1WG4A

Solution structure of rrm domain in protein bab31986
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
b'GSSGSSGGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKDGMGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN (RIKEN cDNA 6030486K23)
publication title Solution structure of RRM domain in protein BAB31986
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 12
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1wg4A01
2RRBA 2LEBA 2E5IA 1WEZA 3G96A 2HGNA 1S79A 1SJRA 3VAGA 1KC8T 4U67Q 1S72S 5H1SV 2DH7A 1WTBA 3P5TL 1VQMS 3NNAA 3CCUS 1VQNS 2MXYA 3IRWP 4IOCQ 1N54B 2CQ1A 2U1AA 3RW7A 5DM6Q 1M5PC 5CA5A 2L08A 2KH9A 1YJ9S 2CQDA 1ZZNA 2EK1A 2DGWA 3NNCA 4TLQA 1KOHA 2HGMA 1VQ5S 2G0CA 3UD4P 2CQHA 2DB1A 3MXHP 1D9AA 3UCGA 4QPTA 4TU9A 3VAKA 1Q81T 1Q7YT 1VQ4S 3CXCR 1U1PA 2UP1A 1VQKS 2MJNA 2MQPA 2M8HA 2X1AA 3JB9k 2G4BA 2J0QD 4WKRA 2OSQA 5D77A 4QQBA 3CF5Q 5CYJA 2KU7A 2MGZA 4W90B 2PE8A 3FEXB 1PGZA 1WI6A 2CPXA 3Q2TC 2OTLS 3I56S 2DHSA 2CPHA 2EK6A 3MUTP 4Y0FA 3NMRA 2MZ1A 1UFWA 2AYEA 2V94A 1X4EA 2N3LA 3CCSS 1H2VZ 1H2UX 4CQ1A 3MDFA 4WFNQ 4WFAQ 2DHXA 2RUGA 2AYBA 1U1OA 1B7FA 2KI2A 1FJCA 1D8ZA 3P49B 1U1QA 2DH8A 2GO9A 4M5DB 3BO2A 4Z2XA 2LA4A 4CIOA 2ZJQQ 2CPJA 3NNHA 2CPIA 5LSOA 4OZ0A 1FHTA 5IQQA 1RK8A 3S01A 1X4DA 3CUNA 1X4HA 2M4MA 2CQGA 2MKCA 2KFYA 2MZTA 1U6FA 2KN4A 2RT3A 2HYIB 1P27B 4LIRA 1CVJA 1G2EA 1YJNS 1VQ7S 3EX7B 3CC2S 2JVRA 3PIOQ 2L41A 2M8DB 3CPWR 3ZZYA 2F9JA 4Y00A 5IM0B 3SMZA 3THTA 1DZ5A 1DRZA 1FO1A 1M5KC 2DGSA 4RU2A 2MZQA 4ED5A 5JVGQ 2LKZA 3P3DA 1FJEB 2MKSA 3RW6A 1VBXA 2O3DA 2MKKA 1O0PA 2KM8C 3NS5A 2OJ3A 2X1BA 3K0JA 4LMZA 1VC0A 2DNQA 2J8AA 2E5GA 2DITA 3SXLA 3TO8A 1VQLS 2MZRA 1SJFA 2AYGA 2FPHX 3HI9A 2KHCA 2RQ4A 1WG5A 1WWHA 5LXRA 5ITHA 3MURP 2MSTA 1JMTA 2CQBA 5GAHU 1SJQA 1WHXA 1WHYA 3CCLS 1VBZA 5DDPC 1VBYA 3P6YC 2PEHA 1U1LA 2DGUA 3EGNA 2KXFA 5LJ5Y 2RU3A 2X1FA 3B4DA 2M7SA 1WF0A 1BY9A 2I38A 2M88A 4LJMA 5LSLA 2YH0A 4PKDB 2XS7A 3G8SA 5DDOC 3BO4A 2DGTA 2CQ0A 3G9CA 3MOJB 2LXUA 2MY8A 5GAEU 2CPYA 4IOAQ 4W92B 2FC9A 3S6EA 2RNEA 3SDEB 2JX2A 2MSSA 2K8GA 5DM7Q 1L3KA 3MI7X 3CC7S 2CPZA 2MKIA 2VONA 2DNMA 1U1NA 3CCES 1OIAA 1X4CA 2NLWA 3IWNC 1X4FA 2I2YA 2MY7A 4CH0S 1YITS 5HL7Q 2XNRA 3L3CA 3DLLQ 1URNA 5LXYA 3HHNB 1WG1A 1YJWS 1VQ6S 3R1HA 1KOOA 1SXLA 2E5JA 1SJ3P 5IFMA 2DNPA 1VC6A 2RRAA 3CMES 2DO4A 1SJ4P 2MB0B 4OZ1A 2LXIA 2F3JA 1YWXA 2D9OA 5GMKa 2MMYA 2J0SD 2LECA 3US5A 2DIUA 2CQPA 4TU7A 4F02A 1FXLA 3OW2R 2KG1A 3CC4S 2MJUA 2ZJRQ 1WI8A 2LA6A 3CCVS 2N7CA 1X5OA 2DHGA 4WIIA 2XSFA 2DGQA 2MKHA 2KRRA 3H2UB 2QA4S 2AYMA 4J5OA 3VAFA 2MQNA 2OIHA 4YUDA 4TU8A 3CMAS 1KQSR 5EN1A 3CCMS 2MGZB 1UP1A 4IUFA 2DH9A 1A9NB 2YH1A 2QFJA 3CD6S 1WELA 3CTRA 5MLCV 1OWXA 2M0GB 2Q79A 2LQ5A 1WF2A 2LYVA 4PR6A 2XS2A 3ZZZA 2FC8A 2RQCA 1WHVA 2CPFA 4QU7A 2ZJPQ 1ZH5A 1WHWA 3BEGB 1WEXA 5HO4A 4C4WA 2CPDA 2BOPA 1R8HA 3G4SS 2AD9A 2U2FA 1P1TA 4F26A 2CJKA 4ZKAA 2GHPA 1HD0A 3N9UC 1QVGR 2EVZA 2G1DA 3V4MA 5CXTA 2DNGA 1U6BA 2QEXS 2D9PA 4PRFA 2DNRA 2MYFA 1X4BA 2FHOB 2N3OA 2JRSA 1N88A 3LPYA 3D2WA 2OTJS 3MD3A 3G71S 1NU4A 1JJ2R 3R1LA 2SXLA 2DHAA 2LMIA 1FJ7A 1U1RA 5GADU 1K8AT 2OSRA 4WFBQ 2YTCA 1ZZFA 3UE2A 2L9WA 5GAGU 4YOEA 1VQ8S 2KYXA 3VAMA 3G6ES 2CQ2A 2DO0A 2F9DA 2D3OR 1VQ9S 4P6QA 4BS2A 1M90T 3U1MA 1U1MA 2MQOA 3B4MA 2YWKA 1YTYA 5DDQC 1RKJA 2KM8B 2X1GA 3ULHA 2CPEA 2A3JA 3S7RA 4UY8T 1U2FA 1U1KA 4UQTA 1M5VC 2KXHA 1X5TA 1X5PA 3VAHA 2KVIA 1YHQS 1K73T 2DNYA 1HA1A 5LJ3Y 5FJ4A 5JVHQ 2MZJA 2JVOA 3I55S 2HZCA 2DNLA 1X0FA 1HL6A 2FY1A 2KRBA 2ERRA 1X4AA 4IO9Q 4YB1P 4WF9Q 1WF1A 3DXBA 1FNXH 2MKJA 2YKAA 4EGLA 2KT5A 2HGLA 5DETA 3TYTA 4A8XA 3CULA 3VAJA 4C0OC 3THPA 1N52B 2RS8A 5IM0A 2HVZA 1AUDA 2VODA 2DNZA 3S8SA 3FEYB 1DBDA 1VC5A 1HD1A 1KD1T 1Q82T 2CQ3A 2VOOA 2CQCA 3H2VE 1M5OC 2N82B 3TP2A 2JWNA 1UW4A 2MQLA 1QVFR 1DHMA 4CH1A 2DK2A 3CCQS 2MPUA 3LQVA 3J7ZT 4C7QA 2ADBA 3BS9A 2KXNB 1UAWA 3UCZP 2E44A 1PO6A 1M1KT 2B0GA 1JJHA 2DNNA 2MQQA 2XNQA 2LEAA 2BZ2A 2DGXA 2LCWA 1OPIA 3VALA 2DNKA 2CQIA 1VQOS 1FT8A 3MUVP 1YIJS 3VF0B 1NO8A 3UCUP 1QM9A 2DGVA 3Q2SC 1NJIT 3NS6A 2WBRA 3G8TA 1YI2S 3R27A 4QU6A 3U1LA 2E5HA 1Q86T 2MHNA 1H6KX 1WG4A 4V19X 1X5SA 3VAIA 3MD1A 2RS2A 2M9KA 2RVJA 2ADCA 2DISA 3J7YU 2NZ4A 1XN9A 5D78A 4FXVA 2J76E 2MZSA 1IQTA 1N8RT 1R8PA 2VOPA 4FXWA 2DIVA 1H2TZ 4F25A 2M52A 2DGOA 3PIPQ 1JJ4A 2XS5A 2DNHA 3SDEA 1F9FA 5BJRA 1X4GA 2KG0A 2K3KA 2M70A 2DNOA 1VQPS 1A7GE 2MQMA 4WCEQ 1W2BR 1K9MT 1WEYA 3UWTA 4ERDA 3MUMP 3UD3P 2XB2D 3EGZA 3CCRS 3CCJS 2CQ4A 3BO3A 5GVQA 5DDRC 2M2BA 1OO0B
chains in the Genus database with same CATH superfamily
