1IBLF

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
b'MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1iblF00
1HNXF 2RJZA 1XMOF 2F4VF 1N32F 1CQNA 4B3TF 1IBLF 4OX9F 4JI0F 4LFCF 1HNWF 3T1YF 4NXMF 4JI8F 1VMBA 2BVZA 1RISA 2UUBF 2VQEF 2ZM6F 4DR3F 4LFAF 4JI3F 4B3RF 5LMUF 4LF4F 4LF9F 4JI4F 4YHHF 2UU9F 3T1HF 4LF7F 4DR6F 4B3SF 1G1XA 1XNQF 1G7CB 2VQFF 4KHPF 4X66F 4JI2F 4X62F 4JYAF 1HR0F 4LF5F 4DR1F 4JI5F 1N36F 2UXCF 4LFBF 4LF6F 1IBKF 4AQYF 5AJ3F 4DR7F 3OTOF 1LOUA 2B7BB 1XNRF 4DV0F 2KJWA 2UUCF 1IJEB 1CQMA 2E5LF 2UXDF 5IWAF 3R3TA 1FKAF 2UUAF 4DR2F 1N34F 1QJHA 1IJFB 4GKJF 2KJVA 1J5EF 4DV5F 4DUZF 4NXNF 5LMNF 2J5AA 4GKKF 2B7CB 4DV1F 4B3MF 4K0KF 2UXBF 4JV5F 4JI7F 1GH8A 4DV2F 1XMQF 2HHHF 1IBMF 4X64F 1I94F 4X65F 4JI1F 5BR8F 2YY3A 1B64A 2BXJA 4LF8F 4DV7F 1F60B 4JI6F 3ZZPA 4DUYF 4DR5F 1HNZF 1N33F 4YY3F 4DV6F 1FJGF 4DR4F 4DV4F 4DV3F
chains in the Genus database with same CATH superfamily
4NEYA 1CQNA 5JJBA 2A1BA 3SEOA 2WK4A 3GILA 1NJZA 1VQ4S 5KFIA 3GV8B 1ZZFA 3SFUA 4GO5X 3VGUA 1S6PA 9ATCB 4C4WA 3T6BA 2QGFB 4F0KA 2B9WA 4X4VA 1JNRB 3L9ZA 4P75A 1D9FA 1OS5A 4I2PB 1DFDA 3M2VB 1RT4B 3J7A1 1QTNB 2P6SA 3NOGA 4OV6A 3VTIA 1PG5B 2WSFC 1RT2B 1PCAA 3AOBA 1SC6A 1D8YA 2IDEA 1R27B 1J27A 3QGPA 4DSIA 3ZTRA 1T9TA 2E1MC 2YNFA 4XAKA 4OYZA 5KFVA 3FRZA 1SC3B 5T41A 4K4ZA 2ZKUA 4KYZA 3HVWA 3OVAA 1L3UA 4GC6A 4B3MJ 3IWLA 4A8XA 2MSTA 2X1FA 1BQMA 2Y9HA 3ZTOA 1N34J 1TL7B 2DNPA 3AA9A 2JLGA 4DSFA 1RT5A 2F4VF 2UVWA 1ZM2A 1S9GB 1IBLF 3UDLA 3W2VB 3V4IA 2E5IA 1X31C 3KMQA 1NK9A 3LAMA 3BV8A 1S0OA 3M2UA 1WD6A 5FDLA 2JEIA 4OZ0A 1XC9A 4IR9A 1S1XB 2A0FB 1F5CA 4ICLA 3OTEA 3HDSA 2BW7A 1VQOS 3CJRA 2D1CA 2QO3A 1PJ5A 2AT1B 4CLUA 1YJWS 2BE9B 1VQSA 5MAOA 1S1TB 2V34A 4C0BA 5K8MA 1T9WA 1TV6A 3US5A 5L1IA 4QIVA 1NPPA 1WDDA 2DIVA 2PC6A 2ASLA 4ETZA 3GJTB 1RCXB 1SJ4P 4WXWA 1FDAA 1S7IA 4QJVA 3Q89A 4X4UA 2C2EA 4OZ5A 3MAQA 1D9AA 4AYBD 5IQQA 1H72C 3I5BA 4ECXA 2HQCA 1EHWA 3M30A 1RTJA 2E9ZA 1QSYA 2VG6B 3W8PA 3ISZA 1FRJA 4L6V3 5EX3A 3H2VE 3W9HA 1VQNS 2X1BA 2R8GA 4UZBA 3JTPA 2VG7A 2WTFA 2J7KA 4RR5A 1UETA 4DCPB 2IFXA 1SV5A 4NMLA 3LF0A 4A8WA 3JAMY 3M7VA 4LR7A 3LP2B 4GVLA 3IRWP 3PJ9A 2QLWA 3L7OA 3FMBA 4GMKA 1TL4A 3LWMA 5HLFA 1S4EA 1N88A 3M2RA 5JVHQ 1BE4A 2DEJA 2UXDF 2PFFB 2KT5A 1RT5B 4GKJF 2L9DA 4OZ1A 3V4IB 3SMZA 4RW4A 3D0IE 1UJ6A 3M2UB 4DPOA 4EYHB 2APOA 3DDNA 3PEJA 1QUVA 4ICLB 2QSFA 3G86A 4URSA 4Y34A 2R7WA 4ID5A 1RWWB 3E01A 3QMQA 1VK3A 3DLKA 5L1LA 3QGHA 3MTKA 3HT3A 3K5PA 2BABA 3W2WB 1TFWA 3R97A 3H5SA 2HW3A 2VC0A 1O51A 3CJ5A 4MIWA 1C0TB 4R8UB 2HKEA 2OMOA 2XMUA 3QIPB 1BC6A 4NWBA 3AFGA 1JLGA 3Q8SB 1KVIA 4WP9A 1FF2A 2RKIB 4EZ6A 3T3FA 5CD4H 2DHSA 5EX0A 4Y2MA 4LBIA 3CTRA 2RS2A 4UOHA 1KLNA 3ZZYA 2H51B 3GJRB 1MMDA 2E29A 3V6JA 2W2OP 1J5EJ 3CB4A 2OI2A 4X4NA 4ZA1A 2XCAA 3HHDA 3TAPA 2BJ8A 5HANA 2VG7B 2YH1A 2CQIA 4OZ2A 4FBTA 4KO0B 4P73A 4USJC 4BWJA 1YIJS 2R3VA 3LP1A 4DV2J 1FRHA 1B3TA 2BUNA 2VJVA 2CZ4A 3KLIA 4MH8A 3M2RB 3JSYA 2NZCA 5F8NA 2HWIA 1KQGB 2UUTA 4Y2KA 3MEGB 2IYGA 2VODA 2XC9A 2F9JA 1S1VA 3OR2B 3TEGA 4X62J 1HHTP 4RX6A 1TL3B 2QG9B 2VPXB 3OLAA 4PG7A 3K8WA 2J0SD 3EVOA 2MKYA 4XK8C 2B9XA 4LF6J 5THWA 2YQ0A 3ZZTA 1QE1A 1UEUA 4CLFA 5KFAA 1TVRA 3J80U 2IM1A 2IPOB 3Q22A 1IBMF 3QRQA 2H3EB 3MPUB 3BQ0A 2XZWA 4I64A 2LEBA 3R1LA 3CJ4A 1HMVB 2CPDA 5F0WA 4PQUB 2PEHA 1ICEB 3MMAA 3G8SA 4DQQA 1U49A 2H5IB 4LFAF 2W9CB 1WEXA 4Q0BB 2MTLA 3R7SB 4NI2B 4NASA 2VOOA 1WC0A 4I2QB 1F2GA 2B4VA 4UOGA 3EZ5A 3W3SA 4MKYA 1W2BR 2F8EX 4BC7A 2ADBA 2VDHA 4DHVA 5IT9U 3CGIA 1K0TA 2M8DB 2E5GA 4Y2CA 3O8WA 3G82B 5B09A 1XR5A 2L41A 5HJXA 4MIBA 2L3MA 1KLMA 4G6VB 1GQEA 4FP9A 1I5OB 1VRTB 3KJQB 2YKPA 3PW4A 4DN0A 4LQ9A 4IQMA 1SKWA 1OY9A 1Y4ZB 3M9MB 2N4DA 1RBOB 5B7WA 3OHAA 2DRBA 2P9GA 4ED0A 2NXUA 1EAYC 2SXLA 3C19A 1CVJA 3DGPB 2GIFA 4OX9F 2YX4A 1NUEA 2NCKL 4C8YA 3W60A 4MMOA 1DLOA 1GTHA 1Z2ZA 4ANEA 4DJBA 5J1NA 4EGLA 2K3IA 4CWBA 4ZLNA 2OPPB 1QE1B 5EN1A 4URQU 4WBFA 3R8YA 2F3JA 3QLHB 1XNQJ 1RZMA 1RE1B 3UDCA 5K20B 5DDOC 3UPFA 4J37A 3DU6A 3GYXB 2DHHA 1ZETA 1EARA 1HHSA 1YJRA 4PQAA 2CQ4A 2DO4A 3FCHA 1LW2B 2GAHC 2FJWA 1ULRA 3NMAA 2FZGB 2Q66A 4JI7F 1KHWA 2JVRA 4DUYF 3L7PA 4KGMA 2B51A 4C97A 2KYXA 4XTTA 4DV3F 3OFHA 5FJ4A 1BMQB 1XMOJ 1HNWF 1H73A 1UMJA 2DGOA 2CJXB 3OL9A 1B70B 3C2PA 1WKKA 2NLWA 4JI6J 3PIOQ 4GVBA 2ZM6J 1KFDA 4I1TA 4ZVTB 2UV8A 3SQOP 3PFOA 5I42B 4J9RA 3SIPB 1Z4UA 2CJAA 2AYBA 1FWLA 1CJTA 2RS8A 3NCRA 3HXMA 2XLJA 4NE9C 1S79A 2XMKA 4O4RA 3MPDA 3PYDA 1K73T 5HI7A 4LUBA 3MMCA 1QSLA 4YOEA 1BUXA 3MMJA 3EVMA 3NP5A 3QAEA 1SJQA 5LXYA 3OL8A 1WHYA 1KQKA 1XJWB 4PXCA 4PWUA 3AY0A 5A8RA 4JI1F 1VISA 2OO4A 4RW7A 2BQRA 2F65A 1HL6A 5KOXA 2PA3A 2A10A 1C1CB 3AOCA 1FJGF 2ZH6A 1FD2A 3F73A 1XR7A 3BDEA 2XMAA 1KN6A 4DSLA 3Q83A 4EEYA 4AUKA 3HZGA 2UUBF 3QIDA 2HRUA 5LMUF 5EWEA 3MMBB 5ETTA 3KLHB 1FK9A 4Q7AA 1KNZA 1TUWA 2I2YA 1KP6A 4X66F 4TNOA 4HH0A 3HVTA 3BO3A 4OFZA 3SXLA 3GMGA 4B08A 1FA0A 1ZM4A 3IRXA 3I55S 1HQUB 2QX0A 4ZVUB 4TLQA 2CA9A 2PO4A 3T1HJ 3PCOB 3NGTA 3W65A 5L46A 4A4JA 4J7CA 3C14B 4K4VA 1S57A 4E8UA 2FHKA 4IYQA 4AL7A 4KPYA 3MAHA 2ZBCA 4DV1F 1B0VA 