1IBLF

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1iblF00
1LOUA 4GKKF 1GH8A 4GKJF 4LF6F 4NXMF 1FKAF 4JI4F 4JV5F 4JI6F 5AJ3F 1VMBA 2BXJA 1CQMA 4DR7F 2BVZA 4DR5F 1HNZF 4LF4F 1XNRF 5BR8F 1HNXF 4LF5F 4YHHF 2VQFF 4X64F 2J5AA 1IJEB 2UUCF 2YY3A 3T1HF 2KJWA 4DUYF 4DV7F 4DV4F 4OX9F 4X62F 4AQYF 4DV3F 4DR3F 2UU9F 1HNWF 4X65F 2B7CB 2UXDF 1J5EF 4JI7F 4K0KF 2VQEF 4YY3F 2HHHF 4X66F 2UXCF 3R3TA 4LFCF 1CQNA 2F4VF 1G7CB 3ZZPA 3T1YF 5LMNF 1N33F 4B3TF 4DV1F 1N36F 4JI2F 1FJGF 4DV2F 4JI8F 1HR0F 1IBLF 4B3MF 2RJZA 1IBKF 4B3RF 5LMUF 2UUBF 1IBMF 4LF8F 4KHPF 1IJFB 4LFAF 3OTOF 2ZM6F 5IWAF 4DV5F 4LF7F 4DR4F 4DV0F 1N34F 1B64A 4DR1F 4LFBF 1XNQF 4DR6F 1RISA 4JI5F 4DR2F 1F60B 2E5LF 1XMOF 4JI1F 4DV6F 1XMQF 4B3SF 4JI0F 1I94F 1N32F 4JI3F 4LF9F 4DUZF 1QJHA 2B7BB 2UUAF 4JYAF 2UXBF 1G1XA 4NXNF 2KJVA
chains in the Genus database with same CATH superfamily
1RYSA 4OIXA 1RBAA 2BE2B 4JI6J 3EGZA 4ZP6A 2NQPA 2BR0A 4I68A 4PWWA 3DRRA 1YRXA 4OX7A 3EDRB 2KJWA 4HT7A 1KEKA 2J0SD 3UQSA 3BN7A 2P9EA 3K58A 3MURP 2HS3A 2DHAA 1WC1A 3W9IA 2IJNA 4C8NA 2IVFB 1S1UB 1APSA 5F8NA 1QUVA 2CG8A 2LQ9A 2L48A 2B43A 3ETOA 5E3AA 3NS5A 4XK8C 2BDPA 2NCKL 2P9GA 4DMZA 1KONA 2ZJPQ 4W98A 3BR9A 4XDCA 5CYJA 5LMUJ 4ATNA 4CLPA 4P52A 2MB0B 1FDNA 1I5OB 2GS8A 3NGRA 2EVZA 1YRTA 2HBZB 1T05B 1FDAA 1R89A 4YUDA 3GU0A 2FJBB 3DDNA 2FVQA 2HMIA 3SIPB 4WP3A 4QPTA 4DN0A 4G1QA 1KFDA 2GMHA 3I32A 3HK2A 4YDXA 3ZTRA 3WX8A 3AHPA 3I82A 4WBFA 2BQRA 1CJVA 4DJBA 2I38A 2HVZA 3UN2A 4ZLNA 2VZ9A 4MKBA 1Y11A 2RQCA 4BC9A 2XWXA 3J81j 1Z2LA 3QGIA 2GO9A 2NR0A 1DQ9A 4NMLA 4WFAQ 4QW9A 1S48A 1KQFB 1FRLA 4LRCA 1J5OA 3I31A 2I8EA 2VBYA 3TP2A 2KH9A 2B9YA 2YKQA 3GB0A 2Q6CA 2H4WB 2DYAA 2ZBPA 1K1SA 3UCUP 3IRXA 4PQUB 3C14B 4NA2A 2MKJA 4NE9C 3R97A 3IXQA 3AB4B 3Q8VA 3T9ZA 2CRLA 5A8WA 2E5GA 1S0OA 3QFHA 1V3ZA 2HFUA 1NPRA 5ETKA 3WC0A 4Z7CA 2DR5A 2EPIA 4CT8A 3T1HJ 5A76A 5KFGA 1FRKA 1RT5A 3R5AA 2PFFB 1AFIA 3KK1B 2XSFA 3SCIE 2V4QA 2XLIA 3IS9B 2XSJB 3DC2A 1ZM4A 1T7PA 4CLSA 3WC2A 2C2KB 3CULA 2L9DA 2IRXA 5HVHA 3MEDA 3NG8A 3FZ2A 4A8SA 4AT1B 2MQQA 1IKYA 1YSJA 3TARA 1QAYA 1WC6A 3GIMA 3SSQA 3V6KA 5KFRA 2GJ2A 3IWXA 1U02A 3DKDA 1B7FA 3ZZ0A 2NYIA 4OJ1A 4ZN3A 3QT5A 5J2QB 3HHLD 2WK4A 2ZE2A 4DR4F 4U95A 2GVDB 2HQIA 2MMYA 1H2TZ 4EMDA 4OI2A 3D0HE 3UR0A 4USWA 4G3IA 5FD1A 2JZ5A 1KLMA 2V2ZA 1RTHB 1HNIB 1ZA1B 5CAAA 1RHRB 5E3QA 2AEMA 4OYBA 2E7XA 4PWUA 3QO9A 1N5YB 2ROGA 4EWTA 3PDNA 1WOPA 2AIRB 4ZPAA 5D4NA 5KFFA 1ZM3A 4N5SA 4B9NA 5B7WA 1RKIA 4YHHF 5F3TA 3DHXA 3OJUA 2IM0A 5DRKA 1CEZA 1N36J 3CDAA 3CCSS 4DV3F 2O3DA 2XMKA 1N0UA 4I1TA 4RNHA 4WF9Q 3VVTA 2C2RA 4I2PA 3PYGA 3D67A 2KT2A 1DTQB 1RWOB 4QIGA 1JLFB 4B08A 4JI8F 3K5PA 3JB9k 4CI0B 4F2SA 1QSLA 3HSZA 5HBMB 2DNPA 1A0OB 2Z4PA 4DR4J 2BZ2A 4JV2A 3VQTA 2CQDA 3VGSA 2OSRA 4IOCQ 2K06A 1LW0B 2R7VA 3HI9A 3CCQS 2LCWA 4CLZA 1YJUA 4F0KA 3IRWP 4XPEA 1U2CA 4ZCKA 2UU9J 3PR5B 3W64A 5AE2A 3RRGA 3MHYA 4DDFA 2F40A 4WFNQ 2HNDA 1UFLA 4OZ1A 3NGTA 2AYGA 1HW9A 3FFIB 4H4OB 8ATCB 3QAEA 4URSA 5KFMA 1VQLS 4K8RA 1V9OA 4LVNP 4RX6A 2BANB 2V68A 2E7WA 1WSVA 3PKYA 3B4DA 5E33A 5KOWA 2KXFA 3QGPA 1UW4A 4JI8J 3POTA 5F8LA 2C1EB 1GX6A 2HFSA 1R8BA 4P75A 1S57A 3OUYB 2YX4A 3GILA 1WHWA 3DDKA 3PYEA 4W4MA 2B9WA 1RB0A 2CQCA 2XMMA 2HIYA 1XMQF 4B3SF 2C3PA 1I94F 2V8VA 2OTLS 1NM2A 1LK7A 4ZP7A 4AL7A 2ASDA 3K0JA 4OYWA 1U6ZA 2VPWB 4FXVA 4QQBA 5LSRA 4OZ0A 2RNEA 3BGRB 2FD2A 2G1DA 1FT8A 3AD8C 3KK3B 3T5JA 1Q7YT 3UD5A 2C3UA 4AFFA 4IH5A 2DCUB 2DXEA 1WF1A 4DV1J 4DV2J 2HNYB 4YS2A 4EYIB 1UVJA 3ET6B 4LF7J 3TVKA 2U1AA 4IH6A 5J2NA 4C8KA 2DHHA 3M05A 1N8RT 3FGVA 2P8IA 4C9DA 2VG5B 3H25A 2GV1A 1P9YA 4N41A 1S4EA 2NXCA 2XNRA 3VHQA 2DITA 2WSFC 4Y3CA 1XMQJ 4B3SJ 2KTQA 1TVRB 1I94J 3TAMA 1QAXA 1LFWA 4NXNF 1OS5A 1SH2A 3HM9A 2CQ4A 4F67A 3VV2B 2G0IA 2CNNB 3HFVA 2XMVA 4P10A 2F4VJ 3NKYA 2KYXA 1IKVA 1UMJA 4DUYF 1S1VB 5C5JA 4DV4F 2XO6A 2MGZA 3AB2B 1DQ8A 4X65F 4IH7A 1S7IA 3FJ2A 1U0HA 3CJ3A 2MZQA 1VLOA 3R2CJ 4CNYA 2V94A 1TV6A 1ZAXA 3M1VB 4ITSA 4OLPA 4B3MF 4J7CA 4OV6A 3G2XA 3OL8A 3D6FB 3O5TB 3OXFA 2AT1B 4RPFA 3OFHA 2OELA 2FVCA 1RISA 3D1OA 1X0PA 1XR5A 4OMFG 3VZHA 3GPAA 5C2GA 1S1WA 1NK5A 2C2OB 4U7UD 3MCMA 4NI2B 1BY9A 3PJXA 4HYKA 2O1PA 5K8MA 1RCOB 2W7AA 4ID8A 2OSQA 4ILRA 1NJYA 1MROA 3M8WA 3DI6B 3DXSX 1HYSA 3MEEA 1HHTP 4PKDB 4UY8T 4ECXA 3PYFA 5E3PA 1HWLA 3IGNA 5HMXA 4DQRA 4DUYJ 1KFSA 3GSDA 3P5BP 5ETLA 2VODA 4KY3A 4ZJQA 1ZOTA 2UP1A 3RG6A 4X65J 3L3CA 3UDEA 1FRIA 2E66A 4ANCA 3AQPA 1TL1A 1G4CA 1RQ0A 3GJSB 3CJ4A 5LSOA 1F2HA 4GC6A 4LFBJ 2LXUA 5EWGA 2LEPA 3VAFA 2MPUA 1VC0A 3N4WA 5EWFA 1RT1B 2ZD1A 5HSPA 2H9ZA 1HBMB 3LANA 3UDVA 4UOGA 1C1BA 1FF2A 1HHSA 4NLQA 4IG3A 3NLCA 4ZP9A 4DV5F 2APOA 1XNQF 1N54B 4JI5F 2AU0A 2HZCA 1FXDA 4UZCA 4FXWA 2QA2A 2GO8A 1T9YA 4DPXA 4EI2A 2XYPB 1NAQA 3UD4P 4NLRA 2HNZB 4HTIA 2B3TB 4ZK7M 2QG9B 2JEGA 5BJRA 1NK0A 4JI4F 2DO0A 2WVBA 2CPEA 3TJ9A 4LSLB 3Q86A 3S1TA 2OMLA 3CB4A 3ZZYA 2XG8A 4I64A 3DDIA 3C6UA 2VBZA 1AA1B 2KYZA 2UXDF 4QIFA 3UO0A 3J80Y 2JNJA 2M88A 4EU0A 1LWEA 5J1EB 2PSZA 3LWLA 2G2YA 2Y1RI 1OY9A 1LWFB 5E0OA 1DFDA 5HMWA 4HI1A 4JI2F 1NHUA 4CYUB 2KG1A 