOP 5F3ZA 3KK3A 4JI5J 3SBMA 2HURA 3PO4A 3OR1B 3M8PB 2WW4A 3LH2S 1Q53A 4GC6A 5DQHA 3EUNA 5C2GA 3J7YI 3MCSA 2CQCA 3N28A 2G1DA 1VBYA 4LFAJ 4PR6A 4I6WA 5LSOA 2H54B 2YX4A 3UE2A 2YH1A 2MKSA 4ZCIA 3OD2A 3OUYA 2MTLA 2O01C 3BGLA 3LWMA 4IRKA 3P8BB 1WC6A 2AF6A 4BBYA 4O4RA 3NKYA 2W7OA 3M7VA 1HQEB 4F25A 1YJ7A 2R3VA 3OVBA 2W01A 2ZBPA 3MD3A 5AJ3F 1VQ7S 1HPZA 3BYPA 4LIWA 4PG6A 2G2YA 3AFGA 1JJHA 2BKPA 2CUYA 3MEGB 2CG4A 2C42A 3DXSX 4WFZA 1N54B 2QC3A 3HHLD 4DHVA 2DRDA 1WELA 1FK9B 2P8IA 3W5XA 1IKXB 2H5JB 2L3MA 5KT5A 1LWFB 1OIAA 2RVJA 3H8YA 4Q0BA 3M2VB 4NCGB 2L9DA 4CH7A 2KYZA 4TLQA 1XJWB 2ZH5A 5L1JA 4ILMA 4W98A 1FE4A 4OHVA 3W5ZA 2QFJA 1OWXA 2FB0A 2EXUA 2Y1IA 1B0TA 4YY3J 4WK3A 4RUCA 5A0YA 1WHYA 2DNNA 3O5TB 1UFLA 2ROPA 4OX6A 1S5ZA 2CPIA 1WOOA 1K73T 3A3OB 5EDWA 1ZTTA 1TV6A 2MMYA 3W8PA 5H9FK 2QGFB 3VZHA 1Q81T 4DF8A 3RRKA 1TAUA 1HBMA 1D09B 1JLEB 3GFZA 3QQCD 2HWTA 4QYRA 2Q6CA 2DXDA 3DDNA 3NOGA 1WUUA 1S6PA 4P7TA 1JB0C 3DDKA 4ZVTB 2XCPA 1TELA 4DU8A 4UOGA 4ED5A 4ZS6A 3BO4A 4V19X 1U49A 2PC6A 3RTVA 3CVKA 4ZLJA 2CNOB 2PI5A 1KN6A 4C8MA 4ZMMA 1SKWA 1YKWA 2HFSA 5CHCB 3CCTA 3WX8A 1REVB 4H4MB 4AE5A 4G1PA 1QSSA 3TVYA 3GYNA 4K4UA 1IN0A 2BACA 2DNZA 4FBUA 4JBCA 4DX8H 1UEKA 3NCPA 1CC8A 3MAHA 3MM9A 3MR5A 3CD7A 1PJ5A 2DRAA 2W8LA 1RE1B 3WIVA 3TAMA 2DHGA 4LFBF 2J9CA 2YNHB 1Q95G 2WK4A 1VFJA 4KO0A 2Z0GA 1B4SA 2EEYA 4WPAA 3ZZPA 4N41A 5JUMA 4CLWA 1QSLA 1UJ5A 3NY0A 2FVPA 1SKRA 4ELVA 1WEXA 1PYTA 3OFEA 5KFZA 3SXLA 2KHCA 5D3GA 3ENAA 2KG0A 3EM1A 1R6VA 2KFNA 4P7VA 1YJ9S 1IM6A 1J5EF 4EI2A 2E66A 1AFJA 3EZUA 4DEZA 4A8FA 2LXIA 3OQ2A 2DGSA 4ES1A 3JTNA 3L09A 4LBHA 4USIA 2Q79A 3W66A 5E3PA 4ZPCA 1SH2A 3FNNA 3G96A 3I0RA 1OY8A 1YITS 1U0HB 2Z4PA 2EFVA 5L1LA 3MAAB 2FLLA 4B9VA 2F4VJ 3S01A 3ITHB 2FHOB 4DSEA 2VG6B 3W2WA 4LF6J 1VC0A 5CYMA 4KJIA 4IQMA 3RU0A 1ZYQA 2CPFA 2DPJA 1RADB 3FC9A 4XK8C 5D0HA 4X64F 2UUCJ 1F3VA 1FKOB 