4DZDA

Crystal structure of the crispr-associated protein cas6e from escherichia coli str. k-12
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
199
structure length
193
Chain Sequence
b'MYLSKVIIARAWSRDLYQLHQGLWHLFPNDFLFHVEKRNTPEGCHVLLQSAQMPVSTAVATVIKTKQVEFQLQVGVPLYFRLRANPIKTILDNQKRLDSKGNIKRCRVPLIKEAEQIAWLQRKLGNAARVEDVHPISERPQYFSGDGKSGKIQTVCFEGVLTINDAPALIDLVQQGIGPAKSMGCGLLSLAPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein ygcH
publication title Crystal Structure of endoribonuclease Cas6e from Escherichia coli
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 36
structure length 193
sequence length 199
ec nomenclature
pdb deposition date 2012-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08798 CRISPR_assoc CRISPR associated protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1200 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 1 4dzdA01
3.30.70.1210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 2 4dzdA02
1WJ9A 5CD4A 5H9FK 2Y8YA 2Y8WA 3QRRA 2Y9HA 4DZDA 5H9EK 4U7UD 3QRQA 3QRPA 4QYZK
chains in the Genus database with same CATH superfamily
4F4XA 4USUA 1VC6A 1SJRA 1CULA 2UUCJ 3QJJA 3OVBA 1LV5A 2LECA 2UUBJ 1YTYA 3EDRB 2E7VA 2M70A 2ZOGA 4C8NA 2MDAA 3SSSA 4CT8A 5KFMA 1KVIA 5DG8A 5GAGI 4ECZA 1HNVB 3OR1B 5BJRA 1RAAB 3GJTB 2DRAA 4Q2MA 5BXIA 5F0WA 4XTTA 5E3PA 4LRDA 5HI7A 2MQQA 3IXQA 1U1OA 2YNGB 3PFEA 4RUHA 2DVIA 5B0DA 2LU2A 1EKRA 4CO5A 4JI3J 1RXOB 4C8MA 1HQUA 3F56A 2WZ1A 4DR7F 1NPRA 2N3LA 1Y5LB 3AA8A 3QLHA 4QWEA 1FRKA 5KFBA 4C2MA 2B7BB 4B3OA 4ELUA 5KG4A 1YKWA 2UUTA 4AT1B 3VCDA 2HHVA 2N4DA 3K17A 3R5BA 1ICEB 2WBRA 3I55S 2HFZA 1GTHA 4RNFA 2J0WA 4YDDB 2VB6A 4OYPA 4DCJB 1NSPA 2CQBA 2HK3A 5KFYA 1N54B 4DSFA 3D6TB 4ZPTR 2HURA 1YJVA 1W7WA 2R8KA 3J7Z5 1RWWB 3MOZA 2K3IA 3PIPQ 2DXFA 3NY0A 4K5SA 3HP6A 2BRKA 2PIIA 1RQ0A 1R8HA 3GFHA 4CCHA 2FY1A 3C15B 4YHHJ 1SB6A 2E66A 4X4VA 5D3GB 3OTEA 1FERA 2Z57B 1SXLA 1WEZA 2OELA 5B7WA 4DV6F 1NXIA 2YWFA 2APOA 1B0PA 3CCZA 5IWAF 3ICLA 3GMGA 5D0EA 4DR2J 1HNXF 1IBMJ 3L09A 2MKKA 3T1HJ 5T41A 3TQEA 2IMOA 1FVSA 1QVFR 1RU1A 1YQHA 2C2KB 3GFXA 4YDXA 1XNRF 3HVTA 3HK2A 3RYLA 4OHZA 4ANCA 1X0FA 1S77D 3TX0A 2YNHA 2XI3A 4RW9B 4ECVA 3F41A 3PKMA 1YITS 4CWBA 4PQUA 2XNRA 4FS2A 2DT9A 4LF8F 3AODA 1W25A 4X4RA 1RTIA 2U2FA 3TJAA 3B54A 3SQGB 3UI3A 1Q79A 3BPDA 3GZ7A 1URRA 4DS5A 2WVEA 1VQOS 3ET6B 5SUHA 2UXBJ 4DX7A 2EBEA 3R2CJ 2IM3A 3NCQA 1UJ5A 4DL5A 3NGSA 2FC9A 3LGHA 1LK7A 3C14A 2BKPA 4Z2XA 1FWLA 5B0FA 1TL1A 3HSGA 3QPIA 3KUGA 3OPKA 3ZZPA 1FRHA 3HSJA 5J2PA 1KOHA 2AJFE 1FHTA 1UWAA 5KT6A 1PGZA 4PG4A 3IBWA 3JSRA 3CC2S 4OI0A 4OI6A 4OZ3A 3AH6A 3ENVA 3HXMA 3Q24A 2J0SD 4B9VA 4HL9A 1RHRB 1YRUA 3VAHA 1HLWA 2WW4A 2I5JA 3R6LB 5JVHQ 1F9EB 4LQ9A 4B9TA 3G6VA 3JYTB 1X7VA 2IM1A 4KHPJ 4F3QA 3FCVA 2CPIA 3KMSA 1O5JA 1VBXA 4HDHA 3DHWC 2XLKA 3CCJS 2IDLA 2CPHA 4XK8C 3J7ZT 2C2OB 2G0CA 4XDCA 4M1KA 1VIXA 4X62F 3GR1A 3G6YA 2XMVA 2DPJA 2BQRA 3M2VA 4B3MF 1RAHB 3QNWB 3PYEA 2V0NA 1ZZNA 1WC4A 3IGVA 2MKCA 1JXEA 2COLA 2B9XA 1K47A 4P2FA 4B9NA 2C22A 5JUMA 4LFBJ 3ISND 2B6AA 2FC8A 2HAFA 3V5RA 2V68A 1VFJA 1NM2A 3TAQA 5GAHU 3MEEB 4OJ3A 5C5JA 2DNNA 1S1UA 2L08A 2YKMB 4BLGA 2IVMA 3TEGA 3BZQA 5LM7E 1YX2A 5C7PA 3BGFA 5CYJA 3DLBA 1S9GA 4DR5J 3BEGB 3KG4A 4JYAJ 3FZBA 2O5DA 4I64A 3CCRS 3LWMA 2HS0A 1NCLA 2BE9B 2KM8C 3EX7B 1S99A 4AXIA 5CD4A 2R8GA 4USHA 1PJ5A 7FD1A 3TOQA 2K1RA 3OUYA 2GHWA 5A8RA 3NGRA 4I67A 1V3RA 3NXZA 5B0AA 1F5AA 1FKAF 1N4LA 1U2FA 4NCGB 1N33J 1UAWA 4C3LA 2FUG9 4U7CA 2FQQB 3TUZC 1T94A 3A8IA 4KYZA 3FEXB 3KLIA 1LKZA 2JNJA 4DV3J 2ILZA 2CUYA 3UNYA 2AYGA 4DR4F 4MK7A 4DV1F 2ZZNA 2KDOA 1CS4A 3G86A 3HHLD 1ZPWX 3M8PA 1C0TA 3E2EA 2VZ9A 3TANA 4L76A 4LSLA 1YRXA 2VA2A 1BWEA 3DFEA 2VOOA 4L6V3 1HR0J 3K2YA 3D68A 4RUAA 2E5JA 4DN9A 1EIYB 1JLFA 2WBMA 1VQ6S 1NK4A 3L95X 3V81B 2XHWA 2HNYA 2GIFA 4ZVPB 2B5JA 1WEYA 4IRDA 1GT8A 3UCZP 4DUYF 2ASJA 2CIMA 5FLXU 4Q0BB 3NBPB 3CGIA 1U6ZA 2K7KA 1Z2ZA 3CDWA 4PZVA 2FLPA 3FRZA 4DUTA 4TY9A 1OS5A 1N56A 2WVDA 1RTDB 4OHWA 1RLCL 3KK3B 2PFFB 4RBVA 1X5PA 2FJEB 2DIVA 2LLZA 2M2BA 4DPTA 4RR5A 4C11B 4C8KA 4DPWA 2UVUA 4R5PB 4OYZA 3N01A 1KBRA 1X5OA 2SXLA 2ZH7A 4B9MA 2MKYA 2VV5A 3EWGA 1X4HA 3C8YA 4YY3F 5KOXA 4ILMA 2LA6A 3N5FA 4QPTA 3SDEA 4DV0F 1Y4ZB 2DNMA 2B4VA 2PC6A 3PFOA 3HO1A 1GFWB 1U49A 4V19X 1CJUA 4GC6A 2HQDA 3OTCA 1NZAA 1S12A 2KJVA 1NDCA 2D9PA 1KN6A 4F0MA 5KG2A 1MW7A 3SMZA 1KWMA 1SKUB 4ES1A 5KFRA 5IQ6A 2RRBA 4NOHA 3WQPA 2WCXA 3DOLA 2XSJA 2C2MB 4OI1A 3HULA 1B99A 3W66A 4OJHA 3TQ1A 2HHTA 1QE1B 4OX8A 1RTHA 1FESA 3CXCR 1S1WA 2KYZA 4ZJOA 2ZJPQ 2MKHA 5IXUA 1FD2A 3GCWP 2HQCA 2EVZA 2N4CA 4TU8A 4HHUA 1PYOB 1OMSA 2OP5A 4Y00A 2XG8A 5KFGA 3T19A 3QAUA 2XMJA 2HRTA 2QG9B 1JLEB 2F4FA 4X65J 1DFDA 2QA2A 5C42B 1FF2A 1WC5A 2VFVA 1Q16B 4TKTA 2GAHC 5A8KA 4KY3A 2YX4A 1TL7A 2DR5A 3DNCA 1SJQA 4OYMA 3NOCA 1HA1A 3BREA 2H5JB 3M32A 2CYYA 3TVKA 1AT1B 1XIQA 3GLJA 4GKJJ 3D67A 1TFYA 4IDKB 2QA4S 3MM7B 3BBFA 2QFIA 3I31A 2E9ZA 2GQCA 2KT2A 4OLOA 2F40A 3O3LA 4FPRA 1S6PB 1N6QB 1RWKB 1JKHB 3VGTA 3P6YC 1JXLA 4KC5A 3CNQP 1M1GA 3NMAA 5ETPA 3GONA 4NZ7A 4WFZA 3VAGA 2OGUA 1D9FA 1Q8BA 3CCVS 4ZPDA 2Q1LA 3DDIA 2V8GA 3HHLA 2ROGA 5DDRC 4K4XA 1WNEA 1SCJB 8AT1B 3GYXB 4NI2B 4I2PB 4CH7A 2B3TB 2GIRA 2VBXA 1CC8A 2OPPB 1DTTB 4C48A 4O4GB 1Y10A 4NX9A 3TJ8A 2CNLB 2MJNA 3MM5B 4CO0A 2D9OA 2DKOB 4LFCJ 4X4UA 4L72B 4F4ZA 2VBWA 4J37A 4OL8A 3A3OB 4DHVA 3LOUA 3GIKA 4JI5F 4NXMJ 1MWZA 1NPPA 2JHEA 2R7QA 5JJBA 5EX0A 3M2RB 4FP9A 2EFVA 2VPWB 2JLEA 2ZKTA 4RNNA 1HBNA 2XHCA 3J7A1 2HSEB 3RR7A 2NCKL 2DGXA 2YQ3A 4WTOB 3BQ0A 1M5PC 3V4IA 3HT0A 2Q6CA 3RBXA 2G1HA 1TUVA 4IFYB 1XR7A 2M8HA 5G0RA 2VFRA 1TL5A 4YUDA 2MZSA 2RRNA 2EFNA 5D0RA 4OI4A 4Q43A 2DH9A 3V6HA 2RUSA 3VAKA 2CDRB 4KPCA 5E7OB 5HL7Q 3Q83A 2QX0A 3CEDA 4E0DA 2OO4A 4I2QA 4H54A 3M2UA 4HYKA 1PKUA 3P3DA 3Q8RB 2H48B 3DLKB 2O01C 3DRRB 4HTIA 1S0MA 2NREA 4A8KA 1NU4A 4YMEA 3H59A 4F50A 2C2DA 1B64A 4FNHA 3CJ2A 1NKBA 1FJ7A 5I42A 2ZHOA 1V5IB 3ZZOA 3CMES 3M7VA 4N8OA 3M8RA 4LBHA 3CCTA 4TLQA 2K8GA 4R25A 1TKTB 1R0AA 3TJ9A 5CCMA 1FK9A 1CLFA 4USVA 4OYOA 3HJFA 1RHKB 1K1SA 3IS9A 4QU7A 4AD6A 3KHHA 3S6EA 3BO2A 2B4UA 3N6LA 4NXNJ 2UVVA 5D4NA 3NWRA 2CJ9A 3CWJA 4OV1A 1VLOA 5M2RA 1KNZA 4QYZJ 2CPYA 2MSSA 3W5ZA 2PT0A 5AJ3F 3PW4A 4OJ1A 4DFPA 3DU5A 2J7UA 3GU0A 3R6GB 1UVLA 2BE2A 3T5HA 2JWNA 3KKFA 4R8UA 4EWTA 5T7LA 4CLYA 1E6YB 1X9WA 1TKDA 3HSDA 5CZVA 1OIAA 2UP1A 1VJQA 1KLMB 2GGPA 4LIRA 2ZBIA 3UD5A 4Q8EA 4TQSA 5L1KA 2KRBA 1OYDA 3GJRB 2Y1RI 1ZM3A 4HEA9 5KFSA 3R5GA 4OQJA 3VAJA 4RUBA 2F7VA 2QE5A 4LF2A 5A0YB 1T05A 4LUBA 2UXCJ 2RF2B 3CW2C 3SSQA 4DUZF 1SKRA 2GIQA 4PXBA 3LO3A 3LUYA 2Y1JA 3OL9A 5F8HA 2G0JA 4EO8A 1NEEA 1HQEB 1I5OB 2PI5A 2BV3A 3CJKA 3OT9A 2OSRA 1QTNB 4M5DB 1Y9OA 1QY7A 1UW9A 2H54B 3C6TA 3H40A 3PEHA 3OHAA 3M1VB 3JTOA 1CSJA 2WONA 3MMBB 4FN5A 4Q7AA 3EUNA 4B17A 2ZM6J 4ALZA 4U6PA 2NUHA 1FNOA 2P2CB 3B8HA 1HYSA 4N41A 3BPSP 2R7TA 1WTFA 1RTJA 1IKYB 1SC1B 2OPRB 1LXNA 4N47A 2UU9F 1S59A 4H4MB 4J9MA 3MI7X 3IWXA 4DL4A 3MPVA 1H74A 3LTOA 1SH2A 3JSYA 3F0NA 4FYYB 2HAIA 3LAKA 3UCUP 1MG7A 4YB5A 3BR8A 1TZ0A 3K5NA 1RWVB 5AT1B 5HANA 3W7BA 2I1RA 5K14A 2ACYA 2Z8QA 3MECA 3MR3A 2LVWA 2OJ3A 3IFEA 4ED5A 4UW2A 2HHHF 3B78A 2UUAJ 4CO3A 3K89A 3PHEA 3IRXB 2H51B 4LR8A 1RT6A 3GCXP 2N82B 3G87A 4IYQA 2VFSA 2ZH6A 5ETNA 3CCLS 2KVQE 3O8WA 1RK8A 2PEBA 3Q2SC 3W2VB 3L9ZA 1HNZF 3JS9A 4UUWA 4YEAA 2ROEA 2ZVIA 3G6ES 3BGRB 2R2RA 3FBEA 3OR2B 2JFDA 4M5JA 3I82A 4QIFA 4DL6A 2AZ1A 2ATCB 5AE2A 1XK8A 1TVRA 5K8PA 5LMUJ 4V19J 4RKUC 2XZDB 3WIUA 2VOPA 1MLAA 3W2WB 4PXEA 4U96A 4B3TJ 3AOBA 4K4WA 4DU7A 3PDNA 1T8EA 2U1AA 3ZO7A 1T3NA 4JOUA 1GXTA 2XZWA 4F4KA 3C6UB 2YQ1A 4NLPA 2A10A 1V3SA 3BO3A 4DCPB 3N28A 4KV8A 4TYAA 4J90A 3QIDA 4Z7YA 4O44A 3IRWP 2FHKA 4IO9Q 3AY0A 1X4EA 3NGKA 2FTRA 5F9NA 1Q95G 4F67A 1RWNB 4Q5VA 2GS8A 3IG1A 2OTJS 2E9RX 3DGVA 3RB0A 2R7OA 3HHNB 5KFIA 2AQ4A 2HFUA 5J1PA 4K50A 5ETQA 2AGPA 3M8ZA 1FJEB 3IR5B 4DR1J 2DGOA 3CSKA 3I5CA 3CD6S 1S79A 4QR1A 3UDLA 2RSQA 4UOHA 2XS2A 2LXIA 2KXNB 5JMNA 3QLHB 1JJ2R 1XMBA 3CDUA 1N34F 1RT5A 3I0SA 3JTNA 3BQ1A 2IRXA 4Y3CA 3OL6A 1T9UA 5EWFA 3D0HE 4ZS6A 2J6SA 2PA8D 2GV1A 3MTJA 3Q8PB 5H9FJ 1K0TA 3W61A 3PCOB 3OFHA 2C2NA 4DDFA 3HHKA 4WFYA 1YBUA 4MFBB 4CTAB 1XMOJ 2KG1A 1KKHA 2YBVA 3MPUB 1IUJA 2ZE2A 1FWKA 4E8UA 4ZCKA 4PUOA 1Q8IA 4EFAC 5SZTA 2LU1A 3DRXA 2N7YA 3T3FA 1T95A 2R7XA 1BHNA 1DTQA 1QLNA 1WHYA 3HMJG 3J80Y 1SL1A 2KFZA 2GHVC 1HW8A 4JI2J 1ZAXA 2GW8A 1WKKA 4OX6A 1T7PA 4U9RA 2IVFB 3J7YI 4B3SJ 4ID8A 2MGZA 3QQCD 2PMWA 5FDLA 1RTZA 2LP4A 1KQKA 3D0IE 3KG1A 4IG3A 2HIQA 1TL3A 1U45A 1LWCB 3BGUA 2K7JA 3H25A 1IKXA 3E01B 2I9SA 4PQUB 2B9YA 2HLTA 2AYEA 2W7PA 1FTCA 1FRMA 1RTIB 2RDDA 1UL3A 3W1YC 1RUSA 1WHXA 4U8YA 4M5KA 4P2MA 4DV5F 1OPZA 1HHSA 3TI0A 5DQGA 2V2QA 4DL3A 4RPFA 4NCBA 1NDPA 4QCLA 3GPAA 4DSEA 5DDOC 4TLRA 2LEAA 2W4CA 4Q44A 3LP1A 3PYDA 1RHUB 3VQSA 2YKQA 1VQMS 2ZUAA 4PG5A 4NCAA 1S48A 3GILA 2ASDA 3M4XA 5DZ7A 5J2PB 1IKWB 3DOKB 4DLEA 6FD1A 1UA1A 5E3QA 4OHXA 2ZOFA 4IQXA 5I3UA 4I0WA 1KQSR 2J6TA 4DPXA 1EP4A 4ZA1A 4GKKF 4LVNP 4BCAA 2LXUA 1SJ3P 2QIFA 2IC3A 4Y2IA 1SQGA 2I5JB 2D7SA 1QD1A 1IWAA 2Y1LB 3B82A 3WBZA 1F6TA 1N5QA 2NZCA 1LW0A 4RBTA 2JJ4D 3OXFA 1URNA 5GMDA 1NO8A 4PABA 1AZSB 1HNWJ 3IP0A 3G71S 5GVQA 5CA5A 3FSXA 2DR8A 3AJ1A 4C4WA 1HARA 2KYXA 3K57A 1RAGB 4RO0A 4K0KF 2CQ4A 3DM2A 2DRBA 3HFZB 2EC0A 1UJ4A 5BYQA 3LPEA 2BOPA 3KFWX 2YNIA 3TZYA 2B6AB 1HIYA 4QU6A 4P74A 1Q86T 2HS4A 1E6VA 3IR7B 3GP9A 4C9DA 3RB3A 4DF8A 1S6QB 3QRQA 3CDBA 2QLBB 3R5CA 1C2PA 2IDEA 2DNGA 3H90A 2IM0A 2WVBA 2OEJA 2KL8A 2AD9A 4CZCA 2BQUA 2A1BA 1S9GB 2KN4A 2KRRA 5E41A 2PEHA 4USIA 3UQSA 3JB9k 3RRGA 5GADU 1YJ9S 3OUYB 1RBAA 1I94J 5A8RB 1U4BA 2MQPA 5KFUA 2HYIB 2FLLA 5J1EB 4WYWA 4KH1B 2HWIA 3DI6B 3U1NA 1JIHA 5J2NB 1FRLA 1LFWA 3KLIB 3V6KA 1FRJA 4QPXA 3MM9A 3RU0A 2FB0A 3KLGB 3QYYA 2AYBA 1GTEA 1QJHA 5KFAA 1MMDA 2FHJD 3FFIA 2E1PA 3M8PB 2VQFJ 1RAEB 3W5XA 4BS2A 3Q8VA 4LSLB 5HLFB 3OLAA 1NK6A 3BH7B 3TA0A 4Q8FA 3O2IA 4IO1A 2QMWA 1JLGA 4LF4J 1HL6A 3MAAB 4GVLA 5L8RC 1ZA1B 3D3CJ 1JLFB 4PR6A 3IWLA 3H8YA 3ISZA 3W65A 5ETMA 2OKQA 2LYVA 4DJBA 1J5OA 3MOJB 3UFCX 2CZ9A 1VOMA 