2UV8A 4RU2A 1IBKF 2RRAA 4PYAA 4OYZA 3M8ZA 1WI8A 1HPZA 4IYQA 4U7UK 4GRSA 4DV5J 5HATA 3ZTQA 1H2VZ 1XNQJ 5M2PA 4JI5J 2QA4S 3DM2B 5DZ6A 2MDAA 2KFNA 3P5TL 1V5IB 1JXVA 2NSBA 4LRAA 3BYRA 2V67A 4RW7B 4MIAA 4KV8A 1RCXB 2L9NA 4N8OA 1Q16B 1TELA 2XYGB 2WBMA 5HI7A 2POKA 4JI4J 2D3OR 2RS2A 4UW2A 1SC1B 1CJKB 1R0AA 2CQ1A 3OT9A 5F9LA 5A6PA 2C2ZB 4A8OA 2A6OA 2V8DA 3S8SA 3TNVA 1VQPS 5AXMA 5GADI 5A8RB 2B7CB 5KFSA 2UXDJ 4J90A 4TQRA 4U8YA 1BE4A 2V8PA 4URGA 5E7OB 3H7HB 4R5PB 2XLKA 2DR7A 2MZ1A 4PG5A 3TANA 4JI2J 2R7UA 1X5PA 2X1GA 1GFWB 4RU9A 5KG3A 4W90B 3HVAA 1IJFB 4FKYA 3DGPA 3BN4A 1OSCA 3ZTPA 4X4PA 4R8UB 1VDHA 4KT0C 1B99A 2MKCA 1UWBB 3CNQP 2Z57B 3HPOA 1B70B 2LXIA 3VALA 1WEXA 2VFTA 2B4UA 3M32A 3H4DA 2WVFA 2WBRA 1SKWA 1PILA 1C1CB 4CCHA 1NK4A 2HWTA 1X4DA 3KWMA 3V81B 4KFBA 3J80U 1CJUA 2A18A 3PRVA 2LKZA 4HHJA 3DRXA 1HNWF 3R7NB 1Q95G 1O6XA 1PSDA 4OYMA 2CQ2A 3T19A 2LMIA 4WFYA 1M5VC 2CADA 2Y8WA 2J76E 2QA1A 1KVIA 1WACA 3W5ZA 1FEHA 1HD0A 3ZTSA 1FDDA 3J7AN 3W1YC 2ABYA 3GTYX 3IAM9 4CTAB 4FF1A 2YX7A 2R2SA 3SDEB 2QLJB 1EP4B 2FC9A 2HK2A 3IWLA 4RWXA 4WZMA 5BXIA 2YWWA 3UNGC 2V2QA 4DBQA 3B78A 2BX6A 2N4DA 1E6YA 1XNRF 1S1TA 3GSIA 4QR1A 4GVLA 3SV3A 2VG7A 5D3GA 1ZS6A 2V69A 2MJNA 1WF0A 4F0MA 2B9EA 1K47A 2WRMA 3PXGa 2VPXB 4IG0B 1OJ4A 1U1PA 2B4PA 3OTOJ 4O3OA 2BKNA 4RBTA 4NEYA 1KKHA 2V8GA 2C42A 3HKZD 4IO1A 1GTEA 6FDRA 2BABA 3OR1B 3ZZOA 2N3LA 2NYHA 2QYCA 1WORA 2ADBA 1CG2A 1UETA 2EFOA 5K8NA 4BC7A 3MR3A 4X4RA 1M5SA 1VRTB 3ICLA 1FX4A 2DNMA 5HQLA 1NSKL 3AFGA 1TKTA 1Q86T 2FJVA 3P49B 5KG6A 4UQTA 3OTEA 3HHLB 2W8KA 5FLXU 2W9AA 3DOLA 1NB7A 3C15A 1TMMA 4M5JA 2AJ0A 3Q8RB 4H4MB 4WE1B 5HLFA 1XNRJ 5T14A 2ZH6A 4RNNA 3P3DA 4X64F 2W7PA 1LWCA 3D0IE 4QZVB 1V3RA 1S72S 1IBLJ 3NEKA 1Q5YA 5JVHQ 1WC5A 3LGHA 3BKFA 3MOJB 4DF4A 4LFCF 1Q8IA 3DRRB 4OYAA 2GJIA 3F0NA 2EFGA 3PY8A 3IR7B 3N5FA 2F4FA 4TN2A 2FHKA 3LO3A 6FD1A 2FC8A 3GWCA 2IDEA 3RR7A 2GHPA 1NSPA 3GCWP 4JYAJ 2HVIA 2SXLA 4YFUA 1GEHA 1RAGB 2AX0A 4GVBA 2HRYA 1HQ2A 3EGVA 4EBCA 3H2UB 2ZHBA 1UZDA 1VBXA 4FKXA 2LFVA 2MLXA 3Q2SC 2XZTB 3PM9A 1FJCA 4FYXB 1M0SA 1W7WA 3KJVA 2VG6A 3IAS9 2K3IA 3TQEA 1VC6A 3O3LA 2HMIB 3E51A 4GC7A 3PW5A 4CH1A 2AF6A 5MAOA 4G1QB 3SBMA 1NU4A 5E3CA 5HN0A 3NRBA 1WJ9A 3PFEA 4X64J 3C6TA 2NZCA 1UVMA 1N0VC 1NO8A 1VISA 4HHUA 4ILMA 1HNVA 1CJVB 3NGSA 2HZVA 4MAKA 1CQNA 3IA0A 4LFCJ 4FYVB 3MFIA 2RQ4A 4J5OA 4P7TA 7FD1A 3RAMA 3TUZC 2R7XA 4AYBD 2GX8A 1S6UA 1J5OB 2Z2LA 1GMVA 1VK3A 4B9TA 2YQ0A 4NRTA 4BWMA 4CO0A 4KHRA 4ZVFA 2WW4A 3KLGA 1XMOF 4UZBA 4M63A 4MYTA 5BR8J 2CPYA 2KO1A 4JV0A 3LOUA 4RO0A 3M8RA 3IRXB 5HVGA 2CG4A 3VAHA 1WOOA 2GAGC 1RT6B 2R42A 3K57A 4ZJLA 1BQMB 1RTIA 2M8HA 1SQGA 2CIMA 3B82A 2WTFA 4ELVA 3M2VA 5HQ8A 2W2QP 2F8HA 2BEFA 2J9DA 1YIJS 2EFPA 3MCNA 1D3WA 1YJNS 2PI5A 2W9CA 3CDUA 3QFWA 1Y0HA 4EBEA 2RH3A 2RD5C 4C3KA 2ZH5A 2QC3A 4PQAA 1GMWA 1ITPA 2OPQB 3OR2A 3U1NA 1KC8T 1IKYB 4I2QB 4LIRA 3IN5A 4P71A 4ANDA 1H74A 3PEHA 1RA6A 4KGVB 3ISZA 4NZ7A 3AODA 4WCEQ 4F4KA 1V3SA 3Q8PB 2UVWA 1XMOJ 2BYCA 1O51A 1SQEA 5IOLA 2E9TA 1I1GA 4P9SA 3KTQA 2B6AA 3D6HB 5JMNA 3IWNC 2VBXA 3W66A 4NXMF 3PW0A 2Z58B 3IG1A 3BB5A 5HMZA 1FD8A 2DIUA 2E1CA 2PI4A 2HHPA 1X8DA 3JQJA 4ELTA 1KSPA 2VPYB 5J1PA 1XEZA 3LAKA 2CDQA 1TQLA 3KLFA 1RLCL 2DGTA 3THTA 1DZ5A 1CS4A 4K0KF 2AD9A 1FJ7A 1YVFA 3S7RA 3CSKA 4J9LA 1Q53A 2Z2ZA 2CYYA 4FPIA 3ZZPA 3BR8A 3RW6A 3T5KA 3EZOA 4DX6A 3IR5B 2BJEA 1SIZA 2A1BA 3TZYA 1YG0A 3UCZP 3MFHA 3W8GA 1T03A 2ZOFA 4DSKA 4U67Q 1YWXA 2HQFA 4DN9A 3U02A 4I2PB 3ENQA 3PJ9A 3V5RA 2CPXA 4QIVA 2CPHA 4CLKA 2Z56B 4F4XA 4LF9F 1F0XA 2PA3A 5IC4B 4YMEA 1B0VA 5KT6A 2MQ8A 5I3QA 4ZVGA 3IR6B 5CYMA 4O3QA 1Y7PA 5IT4A 2YY3A 1MWZA 1RT3A 5LJ5Y 3QYYA 5D4LA 1U1QA 3RU0A 2XS2A 2HWIA 1L3UA 4NPOA 3R9LA 2DPJA 1EARA 2V6AA 5IZHA 4E0DA 3D3BJ 4DHVA 3KYLA 1N5SA 4F3QA 2ASYA 4NLDA 1NK6A 2QMXA 3DOMB 1U25A 3ZXWA 5T7LA 5B0FA 2EG1A 5F3ZA 4NLTA 2LEBA 3V6HA 3E8OA 1T9XA 4ZDNA 3POTB 3NL0A 4FS1A 2LU1A 1TR0A 2BOPA 4LF9J 2FDNA 1E6VB 2EBEA 4DI6A 3CD6S 3MEGA 4O3SA 2ACYA 3ILJA 1RHJB 2PMWA 4OHXA 2QYGA 5AJ3F 1WKKA 1YK9A 2BQ3A 2QLXA 3BDEA 1NZ8A 3M30A 1U1KA 1UPPA 3PTWA 4G6VB 4X62F 3MR2A 2LDYA 3BSNA 1GMWD 2RQMA 2MKIA 5KT7A 5C42B 3DLLQ 2ZM6J 2FLPA 1RT7B 1JNRB 4YQWA 3TWZA 3MPWA 3OTCA 4C11B 1HR0F 2HRUA 2HZAA 2YQ1A 3CC4S 2RF2A 3FCWA 2ZNYA 2LQ8A 5J2NB 1WNEA 1SJ1A 3KMQA 1V5VA 1EHWA 2J9DE 3WX4A 4WK3A 3FBFA 4N77A 2UUAF 1HNXJ 3MPYA 3I0RA 3CJ0A 2ZOMA 1Z4UA 4ZCIA 4AL6A 3HFZB 4USMA 2HK3A 1W25A 3CMAS 2DY9A 4JBCA 2QA4G 4WIIA 3MMBA 3TAMB 4CDIA 3F56A 3BGFA 3LWMA 4C8YA 4TLRA 1G3OA 5A0YB 1PO6A 3DLHA 4N56A 1YJWS 4X62J 2OEKA 1BQXA 4J9KA 4TYBA 5K5MA 3VGTA 1J5EF 1TTHB 4C8OA 2YKAA 3AD7C 2LA4A 2Z0GA 4B9LA 3EPIA 1IKVB 3FCHA 2M70A 4L76A 2MGZB 2HVHA 1FWPA 1U0HB 3TW0A 4PYDA 2DK2A 1F2GA 3HT3A 5DDQC 1N34F 1YBAA 1Y00A 4HTJA 5K8PA 3CMQA 1YBTA 5KT3A 1CPZA 2AGQA 4FNIA 3PRBA 1EETA 3DRPA 4DQIA 2UUAJ 1FXLA 3HHNB 4A47A 3AD9C 3WIUA 1IR1A 4LF6F 3MMCB 2XO7A 2DGXA 3P96A 5GVQA 3K8VA 1S7HA 1SV5A 1S9GB 1S1WB 1Y5IB 1HBUA 3MUTP 4MKYA 2EFNA 2HYIB 1QE1A 4B17A 4Y2CA 1MROB 3CJKB 3I0SA 3T6JA 4ECUA 4OYPA 4MKVA 2QFJA 1RYRA 5HJYA 3OL6A 