1IBLF

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
b'MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
molecule tags Ribosome
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1iblF00
2KJWA 4AQYF 1F60B 2BXJA 2E5LF 2HHHF 1N36F 4JV5F 4JI7F 4DR6F 1FKAF 2UXCF 2J5AA 4DUZF 4DV7F 4DR3F 4JYAF 4LF5F 4NXNF 4X64F 4KHPF 4DV3F 3T1YF 4DR2F 1HNZF 5BR8F 5IWAF 5LMUF 4DR5F 4B3RF 2KJVA 1GH8A 1J5EF 4GKKF 4YHHF 4B3TF 4LF4F 4DR7F 4DV4F 2UXDF 1IJEB 1CQMA 2B7BB 4JI4F 1IJFB 2BVZA 1XMQF 1LOUA 1HNWF 4OX9F 2UU9F 4LF8F 2UUAF 4LF9F 1QJHA 4GKJF 4DV5F 1XNQF 5AJ3F 2ZM6F 1IBLF 1XNRF 4X62F 1HR0F 1B64A 1G7CB 2VQEF 3T1HF 4LFCF 1N33F 1N32F 4X66F 4B3SF 4B3MF 4DV0F 4LFBF 1G1XA 3OTOF 4YY3F 4DR4F 2UUCF 2B7CB 4LFAF 2YY3A 4DUYF 2RJZA 4K0KF 4JI5F 1N34F 1XMOF 4X65F 1IBMF 4JI0F 4DR1F 4JI1F 4LF6F 4DV2F 3ZZPA 3R3TA 2UXBF 1CQNA 5LMNF 2VQFF 4DV6F 4DV1F 4JI2F 2F4VF 1RISA 4JI6F 1I94F 4JI3F 4JI8F 1HNXF 4LF7F 2UUBF 1IBKF 1VMBA 1FJGF 4NXMF
chains in the Genus database with same CATH superfamily
3IM9A 2OPRB 2IYGA 3PM9A 4GKJJ 1K0TA 1X0PA 4L3KA 2BXJA 4P7VA 2JEIA 2JNJA 1VQKS 4JI7J 1HW9A 1UEUA 2QSFA 3MECA 1KQKA 3LO3A 5J2QA 2UXDJ 4JI6J 1OQ3A 2M52A 5DDOC 4CH1A 4U8VA 1X60A 2DHXA 2BA9A 2OPQB 3KJNB 3TEGA 4WP8A 2N7CA 3RU0A 1L3VA 4K4UA 1LFWA 4F3OA 4F0HA 3A12A 1VQ4S 1IKVA 2YNFA 5KFEA 4ZK7M 2VG5A 3CT9A 1RHUB 2NSBA 3FEXB 2WOMB 3D66A 3M2RB 5DGBA 3P8BB 1VQ8S 3O44A 3UO0A 1XR5A 2GQ2A 4F0KA 2IRUA 3CB4A 3UCGA 3TYTA 4EMDA 4TKTA 4O4RA 3BEGB 4OJ1A 5LMNJ 4DV4F 1KFDA 1K44A 1W25A 3FDSA 4ZJOA 3CULA 2YNGA 3FSIA 1FDNA 1F5BA 1F0XA 4ECZA 1W2BR 1QY7A 4NOHA 5D15A 5A8KA 3LP0B 3I55S 5HROA 2IIHA 1GXLA 1KHWA 1WC1A 2RRNA 1T3OA 3CMQA 3I0SB 4TLQA 4CLTA 1LKZA 4ETXA 1QAIA 1AROP 1HNVB 4A8MP 1MWQA 4IRCA 1Q1KA 2XYHB 1WHXA 1RT4A 2V69A 1BHNA 1PYTA 3OFHA 1YX2A 4OHXA 4OI1A 4Q8EA 4PRFA 4R8UA 4M1KA 2KHDA 2N4CA 4ED1A 2ADBA 4X2BA 1NAQA 5AE2A 4RNMA 4OX8A 4C2MA 3CDBA 3T41A 4ANCA 5JXSA 3NNCA 5BYSA 1U2CA 2DO0A 3TUIC 4ENOA 3OXFA 3VAMA 2CQ0A 3BGFA 2V34A 4P2SA 1SXLA 2AX1A 1TL3A 3I5CA 3DOKA 3IRWP 4DL2A 5CCLA 2ZUAA 3B8HA 4GVLA 2C2NA 3T1HJ 1WKKA 3GYGA 2EFGA 3QMQA 1RAOA 3TJAA 1SKSA 4F2RA 3H5XA 3P49B 4ID5A 1ZAVA 2BQUA 2E9TA 1OS5A 2LMIA 4DI6A 5L46A 4C9DA 3BR9A 1U2FA 2EFOA 1IVZA 1HBNB 1S4FA 3QLHA 3PEJA 2FJDB 4OZ3A 2DGOA 2MKKA 4X4TA 5J2PA 2OH2A 2A2CA 1RHMB 1XN9A 4ECTA 3O5TB 2JLEA 3M7VA 4LRFA 5E3PA 2UUTA 1WTBA 1FESA 1RKJA 4DL5A 4YQWA 3QQCD 2GS8A 2VOOA 4OFZA 3T1YJ 2IC3A 2ZITA 2XMAA 2A1BA 2YPYA 3SIPB 2MKCA 3BSAA 1UVLA 1HBUB 1T94A 2IRYA 4J9KA 4JI1F 2AD9A 3MTJA 3M8YA 1HBMB 3M1VA 1FWKA 2B3TB 3IAS9 5EDWA 2ZH2A 4OYIA 4DF8A 2GMJA 1QD1A 1XEZA 1UEVA 3FK4A 1REGX 2JDJA 3HF5A 2LQJA 3L7PA 1PSDA 3AT1B 1XIQA 5B0FA 3LGMA 4USKA 3BBCA 2CQ3A 1JK9B 4RW9B 3IN5A 1BGXT 5FLXU 1I94J 2HMIB 3Q2TC 2B9YA 2FJXA 3KLFA 1NB7A 5KFCA 1VBXA 4JI8F 1VS3A 1NK9A 4IQXA 1F3VA 2L48A 3RJMB 1Q4RA 1CSJA 1RAHB 5B0AA 2VICA 3TAQA 2D3ZA 3MAQA 5JVHQ 1TKTA 4AXIA 2XY5A 3C14B 8RUCA 2H5JB 4USWA 5K8OA 3PCOB 2YQ0A 3TARA 4IQMA 3Q2SC 5HAOA 4PAAA 3C2PA 1XC9A 4HVZA 3I4PA 2QV6A 5J1EB 3DM2B 4W90B 1A6LA 1E6YA 2HVZA 1P1TA 1NSKL 2I5JB 3GZ7A 5J2MB 1JLGA 2CQPA 1B7FA 1WORA 4UUXA 1UP1A 3JAMU 1NJYA 1M90T 3NGKA 1YRXA 1R0CB 2I0XA 3G8TA 1SQFA 3TRGA 5I3UB 2J9CA 5LOQA 4PG6A 5KFDA 4ELTA 4V19J 1NEEA 4MK7A 1UWBB 2V8PA 1WF0A 2GHWA 2MLYA 4HL9A 3ILJA 4C48A 4DR5F 1IR0A 3MR6A 2RDIA 2H9ZA 4YMEA 3EZ5A 3PX6A 5FDLA 1FNOA 2N3OA 4L3NA 1N5YA 3PY8A 2NUHA 1T9XA 3NAIA 3DXBA 4QYZK 4PWDB 2RDDA 2B7BB 2GVZA 4J5OA 3HXMA 5E0OA 2QMXA 5K8NA 5F0WA 4QU6A 2HRUA 4LR8A 1T05B 4LUBA 4B9SA 2VBXA 4KHPJ 3CJKB 2V8GA 1WF2A 4YOEA 2DITA 3PRBA 3LW5C 3DMJB 3L4BC 1A9NB 1F2GA 2HSEB 2DRBA 1FRHA 3PZPA 2O01C 2YWWA 2KFNA 1APSA 1TL7B 3C15B 3D4JA 1KS2A 2QLBB 4LREA 2BMBA 4M5KA 4WU2A 4B9VA 2IPOB 3IWLA 3JS9A 1SH0A 1RSCA 2LDIA 3CJTA 3H20A 3JSMA 1SH2A 3C14A 2YWGA 3VTIA 1PG5B 2FC8A 3F44A 5ETKA 4O3NA 2D69A 4CM0A 1Y9OA 1S0NA 1N88A 1ZTTA 3MAAB 1AA1B 2C3MA 1ACMB 2VIHA 1RTIB 1FHTA 1T9VA 3PHTA 2XBPA 4C3LA 3MD3A 3OUYA 1KLMA 1EP4B 3DMJA 3KXDA 4PWDA 3HHLD 3TWZA 1EETA 2GHVC 2UXBJ 5G4DA 4RNOA 4CTAB 4RW9A 2RKIA 5KFVA 1RWXB 2MHNA 2DPJA 3N6LA 5DGAA 1SL0A 1RA7A 2E29A 4FF4A 2LCWA 5DZ7A 5E7OB 1SCJB 1N6QA 3T1AA 4WE1A 4AL6A 5D0GA 2GJIA 3D6HB 4H4KA 1VR6A 2OPPA 1FI4A 3IBFB 4M5LA 1NKBA 1M5VC 1T03B 4NMXA 1XNQJ 3H0PA 5BYRA 4TU9A 4DJBA 1DFDA 1CLFA 3GJQB 2ZC4A 3D28A 4RW6B 2J6SA 4EZ6A 3BKFA 3KJQB 3VCDA 3I87A 4Y2AA 3W60A 1M0SA 4E8UA 2O66A 3WZ0A 2VDIA 3D5MA 1S1TA 2BR0A 2J7WA 3BYPA 1HNWJ 1TFWA 2NZCA 5RUBA 5J1PA 5KFUA 1HQUB 2JX2A 2YH0A 2HLUA 5T7LB 3J7ZT 3HK2A 1DQ9A 3LH2S 1HIYA 3TVKA 4DR4J 2RS2A 4DCOB 2K06A 1RTHA 2GO9A 2X3GA 3CJ5A 4LSLA 3OTDA 4OYMA 1M5PC 1TL3B 2VKZG 1R8CA 3UR3C 5C7PA 4P72A 2PMZD 1DZ5A 2OEJA 2UV8G 3SFUA 5BR8J 4LF7F 1GXTA 1U2RA 3NGUA 4QYRA 4TXSA 4DFPA 3H4BA 5DJBA 1WUUA 4X62J 2KXNB 3T5HA 2MKJA 3HJFA 4LF2A 3KLFB 1NB2A 2RD5C 2HQFA 5EGYA 2YX7A 2ALZA 2AGOA 1HWJA 1QE1B 1NDPA 1SV5B 3Q8VA 2HS0A 4L74A 3H4DA 2FQQB 4FF1A 5F8IA 2QYGA 1U09A 3NGTA 3CCUS 3EDRB 1YG0A 3QT5A 1HHQA 2HRYA 1FWLA 4DX6A 1D0EA 2VUGA 3HT3A 4OHYA 1DHMA 1X4GA 1Z2LA 4KPYA 1Q7LB 2HFOA 3LP0A 1LW0B 