1WC3A 2DR6A 3LPYA 3MM6B 4ECSA 1NSKL 2P9GA 1QSSA 1TK0A 1YI2S 1ZOTA 2E1RA 2DBBA 4NLQA 2W2QP 3MCNA 3M9MB 2D3ZA 2QTWA 2DITA 4ICLB 1VISA 4JI7J 4LF6J 1M5SA 1DJ0A 3HZGA 1R8PA 3RBZA 3W60A 2Y3YA 3ADAC 1DURA 3W62A 2YPZA 2G1DA 3CULA 1R8BA 4RLEA 2VODA 2DGUA 3DMJA 2VF3A 4WK1A 2V4RA 3JAMU 2G2YA 2R7UA 1U8WA 2AJ0A 4F2SA 2GQ2A 4LRCA 3DLJA 2HNZA 1AFJA 1RT2B 2QMXA 3VAFA 5KFPA 1IJEB 3R8YA 3S7RA 2BKNA 1PJ6A 2DNQA 4CLPA 5F9LA 3DOLB 2XSJB 3NGDA 5HROA 2IVYA 1Q1KA 3T1YJ 2BJDA 1UCNA 3D6HB 1RTHB 4DV2F 1S1WB 1UZHA 2NXUA 1KHVA 1SV5A 4TQRA 1N36J 4FZVA 3VVUA 1UVKA 2BEFA 3QGHA 4H4KC 1OY6A 1G7CB 2D3UA 4Y34A 4UF4A 1XC9A 2GVDA 2RKIA 1MMNA 4OYAA 2OUGA 3G82B 2UUCF 5J2MB 4LVOP 2UUBF 3HVWA 1VRQC 5C24A 2F5GA 4RW7A 2PSZA 3H4DA 1TL7B 4DPUA 2CNKB 2C42A 4J91A 3G6XA 1D0EA 1LW2A 3MMJA 4I7FB 4KFBA 2XO7A 3M32B 4MH8A 5CAAA 4DV7J 1M1KT 1IM6A 1SC4B 3CJQA 1L3KA 3IM8A 4IG0A 3B4MA 1FEHA 2DGSA 5F3ZA 3SI8A 4ZN3A 1VHIA 3S8SA 3PG9A 2JEIA 4USJC 3LQVA 2ZBPA 3C16B 5HJYA 1APSA 3NNHA 4FF3A 1F60B 3THVA 3NAIA 4FYVB 4JI3F 3LAMA 4UZBA 1FWPA 3KLEA 2VG6A 1RGVA 3NAHA 2ZD1B 1DAXA 3OJSA 2PA3A 2Y8YA 1U2RA 4Z37A 2VC0A 4NLXA 4I1TA 2VICA 1YJUA 2NXCA 3GFYA 4LSNB 5GMEA 4M5MA 5B08A 3CD5A 1EHWA 3OW2R 5ETLA 3CDAA 1AXQA 4NLUA 4NZ0A 3ITHA 3R5DA 3CC4S 2X1FA 2VBYA 1VS3A 2BVZA 2AMCB 1TL4A 3HM9A 2DNZA 2HFNA 1SH3A 3LANA 2HWTA 2FLNA 4KE5A 4NWBA 1NB7A 5C25A 4O0NA 3PHTA 1BUXA 1VYAA 5IM0B 4YHHF 3CPWR 2CAJA 2V63A 4ECUA 4K4ZA 1YBTA 4K2JA 3FGVA 5G0RB 4FS1A 1JJCB 1JLQA 1F2GA 4DR2F 1IBMF 1UVJA 2IJRA 2WOMA 5HMZA 3T1HF 3HT3A 1YHQS 3K59A 2Y8WA 3M6VA 1FTRA 2H3EB 4KGMA 2YWGA 1WF0A 4CLZA 3M6WA 2JVOA 1VQSA 4DL7A 5AXKA 2CG8A 2DCLA 3X3UA 2CWXA 1S1VB 3CF5Q 4IQMA 2H1YA 2XLJA 2RQCA 3M2UB 2E5HA 4C7QA 3N9UC 2F8MA 3CJTA 3VVTA 1ZPVA 4URQU 3VTIA 1HI0P 2JX2A 2QGFB 5IOLA 4JI1J 3GG0A 2D41A 4BHQA 4OX9J 5DDQC 4NLTA 1IBLJ 2HNDA 3M8QB 1U0HA 3DLGA 3FNNA 3KTQA 4F7VA 3G2XA 4USMA 1KLNA 1UEVA 3UD3P 2XMKA 4QYZK 1TP7A 4ATNA 2UXBF 5D8HB 3D28A 2PGCA 1PG5B 4QIVA 3WDOA 2IA6A 4KTQA 1Q8KA 3EZ5A 2BJ7A 4KRWA 3QIPA 1UWBA 3MMCA 5IQQA 2HHWA 4NA2A 2IYGA 1HWIA 2XMMA 4ZVTB 1SKWA 3GV7B 3BSAA 4ED4A 2V34A 1D8YA 4NZ6A 1MROB 3KDOA 3ZZZA 1AB8A 5ETOA 3C66A 1CBKA 3LP0B 4YB7A 4DFKA 5HQLA 3W9IA 1S7IA 3ZZ0A 4DX6A 2V9KA 1FJCA 2WRMA 2R3VA 4HI2A 1NHVA 3OTDA 3RW6A 1FI4A 2BE2B 3TAPA 2GO9A 1UPPA 1ZZFA 2DCUB 2HVIA 2MY7A 4IFVB 1Y00A 1FXDA 3OTBA 4KHPF 4RNHA 1QUVA 1WOOA 3TVYA 1SUQB 1H72C 3NCRA 1JMTA 4QYRA 4J9SA 3D6FB 3KK1A 3KNGA 4OZJA 1KTVA 5J2QA 2O3DA 4F25A 2NZ4A 2OEMA 1I6JA 1RWXB 4MKAA 3M05A 3RZAA 4JBCA 1M5OC 2L9WA 4TXSA 3X1LB 1PAEX 2X7IA 3AJDA 2HZVA 1T05B 5L1JA 4WTYA 3UCGA 1P8GA 5D4LA 2JZ5A 3BH6B 1GX6A 2CZVC 3BKTA 2Y9HA 2HFVA 4OZ1A 3D4JA 4QIWD 2UVRA 5ADZA 2C3UA 4KGXB 2WHOA 2LQ9A 4QIEA 2IJFA 1VQ7S 2VKRA 1FKOA 5CXTA 4CDIA 4RW4B 3LGNA 4LMZA 1Y7PA 4WP3A 1U1MA 3RRKA 3KNAA 2P8IA 3C6TB 1TKXA 3ETMA 2M0GB 1SPBP 5FJ4A 1JLBA 4X64J 3P45B 2FJWA 4MKBA 2XS5A 3SZ2A 3TAMA 4DZ6A 3VZHA 4DR5F 5DLFA 4EEYA 4JYAF 3MFIA 2CWKA 1RHJB 1R0BG 1SI9A 2ATLA 4ZJLA 2IM2A 2R2SA 2OI2A 4WFAQ 2EG2A 1T9WA 1HYSB 5E3RA 3V2UC 5HVGA 1D8ZA 4J9PA 1RTJB 2V8VA 2XNQA 2EK6A 3BDEA 1ZS6A 4F0HA 1N33F 4WE1A 3M8YA 3DRPA 3NP5A 3A8JA 4XO0A 3PX6A 2MSTA 2UXDJ 2FZKB 4QWDA 5MLCV 4DV3F 2DHHA 4KSEB 5K14B 3MWBA 3ZZYA 4F8RA 1VI7A 3KJVA 4K4TA 2YKNB 1BQNA 4BWJA 2V4JA 4P2XA 4IRKA 2UV8A 2PO4A 2CVEA 2W9BA 3MEKA 2HFOA 4P75A 1VQNS 4ZVHA 1HR0F 4UY85 3CJ8A 3EVMA 1RT6B 1ZM4A 1UKUA 3MMAB 3QFHA 1QDUB 4WKYA 3GIIA 2F8EX 4NEYA 2CFXA 2DRDA 2W8KA 3PW7A 5B0CA 4FYXB 2YH0A 3H7HB 1ZAWA 2WSFC 4L3KA 3N6NA 4EO6A 4ZVSB 1FCAA 2BJ3A 3AD8C 2ZDPA 1GQEA 2I6WA 1FDDA 1X0PA 4TYBA 1TVRB 3DCAA 2MPUA 3RRHA 3K5PA 4PWDB 1VQPS 2DO4A 4KT0C 1HW9A 4QWBA 2FZCB 5L1IA 1WF2A 4C0HA 3M6XA 3R7BB 3EZOA 2KKHA 2QZ8A 4MT1A 2F63A 2DNOA 1YJNS 4PYAA 2XQCA 4X4TA 1WSRA 1H2VZ 2FGCA 4TY8A 2F9JA 4WU2A 2BOAA 2IFXA 4Y65A 4CLSA 3MR5A 1SL2A 4WP9A 2GJIA 4ZVRB 3DLEB 3QSIA 3IG1B 4EBCA 1PYSB 3DYAB 4K4VA 5HMYA 4NYOA 2J9DA 3V6DA 2FHOB 5H9FK 4AXJA 2EFGA 1HBMB 4DCOB 3BGOP 1X4FA 4JP8A 5L1LA 1S6OA 2EFQA 3DLLQ 2ROPA 3QWPA 1XMQJ 3THPA 1RSCA 1RA6A 1YJTA 3OL7A 2UVWA 2CJBA 2VG7B 3R9LA 4QW9A 1KFSA 2A2CA 2LDIA 1KONA 5B0EA 1FKPB 2B7CB 5DRKA 2OPSB 2BUNA 2CQ1A 4ERDA 1U8SA 1BGXT 1SC3B 4W98A 4DX5A 3NOGA 2I8EA 1UTAA 3MUTP 1VRUA 3BKUA 1C1BA 4RU9A 2ZC3A 5CYQA 4X65F 1MU2B 1YVFA 1WKJA 3FRYA 4WXWA 3JQJA 1D09B 2W8LA 2J7KA 4X4PA 1TUGB 5EWGA 2DNLA 2GA7A 5D15A 3HHDA 2QT7A 1D9DA 1KC8T 3AAWB 3T41A 4GKJF 4KKOA 4WPAA 1JXVA 3IBFB 1ZM2A 4JV0A 1WG5A 5KG0A 1SQFA 1D1UA 2IJNA 3PZPA 1T11A 2ZJRQ 3CUNA 2MQOA 4P7TA 4KPYA 4HH0A 2GMLA 2MGZB 1ROFA 3C15A 4ZVOB 2AEJA 5EUHA 4AL5A 4G1IA 4IG3B 5IC6B 4DS4A 4PYDA 4OFZA 4OZLA 1H7WA 2YNFB 2KVIA 3IAM9 3CCSS 1IKXB 3MAHA 1ZTTA 3H5UA 3Q89A 1EKSA 3IC1A 1AROP 1CJKA 2V50A 3UDVA 2ABYA 2NSBA 1P6TA 5F8MA 2C2ZB 4ECQA 4LFCF 5BR8J 4RW9A 5K8MA 4RNOA 4BC7A 5HQMA 4H4KA 1A7GE 4NXMF 1JQGA 1OSDA 2GO8A 3H5SA 2XSFA 1HPZB 5HVFA 4AQYJ 2MLYA 3JSMB 3PJWA 1IBKJ 3SQGA 2AEMA 1LFPA 3UN3A 1UEKA 4QW8A 3LP1B 1Y3JA 2MHNA 2MQ8A 4NYZA 3QJLA 1QAIA 2NQPA 3ET6A 2ZNZA 3CJRA 2J9DE 4CM2A 1X5TA 2XYHB 5A8WA 2MZ1A 4DF4A 1GK8A 3H2UB 3LP2A 4WFNQ 2KHCA 1SL0A 3R5AA 1LK5A 1IKVA 1EP4B 3R7SB 1A0OB 3NNAA 1A9NB 2YXLA 4TVAB 2IC3B 3MPDA 5CYMA 4ZCMA 4I6WA 5KT5A 2GCFA 2VH7A 4WYLA 1HD0A 5E3AA 2XLIA 2XYGB 1IR1A 1KHWA 2XO6A 3E51A 1C4CA 2VONA 2DGWA 1R27B 3PKYA 1GEHA 4X4SA 2MB0B 2EFPA 3JYTA 5KFTA 4ZPWR 1RADB 1FJGJ 3G8SA 1S6UA 2VKZG 4L3NA 3DM2B 1KSPA 4LFAJ 1X8DA 3AD9C 1U02A 4NLWA 3D9BA 4UOCA 2ZKUA 1UZDA 1ZTWA 1IQZA 4NXNF 3Q22A 3PR5B 3GE9A 2CKWA 3QT5A 2HHQA 2RUGA 4DR3J 1KP6A 2OLWA 3TR5A 2KJWA 1OPIA 3DN9A 3PYFA 1P27B 2VG5B 4ZITA 1HHQA 1K0VA 4LR7A 1GXUA 4KHRA 4UQGA 2EWHA 2YKMA 2B8PA 1VBKA 4F04B 3FEYB 2F4VJ 2QL9B 2O67A 3IMQJ 1H7XA 2DTJA 4ED7A 3GIRA 4DSJA 2R7WA 2BR0A 3GQCA 1PSDA 4PG7A 1XERA 1JK9B 4J9LA 4KAIA 2XCAA 5HJXA 5F8GA 2UXCF 3FFIB 2QA1A 4NCGA 1CJVB 1TV6B 5L9NA 4WJBA 3VHQA 1NSQA 4QOTA 1S1XA 2GMJA 2H9ZA 3K58A 2RQ4A 4JUZA 5HN0A 1EQMA 4F0KA 2I38A 1NJYA 4DWIA 4IR9A 1HWLA 2HIYA 3W64A 5BYSA 1AUDA 5KFHA 2BKOA 3MM8B 3FEZA 2HHXA 4LQ3A 4JI4J 1V9OA 2EBGA 3OJUA 1J5OB 4ZIWA 1WC0A 1R7IA 3TO8A 1FFSB 1RT1B 2BBEA 2KT3A 3RAXA 4HACB 2MKJA 2ZM6F 3AB2B 4N77A 2X1GA 5KFOA 3V81A 1FFWB 3LALA 5CH7B 2RB7A 2L48A 1X5SA 2DGQA 1PIEA 2NLWA 1DY3A 5JVGQ 3PIOQ 4LRFA 3AOCA 1U48A 4B9LA 4IH5A 2HMIB 4Q0BA 3NBPA 4DV4J 3Q86A 2J9CA 4MMOA 4Y2KA 2MY8A 2R8JA 1NPKA 2ZH9A 4O4RA 4ECTA 4LJMA 1RTDA 3KK3A 1RB0A 3D7SB 3A8EA 2V4QA 4PPZA 2R7SA 1LQ9A 2M52A 2I2YA 1WI6A 1SJ1A 2UUAF 3DRSB 2DNRA 2XBPA 4YB1P 1JWWA 2WSEC 3H20A 1Z1ZA 3T5LA 1QSYA 1UVMA 1ZETA 4WIIA 2ZZTA 5C2CA 1X9MA 5D4PA 3OXLA 3H2LA 2FDNA 4PPDA 2WAQD 4U95A 4QBUA 2W2MP 3HHEA 4U7UK 1N5YB 2GVZB 1PAUB 3PRVA 1NJXA 2K06A 3NWGA 3Q8SB 2PN6A 2BM0A 3T1AA 5F8NA 5LMUF 2E5GA 1LWXA 3WX8A 1TAQA 4MIBA 1RYSA 4OMFG 2CQIA 1QE1A 2GVDB 2RKIB 4B3TF 5LT5A 1CG2A 3IM9A 3PXGa 3DGPB 5ETRA 1CEZA 1K8AT 4EMDA 3P5BP 1HWJA 4K5RA 3W9JA 5C24B 1J5EJ 4UOFA 3DDKA 3I87A 3NGUA 4CYUB 2LQ5A 2HQGA 4EK2A 1W2IA 2YWKA 2AJ4A 1KTQA 1D3WA 4KFBB 4MTPA 2XMUA 5KFWA 2NPIA 1PBUA 1NJIT 1EETA 2Z30B 1JLEA 1RBLA 4KB7A 4C3MA 5KFNA 4IG0B 1VLYA 2FHMA 4ZVQB 2V8DA 2LEBA 3EDQB 1X4AA 2EEYA 2UZAA 1RT4B 1P9QC 2OPQB 1HBUB 1YIJS 4YQWA 4F02A 4J9NA 2VPXB 2FJXA 4DR1F 1TR0A 4ZVGA 2YKOA 3TUPA 2VG6B 4K4UA 3KUEA 4HT5A 4ECXA 3MM7A 2NPFA 4DBQA 1RYRA 1U0SA 4B08A 4RWWA 3Q8UA 1WSVA 3NCPA 1Q53A 5J1NA 4X2BA 3W8GA 3VALA 1JKHA 3MPWA 4M5GA 2W4DA 3L3CA 1Q78A 3WZ0A 1NK7A 3M30A 3RTVA 3MR2A 4ANEA 3ITHB 3KK2A 3KWMA 2ZDOA 4WK3A 3CJSA 4BDPA 3P8BB 2A6OA 4NI2A 1WG4A 1Y11A 2RT3A 1HHTP 1FEEA 3CDEA 3VQTA 1XMOF 2OPPA 1JLCA 1DTTA 1F9FA 1SH0A 1WDTA 4PG6A 5KG7A 2J8SA 1QUPA 1G6BA 4DQRA 2POKA 3T6JA 1RWOB 1LWEA 4Q45A 5D77A 5CABA 4P9SA 1FRXA 2DHAA 4Y6IA 1K44A 4QQBA 1FA0A 4JI2F 3AXKA 2XZTB 2MKSA 5HP1B 1IBCB 4WWSA 4B3SF 2MQMA 2GNKA 1RAOA 1KQFB 2J0XA 1NKEA 4DPOA 2IY5B 4ZP7A 3PW0A 2ZH1A 3QZ7A 1NB2A 2YKPA 3PO4A 4QWAA 2FLOA 4JI8J 1U1RA 1OSCA 1VJWA 1KEKA 3EXYA 2HNDB 1U0HB 3I56S 2W9CA 3C46A 4RW8B 3VAMA 3TZWA 2LMIA 3BN4A 3RAQA 5KFKA 3A3PB 2HQIA 4J9QA 2IIHA 3ZZTA 4XAKA 4FXWA 1RWMB 3CJ5A 3DRRA 1NSAA 1CQMA 3QIPB 1UWBB 3MMCB 1HKAA 1I3OB 3EVWA 4ZPBA 1RDRA 4NRUA 4G6VB 4ZLLA 1Q5YA 3OV7A 4M5NA 2KT5A 3H42A 5B0BA 4B9SA 1C0UB 3RAMA 3MCMA 2W2OP 4ZJQA 1VC5A 1VQLS 4XDDA 4EUVA 2M5YA 3R1HA 1MWQA 2E1AA 2Z2ZA 1NMEB 2AX0A 3QWUA 2IAJB 2QA4G 4OZNA 1RT3B 2BX6A 2Z2LA 1LNQA 1XNQJ 2RRAA 3UN5A 4ED3A 3UVJB 1L3VA 3MUVP 4GC7A 1L3UA 3JXOA 4K4SA 3I0RA 2AP6A 1HNWF 3KK1B 1K9MT 3Q2TC 4B9UA 2LDYA 3OFFA 4ZP6A 1E6YA 1S9EB 1NNDA 5M2PA 3AHPA 1TKZA 4LF9J 3I32A 4JV1A 2JLFA 1G2EA 1REVB 3FKBA 4M63A 1XEZA 3A3NB 5DG9A 2Y0BB 3FBCA 1DZ5A 4PG8A 2GHPA 9RUBA 4W92B 3O5TB 1WORA 4K2XA 2B43A 5ETKA 3RJMB 2RF2A 2AJQA 4WCEQ 4I56A 3CD0A 1Y0HA 1YZ6A 3GIJA 5H9EJ 2XY7A 5F0UA 3TA1A 1WEXA 3VR1A 3TAMB 2DISA 2WSCC 3IN5A 1EX8A 2BANA 3UR0A 1S72S 5HATA 3BBCA 3K7RA 2OD6A 4OYWA 2V69A 4M5DA 3HI9A 4MIWA 1I94F 4LIWA 1PBAA 3EGNA 3M1VA 3GIMA 3BR9A 1RBOB 1WDDA 2FVSA 4WE1B 2WTFA 3RW7A 4CO4A 4LR9A 1KD1T 3QO9B 2HHSA 3QT7A 2QFJA 1T03B 5HAOA 4R0JA 1IKYA 3SIPB 3KJVB 2CJYB 3IAS9 1RKIA 3UO0A 3QGPA 2VQFF 4A46A 1BY9A 4G1QB 3AXMA 5EHHA 5U47A 2HKEA 4FDFA 2J0QD 4LF4F 2FJDB 5LOQA 2F3JA 2B56A 4OLPA 3KLFB 1X4GA 3MEDB 1U7LA 3SEOA 4DSIA 4URSA 1U1PA 1FXLA 5A6WA 1HBOB 4S0MA 4F3OA 3UE2A 2D3O1 6FDRA 2VQEJ 3IRXA 3DDNA 5GAEU 2RQKA 4ANDA 1CQNA 3NEKA 4ZVEA 1CC7A 2GAGC 5LSLA 3PEJA 2A18A 1VRTA 1O51A 2IPOB 4ZPVR 5IS2A 3VWSA 1UETA 5T14A 3A8KA 2YX7A 2Q3PA 4ER8A 3MEGA 3VGVA 2H4WB 4X4OA 2B4OA 1O8BA 2BJ9A 4FPIA 3BS9A 2J6UA 2MZRA 3IBCB 4PAAA 4JI7F 4LF6F 4KIAA 5L38A 4ZPAA 4ID5B 4N56A 2Z4PA 1TTHB 2G4BA 3KJQB 5IT0A 3VF0B 4K8RA 3LGMA 4KO0A 3EGVA 3QAEA 1XTZA 2ZHBA 5GAHI 2RILA 3HKWA 3CJ3A 3C6UA 5DM7Q 4DEZA 1N32J 2ZOMA 4EYHB 2FIUA 3U27A 1U1LA 2YPYA 3CMQA 3V6DB 2F9DA 3DXSX 2VC1A 3FBBA 1N5VA 2M7SA 3ONQA 2QLWA 4DLGA 1OQ6A 3AQPA 2V8HA 2NYHA 3T1YF 3RBDA 4P2SA 1JLAA 3JAMY 1DHMA 4JV5J 4DR6J 3DXBA 2ZH3A 1N36F 1NUEA 3K5OA 1WI8A 4DMZA 3KHLA 3GFZA 4DG1A 1IQTA 2BJ1A 1A6LA 2XMTA 3ZTRA 4IOBA 2CPZA 1VRUB 5KFFA 1C1BB 3MF5A 5CYQB 1KS2A 2XWXA 4P7VA 4V1Ak 4EGLA 2FVPA 1B7YB 1LWFA 1KOOA 4U67Q 2HFSA 1SKSA 