1YRUA 1J5EJ 5D8HB 4P6QA 1A7GE 4TKTA 3PX6A 4L3KA 2MQMA 4Q2MA 4A8KA 1CVJA 1X4FA 2UUWA 3SYZA 3MMAB 1KBRA 3JSMB 2EK1A 3DU6A 4NOHA 1TL1B 2KHDA 3I4PA 4X84A 4MJKA 2R2UA 3GIRA 3GYXB 3R7SB 1F60B 1BLUA 2ZD1B 2GHVC 2QMWA 1X4BA 3NGUA 1C1BB 4B3OA 1M90T 2R4FA 4IG3B 3BSAA 3VAGA 3HHEA 1AFJA 3RAXA 1DLOA 4LF6J 3B8HA 3S6EA 4PXDA 2XGQA 3QMQA 2A2CA 4LF4F 1HL6A 1TFWA 1RZMA 1U24A 4CRJA 3ZZTA 3ISND 3QLHB 3EYZA 3UE2A 3OD2A 2Z2YB 5HROA 1NLKL 5KG1A 3EE3A 1TMJA 2VV5A 3TX0A 3BSCA 2AJ2A 2VJUA 4KB7A 1U8SA 4DPYA 3TAQA 3M8PA 2F1FA 2FY1A 1RHUB 2R2RA 1FO1A 3KUHA 3G71S 3C6UB 2E5LJ 1F1BB 1RK8A 4P2MA 3W5YA 1IQZA 1LWEB 2W4DA 4DF8A 4PG6A 1VQOS 4C0HA 3EJMA 2YNHA 3LP1A 3VAIA 1ZH5A 5D6GA 2HAIA 4DR7J 2HBQB 2LQBA 5KFCA 2ZH4A 2H51B 1W2BR 3ZZRA 5C25A 3F41A 1R27B 1RT4A 4H4KA 1OPZA 1YBUA 5CYQA 2D9OA 2RB7A 3EVWA 2MEWA 1K73T 1U49A 1UFKA 1EZZB 3LP2A 1NNDA 3VR1A 2B56A 4KV8B 2D41A 2ROEA 1YZ6A 2GZOA 1JXLA 1H73A 1JK9B 2DPIA 4H4KC 2EK6A 1VHIA 1AROP 2K3KA 1R0AB 1UTAA 2KVQE 2CQBA 2VH7A 4ZVHA 5HQMA 5K14A 2R8GA 1N6QB 5DJBA 4K4WA 1VRQC 3UWTA 1KVKA 1UEKA 3JSBA 3WDOA 2J0QD 3HD2A 3GJTB 3QQCD 2ZJRQ 4QIEA 5FJ4A 2CZVC 2QL7B 2CZ9A 1I6JA 4E2FB 4ZITA 2YNIB 2JLEA 4PUOA 4I67A 5KFUA 3GJQB 2KI2A 1K44A 2IA0A 3LGMA 1RUSA 1WELA 1JQGA 1H72C 4PXCA 3GIIA 4QIWD 3J7A1 1BC6A 4RNOA 5ETPA 5F8GA 3K2YA 3AOBA 5AE3A 4B9VA 5E41A 5GAEU 2FZCB 4ZVPB 1PYSB 1SKUB 1CQMA 1MU2A 3A8IA 3CMES 4CO4A 2CQGA 4NCAA 2HQGA 3M32B 2ZVIA 3W60A 1NDPA 1XR7A 1OWXA 2FVSA 1MWYA 1UEUA 4DSEA 3JQKA 3VTIA 2YPYA 3IP0A 4KHMA 4I7FA 4ERDA 3PRDA 4ECSA 4QYZK 4ZCMA 3TJ8A 2B4VA 1J27A 4FF2A 2CKWA 3LALA 2K2PA 1VBKA 4WWSA 1TL3B 4NCGA 3SSSA 2FVPA 2UXBJ 3H59A 5IWAF 4P72A 2IC3B 5DM7Q 3N79A 2FHOB 1O5JA 2UVVA 2IJFA 4ZPCA 3W2VA 3TYTA 5CA5A 1MG7A 3MUMP 4IRKA 1HWJA 4Z2XA 1B4SA 1HBNA 4YN3B 2KXNB 1DRZA 1MLAA 4USVA 2J9EA 3HVTB 1QUPA 1KQKA 2MQPA 2W7OA 2M5YA 1VQ4S 3M9MB 3T3FA 5LL6d 3H90A 1LQ9A 2HHWA 4ZPBA 2W2OP 4CO1A 2RDIA 2Q1LA 4RW6A 2UVUA 4N47A 1KLNA 2BKOA 1WUUA 4Y28C 4X2BA 3AJDA 2FVRA 4OZJA 2J9CA 3HVWA 1YJRA 3SQGA 1MWQA 1YGYA 1JLBA 5C24A 2GIQA 1F9EB 4B3RJ 1E6YB 1H3DA 2VDHA 4K4ZA 1S1TB 4PABA 4KO0A 3AXMA 2MQNA 3BKUA 3UR3C 3C16A 2JLGA 2VG7B 4EFAC 4R25A 3FCVA 3T1AA 5D4PA 1WHYA 2W01A 2UUBF 1WF2A 3IM9A 1EB0A 2CJXB 3PACA 3H5XA 3HHDA 4EZ6A 2DNLA 3Q8YA 4KGKA 3OHAA 3I4HX 4CT9A 4HACA 1X7VA 2AJFE 3FQKA 3NAIA 4I6AA 4KKOA 1NCLA 4ES3A 5CHCB 4G65A 3IC1A 1NDCA 5KFZA 4L75A 1G6BA 1XWLA 4UY85 4RR5A 5E2QA 2GHWA 1RA7A 1YJVA 3D28A 2IBOA 4M5KA 1IM6A 2A6MA 2ADCA 3OLAA 1PCAA 2IYGA 3ILLA 3P4UB 5HP1A 3C15B 2DB1A 1RWUA 2WVEA 4PR6A 1T11A 5HLFB 3MCOA 4ICLA 1RLDA 1OMSA 1S9FA 1KHVA 1R0CB 2DHXA 2DEJA 4IKAA 1KP6A 1CJTA 4HVZA 4ETXA 1LW2A 1UPMB 2RS8A 3R1HA 4ED6A 2RJZA 4X4UA 4LSNB 4BLGA 1YJTA 4ZPTR 5DGAA 1JLEA 5D15A 1A6LA 4YB6A 2W24A 3HMJG 2VOOA 3OJSA 4LVOP 4UOFA 2Y3YA 1RWNB 2OHDA 1RGVA 1DTTB 4RUHA 4F8RA 1FRJA 1QJHA 2OGUA 3GMGA 1VRUB 2ZC3A 3RB4A 2GIRA 1IQTA 1Y5LB 2BE2A 4AD6A 1C0TA 3CW2C 2EWHA 4FVMA 2DNHA 2BJ3A 4K59A 4YOEA 3W3SA 3AAWB 3KXDA 5KFTA 3KFWX 3PX0A 1SUQB 3GR1A 1ULRA 1FNXH 4MH8A 1RKJA 2R7WA 3KJVB 1FJGJ 3IMQJ 4DCJB 4MKAA 2AEFA 3EPGA 1WG4A 2COLA 4KH0B 3R3TA 3FEXB 2F5GA 2JJ4D 3C6TB 4A8FA 4DSFA 5DZ7A 4BDPA 3Q0AA 1U09A 4Z37A 4ECZA 4UT4A 3BH7B 4OJHA 1HNVB 4WU3A 4ECYA 4Y34A 3CVKA 1UJ4A 2RQKA 4BS2A 3KLHB 4DR6F 5ADZA 4ZKAA 2AYEA 4RWWA 1H6KX 3CCLS 5AXKA 4ED2A 4JI3F 1JKHB 2AJQA 4LRFA 5KFXA 4DUZF 2M2BA 3I5AA 2OPPA 3K5OA 5EN1A 1ZAWA 1Q0NA 3KLGB 3AJ1A 3D54A 3FDSA 3FUYA 5LSLA 1KNZA 1WD6A 5CCMA 2BW7A 4HDGA 4R0EA 2KB2A 1FK9B 4CM2A 3ZNJ1 2ASJA 5U47A 4CO2A 3NNAA 3M2UB 3TOQA 1N88A 3K89A 4TY9A 1RTIB 1TKXB 3OFEA 1Y10A 4KC5A 3M2VB 4FZVA 4CLYA 2DH7A 2DHSA 1P6TA 2RUSA 3UN3A 1S99A 3KDNA 3SFGA 2W9CB 3MD3A 1S9EB 3TUPA 1T0TV 3BDPA 1U26A 3R8YA 1FXRA 9ATCB 1VQSA 1S6QB 2IVYA 3BM7A 5EUHA 3LQVA 4KHPF 3HT0A 4PPDA 2VFSA 5KFAA 3J7ZT 4KGMA 2GW8A 3OR2B 3FMBA 4DR6J 2AV5A 2MHNA 5EX3A 3FSIA 2RT3A 3ILOA 1N32F 3U7JA 4JI3J 4DUZJ 4RJVA 4DCOB 2CJKA 5CD4A 3ADAC 1IR2A 3FEYB 1U6FA 1X9WA 1PJ7A 1VLYA 1C4AA 3TEHB 5KFOA 3KK1A 4Q8FA 1FX2A 3IS9A 2XSJA 5M2RA 4PXBA 2KHCA 4FS2A 4DU7A 2DGUA 1HW8A 2IM3A 3I9V9 3RB3A 2B6AB 4B3TJ 1F9FA 4XIUA 3LF0A 2IMWP 2ZUGA 3IG1B 4EUVA 2DGWA 5IM0A 3GIKA 4QWAA 5H9FJ 4TU9A 1DAXA 2R2TA 1LXNA 1SL2A 4DCPB 2AJ1A 1VBYA 4WYLA 2M9KA 4ZLPA 3BV8A 1KOOA 3MWBA 3KLFB 1N5VA 1NPPA 1CS4B 3EWGA 2HKEA 4GO7X 4DU8A 2YH1A 4KHPJ 1NHVA 4ZPVR 1VQ7S 4QYRA 1RAIB 5KG0A 2GVZA 5L38A 2G2ZA 1HKAA 2JH3A 5DQGA 2CPIA 1ZYQA 3QIPA 5DQHA 4M5NA 2CWXA 1YTYA 1M5OC 3MM8B 4EBDA 1TL4A 1N5YA 4GKKF 3TUJC 2NS1B 3FBEA 1PJ6A 3EM1A 5B0BA 2DEIA 3C66A 4AXIA 4M95A 3T5LA 2NUHA 2JLFA 4X4NA 3CCVS 1U1RA 1MMNA 5KFEA 4J9SA 3A3PB 3RUBL 2UUCF 2MSTA 2P6SA 4U6PA 3M8YA 4Y2KA 1NJIT 1H2UX 2N4CA 3DXBA 2FJDB 2ZBCA 3DLGA 4NLPA 5CYMB 1ZZFA 3OL9A 1KTVA 4H54A 4I6WA 4RW9B 2ATLA 2I5JA 4OX8A 3CJ5A 4U7CA 1X5OA 4Q5VA 3CJSA 1HD1A 2MZSA 4K2XA 3KHGA 1WEZA 4RNMA 3DNCA 2DBBA 3PW4A 4KE5A 1YJ9S 1NK8A 3A13A 2FHMA 2RVJA 3RBZA 1WG5A 4M5LA 4PXEA 1LW0A 4CLTA 2JFDA 2LQ5A 2DKOB 4OZ5A 1XQIA 4IFVA 3OTDA 4GKKJ 4NZ0A 3ZC4A 2IIHA 5DDOC 1N4LA 2IVMA 2DXFA 2ZBQA 4XPCA 2C2NA 