5M2RA 3T6BA 2ADCA 3M2RA 3LANA 2IRUA 4C8NA 2EFPA 3HJFA 1UFKA 3HK2A 2GIFA 4NYPA 2ZUAA 3O1LA 1S1TA 1FTRA 3T1YF 3OR2A 5J2PA 3MF5A 3LP0B 3SSRA 3MHYA 3DM2A 1FNOA 3H42A 1ITPA 4YP3A 4RW7B 4O4GA 1UPPA 5DQIA 4O3NA 1KFDA 3RW7A 2NLWA 2XQCA 1DQ9A 2ZDPA 1BQMB 1NZ8A 3T3FA 5B0AA 2RRAA 2XWYA 4DF4A 2GAHC 2GHPA 1U48A 1FJGJ 5HMYA 3M30A 2HVIA 3CC2S 1Y00A 1JK9B 3HVTA 3V2UC 4N5SA 3TJ9A 3MUMP 2XMUA 2ROEA 1J2VA 1UCNA 4I6YA 2VG7B 3C14A 2AJ2A 1JLFA 2UVVA 1Y9OA 2WVBA 1H7XA 2UVWA 4O3OA 2HRYA 4K4SA 1H0HB 3RR7A 5GAEU 3P45B 3CCUS 4WXWA 1HBNA 1CJKB 3CF5Q 1W25A 4I6AA 1S0MA 1Y4ZB 5KFFA 3KLEB 2Z2ZA 1EHWA 4D3HA 5DGAA 1FJEB 3DHWC 3PXGa 5L38A 1WF0A 2QA2A 3LALA 4OV6A 3UWTA 3D68A 4DPYA 2LQ5A 2YPYA 3B82A 5F8HA 4DR2F 2W7PA 1FX2A 4CNZA 4PG5A 4UZCA 1PJ7A 4OZ1A 2G0JA 3BGFA 1VYAA 2O5DA 3FBCA 4EYIB 3IBFB 2LA4A 3TVZA 4KQZA 5CCLA 5CABA 1VJQA 3SV4A 4ZVOB 4J37A 4JP8A 1GEHA 4JUZA 2J8SA 1FO1A 5D77A 4ZPDA 4J9NA 2XZTB 2Z2YB 3HSDA 5BYQA 3CT9A 3MURP 2QL5B 3HCXA 3HFZB 1YJWS 4RUHA 3G8SA 2WRMA 4MMOA 1F9FA 4B3MJ 3ZXWA 3T1HF 1RTJA 3DOMB 4NLYA 4DMZA 3QWUA 4FF3A 1XR7A 3M2UB 5IV3A 3PKYA 3QBCA 4RW4A 2ZNYA 2BXJA 1YRUA 4F04B 2YKOA 2HHSA 3T41A 2ZE2A 2DGUA 1QDUB 4B3TJ 1R8BA 4K4WA 4GVBA 4KFBB 2MSTA 5DDPC 3P5BP 2C3YA 2XMJA 2MKCA 5KFYA 2VA3A 2RT3A 2D3O1 3NBPB 5KFQA 4FBTA 2QA1A 4MKVA 3DRPB 3IGVA 4IUFA 2I2YA 1SC3B 1IBCB 1H2VZ 3OL6A 5K14A 3O8WA 5J2MB 4ZJOA 3HHLA 4DQIA 1UVIA 1P1TA 3GP9A 4CZCA 3MMBB 4DQQA 3ET6A 4QU6A 1K0TA 3MECB 2VF3A 3QZ7A 5B09A 4OZJA 2BJ9A 1T8EA 4USKA 3H4DA 2HFUA 4KYZA 4DS5A 4UT4A 2Z2LA 2LQJA 1UJ6A 2B8QA 2DYAA 2EW9A 5KFCA 2HBRB 2LXFA 4OHYA 1WACA 4AXIA 4OI0A 2WVFA 2HHUA 4DX7A 1RT4B 2ZOGA 4G1QB 4M5DB 3JTOA 5GMEA 4YN3B 4J9PA 1U1PA 2LXUA 2HHQA 2I1RA 2WONA 1CPZA 2HBZB 1J5EJ 1M0SA 3SCKE 2AQ4A 1WOSA 3V5RA 2Y8YA 2D7SA 2DR8A 8ATCB 1WI6A 1JXEA 2HWIA 2ZH4A 2H9ZA 4ZP7A 2GQ2A 5T41A 4F0KA 3AJDA 2XM3A 4LF9F 1U1NA 2G2OA 