4DZDA

Crystal structure of the crispr-associated protein cas6e from escherichia coli str. k-12
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
199
structure length
193
Chain Sequence
MYLSKVIIARAWSRDLYQLHQGLWHLFPNDFLFHVEKRNTPEGCHVLLQSAQMPVSTAVATVIKTKQVEFQLQVGVPLYFRLRANPIKTILDNQKRLDSKGNIKRCRVPLIKEAEQIAWLQRKLGNAARVEDVHPISERPQYFSGDGKSGKIQTVCFEGVLTINDAPALIDLVQQGIGPAKSMGCGLLSLAPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of endoribonuclease Cas6e from Escherichia coli
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Uncharacterized protein ygcH
total genus 36
structure length 193
sequence length 199
ec nomenclature
pdb deposition date 2012-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08798 CRISPR_assoc CRISPR associated protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1200 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 1 4dzdA01
3.30.70.1210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 2 4dzdA02
1WJ9A 2Y8YA 3QRRA 4DZDA 4QYZK 5CD4A 5H9FK 3QRPA 2Y9HA 2Y8WA 4U7UD 3QRQA 5H9EK
chains in the Genus database with same CATH superfamily
8RUCA 1RYRA 4C98A 3MPVA 2AGPA 5A8WA 1UVIA 2L9NA 4QIVA 4C8LA 2E1RA 3DGPA 2FDNA 3QT6A 1FRMA 1H72C 1N0VC 2J9DE 2KXHA 2BVZA 3MDFA 4R0JA 1VQ7S 2BE9B 1RTDB 1PBUA 3EZOA 3LALA 3RAQA 4J9VA 1OSCA 3WIVA 4QQBA 3C6TB 2MKYA 2FD2A 2F9DA 4J9QA 1N34F 2XMWA 1O0PA 1NHKL 2XLKA 4WKYA 1OY6A 4DQQA 2Q43A 4DS4A 2HQ3A 2XZWA 1QVGR 4QCLA 1VK8A 3ET6A 4OI2A 4LRDA 3H25A 5EDWA 5KFUA 3PZPA 2YNFB 4F0HA 4MMOA 3KJFB 4PG7A 3B78A 5CYQA 1IBLF 3C3LA 5HLFB 4DL0C 1WNEA 5D4NA 3CCJS 3I9V9 2XMKA 4PEOA 3GV5B 3PV8A 1S12A 1UA1A 2BM1A 3ZZ0A 4B17A 3VCDA 1OQ6A 4EI2A 1AT1B 4UTGA 1QY7A 2E5GA 3O5TB 1Q1KA 2C2ZB 4M1KA 4NLOA 3AB2B 2YNHA 1VQKS 3GZ7A 3M1VA 2X51A 2QYCA 3QPIA 4IFVA 4DI6A 3MPDA 3AA9A 3MFHA 1UEKA 2GX8A 5LMUF 1K73T 5ETKA 3IGVA 4LF7J 1GH8A 1VRUA 2I1RA 4V19J 4NCAA 5EX3A 2KG0A 2LQBA 1WUUA 2HGLA 2ZNYA 5IC6B 1BGXT 1N52B 3MUVP 1R0AB 3UDEA 4PUOA 2ZM6F 3RBDA 1LK5A 1WELA 1EX8A 3JQKA 2R8KA 1IKVA 1Q8BA 2CPJA 2MQ8A 3R27A 1SQGA 3PKMA 2YWWA 3TAMB 4ELUA 2JL9A 4C8OA 4EYHB 2BX6A 1A9NB 5J2MA 3EUNA 5F8MA 4DSEA 1CQNA 3T1AA 4DR7J 2XSJA 1B0VA 2YWGA 3FCVA 1YBUA 4WBFA 4WWSA 3OL8A 1NK4A 4DQRA 2WK4A 3FKBA 5DDOC 1MMLA 2Z2YB 4OZLA 1U7LA 3K8WA 2ZE2B 3PJWA 4OYWA 4Y00A 2ZOFA 2UV8G 4KPCA 3W63A 5CD4H 5HSPA 4BS2A 4F4KA 3HCXA 3B4DA 1TKXB 4ZPTR 3U27A 5A0YA 1RDRA 2ALYB 4Z7YA 4ZVFA 3OHBA 3RYLA 3MURP 3EPIA 4DR1J 2B4VA 2JVOA 4C11B 1N5YA 4NXNJ 1HQEA 1J5OA 4CH1A 1FJCA 4ILMA 4OYMA 1QAXA 2NS1B 3T5KA 2IRXA 5HP1A 3LW5C 3CCES 4E0DA 3BBBA 4O3NA 3OL9A 2MQPA 4PG8A 1GAOA 2W9BB 4OI0A 2W7AA 2HEKA 2VOOA 2IVYA 2FJDB 1XC9A 3RRKA 5AXMA 1T0TV 2DNQA 3D3BJ 1LWEA 1OS5A 1FX4A 3MPUB 5THWA 1UTAA 2QSWA 4DV4J 1D8YA 3CIZA 3UD5A 3OW2R 2M2BA 4ID5A 1VQ6S 1WC6A 1FJGJ 1W2IA 3RW6A 1UAWA 1YIJS 3J7A1 2XI3A 3D0HE 3C16A 5KT7A 5MLCV 4BLGA 1HKAA 4UZBA 3UN3A 2V6AA 4RU2A 3JAMU 2JEJA 4FYWB 4DCPB 1F2GA 2ABYA 3DYAA 1T8EA 2MTLA 1BC6A 3A8EA 3PXGa 1PSDA 5C2GA 5C25A 4DF8A 1HHSA 4WU2A 2PDAA 3PACA 4BC9A 4JI4F 1NMEB 2QX0A 2W2MP 4G1QA 4OYXA 1F9HA 5EHHA 2W9CA 2VQFJ 4DUYF 3V4IA 4YY3J 2PMHA 3QT7A 3K5PA 4NA3A 4NOHA 5T14A 4L3KA 3OXFA 4PWDB 3I96A 4F4YA 4DR2J 2L3MA 2ZDOA 2B6AA 4YDXA 2DGWA 1VRTA 3MOJB 1WJ9A 1P9QC 3HVWA 3S1TA 2QSFA 1UJ6A 3DOKA 3PRVA 1HR0J 4I6WA 4X2BA 1AUSL 2C2KB 2DHSA 2CZVC 3D66A 3PHEA 2E9ZA 4U7UK 2DHXA 2EFNA 1EHWA 1F6TA 4ZPVR 4YEAA 4WTOB 3AHPA 1N34J 2EKYA 1S6OA 4HT7A 4KGMA 4ANDA 2KL8A 5BYSA 2PIIA 4ZVPB 1S0MA 4F4AA 3NNAA 3FMBA 4ZCIA 3JSMA 2OIHA 3KLFB 2VA3A 1FD8A 2RB7A 1N5TA 3EXCX 2WZ1A 4PPDA 4F3QA 4EZ9A 1TV6B 1IR1A 1S57A 4DR3F 3BSNA 1VGYA 2DHAA 4WFAQ 4DV1F 4R25A 5D3GA 3KTQA 4C4WA 2FY8A 5J2PA 1X4DA 3LF0A 6FDRA 1LWXA 4Q43A 1GQEA 4N7TA 1R3NA 4AUKA 2EBGA 4DU8A 2I5JB 4GO7X 2B5JA 4CYUB 3D6TB 2E1MC 4RBTA 2ASLA 3CMQA 1DLOA 3LP2B 5JXSA 2EKNA 3POTA 2XNQA 3IC1A 2XYHB 2UV8A 3Q89A 3DLJA 1K9MT 2YWFA 4ECXA 1YJ9S 2CADA 2DRAA 2PFDA 4LIRA 1MN9A 1V3ZA 2GIQA 4OHVA 4M5DB 2HGNA 4JI6J 3DLEA 1SC3B 1OPZA 2J8AA 2M88A 3MUMP 4GKKJ 2YWEA 3H2VE 2UU9J 3OL7A 2YX4A 4KKOA 2D3O1 3H40A 2R2RA 4W92B 1JLAB 3H7HB 5FDLB 5J1EA 3ZZYA 3KK1B 4C8NA 3KHRA 2HW3A 2AQ4A 2QMWA 1E6VA 3TZXA 3MR6A 1I94F 4XPCA 4JI3J 4LF4J 1LQ9A 2JH3A 2WB4A 2JZ5A 4TY8B 4O3PA 3UVJA 3QATA 2IDLA 3DRSB 2BA9A 1B4SA 2K2PA 2FB0A 3C19A 3MM7A 5KT4A 4WKRA 1UJ4A 4PXEA 3TYTA 4NXMJ 3GYNA 4H4OB 3KMSA 4NLTA 1UFWA 1ACMB 1GFWB 2D9OA 1RB0A 3E3XA 4Y28C 4ZP7A 4ANEA 4ENOA 4CLUA 5L1JA 1QSLA 4N41A 1NAQA 4OX6A 3Q2TC 5HROA 3K59A 2C3YA 3DMJA 2VFRA 3IRWP 3KHLA 1HHQA 2A0FB 3NCQA 4M5MA 2VJVA 1OPIA 1XWLA 3OXLA 4IG0B 4DFMA 2IMWP 2XZTB 5KFGA 1RWVB 2KG1A 2BZ2A 4I69A 1U4BA 4I4BA 1SI9A 3S7RA 2DH9A 4CNYA 4ZP6A 3CSKA 1RBOB 3WX4A 3DC2A 5F8GA 1RU2A 4C6AA 1NJYA 4NI2A 4WK1A 1QAIA 2XB2D 4FYYB 2AWZA 1C1BB 2KKHA 2LU1A 1W26A 5CZVA 4ZN3A 5AE3A 5LSRA 3KLEB 2HRYA 4JI0J 4IR1A 4O3OA 3D7SB 5H9FJ 1WI8A 3IR6B 2LMIA 1HMVA 3NS7B 2EI5A 3F56A 5B0BA 4ECVA 1IBLJ 1A0OB 4ED1A 1CC7A 5DS7A 5B08A 3BGLA 4ID8A 3AJ2A 1JKHB 5F0UA 3MMJA 2E7VA 4QYRA 3CO9A 2IC3A 1OJ4A 4NLVA 1PYTA 3M8ZA 1AB8A 4ES3A 5HBMA 5KT2A 1BD6A 1WWHA 2CQCA 3SFUA 1MNEA 3PJ9A 3GV8B 1WG1A 1Q8IA 2CPYA 2I38A 2Q3PA 3G6ES 1YZ6A 2CQDA 4OX9F 5GADI 4DFKA 5T7LA 1VISA 2DNKA 3T5HA 1QAJA 2P2CB 2KH9A 3HZEA 4J90A 3GG1A 4TLRA 4OJGA 1YK9A 3ENWA 1V9OA 2VL1A 2ZHAA 3LH2S 1HNXJ 2ZC3A 1C1CA 2UVRA 3ENAA 5HVFA 4DX7A 1XMQJ 4F0MA 4P72A 1HWUA 4ZVQB 3AD8C 1E6YA 4JV5F 2C2MB 1HBUB 3RJMB 3HI9A 2X1AA 4F4XA 2BDPA 4ZPBA 4Y6IA 3IAS9 2UUBF 1F5CA 3IP0A 1FKOA 2H3EB 3G4SS 2E9TA 1MU2B 4ICLB 3DNCA 2CQ2A 4F7VA 3THPA 3VAIA 3R7BB 5A6PA 3CCTA 4FBTA 5AXLA 3ZNUA 3T1YJ 3MM5B 2G0JA 2YBVA 4DEZA 1LWFB 1S5ZA 1X4AA 2DIUA 1U09A 1FEEA 1VOMA 1JX4A 4DWIA 1MW7A 2I9SA 4HI2A 1N33F 2UUBJ 4NX9A 5HQMA 1OWXA 2BRLA 3NRBA 2G1DA 2XLIA 3F73A 5DGAA 4K0KF 2YWHA 2GHPA 5CYMB 2NXCA 2GGPA 4IH5A 1DURA 4ZP8A 5KT6A 3PR5B 3HO1A 1HWJA 3I0SA 2QRRA 1RT5A 1FTCA 2VB6A 1F5AA 3PFEA 1JLFA 3E01B 3KJVA 3TVZA 5DLFA 3DRRB 4LFAJ 2MKJA 4ITSA 2J76E 2DGUA 3MGJA 2LFVA 4LJMA 3SCKE 1WTBA 1UVNA 3T9NA 4DUTA 1YGYA 1ZYQA 5KFMA 1HD1A 2XLJA 4I2PB 2EWHA 3LP1A 4C3MA 1RABB 3LPEA 2QMXA 4DUYJ 4G65A 1HFEL 5C2CA 4TQRA 1KLMB 1NB7A 5F3ZA 3TA2A 2Z4PA 3SEOA 4F3MA 1JLCA 1RWPB 3T5JA 4Q0BA 1X5TA 3EZ5A 1AXQA 2E7WA 1NDLA 2DGXA 2QGFB 3KG0A 1UKUA 1BQNA 2XS7A 2V5HG 4ZVOB 1RWKB 3P96A 4K50A 3VTIA 4ZK7M 3GWCA 3UR0A 2WOMB 3VGUA 3AY0A 1H3DA 4RBUA 2CYYA 4WXOA 2EW9A 4OHYA 1AFIA 4GMKA 4LREA 5EWGA 1KS2A 4FZVA 4AXIA 2PA3A 2DO0A 3C14A 1RUSA 1YJUA 1NUEA 1RAIB 4IH7A 4DPWA 3PR4A 2BQ3A 3MD1A 5D0GA 5LXYA 2HFVA 2VPWB 1VC6A 4MFBB 3KHHA 2BXJA 1RWOB 2MY8A 5K5MA 1Q4RA 4ES1A 5A8KB 3Q8RB 4ELTA 1FO1A 2OMOA 3HD1A 3TEGA 3M2VA 5IZHA 5D8HB 3DOMB 2H5JB 1QUVA 3HF5A 2HG4A 2IMOA 2ZBPA 3H0PA 4FP9A 1R8PA 1ZA2B 3S01A 2AJFE 3UFCX 3M8YA 3K57A 5L1LA 2G1HA 4OHXA 3BSOA 3D2WA 3SMZA 1RYSA 1W7WA 1S6UA 1Q53A 4WZMA 1CLFA 1E6YB 1HARA 3QGHA 1BQMB 2GW8A 