2W2NP 5E3RA 2HAFA 1H7XA 2CQ0A 2ZJQQ 2UUCJ 3MEGB 4KYZA 3JAMY 1URNA 1NKBA 1BUXA 2HGNA 5BYSA 3CCJS 2E1RA 4H4OA 1RP5A 3QSIA 1HARA 2BANA 2QIFA 3LTOA 3MPUB 2DTJA 2A3JA 4A46A 2K7JA 5DG9A 2PN6A 1U1OA 2B0GA 2BRKA 4DL7A 2E5IA 2FGOA 1QY7A 4P2FA 2M8DB 3D1QA 3ZTOA 3D2WA 2IY5B 3NXZA 4DQPA 3H8YA 3N9UC 2CPZA 2QX0A 1UJ6A 4JI0F 4WP8A 2LP4A 2ILYA 2MHEA 1Z1ZA 2G1HA 2JX2A 3D1HA 3NWGA 2RF2B 3ZNUA 1HHQA 3MEKA 4NWBA 2MKYA 3MTJA 1OO0B 1SCJB 2KM8B 2FB0A 5I3UB 1U7LA 2DGOA 1R8HA 3I0RB 3MM7A 3VGVA 4NEZA 1RT2A 3RGIA 3KK2B 5ETOA 2PC6A 1ZPVA 3MXHP 3HO1A 2KN4A 2CXEA 4DOZA 1XERA 1VJWA 1WWHA 4X4VA 2V2KA 3MMBB 3CGIA 3TZWA 2V63A 3HD1A 2M3DA 3ET6A 5F8JA 5KTQA 1HQEB 2YKMB 4USIA 2F8EX 1IBCB 2CJ9A 3GJRB 1GMUA 1UCNA 3D68A 1FEEA 4F4ZA 2DRAA 3MM9A 1YQHA 3M6XA 3BJYA 1YI2S 2GQ2A 1FWKA 5KFDA 5F0WA 2OIHA 5CD4H 3BGUA 1TVRA 3BQ0A 4RZRA 3OV7A 4YHHJ 1LOUA 1S77D 1S0MA 5FIIA 3ELHA 1WDDA 3C2PA 4DV3J 5AE1A 2HQCA 4AE5A 2RIJA 5EHHA 4TY8A 3HP6A 3JAMU 3CJ8A 3DRPB 2F8MA 2R9LA 3SQOP 3CC2S 3MTKA 2DY1A 3H4BA 2V9KA 4KAIA 2V8HA 1UVKA 2K1RA 1M1KT 1REVA 2HHHF 3J7YU 2X51A 3QZ8A 5KFNA 2J0WA 2QLFB 4ECVA 1RWXB 2RHQB 2H5EA 1QE1B 3D3CJ 1K0TA 2OFGX 3M1VA 1TZ0A 3R5JB 3FBCA 1VOMA 2AP6A 1D0EA 1X4GA 4ID5A 5BYRA 2BM0A 2M52A 2O5DA 2Y1JA 1HFEL 3QT6A 4S0MA 2VC0A 1TL7B 4KRWA 1UZHA 4NLYA 2HFNA 1JLQA 1AZSA 2XS5A 2IRYA 4C98A 4K7QA 2Y8YA 1Q82T 5GADU 2ZKUA 4CO3A 4Q0BB 3OTBA 1H0HB 3CJRA 1SC6A 4J37A 2G2OA 1QTMA 4XTTA 1P1TA 2DH8A 4DL0C 2JEFA 1RAFB 2L41A 1I3OB 4LQ3A 4RLEA 2H5JB 1DLOB 2EG2A 1VQ8S 5B0CA 4JOUA 5D77A 2ZH3A 2VFRA 3QJPA 2HHHJ 1XIQA 4C97A 1DBDA 2P9CA 4OZ2A 4O3NA 4OYIA 3Q83A 4LIWA 3LW5C 1TU0B 3H20A 5L1LA 2QLWA 3T9NA 1RT1A 4QBUA 2OEJA 3GLJA 1RABB 1RXOB 7FDRA 4GMKA 3M8PB 2IAJA 2Q6BA 3OLBA 5F0UA 2RUGA 4DV6F 2FHJA 3I5BA 3BBCA 4DX8H 2HNZA 1IUJA 1GQEA 3KLVA 3LP1B 4DR5F 2WOMA 4LSLA 3G9CA 2VQFF 4NLGA 1VIXA 4K5RA 5C25B 2QLBB 1JLGA 1GXTA 1RT4B 3PVXA 1FFGB 4USKA 2BMBA 5CYQB 2KU7A 1SI9A 4X66F 3UI3A 2E5HA 5J1EA 1X9MA 1D8ZA 1X60A 2ZH1A 1RWPB 1HQUA 1LWFA 3V2UC 3TZZA 2YVSA 2ZH9A 2RHSB 4OI6A 3B54A 4O3RA 2P6TA 4ECWA 4NXNJ 1SC3B 2YNFA 2GNKA 2QGFB 3DM2A 2FTRA 2HQ3A 1R3NA 4DV6J 1RBLA 5HVFA 1SL1A 3PIPQ 1KVJA 4DEZA 4L72B 3BO2A 4ANEA 2HIQA 2PE8A 3TA0A 1ACMB 3JSRA 4RW7A 3AY0A 3UVJB 4QPXA 4GKJF 1L3KA 3LUYA 4DG1A 4DV4J 3PO4A 3IBFB 1BQNA 2N7YA 3HX9A 2GMLA 1Q78A 4ED3A 3IGVA 4DR5J 3BO3A 1PGZA 2N82B 2VUGA 2VQFJ 3NBPB 4IOAQ 1P1LA 5L9NA 1MN7A 1RWMB 4B3MJ 4DL5A 2VQEF 2RU9A 4DZDA 3UNYA 4OHYA 8RUCA 3HULA 3BSOA 4PG4A 2VFVA 2R8KA 1RTJB 3SSRA 4Q44A 2CPDA 2V5HG 4C6AA 2E29A 4I7FB 2LU2A 1Q4RA 4CIOA 4LFAF 2DR9A 5DGBA 2RE1A 4CH0S 3N6LA 2ZHAA 4U96A 3VQSA 4R8UA 1HLWA 2YWFA 1F5BA 4ZS6A 4M5DA 5DS7A 4W92B 4NCGB 2KL8A 3R2DJ 4Q2LA 2D1CA 3KLEB 1TP7A 2BJ9A 1K1QA 2Y0SD 3W2VB 4GKJJ 4OJGA 1ZZNA 1S76D 2LXFA 1T9TA 1PAUB 1JJ2R 4WKRA 1PYTA 4NZ6A 4ZHRB 3KG4A 2LECA 4DPUA 1NBEB 4LRDA 1S97A 1CSJA 3PV8A 3V4MA 5DG8A 3NGKA 3WZ0A 1FI4A 2QTWA 3J7YI 3PIOQ 2BBEA 2AZ3A 3PZPA 4MFBA 3ENAA 1KRPA 4NCBA 3SQGB 3BPDA 5C24B 3FMWA 4I6YA 3AXKA 4USJC 3OXLA 2IA6A 4M1KA 1U4BA 3CJQA 3BGLA 1U2FA 2ZH8A 3C16B 5ETNA 1AB8A 3KG0A 2J8AA 4FYYB 4JI1F 1CC7A 3MAAA 3SDEA 4ECRA 3HJVA 5DM6Q 3DLBA 2VJVA 3GFXA 2DVIA 5IQQA 3RR8A 5L46A 1HI1A 2W9BA 3G6XA 4NA3A 3BF4A 3F44A 3QNWB 3DLKB 3NS7B 3HLUA 3A4TA 2A2DA 1LNQA 1SC4B 3G96A 1LWXA 4USTA 2Y0BB 1S49A 2XMAA 1NEEA 2PA8D 2AJ4A 3N0VA 1IBKJ 3RBXA 4IG0A 2DH9A 2DNGA 2CJYB 4BCAA 4ES1A 4ZLLA 1H98A 5D4OA 2DGQA 1FRMA 2ALYB 3ILIA 5B0EA 2Y1LB 4DL2A 1JJ4A 1RTDA 3A8JA 2XMUA 3HCXA 5HP1B 2YKNA 2VD3A 4WIQA 1RJJA 1FWLA 1CC8A 2FZGB 5GMEA 1IWGA 5JVGQ 4NA1A 2IMOA 1LW2B 1VRTA 5RUBA 3E2EA 3QRPA 5EWEA 4FYDA 1UVLA 5KFPA 2QMUB 2XMTA 4Y00A 4J9MA 1KOHA 2Y1IA 4A8QA 4PG8A 1HNZF 2PEBA 5AXNA 3RBDA 2CPJA 3JS9A 4BWJA 3U1LA 2DO4A 4I69A 2VDIA 2GGPA 3A1YG 1W26A 5B08A 3WIVA 2OKQA 2XY7A 5JXSA 5D0RA 1Y4ZB 2D3UA 3HHLC 4DR3F 5IC6B 1C0TB 5KG2A 3KOAA 3W5XA 2M0GB 3MCSA 2LYVA 1FD2A 2VIHA 1VR6A 2ZZNA 1NK7A 5B09A 3M8SA 1PIEA 3TRGA 1OSDA 3D9BA 1JLAB 2BJ1A 4LF8F 1FKPA 4BHQA 1IR0A 4KH1B 4F7VA 1Q7LB 2X1AA 4K50A 1RAEB 3CD7A 2F3JA 3M6UA 1PC5A 1QAIA 3TI0A 3US5A 2ZUAA 2XULA 3ITHA 2J6SA 1WTFA 2JC1A 1XTZA 2ZDOA 1JLCB 1Q1KA 4OFZA 2PO4A 2WW8A 1HNWJ 4PWDB 4QW8A 1HNZJ 1S1XA 2ZZMA 2QFIA 2FQQB 2JVOA 1QAJA 5H9FK 3PHTA 4J9UE 2UV8G 3T1HF 2OPPB 4PRFA 3H98A 2R7QA 5KG4A 3DOKA 5FDLA 5KFWA 2WSCC 4F50A 4DR3J 3E01A 1JIHA 4OHVA 1P27B 4O4GB 2L9WA 2AYBA 5IXUA 2KT5A 3VVUA 3BKTA 3T1YF 1KD1T 3NGDA 4FXDA 2GC8A 3CC7S 2RU3A 4F2RA 2ZWPA 1UA1A 3FRYA 4LF8J 2NPFA 3KKFA 2ZBIA 4FDFA 2A10A 3I9ZA 1SKSA 3G82A 1T9UA 2GQCA 3NNCA 2GJFA 2PMHA 3THVA 2HFOA 2XZDB 4Q7AA 4Q45A 3LA0A 3I55S 3QJJA 2R7OA 4X4OA 5C7PA 1MN9A 4RBVA 4ZPWR 2RSQA 1VQ6S 1XC9A 2C22A 2C2DA 1RT6A 2XI3A 4AUKA 1JJHA 4URQU 4XAKA 3QPIA 5JJBA 1BQMA 1VYAA 4LREA 4MYUA 4NMXA 1NSQA 2QSFA 4LF5F 5DLGA 2UZAA 3DLEA 3G8SA 3O44A 4PCQA 3TA1A 1K8AT 1RWWB 3RRKA 3DU5A 4OX9F 2P2CB 1HMVA 2HHUA 1X4AA 2CDRB 3MM6A 4RBUA 1NB2A 3JXOA 4KBIA 2NREA 1LEOA 4OJ3A 1QM9A 3MUVP 2OPQA 3T1YJ 2WCXA 3L9ZA 1EX8A 5GMKa 2IBKA 3TUIC 1N36F 3X3UA 4I2QA 2NUUG 3Q8UA 5IM0B 5JUMA 3GV8B 2OTJS 