1WG4A

Solution structure of rrm domain in protein bab31986
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
GSSGSSGGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKDGMGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords HYPOTHETICAL PROTEIN (RIKEN cDNA 6030486K23)
publication title Solution structure of RRM domain in protein BAB31986
rcsb
source organism Mus musculus
total genus 12
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1wg4A01
1HA1A 3CCJS 2RQCA 1SJQA 2LMIA 2G4BA 3G8TA 4IO9Q 5GAHU 1YI2S 4IUFA 2RS2A 1DRZA 2CQ3A 2E44A 2EK1A 3VAIA 1U1NA 3UWTA 5FJ4A 3CCQS 2YTCA 1ZH5A 4UY8T 2DGOA 4WKRA 4PKDB 2E5GA 1FJEB 1H2TZ 1A7GE 2MJUA 2HZCA 2NLWA 3VAMA 3VAGA 1Q82T 2K8GA 1WHXA 5DDOC 2QEXS 3UE2A 2CPJA 4C4WA 5DETA 4QQBA 2DGTA 1L3KA 2AYGA 1N88A 2OSQA 2MB0B 2DNGA 2ZJRQ 3TO8A 2RS8A 1URNA 2M52A 2DGSA 4WFAQ 1U2FA 3R1HA 2M7SA 2KFYA 2CQ1A 2OSRA 1WWHA 2RQ4A 3CUNA 1N8RT 3B4MA 2XSFA 3LQVA 3CCRS 1WEZA 1OIAA 1U1LA 2N7CA 2DNRA 1AUDA 2DGQA 2GHPA 4TU9A 1VQ7S 1KOOA 1WG1A 3G4SS 3NNHA 1FT8A 2XS2A 3CTRA 1Q7YT 1H6KX 1KOHA 2FHOB 2MQMA 3ULHA 4C7QA 5IM0B 4IOCQ 1YJ9S 3P5TL 4Y00A 3CCVS 3BO2A 3MUVP 2L9WA 1S72S 3SDEB 2MY8A 1VQPS 2D9PA 1XN9A 2DITA 3HI9A 2E5IA 3TYTA 2ADCA 2DGWA 2JX2A 1WEXA 1DZ5A 4YOEA 2J0QD 4QU6A 3DLLQ 5GAGU 1M5KC 2K3KA 2CPZA 2MGZB 2GO9A 3EGNA 2MSSA 1B7FA 2XNQA 3J7ZT 1VBZA 2YH0A 2JVOA 4CIOA 1WTBA 4OZ1A 1WF1A 2KXNB 1NJIT 2MQLA 3OW2R 4TLQA 2VODA 2V94A 2B0GA 2D3OR 1WHYA 1FHTA 1P1TA 2RU3A 3CCMS 2JVRA 3MD3A 5IM0A 2DNQA 3UCZP 1KC8T 4J5OA 1HD1A 4C0OC 2M8HA 3Q2SC 1KD1T 3SDEA 5LSLA 3I55S 4LIRA 2CQGA 2KM8C 2RRAA 2CJKA 1VQ5S 3N9UC 2DIVA 3MD1A 2MKJA 1X4FA 1Q81T 1S79A 3NNAA 2MGZA 1DBDA 2YKAA 1OWXA 2HVZA 4PR6A 5ITHA 4F25A 3MDFA 2LEBA 4Z2XA 1U1PA 4IOAQ 2DISA 3L3CA 5GMKa 1Q86T 2PEHA 3G9CA 2KU7A 2MKHA 2F3JA 1R8HA 2J0SD 2MPUA 4P6QA 1VQMS 4FXVA 2N82B 2MKKA 3VAKA 3MXHP 4A8XA 3CPWR 1UFWA 2MZJA 4TU8A 3MURP 1VC5A 2LYVA 5D77A 5HL7Q 2CQIA 1VQ4S 2DH7A 2HGMA 2WBRA 2F9DA 2E5JA 3Q2TC 4WFBQ 2OTLS 2VONA 2OJ3A 3NS5A 1U6FA 2MQPA 3CMAS 3SMZA 2YH1A 2RUGA 5DDQC 1VQ6S 1X4EA 2CQPA 2DHGA 2RRBA 2FC9A 3U1LA 3G6ES 5EN1A 3CCLS 1X4DA 1VQ9S 1VQKS 2FY1A 1ZZFA 2DNZA 1N52B 5H1SV 1M90T 3PIPQ 1NU4A 4UQTA 3EX7B 1U1KA 4PRFA 2LXIA 2JWNA 2DNOA 1X4CA 5LJ5Y 3R27A 3DXBA 2U2FA 2M8DB 2AYMA 5LXRA 2LEAA 1U1QA 2DH9A 1KQSR 3SXLA 1VQLS 5LSOA 2FC8A 2KHCA 2KI2A 3MUMP 2CQHA 2J8AA 2LXUA 3FEXB 1YJWS 1WF0A 1M5PC 2MKCA 4W92B 4W90B 2KM8B 3VALA 2QFJA 5JVHQ 1K9MT 1X5PA 4WCEQ 1WHWA 2XS5A 1FXLA 3NS6A 4U67Q 1FJ7A 3EGZA 3H2VE 2MZTA 5BJRA 2G0CA 3BO4A 1VQ8S 3VAJA 3G8SA 1UAWA 5CYJA 1VQNS 3D2WA 5LJ3Y 2DNKA 4F02A 3U1MA 1YWXA 2E5HA 2VOPA 2KYXA 1VBXA 1JJHA 1VC6A 3UD4P 4V19X 2DHSA 2CPIA 2DIUA 3B4DA 3CXCR 3VAHA 2DHXA 1WG5A 2CQ2A 5GAEU 2DNMA 3LPYA 2DNHA 3H2UB 2KXHA 1U6BA 3CULA 1M1KT 3THPA 2OIHA 3BEGB 3ZZZA 1X0FA 2L08A 3RW7A 3IWNC 1YITS 1H2UX 1CVJA 1WF2A 1OO0B 2DNYA 2LA4A 2FPHX 2ERRA 1H2VZ 2XNRA 1RKJA 2DNNA 2DGUA 3BO3A 2CQ4A 1R8PA 1HL6A 1DHMA 5IFMA 2DNLA 3I56S 1YHQS 2CPDA 2JRSA 2LKZA 2MKSA 2MQOA 1K73T 2MZRA 4TU7A 2Q79A 2KXFA 3CCES 1D8ZA 1U1RA 1NO8A 5HO4A 2BZ2A 2MHNA 2KG0A 3US5A 2HGNA 3UCUP 2MJNA 3P49B 2DB1A 1PO6A 2VOOA 1RK8A 2DK2A 3CCSS 2CPEA 4ERDA 3THTA 1SJ3P 2LECA 2KN4A 2KT5A 4F26A 2NZ4A 4CH1A 2M2BA 4YB1P 3S01A 5DM6Q 2M88A 3J7YU 1X4BA 5JVGQ 3NMRA 2M4MA 3CMES 2LCWA 2X1BA 5IQQA 4WFNQ 1WI8A 1SJFA 2RNEA 2O3DA 2U1AA 3IRWP 1K8AT 4YUDA 3ZZYA 2AYBA 5GVQA 3RW6A 1VC0A 3MOJB 1VQOS 2LQ5A 2MKIA 1X4AA 1W2BR 2KVIA 1M5OC 3FEYB 5DDPC 1UW4A 1WHVA 2CPHA 2LA6A 3VF0B 3UD3P 2SXLA 1SJRA 3CF5Q 3JB9k 3CC7S 5CA5A 3BS9A 4LMZA 2KRBA 2CQDA 1FNXH 2QA4S 1D9AA 2MQNA 1JJ4A 2I2YA 3CCUS 1UP1A 2YWKA 3S8SA 3G71S 2M70A 1X5TA 2F9JA 3P3DA 2CQCA 2MSTA 3S6EA 1SXLA 2KRRA 1IQTA 2ADBA 2AYEA 2N3LA 2DH8A 2RT3A 3V4MA 4ED5A 3P6YC 1JMTA 4CH0S 3VAFA 1YJNS 5DM7Q 2MY7A 1FJCA 5D78A 1ZZNA 2X1FA 2D9OA 2MYFA 1FO1A 3CC4S 2DNPA 2MQQA 3PIOQ 2KG1A 2I38A 4LJMA 1WELA 2N3OA 2HYIB 2M0GB 1QVFR 1U1OA 4EGLA 2EVZA 2DHAA 1X4GA 1X4HA 2AD9A 1QVGR 1BY9A 3R1LA 3S7RA 2L41A 1VBYA 1G2EA 4WIIA 2CPFA 2HGLA 2ZJQQ 2RVJA 4RU2A 2XB2D 4WF9Q 2ZJPQ 5DDRC 2MZQA 5LXYA 3MUTP 3CD6S 3NNCA 2MMYA 2PE8A 1PGZA 2DGVA 2UP1A 1YIJS 2X1GA 1WEYA 4QPTA 1P27B 2A3JA 2G1DA 1M5VC 3MI7X 1A9NB 1QM9A 3HHNB 1WG4A 2CQBA 1JJ2R 4Y0FA 2J76E 3K0JA 2OTJS 2MXYA 2CPXA 2DO4A 4BS2A 2MZ1A 1F9FA 1SJ4P 2EK6A 2MZSA 4OZ0A 4ZKAA 2DO0A 4M5DB 3CC2S 1X5SA 3TP2A 1HD0A 2DGXA 5GADU 2X1AA 1OPIA 1U1MA 2BOPA 2CPYA 5CXTA 4QU7A 3UCGA 1X5OA 5MLCV 2CQ0A 4CQ1A 1O0PA 4FXWA 2M9KA 1N54B 1WI6A 2KH9A 1YTYA 2XS7A 3G96A
chains in the Genus database with same CATH superfamily