4WXWA 3FEXB 5AXKA 1Y11A 4JI5J 4L6V3 2F4VJ 1ZBTA 4DQPA 2P9CA 3LOUA 3V81A 1TFYA 1BY9A 2VBYA 1Y00A 1BXNA 2F8HA 1CJUA 3ENVA 4IFYA 3G96A 3TAPA 2MSSA 3H5XA 2LA6A 4WZQA 5DZ7A 4V19X 4X4OA 2K8GA 4Y2KA 3TI0A 4NLXA 3QJJA 1CJKB 3GIJA 1K1SA 3HFKA 2KM8B 4DOZA 2IC3B 3BPSP 4OHWA 2GFFA 2R42A 3MECB 4RJVA 1JKHA 5E5NA 2RU3A 5DO2A 2RF2A 4BC7A 1GXTA 4QIEA 7FDRA 3JYTB 1B70B 2XWXA 2KT2A 2LXIA 1X4HA 3IMQJ 3K5MA 1JQGA 2YQ3A 4DR5F 4P7TA 3DN9A 1BWVA 1REVB 2JHEA 1RT3A 3CW2C 1U24A 1ZZFA 2HBRB 2ZFHA 1HQUB 3FJ2A 4WPAA 4Y2MA 3H5SA 1BLUA 2KM8C 1RA6A 3P5TL 3ADAC 2FLOA 2W7OA 2KRRA 3X1LB 3N5BA 2Y0BB 5IM0A 4PXDA 4H4KA 5D0RA 4IG0A 1WDDA 2GJFA 4WP9A 5GMEA 2LYVA 3J81U 1Q7YT 3MM8A 3AD9C 2V8DA 3BO2A 1RT4B 3GMGA 5JUMA 1XNRF 5BR8J 1R89A 2HSEB 2AJ4A 2BANA 1SL1A 3BEGB 2RQ4A 5E7OB 4CH0S 1IVZA 2A3JA 1NM2A 2AW0A 3TQ1A 4LUBA 2E1AA 2V67A 3OVSA 2ZH6A 3M2RA 4DL5A 4PYDA 5A8RA 1VBZA 1D0EA 1E6VB 2K1RA 1HHTP 1J5EF 4NMLA 3P8BB 1RT6A 1LXJA 2WVFA 1SJRA 1RBLA 2IBOA 3PW5A 1F9EB 3MPYA 1JLGB 4GO5X 4OV6A 3CCVS 4P6QA 4LF4F 1RI7A 2GAGC 4G1PA 2C22A 2JLEA 2P5VA 2PEHA 5B0DA 2HVHA 4IDKA 1SXLA 4QYZK 2NCKL 3A8IA 1RAEB 3BYPA 4H4MB 1X5SA 4DLGA 5D0HA 3T1HJ 1KDNA 4DV6F 2PO4A 4DV3J 4CLTA 1DHMA 1QDUB 2VKRA 4HT5A 4NZ6A 4PABA 1JLGA 4ED4A 2HMIB 4DF4A 1XEZA 2VG7B 5M2UA 1EB0A 4L73A 3Q8VA 3KWMA 3CNQP 2VFSA 4DL4A 1S59A 4GVLA 1T3OA 3NGDA 4DXLA 5KFSA 3H2LA 3H42A 1N48A 1NK0A 1TL5A 1NPPA 5ETOA 3CDAA 4USVA 4ZVRB 4LVNP 3BKTA 5E41A 5J2PB 5H9EK 2VPYB 4CLZA 3QGPA 3LGNA 4X4QA 5D3GB 2VA2A 1B7YB 4ECSA 5F8HA 4XIUA 2BKNA 1RCXB 3IBFB 3QJPA 2AYEA 3DRYA 1LK7A 2QL5B 2WVDA 5CHCB 5L9XA 2V9WA 2U2FA 3TJAA 4A8OA 4DL2A 3MM8B 4NEZA 2MKSA 4O0IA 4B9SA 4USMA 1CC8A 3OTBA 4A8FA 2VPXB 2CAJA 1JK9B 2MQLA 4YDDB 2DK2A 2GJ2A 5DQGA 2UUAF 4CLLA 2J0SD 2ZH8A 1IJFB 3SSSA 4YB1P 3TUPA 2ASYA 3I0RB 4WFZA 2M9KA 3QMQA 3A4TA 2J6TA 2MGZB 2WSEC 4LF9F 1DTQA 1Y5IB 5E3PA 3ZFVA 4NL5A 3VGVA 3GU0A 1T05A 2WSCC 3EICA 2HHXA 3IO1A 3KJNB 1WC1A 2COLA 2MKHA 3BKUA 1SH0A 3ILOA 4YFUA 2W9CB 4U7UD 4DS5A 4MH8A 1SBRA 2XNRA 1CEZA 4LBIA 4YHHF 1S1VA 4DV4F 1PG5B 1WF1A 1CJKA 2X1FA 3LAKA 1PAUB 4RR5A 2OEJA 3CTRA 1NNDA 2UXCJ 3JTNA 1CJUB 1R43A 2W1BA 3M6WA 4IFYB 2YKQA 4B08A 3PJXA 5CYJA 2X1GA 3V81B 2B7CB 1SIWB 2Y1LB 2BJ1A 3EXYA 2XMTA 4M95A 2H48B 2IJFA 5HP1B 2WCXA 3MFIA 2J7UA 4S0MA 3UE2A 4CH7A 2VG6A 4LMZA 4CLYA 1SJ1A 2G2YA 1FDBA 2IA0A 1WOPA 1FTRA 4XTTA 3VQSA 2KYZA 3OSNA 3HX9A 4OJHA 4C7QA 3HHLA 4IRKA 2XS2A 2ZC4A 4CTAA 2XY7A 3F0NA 1IJEB 1FRXA 1N4LA 2KJWA 4AFFA 4F36A 3GQCA 2AEJA 3DOMA 5IWAF 2QO3A 3PKYA 4K4WA 1EARA 4OJ1A 3NL0A 5A8KA 2MHEA 3MAAB 5HMWA 4NLUA 3J7AN 4H4MA 2HS4A 4D3GA 5HJYA 4WFNQ 2FJXA 1SJQA 4NYOA 4KPYA 2VFTA 2HZVA 2ZE2A 4ED6A 4B3SJ 3T3FA 4LFBJ 2AP6A 1NJIT 3DI6B 4HH0A 3C14B 4KH1B 1T05B 4MKBA 1J27A 1KRPA 3A3NB 2HK2A 4DU7A 4C3LA 3ULHA 2BJ9A 2CPHA 2HPUA 3UD3P 2HHHJ 2R8IA 1FKPA 3KJQB 4C8YA 3NKYA 3NLCA 1IBMF 1EKRA 2EEYA 2RHQB 4YN3B 2EC0A 4CM0A 1T9UA 2M7SA 3T5LA 4FYDA 2V2VA 2KHCA 3CJQA 2NXJA 1RHUB 3D1HA 2DGTA 3TO8A 4CRJA 4ED2A 1R0AA 2KJVA 1JNRB 3HD2A 3TZWA 4ZS6A 3KG4A 1R27B 4TXSA 3VF0B 2UUWA 4JYAF 3MEEB 3HHNB 2ZWPA 1TELA 1G7CB 1HR0F 1G4CA 3DDNA 4HHHA 3Q8UA 1U1KA 4NLDA 1PC4A 4R0EA 1VQLS 2ZH1A 4CO0A 1AUDA 3UCUP 4CLFA 1MMDA 1U8SA 3RTVA 4J91A 2QLJB 2VG5B 2RUSA 1FRIA 3GG0A 2D3OR 2DY9A 3H90A 4CT8A 2GQQA 4WJBA 5B09A 4EEYA 1FKAF 2OTLS 2PEBA 4RW4B 3FSXA 1IKWA 1AA1B 3PRBA 1TK8A 4O3RA 3BQ2A 4TVAB 4RX6A 2BV3A 3BR9A 3FGVA 3VR1A 2ADBA 2DKOB 2FZCB 3FZBA 1N36F 2XEXA 2JEGA 1NSQA 1R0BG 2VC1A 4LQ3A 2A2DA 3IRXA 4ECQA 2BM0A 2YKAA 3QO9B 4NXNF 1SIZA 3MECA 3C6TA 4IOCQ 2AEFA 2M70A 3PHTA 3P4UB 3QRRA 1HW8A 3EGVA 5LMNF 4FPRA 1JXEA 1FKOB 1UPMB 2C3MA 4U8YA 1FXLA 1HBUA 3WZ0A 2XM3A 1KFSA 3TUIC 2RH3A 2O01C 1KLNA 2XGPA 3OHAA 4EO8A 4CI0B 2OO4A 3K89A 3G9CA 2OD4A 2DB1A 1BQMA 1S0VA 4I2QB 1KTVA 2AZ1A 4CO5A 4ILLA 2CPIA 4N56A 2HIQA 3OR1B 3TNVA 3TR5A 4AL5A 2J7WA 2BANB 3FQLA 3I32A 1B0TA 1U0SA 1YKWA 3EDQB 4PKDB 5BXIA 5HBMB 2R7RA 2IA6A 2CNOB 3KOAA 4EFAC 4JI1J 4HLBA 3OV7A 4DV2F 1MSWD 1AFJA 3M2VB 3GTYX 2RVJA 1M1HA 1FA0A 1IM4A 2W25A 3R5JB 2RDDA 6AT1B 2YNIA 4F8RA 3T9ZA 1NK7A 2FPHX 2ZWOA 1TL7B 2W2OP 4J9MA 4JI7F 2N3LA 4NCGA 2D69A 2DEJA 3H59A 2N82B 3KLEA 2JLGA 1HQUA 4DBQA 2GMJA 3D0IE 1RT3B 1HYSA 1RAOA 2M4MA 4L76A 2H5IB 2H5EA 1KN6A 4RW9B 1FDDA 5M2PA 3I55S 4L72B 2R9LA 1EETB 2JC0A 4LFCF 3BS9A 3U1NA 1KONA 4A8YA 2LECA 1NK8A 1N36J 2RUGA 4DL6A 4K4UA 1UCNA 2MZRA 3JQMA 1VBXA 3J81Y 1Q7LB 4CLPA 2ILZA 3VAMA 1EQMA 3DMJB 2ZHBA 2AYBA 2Y8YA 4OQJA 1AW0A 5J1NA 3G86A 3DCAA 5DDPC 4ZVHA 5ETVA 2RAQA 1S7HA 1GXLA 3TVKA 2D9PA 2VUGA 3KUGA 4YB5A 4Q5VA 3NGRA 4DG1A 2JNJA 3BQ0A 2CZ9A 3NBPB 4DUZF 3RRGA 3A13A 2VQFF 1FFSB 1ZETA 1K8AT 2B9EA 2NXNA 3CJRA 5A2QU 1CQMA 2VC0A 4GC7A 2BABA 2W2QP 2F40A 3KXDA 5KFFA 1PGZA 4OZ1A 3MCOA 5DM6Q 2BKPA 1UFLA 3QIDA 4Q2LA 3DLEB 2PGCA 3QSIA 5E3CA 4MYUA 5ETPA 3LTOA 2MB0B 5C24B 1B7FA 1I1GA 2DXDA 5K8PA 5B0CA 5T41A 1VDHA 2BW7A 3OVAA 5LL6d 5D4PA 4QU6A 1SB6A 2DNZA 1K47A 2KDOA 1X4EA 3QLHA 4TQSA 2DNOA 1RTJA 2C3OA 3G6VA 4B3TJ 3M8PA 4ZVTB 1LV5A 1JLBA 2JEIA 1RHJB 1RAHB 1Y3KA 3IG1A 3LP2A 1X4GA 4HACB 4M5KA 2EK6A 1F3FA 2B51A 3NOGA 4K59A 2N7CA 5J2QB 3HHKA 4FBUA 2DO4A 4YS2A 2ZH9A 2IY5B 3MM6B 1N5QA 1UEVA 2XCPA 2VDHA 3OTOJ 5CQGA 3VAJA 2BOPA 4EK2A 1RWUA 2GC8A 3PG9A 2D7SA 3CJKB 3ILLA 1M5HA 2WOMA 2KYXA 3RR7A 5IT4A 3ZTSA 3QT5A 2Y1IA 3N6NA 1ZH5A 3Q22A 1Q8LA 1YJ7A 1ZPVA 1NO8A 2F5GA 2WB1D 4KO0B 1JLEA 3OSPA 1RISA 1B3TA 2D1CA 3W9HA 5KFKA 2AIRB 4LF8J 2GS8A 2MSTA 4X4TA 3PNIA 2DR7A 1JLCB 2V94A 1V5IB 2YX7A 3RBZA 3FFIB 5FJ4A 4U7CA 4CM2A 3A1YG 4Y2CA 1HBMA 1S9EB 1UZDA 3ZZUA 2C2DA 3BH6B 1CJVA 1WHWA 2OFHX 1MLAA 4C48A 2DR9A 4DQIA 3HSDA 1QE1A 3CWJA 4RNNA 2G4BA 3KLIB 1KTQA 1VI7A 1VR6A 2IJNA 3DRRA 2PE8A 3LO3A 2BJ7A 3QFWA 2XYGB 4OMFG 4RUBA 3TP2A 1S9GA 1RT5B 2FHOB 2K3IA 2MLXA 2N7YA 3UDLA 3W65A 3WQPA 4U67Q 3GSIA 3N28A 2ZH3A 2EPIA 3GJQB 2A1BA 3OR2A 5FD1A 1N0UA 2GGPB 4K8RA 3DFEA 5KFQA 5U47A 2JX2A 2VBWA 3H8YA 3P5BP 3V4IB 2I0XA 2HS3A 4G1QB 3CMAS 2B0GA 3MAQA 2XTJP 4K2XA 3W9IA 1KBRA 1M1GA 4JI2J 3TQEA 2Z30B 1GEHA 2YNGB 2FYXA 1R6VA 2HHHF 3DU6A 3D4JA 3QIPA 1XR7A 4EGLA 3AJ1A 3T6BA 3CCSS 2E5LF 2JOQA 4DN9A 5FLXU 2BJDA 1U1RA 1Q78A 2UUAJ 3CD5A 4L3NA 1GK8A 1FX2A 1MU2A 4ICLA 4PWWA 1S9FA 4BDPA 4UOHA 3N5FA 1FESA 1RZMA 4WF9Q 3OXGA 2O3DA 2AMCB 1NHVA 2KXFA 2FVCA 3DRSA 3EX7B 1NPRA 2J5AA 3GV7B 1MROA 3K7RA 4RUHA 1HI1A 2CPEA 2N3OA 2MZ1A 4B9TA 2XZDB 2UZAA 4KKOB 3H5UA 5HJXA 1YBTA 2N4CA 2R2UA 4WFYA 4URGA 2APOA 1K44A 2KRBA 1RU1A 4C11A 5DETA 4JI8J 4TYBA 1VHFA 2GIFA 4CDIA 2LXUA 1I6JA 5A0YB 3GFZA 2LQ9A 3O2IA 1LXNA 2AT1B 5KG2A 3PEHA 4DL3A 2FVQA 2LDYA 4B9LA 1KOOA 3FEYB 4J9UE 4LR8A 3EWGA 1IR2A 4U95A 4GVBB 4F67A 1AYEA 1FXDA 1TL3A 5K14B 3HDSA 1WC5A 1TP7A 4IYQA 2J0QD 1DLOB 2E5LJ 1S1XB 3FCWA 2OPPB 3D28A 1NLKL 3H98A 4AXJA 4KAIA 3IGNA 1U2RA 3OFFA 4PQAA 3I56S 2GO8A 4WU3A 3TAMA 4OFZA 1XMOJ 1ZOTA 2AKWB 2Q6CA 1RGVA 2FQQB 2HZCA 2EFPA 3DRPA 4FPIA 4DQSA 1QSYA 