1TK8A 1RI7A 4EZ9A 1S0MA 2DH7A 1WTBA 1VQMS 4B9NA 4M5NA 1XEZA 2Z2LA 3GFHA 1ZZNA 2R7TA 4F0KA 2VU5A 1DQ9A 1KOHA 1WSRA 2BA9A 4NXNJ 3OJUA 2BABA 4DG1B 4WU3A 3NCQA 4DPYA 3VTIA 3TNVA 4DV3F 3RR7A 3JB9k 2EFNA 3R97A 4W90B 1QE1B 3KNAA 1T3OA 1VLOA 1S99A 4PQUA 1Q8KA 1RBAA 2C3YA 1U1OA 3DOLA 4QIGA 4MK8A 4DUZF 2BJ1A 2YKNB 4OZ2A 4KRWA 2CPJA 2A6MA 3UFCX 3RRKA 3EE3A 5F3TA 4FXDA 3ENVA 4UZCA 1S1UA 1WKKA 1U26A 2F9JA 2ZH5A 3QGGA 2IAJA 4RU2A 2QO3A 1HI1A 3RR8A 3W2WB 4OX6A 1KR4A 1N6QB 2EFGA 4NYZA 1DTTA 4IH6A 3TARA 5K8PA 3I82A 3SI8A 1GFWB 2KTQA 1YVFA 3SXLA 3GV7B 3KMSA 1N5YB 6FD1A 3EDQB 1WHYA 3GIIA 5ETLA 2JC1A 3B4DA 2AX0A 4K4ZA 1FWPA 1EP4B 3MEDA 2CQ0A 3DM2B 1KRPA 2V6AA 4IG0A 3LP0B 1V5IB 3R5AA 3SDEB 1FKOA 5ETKA 4KV8B 3IA0A 4F4WA 4K7QA 4RPFA 4YR2A 4DV5F 3QJPA 1WG1A 2FHMA 1CJUB 2DNPA 1MU2A 3GYXB 3JS9A 4RNFA 4AXJA 3M7VA 2XCPA 3KYLA 2OH2A 4C98A 3I9ZA 4N7TA 2LA6A 5CQGA 1Y00A 2VBXA 1UEKA 2OEJA 4EO8A 3WDOA 4DV3J 5J2NA 3CCMS 4O3RA 2VKZG 1EB0A 1LQ9A 1X60A 4O3QA 3PX6A 2CG8A 5LMUF 5DQGA 5ETVA 3RB3A 3PW2A 3DFEA 2HFOA 4O4GB 1T7PA 2F7VA 2MQ8A 3W3SA 4DUZJ 2CJKA 2HHHF 4Q2MA 1TQLA 3M05A 3MM6A 1QUPA 2DNGA 1ZAVA 2AJ2A 4H4OA 1S4FA 2JRSA 3ICLA 3IM9A 3ZZOA 2RMLA 2OTJS 1U1RA 2UUCF 3VAMA 3BSNA 3G6ES 4HHUA 3KHLA 2BE2B 4PWDA 1XNRF 3D0GE 3R9LA 2HHPA 4LRBA 3HVTA 1M5VC 3T19A 3GONA 2XBPA 5JVHQ 1TKZB 3V6DB 2FY1A 1R27B 1LWXA 2KT3A 3G87A 3CJ5A 3C16B 3CULA 2HVZA 4NA2A 2W8KA 2O01C 1PJ6A 2C2DA 1HPZB 3K8WA 3PXGa 3KK2B 1QVFR 3AA8A 1RTHA 4LF8F 3OVSA 4X2BA 3VQSA 4HH1A 5AT1B 3NAIA 2PMWA 4DX8H 1T9TA 2KKHA 1P6TA 5HAOA 4C11A 1EHWA 4DV5J 1XN9A 4OJGA 2EXUA 1IQTA 3CD5A 2ZOFA 1HQEB 4DG1A 4GKJF 3QT6A 1LK7A 4ZP8A 2C1EB 5KFIA 1QAIA 5CHCB 2UV8G 4ECWA 2R8KA 1HIYA 1U0HA 2VPZB 1KC8T 1S1XB 5HMYA 3UW1A 3HXMA 1N54B 2YKNA 3CJ8A 5LMUJ 3QZ7A 4LVOP 4J37A 5H9FJ 4DPWA 2XYGB 4TLQA 2VPXB 4ZVHA 5E3AA 3WQPA 5CYMB 3GIMA 1AB8A 3OVAA 2G2YA 3M9MB 9RUBA 3QFWA 2HHHJ 2MQPA 5D77A 1HBMA 4QIEA 3FEXB 3ENQA 4ED3A 1HBOA 3PO4A 2EK6A 4WFZA 3CCSS 1H2UX 1D9FA 2UUCJ 4OI3A 1JB0C 2XMVA 4J7CA 1FJCA 2ZDPA 5KFPA 5J2MA 2UXCF 3MMCA 4X4OA 3SV3A 1XNRJ 1BWVA 2EC0A 3MOZA 3ZZUA 1RWWB 3NGUA 4RO0A 1G6BA 4ED2A 1G1XA 2Q1LA 3CC2S 4G1QA 4CLUA 3PIOQ 4P7TA 3DM2A 4Q45A 4LF9F 4TNOA 3POTA 2Q6BA 2BJ7A 1MMNA 2F4FA 4RR5A 4O23A 4DN0A 3J81Y 4LF8J 2X1BA 4JYAF 1GX6A 5IV3A 4MFBB 3X3UA 4M5MA 2ZH3A 2CQBA 3H59A 4DV4F 2ASDA 4FKXA 4KPCA 3ZZPA 1U1LA 2QLWA 1BY9A 2GIQA 2A6OA 1QSLA 1HNWF 3BO4A 2ZUAA 2GQQA 5I42B 4NLQA 2V8DA 4GKJJ 1YQHA 4LRDA 5F41A 2XMAA 5HK4A 3HZEA 3PVXA 3MF5A 1XMOF 1MROA 2RRNA 2C3MA 2XEXA 4OYOA 4LF5F 2H48B 4CI0B 1KVKA 1CQMA 2HFZA 3I0RB 1VC6A 1TU0B 4FYDA 4OZ1A 2F40A 1FESA 4NA1A 4TU7A 4IFYA 4DN9A 2W7OA 3KLEB 2N7CA 2QA4S 3WZ0A 4A47A 3BN4A 4KH1B 4CO5A 2HS4A 2KJVA 4LFCF 1NRKA 3VR1A 4LF2A 3DLGA 3CTRA 3IXQA 4ZVPB 4MK9A 1KHVA 2BE2A 4O3SA 3D4JA 1L5UA 2DCLA 2CFXA 2DTJA 2ZJPQ 3CEDA 4R5PA 3MWBA 3GV5B 5KG4A 2AD9A 2XGQA 3HHLA 4K4WA 2VUGA 1H7XA 2D9PA 1JLFB 3ENAA 3ILOA 3C6TB 1RLDA 4Q5VA 4NA3A 1F5CA 2DJWA 2GMJA 3KK2A 3I32A 4ZPWR 1K8AT 2WOMA 3M6WA 1N48A 2DXFA 4LF9J 5C42B 3NGSA 2C2RA 1NJYA 2GW8A 4M5DA 3TVKA 1JKHB 2FY8A 2VQEF 2RKIA 1FWKA 1U2FA 2E9ZA 4O3OA 4JYAJ 1IKYB 3N79A 3H20A 4DV4J 3HZGA 2PC6A 1EQMA 1FKPB 5E41A 1N52B 2AJ1A 4YDDB 2D3ZA 3DHXA 1VC5A 3TQEA 5HSPA 1LK5A 1HNWJ 3J7ZT 1FDAA 3ADAC 1NHKL 4CT8A 1UVMA 1HWUA 3T9ZA 4UOCA 1T0TV 3QZ8A 1R0AA 3UCUP 3Q2SC 2BJ3A 3DI6A 1XMOJ 2KDOA 2BVZA 4TYAA 3RRHA 4NZ0A 3OXGA 1LWEB 1X5SA 4LF5J 2AT1B 3MD1A 4LRAA 2MKYA 1JXVA 2UUWA 1OY9A 2CADA 3D7SB 4B9SA 1N34F 1RABB 4L3NA 3V81A 1PILA 2C42A 3MEEB 1E6VB 2R7RA 3T1HF 2DT9A 3CCTA 4F04B 1QD1A 3V4IB 5I3UB 3FK4A 4OYIA 1WEYA 5B09A 3RGIA 4UOHA 2PMZD 3OFHA 3BGLA 4WIQA 4N47A 3KK1B 4OHWA 1TK5A 5KFQA 3ITHB 1NKBA 4NASA 4TY8A 4LFCJ 4AL6A 2ZOGA 3UR0A 3H4DA 3IRWP 4KBIA 2ZZNA 2L9DA 2I5JA 2J5AA 2HHWA 2YVSA 3PW7A 1TELA 2PI5A 4CZCA 3IGNA 4TU9A 2I0XA 3L7OA 3O3LA 3QT5A 2YNHB 3OL6A 4OZJA 2E1MC 3W5XA 2OSQA 1IR1A 2ZE2B 2LXFA 3TX0A 1NJWA 2FLLA 3CD7A 3FQLA 2C2KB 2HQFA 3PACA 2E29A 2XWXA 3OXLA 1WC4A 2YQ3A 4K4VA 2DHXA 2AYBA 3AFGA 4DL5A 4GVBA 1D8ZA 1FE4A 2FZKB 4GO5X 1VMBA 3HJFA 1PJ5A 2DKOB 3W65A 4DV7F 2WVFA 1MN9A 3M9OB 2XULA 3NNHA 4OYBA 2VQEJ 5B0EA 2ATCB 1X4DA 2RJZA 4NLOA 3IBWA 1X4HA 4MAKA 2PA3A 5K9FA 1HNVA 3QMQA 2ZZMA 1KHWA 1OY6A 1CVJA 1WC5A 2UUAF 3EX7B 1VQ7S 2BJ8A 3MM9B 4RUCA 3R7BB 3NKYA 4DR6F 4RWWA 1NH7A 4GC7A 3RU0A 1YDLA 5L1KA 4PWUA 4LMZA 2RQ4A 3CDWA 4RBUA 2J6TA 3GJTB 1VBZA 2QV6A 4JI2F 3LP2B 4PWWA 4ZCIA 3BZQA 3CJKB 4AL5A 1UJ5A 2UVUA 4ANCA 2I38A 3NY0A 3QAEA 3F73A 1N34J 2XWYA 2AP6A 3CT9A 2V4JB 5U47A 1NPRA 3T1HJ 3MOJB 1X9MA 2CWKA 2GVDB 2POKA 5KT5A 2ROEA 2KL8A 4HR2A 4M5LA 4LBIA 3TZXA 1C1CA 2NXJA 4N56A 4ILRA 3IRXA 4J9OA 2P6TA 1S9EB 1JWWA 4K4TA 4G6VB 3L3CA 3NEKA 1FDBA 4I68A 3TAQA 4JI3F 2Y3YA 1T9XA 4DBQA 3GJQB 1XR7A 4ZLPA 2MB0B 2YNIA 4TKTA 4P75A 4DFMA 4NX9A 5HQMA 2WTFA 1ZA2B 3W1YC 2XSFA 2IM1A 2AYMA 4URSA 1RT1A 2PFFB 2ACYA 1Y5IB 1SQEA 2QJ3A 5EN1A 1EAYC 4LT6A 2F65A 3CIZA 4WE1B 3EM1A 4N5SA 3LO3A 3BQ2A 4DU7A 2O67A 3BDEA 3VGUA 3ZZZA 4F0HA 3MM7B 2HFUA 1WHWA 5HO4A 2I6WA 2FJVA 3M2VA 4XDCA 1P1TA 2NUUG 1S6QA 3SCIE 1L3VA 3V4MA 4CO1A 3DRSB 1ZS6A 4DV7J 1VQYA 1X9SA 5KFUA 3UI3A 3AQOA 2XCAA 1FKPA 3RB0A 4NLTA 4DLGA 4C0HA 2EC2A 2WVEA 4QPXA 1YSJA 2QLBB 1Q8BA 3OTDA 2HNZA 4HDGA 4NLRA 2UUAJ 3DLEA 4NE9C 2V9KA 2L9WA 4YOEA 4A8QA 2DO0A 2D3OR 4BS2A 1NEEA 4DR6J 2WVCA 2BE9B 1R6YA 3H25A 4NWBA 2HWTA 2KXHA 1K73T 5LJ3Y 3TI0A 2MZJA 1HWLA 5DO2A 2DRDA 3D5MA 3OUYB 4JUZA 4JI2J 3R5JB 1JJCB 4P73A 2RS8A 3W60A 2VODA 2DY9A 4DL4A 2YKPA 1EIYB 1TKTB 2XLIA 3I0SA 2QC3A 2ZC4A 1LWCB 4C48A 3BS9A 5J2PB 1BLUA 2B0GA 1U0SA 1TTHB 3K7RA 1OPIA 1Q16B 3TEGA 2OMOA 4DPTA 1RWUA 4C2MA 1XBWA 3C6UB 