4DZDA

Crystal structure of the crispr-associated protein cas6e from escherichia coli str. k-12
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
199
structure length
193
Chain Sequence
MYLSKVIIARAWSRDLYQLHQGLWHLFPNDFLFHVEKRNTPEGCHVLLQSAQMPVSTAVATVIKTKQVEFQLQVGVPLYFRLRANPIKTILDNQKRLDSKGNIKRCRVPLIKEAEQIAWLQRKLGNAARVEDVHPISERPQYFSGDGKSGKIQTVCFEGVLTINDAPALIDLVQQGIGPAKSMGCGLLSLAPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Uncharacterized protein ygcH
publication title Crystal Structure of endoribonuclease Cas6e from Escherichia coli
rcsb
source organism Escherichia coli
total genus 36
structure length 193
sequence length 199
ec nomenclature
pdb deposition date 2012-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08798 CRISPR_assoc CRISPR associated protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1200 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 1 4dzdA01
3.30.70.1210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 2 4dzdA02
3QRPA 1WJ9A 5H9FK 4DZDA 2Y9HA 5H9EK 3QRRA 2Y8YA 2Y8WA 5CD4A 4U7UD 3QRQA 4QYZK
chains in the Genus database with same CATH superfamily
2J9EA 4FF3A 2BACA 4M5DA 2G1DA 3PRBA 1VHIA 1GK8A 3MI7X 2R7RA 2E1AA 3HD1A 3LP2B 2K8GA 4ZLNA 1X0FA 1UJ4A 1P6TA 2Q6CA 4K0KF 4USUA 4BC7A 2HKEA 3CCSS 4XK8C 2V9WA 4DCPB 4DV3F 1DFDA 1EQ0A 1NDPA 1W26A 2NSBA 3HT0A 3M2UA 3M2RB 2C2OB 5A76A 2UP1A 2HHTA 4G65A 3R5AA 3I55S 2MDAA 2KO1A 4AQYJ 2XC9A 2BOAA 1GTEA 3KJVA 2HBYB 1OIAA 2ADCA 2E5LJ 4RU9A 2QIFA 3PACA 5DM7Q 2VZ9A 4UOHA 1Q16B 4IRKA 5C2GA 4F8RA 2LQ8A 4NOHA 7FDRA 5LMNJ 4X4SA 1HIYA 4J9RA 1XTZA 4CLYA 4I1TA 3W2VB 1PG5B 4DQIA 1Y9OA 3R3TA 2CZ4A 1IWGA 1E6VB 3L4BC 3Q2TC 2NSCA 2OFHX 3CCRS 2J0QD 3OR1A 2QV6A 2FVSA 3BDPA 1FK9A 3M8ZA 4HI1A 2Z30B 4EK2A 3MD1A 3PW0A 1DARA 5EWGA 1OY6A 4LF2A 3BM7A 3OTOJ 4ES2A 1FO1A 3CC7S 4DL4A 1R0AB 4PUOA 3OL7A 3UDCA 1JLEA 1R8AA 2D74B 4ED1A 2MKJA 2YX7A 2CJQA 3HT3A 4Q5VA 2M70A 1WC3A 9ATCB 2JHEA 3GSIA 2O66A 4A8KA 3DNCA 1OMSA 5IQ6A 4FVMA 4NEYA 3GJQB 1VQMS 2V63A 3Q8UA 3P96A 4DSEA 1MMLA 3WHIA 1SC4B 3CIMA 1WKJA 2RRBA 2D9PA 3NXZA 2XMKA 3VR1A 2B7CB 2Y0BB 3M8PA 2E66A 4IRDA 1RAEB 3G9CA 5H1SV 5D8HB 3R2DJ 4PR6A 3I56S 4Y2KA 1Z1ZA 4RWWA 4DV2F 3VAKA 4J7CA 3D6TB 4OYAA 3ZTPA 5DJBA 4DUYF 2VBWA 3GYNA 5IV4A 4D3HA 1S1VA 1QLNA 3W61A 4A47A 2DK2A 2H4WB 2ZITA 1HNIB 5KG0A 2HYIB 3NG8A 3NS6A 5GAHU 5DDRC 5D4LA 4YB7A 4ANEA 3GU0A 1FKPA 3BJYA 3ZTQA 1DTQB 5ETSA 3KLHA 5KFKA 4JI8F 4N47A 2YH0A 3MM5B 2CRLA 1HQUB 2DNZA 4RX6A 2D3ZA 4C8NA 4C7QA 2QE5A 4HACB 4DOZA 3T5KA 2JVOA 3LUYA 1FNOA 4NMLA 1ITPA 2CQ0A 2LLZA 1BHNA 5IM0B 1YQHA 2R3VA 2YQ3A 4B9SA 1W7WA 4A8YA 2C2ZB 1NK4A 3OV7A 1A0OB 3OTDA 3H90A 2DHSA 3E01A 2XNRA 3CJKA 3BPSP 1H2TZ 3BPDA 3LOUA 4PKDB 1L3UA 5J2QB 5MLCV 1OYDA 1YJRA 2LEPA 4QBUA 3G8SA 5L38A 3CUNA 4J9PA 4V19J 3W63A 4N5SA 4ITSA 4LF9F 4U9RA 2VFTA 4HHJA 4OZNA 3GIRA 2OPQB 4X4RA 4MJKA 2DR9A 2C3YA 4RW4A 5J2NA 1S57A 5D4PA 3HSGA 3TJAA 2VH7A 5KT4A 3M05A 2J9DA 3G6VA 3TUPA 1C0TB 4ZLPA 1FX2A 5IV3A 1S1WA 2UXDJ 3QJPA 1Y3KA 1S79A 2QL9B 2LA4A 3KJFB 1EJ7L 2XWYA 1X7VA 2YY3A 4DEZA 5KG7A 1B4SA 2N3OA 5BJRA 4R5PB 3MCSA 2PMZD 3BGOP 3CC4S 2ZBRA 2IRUA 1U1QA 1F5CA 2QA4S 2Y1IA 4FPRA 5DS7A 5I3UB 4FP9A 4AXJA 2B56A 3DFEA 4CLFA 2HS4A 4JV2A 1Y7PA 3T3FA 2DNYA 3DRSB 3JXOA 1K47A 2XGQA 4C8LA 3THTA 2HFOA 3DDIA 2PFDA 1IKXA 2HFZA 4WJBA 2KZZA 1RT6B 1VBZA 1HHTP 2MSTA 2XY6A 4OFZA 4WYLA 1H38A 2R4FA 1N5YB 4FN5A 1S0MA 5IC4B 1RTHA 3NGSA 1TKTB 4I68A 5E33A 2YVSA 1CJVA 2CNLB 4NX9A 1RDRA 2H48B 3T1YJ 4O3NA 2JRSA 2M0GB 4RW9A 3D9BA 4GC6A 4AT1B 3CJTA 4RNHA 1FFGB 1SV5A 4TKTA 1QY7A 1WC1A 1HNZJ 1U0SA 4PG4A 2GHVC 4LSNA 3JS9A 3WQPA 6AT1B 3C6TA 1MU2A 4ES3A 4P7TA 4LF4F 2QLWA 4ELUA 4P6QA 4WF9Q 4NLOA 2VG5A 4K7QA 1BQMA 3W64A 1F9FA 1HMVB 4B9NA 2W25A 2Q43A 3FQLA 2NREA 4DX5A 4PG7A 1KOOA 1S1XB 3F56A 2J9DE 1FEEA 1Y5NB 4L76A 3IRXB 1FRXA 3DOKB 2QEXS 1VQ6S 4ETZA 2HNZA 1V3SA 2QA2A 2ZHAA 4LBHA 1MWYA 4HDGA 2RD5C 4QWDA 2XCPA 3FBCA 2RS2A 4U67Q 5CAAA 5AXLA 1U2CA 2AEFA 3FJ2A 3MDFA 3FFIA 1NJWA 4OI4A 4CT9A 2X51A 5GVQA 4IRCA 1H3DA 4F4WA 3HM9A 4KV8A 2IMOA 5T41A 5J2MB 1QDUB 1SKRA 2HLUA 3AA8A 5LJ5Y 1BQNB 2IM3A 4OYWA 2VKZG 4DPXA 4PXBA 1P9QC 1X0PA 5F8HA 1HI8A 3A8EA 3QIPA 5H9EK 4WYWA 3W9IA 1IBMJ 1B64A 4DQRA 4KH0B 5KT5A 3HFVA 1G6BA 4A8QA 1YGYA 1Z2ZA 2FPHX 3CF5Q 4QOTA 3UFCX 2LYVA 1SXLA 3KK1A 1AUSL 4DV1F 2PC6A 1HYSB 3ENAA 1NHVA 1N36F 3M1VA 1S9EB 4L3KA 4G1PA 2I8EA 2C3PA 2E1PA 2L9DA 2O67A 3KK3A 5CD4H 4M5KA 4I7FA 3ILIA 1LWFB 2RNEA 1H2VZ 1VHFA 2QLJB 1SKWA 3DDKA 3BGRA 1KQKA 4CLTA 2AYMA 1XQIA 1HNWF 1YBTA 3AD9C 4LSLA 2HK2A 2VIHA 2FGOA 2B4PA 4PRFA 1F5BA 2AGOA 4DV0F 3OFHA 4LF5J 4A8MP 1DLOB 3NWGA 2MJUA 3HSJA 1P8GA 4USHA 4PXDA 2HGNA 5E5NA 4OYXA 2IPOB 4LBIA 1QM9A 2EW9A 5HMXA 4DL3A 2BW2A 3FRZA 1XBWA 1XN9A 2M8HA 2N7CA 5CH7B 1SPBP 3B78A 1UWBB 1VRTA 4Y28C 4JYAJ 3O5TB 2L9WA 3H4DA 3SI8A 3OLAA 2WTFA 2CYYA 2DCUB 5LXYA 4RR5A 2F8EX 4RNMA 4YHHJ 2WW8A 1S10A 4MYUA 3W5YA 1RHRB 3UR0A 3MOZA 1TL7B 4KPYA 4B3RJ 3H5XA 2Y9HA 3WX4A 2B43A 2JSXA 1KQSR 4IDKB 3ZZZA 1VQYA 2M9KA 4R8UB 1U6FA 2O1PA 3FBEA 2UXBF 4DQPA 3Q8QB 4K4VA 4BLGA 1YHQS 3W2VA 4RWXA 2BE7D 4HH1A 4EO8A 4B3TF 3N5BA 1XERA 4M63A 3IC1A 1GXTA 4DR6F 1T3NA 4U7UK 3BH6B 3UVJB 1PC4A 3NLCA 2YPZA 5IFMA 3QGGA 3ZZPA 4ILRA 2ZZMA 2RQKA 4X62J 4ZPVR 1RU2A 3I9ZA 2VQFJ 4KHPJ 1KR4A 1EQMA 1BXNA 5L1IA 2PE8A 2CG8A 3QT6A 3M9OB 1M1GA 1U6BA 4I0WA 2KYZA 3KDNA 1TUVA 4Y65A 3TX0A 5I4MA 1R27B 4OYPA 4DHVA 4ES1A 4WU3A 2MQQA 1RWXB 1A7GE 3GTYX 5LT5A 3GIJA 3N0VA 3UR3C 5HL7Q 3SZ2A 3D6HB 5LSRA 1X31C 3PYGA 4O3PA 3JSBA 5BYRA 3CCTA 5FD1A 4M94A 4PWDA 3MF5A 2XTJP 1G4CA 2FQQB 4H4KC 1WC5A 3IWXA 3QWUA 4EUVA 3Q0AA 3MGJA 4I2QB 4NMXA 1X4EA 3MEDA 2FZCB 2V4RA 1JJHA 3UNYA 1H74A 4C0OC 4PABA 1T9YA 2OPPB 1NSKL 4JI6J 4OHWA 1KFDA 2HFSA 5IOLA 3DI6B 2C2KB 5K8MA 2QSFA 3RBXA 2VDIA 3F44A 5CYMA 2NLWA 3PX0A 4BWMA 3IWNC 2GX8A 4C98A 3HSDA 1HNIA 2KFNA 2R7QA 2DT9A 1TKXB 2Z57B 4MKYA 2UVUA 1I3OB 3BB5A 3TP2A 2P9EA 1VQOS 1YIJS 4ECUA 4NXNJ 3VAHA 1X5OA 1DTQA 4Y2MA 4OI0A 3UCGA 5A0YA 1RT1B 3AOBA 4X84A 3PEHA 1N0UA 1HQUA 3ILJA 3IS9A 2ZH7A 1FDAA 4DLGA 1QTNB 4LFCJ 4HACA 2QFIA 2YNHB 2EKNA 2KL8A 2Z56B 3OVBA 5IM0A 1VQ5S 2HRUA 5A6PA 1S1UA 4ZMMA 4C3MA 3Q8YA 5EWEA 4W4MA 4PYAA 3UPFA 3JSYA 3VAGA 1D0EA 3HVWA 2HVZA 2IJNA 3GYXB 3BSNA 1NJZA 2J6TA 4HTJA 2XHCA 3AH6A 2K7KA 1TELA 2DB1A 2GHPA 3B6BA 4CTAB 1SL1A 5F0WA 2KFYA 5F41A 4TN2A 3TRGA 4CDIA 2IIHA 2AJ4A 5ETOA 5C24B 4DV2J 2YNFB 5CZVA 2MQ8A 3MFHA 1CVJA 4DUYJ 4F4YA 2J0SD 2BRLA 1F6TA 2DHAA 5FLXU 4KO0A 2HWIA 3SQGB 2A18A 1WWHA 2VF3A 1FJGJ 4NWBA 1KVIA 4K2XA 4X4QA 2JLFA 2J7WA 4NZ6A 3AD8C 3N79A 4QZVB 2QMWA 4K4YA 1HHSA 4RPFA 2AQ4A 4ECZA 4JI8J 2P9GA 3TX8A 4WK1A 4N76A 2NUUG 3TEHB 2MPUA 3SV4A 3TO8A 1HNVB 3SYZA 3T1AA 2J7KA 2L41A 2KXFA 2MKKA 1X4HA 5B0CA 4DDFA 1NJYA 1VQSA 1U09A 4DU8A 2BANB 2NYIA 3DRSA 2WB1D 3CDEA 3QJJA 4W98A 3N01A 3DLGB 3GQCA 3QBCA 1OY9A 1SIWB 3PFEA 3C46A 4KYZA 3VV2B 2IA6A 1RT6A 2DNQA 2BZ2A 3QT7A 5IT9Y 3GIKA 1CJTB 1N32F 1TTHB 4A46A 2LKZA 2JJ4D 5DDOC 3W5ZA 1SC1B 5HQ8A 4LJMA 5DQIA 2MKYA 3H5SA 3UDVA 4LF9J 1WHYA 1YRXA 1C1BA 2V69A 2R8HA 3VHQA 1XMBA 1Q8BA 4NASA 4JUZA 1KHVA 4DPUA 3ENQA 1NDCA 2A3JA 1FD2A 4EU0A 3BO2A 2MQNA 3HHLB 4IOBA 2VDHA 3D1HA 4WXWA 2R2SA 2CNKB 1F2HA 2OFGX 1N6QA 1JLFB 2DHXA 4ZVEA 1FNXH 1LWEA 3HP6A 4DL7A 4FYVB 1N0VC 2KXHA 2YH1A 3TVYA 3CCZA 5A8KA 4F0HA 1RTZA 5CXTA 2CQ1A 1MW7A 5D3GA 4NCBA 4XPEA 2FZGB 3AXMA 3J81U 1OSCA 2YKAA 3UN2A 1RGVA 2BM1A 4N41A 3HMJG 2M2BA 4IKAA 1RT5B 3ISZA 3V6DB 3PFOA 2XMMA 3DLKB 1HBNA 3DOKA 1BY9A 2V8DA 1S12A 3BBCA 5L1LA 1PKUA 1S6QA 1F9HA 1H7WA 4OIXA 5HI7A 5C7PA 4DR2F 4WP9A 3NMRA 1K1SA 2Y8WA 1RACB 4OI2A 3FCHA 2PA8D 3CCWA 4OZ2A 3VZIA 1IR2A 3GG0A 5JMNA 3EMTA 5BR8F 3RBDA 3KLFB 3MUTP 3IP0A 1U47A 3LANA 4H4MB 3C16B 4IO9Q 1WKKA 4XAKA 4Y2IA 1NK6A 3W7BA 1X4DA 1OS5A 2OUGA 3DOLA 4F4XA 4DQSA 3V4IB 2Q66A 5EHHA 3BSOA 4UOGA 4DL0C 4JV0A 2ZE2A 2C22A 1K44A 2QA4G 3J81j 2RAQA 2VPWB 3KJQB 3M32B 4TYBA 2NXNA 4F4KA 1UJ6A 2HNYA 2XO6A 2LFVA 1TV6A 4QWBA 3AA9A 4LF4J 1YZ6A 2EC2A 3JSRA 2MY8A 1NM2A 4DSJA 1Y5LB 1S49A 5DG9A 4QCLA 4U7UD 4F3MA 3W8GA 2CZ9A 4QIGA 2BJ7A 1G1XA 4B3OA 5L1KA 4DR5F 4ZPBA 3M6VA 1V5IB 3CE8A 5HMZA 3R7NB 2KTQA 3CDUA 1N5TA 5KG2A 1X4GA 2L48A 2RS8A 2HMIB 5KT6A 5DZ6A 1DLOA 2V4JA 2R7WA 2KVQE 1CLFA 5K5MA 3HPOA 3TAMB 4I67A 4KFBA 3G82B 4YEAA 5D0RA 4ECVA 1FFWB 3PX6A 2OHDA 2DR8A 5F8MA 1BGXT 3OW2R 3PNIA 1T9UA 1FF2A 1RA6A 4DZ6A 2N3LA 5K14B 3D66A 4ANDA 4CH0S 5F8LA 1ZAWA 3ET6B 4UY8T 4GMKA 3VCDA 2QFJA 3THVA 4TU7A 2NXJA 2YNGA 1VQLS 1GMUA 4YB1P 3R97A 4U6PA 3RTVA 4ZPWR 4PQUA 2BV3A 4JV5F 2W2MP 2XULA 4EO6A 4HEA9 4ALZA 2VUGA 2VPYB 1IKYB 2AP6A 2K2PA 4CLZA 4Q45A 4XDCA 2V8PA 3MM7A 1TL7A 4DV1J 1AZSB 1GTHA 4FXVA 1NKEA 3O44A 3G87A 1N36J 4EEYA 1CPZA 4R8UA 3LH2S 1QSSA 2BJ3A 3K0JA 4MKBA 3RW7A 1TFYA 1XNQJ 5CYQB 2VG6A 4C11A 1UEVA 1LWCA 1LWXA 5DG8A 2NYHA 1UEUA 4EMDA 1WI6A 1T3OA 1VGYA 1WSRA 5KFSA 4QR1A 4KAIA 1HNWJ 3ZO7A 4RW7A 4X4UA 1SB6A 5SZTA 4GO5X 4LF7F 2LQBA 4P9SA 1ZH5A 1NSPA 2DGWA 4DV0J 2GNKA 5I42A 2YKMB 4ERDA 1N5QA 4GVBA 2U1AA 1S99A 4WFYA 1LFWA 4CQ1A 5AE3A 3JYTB 3TZZA 2QJ3A 1TUWA 1MN9A 3ZZ0A 2RUGA 5E7OB 1M1KT 3MMCB 4I6YA 1FFSB 2QMXA 2E5JA 3SCJE 2DNHA 5KFQA 4G1QA 5AJ3F 3R5DA 4FXDA 3AQPA 4P72A 3KG1A 4FYWB 2VG7B 2O3DA 1GT8A 4I2QA 1S1TB 2OAUA 1U6ZA 2EXUA 3Q22A 2RJZA 2W2OP 2ASDA 2MLYA 4TVAB 1LW2A 1B3TA 2D3OR 3J7AN 4HKQA 2C1EB 4DQQA 3T1HF 2UZAA 1NPPA 5F8IA 1GMVA 2LVWA 1V5VA 4OI3A 4NYZA 1KLNA 4E0DA 2IM1A 3MZIA 1EKSA 2GIQA 2B7BB 4JI5F 3A8JA 3K8WA 2UXBJ 2C2MB 3H5YA 3Q2SC 1G3OA 4UUWA 4DN9A 2Z2MA 1VFJA 1T03A 4B3TJ 2XM3A 2ZH4A 2X3GA 1JJ4A 2R8IA 1KVKA 3NEKA 3BQ0A 2OTLS 4IFVB 4WFAQ 4B08A 1RT4B 1LXNA 1X9SA 2LU1A 2IVMA 2CKWA 1BWEA 2W2QP 4RO0A 1CQNA 1FXDA 1RTDB 5DQGA 2DNLA 2HVEA 4CLKA 4O3RA 1WKLA 4F7VA 3M9NB 2VA3A 2AEMA 3MCOA 3ILOA 2APOA 3AODA 1FJCA 3H2UB 3MMBB 4L73A 1CS4B 1TU0B 3FKBA 1CULB 3ETMA 3W9JA 2CNOB 2JEGA 3JSMB 3NNCA 2V0NA 2FY1A 4ED0A 3NL0A 5KFOA 1X5TA 2W7AA 1WC4A 2BXJA 3TJ8A 4GO7X 3QRRA 2M3DA 3MPUB 5KOWA 3VAFA 4URQU 3RZAA 4DV4F 2CIMA 2O01C 2AYEA 2R8KA 1JNZB 5KFPA 1KHWA 2W7PA 2BKOA 4NLXA 2BBEA 1S6OA 4K4WA 2DR5A 4P73A 1RXOB 2B8QA 