4U95A 1ZM2A 2P6SA 5GAHU 5U47A 1Y00A 2R4FA 3VGSA 3PM9A 3HLUA 2HWTA 4OJ1A 4DS4A 5AE3A 3ZO7A 2DXFA 2AYGA 3LGHA 3T5HA 3FBFA 1N88A 2OSQA 1WC1A 2VG6B 2XHCA 4HDHA 2MB0B 4H4OB 4ZPDA 3E01A 4GMKA 2DGSA 1U2FA 3Q86A 2OEJA 1LWXA 4RNHA 3W64A 1EP4A 4ZMMA 3NNHA 4E0DA 2OPQA 1BHNA 5IM0B 4IOCQ 5KFQA 1VJQA 1S72S 3W65A 2ZVIA 1NK9A 5A8KB 1T03B 2DGWA 2N7YA 2OKQA 1IKYB 2ZBIA 4B3SJ 3M32A 2K3IA 4A8FA 1TK8A 1UETA 3PO5A 3N79A 4WE1A 1GH8A 3CIMA 3UQSA 2ALYB 4OZ1A 2BMBA 4IRKA 1RU1A 2PGCA 1Z2LA 2D3UA 3J7YI 1RAJA 1FKOB 3VCDA 1X7VA 4NCGB 4C6AA 2GZOA 5KG1A 5D4PA 5A8WB 3CJ5A 2FLLA 3NRBA 5EX0A 1NAQA 4X62F 4YS2A 2K1RB 3AOAA 2HURA 4C3KA 3ILJA 4WU2A 1RT7B 3C15A 4HH1A 5I42A 4DG1B 2FVCA 2BJ7A 1UFWA 2ACYA 4IH5A 3EXYA 1VC5A 1KHWA 3W5XA 1B3TA 2GVDA 5HL7Q 4DPUA 2HEKA 3LPEA 4KSEB 2VONA 3NS5A 2IAJA 1HPZB 2J0XA 1KDNA 2JZ5A 1X9MA 3Q8VA 3FMWA 4MKBA 5A6WA 5CQGA 4UQTA 1IKWA 1YBUA 3J80Y 1NH7A 3R27A 4G1PA 4NWBA 2QJ3A 4M5NA 2R8IA 4Q7AA 2CWKA 4XIUA 3IGVA 2W9BA 4NRTA 1HNZJ 3KXDA 1C1BA 4F4WA 3WX8A 1PC4A 1HHTP 3GILA 3ZNUA 4NYOA 3IFEA 5BJRA 1QSLA 3EDQB 4JBCA 4RNFA 1TMMA 4DV0F 4TY8A 3BYPA 1U02A 1OY8A 5A8RA 5GAHI 5B0FA 2CPIA 3M4XA 1TAUA 2DHXA 5HSPA 3RU0A 1BQNA 4YN3B 5BR8F 4P52A 2CNKB 2DNHA 4CM2A 2DXEA 3PRVA 1Q53A 2VQEJ 2R3VA 4DV2F 2HSEB 1H2VZ 1ZBTA 2DGUA 1R8PA 5J1EA 2XMUA 3SFUA 2GMJA 2Q79A 1WC6A 1NHKL 2V4JB 2LLZA 4JI5F 1HWLA 4ZDNA 2GIFA 3H59A 4J9SA 4PXBA 3RYLA 2ZC4A 5KFTA 2DB1A 1REVB 4PAAA 2PI4A 2H4WB 2EKYA 2I9SA 1TR0A 4URQU 3T6JA 3CDUA 3ZFVA 2Q1LA 4LF5J 4WP3A 3CMES 1UVKA 1U2RA 1SIZA 4DUYJ 1K8AT 2GCFA 1F9HA 1N32F 1N5TA 1HQ2A 2YWHA 2KJVA 3TUJC 4CT9A 2OUGA 3FCHA 4Q45A 2IBKA 4OZ2A 4ICLB 5F0UA 4YQWA 2ZE2B 2NXNA 3HKWA 2Z4PA 3DLGA 1VK3A 3ZZRA 4FDFA 3MCNA 3SQOP 1AFIA 1R7IA 4ED8A 1RAAB 4AFFA 3KHLA 4IG0B 4X4TA 2R7OA 3GJSB 5HLFA 4EZ6A 4QR2A 5KT3A 5HQMA 1BQXA 3OL9A 3R1LA 4FF1A 1VBYA 1BE4A 1G2EA 1PAEX 5C42B 3NCRA 4RU2A 1WDTA 1FTRA 1K0VA 3KUHA 1KKHA 3G87A 2ZD1A 1XC9A 4QWEA 3OJUA 3F44A 5A8KA 2ASYA 1WG4A 3G82B 1IKYA 4I0WA 3KG0A 1ZTTA 4UF4A 3MFIA 1ZA2B 4I2QB 4F0KA 1C4CA 1WORA 4CQ1A 2M9KA 2GFFA 1RAEB 1F5CA 3G96A 3C66A 3MEEB 4WTYA 1MSWD 1YI2S 3MCOA 4NXNJ 4ZP7A 1ZM3A 5A8WA 3P96A 3MM6A 3SSRA 2ZFHA 4QQBA 2K1RA 3T5LA 4PG8A 4ZA1A 5HI7A 5HVGA 2OPRA 1QDUB 3CUNA 4DG1A 5C7PA 1VQ7S 2AJ4A 1QAYA 1DJ0A 1KOHA 2FQQB 4DV7F 3IM9A 3IRXB 1VQPS 4NI2A 2HW3A 4LBPA 3UDCA 4QU6A 2JC0A 4UT4A 1VIXA 1T9VA 2BJDA 3I4HX 2R2UA 3FBCA 4KBIA 5ETVA 1ZPVA 1WF1A 2J6TA 3BSAA 2YNGA 3I0RB 3Q89A 4AD6A 3CCMS 1RWOB 1SI9A 5E33A 1HNZF 1HBUB 2KM8C 4A48A 1JLFA 4FNIA 2DXDA 1U4BA 4ZPVR 4CO0A 2D41A 4J90A 3MDFA 4UZBA 3L3CA 5L46A 4I7FA 3KDOA 4LRDA 2P2CB 9RUBA 3QIDA 1FD2A 4FYWB 4Y2CA 4PWWA 3BGOP 3BJYA 5D0EA 1VQ6S 4QZVB 2DCUB 2BE9B 1NSQA 5EN1A 3ILLA 5ETRA 4ZVFA 3TAMB 5J2PB 3GYNA 1XNQF 2DNZA 2OFHX 5KFCA 2EXUA 1TU0B 5SUHA 4ZHRB 3T6BA 3ZTPA 2CJAA 1S48A 4LFCF 1REVA 1ZAXA 3EICA 3RRHA 1GEHA 3FEXB 4QIEA 1WF0A 3TAQA 2MKCA 5KFDA 3RB6A 2K7JA 4FF4A 2RD5C 3DYAB 1S6OA 1S1XB 4ZP6A 3QLHA 2VPXB 2UU9J 2YKMB 2ZDPA 3M30B 4X4QA 4NLSA 3EWGA 4ICLA 2CQ2A 1CS4B 1CJUA 3H2UB 3UFCX 3DI6B 3THPA 4K4ZA 4PWDB 3L7UA 3LP1B 4MYUA 1S1TB 8ATCB 3HKZD 2E9ZA 3KLHB 2JRSA 2VJVA 3MR6A 2MQOA 4IG0A 2ZWPA 2VFVA 3BGUA 3ISZA 3PV8A 5L1LA 4PG4A 1L3SA 4DQSA 1PYSB 1RTHA 2KG0A 2JLFA 4ECZA 2J6UA 2Q3PA 1KTQA 1ZYQA 1J2VA 2GS8A 3THTA 4LRAA 1JK9B 1CSJA 2HAIA 1HQEA 2VL1A 2VFUA 3Q24A 3BR9A 4NLQA 4DL5A 1SJFA 1FRJA 1KVJA 2BUNA 5GAEI 2AJFE 1WHVA 3ZZUA 3Q83A 2UUAJ 1AZSA 5D0RA 2V2KA 2FIUA 1RJJA 3QJJA 4ECRA 4NLDA 4ZP9A 3BREA 1IKVB 3MEEA 3PW2A 2YKPA 3G71S 4L72B 2NUUG 4NA2A 1WSVA 5C25A 5D78A 3GV5B 3ZTQA 3CEDA 2V68A 1SKSA 3I4PA 2KG1A 2R9LA 5CABA 3GR1A 2LDYA 2EI5A 4CI0B 4NYPA 4N7TA 2IRUA 3W1YC 5D3GB 4JV2A 2ZJQQ 1FERA 3C3LA 5LXYA 4DLGA 1DQ9A 4I4BA 4OJGA 1JLEB 2QRRA 1ACMB 1RCOB 1T94A 2DT9A 4DJBA 2DO4A 3JAMU 4M1KA 4R25A 2VKZG 3DLKB 3TP2A 4W4MA 3LALA 1BWEA 4DR6F 3QGIA 2FJWA 1RYRA 4XDCA 3I0RA 1IJEB 3CCJS 2A2DA 2Y1LB 1FI4A 4RW6B 4B9UA 4KHRA 3QRPA 3CDEA 2XMWA 4NLRA 2BJ1A 4C8ZA 1RYSA 2VC0A 3VGVA 1XIQA 3EPGA 1NZ8A 1TL4A 2FYXA 2CA9A 2YQ1A 5L9NA 2AGPA 3WX4A 4K5RA 1WOPA 4KPYA 1EQMA 1JXVA 1Q7YT 2V4QA 2F8HA 3ADAC 1WKLA 3DRYA 2O01C 2WK4A 2W8KA 4JOUA 5MAOA 3A8KA 4RX6A 3TAMA 2JJ4D 2BKPA 4CM0A 2VODA 1TFYA 1NPPA 3IBCB 2E1MC 5ADZA 1Q8KA 1HNVB 1KD1T 1HNIB 4OHYA 1RHMB 3CDBA 3H7HB 3GJRB 2DRAA 1DBDA 2AF6A 3CO9A 1S1XA 1VLOA 3DM2B 4LRFA 1S99A 4DS5A 3G9CA 4PQUB 3FVYA 5A76A 2MKHA 6FDRA 3I0SA 4PWDA 2W4PA 5L8RC 1SB6A 3NGUA 1M1HA 5GAGI 4I1TA 4ES2A 3LP1A 2ZH2A 3L7OA 5DDQC 1FESA 3G8QA 1IVZA 3KLHA 2CVIA 4DPTA 4BC7A 3ILOA 4ED2A 5H1SV 2XLKA 4M5JA 3HSGA 1S0OA 1S0NA 1F5BA 2WSEC 2DNOA 1YKWA 4TY9A 1RHKB 3VVTA 1Y4ZB 1WUUA 4DUTA 4LR8A 3MUMP 1NK5A 1M5PC 1HNWJ 4LF6J 2C42A 2XS5A 5EUHA 2YX4A 4JI2J 1NB2A 3MEKA 4DR5J 5KFEA 3CJ0A 2QZ8A 2CG4A 2KKHA 2E5HA 3SQGB 1GXUA 1VC6A 2QLXA 2UUAF 4B9TA 1RXOB 1T9UA 3TX8A 2OIHA 1V3SA 1KFSA 4L76A 3RAXA 2ZC3A 1UZDA 3LGNA 3BKFA 4RBUA 1IBKF 2NSBA 4PCQA 2GVZB 1K73T 2KXFA 1UTAA 1V3RA 2KZZA 2MLYA 3BN7A 1RZMA 2R7XA 3QGGA 2VB6A 2N4DA 5D3GA 4LSNB 2J0WA 5K9FA 4B3MF 4K50A 1JLBB 4ZPCA 5L9XA 3I6PA 2P5VA 5DM6Q 4G3IA 2LCWA 3NGTA 2HNZB 2H4YB 3W66A 2HFZA 2UVVA 1VRQC 4ELTA 2V0NA 3GG1A 3QZ8A 3MR3A 1KP6A 4DV5F 3DC2A 1N5VA 1S6PB 2AZ3A 2P8IA 5KFSA 1Y5LB 1LK5A 4HEA9 4RNMA 2WONB 3CD0A 2JLGA 2DTJA 4KC5A 2W9AA 3H42A 5F3ZA 3JQMA 4Q43A 1DAXA 3LW5C 1JMTA 3HX9A 1SUQB 4BWMA 3GYXB 1EHWA 2HLUA 2Y8WA 4DV1F 3PR5B 3D3CJ 1R8BA 4P72A 3NBPA 3J81Y 5KFLA 1R8CA 1C0TA 1YSJA 4CCHA 2MMYA 4U9RA 1PGZA 1Q0NA 2ZBCA 5LL6d 1WEYA 5LMUJ 3OR1B 5CCLA 2ZZNA 5GMDA 2FJBB 4FYVB 1CJKB 5G0RB 2EK6A 3GZ7A 2XI2A 2DGXA 1Y7PA 4Y28C 1H98A 1DLOA 3KNAA 1NXIA 1O0PA 2IPOB 4NE9C 4KHMA 5EHHA 4J9OA 