1JLEB 4O3QA 2MYFA 2JFKA 2ZBCA 2DO4A 1R0AA 5U47A 4Q0BA 4IYQA 4PQAA 5C42B 1FFSB 2IC3B 2FUG9 2DH9A 5KG5A 3HVTA 3T19A 2R2UA 3DDNA 4O0NA 3QIPA 1HYSB 2IDEA 2CQ1A 1YRTA 2KT5A 2MKHA 4P7TA 3Q8SB 1GH8A 4QR1A 1R0BG 3CD7A 2A10A 3MCMA 3MEDA 4LF4F 4DSKA 1ZPWX 3MMCA 4WWSA 5BYQA 2MHEA 2KH9A 2HK2A 1RWVB 2V2ZA 2HGNA 2XHCA 3N0VA 1HL6A 1GMWA 2XY6A 2RB7A 4K0KF 4ECQA 4AL7A 5ETQA 2XNQA 4OV1A 1SJQA 3QNWB 4A8XA 4F67A 1S1VB 1WSVA 4KYZA 2DNHA 2WVBA 2FPHX 1UZHA 5D6GA 2XLJA 3KHRA 1T8EA 3D1QA 5HO4A 1YIJS 3HI9A 4CO0A 2JOQA 4FF2A 3PX0A 4LF8F 3P5BP 2GIQA 4B02A 2QE5A 4OYBA 5CHCB 2G2YA 4ZCLA 2FJWA 1TFYA 4H4MA 5AJ3F 2GVDB 4XAKA 1NRKA 5J1NA 1HA1A 4ZLNA 4LRAA 1NK4A 1RAJA 2PD1A 1S9EB 3BDPA 4OZ0A 3MR5A 4OZ2A 2UXCJ 1HNVA 3B6BA 3O6QA 3ONQA 2DB1A 2DGXA 2EFVA 3TX0A 4P74A 3ZTOA 2DXEA 4C8KA 3RB4A 2DBBA 3O3LA 4ZJLA 2M4MA 3MTKA 4B3SF 1X4DA 1UVIA 4RU2A 3HT0A 2C3UA 2R7RA 3HFKA 2EG1A 3OTOF 1TVRB 1K9MT 2R2SA 2WB1D 3DGVA 4IDKB 3TQEA 4CLUA 2DR8A 2PSZA 1R8AA 1VQ9S 1HARA 1X4EA 3GWCA 3H8YA 2C1EB 3SQOP 1V3RA 4I7FA 5IC4B 1U6BA 4URGA 1K0VA 4DUYJ 3QIPB 2CRLA 4YB7A 4J9VA 2W25A 1YTYA 4JI5F 1KTQA 1IKVB 2FVRA 3KNGA 2LKZA 5C42A 2KTQA 3OVSA 4UOHA 1IBMF 1URRA 1U1LA 2Z2LA 5EHHA 3WHIA 1CG2A 4PR6A 1FCAA 1LW0A 2PGCA 2BX6A 1KQGB 2QIFA 2ZD1A 1MWZA 4WCEQ 3KUHA 1IR1A 2HQGA 2K8GA 1U7LA 1UVKA 1RHKB 1KLNA 1RB0A 4WK3A 5J2QB 2MGZB 3Q0AA 2BACA 5HBMB 1HHSA 3MMAB 4KGXB 3OHAA 5D3GA 4PEOA 3LQVA 1S6OA 5FD1A 4W4MA 4ZN1A 1PIEA 4CCHA 2F4VF 1QE1A 3HFVA 3KWMA 1NK6A 1X8DA 1OO0B 4MK9A 3TEHB 2R7XA 1X9MA 2W4PA 3J7YU 3DLEB 1MMDA 3MPWA 3K58A 1WKLA 1NZAA 2HZCA 3BH6B 2IM0A 2DEIA 3VAKA 1RTHB 1FDBA 4LVOP 4X4PA 4RW7B 2FYXA 2I1RA 2RRBA 3LPEA 3O8WA 4AQYF 2C2KB 1RAEB 1A0OB 2GHPA 1HQUA 4WXWA 5E3AA 4Z7CA 5IV3A 3OJSA 2BJ3A 1ICEB 3WIVA 2FJEB 2QA1A 2OD4A 5F8HA 2W9CA 3BO2A 4ICLA 1S0OA 2HHUA 1WI8A 1WG1A 3TZWA 1NK8A 3VGUA 2HHSA 4DUZF 3LANA 3D6MB 2NXNA 2F3JA 1CC8A 2B9XA 4U7CA 2VHGA 2G1HA 2FD2A 3N4WA 5GADU 2BJ1A 4ELVA 3C46A 4MFBB 3CW2C 4ZLPA 2RRAA 2EG2A 3C66A 4YB5A 3EVMA 3PG9A 3HSZA 4NYPA 4X4RA 1FWPA 4XK8C 2G0CA 2I6WA 2PA8D 1BWVA 3AFGA 5E3QA 5K14B 2HFNA 2HG4A 1BQXA 4BCAA 1HNZF 1A7GE 4OX7A 5KFAA 4NLUA 3SSRA 1T03A 2XSFA 3M8RA 1BE4A 1FKOA 1LXJA 1UAWA 2CQ4A 2HS4A 4WFNQ 4WFXA 4BWJA 3ILIA 4PPDA 4TN2A 4WE1B 4ZPTR 1S1XB 5AE1A 2IA0A 2BW2A 2VF3A 3ZXWA 5DG9A 3UDCA 1HKAA 3E8OA 4Q5VA 4JI4F 3UD3P 1M5KC 3KOAA 2YWKA 1JLBB 5KFFA 3N5BA 2YX1A 2RKIB 3KLEA 4HH1A 2IM3A 1EETB 5DM6Q 1PJ5A 3SV3A 2FZKB 3FNNA 3GLJA 3D6TB 1I1GA 2V8DA 2ZUGA 3G82B 3LGHA 1NSQA 3WDOA 1RADB 4LF1A 4BBYA 3EE3A 1HI8A 1WDDA 4I2PA 4UUWA 4WTOB 2OTLS 2VA3A 3KG0A 4LFBJ 1NXIA 2CJBA 1YITS 4AL5A 4QR2A 3M8PA 3A8JA 2UU9J 1ZS6A 2JEFA 1UW9A 3HDSA 4LIRA 4LF8J 3BYRA 2UUAF 2NR0A 2K3IA 2KZMA 9RUBA 1DAXA 4F4XA 2RHQB 4EU0A 1Q78A 1R8PA 1U24A 3T6BA 4UQTA 5AJ3J 1SL1A 4FBTA 1TL7A 3C15A 3AB4B 3D7SB 4NLXA 2VBZA 3VVTA 4ES2A 3V81B 1V6HA 1ZH5A 1CEZA 5D8HB 2CUYA 4ED7A 1SH3A 4WYWA 3K59A 2HQCA 3TI0A 2CDQA 3NRBA 4TYBA 4LFCF 1Q5YA 2MQ8A 3OL7A 3H2UB 4ZVHA 1N33F 1YJRA 1C4CA 3NL0A 3K7RA 2ALYB 1YZ7A 2NSCA 4IKAA 5I4MA 1GQEA 3W63A 3OTOJ 3PW7A 2K7JA 4I69A 2E1RA 3VAHA 4O3RA 3MD1A 3KK3B 1OIAA 2KVIA 1HHTP 3ZZTA 2GAGC 2J8SA 4IG0B 2MZRA 3UN5A 1AXQA 3MEKA 4RZRA 3M9MB 1N5YB 2QX0A 4FS1A 1YJUA 1RYRA 2B51A 5D4PA 1BQMA 2C2EA 3CJ4A 4NRUA 2ILYA 2ZM6J 3MM6B 3A3NB 3HHLB 2Y0BB 2RUSA 3QAEA 3CJ3A 2OFGX 2VG6A 4C97A 3HMJG 4U6PA 5F0UA 3SZ2A 3FGVA 2KB2A 4YFUA 4RBVA 1IQTA 4ZMMA 3S8SA 2A6OA 4ECUA 4ZVUB 2OI2A 4ECVA 1SL2A 2X1FA 3OL9A 2GC8A 4ZCKA 3CDWA 4IO9Q 4DLEA 3AY0A 1RWMB 1WACA 2VD3A 5LMNF 2DR9A 4LFCJ 1N54B 2I5JA 3KMQA 1N33J 2VQFF 4JUZA 4IH5A 3GV7B 1JQGA 1NHVA 3AD8C 3D0GE 1D8ZA 2JVRA 2M5YA 4ZDNA 1RT3A 2MSTA 4UT4A 1U1PA 4F2SA 1LK5A 4P10A 2HFUA 3AH6A 3AXKA 4R25A 2NQPA 3W64A 4ECWA 3CIZA 4KGZB 4BC9A 2DHSA 2ATCB 3SEOA 1H73A 2XYGB 4LT6A 1RHQB 2HRTA 4NEZA 3AODA 4CLWA 5LMUJ 3TJ9A 1EX8A 2ROGA 3MUVP 5DLFA 3RW6A 3RAMA 1FNXH 1HLWA 5C25A 2CPHA 2HWTA 4HEA9 4W98A 2H4YB 1TAQA 3F56A 2UUWA 4KT0C 4DV5J 2QLWA 1RTZA 1BWEA 1U1RA 3MM8B 3SDEA 1S48A 1TKZA 4UOGA 4CO2A 2G4BA 3DDKA 3NS7B 5GAHI 3KLHA 1X4BA 2BM0A 2VFSA 4DU8A 3MUTP 4J9UE 1U1OA 5C2GA 3EZUA 2YQ1A 1FK9B 4IOBA 1S6QB 3H59A 5L38A 4J9RA 1IM6A 4JI4J 3R2DJ 3OVBA 2XS7A 1YWXA 3D54A 3DHXA 3MPDA 2V2KA 1U48A 3MOJB 4O23A 3M1VB 2F8MA 1H2UX 1HWUA 2HKEA 1CJVB 3DU6A 4A8WA 1SJ1A 2AQ4A 2R8HA 2CFXA 4N77A 4ZVTB 3UN2A 4WTYA 4Q45A 4DL4A 3HHEA 5HMZA 5IWAF 3QT7A 3P6YC 2YBVA 2VODA 2W7PA 3PIOQ 4AT1B 3FUYA 4B3TF 4EBCA 2UUAJ 1N8RT 2QLXA 1U25A 2OEMA 2RU9A 2V2VA 2PN6A 1VRUA 3CCWA 3FSYA 3I32A 3NWGA 3TW0A 3MFHA 3W2WB 3DRRA 4TY8B 2MMYA 3JQKA 3TUJC 5KTQA 5HP1B 4QR0A 1ZETA 4ID5B 2VH7A 3OR1B 3A8IA 3CCLS 2BABA 1S6QA 3SSQA 2PI4A 3HD2A 4DV7J 1FD2A 3DOKB 2ZWOA 1SQGA 1C0TA 1FDAA 3PYDA 4TU7A 2CJAA 1FRLA 1HD0A 1VFJA 2VKRA 1VIOA 3FEZA 2B6AA 5F3TA 5KFPA 1QM9A 1VISA 4KSEB 4QZVB 4C0OC 4UTGA 4F3QA 1WG4A 2V50A 2XSJA 2ZBPA 3TZXA 1AB8A 3KK2A 3IMQJ 3IFEA 4OJ3A 1VBYA 1NJIT 2HHVA 3TAMA 3WBZA 3W9HA 4WFBQ 3PO4A 2CJXB 2QL7B 2FVSA 5B09A 2XMKA 5G0RA 1Z4UA 2HK3A 5GAEU 5I42B 4DX7A 3EJMA 1HI1A 3LP2B 1HR0J 1AW0A 2KXFA 1T3NA 1Q86T 1L5UA 3JAMY 2CPYA 