2C2EA 2FJVA 4IG3B 1GMWA 5AXNA 2F9JA 1FE4A 2IM3A 2V34A 3I31A 1TUVA 1RLDA 2H4WB 1DARA 1RA7A 1TKTB 3NP5A 4NWBA 4URQU 1R8BA 4XK8C 2FJAB 3D6MB 5EGYA 2JWNA 1SKUB 5GVQA 5DG9A 4X4SA 3V6HA 2HZAA 3AXMA 1T9WA 1GMUA 2CQPA 1U26A 2ZBQA 3NEKA 3VVUA 2ILYA 2J6SA 4X4VA 2JVRA 3IBWA 2CJ9A 3RB3A 3BZQA 3HKWA 2FVPA 2ZZTA 3LWLA 4QZVB 3EMTA 4UOCA 5EWFA 3MEDA 5F8NA 2GVDB 3R6LB 5BJRA 4B9UA 3KFWX 2Q6BA 3ETOA 2C3PA 3DOKB 2CJBA 2MKIA 4PQUA 1RWXB 3TJ8A 2WAQD 1YG0A 2G13A 5B7WA 4GKKF 4DX5A 2HHPA 1VRTB 1UWAA 3M05A 3Q2SC 2DEIA 1DY3A 5BYRA 5LT5A 5LXRA 3KK1A 2HVDA 1Y3JA 5DRKA 2V2KA 1Q79A 2F8MA 1RP5A 5KFVA 1I94J 4O44B 1EIYB 2G0CA 2WBRA 3OL6A 2OEKA 4MK7A 2O5DA 5KG5A 1U1LA 3DLGB 2OEMA 3BREA 1NK9A 1YWXA 3QWUA 4J9RA 1MWYA 3DYAB 3W61A 5IV4A 3EPGA 2R7WA 1C0UB 4P9SA 1RTDA 4ER8A 2B4OA 1DAXA 2XY6A 3ZTOA 3DGPB 3R5AA 3BO4A 1VRQC 5A8WB 2J6UA 2I5JA 1Q5YA 4DCJB 2UXDF 3EVOA 1V6HA 3MR2A 3G6XA 4C0BA 4JP8A 1R8AA 1RTIA 2Z2LA 4PPZA 4F26A 4JI3F 4PG4A 3NGKA 3QGIA 3G8SA 3IS9B 2DHHA 3BN7A 1KC8T 2A6MA 2HNDA 2ASDA 3SCJE 5IQQA 3IR5B 3GJTB 3ZZPA 4W98A 4RUAA 3G8TA 2GHVC 2QFJA 2MZSA 4WE1B 1W2BR 2GIRA 5L8RC 4Q45A 5KOWA 3CIMA 2BE2B 2YH0A 4MKYA 2OPQB 3BBCA 2CZ4A 3L7PA 5E2QA 3RW7A 2L48A 1TKXA 1NSPA 4YQWA 1VJWA 4P10A 3M4XA 3BQ1A 3B54A 2ATCB 3HSJA 3W64A 2JRSA 3RUBL 1N6QB 2VICA 2LEBA 3AXKA 2ZM6J 2HWTA 4LF8F 3IM9A 3NWGA 4O44A 2B6AB 1LOUA 2FJBB 4OZ0A 5KG4A 5KFOA 4ZHRB 3OT9A 3IR7B 3GYXB 3BB5A 4ZJQA 3BGUA 1FVSA 4KGXB 5HANA 1OY9A 2R7OA 1TMMA 2CFXA 3KKFA 2L9WA 1KQKA 3TUJC 2KFYA 4WIIA 4JUZA 4X66F 3IM8A 3HVRA 1YJWS 4CO4A 3HPOA 1KQGB 2DGSA 5BR8F 2ZH2A 3CCQS 5I3UB 1NDPA 3PX4A 1S79A 1VRUB 4OLPA 3QRQA 3FMWA 3JS9A 1D9DA 4NLYA 3RAXA 1D9FA 2BE7D 3O8WA 4OZNA 3M7VA 3PX0A 2AGQA 2HWHA 3HM9A 2VJUA 5F8JA 5D6GA 4F2SA 4TLQA 3W8GA 2KHDA 3NAHA 5LJ3Y 2V4QA 4ID5B 2CRLA 2YQ1A 3B4MA 3DKDA 1XJWB 3GYGA 4UUXA 2QA4G 4RWXA 4M5JA 3W2VB 1RADB 1S76D 3CCMS 1GX6A 2LEPA 2X1BA 3D5MA 1ZZNA 1YJNS 4HHJA 4DJBA 2KT3A 1NKBA 4IG3A 3TA1A 4JV5J 3PW4A 4B3SF 1HW9A 4N47A 4Q44A 4DSFA 2MQNA 2ACYA 2YNFA 2MJNA 4K4TA 4DV1J 4J9OA 1HQEB 3MMBA 4RBVA 4HYKA 1N5YB 2C42A 3HVTA 1J2VA 2B43A 2CG4A 2NSCA 3CD7A 4RW8B 1SV5B 1VQNS 4X4UA 2MHNA 4CO1A 3EDRB 2KI2A 4O4RA 4AT1B 4DN0A 3K5LA 3OVBA 5B0AA 2HVIA 3DM2A 2HKEA 2N4DA 1HBOB 2NR0A 4D3HA 2WVEA 1O51A 1OYDA 1FCAA 1MWQA 2LQJA 3AD7C 2QN6B 3ELHA 4RW8A 3K5NA 1XMQF 2KFNA 1TMJA 3LP0B 4KV8B 2F8EX 2HK3A 5J2MB 3HFZB 1RT7A 2MQOA 2DPJA 2FLLA 5IT9U 3N4WA 1YJTA 4M8LA 3CVKA 3S6EA 2E7XA 2DGOA 1IKVB 2CPFA 5HQLA 2C2RA 4NMXA 4KRWA 1HIYA 3U1MA 1IWGA 4USJC 1T03A 1W25A 3PCOB 3JTOA 4OJ3A 4LBPA 5I3QA 1NKCA 1M90T 4KHPJ 3W3SA 5GAGU 1U1OA 2PSZA 2Y3YA 2PMWA 2WSFC 1JJ4A 2V8GA 2DPIA 3E51A 2MJUA 2B3TB 3R5DA 5MAOA 3KK3B 4LF7F 5C5JA 5D0EA 5B0EA 1VYAA 3HULA 1VJQA 3L09A 4MK8A 3IWXA 3BDPA 1S99A 2VF3A 2DNPA 4FF4A 4ECTA 1FJEB 5HI7A 2G2OA 1TKTA 2MLYA 4P2SA 1VQOS 1ZPWX 3ZC4A 1LW0A 4X4PA 2BR0A 2JEFA 2VH7A 4LFAF 4N76A 4USTA 1B99A 3OR2B 4FKYA 3X3UA 2KFZA 5HAOA 3OQ2A 4ZHRA 3W1YC 1S9GB 3M2UB 4DPUA 4DR6F 1TUGB 4U8VA 3L9ZA 1N8RT 2BMBA 4X62F 1HA1A 2D74B 2OPPA 3DDKA 4KIAA 2W9AA 1TZ0A 4J5OA 1WOOA 4C8KA 2V4RA 3FRZA 3HLUA 4OYOA 3J7ZT 4UY85 1QLNA 2HNYB 2JJ4D 3AOCA 4KR0B 2W2PP 1F1BB 2OLWA 4OYPA 4JYAJ 2XC9A 3MEGB 1ZTTA 4DR4F 3TEHB 2L08A 4QWEA 2OPQA 2BE2A 2F7VA 4I1TA 1WF0A 1YRTA 4WE1A 2AF6A 2ZOMA 2DXFA 2V0NA 4KO0A 4UOFA 4UOGA 5K9FA 2E5IA 5I42B 4PXBA 5AT1B 4EBEA 2HHQA 1DQ8A 4LR9A 3SCIE 3IAM9 2DR5A 4UY8T 1SC1B 2CJXB 2O67A 4CT9A 3CO0P 3F41A 3TOQA 2MXYA 4EU0A 1RTIB 3O3LA 3TAQA 3BM7A 4RUCA 4LRCA 1FRLA 1R8HA 2CVEA 1IN0A 5HVHA 1HNXF 3KLGA 4ILRA 3N01A 3CJ4A 2RQCA 3UO0A 3AA8A 3D54A 2QL7B 1HPZB 1S1UB 4J7CA 1C0UA 2CKWA 4RNOA 3QIPB 3MXHP 4WTYA 2CNKB 4TN2A 3ICLA 2YNGA 3VAKA 2DIVA 2V4JB 4LF9J 4KGVB 3W62A 1XNRJ 3DLGA 5KFYA 2R8JA 2HFSA 4AQYF 4N8NA 2KB2A 4TU9A 1GNKA 1IKYA 1SUQB 2H1YA 2HNZA 4QW8A 3FBEA 5KFZA 3CCWA 2AZ3A 1U0HA 2YKNB 5DQIA 2IPOB 2GQ2A 4OX9J 1WSRA 3TX0A 1Y0HA 5GAGI 1HNWJ 3KLIA 2QE5A 4JBCA 4M5IA 1VQMS 2UUCF 2UXCF 4RW7A 2BBEA 1VQ4S 4UQGA 2ZBCA 4AYBD 4JOUA 4FVCA 1WC0A 3R7SB 2HQDA 4LF6F 1BQXA 2HQIA 3MEDB 1VQ8S 2R2TA 3FZ2A 1X5OA 1HNWF 1KVIA 3TANA 3U02A 4DX6A 1F60B 2OI2A 2RHSB 3C15B 4GC6A 1JXLA 3NG8A 1JLEB 3ZTPA 2AYGA 2RE1A 2NSBA 3EE3A 3GILA 2ZEJA 5G4DA 2BW2A 3D1QA 2QA4S 3Q8YA 3CGIA 5KFPA 1GX5A 4K0KJ 3CJKA 4ZDNA 4P52A 4PYAA 2MYFA 2VQEF 3AOBA 1HYSB 2KO1A 3DRPB 4ZIWA 3PIOQ 4OL8A 4UF4A 1RLCL 2AYMA 2HS0A 3PW0A 1XNQJ 3EZUA 4FYXB 2NXUA 3R8YA 1Q95G 3FVYA 2QFIA 5J2QA 1FD2A 3VVTA 1YHQS 2QA1A 1NHUA 1PCAA 1Y4ZB 2PD1A 4M5HA 3Q24A 3BPDA 2Z0GA 4O0NA 3AODA 4ZPAA 4CIOA 4HTJA 2ZUAA 4KJIA 3PO5A 4ZVSB 4NLGA 1NU4A 2HLTA 2H51B 2XG8A 1R8CA 1JXVA 3AFGA 5CABA 1TTHB 2HHSA 2XMVA 2YQ0A 1FRJA 5J2NB 4OLOA 4MYTA 3T19A 3V2UC 2E5JA 1AROP 4QIFA 2L9DA 2EFQA 4ECWA 1NJWA 1U8WA 2CQ0A 2XWYA 2R7QA 3BDEA 1T9TA 2Y0SD 4A8QA 2HAFA 2QZ8A 3OFEA 4DV3F 1WTFA 1C0TA 2BRKA 4DFPA 1CULA 3ITHA 5C42A 1SKSA 1KSPA 3CJ8A 1X4BA 1N5VA 2BYCA 3D6FB 3HJVA 4G6VB 4DX8H 5K8MA 3LGHA 1X31C 4GKJJ 2A18A 4WYWA 8AT1B 1U1PA 3AT1B 2DY1A 5DQHA 4FF1A 3HSGA 4F0KA 2LQ8A 2V69A 2LCWA 3G82A 3L3CA 1JWWA 1CBKA 2UVWA 1RKJA 4Y3CA 2WW8A 3MMCB 4RW9A 1C4CA 2AEMA 1OYEA 3P3DA 2FUG9 3A3PB 3WHIA 4DR3J 4L75A 2DBBA 2BOAA 4F2RA 1UVMA 2CQIA 3G87A 2AU0A 1A7GE 2MY7A 3W2WB 2HFZA 4CP5A 1TL7A 2F1FA 1L3KA 3CCZA 1FI4A 4M94A 2K06A 5IFMA 4UW2A 1H0HB 4ZN1A 2J0XA 5F0WA 3AQOA 1NCLA 2Z8QA 2CVIA 2LQ5A 1NSAA 1X7VA 4E8UA 4FN5A 2QIFA 2RJZA 2HFUA 2XCAA 4IO1A 3FFIA 5KT5A 3OJUA 1FXRA 4YMEA 3MEEA 4EO6A 2LXFA 2HVEA 2FC8A 2D3ZA 2EC2A 1RK8A 4LR7A 4GKJF 3R1HA 3RB4A 1T94A 4ETXA 4DR2F 2C3UA 2RU9A 1T03B 2HHTA 2HGMA 2DNMA 3NS6A 1X5PA 3E2EA 4KSEB 4LRAA 2XYPB 3THVA 2F4VF 3PY8A 4Y0FA 3TZZA 3M8SA 4Q7AA 2RSQA 3DI6A 3IWLA 1HNIB 4M5LA 2K7KA 3MM6A 2JC1A 4I56A 1HBOA 3MMAB 3M9NB 2DT9A 3K17A 1FNOA 1LW2B 3HHLC 1SPBP 4RU9A 1P1LA 4DV7F 3GFHA 1XTZA 1BHNA 2LDIA 1SV5A 1FT8A 4BWJA 2ROEA 2RDJA 1DTTB 1P8GA 3NGUA 2RS2A 1IR0A 2V9KA 4P73A 1H2VZ 3R3TA 5D77A 5IC4B 4QOTA 3GR1A 4CTAB 2IIHA 4LVOP 2ZKUA 1JJ2R 3RB6A 4KB7A 1PC5A 4RW4A 2XMMA 3Q0AA 2DHGA 1U1NA 4LRBA 5ADZA 3N9UC 6FD1A 1TK0A 2EBEA 3KUHA 5E3RA 2CNNB 5KOXA 5CXTA 2B4UA 2IM2A 3J7Z5 1M5SA 3W2VA 3KG1A 1IXKA 2QLWA 3UNGC 4KFBB 3NWRA 1VQYA 5L39A 4B9NA 1LEOA 2FZGB 5DG8A 4DSKA 1F2HA 2P6SA 3MM9B 2ZJRQ 4DUZJ 1WG5A 4RZRA 2CQ3A 3SBMA 2IVFB 2FGCA 1UW4A 4LIWA 4P2FA 3RBEA 5A2QY 2Y8WA 3EM1A 2MZTA 1NPKA 4ED3A 5JJBA 4EWTA 5F8IA 5I3UA 1FWKA 1FNXH 1URNA 1I51B 3EGZA 2FZKB 1SL2A 4BHQA 2WBMA 2KT5A 7FD1A 1NXIA 2OFGX 5E33A 4O4GA 4ED8A 1Q81T 2RQKA 1M5OC 3DLLQ 3HJFA 2JFDA 1N32F 2XY5A 1FKPB 3TZYA 2ZOGA 4C0HA 1S49A 2MGZA 1RHKB 2OMLA 5KFXA 3O6QA 1JMTA 4I7FA 2ZBRA 1H73A 2W4CA 1UL3A 5F41A 2AX1A 3CJSA 5AE1A 1X60A 4NCGB 2HQCA 5I4MA 4MIBA 1UJ5A 2ZNZA 1GTEA 1WHXA 1XIQA 1Z4UA 2WONA 2DH8A 3HFVA 3CC4S 2CDRB 2PC6A 5IT0A 2M52A 2VHGA 1IQTA 2ZJQQ 5ITHA 5AJ3F 3HMJG 3UPFA 3GB0A 1RWMB 3MAHA 3PVXA 4QR0A 3T1YF 5G0RB 1S6PA 1VS3A 4OZ2A 3SSQA 4X66J 4J9KA 