5LT5A 1PBUA 4N76A 1TV6A 1UFKA 2V63A 1J5EJ 2B56A 5ETMA 3HMJG 2HHWA 2RB7A 4O4GA 5L1KA 3OTOF 1V6HA 5L39A 4ZPTR 5KTQA 1C1CB 4O3PA 2L9NA 1RHJB 1E6YB 1H3DA 2Q6BA 4DHVA 4DV3J 2VA3A 5HBMB 2RS8A 2H65B 3I5AA 4WFAQ 2OSRA 1RTZA 3LQVA 3OSPA 4P71A 2QX0A 1F2GA 2GX8A 2B51A 1TZ0A 3BGLA 1FVSA 3NXZA 3CTRA 2WVEA 4C7QA 1JKHB 3D68A 1YVFA 4L74A 3CB4A 3OD2A 3O2IA 4DXLA 3AFGA 1GXTA 4P7VA 5KFAA 4NYZA 3ET6A 2Z30B 4UTGA 1UJ5A 1DTTA 1U26A 2YWFA 2G13A 3PTWA 1XNRJ 3FBBA 3A8EA 4MFBB 3HFZB 1AROP 1DURA 5K20B 2UUBJ 3N6NA 5HP1B 4P9SA 4X4OA 5DQIA 2HHQA 2YBVA 2M8HA 1NBEB 2A10A 3SDEA 4U8VA 1OS5A 3OXLA 4LF6F 3G6XA 3M8WA 1C0UB 3L4BC 1NK8A 4JI2F 1R27B 3FKBA 3BF4A 3OL7A 4F25A 1EAYC 3M8YA 1Q1KA 4TKTA 3SQGA 2QA2A 1RSCA 3G2XA 4P6QA 4LSLA 3OFGA 3BKTA 4ECXA 1I94F 2YNFA 3QPIA 4TU8A 2LYVA 1XWLA 2E5JA 4DU7A 4WFBQ 3M9MB 2VUGA 3NG8A 1S1VB 3G6ES 3J80U 1IR2A 1C2PA 2GVZA 1IKXA 1Q8BA 1VQKS 2NYHA 1TL3A 4RW8B 5M2RA 1Y5NB 3MGJA 3G86A 5FDLA 1U1QA 2B8PA 4ZPWR 1NJXA 4YP3A 4LSNA 3NY0A 4ZLJA 3MMCB 4LUBA 3HHDA 4YY3F 2WVFA 2DY9A 1X5PA 3NLCA 2XQCA 2PIIA 2MQ8A 3BPDA 5D6GA 3GCXP 1EETA 3QIPB 1JJHA 2W4DA 3B4DA 3VHQA 1AW0A 1HYSB 5DS7A 1G4CA 1S6PA 4I2PB 2FVRA 3NAIA 2BQRA 3QO9A 2IIHA 3RR8A 2G0IA 3K59A 2QFIA 1B0TA 5KFYA 2XGPA 2WONA 2ZZMA 3DOKB 2XMJA 1RWKB 4RUBA 3ONQA 2DNLA 1FRLA 4HL9A 4TU7A 1HQUB 2Z2LA 4ZCLA 1SUQA 3BH7B 2BZ2A 1NSKL 4KJIA 2HMIB 1NH8A 1YQHA 1IR0A 1RLDA 5AXKA 2UXBF 2WOMB 2VHGA 1RTIA 3JYTB 2NXUA 2BV3A 2C3MA 3BBFA 3KHGA 5KOWA 2CNNB 1IBLJ 1WD6A 2FGCA 3OR1A 4JI1F 3UD5A 1IUJA 4DEZA 3RW6A 1CJKA 2MKIA 1TL7B 3AT1B 4LBIA 3VF0B 3GLJA 4EU0A 2ROPA 1JNZB 3DGPA 1WKJA 1SC3B 4U7UD 2OPPB 3TEHB 2V4RA 4DR7F 5KT7A 1AYEA 3S6EA 1RT1B 3KHHA 1IQTA 1F2HA 5KG3A 2AJ1A 2XMMA 3L09A 4TQRA 4A8OA 1KLMA 3M2RA 4RBTA 3KK2A 4DV3F 2VKRA 2XSJB 2C2OB 1B7YB 4ECWA 1U2CA 3CW2C 2EFPA 2E7VA 1HWUA 2PMWA 2L41A 1RWNB 1U25A 5D0HA 3IO1A 4DV6J 2RE1A 2R7RA 2Q6CA 2RVJA 4ANDA 2R8GA 2ZH4A 1JKHA 2V8GA 2DGVA 2HIQA 2UP1A 4PG5A 4C8YA 1ZS6A 2XZWA 4YHHJ 2OMLA 1MLAA 5CYQB 2VPZB 5T41A 2MZSA 3MPUB 5KFRA 4FZVA 4U6PA 3CCZA 1XNRF 1U7LA 4MIBA 1OPIA 1U1MA 4MFBA 2E9RX 2CNLB 4QYZJ 2VF3A 1VJWA 2ZOFA 3N0VA 2GGPA 3M2UB 2RKIA 5E3CA 2Y3YA 3CJ4A 3OSNA 4V1Ak 3HT0A 2DGOA 2AKWB 2MJUA 2WW8A 3VAGA 1Q82T 1WHXA 1XTZA 3E8OA 2CPJA 4C4WA 4OX6A 4NLUA 1UEKA 2DNGA 4Y2MA 4KKOB 3LOUA 4OJHA 2M7SA 2KFYA 3KK1B 4ED6A 1Q8LA 3B8HA 1OIAA 2CJXB 2N7CA 1B4SA 2AX1A 4HTIA 2Y8YA 2FHOB 2HHSA 3MM9B 1M5SA 4O44A 5D4OA 1JXEA 2YNHB 3IWXA 1H0HB 1DZ5A 1RT6B 2J0QD 2F4VF 5A0YA 3V5RA 4NZ6A 3OHAA 3IC1A 2GO9A 1RHQB 2XNQA 4I6WA 3CDAA 4RW8A 1VCTA 4BHQA 4CIOA 4WFXA 4LF8F 1B70B 3TJ9A 4R8UA 2D3OR 1PBAA 4F0MA 3DDNA 3BDPA 2B9EA 4KV8B 4D3HA 3MWBA 1X60A 2RRAA 2RF2A 5F0WA 3IAM9 2HFVA 5DGAA 3Q8PB 1HWKA 3JS9A 3M7VA 2MKJA 1Q81T 3KLIA 4O0NA 2HRUA 2MPUA 1HYSA 4I2PA 3K5LA 4ZIWA 1UA1A 2P9GA 2P9EA 4JV5J 2IYGA 2BDPA 2QSFA 3CPWR 1S97A 2UUCF 2Q66A 2FY8A 3DOMB 3TJ8A 2OTLS 3H5YA 2YWGA 2RUGA 2KT3A 1L3TA 3O3LA 1HQUA 3QZ7A 4RLEA 2B5JB 3NOGA 2DVIA 3MMAB 2HQFA 3J81j 2JWNA 4BBYA 2FVQA 3BDEA 1ZAVA 4ECYA 2Q43A 2NYIA 3FFIB 4M63A 3H25A 2WVDA 1K9MT 3EVOA 3JSMA 4HACB 2FVSA 2V9KA 1CC7A 1HI8A 2Z2YB 1VQNS 4LF9F 3C14B 3HFVA 1OQ3A 3TQEA 3VAHA 5K8NA 4OYPA 4C8LA 2L08A 2HHVA 3WC2A 2UXCJ 3CE8A 3N5FA 1BD6A 4CLSA 5ETKA 4JUZA 1EIYB 2D74B 4RW4A 2FJAB 4G1IA 2ZBPA 4EUVA 4IFVB 1Y3JA 4IDKA 1TK0A 5HO4A 3D0IE 1N34J 2YKQA 3DOLA 2EFQA 3PO4A 4LF4J 3MFHA 4ANCA 4K4WA 4CH1A 4YB1P 2HPUA 1KRPA 2AGQA 2ZVSA 1D0EA 4CO1A 4YHHF 1WI8A 2RNEA 2E66A 4YUDA 5CYQA 2CIMA 4B9VA 3SIPB 4LF7F 1Q79A 5CCMA 5A2QY 2HNDA 4U96A 4DDFA 4J9UE 2HHUA 5KFNA 4O0IA 1LW0A 3SCLE 4OYOA 2F1FA 1M0SA 2QA4S 2C2DA 3S8SA 1NKBA 2NZCA 1GMWD 4EFAC 2IVMA 4YMEA 4RL1A 5DM7Q 1J5OA 4QWCA 3LTOA 1ZZNA 2HKEA 7AT1B 1TL1A 4OZ3A 2YQ3A 3TZZA 1XJWB 1FFGB 4KKOA 4EGLA 4DF4A 2AIRB 2XMVA 2EEYA 4DR1J 1C4AA 4PQAA 2NS1B 3TOQA 1FKPB 5F3TA 2HQCA 3MM9A 4QPTA 1N56A 1RT6A 1QM9A 5FD1A 1F60B 4JI8F 3IP0A 2J9CA 3DU6A 1N5SA 1FRMA 5AXNA 4OZ0A 1RQ0A 3VTIA 5JXSA 4X66J 1GFWB 1W25A 4LR7A 1TAQA 3LAKA 1N54B 4YB7A 3I9ZA 4KV8A 1ITPA 5KG5A 5F8JA 1DRZA 2CQ3A 3UWTA 4WXOA 2QLFB 1FWLA 4DR2J 4F4ZA 2QC3A 1A7GE 2K8GA 4Q0BB 2AW0A 2Y1RI 1D09B 3DHXA 1NZAA 4KR0B 4JI7J 1RB0A 4WPAA 1YRTA 3WBZA 1N8RT 4DSKA 4QW8A 4JV5F 4KQZA 4KTQA 3BSNA 1BXNA 4MMOA 3DOMA 3K5OA 1K44A 3P5TL 4PPDA 1CLFA 4C8KA 2DITA 2FHKA 3D1QA 4YOEA 1T9XA 2R8HA 3JSBA 2R7SA 2K3KA 1DARA 3ENWA 1RBOB 1VBZA 5HMYA 1UJ6A 3OW2R 4TLQA 3S1TA 4BDPA 2Z2MA 1QTNB 4KGXB 4DR4J 1QE1B 4C0OC 3W9HA 4LSZB 3UPFA 1RT3A 2H54B 3D6TB 2CQGA 5KAKA 3O44A 2DIVA 1GMUA 3MD1A 1S79A 2W1BA 4FF2A 4PR6A 5ITHA 2QLBB 4LR9A 3GJQB 3VV2B 3T1YJ 4GRSA 5J2QB 4M5GA 3EMTA 3GIKA 4ZN1A 4KHPJ 2UVWA 1T0TV 2C2ZB 4WZQA 2UXCF 4WXWA 3JQKA 2CQPA 4C8OA 3CCLS 2YXLA 5CAAA 3MHYA 1O8BA 2IRXA 1G3OA 2ATLA 3HULA 2CWXA 1NU4A 1MN9A 2VV5A 1K1SA 4LQ3A 3BH6B 5LXRA 2DH9A 2ALZA 3NGDA 4DSIA 2C2NA 4L73A 2J8AA 1JWWA 3KNGA 2XYGB 3LP2A 4LRBA 4W90B 2ABYA 2KM8B 3BQ0A 5M2UA 3NS6A 4U67Q 3I31A 2IA6A 1VQ8S 1GT8A 1UAWA 3NAHA 4NLTA 3EDRB 2ZM6J 4JYAJ 2VFSA 3UD4P 3CXCR 4X4UA 2KFNA 3NMAA 2VDIA 3RTVA 1S76D 3R7NB 2HHHF 1YITS 4NX9A 2IM3A 3W8GA 4DWIA 1HR0J 1RKJA 2IM0A 1GMVA 3M8QB 1QY7A 