1SJ4P 3L4BC 4O0NA 4DG1A 4YR3A 3M8RA 2IFXA 2EKNA 1WORA 4OI1A 2VONA 4LIRA 4HVZA 3FDSA 4FZVA 1T94A 2QYCA 3MUTP 2FHJD 1HQUA 4J9OA 1A7GE 1Q78A 2VC0A 3KJNB 4ZPBA 4MFBA 1B7FA 1C0TA 2W25A 3BPDA 4X66J 1WEYA 2HGNA 1U2FA 4CT8A 5CH7B 3P6YC 2ILYA 5KFPA 4CP5A 5L8RC 2QN6B 3AJ2A 2KDOA 2DT9A 1RLDA 3OTCA 4H54A 2B4VA 1CC7A 1HBOB 4NXNF 4R8UA 2JOQA 3JSYA 2DGOA 4L74A 2HPUA 4JI7J 3CEDA 5HP1A 1Q8KA 3CJ8A 5GAGI 4DZDA 5KFOA 3PW5A 2AIRB 4USUA 3I87A 2HQIA 2NS1B 3K2YA 4FPRA 5LT5A 1H72C 1NJWA 1JLAA 2YQ1A 1KQFB 3EZ5A 2RIJA 3AY0A 1MSWD 4LF5F 4PWUA 1CJVB 2D9OA 2DNHA 1IR0A 3KLHB 3SIPB 2FLNA 2W2PP 5I4MA 3IC1A 2J6TA 1J5OA 3CIZA 3IM9A 4FS2A 4BCAA 1NNDA 2BRKA 1AZSA 1SJQA 3LUYA 4FDFA 3THTA 2VJUA 5D0GA 3EDRB 1S7IA 2PFDA 5LMUF 1V9OA 4H4OA 4OZNA 3QAEA 3MPUB 1Q8IA 2DGVA 1SCJB 3GV5B 2XGPA 1K47A 4DV1F 4YB6A 3EPIA 2MPUA 2YKNA 5BXIA 2VV5A 1UEVA 3H7HB 2DXEA 1UWBB 2MKHA 2F63A 2DNYA 2Y1LB 3GG1A 1RTIA 2W2MP 4DR7F 2GX8A 1FWLA 3KMQA 2W9BA 1HHTP 3PCOB 2M88A 1RB0A 1JX4A 3R97A 1N5SA 1G1XA 5LJ3Y 4NYZA 1G3OA 1NDPA 5F8NA 4ED2A 1ZH5A 3C6TA 3SEOA 4MTPA 1CJUB 3M32A 1NPPA 3TJAA 3AB2B 1MLAA 4QWAA 3CJSA 3MMAB 2XO6A 1S49A 3K5MA 3MCNA 2M0GB 4ED3A 3LF0A 1OPZA 1S1VA 3M9NB 5F8IA 4NEYA 1JLQB 4W4MA 1W2IA 1Q8LA 1L3SA 4CLFA 3D0HE 5L1IA 2ZEJA 3PFOA 2WBRA 2VG5B 3C8YA 1KP6A 3MI7X 3A8JA 4TU9A 4A48A 1HKAA 4EBEA 3Q8UA 2KZZA 3G8QA 2FHMA 2BM0A 3CWJA 1ZAWA 1PBUA 1VJWA 1UWAA 2JFDA 3K59A 1HNWJ 2DNGA 3C15A 1HL6A 4BLGA 2KRBA 1TU0B 1NKBA 4LRBA 2CQ1A 3RAXA 1ZM2A 1C1BB 1ZA1B 2IVMA 1T05A 3ZNUA 3FFIB 3KOAA 5IZHA 2NYIA 2M8HA 5THWA 1RISA 4GKJF 3MAQA 1RCXB 3NMRA 3DLEB 2DIUA 4TY8B 1BQNA 3M6WA 3SMZA 1JWWA 3H40A 5CYQA 1RXOB 2R9LA 3GCWP 2RS8A 5F41A 2IJNA 3AQPA 1Q82T 3OL7A 4K4TA 2RU3A 3H98A 2YH0A 1XBWA 4C8ZA 2ASYA 2DR5A 1PCAA 3N5FA 3UDCA 3NEKA 2LFVA 4ECYA 4K4YA 1IR2A 3C16B 2BQUA 4NZ6A 2DISA 3W64A 2HBQB 5HI7A 4I56A 4CLSA 2VKRA 2A2DA 4CO4A 3BR9A 