3OR1A 4IRCA 3V6DB 3GFXA 5C7PA 3NMAA 1IKXA 1T11A 3R97A 4Z37A 2HNDB 1WD6A 1R0CB 4N8OA 2L41A 3IA0A 3LWMA 3IS9A 4EZ6A 1CG2A 2VG6B 2X3GA 4B3MF 3CDEA 3M6XA 2FHMA 2E44A 4Q8FA 2D3UA 1WG4A 3UQSA 4WCEQ 3SIPB 3MOZA 1FRKA 3MEKA 1VC0A 2OPSA 3LGMA 4ECUA 2HBYB 2GJIA 4ZCLA 2VG7A 5KAKA 4B9VA 3AB4B 2D41A 3LPYA 3VAHA 5DDQC 1VIOA 3M32A 3D1OA 4U9RA 2VODA 5F8LA 1S1VB 3PYFA 4CZCA 1XNQF 1XR6A 1WF2A 1S4EA 1UWBB 2ZD1A 2ZJPQ 3UD4P 1S1WB 2PA8D 3ISND 3WX8A 4IH6A 1KHWA 2OUGA 4M5GA 4O3SA 3G6YA 1RTZA 4NYZA 3IRXB 1IBKJ 3M9MB 4CQ1A 2CUYA 2QYGA 3CUNA 2CPXA 2PFFB 3V4MA 2OPRB 2B8QA 3QYYA 3EVWA 1RBAA 3KNGA 3PRDA 3VGTA 1IKWB 3CDBA 5H9EJ 1UVLA 3L95X 1SVDA 3BO3A 5KFDA 2MZJA 4ZJLA 2VBZA 1BWEA 4ES2A 1MWZA 4PQUB 2CG8A 4ZPWR 2VQEJ 2GVDA 1X0PA 3KUEA 1QJHA 4FKXA 4E2FB 1JLQB 1TU0B 2IM1A 4EUVA 4YHHJ 1PO6A 2PI5A 1S10A 3DOLB 1U25A 2NUHA 1FK9A 4B3OA 3EGNA 5DDRC 1Z2ZA 4JI2F 4PR6A 4QW9A 3US5A 1UETA 1JLQA 5KG3A 1LWCA 2ZHOA 1NEEA 2ATLA 2XHCA 4OV1A 4QWAA 1NB2A 4I64A 2R7VA 2R7UA 2FGOA 3R2CJ 4YY3F 4ED7A 2BJEA 3KMQA 3CE8A 5H1SV 2RRNA 1BUXA 1KOHA 3FC9A 1CS4B 3UCZP 1FWPA 2H54B 1H98A 2FVRA 4N77A 3BSAA 3M6UA 4K4VA 4IRDA 4LSNA 2R7SA 3MCMA 3N79A 3K58A 2GAHC 1S1XA 2HMIA 2BQRA 2QT7A 2MKCA 4ZA1A 3M8QB 1VHIA 1RHQB 1RAFB 5K14A 1TL3B 2OHDA 3W5XA 5K8NA 4GVBA 3HP6A 1RCOB 3GR0A 1CPZA 5RUBA 1L3UA 3I4PA 1XR5A 2W8LA 2VONA 4FXDA 4IDKB 4AL7A 3CJ3A 1K0TA 4CLWA 2U1AA 1X4CA 1YI2S 5KFAA 1Q8KA 3GIIA 4ZKAA 5SZTA 4X84A 1TVRB 1FF2A 4KHMA 3SDEB 2W8KA 1T9VA 1HNVA 2B56A 2JLFA 3OTDA 2EVZA 2ACMA 2GVZB 4USIA 2ALZA 3HHLB 3BJYA 4QYZJ 2LEAA 2CJYB 4V1Ak 1YLXA 1I3OB 1GMVA 2FHJA 2CDQA 3Q8SB 3WIUA 4KH0B 4LT6A 4YR0A 4Q2MA 4NZ0A 4ALZA 1R31A 3Q83A 2XBPA 4UUWA 5ETLA 3GONA 5CCMA 2GQCA 2RRAA 2OGUA 3F44A 2E1CA 3FBBA 4DR4J 3BGRA 2BKOA 3I5BA 1S1TA 3OD2A 2DJWA 4OZJA 2V50A 3KLHB 4DFJA 1H38A 4HH1A 2IBKA 1RTHA 1SQEA 3GJSB 1KP6A 3UN5A 4F04B 5EUHA 2A2CA 3PYEA 2DNGA 3U1LA 4J37A 2FJWA 4X62J 4NLQA 2YY3A 4DR6J 2IHR1 2VFUA 1V3SA 1D1UA 1DBDA 2HAIA 2DITA 3MCSA 2CJKA 3QJLA 1MG7A 5L1IA 1FE0A 3Q8QB 1PKUA 2LVWA 1NRKA 2PI4A 5LMUJ 1VQPS 1M0SA 3CCUS 4R8UA 5FLXY 2GV1A 1DTQB 1EP4B 4A48A 3M8RA 4ECYA 3BGFA 4Y2AA 2ZZMA 5CCLA 5F9LA 4K4SA 2VBXA 1KNZA 4KC5A 4AE5A 4IKAA 4DSLA 3I0RA 2AJ2A 3MI7X 4O4GB 1EKSA 2M3DA 1R6YA 1ICEB 2GO9A 2GNKA 2NYIA 3HSZA 4I6AA 4Y2IA 4QWDA 3JYTA 5H9FK 3QNWB 2AJQA 4PZVA 2FHJD 2YPZA 3CB4A 3VGSA 2ZKTA 1HBMB 4FF3A 1OIAA 3CF5Q 2HWIA 1OO0B 1T95A 4EYIB 4LFBF 1RHRB 4OIXA 4HDHA 4LF2A 4DSJA 3AAWB 2C28A 1KLMA 3KK2B 3LQVA 4RPFA 3RZAA 3C2PA 4JV2A 5M2RA 4NASA 4I2PA 2P9EA 2EK1A 3BR8A 4ATNA 1UVKA 3KLVA 1EJ7L 2AHOB 3DLKB 1NK5A 2CQ4A 4X64J 1JJCB 3CCRS 2DYAA 4IO9Q 3W9JA 3HHDA 3E01A 3JSRA 1YTYA 2FC9A 2XHWA 2B4PA 4CO2A 3G2XA 4FNIA 5KFBA 3J81j 2RKIB 3KJVB 3PW2A 1VQ9S 4PAAA 1B0PA 4NRTA 3R7NB 2Y1JA 1NJXA 1VLYA 3CCLS 1VQSA 2RT3A 4XAKA 4RKUC 1RSCA 1G6BA 2B9XA 2NPFA 4ZOSA 3ZZZA 3BH7B 5J1PA 5KFWA 2KVIA 2BJ3A 1WORA 1DTTA 2CQGA 4HACA 1JLBB 3LA0A 3CC2S 3HHEA 3M8PB 4ECRA 1UZHA 1RTJB 4P71A 4U96A 2IRUA 4FVMA 2WW4A 4K5RA 2UU9F 2AV5A 4FDFA 2W4DA 2DGVA 2LP4A 1Y9OA 2J9EA 2RMLA 4MFBA 4HVZA 4F50A 2DNHA 3MMAA 4HTIA 4NLRA 3I4HX 5GAHU 5C24A 4DV6J 2Z56B 2SXLA 4WP3A 4ZJOA 1ULRA 3A8JA 4C0OC 2XO7A 3HXMA 1KQSR 1RT2B 4IOAQ 4QPTA 1YSJA 2C1EB 4A8MP 2M8DB 1RT6B 4X4RA 3A8KA 1IWAA 1P6TA 2JSXA 3MWBA 4QWBA 3FNNA 2KU7A 4DMZA 4K2JA 4LF5J 3NBPA 2R7TA 3OTOF 1U1QA 4DPTA 3T6JA 4UT4A 4J9PA 3DRXA 4JI6F 4DG1B 4Z2XA 2W7PA 2V63A 1SL0A 1DFDA 4OHZA 3OPKA 4Q0BB 4USKA 1VC5A 1VQ5S 4A8SA 3KK2A 2ASJA 1QM9A 1TL4A 5EWEA 1Y7PA 2HBZB 2FLPA 2MQMA 3JTPA 5HMXA 1RT4A 1WKJA 1WOSA 2LKZA 4RLEA 4UZCA 4YR3A 1RAGB 2RS8A 5LSLA 2QLFB 3LP1B 3M30B 2GA7A 2I8EA 1EQ0A 1FVQA 2IAJB 2VZ9A 4NPOA 4NXMF 4YUDA 5AJ3J 1G2EA 1EETA 1XQIA 3PFOA 5E3AA 3NOCA 5K20B 1S72S 2MLZA 1EP4A 3BV8A 4KGZB 3I0SB 4TU7A 1C1BA 3RBXA 2ZH7A 2OSRA 2FLNA 1RE1B 1HWLA 2YKMB 4NI2B 1REVA 2B8PA 1P1TA 1S7IA 2C2OB 3ILJA 4URSA 1NK6A 3RR8A 5L1KA 2J9CA 5HL7Q 1D8ZA 4ZVGA 1APSA 3MPWA 5CD4A 3O44A 4MTPA 1ZM2A 2IAJA 3G82B 4HDGA 4BBYA 1KFDA 4RNMA 3NMRA 2YNIB 4TYAA 1YX2A 3M30A 4KTQA 4PWUA 2RF2B 4DR1F 3AH6A 2P8IA 2VDIA 3BN4A 5D15A 5HROB 2DISA 4G3IA 1VBYA 1DQ9A 4N5SA 3D0GE 3VWSA 2BQUA 3KLHA 4K7QA 3H2UB 1S1TB 2QMUB 4MIWA 3OUYB 5B0FA 1X0FA 2V2ZA 5L38A 5KFNA 4I2QA 3TWZA 1NH7A 3NCPA 4MK9A 2NZCA 4DZ6A 1M5KC 3ZZOA 1T9YA 2XMJA 4NLWA 2Z58B 4FXWA 4PXCA 3PIPQ 4LQ9A 5L9NA 1X9WA 5FDLA 3PM9A 4ZLLA 1NDKA 1N54B 2JFKA 4MT1A 2GVZA 5J1EB 1RT2A 2ZDPA 3ONQA 1SJ3P 3I87A 4Q8EA 1Q82T 3OUYA 2C2NA 4JI5F 4W90B 3QAEA 4YOEA 2W2NP 1U1MA 2AJ1A 4NZ7A 4O3QA 1QAYA 3RB0A 1S77D 3CJ2A 1QD1A 5KG7A 2M8HA 5I3PA 3QO9A 4ZITA 5KFEA 1KWMA 4ZVEA 4ZVUB 1ZTWA 4USUA 3Q8PB 4PRFA 3K0JA 3W5YA 3SV3A 4ED5A 1HMVB 5HATA 3SFGA 2NQPA 2R7XA 2ZZNA 1U6FA 2B5JB 1WI6A 4LSNB 3UW1A 4C3KA 3ZO7A 2MDAA 5K8OA 3P49B 2YKMA 3H4BA 3GJRB 1DJ0A 1WEZA 3EJMA 5JMNA 4DSIA 4XO0A 2CPZA 5KFHA 3ZTQA 5CAAA 5DGBA 4DL7A 2HURA 1IBMJ 2VG5A 2HYIB 2H9ZA 2YPYA 3DXBA 1T9XA 1NJZA 2MMYA 1SH2A 3DLKA 1JIHA 1TUWA 4ZMMA 5FIIA 1G3OA 1VK3A 1QUPA 2BACA 3NNHA 1FK9B 3NNCA 3DOLA 1VMBA 4HHUA 4M63A 4C9DA 1P9YA 4QR2A 1FHTA 1PYOB 4XPEA 3HHLD 1TK5A 4AL6A 1PILA 2NLWA 3K2YA 1M1KT 4ANCA 1ZM9A 3MZIA 1QVFR 2W01A 4FF2A 2B7BB 4OYBA 4W4MA 4F3OA 4DDFA 1CSJA 1SC6A 3UR3C 4U6PA 2X7IA 2IM0A 2MQQA 1JLFB 2PN6A 4NA2A 5KTQA 2NPIA 1FWLA 2A10A 4JI7J 2OPRA 2QLXA 4EBCA 1SJFA 2J0WA 4IQMA 5DZ6A 1YRXA 5CYMA 5ETSA 2UXBJ 4NE9C 4Y65A 2P9GA 4HL9A 1N56A 1SJ4P 3MR3A 4LF1A 2V4JA 3MAAA 2KN4A 4G1IA 3POTB 1UVJA 1UP1A 2CPDA 1PIEA 4FNHA 2EFVA 1U48A 4KHRA 4NLPA 3MTJA 1IQZA 2NUUG 4X65F 3UI3A 1UFKA 4DV7J 2OPSB 4FXVA 4ZLPA 4K4ZA 4KE5A 2R3VA 4H54A 1YJVA 2RKIA 3BGRB 3NXZA 2FVSA 3WC0A 5ETQA 1Q16B 2ADCA 1QTNB 2FJEB 2YKOA 4MJKA 5GMDA 2OELA 5I42A 1OMSA 2VD3A 1MMNA 1WSVA 4HR2A 1U45A 4I67A 1J5EJ 3VAGA 2CNLB 4KBIA 2FY1A 1XERA 1TV6A 5T7LB 2QA2A 2Q79A 3M6VA 3QAUA 2FIUA 5G0RA 5L46A 1NZ8A 1U02A 5AE2A 5ETNA 2AD9A 3DDIA 1HL6A 3CULA 1OY8A 4F4ZA 1NSKL 3NAIA 2HFOA 4YB7A 3E8OA 2GMHA 2VASA 3CD0A 2DRDA 2W24A 3MEGA 1FDAA 3ZZRA 2WONB 2HHWA 1WEXA 3RG6A 1NDCA 1U6ZA 2OAUA 3LUYA 3EVMA 1GT8A 3H4DA 4LF6J 1GXUA 2JDJA 1ZAWA 1RAAB 3AQPA 3M8QA 4QPXA 3DXSX 4QJVA 3GIRA 2G0IA 1Y5NB 2HQFA 3A3OB 3HKZD 3SZ2A 2YWKA 4P2MA 4A4JA 3WDOA 4ETZA 1SKWA 4KHPF 3TRGA 4OYZA 2DCLA 3VHQA 4R8UB 3BF4A 1CVJA 4IR9A 4LFCJ 3OFHA 3SYZA 1LNQA 4P75A 1HD0A 4MIAA 2F4FA 1LW0B 4IOBA 1XMBA 3MHYA 3CDUA 2XMUA 3EYZA 5C25B 1HWIA 1H6KX 7AT1B 1LWCB 1TR0A 3DGVA 2F65A 1I5OB 3A12A 3I6PA 5D78A 3ISZA 4DPYA 3FEZA 4A8WA 4I68A 3P45B 3UN2A 3CMES 4IFVB 4YB6A 2PMZD 3H5YA 1RTHB 2DD8S 4A46A 2DR8A 2QL9B 5DM7Q 4H4OA 1X4FA 2BJ8A 5IWAJ 3R9LA 5IV3A 2DNNA 5IS2A 2WTFA 2ZH4A 1T7PA 3MM7B 5EN1A 1HWKA 2M0GB 4C97A 3MD3A 3I5AA 5CH7B 3UWTA 5HN0A 1VBKA 3DLHA 2BEFA 2HBQB 2W9BA 2VU5A 1L3SA 5HMYA 1EZZB 2WHOA 5HLFA 1PBAA 2LLZA 5F3TA 5DLGA 1JLAA 2CIMA 3TX8A 3RRHA 2UVUA 3HT3A 3FQKA 1HNVB 4DPXA 3SDEA 3S8SA 1TVRA 4CNZA 2O1PA 3CC7S 5D4OA 4FS2A 1YQHA 2VV5A 4OX8A 