4K5SA 2PFDA 3H5UA 3HX9A 3G86A 1SJ3P 4DV3J 2ASLA 2EBEA 4ERDA 4F4AA 4DR4F 2VB6A 1C0UB 1JNZB 2HNYA 4OLOA 2B7CB 2CWKA 3CC4S 2HEKA 3NG8A 1DY3A 3JTOA 2WSEC 4CWBA 5LM7E 4QWDA 2X1GA 3QPIA 3NKYA 3FCVA 2B8QA 2XG8A 5HI7A 2MPUA 3FQLA 1GX6A 3U1NA 2YKNA 3EMTA 1XMOF 4URQU 2J7KA 1PC4A 1T0TV 2E5GA 2XGQA 3Q89A 1VC5A 3W5YA 1NK5A 2IBKA 3W8PA 4HHUA 4Q7AA 5D77A 1JLAB 1LWFB 2DK2A 2UUBJ 3CEDA 3QZ7A 1ULRA 2OPQA 2YNIA 1FO1A 3JXOA 3ZZPA 1LW2A 2IMOA 3US5A 1CQNA 5L39A 3JQJA 1N32J 1QVFR 2RILA 3GFZA 2P9EA 1YI2S 3TO8A 3MPYA 1Y5NB 1BD6A 2ZFHA 2ZJRQ 3LTOA 2E7XA 4J9SA 3PTWA 3PJWA 4HACA 1B4SA 4PYAA 1Y3JA 4U96A 3CPWR 3MM5A 2WRMA 3J7YI 1M1KT 4OHWA 2A2DA 2W9BA 1X4CA 5IFMA 3R5BA 1IKXA 2FDNA 1T9WA 3A8EA 4DL7A 5E41A 1M5OC 1Q16B 3RR7A 1FJGF 2MB0B 2L08A 2V8HA 4G1QA 3HHNB 2L9NA 4F02A 2J9DA 2BEFA 4X4OA 3TUPA 2JL9A 4U95A 3CCSS 2V4JB 3M30B 1F60B 2ZBRA 1U0SA 3CD0A 1R6VA 1RWPB 1CULB 3ISND 4I2PB 5A0YB 4WKYA 2KG0A 4X4UA 1MROA 4K4TA 2RS8A 2RQCA 1VQ6S 1VHFA 1QUPA 3LOUA 4QWEA 3MAHA 1P8GA 4WFAQ 1TKDA 1RAGB 4M5MA 2QJ3A 3E3XA 4DR3F 6AT1B 1R27B 3W7BA 2RU3A 4ZHRB 1SJFA 1KD1T 4LF5F 1JLBA 2CNOB 4IFYB 3ZZUA 3ZZOA 3CUNA 1BQNA 1DLOB 1ZM9A 3BB5A 3MR7A 1PJ7A 3CC7S 4DQSA 4UW2A 3X3UA 1S1XA 3DXSX 4KC5A 3T9NA 3KK1B 2F40A 3K8WA 4NZ7A 3OXLA 2P9CA 5BR8F 4HTIA 4TYAA 1WF1A 1EQMA 2YWHA 2KG1A 2PEBA 4DG1B 2QGFB 1IKYB 5HK4A 2CJQA 2GIFA 2WBRA 3R5CA 2I8EA 4PYDA 1H6KX 4DR7F 1PC5A 2G2ZA 1I6JA 2UXDF 4CLSA 2RQ4A 1CQMA 3BS9A 4RKUC 3OXGA 1IJFB 4OZLA 4ANEA 4ZHRA 4DFMA 1NJWA 2BVZA 4LF6J 4OI6A 2W01A 1B99A 2V2QA 2BQRA 5K8PA 2ZH4A 3PW4A 5KFWA 4XPEA 3H98A 3DGPB 4ZCIA 4N56A 4ICLB 3FBEA 2H1YA 2JWNA 5CA5A 2W2PP 2GGPA 4OLPA 5A0YA 3TANA 4NA1A 3T5JA 4K2XA 5KFRA 4DOZA 2MQOA 2DH7A 4XTTA 3H5SA 3D6FB 3OSPA 1FNMA 2VFTA 1U8SA 4G1QB 5KFTA 4CYUA 2ZC3A 5DQHA 1X0FA 2CJ9A 2BE2B 3BF4A 1XNQF 3VGSA 1VYAA 3MEGA 3HCXA 1NJZA 3E2EA 1MSWD 2IVFB 2DEJA 4I1TA 1C4AA 1HWLA 2DNQA 3PVXA 3UQSA 4NLTA 2AJ1A 1T9TA 1YBTA 2A0FB 3BR8A 2E5HA 1NCLA 1SC6A 2HZVA 3GFXA 2XS5A 2Z0GA 4YDXA 4Y2MA 3MMAA 4PG7A 2M2BA 3SSSA 2NUUG 1NDLA 3ZC4A 2W2MP 2DXDA 3NGSA 1F3FA 1S99A 1OJ4A 1SPBP 2IYIA 2MZSA 3HJVA 3LGNA 4DG1A 4LFAF 1HD1A 2U2FA 3MXHP 4O44A 3V6DA 3RAXA 4H54A 1G4CA 3OJUA 3EGNA 1RWKB 4ED8A 2ACMA 2E9RX 4ZPAA 1AZSB 4I4BA 5KFHA 5DETA 3IBWA 1RT6A 4KV8B 2YKNB 3UD4P 2DY1A 2FLOA 4TNOA 2OSRA 3RRHA 5HLFB 2VZ9A 2YQ3A 2V67A 2YPZA 1RT5B 3ETMA 1TK0A 1FT8A 2KHCA 2DKOB 4WFZA 5KFMA 3DLHA 4Y34A 2DHGA 2BUNA 3G9CA 2AYMA 2QEXS 2HNDB 5FLXY 1S5ZA 2RAQA 2QN6B 1TUWA 3M32A 3A3PB 3FEYB 2AT1B 3I5BA 1CULA 3TUZC 3BQ2A 1RJJA 4PXDA 3BPDA 4RWXA 3NWRA 2XC9A 5F8JA 2VC0A 3C6UB 2HQDA 1E6VB 1P9YA 1UW4A 2M3DA 1SC3B 5L8RC 4ECYA 5I42A 1MG7A 2R7TA 2RT3A 4ATNA 2J6UA 1S9GB 3EX7B 2CPJA 4X4NA 1UJ5A 1IBKF 4OHVA 4IFVB 1VMBA 7FDRA 3QZ8A 2EI5A 2PT0A 2ZHBA 4CIOA 2DRAA 3AHPA 1N4LA 4IO1A 2M88A 3MHYA 4KRWA 2ILZA 1Q53A 3KLIB 5C5JA 3R5AA 4M5JA 4UZBA 3J81Y 2WVFA 1VCTA 2VQFJ 5DDRC 4R5PA 5L9XA 2OMLA 3KJFB 1TL1A 5ETNA 1C0TB 4HTJA 2NXEA 2M7SA 4HH0A 2DNNA 1YBUA 4Y65A 4LR9A 1LXNA 3PHEA 4F3MA 1KWMA 1M5HA 2QC3A 3N79A 3CDAA 4QOTA 4E0DA 2R7SA 2LA6A 4DL3A 3SI8A 5GVQA 1DTTB 2AX0A 1R7IA 1X9WA 3OFGA 4MMOA 1DJ0A 1S49A 1PJ6A 2DJWA 2AZ3A 1HBOA 3HHKA 4C3KA 4FYWB 1C1CB 4CLYA 3TZZA 3I0RA 4EZ9A 1HYSA 1J5OB 3UNYA 2VPYB 2W2NP 3M8SA 2HBZB 1NO8A 3DU5A 3OR2A 1PYSB 4I2QB 1C0UA 2HNYB 3RBDA 2HIYA 1KHVA 3SYZA 2D3OR 2C2DA 2IHR1 5GMEA 2BRKA 4DPUA 2VG7B 3QAUA 2CNNB 1VJWA 1FRKA 2X51A 2BOPA 1KSPA 1XMQF 4IUFA 1KTVA 5EWEA 3BQ0A 2H51B 2V4QA 1SC1B 1O8BA 2HWIA 2DGSA 3W9IA 1F1BB 2VASA 3ETOA 3SDEB 4LQ9A 5ETRA 3QRRA 2E1AA 3G6XA 1T95A 4K0KJ 2R8GA 4Y0FA 3QSYB 2CG8A 2XSJB 4GKJF 2B4OA 1FEHA 2F7VA 1H3DA 4WBFA 2M9KA 5D0RA 1Q8IA 1NH8A 2Z56B 2B6AB 1NLKL 5JMNA 4QW9A 4OQJA 4P6QA 5F9NA 2AEMA 2ROEA 1SUQB 4QJVA 2WW4A 2ZOFA 4AYBD 2W7AA 3M9OB 1S7IA 4ZS6A 2MEWA 3U7JA 4AFFA 3BPSP 3GP9A 3LWLA 2HHWA 3KTQA 1JMTA 3AB2B 4Y28C 3JSYA 4USUA 3T1HF 1VIXA 4MK8A 3LP1B 1WTFA 2R2RA 2DH8A 4WPAA 3SFGA 1RE1B 1KR4A 1K47A 1NHUA 3AA8A 3DRRB 4BLGA 1TV6B 1VQYA 1ZTWA 1VRUB 5I3PA 4ZITA 5THWA 2XO7A 4MYTA 1ITPA 3P45B 4DN0A 3RB3A 4WK1A 2AW0A 4URSA 3I0RB 5A8WA 1WC6A 4IOCQ 1HNXJ 3B82A 3VAGA 2F63A 2Q66A 1S76D 2XMJA 4MYUA 1VLYA 5K20B 1SKWA 1N34F 1FTRA 1D8YA 1PAUB 1TL5A 2AHOB 3PFOA 1IWGA 1GMVA 3POTB 2J76E 4X65F 3RR8A 3MM6A 3J7A1 3CMES 3BO4A 1CJVA 1ZA1B 2CADA 3LF0A 4IRKA 2IDLA 4WJBA 1J27A 4ZPVR 5GAGU 3QJJA 3C16B 2JFDA 1KKHA 1RT1A 4XO0A 4JP8A 1FVQA 2AYGA 3W3SA 2XCAA 2BANB 4N8OA 3KK3A 4ECSA 3CDUA 3IO1A 4KKOA 1TL1B 3UN3A 5B0CA 1VDHA 5IZHA 4UZCA 1P9QC 1HPZA 2CJYB 2MLZA 4HHHA 4PZVA 3TA1A 4CTAA 3CCVS 1T9YA 3KLIA 5ETLA 3TNVA 4MKYA 1YBAA 1O0PA 2JVOA 5HMWA 1V3SA 3QT6A 2V4RA 4JI3F 1KLMB 3EICA 3EXCX 4K2JA 3JSBA 3I31A 3IAM9 4LSZB 1NDKA 2DYAA 3NCPA 3CCRS 3BSOA 1IWAA 1XBWA 3CVKA 4P2MA 1FE4A 4P73A 3U27A 3V81A 1N52B 3W5ZA 2UUBF 3NMAA 4CM2A 4DQIA 4FVCA 4USVA 2DIUA 2E5LJ 2BOAA 4H4OB 2QFIA 1UMJA 3MF5A 5ETOA 2J6TA 4FBUA 4JI1J 1J2VA 2HNZA 5D0EA 4B9TA 4EO6A 4JI7F 1FKAF 2YVSA 2HLTA 2ZKUA 4LSNA 4CQ1A 2HNDA 2JH3A 5HMYA 2YWEA 2X3DA 1JKHB 2QLFB 3M8QA 1WHYA 4PCQA 4DV7F 2FLLA 2DY9A 2ZOGA 4KY3A 1F5CA 1MN7A 4CO5A 2BDPA 