2V9KA 2CPFA 2HHWA 3THPA 3A13A 3VGVA 5C24A 2FVRA 3DMJB 3MECA 2BKPA 2B8PA 1KP6A 2GZOA 5KFGA 4CYUA 1TP7A 4X66F 4Q7AA 4KT0C 3LAKA 2OEMA 2E5IA 3K7RA 3SQGA 4DX6A 3L09A 2PDAA 1QSYA 3M30B 2CPZA 2DXFA 4ZJQA 1U4BA 3ZXWA 3WX8A 4CLLA 4B9TA 3VGSA 1REGX 3S8SA 3ZFVA 5D4NA 3W62A 4LIRA 4M5HA 4NA2A 1N56A 1IVZA 2GQQA 1N8RT 5EN1A 4Z7CA 3HJVA 2MLXA 2NUHA 1CJKB 3M2VB 3GE9A 2ZJPQ 4N7TA 4XTTA 1SJ3P 4BBYA 4EYHB 3D6FB 3P45B 2CDRB 4I4BA 1YITS 1U26A 3J7ZT 2AX0A 2CG4A 2R42A 4YB6A 2BJ8A 3DLGA 5FDLB 4GRSA 1DQAA 5DGBA 2ZZTA 2VB6A 3E51A 1F60B 4ECSA 3MCNA 7AT1B 4TYAA 2JEIA 1IJFB 1LOUA 4NLYA 2RVJA 2Z8QA 3RB6A 2MTLA 2VL1A 4WP8A 4URSA 2ZOMA 1IKWB 4F2RA 1RHMB 1KOHA 1UJ5A 1G2EA 4J9LA 1RT7B 4BS2A 1RABB 1J27A 4WIIA 4J9VA 3CWJA 3CJQA 1JQGA 2VONA 1JLFA 3AB2B 5HLFA 1S7IA 4OJGA 4LR9A 1Q8IA 3CCVS 4WU2A 1U1RA 4WIQA 1APSA 2R9LA 2FJDB 1TR0A 1R0BG 2RIJA 1RISA 2CPIA 4QIEA 3AFGA 5C25B 1JLQB 2MY7A 5KFCA 2VA2A 2ZDOA 3GJRB 1VLOA 2XYPB 3V6DA 4RW8B 2ZH3A 1SJFA 3NS7B 1XWLA 4WE1B 2NQPA 2DPJA 2JL9A 3N5FA 4NRTA 4WKYA 1FXRA 2CAJA 1QAJA 1XJWB 3R5GA 4R0JA 3P3DA 1K9MT 1HNXF 3O1LA 5IT4A 2CQHA 4O44B 4OYMA 3AXKA 1GFWB 1Q81T 2G2ZA 3BEGB 2YWWA 2RDJA 4FDFA 2XB2D 2QYCA 2F3JA 1IJEB 3KLFA 1I1GA 2W4PA 4X2BA 1N32J 2E7XA 2YX4A 3POTB 3TOQA 2HIQA 1SJ4P 2KHDA 3T9ZA 5DLGA 3D0HE 4QQBA 3RGIA 2JNJA 5LSLA 3NBPA 4ELVA 1U1LA 1WTBA 1HLWA 4YOEA 1PYOB 1T05B 3AAWB 1LK7A 4C3LA 9RUBA 3M8SA 3PJXA 2ZH2A 3CMAS 1SH2A 2AJ1A 2EVZA 5H9FJ 2ZVSA 2ZEJA 1TL4A 3HSZA 3MPVA 1JLAB 4DF8A 5HANA 2P6SA 3CMQA 4U95A 4Y34A 2Z0GA 1RCXB 3BS9A 4YR3A 1R8CA 2R2RA 3Q8VA 2WOMB 3R6GB 5KOXA 4ZK7M 2R8GA 2CQGA 3SSSA 1FVQA 4NLTA 4O0IA 2B6AB 3CPWR 2Z2LA 2ZFHA 1YJWS 4ED7A 2HMIA 1JJCB 2DXDA 3EGVA 4DR2J 3HHKA 3CMES 2XI2A 1JNRB 4FF1A 3S1TA 3T9NA 2HSEB 3K5PA 3MURP 2DGQA 1NSQA 2M5YA 2CQ3A 4HYKA 3KKFA 2BVZA 5ETQA 2JH3A 1B99A 1HR0F 4NCAA 2XS2A 4B9LA 3CJRA 5J1EB 1SIZA 3CO9A 2CPYA 3ZTSA 1ZBTA 4ELTA 3EVOA 4MKAA 2XZWA 1FNMA 2D69A 2H65B 2LP4A 4FKXA 1YJNS 1GQEA 4UY85 3K58A 1FDNA 4PPDA 1WI8A 1U2FA 3VGUA 1RWWB 1WSVA 3PIOQ 1VK8A 4DFPA 1YWXA 4J9NA 3JTPA 1WG4A 4ZDNA 2V68A 5BYQA 3PEJA 2KRRA 3GILA 4IFYB 5CYQA 4P2XA 4DCJB 1D8ZA 5CZXA 3NRBA 2HHVA 3HVTA 2VQEF 2EFPA 4DR5J 1VC6A 4NLVA 4NLUA 1FJEB 1KLMA 2PGCA 1EAYC 2JZ5A 2YNIB 2J6UA 4JI2F 5KFXA 1RUSA 3C6UB 4IO1A 5KFBA 3LWLA 1M90T 2YKMA 5LL6d 3CEDA 2EK1A 4USWA 1V9OA 2KT5A 2WSFC 5H9FK 5C2CA 2DEIA 4RW6A 3L7PA 4QYZK 3DU5A 2I5JB 2FLLA 4ZLLA 3MR6A 2L9NA 2RILA 5D6GA 2MXYA 4JI3J 4DX8H 3K57A 4ZP6A 3DOMB 4RNNA 1RTJA 1UWAA 3CD6S 3RW6A 3ISNC 3T5HA 3B82A 3GYGA 2DO4A 4K8RA 2DCLA 1IQZA 4B3MF 4AFFA 4OX6A 2GCFA 5KTQA 1JK9B 2D9OA 2W9CA 3HFKA 1K0VA 4JV5J 1S1TA 3KLIB 2HZVA 3BO3A 3HJFA 1YG0A 4ATNA 2ZD1B 2UV8G 3CC2S 4DV5J 1N52B 2VOOA 1U48A 2DNKA 5F9LA 4OZ5A 4ICLB 4E98A 3NGRA 2VFRA 1FE4A 2AJ2A 1B70B 3Q83A 4ZKAA 3I4PA 3LGNA 4PYDA 1XR5A 2UVRA 4WFZA 1H6KX 4RKUC 1XMQF 1C4AA 1RT2A 3H40A 3QQCD 1VRUB 2RU3A 3PJWA 1MMNA 2QRRA 2COLA 2KDOA 1UP1A 5KFLA 1ZTTA 3SCIE 3MOJB 3IAS9 4LF7J 5F8JA 4LQ9A 2FVPA 3VAMA 3AOCA 1FRLA 3D1OA 3BBFA 2QL5B 3IR7B 3LPEA 3HZEA 5GMKa 2W9BB 1WD6A 4GVLA 2R7OA 1NKCA 2B5JB 1CS4A 1RHKB 4QWAA 3P8BB 2LQ5A 4OYZA 3JSMA 4X64F 2WSEC 4EBEA 4DS4A 4WFNQ 5AJ3J 2WHOA 1DQ8A 1FXLA 1PYSB 2IYIA 5KFYA 5C42B 4JI7J 4KSEB 4UUXA 2CWXA 3CCES 5B0BA 3GSDA 3G6XA 3PM9A 3QLHB 2AT1B 2CA9A 3T1HJ 3MEGA 4M5GA 3MEEB 1NMEB 4ZP7A 2B51A 2NPFA 4QR2A 3QFWA 1RWVB 1RAGB 1TVRA 5CD4A 1NHKL 5A8WA 1QAYA 2JLGA 4JI5J 4RNOA 1U1OA 2YKOA 3KYLA 3FEZA 2FHJD 2XQCA 2KZMA 3TUJC 3W2WA 4ID8A 4MK9A 2ZH9A 3QGIA 2C2DA 3K89A 2UUTA 2C2EA 2XS7A 2HAFA 2ATCB 1X4BA 2I6WA 3L7UA 1LW0B 1KFSA 4M5NA 3AHPA 3DLBA 3QGPA 4TU8A 2FVQA 4KBIA 3IR6B 2F8HA 1PILA 1WUUA 3M2VA 2QG9B 2GGPA 2DEJA 3CD0A 4DLEA 2FLOA 4DXLA 4JI0F 2RRAA 2QN6B 2DGVA 4ZCLA 4X65J 1S97A 1SJQA 2BQ3A 3PG9A 2GMHA 2HWTA 1HI1A 5A2QY 2E1MC 4IG0A 4YY3F 1F5AA 1RLCL 2JDJA 1N5SA 2VICA 2OTJS 4KGVB 4DV4J 2G13A 3D28A 4DR4F 2PIIA 4Q8EA 2MQPA 2B4UA 3MXHP 3HF5A 3BKUA 2W8KA 1N33F 2DGTA 3D5MA 4Y3CA 1X9MA 1W25A 1UPMB 2FLNA 1TL5A 4F67A 1IKWA 5KFZA 5F3ZA 1VQNS 1AROP 3J80U 3NGTA 1JB0C 2DR7A 3D6MB 2CJYB 4C9DA 2A6MA 1XNRF 4HI2A 3ZNUA 4WCEQ 3UE2A 1HW9A 1S9GA 4Q0BA 4RNFA 4K2JA 2P5VA 4OHZA 2AKWB 1F3VA 2G2OA 4KH1B 1UFWA 1NJXA 4W90B 1ZZNA 4C3KA 4PG5A 2EK6A 1U1PA 4TQSA 2KT3A 3MMAA 5LM7E 3QMQA 3OUYA 3M6WA 2E44A 2GVZB 5KFNA 2V2KA 2XMJA 2Y3YA 4ZITA 3Q8PB 1CBKA 2UXCF 2MB0B 4RW8A 3QJLA 1GNKA 3QPIA 3KDOA 1GXUA 2VASA 3DRRA 1TK8A 3LQVA 1RBOB 2R7TA 2HVHA 4IH6A 4O4GB 4JBCA 3T41A 2AZ1A 2ZJQQ 4JI4F 1WHXA 5KFTA 4FBTA 2HQIA 3KK2B 1HBMB 2ZM6F 2ZWPA 3ILLA 1REVB 3Q89A 5LXRA 3D4JA 2IYGA 1DAXA 2V8VA 2BE2B 4EGLA 3POTA 4HL9A 3CCLS 2VD3A 2B9XA 2RKIB 2XWXA 4J91A 4ZVGA 2EFQA 5G0RB 2BYCA 4ZVRB 2FHMA 3MR2A 3KMQA 2MYFA 1DTTB 1VI7A 2BJ1A 4LFAF 4NI2B 3I5CA 2F63A 1UEKA 2ZC3A 1T05A 4NE9C 2PFFB 2XY7A 3MM9B 5KAKA 3JTNA 2UVWA 4YP3A 2LQJA 3WIUA 2CVIA 1JLBB 1Y11A 3MR7A 1SL0A 4KKOB 1IXKA 3DLEA 1VISA 3F73A 4ZPCA 1YJTA 4L6V3 1OSDA 2L08A 4F3OA 3IG1B 1S0VA 2HK3A 4GKJF 2PMHA 1PAUB 3W65A 1RSCA 3HULA 2A1BA 1VMBA 3OTCA 4RBUA 4Y0FA 1N5VA 3IMQJ 4HLBA 3I0SB 3BREA 2CFXA 2AX1A 1TKZB 1X4AA 1NZAA 2P6TA 5HVGA 4CCHA 4OI6A 2HGLA 1N48A 2DGSA 4EBCA 1NCLA 4P71A 2W7OA 3W60A 3MD3A 2WRMA 3UQSA 1BMQB 5DGAA 2KXNB 1CJUB 4CO4A 2BJDA 5DRKA 3IRWP 4EI2A 4NXMF 1NK8A 4DSKA 5B08A 1M5PC 4JI1F 1DURA 5IT9U 4FNIA 2DH8A 3G6ES 1HI0P 3IM8A 4HT5A 4CO0A 3C8YA 5HP1B 1RU1A 2ILYA 1SJ1A 2IAJA 4F25A 1YRUA 2C2NA 2V8GA 3NNHA 1HBOB 3MEKA 1TL3B 4F36A 3N4WA 4BC9A 3DM2A 1Q5VA 2QLXA 2OPRB 3MM6A 1WNEA 2FGCA 4UZCA 1VQKS 4C8KA 2F65A 2VPZB 4Z7YA 3LA0A 2VFVA 1S72S 5B0DA 4OLPA 3OSPA 1VBXA 5L9XA 3OTEA 3SDEA 1TFWA 4CNYA 4P2MA 3DDNA 2J0XA 2KG1A 5MAOA 1M0SA 3S7RA 4IFYA 3SEOA 4GC7A 3H20A 5KFUA 2RDIA 3UCUP 2DNGA 2KN4A 2ZZNA 2K7JA 3S01A 3PKMA 1UTAA 3AY0A 2OPSA 1I94F 1T9WA 2YNIA 4QPTA 2E9TA 3HHLD 5L39A 2HNDA 4CO5A 3C6UA 2JFKA 1SCJB 2OI2A 3A8IA 4CP5A 2YX1A 4CO2A 1VBYA 3BR9A 5GAHI 2ILZA 2I5JA 3UI3A 3WC0A 4K4XA 2R7UA 1WHVA 2IFXA 1FKOB 1VQ8S 3A4TA 4ZCMA 4RZRA 1C1CA 1M1HA 2FJWA 5HROA 2HS3A 1JKHB 4DV6F 1HR0J 1E6YB 1S6PB 2O5DA 3R5JB 4E8UA 2AHOB 2MKIA 2BOPA 1ZAXA 4ECXA 1R7IA 2HRYA 4LRCA 1IM6A 1C0UA 2V50A 3QT5A 2E5LF 1VQ7S 3MAAB 3ITHB 2ZD1A 4URGA 3PR4A 5JUMA 1KBRA 3M8QA 1SUQB 3TAPA 1HBUB 4CO1A 3UD5A 3BN4A 1BLUA 2GIRA 1UVJA 2AYBA 2YWKA 3GV8B 4DV7F 2MLZA 3CDAA 4J9QA 3C15A 3OL9A 2XCAA 1NB2A 1Z2LA 1ZM3A 3OVSA 2IHR1 5E41A 2EG2A 2VQEJ 1TKDA 4CH7A 2YKNA 4DFJA 2P8IA 2RQMA 1TMJA 4DX7A 4JI2J 4MMOA 1YJ9S 3OTOF 4ZVTB 4M5DB 3RB0A 1RT3A 3I9V9 2HW3A 1S4EA 2LECA 1S0OA 4I2PA 4USTA 1ZPVA 3KOAA 1HPZA 2RHQB 4Y2CA 1QE1B 4DL6A 3IM9A 2IBKA 3TZYA 2DY1A 1VBKA 1EKRA 4U8YA 2XMAA 4ZJOA 3M2UB 1D9FA 4NZ7A 2AWZA 5H9EJ 3GLJA 1D8YA 4KTQA 3W8PA 3QNWB 4F3QA 3RB3A 4NCGA 3UO0A 5B7WA 1NDKA 5F0UA 1CC7A 3TWZA 1WG5A 2RU9A 3NP5A 4ZVHA 2QTWA 3ULHA 2C2RA 3KNGA 1FJ7A 5HN0A 4RBTA 4KPCA 1RTIB 5ETVA 1J5OB 1D9AA 4CZCA 3ZZRA 2MZ1A 4C48A 5AE2A 3CJ5A 4Y2AA 3HFZB 4UQTA 1QUPA 4PCQA 5KFDA 1XMQJ 1FDBA 1YLXA 5IT0A 3OR1B 1VJWA 3A3PB 1FK9B 4LR8A 3L7OA 1FWPA 2H9ZA 3VVUA 1S59A 4B9VA 3MFIA 1VJQA 1LW0A 3EXCX 2G0CA 3HKWA 4WWSA 4PUOB 1JLEB 2HVIA 3PIPQ 1B0VA 4CIOA 2QMUB 5J2PA 4ID5A 4YMEA 5A6WA 2KU7A 2BMBA 4Q2MA 3Q8RB 3GB0A 1ZM9A 4X64J 2GQCA 1CEZA 2E5HA 4ECWA 1H0HB 1KN6A 1RYSA 5DLFA 1OYEA 1VR6A 1Q8LA 3H25A 5JVHQ 2FVCA 2MZQA 1QTMA 2DISA 2K1RB 2RRNA 5E2QA 2MQMA 1YI2S 2PI5A 2EC0A 4J9KA 4KGMA 2JWNA 5LMUF 3RRHA 3K2YA 1SKSA 3W66A 4FS1A 3D1QA 2Y1LB 4EWTA 2B4VA 2LMIA 2JEJA 2FD2A 3ZZOA 4FF4A 1UCNA 1TL1B 1RWMB 4ED3A 1FKPB 3CT9A 3KLHB 2FUG9 2I9SA 2LXUA 3FSYA 2EPIA 2B0GA 1SQEA 2KKHA 3EZUA 1DHMA 2P2CB 3R8YA 2WB4A 1FWKA 2NXEA 1EP4B 2MZRA 3MR5A 3FEYB 2UUCF 4F0MA 3EDRB 1UAWA 4WFBQ 4XPCA 1SI9A 4DG1B 4WZMA 2E29A 2AEJA 1U0HB 3PW5A 1PSDA 3R7SB 4QR0A 4LT6A 2XLJA 3LP1A 2GO9A 1VIOA 2V67A 4OHVA 3J7YI 1RWKB 2WZ1A 5HJXA 1RAIB 4JI0J 2DR6A 1OWXA 2H4YB 2DD8S 2HHPA 5D0GA 4O4GA 1FRKA 3CJKB 1F0XA 4IG3B 2WAQD 5DETA 1QVGR 2RF2B 1FWLA 3K5MA 4YY3J 2ZOFA 4ZPAA 1VQPS 1FRJA 1UKUA 2WW4A 4RUHA 5CCLA 1P1LA 4J90A 1REVA 2EFNA 1S4FA 2ASJA 3IAM9 3VALA 1N33J 1U24A 2AW0A 3LP2A 5J2NB 3K5LA 1SC3B 2DGXA 4LFBF 5KG6A 2IDLA 4CRJA 4X4PA 3EGZA 4WTYA 2XG8A 1IKVB 4LUBA 1XNRJ 3FBFA 3MM9A 4AYBD 1M5VC 1R8HA 4ZVPB 1RJJA 2MKHA 3OBIA 2X1AA 3HKZD 2V5HG 4KKOA 1RHQB 1J5EF 2LA6A 4MK8A 4PXCA 2RE1A 3M2RA 2IMWP 1T11A 1OPIA 2IRXA 3GIIA 3OVAA 4OJHA 1KVJA 1IM4A 3U1NA 4Z37A 1A6LA 2QA1A 2HVDA 3T6JA 5HQMA 2Z58B 3MTJA 4KY3A 1NK7A 3A1YG 3IO1A 4V1Ak 3KMSA 2OH2A 2UXCJ 3MAQA 4IOCQ 4G3IA 3PX4A 1Q79A 2AJ0A 1Q86T 4C6AA 1L5UA 1KC8T 3CDBA 2EBGA 4OX8A 1IKXB 1E6VA 3D54A 1JLGB 4LRBA 2D3O1 4DR1J 1FDDA 5BXIA 2QT7A 4KRWA 1RP5A 4PG6A 1ZS6A 4JI4J 4DN0A 2NZCA 2ZM6J 2E9RX 1UZHA 1GEHA 2BX6A 1Q1KA 3QAUA 2ZVIA 1H73A 1MWZA 1R8PA 5ETNA 3FBBA 1R0CB 1RYRA 1FTCA 2C3OA 1R0AA 1TL3A 1DRZA 4RW9B 2DRBA 2Q3PA 2OPRA 1SV5B 4K0KJ 2AYGA 2ABYA 5E3QA 3TJ9A 4LFAJ 1RAHB 2OIHA 1DJ0A 1MU2B 4DV3J 3KNAA 5I3PA 1U1NA 2M8DB 3OD2A 3NY0A 2Y8YA 2G1HA 1IQTA 4H54A 3TZWA 1BQMB 2VU5A 3TQEA 3DN9A 2LXFA 2YWEA 3KLVA 3F0NA 1S77D 4GKJJ 2JLEA 1S76D 5CYJA 3BV8A 4U7CA 2MZSA 2GC8A 2KM8B 2HNZB 3RBEA 3CDWA 4USVA 4USKA 2DNNA 5HK4A 3DGPB 5K8NA 2ZKTA 3W3SA 3KLGB 1UVMA 3FFIB 4OV1A 2CQ4A 2V34A 1ZA1B 3BQ2A 3C14B 4NXMJ 4KV8B 4OJ3A 4JI1J 3OFFA 4J9UE 3MM5A 3EYZA 1FKOA 4WXOA 4M1KA 4EZ6A 3DXSX 5M2PA 1RAAB 3TYTA 2KG0A 2J0WA 5D4OA 5ETPA 3QIPB 2I0XA 1JKHA 2CWKA 4E2FB 3OXFA 3PDNA 3BSCA 1DBDA 1PIEA 1GMWD 3L9ZA 3K17A 3DXBA 1UETA 1N34F 2HFNA 3TA0A 4L3NA 1WEZA 2N4CA 2BDPA 3ZTRA 3M1VB 3MWBA 4CI0B 1SUQA 3CJ4A 4OYOA 1HBUA 1ICEB 4M5JA 4LVNP 5J2QA 3FK4A 3G71S 3TA2A 5E3PA 3K59A 1W2BR 3GV7B 3M7VA 2GV1A 3P5BP 3BGRB 1ZETA 2ROEA 3NAIA 5AXNA 3EPIA 2OPQA 5D0HA 4X62F 2OSRA 2PD1A 2XS5A 2LXIA 1I94J 2MMYA 2GJ2A 1R6YA 2OMOA 3H59A 1C0TA 4U96A 3DCAA 4UT4A 1X5SA 3FQKA 4FXWA 4CM2A 1LV5A 3UD3P 2G0JA 4LF1A 2V8HA 1BWVA 4WP3A 4OX9F 4R5PA 1VQ4S 3WZ0A 4DFKA 1QE1A 1VRTB 1F1BB 2DH9A 2V4QA 3MR3A 4ILLA 4MYTA 2VKRA 4ED6A 1GXLA 4DUTA 3GIMA 2DNRA 4DV6J 5I3UA 2GW8A 1SKUB 1IUJA 2EKYA 5JXSA 1L3TA 5F8GA 2Q1LA 4DBQA 2VC0A 2WVCA 3KFWX 2CQCA 4DU7A 1MG7A 2JC0A 2CQIA 2HIYA 5THWA 2B9YA 4Z2XA 1T9XA 4JI6F 2AGPA 3C66A 3DHXA 3HCXA 1QVFR 3GR1A 1WF2A 