3KLIA 3MCMA 1R8AA 1X31C 2HAFA 3H0PA 3N79A 2DNLA 3GWCA 3WC0A 1PO6A 2P9EA 1XN9A 4L72B 1X9MA 1WTBA 3DRSA 1RT5A 2CG8A 4CO0A 1KONA 1XIQA 3IBWA 3GJSB 2W7AA 5LSLA 4Q7AA 3NS5A 1VQLS 4QPTA 4UTGA 1TKTB 4HACB 2W9CA 1FVSA 1P9YA 4IH7A 4LSLA 3O2IA 3CDAA 3FEYB 3HFKA 1QY7A 1RTDA 1S1XA 4KHMA 3BF4A 3TR5A 4F36A 1HBUA 2FJWA 4NRUA 5C42B 3FRZA 4X4OA 4UW2A 5C7PA 3PZPA 1XTZA 1KR4A 3X1LB 4NCAA 2ZUGA 4QWCA 3QIPB 4I7FB 1YSJA 2NREA 1U24A 1RU2A 2MY7A 4LF1A 3MCOA 4MK8A 3SFUA 4ED7A 1VLYA 4B3SJ 3FSIA 4LSNB 4HDGA 4JOUA 1Q86T 4U7UD 3UN5A 4IQXA 3BM7A 5J2QB 4NLQA 4ZHRB 4WE1B 1UEUA 1VHFA 3FRYA 3D66A 4LSZB 4KHPJ 5K8PA 1I94F 3Q2SC 2C2KB 2Q43A 3DXBA 1FESA 3BGUA 2J9DE 3B4MA 1KNZA 4GO5X 5IOLA 3DDIA 1URNA 1NPKA 3QLHB 4TN2A 4CDIA 3BBCA 2E9ZA 3M6UA 2E1PA 4DX5A 4IFVB 2M4MA 3KJVA 1JLGA 3IAS9 4ED6A 3DCAA 4TU8A 4J9MA 1NK9A 3E01A 5T7LB 6FD1A 3RBDA 4DSIA 3KLGB 3Q8SB 4E8UA 4KE5A 4QOTA 2H4WB 2IVFB 2L9NA 3QIDA 3D4JA 3UW1A 2HNDB 1NK0A 2ZDOA 2CYYA 5KG0A 1T9YA 3PYEA 1VQ6S 1TP7A 1TVRA 4M5GA 1UVJA 4PG7A 3D6TB 5HJXA 2QL9B 1HMVA 4DFKA 1S57A 2FHJA 3CNQP 3BN4A 4DL7A 4HHUA 2NUHA 3B8HA 2XY7A 2RQ4A 4O3QA 1WKLA 2YNIA 4RBUA 1P8GA 3RBXA 2JC0A 3DLGA 1SUQB 2IBKA 1KVIA 2OMOA 3SQGB 1UTAA 1FFSB 4K50A 4DV3F 1M5HA 4CLKA 2HS4A 1NJZA 2GNKA 1EP4B 4RW8B 1N6QA 3OHBA 4DQRA 4DR6F 2B8PA 1MMLA 3QO9B 3A12A 3N4WA 4QWDA 1FRXA 3CPWR 1RACB 2N3LA 1GMVA
chains in the Genus database with same CATH topology
5G4DA 3S1TA 1T95A 2FJEB 2K2PA 3TW0A 1VBZA 2KJWA 4NA3A 5KFHA 2HMIB 1S48A 3HHLB 4KKOB 4EBDA 4KGMA 3QJJA 2LU2A 3M1VA 1U25A 3DOLB 5IM0A 2QIFA 1S9GA 5A8WA 2JFKA 4LQ9A 2U2FA 3CXCR 2VFVA 2HWHA 1RT3B 2B3TB 2XSJA 5J1NA 3HZGA 2QA4G 2QV6A 2OLWA 1I6JA 2CDQA 2CQPA 4G1IA 4ITSA 4FNIA 3GV7B 1R31A 2XMTA 3Q2TC 4FYDA 5H1SV 2IYGA 1R0AA 3CCVS 4ES2A 2HNYB 4AL7A 2WOMB 1YBAA 4M95A 3KK1B 4KFBA 3MUVP 1N36F 3QGIA 4ZP9A 3HM9A 3G6XA 2B9WA 4IO1A 2KB2A 4QIGA 1NHUA 3M4XA 