4F8RA 4ZVGA 5HLFA 1WNEA 2N4DA 2DTJA 2VG6B 5CAAA 4ZKAA 2MQPA 2CPXA 3DLGA 3THVA 3BGLA 1AZSA 4RR5A 2CPIA 2OPSA 5LMUF 3S01A 2DPIA 4RX6A 3V6DB 3V6HA 1L3KA 5D0HA 5B0BA 4QBUA 4ILLA 4ZLJA 3FJ2A 3D3BJ 5KFYA 4D3HA 4HI1A 5IOLA 5A8RA 4BC7A 4AE5A 4CH7A 2BRLA 5L1LA 3DRYA 4RWWA 2FB0A 4G65A 4C8NA 4ZN3A 1UZDA 4HDGA 4QWAA 1HMVB 3EXYA 3GYXB 1RTDB 2BKPA 5CQGA 2XGPA 1RT2A 1WJ9A 4KTQA 3UWTA 2B0GA 3K5PA 3DOMA 4RUBA 2W9CB 2W8KA 3KMSA 2XI2A 3DM2A 1KQFB 1LNQA 4DXLA 3G2XA 4F4WA 1LFPA 3RBZA 2BE2A 2HFSA 3AAWB 3MDFA 4JBCA 4U7UK 2UU9F 3U1LA 1EQ0A 2YTCA 1Y00A 3CCMS 1VJQA 1PILA 2PI5A 1QJHA 4U8YA 4FKXA 4C8MA 4WZQA 4YEAA 3DI6B 1WEYA 2Z2YB 2O1PA 3OPKA 3OLBA 2HHPA 3IR5B 2AF6A 2D9PA 1S57A 3GFHA 4X65J 1U45A 2NLWA 3GCXP 4ZVSB 2HMIA 2VQEF 4RW8A 2YH1A 5K9FA 4X66J 5ETVA 2MTLA 4WFYA 5D3GB 3QRPA 1JXVA 1DQAA 2M8HA 3M2VB 4JV5J 4E98A 2K3KA 2B4VA 5HN0A 1HNIB 3V4IA 4ITSA 5E3RA 2FHJA 2ABYA 2QO3A 3A4TA 3Q22A 3TVZA 1UPPA 2V8VA 1P27B 4H4KC 4M5GA 4RPFA 4HI2A 3GYNA 1MW7A 1TQLA 5KFJA 2ZE2B 2XM3A 1B0TA 3B4DA 2J0XA 1HBUA 2CJKA 5KFQA 2KU7A 3KK1A 4RL1A 3V4MA 5EX3A 3D9BA 4ED2A 1YJVA 1KNZA 1BQNB 1DLOA 2RHSB 3CCES 3NY0A 1EKRA 2YKPA 5D4NA 3PNIA 3H42A 4DPWA 2Z2MA 3LA0A 5IS2A 2WZ1A 1H98A 4KQZA 1RBOB 1YJTA 3HSGA 4G1IA 2POKA 4DEZA 2J0QD 1XQIA 2FIUA 3PKMA 1HBNA 4IH7A 5ETTA 1HQEA 2K2PA 3OVAA 3I56S 1LEOA 2GMHA 5MLCV 4DR3J 4KHPF 1CPZA 2P8IA 2E44A 3CWJA 1QTMA 3MM7B 2I2YA 4C0BA 2Q6BA 1VHIA 1L3SA 4Y00A 4EFAC 4GC6A 4WXOA 4Q44A 1S9EA 3CNQP 2AP6A 4DFJA 4B9NA 4FYXB 3L9ZA 1WD6A 3NNHA 3J81j 4NXMF 3HKWA 2ZZMA 1I5OB 2DGWA 4OMFG 3LALA 4Y6IA 1V5IB 2MZQA 1ZZFA 4A46A 3V5RA 4FZVA 4I67A 3WC0A 2AJQA 1MMLA 1VQSA 2UV8A 3DRPA 5H9FJ 2CPEA 2ZD1B 3Q86A 3VZHA 4JYAF 5KG0A 3KHLA 4PG5A 3AD7C 4RJVA 2XY7A 2RSQA 2RNEA 3D0HE 2IRXA 2YNGB 4HT7A 1Y10A 4I6YA 3C3LA 3UCZP 1S77D 1NPRA 4KGMA 4O3PA 3R9LA 4WZMA 3QO9A 4DR2F 4O4GB 4NCAA 5EUHA 2H5EA 2PE8A 3VZIA 4WKRA 2EPIA 3G4SS 4LR7A 2GJ2A 2QFJA 2RQKA 2WOMA 2ZH1A 5KG7A 2HVDA 1IQZA 2VG5B 3HZGA 1S1UB 1TU0B 2MXYA 4BWMA 3TQ1A 2WW8A 3W2VA 4W92B 2ZZNA 2CQDA 1UA1A 1IN0A 1R6YA 1RI7A 2FZCB 5KG3A 2IVYA 3K17A 1ROFA 2AIRB 3AQOA 3DRPB 1PYOB 2EFNA 4K4VA 2MQNA 1UJ4A 2GCFA 4G3IA 1HNWF 4F4YA 1S79A 4L76A 4PQUB 4K4XA 3G6YA 3OTBA 4NPOA 4WIQA 1RKIA 2LEBA 1G6BA 1AYEA 1MMNA 2QZ8A 1SV5A 3BN4A 3R5DA 2XO6A 4UOFA 2OPRA 1X7VA 2XMWA 3MCNA 4Y2CA 5IT0A 1KN6A 1JXLA 1MWYA 5B08A 1IKWB 3EUNA 4B9LA 1NNDA 4NLQA 3RZAA 4DL6A 1N5TA 4X62F 5KT2A 1CC7A 1FKPB 2RIJA 5CYQA 2DHAA 1VRTB 1K73T 2L9DA 2V68A 1EAYC 3ITHA 3UVJA 4RNNA 4B3OB 4OZ5A 3DLKA 2VJVA 4OL8A 5T7LA 2BBEA 1CJKB 1N5SA 2EFPA 2J9EA 5KT3A 1TL4A 2YKMA 4DV0F 4LFBF 2YXLA 2K1RA 1QAYA 1HQEB 3DRSB 5B0EA 3HD1A 3ZZ0A 1URNA 1Q8LA 1ZM4A 1B70B 3AQPA 3I4HX 5M2RA 2QA4S 2UUCF 3CIMA 4DSLA 1OYDA 2XZDB 3MEDB 4DSFA 1QVGR 1UVMA 2IM2A 1S12A 4ZIVA 4LBHA 1SQEA 1UFKA 3VVUA 3BKUA 2XMUA 2QLJB 4DR7J 1R8BA 3HVTB 2FJBB 1O6XA 2A6MA 3RTVA 2DNZA 4Q0BB 4DR1J 1UETA 1VRQC 2JHEA 1U49A 4BS2A 2FVQA 3M05A 3GJTB 4MTPA 3CJQA 1RYSA 3KYLA 2AJFE 2ACYA 4GVBA 3LUYA 4XIUA 1FK9A 5F8NA 2AGQA 5KFIA 5JUMA 2AYBA 4A8FA 2CG4A 4DV6F 1S97A 2WSCC 1IM4A 3MM8A 4EBEA 3IGVA 3WX4A 4DV1F 1OPIA 5F41A 4DSEA 3S1TA 1BLUA 4RW8B 2OD6A 3JYTB 2EBGA 1H74A 3CO9A 3H2LA 1EP4A 5HJXA 1BY9A 1NDCA 3SBMA 3UDLA 1MU2B 4LFAJ 2CA9A 3LAKA 4HKQA 5KG4A 1NUEA 3ZNUA 1FEEA 3PRDA 4B9UA 2OP5A 1U8WA 1WOPA 2XMTA 3DOLB 2BV3A 1KBRA 3ENVA 1WHWA 3SCJE 1B3TA 4JI0J 1R3NA 2KJWA 4L6V3 4XPCA 3A1YG 3BV8A 2J7UA 1GTEA 4ZCMA 4GC7A 2NCKL 1SC4B 4A8KA 1UCNA 4AXJA 2D41A 3L95X 3S7RA 5F8MA 3KUGA 1U4BA 3QGGA 2COLA 1O5JA 2FHJD 1VC0A 2CPFA 3SQGA 2XI3A 3OTEA 1HMVA 4USTA 3G6VA 5M2UA 4KGKA 3I6PA 2MY8A 3IP0A 3K5LA 2OIHA 4C8YA 2DR5A 4FS2A 2E1CA 4DSJA 4CLZA 4RW6A 5ETSA 1PBUA 2FHOB 2ZZTA 1X5OA 3GONA 3UDEA 4IH6A 2XMVA 2QT7A 3GSIA 3IR7B 3GIJA 1YJ9S 2BKOA 4B3RF 3L7OA 2YNHB 1VBZA 2KJVA 2LU1A 3HHDA 2FTRA 3GB0A 4MIAA 2F8HA 2N3LA 1FE0A 2LU2A 1D9DA 1HFEL 3DN9A 4X4SA 1VGYA 3G6ES 3AOAA 4NLVA 3A3OB 1R31A 4DPTA 1YHQS 5KFLA 5I3UA 2LYVA 4ES1A 2L41A 5IT9Y 5KFZA 2LECA 1XR6A 4NI2B 1S0MA 4K4ZA 4ED4A 3S6EA 1YJWS 2PDAA 2QSWA 1U1NA 3MI7X 5KFOA 2KM8B 4EYIB 3C6TA 1RHJB 3NBPA 3VAFA 1AUSL 3CO0P 2X7IA 3I5AA 3HVRA 3OT9A 4MIBA 1RTIA 1CJUA 5FIIA 3JQMA 2R3VA 4DMZA 4GRSA 2APOA 4CO1A 4FYVB 2CVEA 1VBKA 2MKYA 3FZ2A 2JC1A 1BMQB 1WOSA 2W7OA 3DDIA 2C28A 1Q79A 1Q0NA 4NWBA 1RAAB 1S10A 3CD6S 4OI0A 3VGTA 6FDRA 3AOBA 4FNHA 4CRJA 1KVIA 3EGVA 3B78A 2KKHA 4KR0B 3KLEB 4NI2A 1XK8A 2BJ7A 1MN9A 4DV2J 2AU0A 2DIVA 1C1BB 1I3OB 1K1QA 1RTJB 4OYWA 4CI0B 2KYZA 2XQCA 3KDOA 5H9EJ 3DLBA 4KKOB 2VONA 3MCOA 2BANA 5DM7Q 1DTQB 3SV4A 1X4FA 2DNOA 3W61A 3UR0A 4EYHB 3QFHA 2LEPA 1XMBA 2R8JA 4DUYF 4M5DB 4PXEA 1HBMA 2YNHA 5HVGA 3TVYA 2LQBA 4USJC 4HYKA 3POTA 2MZ1A 3EPIA 1NMEB 3CCZA 2IJNA 1RBLA 2Q43A 4DR1F 1RLDA 3K89A 3ENAA 2HHXA 4YS2A 2HAIA 4MFBA 4YUDA 2UVWA 3IGNA 1RGVA 3R7SB 3GV5B 2MY7A 3UDVA 4DS5A 1JLGB 3R3TA 3CJ8A 4UF4A 4HHJA 5KG6A 5J2MA 2PIIA 1KVJA 4OZJA 1U0HA 2LP4A 1TV6A 3VF0B 3VAIA 2HHHJ 1WSRA 2K7KA 4ZP6A 2EWHA 4FXVA 2F4VJ 2XZTB 1JNRB 3DLKB 3GR0A 2RDJA 1VQPS 1I94F 3IRXA 3M6VA 3NCQA 1NBEB 1FKPA 3CJSA 1TKTB 2XWYA 3DOLA 3DFEA 2RVJA 