1F0XA 3MZIA 2GW8A 2B4PA 2PIIA 4PXDA 3GIMA 4KRWA 3QZ8A 4RNFA 2HFOA 1FXDA 2B4UA 1UVIA 2DH7A 2UUAJ 1BY9A 2RDIA 1YRTA 3JS9A 3KK3B 1NPKA 4DPWA 4GKKJ 2DNHA 3W62A 1CJVB 2F4VJ 2IJNA 4AD6A 3B4DA 1CJTB 4OI4A 3QNWB 4JI8F 3BZQA 3I4PA 3BGFA 5CZVA 4C0OC 2VQEF 2C3OA 1NB7A 2HNYA 4EI2A 4LRBA 4F4KA 2KM8C 4I7FB 4PCQA 1KOOA 5A8WB 2IC3A 4XPEA 3EUNA 3A4TA 2MDAA 2ROEA 4J9VA 1YBAA 5KT2A 2V5HG 3QBCA 3D4JA 1IM4A 4QW9A 4KGZB 2MJNA 5F3TA 3ZZRA 3BN4A 1HBNA 4P7TA 2PI5A 4DG1A 1V5IB 3MM5A 2NSCA 1UW4A 3ET6A 3G6ES 4I69A 2OPQA 4ZDNA 2IM2A 1L3TA 3UFCX 4OYAA 1IJFB 2GMLA 3P5TL 2W2NP 3M1VA 1SXLA 1X5SA 2LXFA 2CJYB 4FN5A 4TYBA 5DDQC 2WOMB 4KT0C 3BDPA 4E98A 1SQGA 2EI5A 3VHQA 4FS2A 4RLEA 2VV5A 2ZZTA 2XO7A 5KFFA 1XR6A 4IDKB 2E44A 5SUHA 3HVTB 3H90A 1JJCB 1ZOTA 3RR8A 3UVJB 1ZH5A 1M5SA 4X64J 4A8QA 1L5UA 5DQIA 1T3OA 2GO9A 2BKOA 1C0UA 3UD5A 5C5JA 2DXFA 4C9DA 2I38A 2MSSA 3PEHA 4PUOA 1U1NA 1TMJA 1SL2A 3H5YA 5G0RA 3AD8C 3MEEA 5F8HA 2W2QP 4YS2A 4TVAB 3JTOA 4I67A 3FZ2A 4DX8H 3PW7A 4OLOA 1FE0A 1Y5NB 2DGTA 1F5AA 4IRCA 5A8KA 4B3SJ 1Y5IB 3G71S 2ZZNA 4ZJOA 2UXDJ 1ZPWX 4GKJJ 3QGGA 5D3GB 4O4GA 1EQ0A 2JOQA 5IQ6A 1NK7A 5A6WA 5HQMA 1QAJA 2BR0A 3M8ZA 2IIHA 5E0OA 1TKTA 3ZZ0A 4Y28C 3EPIA 3IC1A 3ENAA 3RUBL 3RBEA 5E3QA 4GRSA 1PAEX 3LPYA 1DTQA 3LTOA 3NGKA 2KH9A 2ILZA 1AFJA 1HYSB 1D0EA 4CH7A 3MECB 1DHMA 5J2QA 3PW2A 1FRKA 2JZ5A 3EXYA 2QLBB 4AFFA 1A0OB 1NB2A 1G7CB 5I3UA 1RXOB 2DRDA 4ZS6A 3VGTA 1HI8A 2ZOFA 3OTDA 2ZD1B 5E2QA 4NRTA 4CRJA 3SI8A 1NMEB 4NLTA 4YEAA 1LWEA 2BYCA 3EGWB 3KUGA 1Q5YA 4DPXA 4EYIB 4H4MA 2KJWA 1JWWA 1V5VA 4AXIA 1L3VA 1N6QA 4NLWA 4NCGA 2D74B 1S97A 2AF6A 4ZPDA 1IVZA 2Z58B 3FFIB 3N4WA 4QIFA 4FZVA 4DQRA 3MAAB 1OO0B 3NGSA 1YRUA 1H3DA 1S6OA 1HQEA 3D0GE 3CJSA 4PUOB 1HPZB 4PWWA 4K8RA 3CC4S 2VBWA 3CF5Q 1RUSA 2DVIA 4LQ3A 1HWKA 3H8YA 3S6EA 1M5OC 1VQMS 3UD4P 2HVHA 1N0UA 5DGAA 1Q53A 1HBOA 4LR8A 3OXLA 4OI1A 2Y1IA 1HQ2A 1TL1A 4JP8A 4RW9A 1VRUB 2M9KA 3UCGA 3DRRA 1SKUB 3HVRA 1VDHA 6FDRA 4RW6A 3TX0A 1NKEA 1MWQA 4FF3A 1U8WA 3GP9A 3J80Y 4YUDA 1RWPB 4OMFG 4C7QA 3QJJA 1TTHB 4ED1A 3CDBA 3EX7B 3G2XA 2CQGA 4Y3CA 4J5OA 2C2NA 4V1Ak 1R8BA 4F26A 2UVVA 1C1BB 2OFHX 1NSQA 2W2MP 2B9YA 2W9AA 1IBMJ 1B4SA 3K59A 3LO3A 2L48A 3GE9A 4ILMA 3HHLC 2GIRA 4I68A 2DHXA 4U95A 1EP4A 3VCDA 2I6WA 1HNVB 1LKZA 1K47A 2K1RA 4URGA 1U0HB 3C6TB 3QQCD 1RU2A 2DKOB 1BQNA 5A0YA 7FD1A 2X3GA 1XMBA 4DBQA 4LFAJ 2VASA 3EMTA 2V4QA 4J91A 1KDNA 1VBKA 3P8BB 4LSZB 2C28A 4U96A 2ZNZA 4IOAQ 2JRSA 2PMHA 1RT1B 2DHAA 4NXMJ 2FGOA 2V4JB 3D6FB 5IT9Y 3Q8QB 1R89A 1REVA 2VONA 5GMKa 2P9EA 1M5VC 3DLBA 1UTAA 2FD2A 5BYSA 1Q1KA 2FLOA 3RW6A 4DR2F 1OSCA 2DCUB 1QJHA 4YFUA 2CJKA 2VA3A 1TP7A 5HL7Q 2BM0A 1RTDA 3ADAC 3I0SB 1S9FA 4W92B 2FC9A 2V2VA 2KG1A 1DQ9A 3J81Y 3LA0A 4B9SA 4TY8A 2BOPA 2KM8B 3BEGB 2HFZA 2QA2A 2VFVA 2BQ3A 3MWBA 4B9NA 5BYRA 3D1HA 3DRRB 4L74A 2H4YB 4G65A 3MTJA 3TJAA 3FEZA 4F0HA 2UP1A 2HVEA 1U02A 3Q23A 1QSSA 4IR1A 2LQBA 5GMEA 3MCOA 3M8WA 4UOCA 4MK7A 3AH6A 2EG1A 1JLQA 4ZVGA 4CYUA 3RYLA 5B0CA 2VD3A 3DLEA 3GIJA 4LSLA 3ZXWA 2MGZB 1FWKA 1RTIA 4UW2A 2QT7A 3HF5A 4WZQA 2CPXA 3CDEA 4X4QA 2MMYA 1UA0A 2MZSA 3GZ7A 4YMEA 4V19X 2MB0B 1DQAA 3LP0A 1N5YB 2ALYB 1UWBB 3W8GA 2VOPA 3PIPQ 2V8PA 2AD9A 2HSEB 1WG5A 1QAYA 1BQNB 5A0YB 5KG1A 4JI7J 4P10A 3D66A 2NQPA 1HBUA 2MZJA 3V2UC 4HYKA 2B4OA 3QO9A 3TJ8A 5KAKA 2DRAA 4IG0B 2AZ1A 2OH2A 4DUYJ 3QRRA 1HKAA 1ZBTA 5FIIA 4DV3J 1H6KX 2VFRA 1NSKL 3CJ8A 3J7AN 4Q8FA 2J0QD 3AOAA 4KHMA 2DY1A 4B3OA 2FY1A 3DRPB 3V6DA 1NDCA 1RISA 5C7PA 3ZTSA 3CJKB 3OJUA 2OIHA 3M8YA 3JYTB 3TX8A 2DB1A 2H5JB 3T5KA 4EO6A 4RNOA 2NSBA 3WX4A 1N32J 2U2FA 1VCTA 4QYZK 1HBMA 4WYWA 4RNNA 3CXCR 2BANB 2ZWOA 4QPXA 1RHMB 3D1QA 2HIQA 1S6QA 1E6YB 4LRDA 4ZHRB 1P9YA 4RW8B 1RWKB 3RB3A 4E0DA 4DUZF 4EBCA 5D15A 2FPHX 2C42A 2HEKA 2OP5A 4DX5A 2IRXA 3OXGA 1N8RT 5ITHA 2QE5A 1ACMB 1Q8BA 1IKYA 5A2QU 2HGNA 4NA1A 2YNHA 2X7IA 1NO8A 1FJGJ 4OX6A 5KFLA 2YPZA 2FDNA 5DO2A 4NXNJ 2O66A 3GQCA 2AMCB 2Z57B 3CD7A 2HZVA 1W26A 2EKNA 1HFEL 2VPZB 4RUHA 4OYMA 1AT1B 2UUBJ 2HRYA 4XPCA 2Y8YA 1GX6A 1KVJA 2B8QA 2OGUA 3LP0B 4WCEQ 1NK8A 1F6TA 5JUMA 4Q2MA 3CO9A 5F8GA 2YNIB 4AE5A 3D0HE 3PV8A 4H54A 5HQLA 2P6TA 3OHBA 4EUVA 3NKYA 4EWTA 5BJRA 2XG8A 2JSXA 3RTVA 3FMWA 2FVRA 2QTWA 4ZVPB 1AA1B 4DL0C 3TWZA 4EK2A 3BQ2A 4ZPAA 3OV7A 2MQPA 3CWJA 4N76A 4B3OB 2B7CB 3LGNA 3TP2A 4HVZA 1Q8KA 2X1GA 4CTAA 1J5OA 3PR5B 2OEKA 2Z2ZA 2E1CA 4M1KA 2XZDB 4KKOB 1S72S 4AL6A 2J8SA 4N77A 2YPYA 2MHEA 4DPUA 4NRUA 3OFFA 3TANA 1OYDA 1VYAA 1VQYA 3E3XA 4PXEA 1X5TA 2NXEA 2YKOA 4JI8J 4PKDB 2JFDA 1RHQB 3BYRA 3KUHA 2XI2A 1B0PA 4LF9F 3BSOA 1RQ0A 3M8RA 3QT8A 2LMIA 3DOKB 3G6VA 2KHDA 4O44B 3M8SA 4USMA 3R2CJ 2CWKA 3O3LA 1MWYA 1G6BA 1JLEA 4DS5A 3DU5A 4HDHA 3HT0A 2GVZA 3I82A 3BH6B 4LVNP 4NLXA 1PC5A 2R7TA 2LLZA 3TA1A 4A8SA 1XWLA 3PKYA 3HHLB 3ISND 3K17A 5IM0B 2OAUA 1NJIT 3JSRA 1N5SA 3EZUA 4HEA9 1Y3JA 3KJVB 4ZN3A 4FVCA 4FKXA 2N3LA 3L4BC 2ZITA 3A3PB 1FVQA 4TYAA 5CZXA 3IM8A 3BREA 2KN4A 1C4AA 4CDIA 1KS2A 4WFBQ 1U1OA 3L09A 1NAQA 5DG9A 4U7UD 1FTCA 3PJWA 2LQ5A 1DTTB 1VQ6S 1T11A 1KQSR 3S8SA 1V3RA 1SH3A 4QWEA 2W4PA 3VVTA 2C2KB 3KG4A 2QIFA 2HHUA 