1DHMA 2JFDA 4A8WA 4MK8A 1TTHB 4HHHA 2CG8A 2MHNA 2MEWA 2CRLA 2B7CB 3UCUP 2FZGB 3EGVA 5LOQA 1CJTB 3N6LA 1S4FA 1HNXJ 3HHKA 4IOBA 2KN4A 1OYDA 2NZ4A 1Q5YA 4FPRA 1VRTB 2VBZA 3NKYA 2B6AB 5HROA 1IM6A 5D15A 4CLYA 4ALZA 3GIIA 2ZH3A 3IG1B 2O3DA 3IRWP 3W62A 4OI6A 3NOCA 2ZHBA 1W2BR 4ETXA 3C6UA 3FEYB 4X66F 1WJ9A 2KYZA 2QO3A 2FZKB 3IR6B 4WKYA 1N0VC 3H90A 1PC5A 3PG9A 1FE0A 2KRBA 2CQDA 5IWAF 1TKZA 4OZ5A 2ZKUA 2GMHA 2F7VA 4N41A 4QYZK 4Z37A 4EBEA 3V4MA 3OFFA 5RUBA 4EBDA 2MY7A 2P9CA 3A8IA 1ZA1B 3VZIA 2J7KA 3CD5A 5AXMA 3A3NB 4K4UA 4OZLA 3OLBA 4LJMA 3IAS9 3SSSA 1U1OA 2V2ZA 3V81A 4Y6IA 1FKAF 3FK4A 4I67A 4OV6A 3R2DJ 4MK7A 2I8EA 4AXIA 1O6XA 5DDRC 1QAIA 1VQSA 2ZH5A 3MPDA 1S9FA 2H5EA 4OX9J 2CQBA 2BM1A 2K7KA 2MXYA 2FLPA 1XR6A 1UPPA 1RHRB 2BOPA 3E01B 1X5OA 3FBEA 2CQ0A 1T3OA 1VQYA 1PG5B 4C11A 2V9WA 2R7TA 3DRSB 4GC6A 4H4KA 2OPQB 5BXIA 3CCQS 1O51A 3O1LA 1QUPA 2E5GA 4J9VA 2ZH6A 3HZEA 3EJMA 3UDLA 1FFWB 3AODA 2QEXS 4AYBD 3OVBA 1FTCA 2EC0A 4Q5VA 4WE1B 3DLBA 2Y0SD 4M5HA 3HHLA 4KHPF 1B99A 4K4YA 2A6OA 4UZCA 3CCVS 2R7VA 2C3UA 1RWVB 2ZITA 5C5JA 1WEXA 1R0AA 3EM1A 2HVDA 1H74A 2VQFF 4PUOA 2YKNA 4X62J 4GVLA 4EEYA 2YH0A 3VQTA 4ILMA 1FVQA 4AL7A 3C6TB 1F6TA 3RB4A 1NLKL 2B0GA 4ZIVA 1FHTA 3U1NA 2RSQA 3W5ZA 5I42B 2IY5B 3Q2SC 2BA9A 3HSDA 3KLFA 2GVDB 2IVFB 1FA0A 3SSQA 4F4AA 2PN6A 3A1YG 4DL2A 4J9MA 2OGUA 2H9ZA 2C3OA 2HVZA 1SJ1A 3OFEA 1HARA 4JYAF 1DQAA 3AAWB 2X3GA 2DR9A 2B4PA 1P1LA 5K8OA 4EI2A 2DEJA 4EWTA 2R8JA 4A8XA 5L38A 2F63A 4RW9A 4HHJA 3O6QA 3QQCD 3HVTA 3DN9A 2IVYA 2PA3A 3FMBA 3GE9A 3M05A 1C1BB 1U6FA 4S0MA 2FGOA 3M8QA 5IT9Y 2WHOA 4XK8C 3DLEA 4KH1B 4B3TF 3C19A 2BVZA 2C1EB 1REGX 3Q0AA 2X51A 1EJ7L 1U1KA 2GHVC 2BJ8A 1XQIA 4EYIB 1KQFB 3U7JA 5A8RB 2M8DB 2KT2A 1KSPA 4DZDA 1SIWB 4F3QA 1CJTA 1BQNB 4CLZA 5HJYA 1HNXF 2KI2A 4EO6A 4NLOA 2LXUA 4F67A 2H51B 1BWVA 4W92B 2UUTA 3BN4A 5J2NB 4ITSA 1XMBA 4DV2J 4DLEA 3WDOA 1FJ7A 1I6JA 4O4RA 4C8NA 4WZMA 3VAJA 2QLWA 5J1EB 2W25A 3N28A 1RADB 1JLQA 1VBXA 1V3ZA 4CLLA 2IBOA 4DL6A 1X9WA 4V19X 4MJKA 2MKYA 2Z57B 2IMWP 5DJBA 1QJHA 3E2EA 2E1PA 4USVA 2XHWA 4ZVEA 2X7IA 4KIAA 2NXEA 4ZK7M 2AU0A 1WF2A 3PFEA 1H72C 2ERRA 3HXMA 2D7SA 4XPEA 4C48A 4ED1A 1BQMB 2W2NP 2GA7A 2HVEA 2VFTA 1N32J 4IRDA 2C3YA 3PRDA 1U09A 2DK2A 2QT7A 3M9NB 5IT0A 3DLGB 4IH6A 1JLCA 3KUGA 1XERA 4B3OB 1NUEA 5HATA 5C2CA 4OX9F 2X1BA 1N33F 1PCAA 1LKZA 4DPWA 3T3FA 3MECB 5DLGA 5H9FJ 1NK6A 2BYCA 5HLFB 4RPFA 2AJ2A 1FDDA 4QYRA 3RAQA 4ZLLA 2QMUB 3LO3A 1JNRB 2ATCB 3CC7S 5T7LB 3H0PA 5DG8A 1RT2A 2HVHA 2COLA 3QWPA 2YWKA 3DRSA 2M70A 1FRHA 1UJ4A 2FJEB 5C2GA 3FCVA 3NL0A 2ZD1B 1R89A 4DL7A 1GK8A 1CPZA 1NK0A 3QGHA 4RKUC 2E9TA 2FHJA 3MMJA 1JLGA 4DF8A 2KJWA 2LQ9A 2LQ8A 2N3OA 1X4HA 2XWXA 1BY9A 3S7RA 1NRKA 2ASDA 1X0PA 1MWQA 2XB2D 1DFDA 3NNCA 2GC8A 1TKXB 1SL1A 2I6WA 1ZOTA 1A9NB 3ELHA 5DQGA 4U8YA 3HHNB 1WC4A 5HVHA 3HPOA 4X65F 3R5AA 4N56A 2LEPA 2DO0A 3MM6B 1HMVB 2HG4A 4C98A 2G2OA 4NLWA 3T9NA 1D8YA 3C6TA 1FWKA 3T1AA 2OPRB 3OXGA 9ATCB 1YTYA 4I64A 1HA1A 3KWMA 4ID8A 3G8TA 2XG8A 1CQMA 1U1NA 1FNMA 4DV7J 3JSRA 3HZGA 2RDDA 3HSZA 2NSCA 2NLWA 4NASA 4NI2B 3WZ0A 3C46A 2DGTA 4G6VB 1R0CB 3Q8UA 3F41A 3AA8A 4GKKF 2RQ4A 3JTOA 3PKYA 2DBBA 1VYAA 2YNGB 1F1BB 2RHSB 3IA0A 2GHPA 4F50A 2ZUAA 4NA1A 3ZNJ1 3MUVP 5IV4A 3AQPA 3GFYA 4EK2A 4J9PA 3AB2B 3TYTA 2JX2A 3JXOA 4MK9A 4RNNA 1JLFB 5GADI 3QNWB 1LWEB 1M5KC 2ZHOA 4TYBA 1K1QA 3I96A 3A13A 4WWSA 2MQLA 4CZCA 4I7FB 1TFWA 2V94A 2FZCB 5KFFA 1P9QC 1PKUA 2DNQA 4PG7A 1VQ5S 4UW2A 5J2NA 1RAHB 3EGWB 3JTPA 4DL0C 1X4FA 4ED7A 2YKAA 3OT9A 2LFVA 2FJDB 4IOAQ 3KUEA 1L3UA 4RUHA 3DGVA 1XNQJ 1ELOA 4TXSA 1UW9A 5FLXU 1OSCA 2KL8A 1FJGF 3MXHP 2ZDOA 4AT1B 2IYIA 1XBWA 3UNGC 2HGMA 4LFCJ 4MKVA 3BSCA 5DGBA 2JSXA 4PABA 1Y10A 2YX1A 5KFWA 1S9GB 1ZTWA 2E5LJ 2IDEA 1YK9A 5F8HA 1BQMA 3KLGB 5E7OB 1N52B 4OYWA 5K8MA 3QLHB 4PRFA 3DXBA 5CD4A 3KLVA 4NEZA 3VQSA 2UVRA 4C9DA 2LEAA 5KFGA 3SXLA 2HQGA 1R6YA 1CJUB 3CGIA 2QYCA 3AXMA 3Q8SB 1SQEA 2G2ZA 4X4VA 3POTB 2QFJA 1XMOJ 4B3OA 1JQGA 1IJFB 4WU3A 4B08A 4DN0A 3LUYA 4ETZA 1GAOA 5LJ3Y 5L1JA 1T9TA 2DNKA 3MECA 1SVDA 2KYXA 4KGVB 4PWUA 3SZ2A 3LWMA 1RTHB 4DX5A 2DY1A 3BEGB 3M8PA 5T7LA 4ZP8A 3LANA 2XNRA 4ZOSA 4GKJJ 2R7QA 1N36F 3CD7A 3H5SA 1HQEB 1U49A 2HK3A 2BBEA 1S0VA 1P6TA 2MZRA 3P4UB 4I6AA 5HAOA 1HWJA 1NK7A 3CCTA 4X4RA 3QYYA 3W3SA 1U8WA 2BM0A 3RBEA 3V2UC 4NZ0A 2HHXA 2HGNA 3BZQA 4ZCKA 1AZSB 1PO6A 1RK8A 1OYEA 5KT2A 2OPSA 2J5AA 1RTDA 5F8IA 2KT5A 4F26A 3MR7A 4YR0A 1QAJA 1TKXA 3BKUA 4H4KC 4NL5A 1SPBP 2W7AA 1TMJA 4IYQA 5C25B 1I51B 1HMVA 1IWGA 2CZVC 1W7WA 2AEFA 2VPWB 3A4TA 2KFZA 3MPYA 4PPZA 5KFKA 5KG4A 3UD3P 3UN3A 5L1IA 3UR0A 3NGKA 1SJRA 4USJC 3VR1A 4X64J 1MROA 2MQNA 4LVNP 3HHLC 7FDRA 5D4LA 5BYRA 1ROFA 5B0GA 5ETSA 3KG4A 1TP7A 2HFNA 5HN0A 1KVKA 2JEFA 5EWEA 3VGTA 2DNPA 3R8YA 3FC9A 3W2VA 3KHRA 1LXJA 5AJ3F 2KHDA 1RUSA 3DNCA 4DR6J 3PKMA 2FJVA 3CWJA 4QW9A 1YZ7A 8AT1B 4DSEA 5IV3A 2XY5A 4ECTA 3TANA 2XZTB 4X4SA 3R6GB 4DR3F 1RT5B 5F8MA 1LWEA 2FLOA 2CPXA 2D3ZA 3MPWA 2ASLA 4P74A 1SCJB 1RT4B 1X5SA 1ZPWX 3D5MA 2M5YA 1VHIA 3QMQA 4OX7A 4KB7A 3TZWA 4IO9Q 3U27A 3TWZA 1B0PA 4U7UK 5DG9A 2WVCA 1CULA 1SL0A 4PYDA 1SC6A 1D9DA 2DR7A 3PHEA 4P2FA 