4ZVTB 1BD6A 4QJVA 2MYFA 4DFJA 2ROPA 2MXYA 4IFYA 1KR4A 4MIWA 4EYHB 2DNQA 2JOQA 1NXIA 1NSAA 4P2SA 2GVZB 1U45A 1S12A 2PIIA 2QL9B 2YQ3A 3G8TA 3QIPB 3U27A 4PZVA 1ROFA 2C28A 5SZTA 4MIBA 4LF5J 2Q3PA 2HPUA 2J5AA 5K8OA 4ILLA 2IYIA 2DR6A 4DQQA 4OX9J 2UU9F 2HLUA 3GFZA 3OSPA 4L74A 2D3ZA 4DX5A 4FP9A 4C8MA 3G6ES 1F3FA 5GAGI 3R5BA 4HEA9 2XEXA 3T6BA 3R6LB 2AEJA 2F63A 3DRYA 3CXCR 3L95X 2CAJA 3DLGB 1TUWA 2HHSA 2EXUA 3EMTA 3ONQA 3FSXA 2AQ4A 3IM8A 2L3MA 5HK4A 4ZLJA 5A8WB 2I5JB 4WTOB 1ZETA 2OD4A 1V6HA 2BE7D 5G0RA 3MD1A 1NPKA 4NYPA 4MK8A 3QATA 3GZ7A 4ZIVA 1RT5B 5GAHI 4HKQA 4K4XA 1VMBA 2M7SA 4QWDA 2IM1A 5KFJA 2MKSA 4Z7YA 4IFVB 3MM5A 3MEDB 2W4CA 5EX0A 4FBUA 4X4TA 5M2UA 4RUCA 3QSYB 2OUGA 1YJ7A 3OVSA 5KFVA 1OQ6A 1Q8LA 2WVCA 1MMLA 4ZOSA 4EZ9A 4DV1F 2G0CA 4UQGA 4DV2F 3BYPA 3TX8A 4NX9A 2ZHOA 2XZWA 7AT1B 1JJCB 3DOMA 2HRTA 2AYMA 3H5UA 4F3OA 2RRBA 4B9SA 2DNZA 4PPZA 3VWSA 2ZE2B 4LF7F 3M2RA 2PFDA 2B8PA 1X5SA 2HBRB 1SJ4P 1TUGB 1KLMB 2HWHA 2BACA 2H3EB 3W8PA 4CLUA 4L3NA 2R8IA 1E6VA 1IWAA 2FYXA 4KJIA 3QO9B 3M7VA 5T41A 4J9VA 2OPRA 2XWYA 3Q89A 2DNKA 4WP9A 3OHBA 1U2RA 3O2IA 4MMOA 4IUFA 1OPIA 2HS4A 3DMJA 3MDFA 1C2PA 5D78A 1HI0P 4EK2A 4DQSA 3BQ1A 2E9ZA 3OW2R 2M4MA 1PC4A 1NRKA 1ZTWA 2UUTA 4LSZB 2MSSA 5C42A 5LXYA 4RL1A 2F4VF 2YNGA 1CULA 3MM7B 5LMNF 1RT7A 1RT2B 3FNNA 5IT0A 3GFHA 1XR6A 4C11A 3P6YC 1OY8A 1U8WA 2EKYA 4DPTA 3TA2A 5KT5A 2DCLA 2K8GA 4K5SA 1D9FA 1FNMA 2J7UA 3PEJA 3QT8A 1H7WA 4ZPDA 2DRBA 4UUWA 2OFHX 4NXMJ 2ZH2A 2KKHA 3R7BB 5AT1B 2ERRA 3BBFA 1Y9OA 3K7RA 2OP5A 3H5SA 3DYAA 1QSSA 3CTRA 1WKJA 3MM9B 1DARA 1Q8KA 1U1LA 2PT0A 1X4CA 1WOSA 1EIYB 2OJ3A 4LR7A 2VPZB 4J9RA 4K0KJ 2W2MP 2XTJP 5DDPC 1IJEB 4JB8B 2HNDB 5A0YA 2NSCA 5H9EJ 3JTOA 1RU1A 3ZO7A 1BXNA 3CE8A 2C2MB 4A8YA 4TY8B 4QU7A 2AGOA 1VS3A 1RAOA 4K2JA 3BPSP 5LMNJ 1URRA 4UOCA 1NKEA 2AMCB 2CFXA 2K1RB 3HJFA 5D0EA 1YX2A 1REVB 2BJ8A 3W61A 2BA9A 2MQLA 3OPKA 4DSLA 2PD1A 4LFBF 3K17A 4Y65A 3J7Z5 1T8EA 2ZC4A 3UCGA 2D74B 4U9RA 2WONA 1EQ0A 2X7IA 4ED1A 2YWEA 2R8JA 3K5NA 1YLXA 2DT9A 5MLCV 4ID5B 4EEYA 4C7QA 2BUNA 4DSJA 1EKRA 3RAQA 3JSYA 3QRQA 4C3LA 4OX6A 3MMCA 4ER8A 2QO3A 1SH0A 1S9GA 1JLQB 1RHQB 1AZSB 3V4IA 2H4YB 3QJLA 1S0NA 2LA6A 3AOCA 2I0XA 4DL6A 4WFXA 3CJKA 4DL4A 3G6YA 3ULHA 4M5MA 3IO1A 1KQSR 1IKWA 1FA0A 1FERA 3V6DA 3G4SS 3AA8A 1WEYA 4YDDB 4WZQA 2HBYB 3GYGA 3CCRS 1UFWA 2ZH7A 3MOZA 3FEZA 3LPEA 1LKZA 1R0BG 3MMAA 1RACB 3JSMA 3P8BB 4O44A 4N76A 5KT2A 2IHR1 2OAUA 4DV0F 3GFYA 1N52B 2GCFA 3UDCA 2F7VA 2DD8S 1WKLA 2FY8A 1DJ0A 1QSYA 3SCJE 5AJ3J 4WXOA 2I2YA 1UA0A 3G8QA 3W2WA 4I56A 2FJAB 3IFEA 3CO0P 2G13A 2HHVA 3A8EA 3W63A 2IAJB 3K5LA 2F65A 1GH8A 3Q2TC 1S4FA 2VB6A 3EX7B 2D7SA 4FNHA 4X4SA 2GIFA 2R8HA 3PX4A 1WSRA 4OI4A 3QLHA 4O23A 3CUNA 4A8MP 3G86A 4HHHA 2ALZA 1HR0J 1VBZA 3DRSA 2WOMB 3IBWA 1SB6A 4J91A 3QAUA 1TV6B 1OIAA 1JLGB 5KG7A 3JYTA 1IKXA 3SI8A 4NLVA 1NJXA 2V9WA 1EJ7L 4M5GA 2XBPA 2CQHA 2C3MA 2XNQA 2Z30B 1RAHB 4YR3A 2ZZTA 3SXLA 1RWVB 4ZN1A 5J2MA 1NJWA 4DV0J 3LP0A 2LVWA 2WHOA 2BKPA 4WTYA 1HQUB 1RHMB 3A3NB 5DQIA 1K9MT 1YZ7A 1U47A 1M5HA 1NDLA 5GMDA 2QT7A 3KUGA 5HAOA 3N6MA 1D9AA 1UKUA 1HYSB 3MEEB 2KT3A 2YNFB 2CJAA 4MK7A 2FPHX 1D09B 1HBOA 4YB5A 1FESA 4A8WA 4ZP8A 1VQMS 3EGNA 2O66A 4OI3A 4EO6A 3TQ1A 4DG1B 3T5HA 3E3XA 4YEAA 5EDWA 1BQNB 2AGPA 4FF3A 2GQQA 1HWKA 1SBRA 2UXCF 2E1AA 2GA7A 2X3GA 1N6QA 1N34J 2JWNA 3A8KA 3BGOP 2OD6A 1T3NA 1JWWA 2PDAA 2BE9B 2VOPA 1FRXA 2XCPA 4TU8A 2YNIA 1WHVA 1C0UA 3TO8A 4DR1F 3G6VA 3KMSA 3OSNA 3KHRA 1RWKB 1WI6A 4B9UA 1FTRA 1N56A 3BH6B 2NPIA 5SUHA 4DUTA 2E7VA 1S6PA 1Q8BA 2Y9HA 3KJNB 3DCAA 2E1PA 1Q5VA 1TAQA 3MECA 1D1UA 4KPCA 1M1HA 2QEXS 4M5DB 3NS6A 2QV6A 4LR8A 3KLIA 4V19X 2J8SA 2H5IB 3D4JA 5I42A 2A0FB 2NZ4A 2RDJA 4QOTA 4OI1A 4DLGA 1DURA 4FBTA 4C3MA 3PW7A 3W65A 1VGYA 5FLXY 2UXCJ 4NYZA 4UTGA 2CQPA 2VF3A 2RAQA 2MY7A 3BQ2A 3G87A 3M8QA 2CNOB 5J2PA 3GCXP 3PHEA 1VQNS 1VJQA 1TL3A 3MPDA 3D66A 4C8ZA 2WB1D 4C2MA 3OTOF 1HPZB 4MFBB 2IC3A 4RUAA 3KG1A 4IDKA 3U1MA 4DR1J 2B8QA 4A8XA 1FNOA 2D3O1 1ZPWX 5BYQA 2Q43A 1AXQA 1KS2A 1NH7A 4LF4J 1EAYC 3FKBA 5G4DA 3RB6A 5A8KA 3AA9A 5ETRA 2HVEA 3HVTA 2HHXA 5DETA 4ETZA 2O67A 1F5CA 2HW3A 3QGHA 2XY5A 3AJ2A 3MAAB 3CPWR 3UD3P 4EO8A 1DHMA 2L08A 2RKIA 4E8UA 2DNNA 5HMYA 3VZIA 5EGYA 3KUEA 1LFPA 3GQCA 2W9BB 1NDKA 4B02A 2MKHA 1R7IA 5ETTA 2B51A 2CPFA 5KT4A 1ELOA 3GE9A 1OYEA 4F04B 1TKZA 2XHWA 2BOAA 3THPA 1IBLF 4RW8A 5L39A 2CVEA 1TL5A 4LF2A 3NY0A 3C3LA 3DGPB 3ENWA 1BHNA 1HI8A 3VCDA 2QRRA 4JUZA 2YX1A 1RTDB 3HSDA 3ETMA 3CCES 2YKNB 4QYZJ 4JYAF 3RBEA 1AUSL 1JMTA 2MTLA 3CWJA 3FC9A 5ETMA 1YITS 1BWVA 2WSEC 4TQSA 5ITHA 1GXLA 1VCTA 4C8LA 5CABA 3ZZZA 3BEGB 3JTNA 4ZVSB 4K4UA 2KXHA 1CLFA 1X31C 3I96A 4KFBB 1CJUB 1ZAVA 1TK8A 1LV5A 3MR5A 2AX1A 5F9NA 4F3MA 2DHGA 4Y2AA 3R5CA 2GGPB 1N33F 2IFXA 4NYOA 1VQ9S 5B0AA 3SCLE 1JB0C 2XYHB 1NUEA 4DPWA 2BQUA 1W2IA 2OI2A 2MZRA 4LSNA 1S59A 1FCAA 1T95A 1GXUA 5CCLA 1RAAB 3OFGA 3T41A 1G2EA 3L4BC 1KN6A 4RW4A 2VU5A 5IV4A 2MZJA 1WHXA 1MW7A 2CA9A 1WC3A 4AL5A 1DTTA 1FRHA 1KDNA 2HEKA 2IDLA 2VBWA 3QZ7A 1FKPB 1VRUA 3CCMS 1HIYA 2DGVA 1FKOA 1BGXT 4F4AA 5B0DA 3OXGA 3R6GB 