1OO0B 2WVCA 3UD4P 4DV7F 4RU2A 1RWPB 3ELHA 4YS2A 1NLKL 4KKOB 2MLXA 4LBIA 4PXCA 3IWNC 4MFBA 2DK2A 1VBZA 4CTAA 5HO4A 4USWA 3BV8A 1X4DA 4ZN1A 1J2VA 1IWGA 4R0EA 1RP5A 1VBYA 1Q7LB 2PE8A 2ZH8A 3TZXA 4QZVB 1AW0A 1SVDA 5A76A 1JNZB 3HD1A 2IYIA 4NLOA 2E5LJ 4ED0A 1RHQB 1VK3A 1CJKB 2W24A 4FKYA 1CULB 1G3OA 2DH8A 3OTOJ 3MR7A 3ZTSA 1MMLA 1FNXH 1T02A 1WKLA 1LWCA 1HI1A 2X3DA 4KH0B 1HWKA 3PJ9A 1RKJA 2R9LA 3E01A 3TA2A 2KH9A 1N5SA 1WC6A 4FF2A 3KJNB 3QJPA 3EYZA 5LXYA 2E1CA 1P1TA 5IV3A 3J81j 4MIAA 5I4MA 4P71A 3TEHB 3CCQS 4RX6A 2OAUA 3PW2A 2J5AA 1DQ8A 3AD7C 1QAXA 2XGQA 2Z2MA 1KVJA 1VK8A 3GV8B 5A8WB 2W7AA 1HQUB 1WJ9A 4QR2A 3LP2B 2FY8A 3C19A 2ZFHA 2VA3A 2JOQA 2ERRA 2CA9A 2CQDA 2VFUA 2XI2A 4J9KA 3WC2A 3WX4A 2KZZA 4ZKAA 4B3RJ 1IKVB 4B3OB 8ATCB 3U1LA 3GYNA 1JX4A 4HKQA 4OIXA 1IKWA 3DOKA 3FC9A 2A0FB 2QLJB 5EN1A 5CYMB 2J7WA 4NMXA 1ELOA 4N5SA 2AX1A 2HBRB 4H4OA 4PWUA 4ED6A 2RU3A 2PI4A 4ZMMA 1TK5A 2YKAA 4JI1F 2VIHA 5E0OA 3D1QA 4ECYA 3FQKA 4ZHRA 1MNEA 4IH6A 4OX9F 1BE4A 1NKCA 1IBLF 3K8VA 2Q6BA 1ZAVA 3LWLA 1QSLA 2P9CA 1N48A 1GAOA 4IUFA 2DYAA 2YVSA 2N7CA 4OHYA 1SIWB 3E8OA 2FVQA 1AZSA 3QRRA 4Y28C 1HMVA 4EYIB 4CIOA 3HSZA 2GZOA 3BM7A 2I0XA 1ZA2B 2RVJA 4RWXA 2HVHA 2OFGX 2NXNA 2G0IA 2ZNYA 2XMAA 2V2VA 2J76E 4NEZA 2LQBA 3HVTB 4RNMA 5HQ8A 1B70B 3UN2A 4LRBA 2DGTA 2QJ3A 2YNHB 2LFVA 1BXNA 4JI6F 2OSQA 2ZEJA 2GX8A 2G13A 4QIGA 8RUCA 1S6QA 4JI0J 1GMUA 2JL9A 4J5OA 1RAIB 4P72A 4KGZB 2B9WA 2AZ3A 2QV6A 1EB0A 3BQ2A 5A6PA 5K9FA 2F8HA 1SJFA 2EPIA 2QSWA 4NLYA 2CJQA 4U7UD 1RJJA 4FXVA 4LF7J 2HBQB 1U1NA 4DI6A 1OYEA 2RHSB 3QRPA 2ZZMA 3QSYB 4D3HA 5DM6Q 2HS3A 2PDAA 5J1EA 2EK1A 3UDEA 4OYXA 3OD2A 4LREA 3DI6A 1Q5VA 3C14B 3EMTA 1OY9A 4P73A 3UNGC 5J2NA 4N7TA 1B7FA 1TL1B 5DETA 1BQMA 1S1XB 2HRYA 3FVYA 4FVMA 2X51A 2R4FA 2AF6A 3BO4A 3KLGA 5GMKa 3EGWB 4X66J 2GQQA 4HVZA 3B6BA 1NJWA 2Q43A 4FYWB 3MAQA 3QGIA 2CQPA 4LF5J 1MN9A 4ES2A 2EKYA 5HLFA 2H5EA 1B4SA 4X64F 1VCTA 2HZCA 3D0GE 3D3BJ 2V5HG 3MAAA 4USTA 2C28A 3LW5C 4ITSA 4NASA 4GO7X 1H38A 4O23A 3HFVA 4YN3B 1Q82T 1LOUA 4A8MP 3ZNJ1 4EBEA 2CG4A 1NK8A 2L9DA 1KQGB 2RMLA 1HNIA 3H5YA 2LEPA 3M2VB 3MM6A 2XM3A 4CLLA 3DOMA 3G9CA 2DJWA 2UXDF 2RQMA 2HG4A 3WC0A 2GFFA 1N0VC 2G9OA 5F41A 2KU7A 1I51B 4ICLA 5CQGA 2LKZA 3QT6A 4KR0B 1NK0A 2HVDA 4M95A 4FVCA 3D2WA 4PRFA 4CH1A 1WACA 1S1UB 4IR1A 1AUSL 2CJXB 2CPJA 1ZH5A 1Z2LA 5HK4A 5RUBA 4GVBA 3G4SS 3OFEA 2V2KA 5GAEI 3RG6A 1YJ7A 1NZ8A 3LH2S 4CRJA 2BE7D 1R31A 1RT2A 4OZ5A 2K1RB 3U7JA 1Q81T 2BYCA 2VPZB 1F9HA 2J8AA 1EJ7L 3G8TA 1UFWA 2RJZA 7FDRA 3FSYA 3GWCA 3LA0A 1TELA 5LSRA 3MD3A 5KFCA 1U25A 2ILYA 5F8LA 1SIZA 1CS4B 2DB1A 4ZPCA 1VQ8S 1SBRA 3H0PA 4ELVA 1Q8LA 3SCLE 3KOAA 1C0TB 2JSXA 2FYXA 2MLZA 2JEGA 2JRSA 2BW2A 4CLUA 2HW3A 2UUWA 1S7HA 2FJBB 3RBEA 1RT7A 3G82A 5CZXA 1EETB 2VDIA 4OZ0A 3GV5B 5J2MA 2HNYB 3OVAA 3UW1A 1VQ5S 4N8NA 4RL1A 2X1AA 5KFXA 2B5JB 3J81U 5LMNJ 4LT6A 2BJEA 4QWCA 4I7FA 5LJ3Y 3ILJA 3QGGA 1KR4A 4NE9C 3CO0P 2C1EB 1XMQF 2DH7A 1H2UX 1F3VA 4N76A 2FD2A 2ALZA 2P9EA 3THTA 5IC4B 4X4NA 2ZH5A 5DQHA 3C16A 3HLUA 2G2OA 4DZDA 2K2PA 4WKRA 1VQYA 2MMYA 2HK2A 3ULHA 4WFXA 4DQSA 3GYGA 2ZD1A 2RNEA 5FIIA 3J7YU 3ENAA 3IA0A 4ZLNA 3SDEB 2X1BA 3M30B 4TU7A 3KK2B 3OHBA 4AL7A 3KYLA 4A48A 2DXEA 1M5HA 1JJHA 2DNPA 2VASA 2ASYA 1CJUB 4LSNA 2XMWA 1U1QA 1BMQB 2XEXA 1JLCB 3N5BA 3G96A 1GNKA 1YZ7A 2DGVA 5AE3A 3FMBA 3VAIA 1BLUA 2AGQA 4DL0C 3ZZUA 2YWEA 1LWEB 3MDFA 2AIRB 1NH8A 2RIJA 2XY5A 1DBDA 1BWVA 3EICA 2XGPA 4WBFA 2GJFA 3RGIA 2BJ8A 2BACA 5IM0A 4YR0A 1TUWA 1T9XA 4ZK7M 4W90B 5THWA 4ZCIA 1UEUA 1PO6A 4DR7J 3SFGA 3KG0A 1WOSA 3NG8A 1UMJA 1VC0A 3PX4A 1C1CA 4KGKA 3FUYA 3NGTA 3MHYA 2Z58B 3D54A 5KAKA 4UOGA 2RHQB 4J9UE 1PYTA 4I69A 1S1VA 4NYPA 3HVAA 5A8KB 2W9CB 5MAOA 5BR8F 2WB4A 1KRPA 4O3QA 1FT8A 1S1TA 1T9VA 4P52A 1RISA 2RS8A 2D1CA 2PD1A 4AFFA 2XYPB 1C4AA 4AQYF 3SCJE 1UVIA 1O6XA 1IBKF 3M8QA 2JEFA 4JV2A 3Q8YA 2HVZA 5DG7A 1X9SA 4D3GA 4RW6A 3SV4A 2PMZD 1YWXA 4G1PA 4LSZB 4CH0S 3OSPA 2DR7A 3ENWA 3DRYA 3CTRA 1F5CA 3US5A 1Q4RA 4DV6J 3H5XA 2VU5A 3HHLB 2H5IB 5IWAJ 4J9VA 2ADBA 2HVEA 1EZZB 2FHJA 1HNXJ 5K8OA 3PNIA 1QVGR 1MROA 1U2CA 3GR0A 1Y5NB 3LP0A 3F44A 1XNRJ 2ACMA 1NHUA 3R97A 2DEJA 2D3OR 2IBOA 3KHRA 3I0RB 3QFWA 2ZITA 2IMWP 3OBIA 4LF8J 3DHXA 3HDSA 1M0SA 4DFMA 4A8FA 2MEWA 4IFVA 2DR9A 5H9EK 1HBNB 3NMRA 2CZ4A 2ZH4A 1FJGF 2E7XA 1DQ9A 1B0TA 2AKWB 2VHGA 1SUQA 1TKZB 2M3DA 3HCXA 3MCSA 3CO9A 4C8LA 2QLXA 2CQ2A 4OYIA 3V4IB 1G4CA 5IZHA 4LFAF 2KFNA 3EE3A 3WHIA 2B8QA 1W2BR 1YLXA 3N6MA 1HFEL 3TRGA 1UVNA 3NS5A 4E2FB 2KO1A 1FE0A 5ETVA 3H2VE 2E29A 3L7PA 3E3XA 1PC5A 4C98A 1V3ZA 3BSCA 3MURP 2AV5A 4MKYA 3RB6A 2C3OA 4I2QB 3AB4B 2BANB 3FZ2A 4DR3F 3TVZA 4RW4A 2R2UA 2LQ8A 3PRBA 2BZ2A 1XR6A 1N52B 1TMMA 1NRKA 4NLGA 4ZDNA 2NS1B 2F4VF 2BDPA 3SBMA 3P96A 1U24A 4L73A 5I42B 5DGAA 4AUKA 2HHUA 2W4PA 5HBMA 2HWHA 2QL5B 2QL7B 3FJ2A 3AT1B 3L7OA 5KG6A 1OJ4A 1R0AB 4X62J 2DHSA 4ZCLA 3QMQA 1FK9B 1YJRA 4B3MJ 3IS9B 1R0CB 2R42A 5D4OA 4C0BA 2HPUA 4CNYA 1UA0A 2VPYB 3EXCX 1M90T 2CQHA 4A8WA 5K8NA 2V9WA 1KDNA 3SQOP 1QAJA 2R7VA 4B02A 2YKNA 1HD1A 3BJYA 3PO5A 3HKZD 3T6BA 4ED2A 4NA3A 4JI4F 4JI6J 4DXLA 1L3TA 5ETTA 2BXJA 4F3MA 4R8UB 1K1QA 1H0HB 3BSOA 3N4WA 1U09A 4NMLA 3CIZA 3HD2A 4LF1A 5T7LB 4FKXA 1B3TA 3GB0A 3MMAA 1JB0C 3MXHP 2GGPB 4ZP9A 3HX9A 1KFDA 3MR6A 3KLHA 5LXRA 1VRTB 3ILLA 9ATCB 2W25A 1XJWB 3CJ0A 3R2DJ 4Y2CA 4I4BA 3MEGB 4G3IA 2EXUA 5KG5A 1VQ4S 3T9NA 3OFGA 2ZBCA 5IV4A 4DV4F 1RAJA 2KG0A 4IH7A 3CCES 3M6UA 5D0GA 1T9YA 2MZTA 2E1MC 1X4BA 4PWDA 4KO0B 2A6MA 3OLBA 3POTA 1PILA 1YK9A 7AT1B 3VGSA 4DR4J 2ZBQA 4DV1J 5DZ6A 1VHFA 2PMHA 2ZBRA 3W3SA 3CJKB 4DOZA 2DNYA 1WF1A 4F2RA 4HHJA 2WONB 1Z4UA 3TYTA 4M94A 1FDNA 4AL6A 3PX0A 1ULRA 5GADI 3FK4A 2EI5A 3CCWA 4TNOA 3H98A 3BF4A 2C3MA 3DLEA 3DLHA 2HRUA 4GRSA 1JLAB 3DYAA 1RCXB 2BMBA 4ILRA 4CLWA 2LXFA 4DUYJ 1HBMA 2C3PA 2OFHX 1F1BB 2W2PP 4DG1B 4DSKA 3TW0A 3W8PA 3K5MA 5CCLA 2FVRA 2OH2A 3RB4A 4W4MA 4PCQA 2VG7A 3MECB 4PXDA 4ECWA 3FDSA 3CVKA 4A4JA 4A8XA 1FKPA 5E33A 3D1OA 2DY9A 2OPSA 1J5EF 1NAQA 1LWFB 4KQZA 4NRTA 5LJ5Y 1NK5A 5HMWA 4YY3J 3F73A 1RZMA 4A8OA 1S49A 4DV0J 2D74B 5EGYA 5KT3A 4FNIA 4ED1A 1OY8A 4P6QA 1MU2A 4J9OA 3NRBA 4HHHA 1S57A 3AQOA 1DLOA 3ZTQA 4J9RA 4MYUA 3ZNUA 1F0XA 2MTLA 4HDGA 3FSIA 4FF1A 2NXJA 4MJKA 2JC0A 1YBAA 5CHCB 4CLKA 1QAYA 2G2ZA 5EWEA 3I6PA 4DFJA 1F3FA 3KHGA 4EZ6A 3M9NB 1CJTA 4J7CA 5KTQA 1H98A 1W26A 4CO2A 2DY1A 4NLSA 4DQQA 4Q2LA 1UP1A 3I5AA 3T5JA 2FVCA 2MKIA 2ALYB 2C3YA 3I9V9 2OTLS 2KM8B 3BKFA 1TFWA 1RACB 2AU0A 3M8WA 3KMQA 3P5TL 4A47A 2AEFA 2YNFA 4KV8B 3M8SA 2JH3A 3KXDA 5C2GA 4I6YA 2V8PA 4O44B 5KOWA 3JQKA 1TQLA 4CI0B 3MPYA 3UR3C 1OWXA 4A8YA 3R7NB 1F2HA 3D6MB 5DGBA 1HQ2A 3H4BA 4ZIVA 4F26A 4RJVA 4MK8A 4C3KA 4GO5X 3IR6B 4DN0A 3HFKA 1HPZA 1HNVA 3OR1A 3JSMA 4ZP8A 1X31C 3OL8A 1MN7A 2M8DB 3NKYA 4ILLA 5D78A 3PM9A 2RD5C 2YNGA 1RT5B 3I0SB 1RWUA 3DKDA 2KXHA 3KLVA 4ETXA 2VJUA 4YR3A 2UV8G 1U6FA 2CDQA 5L39A 4PKDB 4JI8F 4H4OB 2ZWOA 5KG1A 5B0GA 2XCPA 4O3OA 3R5JB 4ZHRB 4O3PA 2BM1A 4YR2A 2YH1A 4KJIA 3MGJA 4PWWA 2ZE2B 1S10A 1H6KX 4UY8T 3W63A 4EU0A 3TP2A 4DSLA 4PUOB 2YTCA 4QR0A 2RAQA 5A2QY 3N0VA 2AGOA 4ED8A 1IM4A 2QEXS 4JI5J 1GX5A 1HMVB 3CCMS 3Q8QB 1DTQB 4HT7A 3I4PA 2BQ3A 5I3PA 2RU9A 1S0VA 1GMWD 3ZTPA 3AJ2A 3QATA 3C2PA 2HZAA 5G4DA 2KHDA 2CJKA 4LRAA 2AHOB 1RLDA 5BYRA 3BYPA 2ZH2A 5D3GA 5FDLB 1H3DA 1R8AA 3T9ZA 5AE1A 4FBUA 1TL3B 4Y2AA 1WG1A 1CPZA 2M88A 3I5BA 2FJVA 5DDPC 2P6TA 4DU8A 2IBKA 3CJ4A 3HZEA 4NPOA 4WFBQ 4NA1A 4M5HA 2RS2A 2V6AA 3L7UA 1XNQF 2W7OA 2B0GA 1IR2A 2L41A 5DLGA 4UT4A 2WVFA 2P5VA 2V67A 3JTPA 4EI2A 2CNOB 4UZCA 2VG5A 3UPFA 2XY6A 2FZGB 5LL6d 4DQPA 3P49B 2R2TA 3MCOA 2EC2A 5KT2A 5LSOA 2CJAA 2VFTA 3PYGA 4I68A 1WC1A 2DD8S 1T0TV 4EBDA 3TUIC 4LF9F 4OI3A 4UUXA 5KFDA 2VD3A 1BQMB 1XN9A 2O66A 3CIMA 4E98A 1R3NA 4RBUA 5I3UB 2DHGA 2OHDA 1CJVA 1TV6A 2WW8A 2CQGA 3SXLA 3D5MA 3IGNA 1MSWD 5L9XA 3FCWA 2PFDA 3SCIE 4HTJA 1LW0B 1IJFB 4FYDA 1EQ0A 5AJ3J 3MM8A 1OQ3A 4YB6A 2DEIA 2E5IA 1S4EA 4NLRA 4HLBA 5E5NA 2MQNA 1HNIB 2B9EA 1RT1A 2CQ0A 3W5YA 3HF5A 4HACA 1RHMB 4QJVA 2QO3A 4OHVA 3DOMB 3PTWA 2ZHAA 5AXLA 1REGX 2WK4A 3ENQA 3TZZA 1Q7YT 2AT1B 3A1YG 2HQ3A 3O44A 4A8QA 1GH8A 4MK9A 2YNIB 1YDLA 1T3OA 2HMIA 2L3MA 2FGOA 3BSNA 2W2NP 1E6VB 5M2UA 4PEOA 5KFLA 4CLTA 4DUZJ 1AFIA 3QBCA 3KUHA 3V4MA 1Y3KA 3TX8A 2QMUB 5K5MA 2Q66A 1S0OA 4GVBB 1RA7A 4K4YA 4WP8A 1YJWS 3RUBL 3DRSA 3NS7B 1R8CA 3MEEA 4IKAA 2VQEF 1U26A 3PY8A 2YWWA 1NBEB 3MFHA 2A3JA 5IT9Y 4C6AA 2AWZA 3MUMP 1G1XA 2KB2A 4WXOA 4ZLJA 3MM9B 1GMWA 4WZMA 4RUCA 2JLGA 3TNVA 1N5YA 2GVZA 4P10A 1NH7A 2UU9J 3KJFB 2OEKA 2R8IA 1S97A 4C8OA 1UFLA 1IN0A 2YY3A 1WUUA 3C3LA 1QM9A 2B4PA 5HVHA 3NL0A 2CPFA 4X4QA 1JLGB 3HJVA 4Y0FA 4O0IA 2HGLA 1N88A 3NNCA 1RT7B 2GJ2A 1J27A 3GJQB 4PQAA 3DGPA 5H1SV 1RABB 2ZUGA 1FVQA 1N32F 2HHHJ 2HBYB 2CQ3A 2AJ1A 4CYUA 2QSFA 3FMWA 4C8ZA 3GSDA 2F65A 4MKVA 1NDLA 4FXDA 1D9AA 4K59A 1K73T 5KT4A 3Q0AA 1FO1A 2JC1A 3M9OB 4X84A 3U02A 3CT9A 2N3OA 4CT9A 2ZC4A 4JV5F 1RT4A 3T5KA 1MWYA 4ZLPA 3FQLA 2OPQA 4M8LA 1HBUA 4DR6F 4ECRA 1XBWA 4GMKA 3DC2A 1HNZJ 3N79A 1XR5A 2MJUA 1NK9A 2AW0A 1YRTA 1PCAA 4ELTA 4DPYA 1YGYA 2ZVSA 2C2EA 3V6JA 1BC6A 2HLUA 4DL2A 2XS7A 1FRIA 1H2TZ 1FX4A 1VIOA 5HMXA 3DMJB 4C11A 2HBZB 3R1LA 4R5PA 3AFGA 2MZQA 1FE4A 3LF0A 2CNNB 4F4WA 3CE8A 1DQAA 2HNZB 1TK8A 1P9YA 3BDPA 2E9TA 4HH1A 4O3SA 2VJVA 4O3RA 4FF4A 3D66A 3O6QA 2NR0A 3PV8A 2NSCA 5HROB 3BN7A 2OD4A 1JJ4A 4F4AA 5K20B 4ENOA 5GAGU 2LA4A 5IT4A 2OMLA 3VZIA 1SV5B 3CD7A 3ZZRA 3NLCA 1R6YA 2E7WA 2O1PA 4NL5A 4BWMA 1NJZA 2E5LF 1SJ4P 5I3QA 1GMVA 5HP1A 4M5IA 5B09A 3QZ8A 2RE1A 3R27A 4OI2A 1C1CB 1N34J 2DNKA 3OTOF 3NS6A 3UWTA 2XC9A 1P1LA 1FXRA 2MHEA 4C8YA 4RW7B 2B51A 5KG3A 3ZXWA 1IR0A 1BQXA 1S1TB 1LW2B 1O0PA 2Z0GA 2HQFA 4O3NA 3GJSB 1WELA 3D1HA 2H4YB 3J80U 3A13A 4OJGA 4OX7A 4ZOSA 4OYBA 5KFQA 1IVZA 5C42A 3OQ2A 1WHVA 2CQCA 4RW8A 2BABA 3EZUA 5DQIA 1RAFB 5CD4H 5KFEA 4RW6B 1TAUA 5AXMA 1N8RT 2QN6B 3HVRA 4AYBD 3KLEB 3SV3A 1H73A 1XWLA 4IDKA 1FNMA 2E44A 2CVIA 2Q79A 2IRYA 4UTGA 4B3RF 4U8VA 3K0JA 1R89A 2GMHA 1X4CA 1ITPA 1RI7A 4AE5A 1S6PA 1N6QA 4URGA 3I96A 1YG0A 3K5LA 4OV6A 2EW9A 3KDNA 3I9ZA 1C0UA 2CRLA 1ZBTA 1V6HA 3W9HA 3B4DA 2XB2D 5F8JA 2JFKA 2MYFA 2W9AA 