4DFKA 4EMDA 1S5ZA 5CHCB 1U6ZA 4HTJA 2R7WA 1TKTA 5IZHA 2E29A 2MQMA 4CYUA 5ETOA 5EGYA 1RA6A 2F65A 4M5KA 1NSAA 2QMWA 1S9GA 3R9LA 4F0HA 2E5LF 2JEIA 1ZAWA 3KLGA 3AD8C 2OMOA 4NLPA 5KG0A 1G6BA 1WTBA 2LDIA 3A12A 2WB1D 3F73A 2EBGA 4ZVTB 3D28A 4AQYF 3I0SB 3MMBB 1HD1A 3BYRA 2RQKA 4RJVA 5HMZA 3POTA 1XMOF 4QIFA 2AX0A 4QWBA 3CJRA 4YDDB 4FP9A 2LQJA 3PZPA 2JNJA 1YRXA 3OTDA 3MEGA 4GO7X 2CZ9A 4KY3A 3DRRA 3HO1A 2XGQA 2WBRA 2F9DA 2XBPA 3I5BA 3HCXA 2MQPA 4GKJF 2XZDB 1HLWA 4ES1A 3HJVA 1NDLA 1T3NA 3H5XA 1X4DA 2PI5A 1ZZFA 4ID5A 1RTJB 3CMQA 4IKAA 2BKOA 3HDSA 1KQSR 4CLFA 1IBMF 5E5NA 2PO4A 4NRUA 3BR8A 5AE2A 2EBEA 2VIHA 3CNQP 1VHFA 3KKFA 1UVLA 5D0GA 3BO4A 3WIVA 2IHR1 3IR7B 2XULA 4TQSA 1IBKJ 2CADA 1VFJA 4C3LA 5CYMA 2IJRA 3TUIC 2YPYA 2XMKA 1SKUB 1V9OA 1S9EA 5H9FK 2HRYA 4FYYB 5ETPA 2R7UA 4X64F 2KXHA 3CULA 2L9DA 2VBYA 2AQ4A 3OQ2A 4B3MJ 4DCJB 3QRQA 2QA1A 2QV6A 1GXLA 1HL6A 5AXLA 1EX8A 1SQGA 2A1BA 3W8PA 4YB6A 5D4NA 2FB0A 4FVCA 2DR8A 4OYZA 5HQ8A 4MT1A 4C97A 5B0AA 3JTNA 1RABB 4JI3F 4DV5J 4FPIA 2GW8A 2ROGA 2VOOA 3DFEA 3PW5A 4ERDA 3QAEA 5IT4A 1OSDA 3T9ZA 4USHA 4CLTA 2XTJP 5HMWA 1RT5A 1FD8A 3SCJE 2YY3A 2U1AA 4PEOA 2KTQA 1VC0A 2R2TA 1RT4A 4USMA 2B43A 5DDPC 1UW4A 5D8HB 3AD7C 4NLVA 3Q8QB 1YJUA 4I68A 1TQLA 3EE3A 4CTAB 2OHDA 4DV1J 2BX6A 1FNXH 2V8HA 5A6PA 3VZHA 1WNEA 3TX0A 4LIWA 2HAFA 3NBPB 1UWAA 4Q2MA 1C0TB 2CQCA 1RWXB 4RR5A 3AJ2A 3BGRB 3TZXA 2ADBA 1ZETA 4XO0A 4JI0F 1F5AA 2WZ1A 3QBCA 2V2QA 2D9OA 3CC4S 2LU2A 2CYYA 1MU2A 3GV8B 4ZVPB 1JIHA 2EVZA 1DLOB 3UN5A 3RGIA 3MUTP 4YB5A 1IM4A 3K5PA 2CAJA 3TA0A 4N5SA 1TV6B 1M5VC 3PY8A 1OMSA 3RB3A 4O4GB 3OTOJ 1IR1A 5IQ6A 3FJ2A 3TNVA 5B0EA 2OD6A 1N0UA 2GHWA 3M2VB 3O8WA 1HD0A 3C16B 1JLAB 3DRXA 1YZ6A 4Y2IA 1RCXB 2KH9A 3RBDA 1NMEB 2DR5A 3MMBA 1SJQA 2MLZA 2BJ3A 3EYZA 3IS9B 4UY8T 1EKRA 4LQ9A 3H5UA 1ZM9A 3DDKA 5DDOC 4M5DA 5H9EJ 5DETA 3ET6B 2RDIA 1DTTB 3R2CJ 1V5VA 3ISNC 4YR2A 2JDJA 1RE1B 1KOOA 1Q8IA 3G4SS 3NEKA 3HVRA 4Y3CA 1SKWA 2QGFB 4ZVSB 2UVUA 2Y1JA 3SDEB 4ZVRB 2E5IA 2V69A 2AZ1A 3N4WA 4BLGA 3M6UA 4Z7CA 1IQZA 1RTJA 2LP4A 3D0GE 4OIXA 4OJ3A 4LVOP 1WOOA 1NJIT 3GR0A 4ZVHA 3OTCA 1WHYA 1P1TA 4LSLB 4TYAA 1NHVA 1I94J 2G1HA 2YNFB 2HS3A 2XC9A 4QPXA 1MMDA 4UUXA 4CWBA 3TA2A 1DQ8A 4I69A 3NNAA 2MGZA 2NREA 1OWXA 4ECVA 2OI2A 2ZBRA 3B6BA 1IKXB 1TL3B 4A47A 2X3DA 3V6KA 4XTTA 3PR4A 2ZNYA 4RU9A 5FDLB 2BQUA 2YKOA 1K47A 5IT9U 4K8RA 3KJQB 4Y2KA 3BQ1A 3AOCA 4OI3A 1PILA 3LA0A 4YY3J 2YH1A 2DHGA 2E1CA 3RR7A 2UXDF 2DJWA 5K14A 3I87A 3G6YA 1KBRA 2FY1A 1FDNA 3PIPQ 3BGFA 1UMJA 1X4CA 2Y1IA 1EETB 2PMHA 4X4PA 2AYMA 2HLTA 4NEYA 1I3OB 3MTKA 3QO9B 2CXEA 3R5GA 4OHXA 4NOHA 1FF2A 5J1NA 3VALA 3KYLA 3H2VE 4B9MA 4FBTA 2MZTA 4L3KA 3QJLA 1CJVA 1RGVA 2AGOA 3X1LB 5B08A 2YPZA 3AH6A 2DNMA 3K5MA 2UXBJ 4CTAA 4M5LA 4Q2LA 2WSFC 1RTIB 3DRPA 3DXSX 1MN7A 4B9NA 4JP8A 1OO0B 3DCAA 2FPHX 1YGYA 2DNNA 2AV5A 4OZJA 2CQ4A 4OI4A 4JB8B 3BGRA 4QIGA 2CPDA 3CO0P 4JI1J 2MKSA 1ZM4A 2HS4A 3EVMA 3LH2S 5B7WA 1L5UA 3HM9A 1M1GA 4I56A 4K4VA 4A8KA 2Y9HA 1YG0A 3QT8A 3PX4A 2POKA 3OFHA 2VICA 3FSYA 2BE2A 2WRMA 3PFOA 3DGPB 4OMFG 3ENQA 2M2BA 1PJ7A 4FKXA 4ZLNA 4F3MA 2YNIB 1NDPA 1Q78A 2M88A 4DR7J 1KTVA 2AYBA 1S77D 1RLCL 3MOJB 1VQOS 5LMNJ 1KLMB 3M2VA 2ZH9A 3C16A 3V6DB 1JLAA 3M2RB 3KK2B 3FDSA 1RACB 3ETMA 5KFJA 3BS9A 4IQXA 3JSYA 5C24A 1Q7LB 4OLOA 1BGXT 5BYSA 3TI0A 3AA9A 4B3RJ 5F9NA 1S49A 3V4IA 3P3DA 5ETLA 3IS9A 3IMQJ 2DH8A 1RWWB 4CH0S 4O3QA 1FJCA 2BRKA 2EG2A 1RWUA 1PIEA 4OI2A 2H5JB 3PIOQ 2CJYB 1H7XA 1QVFR 1FDAA 2DHAA 4NMXA 3I82A 4TVAB 3MAAB 4QOTA 4ECUA 4WIIA 4F8RA 4Y65A 2NR0A 1RAGB 3H20A 4ZVGA 2B8QA 2P6TA 4GVBA 2PE8A 3MR5A 2GGPB 2RKIB 2R8KA 3UI3A 3AB4B 1AB8A 2J76E 2YWWA 1N4LA 2KVQE 1BUXA 2OP5A 4A8SA 3CC2S 2BW7A 3GG0A 3QJPA 4RW7B 3RRKA 2W2OP 1NKCA 2PEBA 5CXTA 3KK3A 4LBHA 2OH2A 1QD1A 3R7SB 4DN9A 1S4EA 3CDWA 4ATNA 2G4BA 1HHSA 1AUSL 3QSIA 2E44A 2HRTA 3T5JA 2E7XA 2O5DA 4O44B 4DCPB 4WKRA 4PKDB 3V6HA 2CJBA 3R5CA 1H2TZ 3UDEA 5CZVA 2KB2A 3UNYA 2F4VJ 4K0KF 5KT6A 4NCAA 5LSRA 1L3KA 5A0YB 3FRYA 1HKAA 2HHPA 1IWAA 3TQ1A 1FX2A 2BW2A 4LF8J 1U1LA 4R8UB 1WG1A 1FT8A 1MMLA 3IR5B 2BEFA 1FRIA 2RHQB 4WYLA 2D9PA 1XN9A 4DQRA 2RF2B 5KOXA 1AA1B 1R6VA 3D3BJ 3D7SB 5DO2A 2VG6A 4H4OA 4F3OA 2EG1A 3J7ZT 4B02A 2JVOA 3GONA 5DLFA 4F2RA 2KXNB 3KLIB 4ZPAA 3QT6A 5KFUA 4MYTA 2JVRA 3MD3A 5IM0A 4OI0A 2UUCJ 4B9SA 4DSLA 1T03A 3KMQA 4CLPA 4NXMJ 3RG6A 4EO8A 1UWBB 4Y2AA 4B3SF 2W7PA 2GMLA 1RWPB 2HFOA 2BE7D 2F3JA 2QG9B 4FXVA 4DFJA 5J2MB 1TUVA 2YWEA 3GFXA 1FKOA 1HBNB 2B9YA 2GIRA 1VBKA 2XCAA 1Q95G 4NCGA 1VQ4S 5F8GA 1FCAA 2C2MB 1X8DA 2FJXA 1VRUB 1RBLA 3AJDA 3JSMB 4LF9J 4CH7A 1F3VA 1TK5A 5IC6B 1RT7A 1O5JA 2LXIA 3SEOA 4EBCA 3GV7B 5KFOA 2V34A 4UOHA 2CDQA 2W2MP 3OVAA 2HWIA 2BOAA 1HPZA 5E3PA 4ES3A 3AOBA 2UUWA 2YNIA 1VR6A 3FGVA 3EPIA 2EPIA 1CEZA 5CZXA 3OVSA 3TZYA 4RW4B 4DCOB 3QAUA 5LMNF 3TUZC 3T5KA 4ER8A 3V6DA 1QSYA 1S7HA 4IDKB 3K2YA 5GAEU 3DOLB 2XMTA 2XLIA 1JB0C 1OPZA 1M1KT 1N5QA 4KO0B 1X0FA 4QR1A 2ZH7A 2HBQB 2DNYA 1S6UA 4IO1A 2ROEA 4B3RF 5DZ7A 4NZ7A 1YDLA 2C28A 4ECQA 3R3TA 1EKSA 3MOZA 1NCLA 1U1RA 1NHUA 1I1GA 3HD1A 2HFUA 4OHZA 3UO0A 4LF7J 2AJ0A 1RAIB 3CJ8A 2HNDB 3MAAA 4DPXA 2VBXA 3T19A 2W2PP 2C3PA 