4OJGA 5CZVA 2QA4G 1HNXF 2YKOA 4C98A 4M8LA 4C0HA 2KRBA 3BJYA 2P9GA 2CQBA 2LXIA 2W4DA 4NLRA 1YJNS 2AJ4A 4TQSA 4LRBA 1MU2A 2DGQA 2FGCA 3PDNA 5KT4A 3GIIA 4ELUA 4LQ3A 1M1GA 5HATA 5B7WA 4I0WA 4JOUA 3KJVB 3ILOA 1X5SA 2LVWA 2O67A 4R8UB 2JSXA 2VC1A 3UD5A 1LQ9A 5HBMA 2MJUA 3W1YC 4DZ6A 4EUVA 2GFFA 3GILA 2W2QP 3GU0A 5H9FK 1FX2A 4J9OA 1RU2A 5HROB 1JJCB 3B54A 1NSAA 4USIA 5KT7A 1UFWA 2VG7A 5HANA 4NXNJ 3H25A 4MKAA 2LQ9A 2WAQD 4KO0A 3UI3A 4CLKA 4C8LA 3E01A 4DWIA 1S1UA 1YK9A 4Y2KA 1RDRA 1ZZNA 3LPYA 4DL0C 3KKFA 2DD8S 2WBMA 3BDEA 4ETZA 2BZ2A 2P5VA 2ZKTA 2C3YA 4ALZA 4Z7YA 1ZAWA 5LT5A 4LBPA 3OHBA 2EXUA 2HAFA 2VFVA 4O4GA 5J2NB 4CLLA 3L3CA 3KHGA 2YNFB 4HLBA 5CD4H 1N34J 4B3TJ 1GFWB 1G3OA 4IDKA 1DTTA 3M2UA 3OD2A 4IG3A 3ULHA 2F8EX 2K1RB 3DRSA 3FZBA 2YKMB 4CLFA 2RUGA 1YRUA 5E2QA 3PW5A 1F5AA 2BE7D 2BJ8A 3CE8A 3PACA 4QIEA 2CQHA 3TJ8A 1U1QA 1LOUA 2EFQA 7FD1A 1D9FA 3J7AN 2Y0SD 3TZYA 2X1BA 3K57A 1YSJA 2ZH6A 1S59A 4NLDA 2M8DB 4A8QA 2WVCA 4PUOA 2LDYA 3H2VE 4J9LA 1GEHA 2C42A 5DRKA 3WIUA 2AKWB 3QATA 5IXUA 2ZVIA 3CCJS 2G2OA 2XYPB 1KONA 1V9OA 3CCQS 2VBWA 2BE9B 4JI8J 4DV5F 4KHRA 4HDHA 4J9QA 5JJBA 4IFVA 4CO3A 1XNRF 4PQUA 1EIYB 2MSSA 4EK2A 5F3ZA 1D9AA 1H2VZ 2IJRA 2Y1LB 1E6VA 1GX5A 3FC9A 3MM7A 1VK3A 4RNFA 5KFNA 2DHHA 2V94A 3ADAC 5B0DA 4QQBA 2KZZA 5EWFA 2W2OP 3W2VB 3R2CJ 7AT1B 4NCGB 1OMSA 1NKCA 3MMCB 1N5VA 3DCAA 4A4JA 4N41A 2ZBIA 4ZPWR 1T11A 3NOCA 3Q8QB 4A8YA 4K50A 5J2NA 1FERA 2KFYA 2CZ9A 1H38A 3GPAA 3FSXA 2R4FA 1YKWA 9ATCB 5KFBA 1RWWB 3M2RA 1X9SA 2E7WA 3N01A 3QO9B 3MM9B 4MKBA 3E01B 2I38A 1QTNB 3N6MA 3CCTA 3MPVA 4MAKA 4QCLA 2FGOA 4U67Q 4O44B 1JXEA 2XCPA 3KLGA 1NKEA 3EM1A 4FPRA 4CT8A 4DV0J 2P2CB 1OWXA 2KT3A 3G96A 1WC3A 1KRPA 2G13A 1T02A 2JRSA 4FN5A 4RO0A 3FRYA 4HR2A 3MECB 4QIWD 1SIZA 4KIAA 4L73A 4OV6A 2HYIB 2PMHA 1NJXA 3M2VA 3CGIA 1T7PA 2R7VA 2QL5B 2H3EB 3KJVA 1EARA 3MMJA 2MZTA 3ELHA 3RRGA 3IG1B 3H5YA 2Z2ZA 1JLFB 1W2IA 3JTPA 5EWGA 3J7Z5 4A8SA 1VQLS 2NYHA 2YX4A 3WQPA 3R1HA 3QGHA 2VPWB 2F4FA 5KT6A 4BDPA 3F41A 2C3PA 1TR0A 2UVUA 4RLEA 3L09A 4OZ1A 1PAEX 4QWBA 3ZTRA 3FQKA 4M5HA 2YWFA 3HULA 1UWAA 2OO4A 2CKWA 4CYUB 2LXFA 1H7XA 2KYXA 1JJ4A 1Y4ZB 1U26A 3WX8A 2AYEA 5A2QY 2FLNA 3VWSA 2QA2A 2PA3A 3ZZYA 1LWEB 1S0VA 3ICLA 1HR0F 2DCLA 2E5LF 1N36J 4LRDA 4DR6J 2R9LA 5AE3A 4WIIA 4RUHA 3GTYX 3PRVA 3DGPA 2HS3A 5B0GA 3TA2A 2DNGA 5C24B 1S1TB 1FJ7A 2E1PA 4J90A 3UFCX 3EGWB 4F04B 1ZYQA 3OV7A 4NXNF 4WP3A 4PG4A 2ZBQA 2ZH3A 3MWBA 1WEXA 5LSOA 2ZHAA 4YN3B 3MUMP 3AXMA 3RYLA 1QUVA 2VOPA 2E9ZA 1RU1A 2XS2A 2G1DA 3BM7A 2EEYA 2HFZA 2ZWPA 3KG1A 3PEHA 4ZPDA 2HBRB 4M5DA 1LV5A 3LAMA 2GAHC 2OPPB 4V1Ak 4YDDB 5IV4A 3IXQA 3PIPQ 4YHHF 1J5EJ 5DQGA 5HL7Q 3NXZA 2KL8A 2WSFC 2XHWA 3DLGB 4U9RA 3Q83A 5A6WA 3TR5A 5GADI 1HNIA 2G0IA 1U02A 2EKYA 4R0JA 3V4IB 4KJIA 2DNLA 3QYYA 5SZTA 1C1BA 1RTJA 2W24A 3JTNA 3SCIE 2NXJA 3MFIA 4NEYA 3QJPA 1TUVA 3M8ZA 5FJ4A 2CWXA 3V6JA 2UUCJ 4WF9Q 4LSNB 2NXCA 1KVKA 1S6PA 3D67A 5AXLA 4EI2A 5BJRA 1SKUB 1FJGJ 4ILMA 4M5IA 3FMWA 4F25A 5IQ6A 3M30A 2HWHA 3KHHA 2HVIA 1M5SA 3EZOA 2E5JA 1Q5VA 2MQMA 2Z8QA 1RP5A 3ISNC 4I64A 4NLPA 2ZDOA 4DUTA 4F0MA 4RU9A 3JSMB 1OY6A 1FJEB 1H0HB 5DZ6A 3W65A 3ZFVA 1Q82T 3FKBA 4KFBA 1NK0A 1CJUB 2V9KA 3PW0A 3PV8A 1ZA2B 4ED5A 4QYZJ 1RHRB 3DOMB 1RCXB 3QIDA 4R0EA 4ZLLA 3C6TB 2HZAA 3QWPA 1EZZB 1RT2B 2GQCA 2MZJA 4KHMA 3SXLA 4EO8A 2VQEJ 3Q8PB 2DNKA 2CZ4A 3M4XA 4X66F 1B0VA 1T05A 4FYDA 1JJHA 4J37A 2D3O1 4NYOA 3B4MA 2KVQE 2GVZB 1GMUA 3R8YA 4DF4A 1TMJA 1F2HA 2DGVA 1D1UA 4JV2A 4LF9F 2FZGB 2JLFA 1KDNA 1ZBTA 3FCWA 4QPXA 2BQ3A 1F9FA 1N0UA 1RT1B 3FCHA 2HFVA 1UKUA 5HMXA 2YY3A 3FFIA 2DNRA 2LA4A 4Q2MA 1SJRA 2ZHOA 4RNHA 3IWXA 1DARA 2AJ2A 3OL6A 3GJSB 4EBDA 3L7UA 3F73A 2SXLA 4BHQA 4NE9C 3NS6A 1N48A 1EHWA 1OYEA 3BN7A 3MZIA 3CTRA 3DYAB 4N7TA 2JJ4D 4JI0F 4JB8B 1IBMJ 5EN1A 2FY1A 2VJUA 2PC6A 1HI0P 1UEKA 4NXMJ 3IM8A 4OIXA 5KFSA 3BH7B 2IMWP 1XR7A 4IR9A 2OTJS 2Y9HA 1P6TA 1I51B 2KT2A 4EGLA 3MGJA 1KEKA 3T6JA 2BYCA 3C19A 2WHOA 4DQRA 2MKSA 4C3MA 1WWHA 2VL1A 2GJFA 2FVCA 2XB2D 1H72C 4JI2F 5J1EA 3MURP 3FBBA 3LP1A 1QSSA 2CQIA 1RWNB 4U7UD 1OSCA 1JWWA 2VDHA 3LP2A 2C3OA 2J9DE 2R7QA 4TQRA 4F50A 1DURA 1NK7A 1QAXA 1GMWD 1YDLA 3K5MA 3M6WA 4WU3A 3HHLC 4ZVOB 4IR1A 3V2UC 2HHTA 3OLAA 3GG1A 1AFIA 1JLCA 3R5JB 2LQ5A 4N47A 1LWCA 2ZVSA 3G71S 3JYTA 1WC5A 2G9OA 2HQIA 2HGMA 1HPZB 3EVWA 2HHHF 1Q95G 3PJ9A 1N36F 2IJFA 4DR6F 4QPTA 4Y3CA 2UXCF 1K1SA 1Y7PA 3I9ZA 5D78A 4YB6A 4NYZA 2RF2B 1FRMA 2J5AA 3SCLE 1OPZA 4DBQA 2ZH8A 1AUDA 3NS5A 4MH8A 4GMKA 4DV1J 1PKUA 2DVIA 3U1MA 4Q43A 2Q79A 3W62A 3ET6A 3W2WA 1YZ6A 5LXYA 2OELA 1GTHA 1FRXA 5DO2A 2GQQA 5DDQC 5DLGA 2X1AA 3BSCA 3RRKA 1F6TA 1FFWB 1TTHB 3OFFA 3E51A 3H40A 3K0JA 2R7UA 1HBOB 2HURA 5A8WB 1J5EF 5J2PB 3HSJA 5GMKa 2DR7A 1YLXA 4I6WA 4LF4J 3HSDA 1AFJA 1EJ7L 2WVDA 1KOHA 1YJ7A 5CABA 2RE1A 4J9PA 1RT7B 2NXUA 3M6XA 2DXFA 4MJKA 2VA2A 4OX6A 3DRXA 5F8LA 2D9OA 3MCSA 3PJXA 2KM8C 3RBEA 1UA0A 3ITHB 2R8IA 1RA6A 2GO8A 3Q8YA 8AT1B 5CYQB 4K4WA 2L3MA 2BJEA 1WC0A 2PO4A 1TKZB 2GX8A 2D74B 3DLJA 3BBFA 3DKDA 2BJDA 2EK1A 4X84A 3TA0A 1Z1ZA 4R5PB 1YVFA 1ZM3A 5D4OA 3NNAA 3GMGA 4DFKA 1TK8A 4NL5A 4K4YA 