3EDQB 1APSA 3BKTA 4OHZA 4CO2A 3C15A 2BKNA 2HFUA 5F8JA 2MQ8A 1J5OB 2J6TA 1FDDA 1YKWA 2IA6A 3GFHA 2IY5B 1HARA 2RDDA 4CLPA 3TW0A 3C46A 2HBYB 2ZJQQ 2VBXA 4F7VA 2FVPA 1H2UX 4ZVQB 3VWSA 2QMXA 1GH8A 2FJAB 3TAQA 1EB0A 1X0PA 2W7AA 3AD9C 5IZHA 1YJNS 3ZNJ1 3NAIA 2BJEA 3AQPA 4PPZA 2BJ3A 2LQ8A 1RTZA 1FE4A 1WC6A 3VAGA 2CPJA 1FRMA 1YITS 3F44A 5B0GA 1YJUA 4KHRA 4F36A 3TAMA 3NMRA 3MPVA 4P72A 3M8QA 1RYSA 2XS2A 4J9SA 1SJ1A 5F8LA 3CMQA 3VZHA 4OX7A 5ETKA 3KLFA 1RYRA 5CYMA 3MPYA 2HQ3A 2X3DA 1RKIA 4J9NA 3N6LA 2JX2A 3HK2A 4KV8B 1IQZA 1N34F 1S6UA 3P6YC 1WTFA 3HO1A 3HFKA 4NYZA 5M2UA 1TFYA 1NSAA 1LFWA 4HTJA 4QYZJ 1LW0B 5LJ3Y 1U1KA 1JLAB 3R5DA 2IRUA 3CPWR 3JSMA 3RB0A 1R0BG 2J76E 2A6MA 4DV6F 3KTQA 2FVSA 2CKWA 1W2IA 1NJYA 2BE2A 3GG1A 4HR2A 1S9EA 3ENVA 4NZ7A 3HFZB 3C15B 5GAGU 3GJSB 5DZ7A 4JB8B 2IJFA 4LREA 1ZPVA 4F3QA 3CNQP 2MYFA 3VALA 5HSPA 1TKXA 3C3LA 3RAQA 2RDJA 1U6BA 2XZTB 1CULB 4DCJB 4K59A 3ULHA 4LT6A 3JQMA 4R25A 3QWUA 3M6XA 3DM2A 3BGLA 1LQ9A 5K14A 4KBIA 2BJ1A 4ERDA 3TUZC 3PX0A 5D0EA 1U2RA 3M8PB 2BX6A 3AD7C 3D3CJ 2FJBB 4RU9A 4IG3A 3FBEA 2BKPA 4ZLLA 3TAMB 1L3KA 4ES2A 3VAHA 1IWAA 3M8QB 3UQSA 5DS7A 2JLEA 1NK4A 4C11A 3UO0A 2RJZA 5LM7E 2A6OA 2OPRA 1HI1A 3IWNC 2IDLA 3GWCA 4C0HA 1KEKA 1T03A 5C42B 1MMNA 3MUTP 4L72B 4IH5A 2GQ2A 3G96A 3VF0B 1B7FA 5MLCV 2RUSA 2ZOMA 3CD6S 2HAIA 1X4CA 5CXTA 1RTHB 2O3DA 4P2SA 3HHKA 1X4BA 4HI2A 3IM9A 3IO1A 3J7YU 3HJVA 4USIA 1Q5VA 2EVZA 2YQ3A 2KRRA 4C2MA 3DRSA 3W5ZA 2E5LF 5C25B 4K50A 3I9ZA 2MZQA 1NSPA 4X4TA 2ZH2A 2YKNA 5HBMB 2RILA 3B78A 2XSFA 5DDRC 2QA4S 2COLA 2V9KA 2M2BA 1JMTA 3HM9A 1T9VA 4ZMMA 2CNOB 3VGVA 5LSRA 3IAM9 4DSJA 4U67Q 5IWAJ 1Y10A 1JKHB 2JEFA 1P9QC 4UZCA 2FLNA 4WKYA 3HULA 4U6PA 1NXIA 2RRAA 5KFUA 2CPFA 4Y2AA 5KT3A 5E33A 4NZ6A 2JDJA 2FLLA 3OVSA 3BSNA 2AU0A 2DXDA 2C2DA 2V8VA 2AYMA 4GO7X 1PILA 5H9EJ 3DLHA 1YBTA 3MR5A 4ZCMA 2Y1JA 1VBZA 1NK5A 1FXLA 2FHJD 5HK4A 1SUQB 4ZJLA 4CM0A 4H4OB 1AUDA 2V2QA 2WW4A 3GV7B 1D3WA 2ZHAA 4LBHA 2EC2A 5IOLA 2H5EA 3T1AA 2DR7A 1YI2S 2EFVA 3CJ0A 4ELUA 3T9ZA 5JXSA 4DR1J 3AQOA 1QAIA 1T05A 2DITA 2CQ0A 2RVJA 5IXUA 3EWGA 1NJWA 4DV2F 4U8YA 3DDIA 4FYWB 3QZ7A 4YB5A 4CH0S 2V2ZA 4MT1A 1RSCA 3SV4A 1NNDA 2KG0A 3H20A 2W2PP 1AYEA 5LMNJ 1NHKL 4HI1A 2QA1A 3RBXA 4DX7A 4ATNA 1NEEA 1NKCA 4FKYA 5HP1A 1S99A 2JJ4D 2CQ1A 1OPZA 1Q0NA 1FKOA 5ETVA 3KK2A 2NPIA 1N33J 3FSXA 2HAFA 4A47A 2LKZA 2Z2MA 1CJUA 1IKVA 4ED5A 3B4MA 2DBBA 3KUEA 4DUTA 4LFCJ 3AB4B 3DKDA 2ZDPA 4MKVA 5DETA 3OBIA 1VQ5S 3P49B 2YX1A 2H48B 1RHKB 5B0DA 3DXSX 1RWVB 4RL1A 3K5MA 4W98A 2B43A 2V67A 2HVZA 1IKXA 2CFXA 4MYUA 5SZTA 2BOAA 3BBCA 3TVZA 1R6YA 2DNNA 3T19A 2IMWP 5FLXU 3NEKA 3HP6A 4JV1A 1QY7A 3CJ3A 4MFBA 2XS7A 4U7UK 5KG4A 2HQIA 2YNGB 1UCNA 5A2QY 1IN0A 4DN9A 3KDNA 4IKAA 4YY3F 3K5LA 2E66A 4X4PA 3M32B 4FF4A 4NMXA 4G3IA 1XEZA 3R6LB 4Y6IA 2GIQA 5ADZA 3GFZA 2W7OA 2CPZA 1E6VA 1Y00A 2FZCB 1RT3B 5J2NA 3WIVA 3R7BB 1NH8A 5KT5A 1YDLA 4ECYA 3ONQA 4RKUC 1S48A 2LA6A 3WZ0A 3MM8B 5FD1A 1T05B 3W9IA 4IFYA 5DQGA 3W63A 2HS3A 1PGZA 2LDYA 4JUZA 2ATLA 4ES1A 3CCRS 2POKA 2MJUA 4K5SA 1YTYA 3L95X 1H38A 1IR1A 1YRXA 1WUUA 2V94A 3HHNB 2X1AA 2FGCA 3BYPA 3FZBA 2IBOA 1XIQA 2R8HA 1TUGB 1FFGB 2DPIA 2G1DA 2V8HA 2FC8A 3OTCA 5IS2A 2YWKA 1Y11A 8ATCB 3KLGB 1CEZA 4DZ6A 4QZVB 4M5DA 3KK2B 2QLJB 2J7UA 4I0WA 2R42A 4DCOB 1VC6A 1SL0A 1FD8A 1CS4A 1Q8IA 3NNHA 1Q86T 3CJ2A 5HMWA 5H1SV 2MQNA 3TVYA 1HNIB 3FC9A 2VC1A 3RW7A 3SDEB 5GAEU 2W4DA 1IKXB 5AXNA 1QAXA 3B82A 3MXHP 4OZNA 1U4BA 5CH7B 2NREA 2FY8A 4B17A 2I5JA 3PO5A 3EDRB 3DMJA 3MM6A 1CG2A 1KOHA 1ZM9A 2VZ9A 2CYYA 4JOUA 3NLCA 2E1PA 1R8AA 1T9YA 4MJKA 4WFXA 3NGDA 4ED2A 4DOZA 1GMVA 4LR9A 1MWZA 3IR5B 2B8PA 4DV5F 3SSQA 3A1YG 3EE3A 4B9LA 1G4CA 1R8HA 2C3YA 1LV5A 2MZ1A 4WE1A 1RAGB 3DN9A 4A8YA 5M2RA 2BW2A 5CYJA 3DI6A 4JI6F 1BHNA 3CMES 2ROPA 4OV1A 3NL0A 4Z7CA 4I6YA 2XSJB 2PFDA 2QL9B 4FS1A 1J2VA 3BGRB 2BRKA 4DU7A 4FNHA 2VG5A 6FD1A 2A2DA 1CJKA 2XM3A 8RUCA 3G9CA 4KQZA 1Y0HA 1O0PA 1RGVA 4NLDA 3A8EA 4YHHF 4RU2A 1KONA 4HACB 3BSAA 2GFFA 2YWEA 2IHR1 2ZBPA 7AT1B 2V68A 5E3PA 4M95A 3D3BJ 2XTJP 2A3JA 3SCJE 1X4DA 6AT1B 1OMSA 1R0AB 2BMBA 4RBUA 2XY7A 3DYAA 1RAEB 1MLAA 2EFQA 2R2UA 1X7VA 3Q0AA 3IBWA 5KG6A 3MCMA 3B8HA 4C8OA 3N9UC 4TXSA 4HKQA 3DOMA 1EKSA 2PGCA 1Q16B 1FJCA 1U24A 1PBAA 1S1WA 4PWDA 1FXRA 2E9TA 4QIEA 3DLGB 3DCAA 3RG6A 3V81B 4O3OA 4USTA 4QU7A 2F8MA 1YG0A 4P2MA 4KFBB 5KFOA 4DL6A 4G1IA 2I5JB 1X4HA 3V4MA 3FQLA 3I6PA 2M8HA 2FVQA 1CBKA 2LQ9A 2CUYA 3KJFB 4OYOA 1Y9OA 2Q1LA 1N54B 2IAJA 3T1HF 1VI7A 1MU2B 4F2RA 5D0HA 3MUMP 4BHQA 2HNZA 4LSNA 3EM1A 2Z2YB 1TKDA 2HBZB 1FFWB 1UFLA 5J2MB 3DOLA 2RF2B 4J9PA 2R8KA 1Y3KA 1VHFA 4DQIA 2R2SA 2HHWA 5GAHU 3IG1B 4B02A 2V69A 3QWPA 2HNDB 2UUAF 1TKZB 4L3NA 1SH2A 1T7PA 2RU3A 3PKMA 4GKKF 4P9SA 3A12A 1EJ7L 2K2PA 3ITHB 4X84A 2PMZD 3UD3P 5BR8F 2YY3A 4LMZA 4K4UA 2FZKB 2C2ZB 3NGUA 4R5PB 4DV6J 1NK6A 2OD6A 1IR0A 2H4WB 2RUGA 5CYQB 3UNGC 1P27B 4B9VA 4K2JA 5CA5A 2ZH5A 2LXUA 1SC1B 4IFVA 2XMVA 1NZAA 1R31A 3C6UA 1CC7A 4PZVA 2Z2LA 4G1QA 3CCMS 2E7VA 5F8MA 4TU9A 1RT6B 5E41A 2N82B 2R8IA 4K4SA 2Q6CA 4EU0A 4C48A 4DL4A 4LF2A 1R3NA 3OFGA 2QL7B 3RZAA 