4W92B 1IXKA 1OSCA 2PEHA 2V8VA 2RF2A 2AGQA 2HHTA 3EGWB 1IKYA 3NP5A 1HNVB 3SDEA 4QBUA 1DTQA 4MIAA 2KFZA 2OFHX 1RWUA 4ZLPA 4DL5A 5KG7A 1NJYA 1TAQA 2AGPA 4ILLA 4ZPWR 1D9DA 1OO0B 3NBPA 4Q5VA 3VAGA 1GAOA 4QCLA 2B7CB 3VZIA 4X66F 1KQGB 4QWEA 1TL1A 2M2BA 3IAM9 2J6UA 3DRPA 3TARA 1QTMA 3VALA 3PIOQ 3V6DB 2FPHX 4E0DA 1X5OA 2O1PA 1N33F 2V5HG 2WONB 1XWLA 2A10A 4HT7A 4OI4A 5KFSA 5I42B 1JXLA 2IRYA 3W2VB 3KNGA 1JKHB 1P9QC 4PUOA 2YNFB 3T1AA 2JDJA 4C3MA 3OXGA 2AD9A 4IR9A 2HHPA 2PO4A 1VS3A 4N56A 2AW0A 3IA0A 3Q8PB 4LQ3A 4C8OA 4CCHA 3MEDB 3NMAA 3L95X 1CQNA 2HZCA 2CQ3A 4DR5F 2ZD1B 3FCHA 3VAIA 1YJNS 1U45A 1TKTA 2F8EX 4WTYA 3NAHA 2A18A 2K1RA 3MMBA 5AXLA 3J7Z5 2MQOA 4XPEA 1KS2A 4OHZA 1DJ0A 4YDXA 2B56A 1O51A 1VQPS 4NXMF 3RRGA 4Q8EA 5EX0A 1CEZA 1Q79A 2XG8A 4L3NA 3WDOA 4PG4A 1KQKA 4OJGA 3GZ7A 3EPGA 4JI7F 4ID5B 4ZKAA 1QUVA 3CDUA 4YEAA 1DHMA 4X4QA 2W4PA 3TNVA 2HVZA 5IQQA 5FLXY 4R25A 1N5TA 4CTAA 1S10A 4DG1B 3MM6B 4FF1A 4DL3A 2FVRA 2RQMA 1RP5A 3MXHP 3MMCA 2MKKA 4RU9A 2M3DA 2EBEA 3BO2A 4X62F 4J5OA 3BSNA 4FF4A 3QJPA 2WB1D 5HMXA 1HNIA 4RW9B 2ACYA 4KRWA 1FDBA 1UVLA 3DNCA 4KR0B 5BYSA 2YX7A 2BUNA 2BYCA 3FSXA 4MKYA 1RT4A 1S9EA 4I7FA 2UXCF 2YWEA 1W2BR 2RD5C 4K0KF 4M5DA 1L3KA 5CCMA 4O44B 1R8PA 4Y65A 3FVYA 2P5VA 1FKPB 2LEBA 2NSBA 1LFWA 2F40A 4ICLA 2M5YA 4LF8F 1HQUB 4OIXA 2GC8A 1VK8A 5FD1A 2EWHA 1Y3KA 2MQPA 5C24B 4NLRA 3KHLA 1KTQA 2JWNA 1R6YA 1GT8A 1VRTB 3IGNA 4U6PA 2Y1JA 4V19J 3MR3A 4DR3F 1X0PA 2HRUA 2VBWA 4GMKA 4MFBB 2ZM6F 3Q24A 4JI3F 1DBDA 2LLZA 5F0UA 4X4SA 1FNMA 3IXQA 2DK2A 4RNMA 3V81A 2XULA 3CDBA 2KI2A 1C0TB 4RBTA 2R2SA 2IVYA 2QMXA 3VQSA 3G6VA 2W4CA 3ZZZA 4WKRA 1V6HA 2KT5A 4UQGA 5C25B 3H59A 2MY8A 3GMGA 1K9MT 1FD8A 3DN9A 2QMWA 1AW0A 2OPPA 1B0VA 2U1AA 1QE1B 4HH0A 4NA2A 2CPXA 2F1FA 4XAKA 1TKZB 3MR2A 4KHRA 1PILA 3A1YG 1IBKF 2NZ4A 4OQJA 5KFIA 4I0WA 5KFLA 3BJYA 3IWLA 1XK8A 2ZKTA 1TL4A 3OVSA 