2ADCA 1LWCB 3KNAA 1UL3A 2VFUA 2WB4A 1TKXA 2ROPA 1RLCL 2OAUA 1S9GA 2A18A 2ZNYA 4JV0A 1RT4B 1KFSA 3GQCA 2AV5A 1VQOS 3OL8A 1CS4B 3RAQA 2B4PA 1DRZA 4KH0B 5DS7A 2Y1RI 3I0SA 3W9JA 3PYFA 1CBKA 4ES3A 1NH7A 3GIMA 5A8KB 4KPCA 4DS4A 2DISA 3EPGA 2R7WA 2UVVA 1ZM2A 1FDDA 2JC0A 2PMWA 1EKSA 2RMLA 3M32B 4RBTA 4ZPCA 6FD1A 5KT5A 4YP3A 2HHQA 2CYYA 1FXRA 4M63A 3OR2B 4I2QA 4ZPBA 4ANDA 5KOWA 4IOAQ 3EDQB 1C1CA 4MKVA 4F36A 1ELOA 5GAEI 4G6VB 2E7VA 4C11A 3UCUP 3ZTQA 1V3ZA 4FKYA 3DYAA 5LJ5Y 5DDPC 1SKRA 3R6LB 1WI6A 2HQ3A 2D7SA 2H48B 2GW8A 2WVEA 4KV8A 4YR3A 3BZQA 3AD9C 3CDEA 1OY8A 2ERRA 3MOZA 1REVB 1OSDA 3P5TL 2ZH9A 4B3RJ 3BBBA 2CNKB 3FFIB 2V63A 4CT9A 3MMBA 3SCKE 2D3UA 2VV5A 4F7VA 3RB0A 3EYZA 4IG0A 4K7QA 4TLRA 5ITHA 1G2EA 3G87A 1MNEA 2KI2A 2V5HG 2AEFA 1R8HA 5F8GA 3CC2S 1RZMA 5DG7A 3TOQA 4NLGA 4PABA 4NLWA 4J9MA 4ER8A 1H7WA 1VK8A 1IBCB 3OBIA 1NPPA 2KN4A 4FVMA 3NLCA 5CH7B 4P71A 4ZP9A 3T3FA 1TZ0A 2D1CA 4HT5A 1VQNS 4NLOA 1Z2ZA 2IAJA 3KLVA 2QL9B 4FDFA 1XTZA 1LK7A 3DHWC 4PPZA 2KO1A 5IM0A 4X64J 1L3UA 2VBYA 4ILRA 4KFBB 2FY8A 2OSQA 2WCXA 3GSDA 2GIRA 4P75A 4QIFA 5ETMA 4F26A 4GKKJ 3CXCR 1JLQB 3Q8RB 2PFFB 3QBCA 2NPFA 2BKNA 4K8RA 5HSPA 4P52A 4DV4J 2JEJA 3P3DA 4K4SA 1SIWB 1HWKA 2B9WA 5M2PA 2XTJP 3PKYA 2N7YA 1UVNA 1R43A 2H4WB 2KRRA 1WELA 4EWTA 4A48A 1W7WA 3G82A 3P4UB 4YR0A 2F1FA 1Q81T 5H9EK 3MEEA 2ZOMA 1QAJA 5HVHA 5KG2A 4LVNP 1RT5A 2LFVA 1X4AA 2Y1IA 3O1LA 1V5VA 3TX8A 4I6AA 2KDOA 4OX9J 3T1YF 1QLNA 3CJRA 2EVZA 3X1LB 3CSKA 3PR4A 4CLPA 3I9V9 2FC9A 1X5PA 1S1WA 2ZE2A 2U1AA 2B5JA 1FKOB 2DGUA 2GV1A 3AA9A 5AXMA 5KG1A 4GKKF 4ZP7A 3KUEA 2AMCB 1JX4A 1F9EB 3KFWX 5K14A 4OYPA 4ECRA 1K8AT 3HO1A 2MJNA 4Z2XA 1NPKA 2NPIA 3N5FA 1QDUB 2AGPA 2HW3A 1MLAA 4S0MA 5HQLA 1Y0HA 1CJTB 2Z57B 3MEEB 1VQMS 4CO4A 2H54B 3GIKA 3HM9A 4GO7X 2WONB 5CYMB 3Q24A 3M9NB 2EK6A 4C4WA 1MROB 4DQPA 4KE5A 2LLZA 3IBCB 3N9UC 1LWEA 2B4UA 3DI6A 1X31C 3GG0A 4OX9F 3THTA 3R27A 4ZA1A 3ZO7A 1JJ2R 3I82A 4RW7A 2DNYA 2OGUA 5KOXA 4A8OA 1HW8A 1U1KA 1N5QA 4JI3J 1GXUA 1JLQA 3F0NA 2F9JA 4M5NA 2MQLA 1UFLA 1SBRA 3JSRA 5CCMA 5KFKA 4X4QA 2W9BB 2GGPB 3EVOA 4DLGA 2QRRA 3K8VA 1FXLA 4USHA 3CMAS 2WONA 5CYMA 3PR5B 3IG1A 2F9DA 1RTDA 2FHMA 2UP1A 2Y8WA 1CJTA 3NOGA 4DX5A 4O0IA 3PYEA 2DRDA 2CDRB 4ED0A 2MLXA 2ZH7A 1UTAA 4ZIWA 2FLPA 1G1XA 3BO3A 4G1PA 5A8RB 1TK5A 4DR5J 5LJ3Y 2ATLA 3ZNJ1 1GNKA 3BREA 1IKYA 3MMBB 4N76A 3KLGB 3NGRA 3TP2A 3FBFA 1RAIB 1S1WB 2HGLA 2E5IA 5KAKA 3H90A 2OPSB 3BQ1A 5GAHU 3VALA 1VC6A 4OZNA 2J8AA 2XLKA 4QIVA 5HJYA 2B43A 4ID8A 2NREA 2UVRA 4RBUA 3QSIA 5IWAJ 2C2RA 3TAPA 2C2ZB 3C8YA 1SJ4P 4DX8H 2OJ3A 1JB0C 3N6NA 2B9EA 1JKHA 3M8QB 3W5XA 1RACB 1X5TA 2MDAA 4QWCA 3QJLA 4B08A 3PXGa 1FJCA 4O3SA 1D09B 5HVFA 1O51A 4NCGA 1Q8BA 1FRJA 2R7OA 4FF3A 1B7YB 4DZDA 2CVIA 3UE2A 2HNZB 2V4JA 1SB6A 4JI6F 3OW2R 1EB0A 4DU7A 2ZJQQ 4DUZJ 1S72S 2QMUB 1Q8KA 3QRQA 2EW9A 4H4OA 2OEKA 4OYOA 3EWGA 1CS4A 3VR1A 3D1OA 5G0RB 3ZZRA 2HIQA 4WP9A 4RW4A 2BW7A 3NEKA 3RUBL 1TKXB 3HPOA 2GVDA 3VQSA 3ZTSA 1N0VC 3TAMB 4PG8A 4H4MB 5LL6d 4E2FB 4V19X 5H1SV 3T5LA 4USMA 1Y5IB 3MM5B 2IAJB 3HVWA 4NRTA 5L1KA 3K2YA 2OLWA 4HACB 3IS9A 2AEJA 3PO5A 4DV6J 4P9SA 3OFEA 1F9HA 2MKIA 4JV5F 2QG9B 2E1MC 2H65B 4ECXA 4PUOB 3ZTPA 1VOMA 4L75A 1ZOTA 2O5DA 3THPA 3UPFA 1RQ0A 3M8WA 3U02A 3J81U 1S1VA 4KAIA 1FD8A 2IA6A 3D68A 2ZH5A 1LW2B 4PXCA 3NAHA 5K8MA 2YNIB 4CZCA 1TAUA 3K5NA 3C16A 4I68A 1ZAXA 4JYAJ 4LF7J 1JLAA 1LWFA 3GIRA 1WHVA 2ZDPA 1REVA 1DBDA 1FXDA 2OFHX 4TY8A 3RB6A 1XMOJ 4IG3B 3QGPA 3M2UB 5A6PA 1WKJA 8ATCB 5L9NA 4DV3F 2AWZA 4Q8FA 2XZWA 4Y2IA 5I3QA 4LF9J 1IXKA 3DC2A 5ETPA 2HVEA 2DNPA 4C11B 4C6AA 4B9MA 3VQTA 2O3DA 5ADZA 5IT9U 3BGRB 2XWXA 5A76A 5EX0A 2Q6CA 4ZJQA 2XNRA 4DHVA 1R0AB 1M1HA 2HVHA 4KO0B 4OI4A 3RGIA 1R89A 1AT1B 2I9SA 2L9WA 2VPZB 3RG6A 5KFXA 4AUKA 4CNYA 1N56A 3BSNA 1JLEA 2M0GB 2ZNZA 4RUAA 4OYZA 3ENWA 1U6FA 4P2FA 1WOOA 3QFWA 2GNKA 2GA7A 5C2CA 4C8ZA 3ISZA 1KP6A 2IBOA 3A8KA 3BKTA 3GJRB 5CYJA 2XLIA 3NP5A 3KLHB 1SUQA 3D0IE 5HQMA 3FVYA 3KG4A 3UW1A 3LWMA 4OJHA 4NLYA 2VPXB 5SUHA 4OYXA 3JB9k 2W4CA 2ASJA 3AOCA 3KK2B 4Q2LA 4ZVEA 4LIWA 3HZEA 5L1JA 5E5NA 2RQMA 4FYYB 4N5SA 1Q7YT 1JLCB 1RWOB 4X4VA 4M95A 1PCAA 2FHKA 5T41A 1UVJA 3W66A 4Z37A 2ZM6F 1FVSA 4F4ZA 1ZPVA 1GAOA 4ZVRB 4LSLB 3R7BB 5IQQA 1FRIA 2CZVC 2Z30B 3IRXB 1FA0A 4PXBA 2JZ5A 1G7CB 1Y11A 5D4LA 1N32F 1HQ2A 4DPXA 1RT3B 2VU5A 3OR1A 4PWUA 5L1IA 4B3MF 4LF5J 4UY85 3FRZA 1Y5LB 3R97A 5HP1A 2C2MB 1RT7A 5DG8A 1VQ7S 4JI2J 1U0HB 2W8LA 3K5OA 4ZVFA 1L3TA 2LXUA 3KDNA 3HFZB 3BGRA 3MPUB 1U6ZA 2IFXA 2XEXA 3IR6B 2Q3PA 1J5OA 2NS1B 2R8KA 2R42A 4CP5A 3IC1A 3R6GB 5LSRA 1S9FA 3NCRA 3QT8A 1IBLJ 1RABB 4K59A 4M94A 1D3WA 4TU8A 3R5GA 4N8NA 3ET6B 2HPUA 2W1BA 4XDDA 2YKQA 2N82B 4LF6F 1IR2A 4NA3A 1TP7A 3T9ZA 5BXIA 4DV2F 1KC8T 2UZAA 4L72B 1FF2A 4B3SJ 2P6SA 1YQHA 3G8QA 3RBXA 1PBAA 4DN9A 1VQ5S 1DTQA 4LRCA 1N6QB 4MT1A 2UXBF 1TMMA 2CAJA 2G0JA 2RF2A 4FPIA 1LWXA 2OHDA 3HKZD 5CZXA 1RBAA 2CIMA 4OI2A 3R1LA 1NZ8A 1U1MA 1KOOA 3IS9B 1RISA 1GT8A 2LEAA 1IUJA 2ASDA 2AJ0A 5C25B 2AZ1A 2Q1LA 2CNLB 4ED6A 2P6TA 2QMWA 3R7NB 4ZVPB 3OUYB 5GAGI 4LBIA 1NHKL 2FJAB 4XDCA 3D2WA 4NASA 1WC4A 