1IKWA 1BD6A 4DR7F 2J8AA 3PO4A 1S6PB 4A8OA 2D3UA 2GJ2A 2QMWA 4DL5A 2LXIA 3UWTA 2H9ZA 3PW0A 1MN9A 2CJ9A 4OI0A 3RRGA 4X64F 5KFYA 1YJVA 4B9TA 3POTA 3QAUA 1MROA 2DNOA 3MM9A 4LSNB 3KLEA 3U1NA 2W9BA 3M05A 2BDPA 3IP0A 1K0VA 1UZHA 2KO1A 1RB0A 1WOOA 2YNFB 1RT7A 2HHHJ 3N0VA 1X9WA 1VBYA 3WX8A 3G87A 2XY6A 3CJTA 1B7YB 3FDSA 5J2PA 2YWHA 4B3SF 1BQMB 2MPUA 2B5JA 2EK1A 1HR0F 1WG4A 2M3DA 3B54A 3TYTA 3KHLA 4KGKA 4M5NA 2HMIA 5GAGI 1S1UA 1Y7PA 3Q24A 3CD0A 4LF7J 2HFVA 1U6FA 5FDLB 2XEXA 5IT4A 4O3PA 2E5LJ 3THPA 4XO0A 2IVMA 2G2ZA 2AWZA 2W4CA 2C1EB 3FGVA 2UXBF 4C6AA 2HK2A 3C6UB 1FRLA 3CIZA 4I6AA 4FF2A 4K2XA 2WVDA 1HIYA 2EKYA 3SQGA 1TV6B 3LH2S 3G8QA 2OEJA 3NBPA 1IKWB 5KFSA 2YKQA 2A2CA 1WI8A 4QQBA 2ATCB 2ZE2A 1X4AA 4ZVRB 4CO1A 3EPGA 2YKMA 4ECRA 1HNXJ 3M6WA 2VPWB 4J9QA 2CZ9A 3NNCA 2ZFHA 3M30B 1X60A 1RTJB 1T02A 1MMLA 5AJ3F 2GNKA 3P45B 2DNGA 2E1RA 3H42A 2W9BB 3D6MB 1YQHA 5AE3A 5I3PA 3MUVP 1Y5LB 1WC1A 2KJVA 1SV5B 1OY8A 4OJ1A 4FPIA 1WG1A 4UT4A 2EW9A 2I0XA 5J2PB 3OL7A 4FBUA 2LFVA 4OHYA 2R7XA 3J7YI 1RA6A 3BB5A 2ILYA 3GIRA 3HHLD 5KFJA 2KXNB 3F0NA 5HLFB 3LQVA 3OUYA 3CO0P 3IWXA 3R5BA 3OQ2A 1VS3A 4ZN1A 5EWGA 4ZP7A 3D6HB 1PIEA 4PXBA 2W25A 4RW4B 2HHVA 2N7YA 2W24A 4PR6A 5E5NA 1V3ZA 4Q5VA 5HROA 1RADB 3K8VA 1LXNA 4ECUA 3NS6A 3BS9A 2MLXA 2XMTA 2AGOA 1QDUB 3R5AA 1SPBP 4WFZA 4ID5B 4JYAF 3T1YJ 3E01B 2PE8A 4ILLA 3DLKB 3H0PA 3BO4A 1D1UA 2ZKTA 2QLFB 3ILIA 2C2OB 3EICA 4NLGA 1CQMA 4OHXA 3R3TA 1FDNA 3Q8UA 1DAXA 3JAMU 3NWRA 3A13A 5JVGQ 4N7TA 3PRBA 3HKWA 1UAWA 3WBZA 1WHWA 1JLGB 4TQSA 4PABA 2G4BA 1PJ6A 2HYIB 2YX7A 2GAGC 3EGZA 4YY3J 3BH7B 3MGJA 1S12A 2MQOA 5H9FK 3K5NA 3JXOA 3AJ1A 3D2WA 3KXDA 4NXMF 2XS5A 1S7HA 2EK6A 1JX4A 5B08A 3IS9A 4YQWA 2ZJPQ 4P52A 2VQFF 4EZ9A 4ECZA 4OZJA 2W1BA 3JSBA 4ANCA 1KFSA 2KVIA 1U0SA 3TA2A 4RBVA 3LP1B 5DM6Q 3MI7X 3EJMA 4IH7A 2BV3A 3KLIB 4UOFA 5AE1A 4NEZA 4WP3A 1AW0A 3KDOA 5L38A 2LU2A 1S1VB 4F04B 4JV5F 2NXCA 3LANA 4D3HA 2DR6A 1UPMB 4QW8A 2AEMA 4OZ3A 4ZPWR 3B6BA 4NLUA 1RLDA 1X4FA 1RU1A 3FEXB 1TVRB 2WHOA 5B0EA 3Q8YA 2PD1A 2R4FA 3H59A 3NS7B 5IFMA 1FJEB 1N5QA 1P6TA 5C2CA 1HD1A 4C8LA 4DV7J 4DX6A 2KTQA 1BWEA 3IA0A 1SVDA 4DFJA 2ASDA 2VHGA 5L8RC 5I3QA 2D9OA 2YTCA 1UJ4A 2D3OR 1U47A 3G8TA 1BLUA 3MMAB 1YVFA 4L3KA 1ZA2B 2GGPA 4HDGA 4B3RJ 1JB0C 3OSNA 1UJ5A 2YH0A 1K1QA 4FVMA 2XNRA 1IR2A 4DV5J 2MZRA 4ZVFA 3THTA 1FKPA 2CG4A 4F3OA 3J7Z5 4PAAA 5KT6A 5F41A 5HN0A 4LF1A 1RA7A 1X4EA 1FFSB 2ZHOA 4DWIA 3WC2A 5DG7A 4DV4F 4CLZA 1DARA 1N32F 1JLCA 2HHXA 5L1JA 1NZ8A 1Q7YT 1UP1A 2HBQB 2FTRA 1KLMB 3ZC4A 1JLBA 4DFPA 1U45A 4DF4A 2FJVA 2KZZA 4Q45A 2BACA 4NA3A 1XBWA 4YHHJ 2NUUG 3FSIA 3FNNA 4N56A 3BSCA 4ECSA 3MR3A 1U1MA 3BPSP 4USHA 4K4TA 3FBFA 3MM7A 1VQLS 4N5SA 1DLOB 3BO2A 2R7OA 3I0RA 1OQ3A 2MKIA 4ECTA 2LDIA 3GR1A 2V4RA 5GAEI 3CMAS 1QLNA 5HMXA 3OLBA 4OI3A 2AJQA 4NXNF 5KFXA 4IQXA 1GMUA 1UPPA 1G3OA 3OR1A 1KRPA 2CQDA 3A3OB 3N01A 1PYTA 2AW0A 1PYOB 1SJRA 4DLEA 4LF8F 1F2HA 3PZPA 3VAJA 1FDBA 3PRVA 5AXLA 1YK9A 4PEOA 4N8NA 2EWHA 2AEFA 2GX8A 1VGYA 2JNJA 4C8NA 2VICA 2NZ4A 4LBPA 1U7LA 3RRHA 3IR7B 1F3VA 4ZPCA 1JLFA 2VBYA 2RHSB 3HX9A 4B3TJ 4AT1B 3AB2B 4K5RA 4M5KA 4MAKA 3HCXA 2KFNA 4ZP6A 3L3CA 4DR3J 2C2MB 1H98A 1I51B 5EGYA 4QR0A 2HWTA 4FF1A 4EBEA 4GVBB 4CLSA 2AEJA 3PR4A 3TI0A 2LP4A 2CVIA 2PN6A 3UN3A 4LJMA 3GFYA 2BJ9A 2HIYA 2PA8D 3VAKA 4BC9A 3BGUA 2V63A 5BR8J 1T9UA 1YJ9S 4YDDB 3MMCB 1K44A 4I2PA 3M2VA 2XHCA 1FO1A 4LVOP 1RT4A 4PG6A 3KG1A 1OY6A 5E7OB 5A8RB 4DR5J 4ZCLA 4RW7B 5AXMA 3KWMA 2VDIA 4I56A 1M90T 3ZNUA 5H9FJ 1XQIA 1VC5A 3CC7S 3ENWA 1PO6A 3CCLS 2MKCA 4WTYA 1TK5A 2WRMA 4DR7J 3DC2A 3K5OA 3Q2TC 4K4WA 2OELA 1TL7A 4RPFA 1IXKA 1FK9B 1UEVA 3AT1B 1TAUA 3W2VA 3PY8A 4NZ0A 1LWFA 2I1RA 3R2DJ 3NCPA 4WKRA 4C3LA 1FNMA 1NCLA 3HSZA 2WCXA 3IRXB 1S1XA 1VJWA 2HVDA 7FDRA 2KDOA 1WDTA 3E51A 5GAHI 3CCWA 3AHPA 1WKLA 1TAQA 3PG9A 3KNAA 2FJXA 8AT1B 3PFEA 2KVQE 5G4DA 3H2LA 1S1TA 2HGLA 1N56A 1YJ7A 4KTQA 4M8LA 3FK4A 5KFDA 2DIUA 2MEWA 1HWLA 2ZVSA 1FX2A 1V6HA 3MPWA 3HSDA 1HR0J 1R8CA 1RWOB 1X9SA 2AGPA 4F25A 3PNIA 3T5HA 2HNYB 1SKSA 2GQQA 4YB1P 1H2VZ 4CH1A 2KFZA 2IC3B 3QFWA 2YWWA 2DTJA 1RABB 2VG6A 4LFBJ 3ELHA 2AGQA 2QC3A 3ZTQA 4BCAA 3RR7A 4L73A 3CC2S 2FHMA 4NL5A 1N52B 5K9FA 2K8GA 2UXBJ 1B99A 1VOMA 1HBNB 1RLCL 4DG1B 3MM5B 2ZDOA 1I6JA 1F60B 2JL9A 4H4KC 3ET6B 2OPQB 1WC3A 3PJXA 3DHWC 4A48A 3QGIA 3LP2A 4ITSA 2HS4A 1K1SA 4KH0B 1RAAB 3M1VB 3GCXP 2DHGA 1HA1A 2RT3A 5J1EA 4KE5A 4OHVA 3BBFA 1TR0A 1Q8LA 2EFOA 2IRYA 1X8DA 5IV4A 1RAIB 1RBLA 5B0AA 3H98A 2HLTA 1LWFB 2J9CA 2J9DA 4MTPA 1UW9A 1OQ6A 2P8IA 3NOCA 1N36F 2BRLA 2E1AA 4ZITA 4U7CA 4Z7YA 1FNXH 4MK9A 3ZZUA 4OJHA 5AJ3J 4F4XA 2Y1RI 3KFWX 1C0UB 2ZNYA 3CULA 2KXHA 4ILRA 2QMUB 4ALZA 3DDKA 2QSWA 2MKSA 1PC4A 1YX2A 4KAIA 4QWDA 2LVWA 1MSWD 2LEPA 5G0RB 3MEEB 2WB4A 1UZDA 3S7RA 1KTQA 2G2OA 3C66A 4CNYA 3W2WA 2HRTA 2ABYA 4O3QA 4IOCQ 3OW2R 1RAOA 5A8KB 4KSEB 1C0TA 2WONA 1SCJB 3D5MA 4R8UA 3QT7A 3KJNB 3QIPA 2AP6A 5K8PA 2MKJA 2RKIA 4WWSA 4O4GB 2ZBQA 5IT0A 1JJ2R 3OVBA 3VV2B 3P5BP 3MR6A 4JI3F 1R8PA 1TKTB 1RI7A 1G1XA 3O6QA 5KG7A 3V6HA 3A8JA 2VB6A 2CNLB 3DRYA 2M88A 4RBTA 4JYAJ 2UXCF 5KFMA 