2VQEF 3CCSS 4A46A 1LW0B 3PX6A 2HQDA 4OQJA 1MNEA 4UUWA 2PA8D 2NPIA 4F2SA 4X84A 3IM8A 2ZZTA 3QT5A 3S01A 5DG7A 4WFYA 2HWHA 5IQQA 2CUYA 2AJQA 2AMCB 2V4JA 2V8DA 4HLBA 1IXKA 3U02A 1J5OB 3W9JA 2XCPA 1Q4RA 4NLXA 3NCQA 4M95A 1S1UB 4RW7A 1TL1B 3JB9k 2C22A 4CO5A 5CA5A 2Y0BB 4FNHA 4C0BA 4DQQA 4ZN3A 4LF5F 5F41A 4OHWA 2N3LA 4DUYF 1LEOA 1URRA 4MAKA 4ED5A 3P6YC 3QGPA 4LF1A 4FF3A 3QATA 3QWUA 4JI8J 2J9DE 2MQQA 1ULRA 5E3AA 3KFWX 5H9EK 3IBWA 2ZE2A 4LREA 4IR1A 3B82A 1NJZA 3K7RA 3FQLA 4ED4A 2W4CA 1GNKA 5FIIA 5HVFA 3HP6A 4WF9Q 1P8GA 2HZVA 2H48B 3PCOB 3QRRA 4E8UA 2W01A 2PFDA 4PG6A 1TL5A 2GAHC 2DR6A 2V8PA 1GX6A 3PHTA 4L6V3 3MZIA 2R2SA 4QU7A 5C42A 2B4UA 2QN6B 2GAGC 4FXWA 2NCKL 2RQCA 1U8SA 3UVJB 1FNOA 4F7VA 2YTCA 2HBZB 3G82A 4NXMF 1UWBA 3ICLA 1UZHA 1UVNA 5THWA 4F36A 3W63A 5F8LA 5K8PA 4NPOA 3PDNA 3GYGA 3R97A 1LQ9A 4I2QA 3TO8A 1URNA 2VBWA 1WWHA 1XR5A 5J2MA 4ECSA 3UN2A 3TAPA 4J9QA 1AUDA 1HBNA 3X3UA 4TU9A 4M8LA 1JXLA 2XS2A 4NXNF 3ULHA 1TELA 5ETTA 4Y00A 3BQ2A 4LFAJ 1QSSA 2MY8A 1RT3B 5EDWA 4OYXA 2V2VA 1RKIA 1WACA 4WBFA 5GAGU 1HIYA 3E3XA 1VRUA 1YJRA 3MM5B 3PYGA 2PC6A 4Z7YA 2B9XA 4OYIA 4ELVA 3D54A 3PJXA 1CC8A 3D1OA 3PXGa 2L48A 3PX0A 3D1HA 3EZOA 4HYKA 2GJIA 2F8MA 6AT1B 2QE5A 3IRXA 4M94A 2W2QP 1LXNA 1WTFA 2MTLA 3HT3A 1S59A 4QR0A 3DLHA 4F4YA 4URGA 1HHQA 3MPVA 4CLKA 2DISA 4WK3A 2I5JB 5GMKa 2PEHA 3W2WB 1R8HA 1T02A 4P2XA 3M6WA 3GPAA 3VAKA 3HK2A 1HBUA 2AEMA 4KO0A 2ILYA 1HI1A 2DRBA 2OJ3A 5JJBA 3LP2B 2RRBA 2VA2A 1UEVA 3VVUA 1APSA 4WK1A 1EZZB 2LVWA 4WP9A 3M8RA 5E2QA 2QA4G 2HZAA 1Y11A 5ETNA 2V67A 2Z56B 1LOUA 2IM1A 5SZTA 2FD2A 3AHPA 2HHHJ 3UR3C 1VS3A 4N77A 1T95A 1SH0A 5J2PA 2PDAA 4MIWA 3M1VB 3FZBA 3CSKA 3R6LB 4ZITA 2K2PA 4F02A 2KO1A 4DQPA 2VOPA 3KDNA 4ZHRA 1U0SA 3BBBA 3N5BA 1S1UA 3D9BA 4C8MA 2KZMA 3HHLD 1WG5A 1TUWA 3LPYA 5B09A 5KG7A 3P5BP 5K5MA 3RW7A 4NCBA 4WFZA 1LWFB 3SI8A 4A8QA 2JLEA 1G1XA 2OELA 3DYAA 5F8NA 1UVIA 1YHQS 1SC4B 5HROB 1A0OB 2LKZA 2UU9F 2YKMA 3PW7A 3CCES 3M30A 1RHUB 1H38A 2R2RA 1OQ6A 2M3DA 2RH3A 3GFZA 1CS4A 3C6UB 3DI6A 3T41A 1KHVA 5KT4A 5KFMA 1SJ3P 1S1TA 1MW7A 3NCPA 5IWAJ 2VU5A 4DPYA 1TKZB 2JFKA 5JVGQ 2M4MA 4DFMA 4JI6J 2QSWA 3FZ2A 1DTQB 3SCKE 2N4CA 2JH3A 1P9YA 1R0BG 1T8EA 3V81B 2F4FA 1S0MA 1S6QB 1KWMA 2GQCA 5KFXA 3SV3A 1FRXA 1EQ0A 4J9NA 3UVJA 1UP1A 4KGZB 1SXLA 4QWAA 1PYOB 2AYEA 3MCSA 4XDDA 3FSXA 3VAFA 3PVXA 4RUAA 1DY3A 1N48A 4E2FB 5DRKA 3PJWA 1PJ5A 1NB7A 1HW8A 1WELA 3KJFB 2D1CA 3DMJB 1X4GA 2AD9A 2WW4A 1NJWA 3F56A 4ZVQB 4NLYA 3LGMA 1IKVA 2FVPA 3AXKA 5GMEA 2DRDA 2W9CB 2ZNZA 1KR4A 4C11B 2EC2A 4BCAA 4MIAA 2J7WA 2BJ9A 4LFAF 4H4MB 2QYGA 1P27B 4OYBA 2A3JA 1F9EB 3MM5A 4AXJA 1F9FA 4GO5X 5B0BA 1UL3A 4G1QB 3TUPA 2EW9A 1Y0HA 4HHUA 2IA0A 3CJKB 4J7CA 2G0JA 1JLEA 4WP8A 3HHLB 1T9WA 4OX8A 2RS2A 4CDIA 3VAIA 2RILA 1X31C 2E1RA 1VIOA 1S57A 4MKYA 2V6AA 3K8VA 1FJEB 3R5JB 4QBUA 1KEKA 1Q5VA 1R0AB 3PJ9A 3DLKA 2AP6A 4EZ9A 2RJZA 3H8YA 3H4DA 5E3QA 4K4TA 3VWSA 2VQFJ 4PUOB 3R5BA 2I5JA 2M52A 3TVYA 2YKNB 1RDRA 5HJXA 1R31A 3W2WA 3M8ZA 3AJ1A 3B4MA 1GQEA 1PJ6A 3I9V9 4OHVA 3CCRS 1FEHA 1YJ7A 4RW6A 1VK8A 1YJ9S 2FUG9 4USUA 2OLWA 2GJFA 2L9WA 4L3NA 4ZJQA 4NMLA 3KLFB 1KQGB 2IDLA 2ZOGA 4K7QA 2I0XA 3EGNA 2MSSA 1U45A 1B7FA 5EX3A 2PD1A 2QL5B 5E3RA 5IC4B 3ZC4A 2XO7A 1S12A 4N8OA 5J1PA 3H98A 2DHHA 5LM7E 2RU3A 2Z8QA 2XWYA 1HI0P 1SC1B 4RW9B 3IXQA 2QL7B 3HVTB 1PSDA 3N9UC 3AD9C 1T7PA 4K2XA 2FHJD 3RUBL 1NDCA 4OZNA 3M1VA 4QIWD 3VGUA 3DLEB 4B3TJ 2LEBA 2BANB 2R42A 3HD2A 1T9YA 1RISA 1YJTA 1VQMS 3DU5A 3TR5A 1U24A 1HNVA 3GIRA 3Q8RB 1NKEA 2CQIA 1HNIA 1LWFA 3ENAA 3K8WA 2XM3A 3LF0A 3IN5A 1X4EA 2LU1A 3CJQA 2HHTA 3DM2A 1U48A 5KG6A 1VQ9S 4ED3A 4W98A 2C2EA 2GIQA 4PQUA 1M90T 2JEGA 1AFJA 4HI2A 2CKWA 1JLQB 5B0CA 3H40A 1VMBA 4IR9A 1Y3KA 3J7AN 4ELUA 1HWIA 5JVHQ 2W24A 4G65A 2GNKA 3EGZA 3AY0A 4RWXA 4JI6F 1NJYA 2QMXA 5KG2A 2ZUGA 3U1MA 1DTQA 1M5HA 3MM7B 5E0OA 3OTEA 3J81U 1TKDA 4F4KA 1S6QA 4HT7A 4FVMA 4XAKA 1HNWF 4HH0A 5I4MA 4P2SA 1H2UX 2DPIA 4EYHB 3Q22A 2NQPA 4DMZA 5T14A 4PXDA 4RWWA 1JLCB 4DR5F 5HQLA 3K58A 3TW0A 3P8BB 1N33J 1NO8A 1RI7A 3MEDB 2D3O1 2WAQD 3DMJA 2B3TB 4DI6A 4KPCA 3D6HB 4KAIA 2QLJB 2CPEA 3PEJA 3LAMA 3NGRA 4OL8A 2FDNA 2ZKTA 1RT2B 4HR2A 2W9CA 4H4MA 1X4BA 3NMRA 2F40A 4DX7A 1I5OB 3PW4A 3ZZYA 5G4DA 2EFVA 1M5OC 1KFDA 3GU0A 1JLGB 3TRGA 4CLUA 4G1QA 4H54A 2FHMA 2CJ9A 3CF5Q 1RA7A 2IM2A 3OJSA 3TJAA 2QTWA 4LMZA 2RU9A 3CJKA 2AWZA 3GP9A 3OLAA 1JLBA 1NEEA 4R5PB 2I2YA 4BWJA 1VISA 4ZJLA 1X5TA 2F9JA 3QFWA 2AEJA 4LFBJ 2B4VA 3OPKA 2K06A 3GJTB 2HNZA 5I3UB 2DYAA 4ILRA 3K17A 3CJSA 2A6MA 2X1FA 4AL5A 2WTFA 4X65J 3ISND 3RBZA 1Z1ZA 2WBMA 3CIZA 3HSJA 1SH2A 2NXCA 3OTBA 4KYZA 1VDHA 1VLYA 4ZJOA 2DD8S 2HVIA 1E6VB 4AE5A 3CD6S 1WC3A 4ZCMA 1F3FA 3ETOA 3FRZA 2XY7A 2G1DA 3RBXA 3MI7X 2XO6A 4P7TA 1JJ2R 4Y0FA 3IWLA 2WSCC 3L95X 1WC0A 2XEXA 2ZHAA 5EWGA 2X1AA 2XY6A 4DU8A 4DBQA 4GKKJ 4OLPA 2EFGA 3MF5A 1RWMB 2BXJA 3BSOA 2LMIA 4K4XA 3EZUA 4A8YA 2CFXA 5LMUF 3OV7A 1ZH5A 4IQMA 2J6SA 3ENVA 5KFVA 1KN6A 3GWCA 2H1YA 5G0RA 2MDAA 2BANA 2BQ3A 2VFRA 4U7CA 2ZJRQ 1FXRA 2VDHA 2BABA 3RAMA 1AT1B 2APOA 3ILIA 4C0HA 2DGQA 1HFEL 1J5EF 1H6KX 4DQIA 3GB0A 1C1CA 3JQJA 1SKRA 4DOZA 2Z2ZA 4JI4J 