3VV2B 4WZQA 1XQIA 1ZM9A 3EM1A 4CQ1A 3JQMA 2YQ0A 2IAJA 4I2PA 2DO0A 2R7RA 4L74A 1RT3A 4IRCA 2A2DA 2AJ2A 5E3CA 1IXKA 4O4GA 3JSBA 4M5LA 4DV5J 2D69A 2H65B 3WIVA 3UVJA 5C25B 2V94A 1SC6A 2R8HA 3MM5A 5F3TA 2VUGA 2F1FA 2ADCA 1N5TA 1M1HA 1VGYA 1WHWA 5DO2A 3PW5A 1DARA 3AA9A 3M2RA 3UDCA 3G8QA 1JLQB 3SYZA 1S9EA 4DQIA 2CPXA 2WOMB 2P6SA 2OIHA 2KTQA 3ZTOA 1UW4A 3MZIA 1REVA 3FBFA 2XULA 2VDHA 4IFYA 4OZ2A 1Q0NA 3CB4A 5D6GA 2Y1IA 2IHR1 3EPGA 4LFBF 5A2QU 1S76D 5KFZA 2KXFA 3GTYX 1WD6A 2JEJA 1Y5IB 1F5BA 4GKKJ 4JI0F 1LXJA 1R43A 3ILOA 5E2QA 1WWHA 4ES3A 4TN2A 3CC7S 1GXLA 3DLGB 1KVKA 3TWZA 5FD1A 2BRLA 2ZJQQ 1X60A 2X3GA 2Z2YB 4LF7F 3OVSA 3BYRA 2BW7A 1LEOA 4YOEA 4USKA 4DX8H 3BB5A 5HBMB 5ETSA 1S5ZA 1DRZA 3DLKA 5AXNA 3SFUA 5DJBA 3A12A 4HR2A 2KFYA 2CXEA 2EG1A 4XPEA 1WTBA 3S01A 3QO9A 3ILIA 1PJ7A 2LQJA 3SCKE 1T03A 4CNZA 4K0KJ 1FDBA 2HEKA 4NLDA 4X66F 2EFOA 1EAYC 2FPHX 2NUUG 1TKTA 3GSIA 3PR4A 5L46A 1NDKA 1VR6A 4XIUA 4LF5F 1UFKA 2NYIA 3EPIA 3PACA 1BD6A 2RDIA 4G1QA 4KBIA 2FJAB 1L5UA 4Z7CA 3ZC4A 2ASLA 4F36A 2VBZA 2Y0SD 3KLFA 3MEDA 2NXEA 2RH3A 2QYGA 2HHPA 3KLHB 1HBOA 1FDAA 2QYCA 2MXYA 4C0OC 4LBPA 3QT8A 2C2RA 1EARA 2DHXA 5J2QB 1HWUA 4YP3A 2XTJP 3CMAS 3OSNA 1S9FA 3TUJC 2KI2A 4MAKA 5JXSA 4HI1A 2JDJA 5EX3A 2LCWA 4RZRA 3BBBA 1VQ9S 4CM0A 1KLMA 4G65A 2QRRA 3EVOA 1R6VA 2QC3A 2M4MA 4FBTA 3O1LA 2CPEA 3POTB 4BBYA 2WB1D 3VGUA 2M9KA 1RU2A 4IOAQ 3HPOA 1FKOB 4I6AA 4JB8B 2OMOA 4YFUA 5A0YA 4ID5A 2GC8A 3L4BC 1CVJA 6AT1B 2BA9A 1FX2A 2KZMA 3R3TA 5FLXY 1TKXB 4ZVUB 1JLBB 3A4TA 3P4UB 3DU6A 3U1MA 1HQEA 1FD8A 1VDHA 3ZFVA 3ETOA 2YX1A 4CP5A 4CLFA 4EZ9A 2DIUA 5EDWA 3BGLA 1JNRB 1QTMA 3MMBA 3AOAA 3EGZA 2JVRA 5KFVA 3K8WA 1RE1B 1VQKS 2CPDA 2K3KA 3DRPB 4WU3A 1M5KC 3ISNC 1UJ6A 3MTKA 3SSRA 1HI8A 4ZVFA 3RR8A 1FFGB 5D0HA 2YWHA 2DPIA 1AA1B 2OPRA 1I1GA 4H4MA 1T9TA 2MZJA 2XWYA 4NLVA 2DNHA 2L9NA 1BQNB 3PJXA 2V4JB 5KFJA 1S0NA 3OXGA 2W01A 4MYTA 1L3SA 3Q23A 2W9BB 5ITHA 5IT9U 3EJMA 2AYMA 1YSJA 5KT7A 2QLFB 4IOCQ 1ZYQA 4ETZA 3FCHA 4UQTA 2IA0A 4WIQA 1U1KA 1SQEA 1V5VA 1DLOB 3I4HX 1WOPA 1VMBA 1TU0B 3S1TA 2DXDA 5DS7A 2V2ZA 1AYEA 5IFMA 4K7QA 4TU9A 5LMNF 4CO1A 4L75A 1U47A 4C97A 1RCOB 4XPCA 3PRDA 1U6BA 3IO1A 1PC4A 3TARA 3GG1A 1CJTB 1ACMB 2IRUA 4BC9A 3J7AN 4Y2MA 3HHLC 4KGVB 1M5VC 3CCUS 2ZWPA 2RDJA 2MQLA 2EKNA 2CADA 3PVXA 1S4FA 2HGNA 1N0UA 3W2VA 4DV2J 3BGRA 2W1BA 1NHKL 3J81Y 3OR2A 5F8IA 2J9EA 3MD1A 4WF9Q 4F4YA 1UPMB 2Z56B 4KHMA 2VL1A 2HGMA 5HSPA 1TMJA 3W2WA 4A8SA 4TY8B 1B0VA
chains in the Genus database with same CATH topology
1WJ9A 5CD4A 5H9FK 2Y8YA 2Y8WA 3QRRA 2Y9HA 4DZDA 5H9EK 4U7UD 3QRQA 3QRPA 4QYZK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJ9 A;  5CD4 A;  5H9F K;  2Y8Y A;  2Y8W A;  3QRR A;  2Y9H A;  4DZD A;  5H9E K;  4U7U D;  3QRQ A;  3QRP A;  4QYZ K; 
#chains in the Genus database with same CATH topology
 4F4X A;  4USU A;  1VC6 A;  1SJR A;  1CUL A;  2UUC J;  3QJJ A;  3OVB A;  1LV5 A;  2LEC A;  2UUB J;  1YTY A;  3EDR B;  2E7V A;  2M70 A;  2ZOG A;  4C8N A;  2MDA A;  3SSS A;  4CT8 A;  5KFM A;  1KVI A;  5DG8 A;  5GAG I;  4ECZ A;  1HNV B;  3OR1 B;  5BJR A;  1RAA B;  3GJT B;  2DRA A;  4Q2M A;  5BXI A;  5F0W A;  4XTT A;  5E3P A;  4LRD A;  5HI7 A;  2MQQ A;  3IXQ A;  1U1O A;  2YNG B;  3PFE A;  4RUH A;  2DVI A;  5B0D A;  2LU2 A;  1EKR A;  4CO5 A;  4JI3 J;  1RXO B;  4C8M A;  1HQU A;  3F56 A;  2WZ1 A;  4DR7 F;  1NPR A;  2N3L A;  1Y5L B;  3AA8 A;  3QLH A;  4QWE A;  1FRK A;  5KFB A;  4C2M A;  2B7B B;  4B3O A;  4ELU A;  5KG4 A;  1YKW A;  2UUT A;  4AT1 B;  3VCD A;  2HHV A;  2N4D A;  3K17 A;  3R5B A;  1ICE B;  2WBR A;  3I55 S;  2HFZ A;  1GTH A;  4RNF A;  2J0W A;  4YDD B;  2VB6 A;  4OYP A;  4DCJ B;  1NSP A;  2CQB A;  2HK3 A;  5KFY A;  1N54 B;  4DSF A;  3D6T B;  4ZPT R;  2HUR A;  1YJV A;  1W7W A;  2R8K A;  3J7Z 5;  1RWW B;  3MOZ A;  2K3I A;  3PIP Q;  2DXF A;  3NY0 A;  4K5S A;  3HP6 A;  2BRK A;  2PII A;  1RQ0 A;  1R8H A;  3GFH A;  4CCH A;  2FY1 A;  3C15 B;  4YHH J;  1SB6 A;  2E66 A;  4X4V A;  5D3G B;  3OTE A;  1FER A;  2Z57 B;  1SXL A;  1WEZ A;  2OEL A;  5B7W A;  4DV6 F;  1NXI A;  2YWF A;  2APO A;  1B0P A;  3CCZ A;  5IWA F;  3ICL A;  3GMG A;  5D0E A;  4DR2 J;  1HNX F;  1IBM J;  3L09 A;  2MKK A;  3T1H J;  5T41 A;  3TQE A;  2IMO A;  1FVS A;  1QVF R;  1RU1 A;  1YQH A;  2C2K B;  3GFX A;  4YDX A;  1XNR F;  3HVT A;  3HK2 A;  3RYL A;  4OHZ A;  4ANC A;  1X0F A;  1S77 D;  3TX0 A;  2YNH A;  2XI3 A;  4RW9 B;  4ECV A;  3F41 A;  3PKM A;  1YIT S;  4CWB A;  4PQU A;  2XNR A;  4FS2 A;  2DT9 A;  4LF8 F;  3AOD A;  1W25 A;  4X4R A;  1RTI A;  2U2F A;  3TJA A;  3B54 A;  3SQG B;  3UI3 A;  1Q79 A;  3BPD A;  3GZ7 A;  1URR A;  4DS5 A;  2WVE A;  1VQO S;  3ET6 B;  5SUH A;  2UXB J;  4DX7 A;  2EBE A;  3R2C J;  2IM3 A;  3NCQ A;  1UJ5 A;  4DL5 A;  3NGS A;  2FC9 A;  3LGH A;  1LK7 A;  3C14 A;  2BKP A;  4Z2X A;  1FWL A;  5B0F A;  1TL1 A;  3HSG A;  3QPI A;  3KUG A;  3OPK A;  3ZZP A;  1FRH A;  3HSJ A;  5J2P A;  1KOH A;  2AJF E;  1FHT A;  1UWA A;  5KT6 A;  1PGZ A;  4PG4 A;  3IBW A;  3JSR A;  3CC2 S;  4OI0 A;  4OI6 A;  4OZ3 A;  3AH6 A;  3ENV A;  3HXM A;  3Q24 A;  2J0S D;  4B9V A;  4HL9 A;  1RHR B;  1YRU A;  3VAH A;  1HLW A;  2WW4 A;  2I5J A;  3R6L B;  5JVH Q;  1F9E B;  4LQ9 A;  4B9T A;  3G6V A;  3JYT B;  1X7V A;  2IM1 A;  4KHP J;  4F3Q A;  3FCV A;  2CPI A;  3KMS A;  1O5J A;  1VBX A;  4HDH A;  3DHW C;  2XLK A;  3CCJ S;  2IDL A;  2CPH A;  4XK8 C;  3J7Z T;  2C2O B;  2G0C A;  4XDC A;  4M1K A;  1VIX A;  4X62 F;  3GR1 A;  3G6Y A;  2XMV A;  2DPJ A;  2BQR A;  3M2V A;  4B3M F;  1RAH B;  3QNW B;  3PYE A;  2V0N A;  1ZZN A;  1WC4 A;  3IGV A;  2MKC A;  1JXE A;  2COL A;  2B9X A;  1K47 A;  4P2F A;  4B9N A;  2C22 A;  5JUM A;  4LFB J;  3ISN D;  2B6A A;  2FC8 A;  2HAF A;  3V5R A;  2V68 A;  1VFJ A;  1NM2 A;  3TAQ A;  5GAH U;  3MEE B;  4OJ3 A;  5C5J A;  2DNN A;  1S1U A;  2L08 A;  2YKM B;  4BLG A;  2IVM A;  3TEG A;  3BZQ A;  5LM7 E;  1YX2 A;  5C7P A;  3BGF A;  5CYJ A;  3DLB A;  1S9G A;  4DR5 J;  3BEG B;  3KG4 A;  4JYA J;  3FZB A;  2O5D A;  4I64 A;  3CCR S;  3LWM A;  2HS0 A;  1NCL A;  2BE9 B;  2KM8 C;  3EX7 B;  1S99 A;  4AXI A;  5CD4 A;  2R8G A;  4USH A;  1PJ5 A;  7FD1 A;  3TOQ A;  2K1R A;  3OUY A;  2GHW A;  5A8R A;  3NGR A;  4I67 A;  1V3R A;  3NXZ A;  5B0A A;  1F5A A;  1FKA F;  1N4L A;  1U2F A;  4NCG B;  1N33 J;  1UAW A;  4C3L A;  2FUG 9;  4U7C A;  2FQQ B;  3TUZ C;  1T94 A;  3A8I A;  4KYZ A;  3FEX B;  3KLI A;  1LKZ A;  2JNJ A;  4DV3 J;  2ILZ A;  2CUY A;  3UNY A;  2AYG A;  4DR4 F;  4MK7 A;  4DV1 F;  2ZZN A;  2KDO A;  1CS4 A;  3G86 A;  3HHL D;  1ZPW X;  3M8P A;  1C0T A;  3E2E A;  2VZ9 A;  3TAN A;  4L76 A;  4LSL A;  1YRX A;  2VA2 A;  1BWE A;  3DFE A;  2VOO A;  4L6V 3;  1HR0 J;  3K2Y A;  3D68 A;  4RUA A;  2E5J A;  4DN9 A;  1EIY B;  1JLF A;  2WBM A;  1VQ6 S;  1NK4 A;  3L95 X;  3V81 B;  2XHW A;  2HNY A;  2GIF A;  4ZVP B;  2B5J A;  1WEY A;  4IRD A;  1GT8 A;  3UCZ P;  4DUY F;  2ASJ A;  2CIM A;  5FLX U;  4Q0B B;  3NBP B;  3CGI A;  1U6Z A;  2K7K A;  1Z2Z A;  3CDW A;  4PZV A;  2FLP A;  3FRZ A;  4DUT A;  4TY9 A;  1OS5 A;  1N56 A;  2WVD A;  1RTD B;  4OHW A;  1RLC L;  3KK3 B;  2PFF B;  4RBV A;  1X5P A;  2FJE B;  2DIV A;  2LLZ A;  2M2B A;  4DPT A;  4RR5 A;  4C11 B;  4C8K A;  4DPW A;  2UVU A;  4R5P B;  4OYZ A;  3N01 A;  1KBR A;  1X5O A;  2SXL A;  2ZH7 A;  4B9M A;  2MKY A;  2VV5 A;  3EWG A;  1X4H A;  3C8Y A;  4YY3 F;  5KOX A;  4ILM A;  2LA6 A;  3N5F A;  4QPT A;  3SDE A;  4DV0 F;  1Y4Z B;  2DNM A;  2B4V A;  2PC6 A;  3PFO A;  3HO1 A;  1GFW B;  1U49 A;  4V19 X;  1CJU A;  4GC6 A;  2HQD A;  3OTC A;  1NZA A;  1S12 A;  2KJV A;  1NDC A;  2D9P A;  1KN6 A;  4F0M A;  5KG2 A;  1MW7 A;  3SMZ A;  1KWM A;  1SKU B;  4ES1 A;  5KFR A;  5IQ6 A;  2RRB A;  4NOH A;  3WQP A;  2WCX A;  3DOL A;  2XSJ A;  2C2M B;  4OI1 A;  3HUL A;  1B99 A;  3W66 A;  4OJH A;  3TQ1 A;  2HHT A;  1QE1 B;  4OX8 A;  1RTH A;  1FES A;  3CXC R;  1S1W A;  2KYZ A;  4ZJO A;  2ZJP Q;  2MKH A;  5IXU A;  1FD2 A;  3GCW P;  2HQC A;  2EVZ A;  2N4C A;  4TU8 A;  4HHU A;  1PYO B;  1OMS A;  2OP5 A;  4Y00 A;  2XG8 A;  5KFG A;  3T19 A;  3QAU A;  2XMJ A;  2HRT A;  2QG9 B;  1JLE B;  2F4F A;  4X65 J;  1DFD A;  2QA2 A;  5C42 B;  1FF2 A;  1WC5 A;  2VFV A;  1Q16 B;  4TKT A;  2GAH C;  5A8K A;  4KY3 A;  2YX4 A;  1TL7 A;  2DR5 A;  3DNC A;  1SJQ A;  4OYM A;  3NOC A;  1HA1 A;  3BRE A;  2H5J B;  3M32 A;  2CYY A;  3TVK A;  1AT1 B;  1XIQ A;  3GLJ A;  4GKJ J;  3D67 A;  1TFY A;  4IDK B;  2QA4 S;  3MM7 B;  3BBF A;  2QFI A;  3I31 A;  2E9Z A;  2GQC A;  2KT2 A;  4OLO A;  2F40 A;  3O3L A;  4FPR A;  1S6P B;  1N6Q B;  1RWK B;  1JKH B;  3VGT A;  3P6Y C;  1JXL A;  4KC5 A;  3CNQ P;  1M1G A;  3NMA A;  5ETP A;  3GON A;  4NZ7 A;  4WFZ A;  3VAG A;  2OGU A;  1D9F A;  1Q8B A;  3CCV S;  4ZPD A;  2Q1L A;  3DDI A;  2V8G A;  3HHL A;  2ROG A;  5DDR C;  4K4X A;  1WNE A;  1SCJ B;  8AT1 B;  3GYX B;  4NI2 B;  4I2P B;  4CH7 A;  2B3T B;  2GIR A;  2VBX A;  1CC8 A;  2OPP B;  1DTT B;  4C48 A;  4O4G B;  1Y10 A;  4NX9 A;  3TJ8 A;  2CNL B;  2MJN A;  3MM5 B;  4CO0 A;  2D9O A;  2DKO B;  4LFC J;  4X4U A;  4L72 B;  4F4Z A;  2VBW A;  4J37 A;  4OL8 A;  3A3O B;  4DHV A;  3LOU A;  3GIK A;  4JI5 F;  4NXM J;  1MWZ A;  1NPP A;  2JHE A;  2R7Q A;  5JJB A;  5EX0 A;  3M2R B;  4FP9 A;  2EFV A;  2VPW B;  2JLE A;  2ZKT A;  4RNN A;  1HBN A;  2XHC A;  3J7A 1;  2HSE B;  3RR7 A;  2NCK L;  2DGX A;  2YQ3 A;  4WTO B;  3BQ0 A;  1M5P C;  3V4I A;  3HT0 A;  2Q6C A;  3RBX A;  2G1H A;  1TUV A;  4IFY B;  1XR7 A;  2M8H A;  5G0R A;  2VFR A;  1TL5 A;  4YUD A;  2MZS A;  2RRN A;  2EFN A;  5D0R A;  4OI4 A;  4Q43 A;  2DH9 A;  3V6H A;  2RUS A;  3VAK A;  2CDR B;  4KPC A;  5E7O B;  5HL7 Q;  3Q83 A;  2QX0 A;  3CED A;  4E0D A;  2OO4 A;  4I2Q A;  4H54 A;  3M2U A;  4HYK A;  1PKU A;  3P3D A;  3Q8R B;  2H48 B;  3DLK B;  2O01 C;  3DRR B;  4HTI A;  1S0M A;  2NRE A;  4A8K A;  1NU4 A;  4YME A;  3H59 A;  4F50 A;  2C2D A;  1B64 A;  4FNH A;  3CJ2 A;  1NKB A;  1FJ7 A;  5I42 A;  2ZHO A;  1V5I B;  3ZZO A;  3CME S;  3M7V A;  4N8O A;  3M8R A;  4LBH A;  