4HR2A 4QCLA 1FKAF 2RRNA 3NOGA 5CQGA 1F6TA 5ETQA 5LM7E 1DQAA 4WYWA 3C8YA 3PNIA 5BR8F 4LMZA 1X9SA 3ITHB 2B5JA 2W2PP 4GO5X 2XM3A 2AHOB 1SUQA 5LXRA 1C4CA 4C4WA 1FHTA 5D3GB 1M1GA 3MF5A 3OL7A 2XCAA 2CWKA 3PFOA 4LBPA 4K4TA 2EEYA 1U0SA 1T3OA 4QR0A 2EI5A 1S1XB 4TVAB 3GP9A 2BV3A 5IWAJ 2HQDA 4P73A 5DO2A 3NMAA 1D9DA 1R8AA 2ZEJA 3BZQA 2DRDA 1N33J 2C3OA 2YKPA 4UUXA 3DOKB 5FDLB 3E01B 1L3TA 5LJ3Y 3EDQB 1VQ5S 5ETSA 2VICA 2IJRA 4IQXA 2DXDA 5KFHA 3M6WA 2KZMA 1B64A 3KLHA 2OPSA 1U48A 3BS9A 3CCWA 2QSWA 5F41A 2ILZA 1U6BA 3OFFA 4HT5A 1JKHA 1SH3A 1RI7A 3HDSA 4LBHA 2B7BB 1CBKA 1TK0A 3AH6A 1TK5A 1TKTB 4F4YA 1RE1B 1XK8A 2V4JA 3DOLB 3O8WA 2U2FA 1AYEA 3FZBA 4TU7A 4ZVRB 4YP3A 3G82B 4WFZA 3R27A 4C0BA 1HWIA 2JDJA 2E9RX 3NAHA 1M5PC 1FK9A 3AT1B 2YWGA 1LWCB 4KQZA 4ZMMA 2R7SA 3M2UA 3QRRA 5A6WA 4PAAA 5DG7A 1N5TA 1PG5B 3K8WA 2MQOA 2W8LA 5KFKA 2W4PA 1TKXA 1K0VA 2UUBJ 1PYOB 3B4MA 4R0JA 2EFVA 1T94A 3DLEB 3PO5A 4ECTA 1S9EA 1HMVB 3HHKA 1UVNA 3MM6B 2VL1A 1S6QA 3GV5B 3RTVA 4O4RA 4RKUC 1OQ3A 4CZCA 5J1NA 2XMJA 2KFYA 2DNRA 3GV7B 4GVBB 4DR2F 1TKDA 3L7OA 2YH0A 3HSJA 4Y2MA 4O3PA 1HWUA 4F0HA 2XHCA 2MLZA 4TNOA 1G1XA 4XDDA 1XBWA 3UW1A 2H54B 5LT5A 2VG6B 3GONA 2CZ4A 4G1PA 4IFYB 1S1UA 3J81Y 4V1Ak 4O0IA 1F3VA 2MJUA 3KHLA 1VFJA 2PGCA 3PR4A 1AW0A 4DLEA 2LLZA 1B0TA 1RBOB 4AXJA 5IV3A 4FF4A 3QGGA 1TUVA 4M5IA 4OV1A 1KWMA 1JXEA 3C19A 3EVOA 1Y3JA 1GX5A 3M6VA 1YDLA 1T05A 2KRBA 4YB7A 2O01C 1IN0A 4EGLA 2EW9A 4QWEA 5KFIA 1SIWB 5F8HA 1IBMF 2XY6A 4K4YA 4OHWA 3EZ5A 1B7YB 4XO0A 3EXCX 5F8MA 3M9NB 3TJAA 4DR2J 3OQ2A 5THWA 3SV4A 3A3OB 3NNHA 3MM8A 3EICA 5C2CA 1M5KC 4C0OC 2KFZA 1I51B 3D6MB 4USUA 3K5MA 4HDHA 3MR6A 2J0XA 2N3OA 3MAHA 3UDLA 1R31A 3OBIA 3HVRA 4B9MA 2RILA 4NL5A 1Q81T 2WVDA 4Y2IA 5G0RB 4IRDA 2HS0A 1N5QA 3HKWA 1Y3KA 4NASA 4ES2A 3BREA 4AQYF 2YBVA 3CDEA 4KGXB 3EZUA 1NMEB 4LR9A 1WDTA 4PQUA 3C14A 3FK4A 5CZVA 3H2VE 4KSEB 3MM5B 4CO5A 4RW9A 2JFKA 4Q43A 4E98A 5KAKA 2JRSA 5KFBA 1IBMJ 2ZM6F 2FZKB 1A9NB 1R8PA 3CJTA 2X3DA 1RDRA 5CZXA 2DGSA 2IRUA 2YXLA 2MLYA 3LAMA 5CH7B 2JHEA 1ZBTA 5KG5A 1JX4A 3JQMA 3NCPA 3M2RB 3GYNA 3PYDA 2HFZA 4V19J 3J81U 2F9JA 3CIMA 3KJQB 5H9EK 1SQFA 4QWCA 3MMJA 1Z2ZA 3S01A 1HNXF 3WQPA 3UN5A 1PKUA 4NLOA 1VHFA 4LJMA 3NOCA 1GT8A 2OPRB 4PG7A 4RNFA 4TYAA 4AQYJ 4OYOA 4JI7F 5J2QA 3QWPA 4YY3F 2BJDA 2VASA 3DMJB 3LH2S 1WC0A 2GVDA 3N5BA 2HGMA 3RB0A 5L1KA 2VFUA 3RW7A 2ZWOA 5DLFA 1L3VA 1ICEB 5K9FA 2G4BA 4QU6A 1RTHA 2VA2A 4DFMA 1HNIA 1T03B 1N32J 4F25A 4DFPA 1VC5A 2YNGB 1CULB 1IVZA 5IS2A 4FYWB 3SEOA 3LGNA 2J7WA 4NLXA 1R43A 3QT7A 4YR2A 4I0WA 3GR0A 5L8RC 4OZLA 2R7RA 3ISNC 3PCOB 1T9VA 3K59A 1N48A 5H1SV 3HFKA 4DS5A 2BXJA 4M8LA 4WKYA 4F36A 2C3YA 2WB4A 2Z8QA 5L9XA 4DL3A 5I3UA 4A48A 2FGCA 2R3VA 2LQJA 3DYAB 1RU2A 1TAUA 3M4XA 4OZNA 5CXTA 1DTQA 3PW2A 3KK2A 1RT3B 1X5TA 1NH8A 5HJXA 4A4JA 3B6BA 4MTPA 1JLFA 3H40A 1P8GA 1SVDA 4JI7J 4YY3J 5HBMA 2NXEA 3HF5A 2KM8C 3MZIA 3CCTA 4HL9A 4BBYA 1GAOA 4FVCA 4J9NA 1QTNB 4I4BA 3EVMA 1OY6A 4ZVEA 3DLJA 1HQEA 2YKMA 4NLUA 2PMZD 4MK9A 4IRCA 4J9PA 4YR0A 3ENVA 2VKRA 2XMWA 2FJWA 5T7LB 3Q8QB 1X4HA 2EC2A 3L09A 2BJ7A 2CVIA 4ENOA 3C46A 3HZGA 3O6QA 4WU2A 3TAPA 1JNZB 5D0GA 5AXLA 2HSEB 2B4OA 2GFFA 3DHWC 3FFIA 2WONB 1REGX 4JP8A 3M30B 3TZXA 1J2VA 3R5GA 2DIVA 3H5YA 3DFEA 1XJWB 2QN6B 2N7CA 3OUYA 4ELUA 1QVGR 3V4IB 2G9OA 1GTHA 4IR9A 1X0FA 2CQIA 5KFLA 3MPVA 2Q66A 4OLOA 2HVDA 4DXLA 1IKWB 2AWZA 2P5VA 3D7SB 3V6DB 3OVBA 4LF1A 3CCZA 4M5HA 1SJFA 3BO4A 3BBBA 3V6JA 5A2QY 2E5LF 3GG0A 4D3HA 2DNYA 2RMLA 3BGRA 1SXLA 1TL7A 1EKSA 3MAQA 2AW0A 4QWBA 1OYDA 2XQCA 1S0VA 3KK3A 1XN9A 1SJRA 1QD1A 4O44B 2KJVA 1WC4A 3A12A 2EBGA 2LEAA 1U1NA 1UW9A 3DGVA 4ZVOB 1VQYA 2C2EA 2FJXA 4DS4A 2HNYA 5I3PA 2ZFHA 4Q0BA 4DR7F 3Q24A 3W2WB 1T02A 2CNLB 3TEGA 2V4RA 1YKWA 4IR1A 3D5MA 2GAHC 3TVYA 4P2XA 2XI2A 1UL3A 3VAKA 5B0GA 2IPOB 4RUBA 5F8IA 5KFQA 2VG5A 2VHGA 1FFSB 1SJQA 2OO4A 2DJWA 1G7CB 3CDBA 1F5AA 1HA1A 1FVQA 3MGJA 4X4QA 2YWHA 3DN9A 4LBIA 3IBCB 4DSIA 2BW2A 4JI0J 2FLLA 1ZA2B 3PKMA 3DRSB 5I4MA 4CLWA 4U8VA 3NCQA 3HZEA 4FN5A 1SJ3P 4LQ9A 1ZTTA 1X4EA 6AT1B 3JYTB 1IKXB 4YB1P 3CEDA 1WG1A 2XGPA 4ZVUB 3W9JA 2WZ1A 4L73A 1EETB 4ZJOA 5J2MB 1UP1A 1AUDA 1S1VA 3LP0B 4HLBA 3L7UA 1SV5B 1WTBA 1KQGB 1RAJA 2Z2MA 3N01A 1AT1B 2BVZA 2FIUA 1HBUB 4WFBQ 2KRRA 1PAEX 3N6NA 1NK9A 1ZM2A 3D0GE 3QBCA 3P45B 2H65B 3I0SB 9RUBA 1HBOB 3OVAA 3WHIA 2W1BA 4FPRA 4DX7A 2EKNA 4M94A 1UWAA 2HHTA 4ED7A 3R5DA 3AQOA 2DR8A 1XMBA 4NI2A 5IT9Y 5A2QU 3CIZA 2K7KA 4KPYA 5HANA 2NXNA 4CM0A 3DI6A 4OYXA 2WAQD 3CT9A 3VF0B 4B3OB 2YKOA 2UXBF 4CLFA 3RYLA 3TVZA 3UVJA 1C0UB 1BMQB 4Y0FA 2CNKB 4JV5F 4G1IA 2V0NA 3FRZA 3LPYA 4KIAA 4LRBA 2ZVSA 3L7PA 4NLSA 2ZDPA 1S6PB 3NBPA 3FVYA 1IM4A 1L3SA 2ZNZA 3MECB 5HROB 1HBMA 2FLOA 1SPBP 3NP5A 4L6V3 4F26A 2NLWA 3KLIB 1UEVA 2I9SA 2W25A 5I42B 2DNOA 2E1MC 2E5JA 2H48B 3O1LA 2VONA 3NCRA 1RTJA 1UVIA 2JL9A 3I5CA 4B3RF 2JEIA 2JSXA 3QIDA 3RZAA 4CQ1A 5KFYA 1YHQS 4O0NA 3CD0A 4DFKA 4DZ6A 4OQJA 1PBAA 2YNHB 4TLQA 2NXJA 3HXMA 3M8QB 5J2PB 4Y6IA 2HURA 2AZ1A 1FTCA 3KDOA 3SFUA 2CUYA 1S10A 1TFYA 1NHKL 2ZKTA 5DDRC 3KLEA 2CJQA 4TXSA 4IDKB 1U1MA 4JV5J 