4F02A 4KPCA 1TUVA 3DHXA 1AUSL 3QT6A 3MEKA 2XLKA 1DTQB 1IBKF 1JXLA 4KO0A 2M0GB 2OMLA 5EWFA 1C2PA 1TL5A 4RWWA 2R2TA 5J2QB 1T8EA 2AX1A 1T3NA 2K06A 3DLJA 4TU8A 5I3UB 3QRPA 1EIYB 1YBUA 1SB6A 3T5JA 2ALZA 4ELVA 5J1EB 2RIJA 1VC0A 2RQKA 2BXJA 2UUCJ 1VLYA 1LWEB 3MEGA 3IR6B 4N41A 4TU7A 2ADCA 4CNZA 4H4MB 1F1BB 4V19J 3U27A 3KHRA 3OR2A 4NOHA 1N6QB 2BJ7A 4NCGB 3ZZZA 2KHCA 3CDAA 1TL3A 3CEDA 1YZ6A 2VJUA 4KB7A 2UZAA 3QSYB 2KRBA 1HQEB 1JXVA 2G13A 2P9CA 2VQFJ 2KXFA 3PX6A 5AE2A 1UL3A 1HWJA 1Q95G 4PYAA 2N3OA 1U1PA 4OYPA 3MEDA 3RB4A 2NXNA 4Y65A 4HHJA 2WONB 3WIUA 5D78A 1HMVA 5IWAF 1HBOB 1FKAF 2HQGA 5C2GA 2XWXA 4PQUA 1KWMA 1TL1B 4PRFA 1FRIA 4RW9B 3CT9A 1YZ7A 2W9CA 4JV5J 1URRA 4Q0BA 2IA0A 4NLVA 2QN6B 4NI2A 4I2QA 2DNZA 2OPSA 4RW6B 1QTMA 1H2TZ 1HW8A 1X4GA 2XYPB 2D9PA 4JI0F 1CSJA 3O5TB 3TARA 3K0JA 1WEYA 3TZZA 4TY9A 3BM7A 3G82A 1X9MA 2Z4PA 2ZH9A 3I32A 4CQ1A 2D3O1 1FEHA 4ES3A 2MQMA 2AV5A 2IM3A 4UQGA 3FQKA 2CPIA 2OFGX 2F1FA 3TVKA 4DR1F 2A18A 1VRTA 1EP4B 4CP5A 4DL7A 2BZ2A 4KC5A 4ED8A 1VJQA 5IV3A 2K1RB 1SC4B 3VAIA 4WP8A 2IBKA 1RAHB 1YWXA 1VQKS 1WWHA 2HVIA 4DL2A 4AQYF 2DNQA 2XO6A 3ENQA 1T94A 1TU0B 2L9NA 1XTZA 2Q79A 3HFVA 1ZA1B 4ZLJA 4P6QA 1SKRA 5HMYA 3DGPA 3X3UA 2ZVIA 2ACYA 5CHCB 3P3DA 5LMNF 2HFSA 1YGYA 1M5PC 4K4YA 5D4NA 4Q8EA 1HWIA 1PAUB 1T0TV 1RHRB 2KU7A 2JEGA 1FEEA 5LL6d 2GHVC 3TZXA 5F9LA 1REVB 5AT1B 2OPPA 2Q6BA 4C8MA 1N33F 3TUPA 3EGVA 2P5VA 3QLHA 4F8RA 4DV4J 1OWXA 4LFCF 4RO0A 3HVAA 4KH1B 4BBYA 2BBEA 3GSIA 5D8HB 3MEDB 3TEHB 4RNHA 4RNMA 1RTDB 3UW1A 1Q7LB 1SBRA 2U1AA 1LW2A 2AJ0A 3HZEA 3PHEA 2I9SA 1RK8A 3BGOP 2D7SA 3QPIA 3RAXA 4TY8B 2DNMA 4DQPA 1UVNA 1SI9A 1RBAA 3FSYA 2XQCA 4QIGA 2R7UA 5DZ6A 5KG2A 4MYTA 1DQ8A 2OPSB 2PI4A 3BR8A 1N48A 2L9WA 3SFGA 3KMSA 3GV5B 1JLQB 4CYUB 2Y1LB 3DLEB 4QWBA 3UN2A 3TUIC 2O67A 4LSLB 1WKJA 1F5BA 4NLPA 1RTIB 3FBCA 2C3PA 3F56A 4LF8J 3SCLE 5I42A 2DO0A 3Q8VA 1C4CA 2DXEA 1S10A 4YB7A 2VFUA 4Q43A 5ETOA 4DMZA 3QYYA 5BXIA 5LSOA 1HBUB 3J81U 2XI3A 2CQHA 3QO9B 4M63A 1T9XA 4LIRA 5CAAA 4Q2LA 1Q82T 1V9OA 2KB2A 2B6AA 5KTQA 4IO9Q 3W5YA 1FESA 4TLRA 3V6DB 1C1CA 4O23A 4DZDA 3LPEA 2EG2A 2O01C 2NYIA 1W25A 2J9EA 1YSJA 5LOQA 3I87A 3CCES 2B56A 1HBMB 4K0KF 1S76D 2HWHA 4F4YA 4ZKAA 3ETOA 3ZFVA 2V8DA 3T6JA 3MMBA 3KLHA 2MY7A 4FYYB 1S6QB 5M2PA 3T5LA 1VR6A 2WBMA 4DU8A 1O8BA 1KHVA 4OJGA 4WFYA 5E3RA 1HQUA 4CLKA 2N7CA 2NS1B 2B0GA 4LF4F 2FLPA 1IKYB 4DR6F 2ZC3A 5ETMA 3C14A 5DLGA 1F9HA 2YNHB 3HPOA 1HI0P 4YR0A 2NUHA 1V3SA 2ZWPA 3CCZA 3FVYA 2FYXA 4P71A 2DISA 1LOUA 1UVMA 4NLOA 1S0VA 3KK3A 2DNKA 2GC8A 4KHPJ 2ZUAA 4OYBA 1CJVA 3UNYA 2VBZA 3GCWP 3V5RA 2FHJA 5HAOA 4LRCA 4I7FA 2RHQB 5A8WA 2VFSA 2LEAA 2G9OA 2R7VA 2BQUA 2F63A 5HJYA 5KG3A 2B6AB 5K5MA 3PW5A 2XBPA 3R27A 1U1QA 2MLYA 1NLKL 2PDAA 4WPAA 1UKUA 2FQQB 4F0MA 3CCTA 2UV8G 2XY5A 4CTAB 2V8GA 2VPYB 3RRKA 4ED3A 2QL5B 3IN5A 3NRBA 1Z2LA 2F5GA 2CNKB 3M9NB 2DGVA 3W64A 2WOMA 3OJSA 1P8GA 2N4CA 4HHHA 4QOTA 1KKHA 4MK8A 3CDUA 1WF1A 2XMWA 2AZ3A 4CO0A 1TK8A 4UY8T 4IDKA 3JB9k 1PYSB 4OL8A 1UVKA 3UVJA 4R0JA 2J5AA 4FYVB 2DGUA 4IO1A 3I9V9 4NLRA 3CCUS 3WQPA 4DPTA 1NDKA 1JK9B 2JWNA 2YQ1A 3ETMA 2DT9A 1JLEB 1LWXA 4HLBA 1GXTA 2GVZB 4NYOA 2L08A 4CZCA 4RUCA 1WSRA 4OZLA 4HH1A 1XN9A 4UTGA 2ZHBA 2WVCA 2R8JA 2VKZG 4OYXA 3THVA 3J81j 4M5JA 2V50A 2CXEA 2R7SA 1S0MA 4Y00A 1ZS6A 2GMHA 3Q8RB 4M94A 2EBGA 1LWCA 5KFQA 5D3GA 1IBLJ 2CG8A 4WK1A 2ZBIA 3NG8A 3U7JA 1N36J 4CO5A 1IQTA 5D4PA 2D3ZA 2HLUA 2PMWA 5IC6B 2KI2A 4ZOSA 4UUXA 2J0WA 2G0IA 1GFWB 3GSDA 1ZAVA 1EKRA 2XMJA 1I3OB 4DXLA 1JJHA 4PG4A 4XDDA 4DFKA 4R0EA 4OQJA 4QWCA 2K7KA 5DG8A 4M5MA 2FVCA 1HYSA 2WW8A 2DPJA 3MECA 2CAJA 2V9WA 4HTIA 2IM0A 3VAMA 2EXUA 2XHWA 1R7IA 2DY9A 1GTEA 2KFYA 1RWXB 2HG4A 1KD1T 4MKBA 3Q86A 2ZD1A 3MOJB 4ZCIA 2ZZMA 5KFEA 1PSDA 3A3NB 2MKHA 4C8KA 2H65B 5IC4B 5AXKA 4JI3J 4WU2A 1O5JA 2IJRA 2JEJA 2W01A 4ZP8A 1S49A 2DNYA 2VU5A 2HZAA 5DRKA 4AXJA 4KGXB 3HKZD 3FFIA 2R7QA 2O5DA 2R2RA 1GXUA 3MAAA 4I6WA 3K57A 1FT8A 4FYDA 2UXCJ 4RZRA 2CPEA 1MG7A 1IBKJ 3D54A 4A8KA 3E2EA 1HPZA 1OSDA 3VR1A 3I31A 3CCSS 1WNEA 2XLIA 3UI3A 3KLFB 3LUYA 3TOQA 1ZM3A 5CYMB 3FBBA 4IRKA 3OFEA 2C2RA 4I4BA 4ETXA 3X1LB 3D7SB 2HHHF 3D6TB 1DRZA 3BR9A 1MNEA 1RWMB 1K8AT 5L9XA 4ZCKA 5F3ZA 3IAS9 1LWCB 1M1HA 3T9NA 2VKRA 3RAMA 3DLLQ 3RB6A 1VRUA 4J9UE 3ILLA 4CLYA 1W7WA 1TMMA 1RJJA 1IUJA 4KY3A 3JSMB 2IYIA 4LF7F 2RQCA 1ZAXA 3OD2A 2GQCA 1VBXA 2GVDA 2KL8A 4WTOB 1WF2A 4U8VA 5KG0A 5HATA 4LRAA 2GS8A 4J9OA 3HI9A 2BE2B 1GEHA 1S9EB 1SQEA 4L75A 2R9LA 1C1BA 3CCQS 2MHNA 2J7WA 2ZC4A 2ERRA 2Z56B 3CJQA 4D3GA 1SIZA 1XNRF 4HL9A 1KR4A 5JMNA 3H4BA 1QVFR 5K8NA 4CO3A 2XWYA 1HNVA 1TKXB 2BEFA 1U0HA 2ROGA 3C6TA 4FPRA 4OI2A 3TUJC 1I94F 2V6AA 3CVKA 3G6YA 3AJ2A 3GJQB 1IWGA 1IBCB 2I8EA 3GB0A 2RQ4A 3DM2B 2XGQA 2GJIA 5K14B 5T7LA 3K7RA 3D68A 4NLYA 4L76A 1HNXF 3GTYX 3IBFB 1RT1A 4OI6A 5KFHA 2V4JA 4NCBA 4JI0J 3PDNA 4IG3B 4YR3A 1GNKA 3N6MA 2DGWA 1URNA 3D9BA 1VRQC 2XYHB 3BPDA 3MR2A 1ZTWA 3D67A 4UY85 2J6UA 1EQMA 2XNQA 4C11B 3VAFA 3O1LA 3VZIA 4PYDA 4DI6A 2OPRB 2Q3PA 4ZLPA 3QJLA 2Y0SD 1KSPA 1PBUA 3I0SA 4N47A 1FJ7A 1T03B 5HVHA 2ZH7A 4RUAA 4AQYJ 3HHEA 3UE2A 