1SL0A 3MM5A 4DCOB 2RVJA 3MCNA 2RQKA 1VR6A 1KTQA 2Z8QA 1AW0A 1T11A 4JI3J 2EFPA 1I1GA 2J76E 1Q78A 1VCTA 3HF5A 2HMIA 4M5IA 1OPZA 1C4CA 3E51A 1Q1KA 1SKUB 4JI7F 4I0WA 2KVQE 3ILIA 2H1YA 3DRXA 2LEBA 4OZ3A 2VA2A 2ZH4A 2AIRB 5H1SV 2AU0A 1OQ3A 4IRKA 3NNAA 3CO9A 1IKVA 1VQNS 1S6PB 3M2UB 3BH6B 3W9IA 1M5PC 1SIZA 2F5GA 2CZVC 2X7IA 2W7PA 3Q86A 1UPPA 3MXHP 1VQ4S 3DYAB 3FFIA 1U1PA 4JI8F 1NK9A 2A18A 4CLZA 3GR0A 4Z7YA 4QQBA 5CYJA 4PXDA 5J2QA 3GFXA 3NWGA 3QSIA 2G2OA 1HMVA 1G4CA 4ZDNA 1TL4A 5LMNF 3CW2C 3MUTP 1P1LA 4Y0FA 3W7BA 2MZ1A 1NDPA 4Q43A 2OEKA 3UVJA 2YKQA 3M9NB 4EMDA 4RW7B 3MFIA 4LF6F 1S1VA 2DH8A 3E2EA 4CH7A 3TZYA 1TFWA 4CO4A 3H2LA 4I6AA 3GSDA 4Y2KA 3W66A 1D3WA 2ZKTA 3BM7A 2KN4A 3SCKE 1Q4RA 1NK5A 2VBZA 4J90A 1WC0A 3UNYA 5KG1A 3D0IE 1JQGA 5IM0B 2P9EA 2FJAB 4PG4A 1HBNA 3H98A 1E6YB 1YZ6A 3M6UA 4ELVA 2H5JB 2LVWA 1R8BA 4QWBA 1MMLA 3BYPA 5JMNA 2ZH1A 3CJ3A 5ITHA 5GAHU 1V6HA 4OZLA 1P8GA 3W5ZA 2B9YA 3T6JA 4LJMA 1U47A 1R7IA 4ZPAA 4CP5A 1D9DA 2CG4A 2W9CA 2IC3A 5DDOC 5RUBA 4NLSA 2FC9A 3CJ4A 2JDJA 3MI7X 3GPAA 1WOPA 4JI7J 1RTIA 1I6JA 3DHWC 4C8LA 5H9EJ 5KFAA 4WPAA 4ANEA 1FRMA 2V2KA 5EWFA 3MM7A 5KFFA 4RW6A 4OLOA 3FCVA 1SJ4P 4HEA9 3C2PA 2IYIA 2V8HA 2J0SD 3OW2R 1Q7LB 2KB2A 2WSCC 5D4LA 4E2FB 5KFOA 3SQOP 4JOUA 4MJKA 1H74A 5L1JA 1G3OA 4JI8J 1O51A 3DRRB 2HNDB 3KUHA 4WP8A 1LW0B 1PC4A 3VZIA 4LIWA 2QFJA 3CD6S 4IRDA 5KOWA 2XS2A 5LMNJ 2J9DA 2VG6A 2CPFA 1YKWA 4A48A 4OHXA 4LF6J 3TJ8A 4ILMA 1AROP 3G2XA 4IH5A 2UU9F 1SH2A 3OUYA 4ZVSB 1NPKA 2HIQA 2DNRA 2CZ9A 3R5GA 5HLFB 2BJEA 1S1WA 4PABA 4I6YA 2B4PA 4EI2A 5J2PA 1S7HA 3IN5A 2C28A 1CJVB 3MAHA 4P6QA 1RHJB 3Q8RB 1U1MA 3NGTA 4LSZB 2YWKA 4RUBA 4ZIVA 2KM8B 1NB2A 1RP5A 2IIHA 2K1RB 3M2RB 1YBTA 2BE7D 2P6SA 5FJ4A 4KY3A 4HKQA 4P72A 1HL6A 4P10A 3R5DA 2ERRA 4Z37A 2DPJA 2ROPA 2YKAA 2NPFA 1REVB 4MIWA 4I56A 3E01B 2IPOB 3FEYB 5E33A 4UOGA 3IGVA 2UVWA 2CQCA 1M5OC 1DAXA 3NBPB 2Z2YB 1RT3A 2EBGA 1UAWA 2PIIA 2ZKUA 2BRLA 3CDAA 2J9EA 3PHTA 2CQIA 3RBDA 5GMEA 4ATNA 1BQXA 3BKUA 4MKBA 4DI6A 1JK9B 1F9EB 5CYQA 3DC2A 2H51B 3VGTA 1P9YA 3MCSA 4GMKA 3QPIA 4MYTA 3EPGA 1XMQF 3RAXA 2DGOA 3DYAA 2XS5A 5A2QY 2JEIA 4X4NA 2VC0A 4CCHA 1S6UA 3O5TB 3QO9B 1SQFA 4RZRA 4OFZA 1UKUA 5A0YA 4LSLA 3OQ2A 3M30A 3EZOA 1N33F 2IM2A 4RW7A 4AL7A 4IYQA 1C1BB 1XJWB 1GXTA 4RJVA 3OFEA 1DY3A 2DXDA 2XZWA 4DCPB 1FJGF 2CJAA 2IDEA 4Q44A 1XQIA 1SI9A 1Y4ZB 3A4TA 3DRPB 2UU9J 3PJXA 4K0KF 2JFDA 5B0FA 1TFYA 1X0PA 1UFKA 5BYQA 2WBMA 3WIUA 4FBTA 3NMRA 4I2PB 4ITSA 2AYEA 2Y0BB 2B43A 4P52A 1WOSA 4OJHA 4IG3A 2GHVC 2GAGC 1C0TB 5KOXA 2XY6A 1S48A 4OV6A 2JNJA 4B9LA 1HKAA 1FHTA 5A8RB 1RK8A 1IKXB 1URRA 2CA9A 5HQLA 3CO0P 1S1TB 3CUNA 3CNQP 3BR8A 1GNKA 2M4MA 1U6FA 4L76A 3GE9A 2J9CA 2AJ4A 3CPWR 4Y2IA 3VGSA 2D1CA 4Y00A 4NCGB 1M5KC 2HHSA 3OR2B 2OPRB 3VQTA 3LALA 4MK7A 5KG2A 2MKKA 1SC4B 2KM8C 3FBEA 1IR0A 1MWZA 1RT7B 2IDLA 1OMSA 3M8QA 1WHXA 2QFIA 5KFLA 1J27A 2PSZA 3R2CJ 2QYCA 2DGUA 2BQRA 2NCKL 2W9BB 2IA0A 1WDTA 2GQCA 4ECRA 1LEOA 1SIWB 3IS9A 3G8SA 4JB8B 4PPDA 4ZP9A 2LXUA 1XMQJ 2ALYB 1FCAA 3BR9A 5GAEI 2JC0A 2EW9A 4RKUC 1LW0A 2X51A 4H4MB 1H7WA 3WC2A 3I31A 2GVZB 4OI0A 2QE5A 1RAEB 2WCXA 2Y9HA 4G65A 5CZVA 4R25A 1YJ7A 2VDIA 1PAUB 4JV1A 5KFZA 5IFMA 2ABYA 1N33J 2P9GA 2BYCA 1Y10A 5HMZA 3PHEA 2MMYA 4G1IA 2QZ8A 1U02A 2CQPA 2BANB 2WB4A 3SCJE 1KEKA 2FUG9 1FJGJ 1UEVA 2KZMA 1FFSB 3BB5A 1ACMB 3HO1A 4K0KJ 4K4YA 2LU1A 1FFGB 3N28A 1RAAB 3J7A1 2DCUB 4B9TA 2WVBA 5MLCV 2FGOA 1NBEB 2Z2ZA 2LYVA 1HWIA 2QRRA 4FS1A 2J0XA 2CPDA 3TUJC 2V0NA 5EX0A 3T5LA 4F26A 4OYZA 4DZDA 2XHWA 4F4XA 3M4XA 4ICLA 4DR3F 2BKNA 1GAOA 1IBKF 3D2WA 4LSNA 3MECB 2SXLA 1CC7A 4Q2LA 3CB4A 4YS2A 2IVYA 3JYTA 1ZZFA 1NJZA 5CAAA 5GAGI 2AKWB 4BBYA 5A8WB 3B4MA 4USMA 1TK0A 3V5RA 3J7Z5 3KLHB 2BEFA 2CPEA 2A3JA 4IDKB 3CSKA 1HA1A 2BX6A 2ZOMA 4ZLLA 3M1VA 2KRBA 2AGQA 3OD2A 1MW7A 4DQSA 4A8XA 4DL7A 2OKQA 3NMAA 4P2SA 1MMDA 5B0AA 4F36A 2Y8WA 1Q82T 1HLWA 2VOOA 2MLZA 2N82B 4OQJA 2AHOB 1N0UA 2A0FB 4OI4A 3IG1A 5CD4H 2BZ2A 2LCWA 3PR4A 4J9LA 4O3PA 1NO8A 1NJIT 2ZEJA 1B0VA 3T5HA 1JXEA 3IO1A 3U1LA 3C14A 4X62F 1S57A 3UDCA 1C1BA 1MLAA 1UVKA 5G0RB 4C8YA 3DLKA 4FYWB 4GVLA 2IHR1 4C3MA 2DNHA 4K4XA 1F9FA 2M70A 4B17A 1W2BR 3IMQJ 3PRDA 5IT9Y 5JJBA 3MM8B 1OO0B 1NSKL 3VAGA 3MMBA 4Y2CA 2GJ2A 2ZH6A 2R2SA 2NXCA 3IR6B 3UD5A 4ZIWA 4J91A 2V5HG 5A8RA 2HGMA 1SL2A 1UJ6A 4MMOA 1D0EA 3VAKA 3CXCR 4OV1A 1WDDA 5F8LA 2PMHA 1PGZA 4DR3J 1IBKJ 2W2MP 5E3RA 2O66A 1JLBA 4DV0F 1RT5A 4J9UE 2F8EX 2ZBCA 3KLFB 2V94A 1X31C 1K44A 1DLOB 2FGCA 4WBFA 1LFWA 2BMBA 3P49B 1RHQB 4AD6A 2EEYA 1GMVA 3CJ2A 5C7PA 5J1EA 4G3IA 3UDLA 3TAMB 2IM3A 3NG8A 1KLMB 5KG5A 2PEBA 4PUOA 1YJNS 1IR2A 2M8DB 4HACB 1QY7A 1FRJA 1L3TA 2C2NA 4JP8A 6AT1B 4ED5A 4ZMMA 3P3DA 3PJ9A 5HI7A 1FFWB 3RW6A 1X8DA 3A12A 1IM4A 3HKZD 1Q8IA 4HI2A 2WHOA 4CYUA 4F3QA 1S77D 5D0HA 3JTOA 2MSTA 1Q5YA 1ZETA 3D67A 5IC6B 5LJ5Y 5LSLA 3DGVA 2E66A 3KJQB 1QSYA 2YWFA 3BBBA 1NH8A 4WK3A 3IWXA 1G7CB 4CO3A 2WK4A 2HRUA 5DM7Q 1L3KA 2GAHC 2V4QA 1B3TA 2NXNA 1FNOA 3CC7S 1RLCL 2Y0SD 1U1NA 1OIAA 1V5VA 2I2YA 2ZNYA 4K5RA 3OSNA 5LXYA 3BDPA 1KOOA 2E1CA 3LP1A 2PA8D 2KFZA 2F3JA 1YWXA 2WONB 3US5A 4OHVA 2CNLB 5K5MA 2R7XA 2DR7A 1FD2A 