1T9WA 4DPOA 2HLTA 3NMRA 4DWIA 4IOBA 1L5UA 3H42A 4HI2A 1RTZA 3LP2B 2ATCB 1QDUB 4ZHRA 5A8KB 1MMDA 2LDIA 2HHQA 4MT1A 4F4WA 4CYUA 3PJWA 4OHZA 1IXKA 4NLWA 2OH2A 3Q22A 3F73A 3AOAA 2RKIB 4ZIWA 5K14B 2JVRA 1Y5NB 1SL0A 5IT9U 3JTPA 2FUG9 2MZTA 1KHWA 2GMJA 1ZM9A 2OEMA 1RSCA 2B9XA 3D6TB 3N28A 1O8BA 5HL7Q 4ED4A 4PUOB 3W7BA 2H1YA 1VIOA 2OMOA 5LOQA 3FBBA 1TKZB 1R6YA 2HFVA 1F9HA 3CD5A 1FDBA 2D69A 1CJKA 2BRLA 4RW8B 2CJBA 5L1IA 4CLLA 1KTQA 2KVIA 4WXWA 2ZBRA 1VQKS 2RDDA 2CQ3A 3EGWB 4USHA 4HH0A 3W9HA 4N7TA 2IM2A 1FJEB 5A8RA 1QVFR 3DLKA 2JEJA 1MU2B 4X66J 4UOHA 1O0PA 2I1RA 1VK8A 3WBZA 4R5PA 3FQLA 1S79A 1NZAA 4DV7F 2XB2D 1FE0A 3I56S 2V2VA 3MI7X 1BWEA 3TR5A 2PEHA 2EC0A 2FLNA 3PG9A 2HG4A 3CJ2A 4CWBA 2JC0A 1FJGF 1UAWA 4C48A 4ED8A 1UWBA 2VKZG 2QL5B 2KG0A 4WK1A 1S6OA 4CNZA 2MY8A 2J7KA 1C1CA 3H0PA 3SMZA 4UF4A 2YPZA 2KZZA 3GIJA 1LXJA 1EQMA 4ALZA 4QR2A 4OI0A 1HBNB 3CDWA 3I87A 3QWUA 2YWKA 4J9QA 2QE5A 3V81A 4P74A 5L1JA 4RW4B 1Q79A 2FJEB 3RRHA 2F9DA 1NKCA 2VQEJ 2J6UA 4PEOA 5D0HA 4RW6B 4WPAA 1LK5A 3EXYA 3GG1A 3FSYA 2ZOGA 2VA3A 3UPFA 4DV7J 1FKOB 4F02A 1GNKA 3CO9A 3Q8SB 1JLBB 1GK8A 5E5NA 2D9PA 1D8YA 4ED5A 3CF5Q 5IQ6A 2OLWA 3ZFVA 4LFAJ 2B5JB 4Q8EA 4KO0B 1FE4A 2FHJD 2X1BA 2ACMA 3KNGA 1P9QC 4CTAA 3EUNA 5K20B 1PJ5A 4KTQA 1DY3A 5ETVA 1SKRA 4CP5A 1VI7A 1EP4A 4OL8A 1JLAA 1B0PA 3VGUA 2I6WA 1R8CA 3W62A 3VAJA 4ZA1A 3M9OB 3H2LA 4N8NA 1RHKB 3SCKE 2R7TA 4NRUA 2XS7A 2UVRA 3Q23A 2EFQA 4HACB 4KGZB 2E44A 4JV1A 4KKOB 3UFCX 1UJ5A 3HSGA 3RJMB 2X1FA 4IO9Q 2QZ8A 5KOXA 2OPSB 1PBUA 4JI6F 1JLCA 2V50A 4PWDA 3KNAA 2NXUA 2G0JA 4LUBA 1MSWD 3KJFB 3R1LA 5GAGU 3CCUS 3X1LB 4CH7A 2V4JB 5GAEI 3OR1A 4OZ3A 2VC1A 3ZZUA 4O4GA 2YTCA 4ED0A 8AT1B 1FFWB 2XC9A 4ICLB 4WJBA 4J9OA 2KDOA 4P7VA 1MNEA 5HO4A 4B3TF 1NJZA 1CJTB 3VAMA 1R6VA 1QLNA 1H38A 4JI1J 4ZCLA 4LT6A 1S5ZA 4HH1A 3KHHA 5LMUF 5IFMA 1B3TA 1JLEB 3SZ2A 3MR7A 4D3GA 2ZITA 2Q79A 4IQMA 3I6PA 3NWRA 4K4VA 2MKKA 3HHLA 1FVSA 5GAHU 1RADB 2AKWB 2ASLA 2DISA 4ZVQB 4H4MA 4WE1A 4ECQA 2XLJA 4K4SA 2J6TA 4KR0B 2BM1A 2HGLA 2V34A 2QJ3A
chains in the Genus database with same CATH topology
2PA3A 4C98A 1RYSA 4OIXA 4YMEA 1B0VA 3HVTA 2HHXA 5KT6A 1Q82T 2BE2B 5DETA 4ETZA 2O67A 1F5CA 2HW3A 5I3QA 5GADU 3QGHA 2ZKUA 4CO3A 4Q0BB 3OTBA 3EGZA 2XY5A 4ZP6A 3AJ2A 2NQPA 1H0HB 3CPWR 1SC6A 4ZVGA 4J37A 3UD3P 4EO8A 3IR6B 2BR0A 5CYMA 1DHMA 2L08A 4O3QA 2RKIA 4I68A 1Y7PA 3DRRA 1QTMA 4E8UA 5IT4A 1P1TA 1YRXA 4OX7A 2DNNA 2DH8A 2YY3A 1MWZA 4DL0C 5HMYA 2JEFA 2KJWA 3VZIA 4HT7A 1KEKA 5EGYA 1RT3A 2L41A 5LJ5Y 2J0SD 4LQ3A 3UQSA 3BN7A 2P9EA 4RLEA 1LFPA 1DLOB 2EG2A 3QYYA 3K58A 1VQ8S 3GQCA 5D4LA 5B0CA 4JOUA 2W9BB 3RU0A 3MURP 1U1QA 2XS2A 2HS3A 2HWIA 2DHAA 5D77A 4B02A 2ZH3A 2IJNA 2MKHA 2VFRA 1L3UA 4NPOA 1R7IA 3QJPA 4C8NA 2IVFB 2DPJA 1S1UB 4C97A 1DBDA 1APSA 2B51A 5F8NA 2CPFA 2P9CA 5KT4A 1ELOA 4O3NA 5IZHA 1QUVA 3GE9A 4LIWA 3LW5C 2LQ9A 4E0DA 2L48A 2B43A 3ETOA 4DHVA 3KYLA 3H20A 5E3AA 5L1LA 1TKZA 1N5SA 2XHWA 3NS5A 2QLWA 3T9NA 4XK8C 2BDPA 2P9GA 4F3QA 4DMZA 1RT1A 2ASYA 1KONA 2ZJPQ 4NLDA 3THPA 1IBLF 4RW8A 1NK6A 5L39A 2QMXA 4QU7A 2CVEA 3BR9A 4QBUA 1TL5A 4XDCA 5CYJA 4ATNA 2MB0B 1U25A 1FDNA 5T7LA 7FDRA 4GMKA 2EVZA 3M8PB 5B0FA 1YRTA 2EG1A 2IAJA 2Q6BA 3C3LA 5F3ZA 3ENWA 1T05B 1FDAA 1R89A 4YUDA 3OLBA 1HI8A 4NLTA 3VCDA 5F0UA 2FJBB 2QRRA 4JUZA 2RUGA 2YX1A 2LEBA 3DDNA 1RTDB 4DV6F 3V6HA 3E8OA 4ZDNA 3POTB 2FHJA 2FVQA 3CCES 3I5BA 3NL0A 4FS1A 2LU1A 1TR0A 2YKNB 2HMIA 2BOPA 4QYZJ 2FDNA 4QPTA 4JYAF 3RBEA 4DX8H 4DN0A 2HNZA 4G1QA 1E6VB 1KFDA 1JMTA 2GMHA 3I32A 3HK2A 2EBEA 3CD6S 4YDXA 3CWJA 3MEGA 4O3SA 2ACYA 1IUJA 1GQEA 4OHXA 1YITS 2WSEC 3KLVA 3AHPA 3LP1B 3I82A 5AJ3F 4TQSA 5ITHA 2BQRA 1GXLA 4DJBA 2I38A 2WOMA 4DR5F 2HVZA 4LSLA 2VZ9A 4MKBA 4C8LA 3ZZZA 2RQCA 3BEGB 2BQ3A 4BC9A 3G9CA 2QLXA 3BDEA 2VQFF 3JTNA 4NLGA 1VIXA 4K5RA 4K4UA 2KXHA 1CLFA 2XWXA 3M30A 5C25B 1JLGA 3I96A 1U1KA 1Z2LA 4KFBB 3QGIA 2GO9A 4G6VB 1ZAVA 1GXTA 1RT4B 3PVXA 2NR0A 4X62F 1DQ9A 4NMLA 3MR2A 2LDYA 1TK8A 4WFAQ 1LV5A 5CYQB 3BSNA 4QW9A 2RQMA 3MR5A 1S48A 1SI9A 2KU7A 1FRLA 1KQFB 2AX1A 5F9NA 1J5OA 4F3MA 2MKIA 5KT7A 2DHGA 5C42B 4X66F 3DLLQ 4Y2AA 3I31A 3UI3A 2I8EA 2E5HA 5J1EA 2VBYA 3TP2A 1X9MA 1D8ZA 2FLPA 2KH9A 2B9YA 2ZH1A 1RT7B 3R5CA 2GGPB 1HQUA 2YKQA 1N33F 1LWFA 3GB0A 2IFXA 4NYOA 1JNRB 3V2UC 4YQWA 1VQ9S 5B0AA 3SCLE 1JB0C 3MPWA 3OTCA 2YVSA 4C11B 2Q6CA 1HR0F 2BQUA 2HRUA 1K1SA 1W2IA 2MZRA 4LSNA 2ZH9A 1FCAA 4OI6A 3UCUP 1T95A 1GXUA 5CCLA 4O3RA 3IRXA 2P6TA 3CC4S 4ECWA 4PQUB 3OFGA 1G2EA 2RF2A 1KN6A 2ZNYA 4RW4A 4NA2A 2MKJA 3IXQA 3AB4B 5J2NB 3T9ZA 1WNEA 2CRLA 2YNFA 5A8WA 2GNKA 1SJ1A 1WHXA 2MZJA 3KMQA 2E5GA 2J9DE 3DM2A 2FTRA 3WX4A 1MW7A 2HQ3A 4WK3A 1R3NA 1S0OA 4N77A 1V3ZA 4AL5A 1DTTA 1SL1A 3PIPQ 1FRHA 1KVJA 3WC0A 2UUAF 4DEZA 4L72B 3BO2A 3MPYA 2HIQA 2VBWA 3I0RA 3CJ0A 2PE8A 2ZOMA 2DR5A 3TA0A 2EPIA 3JSRA 3QZ7A 1Z4UA 1FKPB 4RW7A 3AY0A 4CT8A 4ZCIA 1VRUA 4AL6A 3CCMS 2DGVA 1FKOA 1BGXT 5KFGA 5B0DA 4QPXA 1FRKA 3OXGA 4GKJF 4QCLA 1FKAF 1RT5A 1L3KA 3R5AA 3LUYA 4DG1A 2PFFB 3PO4A 1BQNA 1AFIA 2N7YA 3HX9A 2GMLA 2RRNA 3KK1B 1Q78A 1W25A 5CQGA 3CMAS 2XSFA 1DQAA 