4S0MA 4JV2A 4J9LA 3OSPA 3KKFA 2DD8S 3SZ2A 1O6XA 2UVRA 5KOWA 3NAHA 1H7WA 2HGMA 1FVSA 1GT8A 2LU1A 2QA4G 4ECWA 4HT7A 5DGBA 2GVDB 3HD2A 2QRRA 2VL1A 3DRSB 1VHIA 1YLXA 3KNGA 2AQ4A 1U6ZA 2YKNB 3GYGA 3T1YF 1A9NB 4RJVA 2MGZA 2D69A 2AJ1A 2ZBRA 4NLQA 1LK5A 4OX8A 1S0NA 3MFHA 2UU9F 2CADA 2JFKA 1N5YA 1UWBA 2O1PA 4ZPBA 4YDXA 5LJ5Y 4JI2F 4LF5F 1NM2A 4FDFA 2RD5C 2EFNA 2M5YA 1WHVA 3UR3C 4EFAC 1NKBA 1QD1A 4IG0A 3G4SS 4DV0F 5T7LB 4WU3A 4E2FB 2B9EA 2HPUA 1LEOA 3F41A 2HHPA 5CABA 2XCPA 4C3MA 3DRPA 3H4DA 4NX9A 2YXLA 3CJKA 1WEZA 4MKAA 4DQSA 4OLPA 4USUA 1KQFB 3IGVA 2J0XA 3JYTA 1MW7A 2KKHA 3D28A 3M4XA 4DR4F 4USVA 5KFKA 4CLLA 2HS0A 2C22A 4YB6A 3MF5A 1RHUB 1HLWA 3Q2SC 3FUYA 2ASYA 2BANA 3L7UA 4K7QA 5DQHA 4F3MA 3TZYA 2GHWA 3EYZA 1E6YA 2F4FA 4ZHRA 3FCVA 4W4MA 4RW8A 4FYXB 2IVFB 5GADU 2DYAA 2WSEC 2YWGA 4OX9J 2CIMA 4A8MP 3PTWA 3TO8A 4JI5F 1KVKA 1DURA 3K89A 3MURP 5HP1B 2HURA 4FXVA 1SJ3P 2XMMA 1FKOB 3MD3A 4H4KA 5B0FA 1Q79A 1SL1A 2AKWB 1IJEB 2FUG9 2WSCC 2WVEA 3LOUA 3T41A 1CJUB 1IKVB 1RAJA 2M52A 4CLTA 5GVQA 3HJFA 2NR0A 1H0HB 2MLZA 4K0KJ 5D0GA 3I56S 4F4WA 2HK3A 1WORA 2VA2A 2YBVA 4DV7F 3EVWA 1AZSA 4C98A 4DS4A 4C8ZA 3CE8A 2RRNA 2DR9A 2F7VA 4UQTA 4WFNQ 2YNIA 5I4MA 2AHOB 3QSIA 2YKAA 3JTNA 2BM1A 1TK0A 3GONA 1LK7A 2GA7A 4MFBB 2VF3A 1KC8T 4ID8A 4B3RF 3O2IA 2CNNB 1LNQA 1ELOA 4LF4J 5KFTA 3PX4A 4DR6J 5ETPA 4P2XA 3P4UB 4FXDA 1HNWJ 3N5BA 2D41A 3MD1A 1CPZA 4OIXA 3DFEA 1WSVA 2J6SA 1E6VB 4ZIVA 1GXLA 3M6UA 2NYHA 5J2NB 5F0UA 2B7BB 4NYPA 5CD4A 4KKOA 2NXJA 5DLFA 2MKKA 3MHYA 3TZWA 4UF4A 4IFYB 2DR5A 4AL5A 1UWAA 2MXYA 2C3MA 1U25A 1NH7A 2VUGA 1REGX 2JC0A 2E7XA 1NPRA 4ZIWA 1BQXA 2G1HA 3H5UA 1SJFA 3QATA 5D4LA 3DOKA 1VK8A 4ED7A 1HW9A 2IVYA 4O44A 4CLWA 1S77D 1U48A 1WI6A 1UFWA 1VMBA 4JI1J 5K8OA 4M5DB 1F3FA 1RKJA 4JI4F 4B9MA 3I4HX 2DNLA 3K58A 4LIWA 4O0NA 1CS4B 2CDRB 3HHLA 3BQ1A 3FJ2A 1WC5A 3W61A 1U2FA 5IM0A 2WVBA 4A46A 3KJVA 3AJDA 5LMUJ 3OTOF 1AZSB 5LT5A 2OTJS 2CJBA 1M1GA 2EC0A 5HVGA 2JVOA 2DR8A 4X66J 4WFAQ 3IXQA 4NLSA 3LW5C 1DTTA 4QBUA 2WBRA 2CZVC 1XMQF 3DMJB 3MM6B 5D77A 4F4AA 2GO8A 3C16A 1X5OA 3ZTPA 2F40A 1DJ0A 3BN7A 2K3KA 3EXCX 4NA2A 3OT9A 1A7GE 3AODA 4B3TF 1TZ0A 4M5LA 3R6GB 3VQTA 1ZZNA 4DV1J 3W5XA 4U9RA 1OJ4A 2J9DE 5RUBA 2OSRA 2JH3A 1VLOA 4DR3F 3NNAA 4Z37A 4WE1B 4OJ3A 1K9MT 4J9KA 1ITPA 3QT5A 3DI6B 3SSSA 1BXNA 1WACA 3GYNA 3G6XA 1ZYQA 3AA8A 4DSKA 3DNCA 5LXRA 4IRDA 2VG5B 3LWLA 4FNIA 1CJKB 2VQEJ 3PXGa 3A8KA 1L3SA 3OTBA 3TRGA 4TN2A 2DH9A 3MCNA 1M0SA 4P74A 2HQDA 3DRXA 4F67A 3AAWB 1P1LA 4RWXA 1ZAWA 1NRKA 2LYVA 3EGNA 3OL6A 4X65F 4FXWA 5BYQA 1B64A 1N5VA 5ETNA 1HNZF 3DYAB 4DR5F 4ZPTR 2EFPA 3FCWA 1KBRA 5KFWA 3MOZA 2E5HA 2WZ1A 2DGSA 1F9FA 3PYGA 2H1YA 2PSZA 4ANDA 5H9EK 3DOMB 2DJWA 1I1GA 2GJFA 1IM6A 4WK3A 1RACB 4PPDA 1S1WB 4PWDB 4KV8A 2XB2D 1NHVA 4WYLA 3TQ1A 5F9NA 1X5PA 2Q43A 1GK8A 5F8IA 3LGHA 3HD1A 1U26A 1LW0A 1JLAA 3OPKA 1N0VC 3C16B 2W8LA 3HSJA 3TR5A 2RH3A 2OSQA 1AXQA 5DM7Q 1AB8A 3QFHA 2IAJB 3CDWA 1UVLA 2HNZB 2YWFA 2FJEB 5J1PA 3M6VA 1PJ7A 1U8SA 3N6NA 3BJYA 4QPTA 4CIOA 4CM2A 2B3TB 3DOLB 4CI0B 1M5HA 2AYEA 1FRXA 2BA9A 3U1LA 1Q81T 2P2CB 1PKUA 3JQKA 3VGSA 4Q44A 4RUBA 1SIWB 3EZOA 2GCFA 2Y3YA 2F9DA 2W8KA 4ZVEA 1SQFA 3R1HA 3TNVA 1S5ZA 1ZTTA 1CULA 1D09B 1NDPA 3S01A 5E3CA 4NPOA 1AROP 2DGQA 2HHSA 3CUNA 2OHDA 1DBDA 2DNRA 3ZO7A 4QWAA 3KOAA 3M8PA 3O44A 4NCAA 3LGMA 3R9LA 3NY0A 3E8OA 3W66A 4LFBF 3ILOA 2HQFA 2AJFE 1FI4A 1FERA 4IFVB 4BWMA 4TKTA 5GMDA 2WVFA 1XNRJ 4G1QB 3AXMA 2XYGB 2KT3A 3KLVA 1RWUA 3H25A 5HMZA 1Q78A 1SH0A 2NPFA 5C42A 4USKA 4B3MF 4TQRA 3IFEA 3H5XA 5EUHA 4QR1A 3MDFA 1I94J 2AIRB 3J7ZT 1JJ4A 1OIAA 3N5FA 2MY8A 4EMDA 2E7WA 3PRDA 2OD4A 3UN5A 1RTHA 4A8FA 4CCHA 2QEXS 2Z0GA 3A8IA 4X4OA 5KT7A 2JHEA 4ELTA 4J90A 5A76A 4DSEA 1RWNB 2QFJA 4DFMA 2G0CA 5C25A 2QZ8A 3POTB 1WF0A 4B9UA 4CT8A 1MROB 4DPYA 2M4MA 3MM9B 3KLEB 2AYGA 3U02A 5HBMA 5D0RA 2HHTA 1R43A 5D4OA 3CCVS 3M9OB 3R7NB 4WIQA 3WHIA 1RT7B 4YR2A 2G0JA 5L1KA 3GLJA 1QM9A 4JV0A 1CLFA 1JKHA 4GC7A 1Q4RA 5CQGA 2PEBA 3H7HB 4KIAA 2QFIA 2B5JB 3CCJS 3IBCB 1FHTA 3WC0A 3TA0A 3ICLA 2ZJRQ 3GPAA 4HHUA 3UR0A 3U1MA 3BBBA 2HMIB 1S1UB 2LQJA 1FTRA 5C24A 4JBCA 2QLXA 3SBMA 1JQGA 3K2YA 2RU9A 4LRFA 1SUQA 4H4OA 2GV1A 2ZH4A 1VQ7S 2KZMA 2BVZA 4CT9A 1N4LA 5ETLA 3R5JB 4Y0FA 1D8ZA 2RRBA 2FIUA 3I5CA 3RJMB 1RDRA 2UU9J 2DGXA 3I96A 3SQGB 1NDLA 1MN7A 5FLXY 4JI2J 1JXEA 4QCLA 4LF5J 3D1OA 3NBPB 1FNOA 4X4SA 2EFGA 2LCWA 3FEYB 4KR0B 1GMWA 4QU6A 1DZ5A 2ZE2B 2UUCF 5KFCA 1WOSA 3CW2C 1DY3A 4DV0J 4ENOA 1D9DA 1RAFB 2YKMB 5HQ8A 2BE7D 4MIAA 1NHUA 3N79A 2ZH1A 4BS2A 2CQBA 4ZVHA 2VFTA 3RGIA 2CJQA 2CPYA 3RBZA 1FX4A 3GU0A 4DR2J 5DJBA 2C3UA 1EZZB 5EHHA 3OXFA 3DGVA 4X4RA 3GFXA 4YP3A 4DR4J 1H74A 2OTLS 2UUWA 3UCUP 3IGNA 1A6LA 4IUFA 1S59A 3NGRA 2QYGA 3KG0A 2KYZA 2QJ3A 1RP5A 3MCSA 4DDFA 4O3RA 4OHWA 2KT2A 3KYLA 1HWUA 3OUYB 4ZJQA 1B0TA 2LECA 4QIWD 2LA4A 3NWGA 2OLWA 4JI5J 1H7XA 2XGPA 2DCLA 3P96A 1U1LA 2YNGA 1N5TA 5KFBA 4ZPVR 4OYIA 3UCZP 3R5GA 5ETSA 4K4XA 3GIIA 5C24B 4P7VA 4WJBA 3M32A 4DLGA 4IH6A 5HROB 1XERA 3LALA 1NK0A 1J5EF 5KFGA 1WELA 1BGXT 1RT3A 3HSGA 3AXKA 2GMJA 5KFPA 3H2UB 3KHHA 4ECQA 