2RDDA 1QAYA 2ZBPA 4J5OA 5HROA 4JI5F 5F8NA 4O3NA 3JQJA 4DFPA 2YH1A 5JUMA 1KBRA 3PKYA 4F2RA 2Q3PA 2R7WA 4DV0J 3NL0A 4PR6A 4EUVA 1RU1A 2QA1A 1WHVA 3C19A 3DOMB 3LANA 4IDKA 3SFUA 1T94A 4Y34A 1TL7A 1U6BA 1HHQA 2QLFB 3QIPA 4QYZK 1GEHA 5AXLA 4N8NA 2H5EA 3LPYA 4J9VA 1H38A 1GMUA 1IXKA 5CH7B 3UN3A 1UL3A 5GADU 3R5BA 2ZD1B 4CRJA 1VQ9S 3U1MA 4RW9A 4DSKA 4RX6A 1VRTA 3JAMU 1S9GB 5IC4B 4N77A 4BLGA 4EWTA 1Y7PA 4PYDA 3KLIB 4YB1P 4CWBA 4EFAC 3ZTQA 4C0OC 4LUBA 2C2ZB 3QJLA 2JH3A 4ZPTR 4ZOSA 3FSXA 1GMWD 4CH1A 3QSYB 5B7WA 4MH8A 2BQUA 2GV1A 3TUIC 2DGXA 4UZBA 5K20B 1YIJS 1FT8A 3DU6A 3MUVP 2DRBA 1J2VA 1TVRA 2DVIA 1ZM2A 5B0DA 5L8RC 4GC6A 2UVRA 4PXBA 3QGIA 5C24A 4NRTA 2JJ4D 1TP7A 4U7CA 4X4SA 4KQZA 4RNMA 1CULA 3MMAA 3NLCA 2OFGX 4F25A 5ETRA 3AAWB 3VCDA 3Q89A 3ELHA 3UDEA 3MR5A 5T7LB 5BJRA 4KO0A 3I5BA 2XG8A 1VQPS 3R5CA 4CM2A 3MUMP 1EZZB 1UCNA 1QTMA 2ATLA 4X4QA 3CCJS 3BO3A 1TZ0A 4JI5J 3RB6A 4Q0BB 1WEZA 4KFBA 2HGNA 1NB7A 5ETOA 3PW5A 3QLHB 2ZHBA 3MPUB 1JNRB 4DQQA 3N6NA 3PO5A 3CDBA 2G0JA 2H54B 3DLBA 2BBEA 4FDFA 9ATCB 3GWCA 4ZCKA 4DF8A 2IRYA 5L39A 2GA7A 2CJ9A 3UD4P 2XLJA 4KGKA 1PCAA 1RU2A 2BOAA 3W2VA 2JFKA 3IFEA 3GIJA 3MTJA 1R8CA 3SIPB 1S12A 1YJVA 3FNNA 1BQMB 2CPXA 4I2QA 4RBVA 2VQFF 1RAIB 1UA1A 3QNWB 4KGMA 1B4SA 1UFWA 4PG8A 4WFAQ 5E2QA 2PGCA 2RUGA 1RWVB 3ZXWA 5F0UA 1B70B 2WSFC 2XGPA 2F8HA 4KC5A 2LA4A 2HEKA 2ZJQQ 5F8JA 4NXMF 2FLOA 4QJVA 2OHDA 3OT9A 1YX2A 2CPIA 1YBAA 2OPQA 3TZWA 4FN5A 5D3GB 4L73A 3FBFA 4DX5A 4NYPA 2HYIB 3PTWA 4LR7A 2ALZA 2IM0A 1HI8A 4WP3A 1F0XA 3VHQA 1DRZA 4ZN3A 2IYGA 3CJRA 2ZH7A 3MR2A 3KHHA 1HI0P 2HBZB 3HHKA 2B7CB 3DLJA 3G82B 4EO6A 2YNGB 1PKUA 2DPIA 2FPHX 4C8MA 2K3IA 5IS2A 5BR8F 3T1AA 3J81j 4OX9F 2D69A 1DTQB 1VBYA 4ECZA 2JOQA 3FUYA 3MAAB 4NCAA 2KXFA 2M7SA 1CPZA 4KGXB 2C3UA 3KK3A 5KFSA 2XMUA 2MY8A 2Z0GA 3HULA 1F1BB 4R8UA 3S6EA 3K5NA 3T9NA 2B9XA 3PKMA 2VG7B 1RWXB 4ES1A 2CPZA 1VI7A 2Y1IA 2HZVA 2QX0A 3RBXA 3EVOA 1FE0A 1NKCA 4DR1F 1X4FA 2ROGA 3LWLA 4CH0S 1YITS 4CLFA 4IR9A 3DOMA 2HVHA 4ZJOA 1J5OB 4K59A 2DO4A 1JLEB 2W25A 2N7YA 4I6WA 2DIUA 2HIYA 2MJUA 3M8PB 4NYOA 2ZJRQ 2E5LF 2J7UA 1Q53A 1HNIA 2GIRA 1F5BA 3VAFA 3OVBA 3QT8A 3OR1A 4WFYA 2VBYA 2V68A 1S5ZA 2RF2B 5EHHA 1HQUB 3D1QA 1BXNA 1FVSA 2DH9A 2FHJD 1RT4A 1NUEA 4M5JA 2VIHA 3DOKB 4C3KA 2RQCA 4QU7A 3CJTA 1YBUA 4XK8C 2B3TB 1WEXA 3K57A 2FVPA 3ZNJ1 4MYUA 1HD0A 3R7NB 4NZ6A 3A8KA 2HW3A 4NXMJ 2QEXS 2HK3A 4B3OA 3ZTRA 5IT4A 4DR5F 4DV1F 3I5CA 1ITPA 3Q8UA 3THVA 3DNCA 3IM8A 4DV6J 2WW4A 2H3EB 1U6ZA 1NK8A 2CQ2A 2HNYA 2LQ8A 1BQNB 5SUHA 1TV6A 3KXDA 3NCPA 1FRIA 4K5SA 2B6AA 2HBQB 1IVZA 4C8KA 5BR8J 4L6V3 3ZC4A 4EGLA 4MKYA 4BDPA 4OX9J 3L95X 4IRCA 5IXUA 4DR2F 2DNZA 3J80Y 2P9CA 1UTAA 1K1SA 2Z56B 1NHUA 3LQVA 2WVDA 5H9FK 1M1GA 2PT0A 2GIFA 2W2OP 5HVFA 3VALA 1HYSA 2DNKA 4KGZB 3HJVA 4JI4F 1S9FA 3R27A 4H4KA 3HFVA 2EKYA 1WG4A 4OMFG 2M9KA 4DR1J 4O44A 5D78A 3SCLE 3DDKA 3PDNA 5A76A 3CMQA 1N8RT 1RJJA 4NLYA 4USUA 2QL5B 4Q7AA 1TAUA 3FBCA 3UO0A 2E5LJ 1LW2A 2NREA 1JLGB 4AE5A 2VFRA 2DEIA 2M2BA 3SFGA 1MG7A 3ZFVA 1U8WA 3BQ1A 3DU5A 5SZTA 7FDRA 5A8KA 4NLWA 2VFUA 2HQIA 2CQ1A 1NDKA 1ULRA 3WHIA 1NHVA 1YJ9S 2CQDA 2EKNA 1IBLF 2E1AA 5DLGA 4DF4A 2DB1A 2JEFA 5ETNA 4KTQA 3D9BA 3JSMA 2G4BA 2WAQD 2ZC3A 4N76A 2H65B 2PE8A 3GLJA 4DR5J 5LL6d 4Q8EA 1LXJA 4DV1J 3DDNA 1Y11A 1R0CB 3AJ1A 3PCOB 1RYRA 1I3OB 1F2GA 2WZ1A 3DGPA 3KJVB 4EBDA 3G82A 4ZHRA 4E0DA 2B56A 2VL1A 1JLCB 3EWGA 4F4YA 4PXCA 3BO2A 1NNDA 3JTNA 3PV8A 5L1LA 5AE3A 3KKFA 1T03A 3O6QA 5CZXA 2Z4PA 3KMQA 3PNIA 3OXFA 3PYGA 2HSEB 3M8YA 4XAKA 3MGJA 4YY3F 1XERA 4RW8A 5HP1B 3OLAA 2M5YA 2PDAA 2R7VA 4G1PA 2B5JB 2WRMA 4WWSA 1ZA1B 4DR2J 4NEZA 2VHGA 1HBUB 2JSXA 2J6SA 3BGFA 3A1YG 1A6LA 5I3QA 3RZAA 2ZITA 4RW4A 1SJFA 3K5LA 4OYWA 3N0VA 1NM2A 2LDIA 4DSFA 4JI4J 1JLQB 2JEGA 3P4UB 1PYTA 4LQ9A 3MTKA 1OQ6A 3J80U 4DPXA 2Y1RI 4X4PA 4NMXA 3GQCA 3H5UA 4WXOA 3RBZA 4F4ZA 5C25B 3DXSX 4UOFA 1N5QA 1IJFB 5GAEU 2WSEC 4LBHA 3B6BA 5FDLA 3GTYX 1CQNA 4DFKA 3NAHA 2RF2A 3SQGA 2RHSB 1NKEA 1T9VA 5AE1A 1PC5A 4XDDA 2W2NP 2XYHB 5HL7Q 3LGHA 1ZM9A 1VQ6S 2ZVIA 1N5VA 1TL1A 2E5JA 2ZWOA 1PSDA 2BM1A 2IFXA 3QRRA 1N0VC 4HT7A 2D9OA 4RNNA 4ECUA 4Z7CA 1B0TA 4IFVA 2L3MA 3TWZA 1IBLJ 1NCLA 5KFNA 1RTDB 2MQNA 2OIHA 5LM7E 3B54A 4AUKA 3T41A 5FLXY 1AZSB 2BKPA 4KAIA 2MGZB 4R0EA 3GCWP 3C15B 1CBKA 3LH2S 4USJC 5JXSA 4WP9A 1RTJB 4KE5A 4JBCA 3UN5A 2OMLA 2HQ3A 2AJFE 2PFDA 4KKOB 3MPYA 3I5AA 3SSRA 1SC1B 1LXNA 5EGYA 2XSJB 1QE1A 1JXLA 1SC6A 3AD9C 4DSLA 2YX7A 4YY3J 2QA4G 3W5YA 4DDFA 1WOOA 5GAGU 3F44A 2MEWA 1Q95G 5AXKA 3A3OB 3H0PA 5K8MA 4J9QA 1U1KA 2J0WA 2V63A 2Q66A 4QCLA 4YHHF 2AGPA 3TA0A 2EBEA 1WNEA 1RXOB 1K0TA 1T9UA 4HT5A 3TVYA 3LGNA 2KT5A 1TL5A 4DMZA 3VV2B 1AUDA 3HK2A 3S8SA 1MWYA 5A6WA 3W2WA 1XNQF 1LOUA 1N6QA 3CCQS 2MLYA 2RB7A 1VK8A 1VOMA 3UCZP 1N4LA 1N5YA 5B08A 4EYIB 2R2RA 2GHWA 4DQPA 1D8YA 1SUQB 5K8OA 5HJXA 5L46A 2CXEA 1JLAB 2DISA 4YR3A 3KLGB 1EP4A 1EJ7L 3U02A 4K8RA 3PEJA 1RT6B 4L72B 3JSBA 3C8YA 3GFZA 3LP0A 3U27A 3SDEA 2O5DA 3HSJA 4KV8A 1SV5B 3K2YA 4ERDA 4TVAB 3WIVA 5GVQA 5KFDA 2KHDA 3HFZB 4EYHB 4JV5F 5KT7A 3R2DJ 4P74A 1S79A 4U67Q 1CJUA 2NR0A 2MXYA 1Q79A 2W2PP 2VJVA 2U1AA 1KKHA 1NMEB 