4JBCA 2QA4G 4ED3A 4WYWA 3IGVA 3C8YA 3MMBA 3PNIA 4WIIA 3SCIE 5BR8F 3BO3A 2V4QA 2XLIA 4LMZA 1PGZA 1X9SA 3IS9B 2XSJB 3DC2A 3ITHB 1ZM4A 2B5JA 3F56A 3TAMB 1T7PA 4GO5X 3BGFA 3LWMA 3WC2A 2N82B 3CULA 2VUGA 4C8YA 1SUQA 3NBPB 4TLRA 5LXRA 1C4CA 1G3OA 2L9DA 2IRXA 5A0YB 4IOAQ 3MEDA 4C4WA 1FHTA 5D3GB 1P1LA 3NG8A 3FZ2A 1PO6A 3DLHA 5L9NA 3MF5A 4N56A 3OL7A 2XCAA 2MQQA 4A8SA 1YJWS 1IKYA 3PFOA 1YSJA 1BQXA 4J9KA 4TYBA 4K4TA 5K5MA 3TARA 4DL5A 1J5EF 1QAYA 2VQEF 1T3OA 4QR0A 2EI5A 3GIMA 4C8OA 1S1XB 2RU9A 2YKAA 2BV3A 2LA4A 4OHYA 2Z0GA 3SSQA 5DO2A 3BSOA 3V6KA 3EPIA 4B9LA 1D9DA 3NMAA 5KFRA 4PG4A 1IKVB 2GJ2A 1R8AA 3BZQA 2VFVA 3IWXA 3FCHA 2R8KA 2M70A 1B7FA 2C3OA 2YKPA 1RTJB 4UUXA 3SSRA 2MGZB 3ZZ0A 3DOKB 2HVHA 2NYIA 4OJ1A 5FDLB 4Q44A 3E01B 1L3TA 2CPDA 5LJ3Y 5J2QB 1VQ5S 2V5HG 2E29A 3TW0A 3HHLD 4I7FB 2LU2A 1Q4RA 2WK4A 4CIOA 2DK2A 2DR9A 4IQXA 4LFAF 1F2GA 3HT3A 5DGBA 2ZE2A 5KFHA 2RE1A 4CH0S 3N6LA 3M6WA 4DR4F 2ZHAA 5DDQC 1N34F 2HQIA 2KZMA 2MMYA 1H2TZ 1B64A 4OI2A 1YBAA 3D0HE 2OPSA 3VQSA 3KLHA 1Y00A 1U48A 4HTJA 5K8PA 4R8UA 3BS9A 3CCWA 2QSWA 5F41A 2ILZA 3UR0A 1U6BA 4G3IA 3OFFA 5FD1A 2JZ5A 1KLMA 2YWFA 1F5BA 1RTHB 5KT3A 4ZS6A 4M5DA 1HNIB 4HT5A 1CPZA 1JKHA 5DS7A 5E3QA 1SH3A 2AGQA 4FNIA 3PRBA 1EETA 4W92B 1RI7A 2E7XA 3DRPA 3HDSA 4NCGB 4DQIA 2B7BB 1TK0A 3AH6A 1TK5A 1TKTB 4Q2LA 1FXLA 4PWUA 2D1CA 3KLEB 3QO9A 1N5YB 1TP7A 3HHNB 1K1QA 2Y0SD 2ROGA 4F4YA 4A47A 4EWTA 3PDNA 3MMCB 1XK8A 2XO7A 4ZPAA 2DGXA 3W2VB 4LF6F 3P96A 2V4JA 3DOLB 3O8WA 4OJGA 5GVQA 2U2FA 5D4NA 3FZBA 5KFFA 4TU7A 3K8VA 1S7HA 4YP3A 1SV5A 1ZM3A 1ZZNA 4WFZA 4N5SA 4B9NA 3R27A 1S9GB 1S76D 2LXFA 4C0BA 1S1WB 1HWIA 1Y5IB 1JJ2R 4WKRA 1HBUA 3MUTP 4NZ6A 5B7WA 2JDJA 1RKIA 2E9RX 4MKYA 2EFNA 4YHHF 3NAHA 1M5PC 2HYIB 1FK9A 4ZHRB 3KG4A 5F3TA 2LECA 2YWGA 1LWCB 1QE1A 4B17A 4KQZA 4Y2CA 3DHXA 3OJUA 2IM0A 1S97A 1MROB 5DRKA 1CSJA 3CJKB 3I0SA 3T6JA 3PV8A 1CEZA 3V4MA 4ZMMA 2R7SA 3CDAA 3M2UA 5DG8A 5A6WA 4ECUA 5DG7A 1N5TA 3NGKA 3WZ0A 2QFJA 3CCSS 1RYRA 4DV3F 3K8WA 2MQOA 2O3DA 2W8LA 5KFKA 3OL6A 2W4PA 1TKXA 1YRUA 1K0VA 2XMKA 1N0UA 3J7YI 3PIOQ 4I1TA 3B4MA 5D8HB 4R0JA 2BBEA 4RNHA 3PZPA 4WF9Q 4MFBA 2C2RA 2EFVA 4P6QA 1T94A 1A7GE 4TKTA 1KRPA 4I2PA 3DLEB 3PX6A 3PO5A 4ECTA 2KT2A 1DTQB 4NCBA 1S9EA 3SQGB 2MQMA 4QIGA 4Q2MA 1JLFB 4B08A 4A8KA 4JI8F 1HMVB 3HHKA 1CVJA 5C24B 1UVNA 3FMWA 1X4FA 2UUWA 3MM6B 4I6YA 3SYZA 3K5PA 3JB9k 3MMAB 2VL1A 4USJC 4CI0B 4F2SA 1S6QA 3GV5B 3OXLA 1QSLA 3JSMB 3RTVA 2IA6A 2EK1A 3DU6A 4O4RA 2DNPA 4NOHA 5HBMB 4RKUC 1TL1B 4M1KA 1U4BA 2KHDA 3BGLA 1OQ3A 2Z4PA 3I4PA 4X84A 1U2FA 4CZCA 4MJKA 5J1NA 2R2UA 2XMJA 2ZH8A 2KFYA 2DNRA 3GV7B 3GYXB 2BZ2A 3KG0A 1F60B 2J8AA 1BLUA 4DR2F 4JV2A 3VQTA 2CQDA 1TKDA 2OSRA 4JI1F 3L7OA 1CC7A 2YH0A 2ZD1B 4IOCQ 4Y2MA 1LW0B 2GHVC 2QMWA 2R7VA 1X4BA 3SDEA 4O3PA 4ECRA 1C1BB 1HWUA 3HI9A 3CCQS 4B3OA 1M90T 5DM6Q 2R4FA 3DLBA 2LCWA 4TNOA 1G1XA 4IG3B 3GFXA 3BSAA 1YJUA 3VAGA 2DVIA 3HHEA 4XDDA 1XBWA 1AFJA 3IRWP 4XPEA 5IQQA 3UW1A 3RAXA 3RR8A 1DLOA 5LT5A 3B8HA 1HI1A 2VG6B 3S6EA 4PXDA 2XGQA 2W9BA 3G6XA 4NA3A 3BF4A 2CZ4A 4G1PA 4ZCKA 3F44A 3PR5B 3DLKB 4IFYB 3QMQA 2A2CA 4LF4F 1HL6A 1S1UA 3HLUA 3J81Y 5AE2A 4O0IA 2MJUA 1TFWA 3RRGA 3MHYA 1U24A 4DDFA 3KHLA 2A2DA 1VFJA 2F40A 2PGCA 4WFNQ 3ZZTA 3G96A 3ISND 3QLHB 2HNDA 3PR4A 1UFLA 3EYZA 1AW0A 4DLEA 2LLZA 4OZ1A 3UE2A 1B0TA 1S49A 1NEEA 5HROA 2PA8D 5KG1A 4AXJA 2AYGA 1HW9A 2VV5A 2AJ4A 3FFIB 3N0VA 3BSCA 3QGGA 3QAEA 4H4OB 4URSA 5KFMA 1TUVA 4FF4A 1VQLS 4OV1A 1JXEA 1V9OA 4LVNP 4IG0A 2DH9A 4RX6A 2DNGA 2BANB 1Y3JA 1GX5A 4BCAA 4KB7A 1U8SA 3TAQA 4ES1A 3M8PA 2E7WA 2F1FA 3M6VA 2FY1A 1H98A 5D4OA 2R2RA 2DGQA 1T05A 2KRBA 3PKYA 1FO1A 4YB7A 1FRMA 3B4DA 3G71S 3C6UB 5E33A 5B0EA 5KOWA 2O01C 1IN0A 2KXFA 4DL2A 1RK8A 3QGPA 1JJ4A 1UW4A 1RTDA 4EGLA 2EW9A 4QWEA 2XMUA 5HP1B 3POTA 5KFIA 5F8LA 1SIWB 5F8HA 2YKNA 1GX6A 2VD3A 1R8BA 1RJJA 1IBMF 1CC8A 1IQZA 2XY6A 4K4YA 3OUYB 2YX4A 4OHWA 3GILA 1LWEB 1WHWA 3DDKA 3EZ5A 2W4DA 4XO0A 3EXCX 4DF8A 4PG6A 5JVGQ 1VQOS 4C0HA 2B9WA 5F8MA 2CQCA 3M9NB 4NA1A 2YNHA 2XMMA 2IMOA 3LP1A 3VAIA 1ZH5A 1LW2B 3OQ2A 5THWA 5D6GA 1VRTA 2HAIA 3SV4A 1XMQF 2C3PA 4B3SF 1I94F 3NNHA 2V8VA 2LQBA 3MM8A 5KFCA 2OTLS 1LK7A 2ZH4A 1M5KC 4ZP7A 4C0OC 4AL7A 2ASDA 2KFZA 3E2EA 1W2BR 3ZZRA 5EWEA 4FYDA 3K0JA 5C25A 1UVLA 3K5MA 3F41A 5KFPA 1R27B 4HDHA 1U6ZA 3MR6A 1RT4A 4H4KA 1OPZA 2VPWB 4FXVA 2XMTA 4QQBA 2J0XA 4Y00A 2N3OA 3MAHA 5LSRA 3UDLA 5CYQA 1R31A 2D9OA 1KOHA 2RB7A 2RNEA 3BGRB 4OZ0A 4J9MA 3OBIA 1K73T 2Y1IA 1U49A 2FD2A 2G1DA 3HVRA 4PG8A 4A8QA 4B9MA 2RILA 1FT8A 4NL5A 3KK3B 1HNZF 1Q81T 5AXNA 3T5JA 3RBDA 1Q7YT 4Y2IA 2C3UA 2CPJA 3LP2A 4BWJA 4AFFA 5G0RB 4IRDA 1NNDA 2HS0A 3VR1A 1N5QA 3U1LA 4IH5A 2DO4A 2B56A 3HKWA 4I69A 2DCUB 2GGPA 3A1YG 1Y3KA 5B08A 4KV8B 2OKQA 2D41A 2ROEA 1WF1A 2XY7A 5JXSA 4ES2A 1Y4ZB 2D3UA 2HNYB 1JK9B 3BREA 1JXLA 2DPIA 4AQYF 3HHLC 4H4KC 4DR3F 1C0TB 2EK6A 5KG2A 3KOAA 2M0GB 3CDEA 3MCSA 1AROP 2K3KA 1R0AB 2LYVA 2CQBA 1FD2A 2VH7A 4EYIB 1UVJA 3EZUA 2ZZNA 1NK7A 4ZVHA 4PQUA 5CZVA 3H2VE 5B09A 5K14A 2R8GA 3TVKA 1N6QB 2U1AA 4IH6A 3M8SA 4KSEB 5J2NA 4C8KA 5DJBA 3MM5B 4CO5A