4UOCA 2CPZA 3MAAA 4RW4B 4DPOA 2NYIA 4I56A 4DPYA 3CD5A 2E66A 1P1LA 3BGOP 1T9UA 1XWLA 2IVMA 4GO5X 4NZ6A 3UNGC 3ZZZA 3V6KA 1Y3KA 3HLUA 3WC2A 4IRDA 1RK8A 2GMLA 2OUGA 3C6UA 4LMZA 3M8PB 5E3CA 1QSYA 1VI7A 3OSNA 1SVDA 1BC6A 1YGYA 2XULA 1W26A 2JLGA 1S6PB 3GV8B 4NCBA 1PGZA 3AJDA 3NBPB 3DNCA 1XJWB 4NX9A 2HBQB 4NMLA 2B8PA 3O2IA 1DQ8A 1RAFB 4NA2A 4OI3A 3CJKA 2H5IB 3J80U 2Y1JA 2FJVA 2J0SD 4D3GA 1FTCA 2Z58B 4DQQA 4FXDA 4X64F 1C2PA 5JVGQ 3RW7A 2CQ2A 4JI5J 2F65A 5MAOA 2IY5B 1RT6B 2VFRA 2IM1A 3FMBA 4FXWA 3HHLA 4J7CA 5F9LA 4DR2J 5FDLB 1PO6A 5GMDA 1S6UA 4O3OA 4DCJB 1BQMB 4QU7A 3CJ0A 4YHHJ 3ILLA 2Z4PA 3N28A 4QW8A 2CXEA 2PEHA 1UWBA 4KH1B 4TVAB 4UQGA 3VAJA 4FNIA 1IJEB 5K5MA 2Y8YA 4C8OA 1SI9A 3GR1A 5CD4A 4F4KA 4UY8T 1NSPA 2B56A 4KBIA 4OHZA 4DDFA 2EC2A 2WTFA 2F5GA 3SQGB 3D1HA 1NU4A 5T14A 2KXHA 4FP9A 5DQIA 5AXNA 2ZJPQ 1KQSR 3VGVA 3NMRA 3GE9A 2C2OB 3QGIA 3NGDA 2CPDA 4J91A 3D3CJ 4YB1P 4B3MJ 2DNMA 3CF5Q 1E6YB 1IBKJ 3GFYA 3W8GA 3MEGB 2RH3A 2V9WA 1BXNA 5AXKA 2CQGA 1NM2A 3OTCA 3IWNC 4OYAA 4C7QA 1JIHA 2DT9A 3J80Y 1OY9A 1TELA 2A3JA 1RUSA 4TY9A 1BUXA 3FBCA 3SMZA 2YKAA 3PW2A 4ED3A 2DR6A 3CJ2A 3DLEA 1IBLF 2NZ4A 2JEGA 2BJ9A 4K5RA 4WYLA 4ZP8A 3M6UA 2HBYB 4JV1A 2WK4A 4PWWA 4NZ0A 1JLFA 2LQ8A 1S7HA 4YR2A 4ZVQB 1QSLA 3A13A 3ENQA 2R2TA 4DSIA 1B64A 4NLSA 3AJ1A 3GCWP 3I96A 3PYGA 4RUCA 3BGUA 2KFZA 4ZOSA 5LSLA 1RWUA 2C22A 1RXOB 1X4HA 3Q8UA 4YY3F 2MGZA 3G8SA 2ASYA 1OQ6A 2EC0A 3PX4A 4CNZA 1S4EA 4EEYA 4KGVB 2OKQA 1FFGB 4GVBB 3AJ2A 1WEZA 5HQ8A 2B5JB 1XERA 2RJZA 4P2XA 2CQCA 3Q23A 3DLLQ 1XNRJ 2EKNA 5KFGA 1GK8A 2QYCA 3T5KA 1VLOA 1WG5A 2DCUB 3VV2B 3VHQA 4B17A 3MR3A 3MM9A 3OQ2A 2V6AA 4AQYJ 4IFYA 4CH0S 3H7HB 4I7FB 3QWUA 1UJ6A 1TUGB 1RCOB 2OMOA 1CVJA 5C24A 1B0PA 3QLHB 5LXRA 2J0WA 2M70A 2MQQA 2GZOA 1TVRA 4KB7A 3P96A 5IT4A 1HWIA 4AD6A 3HP6A 4A47A 5CXTA 3PFEA 4J9NA 1CJKA 4QIGA 3IA0A 4YY3J 4DCPB 4CDIA 1FX4A 4PKDB 2DGTA 2QTWA 2V0NA 1XMQJ 3UVJB 4LJMA 3MR2A 1VRTA 4B3OA 3EGZA 1WDTA 1UPMB 2W9AA 1U47A 2BM1A 3HVAA 2XMMA 1HNZJ 1IKXB 5AT1B 2Y3YA 1IKWA 5A2QU 2FVPA 5IM0B 4MIWA 5E33A 2ZEJA 1H2TZ 5IC6B
chains in the Genus database with same CATH topology
2OPRB 2IYGA 3PM9A 1K0TA 1X0PA 2BXJA 4P7VA 2JEIA 1VQKS 1HW9A 1UEUA 2QSFA 3MECA 1KQKA 3LO3A 5J2QA 1OQ3A 2M52A 5DDOC 4CH1A 2DHXA 2BA9A 2OPQB 2N7CA 3RU0A 1L3VA 4K4UA 1LFWA 4F3OA 1VQ4S 1IKVA 2YNFA 5KFEA 4ZK7M 2VG5A 3CT9A 2NSBA 3FEXB 2WOMB 1VQ8S 3M2RB 5DGBA 3O44A 1XR5A 2GQ2A 2IRUA 3CB4A 3UCGA 3TYTA 4TKTA 4O4RA 3BEGB 4OJ1A 4DV4F 1KFDA 1W25A 3FDSA 3CULA 2YNGA 3FSIA 1FDNA 1F5BA 1F0XA 1W2BR 1QY7A 4NOHA 5A8KA 3LP0B 3I55S 5HROA 1GXLA 1KHWA 2RRNA 4TLQA 1T3OA 4ETXA 3I0SB 1QAIA 1LKZA 1AROP 1HNVB 4A8MP 4IRCA 1Q1KA 1WHXA 1RT4A 3OFHA 4OHXA 4Q8EA 4PRFA 4OI1A 4R8UA 4M1KA 2KHDA 2N4CA 4ED1A 2ADBA 4X2BA 1NAQA 5AE2A 4RNMA 4OX8A 4C2MA 3CDBA 5JXSA 3NNCA 5BYSA 3VAMA 2DO0A 3TUIC 3OXFA 2CQ0A 3BGFA 4P2SA 1SXLA 2AX1A 1TL3A 3I5CA 3DOKA 3IRWP 4DL2A 5CCLA 3B8HA 4F2RA 2EFGA 3QMQA 1SKSA 3H5XA 3P49B 4ID5A 1ZAVA 2BQUA 2E9TA 1OS5A 2LMIA 4C9DA 3BR9A 1U2FA 2EFOA 1HBNB 1S4FA 3QLHA 3PEJA 2FJDB 2DGOA 2MKKA 4X4TA 5J2PA 2OH2A 2A2CA 1XN9A 1WTBA 4ECTA 3O5TB 2JLEA 5E3PA 2UUTA 2VOOA 1FESA 1RKJA 4DL5A 4YQWA 4OFZA 2IC3A 2ZITA 2A1BA 2MKCA 3BSAA 1UVLA 1HBUB 1T94A 2IRYA 4J9KA 4JI1F 2AD9A 3MTJA 1HBMB 3M1VA 2B3TB 3IAS9 5EDWA 2ZH2A 4DF8A 2GMJA 1XEZA 1UEVA 2JDJA 3HF5A 2LQJA 3L7PA 1PSDA 5B0FA 3LGMA 2CQ3A 1JK9B 4RW9B 3IN5A 1BGXT 2HMIB 3Q2TC 2B9YA 2FJXA 3KLFA 1NB7A 5KFCA 1VBXA 4JI8F 1VS3A 1NK9A 4IQXA 2L48A 1Q4RA 1CSJA 5B0AA 3TAQA 2D3ZA 3MAQA 5JVHQ 1TKTA 4AXIA 2XY5A 5K8OA 3TARA 4IQMA 3Q2SC 3C2PA 1XC9A 4HVZA 3I4PA 2QV6A 5J1EB 3DM2B 4W90B 1A6LA 1E6YA 2HVZA 1P1TA 2I5JB 3GZ7A 5J2MB 1JLGA 2CQPA 1B7FA 4UUXA 1UP1A 1NJYA 1M90T 3NGKA 1YRXA 2I0XA 3TRGA 5I3UB 2J9CA 4PG6A 5KFDA 4ELTA 4V19J 1NEEA 4MK7A 1UWBB 1WF0A 2GHWA 4HL9A 4DR5F 1IR0A 3MR6A 2RDIA 2H9ZA 4YMEA 3EZ5A 3PX6A 5FDLA 1FNOA 2N3OA 4L3NA 1N5YA 3PY8A 2NUHA 3NAIA 3DXBA 2B7BB 4J5OA 3HXMA 5E0OA 2QMXA 5K8NA 5F0WA 4QU6A 2HRUA 1T05B 4LUBA 4B9SA 2VBXA 3CJKB 2V8GA 1WF2A 4YOEA 2DITA 3PRBA 3LW5C 3DMJB 1A9NB 1F2GA 2DRBA 1FRHA 3PZPA 2O01C 2KFNA 1KS2A 4WU2A 4B9VA 3IWLA 1SH0A 2LDIA 3H20A 3JSMA 1SH2A 3VTIA 2YWGA 2FC8A 3F44A 4O3NA 1S0NA 1Y9OA 1N88A 1ZTTA 2C3MA 1RTIB 1FHTA 4C3LA 2XBPA 3MD3A 3OUYA 1KLMA 1EP4B 3DMJA 4PWDA 3HHLD 1EETA 2GHVC 5G4DA 4RNOA 4CTAB 4RW9A 2RKIA 5KFVA 2MHNA 2DPJA 3N6LA 5DGAA 1SL0A 1RA7A 2E29A 4FF4A 2LCWA 5E7OB 1N6QA 3T1AA 4WE1A 4AL6A 2GJIA 4H4KA 2OPPA 1NKBA 1M5VC 1T03B 5BYRA 4TU9A 4DJBA 1DFDA 2ZC4A 3D28A 4RW6B 2J6SA 4EZ6A 3VCDA 3I87A 4Y2AA 1M0SA 4E8UA 2O66A 3WZ0A 3D5MA 1S1TA 2BR0A 2J7WA 1TFWA 5J1PA 5KFUA 1HQUB 2JX2A 2YH0A 2HLUA 5T7LB 3J7ZT 3HK2A 1DQ9A 3LH2S 3TVKA 2RS2A 2X3GA 1RTHA 2GO9A 3CJ5A 4LSLA 3OTDA 1M5PC 1TL3B 2VKZG 1R8CA 3UR3C 2PMZD 1DZ5A 2UV8G 3SFUA 4LF7F 1GXTA 1U2RA 4TXSA 4QYRA 4DFPA 3H4BA 5DJBA 2KXNB 3T5HA 2MKJA 3HJFA 3KLFB 2AGOA 2RD5C 5EGYA 2ALZA 2YX7A 1HWJA 1QE1B 1SV5B 3H4DA 4FF1A 2HS0A 5F8IA 1U09A 3CCUS 1YG0A 2HRYA 1D0EA 2VUGA 3HT3A 4OHYA 1DHMA 1X4GA 1Z2LA 4KPYA 1Q7LB 2HFOA 3LP0A 1LW0B 1JLEB 4O3QA 2MYFA 2JFKA 2ZBCA 2DO4A 