4MKVA 1OSDA 1FRXA 1TL3B 5KG3A 5KFKA 1O5JA 4QPTA 1F5AA 1U25A 1RADB 1IKWB 1S49A 2MJNA 3EGWB 2M8HA 2FJBB 5LOQA 3PZPA 2VG5B 3W9HA 5AXMA 2CJXB 3D6TB 3RG6A 4ZPCA 5IZHA 4EBCA 1LNQA 4O4GA 3BGRB 2QLJB 2KZZA 2B4UA 2GFFA 3JSRA 3LAMA 2CNKB 4KT0C 4EK2A 2UUTA 3IR5B 5IQQA 4OX7A 3S01A 4ZP6A 2DYAA 2ZHOA 4YHHJ 3Q8YA 2OD6A 1QTNB 4M5GA 3IR7B 1FDDA 4W4MA 4X4VA 2JVRA 3G8QA 2V2ZA 3WX4A 3IBCB 2M3DA 2XQCA 5CD4A 3B78A 3TX8A 2DR8A 2D7SA 1FJEB 1C2PA 1XNQJ 4F2SA 1RACB 2OJ3A 4EZ6A 4NRUA 2UXCJ 3AD8C 1Y5LB 1TKZA 3HI9A 4HL9A 3V6DA 1T05B 1FX4A 3BGUA 4YB6A 1FRKA 4FZVA 5DDPC 4F4KA 3C16A 3KOAA 2PEHA 2GX8A 4ES3A 2HS0A 1T95A 1R6VA 1CJTB 3UNGC 1HPZA 3FSIA 4B3MF 5EWGA 4PCQA 5IWAF 4DL6A 5E7OB 1UEUA 5K14B 3D28A 2OFHX 3AXKA 3RAQA 4IKAA 4U96A 2R8JA 4URQU 1SPBP 3CIMA 2VONA 2GJFA 3M32B 1Y9OA 4JV5J 2AZ1A 1U2RA 2YPZA 3AT1B 4ZVOB 1ROFA 1R8AA 3CMES 2COLA 1HQEA 3K5MA 5HMWA 4ZVRB 3UPFA 2LECA 4OHZA 4DZ6A 1JX4A 3J81U 3CCVS 3LW5C 4DL2A 3HLUA 2V9WA 2HWHA 1NK4A 1RA7A 1RCXB 1S1XA 1S97A 1GXUA 2RDIA 3D6MB 1SH3A 4PQUB 2ZH9A 4ZP7A 1ZBTA 3DOLB 4AXIA 4GRSA 5CYMA 5DQIA 3HD2A 2BV3A 2VB6A 4IOBA 5CXTA 1NSQA 3KG4A 2DR5A 4PRFA 1XIQA 2N3OA 2YX1A 4DPOA 4CNYA 4U95A 4B08A 4ELUA 2J7WA 3AA9A 1IBMF 2LMIA 1S1UB 3Q8SB 2UXDF 2OSRA 1UVNA 3FVYA 2R42A 2HQDA 2VD3A 3H40A 2IAJB 1BGXT 3V2UC 4DSIA 1RKJA 3S7RA 5HQ8A 3X1LB 2BW7A 1HHSA 1X5PA 4KR0B 2Z57B 2JEJA 2HZCA 2FJWA 4WF9Q 5ADZA 2MKJA 1RT6A 2HGLA 4PG7A 4X65F 2CKWA 3D1OA 2HK2A 1PJ7A 1H98A 1DHMA 2IY5B 3TUPA 4B3MJ 3PW4A 4IG0B 2DNNA 2MQQA 5IWAJ 2LEAA 5D0GA 1UJ4A 4MFBA 1FKOB 1VYAA 4J9KA 3NS6A 2YY3A 1FX2A 1GXLA 5I4MA 2BRKA 4DUYF 1ZM3A 3J7YI 1AFIA 1UMJA 1MU2B 4NZ7A 4CTAB 5I42A 4U6PA 2E7XA 2VF3A 1VRUB 3BN7A 1IKWA 4FYXB 4WCEQ 1XC9A 3PX4A 2E1PA 1BWEA 2VG5A 4DV2F 4A8YA 1VIOA 4AT1B 1WC6A 2ZUGA 3KTQA 5J2NB 2QG9B 3I0RA 2UZAA 1U09A 3DRYA 3I4HX 4O0NA 2AEFA 3R7SB 5L38A 4LRCA 2NZCA 2DXEA 4HH0A 3KLEA 3Q8QB 2E9RX 2NS1B 2DRAA 4DQRA 1QAJA 3MM6B 1CG2A 2IBOA 3FMBA 2J0QD 4NCBA 3ETMA 4H4OB 1IM6A 1WI6A 2R2TA 2CNOB 1KP6A 1K1QA 1IBMJ 4QZVB 4J9PA 2UXDJ 1B7FA 4XPCA 4AQYF 4YEAA 4Z2XA 4CIOA 4PWDB 3K58A 2AEJA 1JLFA 3L7PA 3C6TA 3HVTB 4ER8A 4E8UA 4Y65A 4H4KC 4KB7A 4OYAA 5DS7A 5KT4A 3HVWA 2RT3A 5AJ3F 5H9EK 1GK8A 1N5TA 3OTOF 3H4BA 5C42A 4X65J 3SMZA 1CC8A 3FRZA 1Q0NA 2NXEA 2V8GA 1RBOB 2GO8A 2MZQA 2LKZA 1JKHA 1HNXF 5HBMB 3NS5A 3WC0A 1RISA 1IKYA 1CJKB 1TMJA 5KG7A 3TVZA 1Q5VA 3JXOA 2KHCA 1WG5A 2VPWB 5LXRA 3HVAA 1JMTA 3CCLS 3QRQA 3P8BB 3KHRA 2XO6A 3K17A 4ZITA 4YMEA 4C11B 4DUYJ 5F9LA 2OPPB 3HX9A 2W1BA 4LF4F 2DGTA 3G9CA 4O4RA 4UTGA 2CPYA 4IOAQ 4W92B 1KQFB 2MSSA 4H54A 5DZ6A 2XC9A 3PG9A 1LWEA 2AX1A 4USWA 4DV2J 1U0HB 3HHNB 5DGBA 4RU9A 3KUGA 4MKAA 4HDHA 4C8ZA 3MEEA 3TAPA 1E6VA 3AJ2A 1S0VA 2VV5A 1LFPA 3V4IA 3QWPA 1RSCA 3UDVA 5I3UA 3K89A 3CC4S 3DKDA 2KRRA 3KK1A 1GTHA 2B4VA 3ITHA 1PBAA 1HBMB 1YJTA 3AB2B 4IUFA 2VBWA 1A9NB 1HBOB 1SVDA 2FC8A 5D4PA 3ZTSA 1NAQA 2R8GA 4A8OA 3TA1A 3IP0A 5J2MB 4AQYJ 2U2FA 3MMCB 2EVZA 2YNHA 3FSYA 3FJ2A 2OP5A 5CCMA 4DR7F 1ZYQA 4RL1A 2ZE2A 3EZUA 5GAHI 2DD8S 2MYFA 3RBEA 1X4BA 2V67A 3CJ0A 3MD3A 1XWLA 3JSYA 5E3QA 3BBCA 4USIA 2IBKA 5AJ3J 2K2PA 4G1QB 4GO7X 3UE2A 3OTOJ 3K5PA 3FZBA 2KYXA 3V6KA 3POTB 2KT2A 4ELTA 3GJRB 2H5IB 3BSAA 4DCJB 2MQOA 5DDQC 2Q43A 1HNXJ 1W2IA 3KUEA 4U9RA 4DU8A 2YKOA 3ISNC 1OYEA 2IJFA 3FQKA 3DLHA 1PBUA 1X7VA 2LQJA 2GS8A 2JVOA 2C3OA 2DNLA 1X0FA 3G6VA 2B8QA 3DXBA 1FNXH 4FNIA 3MM9A 4PPZA 4CTAA 3BV8A 1VRUA 3MFHA 3ZNUA 7FD1A 1GH8A 4OI1A 3BREA 2BDPA 4LF4J 3HHDA 3TOQA 4B9MA 4UUXA 4LQ3A 3AOAA 2FTRA 1N5SA 2V34A 2AV5A 3LP2A 3HSZA 4QU6A 4ZCLA 1MROB 1RAOA 4F3MA 2OLWA 3SYZA 3CJKA 2QN6B 2F8MA 5CABA 5D6GA 2NZ4A 3EXYA 2W2QP 4FF1A 1U4BA 2UVVA 2CAJA 2V4JA 3GIRA 1KFDA 1X9WA 2GVDA 1FF2A 1SKWA 4DR4F 2DNOA 4OZ5A 4IFYB 3KFWX 2XI3A 4TXSA 3O1LA 1S9EA 3B8HA 3W62A 5DDRC 2Q6CA 4YN3B 1WACA 3VVUA 2YXLA 3DLGB 3CCUS 5KFXA 1QJHA 3I4PA 1F6TA 1UW9A 1F9HA 4R5PB 5EUHA 1FA0A 3AB4B 3HHLB 1D9AA 2OEMA 4XTTA 4B02A 3MMJA 4DR7J 2ZDOA 4YDXA 3EVMA 4WE1A 4OIXA 1B7YB 1FRHA 1I5OB 3CCWA 3P96A 2GC8A 5HBMA 1SKRA 2WOMB 1HNZF 2ZBIA 5D0EA 2R7OA 2AW0A 1CJKA 4ID8A 4BC7A 4M5DB 3DRSA 1EARA 3N4WA 2RKIB 3BSCA 1M1HA 3MPWA 2KFYA 3MCOA 2DBBA 4ZCMA 2OPPA 5GMDA 4WXWA 1G2EA 2C3PA 2VZ9A 4UW2A 4C8NA 4NOHA 1FVQA 2HURA 2W4DA 2X3GA 1FKAF 2BQ3A 2HWIA 2VA3A 2RD5C 2DNQA 2E5GA 2DITA 1MWQA 5DGAA 3EICA 5KFWA 1R0AB 2BJDA 5KAKA 4ZJLA 3DI6B 4ETXA 1VHFA 4LFBF 2OUGA 3NOGA 3BKFA 2XZTB 4MIAA 5KG6A 4XO0A 3OFFA 4YFUA 1BHNA 3D3CJ 1JNZB 3MZIA 3V81B 3HT3A 1TKTA 1LWCA 2O1PA 2OAUA 4DR4J 4NI2B 3C6UA 1N56A 4OL8A 2I8EA 4OLPA 4DPUA 3I96A 1ZPVA 4TY8B 4F0MA 1SXLA 3CVKA 3N5FA 2CWXA 1WKJA 2LXIA 2I5JB 2CVIA 2RH3A 3T3FA 4YB7A 3BH7B 1WI8A 1X5OA 5T41A 2ASJA 3LGMA 2ZWPA 2F63A 2DGQA 3H2UB 3HHEA 2IVMA 3GILA 1OSCA 1HWKA 1OY8A 3CMAS 2HFNA 3NS7B 1GMWA 3TR5A 1UP1A 1WTFA 1NZAA 1S6PA 2ASLA 3R3TA 3IBFB 1Z2LA 3M2UA 2C2MB 2VPYB 4O0IA 4IQXA 3ZZRA 5HN0A 3BEGB 4C4WA 3D68A 4GVBB 1HNZJ 4K4SA 1BUXA 1O6XA 3LUYA 5THWA 1P9QC 1QVGR 3NGDA 5K8NA 4PXEA 3HHLC 4CLKA 4F50A 3OTCA 2FHOB 1HNVB 3GMGA 1NU4A 4NPOA 2DHAA 4M5HA 1TKXB 1YJUA 3W61A 2ZVSA 2OGUA 4WFXA 1EKSA 2HHUA 2J9DE 2KFNA 4PG5A 3BSOA 4KGVB 1VQSA 