4NLSA 1NUEA 3T19A 3CULA 5IXUA 3ZNJ1 3QZ7A 1RTIA 1J5OA 4QIVA 3MTKA 5GADI 2RB7A 1Q7LB 8RUCA 2XMUA 3M4XA 3PW2A 4CNZA 4K4SA 1FD8A 3TARA 1N5YA 4DV7J 3CGIA 2FJVA 2QGFB 4K50A 3EXYA 1FHTA 1TKTA 3FNNA 4DPYA 2ZBQA 4NXNF 6FD1A 2POKA 3CJ2A 4P2SA 2IDEA 4USIA 1WDDA 2WVEA 2DH7A 2QX0A 3G96A 3BBBA 3EGWB 5ITHA 4PWWA 1R6VA 3VGTA 4FPIA 3SQOP 3ONQA 4M5IA 1UVLA 2HHQA 4P7VA 2UV8A 4LFCF 4A48A 2KRBA 1RLDA 3FMWA 4DMZA 2AJQA 1HWLA 5GMDA 3QRPA 1CC8A 3N9UC 3PJ9A 2U2FA 4B17A 3OJUA 3RAQA 4X4NA 1VDHA 4MIAA 3D2WA 4PXEA 1QD1A 2H5IB 4PWDB 4DSIA 4Y6IA 2DPIA 1D9DA 1HMVA 1RHUB 2H5JB 3J7A1 2ASYA 4WK3A 1FA0A 3I6PA 2ZHBA 4DL2A 1S1XA 1AT1B 3OFGA 4PZVA 4C0BA 2IA0A 3IRXA 4MH8A 3BYRA 3MEDB 3RAXA 3I4HX 2GAGC 4XIUA 4QW9A 3CCJS 3HDSA 2N4DA 3KHGA 1D3WA 4IR9A 2PA3A 3G2XA 3NKYA 4DSLA 5CQGA 4ANCA 2K1RA 3PW4A 4KJIA 4LVOP 1KEKA 2HQGA 2ADBA 3DKDA 4FVCA 5CYMB 2IJFA 3NGUA 4WTOB 4PEOA 2XY5A 3GR0A 2WVBA 1TAUA 4JB8B 1TL1A 4YDXA 5J2MA 1FJGF 1BQNA 3NWRA 1Q95G 2F9DA 4N8NA 5A0YB 2ZBPA 3IBFB 4OLOA 5E3CA 1IWAA 2R2UA 4LSZB 2B4OA 5HVFA 3IS9B 1EP4A 1K8AT 1TZ0A 2FTRA 2CJKA 2KVIA 4G6VB 2FHKA 4A8SA 1M5SA 4DG1A 2DITA 1S5ZA 5LOQA 3PYFA 4EBDA 3LGHA 3MHYA 1RZMA 3V5RA 1U0HA 2IC3B 3OTBA 3KHLA 5DDQC 1HYSA 3LW5C 4MK7A 1S1UB 1S9EA 4FYDA 1NXIA 1EB0A 3JTOA 1LWFA 1WG1A 3HXMA 1YX2A 2QZ8A 4FF2A 1YBAA 3PCOB 4F0KA 4IG3A 4C8MA 4PPZA 2R8JA 4F2SA 1NHUA 2RF2A 3E2EA 2WCXA 1RE1B 1H72C 3GCWP 3U02A 5KG1A 1V3RA 1C2PA 2ROPA 4KE5A 3FSXA 2ZBCA 3IN5A 1VQ9S 2M7SA 1U7LA 3UWTA 5LMUJ 1JXVA 2CQBA 2OEKA 4KHRA 5IZHA 4ZN1A 3S6EA 2H54B 4OMFG 2ZH5A 2DGOA 1PJ5A 4KO0B 2DBBA 3UN5A 1XEZA 3UW1A 1WOOA 1R3NA 2FHJA 1HD0A 2OJ3A 3OJSA 1UWBA 2UU9F 2DYAA 1NDLA 4RBVA 1TK0A 3TNVA 1IKVA 3CSKA 1NJIT 1J2VA 1SL2A 3R5BA 4U8VA 3B8HA 2DXEA 2OP5A 4H4OB 3T6BA 4J9SA 4WFXA 3V2UC 1KD1T 3LPYA 1U45A 4O3SA 4ECRA 2WBMA 2HHSA 4OV6A 5DDPC 1PGZA 2UUCJ 2K3KA 1VYAA 1D1UA 2RQ4A 1KRPA 4MKVA 1B0PA 3G8TA 4IDKA 3MM8B 4WBFA 3C2PA 2FB0A 2ZUAA 2J5AA 1KQFB 2M52A 3D0IE 3SXLA 1NSAA 2HFVA 2J8AA 2RT3A 2OMLA 2XYHB 5A2QU 2ALYB 4QW8A 3BQ1A 1JLGA 4ILMA 4F50A 1FRHA 2LEAA 5IS2A 3UVJA 5IWAF 5ETMA 2CVEA 2PT0A 4R0EA 4DR7F 1G7CB 4QWEA 3LF0A 2EG1A 3QO9B 5EUHA 2MQOA 1C1BB 3KHRA 1L3KA 4ZCIA 1X5PA 2WONB 1AFIA 1TMMA 2DJWA 4TNOA 3JAMU 2R7SA 4LFBJ 3L3CA 2F5GA 4DR3F 2VJUA 1N6QB 1IR1A 1LWEB 3WIVA 3H7HB 2ZH6A 2FDNA 2CXEA 2LQ9A 2ZOGA 5A8KB 1FE0A 5ADZA 1J5EJ 5D3GB 3QIDA 3QWPA 1IR0A 1NPRA 2HQDA 4ZOSA 2E1CA 2X1FA 2RDDA 3WDOA 4UZBA 2OPPA 3NGDA 3EX7B 3P49B 1PAEX 4UOFA 2BJEA 4OI1A 1WC6A 3DI6A 2R2TA 3DLJA 1YTYA 2GQ2A 1HBNB 3PVXA 3EJMA 1PO6A 1T95A 2AGQA 3IBCB 1UVIA 1S6QB 2BQRA 3LP0B 3K5OA 1Q8KA 3DGPA 1RBLA 4NPOA 3EDQB 1TKXA 2DNPA 3KLGA 2WSCC 4DR6J 4F26A 2GS8A 2YWGA 1WJ9A 2C28A 1RAOA 4M5LA 3C14A 1RT1A 4DPOA 3DOLB 5J1PA 1NH8A 2WVFA 1KTQA 3BGUA 2YNHA 2BABA 1S48A 2EBEA 2EFVA 2ZE2B 3AD7C 4UOCA 3KG0A 1LFPA 5GAGI 3U7JA 3BGLA 1FKAF 5EGYA 3KJNB 1B0TA 2HNYB 3J7YU 1TV6B 1IBCB 5LJ3Y 4KIAA 1SBRA 3I31A 1RKJA 4ED5A 1Q78A 4FKYA 5BYSA 1R8BA 3EGNA 1VC5A 1RQ0A 4CTAA 3P4UB 1XNQF 3BKTA 3H0PA 4W92B 3PZPA 2QSWA 2ZBIA 4B3OB 2VPXB 2YNFA 1M5KC 3EUNA 4HTIA 2UUAF 2XSJB 1UW4A 3RU0A 4ZPDA 1TQLA 1VIXA 3AOAA 1HD1A 2V4JB 1HKAA 4CLPA 3CJ0A 4HVZA 4KFBB 3VQSA 2MGZB 5GAEI 3GCXP 4AL5A 2X3DA 1RWNB 5ETLA 3UD4P 4C0HA 4KGXB 2F4FA 3KUEA 4L75A 2XMTA 5KFJA 4IH5A 1Y0HA 1HNVA 1SVDA 2IM2A 3MPWA 4WKRA 2YNGB 5AXKA 4N8OA 3B4MA 4PQUB 2ALZA 1IBKF 2V2ZA 2BANA 2KJVA 4M95A 3RG6A 1N34J 2HBZB 2LU2A 5HQLA 3R2CJ 2HQFA 1YKWA 3MM7B 3BF4A 1WOSA 3HVAA 2E9ZA 3TA1A 3TEGA 1O51A 4QWCA 3CIZA 1CJTA 5G4DA 2VG6B 3D3CJ 2DKOB 4C11B 3GJSB 1LWCB 2XO7A 3GPAA 5C5JA 1RCOB 1X8DA 1VOMA 3H42A 4RW7B 3C3LA 1TAQA 3VVTA 1N88A 3HHLA 5I42B 4GVBB 1U2RA 2HLTA 4NA1A 4ECTA 4TLQA 2ZDPA 4NLGA 4OQJA 1Q5YA 4LF6F 2XI3A 3FSIA 1HA1A 2H5EA 4GKKF 1VC0A 1T94A 3I5BA 4OX9J 5L46A 5K9FA 3Q8SB 3PTWA 4TU9A 3VAJA 3LGMA 1Y00A 2AJFE 4F4ZA 1AB8A 3HO1A 1HQ2A 4UW2A 2BEFA 2ZHOA 1NK9A 4UTGA 4G1QB 1NRKA 1MLAA 4L74A 2DRAA 2A0FB 1RT5A 3KG4A 3SSRA 4TQRA 5KFIA 2V2QA 3DLKA 3DRPB 2LEBA 3MUVP 1U8SA 1WACA 1LW2B 2JVRA 3H8YA 3PHTA 1QJHA 2R7XA 2Z4PA 3ZC4A 4CLSA 4J5OA 3UCZP 1YBUA 5KT3A 1ZTWA 3X3UA 1ZYQA 2M4MA 2A2DA 3J80Y 3TI0A 3HD2A 3NCPA 4K5RA 1XR7A 4YDDB 4I56A 3I0RB 4RLEA 2FJEB 1M5OC 4H4MA 3A12A 3C16A 1T03B 5B0GA 4NLRA 4XDDA 1RI7A 5CA5A 2EEYA 3V4IA 4K59A 4I69A 5F9NA 1ELOA 4LMZA 3OXLA 2F8MA 3GFXA 3FDSA 3M32A 2C42A 2DNOA 3PKYA 2IC3A 2MZJA 1YK9A 4QYZJ 4DF4A 2FZKB 3PYDA 2MHEA 4BHQA 1FX4A 2EFGA 3Q23A 4J37A 3FEXB 1F3FA 3RRGA 1WORA 1BE4A 2C3UA 2RMLA 1L3VA 4IR1A 1Q7YT 4C2MA 4C8YA 2LDIA 1R43A 3OFEA 3OLBA 3KHHA 1WOPA 5KFHA 3KUGA 4HT7A 2IRYA 4NLWA 1Q82T 1RHJB 1Q4RA 3HK2A 3FRYA 2YPYA 3MECB 2Q6BA 4ZP8A 3TAMA 4HH0A 3NMAA 3A8KA 4CYUB 2NS1B 3SCLE 3G82A 3RR7A 3JQKA 3EVWA 4TY9A 4ENOA 5BR8J 2YKPA 1DQ9A 4RJVA 3IXQA 2VFSA 2ZNYA 4DSFA 1MMDA 5K14A 1NB7A 4QU6A 1UPPA 3ET6A 2V6AA 2IBOA 5ETKA 3FCWA 4H4OA 2FIUA 3L95X 4KGKA 5T7LB 2BR0A 2F1FA 2CPEA 1KS2A 2KI2A 2LCWA 4I64A 3BKFA 1YDLA 4OZ3A 3T5JA 1IKYA 4USMA 1NK5A 3C19A 3RJMB 1KDNA 2PEBA 1AZSA 2WVDA 1QSLA 1NK0A 2VJVA 4M5MA 3TQ1A 2QL7B 5K8PA 3MM8A 3CCQS 1P27B 3W5XA 3N6NA 2E7WA 5GADU 2EI5A 3N28A 2YTCA 1XMOF 1OY8A 3KXDA 2BQUA 5KG3A 4MFBB 3ENVA 2H51B 3D68A 4CLWA 3JQMA 3EVMA 3QO9A 5M2RA 3SMZA 2FJBB 3EZ5A 3TVZA 2YWHA 4C97A 4ETXA 3E3XA 1X4FA 4ED2A 5B0AA 2WONA 3JYTA 4ZHRB 1O6XA 5U47A 4J9MA 1IN0A 1S7HA 3OQ2A 2YKQA 5HLFB 2ZH1A 2UU9J 2B9EA 1HWKA 3MMCA 2CZVC 3IR5B 1NNDA 3W1YC 2YBVA 2HS0A 5EDWA 4TY8B 2PSZA 2FJAB 3FZ2A 1NH7A 3GFHA 2I38A 3D7SB 2VG7A 5KT7A 3QYYA 2HHHF 1T8EA 3PRDA 3NAHA 1VLYA 2VHGA 3CO0P 4YS2A 3RAMA 1MNEA 4IYQA 4CH1A 4DUZF 4V19X 1PBAA 2J9CA 3PR5B 1VRQC 2DHGA 1YJUA 3LP0A 3G4SS 2BE9B 5CABA 2Y1JA 2QLBB 4I6AA 1N4LA 1O8BA 1U8WA 3CTRA 3DU6A 5IWAJ 4YFUA 2G9OA 1NEEA 4AE5A 2DNMA 4IFVA 4DR7J 1O5JA 1RT4A 2I1RA 5DQHA 1IBLF 2PN6A 3HX9A 2HWHA 3TR5A 1U1KA 3R27A 1RTDA 4B3SF 1HQEB 1BD6A 4BCAA 3BGFA 4QU7A 3NBPB 5D77A 5HATA 2Q79A 2JX2A 4LR7A 3MMBA 1ZZFA 4ZIVA 4DR3J 3EZOA 1OPZA 1CULA 1MN7A 3KWMA 4OZ1A 4B9UA 3IGVA 4FYXB 4ZN3A 4AXIA 1JWWA 1RAFB 5HSPA 1WELA 3UDEA 2F40A 2BW7A 3EE3A 3OR2B 4FNHA 1FERA 3HVRA 5SUHA 3W9HA 3HI9A 3I82A 2BA9A 2W2NP 3HHNB 2DGUA 2HAIA 5HBMB 4DS5A 1T9VA 3BH7B 3AT1B 4NYPA 4B9MA 2OO4A 3B4DA 2CUYA 1FRMA 3DMJA 4OYIA 3RB4A 2XSJA 3H5UA 2HURA 2YWFA 4WPAA 1UVKA 3CJ3A 3OT9A 2KYXA 4M8LA 2UUBF 4IUFA 2HZCA 2FHOB 3DC2A 2MQLA 5CCMA 3M30A 5KFMA 2AF6A 2D3UA 2MGZA 1KNZA 1SQGA 2ZWOA 4JI3F 3DLHA 1SJRA 1QAIA 3G6YA 4KQZA 3BDEA 2J8SA 1JIHA 4Q8FA 2W1BA 3E8OA 1X60A 4A8XA 1CJKA 3VAIA 1UMJA 1HHQA 2R7VA 5KG4A 4S0MA 4NLQA 2VBXA 3ZTOA 2HQ3A 3DYAB 1S9FA 5A8RB 3D67A 4LQ3A 3I87A 5HJYA 3R1LA 5FDLA 2B3TB 4DV5F 5D78A 2GJFA 2F4VF 1HWUA 4DWIA 4K4UA 2DO0A 3CVKA 2ZUGA 4NL5A 5DO2A 3GONA 1WHWA 4YUDA 2CPHA 2H3EB 2WK4A 3PRVA 4UF4A 1S6UA 2QLFB 2CQPA 4A4JA 3HVTB 4FBUA 2KT2A 5EWFA 2ROGA 3TAQA 2NR0A 2BUNA 4OZLA 1KLMB 1T7PA 2UUAJ 3R6LB 4X66J 1RT7A 2XEXA 1Q0NA 3U27A 2MKSA 2GO8A 2RSQA 2XZTB 4RL1A 3P6YC 4RW6B 2KB2A 1AYEA 6FDRA 2AV5A 2GFFA 3O3LA 2OKQA 2UVVA 2F7VA 3BR8A 1NO8A 1MROB 4MIBA 3PO5A 4LREA 4RUCA 2XNQA 3GG1A 1RTJB 5C25A 1JLQA 2CJ9A 3VTIA 2HHUA 3CD5A 1PC5A 3QRQA 3U1LA 2MKCA 1XK8A 1Y10A 3PY8A 2IM0A 2JFDA 2K06A 1GMWA 2W9CB 4XO0A 3DRPA 3MMJA 4JI7F 1IBKJ 5HO4A 4WE1A 1DZ5A 1QUVA 3AJDA 3DHWC 3RUBL 4A8WA 1ZOTA 1FI4A 1ZA2B 2EWHA 5DZ7A 1XC9A 3VWSA 1M5HA 2ACMA 1X4CA 4O44A 3EM1A 3FUYA 3G8QA 5IC6B 2FYXA 4KR0B 2W24A 3I0RA 1GH8A 4OJ1A 4YR0A 1RT2B 1JXLA 3VZHA 2L3MA 2IVFB 1EIYB 5T14A 2N7YA 4FS2A 3IBWA 3RR8A 2W8LA 4O23A 2ERRA 3BZQA 4ZIWA 2H1YA 3UDLA 5AT1B 4KHMA 1XR6A 1EETB 1VK3A 4X4TA 1HL6A 3IA0A 5GAGU 1RKIA 5L1JA 5KG5A 1JX4A 1FEHA 1RWPB 4LF6J 2G4BA 2XYGB 1LK5A 5M2UA 1BQXA 4GKKJ 3HZGA 3QSIA 3QZ8A 4ZVUB 1JLAA 4X65F 4EYIB 4IQXA 1UFKA 3NOGA 5J1NA 4LF8F 3SBMA 1YJ7A 3ZZYA 2WOMA 2HPUA 3BO4A 7FD1A 3SFUA 2XHWA 2B6AA 4USJC 5I3QA 1MWQA 2IVYA 4K4TA 1FVSA 2KHCA 3MEGB 2OELA 3V6JA 5E0OA 1HNXJ 3ICLA 2W2PP 1TVRB 3FZBA 4DPTA 5A8WB 2D41A 2GAHC 2QC3A 3V81B 5AE1A 3ETOA 5GAEU 1U25A 2OD6A 5CHCB 3LTOA 3W2WB 2KM8C 2G2YA 3NCRA 4ZS6A 1FRIA 3PW7A 4ECQA 5JVGQ 2NZ4A 2GVDB 4NEZA 3TUZC 1LXJA 1ZM2A 5K20B 4ZA1A 1LKZA 5J1EA 1FCAA 1BUXA 5T7LA 2HZAA 1OQ6A 3D3BJ 1XIQA 1Y3JA 2DVIA 2PI4A 2ZNZA 1NKBA 2GMLA 3SIPB 2NPIA 4HHHA 2GGPB 3CJ8A 2AZ3A 1JMTA 1K1QA 4KC5A 1YRTA 1UL3A 8ATCB 1JLCB 1Y5IB 1VS3A 1AA1B 4P52A 4DPWA 3QAEA 5IQQA 5D15A 2X1GA 4IG0B 2ZJRQ 3SFGA 3H98A 2ACYA 5DG7A 1RWUA 4UQGA 2JC1A 2JOQA 5ETTA 5L8RC 2JEFA 2J76E 1KKHA 3F41A 2BRKA 4MFBA 1PCAA 5L9NA 1NBEB 4QIWD 3WBZA 4R25A 1EZZB 1HFEL 1T9TA 2CADA 2CPJA 2RH3A 4C4WA 3SCKE 3LWMA 4DZDA 4O4RA 4LRAA 3DRXA 4ZHRA 4ZVOB 4O0NA 4EFAC 2DIVA 4O3OA 1W2IA 3UN3A 3CW2C 3DOMA 3KLEB 2AD9A 4QYRA 1S9GB 2G0IA 4Q0BB 3GP9A 2YQ1A 3TW0A 1C4CA 1RB0A 2MJNA 2DHHA 4PG8A 3O8WA 4NZ0A 5KFWA 4X4VA 4C8ZA 2A6OA 5KT2A 4TY8A 3ENWA 3GZ7A 4RUAA 3MMAB 3GV5B 4Q43A 3OUYB 4AQYF 2CJBA 2HEKA 3KLIA 2QYGA 1KSPA 5E3AA 2HRTA 2FC8A 4Q2LA 2XMVA 3AJ2A 3VQTA 5LMNF 1Z4UA 2OD4A 3MCMA 5B0EA 4X4OA 3DRRB 1S0NA 1H98A 4F04B 4IQMA 2DTJA 4ICLA 3PHEA 2XLIA 1YJVA 4DL5A 1BC6A 1KQGB 2XMWA 1P9YA 2MEWA 1T0TV 3BSAA 2DRDA 1XMOJ 2E1RA 1VRUA 3ZZUA 3QFHA 3EICA 5LSOA 1YVFA 1K0TA 3VF0B 4LRDA 2K3IA 3AJ1A 1ROFA 2A10A 4P75A 3IGNA 2XGPA 4ZCKA 1U1MA 3B54A 3PV8A 1Q53A 1HWIA 3FGVA 3T5LA 3RYLA 3G86A 1HQEA 5AXMA 2ATLA 1SH3A 4A8OA 3UNGC 4F02A 2W9BA 1OQ3A 2MZTA 4NLDA 8AT1B 3R9LA 1TK5A 3NS5A 4D3GA 4I6WA 4OHYA 2B5JA 1PBUA 1P1TA 3GFZA 5KFRA 1NPKA 2I2YA 3H4BA 1L3SA 4G1IA 4ER8A 1K73T 3DLEB 2KH9A 4NRUA 4C8OA 3GJTB 3HHLC 1AXQA 1O0PA 5HMWA 4HHUA 4L72B 3MPYA 4P10A 4B3MJ 3OL6A 1UA0A 1HWJA 3D0GE 3OR2A 2OGUA 3KJVB 5C42A 1DY3A 3FC9A 5KFVA 2HHHJ 3DRYA 5HBMA 3MPDA 4N56A 3Q86A 3I5AA 1ULRA 3QLHA 3OSNA 3JB9k 4DUZJ 3MEEA 3US5A 2N82B 3ISND 4QIFA 2E5GA 1H2UX 1UA1A 5FLXY 1CQMA 4A8FA 2HFUA 5KFEA 4IOAQ 1SC6A 2HHXA 3V6KA 1WEYA 3K5NA 1ZPWX 3O2IA 4OZ0A 1PJ6A 3FMBA 1ACMB 1YZ7A 1EHWA 2XLKA 3N6MA 1B7YB 2IAJB 1D09B 4N77A 4NLPA 2J7UA 2P9CA 1IBLJ 4Q44A 4B3SJ 4PQAA 3LALA 3DM2B 4TLRA 5RUBA 3MM6B 1NZ8A 3WC2A 1NLKL 3DYAA 1WEXA 3V4MA 5A8RA 2DIUA 2ZC4A 1RA7A 3ELHA 3PXGa 2A2CA 3IFEA 2ZKUA 1SQFA 3SDEB 3M8PB 2OEJA 3OHBA 3TANA 3CCUS 4LIWA 4MIWA 2GMJA 5EX3A 5DM6Q 2WBRA 2IY5B 