3CCT A;  4TLQ A;  2K8G A;  4R25 A;  1TKT B;  1R0A A;  3TJ9 A;  5CCM A;  1FK9 A;  1CLF A;  4USV A;  4OYO A;  3HJF A;  1RHK B;  1K1S A;  3IS9 A;  4QU7 A;  4AD6 A;  3KHH A;  3S6E A;  3BO2 A;  2B4U A;  3N6L A;  4NXN J;  2UVV A;  5D4N A;  3NWR A;  2CJ9 A;  3CWJ A;  4OV1 A;  1VLO A;  5M2R A;  1KNZ A;  4QYZ J;  2CPY A;  2MSS A;  3W5Z A;  2PT0 A;  5AJ3 F;  3PW4 A;  4OJ1 A;  4DFP A;  3DU5 A;  2J7U A;  3GU0 A;  3R6G B;  1UVL A;  2BE2 A;  3T5H A;  2JWN A;  3KKF A;  4R8U A;  4EWT A;  5T7L A;  4CLY A;  1E6Y B;  1X9W A;  1TKD A;  3HSD A;  5CZV A;  1OIA A;  2UP1 A;  1VJQ A;  1KLM B;  2GGP A;  4LIR A;  2ZBI A;  3UD5 A;  4Q8E A;  4TQS A;  5L1K A;  2KRB A;  1OYD A;  3GJR B;  2Y1R I;  1ZM3 A;  4HEA 9;  5KFS A;  3R5G A;  4OQJ A;  3VAJ A;  4RUB A;  2F7V A;  2QE5 A;  4LF2 A;  5A0Y B;  1T05 A;  4LUB A;  2UXC J;  2RF2 B;  3CW2 C;  3SSQ A;  4DUZ F;  1SKR A;  2GIQ A;  4PXB A;  3LO3 A;  3LUY A;  2Y1J A;  3OL9 A;  5F8H A;  2G0J A;  4EO8 A;  1NEE A;  1HQE B;  1I5O B;  2PI5 A;  2BV3 A;  3CJK A;  3OT9 A;  2OSR A;  1QTN B;  4M5D B;  1Y9O A;  1QY7 A;  1UW9 A;  2H54 B;  3C6T A;  3H40 A;  3PEH A;  3OHA A;  3M1V B;  3JTO A;  1CSJ A;  2WON A;  3MMB B;  4FN5 A;  4Q7A A;  3EUN A;  4B17 A;  2ZM6 J;  4ALZ A;  4U6P A;  2NUH A;  1FNO A;  2P2C B;  3B8H A;  1HYS A;  4N41 A;  3BPS P;  2R7T A;  1WTF A;  1RTJ A;  1IKY B;  1SC1 B;  2OPR B;  1LXN A;  4N47 A;  2UU9 F;  1S59 A;  4H4M B;  4J9M A;  3MI7 X;  3IWX A;  4DL4 A;  3MPV A;  1H74 A;  3LTO A;  1SH2 A;  3JSY A;  3F0N A;  4FYY B;  2HAI A;  3LAK A;  3UCU P;  1MG7 A;  4YB5 A;  3BR8 A;  1TZ0 A;  3K5N A;  1RWV B;  5AT1 B;  5HAN A;  3W7B A;  2I1R A;  5K14 A;  2ACY A;  2Z8Q A;  3MEC A;  3MR3 A;  2LVW A;  2OJ3 A;  3IFE A;  4ED5 A;  4UW2 A;  2HHH F;  3B78 A;  2UUA J;  4CO3 A;  3K89 A;  3PHE A;  3IRX B;  2H51 B;  4LR8 A;  1RT6 A;  3GCX P;  2N82 B;  3G87 A;  4IYQ A;  2VFS A;  2ZH6 A;  5ETN A;  3CCL S;  2KVQ E;  3O8W A;  1RK8 A;  2PEB A;  3Q2S C;  3W2V B;  3L9Z A;  1HNZ F;  3JS9 A;  4UUW A;  4YEA A;  2ROE A;  2ZVI A;  3G6E S;  3BGR B;  2R2R A;  3FBE A;  3OR2 B;  2JFD A;  4M5J A;  3I82 A;  4QIF A;  4DL6 A;  2AZ1 A;  2ATC B;  5AE2 A;  1XK8 A;  1TVR A;  5K8P A;  5LMU J;  4V19 J;  4RKU C;  2XZD B;  3WIU A;  2VOP A;  1MLA A;  3W2W B;  4PXE A;  4U96 A;  4B3T J;  3AOB A;  4K4W A;  4DU7 A;  3PDN A;  1T8E A;  2U1A A;  3ZO7 A;  1T3N A;  4JOU A;  1GXT A;  2XZW A;  4F4K A;  3C6U B;  2YQ1 A;  4NLP A;  2A10 A;  1V3S A;  3BO3 A;  4DCP B;  3N28 A;  4KV8 A;  4TYA A;  4J90 A;  3QID A;  4Z7Y A;  4O44 A;  3IRW P;  2FHK A;  4IO9 Q;  3AY0 A;  1X4E A;  3NGK A;  2FTR A;  5F9N A;  1Q95 G;  4F67 A;  1RWN B;  4Q5V A;  2GS8 A;  3IG1 A;  2OTJ S;  2E9R X;  3DGV A;  3RB0 A;  2R7O A;  3HHN B;  5KFI A;  2AQ4 A;  2HFU A;  5J1P A;  4K50 A;  5ETQ A;  2AGP A;  3M8Z A;  1FJE B;  3IR5 B;  4DR1 J;  2DGO A;  3CSK A;  3I5C A;  3CD6 S;  1S79 A;  4QR1 A;  3UDL A;  2RSQ A;  4UOH A;  2XS2 A;  2LXI A;  2KXN B;  5JMN A;  3QLH B;  1JJ2 R;  1XMB A;  3CDU A;  1N34 F;  1RT5 A;  3I0S A;  3JTN A;  3BQ1 A;  2IRX A;  4Y3C A;  3OL6 A;  1T9U A;  5EWF A;  3D0H E;  4ZS6 A;  2J6S A;  2PA8 D;  2GV1 A;  3MTJ A;  3Q8P B;  5H9F J;  1K0T A;  3W61 A;  3PCO B;  3OFH A;  2C2N A;  4DDF A;  3HHK A;  4WFY A;  1YBU A;  4MFB B;  4CTA B;  1XMO J;  2KG1 A;  1KKH A;  2YBV A;  3MPU B;  1IUJ A;  2ZE2 A;  1FWK A;  4E8U A;  4ZCK A;  4PUO A;  1Q8I A;  4EFA C;  5SZT A;  2LU1 A;  3DRX A;  2N7Y A;  3T3F A;  1T95 A;  2R7X A;  1BHN A;  1DTQ A;  1QLN A;  1WHY A;  3HMJ G;  3J80 Y;  1SL1 A;  2KFZ A;  2GHV C;  1HW8 A;  4JI2 J;  1ZAX A;  2GW8 A;  1WKK A;  4OX6 A;  1T7P A;  4U9R A;  2IVF B;  3J7Y I;  4B3S J;  4ID8 A;  2MGZ A;  3QQC D;  2PMW A;  5FDL A;  1RTZ A;  2LP4 A;  1KQK A;  3D0I E;  3KG1 A;  4IG3 A;  2HIQ A;  1TL3 A;  1U45 A;  1LWC B;  3BGU A;  2K7J A;  3H25 A;  1IKX A;  3E01 B;  2I9S A;  4PQU B;  2B9Y A;  2HLT A;  2AYE A;  2W7P A;  1FTC A;  1FRM A;  1RTI B;  2RDD A;  1UL3 A;  3W1Y C;  1RUS A;  1WHX A;  4U8Y A;  4M5K A;  4P2M A;  4DV5 F;  1OPZ A;  1HHS A;  3TI0 A;  5DQG A;  2V2Q A;  4DL3 A;  4RPF A;  4NCB A;  1NDP A;  4QCL A;  3GPA A;  4DSE A;  5DDO C;  4TLR A;  2LEA A;  2W4C A;  4Q44 A;  3LP1 A;  3PYD A;  1RHU B;  3VQS A;  2YKQ A;  1VQM S;  2ZUA A;  4PG5 A;  4NCA A;  1S48 A;  3GIL A;  2ASD A;  3M4X A;  5DZ7 A;  5J2P B;  1IKW B;  3DOK B;  4DLE A;  6FD1 A;  1UA1 A;  5E3Q A;  4OHX A;  2ZOF A;  4IQX A;  5I3U A;  4I0W A;  1KQS R;  2J6T A;  4DPX A;  1EP4 A;  4ZA1 A;  4GKK F;  4LVN P;  4BCA A;  2LXU A;  1SJ3 P;  2QIF A;  2IC3 A;  4Y2I A;  1SQG A;  2I5J B;  2D7S A;  1QD1 A;  1IWA A;  2Y1L B;  3B82 A;  3WBZ A;  1F6T A;  1N5Q A;  2NZC A;  1LW0 A;  4RBT A;  2JJ4 D;  3OXF A;  1URN A;  5GMD A;  1NO8 A;  4PAB A;  1AZS B;  1HNW J;  3IP0 A;  3G71 S;  5GVQ A;  5CA5 A;  3FSX A;  2DR8 A;  3AJ1 A;  4C4W A;  1HAR A;  2KYX A;  3K57 A;  1RAG B;  4RO0 A;  4K0K F;  2CQ4 A;  3DM2 A;  2DRB A;  3HFZ B;  2EC0 A;  1UJ4 A;  5BYQ A;  3LPE A;  2BOP A;  3KFW X;  2YNI A;  3TZY A;  2B6A B;  1HIY A;  4QU6 A;  4P74 A;  1Q86 T;  2HS4 A;  1E6V A;  3IR7 B;  3GP9 A;  4C9D A;  3RB3 A;  4DF8 A;  1S6Q B;  3QRQ A;  3CDB A;  2QLB B;  3R5C A;  1C2P A;  2IDE A;  2DNG A;  3H90 A;  2IM0 A;  2WVB A;  2OEJ A;  2KL8 A;  2AD9 A;  4CZC A;  2BQU A;  2A1B A;  1S9G B;  2KN4 A;  2KRR A;  5E41 A;  2PEH A;  4USI A;  3UQS A;  3JB9 k;  3RRG A;  5GAD U;  1YJ9 S;  3OUY B;  1RBA A;  1I94 J;  5A8R B;  1U4B A;  2MQP A;  5KFU A;  2HYI B;  2FLL A;  5J1E B;  4WYW A;  4KH1 B;  2HWI A;  3DI6 B;  3U1N A;  1JIH A;  5J2N B;  1FRL A;  1LFW A;  3KLI B;  3V6K A;  1FRJ A;  4QPX A;  3MM9 A;  3RU0 A;  2FB0 A;  3KLG B;  3QYY A;  2AYB A;  1GTE A;  1QJH A;  5KFA A;  1MMD A;  2FHJ D;  3FFI A;  2E1P A;  3M8P B;  2VQF J;  1RAE B;  3W5X A;  4BS2 A;  3Q8V A;  4LSL B;  5HLF B;  3OLA A;  1NK6 A;  3BH7 B;  3TA0 A;  4Q8F A;  3O2I A;  4IO1 A;  2QMW A;  1JLG A;  4LF4 J;  1HL6 A;  3MAA B;  4GVL A;  5L8R C;  1ZA1 B;  3D3C J;  1JLF B;  4PR6 A;  3IWL A;  3H8Y A;  3ISZ A;  3W65 A;  5ETM A;  2OKQ A;  2LYV A;  4DJB A;  1J5O A;  3MOJ B;  3UFC X;  2CZ9 A;  1VOM A;  1WC3 A;  2DR6 A;  3LPY A;  3MM6 B;  4ECS A;  1NSK L;  2P9G A;  1QSS A;  1TK0 A;  1YI2 S;  1ZOT A;  2E1R A;  2DBB A;  4NLQ A;  2W2Q P;  3MCN A;  3M9M B;  2D3Z A;  2QTW A;  2DIT A;  4ICL B;  1VIS A;  4JI7 J;  4LF6 J;  1M5S A;  1DJ0 A;  3HZG A;  1R8P A;  3RBZ A;  3W60 A;  2Y3Y A;  3ADA C;  1DUR A;  3W62 A;  2YPZ A;  2G1D A;  3CUL A;  1R8B A;  4RLE A;  2VOD A;  2DGU A;  3DMJ A;  2VF3 A;  4WK1 A;  2V4R A;  3JAM U;  2G2Y A;  2R7U A;  1U8W A;  2AJ0 A;  4F2S A;  2GQ2 A;  4LRC A;  3DLJ A;  2HNZ A;  1AFJ A;  1RT2 B;  2QMX A;  3VAF A;  5KFP A;  1IJE B;  3R8Y A;  3S7R A;  2BKN A;  1PJ6 A;  2DNQ A;  4CLP A;  5F9L A;  3DOL B;  2XSJ B;  3NGD A;  5HRO A;  2IVY A;  1Q1K A;  3T1Y J;  2BJD A;  1UCN A;  3D6H B;  1RTH B;  4DV2 F;  1S1W B;  1UZH A;  2NXU A;  1KHV A;  1SV5 A;  4TQR A;  1N36 J;  4FZV A;  3VVU A;  1UVK A;  2BEF A;  3QGH A;  4H4K C;  1OY6 A;  1G7C B;  2D3U A;  4Y34 A;  4UF4 A;  1XC9 A;  2GVD A;  2RKI A;  1MMN A;  4OYA A;  2OUG A;  3G82 B;  2UUC F;  5J2M B;  4LVO P;  2UUB F;  3HVW A;  1VRQ C;  5C24 A;  2F5G A;  4RW7 A;  2PSZ A;  3H4D A;  1TL7 B;  4DPU A;  2CNK B;  2C42 A;  4J91 A;  3G6X A;  1D0E A;  1LW2 A;  3MMJ A;  4I7F B;  4KFB A;  2XO7 A;  3M32 B;  4MH8 A;  5CAA A;  4DV7 J;  1M1K T;  1IM6 A;  1SC4 B;  3CJQ A;  1L3K A;  3IM8 A;  4IG0 A;  3B4M A;  1FEH A;  2DGS A;  5F3Z A;  3SI8 A;  4ZN3 A;  1VHI A;  3S8S A;  3PG9 A;  2JEI A;  4USJ C;  3LQV A;  2ZBP A;  3C16 B;  5HJY A;  1APS A;  3NNH A;  4FF3 A;  1F60 B;  3THV A;  3NAI A;  4FYV B;  4JI3 F;  3LAM A;  4UZB A;  1FWP A;  3KLE A;  2VG6 A;  1RGV A;  3NAH A;  2ZD1 B;  1DAX A;  3OJS A;  2PA3 A;  2Y8Y A;  1U2R A;  4Z37 A;  2VC0 A;  4NLX A;  4I1T A;  2VIC A;  1YJU A;  2NXC A;  3GFY A;  4LSN B;  5GME A;  4M5M A;  5B08 A;  3CD5 A;  1EHW A;  3OW2 R;  5ETL A;  3CDA A;  1AXQ A;  4NLU A;  4NZ0 A;  3ITH A;  3R5D A;  3CC4 S;  2X1F A;  2VBY A;  1VS3 A;  2BVZ A;  2AMC B;  1TL4 A;  3HM9 A;  2DNZ A;  2HFN A;  1SH3 A;  3LAN A;  2HWT A;  2FLN A;  4KE5 A;  4NWB A;  1NB7 A;  5C25 A;  4O0N A;  3PHT A;  1BUX A;  1VYA A;  5IM0 B;  4YHH F;  3CPW R;  2CAJ A;  2V63 A;  4ECU A;  4K4Z A;  1YBT A;  4K2J A;  3FGV A;  5G0R B;  4FS1 A;  1JJC B;  1JLQ A;  1F2G A;  4DR2 F;  1IBM F;  1UVJ A;  2IJR A;  2WOM A;  5HMZ A;  3T1H F;  3HT3 A;  1YHQ S;  3K59 A;  2Y8W A;  3M6V A;  1FTR A;  2H3E B;  4KGM A;  2YWG A;  1WF0 A;  4CLZ A;  3M6W A;  2JVO A;  1VQS A;  4DL7 A;  5AXK A;  2CG8 A;  2DCL A;  3X3U A;  2CWX A;  1S1V B;  3CF5 Q;  4IQM A;  2H1Y A;  2XLJ A;  2RQC A;  3M2U B;  2E5H A;  4C7Q A;  3N9U C;  2F8M A;  3CJT A;  3VVT A;  1ZPV A;  4URQ U;  3VTI A;  1HI0 P;  2JX2 A;  2QGF B;  5IOL A;  4JI1 J;  3GG0 A;  2D41 A;  4BHQ A;  4OX9 J;  5DDQ C;  4NLT A;  1IBL J;  2HND A;  3M8Q B;  1U0H A;  3DLG A;  3FNN A;  3KTQ A;  4F7V A;  3G2X A;  4USM A;  1KLN A;  1UEV A;  3UD3 P;  2XMK A;  4QYZ K;  1TP7 A;  4ATN A;  2UXB F;  5D8H B;  3D28 A;  2PGC A;  1PG5 B;  4QIV A;  3WDO A;  2IA6 A;  4KTQ A;  1Q8K A;  3EZ5 A;  2BJ7 A;  4KRW A;  3QIP A;  1UWB A;  3MMC A;  5IQQ A;  2HHW A;  4NA2 A;  2IYG A;  1HWI A;  2XMM A;  4ZVT B;  1SKW A;  3GV7 B;  3BSA A;  4ED4 A;  2V34 A;  1D8Y A;  4NZ6 A;  1MRO B;  3KDO A;  3ZZZ A;  1AB8 A;  5ETO A;  3C66 A;  1CBK A;  3LP0 B;  4YB7 A;  4DFK A;  5HQL A;  3W9I A;  1S7I A;  3ZZ0 A;  4DX6 A;  2V9K A;  1FJC A;  2WRM A;  2R3V A;  4HI2 A;  1NHV A;  3OTD A;  3RW6 A;  1FI4 A;  2BE2 B;  3TAP A;  2GO9 A;  1UPP A;  1ZZF A;  2DCU B;  2HVI A;  2MY7 A;  4IFV B;  1Y00 A;  1FXD A;  3OTB A;  4KHP F;  4RNH A;  1QUV A;  1WOO A;  3TVY A;  1SUQ B;  1H72 C;  3NCR A;  1JMT A;  4QYR A;  4J9S A;  3D6F B;  3KK1 A;  3KNG A;  4OZJ A;  1KTV A;  5J2Q A;  2O3D A;  4F25 A;  2NZ4 A;  2OEM A;  1I6J A;  1RWX B;  4MKA A;  3M05 A;  3RZA A;  4JBC A;  1M5O C;  2L9W A;  4TXS A;  3X1L B;  1PAE X;  2X7I A;  3AJD A;  2HZV A;  1T05 B;  5L1J A;  4WTY A;  3UCG A;  1P8G A;  5D4L A;  2JZ5 