4Q2MA 4TYAA 1NZAA 4UUWA 3MDFA 4RW6A 4U7CA 3NNCA 4Y3CA 4R8UB 2DNRA 2FJBB 1D8YA 4Y2CA 1D8ZA 3HKWA 3OFFA 3CSKA 3U1LA 5F3ZA 3KK3A 1H2UX 4NA1A 4WFYA 4Q8FA 1NB7A 2KG1A 1SC6A 4DLEA 3E8OA 2X1AA 1U1QA 2AYEA 5KG1A 3AA8A 3CJ0A 3PY8A 2IYIA 2UUBF 3T5JA 2F9JA 3PO4A 1FRIA 3EXYA 3OR1B 4OI2A 2AJ0A 5HP1B 3M8PB 1X4BA 5G0RB 4PXDA 1C1CB 3LH2S 2ZC4A 3EYZA 5KTQA 4HKQA 1Q53A 4GC6A 1FEHA 1Q8BA 2P6SA 4O23A 5DQHA 3EUNA 1X4EA 3J7YI 3MCSA 3LQVA 4WZMA 2CQCA 4I67A 5CQGA 3N28A 2G1DA 1VBYA 4IKAA 2HHXA 4PR6A 4I6WA 1VRUB 3ZC4A 5LSOA 4TQSA 5K8OA 1RT7A 2YX4A 4WYLA 3HX9A 1TKXA 3UE2A 4DL4A 2V4QA 1B64A 2YH1A 1MWZA 3IR5B 2MKSA 3GE9A 3MZIA 3AHPA 1IKVB 4ZCIA 1SI9A 2B43A 4MK7A 4X4VA 3WX4A 1JLAB 3MR6A 3E3XA 1HYSB 2E1AA 2M70A 3DU6A 3OUYA 3LAMA 1ZPWX 5KOXA 4PKDB 4F2RA 1FXLA 4DUZF 3K8VA 3BQ0A 3U7JA 4KGKA 3VCDA 1SKSA 1H7WA 3OLBA 2XY6A 3WZ0A 3C6UA 2NQPA 4MJKA 1FJCA 2KXHA 2O01C 3BGLA 3BZQA 3LWMA 4DV4F 2DITA 4Y2MA 4IRKA 2AF6A 4BBYA 2GMJA 2DGQA 4OZLA 5SZTA 4D3GA 4O4RA 1HBOA 3NKYA 1BGXT 4Y0FA 3RRHA 2V8HA 5B0DA 2W7OA 1K1QA 3K58A 4J9RA 2RJZA 5CYMB 2WTFA 1HQEB 1EETA 4F25A 2FVSA 3OVBA 4IH6A 3IR7B 3MD3A 3OXFA 5AJ3F 4C0OC 2CPEA 1VQ7S 1HPZA 4BHQA 4FS1A 3TAQA 1J5OB 4LIWA 2I8EA 1LK7A 3AJ1A 2ZFHA 4PG6A 4U9RA 4NLSA 3CC4S 3MFHA 1JJHA 1KOOA 1D3WA 2YKPA 4ED1A 3RW6A 2EI5A 4B02A 2LQ9A 4ERDA 3MEGB 4JI8F 1S6QB 2CG4A 2C42A 2D74B 3DXSX 3M2RB 4WFZA 5J1EA 2UVRA 1FVQA 1N54B 2PT0A 5K8NA 4A8WA 3CCWA 4DQSA 5JXSA 3HHLD 2J7WA 4A8SA 2QSWA 1OQ6A 3GFHA 1KLMB 3IFEA 4B3OA 4DHVA 2J0QD 4ZPVR 1LXJA 4B9LA 1WELA 2D9PA 1FK9B 4NLUA 2MHNA 1IKXB 2L3MA 1VMBA 2B6AB 1NK8A 1FKAF 5KT5A 1LWFB 4JI6F 1NHVA 1OIAA 1C0UA 2RVJA 3H8YA 4QZVB 3D54A 4Q0BA 2DO0A 3H2LA 3M2VB 4NCGB 2L9DA 4CH7A 1HFEL 2KYZA 2SXLA 3H5UA 4TLQA 2IC3A 2KHDA 4I2QB 2ZH5A 5L1JA 4ILMA 2AJQA 1S9FA 1S0OA 1D9FA 1FE4A 1N8RT 1NRKA 2CZVC 4OHVA 2EFOA 4K4VA 2EFGA 1NU4A 1HR0F 2B4OA 4RNNA 4C9DA 