2VV5A 2M88A 2GA7A 5KFAA 1RK8A 3EPGA 3OXGA 3TZXA 3CCMS 1WC0A 4O3QA 2OPSB 1S1VB 3O6QA 4P74A 1V6HA 2HNDB 3HLUA 1TUGB 3CNQP 4JV1A 1A9NB 3CD7A 1GX6A 2UXDF 2UUBJ 5K8OA 2FC9A 2GHWA 4AL6A 1AFJA 4MTPA 2FJXA 2W4CA 3TVKA 3PYEA 1X9WA 3CB4A 1MROA 2VBZA 1URNA 2SXLA 2CJXB 2RUSA 2KFZA 1C1CB 1URRA 1F2GA 5HROB 3J81Y 2CJAA 1AUDA 4K5SA 2GVZA 4CO3A 3ZZTA 4AL7A 4ED8A 3K8VA 2FLPA 3M8YA 3M8RA 4LBPA 1MSWD 1H7XA 2ASLA 4PWUA 2OSQA 1C0UB 1JJ2R 3ADAC 4HR2A 3E01B 5EX0A 1F9EB 1KONA 4NYOA 4ZLJA 4CWBA 3TUIC 4DJBA 2F4VJ 3M8QB 3M6XA 2AMCB 1LNQA 1HARA 2CNNB 2CPDA 3KK2A 1HBMA 4DR4J 3R7BB 4OX7A 3LAMA 2J6SA 2RQCA 3C15B 1FESA 4BWJA 4DCOB 2VBYA 3NCQA 3MUMP 1UVNA 1NU4A 3AQOA 2BE2A 3DLLQ 1I6JA 4ZVSB 5B09A 2RKIA 1N54B 3T1YF 2YKNB 4RW4B 5G0RA 3H2LA 4H4KA 4OHXA 4JP8A 3X1LB 1WTFA 1DTTA 1RT3B 3I32A 1S1WB 4FYYB 1HNZF 4NI2A 2XBPA 2PMWA 3M8WA 2BJ9A 1KTVA 5F8NA 2W01A 1EETA 3A3NB 4I2PB 4AUKA 2XZDB 4Y00A 4YR2A 2PO4A 1JLBA 1HPZB 3LO3A 3P5TL 2AIRB 2B9WA 3U1MA 1VCTA 3R1HA 3IG1A 2NXCA 2UUWA 2GIFA 3QSYB 2VODA 2QO3A 1RWOB 3H2VE 3OHAA 3I0SA 2C3MA 1GAOA 1FTRA 1WDTA 1RAJA 2NCKL 4NCGB 1TKZA 4OL8A 5HAOA 3KUHA 2AU0A 3OL8A 4ED4A 1U49A 5HMYA 3OPKA 4K4ZA 2DY9A 3HHDA 2NXUA 5FIIA 3QATA 1I5OB 2EFOA 2HGMA 3KTQA 2MHNA 3HHEA 4QPXA 1CJUA 5B0FA 3SV3A 3V81A 4ZJLA 2IJRA 3V6HA 1RTHB 3RRKA 4RUBA 1B7FA 5GMEA 3EWGA 5HP1A 1CJVB 1WF0A 1LEOA 2F9JA 1EARA 1IBMF 4MT1A 4PAAA 1HBOA 4DFMA 2GVDA 3JQJA 2HG4A 2CQDA 1ZM4A 5FJ4A 1EX8A 3Q24A 5ETRA 3N6LA 2E7VA 4QJVA 2V94A 4JOUA 4LSNB 3CXCR 3C6TB 2VC1A 1OJ4A 4ZPTR 5J2PB 4ID5B 3GMGA 4OYBA 3GFYA 2VG5B 1HW8A 1R31A 4YQWA 1JLCA 3DGVA 2FY8A 4CT8A 1T02A 2OLWA 3FCVA 4LF8J 2Y1RI 4KB7A 1CG2A 2W4DA 3CJSA 3NOCA 2HBRB 4HDHA 4EZ9A 5JJBA 4WZQA 3FVYA 1FT8A 4B02A 2V2VA 4ZP9A 1SH0A 1RADB 2PEHA 4ZVFA 3J7Z5 1RBAA 2D1CA 2MSSA 2Y0SD 3AB4B 4YN3B 1U02A 1UFLA 4LF5F 1QAXA 1YSJA 3RBZA 4OZJA 2HBQB 4CLUA 2LDYA 1WF1A 2KJWA 2VFUA 4YB5A 3JAMY 3BN7A 1I51B 1PYTA 3M6UA 3QT8A 5HVHA 2YQ0A 4JYAF 4TXSA 3PO4A 2RHSB 3KLEA 4DI6A 1KWMA 4NA3A 1V3ZA 4BDPA 1E6YA 4MAKA 1S6PA 2Z2YB 3GWCA 4YHHF 3IWLA 2HQCA 4RU2A 2X7IA 1OO0B 1PJ7A 3R5CA 2CPXA 1GX5A 3I96A 2CDQA 4AD6A 2W9AA 2GJIA 4J9OA 4FZVA 3KK1B 4CM0A 4KGZB 3SSQA 4LRFA 2BKNA 3M9MB 4B3RF 3BYPA 3MAAA 3ITHA 5F3TA 5KFFA 3LP1B 2BM0A 3NNAA 2VOPA 3A3OB 3KK3B 3QGHA 4I7FB 2CQ2A 4ZVQB 2Z2ZA 1ZAVA 3MAHA 1AW0A 1NAQA 5E3RA 1UZDA 4ECYA 3NGKA 4DR1F 1UW9A 1LQ9A 1CSJA 2XSFA 2D7SA 1R89A 1JXEA 4LSLB 1Y4ZB 4F4AA 2VQFF 4KHPF 4P2FA 2ZH8A 4IH7A 2YXLA 5D0EA 2X1BA
chains in the Genus database with same CATH topology
3QRPA 1WJ9A 5H9FK 4DZDA 2Y9HA 5H9EK 3QRRA 2Y8YA 2Y8WA 5CD4A 4U7UD 3QRQA 4QYZK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QRP A;  1WJ9 A;  5H9F K;  4DZD A;  2Y9H A;  5H9E K;  3QRR A;  2Y8Y A;  2Y8W A;  5CD4 A;  4U7U D;  3QRQ A;  4QYZ K; 
#chains in the Genus database with same CATH topology
 2J9E A;  4FF3 A;  2BAC A;  4M5D A;  2G1D A;  3PRB A;  1VHI A;  1GK8 A;  3MI7 X;  2R7R A;  2E1A A;  3HD1 A;  3LP2 B;  2K8G A;  4ZLN A;  1X0F A;  1UJ4 A;  1P6T A;  2Q6C A;  4K0K F;  4USU A;  4BC7 A;  2HKE A;  3CCS S;  4XK8 C;  2V9W A;  4DCP B;  4DV3 F;  1DFD A;  1EQ0 A;  1NDP A;  1W26 A;  2NSB A;  3HT0 A;  3M2U A;  3M2R B;  2C2O B;  5A76 A;  2UP1 A;  2HHT A;  4G65 A;  3R5A A;  3I55 S;  2MDA A;  2KO1 A;  4AQY J;  2XC9 A;  2BOA A;  1GTE A;  3KJV A;  2HBY B;  1OIA A;  2ADC A;  2E5L J;  4RU9 A;  2QIF A;  3PAC A;  5DM7 Q;  2VZ9 A;  4UOH A;  1Q16 B;  4IRK A;  5C2G A;  4F8R A;  2LQ8 A;  4NOH A;  7FDR A;  5LMN J;  4X4S A;  1HIY A;  4J9R A;  1XTZ A;  4CLY A;  4I1T A;  3W2V B;  1PG5 B;  4DQI A;  1Y9O A;  3R3T A;  2CZ4 A;  1IWG A;  1E6V B;  3L4B C;  3Q2T C;  2NSC A;  2OFH X;  3CCR S;  2J0Q D;  3OR1 A;  2QV6 A;  2FVS A;  3BDP A;  1FK9 A;  3M8Z A;  4HI1 A;  2Z30 B;  4EK2 A;  3MD1 A;  3PW0 A;  1DAR A;  5EWG A;  1OY6 A;  4LF2 A;  3BM7 A;  3OTO J;  4ES2 A;  1FO1 A;  3CC7 S;  4DL4 A;  1R0A B;  4PUO A;  3OL7 A;  3UDC A;  1JLE A;  1R8A A;  2D74 B;  4ED1 A;  2MKJ A;  2YX7 A;  2CJQ A;  3HT3 A;  4Q5V A;  2M70 A;  1WC3 A;  9ATC B;  2JHE A;  3GSI A;  2O66 A;  4A8K A;  3DNC A;  1OMS A;  5IQ6 A;  4FVM A;  4NEY A;  3GJQ B;  1VQM S;  2V63 A;  3Q8U A;  3P96 A;  4DSE A;  1MML A;  3WHI A;  1SC4 B;  3CIM A;  1WKJ A;  2RRB A;  2D9P A;  3NXZ A;  2XMK A;  3VR1 A;  2B7C B;  2Y0B B;  3M8P A;  2E66 A;  4IRD A;  1RAE B;  3G9C A;  5H1S V;  5D8H B;  3R2D J;  4PR6 A;  3I56 S;  4Y2K A;  1Z1Z A;  4RWW A;  4DV2 F;  3VAK A;  4J7C A;  3D6T B;  4OYA A;  3ZTP A;  5DJB A;  4DUY F;  2VBW A;  3GYN A;  5IV4 A;  4D3H A;  1S1V A;  1QLN A;  3W61 A;  4A47 A;  2DK2 A;  2H4W B;  2ZIT A;  1HNI B;  5KG0 A;  2HYI B;  3NG8 A;  3NS6 A;  5GAH U;  5DDR C;  5D4L A;  4YB7 A;  4ANE A;  3GU0 A;  1FKP A;  3BJY A;  3ZTQ A;  1DTQ B;  5ETS A;  3KLH A;  5KFK A;  4JI8 F;  4N47 A;  2YH0 A;  3MM5 B;  2CRL A;  1HQU B;  2DNZ A;  4RX6 A;  2D3Z A;  4C8N A;  4C7Q A;  2QE5 A;  4HAC B;  4DOZ A;  3T5K A;  2JVO A;  3LUY A;  1FNO A;  4NML A;  1ITP A;  2CQ0 A;  2LLZ A;  1BHN A;  5IM0 B;  1YQH A;  2R3V A;  2YQ3 A;  4B9S A;  1W7W A;  4A8Y A;  2C2Z B;  1NK4 A;  3OV7 A;  1A0O B;  3OTD A;  3H90 A;  2DHS A;  3E01 A;  2XNR A;  3CJK A;  3BPS P;  1H2T Z;  3BPD A;  3LOU A;  4PKD B;  1L3U A;  5J2Q B;  5MLC V;  1OYD A;  1YJR A;  2LEP A;  4QBU A;  3G8S A;  5L38 A;  3CUN A;  4J9P A;  4V19 J;  3W63 A;  4N5S A;  4ITS A;  4LF9 F;  4U9R A;  2VFT A;  4HHJ A;  4OZN A;  3GIR A;  2OPQ B;  4X4R A;  4MJK A;  2DR9 A;  2C3Y A;  4RW4 A;  5J2N A;  1S57 A;  5D4P A;  3HSG A;  3TJA A;  2VH7 A;  5KT4 A;  3M05 A;  2J9D A;  3G6V A;  3TUP A;  1C0T B;  4ZLP A;  1FX2 A;  5IV3 A;  1S1W A;  2UXD J;  3QJP A;  1Y3K A;  1S79 A;  2QL9 B;  2LA4 A;  3KJF B;  1EJ7 L;  2XWY A;  1X7V A;  2YY3 A;  4DEZ A;  5KG7 A;  1B4S A;  2N3O A;  5BJR A;  4R5P B;  3MCS A;  2PMZ D;  3BGO P;  3CC4 S;  2ZBR A;  2IRU A;  1U1Q A;  1F5C A;  2QA4 S;  2Y1I A;  4FPR A;  5DS7 A;  5I3U B;  4FP9 A;  4AXJ A;  2B56 A;  3DFE A;  4CLF A;  2HS4 A;  4JV2 A;  1Y7P A;  3T3F A;  2DNY A;  3DRS B;  3JXO A;  1K47 A;  2XGQ A;  4C8L A;  3THT A;  2HFO A;  3DDI A;  2PFD A;  1IKX A;  2HFZ A;  4WJB A;  2KZZ A;  1RT6 B;  1VBZ A;  1HHT P;  2MST A;  2XY6 A;  4OFZ A;  4WYL A;  1H38 A;  2R4F A;  1N5Y B;  4FN5 A;  1S0M A;  5IC4 B;  1RTH A;  3NGS A;  1TKT B;  4I68 A;  5E33 A;  2YVS A;  1CJV A;  2CNL B;  4NX9 A;  1RDR A;  2H48 B;  3T1Y J;  4O3N A;  2JRS A;  2M0G B;  4RW9 A;  3D9B A;  4GC6 A;  4AT1 B;  3CJT A;  4RNH A;  1FFG B;  1SV5 A;  4TKT A;  1QY7 A;  1WC1 A;  1HNZ J;  1U0S A;  4PG4 A;  2GHV C;  4LSN A;  3JS9 A;  3WQP A;  6AT1 B;  3C6T A;  1MU2 A;  4ES3 A;  4P7T A;  4LF4 F;  2QLW A;  4ELU A;  4P6Q A;  4WF9 Q;  4NLO A;  2VG5 A;  4K7Q A;  1BQM A;  3W64 A;  1F9F A;  1HMV B;  4B9N A;  2W25 A;  2Q43 A;  3FQL A;  2NRE A;  4DX5 A;  4PG7 A;  1KOO A;  1S1X B;  3F56 A;  2J9D E;  1FEE A;  1Y5N B;  4L76 A;  3IRX B;  1FRX A;  3DOK B;  2QEX S;  1VQ6 S;  4ETZ A;  2HNZ A;  1V3S A;  2QA2 A;  2ZHA A;  4LBH A;  1MWY A;  4HDG A;  2RD5 C;  4QWD A;  2XCP A;  3FBC A;  2RS2 A;  4U67 Q;  5CAA A;  5AXL A;  1U2C A;  2AEF A;  3FJ2 A;  3MDF A;  3FFI A;  1NJW A;  4OI4 A;  4CT9 A;  2X51 A;  5GVQ A;  4IRC A;  1H3D A;  4F4W A;  3HM9 A;  4KV8 A;  2IMO A;  5T41 A;  5J2M B;  1QDU B;  1SKR A;  2HLU A;  3AA8 A;  5LJ5 Y;  1BQN B;  2IM3 A;  4OYW A;  2VKZ G;  4DPX A;  4PXB A;  1P9Q C;  1X0P A;  5F8H A;  1HI8 A;  3A8E A;  3QIP A;  5H9E K;  4WYW A;  3W9I A;  1IBM J;  1B64 A;  4DQR A;  4KH0 B;  5KT5 A;  3HFV A;  1G6B A;  4A8Q A;  1YGY A;  1Z2Z A;  2FPH X;  3CF5 Q;  4QOT A;  3UFC X;  2LYV A;  1SXL A;  3KK1 A;  1AUS L;  4DV1 F;  2PC6 A;  1HYS B;  3ENA A;  1NHV A;  1N36 F;  3M1V A;  1S9E B;  4L3K A;  4G1P A;  2I8E A;  2C3P A;  2E1P A;  2L9D A;  2O67 A;  3KK3 A;  5CD4 H;  4M5K A;  4I7F A;  3ILI A;  1LWF B;  2RNE A;  1H2V Z;  1VHF A;  2QLJ B;  1SKW A;  3DDK A;  3BGR A;  1KQK A;  4CLT A;  2AYM A;  1XQI A;  1HNW F;  1YBT A;  3AD9 C;  4LSL A;  2HK2 A;  2VIH A;  2FGO A;  2B4P A;  4PRF A;  1F5B A;  2AGO A;  4DV0 F;  3OFH A;  4LF5 J;  4A8M P;  1DLO B;  3NWG A;  2MJU A;  3HSJ A;  1P8G A;  4USH A;  4PXD A;  2HGN A;  5E5N A;  4OYX A;  2IPO B;  4LBI A;  1QM9 A;  2EW9 A;  5HMX A;  4DL3 A;  2BW2 A;  3FRZ A;  1XBW A;  1XN9 A;  2M8H A;  2N7C A;  5CH7 B;  1SPB P;  3B78 A;  1UWB B;  1VRT A;  4Y28 C;  4JYA J;  3O5T B;  2L9W A;  3H4D A;  3SI8 A;  3OLA A;  2WTF A;  2CYY A;  2DCU B;  5LXY A;  4RR5 A;  2F8E X;  4RNM A;  4YHH J;  2WW8 A;  1S10 A;  4MYU A;  3W5Y A;  1RHR B;  3UR0 A;  3MOZ A;  1TL7 B;  4KPY A;  4B3R J;  3H5X A;  2Y9H A;  3WX4 A;  2B43 A;  2JSX A;  1KQS R;  4IDK B;  3ZZZ A;  1VQY A;  2M9K A;  4R8U B;  1U6F A;  2O1P A;  3FBE A;  2UXB F;  4DQP A;  3Q8Q B;  4K4V A;  4BLG A;  1YHQ S;  3W2V A;  4RWX A;  2BE7 D;  4HH1 A;  4EO8 A;  4B3T F;  3N5B A;  1XER A;  4M63 A;  3IC1 A;  1GXT A;  4DR6 F;  1T3N A;  4U7U K;  3BH6 B;  3UVJ B;  1PC4 A;  3NLC A;  2YPZ A;  5IFM A;  3QGG A;  3ZZP A;  4ILR A;  2ZZM A;  2RQK A;  4X62 J;  4ZPV R;  1RU2 A;  3I9Z A;  2VQF J;  4KHP J;  1KR4 A;  1EQM A;  1BXN A;  5L1I A;  2PE8 A;  2CG8 A;  3QT6 A;  3M9O B;  1M1G A;  1U6B A;  4I0W A;  2KYZ A;  3KDN A;  1TUV A;  4Y65 A;  3TX0 A;  5I4M A;  1R27 B;  4OYP A;  4DHV A;  4ES1 A;  4WU3 A;  2MQQ A;  1RWX B;  1A7G E;  3GTY X;  5LT5 A;  3GIJ A;  3N0V A;  3UR3 C;  5HL7 Q;  3SZ2 A;  3D6H B;  5LSR A;  1X31 C;  3PYG A;  4O3P A;  3JSB A;  5BYR A;  3CCT A;  5FD1 A;  4M94 A;  4PWD A;  3MF5 A;  2XTJ P;  1G4C A;  2FQQ B;  4H4K C;  1WC5 A;  3IWX A;  3QWU A;  4EUV A;  3Q0A A;  3MGJ A;  4I2Q B;  4NMX A;  1X4E A;  3MED A;  2FZC B;  2V4R A;  1JJH A;  3UNY A;  1H74 A;  4C0O C;  4PAB A;  1T9Y A;  2OPP B;  1NSK L;  4JI6 J;  4OHW A;  1KFD A;  2HFS A;  5IOL A;  3DI6 B;  2C2K B;  5K8M A;  2QSF A;  3RBX A;  2VDI A;  3F44 A;  5CYM A;  2NLW A;  3PX0 A;  4BWM A;  3IWN C;  2GX8 A;  4C98 A;  3HSD A;  1HNI A;  2KFN A;  2R7Q A;  2DT9 A;  1TKX B;  2Z57 B;  4MKY A;  2UVU A;  1I3O B;  3BB5 A;  3TP2 A;  2P9E A;  1VQO S;  1YIJ S;  4ECU A;  4NXN J;  3VAH A;  1X5O A;  1DTQ A;  4Y2M A;  4OI0 A;  