2EFOA 5D4NA 2YWEA 5L1IA 4ECYA 2DNYA 1NZ8A 2V50A 3I55S 1SL1A 3OBIA 2QYGA 2DY1A 3SZ2A 2CUYA 3QIDA 4LFBJ 3THPA 5IM0A 4QWAA 2QMWA 2D74B 4LR8A 2JWNA 1TAQA 3VWSA 4WZQA 1E6YA 4FP9A 3L09A 3MR3A 2ASYA 3UQSA 3C46A 1UVIA 3VVTA 4ILLA 3FKBA 1C1CB 2YQ0A 3G8TA 2BW2A 1V3RA 3IRXB 4ENOA 1KFSA 2JL9A 5IQ6A 1S0NA 4QWDA 1RUSA 1KWMA 4OJ1A 3D1HA 2ZZTA 4DL0C 3BJYA 2VOPA 4M94A 2QMXA 3ILLA 1NLKL 2YNIB 3KG0A 1SB6A 2KG0A 2MQMA 3NCRA 3UD3P 2XB2D 5ETSA 1NSPA 2CDQA 3M8SA 1RT1B 2CQ4A 4TLRA 1S72S 2NSCA 3AOBA 1PAEX 3DN9A 3T6BA 1ZTTA 1FTRA 3KHGA 4X64F 4I64A 2DR9A 3M2VB 1DFDA 3JQKA 1S6QB 2H9ZA 1VQKS 3DRRA 2HNDA 2BUNA 2XTJP 4UUWA 2G13A 4WKYA 2DHSA 2VFTA 3QGPA 2HNZB 3PEHA 4WFNQ 2XMJA 3PRBA 3DLEB 2FVCA 2KI2A 1WD6A 3EJMA 4HHJA 1U1QA 3N6LA 5A2QU 1LKZA 2Z2MA 3A8JA 1CEZA 3M8WA 3LWMA 4OZ0A 1BC6A 4IQMA 3HT0A 3A13A 3IAM9 4MT1A 2C2EA 4JI1F 2CQGA 1IWGA 4LIRA 5HLFA 4L74A 2B8PA 2B9EA 3QJJA 4LFAF 1UA0A 4FYYB 2JHEA 3THTA 1CJVA 2E7WA 4EU0A 1ZAXA 2MKSA 4NI2A 1VBXA 1YRTA 2FHJA 3I0SB 2K1RA 3CGIA 3M2RA 2J8AA 3DDIA 4MIBA 3RTVA 3MURP 1T02A 3QRPA 2F1FA 4LVNP 3H7HB 1REVA 4ECQA 3P6YC 3MM5B 4FF4A 4Y2AA 1APSA 3E01A 2GGPB 3BBFA 2B4OA 3L7UA 4M8LA 4C3LA 4DX6A 2EI5A 3NBPA 3TJAA 5D15A 4OZNA 3LPEA 1HHTP 2MDAA 2R2UA 2HMIB 2Z58B 1FTCA 4BWJA 1F3FA 1PG5B 2RQMA 1RYSA 1X4CA 5DQHA 4NMLA 2GMLA 4CLWA 2LDYA 3NWRA 7AT1B 1M5SA 4FVCA 2BM0A 1WJ9A 5E3PA 4FPIA 3V6JA 3TW0A 4ZVFA 1SJ3P 2RRAA 1IKVB 1T9WA 5DRKA 4RBTA 4X66F 2HLUA 1XK8A 3RB4A 4I7FB 4ETZA 4X64J 1RWKB 3QO9A 4P7VA 2MKHA 2HVDA 3FFIB 3BKTA 2HHVA 1TKXA 1AXQA 2HQCA 1HARA 5J2QB 1WELA 5KFGA 1XTZA 3BGOP 2Q79A 1HMVB 1WF2A 4EBEA 4K50A 2VASA 1SJ1A 1HFEL 3UVJB 3AY0A 2QLXA 1D1UA 4ZKAA 1S1VB 2ZM6F 5CCLA 1T9YA 3AH6A 3LAKA 3DRPA 2J7KA 3ZZ0A 2IJNA 1R0BG 4FYVB 4QR2A 1RGVA 4DX7A 4CT9A 5F8HA 4JI1J 2A10A 3IWLA 4I2PA 2D3UA 1FJ7A 1TMMA 4L75A 4ZPVR 4LFAJ 4CLSA 1C0TA 1M90T 1HBNB 3OTEA 1DJ0A 1IKXA 4UY8T 1S1TA 1X5TA 4KJIA 4ALZA 4NLUA 3FGVA 1WF1A 3F56A 1VJQA 5HANA 2VDHA 5EX3A 3I87A 4NCGA 3CWJA 4K2XA 3HKWA 3NRBA 3OR2A 2OPRA 1FI4A 4JV0A 1Z2ZA 2E7VA 2MQLA 4ID5B 2W9CB 2IC3B 2ADBA 5DG9A 4A46A 1SC3B 2ILZA 1VS3A 2B51A 1ZM4A 1RT7A 2XY5A 5KT3A 1AUSL 4X4TA 4D3GA 3EGVA 5KFBA 5IT0A 1RTIB 4X84A 3M6VA 3VAIA 1DQ8A 5HMXA 2W9BA 2ADCA 2V4RA 3HCXA 3J7YU 2YBVA 4RW6B 1S4EA 1NJXA 2V69A 3PFEA 3EPIA 2LU2A 1H2TZ 4X66J 1A7GE 4H4MA 2AJQA 3W63A 2GVZA 3AOCA 2R8IA 5B0GA 3KLVA 2RRBA 2YX4A 1LV5A 1QSSA 1OYDA 2H4WB 3B82A 3ISND 5FIIA 3VZHA 3EXCX 5GADI 3HD1A 3CDUA 1DARA 2FLPA 4IOCQ 4Y28C 5E3CA 2IMWP 2WW8A 4X62J 3RW7A 4BCAA 2VG6B 2BANA 4F67A 3MPVA 3NNCA 4QIWD 2K7JA 1TUWA 1C4AA 4BHQA 2G0CA 3I9V9 5ETMA 1Q81T 2IVFB 1Q7YT 2HRTA 4QW9A 2ZM6J 2FB0A 2LQ9A 3PX0A 1AFJA 2EPIA 3PYEA 4A8WA 2KU7A 4M5KA 4DFJA 2CJYB 1WUUA 3RUBL 3Q23A 4DL3A 2C22A 3PW0A 1RT2B 2W4PA 1S1WB 2V8VA 3MHYA 1QLNA 2R7SA 1ZAWA 5ETPA 3H5XA 4DLEA 5IT9U 3M8RA 1U24A 4UQGA 1F3VA 3FBBA 1ELOA 1QDUB 2GGPA 3GIKA 3MECA 5DJBA 3RRGA 4OYMA 3UR3C 3MEGB 5C2GA 4AYBD 4LF7F 1FXDA 4AFFA 2NPIA 2UV8A 1RAJA 3H42A 3TA2A 5A8WA 4X4RA 1VISA 1FXRA 2XI2A 3KLHA 3OPKA 1RT3B 1TKDA 2VFVA 4N8OA 4Q8FA 1PYOB 4ZPDA 1VC0A 1RCOB 3TO8A 4ECXA 1WWHA 3BQ0A 3OL8A 1SJQA 3I6PA 4YB5A 5MAOA 2HBYB 1CSJA 4QBUA 4WZMA 5CYQB 3HMJG 1W25A 4I7FA 1U2CA 1RBLA 2FHKA 2QSFA 3JQMA 3CE8A 3L9ZA 1UWBB 3OFGA 1RKIA 1SBRA 2CNNB 3LOUA 4B3RF 2K8GA 4LBPA 3N01A 3RAMA 3GG1A 2XNRA 2QIFA 5G0RA 3R1HA 5A0YB 4LSLB 4CLYA 3M30B 4TY9A 2HHTA 2LEPA 1B99A 1FERA 4XIUA 4PEOA 2NQPA 5LSRA 2HFSA 5KFJA 4QWCA 4UT4A 1KS2A 2DHGA 5I3PA 2APOA 2B7BB 3MM8A 2RHQB 1RZMA 1N36F 4FF3A 4DUTA 1TUVA 1KQSR 1VGYA 1OJ4A 2FQQB 2ZHAA 2ILYA 4JI0F 4ED1A 3HSDA 2M0GB 5EWEA 2AMCB 1VBKA 1RAGB 2V2VA 3C3LA 1ZH5A 3CJQA 5KTQA 1T3NA 4WTYA 2HHQA 1RQ0A 5HVHA 3FMWA 1CLFA 4IG3B 3A3PB 3G4SS 1R89A 1KQGB 4QIVA 2FJEB 1M0SA 3HP6A 4LF1A 3ZTOA 3C66A 2RIJA 2HS3A 2OD4A 4U8YA 1SKSA 3ET6B 3D0HE 1WSVA 1FK9B 3WBZA 3KLFA 4F4AA 1DLOA 3P45B 1KSPA 2FLNA 3QQCD 4ID5A 4WFBQ 1HQ2A 1L3UA 4LF7J 2GNKA 4FNHA 4ZVTB 3OL7A 1Y5NB 3D66A 1A0OB 3FRYA 4I4BA 2EG2A 3D6FB 2QL9B 2NUHA 1Y3JA 2E1RA 3TAMA 4RUHA 1RWPB 1KLMA 1F2HA 4PG6A 2XHCA 1BE4A 3M8QB 1VK3A 1LWFB 4CLLA 3BYRA 4HACA 3TYTA 1CS4B 8RUCA 3TQ1A 1O8BA 5KFVA 1HD1A 3RYLA 1KD1T 3TP2A 3IS9B 2VJUA 4C7QA 2XZDB 4Y6IA 5KG0A 1RWNB 4B3RJ 3PRVA 1VQOS 3VF0B 2DGVA 2HBRB 4C8OA 1VHIA 4ED0A 4V19X 3HHLD 5M2UA 3GYNA 3PFOA 2FJXA 1BD6A 4DOZA 1PIEA 3G6YA 1VLYA 2DIVA 3PIPQ 2Y1JA 1N32F 1R43A 1MNEA 3SSQA 3EVWA 1K9MT 3H8YA 4B9VA 2HAIA 2P8IA 1HR0F 1N36J 4BWMA 3G96A 1RT2A 4ZN1A 1T8EA 3O44A 3G6XA 5KFTA 3P5TL 2KO1A 1UETA 1U8SA 4JI0J 1PYSB 4ANDA 4J9SA 2NYHA 1YK9A 4KPYA 2WONA 2XMWA 2G9OA 1IQZA 2EK1A 3Q83A 4CO2A 2DGWA 1S76D 2LP4A 3PYFA 2QGFB 2EG1A 3UCGA 5DZ7A 3VGVA 2IA6A 5M2RA 4FVMA 3HSGA 2AEMA 2X1AA 3KJNB 4WKRA 5A6PA 4ICLB 3MEGA 3GB0A 2XM3A 3R8YA 2OTLS 2CPHA 4LSNB 1FEEA 4HLBA 3CCZA 1H2VZ 3MCMA 1UFLA 3MDFA 3Q8PB 3W8PA 3JYTB 3BPDA 2J8SA 5F8IA 2KYZA 3OTBA 1EQ0A 2G2ZA 3O8WA 4OJ3A 1EX8A 2MKCA 2B9WA 3QATA 3M1VB 2HQGA 3H90A 2L41A 2HG4A 2R9LA 1UWBA 2OO4A 3IC1A 3ZZYA 2ZD1A 3HDSA 2VQFJ 3QGHA 4NLXA 1UZDA 2F4VF 3NXZA 1WC3A 4A8SA 2FIUA 4FKYA 2L9NA 4I69A 1S9GA 3IG1B 1VQLS 2AYGA 2ZFHA 4ZA1A 3KLIA 4DXLA 2HAFA 