1R0AA 5U47A 4Q0BA 4IYQA 4PQAA 5C42B 2IC3B 2FUG9 2DH9A 5KG5A 3HVTA 3T19A 2R2UA 3DDNA 3QIPA 1HYSB 2CQ1A 1YRTA 2KT5A 2MKHA 4P7TA 3Q8SB 1GH8A 4QR1A 3CD7A 2A10A 3MEDA 4LF4F 4DSKA 1ZPWX 3MMCA 5BYQA 2MHEA 2KH9A 3N0VA 2HGNA 1HL6A 2XY6A 2RB7A 4ECQA 4AL7A 2XNQA 4OV1A 1SJQA 4A8XA 4F67A 1S1VB 2DNHA 5D6GA 2FPHX 2XLJA 3KHRA 1T8EA 3D1QA 5HO4A 1YIJS 3HI9A 4CO0A 2JOQA 4FF2A 3PX0A 4LF8F 2GIQA 4B02A 2QE5A 5CHCB 4ZCLA 2FJWA 1TFYA 4H4MA 5AJ3F 4XAKA 1NRKA 5J1NA 1HA1A 1NK4A 1RAJA 2PD1A 1S9EB 3BDPA 4OZ0A 3MR5A 1HNVA 3O6QA 2EFVA 3ONQA 2DB1A 2DGXA 4HYKA 4C8KA 3RB4A 2DBBA 3O3LA 2M4MA 3MTKA 4B3SF 1X4DA 4RU2A 2C3UA 2R7RA 3HFKA 2EG1A 3OTOF 1TVRB 1K9MT 2R2SA 2WB1D 4IDKB 2DR8A 2PSZA 1R8AA 1VQ9S 1HARA 1X4EA 3GWCA 3H8YA 1V3RA 4I7FA 1K0VA 1U6BA 4URGA 3QIPB 2CRLA 2W25A 1YTYA 4JI5F 1KTQA 1IKVB 2FVRA 3KNGA 2LKZA 5C42A 2KTQA 3OVSA 1IBMF 1URRA 1U1LA 2Z2LA 5EHHA 1CG2A 4PR6A 1FCAA 1LW0A 2PGCA 1KQGB 2QIFA 2ZD1A 1MWZA 4WCEQ 1U7LA 1UVKA 2K8GA 1KLNA 4N76A 4WK3A 5J2QB 2MGZB 3Q0AA 2BACA 5HBMB 1HHSA 3MMAB 3OHAA 5D3GA 4CCHA 3LQVA 1S6OA 5FD1A 2F4VF 1QE1A 3KWMA 1NK6A 1X8DA 1OO0B 4MK9A 2R7XA 1X9MA 2W4PA 3J7YU 3DLEB 1MMDA 3MPWA 3K58A 1NZAA 2HZCA 2IM0A 3VAKA 1RTHB 1FDBA 4LVOP 4X4PA 4RW7B 3O8WA 2I1RA 2RRBA 4AQYF 2GHPA 4WXWA 5E3AA 3OJSA 1HQUA 2HHUA 2FJEB 2QA1A 2OD4A 5F8HA 2W9CA 3BO2A 4ICLA 1S0OA 1WI8A 1WG1A 2HHSA 1NK8A 4DUZF 3LANA 1CC8A 2B9XA 2F3JA 4U7CA 2FD2A 3N4WA 5GADU 4ELVA 3C46A 4MFBB 4ZLPA 2RRAA 2EG2A 3C66A 4YB5A 4NYPA 4X4RA 4XK8C 2G0CA 2PA8D 5K14B 5E3QA 4BCAA 2HFNA 2HG4A 1BQXA 1HNZF 1A7GE 4OX7A 5KFAA 4NLUA 3SSRA 1T03A 2XSFA 3M8RA 1FKOA 1UAWA 1LXJA 2CQ4A 2HS4A 4WFNQ 4WFXA 4BWJA 4PPDA 4WE1B 4TN2A 4ZPTR 1S1XB 5AE1A 2IA0A 2BW2A 5DG9A 4Q5VA 3UDCA 3E8OA 4JI4F 1M5KC 3UD3P 3KOAA 2YWKA 1JLBB 5KFFA 3N5BA 2YX1A 2RKIB 3KLEA 4HH1A 2IM3A 1EETB 5DM6Q 3SV3A 3FNNA 1I1GA 2V8DA 2ZUGA 3WDOA 4BBYA 3GQCA 2VA3A 1HI8A 4UUWA 4I2PA 2OTLS 3KG0A 2CJBA 1YITS 4AL5A 4QR2A 3M8PA 2JEFA 4LIRA 3HDSA 2UUAF 2NR0A 2K3IA 2KZMA 1DAXA 4F4XA 4FBTA 4EU0A 1Q78A 1R8PA 1U24A 3T6BA 4UQTA 1SL1A 1APSA 4NLXA 3AB4B 4ES2A 1ZH5A 2VBZA 3V81B 1CEZA 1V6HA 5D8HB 4ED7A 1SH3A 4WYWA 3K59A 3TI0A 2CDQA 3NRBA 4TYBA 4LFCF 1N33F 3H2UB 4ZVHA 1YJRA 1C4CA 3NL0A 3K7RA 4OL8A 5I4MA 2NSCA 4IKAA 3PW7A 1GQEA 2K7JA 4I69A 2E1RA 3VAHA 4O3RA 3MD1A 3KK3B 1OIAA 2KVIA 1HHTP 3ZZTA 2OTJS 1N5YB 4IG0B 2MZRA 1AXQA 3MEKA 4RZRA 3M9MB 4FS1A 1YJUA 1RYRA 2B51A 5D4PA 1BQMA 2C2EA 3CJ4A 4NRUA 2ILYA 3MM6B 3HHLB 3QAEA 3CJ3A 2OFGX 2VG6A 4C97A 3HMJG 4U6PA 5F0UA 3SZ2A 3FGVA 2KB2A 4YFUA 4RBVA 1IQTA 4ZMMA 3S8SA 4ECUA 3OL9A 4ECVA 1SL2A 2X1FA 2GC8A 4ZCKA 3CDWA 4IO9Q 4DLEA 3AY0A 1WACA 5LMNF 2VD3A 2DR9A 3KMQA 1N54B 2I5JA 2VQFF 4JUZA 4IH5A 3GV7B 1NHVA 3D0GE 1D8ZA 2JVRA 2M5YA 4ZDNA 1RT3A 2MSTA 1U1PA 4F2SA 1LK5A 3AH6A 4R25A 2NQPA 4ECWA 3CIZA 4BC9A 2DHSA 3SEOA 2LECA 4LT6A 3RW6A 5DLFA 2ROGA 3MUVP 3RAMA 1FNXH 5C25A 2CPHA 2HWTA 4HEA9 4KT0C 1TAQA 3F56A 2UUWA 2QLWA 1BWEA 1U1RA 3MM8B 3SDEA 1S48A 1TKZA 2G4BA 4CO2A 4HKQA 3DDKA 5GAHI 3KLHA 1X4BA 2BM0A 2VFSA 3MUTP 1U1OA 3EZUA 4IOBA 1FK9B 5L38A 1S6QB 3H59A 4J9RA 3OVBA 2XS7A 1YWXA 3D54A 3DHXA 1U48A 2V2KA 3MOJB 4O23A 3M1VB 2F8MA 1H2UX 1HWUA 3DU6A 4A8WA 1SJ1A 2AQ4A 2R8HA 2CFXA 4N77A 4Q45A 4WTYA 4DL4A 3HHEA 5HMZA 5IWAF 3P6YC 2VODA 2W7PA 3PIOQ 4B3TF 4EBCA 1N8RT 2QLXA 1U25A 2RU9A 3CCWA 3FSYA 2PN6A 1VRUA 3I32A 3TW0A 3MFHA 3NWGA 3W2WB 3DRRA 4TY8B 2MMYA 5KTQA 3TUJC 5HP1B 1ZETA 4QR0A 4ID5B 2VH7A 3OR1B 3CCLS 2BABA 1S6QA 3SSQA 2PI4A 1FD2A 3DOKB 1C0TA 1FDAA 4TU7A 2CJAA 1FRLA 1HD0A 1VFJA 2VKRA 1VIOA 3FEZA 2B6AA 5F3TA 5KFPA 1QM9A 4KSEB 4QZVB 4C0OC 4F3QA 1WG4A 2XSJA 1NJIT 3KK2A 3IFEA 4OJ3A 1VBYA 2HHVA 3TAMA 3WBZA 4WFBQ 3PO4A 2FVSA 5B09A 2XMKA 5G0RA 1Z4UA 5GAEU 5I42B 1HI1A 3LP2B 1AW0A 2KXFA 1T3NA 1Q86T 1L5UA 3JAMY 2CPYA 4K5SA 3H5UA 3HX9A 3G86A 1SJ3P 2ASLA 2EBEA 4ERDA 4DR4F 2VB6A 1C0UB 1JNZB 2HNYA 4OLOA 2B7CB 3CC4S 3NG8A 3JTOA 2WSEC 4QWDA 2X1GA 3QPIA 3NKYA 2XG8A 5HI7A 2MPUA 3FQLA 1GX6A 3U1NA 2YKNA 1XMOF 4URQU 2J7KA 1PC4A 2E5GA 2XGQA 1VC5A 1NK5A 2IBKA 4Q7AA 5D77A 1JLAB 1LWFB 2DK2A 3CEDA 3QZ7A 1ULRA 2OPQA 2YNIA 1FO1A 3ZZPA 1LW2A 2IMOA 3US5A 1CQNA 5L39A 1QVFR 2RILA 3GFZA 2P9EA 1YI2S 3TO8A 3MPYA 1Y5NB 1BD6A 2ZFHA 2ZJRQ 2E7XA 4J9SA 3PJWA 1Y3JA 3CPWR 3MM5A 2WRMA 3J7YI 1M1KT 4OHWA 2A2DA 2W9BA 1X4CA 5IFMA 3R5BA 1IKXA 2FDNA 4DL7A 3A8EA 1M5OC 5E41A 3RR7A 1Q16B 1FJGF 2MB0B 2L08A 2V8HA 4G1QA 3HHNB 2L9NA 4F02A 2J9DA 4X4OA 2JL9A 3CCSS 2V4JB 3M30B 1F60B 3CD0A 3ISND 4I2PB 5A0YB 4WKYA 2KG0A 4X4UA 1MROA 4K4TA 2RS8A 2RQCA 1VHFA 1QUPA 3LOUA 4QWEA 3MAHA 1P8GA 4WFAQ 1TKDA 1SJFA 3E3XA 4DR3F 1KD1T 1R27B 3W7BA 2RU3A 4ZHRB 4LF5F 1JLBA 4IFYB 3ZZUA 3CUNA 3ZZOA 4KHPF 1BQNA 1DLOB 1ZM9A 3BB5A 3CC7S 4DQSA 4UW2A 3X3UA 1S1XA 3DXSX 4KC5A 3T9NA 3KK1B 2F40A 3K8WA 4NZ7A 3OXLA 2P9CA 5BR8F 4HTIA 4TYAA 1WF1A 2YWHA 2KG1A 4DG1B 1IKYB 2CJQA 2WBRA 3R5CA 2I8EA 1H6KX 4DR7F 1PC5A 1I6JA 2UXDF 2RQ4A 1CQMA 3BS9A 4RKUC 3OXGA 1IJFB 4OZLA 4ZHRA 4DFMA 1NJWA 2BVZA 4OI6A 2BQRA 2ZH4A 3PW4A 5KFWA 4XPEA 3H98A 4ZCIA 4N56A 4ICLB 5CA5A 2JWNA 2GGPA 4OLPA 5A0YA 3TANA 4NA1A 3T5JA 4K2XA 5KFRA 4DOZ