3UCG A;  5A0Y A;  1RT1 B;  3AOB A;  4X84 A;  3PEH A;  1N0U A;  1HQU A;  3ILJ A;  3IS9 A;  2ZH7 A;  1FDA A;  4DLG A;  1QTN B;  4LFC J;  4HAC A;  2QFI A;  2YNH B;  2EKN A;  2KL8 A;  2Z56 B;  3OVB A;  5IM0 A;  1VQ5 S;  2HRU A;  5A6P A;  1S1U A;  4ZMM A;  4C3M A;  3Q8Y A;  5EWE A;  4W4M A;  4PYA A;  3UPF A;  3JSY A;  3VAG A;  1D0E A;  3HVW A;  2HVZ A;  2IJN A;  3GYX B;  3BSN A;  1NJZ A;  2J6T A;  4HTJ A;  2XHC A;  3AH6 A;  2K7K A;  1TEL A;  2DB1 A;  2GHP A;  3B6B A;  4CTA B;  1SL1 A;  5F0W A;  2KFY A;  5F41 A;  4TN2 A;  3TRG A;  4CDI A;  2IIH A;  2AJ4 A;  5ETO A;  5C24 B;  4DV2 J;  2YNF B;  5CZV A;  2MQ8 A;  3MFH A;  1CVJ A;  4DUY J;  4F4Y A;  2J0S D;  2BRL A;  1F6T A;  2DHA A;  5FLX U;  4KO0 A;  2HWI A;  3SQG B;  2A18 A;  1WWH A;  2VF3 A;  1FJG J;  4NWB A;  1KVI A;  4K2X A;  4X4Q A;  2JLF A;  2J7W A;  4NZ6 A;  3AD8 C;  3N79 A;  4QZV B;  2QMW A;  4K4Y A;  1HHS A;  4RPF A;  2AQ4 A;  4ECZ A;  4JI8 J;  2P9G A;  3TX8 A;  4WK1 A;  4N76 A;  2NUU G;  3TEH B;  2MPU A;  3SV4 A;  3TO8 A;  1HNV B;  3SYZ A;  3T1A A;  2J7K A;  2L41 A;  2KXF A;  2MKK A;  1X4H A;  5B0C A;  4DDF A;  1NJY A;  1VQS A;  1U09 A;  4DU8 A;  2BAN B;  2NYI A;  3DRS A;  2WB1 D;  3CDE A;  3QJJ A;  4W98 A;  3N01 A;  3DLG B;  3GQC A;  3QBC A;  1OY9 A;  1SIW B;  3PFE A;  3C46 A;  4KYZ A;  3VV2 B;  2IA6 A;  1RT6 A;  2DNQ A;  2BZ2 A;  3QT7 A;  5IT9 Y;  3GIK A;  1CJT B;  1N32 F;  1TTH B;  4A46 A;  2LKZ A;  2JJ4 D;  5DDO C;  3W5Z A;  1SC1 B;  5HQ8 A;  4LJM A;  5DQI A;  2MKY A;  3H5S A;  3UDV A;  4LF9 J;  1WHY A;  1YRX A;  1C1B A;  2V69 A;  2R8H A;  3VHQ A;  1XMB A;  1Q8B A;  4NAS A;  4JUZ A;  1KHV A;  4DPU A;  3ENQ A;  1NDC A;  2A3J A;  1FD2 A;  4EU0 A;  3BO2 A;  2MQN A;  3HHL B;  4IOB A;  2VDH A;  3D1H A;  4WXW A;  2R2S A;  2CNK B;  1F2H A;  2OFG X;  1N6Q A;  1JLF B;  2DHX A;  4ZVE A;  1FNX H;  1LWE A;  3HP6 A;  4DL7 A;  4FYV B;  1N0V C;  2KXH A;  2YH1 A;  3TVY A;  3CCZ A;  5A8K A;  4F0H A;  1RTZ A;  5CXT A;  2CQ1 A;  1MW7 A;  5D3G A;  4NCB A;  4XPE A;  2FZG B;  3AXM A;  3J81 U;  1OSC A;  2YKA A;  3UN2 A;  1RGV A;  2BM1 A;  4N41 A;  3HMJ G;  2M2B A;  4IKA A;  1RT5 B;  3ISZ A;  3V6D B;  3PFO A;  2XMM A;  3DLK B;  1HBN A;  3DOK A;  1BY9 A;  2V8D A;  1S12 A;  3BBC A;  5L1L A;  1PKU A;  1S6Q A;  1F9H A;  1H7W A;  4OIX A;  5HI7 A;  5C7P A;  4DR2 F;  4WP9 A;  3NMR A;  1K1S A;  2Y8W A;  1RAC B;  4OI2 A;  3FCH A;  2PA8 D;  3CCW A;  4OZ2 A;  3VZI A;  1IR2 A;  3GG0 A;  5JMN A;  3EMT A;  5BR8 F;  3RBD A;  3KLF B;  3MUT P;  3IP0 A;  1U47 A;  3LAN A;  4H4M B;  3C16 B;  4IO9 Q;  1WKK A;  4XAK A;  4Y2I A;  1NK6 A;  3W7B A;  1X4D A;  1OS5 A;  2OUG A;  3DOL A;  4F4X A;  4DQS A;  3V4I B;  2Q66 A;  5EHH A;  3BSO A;  4UOG A;  4DL0 C;  4JV0 A;  2ZE2 A;  2C22 A;  1K44 A;  2QA4 G;  3J81 j;  2RAQ A;  2VPW B;  3KJQ B;  3M32 B;  4TYB A;  2NXN A;  4F4K A;  1UJ6 A;  2HNY A;  2XO6 A;  2LFV A;  1TV6 A;  4QWB A;  3AA9 A;  4LF4 J;  1YZ6 A;  2EC2 A;  3JSR A;  2MY8 A;  1NM2 A;  4DSJ A;  1Y5L B;  1S49 A;  5DG9 A;  4QCL A;  4U7U D;  4F3M A;  3W8G A;  2CZ9 A;  4QIG A;  2BJ7 A;  1G1X A;  4B3O A;  5L1K A;  4DR5 F;  4ZPB A;  3M6V A;  1V5I B;  3CE8 A;  5HMZ A;  3R7N B;  2KTQ A;  3CDU A;  1N5T A;  5KG2 A;  1X4G A;  2L48 A;  2RS8 A;  2HMI B;  5KT6 A;  5DZ6 A;  1DLO A;  2V4J A;  2R7W A;  2KVQ E;  1CLF A;  5K5M A;  3HPO A;  3TAM B;  4I67 A;  4KFB A;  3G82 B;  4YEA A;  5D0R A;  4ECV A;  1FFW B;  3PX6 A;  2OHD A;  2DR8 A;  5F8M A;  1BGX T;  3OW2 R;  3PNI A;  1T9U A;  1FF2 A;  1RA6 A;  4DZ6 A;  2N3L A;  5K14 B;  3D66 A;  4AND A;  4CH0 S;  5F8L A;  1ZAW A;  3ET6 B;  4UY8 T;  4GMK A;  3VCD A;  2QFJ A;  3THV A;  4TU7 A;  2NXJ A;  2YNG A;  1VQL S;  1GMU A;  4YB1 P;  3R97 A;  4U6P A;  3RTV A;  4ZPW R;  4PQU A;  2BV3 A;  4JV5 F;  2W2M P;  2XUL A;  4EO6 A;  4HEA 9;  4ALZ A;  2VUG A;  2VPY B;  1IKY B;  2AP6 A;  2K2P A;  4CLZ A;  4Q45 A;  4XDC A;  2V8P A;  3MM7 A;  1TL7 A;  4DV1 J;  1AZS B;  1GTH A;  4FXV A;  1NKE A;  3O44 A;  3G87 A;  1N36 J;  4EEY A;  1CPZ A;  4R8U A;  3LH2 S;  1QSS A;  2BJ3 A;  3K0J A;  4MKB A;  3RW7 A;  1TFY A;  1XNQ J;  5CYQ B;  2VG6 A;  4C11 A;  1UEV A;  1LWC A;  1LWX A;  5DG8 A;  2NYH A;  1UEU A;  4EMD A;  1WI6 A;  1T3O A;  1VGY A;  1WSR A;  5KFS A;  4QR1 A;  4KAI A;  1HNW J;  3ZO7 A;  4RW7 A;  4X4U A;  1SB6 A;  5SZT A;  4GO5 X;  4LF7 F;  2LQB A;  4P9S A;  1ZH5 A;  1NSP A;  2DGW A;  4DV0 J;  2GNK A;  5I42 A;  2YKM B;  4ERD A;  1N5Q A;  4GVB A;  2U1A A;  1S99 A;  4WFY A;  1LFW A;  4CQ1 A;  5AE3 A;  3JYT B;  3TZZ A;  2QJ3 A;  1TUW A;  1MN9 A;  3ZZ0 A;  2RUG A;  5E7O B;  1M1K T;  3MMC B;  4I6Y A;  1FFS B;  2QMX A;  2E5J A;  3SCJ E;  2DNH A;  5KFQ A;  4G1Q A;  5AJ3 F;  3R5D A;  4FXD A;  3AQP A;  4P72 A;  3KG1 A;  4FYW B;  2VG7 B;  2O3D A;  1GT8 A;  4I2Q A;  1S1T B;  2OAU A;  1U6Z A;  2EXU A;  3Q22 A;  2RJZ A;  2W2O P;  2ASD A;  2MLY A;  4TVA B;  1LW2 A;  1B3T A;  2D3O R;  3J7A N;  4HKQ A;  2C1E B;  4DQQ A;  3T1H F;  2UZA A;  1NPP A;  5F8I A;  1GMV A;  2LVW A;  1V5V A;  4OI3 A;  4NYZ A;  1KLN A;  4E0D A;  2IM1 A;  3MZI A;  1EKS A;  2GIQ A;  2B7B B;  4JI5 F;  3A8J A;  3K8W A;  2UXB J;  2C2M B;  3H5Y A;  3Q2S C;  1G3O A;  4UUW A;  4DN9 A;  2Z2M A;  1VFJ A;  1T03 A;  4B3T J;  2XM3 A;  2ZH4 A;  2X3G A;  1JJ4 A;  2R8I A;  1KVK A;  3NEK A;  3BQ0 A;  2OTL S;  4IFV B;  4WFA Q;  4B08 A;  1RT4 B;  1LXN A;  1X9S A;  2LU1 A;  2IVM A;  2CKW A;  1BWE A;  2W2Q P;  4RO0 A;  1CQN A;  1FXD A;  1RTD B;  5DQG A;  2DNL A;  2HVE A;  4CLK A;  4O3R A;  1WKL A;  4F7V A;  3M9N B;  2VA3 A;  2AEM A;  3MCO A;  3ILO A;  2APO A;  3AOD A;  1FJC A;  3H2U B;  3MMB B;  4L73 A;  1CS4 B;  1TU0 B;  3FKB A;  1CUL B;  3ETM A;  3W9J A;  2CNO B;  2JEG A;  3JSM B;  3NNC A;  2V0N A;  2FY1 A;  4ED0 A;  3NL0 A;  5KFO A;  1X5T A;  2W7A A;  1WC4 A;  2BXJ A;  3TJ8 A;  4GO7 X;  3QRR A;  2M3D A;  3MPU B;  5KOW A;  3VAF A;  4URQ U;  3RZA A;  4DV4 F;  2CIM A;  2O01 C;  2AYE A;  2R8K A;  1JNZ B;  5KFP A;  1KHW A;  2W7P A;  2BKO A;  4NLX A;  2BBE A;  1S6O A;  4K4W A;  2DR5 A;  4P73 A;  1RXO B;  2B8Q A;  2V9K A;  2CPF A;  2HHW A;  3THP A;  3A13 A;  3VGV A;  5C24 A;  2FVR A;  3DMJ B;  3MEC A;  2BKP A;  2B8P A;  1KP6 A;  2GZO A;  5KFG A;  4CYU A;  1TP7 A;  4X66 F;  4Q7A A;  4KT0 C;  3LAK A;  2OEM A;  2E5I A;  3K7R A;  3SQG A;  4DX6 A;  3L09 A;  2PDA A;  1QSY A;  3M30 B;  2CPZ A;  2DXF A;  4ZJQ A;  1U4B A;  3ZXW A;  3WX8 A;  4CLL A;  4B9T A;  3VGS A;  1REG X;  3S8S A;  3ZFV A;  5D4N A;  3W62 A;  4LIR A;  4M5H A;  4NA2 A;  1N56 A;  1IVZ A;  2GQQ A;  1N8R T;  5EN1 A;  4Z7C A;  3HJV A;  2MLX A;  2NUH A;  1CJK B;  3M2V B;  3GE9 A;  2ZJP Q;  4N7T A;  4XTT A;  1SJ3 P;  4BBY A;  4EYH B;  3D6F B;  3P45 B;  2CDR B;  4I4B A;  1YIT S;  1U26 A;  3J7Z T;  2AX0 A;  2CG4 A;  2R42 A;  4YB6 A;  2BJ8 A;  3DLG A;  5FDL B;  4GRS A;  1DQA A;  5DGB A;  2ZZT A;  2VB6 A;  3E51 A;  1F60 B;  4ECS A;  3MCN A;  7AT1 B;  4TYA A;  2JEI A;  1IJF B;  1LOU A;  4NLY A;  2RVJ A;  2Z8Q A;  3RB6 A;  2MTL A;  2VL1 A;  4WP8 A;  4URS A;  2ZOM A;  1IKW B;  4F2R A;  1RHM B;  1KOH A;  1UJ5 A;  1G2E A;  4J9L A;  1RT7 B;  4BS2 A;  1RAB B;  1J27 A;  4WII A;  4J9V A;  3CWJ A;  3CJQ A;  1JQG A;  2VON A;  1JLF A;  3AB2 B;  5HLF A;  1S7I A;  4OJG A;  4LR9 A;  1Q8I A;  3CCV S;  4WU2 A;  1U1R A;  4WIQ A;  1APS A;  2R9L A;  2FJD B;  1TR0 A;  1R0B G;  2RIJ A;  1RIS A;  2CPI A;  4QIE A;  3AFG A;  5C25 B;  1JLQ B;  2MY7 A;  5KFC A;  2VA2 A;  2ZDO A;  3GJR B;  1VLO A;  2XYP B;  3V6D A;  4RW8 B;  2ZH3 A;  1SJF A;  3NS7 B;  1XWL A;  4WE1 B;  2NQP A;  2DPJ A;  2JL9 A;  3N5F A;  4NRT A;  4WKY A;  1FXR A;  2CAJ A;  1QAJ A;  1XJW B;  3R5G A;  4R0J A;  3P3D A;  1K9M T;  1HNX F;  3O1L A;  5IT4 A;  2CQH A;  4O44 B;  4OYM A;  3AXK A;  1GFW B;  1Q81 T;  2G2Z A;  3BEG B;  2YWW A;  2RDJ A;  4FDF A;  2XB2 D;  2QYC A;  2F3J A;  1IJE B;  3KLF A;  1I1G A;  2W4P A;  4X2B A;  1N32 J;  2E7X A;  2YX4 A;  3POT B;  3TOQ A;  2HIQ A;  1SJ4 P;  2KHD A;  3T9Z A;  5DLG A;  3D0H E;  4QQB A;  3RGI A;  2JNJ A;  5LSL A;  3NBP A;  4ELV A;  1U1L A;  1WTB A;  1HLW A;  4YOE A;  1PYO B;  1T05 B;  3AAW B;  1LK7 A;  4C3L A;  9RUB A;  3M8S A;  3PJX A;  2ZH2 A;  3CMA S;  1SH2 A;  2AJ1 A;  2EVZ A;  5H9F J;  2ZVS A;  2ZEJ A;  1TL4 A;  3HSZ A;  3MPV A;  1JLA B;  4DF8 A;  5HAN A;  2P6S A;  3CMQ A;  4U95 A;  4Y34 A;  2Z0G A;  1RCX B;  3BS9 A;  4YR3 A;  1R8C A;  2R2R A;  3Q8V A;  2WOM B;  3R6G B;  5KOX A;  4ZK7 M;  2R8G A;  2CQG A;  3SSS A;  1FVQ A;  4NLT A;  4O0I A;  2B6A B;  3CPW R;  2Z2L A;  2ZFH A;  1YJW S;  4ED7 A;  2HMI A;  1JJC B;  2DXD A;  3EGV A;  4DR2 J;  3HHK A;  3CME S;  2XI2 A;  1JNR B;  4FF1 A;  3S1T A;  3T9N A;  2HSE B;  3K5P A;  3MUR P;  2DGQ A;  1NSQ A;  2M5Y A;  2CQ3 A;  4HYK A;  3KKF A;  2BVZ A;  5ETQ A;  2JH3 A;  1B99 A;  1HR0 F;  4NCA A;  2XS2 A;  4B9L A;  3CJR A;  5J1E B;  1SIZ A;  3CO9 A;  2CPY A;  3ZTS A;  1ZBT A;  4ELT A;  3EVO A;  4MKA A;  2XZW A;  1FNM A;  2D69 A;  2H65 B;  2LP4 A;  4FKX A;  1YJN S;  1GQE A;  4UY8 5;  3K58 A;  1FDN A;  4PPD A;  1WI8 A;  1U2F A;  3VGU A;  1RWW B;  1WSV A;  3PIO Q;  1VK8 A;  4DFP A;  1YWX A;  4J9N A;  3JTP A;  1WG4 A;  4ZDN A;  2V68 A;  5BYQ A;  3PEJ A;  2KRR A;  3GIL A;  4IFY B;  5CYQ A;  4P2X A;  4DCJ B;  1D8Z A;  5CZX A;  3NRB A;  2HHV A;  3HVT A;  2VQE F;  2EFP A;  4DR5 J;  1VC6 A;  4NLV A;  4NLU A;  1FJE B;  1KLM A;  2PGC A;  1EAY C;  2JZ5 A;  2YNI B;  2J6U A;  4JI2 F;  5KFX A;  1RUS A;  3C6U B;  4IO1 A;  5KFB A;  3LWL A;  1M90 T;  2YKM A;  5LL6 d;  3CED A;  2EK1 A;  4USW A;  1V9O A;  2KT5 A;  2WSF C;  5H9F K;  5C2C A;  2DEI A;  4RW6 A;  3L7P A;  4QYZ K;  3DU5 A;  2I5J B;  2FLL A;  4ZLL A;  3MR6 A;  2L9N A;  2RIL A;  5D6G A;  2MXY A;  4JI3 J;  4DX8 H;  3K57 A;  4ZP6 A;  3DOM B;  4RNN A;  1RTJ A;  1UWA A;  3CD6 S;  3RW6 A;  3ISN C;  3T5H A;  3B82 A;  3GYG A;  2DO4 A;  4K8R A;  2DCL A;  1IQZ A;  4B3M F;  4AFF A;  4OX6 A;  2GCF A;  5KTQ A;  1JK9 B;  2D9O A;  2W9C A;  3HFK A;  1K0V A;  4JV5 J;  1S1T