2EG2A 2QLBB 4M5DA 2OP5A 3TVYA 1T02A 2IYIA 1S1WA 4E98A 3C8YA 3DLBA 1UWBA 2ZD1B 3IWNC 3DM2B 4A8XA 4FS1A 2H65B 3JQJA 3L7UA 3MUTP 1Q5VA 2J8SA 3M32B 3H20A 4J9LA 4ED0A 4NA1A 3RAMA 3TARA 2KZZA 2IVMA 2UUTA 3SXLA 3SI8A 3BBFA 4NRUA 2RIJA 1CS4A 1RWWB 4DLEA 3JB9k 2K1RB 2DXEA 3PDNA 4MKAA 2ZBIA 1KQFB 2QEXS 3RGIA 1TFWA 4OI3A 4LSZB 5A8RB 1O5JA 1U6BA 2DTJA 3M2RB 5KFCA 4PUOB 1FEHA 4QR1A 4ZIVA 1ZA1B 3J80U 3QQCD 3HK2A 2BUNA 3J80Y 1RACB 4EMDA 1BE4A 2RNEA 1HBNB 1PJ6A 1LKZA 1C4AA 1S6PB 4KYZA 5D4LA 3VZHA 4X4NA 1YRUA 5EX0A 3OLBA 3JSMB 4B3OB 2YTCA 1O8BA 4DV0F 1S0NA 3W60A 3J7YI 3I82A 3N6MA 1WHVA 1O6XA 5CA5A 3KDNA 2V8HA 1KD1T 5KFLA 3OBIA 5IM0B 1NKEA 3IN5A 4ELVA 1QTMA 3MCNA 5GAEU 3I5CA 2XO6A 1KEKA 3KHGA 3IFEA 2DNRA 3SCLE 4AD6A 1JJHA 2VPZB 5CYQB 2F3JA 1YBAA 2CJAA 2RD5C 1N33J 4PWDA 1RHMB 5IXUA 3ILIA 3MMCA 5HVGA 4KQZA 4CLKA 4TY9A 3QZ8A 3Q23A 2Z2MA 3TJ9A 3FDSA 3GSDA 3L7OA 4XDDA 2R8HA 2A6OA 1N6QA 4B9MA 2EG1A 3ZTRA 1VLOA 4DV5J 4DR7F 2FTRA 3IBCB 5BYQA 3FSIA 5KG0A 4DHVA 2V68A 1X9SA 2P6TA 4HEA9 5LOQA 5GADU 3IXQA 3D9BA 1CULB 3ITHB 2CA9A 1C0TB 3C16B 4ZPCA 3HVAA 3G71S 3PW7A 4B3MJ 4HKQA 1D3WA 2PT0A 1WKLA 1WACA 1HQ2A 3QBCA 2GMLA 4TNOA 4BWMA 4C2MA 1F9FA 5IQ6A 2O66A 1U2FA 2X3DA 3GIKA 3OFGA 1L3TA 2DRBA 1AZSB 3BYRA 1D9AA 3MF5A 1PJ5A 4ZP9A 3QSYB 1IKXB 3GPAA 4CWBA 3V6DA 4JV1A 4TU8A 1RT1B 1XN9A 4LSLA 2EFGA 3CT9A 3ZXWA 4CLSA 2Z2ZA 1J5OB 5GAEI 3W5ZA 3T41A 1YVFA 1A6LA 4OI4A 2AGOA 1UEUA 2OJ3A 5A76A 1C2PA 1KVJA 1LW2A 1Y10A 2DNYA 3CEDA 3JSYA 3K5OA 4JB8B 5B0GA 2M5YA 4WYLA 1HNZJ 2I2YA 2ROGA 3VQTA 1HNIA 3NGSA 4F25A 3B6BA 3D6HB 1WC4A 3QGGA 4I7FB 2XSJB 2WRMA 3MTKA 3FBCA 3PYGA 5KFTA 3KYLA 2ZH5A 2HIYA 1FDNA 1V3RA 1ROFA 2Q1LA 4JI0F 4IQXA 2ERRA 3WBZA 2R2SA 2EXUA 4A8KA 1BQNB 2RQMA 2DNLA 2G9OA 4DZDA 1F0XA 1M5VC 2YX1A 3RU0A 4DPOA 1SCJB 5DJBA 2AJ0A 4OZ3A 2XMAA 4EBDA 1DRZA 4XDCA 3NY0A 1TKDA 1WC3A 1H74A 2CJQA 3QFHA 4B3RJ 2NXEA 3MM9A 3THTA 3AJDA 2KZMA 1HLWA 4K4YA 3M1VB 2YNHB 3OLAA 1XK8A 4KFBA 4RW7B 2CQBA 2DVIA 2OD6A 1XMOF 1IBKF 3D67A 4B02A 2Q66A 2UXBF 2DH7A 1UMJA 4FYVB 3ETMA 2IFXA 2LA4A 4ZCKA 3ENQA 3TA0A 3W2WA 1HI0P 2POKA 1UPPA 1ZM3A 3CDWA 5HO4A 3OJSA 3C6UB 5JVGQ 2NZ4A 2Y9HA 3TW0A 1LFPA 1GMWD 1Q0NA 1YDLA 3AOAA 3KDOA 1YZ7A 2ZITA 1QSSA 1RAJA 3ET6B 4ZLNA 5A6WA 2AX0A 1KKHA 2V8VA 2V8PA 4DV2J 5IT9Y 1WHYA 1B64A 1TL1A 1LWFA 3MM5A 4RL1A 4QBUA 2OH2A 1S0OA 3L4BC 4OYAA 1Z1ZA 2F63A 3R5CA 1N5SA 2GZOA 3SSRA 2UP1A 2E5HA 2FHKA 4B3TF 1OSDA 3VZIA 1HNZF 2HFNA 5ETTA 4PG5A 1TAUA 2DGQA 2RILA 3FSYA 1TKZA 5ETRA 1C1CB 2HLUA 2VFVA 2H4YB 4L74A 3KNAA 4O23A 2J9DA 4USHA 4F02A 1PAEX 2ZVIA 3JXOA 1K1QA 1MROB 4RO0A 1NH8A 1EAYC 5LMNJ 5LM7E 1REGX 9ATCB 2XGQA 5J2NA 4OI1A 1TKZB 4TKTA 3GFYA 2CQ1A 3UDVA 3T1HF 1RQ0A 4OI6A 2OSQA 2OKQA 1S6QB 2RDIA 3EGWB 4NCBA 3N0VA 4QIGA 2EFOA 3K8VA 4QWCA 4HI1A 3CPWR 1TQLA 1ZS6A 1ZM4A 4NLSA 4PG6A 3GCXP 4RNHA 1ZAXA 3FUYA 3CD6S 1FRHA 1MN7A 2WVBA 3ZZTA 5KFIA 4CO3A 1H2UX 2NYHA 3VV2B 1N32J 2DCUB 2YXLA 3SQOP 1CJTA 3D68A 5JVHQ 3TUZC 1D09B 3V5RA 3PO4A 1M5PC 2XSFA 2YH1A 4RW6A 3CJ0A 4ZLJA 5GMKa 5E0OA 5HK4A 5KT3A 2GCFA 2UUCJ 1F3VA 1NZAA 1S48A 1WKKA 2IYGA 4UQTA 4RNFA 2XQCA 1CJTB 4WFBQ 3R2DJ 2HRTA 3DHWC 4CCHA 3UDCA 3NS5A 2CWXA 1QE1B 2Y1RI 3M9OB 2E66A 3G8QA 2NREA 2XULA 2VKZG 1CJVB 3QWPA 2KTQA 3QT8A 3UCGA 4AQYJ 2R4FA 1R7IA 1S9EA 3HZGA 4WIQA 2K3KA 2MKKA 3KK3A 1H7XA 2IJRA 5CZXA 5DG7A 3D3CJ 5C42B 2R8GA 1ITPA 4M5NA 3GLJA 3GCWP 3MR7A 4P74A 4R5PA 4P7VA 1PYSB 1X8DA 3W8PA 3QRPA 4USWA 4PCQA 3LAMA 4TY8A 3FRYA 3UVJB 4LBHA 3Q86A 4WFXA 1FJGF 3FK4A 5ETMA 3N6LA 4J9NA 1S97A 2Z57B 4NYPA 3U7JA 2J7KA 5KG6A 4YR2A 2HHUA 4B3RF 2QG9B 3BGOP 1TAQA 1RT7B 5KG1A 1U0HB 2YKNA 4JV0A 4KV8A 1SKRA 3LP0A 1ELOA 4ECZA 2KVQE 3M8WA 3SQGB 3P6YC 4JI4J 1FJ7A 2HRUA 3CJ5A 1PJ7A 4DCOB 9RUBA 4I0WA 4I6YA 2HQGA 2YKPA 2CXEA 3V6KA 1L3VA 2G2ZA 3B82A 5HMZA 5LJ5Y 1T3NA 3IG1B 8ATCB 2E1PA 3NCRA 1HPZA 1NBEB 1S1UA 2MEWA 3B8HA 1TL1B 1P27B 3QLHB 4MKVA 4J9SA 1ZAVA 3V6JA 3MR5A 2LU2A 3HVTB 2I6WA 4CYUA 3GP9A 1U49A 3MMBB 1WEYA 1FFGB 3JSBA 2GHWA 4GRSA 1FNMA 1GTHA 4QIWD 1JB0C 5HQ8A 1RT1A 4LSLB 3SQGA 3QZ7A 1SQFA 4K5SA 4RWWA 4KY3A 1IM6A 1WDTA 2E29A 1DZ5A 3DHXA 3R6GB 1G1XA 1IBCB 1OQ3A 3C6UA 3OTCA 2HHVA 5F9NA 4IUFA 3NGTA 2CQHA 1RXOB 3R5BA 3GE9A 1SC4B 2QTWA 4K4XA 4ZPDA 1YJRA 3W7BA 3W66A 3LANA 1YITS 1H2TZ 3GIMA 1UW9A 3UNYA 1URRA 3FBFA 3C15A 3KLFA 1SH3A 3OTEA 1Z2LA 4YP3A 1BMQB 1VFJA 4ERDA 4R5PB 4WP8A 3PTWA 4X64F 2XI2A 4Z7CA 3PYDA 5KFRA 4DV5F 2ZUGA 2K7JA 3ISNC 4DV0J 4KT0C 3R1LA 4JI1F 2HNYA 1LFWA 2ROPA 2VOPA 2OTJS 4Y34A 1Y5LB 3O1LA 2RRBA 1Q86T 2MPUA 5LSOA 2YVSA 3J7YU 2VIHA 1FERA 4C8MA 4C8ZA 1U47A 3M2UA 4F4WA 1X9MA 1UA0A 2B9WA 4RW6B 2E9RX 5SUHA 1IKYB 1SUQA 2HNZB 3CJTA 5E3QA 1XBWA 3BKFA 1RWNB 4WK3A 2QC3A 2WVCA 1V5VA 2B9YA 1H7WA 1RJJA 2V2QA 3C66A 3R5GA 5GAHI 1VIXA 3BSCA 4OX7A 4OZ5A 2HVZA 4ZCMA 3I9ZA 1KHVA 1IUJA 2ZVSA 4NEYA 5KFJA 2KXNB 3VALA 3SV4A 1K0VA 1F5BA 4DR5J 2QJ3A 2MZQA 2UVVA 1RKIA 1U2CA 1KVKA 2IDEA 3FCHA 4KGKA 1L5UA 3PX6A 2W4PA 1HI8A 4MAKA 3KLGB 4P2XA 1S6QA 5IOLA 4LF5F 3VAFA 3C46A 1HBNA 1N88A 4OYIA 3CXCR 2IRYA 4H4KC 1LWEB 2CWKA 4LRFA 1DQAA 1S4FA 2QV6A 1FFWB 2DR6A 3DU5A 4A47A 1AZSA 3JAMY 4X65J 3WC2A 3ZNJ1 4JI8F 4QU7A 2UXDJ 4BCAA 3HT0A 2XS5A 3PEJA 1KR4A 1VCTA 1JNZB
chains in the Genus database with same CATH topology
1WJ9A 2Y8YA 3QRRA 4DZDA 4QYZK 5CD4A 5H9FK 3QRPA 2Y9HA 2Y8WA 4U7UD 3QRQA 5H9EK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJ9 A;  2Y8Y A;  3QRR A;  4DZD A;  4QYZ K;  5CD4 A;  5H9F K;  3QRP A;  2Y9H A;  2Y8W A;  4U7U D;  3QRQ A;  5H9E K; 
#chains in the Genus database with same CATH topology
 8RUC A;  1RYR A;  4C98 A;  3MPV A;  2AGP A;  5A8W A;  1UVI A;  2L9N A;  4QIV A;  4C8L A;  2E1R A;  3DGP A;  2FDN A;  3QT6 A;  1FRM A;  1H72 C;  1N0V C;  2J9D E;  2KXH A;  2BVZ A;  3MDF A;  4R0J A;  1VQ7 S;  2BE9 B;  1RTD B;  1PBU A;  3EZO A;  3LAL A;  3RAQ A;  4J9V A;  1OSC A;  3WIV A;  4QQB A;  3C6T B;  2MKY A;  2FD2 A;  2F9D A;  4J9Q A;  1N34 F;  2XMW A;  1O0P A;  1NHK L;  2XLK A;  4WKY A;  1OY6 A;  4DQQ A;  2Q43 A;  4DS4 A;  2HQ3 A;  2XZW A;  1QVG R;  4QCL A;  1VK8 A;  3ET6 A;  4OI2 A;  4LRD A;  3H25 A;  5EDW A;  5KFU A;  3PZP A;  2YNF B;  4F0H A;  4MMO A;  3KJF B;  4PG7 A;  3B78 A;  5CYQ A;  1IBL F;  3C3L A;  5HLF B;  4DL0 C;  1WNE A;  5D4N A;  3CCJ S;  3I9V 9;  2XMK A;  4PEO A;  3GV5 B;  3PV8 A;  1S12 A;  1UA1 A;  2BM1 A;  3ZZ0 A;  4B17 A;  3VCD A;  1OQ6 A;  4EI2 A;  1AT1 B;  4UTG A;  1QY7 A;  2E5G A;  3O5T B;  1Q1K A;  2C2Z B;  4M1K A;  4NLO A;  3AB2 B;  2YNH A;  1VQK S;  3GZ7 A;  3M1V A;  2X51 A;  2QYC A;  3QPI A;  4IFV A;  4DI6 A;  3MPD A;  3AA9 A;  3MFH A;  1UEK A;  2GX8 A;  5LMU F;  1K73 T;  5ETK A;  3IGV A;  4LF7 J;  1GH8 A;  1VRU A;  2I1R A;  4V19 J;  4NCA A;  5EX3 A;  2KG0 A;  2LQB A;  1WUU A;  2HGL A;  2ZNY A;  5IC6 B;  1BGX T;  1N52 B;  3MUV P;  1R0A B;  3UDE A;  4PUO A;  2ZM6 F;  3RBD A;  1LK5 A;  