4KV8A 3O6QA 3CCQS 2RUGA 3I4HX 4X4TA 2JSXA 2YKNB 2R7RA 4UUXA 2QFJA 3T9ZA 1F5CA 5DQGA 4RU2A 1OWXA 1T02A 3LW5C 5KFDA 3N0VA 3KLHA 4MIBA 2FB0A 5A8KA 4KAIA 3QZ8A 4O4GB 1GH8A 1HWUA 2GA7A 4EU0A 3H25A 2MQNA 4I69A 4NYOA 1QAYA 2Y1IA 3THPA 3UQSA 4CH1A 1HNWF 1RTIB 4IG3B 1B0TA 1KHWA 2BVZA 4N47A 5ITHA 4PXEA 4WK3A 5A0YA 4RUCA 2UVUA 3LGMA 3LP2B 4YFUA 4WYWA 3KFWX 1WHYA 1ZM3A 2DNNA 3DRRB 3GFXA 3O5TB 1WEZA 2R8JA 1UFLA 1SH3A 2XMVA 2RMLA 2MZJA 1QAIA 2ROPA 2BE2A 4F02A 4EO6A 4OX6A 1PGZA 2BW2A 2CPIA 1RYRA 2ZZMA 3M30B 1XNRF 2GJIA 2H5EA 5DGBA 2JC1A 1K73T 1ZTTA 2JLFA 5EDWA 3OJSA 2HNYA 4ZDNA 2VBZA 4M63A 3JSBA 3KLFB 3EGZA 2RQKA 1TV6A 5AE3A 2MMYA 1LK5A 3MPVA 1UA0A 1HWLA 4R0JA 1FNXH 2CKWA 3J80Y 3VZHA 4TY9A 4OL8A 3R27A 3C6TB 2JHEA 2ASDA 1Q81T 7FDRA 4DF8A 3POTA 3RRKA 6FDRA 5HLFB 1XMOF 3I6PA 3M32B 1JJ2R 2XWXA 4WFAQ 2JEJA 3PW7A 1TAUA 1HBMA 5U47A 4B17A 4F3QA 1JLEB 3GFZA 5L39A 1SJRA 2HG4A 2HWTA 3DRXA 2MSSA 1JMTA 5LXRA 4QYRA 5KFTA 2Q6CA 3DDNA 2EK1A 3BDEA 1UWBA 2ILZA 2RRNA 3OL8A 3PEJA 3FGVA 1F2GA 3MOJB 3I0SB 4NZ0A 2W4DA 4NL5A 4MYTA 2VA2A 1E6YA 1S6PA 3Q22A 3G9CA 1U47A 4P7TA 1JB0C 1FDNA 5D8HB 4AYBD 1O8BA 3BSCA 3JYTA 3DDKA 5D4OA 5L9NA 3U02A 2QRRA 3KHHA 2HS0A 3PRDA 2XCPA 2QE5A 3VWSA 3IS9B 1ELOA 1IBMF 1S1UA 2FJAB 1LWEA 3JTPA 4HLBA 1FXDA 1N5VA 1K8AT 4ED5A 1YJUA 5B0CA 5KG5A 3M8QB 5H9FJ 5LMNF 4DFMA 1AFIA 5B0FA 4ZS6A 3QMQA 3BO4A 4DSJA 2KT3A 1T3NA 5HBMA 3T5LA 4V19X 3G6YA 2PC6A 3RTVA 3CVKA 1U49A 2DR7A 4G6VB 1S1WB 4XDCA 2PI5A 1KN6A 3ULHA 4C8MA 4ZMMA 2M8DB 1M5PC 1IQTA 4M94A 2R7OA 1SKWA 5DJBA 2B9XA 4ID5A 4A8YA 4DV0F 3NCRA 4JI2F 2PIIA 3CJ5A 1U1OA 5CHCB 4C98A 3CCTA 1WI8A 3D1OA 4DPOA 3CUNA 1REVB 4H4MB 4AE5A 1X0FA 1QVGR 3T19A 4WU2A 5DS7A 4G1PA 3NS6A 3TVYA 2G9OA 1RI7A 3MGJA 1QSSA 2PI4A 3JSRA 5CZVA 5JJBA 1WHVA 3SSQA 3PNIA 2IM2A 3MMAA 3GYXB 2V94A 1LKZA 1QAJA 1P6TA 5IS2A 1T05B 2LDYA 3TOQA 4N76A 3GYNA 4F26A 3NCQA 