A;  3KLI B;  2HZV A;  3BO3 A;  3HJF A;  1YG0 A;  4ATN A;  2ZD1 B;  2UV8 G;  3CC2 S;  4DV5 J;  1N52 B;  2VOO A;  1U48 A;  2DNK A;  5F9L A;  4OZ5 A;  4ICL B;  4E98 A;  3NGR A;  2VFR A;  1FE4 A;  2AJ2 A;  1B70 B;  3Q83 A;  4ZKA A;  3I4P A;  3LGN A;  4PYD A;  1XR5 A;  2UVR A;  4WFZ A;  1H6K X;  4RKU C;  1XMQ F;  1C4A A;  1RT2 A;  3H40 A;  3QQC D;  1VRU B;  2RU3 A;  3PJW A;  1MMN A;  2QRR A;  2COL A;  2KDO A;  1UP1 A;  5KFL A;  1ZTT A;  3SCI E;  3MOJ B;  3IAS 9;  4LF7 J;  5F8J A;  4LQ9 A;  2FVP A;  3VAM A;  3AOC A;  1FRL A;  3D1O A;  3BBF A;  2QL5 B;  3IR7 B;  3LPE A;  3HZE A;  5GMK a;  2W9B B;  1WD6 A;  4GVL A;  2R7O A;  1NKC A;  2B5J B;  1CS4 A;  1RHK B;  4QWA A;  3P8B B;  2LQ5 A;  4OYZ A;  3JSM A;  4X64 F;  2WSE C;  4EBE A;  4DS4 A;  4WFN Q;  5AJ3 J;  2WHO A;  1DQ8 A;  1FXL A;  1PYS B;  2IYI A;  5KFY A;  5C42 B;  4JI7 J;  4KSE B;  4UUX A;  2CWX A;  3CCE S;  5B0B A;  3GSD A;  3G6X A;  3PM9 A;  3QLH B;  2AT1 B;  2CA9 A;  3T1H J;  3MEG A;  4M5G A;  3MEE B;  1NME B;  4ZP7 A;  2B51 A;  2NPF A;  4QR2 A;  3QFW A;  1RWV B;  1RAG B;  1TVR A;  5CD4 A;  1NHK L;  5A8W A;  1QAY A;  2JLG A;  4JI5 J;  4RNO A;  1U1O A;  2YKO A;  3KYL A;  3FEZ A;  2FHJ D;  2XQC A;  2KZM A;  3TUJ C;  3W2W A;  4ID8 A;  4MK9 A;  2ZH9 A;  3QGI A;  2C2D A;  3K89 A;  2UUT A;  2C2E A;  2XS7 A;  2HAF A;  2ATC B;  1X4B A;  2I6W A;  3L7U A;  1LW0 B;  1KFS A;  4M5N A;  3AHP A;  3DLB A;  3QGP A;  4TU8 A;  2FVQ A;  4KBI A;  3IR6 B;  2F8H A;  1PIL A;  1WUU A;  3M2V A;  2QG9 B;  2GGP A;  2DEJ A;  3CD0 A;  4DLE A;  2FLO A;  4DXL A;  4JI0 F;  2RRA A;  2QN6 B;  2DGV A;  4ZCL A;  4X65 J;  1S97 A;  1SJQ A;  2BQ3 A;  3PG9 A;  2GMH A;  2HWT A;  1HI1 A;  5A2Q Y;  2E1M C;  4IG0 A;  4YY3 F;  1F5A A;  1RLC L;  2JDJ A;  1N5S A;  2VIC A;  2OTJ S;  4KGV B;  4DV4 J;  2G13 A;  3D28 A;  4DR4 F;  2PII A;  4Q8E A;  2MQP A;  2B4U A;  3MXH P;  3HF5 A;  3BKU A;  2W8K A;  1N33 F;  2DGT A;  3D5M A;  4Y3C A;  1X9M A;  1W25 A;  1UPM B;  2FLN A;  1TL5 A;  4F67 A;  1IKW A;  5KFZ A;  5F3Z A;  1VQN S;  1ARO P;  3J80 U;  3NGT A;  1JB0 C;  2DR7 A;  3D6M B;  2CJY B;  4C9D A;  2A6M A;  1XNR F;  4HI2 A;  3ZNU A;  4WCE Q;  3UE2 A;  1HW9 A;  1S9G A;  4Q0B A;  4RNF A;  4K2J A;  2P5V A;  4OHZ A;  2AKW B;  1F3V A;  2G2O A;  4KH1 B;  1UFW A;  1NJX A;  4W90 B;  1ZZN A;  4C3K A;  4PG5 A;  2EK6 A;  1U1P A;  4TQS A;  2KT3 A;  3MMA A;  5LM7 E;  3QMQ A;  3OUY A;  3M6W A;  2E44 A;  2GVZ B;  5KFN A;  2V2K A;  2XMJ A;  2Y3Y A;  4ZIT A;  3Q8P B;  1CBK A;  2UXC F;  2MB0 B;  4RW8 A;  3QJL A;  1GNK A;  3QPI A;  3KDO A;  1GXU A;  2VAS A;  3DRR A;  1TK8 A;  3LQV A;  1RBO B;  2R7T A;  2HVH A;  4IH6 A;  4O4G B;  4JBC A;  3T41 A;  2AZ1 A;  2ZJQ Q;  4JI4 F;  1WHX A;  5KFT A;  4FBT A;  2HQI A;  3KK2 B;  1HBM B;  2ZM6 F;  2ZWP A;  3ILL A;  1REV B;  3Q89 A;  5LXR A;  3D4J A;  2IYG A;  1DAX A;  2V8V A;  2BE2 B;  4EGL A;  3POT A;  4HL9 A;  3CCL S;  2VD3 A;  2B9X A;  2RKI B;  2XWX A;  4J91 A;  4ZVG A;  2EFQ A;  5G0R B;  2BYC A;  4ZVR B;  2FHM A;  3MR2 A;  3KMQ A;  2MYF A;  1DTT B;  1VI7 A;  2BJ1 A;  4LFA F;  4NI2 B;  3I5C A;  2F63 A;  1UEK A;  2ZC3 A;  1T05 A;  4NE9 C;  2PFF B;  2XY7 A;  3MM9 B;  5KAK A;  3JTN A;  2UVW A;  4YP3 A;  2LQJ A;  3WIU A;  2CVI A;  1JLB B;  1Y11 A;  3MR7 A;  1SL0 A;  4KKO B;  1IXK A;  3DLE A;  1VIS A;  3F73 A;  4ZPC A;  1YJT A;  4L6V 3;  1OSD A;  2L08 A;  4F3O A;  3IG1 B;  1S0V A;  2HK3 A;  4GKJ F;  2PMH A;  1PAU B;  3W65 A;  1RSC A;  3HUL A;  2A1B A;  1VMB A;  3OTC A;  4RBU A;  4Y0F A;  1N5V A;  3IMQ J;  4HLB A;  3I0S B;  3BRE A;  2CFX A;  2AX1 A;  1TKZ B;  1X4A A;  1NZA A;  2P6T A;  5HVG A;  4CCH A;  4OI6 A;  2HGL A;  1N48 A;  2DGS A;  4EBC A;  1NCL A;  4P71 A;  2W7O A;  3W60 A;  3MD3 A;  2WRM A;  3UQS A;  1BMQ B;  5DGA A;  2KXN B;  1CJU B;  4CO4 A;  2BJD A;  5DRK A;  3IRW P;  4EI2 A;  4NXM F;  1NK8 A;  4DSK A;  5B08 A;  1M5P C;  4JI1 F;  1DUR A;  5IT9 U;  4FNI A;  2DH8 A;  3G6E S;  1HI0 P;  3IM8 A;  4HT5 A;  4CO0 A;  3C8Y A;  5HP1 B;  1RU1 A;  2ILY A;  1SJ1 A;  2IAJ A;  4F25 A;  1YRU A;  2C2N A;  2V8G A;  3NNH A;  1HBO B;  3MEK A;  1TL3 B;  4F36 A;  3N4W A;  4BC9 A;  3DM2 A;  1Q5V A;  2QLX A;  2OPR B;  3MM6 A;  1WNE A;  2FGC A;  4UZC A;  1VQK S;  4C8K A;  2F65 A;  2VPZ B;  4Z7Y A;  3LA0 A;  2VFV A;  1S72 S;  5B0D A;  4OLP A;  3OSP A;  1VBX A;  5L9X A;  3OTE A;  3SDE A;  1TFW A;  4CNY A;  4P2M A;  3DDN A;  2J0X A;  2KG1 A;  5MAO A;  1M0S A;  3S7R A;  4IFY A;  3SEO A;  4GC7 A;  3H20 A;  5KFU A;  2RDI A;  3UCU P;  2DNG A;  2KN4 A;  2ZZN A;  2K7J A;  3S01 A;  3PKM A;  1UTA A;  3AY0 A;  2OPS A;  1I94 F;  1T9W A;  2YNI A;  4QPT A;  2E9T A;  3HHL D;  5L39 A;  2HND A;  4CO5 A;  3C6U A;  2JFK A;  1SCJ B;  2OI2 A;  3A8I A;  4CP5 A;  2YX1 A;  4CO2 A;  1VBY A;  3BR9 A;  5GAH I;  2ILZ A;  2I5J A;  3UI3 A;  3WC0 A;  4K4X A;  2R7U A;  1WHV A;  2IFX A;  1FKO B;  1VQ8 S;  3A4T A;  4ZCM A;  4RZR A;  1C1C A;  1M1H A;  2FJW A;  5HRO A;  2HS3 A;  1JKH B;  4DV6 F;  1HR0 J;  1E6Y B;  1S6P B;  2O5D A;  3R5J B;  4E8U A;  2AHO B;  2MKI A;  2BOP A;  1ZAX A;  4ECX A;  1R7I A;  2HRY A;  4LRC A;  1IM6 A;  1C0U A;  2V50 A;  3QT5 A;  2E5L F;  1VQ7 S;  3MAA B;  3ITH B;  2ZD1 A;  4URG A;  3PR4 A;  5JUM A;  1KBR A;  3M8Q A;  1SUQ B;  3TAP A;  1HBU B;  4CO1 A;  3UD5 A;  3BN4 A;  1BLU A;  2GIR A;  1UVJ A;  2AYB A;  2YWK A;  3GV8 B;  4DV7 F;  2MLZ A;  3CDA A;  4J9Q A;  3C15 A;  3OL9 A;  2XCA A;  1NB2 A;  1Z2L A;  1ZM3 A;  3OVS A;  2IHR 1;  5E41 A;  2EG2 A;  2VQE J;  1TKD A;  4CH7 A;  2YKN A;  4DFJ A;  2P8I A;  2RQM A;  1TMJ A;  4DX7 A;  4JI2 J;  4MMO A;  1YJ9 S;  3OTO F;  4ZVT B;  4M5D B;  3RB0 A;  1RT3 A;  3I9V 9;  2HW3 A;  1S4E A;  2LEC A;  1S0O A;  4I2P A;  4UST A;  1ZPV A;  3KOA A;  1HPZ A;  2RHQ B;  4Y2C A;  1QE1 B;  4DL6 A;  3IM9 A;  2IBK A;  3TZY A;  2DY1 A;  1VBK A;  1EKR A;  4U8Y A;  2XMA A;  4ZJO A;  3M2U B;  1D9F A;  4NZ7 A;  2AWZ A;  5H9E J;  3GLJ A;  1D8Y A;  4KTQ A;  3W8P A;  3QNW B;  4F3Q A;  3RB3 A;  4NCG A;  3UO0 A;  5B7W A;  1NDK A;  5F0U A;  1CC7 A;  3TWZ A;  1WG5 A;  2RU9 A;  3NP5 A;  4ZVH A;  2QTW A;  3ULH A;  2C2R A;  3KNG A;  1FJ7 A;  5HN0 A;  4RBT A;  4KPC A;  1RTI B;  5ETV A;  1J5O B;  1D9A A;  4CZC A;  3ZZR A;  2MZ1 A;  4C48 A;  5AE2 A;  3CJ5 A;  4Y2A A;  3HFZ B;  4UQT A;  1QUP A;  4PCQ A;  5KFD A;  1XMQ J;  1FDB A;  1YLX A;  5IT0 A;  3OR1 B;  1VJW A;  3A3P B;  1FK9 B;  4LR8 A;  3L7O A;  1FWP A;  2H9Z A;  3VVU A;  1S59 A;  4B9V A;  3MFI A;  1VJQ A;  1LW0 A;  3EXC X;  2G0C A;  3HKW A;  4WWS A;  4PUO B;  1JLE B;  2HVI A;  3PIP Q;  1B0V A;  4CIO A;  2QMU B;  5J2P A;  4ID5 A;  4YME A;  5A6W A;  2KU7 A;  2BMB A;  4Q2M A;  3Q8R B;  3GB0 A;  1ZM9 A;  4X64 J;  2GQC A;  1CEZ A;  2E5H A;  4ECW A;  1H0H B;  1KN6 A;  1RYS A;  5DLF A;  1OYE A;  1VR6 A;  1Q8L A;  3H25 A;  5JVH Q;  2FVC A;  2MZQ A;  1QTM A;  2DIS A;  2K1R B;  2RRN A;  5E2Q A;  2MQM A;  1YI2 S;  2PI5 A;  2EC0 A;  4J9K A;  4KGM A;  2JWN A;  5LMU F;  3RRH A;  3K2Y A;  1SKS A;  3W66 A;  4FS1 A;  3D1Q A;  2Y1L B;  4EWT A;  2B4V A;  2LMI A;  2JEJ A;  2FD2 A;  3ZZO A;  4FF4 A;  1UCN A;  1TL1 B;  1RWM B;  4ED3 A;  1FKP B;  3CT9 A;  3KLH B;  2FUG 9;  2I9S A;  2LXU A;  3FSY A;  2EPI A;  2B0G A;  1SQE A;  2KKH A;  3EZU A;  1DHM A;  2P2C B;  3R8Y A;  2WB4 A;  1FWK A;  2NXE A;  1EP4 B;  2MZR A;  3MR5 A;  3FEY B;  2UUC F;  4F0M A;  3EDR B;  1UAW A;  4WFB Q;  4XPC A;  1SI9 A;  4DG1 B;  4WZM A;  2E29 A;  2AEJ A;  1U0H B;  3PW5 A;  1PSD A;  3R7S B;  4QR0 A;  4LT6 A;  2XLJ A;  3LP1 A;  2GO9 A;  1VIO A;  2V67 A;  4OHV A;  3J7Y I;  1RWK B;  2WZ1 A;  5HJX A;  1RAI B;  4JI0 J;  2DR6 A;  1OWX A;  2H4Y B;  2DD8 S;  2HHP A;  5D0G A;  4O4G A;  1FRK A;  3CJK B;  1F0X A;  4IG3 B;  2WAQ D;  5DET A;  1QVG R;  2RF2 B;  1FWL A;  3K5M A;  4YY3 J;  2ZOF A;  4ZPA A;  1VQP S;  1FRJ A;  1UKU A;  2WW4 A;  4RUH A;  5CCL A;  1P1L A;  4J90 A;  1REV A;  2EFN A;  1S4F A;  2ASJ A;  3IAM 9;  3VAL A;  1N33 J;  1U24 A;  2AW0 A;  3LP2 A;  5J2N B;  3K5L A;  1SC3 B;  2DGX A;  4LFB F;  5KG6 A;  2IDL A;  4CRJ A;  4X4P A;  3EGZ A;  4WTY A;  2XG8 A;  1IKV B;  4LUB A;  1XNR J;  3FBF A;  3MM9 A;  4AYB D;  1M5V C;  1R8H A;  4ZVP B;  1RJJ A;  2MKH A;  3OBI A;  2X1A A;  3HKZ D;  2V5H G;  4KKO A;  1RHQ B;  1J5E F;  2LA6 A;  4MK8 A;  4PXC A;  2RE1 A;  3M2R A;  2IMW P;  1T11 A;  1OPI A;  2IRX A;  3GII A;  3OVA A;  4OJH A;  1KVJ A;  1IM4 A;  3U1N A;  4Z37 A;  1A6L A;  2QA1 A;  2HVD A;  3T6J A;  5HQM A;  2Z58 B;  3MTJ A;  4KY3 A;  1NK7 A;  3A1Y G;  3IO1 A;  4V1A k;  3KMS A;  2OH2 A;  2UXC J;  3MAQ A;  4IOC Q;  4G3I A;  3PX4 A;  1Q79 A;  2AJ0 A;  1Q86 T;  4C6A A;  1L5U A;  1KC8 T;  3CDB A;  2EBG A;  4OX8 A;  1IKX B;  1E6V A;  3D54 A;  1JLG B;  4LRB A;  2D3O 1;  4DR1 J;  1FDD A;  5BXI A;  2QT7 A;  4KRW A;  1RP5 A;  4PG6 A;  1ZS6 A;  4JI4 J;  4DN0 A;  2NZC A;  2ZM6 J;  2E9R X;  1UZH A;  1GEH A;  2BX6 A;  1Q1K A;  3QAU A;  2ZVI A;  1H73 A;  1MWZ A;  1R8P A;  5ETN A;  3FBB A;  1R0C B;  1RYR A;  1FTC A;  2C3O A;  1R0A A;  1TL3 A;  1DRZ A;  4RW9 B;  2DRB A;  2Q3P A;  2OPR A;  1SV5 B;  4K0K J;  2AYG A;  2ABY A;  5E3Q A;  3TJ9 A;  4LFA J;  1RAH B;  2OIH A;  1DJ0 A;  1MU2 B;  4DV3 J;  3KNA A;  5I3P A;  1U1N A;  2M8D B;  3OD2 A;  3NY0 A;  2Y8Y A;  2G1H A;  1IQT A;  4H54 A;  3TZW A;  1BQM B;  2VU5 A;  3TQE A;  3DN9 A;  2LXF A;  2YWE A;  3KLV A;  3F0N A;  1S77 D;  4GKJ J;  2JLE A;  1S76 D;  5CYJ A;  3BV8 A;  4U7C A;  2MZS A;  2GC8 A;  2KM8 B;  2HNZ B;  3RBE A;  3CDW A;  4USV A;  4USK A;  2DNN A;  5HK4 A;  3DGP B;  5K8N A;  2ZKT A;  3W3S A;  3KLG B;  1UVM A;  3FFI B;  4OV1 A;  2CQ4 A;  2V34 A;  1ZA1 B;  3BQ2 A;  3C14 B;  4NXM J;  4KV8 B;  4OJ3 A;  4JI1 J;  3OFF A;  4J9U E;  3MM5 A;  3EYZ A;  1FKO A;  4WXO A;  4M1K A;  4EZ6 A;  3DXS X;  5M2P A;  1RAA B;  3TYT A;  2KG0 A;  2J0W A;  5D4O A;  5ETP A;  3QIP B;  2I0X A;  1JKH A;  2CWK A;  4E2F B;  3OXF A;  3PDN A;  3BSC A;  1DBD A;  1PIE A;  1GMW D;  3L9Z A;  3K17 A;  3DXB A;  1UET A;  1N34 