1WEL A;  1EX8 A;  3JQK A;  2R8K A;  1IKV A;  1Q8B A;  2CPJ A;  2MQ8 A;  3R27 A;  1SQG A;  3PKM A;  2YWW A;  3TAM B;  4ELU A;  2JL9 A;  4C8O A;  4EYH B;  2BX6 A;  1A9N B;  5J2M A;  3EUN A;  5F8M A;  4DSE A;  1CQN A;  3T1A A;  4DR7 J;  2XSJ A;  1B0V A;  2YWG A;  3FCV A;  1YBU A;  4WBF A;  4WWS A;  3OL8 A;  1NK4 A;  4DQR A;  2WK4 A;  3FKB A;  5DDO C;  1MML A;  2Z2Y B;  4OZL A;  1U7L A;  3K8W A;  2ZE2 B;  3PJW A;  4OYW A;  4Y00 A;  2ZOF A;  2UV8 G;  4KPC A;  3W63 A;  5CD4 H;  5HSP A;  4BS2 A;  4F4K A;  3HCX A;  3B4D A;  1TKX B;  4ZPT R;  3U27 A;  5A0Y A;  1RDR A;  2ALY B;  4Z7Y A;  4ZVF A;  3OHB A;  3RYL A;  3MUR P;  3EPI A;  4DR1 J;  2B4V A;  2JVO A;  4C11 B;  1N5Y A;  4NXN J;  1HQE A;  1J5O A;  4CH1 A;  1FJC A;  4ILM A;  4OYM A;  1QAX A;  2NS1 B;  3T5K A;  2IRX A;  5HP1 A;  3LW5 C;  3CCE S;  4E0D A;  3BBB A;  4O3N A;  3OL9 A;  2MQP A;  4PG8 A;  1GAO A;  2W9B B;  4OI0 A;  2W7A A;  2HEK A;  2VOO A;  2IVY A;  2FJD B;  1XC9 A;  3RRK A;  5AXM A;  1T0T V;  2DNQ A;  3D3B J;  1LWE A;  1OS5 A;  1FX4 A;  3MPU B;  5THW A;  1UTA A;  2QSW A;  4DV4 J;  1D8Y A;  3CIZ A;  3UD5 A;  3OW2 R;  2M2B A;  4ID5 A;  1VQ6 S;  1WC6 A;  1FJG J;  1W2I A;  3RW6 A;  1UAW A;  1YIJ S;  3J7A 1;  2XI3 A;  3D0H E;  3C16 A;  5KT7 A;  5MLC V;  4BLG A;  1HKA A;  4UZB A;  3UN3 A;  2V6A A;  4RU2 A;  3JAM U;  2JEJ A;  4FYW B;  4DCP B;  1F2G A;  2ABY A;  3DYA A;  1T8E A;  2MTL A;  1BC6 A;  3A8E A;  3PXG a;  1PSD A;  5C2G A;  5C25 A;  4DF8 A;  1HHS A;  4WU2 A;  2PDA A;  3PAC A;  4BC9 A;  4JI4 F;  1NME B;  2QX0 A;  2W2M P;  4G1Q A;  4OYX A;  1F9H A;  5EHH A;  2W9C A;  2VQF J;  4DUY F;  3V4I A;  4YY3 J;  2PMH A;  3QT7 A;  3K5P A;  4NA3 A;  4NOH A;  5T14 A;  4L3K A;  3OXF A;  4PWD B;  3I96 A;  4F4Y A;  4DR2 J;  2L3M A;  2ZDO A;  2B6A A;  4YDX A;  2DGW A;  1VRT A;  3MOJ B;  1WJ9 A;  1P9Q C;  3HVW A;  3S1T A;  2QSF A;  1UJ6 A;  3DOK A;  3PRV A;  1HR0 J;  4I6W A;  4X2B A;  1AUS L;  2C2K B;  2DHS A;  2CZV C;  3D66 A;  3PHE A;  2E9Z A;  4U7U K;  2DHX A;  2EFN A;  1EHW A;  1F6T A;  4ZPV R;  4YEA A;  4WTO B;  3AHP A;  1N34 J;  2EKY A;  1S6O A;  4HT7 A;  4KGM A;  4AND A;  2KL8 A;  5BYS A;  2PII A;  4ZVP B;  1S0M A;  4F4A A;  3NNA A;  3FMB A;  4ZCI A;  3JSM A;  2OIH A;  3KLF B;  2VA3 A;  1FD8 A;  2RB7 A;  1N5T A;  3EXC X;  2WZ1 A;  4PPD A;  4F3Q A;  4EZ9 A;  1TV6 B;  1IR1 A;  1S57 A;  4DR3 F;  3BSN A;  1VGY A;  2DHA A;  4WFA Q;  4DV1 F;  4R25 A;  5D3G A;  3KTQ A;  4C4W A;  2FY8 A;  5J2P A;  1X4D A;  3LF0 A;  6FDR A;  1LWX A;  4Q43 A;  1GQE A;  4N7T A;  1R3N A;  4AUK A;  2EBG A;  4DU8 A;  2I5J B;  4GO7 X;  2B5J A;  4CYU B;  3D6T B;  2E1M C;  4RBT A;  2ASL A;  3CMQ A;  1DLO A;  3LP2 B;  5JXS A;  2EKN A;  3POT A;  2XNQ A;  3IC1 A;  2XYH B;  2UV8 A;  3Q89 A;  3DLJ A;  1K9M T;  2YWF A;  4ECX A;  1YJ9 S;  2CAD A;  2DRA A;  2PFD A;  4LIR A;  1MN9 A;  1V3Z A;  2GIQ A;  4OHV A;  4M5D B;  2HGN A;  4JI6 J;  3DLE A;  1SC3 B;  1OPZ A;  2J8A A;  2M88 A;  3MUM P;  4GKK J;  2YWE A;  3H2V E;  2UU9 J;  3OL7 A;  2YX4 A;  4KKO A;  2D3O 1;  3H40 A;  2R2R A;  4W92 B;  1JLA B;  3H7H B;  5FDL B;  5J1E A;  3ZZY A;  3KK1 B;  4C8N A;  3KHR A;  2HW3 A;  2AQ4 A;  2QMW A;  1E6V A;  3TZX A;  3MR6 A;  1I94 F;  4XPC A;  4JI3 J;  4LF4 J;  1LQ9 A;  2JH3 A;  2WB4 A;  2JZ5 A;  4TY8 B;  4O3P A;  3UVJ A;  3QAT A;  2IDL A;  3DRS B;  2BA9 A;  1B4S A;  2K2P A;  2FB0 A;  3C19 A;  3MM7 A;  5KT4 A;  4WKR A;  1UJ4 A;  4PXE A;  3TYT A;  4NXM J;  3GYN A;  4H4O B;  3KMS A;  4NLT A;  1UFW A;  1ACM B;  1GFW B;  2D9O A;  1RB0 A;  3E3X A;  4Y28 C;  4ZP7 A;  4ANE A;  4ENO A;  4CLU A;  5L1J A;  1QSL A;  4N41 A;  1NAQ A;  4OX6 A;  3Q2T C;  5HRO A;  3K59 A;  2C3Y A;  3DMJ A;  2VFR A;  3IRW P;  3KHL A;  1HHQ A;  2A0F B;  3NCQ A;  4M5M A;  2VJV A;  1OPI A;  1XWL A;  3OXL A;  4IG0 B;  4DFM A;  2IMW P;  2XZT B;  5KFG A;  1RWV B;  2KG1 A;  2BZ2 A;  4I69 A;  1U4B A;  4I4B A;  1SI9 A;  3S7R A;  2DH9 A;  4CNY A;  4ZP6 A;  3CSK A;  1RBO B;  3WX4 A;  3DC2 A;  5F8G A;  1RU2 A;  4C6A A;  1NJY A;  4NI2 A;  4WK1 A;  1QAI A;  2XB2 D;  4FYY B;  2AWZ A;  1C1B B;  2KKH A;  2LU1 A;  1W26 A;  5CZV A;  4ZN3 A;  5AE3 A;  5LSR A;  3KLE B;  2HRY A;  4JI0 J;  4IR1 A;  4O3O A;  3D7S B;  5H9F J;  1WI8 A;  3IR6 B;  2LMI A;  1HMV A;  3NS7 B;  2EI5 A;  3F56 A;  5B0B A;  4ECV A;  1IBL J;  1A0O B;  4ED1 A;  1CC7 A;  5DS7 A;  5B08 A;  3BGL A;  4ID8 A;  3AJ2 A;  1JKH B;  5F0U A;  3MMJ A;  2E7V A;  4QYR A;  3CO9 A;  2IC3 A;  1OJ4 A;  4NLV A;  1PYT A;  3M8Z A;  1AB8 A;  4ES3 A;  5HBM A;  5KT2 A;  1BD6 A;  1WWH A;  2CQC A;  3SFU A;  1MNE A;  3PJ9 A;  3GV8 B;  1WG1 A;  1Q8I A;  2CPY A;  2I38 A;  2Q3P A;  3G6E S;  1YZ6 A;  2CQD A;  4OX9 F;  5GAD I;  4DFK A;  5T7L A;  1VIS A;  2DNK A;  3T5H A;  1QAJ A;  2P2C B;  2KH9 A;  3HZE A;  4J90 A;  3GG1 A;  4TLR A;  4OJG A;  1YK9 A;  3ENW A;  1V9O A;  2VL1 A;  2ZHA A;  3LH2 S;  1HNX J;  2ZC3 A;  1C1C A;  2UVR A;  3ENA A;  5HVF A;  4DX7 A;  1XMQ J;  4F0M A;  4P72 A;  1HWU A;  4ZVQ B;  3AD8 C;  1E6Y A;  4JV5 F;  2C2M B;  1HBU B;  3RJM B;  3HI9 A;  2X1A A;  4F4X A;  2BDP A;  4ZPB A;  4Y6I A;  3IAS 9;  2UUB F;  1F5C A;  3IP0 A;  1FKO A;  2H3E B;  3G4S S;  2E9T A;  1MU2 B;  4ICL B;  3DNC A;  2CQ2 A;  4F7V A;  3THP A;  3VAI A;  3R7B B;  5A6P A;  3CCT A;  4FBT A;  5AXL A;  3ZNU A;  3T1Y J;  3MM5 B;  2G0J A;  2YBV A;  4DEZ A;  1LWF B;  1S5Z A;  1X4A A;  2DIU A;  1U09 A;  1FEE A;  1VOM A;  1JX4 A;  4DWI A;  1MW7 A;  2I9S A;  4HI2 A;  1N33 F;  2UUB J;  4NX9 A;  5HQM A;  1OWX A;  2BRL A;  3NRB A;  2G1D A;  2XLI A;  3F73 A;  5DGA A;  4K0K F;  2YWH A;  2GHP A;  5CYM B;  2NXC A;  2GGP A;  4IH5 A;  1DUR A;  4ZP8 A;  5KT6 A;  3PR5 B;  3HO1 A;  1HWJ A;  3I0S A;  2QRR A;  1RT5 A;  1FTC A;  2VB6 A;  1F5A A;  3PFE A;  1JLF A;  3E01 B;  3KJV A;  3TVZ A;  5DLF A;  3DRR B;  4LFA J;  2MKJ A;  4ITS A;  2J76 E;  2DGU A;  3MGJ A;  2LFV A;  4LJM A;  3SCK E;  1WTB A;  1UVN A;  3T9N A;  4DUT A;  1YGY A;  1ZYQ A;  5KFM A;  1HD1 A;  2XLJ A;  4I2P B;  2EWH A;  3LP1 A;  4C3M A;  1RAB B;  3LPE A;  2QMX A;  4DUY J;  4G65 A;  1HFE L;  5C2C A;  4TQR A;  1KLM B;  1NB7 A;  5F3Z A;  3TA2 A;  2Z4P A;  3SEO A;  4F3M A;  1JLC A;  1RWP B;  3T5J A;  4Q0B A;  1X5T A;  3EZ5 A;  1AXQ A;  2E7W A;  1NDL A;  2DGX A;  2QGF B;  3KG0 A;  1UKU A;  1BQN A;  2XS7 A;  2V5H G;  4ZVO B;  1RWK B;  3P96 A;  4K50 A;  3VTI A;  4ZK7 M;  3GWC A;  3UR0 A;  2WOM B;  3VGU A;  3AY0 A;  1H3D A;  4RBU A;  2CYY A;  4WXO A;  2EW9 A;  4OHY A;  1AFI A;  4GMK A;  4LRE A;  5EWG A;  1KS2 A;  4FZV A;  4AXI A;  2PA3 A;  2DO0 A;  3C14 A;  1RUS A;  1YJU A;  1NUE A;  1RAI B;  4IH7 A;  4DPW A;  3PR4 A;  2BQ3 A;  3MD1 A;  5D0G A;  5LXY A;  2HFV A;  2VPW B;  1VC6 A;  4MFB B;  3KHH A;  2BXJ A;  1RWO B;  2MY8 A;  5K5M A;  1Q4R A;  4ES1 A;  5A8K B;  3Q8R