4AUKA 3H2VE 4K4UA 2WBMA 2HS3A 4HEA9 4NRTA 1IN0A 2VQFF 4AQYF 3ONQA 2BACA 5I3UA 2DNZA 2XMMA 2G4BA 4EO8A 4JBCA 4FBUA 1MW7A 1N4LA 2V4JB 3ICLA 4DX8H 1YTYA 2YTCA 1VI7A 3NCPA 1CC8A 3MAHA 5GAEI 1YVFA 1JLQA 3MM9A 2F7VA 3MR5A 4PCQA 3CD7A 3F41A 1VQ5S 2CQHA 4J9SA 2B5JA 2GQQA 4IFYB 2DRAA 2N3OA 2FY1A 1RT2A 3KK2B 2MZ1A 4PQUB 4Y2KA 2W8LA 4TNOA 2DVIA 1G2EA 1BQNB 5CYQB 2QO3A 3A8EA 3E2EA 3MEEA 3TAMA 3FQKA 2DHGA 3UI3A 3RZAA 5IT0A 3TANA 1LWCB 4NOHA 3IRWP 4LFBF 2J9CA 2LEPA 2QLWA 2YNHB 1R8HA 5BR8F 2G13A 2HGLA 2WK4A 1VFJA 3IRXA 4IG0B 2KT2A 2GMLA 2Z0GA 2RNEA 4I2PB 4KO0A 4C3KA 4NLVA 3BQ1A 4EYHB 2QEXS 1T03B 4IRDA 5E3RA 4ZK7M 2BANB 3AAWB 2VFSA 2LECA 3ISNC 4ATNA 2X1GA 5J2NA 2AX1A 2K3KA 3ZZPA 4N41A 5JUMA 1UVMA 3GR1A 1QSLA 1UJ5A 5A8RA 2XS2A 2VB6A 4EBCA 2Y0SD 2FVPA 4JI1F 3CJ4A 1SKRA 2E9RX 1MROA 2OKQA 4KBIA 4ELVA 1WEXA 1N52B 3NL0A 1C1BA 1JNZB 3OFEA 5KFZA 3FFIA 3T9NA 3SXLA 2KHCA 2OSQA 5F8GA 1S6OA 1S72S 7FD1A 2PFFB 4PPZA 1HW9A 2C28A 5D3GA 2KG0A 3HXMA 1M90T 2P9CA 2R7WA 4PWDB 2UUTA 2FTRA 2KFNA 4P7VA 4PG8A 3OSNA 4LVOP 1YJ9S 2CPZA 4O3SA 1R7IA 5GVQA 1RKJA 5AXMA 1J5EF 2P6TA 4C11A 4B3SF 2CRLA 1DFDA 2VQEF 1KRPA 2E66A 1AFJA 4AL5A 5B0GA 4USJC 2JX2A 3EZUA 3KLIB 4K5SA 1NEEA 4PXBA 3ZZTA 1N48A 1YRXA 2KXFA 4DEZA 4A8FA 2LXIA 2LYVA 4O3PA 2LKZA 2MZQA 3OQ2A 3DLEA 4DFJA 3O3LA 3PRBA 4TY8A 3T5HA 3TAPA 2DGSA 2DBBA 3JTNA 3L09A 4ES1A 3RB4A 2DNQA 2ABYA 2AP6A 4USIA 2Q79A 5EWEA 5E3PA 2DHSA 4ZPCA 1KFSA 1SH2A 2HNZA 1U1KA 3FNNA 3G96A 3I0RA 4OHWA 3CCLS 3GV8B 2HW3A 4F4WA 1YITS 2Z4PA 4KHPF 2EFVA 4K5RA 1DARA 3DRSB 1RT5B 5L1LA 2VODA 2EG2A 2ZH6A 2FLLA 1P27B 1KEKA 4B9VA 1U1RA 2V9KA 4CT9A 3S01A 2WCXA 3ITHB 5AXKA 1KC8T 2FHOB 2V8GA 3MM5A 3MM7A 2B51A 3ZZ0A 2I9SA 2YQ3A 1JLCA 3OTEA 2MGZB 4DSEA 1FRMA 3OSPA 2VG6B 4C97A 1SIZA 2KO1A 5B7WA 4QU7A 3W2WA 4YR0A 2DIVA 3N01A 3EXCX 4K2XA 2R8HA 3DMJB 3S6EA 1VC0A 3QJLA 5CYMA 4KIAA 4O0IA