F;  2HFN A;  3TA0 A;  4L3N A;  1WEZ A;  2N4C A;  2BDP A;  3ZTR A;  3M1V B;  3MWB A;  4CI0 B;  1SUQ A;  3CJ4 A;  4OYO A;  1HBU A;  1ICE B;  4M5J A;  4LVN P;  5J2Q A;  3FK4 A;  3G71 S;  3TA2 A;  5E3P A;  3K59 A;  1W2B R;  3GV7 B;  3M7V A;  2GV1 A;  3P5B P;  3BGR B;  1ZET A;  2ROE A;  3NAI A;  5AXN A;  3EPI A;  2OPQ A;  5D0H A;  4X62 F;  2OSR A;  2PD1 A;  2XS5 A;  2LXI A;  1I94 J;  2MMY A;  2GJ2 A;  1R6Y A;  2OMO A;  3H59 A;  1C0T A;  4U96 A;  3DCA A;  4UT4 A;  1X5S A;  3FQK A;  4FXW A;  4CM2 A;  1LV5 A;  3UD3 P;  2G0J A;  4LF1 A;  2V8H A;  1BWV A;  4WP3 A;  4OX9 F;  4R5P A;  1VQ4 S;  3WZ0 A;  4DFK A;  1QE1 A;  1VRT B;  1F1B B;  2DH9 A;  2V4Q A;  3MR3 A;  4ILL A;  4MYT A;  2VKR A;  4ED6 A;  1GXL A;  4DUT A;  3GIM A;  2DNR A;  4DV6 J;  5I3U A;  2GW8 A;  1SKU B;  1IUJ A;  2EKY A;  5JXS A;  1L3T A;  5F8G A;  2Q1L A;  4DBQ A;  2VC0 A;  2WVC A;  3KFW X;  2CQC A;  4DU7 A;  1MG7 A;  2JC0 A;  2CQI A;  2HIY A;  5THW A;  2B9Y A;  4Z2X A;  1T9X A;  4JI6 F;  2AGP A;  3C66 A;  3DHX A;  3HCX A;  1QVF R;  3GR1 A;  1WF2 A;  4NLS A;  1NUE A;  3T19 A;  3CUL A;  5IXU A;  3ZNJ 1;  3QZ7 A;  1RTI A;  1J5O A;  4QIV A;  3MTK A;  5GAD I;  2RB7 A;  1Q7L B;  8RUC A;  2XMU A;  3M4X A;  3PW2 A;  4CNZ A;  4K4S A;  1FD8 A;  3TAR A;  1N5Y A;  4DV7 J;  3CGI A;  2FJV A;  2QGF B;  4K50 A;  3EXY A;  1FHT A;  1TKT A;  3FNN A;  4DPY A;  2ZBQ A;  4NXN F;  6FD1 A;  2POK A;  3CJ2 A;  4P2S A;  2IDE A;  4USI A;  1WDD A;  2WVE A;  2DH7 A;  2QX0 A;  3G96 A;  3BBB A;  3EGW B;  5ITH A;  4PWW A;  1R6V A;  3VGT A;  4FPI A;  3SQO P;  3ONQ A;  4M5I A;  1UVL A;  2HHQ A;  4P7V A;  2UV8 A;  4LFC F;  4A48 A;  2KRB A;  1RLD A;  3FMW A;  4DMZ A;  2AJQ A;  1HWL A;  5GMD A;  3QRP A;  1CC8 A;  3N9U C;  3PJ9 A;  2U2F A;  4B17 A;  3OJU A;  3RAQ A;  4X4N A;  1VDH A;  4MIA A;  3D2W A;  4PXE A;  1QD1 A;  2H5I B;  4PWD B;  4DSI A;  4Y6I A;  2DPI A;  1D9D A;  1HMV A;  1RHU B;  2H5J B;  3J7A 1;  2ASY A;  4WK3 A;  1FA0 A;  3I6P A;  2ZHB A;  4DL2 A;  1S1X A;  1AT1 B;  3OFG A;  4PZV A;  4C0B A;  2IA0 A;  3IRX A;  4MH8 A;  3BYR A;  3MED B;  3RAX A;  3I4H X;  2GAG C;  4XIU A;  4QW9 A;  3CCJ S;  3HDS A;  2N4D A;  3KHG A;  1D3W A;  4IR9 A;  2PA3 A;  3G2X A;  3NKY A;  4DSL A;  5CQG A;  4ANC A;  2K1R A;  3PW4 A;  4KJI A;  4LVO P;  1KEK A;  2HQG A;  2ADB A;  3DKD A;  4FVC A;  5CYM B;  2IJF A;  3NGU A;  4WTO B;  4PEO A;  2XY5 A;  3GR0 A;  2WVB A;  1TAU A;  4JB8 B;  1TL1 A;  4YDX A;  5J2M A;  1FJG F;  1BQN A;  3NWR A;  1Q95 G;  2F9D A;  4N8N A;  5A0Y B;  2ZBP A;  3IBF B;  4OLO A;  5E3C A;  1IWA A;  2R2U A;  4LSZ B;  2B4O A;  5HVF A;  3IS9 B;  1EP4 A;  1K8A T;  1TZ0 A;  2FTR A;  2CJK A;  2KVI A;  4G6V B;  2FHK A;  4A8S A;  1M5S A;  4DG1 A;  2DIT A;  1S5Z A;  5LOQ A;  3PYF A;  4EBD A;  3LGH A;  3MHY A;  1RZM A;  3V5R A;  1U0H A;  2IC3 B;  3OTB A;  3KHL A;  5DDQ C;  1HYS A;  3LW5 C;  4MK7 A;  1S1U B;  1S9E A;  4FYD A;  1NXI A;  1EB0 A;  3JTO A;  1LWF A;  1WG1 A;  3HXM A;  1YX2 A;  2QZ8 A;  4FF2 A;  1YBA A;  3PCO B;  4F0K A;  4IG3 A;  4C8M A;  4PPZ A;  2R8J A;  4F2S A;  1NHU A;  2RF2 A;  3E2E A;  2WCX A;  1RE1 B;  1H72 C;  3GCW P;  3U02 A;  5KG1 A;  1V3R A;  1C2P A;  2ROP A;  4KE5 A;  3FSX A;  2ZBC A;  3IN5 A;  1VQ9 S;  2M7S A;  1U7L A;  3UWT A;  5LMU J;  1JXV A;  2CQB A;  2OEK A;  4KHR A;  5IZH A;  4ZN1 A;  3S6E A;  2H54 B;  4OMF G;  2ZH5 A;  2DGO A;  1PJ5 A;  4KO0 B;  2DBB A;  3UN5 A;  1XEZ A;  3UW1 A;  1WOO A;  1R3N A;  2FHJ A;  1HD0 A;  2OJ3 A;  3OJS A;  1UWB A;  2UU9 F;  2DYA A;  1NDL A;  4RBV A;  1TK0 A;  3TNV A;  1IKV A;  3CSK A;  1NJI T;  1J2V A;  1SL2 A;  3R5B A;  4U8V A;  3B8H A;  2DXE A;  2OP5 A;  4H4O B;  3T6B A;  4J9S A;  4WFX A;  3V2U C;  1KD1 T;  3LPY A;  1U45 A;  4O3S A;  4ECR A;  2WBM A;  2HHS A;  4OV6 A;  5DDP C;  1PGZ A;  2UUC J;  2K3K A;  1VYA A;  1D1U A;  2RQ4 A;  1KRP A;  4MKV A;  1B0P A;  3G8T A;  4IDK A;  3MM8 B;  4WBF A;  3C2P A;  2FB0 A;  2ZUA A;  2J5A A;  1KQF B;  2M52 A;  3D0I E;  3SXL A;  1NSA A;  2HFV A;  2J8A A;  2RT3 A;  2OML A;  2XYH B;  5A2Q U;  2ALY B;  4QW8 A;  3BQ1 A;  1JLG A;  4ILM A;  4F50 A;  1FRH A;  2LEA A;  5IS2 A;  3UVJ A;  5IWA F;  5ETM A;  2CVE A;  2PT0 A;  4R0E A;  4DR7 F;  1G7C B;  4QWE A;  3LF0 A;  2EG1 A;  3QO9 B;  5EUH A;  2MQO A;  1C1B B;  3KHR A;  1L3K A;  4ZCI A;  1X5P A;  2WON B;  1AFI A;  1TMM A;  2DJW A;  4TNO A;  3JAM U;  2R7S A;  4LFB J;  3L3C A;  2F5G A;  4DR3 F;  2VJU A;  1N6Q B;  1IR1 A;  1LWE B;  3WIV A;  3H7H B;  2ZH6 A;  2FDN A;  2CXE A;  2LQ9 A;  2ZOG A;  5A8K B;  1FE0 A;  5ADZ A;  1J5E J;  5D3G B;  3QID A;  3QWP A;  1IR0 A;  1NPR A;  2HQD A;  4ZOS A;  2E1C A;  2X1F A;  2RDD A;  3WDO A;  4UZB A;  2OPP A;  3NGD A;  3EX7 B;  3P49 B;  1PAE X;  4UOF A;  2BJE A;  4OI1 A;  1WC6 A;  3DI6 A;  2R2T A;  3DLJ A;  1YTY A;  2GQ2 A;  1HBN B;  3PVX A;  3EJM A;  1PO6 A;  1T95 A;  2AGQ A;  3IBC B;  1UVI A;  1S6Q B;  2BQR A;  3LP0 B;  3K5O A;  1Q8K A;  3DGP A;  1RBL A;  4NPO A;  3EDQ B;  1TKX A;  2DNP A;  3KLG A;  2WSC C;  4DR6 J;  4F26 A;  2GS8 A;  2YWG A;  1WJ9 A;  2C28 A;  1RAO A;  4M5L A;  3C14 A;  1RT1 A;  4DPO A;  3DOL B;  5J1P A;  1NH8 A;  2WVF A;  1KTQ A;  3BGU A;  2YNH A;  2BAB A;  1S48 A;  2EBE A;  2EFV A;  2ZE2 B;  3AD7 C;  4UOC A;  3KG0 A;  1LFP A;  5GAG I;  3U7J A;  3BGL A;  1FKA F;  5EGY A;  3KJN B;  1B0T A;  2HNY B;  3J7Y U;  1TV6 B;  1IBC B;  5LJ3 Y;  4KIA A;  1SBR A;  3I31 A;  1RKJ A;  4ED5 A;  1Q78 A;  4FKY A;  5BYS A;  1R8B A;  3EGN A;  1VC5 A;  1RQ0 A;  4CTA A;  3P4U B;  1XNQ F;  3BKT A;  3H0P A;  4W92 B;  3PZP A;  2QSW A;  2ZBI A;  4B3O B;  2VPX B;  2YNF A;  1M5K C;  3EUN A;  4HTI A;  2UUA F;  2XSJ B;  1UW4 A;  3RU0 A;  4ZPD A;  1TQL A;  1VIX A;  3AOA A;  1HD1 A;  2V4J B;  1HKA A;  4CLP A;  3CJ0 A;  4HVZ A;  4KFB B;  3VQS A;  2MGZ B;  5GAE I;  3GCX P;  4AL5 A;  2X3D A;  1RWN B;  5ETL A;  3UD4 P;  4C0H A;  4KGX B;  2F4F A;  3KUE A;  4L75 A;  2XMT A;  5KFJ A;  4IH5 A;  1Y0H A;  1HNV A;  1SVD A;  2IM2 A;  3MPW A;  4WKR A;  2YNG B;  5AXK A;  4N8O A;  3B4M A;  4PQU B;  2ALZ A;  1IBK F;  2V2Z A;  2BAN A;  2KJV A;  4M95 A;  3RG6 A;  1N34 J;  2HBZ B;  2LU2 A;  5HQL A;  3R2C J;  2HQF A;  1YKW A;  3MM7 B;  3BF4 A;  1WOS A;  3HVA A;  2E9Z A;  3TA1 A;  3TEG A;  1O51 A;  4QWC A;  3CIZ A;  1CJT A;  5G4D A;  2VG6 B;  3D3C J;  2DKO B;  4C11 B;  3GJS B;  1LWC B;  2XO7 A;  3GPA A;  5C5J A;  1RCO B;  1X8D A;  1VOM A;  3H42 A;  4RW7 B;  3C3L A;  1TAQ A;  3VVT A;  1N88 A;  3HHL A;  5I42 B;  4GVB B;  1U2R A;  2HLT A;  4NA1 A;  4ECT A;  4TLQ A;  2ZDP A;  4NLG A;  4OQJ A;  1Q5Y A;  4LF6 F;  2XI3 A;  3FSI A;  1HA1 A;  2H5E A;  4GKK F;  1VC0 A;  1T94 A;  3I5B A;  4OX9 J;  5L46 A;  5K9F A;  3Q8S B;  3PTW A;  4TU9 A;  3VAJ A;  3LGM A;  1Y00 A;  2AJF E;  4F4Z A;  1AB8 A;  3HO1 A;  1HQ2 A;  4UW2 A;  2BEF A;  2ZHO A;  1NK9 A;  4UTG A;  4G1Q B;  1NRK A;  1MLA A;  4L74 A;  2DRA A;  2A0F B;  1RT5 A;  3KG4 A;  3SSR A;  4TQR A;  5KFI A;  2V2Q A;  3DLK A;  3DRP B;  2LEB A;  3MUV P;  1U8S A;  1WAC A;  1LW2 B;  2JVR A;  3H8Y A;  3PHT A;  1QJH A;  2R7X A;  2Z4P A;  3ZC4 A;  4CLS A;  4J5O A;  3UCZ P;  1YBU A;  5KT3 A;  1ZTW A;  3X3U A;  1ZYQ A;  2M4M A;  2A2D A;  3J80 Y;  3TI0 A;  3HD2 A;  3NCP A;  4K5R A;  1XR7 A;  4YDD B;  4I56 A;  3I0R B;  4RLE A;  2FJE B;  1M5O C;  4H4M A;  3A12 A;  3C16 A;  1T03 B;  5B0G A;  4NLR A;  4XDD A;  1RI7 A;  5CA5 A;  2EEY A;  3V4I A;  4K59 A;  4I69 A;  5F9N A;  1ELO A;  4LMZ A;  3OXL A;  2F8M A;  3GFX A;  3FDS A;  3M32 A;  2C42 A;  2DNO A;  3PKY A;  2IC3 A;  2MZJ A;  1YK9 A;  4QYZ J;  4DF4 A;  2FZK B;  3PYD A;  2MHE A;  4BHQ A;  1FX4 A;  2EFG A;  3Q23 A;  4J37 A;  3FEX B;  1F3F A;  3RRG A;  1WOR A;  1BE4 A;  2C3U A;  2RML A;  1L3V A;  4IR1 A;  1Q7Y T;  4C2M A;  4C8Y A;  2LDI A;  1R43 A;  3OFE A;  3OLB A;  3KHH A;  1WOP A;  5KFH A;  3KUG A;  4HT7 A;  2IRY A;  4NLW A;  1Q82 T;  1RHJ B;  1Q4R A;  3HK2 A;  3FRY A;  2YPY A;  3MEC B;  2Q6B A;  4ZP8 A;  3TAM A;  4HH0 A;  3NMA A;  3A8K A;  4CYU B;  2NS1 B;  3SCL E;  3G82 A;  3RR7 A;  3JQK A;  3EVW A;  4TY9 A;  4ENO A;  5BR8 J;  2YKP A;  1DQ9 A;  4RJV A;  3IXQ A;  2VFS A;  2ZNY A;  4DSF A;  1MMD A;  5K14 A;  1NB7 A;  4QU6 A;  1UPP A;  3ET6 A;  2V6A A;  2IBO A;  5ETK A;  3FCW A;  4H4O A;  2FIU A;  3L95 X;  4KGK A;  5T7L B;  2BR0 A;  2F1F A;  2CPE A;  1KS2 A;  2KI2 A;  2LCW A;  4I64 A;  3BKF A;  1YDL A;  4OZ3 A;  3T5J A;  1IKY A;  4USM A;  1NK5 A;  3C19 A;  3RJM B;  1KDN A;  2PEB A;  1AZS A;  2WVD A;  1QSL A;  1NK0 A;  2VJV A;  4M5M A;  3TQ1 A;  2QL7 B;  5K8P A;  3MM8 A;  3CCQ S;  1P27 B;  3W5X A;  3N6N A;  2E7W A;  5GAD U;  2EI5 A;  3N28 A;  2YTC A;  1XMO F;  1OY8 A;  3KXD A;  2BQU A;  5KG3 A;  4MFB B;  3ENV A;  2H51 B;  3D68 A;  4CLW A;  3JQM A;  3EVM A;  3QO9 A;  5M2R A;  3SMZ A;  2FJB B;  3EZ5 A;  3TVZ A;  2YWH A;  4C97 A;  4ETX A;  3E3X A;  1X4F A;  4ED2 A;  5B0A A;  2WON A;  3JYT A;  4ZHR B;  1O6X A;  5U47 A;  4J9M A;  1IN0 A;  1S7H A;  3OQ2 A;  2YKQ A;  5HLF B;  2ZH1 A;  2UU9 J;  2B9E A;  1HWK A;  3MMC A;  2CZV C;  3IR5 B;  1NND A;  3W1Y C;  2YBV A;  2HS0 A;  5EDW A;  4TY8 B;  2PSZ A;  2FJA B;  3FZ2 A;  1NH7 A;  3GFH A;  2I38 A;  3D7S B;  2VG7 A;  5KT7 A;  3QYY A;  2HHH F;  1T8E A;  3PRD A;  3NAH A;  1VLY A;  2VHG A;  3CO0 P;  4YS2 A;  3RAM A;  1MNE A;  4IYQ A;  4CH1 A;  4DUZ F;  4V19 X;  1PBA A;  2J9C A;  3PR5 B;  1VRQ C;  2DHG A;  1YJU A;  3LP0 A;  3G4S S;  2BE9 B;  5CAB A;  2Y1J A;  2QLB B;  4I6A A;  1N4L A;  1O8B A;  1U8W A;  3CTR A;  3DU6 A;  5IWA J;  4YFU A;  2G9O A;  1NEE A;  4AE5 A;  2DNM A;  4IFV A;  4DR7 J;  1O5J A;  1RT4 A;  2I1R A;  5DQH A;  1IBL F;  2PN6 A;  3HX9 A;  2HWH A;  3TR5 A;  1U1K A;  3R27 A;  1RTD A;  4B3S F;  1HQE B;  1BD6 A;  4BCA A;  3BGF A;  4QU7 A;  3NBP B;  5D77 A;  5HAT A;  2Q79 A;  2JX2 A;  4LR7 A;  3MMB A;  1ZZF A;  4ZIV A;  4DR3 J;  3EZO A;  1OPZ A;  1CUL A;  1MN7 A;  3KWM A;  4OZ1 A;  4B9U A;  3IGV A;  4FYX B;  4ZN3 A;  4AXI A;  1JWW A;  1RAF B;  5HSP A;  