3C14B 4LR9A 2I9SA 4WJBA 3EGNA 2X1FA 1WF0A 4ED7A 2P5VA 1BMQB 3DLKB 3CD0A 2LLZA 3KJFB 4PKDB 2ACMA 2XS7A 3EZ5A 4OI2A 4OYPA 3TRGA 2RDJA 1H3DA 1NPPA 2AQ4A 1N32J 3ZTPA 1H73A 3KDOA 4FS2A 1XR5A 2DNMA 5KT2A 2R4FA 2MY7A 2BKOA 2ZNZA 1HR0J 1URNA 1YJWS 2VH7A 2UXBF 3MMBB 4DQIA 1KVJA 5BYSA 2N4DA 4M63A 4E98A 4FBUA 2HKEA 2XMMA 2Y1LB 2G0IA 2HHXA 5T7LA 2GQ2A 2VICA 1ICEB 2YWGA 4CNZA 2HVIA 1YJRA 3ET6A 4KIAA 1FK9A 2EFQA 1S0OA 4NLPA 4Q0BA 1Y3KA 3K8VA 4F3OA 2NYIA 3QLHA 1Y0HA 4A4JA 5KFMA 2RE1A 1YRUA 1NSAA 1IJEB 4ZVQB 1ZOTA 1JLBB 4DHVA 1RT5B 1UZHA 3Q24A 1NDCA 3F41A 3FC9A 2RU9A 4TYBA 1HWJA 4ECVA 2BOPA 2AZ3A 2A2CA 1RTZA 3Q0AA 2RAQA 5J1EB 1FWLA 3NGRA 1LWFA 1BQMA 1CS4A 2HPUA 4ZLNA 2RILA 2HZAA 3H5YA 2I1RA 5FD1A 1JJ2R 4PUOB 1L3SA 1FDNA 3HVRA 3TEHB 1QAXA 2YTCA 2OI2A 3U7JA 1AYEA 1FNMA 4B9UA 3SSSA 4CO0A 1YTYA 2F4VJ 3ULHA 4KYZA 1VJWA 3E8OA 5D3GA 1KQKA 2AGOA 4CYUB 2ZBRA 3HFKA 2LQBA 2LFVA 2YNFB 4KSEB 4BC9A 3VAJA 4RNHA 2EWHA 3CJSA 3EDRB 4B3SF 3SV4A 2QSWA 4HTJA 4KH0B 1ZTWA 3OHBA 1S6OA 1PO6A 2YNGA 4HHHA 4NEYA 3KWMA 3BF4A 2PO4A 4RUAA 1H0HB 2UUBF 1DTQA 3BPSP 3MAAA 1B64A 2UXBJ 4FXVA 1MSWD 2A1BA 3DMJB 2XY7A 3LP1B 2M52A 3OLBA 5J1PA 1IWAA 5F8MA 1GX5A 1IBCB 2VG7A 3GR1A 3UWTA 1YRXA 5T14A 1GT8A 5HROB 3N6MA 2BXJA 3FCHA 3ZO7A 4J9MA 1RAHB 1SJRA 4KHPF 2YKMB 1J5OA 1JLEA 5L9NA 2QT7A 4ED4A 5DM6Q 4LRFA 5CA5A 2L08A 2KH9A 2OELA 3R6LB 2YWHA 2AWZA 2W4CA 2Y8YA 3M8PA 3GSIA 1C0UB 2FJDB 3GYGA 3SBMA 1VFJA 2CQHA 4JI6F 2QTWA 2FDNA 2UP1A 1TL7B 3Q22A 3QIPB 4JV2A 3ILJA 1R3NA 1HQUA 3OJSA 4CDIA 1NK7A 2VC1A 3DOKA 2N3LA 4CQ1A 4DEZA 2NSBA 3D3BJ 3V6HA 3T1YF 3D6HB 5HATA 2ZH2A 4PYAA 2GO9A 4RW9B 2XYPB 5DG7A 5J1NA 1V9OA 5LSOA 4MTPA 1VRTB 2QMUB 2MTLA 4A8KA 1AT1B 3AQPA 5IV4A 3A3NB 3KDNA 4P9SA 3JTPA 3ISZA 2NXUA 4C97A 5F0WA 1S7IA 1DZ5A 3AXMA 5KFRA 1VRQC 4B3SJ 4Y3CA 4ECSA 4IH7A 5JVGQ 1BQNA 1O0PA 3K0JA 2CJQA 2AJ0A 2FZCB 1DQAA 2GCFA 4TQRA 1K0VA 3GV8B 1TVRB 1AA1B 4NLVA 2UUBJ 1HW9A 3T5JA 1RAFB 2ZBQA 5C24B 2M88A 3GP9A 4U7UK 2XMTA 2W9AA 2YH0A 1CULB 3MMAB 4USKA 4M1KA 4EEYA 2ZH8A 2IRUA 1S10A 2YWWA 3MEKA 2JX2A 4KO0B 1NXIA 1V3ZA 5C2CA 1EETB 3LA0A 4HVZA 4K2JA 2MKIA 1RWMB 1U45A 4RLEA 3CCES 3IWNC 1YG0A 3DLLQ 2XLKA 4KFBB 1KLNA 1SH0A 2VFSA 4KHPJ 4ZLJA 1TR0A 2FYXA 4YQWA 4GKKF 5GMKa 2FVSA 1J5EF 1FXLA 2J6UA 1H72C 4FPRA 2HLTA 4ZVEA 5D8HB 3T5KA 4ED8A 1KONA 4WIIA 4HI1A 4IO1A 2CJBA 3A8EA 4XPEA 3JAMY 1JLGA 4YUDA 4JI6J 3W2VB 1U7LA 4KHRA 4OHYA 1RHUB 3L4BC 2CDRB 4I2QB 1OWXA 2JZ5A 4J9NA 2MLXA 1REGX 4HTIA 4F7VA 1GTEA 3R6GB 5G4DA 3T1YJ 2BR0A 1WC1A 1UVJA 2G1DA 1NK6A 3PR5B 2VKRA 4ED6A 2YNFA 4UY85 2OPQB 2JLEA 1N88A 1UWAA 2GZOA 3W9JA 3EMTA 1R31A 4NLDA 4D3HA 4QOTA 3KJVA 2YQ1A 1VQ8S 1FD8A 2IJRA 2F9DA 1VDHA 1JLCA 3FZ2A 3TANA 3SEOA 1U49A 4WK1A 4ECTA 4UQTA 1XR6A 3VAHA 2KVIA 3KG1A 4P2MA 5FLXU 5E0OA 4HYKA 1D09B 1SCJB 1X4AA 5HP1A 3DMJA 2PI4A 5DETA 2GJIA 3QAUA 2B5JA 2CVEA 3NGKA 5F8GA 1HBUA 2W7AA 3AODA 4QYRA 1UW4A 4OYXA 4USHA 3KK3B 1RHMB 2MPUA 4FF2A 2KXNB 2E44A 1M1KT 1WKLA 4RWXA 4X4UA 2RUSA 1JJHA 2XNQA 4R8UB 1RB0A 2IRXA 5B0BA 1QM9A 1YI2S 2WBRA 3FDSA 2YKMA 1JLQA 4WYWA 2MHNA 2FVQA 2FVRA 2KJWA 3S1TA 2CIMA 4B3TF 2K7KA 2RS2A 3PM9A 4UF4A 4I1TA 3AD7C 5C25A 1HW8A 3RJMB 2W24A 4YP3A 2GMHA 2R7UA 1C0UA 2OPSB 4URGA 1R8PA 1UPMB 5IOLA 2IMOA 1JJ4A 4C6AA 4GKKJ 3OHAA 3D54A 1J5EJ 1X4GA 4QR0A 5D4OA 2L48A 4DJBA 3ETOA 1HNIB 1QUVA 3M8ZA 3OR1B 2E5IA 3UN2A 3ONQA 3DCAA 4USTA 4RNOA 1RT4B 5KFHA 2HRYA 3GFYA 4CLPA 4DS4A 3EYZA 2CRLA 3GZ7A 5ETTA 1DURA 3ENWA 4DSJA 5BXIA 4QWEA 2K06A 1VQ5S 2Z30B 2N4CA 1RTDA 4R0JA 1JIHA 1KVIA 4W98A 5ETQA 1YGYA 2D41A 1AZSA 4B3OB 3CF5Q 4ZK7M 2MGZA 1F60B 3GU0A 5HJYA 3Q2TC 3C15A 3I56S 3LTOA 1X4EA 4S0MA 1RTJA 3K59A 4WTOB 5DLFA 4DS5A 1RE1B 1ZPWX 3E3XA 4U7UD 4QIFA 2HFVA 4KKOA 2R3VA 2HNYB 1OS5A 4I67A 5KFCA 4F8RA 3M6XA 2CYYA 2FD2A 1I94F 1TV6B 2XSJA 3OV7A 3P5BP 3GG0A 2B6AB 3MR6A 2MZTA 5AXNA 1P27B 5C5JA 1U48A 2CZ4A 1VIXA 1KTVA 3H5SA 1FO1A 2DR6A 3IAS9 2DGSA 4N41A 3U1NA 1W7WA 4USVA 1EETA 4NL5A 2O3DA 4KHMA 5EDWA 5M2PA 2MZRA 4K4UA 1HYSB 4M95A 1K47A 3GCXP 1KN6A 3TJ9A 2RU3A 4B3TJ 4WU2A 4O44B 4LREA 4PZVA 4ES2A 3G86A 3F0NA 5E5NA 3W8GA 2RNEA 1NK0A 1Z1ZA 5AE2A 4C0BA 3CDEA 5KFYA 3HPOA 5BYRA 3OSPA 1LW2B 2R7QA 1SUQA 1DTTB 3NP5A 5F9NA 2NLWA 2G1HA 5LT5A 2W01A 5HVGA 1JLAA 3KLGA 4OI6A 3WX8A 1B0PA 4YR0A 1GQEA 5A8KB 3MPDA 3FEZA 4NLGA 2JLGA 3QWUA 4F02A 2KG1A 4A8FA 3GJSB 3MEDB 2V8PA 1SV5A 3TUZC 2HVEA 3MAQA 1XMBA 2BJ9A 2XO7A 2BACA 4TU8A 1S59A 2JLFA 4IR1A 3JSMB 4DV6F 3PYDA 4U8VA 2YPYA 4PQAA 2LQ5A 1Q8LA 3QT7A 2PN6A 1FEHA 4ZPBA 4L3KA 1TL3A 3MR7A 1FRLA 5D0RA 3DGPB 2XMKA 1R8HA 4ZHRB 4NXNF 2GHPA 3N9UC 3NOCA 1V3SA 1TUGB 1IN0A 1UVLA 2E9TA 1T03B 1I94J 4ZJQA 3EUNA 2A2DA 2AF6A 5F3ZA 3FCWA 2QL7B 4ZVUB 3ZZTA 3QBCA 3J7AN 3G71S 3K5OA 3R1LA 2MHEA 4RW8B 3AHPA 2C2OB 4V1Ak 1KDNA 3BGRA 3O2IA 1SQGA 2DHHA 1YLXA 3A8IA 2WB1D 3PY8A 3PJWA 4CM0A 2X1GA 2P2CB 8ATCB 1I51B 6FDRA 3TZZA 3W64A 4CLTA 4PAAA 1YHQS 3KNGA 2QA2A 4P2XA 4RW4B 4WYLA 1WORA 3Q8VA 2V2QA 4Y2MA 4A8MP 4IO9Q 4TQSA 1Z4UA 3HM9A 2RSQA 2EFVA 2OPSA 4DWIA 3AJDA 2H4YB 1RHRB 1RHKB 1DBDA 4DSEA 2CQ3A 4ZVGA 3N5BA 3H2VE 2PD1A 4OX8A 5L9XA 2DK2A 4QYZJ 1NDLA 2X3DA 3QFHA 4QR1A 4ZS6A 5FDLB 1T05A 5B0CA 1RA6A 4P2FA 3SQGB 1YZ7A 2E5HA 1Q86T 1H6KX 1RDRA 1W26A 1CJTA 5KFEA 2D3O1 2DEJA 1KNZA 1TL1B 4P71A 2FZGB 1RWOB 3OL9A 2MZSA 3LF0A 4FXWA 4J9RA 3QYYA 5K14A 4C9DA 1IUJA 2K3KA 4IFVB 1MN7A 2W8LA 2R8HA 3EGZA 5DG8A 3CCRS 4TN2A 1RTHB 1EKRA 8AT1B 1M5HA 3M32A 4V19J 5KT6A 4QW8A