A;  3BH6 B;  1GX6 A;  2CZV C;  3BKT A;  2Y9H A;  2HFV A;  4OZ1 A;  3D4J A;  4QIW D;  2UVR A;  5ADZ A;  2C3U A;  4KGX B;  2WHO A;  2LQ9 A;  4QIE A;  2IJF A;  1VQ7 S;  2VKR A;  1FKO A;  5CXT A;  4CDI A;  4RW4 B;  3LGN A;  4LMZ A;  1Y7P A;  4WP3 A;  1U1M A;  3RRK A;  3KNA A;  2P8I A;  3C6T B;  1TKX A;  3ETM A;  2M0G B;  1SPB P;  5FJ4 A;  1JLB A;  4X64 J;  3P45 B;  2FJW A;  4MKB A;  2XS5 A;  3SZ2 A;  3TAM A;  4DZ6 A;  3VZH A;  4DR5 F;  5DLF A;  4EEY A;  4JYA F;  3MFI A;  2CWK A;  1RHJ B;  1R0B G;  1SI9 A;  2ATL A;  4ZJL A;  2IM2 A;  2R2S A;  2OI2 A;  4WFA Q;  2EG2 A;  1T9W A;  1HYS B;  5E3R A;  3V2U C;  5HVG A;  1D8Z A;  4J9P A;  1RTJ B;  2V8V A;  2XNQ A;  2EK6 A;  3BDE A;  1ZS6 A;  4F0H A;  1N33 F;  4WE1 A;  3M8Y A;  3DRP A;  3NP5 A;  3A8J A;  4XO0 A;  3PX6 A;  2MST A;  2UXD J;  2FZK B;  4QWD A;  5MLC V;  4DV3 F;  2DHH A;  4KSE B;  5K14 B;  3MWB A;  3ZZY A;  4F8R A;  1VI7 A;  3KJV A;  4K4T A;  2YKN B;  1BQN A;  4BWJ A;  2V4J A;  4P2X A;  4IRK A;  2UV8 A;  2PO4 A;  2CVE A;  2W9B A;  3MEK A;  2HFO A;  4P75 A;  1VQN S;  4ZVH A;  1HR0 F;  4UY8 5;  3CJ8 A;  3EVM A;  1RT6 B;  1ZM4 A;  1UKU A;  3MMA B;  3QFH A;  1QDU B;  4WKY A;  3GII A;  2F8E X;  4NEY A;  2CFX A;  2DRD A;  2W8K A;  3PW7 A;  5B0C A;  4FYX B;  2YH0 A;  3H7H B;  1ZAW A;  2WSF C;  4L3K A;  3N6N A;  4EO6 A;  4ZVS B;  1FCA A;  2BJ3 A;  3AD8 C;  2ZDP A;  1GQE A;  2I6W A;  1FDD A;  1X0P A;  4TYB A;  1TVR B;  3DCA A;  2MPU A;  3RRH A;  3K5P A;  4PWD B;  1VQP S;  2DO4 A;  4KT0 C;  1HW9 A;  4QWB A;  2FZC B;  5L1I A;  1WF2 A;  4C0H A;  3M6X A;  3R7B B;  3EZO A;  2KKH A;  2QZ8 A;  4MT1 A;  2F63 A;  2DNO A;  1YJN S;  4PYA A;  2XQC A;  4X4T A;  1WSR A;  1H2V Z;  2FGC A;  4TY8 A;  2F9J A;  4WU2 A;  2BOA A;  2IFX A;  4Y65 A;  4CLS A;  3MR5 A;  1SL2 A;  4WP9 A;  2GJI A;  4ZVR B;  3DLE B;  3QSI A;  3IG1 B;  4EBC A;  1PYS B;  3DYA B;  4K4V A;  5HMY A;  4NYO A;  2J9D A;  3V6D A;  2FHO B;  5H9F K;  4AXJ A;  2EFG A;  1HBM B;  4DCO B;  3BGO P;  1X4F A;  4JP8 A;  5L1L A;  1S6O A;  2EFQ A;  3DLL Q;  2ROP A;  3QWP A;  1XMQ J;  3THP A;  1RSC A;  1RA6 A;  1YJT A;  3OL7 A;  2UVW A;  2CJB A;  2VG7 B;  3R9L A;  4QW9 A;  1KFS A;  2A2C A;  2LDI A;  1KON A;  5B0E A;  1FKP B;  2B7C B;  5DRK A;  2OPS B;  2BUN A;  2CQ1 A;  4ERD A;  1U8S A;  1BGX T;  1SC3 B;  4W98 A;  4DX5 A;  3NOG A;  2I8E A;  1UTA A;  3MUT P;  1VRU A;  3BKU A;  1C1B A;  4RU9 A;  2ZC3 A;  5CYQ A;  4X65 F;  1MU2 B;  1YVF A;  1WKJ A;  3FRY A;  4WXW A;  3JQJ A;  1D09 B;  2W8L A;  2J7K A;  4X4P A;  1TUG B;  5EWG A;  2DNL A;  2GA7 A;  5D15 A;  3HHD A;  2QT7 A;  1D9D A;  1KC8 T;  3AAW B;  3T41 A;  4GKJ F;  4KKO A;  4WPA A;  1JXV A;  3IBF B;  1ZM2 A;  4JV0 A;  1WG5 A;  5KG0 A;  1SQF A;  1D1U A;  2IJN A;  3PZP A;  1T11 A;  2ZJR Q;  3CUN A;  2MQO A;  4P7T A;  4KPY A;  4HH0 A;  2GML A;  2MGZ B;  1ROF A;  3C15 A;  4ZVO B;  2AEJ A;  5EUH A;  4AL5 A;  4G1I A;  4IG3 B;  5IC6 B;  4DS4 A;  4PYD A;  4OFZ A;  4OZL A;  1H7W A;  2YNF B;  2KVI A;  3IAM 9;  3CCS S;  1IKX B;  3MAH A;  1ZTT A;  3H5U A;  3Q89 A;  1EKS A;  3IC1 A;  1ARO P;  1CJK A;  2V50 A;  3UDV A;  2ABY A;  2NSB A;  1P6T A;  5F8M A;  2C2Z B;  4ECQ A;  4LFC F;  5BR8 J;  4RW9 A;  5K8M A;  4RNO A;  4BC7 A;  5HQM A;  4H4K A;  1A7G E;  4NXM F;  1JQG A;  1OSD A;  2GO8 A;  3H5S A;  2XSF A;  1HPZ B;  5HVF A;  4AQY J;  2MLY A;  3JSM B;  3PJW A;  1IBK J;  3SQG A;  2AEM A;  1LFP A;  3UN3 A;  1UEK A;  4QW8 A;  3LP1 B;  1Y3J A;  2MHN A;  2MQ8 A;  4NYZ A;  3QJL A;  1QAI A;  2NQP A;  3ET6 A;  2ZNZ A;  3CJR A;  2J9D E;  4CM2 A;  1X5T A;  2XYH B;  5A8W A;  2MZ1 A;  4DF4 A;  1GK8 A;  3H2U B;  3LP2 A;  4WFN Q;  2KHC A;  1SL0 A;  3R5A A;  1LK5 A;  1IKV A;  1EP4 B;  3R7S B;  1A0O B;  3NNA A;  1A9N B;  2YXL A;  4TVA B;  2IC3 B;  3MPD A;  5CYM A;  4ZCM A;  4I6W A;  5KT5 A;  2GCF A;  2VH7 A;  4WYL A;  1HD0 A;  5E3A A;  2XLI A;  2XYG B;  1IR1 A;  1KHW A;  2XO6 A;  3E51 A;  1C4C A;  2VON A;  2DGW A;  1R27 B;  3PKY A;  1GEH A;  4X4S A;  2MB0 B;  2EFP A;  3JYT A;  5KFT A;  4ZPW R;  1RAD B;  1FJG J;  3G8S A;  1S6U A;  2VKZ G;  4L3N A;  3DM2 B;  1KSP A;  4LFA J;  1X8D A;  3AD9 C;  1U02 A;  4NLW A;  3D9B A;  4UOC A;  2ZKU A;  1UZD A;  1ZTW A;  1IQZ A;  4NXN F;  3Q22 A;  3PR5 B;  3GE9 A;  2CKW A;  3QT5 A;  2HHQ A;  2RUG A;  4DR3 J;  1KP6 A;  2OLW A;  3TR5 A;  2KJW A;  1OPI A;  3DN9 A;  3PYF A;  1P27 B;  2VG5 B;  4ZIT A;  1HHQ A;  1K0V A;  4LR7 A;  1GXU A;  4KHR A;  4UQG A;  2EWH A;  2YKM A;  2B8P A;  1VBK A;  4F04 B;  3FEY B;  2F4V J;  2QL9 B;  2O67 A;  3IMQ J;  1H7X A;  2DTJ A;  4ED7 A;  3GIR A;  4DSJ A;  2R7W A;  2BR0 A;  3GQC A;  1PSD A;  4PG7 A;  1XER A;  1JK9 B;  4J9L A;  4KAI A;  2XCA A;  5HJX A;  5F8G A;  2UXC F;  3FFI B;  2QA1 A;  4NCG A;  1CJV B;  1TV6 B;  5L9N A;  4WJB A;  3VHQ A;  1NSQ A;  4QOT A;  1S1X A;  2GMJ A;  2H9Z A;  3K58 A;  2RQ4 A;  4JUZ A;  5HN0 A;  1EQM A;  4F0K A;  2I38 A;  1NJY A;  4DWI A;  4IR9 A;  1HWL A;  2HIY A;  3W64 A;  5BYS A;  1AUD A;  5KFH A;  2BKO A;  3MM8 B;  3FEZ A;  2HHX A;  4LQ3 A;  4JI4 J;  1V9O A;  2EBG A;  3OJU A;  1J5O B;  4ZIW A;  1WC0 A;  1R7I A;  3TO8 A;  1FFS B;  1RT1 B;  2BBE A;  2KT3 A;  3RAX A;  4HAC B;  2MKJ A;  2ZM6 F;  3AB2 B;  4N77 A;  2X1G A;  5KFO A;  3V81 A;  1FFW B;  3LAL A;  5CH7 B;  2RB7 A;  2L48 A;  1X5S A;  2DGQ A;  1PIE A;  2NLW A;  1DY3 A;  5JVG Q;  3PIO Q;  4LRF A;  3AOC A;  1U48 A;  4B9L A;  4IH5 A;  2HMI B;  4Q0B A;  3NBP A;  4DV4 J;  3Q86 A;  2J9C A;  4MMO A;  4Y2K A;  2MY8 A;  2R8J A;  1NPK A;  2ZH9 A;  4O4R A;  4ECT A;  4LJM A;  1RTD A;  3KK3 A;  1RB0 A;  3D7S B;  3A8E A;  2V4Q A;  4PPZ A;  2R7S A;  1LQ9 A;  2M52 A;  2I2Y A;  1WI6 A;  1SJ1 A;  2UUA F;  3DRS B;  2DNR A;  2XBP A;  4YB1 P;  1JWW A;  2WSE C;  3H20 A;  1Z1Z A;  3T5L A;  1QSY A;  1UVM A;  1ZET A;  4WII A;  2ZZT A;  5C2C A;  1X9M A;  5D4P A;  3OXL A;  3H2L A;  2FDN A;  4PPD A;  2WAQ D;  4U95 A;  4QBU A;  2W2M P;  3HHE A;  4U7U K;  1N5Y B;  2GVZ B;  1PAU B;  3PRV A;  1NJX A;  2K06 A;  3NWG A;  3Q8S B;  2PN6 A;  2BM0 A;  3T1A A;  5F8N A;  5LMU F;  2E5G A;  1LWX A;  3WX8 A;  1TAQ A;  4MIB A;  1RYS A;  4OMF G;  2CQI A;  1QE1 A;  2GVD B;  2RKI B;  4B3T F;  5LT5 A;  1CG2 A;  3IM9 A;  3PXG a;  3DGP B;  5ETR A;  1CEZ A;  1K8A T;  4EMD A;  3P5B P;  1HWJ A;  4K5R A;  3W9J A;  5C24 B;  1J5E J;  4UOF A;  3DDK A;  3I87 A;  3NGU A;  4CYU B;  2LQ5 A;  2HQG A;  4EK2 A;  1W2I A;  2YWK A;  2AJ4 A;  1KTQ A;  1D3W A;  4KFB B;  4MTP A;  2XMU A;  5KFW A;  2NPI A;  1PBU A;  1NJI T;  1EET A;  2Z30 B;  1JLE A;  1RBL A;  4KB7 A;  4C3M A;  5KFN A;  4IG0 B;  1VLY A;  2FHM A;  4ZVQ B;  2V8D A;  2LEB A;  3EDQ B;  1X4A A;  2EEY A;  2UZA A;  1RT4 B;  1P9Q C;  2OPQ B;  1HBU B;  1YIJ S;  4YQW A;  4F02 A;  4J9N A;  2VPX B;  2FJX A;  4DR1 F;  1TR0 A;  4ZVG A;  2YKO A;  3TUP A;  2VG6 B;  4K4U A;  3KUE A;  4HT5 A;  4ECX A;  3MM7 A;  2NPF A;  4DBQ A;  1RYR A;  1U0S A;  4B08 A;  4RWW A;  3Q8U A;  1WSV A;  3NCP A;  1Q53 A;  5J1N A;  4X2B A;  3W8G A;  3VAL A;  1JKH A;  3MPW A;  4M5G A;  2W4D A;  3L3C A;  1Q78 A;  3WZ0 A;  1NK7 A;  3M30 A;  3RTV A;  3MR2 A;  4ANE A;  3ITH B;  3KK2 A;  3KWM A;  2ZDO A;  4WK3 A;  3CJS A;  4BDP A;  3P8B B;  2A6O A;  4NI2 A;  1WG4 A;  1Y11 A;  2RT3 A;  1HHT P;  1FEE A;  3CDE A;  3VQT A;  1XMO F;  2OPP A;  1JLC A;  1DTT A;  1F9F A;  1SH0 A;  1WDT A;  4PG6 A;  5KG7 A;  2J8S A;  1QUP A;  1G6B A;  4DQR A;  2POK A;  3T6J A;  1RWO B;  1LWE A;  4Q45 A;  5D77 A;  5CAB A;  4P9S A;  1FRX A;  2DHA A;  4Y6I A;  1K44 A;  4QQB A;  1FA0 A;  4JI2 F;  3AXK A;  2XZT B;  2MKS A;  5HP1 B;  1IBC B;  4WWS A;  4B3S F;  2MQM A;  2GNK A;  1RAO A;  1KQF B;  2J0X A;  1NKE A;  4DPO A;  2IY5 B;  4ZP7 A;  3PW0 A;  2ZH1 A;  3QZ7 A;  1NB2 A;  2YKP A;  3PO4 A;  4QWA A;  2FLO A;  4JI8 J;  1U1R A;  1OSC A;  1VJW A;  1KEK A;  3EXY A;  2HND B;  1U0H B;  3I56 S;  2W9C A;  3C46 A;  4RW8 B;  3VAM A;  3TZW A;  2LMI A;  3BN4 A;  3RAQ A;  5KFK A;  3A3P B;  2HQI A;  4J9Q A;  2IIH A;  3ZZT A;  4XAK A;  4FXW A;  1RWM B;  3CJ5 A;  3DRR A;  1NSA A;  1CQM A;  3QIP B;  1UWB B;  3MMC B;  1HKA A;  1I3O B;  3EVW A;  4ZPB A;  1RDR A;  4NRU A;  4G6V B;  4ZLL A;  1Q5Y A;  3OV7 A;  4M5N A;  2KT5 A;  3H42 A;  5B0B A;  4B9S A;  1C0U B;  3RAM A;  3MCM A;  2W2O P;  4ZJQ A;  1VC5 A;  1VQL S;  4XDD A;  4EUV A;  2M5Y A;  3R1H A;  1MWQ A;  2E1A A;  2Z2Z A;  1NME B;  2AX0 A;  3QWU A;  2IAJ B;  2QA4 G;  4OZN A;  1RT3 B;  2BX6 A;  2Z2L A;  1LNQ A;  1XNQ J;  2RRA A;  3UN5 A;  4ED3 A;  3UVJ B;  1L3V A;  3MUV P;  4GC7 A;  1L3U A;  3JXO A;  4K4S A;  3I0R A;  2AP6 A;  1HNW F;  3KK1 B;  1K9M T;  3Q2T C;  4B9U A;  2LDY A;  3OFF A;  4ZP6 A;  1E6Y A;  1S9E B;  1NND A;  5M2P A;  3AHP A;  1TKZ A;  4LF9 J;  3I32 A;  4JV1 A;  2JLF A;  1G2E A;  1REV B;  3FKB A;  4M63 A;  1XEZ A;  3A3N B;  5DG9 A;  2Y0B B;  3FBC A;  1DZ5 A;  4PG8 A;  2GHP A;  9RUB A;  4W92 B;  3O5T B;  1WOR A;  4K2X A;  2B43 A;  5ETK A;  3RJM B;  2RF2 A;  2AJQ A;  4WCE Q;  4I56 A;  3CD0 A;  1Y0H A;  1YZ6 A;  3GIJ A;  5H9E J;  2XY7 A;  5F0U A;  3TA1 A;  1WEX A;  3VR1 A;  3TAM B;  2DIS A;  2WSC C;  3IN5 A;  1EX8 A;  2BAN A;  3UR0 A;  1S72 S;  5HAT A;  3BBC A;  3K7R A;  2OD6 A;  4OYW A;  2V69 A;  4M5D A;  3HI9 A;  4MIW A;  1I94 F;  4LIW A;  1PBA A;  3EGN A;  3M1V A;  3GIM A;  3BR9 A;  1RBO B;  1WDD A;  2FVS A;  4WE1 B;  2WTF A;  3RW7 A;  4CO4 A;  4LR9 A;  1KD1 T;  3QO9 B;  2HHS A;  3QT7 A;  2QFJ A;  1T03 B;  5HAO A;  4R0J A;  1IKY A;  3SIP B;  3KJV B;  2CJY B;  3IAS 9;  1RKI A;  3UO0 A;  3QGP A;  2VQF F;  4A46 A;  1BY9 A;  4G1Q B;  3AXM A;  5EHH A;  5U47 A;  2HKE A;  4FDF A;  2J0Q D;  4LF4 F;  2FJD B;  5LOQ A;  2F3J A;  2B56 A;  4OLP A;  3KLF B;  1X4G A;  3MED B;  1U7L A;  3SEO A;  4DSI A;  4URS A;  1U1P A;  1FXL A;  5A6W A;  1HBO B;  4S0M A;  4F3O A;  3UE2 A;  2D3O 1;  6FDR A;  2VQE J;  3IRX A;  3DDN A;  5GAE U;  2RQK A;  4AND A;  1CQN A;  3NEK A;  4ZVE A;  1CC7 A;  2GAG C;  5LSL A;  3PEJ A;  2A18 A;  1VRT A;  