1WEL A;  3UDE A;  2F40 A;  2BW7 A;  3EE3 A;  3OR2 B;  4FNH A;  1FER A;  3HVR A;  5SUH A;  3W9H A;  3HI9 A;  3I82 A;  2BA9 A;  2W2N P;  3HHN B;  2DGU A;  2HAI A;  5HBM B;  4DS5 A;  1T9V A;  3BH7 B;  3AT1 B;  4NYP A;  4B9M A;  2OO4 A;  3B4D A;  2CUY A;  1FRM A;  3DMJ A;  4OYI A;  3RB4 A;  2XSJ A;  3H5U A;  2HUR A;  2YWF A;  4WPA A;  1UVK A;  3CJ3 A;  3OT9 A;  2KYX A;  4M8L A;  2UUB F;  4IUF A;  2HZC A;  2FHO B;  3DC2 A;  2MQL A;  5CCM A;  3M30 A;  5KFM A;  2AF6 A;  2D3U A;  2MGZ A;  1KNZ A;  1SQG A;  2ZWO A;  4JI3 F;  3DLH A;  1SJR A;  1QAI A;  3G6Y A;  4KQZ A;  3BDE A;  2J8S A;  1JIH A;  4Q8F A;  2W1B A;  3E8O A;  1X60 A;  4A8X A;  1CJK A;  3VAI A;  1UMJ A;  1HHQ A;  2R7V A;  5KG4 A;  4S0M A;  4NLQ A;  2VBX A;  3ZTO A;  2HQ3 A;  3DYA B;  1S9F A;  5A8R B;  3D67 A;  4LQ3 A;  3I87 A;  5HJY A;  3R1L A;  5FDL A;  2B3T B;  4DV5 F;  5D78 A;  2GJF A;  2F4V F;  1HWU A;  4DWI A;  4K4U A;  2DO0 A;  3CVK A;  2ZUG A;  4NL5 A;  5DO2 A;  3GON A;  1WHW A;  4YUD A;  2CPH A;  2H3E B;  2WK4 A;  3PRV A;  4UF4 A;  1S6U A;  2QLF B;  2CQP A;  4A4J A;  3HVT B;  4FBU A;  2KT2 A;  5EWF A;  2ROG A;  3TAQ A;  2NR0 A;  2BUN A;  4OZL A;  1KLM B;  1T7P A;  2UUA J;  3R6L B;  4X66 J;  1RT7 A;  2XEX A;  1Q0N A;  3U27 A;  2MKS A;  2GO8 A;  2RSQ A;  2XZT B;  4RL1 A;  3P6Y C;  4RW6 B;  2KB2 A;  1AYE A;  6FDR A;  2AV5 A;  2GFF A;  3O3L A;  2OKQ A;  2UVV A;  2F7V A;  3BR8 A;  1NO8 A;  1MRO B;  4MIB A;  3PO5 A;  4LRE A;  4RUC A;  2XNQ A;  3GG1 A;  1RTJ B;  5C25 A;  1JLQ A;  2CJ9 A;  3VTI A;  2HHU A;  3CD5 A;  1PC5 A;  3QRQ A;  3U1L A;  2MKC A;  1XK8 A;  1Y10 A;  3PY8 A;  2IM0 A;  2JFD A;  2K06 A;  1GMW A;  2W9C B;  4XO0 A;  3DRP A;  3MMJ A;  4JI7 F;  1IBK J;  5HO4 A;  4WE1 A;  1DZ5 A;  1QUV A;  3AJD A;  3DHW C;  3RUB L;  4A8W A;  1ZOT A;  1FI4 A;  1ZA2 B;  2EWH A;  5DZ7 A;  1XC9 A;  3VWS A;  1M5H A;  2ACM A;  1X4C A;  4O44 A;  3EM1 A;  3FUY A;  3G8Q A;  5IC6 B;  2FYX A;  4KR0 B;  2W24 A;  3I0R A;  1GH8 A;  4OJ1 A;  4YR0 A;  1RT2 B;  1JXL A;  3VZH A;  2L3M A;  2IVF B;  1EIY B;  5T14 A;  2N7Y A;  4FS2 A;  3IBW A;  3RR8 A;  2W8L A;  4O23 A;  2ERR A;  3BZQ A;  4ZIW A;  2H1Y A;  3UDL A;  5AT1 B;  4KHM A;  1XR6 A;  1EET B;  1VK3 A;  4X4T A;  1HL6 A;  3IA0 A;  5GAG U;  1RKI A;  5L1J A;  5KG5 A;  1JX4 A;  1FEH A;  1RWP B;  4LF6 J;  2G4B A;  2XYG B;  1LK5 A;  5M2U A;  1BQX A;  4GKK J;  3HZG A;  3QSI A;  3QZ8 A;  4ZVU B;  1JLA A;  4X65 F;  4EYI B;  4IQX A;  1UFK A;  3NOG A;  5J1N A;  4LF8 F;  3SBM A;  1YJ7 A;  3ZZY A;  2WOM A;  2HPU A;  3BO4 A;  7FD1 A;  3SFU A;  2XHW A;  2B6A A;  4USJ C;  5I3Q A;  1MWQ A;  2IVY A;  4K4T A;  1FVS A;  2KHC A;  3MEG B;  2OEL A;  3V6J A;  5E0O A;  1HNX J;  3ICL A;  2W2P P;  1TVR B;  3FZB A;  4DPT A;  5A8W B;  2D41 A;  2GAH C;  2QC3 A;  3V81 B;  5AE1 A;  3ETO A;  5GAE U;  1U25 A;  2OD6 A;  5CHC B;  3LTO A;  3W2W B;  2KM8 C;  2G2Y A;  3NCR A;  4ZS6 A;  1FRI A;  3PW7 A;  4ECQ A;  5JVG Q;  2NZ4 A;  2GVD B;  4NEZ A;  3TUZ C;  1LXJ A;  1ZM2 A;  5K20 B;  4ZA1 A;  1LKZ A;  5J1E A;  1FCA A;  1BUX A;  5T7L A;  2HZA A;  1OQ6 A;  3D3B J;  1XIQ A;  1Y3J A;  2DVI A;  2PI4 A;  2ZNZ A;  1NKB A;  2GML A;  3SIP B;  2NPI A;  4HHH A;  2GGP B;  3CJ8 A;  2AZ3 A;  1JMT A;  1K1Q A;  4KC5 A;  1YRT A;  1UL3 A;  8ATC B;  1JLC B;  1Y5I B;  1VS3 A;  1AA1 B;  4P52 A;  4DPW A;  3QAE A;  5IQQ A;  5D15 A;  2X1G A;  4IG0 B;  2ZJR Q;  3SFG A;  3H98 A;  2ACY A;  5DG7 A;  1RWU A;  4UQG A;  2JC1 A;  2JOQ A;  5ETT A;  5L8R C;  2JEF A;  2J76 E;  1KKH A;  3F41 A;  2BRK A;  4MFB A;  1PCA A;  5L9N A;  1NBE B;  4QIW D;  3WBZ A;  4R25 A;  1EZZ B;  1HFE L;  1T9T A;  2CAD A;  2CPJ A;  2RH3 A;  4C4W A;  3SCK E;  3LWM A;  4DZD A;  4O4R A;  4LRA A;  3DRX A;  4ZHR A;  4ZVO B;  4O0N A;  4EFA C;  2DIV A;  4O3O A;  1W2I A;  3UN3 A;  3CW2 C;  3DOM A;  3KLE B;  2AD9 A;  4QYR A;  1S9G B;  2G0I A;  4Q0B B;  3GP9 A;  2YQ1 A;  3TW0 A;  1C4C A;  1RB0 A;  2MJN A;  2DHH A;  4PG8 A;  3O8W A;  4NZ0 A;  5KFW A;  4X4V A;  4C8Z A;  2A6O A;  5KT2 A;  4TY8 A;  3ENW A;  3GZ7 A;  4RUA A;  3MMA B;  3GV5 B;  4Q43 A;  3OUY B;  4AQY F;  2CJB A;  2HEK A;  3KLI A;  2QYG A;  1KSP A;  5E3A A;  2HRT A;  2FC8 A;  4Q2L A;  2XMV A;  3AJ2 A;  3VQT A;  5LMN F;  1Z4U A;  2OD4 A;  3MCM A;  5B0E A;  4X4O A;  3DRR B;  1S0N A;  1H98 A;  4F04 B;  4IQM A;  2DTJ A;  4ICL A;  3PHE A;  2XLI A;  1YJV A;  4DL5 A;  1BC6 A;  1KQG B;  2XMW A;  1P9Y A;  2MEW A;  1T0T V;  3BSA A;  2DRD A;  1XMO J;  2E1R A;  1VRU A;  3ZZU A;  3QFH A;  3EIC A;  5LSO A;  1YVF A;  1K0T A;  3VF0 B;  4LRD A;  2K3I A;  3AJ1 A;  1ROF A;  2A10 A;  4P75 A;  3IGN A;  2XGP A;  4ZCK A;  1U1M A;  3B54 A;  3PV8 A;  1Q53 A;  1HWI A;  3FGV A;  3T5L A;  3RYL A;  3G86 A;  1HQE A;  5AXM A;  2ATL A;  1SH3 A;  4A8O A;  3UNG C;  4F02 A;  2W9B A;  1OQ3 A;  2MZT A;  4NLD A;  8AT1 B;  3R9L A;  1TK5 A;  3NS5 A;  4D3G A;  4I6W A;  4OHY A;  2B5J A;  1PBU A;  1P1T A;  3GFZ A;  5KFR A;  1NPK A;  2I2Y A;  3H4B A;  1L3S A;  4G1I A;  4ER8 A;  1K73 T;  3DLE B;  2KH9 A;  4NRU A;  4C8O A;  3GJT B;  3HHL C;  1AXQ A;  1O0P A;  5HMW A;  4HHU A;  4L72 B;  3MPY A;  4P10 A;  4B3M J;  3OL6 A;  1UA0 A;  1HWJ A;  3D0G E;  3OR2 A;  2OGU A;  3KJV B;  5C42 A;  1DY3 A;  3FC9 A;  5KFV A;  2HHH J;  3DRY A;  5HBM A;  3MPD A;  4N56 A;  3Q86 A;  3I5A A;  1ULR A;  3QLH A;  3OSN A;  3JB9 k;  4DUZ J;  3MEE A;  3US5 A;  2N82 B;  3ISN D;  4QIF A;  2E5G A;  1H2U X;  1UA1 A;  5FLX Y;  1CQM A;  4A8F A;  2HFU A;  5KFE A;  4IOA Q;  1SC6 A;  2HHX A;  3V6K A;  1WEY A;  3K5N A;  1ZPW X;  3O2I A;  4OZ0 A;  1PJ6 A;  3FMB A;  1ACM B;  1YZ7 A;  1EHW A;  2XLK A;  3N6M A;  1B7Y B;  2IAJ B;  1D09 B;  4N77 A;  4NLP A;  2J7U A;  2P9C A;  1IBL J;  4Q44 A;  4B3S J;  4PQA A;  3LAL A;  3DM2 B;  4TLR A;  5RUB A;  3MM6 B;  1NZ8 A;  3WC2 A;  1NLK L;  3DYA A;  1WEX A;  3V4M A;  5A8R A;  2DIU A;  2ZC4 A;  1RA7 A;  3ELH A;  3PXG a;  2A2C A;  3IFE A;  2ZKU A;  1SQF A;  3SDE B;  3M8P B;  2OEJ A;  3OHB A;  3TAN A;  3CCU S;  4LIW A;  4MIW A;  2GMJ A;  5EX3 A;  5DM6 Q;  2WBR A;  2IY5 B;  2VV5 A;  2M88 A;  2GA7 A;  5KFA A;  1RK8 A;  3EPG A;  3OXG A;  3TZX A;  3CCM S;  1WC0 A;  4O3Q A;  2OPS B;  1S1V B;  3O6Q A;  4P74 A;  1V6H A;  2HND B;  3HLU A;  1TUG B;  3CNQ P;  4JV1 A;  1A9N B;  3CD7 A;  1GX6 A;  2UXD F;  2UUB J;  5K8O A;  2FC9 A;  2GHW A;  4AL6 A;  1AFJ A;  4MTP A;  2FJX A;  2W4C A;  3TVK A;  3PYE A;  1X9W A;  3CB4 A;  1MRO A;  2VBZ A;  1URN A;  2SXL A;  2CJX B;  2RUS A;  2KFZ A;  1C1C B;  1URR A;  1F2G A;  5HRO B;  3J81 Y;  2CJA A;  1AUD A;  4K5S A;  2GVZ A;  4CO3 A;  3ZZT A;  4AL7 A;  4ED8 A;  3K8V A;  2FLP A;  3M8Y A;  3M8R A;  4LBP A;  1MSW D;  1H7X A;  2ASL A;  4PWU A;  2OSQ A;  1C0U B;  1JJ2 R;  3ADA C;  4HR2 A;  3E01 B;  5EX0 A;  1F9E B;  1KON A;  4NYO A;  4ZLJ A;  4CWB A;  3TUI C;  4DJB A;  2F4V J;  3M8Q B;  3M6X A;  2AMC B;  1LNQ A;  1HAR A;  2CNN B;  2CPD A;  3KK2 A;  1HBM A;  4DR4 J;  3R7B B;  4OX7 A;  3LAM A;  2J6S A;  2RQC A;  3C15 B;  1FES A;  4BWJ A;  4DCO B;  2VBY A;  3NCQ A;  3MUM P;  1UVN A;  1NU4 A;  3AQO A;  2BE2 A;  3DLL Q;  1I6J A;  4ZVS B;  5B09 A;  2RKI A;  1N54 B;  3T1Y F;  2YKN B;  4RW4 B;  5G0R A;  3H2L A;  4H4K A;  4OHX A;  4JP8 A;  3X1L B;  1WTF A;  1DTT A;  1RT3 B;  3I32 A;  1S1W B;  4FYY B;  1HNZ F;  4NI2 A;  2XBP A;  2PMW A;  3M8W A;  2BJ9 A;  1KTV A;  5F8N A;  2W01 A;  1EET A;  3A3N B;  4I2P B;  4AUK A;  2XZD B;  4Y00 A;  4YR2 A;  2PO4 A;  1JLB A;  1HPZ B;  3LO3 A;  3P5T L;  2AIR B;  2B9W A;  3U1M A;  1VCT A;  3R1H A;  3IG1 A;  2NXC A;  2UUW A;  2GIF A;  3QSY B;  2VOD A;  2QO3 A;  1RWO B;  3H2V E;  3OHA A;  3I0S A;  2C3M A;  1GAO A;  1FTR A;  1WDT A;  1RAJ A;  2NCK L;  4NCG B;  1TKZ A;  4OL8 A;  5HAO A;  3KUH A;  2AU0 A;  3OL8 A;  4ED4 A;  1U49 A;  5HMY A;  3OPK A;  4K4Z A;  2DY9 A;  3HHD A;  2NXU A;  5FII A;  3QAT A;  1I5O B;  2EFO A;  2HGM A;  3KTQ A;  2MHN A;  3HHE A;  4QPX A;  1CJU A;  5B0F A;  3SV3 A;  3V81 A;  4ZJL A;  2IJR A;  3V6H A;  1RTH B;  3RRK A;  4RUB A;  1B7F A;  5GME A;  3EWG A;  5HP1 A;  1CJV B;  1WF0 A;  1LEO A;  2F9J A;  1EAR A;  1IBM F;  4MT1 A;  4PAA A;  1HBO A;  4DFM A;  2GVD A;  3JQJ A;  2HG4 A;  2CQD A;  1ZM4 A;  5FJ4 A;  1EX8 A;  3Q24 A;  5ETR A;  3N6L A;  2E7V A;  4QJV A;  2V94 A;  4JOU A;  4LSN B;  3CXC R;  3C6T B;  2VC1 A;  1OJ4 A;  4ZPT R;  5J2P B;  4ID5 B;  3GMG A;  4OYB A;  3GFY A;  2VG5 B;  1HW8 A;  1R31 A;  4YQW A;  1JLC A;  3DGV A;  2FY8 A;  4CT8 A;  1T02 A;  2OLW A;  3FCV A;  4LF8 J;  2Y1R I;  4KB7 A;  1CG2 A;  2W4D A;  3CJS A;  3NOC A;  2HBR B;  4HDH A;  4EZ9 A;  5JJB A;  4WZQ A;  3FVY A;  1FT8 A;  4B02 A;  2V2V A;  4ZP9 A;  1SH0 A;  1RAD B;  2PEH A;  4ZVF A;  3J7Z 5;  1RBA A;  2D1C A;  2MSS A;  2Y0S D;  3AB4 B;  4YN3 B;  1U02 A;  1UFL A;  4LF5 F;  1QAX A;  1YSJ A;  3RBZ A;  4OZJ A;  2HBQ B;  4CLU A;  2LDY A;  1WF1 A;  2KJW A;  2VFU A;  4YB5 A;  3JAM Y;  3BN7 A;  1I51 B;  1PYT A;  3M6U A;  3QT8 A;  5HVH A;  2YQ0 A;  4JYA F;  4TXS A;  3PO4 A;  2RHS B;  3KLE A;  4DI6 A;  1KWM A;  4NA3 A;  1V3Z A;  4BDP A;  1E6Y A;  4MAK A;  1S6P A;  2Z2Y B;  3GWC A;  4YHH F;  3IWL A;  2HQC A;  4RU2 A;  2X7I A;  1OO0 B;  1PJ7 A;  3R5C A;  2CPX A;  1GX5 A;  3I96 A;  2CDQ A;  4AD6 A;  2W9A A;  2GJI A;  4J9O A;  4FZV A;  3KK1 B;  4CM0 A;  4KGZ B;  3SSQ A;  4LRF A;  2BKN A;  3M9M B;  4B3R F;  3BYP A;  3MAA A;  3ITH A;  5F3T A;  5KFF A;  3LP1 B;  2BM0 A;  3NNA A;  2VOP A;  3A3O B;  3KK3 B;  3QGH A;  4I7F B;  2CQ2 A;  4ZVQ B;  2Z2Z A;  1ZAV A;  3MAH A;  1AW0 A;  1NAQ A;  5E3R A;  1UZD A;  4ECY A;  3NGK A;  4DR1 F;  1UW9 A;  1LQ9 A;  1CSJ A;  2XSF A;  2D7S A;  1R89 A;  1JXE A;  4LSL B;  1Y4Z B;  4F4A A;  2VQF F;  4KHP F;  4P2F A;  2ZH8 A;  4IH7 A;  2YXL A;  5D0E A;  2X1B A; 
#chains in the Genus database with same CATH homology
 3QRP A;  1WJ9 A;  5H9F K;  4DZD A;  2Y9H A;  5H9E K;  3QRR A;  2Y8Y A;  2Y8W A;  5CD4 A;  4U7U D;  3QRQ A;  4QYZ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...