chains in the Genus database with same CATH topology
2RRBA 2YX4A 5KT7A 1TK8A 1LV5A 1RI7A 1QSSA 1S0MA 4EZ9A 1UKUA 1S79A 5A0YA 4LSLA 3B82A 4U67Q 3OQ2A 3ISND 3M30A 2DH7A 5FIIA 1WTBA 3VZHA 3EXCX 1VQMS 1N33F 4B9NA 2IM2A 5GADI 2NR0A 3CDUA 1XEZA 4RW7A 2MXYA 1DARA 2FLPA 1Q79A 4IOCQ 4Y28C 5E3CA 2IMWP 2WW8A 4AL7A 4IYQA 2U1AA 2Z2LA 1C1BB 3RW7A 1GXTA 4BCAA 3GFHA 1ZZNA 3OFEA 2VG6B 2R7TA 1OSDA 2BANA 4F67A 3MPVA 2XZWA 3NNCA 1DQ9A 1FRXA 1KOHA 1TL3B 1MSWD 4QIWD 5KG3A 2K7JA 1FJGF 1C4AA 4BHQA 2G0CA 2BA9A 5KFKA 3I9V9 1O5JA 2IVFB 4QPTA 1Q81T 1Q7YT 3OJUA 2BABA 2CJAA 4Q44A 4DG1B 1F5AA 4WU3A 4QW9A 1SI9A 3NCQA 1Y4ZB 1U25A 2FB0A 2LQ9A 3VTIA 1IKWB 1S49A 3TNVA 2MJNA 2EPIA 2M8HA 3DRPB 3EGWB 3PJXA 4DV3F 3JB9k 3RR7A 2EFNA 4A8WA 2FJBB 2KU7A 4K0KF 4W90B 4DFJA 2JFDA 5B0FA 1TFYA 1QE1B 1X0PA 5BYQA 3PZPA 3Q23A 2VG5B 2WBMA 5AXMA 1T3OA 3KNAA 4FBTA 4DL3A 4ZPCA 3NMRA 4I2PB 4ITSA 2C22A 2AYEA 1RT2B 5IZHA 3PW0A 4EBCA 1S99A 2B43A 2W4PA 4PQUA 4O4GA 2C3YA 1S1WB 3BGRB 2KZZA 1U1OA 3DOLA 4QIGA 2B4UA 4OJHA 2V8VA 3MHYA 4IG3A 2GHVC 4MK8A 4DUZF 1C0TB 1QLNA 2GFFA 5KOXA 2YKNB 3JSRA 4KRWA 2XY6A 3LAMA 2R7SA 1S48A 1ZAWA 2CPJA 4B9LA 4KT0C 2UUTA 3IR5B 3H5XA 1FHTA 5IQQA 5A8RB 1RK8A 4OX7A 1IKXB 1URRA 3UFCX 4DLEA 3RRKA 3S01A 3M8RA 5F3TA 1U24A 4ZP6A 4UQGA 1S1TB 3CUNA 4FXDA 3BR8A 1GNKA 1ELOA 2GGPA 2M4MA 2ZHOA 3ENVA 1U6FA 3GIKA 3MECA 5DJBA 3RRGA 2OD6A 1S1UA 3UR3C 3IR7B 1FDDA 3MEGB 4X4VA 2JVRA 3GE9A 3G8QA 3WX4A 2J9CA 2AJ4A 1CPZA 4AYBD 1U26A 3CPWR 4LF7F 4Y2IA 2F9JA 1FXDA 2M3DA 4AFFA 2ZH5A 2D1CA 4Y00A 4NCGB 2NPIA 2UV8A 3B78A 3QGGA 1M5KC 1RAJA 2HHSA 2IAJA 3TX8A 3TA2A 3OR2B 2DR8A 2OPRB 3VQTA 5A8WA 4RU2A 4X4RA 2QO3A 3LALA 1HI1A 2D7SA 4MK7A 1FJEB 1C2PA 1FXRA 5KG2A 3W2WB 3RR8A 2XI2A 4OX6A 1KR4A 1N6QB 2MKKA 4F2SA 3KLHA 2EFGA 3OPKA 1RT3B 4NYZA 1TKDA 2VFVA 1DTTA 4N8OA 2KM8C 4IH6A 3TARA 1IR0A 2OJ3A 4ZPDA 4Q8FA 4EZ6A 4NRUA 5K8PA 1VC0A 3I82A 3SI8A 2KTQA 1YVFA 3SXLA 3TO8A 3GV7B 3KMSA 4ECXA 4K4VA 1MWZA 1Y5LB 1TKZA 3HI9A 4HL9A 3V6DA 1T05B 1RT7B 1WWHA 1N5YB 3BQ0A 6FD1A 3BGUA 4YB6A 3OL8A 3M8QA 1SJQA 1WHXA 1WHYA 1FRKA 4FZVA 5KFLA 3I6PA 4YB5A 5DDPC 4F4KA 2PSZA 3GIIA 2JC1A 5MAOA 3KOAA 2PEHA 1CSJA 2QYCA 2DGUA 2BQRA 2GX8A 4QBUA 3B4DA 2IA0A 5CYQB 2W9BB 4WZMA 4ES3A 2AX0A 1KFSA 4K4ZA 2HS0A 2GQCA 4ECRA 1T95A 3HMJG 3UNGC 1W25A 1HPZA 3FSIA 4I7FA 1EP4B 1SIWB 3MEDA 3IS9A 2FHKA 2QSFA 3CE8A 4B3MF 5EWGA 3G8SA 4PPDA 1UWBB 2CQ0A 3DM2B 1KRPA 4ZP9A 3OFGA 4IG0A 2LXUA 4PCQA 1RKIA 1SBRA 3LP0B 5IWAF 3LOUA 4DL6A 5E7OB 1FCAA 1UEUA 3BR9A 3R5AA 5K14B 4B3RF 5GAEI 2JC0A 3SDEB 3D28A 2OFHX 1FKOA 2EW9A 2K8GA 4RKUC 3RAQA 1LW0A 4IKAA 2X51A 3IA0A 4H4MB 4KV8B 4F4WA 1H7WA 2R8JA 4URQU 3CIMA 3N01A 3WC2A 3I31A 2VONA 3RAMA 4OI0A 3GG1A 2QE5A 3M32B 2WCXA 1Y9OA 4YR2A 4DV5F 2XNRA 5CZVA 3QJPA 4R25A 1WG1A 2QIFA 5G0RA 1U2RA 3R1HA 5A0YB 4LSLB 2FHMA 4JV1A 5KFZA 3M30B 1ROFA 4TY9A 2HHTA 2LEPA 5IFMA 2DNPA 2ABYA 1R8AA 1FERA 2P9GA 3CMES 2BYCA 1MU2A 2COLA 3GYXB 4XIUA 5HMZA 1HQEA 3K5MA 3PHEA 4RNFA 5HMWA 4AXJA 2MMYA 3UPFA 4G1IA 2QZ8A 2XCPA 3KYLA 2LECA 2NQPA 4OHZA 2OH2A 4C98A 5LSRA 2CQPA 1JX4A 3I9ZA 2BANB 2WB4A 3SCJE 1KEKA 2FUG9 5KFJA 4QWCA 2LA6A 3CCVS 3LW5C 1KS2A 1UEVA 2DHGA 5I3PA 2APOA 5CQGA 4DL2A 2KZMA 1Y00A 2B7BB 3HLUA 2VBXA 3MM8A 2V9WA 2HWHA 1N36F 4EO8A 3WDOA 1NK4A 4FF3A 1RA7A 1TUVA 1KQSR 5J2NA 3CCMS 1VGYA 4O3RA 2VKZG 3BB5A 4K4YA 1LQ9A 1S1XA 2ZHAA 3HO1A 2ILYA 2LU1A 4O3QA 4JI0F 3N28A 3J7A1 1S97A 2DCUB 1GXUA 4B9TA 2RDIA 4ED1A 3PX6A 5MLCV 2M0GB 5EWEA 2FGOA 5LMUF 5DQGA 2LYVA 3RB3A 1HWIA 3DFEA 1SH3A 3PW2A 2QRRA 4FS1A 2HFOA 3C3LA 4PQUB 2J0XA 1ZH5A 2ZH9A 4O4GB 5KTQA 1T7PA 2F7VA 4ZP7A 1ZBTA 3DOLB 1T3NA 4WTYA 2CPDA 3TUJC 4AXIA 2HHQA 1RQ0A 5CYMA 3FMWA 2V0NA 4IG3B 5DQIA 5EX0A 3G4SS 1R89A 3T5LA 2BV3A 3W3SA 4F26A 1KQGB 2CJKA 2VB6A 4QIVA 4IOBA 2FJEB 1M0SA 4Q2MA 1TQLA 3HP6A 3M05A 2HHHF 5CXTA 3MM6A 1QUPA 2DNGA 1ZAVA 3C66A 2XHWA 3KG4A 4F4XA 3M4XA 4ICLA 2DR5A 2RIJA 2HS3A 2OD4A 4DR3F 4H4OA 4PRFA 1GAOA 1SKSA 1IBKF 1S4FA 3D0HE 2JRSA 2N3OA 3ICLA 3ZZOA 2YX1A 2RMLA 4DPOA 1FK9B 4CNYA 3WBZA 4B08A 3D2WA 4ELUA 2OTJS 2J7WA 4LSNA 3MECB 2SXLA 3AA9A 1IBMF 1CC7A 4Q2LA 2LMIA 3CB4A 3KLFA 1DLOA 1S1UB 1U1RA 3Q8SB 2IVYA 1KSPA 2FLNA 2UUCF 3JYTA 2UXDF 2OSRA 4ID5A 4WFBQ 1UVNA 3FVYA 1L3UA 1ZZFA 2GNKA 4FNHA 1NJZA 3VAMA 3BSNA 3G6ES 5GAGI 3OL7A 1Y5NB 2VD3A 3H40A 3KHLA 4BBYA 2BE2B 2IAJB 3FRYA 5A8WB 4PWDA 3B4MA 1BGXT 3V2UC 1TK0A 1XNRF 3V5RA 3D0GE 4I4BA 4DSIA 1RKJA 2EG2A 3J7Z5 2HHPA 3KLHB 2CPEA 2A3JA 3S7RA 3HVTA 4IDKB 5HQ8A 1M5VC 3T19A 3X1LB 2NUHA 1HHSA 1X5PA 1Y3JA 2E1RA 4KR0B 3TAMA 3CSKA 4RUHA 2XBPA 1HA1A 5JVHQ 2JEJA 2ZOMA 1TKZB 3V6DB 2HZCA 1KLMA 3M1VA 2FY1A 2KRBA 2AGQA 1R27B 2KT3A 4PG6A 2FJWA 4WF9Q 3M8QB 5ADZA 1VK3A 2MKJA 1LWFB 1MW7A 1RT6A 3CJ5A 2HGLA 3TYTA 4DQSA 4A8XA 4DL7A 3TQ1A 3CULA 2OKQA 1O8BA 4PG7A 4X65F 3NMAA 2CKWA