B;  4ELT A;  1FO1 A;  2OMO A;  3HD1 A;  3TEG A;  3M2V A;  5IZH A;  5D8H B;  3DOM B;  2H5J B;  1QUV A;  3HF5 A;  2HG4 A;  2IMO A;  2ZBP A;  3H0P A;  4FP9 A;  1R8P A;  1ZA2 B;  3S01 A;  2AJF E;  3UFC X;  3M8Y A;  3K57 A;  5L1L A;  2G1H A;  4OHX A;  3BSO A;  3D2W A;  3SMZ A;  1RYS A;  1W7W A;  1S6U A;  1Q53 A;  4WZM A;  1CLF A;  1E6Y B;  1HAR A;  3QGH A;  1BQM B;  2GW8 A;  4WXW A;  3FEX B;  5AXK A;  1Y11 A;  4JI5 J;  4L6V 3;  2F4V J;  1ZBT A;  4DQP A;  2P9C A;  3LOU A;  3V81 A;  1TFY A;  1BY9 A;  2VBY A;  1Y00 A;  1BXN A;  2F8H A;  1CJU A;  3ENV A;  4IFY A;  3G96 A;  3TAP A;  2MSS A;  3H5X A;  2LA6 A;  4WZQ A;  5DZ7 A;  4V19 X;  4X4O A;  2K8G A;  4Y2K A;  3TI0 A;  4NLX A;  3QJJ A;  1CJK B;  3GIJ A;  1K1S A;  3HFK A;  2KM8 B;  4DOZ A;  2IC3 B;  3BPS P;  4OHW A;  2GFF A;  2R42 A;  3MEC B;  4RJV A;  1JKH A;  5E5N A;  2RU3 A;  5DO2 A;  2RF2 A;  4BC7 A;  1GXT A;  4QIE A;  7FDR A;  3JYT B;  1B70 B;  2XWX A;  2KT2 A;  2LXI A;  1X4H A;  3IMQ J;  3K5M A;  1JQG A;  2YQ3 A;  4DR5 F;  4P7T A;  3DN9 A;  1BWV A;  1REV B;  2JHE A;  1RT3 A;  3CW2 C;  1U24 A;  1ZZF A;  2HBR B;  2ZFH A;  1HQU B;  3FJ2 A;  4WPA A;  4Y2M A;  3H5S A;  1BLU A;  2KM8 C;  1RA6 A;  3P5T L;  3ADA C;  2FLO A;  2W7O A;  2KRR A;  3X1L B;  3N5B A;  2Y0B B;  5IM0 A;  4PXD A;  4H4K A;  5D0R A;  4IG0 A;  1WDD A;  2GJF A;  4WP9 A;  5GME A;  2LYV A;  3J81 U;  1Q7Y T;  3MM8 A;  3AD9 C;  2V8D A;  3BO2 A;  1RT4 B;  3GMG A;  5JUM A;  1XNR F;  5BR8 J;  1R89 A;  2HSE B;  2AJ4 A;  2BAN A;  1SL1 A;  3BEG B;  2RQ4 A;  5E7O B;  4CH0 S;  1IVZ A;  2A3J A;  1NM2 A;  2AW0 A;  3TQ1 A;  4LUB A;  2E1A A;  2V67 A;  3OVS A;  2ZH6 A;  3M2R A;  4DL5 A;  4PYD A;  5A8R A;  1VBZ A;  1D0E A;  1E6V B;  2K1R A;  1HHT P;  1J5E F;  4NML A;  3P8B B;  1RT6 A;  1LXJ A;  2WVF A;  1SJR A;  1RBL A;  2IBO A;  3PW5 A;  1F9E B;  3MPY A;  1JLG B;  4GO5 X;  4OV6 A;  3CCV S;  4P6Q A;  4LF4 F;  1RI7 A;  2GAG C;  4G1P A;  2C22 A;  2JLE A;  2P5V A;  2PEH A;  5B0D A;  2HVH A;  4IDK A;  1SXL A;  4QYZ K;  2NCK L;  3A8I A;  1RAE B;  3BYP A;  4H4M B;  1X5S A;  4DLG A;  5D0H A;  3T1H J;  1KDN A;  4DV6 F;  2PO4 A;  4DV3 J;  4CLT A;  1DHM A;  1QDU B;  2VKR A;  4HT5 A;  4NZ6 A;  4PAB A;  1JLG A;  4ED4 A;  2HMI B;  4DF4 A;  1XEZ A;  2VG7 B;  5M2U A;  1EB0 A;  4L73 A;  3Q8V A;  3KWM A;  3CNQ P;  2VFS A;  4DL4 A;  1S59 A;  4GVL A;  1T3O A;  3NGD A;  4DXL A;  5KFS A;  3H2L A;  3H42 A;  1N48 A;  1NK0 A;  1TL5 A;  1NPP A;  5ETO A;  3CDA A;  4USV A;  4ZVR B;  4LVN P;  3BKT A;  5E41 A;  5J2P B;  5H9E K;  2VPY B;  4CLZ A;  3QGP A;  3LGN A;  4X4Q A;  5D3G B;  2VA2 A;  1B7Y B;  4ECS A;  5F8H A;  4XIU A;  2BKN A;  1RCX B;  3IBF B;  3QJP A;  2AYE A;  3DRY A;  1LK7 A;  2QL5 B;  2WVD A;  5CHC B;  5L9X A;  2V9W A;  2U2F A;  3TJA A;  4A8O A;  4DL2 A;  3MM8 B;  4NEZ A;  2MKS A;  4O0I A;  4B9S A;  4USM A;  1CC8 A;  3OTB A;  4A8F A;  2VPX B;  2CAJ A;  1JK9 B;  2MQL A;  4YDD B;  2DK2 A;  2GJ2 A;  5DQG A;  2UUA F;  4CLL A;  2J0S D;  2ZH8 A;  1IJF B;  3SSS A;  4YB1 P;  3TUP A;  2ASY A;  3I0R B;  4WFZ A;  2M9K A;  3QMQ A;  3A4T A;  2J6T A;  2MGZ B;  2WSE C;  4LF9 F;  1DTQ A;  1Y5I B;  5E3P A;  3ZFV A;  4NL5 A;  3VGV A;  3GU0 A;  1T05 A;  2WSC C;  3EIC A;  2HHX A;  3IO1 A;  3KJN B;  1WC1 A;  2COL A;  2MKH A;  3BKU A;  1SH0 A;  3ILO A;  4YFU A;  2W9C B;  4U7U D;  4DS5 A;  4MH8 A;  1SBR A;  2XNR A;  1CEZ A;  4LBI A;  4YHH F;  1S1V A;  4DV4 F;  1PG5 B;  1WF1 A;  1CJK A;  2X1F A;  3LAK A;  1PAU B;  4RR5 A;  2OEJ A;  3CTR A;  1NND A;  2UXC J;  3JTN A;  1CJU B;  1R43 A;  2W1B A;  3M6W A;  4IFY B;  2YKQ A;  4B08 A;  3PJX A;  5CYJ A;  2X1G A;  3V81 B;  2B7C B;  1SIW B;  2Y1L B;  2BJ1 A;  3EXY A;  2XMT A;  4M95 A;  2H48 B;  2IJF A;  5HP1 B;  2WCX A;  3MFI A;  2J7U A;  4S0M A;  3UE2 A;  4CH7 A;  2VG6 A;  4LMZ A;  4CLY A;  1SJ1 A;  2G2Y A;  1FDB A;  2IA0 A;  1WOP A;  1FTR A;  4XTT A;  3VQS A;  2KYZ A;  3OSN A;  3HX9 A;  4OJH A;  4C7Q A;  3HHL A;  4IRK A;  2XS2 A;  2ZC4 A;  4CTA A;  2XY7 A;  3F0N A;  1IJE B;  1FRX A;  1N4L A;  2KJW A;  4AFF A;  4F36 A;  3GQC A;  2AEJ A;  3DOM A;  5IWA F;  2QO3 A;  3PKY A;  4K4W A;  1EAR A;  4OJ1 A;  3NL0 A;  5A8K A;  2MHE A;  3MAA B;  5HMW A;  4NLU A;  3J7A N;  4H4M A;  2HS4 A;  4D3G A;  5HJY A;  4WFN Q;  2FJX A;  1SJQ A;  4NYO A;  4KPY A;  2VFT A;  2HZV A;  2ZE2 A;  4ED6 A;  4B3S J;  3T3F A;  4LFB J;  2AP6 A;  1NJI T;  3DI6 B;  4HH0 A;  3C14 B;  4KH1 B;  1T05 B;  4MKB A;  1J27 A;  1KRP A;  3A3N B;  2HK2 A;  4DU7 A;  4C3L A;  3ULH A;  2BJ9 A;  2CPH A;  2HPU A;  3UD3 P;  2HHH J;  2R8I A;  1FKP A;  3KJQ B;  4C8Y A;  3NKY A;  3NLC A;  1IBM F;  1EKR A;  2EEY A;  2RHQ B;  4YN3 B;  2EC0 A;  4CM0 A;  1T9U A;  2M7S A;  3T5L A;  4FYD A;  2V2V A;  2KHC A;  3CJQ A;  2NXJ A;  1RHU B;  3D1H A;  2DGT A;  3TO8 A;  4CRJ A;  4ED2 A;  1R0A A;  2KJV A;  1JNR B;  3HD2 A;  3TZW A;  4ZS6 A;  3KG4 A;  1R27 B;  4TXS A;  3VF0 B;  2UUW A;  4JYA F;  3MEE B;  3HHN B;  2ZWP A;  1TEL A;  1G7C B;  1HR0 F;  1G4C A;  3DDN A;  4HHH A;  3Q8U A;  1U1K A;  4NLD A;  1PC4 A;  4R0E A;  1VQL S;  2ZH1 A;  4CO0 A;  1AUD A;  3UCU P;  4CLF A;  1MMD A;  1U8S A;  3RTV A;  4J91 A;  2QLJ B;  2VG5 B;  2RUS A;  1FRI A;  3GG0 A;  2D3O R;  2DY9 A;  3H90 A;  4CT8 A;  2GQQ A;  4WJB A;  5B09 A;  4EEY A;  1FKA F;  2OTL S;  2PEB A;  4RW4 B;  3FSX A;  1IKW A;  1AA1 B;  3PRB A;  1TK8 A;  4O3R A;  3BQ2 A;  4TVA B;  4RX6 A;  2BV3 A;  3BR9 A;  3FGV A;  3VR1 A;  2ADB A;  2DKO B;  2FZC B;  3FZB A;  1N36 F;  2XEX A;  2JEG A;  1NSQ A;  1R0B G;  2VC1 A;  4LQ3 A;  2A2D A;  3IRX A;  4ECQ A;  2BM0 A;  2YKA A;  3QO9 B;  4NXN F;  1SIZ A;  3MEC A;  3C6T A;  4IOC Q;  2AEF A;  2M70 A;  3PHT A;  3P4U B;  3QRR A;  1HW8 A;  3EGV A;  5LMN F;  4FPR A;  1JXE A;  1FKO B;  1UPM B;  2C3M A;  4U8Y A;  1FXL A;  1HBU A;  3WZ0 A;  2XM3 A;  1KFS A;  3TUI C;  2RH3 A;  2O01 C;  1KLN A;  2XGP A;  3OHA A;  4EO8 A;  4CI0 B;  2OO4 A;  3K89 A;  3G9C A;  2OD4 A;  2DB1 A;  1BQM A;  1S0V A;  4I2Q B;  1KTV A;  2AZ1 A;  4CO5 A;  4ILL A;  2CPI A;  4N56 A;  2HIQ A;  3OR1 B;  3TNV A;  3TR5 A;  4AL5 A;  2J7W A;  2BAN B;  3FQL A;  3I32 A;  1B0T A;  1U0S A;  1YKW A;  3EDQ B;  4PKD B;  5BXI A;  5HBM B;  2R7R A;  2IA6 A;  2CNO B;  3KOA A;  4EFA C;  4JI1 J;  4HLB A;  3OV7 A;  4DV2 F;  1MSW D;  1AFJ A;  3M2V B;  3GTY X;  2RVJ A;  1M1H A;  1FA0 A;  1IM4 A;  2W25 A;  3R5J B;  2RDD A;  6AT1 B;  2YNI A;  4F8R A;  3T9Z A;  1NK7 A;  2FPH X;  2ZWO A;  1TL7 B;  2W2O P;  4J9M A;  4JI7 F;  2N3L A;  4NCG A;  2D69 A;  2DEJ A;  3H59 A;  2N82 B;  3KLE A;  2JLG A;  1HQU A;  4DBQ A;  2GMJ A;  3D0I E;  1RT3 B;  1HYS A;  1RAO A;  2M4M A;  4L76 A;  2H5I B;  2H5E A;  1KN6 A;  4RW9 B;  1FDD A;  5M2P A;  3I55 S;  4L72 B;  2R9L A;  1EET B;  2JC0 A;  4LFC F;  3BS9 A;  3U1N A;  1KON A;  4A8Y A;  