2EPIA 2BJDA 4ZP9A 2RAQA 1F9EB 3MM8A 2HZCA 5L9NA 3NCQA 2Y8WA 4WZMA 2IMOA 4ED4A 3PM9A 1WTBA 2YVSA 4BDPA 2E5JA 3UDVA 1WOPA 3PACA 2H54B 5KFZA 1S4FA 1T95A 4XIUA 2ZH3A 3VQSA 4N8OA 1OPIA 3FRYA 4X62F 4ZVOB 4ZK7M 1VQ9S 3KLGA 1M5KC 1KTVA 1NU4A 2HFNA 1VFJA 3JQJA 4LF6F 3RU0A 3R5CA 5KFRA 3W1YC 4J9MA 3KK1A 2HBRB 3RBDA 4XDCA 1QVGR 3IS9B 1NJXA 1UEKA 4USWA 3HLUA 1VQ8S 3ZZOA 1HNIA 3C8YA 2ZEJA 2GHPA 1BWVA 1HHQA 2MQLA 5GADI 3SDEA 4IOBA 1GAOA 2WB1D 2CWXA 1LFPA 3ZZPA 1HD0A 1G2EA 5CCLA 3DXBA 2OKQA 1JNZB 2RSQA 4DUZJ 2W7PA 2PT0A 4PG8A 4W90B 2AX0A 2WAQD 4M5GA 1EETA 2EEYA 4Y2IA 3MR7A 5HVFA 1OYEA 2OEMA 5KFNA 1RHJB 4JI4J 3QJPA 2UVUA 2HHQA 4EBDA 3GG0A 1U2CA 5B0BA 2ASJA 2AJ4A 1FWPA 2CRLA 1TELA 3W7BA 1VQPS 5EDWA 1NBEB 9RUBA 3S1TA 3ILJA 2CQPA 2V2KA 2DEIA 3OTOJ 1ROFA 1M1KT 1Z1ZA 3CSKA 2XSJA 3FKBA 4KGVB 2E9RX 1TQLA 2CVEA 3BGRA 1YJTA 4QYRA 4WXOA 3SCKE 3GIKA 1QUPA 4F4ZA 2FHOB 1XMQJ 2Z30B 2V0NA 2GGPB 3BKFA 4HACA 2RMLA 4UUWA 2RQMA 2RB7A 1U09A 2CQ2A 4YN3B 2ZOGA 2M70A 1R0AA 4CO4A 3IMQJ 4X2BA 4PG5A 4C3KA 2MQQA 1FKPB 3I5AA 3SCIE 5L39A 1LXJA 3GR0A 1EX8A 3KK1B 3SV3A 1R0CB 3H40A 1WC4A 2CPHA 1GX5A 1XNQF 4O3SA 1RCOB 4BLGA 5D6GA 2Z8QA 4Z2XA 2VH7A 2M7SA 1JLCB 5A6PA 5DDPC 2K7JA 5KT4A 1VIOA 3DLGA 4QR2A 1JLBB 2CQCA 3V81A 4ER8A 4LF9J 2R7RA 3WDOA 2X51A 1JIHA 3BF4A 4O0IA 4DEZA 4KFBA 2QV6A 5E3AA 3SSRA 2DK2A 2XULA 4F2SA 4WIIA 3CD5A 1EETB 2FJDB 4O3NA 2RE1A 3UDEA 3PVXA 3KHGA 3MM7B 1UA1A 1GMWD 4F50A 3TJ9A 4X65J 3I0RB 1MU2A 5U47A 2JLFA 4OYWA 2F8HA 1RT2A 5KG5A 3V6KA 2GZOA 5HO4A 1HNZJ 3PHTA 1FCAA 1WHXA 1AFIA 1XMOF 5J2MA 2RF2A 1VIXA 3NXZA 1R6VA 3OR1B 4G1PA 1XK8A 2OUGA 2AJ2A 2ZM6F 2MZTA 1UVJA 3IG1A 2DH8A 3CIMA 5ETRA 1WJ9A 2G2YA 2HNDA 1TKZA 3PYEA 2RNEA 2EBEA 2ZH8A 2JC1A 1U1RA 3N28A 4KHPF 1UFKA 2OJ3A 3BKUA 1S9GA 4KJIA 3ITHA 2Y0BB 1YHQS 4WF9Q 2QYCA 3TQEA 4DL3A 3MFIA 4R5PA 1CC8A 3LAKA 4M5IA 4EO8A 3Q8PB 3HMJG 3VVUA 3SYZA 5ETQA 1JLFB 4DF8A 5T14A 5CYQA 1X0FA 5CCMA 4ZVSB 5LSLA 2VIHA 3W9JA 2CDQA 3ISNC 3NS5A 2CQ3A 4ECVA 4HT5A 3PYFA 2FB0A 1RT6A 4P2FA 2ACMA 2ZUGA 1P1TA 4M5HA 4ED6A
chains in the Genus database with same CATH topology
5DO2A 3RAMA 3K5NA 2O66A 1CQNA 3DLLQ 5JJBA 3RB6A 1VRUA 2A1BA 3GQCA 3AJ1A 3D2WA 3CD7A 3SEOA 2WK4A 3GILA 4NXMF 1NJZA 1VQ4S 1RJJA 1HFEL 5KFIA 3GV8B 1ZZFA 2VPZB 3SFUA 2XS5A 4GO5X 1IUJA 4RUHA 1S6PA 1S7HA 2EK6A 2HRYA 4XPCA 1JX4A 3JSMB 1GX6A 5B08A 1KVJA 2IYIA 4C4WA 3IS9A 4YQWA 4LF7F 2ZJPQ 2RQCA 3T6BA 1ZAXA 3LP0B 2GQCA 1VBXA 4WCEQ 2VQFF 1NK8A 1WF2A 2B9WA 4X4VA 5KG0A 1JNRB 5JUMA 4ECZA 4EZ9A 4Q2MA 1D9FA 3CO9A 4OZJA 5F8GA 2YNIB 1OS5A 4I2PB 4J9OA 3HI9A 1DFDA 2BE2B 3JSBA 3M2VB 1S9EB 1SQEA 1RT4B 2R9LA 3J7A1 1KFSA 4AE5A 1C1BA 3CCQS 2KVIA 3TA2A 2MHNA 4RBVA 3LP1B 3D0HE 2J7WA 2ZC4A 2ERRA 2P6SA 3VTIA 5DM6Q 4H54A 3PV8A 3MI7X 4D3GA 2P6TA 1SIZA 4IH7A 2WSFC 1RT2B 3OHBA 1XNRF 4EUVA 3NKYA 2BV3A 3KLIB 4EWTA 5BJRA 2XG8A 2JSXA 5AE1A 4HL9A 3FMWA 1KR4A 3RTVA 1SC6A 1D8YA 2FVRA 3H4BA 1R27B 3QGPA 4DSIA 1AW0A 1QVFR 5K8NA 4CO3A 4DL0C 2XWYA 3BQ2A 1HNVA 1TKXB 2E1MC 5L38A 2YNFA 4XAKA 4ZPAA 3FRZA 5KFVA 3OV7A 2LU2A 2MQPA 3CWJA 2ROGA 1S1VB 3C6TA 4FPRA 4N76A 4B3OB 5T41A 4K4ZA 4OI2A 2B7CB 3LGNA 2ZKUA 3TP2A 4JV5F 3HVWA 3OVAA 3TUJC 4HVZA 1L3UA 4GC6A 1I94F 2X1GA 4CTAA 1J5OA 3PR5B 3CVKA 3IWLA 4A8XA 3G6YA 3AJ2A 2MSTA 2E1CA 2X1FA 1BQMA 2I8EA 3GB0A 3LANA 4M1KA 2RQ4A 4D3HA 3DM2B 4KKOB 2XGQA 4QW8A 1S72S 2GJIA 5K14B 4ZPWR 5T7LA 2DNPA 3AA9A 3K7RA 4NLYA 2JLGA 4NLUA 4AL6A 4DSFA 1HNXF 1RT5A 2F4VF 1RT1A 1X4FA 1ZM2A 1S9GB 4N77A 1IBLF 3UDLA 2UVWA 2MHEA 3W2VB 4OI6A 5KFHA 4NRUA 3OFFA 3V4IA 3TANA 3FEXB 1TVRB 2V4JA 1VQYA 4NCBA 2E5IA 3E3XA 2WHOA 3PDNA 5B0EA 3KMQA 2PD1A 4PXEA 1X5TA 1NK9A 2R4FA 4IG3B 4YR3A 3H59A 3LAMA 5IFMA 2YKOA 1FJEB 1GNKA 2JFDA 4PKDB 1N5QA 3N6MA 1P6TA 2DGWA 1URNA 1HD1A 1S0OA 2XI2A 3M2UA 4C8LA 1B0PA 1WD6A 5FDLA 2JEIA 4LF9F 4OZ0A 3MR2A 1ZTWA 2KTQA 1XC9A 4IR9A 1S1XB 3BSOA 1BWEA 1F5CA 4UY85 3IA0A 1RQ0A 4ICLA 3M8RA 4DFJA 2ASDA 2J6UA 3OTEA 2LMIA 3DOKB 3G6VA 2KHDA 2XNQA 4C11B 3VAFA 5L8RC 4O44B 5I3QA 3M8SA 3O1LA 3VZIA 2D9OA 2YTCA 3HDSA 1UJ4A 1VQOS 2OPRB 3O3LA 2D1CA 2Q3PA 2QO3A 4ZLPA 2D3OR 3QJLA 2Y0SD 1U47A 1KSPA 3G8TA 1BLUA 1MWYA 1G6BA 3I0SA 3MMAB 1YJWS 4N47A 1YVFA 1FJ7A 1T03B 2GGPA 1JLEA 4HDGA 2ZH7A 1VQSA 5MAOA 4RUAA 1JB0C 4DS5A 3DU5A 4HDHA 3HHEA 3UE2A 3OSNA 3I82A 1S1TB 1UJ5A 2YH0A 4JV2A 1K1QA 4FVMA 4C0BA 4LVNP 5K8MA 1TV6A 3US5A 4NLXA 1PC5A 5L1IA 4J9LA 2R7TA 4QIVA 3OSPA 2LLZA 3TA1A 4A8SA 2XNRA 1XWLA 3KKFA 3PKYA 2DIVA 2DD8S 2PC6A 3SZ2A 3HHLB 2ASLA 3ISND 4ETZA 2MZRA 4ZVFA 3THTA 1FKPA 2CG4A 1SJ4P 4WXWA 2UVRA 5KOWA 1FDAA 4QJVA 3NAHA 4F3OA 5IM0B 2OAUA 1H7WA 1NJIT 4X4UA 3JSRA 2HGMA 1FVSA 1N5SA 3EZUA 4HEA9 1Y3JA 3J7Z5 2C2EA 3KJVB 4OZ5A 1GT8A 3MAQA 5KT6A 1D9AA 4FVCA 2LU1A 2N3LA 5F41A 5HN0A 1RA7A 1X4EA 2QA4G 4ECWA 4HT7A 2ZITA 5DGBA 2ZHOA 4AYBD 1FVQA 2QRRA 4TYAA 5CZXA 3WC2A 4DWIA 5DG7A 2VL1A 3DRSB 3BREA 4DV4F 2KN4A 5IQQA 1DARA 1N32F 1C4AA 3I5BA 1KS2A 4WFBQ 1JLCA 3KNGA 4ECXA 2HHXA 5L1JA 1U1OA 1Q7YT 3L09A 2AQ4A 1U6ZA 2YKNB 3M30A 1NAQA 1RTJA 3T1YF 2E9ZA 1UP1A 1QSYA 2VG6B 2FTRA 1KLMB 1FRJA 1FTCA 3ISZA 