1O51 A;  2IPO B;  4ZPV R;  5IS2 A;  3VWS A;  1UET A;  5T14 A;  3A8K A;  2YX7 A;  2Q3P A;  4ER8 A;  3MEG A;  3VGV A;  2H4W B;  4X4O A;  2B4O A;  1O8B A;  2BJ9 A;  4FPI A;  3BS9 A;  2J6U A;  2MZR A;  3IBC B;  4PAA A;  4JI7 F;  4LF6 F;  4KIA A;  5L38 A;  4ZPA A;  4ID5 B;  4N56 A;  2Z4P A;  1TTH B;  2G4B A;  3KJQ B;  5IT0 A;  3VF0 B;  4K8R A;  3LGM A;  4KO0 A;  3EGV A;  3QAE A;  1XTZ A;  2ZHB A;  5GAH I;  2RIL A;  3HKW A;  3CJ3 A;  3C6U A;  5DM7 Q;  4DEZ A;  1N32 J;  2ZOM A;  4EYH B;  2FIU A;  3U27 A;  1U1L A;  2YPY A;  3CMQ A;  3V6D B;  2F9D A;  3DXS X;  2VC1 A;  3FBB A;  1N5V A;  2M7S A;  3ONQ A;  2QLW A;  4DLG A;  1OQ6 A;  3AQP A;  2V8H A;  2NYH A;  3T1Y F;  3RBD A;  4P2S A;  1JLA A;  3JAM Y;  1DHM A;  4JV5 J;  4DR6 J;  3DXB A;  2ZH3 A;  1N36 F;  1NUE A;  3K5O A;  1WI8 A;  4DMZ A;  3KHL A;  3GFZ A;  4DG1 A;  1IQT A;  2BJ1 A;  1A6L A;  2XMT A;  3ZTR A;  4IOB A;  2CPZ A;  1VRU B;  5KFF A;  1C1B B;  3MF5 A;  5CYQ B;  1KS2 A;  2XWX A;  4P7V A;  4V1A k;  4EGL A;  2FVP A;  1B7Y B;  1LWF A;  1KOO A;  4U67 Q;  2HFS A;  1SKS A;  1OO0 B;  2WVC A;  3UD4 P;  4DV7 F;  4RU2 A;  1RWP B;  3ELH A;  4YS2 A;  1NLK L;  4KKO B;  2MLX A;  4LBI A;  4PXC A;  3IWN C;  4MFB A;  2DK2 A;  1VBZ A;  4CTA A;  5HO4 A;  4USW A;  3BV8 A;  1X4D A;  4ZN1 A;  1J2V A;  1IWG A;  4R0E A;  1RP5 A;  1VBY A;  1Q7L B;  2PE8 A;  2ZH8 A;  3TZX A;  4QZV B;  1AW0 A;  1SVD A;  5A76 A;  1JNZ B;  3HD1 A;  2IYI A;  4NLO A;  2E5L J;  4ED0 A;  1RHQ B;  1VK3 A;  1CJK B;  2W24 A;  4FKY A;  1CUL B;  1G3O A;  2DH8 A;  3OTO J;  3MR7 A;  3ZTS A;  1MML A;  1FNX H;  1T02 A;  1WKL A;  1LWC A;  1HI1 A;  2X3D A;  4KH0 B;  1HWK A;  3PJ9 A;  1RKJ A;  2R9L A;  3E01 A;  3TA2 A;  2KH9 A;  1N5S A;  1WC6 A;  4FF2 A;  3KJN B;  3QJP A;  3EYZ A;  5LXY A;  2E1C A;  1P1T A;  5IV3 A;  3J81 j;  4MIA A;  5I4M A;  4P71 A;  3TEH B;  3CCQ S;  4RX6 A;  2OAU A;  3PW2 A;  2J5A A;  1DQ8 A;  3AD7 C;  1QAX A;  2XGQ A;  2Z2M A;  1KVJ A;  1VK8 A;  3GV8 B;  5A8W B;  2W7A A;  1HQU B;  1WJ9 A;  4QR2 A;  3LP2 B;  2FY8 A;  3C19 A;  2ZFH A;  2VA3 A;  2JOQ A;  2ERR A;  2CA9 A;  2CQD A;  2VFU A;  2XI2 A;  4J9K A;  3WC2 A;  3WX4 A;  2KZZ A;  4ZKA A;  4B3R J;  1IKV B;  4B3O B;  8ATC B;  3U1L A;  3GYN A;  1JX4 A;  4HKQ A;  4OIX A;  1IKW A;  3DOK A;  3FC9 A;  2A0F B;  2QLJ B;  5EN1 A;  5CYM B;  2J7W A;  4NMX A;  1ELO A;  4N5S A;  2AX1 A;  2HBR B;  4H4O A;  4PWU A;  4ED6 A;  2RU3 A;  2PI4 A;  4ZMM A;  1TK5 A;  2YKA A;  4JI1 F;  2VIH A;  5E0O A;  3D1Q A;  4ECY A;  3FQK A;  4ZHR A;  1MNE A;  4IH6 A;  4OX9 F;  1BE4 A;  1NKC A;  1IBL F;  3K8V A;  2Q6B A;  1ZAV A;  3LWL A;  1QSL A;  2P9C A;  1N48 A;  1GAO A;  4IUF A;  2DYA A;  2YVS A;  2N7C A;  4OHY A;  1SIW B;  3E8O A;  2FVQ A;  1AZS A;  3QRR A;  4Y28 C;  1HMV A;  4EYI B;  4CIO A;  3HSZ A;  2GZO A;  3BM7 A;  2I0X A;  1ZA2 B;  2RVJ A;  4RWX A;  2HVH A;  2OFG X;  2NXN A;  2G0I A;  2ZNY A;  2XMA A;  2V2V A;  2J76 E;  4NEZ A;  2LQB A;  3HVT B;  4RNM A;  5HQ8 A;  1B70 B;  3UN2 A;  4LRB A;  2DGT A;  2QJ3 A;  2YNH B;  2LFV A;  1BXN A;  4JI6 F;  2OSQ A;  2ZEJ A;  2GX8 A;  2G13 A;  4QIG A;  8RUC A;  1S6Q A;  4JI0 J;  1GMU A;  2JL9 A;  4J5O A;  1RAI B;  4P72 A;  4KGZ B;  2B9W A;  2AZ3 A;  2QV6 A;  1EB0 A;  3BQ2 A;  5A6P A;  5K9F A;  2F8H A;  1SJF A;  2EPI A;  2QSW A;  4NLY A;  2CJQ A;  4U7U D;  1RJJ A;  4FXV A;  4LF7 J;  2HBQ B;  1U1N A;  4DI6 A;  1OYE A;  2RHS B;  3QRP A;  2ZZM A;  3QSY B;  4D3H A;  5DM6 Q;  2HS3 A;  2PDA A;  5J1E A;  2EK1 A;  3UDE A;  4OYX A;  3OD2 A;  4LRE A;  3DI6 A;  1Q5V A;  3C14 B;  3EMT A;  1OY9 A;  4P73 A;  3UNG C;  5J2N A;  4N7T A;  1B7F A;  1TL1 B;  5DET A;  1BQM A;  1S1X B;  2HRY A;  3FVY A;  4FVM A;  2X51 A;  2R4F A;  2AF6 A;  3BO4 A;  3KLG A;  5GMK a;  3EGW B;  4X66 J;  2GQQ A;  4HVZ A;  3B6B A;  1NJW A;  2Q43 A;  4FYW B;  3MAQ A;  3QGI A;  2CQP A;  4LF5 J;  1MN9 A;  4ES2 A;  2EKY A;  5HLF A;  2H5E A;  1B4S A;  4X64 F;  1VCT A;  2HZC A;  3D0G E;  3D3B J;  2V5H G;  3MAA A;  4UST A;  2C28 A;  3LW5 C;  4ITS A;  4NAS A;  4GO7 X;  1H38 A;  4O23 A;  3HFV A;  4YN3 B;  1Q82 T;  1LOU A;  4A8M P;  3ZNJ 1;  4EBE A;  2CG4 A;  1NK8 A;  2L9D A;  1KQG B;  2RML A;  1HNI A;  3H5Y A;  2LEP A;  3M2V B;  3MM6 A;  2XM3 A;  4CLL A;  3DOM A;  3G9C A;  2DJW A;  2UXD F;  2RQM A;  2HG4 A;  3WC0 A;  2GFF A;  1N0V C;  2G9O A;  5F41 A;  2KU7 A;  1I51 B;  4ICL A;  5CQG A;  2LKZ A;  3QT6 A;  4KR0 B;  1NK0 A;  2HVD A;  4M95 A;  4FVC A;  3D2W A;  4PRF A;  4CH1 A;  1WAC A;  1S1U B;  4IR1 A;  1AUS L;  2CJX B;  2CPJ A;  1ZH5 A;  1Z2L A;  5HK4 A;  5RUB A;  4GVB A;  3G4S S;  3OFE A;  2V2K A;  5GAE I;  3RG6 A;  1YJ7 A;  1NZ8 A;  3LH2 S;  4CRJ A;  2BE7 D;  1R31 A;  1RT2 A;  4OZ5 A;  2K1R B;  3U7J A;  1Q81 T;  2BYC A;  2VPZ B;  1F9H A;  2J8A A;  1EJ7 L;  3G8T A;  1UFW A;  2RJZ A;  7FDR A;  3FSY A;  3GWC A;  3LA0 A;  1TEL A;  5LSR A;  3MD3 A;  5KFC A;  1U25 A;  2ILY A;  5F8L A;  1SIZ A;  1CS4 B;  2DB1 A;  4ZPC A;  1VQ8 S;  1SBR A;  3H0P A;  4ELV A;  1Q8L A;  3SCL E;  3KOA A;  1C0T B;  2JSX A;  2FYX A;  2MLZ A;  2JEG A;  2JRS A;  2BW2 A;  4CLU A;  2HW3 A;  2UUW A;  1S7H A;  2FJB B;  3RBE A;  1RT7 A;  3G82 A;  5CZX A;  1EET B;  2VDI A;  4OZ0 A;  3GV5 B;  5J2M A;  2HNY B;  3OVA A;  3UW1 A;  1VQ5 S;  4N8N A;  4RL1 A;  2X1A A;  5KFX A;  2B5J B;  3J81 U;  5LMN J;  4LT6 A;  2BJE A;  4QWC A;  4I7F A;  5LJ3 Y;  3ILJ A;  3QGG A;  1KR4 A;  4NE9 C;  3CO0 P;  2C1E B;  1XMQ F;  2DH7 A;  1H2U X;  1F3V A;  4N76 A;  2FD2 A;  2ALZ A;  2P9E A;  3THT A;  5IC4 B;  4X4N A;  2ZH5 A;  5DQH A;  3C16 A;  3HLU A;  2G2O A;  4DZD A;  2K2P A;  4WKR A;  1VQY A;  2MMY A;  2HK2 A;  3ULH A;  4WFX A;  4DQS A;  3GYG A;  2ZD1 A;  2RNE A;  5FII A;  3J7Y U;  3ENA A;  3IA0 A;  4ZLN A;  3SDE B;  2X1B A;  3M30 B;  4TU7 A;  3KK2 B;  3OHB A;  4AL7 A;  3KYL A;  4A48 A;  2DXE A;  1M5H A;  1JJH A;  2DNP A;  2VAS A;  2ASY A;  1CJU B;  4LSN A;  2XMW A;  1U1Q A;  1BMQ B;  2XEX A;  1JLC B;  3N5B A;  3G96 A;  1GNK A;  1YZ7 A;  2DGV A;  5AE3 A;  3FMB A;  3VAI A;  1BLU A;  2AGQ A;  4DL0 C;  3ZZU A;  2YWE A;  1LWE B;  3MDF A;  2AIR B;  1NH8 A;  2RIJ A;  2XY5 A;  1DBD A;  1BWV A;  3EIC A;  2XGP A;  4WBF A;  2GJF A;  3RGI A;  2BJ8 A;  2BAC A;  5IM0 A;  4YR0 A;  1TUW A;  1T9X A;  4ZK7 M;  4W90 B;  5THW A;  4ZCI A;  1UEU A;  1PO6 A;  4DR7 J;  3SFG A;  3KG0 A;  1WOS A;  3NG8 A;  1UMJ A;  1VC0 A;  3PX4 A;  1C1C A;  4KGK A;  3FUY A;  3NGT A;  3MHY A;  2Z58 B;  3D54 A;  5KAK A;  4UOG A;  2RHQ B;  4J9U E;  1PYT A;  4I69 A;  1S1V A;  4NYP A;  3HVA A;  5A8K B;  2W9C B;  5MAO A;  5BR8 F;  2WB4 A;  1KRP A;  4O3Q A;  1FT8 A;  1S1T A;  1T9V A;  4P52 A;  1RIS A;  2RS8 A;  2D1C A;  2PD1 A;  4AFF A;  2XYP B;  1C4A A;  4AQY F;  3SCJ E;  1UVI A;  1O6X A;  1IBK F;  3M8Q A;  2JEF A;  4JV2 A;  3Q8Y A;  2HVZ A;  5DG7 A;  1X9S A;  4D3G A;  4RW6 A;  3SV4 A;  2PMZ D;  1YWX A;  4G1P A;  4LSZ B;  4CH0 S;  3OSP A;  2DR7 A;  3ENW A;  3DRY A;  3CTR A;  1F5C A;  3US5 A;  1Q4R A;  4DV6 J;  3H5X A;  2VU5 A;  3HHL B;  2H5I B;  5IWA J;  4J9V A;  2ADB A;  2HVE A;  1EZZ B;  2FHJ A;  1HNX J;  5K8O A;  3PNI A;  1QVG R;  1MRO A;  1U2C A;  3GR0 A;  1Y5N B;  3LP0 A;  3F44 A;  1XNR J;  2ACM A;  1NHU A;  3R97 A;  2DEJ A;  2D3O R;  2IBO A;  3KHR A;  3I0R B;  3QFW A;  2ZIT A;  2IMW P;  3OBI A;  4LF8 J;  3DHX A;  3HDS A;  1M0S A;  4DFM A;  4A8F A;  2MEW A;  4IFV A;  2DR9 A;  5H9E K;  1HBN B;  3NMR A;  2CZ4 A;  2ZH4 A;  1FJG F;  2E7X A;  1DQ9 A;  1B0T A;  2AKW B;  2VHG A;  1SUQ A;  1TKZ B;  2M3D A;  3HCX A;  3MCS A;  3CO9 A;  4C8L A;  2QLX A;  2CQ2 A;  4OYI A;  3V4I B;  1G4C A;  5IZH A;  4LFA F;  2KFN A;  3EE3 A;  3WHI A;  2B8Q A;  1W2B R;  1YLX A;  3N6M A;  1HFE L;  3TRG A;  1UVN A;  3NS5 A;  4E2F B;  2KO1 A;  1FE0 A;  5ETV A;  3H2V E;  2E29 A;  3L7P A;  3E3X A;  1PC5 A;  4C98 A;  1V3Z A;  3BSC A;  3MUR P;  2AV5 A;  4MKY A;  3RB6 A;  2C3O A;  4I2Q B;  3AB4 B;  2BAN B;  3FZ2 A;  4DR3 F;  3TVZ A;  4RW4 A;  2R2U A;  2LQ8 A;  3PRB A;  2BZ2 A;  1XR6 A;  1N52 B;  1TMM A;  1NRK A;  4NLG A;  4ZDN A;  2NS1 B;  2F4V F;  2BDP A;  3SBM A;  3P96 A;  1U24 A;  4L73 A;  5I42 B;  5DGA A;  4AUK A;  2HHU A;  2W4P A;  5HBM A;  2HWH A;  2QL5 B;  2QL7 B;  3FJ2 A;  3AT1 B;  3L7O A;  5KG6 A;  1OJ4 A;  1R0A B;  4X62 J;  2DHS A;  4ZCL A;  3QMQ A;  1FK9 B;  1YJR A;  4B3M J;  3IS9 B;  1R0C B;  2R42 A;  5D4O A;  4C0B A;  2HPU A;  4CNY A;  1UA0 A;  2VPY B;  3EXC X;  1M90 T;  2CQH A;  4A8W A;  5K8N A;  2V9W A;  1KDN A;  3SQO P;  1QAJ A;  2R7V A;  4B02 A;  2YKN A;  1HD1 A;  3BJY A;  3PO5 A;  3HKZ D;  3T6B A;  4ED2 A;  4NA3 A;  4JI4 F;  4JI6 J;  4DXL A;  1L3T A;  5ETT A;  2BXJ A;  4F3M A;  4R8U B;  1K1Q A;  1H0H B;  3BSO A;  3N4W A;  1U09 A;  4NML A;  3CIZ A;  3HD2 A;  4LF1 A;  5T7L B;  4FKX A;  1B3T A;  3GB0 A;  3MMA A;  1JB0 C;  3MXH P;  2GGP B;  4ZP9 A;  3HX9 A;  1KFD A;  3MR6 A;  3KLH A;  5LXR A;  1VRT B;  3ILL A;  9ATC B;  2W25 A;  1XJW B;  3CJ0 A;  3R2D J;  4Y2C A;  4I4B A;  3MEG B;  4G3I A;  2EXU A;  5KG5 A;  1VQ4 S;  3T9N A;  3OFG A;  2ZBC A;  5IV4 A;  4DV4 F;  1RAJ A;  2KG0 A;  4IH7 A;  3CCE S;  3M6U A;  5D0G A;  1T9Y A;  2MZT A;  2E1M C;  1X4B A;  4PWD A;  4KO0 B;  2A6M A;  3OLB A;  3POT A;  1PIL A;  1YK9 A;  7AT1 B;  3VGS A;  4DR4 J;  2ZBQ A;  4DV1 J;  5DZ6 A;  1VHF A;  2PMH A;  2ZBR A;  3W3S A;  3CJK B;  4DOZ A;  2DNY A;  1WF1 A;  4F2R A;  4HHJ A;  2WON B;  1Z4U A;  3TYT A;  4M94 A;  1FDN A;  4AL6 A;  3PX0 A;  1ULR A;  5GAD I;  3FK4 A;  2EI5 A;  3CCW A;  4TNO A;  3H98 A;  3BF4 A;  2C3M A;  3DLE A;  3DLH A;  2HRU A;  4GRS A;  1JLA B;  3DYA A;  1RCX B;  2BMB A;  4ILR A;  4CLW A;  2LXF A;  4DUY J;  1HBM A;  2C3P A;  2OFH X;  1F1B B;  2W2P P;  4DG1 B;  4DSK A;  3TW0 A;  3W8P A;  3K5M A;  5CCL A;  2FVR A;  2OH2 A;  3RB4 A;  4W4M A;  4PCQ A;  2VG7 A;  3MEC B;  4PXD A;  4ECW A;  3FDS A;  3CVK A;  4A4J A;  4A8X A;  1FKP A;  5E33 A;  3D1O A;  2DY9 A;  2OPS A;  1J5E F;  1NAQ A;  1LWF B;  4KQZ A;  4NRT A;  5LJ5 Y;  1NK5 