3DLLQ 1E6YA 1FX4A 5HBMA 4J37A 2JOQA 1V5IB 3MM8B 2IFXA 4ZPBA 2IRYA 4PYAA 4PXCA 1FJGJ 3DLJA 2W7OA 4KE5A 4ZVUB 2UZAA 3I55S 3V6JA 1FEEA 3I5CA 4UOGA 4N8NA 3K89A 4A4JA 4DX6A 3J7A1 1U1PA 1XMQJ 3DKDA 4OI1A 1IBCB 4DL3A 2UUBF 4M5IA 4ZCIA 5HP1A 2J0SD 3MM7A 2D69A 1WKKA 2EFNA 4IFYB 3NGSA 4NA3A 5D77A 1IN0A 2HQ3A 1C0UA 4FS2A 1FWPA 1TVRB 4UOFA 3PRBA 4DL4A 2E1AA 2B9WA 3HJFA 3HVWA 4KT0C 2OEKA 3B54A 3MEDA 1JJCB 2A0FB 4UQGA 5KFIA 4K5SA 3GSIA 2FLNA 3KOAA 1AXQA 5LSOA 2FC8A 2KHCA 1WSRA 2CQHA 3GFHA 1YJWS 2HFSA 3L7PA 3M8PB 2OAUA 1XEZA 1N6QB 1S1VA 2NUHA 2ZOMA 1FXLA 1H7WA 2JEJA 1N36J 2CVEA 2G0CA 2VPYB 4O3OA 3ITHB 2ACMA 3KJVB 2HIYA 2DHSA 3PYEA 1T11A 2OEMA 1UFLA 3MMCA 4O3SA 4X2BA 2A18A 4R5PA 4J9RA 4FBUA 2OPSB 2PT0A 1RTDB 4HVZA 3WHIA 5IFMA 3I56S 4LFBF 5I3UA 4UY85 3QIPA 5IOLA 3W61A 2E7WA 3US5A 1K0TA 5FLXY 3EZ5A 1YBAA 2A2CA 1YRUA 3DOKA 1E6VA 1SH3A 1MROB 4ANEA 2JC1A 1NDKA 2AT1B 3Q23A 2VJUA 1D1UA 1W2IA 3MTJA 5GVQA 2GO8A 2HMIA 3SFGA 1X4AA 3OL6A 4J9KA 2IC3B 1HBMB 2WOMA 3R5DA 2LA6A 3JYTA 4OFZA 3W2VB 5AE1A 4YFUA 5AT1B 5KFPA 5AJ3J 4LF2A 2HK2A 5JMNA 1QAXA 1IBLF 3OUYB 3CCUS 3CVKA 2IJNA 4LT6A 1LW2B 1T05B 3A3PB 2RT3A 3W5YA 3MR2A 2F5GA 4DR3J 1NPRA 1TL7A 2O1PA 2V5HG 2HYIB 1D3WA 2F8EX 2B4OA 3KLEB 2CPFA 1S1WB 2HGLA 1N5YB 2OPPA 3NWRA 1JX4A 3M9OB 1RT1A 1KQKA 2WVBA 2J9EA 2J7UA 1MWYA 5I3QA 5CH7B 5B0DA 4L75A 4QJVA 4JI4F 1CULB 4BS2A 1MG7A 4WJBA 4B17A 2MZ1A 3GIMA 4P75A 4ZKAA 2XSJA 3MM8A 1LWCB 4DV6F 2CPYA 2CJQA 3UCGA 4KRWA 1WI6A 2XS7A 1TKTB 3AQOA 2IMOA 2ZEJA 4Q8EA 3OL8A 1G7CB 2EK1A 3E51A 4DUZJ 4CYUB 3OHBA 3G6VA 5F9LA 2HZCA 3VAMA 3UDVA 4FYDA 4AL6A 1Y9OA 2BKNA 2I1RA 3M6VA 1XMQF 3EUNA 4DV4J 2CQ1A 1RU2A 2XSFA 3UW1A 2GV1A 3M2UA 4IFYA 1GTEA 4AQYJ 1H73A 2XLJA 4P10A 3BO2A 4C2MA 1OY6A 2ADCA 2VG7B 2HNYB 1TVRA 3LP0B 4TLRA 4YDXA 1OY9A 4P73A 3NS7B 4O3NA 3KK1A 3FNNA 2XYPB 1S10A 2RIJA 4CO3A 2YX7A 1YJVA 3GMGA 2J9DA 8RUCA 2VASA 2H3EB 3MEGB 1EB0A 2XMAA 2EWHA 4OYMA 2YNHA 5LSLA 3DRRB 4MTPA 2CJKA 3D67A 3C2PA 1N6QA 3GQCA 2O66A 2PFFB 2VC1A 1QUVA 3HHEA 3WIUA 1WC5A 3ZZ0A 4O3RA 3ITHA 2NPFA 2MHEA 4Z2XA 3OR2B 4ENOA 2G9OA 3KJVA 4DFPA 1Q86T 4ID5B 3FUYA 4HDGA 3CT9A 3BBCA 1UEUA 3BM7A 4FXDA 3NWGA 4K2JA 2GQQA 4FS1A 1IBMJ 2QL9B 3QSYB 1LFPA 5I3PA 3Q2TC 5KFBA 4USTA 1GX5A 1HBOB 1NK4A 3CMAS 1FRKA 3RRGA 4DPOA 2G2YA 2BACA 5KT5A 2CZ4A 5A2QU 3W60A 3QFHA 4Q44A 4CP5A 3EX7B 5CYMB 1FE4A 1UKUA 1FDBA 5HK4A 1SBRA 1XK8A 3A3OB 4DSFA 4CO4A 3WC0A 1S9EB 2OFGX 3K57A 1KVIA 3EXCX 4WCEQ 1WHWA 2OD4A 1HW9A 2B5JA 3MMAA 3G8SA 5CYJA 4C3MA 3D2WA 2IC3A 1HBMA 4CLWA 2UV8G 3W9IA 3FFIA 3P45B 4JI3J 5EWFA 1F0XA 3IWNC 3IBFB 4RO0A 1KLNA 4I6YA 3OUYA 4HACA 3BO3A 3MAHA 4K4SA 1LW2A 1T05A 4KGMA 3C14A 3ZTSA 3KJNB 3SBMA 3M8SA 1D8ZA 1LNQA 2HS0A 4QWDA 4MKAA 5CD4H 4USKA 2CDRB 2BR0A 2RDJA 4DX8H 2NXJA 3Q8YA 3KLEA 2LQBA 4X4NA 1S1WA 1SL2A 1N5YA 4PXEA 1MWZA 1TUGB 2BRLA 3RB0A 4Q8FA 3T1HJ 4NLGA 2JHEA 4IFVA 2EFOA 1GTHA 5M2PA 1PYTA 4JI0J 2C2RA 3D66A 1YX2A 1N34F 4CNZA 1UVMA 2CPHA 3CJ2A 4KFBB 4IH7A 1LWCA 1MU2B 4LF4F 2ZH8A 3J7Z5 2CNOB 4IG3B 5DZ6A 1JJ4A 4QIVA 3ZTRA 3TEGA 3RZAA 3H4BA 2MSTA 4QCLA 4DUZF 4RBVA 3D4JA 2IJFA 2RRNA 2WB4A 7FD1A 5BYQA 2YVSA 1KNZA 2B7BB 3PEHA 4IRCA 2MYFA 2VG5B 3D6FB 2HQIA 4B9LA 3TARA 4DV4F 4FN5A 3FQKA 2J8SA 4R0EA 4RUCA 1QTMA 4PZVA 1U0HB 2ZJPQ 1NPKA 2C2KB 3TA1A 4E98A 4F04B 4M5MA 3BPSP 4F4XA 3TVKA 4TNOA 4ZVOB 2VG7A 2HNYA 2GQ2A 3LP0A 3K0JA 2OTJS 1SJ4P 1RAOA 2VD3A 4M5DB 4ED0A 1Q16B 3JAMY 2ZBQA 1VOMA 2WCXA 4DR1F 2XI3A 5MLCV 1EARA 1FK9B 1FKPA 2ASJA 4KGKA 1NM2A 2HBRB 4IUFA 4CT8A 2L3MA 5FJ4A 3RJMB 5IXUA 1FFSB 4YR3A 2QIFA 1MMNA 2PSZA 3UE2A 3KG1A 3FSIA 3I32A 4XPCA 1B0VA 3OR2A 4V19J 3ZZTA 5JUMA 3R1HA 1UA0A 1YBTA 5E41A 1KONA 1WEZA 3PNIA 3ZXWA 2DNRA 3IGNA 5ETQA 3CCWA 1J27A 5IS2A 3GIJA 4OV1A 4HT5A 1U47A 4DR2F 3N6MA 1Z4UA 1RBAA 1HBOA 3HI9A 4CO2A 4Q0BA 1A6LA 1SV5B 3MCMA 4DSJA 2CPZA 2MGZB 4JI7F 4LRCA 1S7IA 2ZH1A 4N47A 3EVWA 3H2LA 1KS2A 4ILLA 2DPJA 1CQNA 4D3GA 2VZ9A 3GTYX 3UCZP 1KC8T 4J5OA 1NSPA 4LIRA 3N01A 1R8AA 3PW0A 1X9SA 2MLXA 4ZS6A 1D9FA 3SV4A 2UXDJ 4P2MA 5K14B 1RP5A 1Z2ZA 4YEAA 4WIQA 2KU7A 4HKQA 1UPMB 2N82B 3ZZOA 2MKKA 4DR4F 1QE1A 1EP4B 3ZZPA 2MZJA 3MURP 1QLNA 4FYXB 5DQHA 4JV0A 2DH7A 3D6MB 3PACA 1ICEB 1R43A 4OYAA 4TN2A 2DEIA 1WDDA 3SMZA 3F0NA 4GC7A 2FC9A 4USIA 3U1LA 2OO4A 2W8LA 3L9ZA 4JV1A 1GMWA 1FXDA 3M32B 1CJVB 3SYZA 4J9LA 3T1YF 1OJ4A 5J2QA 4A8MP 5LJ5Y 4URSA 3W7BA 3KTQA 2U2FA 1VQLS 2V8VA 3FEZA 3OBIA 2Z58B 3FCWA 3O5TB 3DRPB 1BMQB 2ZWOA 2BJEA 2XYHB 2VH7A 1CBKA 4WYWA 3T1HF 2O67A 4O23A 4Y34A 5KFZA 3M6XA 1YWXA 4HI1A 2AHOB 6FD1A 3B78A 2DIUA 4KFBA 3C15B 3MAQA 1UVJA 3OXFA 1XR7A 1U6BA 3ZZZA 2BE2B 4IG3A 1B64A 1CVJA 2LA4A 3BB5A 3C8YA 2IAJB 4WTOB 2ZM6F 1VGYA 2V50A 3THVA 2RAQA 2HBYB 2H5IB 1R3NA 4MH8A 1IKWB 2VG5A 2LXFA 2YQ0A 2MJNA 3P49B 4ZLPA 2W9BB 3HF5A 1U0HA 3PYFA 5HANA 2LECA 2UV8A 1HR0F 1SQFA 1WOSA 4RZRA 3CJTA 5C24B 3V4IB 3J7YU 3D0HE 4FKYA 2RMLA 4KH0B 4UOCA 4WFNQ 4DV0J 3LWLA 4TY8B 2DCLA 2LQ5A 3QT7A 2KVIA 5HMXA 3SCIE 1CG2A 1LK7A 1LV5A 4AUKA 2SXLA 2RQMA 5BR8J 2ILZA 1RAFB 1VI7A 2GJ2A 1FK9A 4RNOA 3CJ3A 1PAUB 4J91A 1D9AA 1VRTA 3HFKA 2B6AA 1Y5IB 4GVBB 3KMSA 4DZ6A 2KRRA 4CRJA 5KFHA 1L3VA 3IG1A 2JL9A 3BV8A 3K5NA 2FTRA 3DHWC 1YLXA 1YJNS 4JI5J 1FO1A 3TVZA 2I38A 2EKNA 4BC9A 1UCNA 4CNYA 2M0GB 4USWA 1QVGR 3DDIA 2DKOB 1BLUA 3KK3B 3PYDA 3R7BB 1BC6A 2MZQA 3GCWP 3ZTOA 1NNDA 3WQPA 1YIJS 1LFWA 2X1GA 1SV5A 2KDOA 4K59A 3NP5A 4R0JA 1W26A 2PMZD 4K0KJ 5GADU 3GSDA 2Z0GA 3A8JA 3HVAA 2RUSA