2LQ5A 3PJWA 1DTTB 3ZC4A 5DG9A 1A9NB 4L6V3 1JLBA 2MGZA 4DFPA 1U45A 2AJ1A 5EX3A 4DF4A 2FJVA 1VQ6S 3H2VE 1VQNS 2X1BA 2R8GA 4NLQA 1KQSR 1LK5A 4OX8A 3S8SA 1S0NA 1V3RA 3JTPA 1SH3A 4QWEA 2VG7A 2KZZA 4Q45A 2BACA 4NA3A 2WTFA 3MFHA 2J7KA 1XBWA 2UU9F 2JFKA 2W4PA 1UETA 1N5YA 1UWBA 2NUUG 3FSIA 2O1PA 3FNNA 2QIFA 3KG4A 2HHUA 2IFXA 4N56A 1SV5A 4ZPBA 4YDXA 4NMLA 5LJ5Y 3LF0A 4JI2F 4A8WA 3JAMY 3BSCA 4ECSA 4LF5F 1APSA 2RD5C 2EFNA 3LP2B 2M5YA 3MR3A 3IRWP 4OHZA 1U1MA 4CO2A 1WHVA 4USHA 2QLWA 4K4TA 3MM7A 5F8JA 1VQLS 4N5SA 1J5OB 3L7OA 2J6TA 1DLOB 3UR3C 2R7OA 3BO2A 4EFAC 3I0RA 1FDDA 3FMBA 4GMKA 1OQ3A 1TL4A 3LWMA 2MKIA 2IA6A 4ECTA 3GFHA 5HLFA 1NKBA 4IG0A 1HARA 2LDIA 3G4SS 1N88A 3GR1A 4DV0F 3M2RA 5JVHQ 2V4RA 3TW0A 5GAEI 3CMAS 2UXDF 5T7LB 4WU3A 2PFFB 2KT5A 1RT5B 5HMXA 1QLNA 3C46A 2L9DA 2HPUA 4GKJF 3OLBA 4OI3A 2ZJQQ 2AJQA 4OZ1A 4NXNF 5KFXA 3V4IB 4IQXA 2VBXA 3F41A 2FVPA 1H2UX 2HHPA 3SMZA 1G3OA 3OR1A 2XCPA 3VWSA 4RW4A 3D0IE 4C3MA 2CQDA 3DRPA 1KRPA 1UJ6A 2QMXA 1GH8A 2FJAB 3H4DA 3TAQA 4NX9A 3CJKA 1WEZA 1X0PA 2W7AA 3M2UB 3N01A 4MKAA 2APOA 4OLPA 4DPOA 4EYHB 4DQSA 3DDNA 1KQFB 2AW0A 3IGVA 2J0XA 3PEJA 5IZHA 3JYTA 1YJNS 1SJRA 3NAIA 4DLEA 1QUVA 4LF8F 1MW7A 2BJEA 3AQPA 2KKHA 4ICLB 3D28A 2QSFA 4PPZA 3G86A 4URSA 4Y34A 3M4XA 4DR4F 3PZPA 3VAJA 5KFKA 2R7WA 4ID5A 2HS0A 2C22A 1FE4A 4YB6A 1FDBA 3T5KA 3VAGA 3E01A 3MF5A 3QMQA 1VK3A 3Q2SC 2CPJA 2ASYA 2BANA 1FRMA 1YITS 3DLKA 3F44A 5AXLA 5L1LA 5B0GA 1YJUA 4KHRA 4N8NA 3QGHA 2EWHA 5DQHA 4F3MA 3TAMA 3NMRA 2GX8A 2GHWA 3MPVA 3EYZA 1VGYA 3MTKA 3M8QA 4C8NA 3HT3A 1E6YA 3K5PA 4ZHRA 2BABA 1RYSA 2XS2A 3W2WB 4J9SA 1TFWA 2NZ4A 4RW8A 1U7LA 3H5SA 2HW3A 3RRHA 1SJ1A 3IR7B 5F8LA 4ZPCA 2VC0A 3VZHA 4OX7A 2IVFB 1O51A 1JLFA 3KLFA 1RYRA 2VBYA 3CJ5A 4MIWA 1C0TB 5GADU 5CYMA 2WSEC 3HX9A 2YWGA 4R8UB 3MPYA 2HQ3A 2CIMA 4A8MP 2OMOA 1RKIA 2XMUA 3QIPB 3TO8A 4JI5F 3AB2B 4K5RA 1BC6A 4NWBA 1JLGA 4MAKA 3Q8SB 1KVIA 1FF2A 2RKIB 1DURA 3N6LA 4J9NA 2KFNA 2JX2A 4ZP6A 3L3CA 4EZ6A 3MURP 3T3FA 5HP1B 5CD4H 1H98A 4FXVA 1SJ3P 2XMMA 3HK2A 1FKOB 3MD3A 4H4KA 5B0FA 1Q79A 2DHSA 5EGYA 4QR0A 5EX0A 2HWTA 4FF1A 4EBEA 1SL1A 1IJEB 4Y2MA 4KV8B 3CTRA 2FUG9 2RS2A 1IQZA 2WSCC 1KLNA 1N34F 1S6UA 3ZZYA 3PR4A 3TI0A 3LOUA 1MMDA 3P6YC 1IKVB 1WTFA 3HO1A 1RAJA 2E29A 3V6JA 3HFKA 2M52A 3CB4A 2CVIA 4NYZA 5GVQA 5M2UA 2PN6A 1TFYA 1LFWA 3HJFA 2NR0A 1H0HB 4HTJA 4QYZJ 4LJMA 1LW0B 5LJ3Y 3GFYA 4X4NA 4ZA1A 2XCAA 1U1KA 1JLAB 3HHDA 3R5DA 2IRUA 3I56S 3CPWR 4F4WA 3JSMA 2PA8D 3VAKA 2VG7B 3TAPA 2YH1A 2CQIA 4BC9A 3RB0A 3BGUA 2J76E 2VA2A 4DV7F 4C98A 4DS4A 4C8ZA 1YJ9S 4DV6F 3KTQA 4FBTA 3CE8A 2FVSA 2RRNA 4KO0B 2DR9A 4YDDB 2CKWA 2F7VA 3MMCB 4UQTA 1W2IA 1NJYA 4WFNQ 2YNIA 4USJC 4I2PA 5I4MA 4BWJA 2BE2A 3M2VA 3GG1A 2YKAA 1S9EA 3ENVA 1YIJS 1FO1A 4LVOP 1RT4A 3JTNA 4NZ7A 2BM1A 1TK0A 4PG6A 5GAGU 3LP1A 3KG1A 1LK7A 1FRHA 2IJFA 2BUNA 5E7OB 2GA7A 4MFBB 2CZ4A 1ZPVA 4F3QA 1KC8T 4ID8A 3KLIA 4B3RF 5A8RB 3O2IA 4MH8A 4ZCLA 3M2RB 3JSYA 4RW7B 5F8NA 2MYFA 1ELOA 2HWIA 3VALA 5AXMA 3KWMA 5KFTA 3PX4A 1KQGB 2UUTA 4Y2KA 3MEGB 4I56A 2IYGA 1TKXA 3C3LA 2VODA 1M90T 2XC9A 2F9JA 4FXDA 1S1VA 3N5BA 3RAQA 2RDJA 3OR2B 1U6BA 5H9FJ 1HHTP 4RX6A 1TL3B 2D41A 2VPXB 3OLAA 4PG7A 3K8WA 2J0SD 3MD1A 1VC5A 4OIXA 3CC7S 1CPZA 3DFEA 4K59A 3ULHA 3ENWA 4LT6A 1PO6A 3CCLS 4XK8C 2B9XA 2MKCA 4R25A 2J6SA 1E6VB 3QWUA 4WTYA 1TK5A 3M6XA 5THWA 3DM2A 1GXLA 2WRMA 3DC2A 3M6UA 5F0UA 3BGLA 2B7BB 4NYPA 5J2NB 3K5OA 4KKOA 3ZZTA 1LQ9A 3Q2TC 5DLFA 4K4WA 5K14A 4KBIA 4ERDA 3TUZC 3PX0A 1QE1A 1IXKA 1UEUA 2MKKA 1FK9B 1UEVA 3MHYA 1TAUA 3W2VA 3PY8A 1U2RA 3M8PB 5KFAA 1TVRA 4NZ0A 1LWFA 2IM1A 4IFYB 2FJBB 4RU9A 2DR5A 4IG3A 2I1RA 3NCPA 3Q22A 4AL5A 4WKRA 2MXYA 4C3LA 2C3MA 3TAMB 1U25A 1L3KA 1NH7A 4ES2A 2VUGA 1FNMA 3VAHA 1IBMF 3M8QB 3BQ0A 2JC0A 2E7XA 2WCXA 1BQXA 3IRXB 2XZWA 1S1XA 4I64A 1VJWA 3UQSA 3H5UA 2LEBA 1SJFA 3R1LA 5DS7A 5D4LA 2JLEA 3CJ4A 3DOKA 1VK8A 1NK4A 4C11A 7FDRA 2KDOA 4ED7A 1HW9A 2IVYA 3E51A 4O44A 1HMVB 2CPDA 5F0WA 5GAHI 2RJZA 3CCWA 1S77D 3AHPA 2OPRA 1HI1A 1U48A 3IWNC 1TAQA 4PQUB 3KNAA 2PEHA 3GWCA 4C0HA 3MMAA 2FJXA 3G8SA 1KEKA 4DQQA 1U49A 1WI6A 1T03A 5C42B 3PFEA 1UFWA 1VMBA 1MMNA 5G4DA 5K8OA 3MUTP 4L72B 3H2LA 4LFAF 2W9CB 4IH5A 4M5DB 1S1TA 1WEXA 2GQ2A 2HGLA 3G96A 1N56A 4Q0BB 3VF0B 1RKJA 4JI4F 1B7FA 4B9MA 5MLCV 3I4HX 4KTQA 4M8LA 2DNLA 2VOOA 5KFDA 2ZOMA 4I2QB 4LIWA 3K58A 1F2GA 2B4VA 2DIUA 3CD6S 1HWLA 2ZVSA 3EZ5A 2HAIA 3W3SA 4MKYA 1W2BR 3HHLA 3BQ1A 3FJ2A 1V6HA 2F8EX 1X4CA 4BC7A 3MPWA 5CXTA 1RTHB 2O3DA 4P2SA 3HHKA 1X4BA 4HI2A 1U2FA 1R8CA 3IO1A 5IM0A 1X9SA 3J7YU 4USIA 2ADBA 2AGPA 4A46A 4F25A 4DHVA 3KJVA 3CGIA 1K0TA 2M8DB 2E5GA 2EVZA 3PNIA 2YQ3A 3OTOF 4Y2CA 3O8WA 5LT5A 3T5HA 2HNYB 1SKSA 2OTJS 2CJBA 5B09A 2EC0A 1XR5A 2KRRA 2L41A 4C2MA 2JVOA 3DRSA 2GQQA 5C25B 2E5LF 4K50A 4YB1P 1H2VZ 2DR8A 3I9ZA 4CH1A 2KFZA 2IC3B 2MZQA 4WFAQ 4X4TA 3IXQA 2ZH2A 2YKNA 2DTJA 4MIBA 4NLSA 2L3MA 3LW5C 2VG6A 1KLMA 4G6VB 5HBMB 1DTTA 4QBUA 1GQEA 2AGQA 2RILA 4FP9A 2WBRA 3B78A 4BCAA 1VRTB 3RR7A 2CZVC 2XSFA 2YKPA 2FHMA 4NL5A 3CC2S 3PW4A 1XMQF 3DMJB 1N52B 3MM6B 5D77A 5K9FA 4DN0A 5DDRC 2K8GA 4LQ9