A;  5HMW A;  4YY3 J;  3F73 A;  1RZM A;  4A8O A;  1S49 A;  4DV0 J;  2D74 B;  5EGY A;  5KT3 A;  4FNI A;  4ED1 A;  1OY8 A;  4P6Q A;  1MU2 A;  4J9O A;  3NRB A;  4HHH A;  1S57 A;  3AQO A;  1DLO A;  3ZTQ A;  4J9R A;  4MYU A;  3ZNU A;  1F0X A;  2MTL A;  4HDG A;  3FSI A;  4FF1 A;  2NXJ A;  4MJK A;  2JC0 A;  1YBA A;  5CHC B;  4CLK A;  1QAY A;  2G2Z A;  5EWE A;  3I6P A;  4DFJ A;  1F3F A;  3KHG A;  4EZ6 A;  3M9N B;  1CJT A;  4J7C A;  5KTQ A;  1H98 A;  1W26 A;  4CO2 A;  2DY1 A;  4NLS A;  4DQQ A;  4Q2L A;  1UP1 A;  3I5A A;  3T5J A;  2FVC A;  2MKI A;  2ALY B;  2C3Y A;  3I9V 9;  2OTL S;  2KM8 B;  3BKF A;  1TFW A;  1RAC B;  2AU0 A;  3M8W A;  3KMQ A;  3P5T L;  4A47 A;  2AEF A;  2YNF A;  4KV8 B;  3M8S A;  2JH3 A;  3KXD A;  5C2G A;  4I6Y A;  2V8P A;  4O44 B;  5KOW A;  3JQK A;  1TQL A;  4CI0 B;  3MPY A;  3UR3 C;  1OWX A;  4A8Y A;  3R7N B;  1F2H A;  3D6M B;  5DGB A;  1HQ2 A;  3H4B A;  4ZIV A;  4F26 A;  4RJV A;  4MK8 A;  4C3K A;  4GO5 X;  3IR6 B;  4DN0 A;  3HFK A;  1HPZ A;  1HNV A;  3OR1 A;  3JSM A;  4ZP8 A;  1X31 C;  3OL8 A;  1MN7 A;  2M8D B;  3NKY A;  4ILL A;  5D78 A;  3PM9 A;  2RD5 C;  2YNG A;  1RT5 B;  3I0S B;  1RWU A;  3DKD A;  2KXH A;  3KLV A;  4ETX A;  2VJU A;  4YR3 A;  2UV8 G;  1U6F A;  2CDQ A;  5L39 A;  4PKD B;  4JI8 F;  4H4O B;  2ZWO A;  5KG1 A;  5B0G A;  2XCP A;  4O3O A;  3R5J B;  4ZHR B;  4O3P A;  2BM1 A;  4YR2 A;  2YH1 A;  4KJI A;  3MGJ A;  4PWW A;  2ZE2 B;  1S10 A;  1H6K X;  4UY8 T;  3W63 A;  4EU0 A;  3TP2 A;  4DSL A;  4PUO B;  2YTC A;  4QR0 A;  2RAQ A;  5A2Q Y;  3N0V A;  2AGO A;  4ED8 A;  1IM4 A;  2QEX S;  4JI5 J;  1GX5 A;  1HMV B;  3CCM S;  3Q8Q B;  1DTQ B;  4HT7 A;  3I4P A;  2BQ3 A;  5I3P A;  2RU9 A;  1S0V A;  1GMW D;  3ZTP A;  3AJ2 A;  3QAT A;  3C2P A;  2HZA A;  5G4D A;  2KHD A;  2CJK A;  4LRA A;  2AHO B;  1RLD A;  5BYR A;  3BYP A;  2ZH2 A;  5D3G A;  5FDL B;  1H3D A;  1R8A A;  3T9Z A;  5AE1 A;  4FBU A;  1TL3 B;  4Y2A A;  1WG1 A;  1CPZ A;  2M88 A;  3I5B A;  2FJV A;  5DDP C;  2P6T A;  4DU8 A;  2IBK A;  3CJ4 A;  3HZE A;  4NPO A;  4WFB Q;  4NA1 A;  4M5H A;  2RS2 A;  2V6A A;  3L7U A;  1XNQ F;  2W7O A;  2B0G A;  1IR2 A;  2L41 A;  5DLG A;  4UT4 A;  2WVF A;  2P5V A;  2V67 A;  3JTP A;  4EI2 A;  2CNO B;  4UZC A;  2VG5 A;  3UPF A;  2XY6 A;  2FZG B;  5LL6 d;  4DQP A;  3P49 B;  2R2T A;  3MCO A;  2EC2 A;  5KT2 A;  5LSO A;  2CJA A;  2VFT A;  3PYG A;  4I68 A;  1WC1 A;  2DD8 S;  1T0T V;  4EBD A;  3TUI C;  4LF9 F;  4OI3 A;  4UUX A;  5KFD A;  2VD3 A;  1BQM B;  1XN9 A;  2O66 A;  3CIM A;  4E98 A;  1R3N A;  4RBU A;  5I3U B;  2DHG A;  2OHD A;  1CJV A;  1TV6 A;  2WW8 A;  2CQG A;  3SXL A;  3D5M A;  3IGN A;  1MSW D;  5L9X A;  3FCW A;  2PFD A;  3SCI E;  4HTJ A;  1LW0 B;  1IJF B;  4FYD A;  1EQ0 A;  5AJ3 J;  3MM8 A;  1OQ3 A;  4YB6 A;  2DEI A;  2E5I A;  1S4E A;  4NLR A;  4HLB A;  5E5N A;  2MQN A;  1HNI B;  2B9E A;  1RT1 A;  2CQ0 A;  3W5Y A;  3HF5 A;  4HAC A;  1RHM B;  4QJV A;  2QO3 A;  4OHV A;  3DOM B;  3PTW A;  2ZHA A;  5AXL A;  1REG X;  2WK4 A;  3ENQ A;  3TZZ A;  1Q7Y T;  2AT1 B;  3A1Y G;  2HQ3 A;  3O44 A;  4A8Q A;  1GH8 A;  4MK9 A;  2YNI B;  1YDL A;  1T3O A;  2HMI A;  2L3M A;  2FGO A;  3BSN A;  2W2N P;  1E6V B;  5M2U A;  4PEO A;  5KFL A;  4CLT A;  4DUZ J;  1AFI A;  3QBC A;  3KUH A;  3V4M A;  1Y3K A;  3TX8 A;  2QMU B;  5K5M A;  2Q66 A;  1S0O A;  4GVB B;  1RA7 A;  4K4Y A;  4WP8 A;  1YJW S;  3RUB L;  3DRS A;  3NS7 B;  1R8C A;  3MEE A;  4IKA A;  2VQE F;  1U26 A;  3PY8 A;  2YWW A;  1NBE B;  3MFH A;  2A3J A;  5IT9 Y;  4C6A A;  2AWZ A;  3MUM P;  1G1X A;  2KB2 A;  4WXO A;  4ZLJ A;  3MM9 B;  1GMW A;  4WZM A;  4RUC A;  2JLG A;  3TNV A;  1N5Y A;  2GVZ A;  4P10 A;  1NH7 A;  2UU9 J;  3KJF B;  2OEK A;  2R8I A;  1S97 A;  4C8O A;  1UFL A;  1IN0 A;  2YY3 A;  1WUU A;  3C3L A;  1QM9 A;  2B4P A;  5HVH A;  3NL0 A;  2CPF A;  4X4Q A;  1JLG B;  3HJV A;  4Y0F A;  4O0I A;  2HGL A;  1N88 A;  3NNC A;  1RT7 B;  2GJ2 A;  1J27 A;  3GJQ B;  4PQA A;  3DGP A;  5H1S V;  1RAB B;  2ZUG A;  1FVQ A;  1N32 F;  2HHH J;  2HBY B;  2CQ3 A;  2AJ1 A;  4CYU A;  2QSF A;  3FMW A;  4C8Z A;  3GSD A;  2F65 A;  4MKV A;  1NDL A;  4FXD A;  1D9A A;  4K59 A;  1K73 T;  5KT4 A;  3Q0A A;  1FO1 A;  2JC1 A;  3M9O B;  4X84 A;  3U02 A;  3CT9 A;  2N3O A;  4CT9 A;  2ZC4 A;  4JV5 F;  1RT4 A;  3T5K A;  1MWY A;  4ZLP A;  3FQL A;  2OPQ A;  4M8L A;  1HBU A;  4DR6 F;  4ECR A;  1XBW A;  4GMK A;  3DC2 A;  1HNZ J;  3N79 A;  1XR5 A;  2MJU A;  1NK9 A;  2AW0 A;  1YRT A;  1PCA A;  4ELT A;  4DPY A;  1YGY A;  2ZVS A;  2C2E A;  3V6J A;  1BC6 A;  2HLU A;  4DL2 A;  2XS7 A;  1FRI A;  1H2T Z;  1FX4 A;  1VIO A;  5HMX A;  3DMJ B;  4C11 A;  2HBZ B;  3R1L A;  4R5P A;  3AFG A;  2MZQ A;  1FE4 A;  3LF0 A;  2CNN B;  4F4W A;  3CE8 A;  1DQA A;  2HNZ B;  1TK8 A;  1P9Y A;  3BDP A;  2E9T A;  4HH1 A;  4O3S A;  2VJV A;  4O3R A;  4FF4 A;  3D66 A;  3O6Q A;  2NR0 A;  3PV8 A;  2NSC A;  5HRO B;  3BN7 A;  2OD4 A;  1JJ4 A;  4F4A A;  5K20 B;  4ENO A;  5GAG U;  2LA4 A;  5IT4 A;  2OML A;  3VZI A;  1SV5 B;  3CD7 A;  3ZZR A;  3NLC A;  1R6Y A;  2E7W A;  2O1P A;  4NL5 A;  4BWM A;  1NJZ A;  2E5L F;  1SJ4 P;  5I3Q A;  1GMV A;  5HP1 A;  4M5I A;  5B09 A;  3QZ8 A;  2RE1 A;  3R27 A;  4OI2 A;  1C1C B;  1N34 J;  2DNK A;  3OTO F;  3NS6 A;  3UWT A;  2XC9 A;  1P1L A;  1FXR A;  2MHE A;  4C8Y A;  4RW7 B;  2B51 A;  5KG3 A;  3ZXW A;  1IR0 A;  1BQX A;  1S1T B;  1LW2 B;  1O0P A;  2Z0G A;  2HQF A;  4O3N A;  3GJS B;  1WEL A;  3D1H A;  2H4Y B;  3J80 U;  3A13 A;  4OJG A;  4OX7 A;  4ZOS A;  4OYB A;  5KFQ A;  1IVZ A;  5C42 A;  3OQ2 A;  1WHV A;  2CQC A;  4RW8 A;  2BAB A;  3EZU A;  5DQI A;  1RAF B;  5CD4 H;  5KFE A;  4RW6 B;  1TAU A;  5AXM A;  1N8R T;  2QN6 B;  3HVR A;  4AYB D;  3KLE B;  3SV3 A;  1H73 A;  1XWL A;  4IDK A;  1FNM A;  2E44 A;  2CVI A;  2Q79 A;  2IRY A;  4UTG A;  4B3R F;  4U8V A;  3K0J A;  1R89 A;  2GMH A;  1X4C A;  1ITP A;  1RI7 A;  4AE5 A;  1S6P A;  1N6Q A;  4URG A;  3I96 A;  1YG0 A;  3K5L A;  4OV6 A;  2EW9 A;  3KDN A;  3I9Z A;  1C0U A;  2CRL A;  1ZBT A;  1V6H A;  3W9H A;  3B4D A;  2XB2 D;  5F8J A;  2JFK A;  2MYF A;  2W9A A;  3VV2 B;  4WZQ A;  1XQI A;  1ZM9 A;  3EM1 A;  4CQ1 A;  3JQM A;  2YQ0 A;  2IAJ A;  4I2P A;  2DO0 A;  2R7R A;  4L74 A;  1RT3 A;  4IRC A;  2A2D A;  2AJ2 A;  5E3C A;  1IXK A;  4O4G A;  3JSB A;  4M5L A;  4DV5 J;  2D69 A;  2H65 B;  3WIV A;  3UVJ A;  5C25 B;  2V94 A;  1SC6 A;  2R8H A;  3MM5 A;  5F3T A;  2VUG A;  2F1F A;  2ADC A;  1N5T A;  1M1H A;  1VGY A;  1WHW A;  5DO2 A;  3PW5 A;  1DAR A;  3AA9 A;  3M2R A;  3UDC A;  3G8Q A;  1JLQ B;  3SYZ A;  1S9E A;  4DQI A;  2CPX A;  2WOM B;  2P6S A;  2OIH A;  2KTQ A;  3ZTO A;  1UW4 A;  3MZI A;  1REV A;  3FBF A;  2XUL A;  2VDH A;  4IFY A;  4OZ2 A;  1Q0N A;  3CB4 A;  5D6G A;  2Y1I A;  2IHR 1;  3EPG A;  4LFB F;  5A2Q U;  1S76 D;  5KFZ A;  2KXF A;  3GTY X;  1WD6 A;  2JEJ A;  1Y5I B;  1F5B A;  4GKK J;  4JI0 F;  1LXJ A;  1R43 A;  3ILO A;  5E2Q A;  1WWH A;  4ES3 A;  4TN2 A;  3CC7 S;  1GXL A;  3DLG B;  1KVK A;  3TWZ A;  5FD1 A;  2BRL A;  2ZJQ Q;  1X60 A;  2X3G A;  2Z2Y B;  4LF7 F;  3OVS A;  3BYR A;  2BW7 A;  1LEO A;  4YOE A;  4USK A;  4DX8 H;  3BB5 A;  5HBM B;  5ETS A;  1S5Z A;  1DRZ A;  3DLK A;  5AXN A;  3SFU A;  5DJB A;  3A12 A;  4HR2 A;  2KFY A;  2CXE A;  2EG1 A;  4XPE A;  1WTB A;  3S01 A;  3QO9 A;  3ILI A;  1PJ7 A;  2LQJ A;  3SCK E;  1T03 A;  4CNZ A;  4K0K J;  1FDB A;  2HEK A;  4NLD A;  4X66 F;  2EFO A;  1EAY C;  2FPH X;  2NUU G;  1TKT A;  3GSI A;  3PR4 A;  5L46 A;  1NDK A;  1VR6 A;  4XIU A;  4LF5 F;  1UFK A;  2NYI A;  3EPI A;  3PAC A;  1BD6 A;  2RDI A;  4G1Q A;  4KBI A;  2FJA B;  1L5U A;  4Z7C A;  3ZC4 A;  2ASL A;  4F36 A;  2VBZ A;  2Y0S D;  3KLF A;  3MED A;  2NXE A;  2RH3 A;  2QYG A;  2HHP A;  3KLH B;  1HBO A;  1FDA A;  2QYC A;  2MXY A;  4C0O C;  4LBP A;  3QT8 A;  2C2R A;  1EAR A;  2DHX A;  5J2Q B;  1HWU A;  4YP3 A;  2XTJ P;  3CMA S;  3OSN A;  1S9F A;  3TUJ C;  2KI2 A;  4MAK A;  5JXS A;  4HI1 A;  2JDJ A;  5EX3 A;  2LCW A;  4RZR A;  3BBB A;  1VQ9 S;  4CM0 A;  1KLM A;  4G65 A;  2QRR A;  3EVO A;  1R6V A;  2QC3 A;  2M4M A;  4FBT A;  3O1L A;  2CPE A;  3POT B;  4BBY A;  2WB1 D;  3VGU A;  2M9K A;  1RU2 A;  4IOA Q;  3HPO A;  1FKO B;  4I6A A;  4JB8 B;  2OMO A;  4YFU A;  5A0Y A;  4ID5 A;  2GC8 A;  3L4B C;  1CVJ A;  6AT1 B;  2BA9 A;  1FX2 A;  2KZM A;  3R3T A;  5FLX Y;  1TKX B;  4ZVU B;  1JLB B;  3A4T A;  3P4U B;  3DU6 A;  3U1M A;  1HQE A;  1FD8 A;  1VDH A;  3ZFV A;  3ETO A;  2YX1 A;  4CP5 A;  4CLF A;  4EZ9 A;  2DIU A;  5EDW A;  3BGL A;  1JNR B;  1QTM A;  3MMB A;  3AOA A;  3EGZ A;  2JVR A;  5KFV A;  3K8W A;  1RE1 B;  1VQK S;  2CPD A;  2K3K A;  3DRP B;  4WU3 A;  1M5K C;  3ISN C;  1UJ6 A;  3MTK A;  3SSR A;  1HI8 A;  4ZVF A;  3RR8 A;  1FFG B;  5D0H A;  2YWH A;  2DPI A;  1AA1 B;  2OPR A;  1I1G A;  4H4M A;  1T9T A;  2MZJ A;  2XWY A;  4NLV A;  2DNH A;  2L9N A;  1BQN B;  3PJX A;  2V4J B;  5KFJ A;  1S0N A;  3OXG A;  2W01 A;  4MYT A;  1L3S A;  3Q23 A;  2W9B B;  5ITH A;  5IT9 U;  3EJM A;  2AYM A;  1YSJ A;  5KT7 A;  2QLF B;  4IOC Q;  1ZYQ A;  4ETZ A;  3FCH A;  4UQT A;  2IA0 A;  4WIQ A;  1U1K A;  1SQE A;  1V5V A;  1DLO B;  3I4H X;  1WOP A;  1VMB A;  1TU0 B;  3S1T A;  2DXD A;  5DS7 A;  2V2Z A;  1AYE A;  5IFM A;  4K7Q A;  4TU9 A;  5LMN F;  4CO1 A;  4L75 A;  1U47 A;  4C97 A;  1RCO B;  4XPC A;  3PRD A;  1U6B A;  3IO1 A;  1PC4 A;  3TAR A;  3GG1 A;  1CJT B;  1ACM B;  2IRU A;  4BC9 A;  3J7A N;  4Y2M A;  3HHL C;  4KGV B;  1M5V C;  3CCU S;  2ZWP A;  2RDJ A;  2MQL A;  2EKN A;  2CAD A;  3PVX A;  1S4F A;  2HGN A;  1N0U A;  3W2V A;  4DV2 J;  3BGR A;  2W1B A;  1NHK L;  3J81 Y;  3OR2 A;  5F8I A;  2J9E A;  3MD1 A;  4WF9 Q;  4F4Y A;  1UPM B;  2Z56 B;  4KHM A;  2VL1 A;  2HGM A;  5HSP A;  1TMJ A;  3W2W A;  4A8S A;  4TY8 B;  1B0V A; 
#chains in the Genus database with same CATH homology
 1WJ9 A;  5CD4 A;  5H9F K;  2Y8Y A;  2Y8W A;  3QRR A;  2Y9H A;  4DZD A;  5H9E K;  4U7U D;  3QRQ A;  3QRP A;  4QYZ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...