chains in the Genus database with same CATH topology
2ZOFA 1VJWA 3N0VA 1ZM2A 2GGPA 4OX7A 2P6SA 1JLEA 4KB7A 3M2UB 4IO9Q 5GAHU 2RKIA 3HHLB 4OX8A 5E3CA 5U47A 3U27A 2RS2A 1B0PA 1Y00A 3VAIA 4U7UK 3CJ4A 3OSNA 2R4FA 2RILA 5DG9A 2E1RA 1VIOA 2DGOA 3PM9A 3HLUA 2HWTA 4OJ1A 4MKYA 1SL0A 3K8VA 1FJEB 2MJUA 2WW8A 4QBUA 4DS4A 5AE3A 1KEKA 3VAGA 1SC6A 1Q82T 1WHXA 2DR7A 1D9DA 1XTZA 3E8OA 3PHEA 1R0AB 2CPJA 3DLKA 4C4WA 2AP6A 4OX6A 4DFKA 4EZ9A 2RJZA 3H8YA 2AYGA 3H4DA 4NLUA 3T5HA 1N88A 2OSQA 4HDHA 2VG6B 5E3QA 4K4TA 3VWSA 2MB0B 4H4OB 2DNGA 4ZPDA 4Y2MA 5CHCB 4PUOB 3R5BA 2I5JA 3E01A 4GMKA 4KKOB 1U6ZA 2M52A 2DGSA 3LOUA 1U2FA 2YKNB 1RDRA 4HTJA 1R31A 2M7SA 4OJHA 3TVYA 2KFYA 3W2WA 3KK1B 2R7WA 1Q8LA 4ED6A 3AJ1A 3B8HA 3B4MA 1TKTA 1GQEA 3I9V9 4OHVA 3CCRS 1OIAA 1FEHA 5IZHA 4RNHA 2N7CA 1EP4A 2AX1A 4HTIA 2E29A 4RW6A 4ZMMA 1VK8A 3NNHA 4E0DA 2OPQA 1YJ9S 2MQMA 2FHOB 5IM0B 2FUG9 2HHSA 4IOCQ 2OLWA 3MM9B 1M5SA 4O44A 2L9WA 5KFQA 4L3NA 5EGYA 1RA6A 1S72S 4NMLA 1JXEA 2YNHB 5D4OA 3IWXA 3KLFB 1H0HB 1NK9A 1DZ5A 5A8KB 1T03B 1RT6B 2DGWA 2N7YA 2QMWA 1KQGB 1S9GA 2J0QD 2F4VF 2OKQA 2E5LF 2JEIA 5A0YA 2ZOGA 3V5RA 4NZ6A 3OHAA 1ZAWA 3IC1A 2I0XA 1IKYB 2GO9A 2ZBIA 2MSSA 3EGNA 3M32A 3KLGA 1U45A 2K3IA 4A8FA 1B7FA 2XNQA 1TK8A 1UETA 3PO5A 3N79A 4I6WA 5EX3A 2OMOA 2PD1A 3CDAA 4NLPA 4RW8A 4WE1A 1GH8A 3CIMA 5E3RA 5KG0A 3ZC4A 4BHQA 1G6BA 2XO7A 4CIOA 3UQSA 1WTBA 2LDIA 4N8OA 4OZ1A 5J1PA 3H98A 4WFXA 2WB1D 4IRKA 3F73A 4LF8F 2EBGA 2PGCA 4R8UA 1Z2LA 2D3OR 2D3UA 3J7YI 3D28A 3DDNA 3BDPA 2RU3A 4AQYF 2Z8QA 3I0SB 3MMBB 1HD1A 4KV8B 1RAJA 4D3HA 1FKOB 2XWYA 3MWBA 3VCDA 1HI0P 4RW9B 2RQKA 1X7VA 3IXQA 4NCGB 5HMZA 2RF2A 2RRAA 5F0WA 3IAM9 3HVTB 1PSDA 3N9UC 3POTA 5DGAA 5KG1A 1T7PA 3Q8PB 1XMOF 1HWKA 4QIFA 5D4PA 4K2XA 2AX0A 2FHJD 4QWBA 2MKJA 1Q81T 5A8WB 3CJ5A 4OZNA 2FLLA 3NRBA 5EX0A 1NAQA 3M1VA 4QIWD 3DLEB 4YDDB 4X62F 2K1RB 2LEBA 4FP9A 2BANB 2LQJA 3PZPA 4C3KA 3KLIA 2HRUA 1RISA 1YRXA 3OTDA 4WU2A 1YJTA 2MPUA 1VQMS 1HYSA 1RT7B 4I2PA 3DU5A 4HH1A 3K5LA 4DG1B 5I42A 1UA1A 2P9GA 2FVCA 2P9EA 3TR5A 3MEGA 1U24A 2IYGA 2BDPA 2QSFA 1HNVA 3CPWR 1UFWA 2ACYA 4GO7X 3EXYA 4IH5A 1S97A 1KHWA 1VC5A 2UUCF 2Q66A 3Q8RB 1NKEA 3DRRA 3HO1A 5HL7Q 2XGQA 2CQIA 1HNIA 2WBRA 2F9DA 1LWFA 2XBPA 4KSEB 3K8WA 2OTLS 3I5BA 2VONA 3NS5A 3H5YA 2IAJA 2MQPA 4GKJF 1HPZB 2YWGA 3LF0A 3IN5A 2RUGA 2J0XA 1X4EA 2LU1A 4ES1A 2KT3A 2HHTA 1L3TA 3DM2A 1T3NA 1U48A 3H5XA 5KG6A 2JZ5A 1X9MA 1X4DA 1VQ9S 3O3LA 1HQUA 3QZ7A 4ED3A 4RLEA 3FMWA 2B5JB 2PI5A 2DVIA 1ZZFA 3MMAB 2C2EA 2GIQA 4PQUA 4MKBA 4ID5A 5A6WA 1M90T 1RTJB 5CQGA 4UQTA 2JEGA 1AFJA 1IKWA 4HI2A 3J80Y 2CKWA 2JWNA 1JLQB 1NH7A 4BBYA 2FVQA 3BDEA 3R27A 4G1PA 4IKAA 5B0CA 3HDSA 4NWBA 1ZAVA 1KQSR 2R8IA 4Q7AA 4ECYA 1IBMF 5E5NA 2Q43A 4XIUA 3IGVA 3H40A 2PO4A 2W9BA 4NRUA 1VMBA 4NRTA 2NYIA 4IR9A 1Y3KA 3FFIB 3BR8A 5AE2A 1C1BA 2EBEA 4M63A 4F4WA 3H25A 1PC4A 4ELUA 1HHTP 1HWIA 3GILA 5JVHQ 1K9MT 1VHFA 3KKFA 4NYOA 3IFEA 2W24A 1UVLA 2GNKA 3EGZA 3JSMA 5BJRA 3BO4A 2FVSA 2V9KA 1QSLA 3AY0A 1CC7A 2IHR1 1HI8A 4RWXA 1VQNS 4JBCA 4JI6F 3IR7B 4RNFA 1NJYA 4LF9F 2XULA 4TQSA 2QMXA 1VFJA 4C3LA 2ZUGA 5KG2A 5CYMA 3U1MA 1DTQA 4DV0F 4TY8A 3TUIC 2XMKA 1OQ3A 5A8RA 1V9OA 5GAHI 5B0FA 1M5HA 2CPIA 3M4XA 3VAHA 1TAUA 5K8NA 2DHXA 1S9EA 3MM7B 3RU0A 2HRYA 5E0OA 1BQNA 5BR8F 3OTEA 4C8LA 2R7UA 1TKDA 2DNHA 4X64F 2KXHA 4F4KA 3CULA 1S6QA 4HT7A 2L08A 4FVMA 4XAKA 2L9DA 1HNWF 2HHVA 4HH0A 1Q53A 5I4MA 2VBYA 4P2SA 1H2UX 2DPIA 2AQ4A 3OQ2A 4DV2F 4EYHB 3WC2A 1H2VZ 3Q22A 2QA1A 1ZBTA 2DGUA 2NQPA 4DMZA 3CE8A 5T14A 2QV6A 1R8PA 4PXDA 1GXLA 1HL6A 3N5FA 4RWWA 5J1EA 1JLCB 5AXLA 2XMUA 1BD6A 2A1BA 4DR5F 3SFUA 4YB6A 2GMJA 4JUZA 2D74B 4RW4A 3K58A 5D4NA 2Q79A 3TW0A 2FJAB 4G1IA 2FB0A 4FVCA 4EUVA 2DR8A 1NO8A 5HQ8A 2V4JB 2LLZA 4IFVB 4JI5F 1Y3JA 1RI7A 3MEDB 4IDKA 1TK0A 4C97A 5HO4A 5B0AA 1HWLA 3D0IE 3JTNA 4ZDNA 3H59A 2YKQA 3DOLA 2WAQD 4J9SA 4PXBA 2EFQA 2ZC4A 3DMJA 3RYLA 3PO4A 4JI3F 2B3TB 5KFTA 2DB1A 2GW8A 2ROGA 2VOOA 1REVB 4KAIA 3MFHA 3DFEA 3PEJA 2CPEA 2PI4A 3PW5A 4ERDA 3QAEA 2EKYA 3LAMA 2I9SA 5IT4A 4K4WA 4OL8A 2FDNA 2ZKTA 1RT2B 1TR0A 4CH1A 4URQU 2W9CA 4YB1P 1OSDA 3T6JA 3CDUA 4H4MA 2HPUA 3ZFVA 2Q1LA 1KRPA 3T9ZA 4USHA 1X4BA 3NMRA 2AGQA 2F40A 2ZVSA 1D0EA 3CMES 5HMWA 4CO1A 1RT5A 4YHHF 1FD8A 1UVKA 1WI8A 1U2RA 2YY3A 3SCJE 2U1AA 2RNEA 1SIZA 2E66A 2GCFA 1K8AT 4YUDA 3PW4A 1N5TA 3ZZYA 1N32F 5G4DA 5CYQA 2CIMA 2EFVA 4B9VA 1VC0A 2KTQA 2R2TA 4LF7F 2YWHA 1M5OC 1RT4A 1Q79A 1KFDA 2KJVA 3TUJC 4CT9A 5CCMA 2HNDA 4DDFA 5A2QY 2B43A 5DDPC 1UW4A 5D8HB 1JLGB 3FCHA 3TRGA 4NLVA 4Q45A 2IBKA 2HHUA 4ICLB 5KFNA 3Q8QB 1YJUA 5F0UA 4G1QA 4H54A 4I68A 2FHMA 1TQLA 2CJ9A 4O0IA 4YQWA 3CF5Q 1RA7A 2IM2A 1LW0A 2ZE2B 3OJSA 3SCLE 4CTAB 2F1FA 3HKWA 1M0SA 2Z4PA 3DLGA 4LMZA 2RU9A 3CJKA 2QA4S 1FNXH 2V8HA 2AWZA 5A6PA 3VZHA 1WNEA 3OLAA 1JLBA 4LIWA 1NEEA 4R5PB 1VK3A