2LEC A;  1NK8 A;  1N36 J;  2RUG A;  4DL6 A;  4K4U A;  1UCN A;  2MZR A;  3JQM A;  1VBX A;  3J81 Y;  1Q7L B;  4CLP A;  2ILZ A;  3VAM A;  1EQM A;  3DMJ B;  2ZHB A;  2AYB A;  2Y8Y A;  4OQJ A;  1AW0 A;  5J1N A;  3G86 A;  3DCA A;  5DDP C;  4ZVH A;  5ETV A;  2RAQ A;  1S7H A;  1GXL A;  3TVK A;  2D9P A;  2VUG A;  3KUG A;  4YB5 A;  4Q5V A;  3NGR A;  4DG1 A;  2JNJ A;  3BQ0 A;  2CZ9 A;  3NBP B;  4DUZ F;  3RRG A;  3A13 A;  2VQF F;  1FFS B;  1ZET A;  1K8A T;  2B9E A;  2NXN A;  3CJR A;  5A2Q U;  1CQM A;  2VC0 A;  4GC7 A;  2BAB A;  2W2Q P;  2F40 A;  3KXD A;  5KFF A;  1PGZ A;  4OZ1 A;  3MCO A;  5DM6 Q;  2BKP A;  1UFL A;  3QID A;  4Q2L A;  3DLE B;  2PGC A;  3QSI A;  5E3C A;  4MYU A;  5ETP A;  3LTO A;  2MB0 B;  5C24 B;  1B7F A;  1I1G A;  2DXD A;  5K8P A;  5B0C A;  5T41 A;  1VDH A;  2BW7 A;  3OVA A;  5LL6 d;  5D4P A;  4QU6 A;  1SB6 A;  2DNZ A;  1K47 A;  2KDO A;  1X4E A;  3QLH A;  4TQS A;  2DNO A;  1RTJ A;  2C3O A;  3G6V A;  4B3T J;  3M8P A;  4ZVT B;  1LV5 A;  1JLB A;  2JEI A;  1RHJ B;  1RAH B;  1Y3K A;  3IG1 A;  3LP2 A;  1X4G A;  4HAC B;  4M5K A;  2EK6 A;  1F3F A;  2B51 A;  3NOG A;  4K59 A;  2N7C A;  5J2Q B;  3HHK A;  4FBU A;  2DO4 A;  4YS2 A;  2ZH9 A;  2IY5 B;  3MM6 B;  1N5Q A;  1UEV A;  2XCP A;  2VDH A;  3OTO J;  5CQG A;  3VAJ A;  2BOP A;  4EK2 A;  1RWU A;  2GC8 A;  3PG9 A;  2D7S A;  3CJK B;  3ILL A;  1M5H A;  2WOM A;  2KYX A;  3RR7 A;  5IT4 A;  3ZTS A;  3QT5 A;  2Y1I A;  3N6N A;  1ZH5 A;  3Q22 A;  1Q8L A;  1YJ7 A;  1ZPV A;  1NO8 A;  2F5G A;  2WB1 D;  4KO0 B;  1JLE A;  3OSP A;  1RIS A;  1B3T A;  2D1C A;  3W9H A;  5KFK A;  2AIR B;  4LF8 J;  2GS8 A;  2MST A;  4X4T A;  3PNI A;  2DR7 A;  1JLC B;  2V94 A;  1V5I B;  2YX7 A;  3RBZ A;  3FFI B;  5FJ4 A;  4U7C A;  4CM2 A;  3A1Y G;  4Y2C A;  1HBM A;  1S9E B;  1UZD A;  3ZZU A;  2C2D A;  3BH6 B;  1CJV A;  1WHW A;  2OFH X;  1MLA A;  4C48 A;  2DR9 A;  4DQI A;  3HSD A;  1QE1 A;  3CWJ A;  4RNN A;  2G4B A;  3KLI B;  1KTQ A;  1VI7 A;  1VR6 A;  2IJN A;  3DRR A;  2PE8 A;  3LO3 A;  2BJ7 A;  3QFW A;  2XYG B;  4OMF G;  4RUB A;  3TP2 A;  1S9G A;  1RT5 B;  2FHO B;  2K3I A;  2MLX A;  2N7Y A;  3UDL A;  3W65 A;  3WQP A;  4U67 Q;  3GSI A;  3N28 A;  2ZH3 A;  2EPI A;  3GJQ B;  2A1B A;  3OR2 A;  5FD1 A;  1N0U A;  2GGP B;  4K8R A;  3DFE A;  5KFQ A;  5U47 A;  2JX2 A;  2VBW A;  3H8Y A;  3P5B P;  3V4I B;  2I0X A;  2HS3 A;  4G1Q B;  3CMA S;  2B0G A;  3MAQ A;  2XTJ P;  4K2X A;  3W9I A;  1KBR A;  1M1G A;  4JI2 J;  3TQE A;  2Z30 B;  1GEH A;  2YNG B;  2FYX A;  1R6V A;  2HHH F;  3DU6 A;  3D4J A;  3QIP A;  1XR7 A;  4EGL A;  3AJ1 A;  3T6B A;  3CCS S;  2E5L F;  2JOQ A;  4DN9 A;  5FLX U;  2BJD A;  1U1R A;  1Q78 A;  2UUA J;  3CD5 A;  4L3N A;  1GK8 A;  1FX2 A;  1MU2 A;  4ICL A;  4PWW A;  1S9F A;  4BDP A;  4UOH A;  3N5F A;  1FES A;  1RZM A;  4WF9 Q;  3OXG A;  2O3D A;  2AMC B;  1NHV A;  2KXF A;  2FVC A;  3DRS A;  3EX7 B;  1NPR A;  2J5A A;  3GV7 B;  1MRO A;  3K7R A;  4RUH A;  1HI1 A;  2CPE A;  2N3O A;  2MZ1 A;  4B9T A;  2XZD B;  2UZA A;  4KKO B;  3H5U A;  5HJX A;  1YBT A;  2N4C A;  2R2U A;  4WFY A;  4URG A;  2APO A;  1K44 A;  2KRB A;  1RU1 A;  4C11 A;  5DET A;  4JI8 J;  4TYB A;  1VHF A;  2GIF A;  4CDI A;  2LXU A;  1I6J A;  5A0Y B;  3GFZ A;  2LQ9 A;  3O2I A;  1LXN A;  2AT1 B;  5KG2 A;  3PEH A;  4DL3 A;  2FVQ A;  2LDY A;  4B9L A;  1KOO A;  3FEY B;  4J9U E;  4LR8 A;  3EWG A;  1IR2 A;  4U95 A;  4GVB B;  4F67 A;  1AYE A;  1FXD A;  1TL3 A;  5K14 B;  3HDS A;  1WC5 A;  1TP7 A;  4IYQ A;  2J0Q D;  1DLO B;  2E5L J;  1S1X B;  3FCW A;  2OPP B;  3D28 A;  1NLK L;  3H98 A;  4AXJ A;  4KAI A;  3IGN A;  1U2R A;  3OFF A;  4PQA A;  3I56 S;  2GO8 A;  4WU3 A;  3TAM A;  4OFZ A;  1XMO J;  1ZOT A;  2AKW B;  2Q6C A;  1RGV A;  2FQQ B;  2HZC A;  2EFP A;  3DRP A;  4FPI A;  4DQS A;  1QSY A;  2C2E A;  2FJV A;  4IG3 B;  1GMW A;  5AXN A;  2F9J A;  1FE4 A;  2IM3 A;  2V34 A;  3I31 A;  1TUV A;  1RLD A;  2H4W B;  1DAR A;  1RA7 A;  1TKT B;  3NP5 A;  4NWB A;  4URQ U;  1R8B A;  4XK8 C;  2FJA B;  3D6M B;  5EGY A;  2JWN A;  1SKU B;  5GVQ A;  5DG9 A;  4X4S A;  3V6H A;  2HZA A;  3AXM A;  1T9W A;  1GMU A;  2CQP A;  1U26 A;  2ZBQ A;  3NEK A;  3VVU A;  2ILY A;  2J6S A;  4X4V A;  2JVR A;  3IBW A;  2CJ9 A;  3RB3 A;  3BZQ A;  3HKW A;  2FVP A;  2ZZT A;  3LWL A;  4QZV B;  3EMT A;  4UOC A;  5EWF A;  3MED A;  5F8N A;  2GVD B;  3R6L B;  5BJR A;  4B9U A;  3KFW X;  2Q6B A;  3ETO A;  2C3P A;  3DOK B;  2CJB A;  2MKI A;  4PQU A;  1RWX B;  3TJ8 A;  2WAQ D;  1YG0 A;  2G13 A;  5B7W A;  4GKK F;  4DX5 A;  2HHP A;  1VRT B;  1UWA A;  3M05 A;  3Q2S C;  2DEI A;  1DY3 A;  5BYR A;  5LT5 A;  5LXR A;  3KK1 A;  2HVD A;  1Y3J A;  5DRK A;  2V2K A;  1Q79 A;  2F8M A;  1RP5 A;  5KFV A;  1I94 J;  4O44 B;  1EIY B;  2G0C A;  2WBR A;  3OL6 A;  2OEK A;  4MK7 A;  2O5D A;  5KG5 A;  1U1L A;  3DLG B;  2OEM A;  3BRE A;  1NK9 A;  1YWX A;  3QWU A;  4J9R A;  1MWY A;  3DYA B;  3W61 A;  5IV4 A;  3EPG A;  2R7W A;  1C0U B;  4P9S A;  1RTD A;  4ER8 A;  2B4O A;  1DAX A;  2XY6 A;  3ZTO A;  3DGP B;  3R5A A;  3BO4 A;  1VRQ C;  5A8W B;  2J6U A;  2I5J A;  1Q5Y A;  4DCJ B;  2UXD F;  3EVO A;  1V6H A;  3MR2 A;  3G6X A;  4C0B A;  4JP8 A;  1R8A A;  1RTI A;  2Z2L A;  4PPZ A;  4F26 A;  4JI3 F;  4PG4 A;  3NGK A;  3QGI A;  3G8S A;  3IS9 B;  2DHH A;  3BN7 A;  1KC8 T;  2A6M A;  2HND A;  2ASD A;  3SCJ E;  5IQQ A;  3IR5 B;  3GJT B;  3ZZP A;  4W98 A;  4RUA A;  3G8T A;  2GHV C;  2QFJ A;  2MZS A;  4WE1 B;  1W2B R;  2GIR A;  5L8R C;  4Q45 A;  5KOW A;  3CIM A;  2BE2 B;  2YH0 A;  4MKY A;  2OPQ B;  3BBC A;  2CZ4 A;  3L7P A;  5E2Q A;  3RW7 A;  2L48 A;  1TKX A;  1NSP A;  4YQW A;  1VJW A;  4P10 A;  3M4X A;  3BQ1 A;  3B54 A;  2ATC B;  3HSJ A;  3W64 A;  2JRS A;  3RUB L;  1N6Q B;  2VIC A;  2LEB A;  3AXK A;  2ZM6 J;  2HWT A;  4LF8 F;  3IM9 A;  3NWG A;  4O44 A;  2B6A B;  1LOU A;  2FJB B;  4OZ0 A;  5KG4 A;  5KFO A;  4ZHR B;  3OT9 A;  3IR7 B;  3GYX B;  3BB5 A;  4ZJQ A;  3BGU A;  1FVS A;  4KGX B;  5HAN A;  1OY9 A;  2R7O A;  1TMM A;  2CFX A;  3KKF A;  2L9W A;  1KQK A;  3TUJ C;  2KFY A;  4WII A;  4JUZ A;  4X66 F;  3IM8 A;  3HVR A;  1YJW S;  4CO4 A;  3HPO A;  1KQG B;  2DGS A;  5BR8 F;  2ZH2 A;  3CCQ S;  5I3U B;  1NDP A;  3PX4 A;  1S79 A;  1VRU B;  4OLP A;  3QRQ A;  3FMW A;  3JS9 A;  1D9D A;  4NLY A;  3RAX A;  1D9F A;  2BE7 D;  3O8W A;  4OZN A;  3M7V A;  3PX0 A;  2AGQ A;  2HWH A;  3HM9 A;  2VJU A;  5F8J A;  5D6G A;  4F2S A;  4TLQ A;  3W8G A;  2KHD A;  3NAH A;  5LJ3 Y;  2V4Q A;  4ID5 B;  2CRL A;  2YQ1 A;  3B4M A;  3DKD A;  1XJW B;  3GYG A;  4UUX A;  2QA4 G;  4RWX A;  4M5J A;  3W2V B;  1RAD B;  1S76 D;  3CCM S;  1GX6 A;  2LEP A;  2X1B A;  3D5M A;  1ZZN A;  1YJN S;  4HHJ A;  4DJB A;  2KT3 A;  1NKB A;  4IG3 A;  3TA1 A;  4JV5 J;  3PW4 A;  4B3S F;  1HW9 A;  4N47 A;  4Q44 A;  4DSF A;  2MQN A;  2ACY A;  2YNF A;  2MJN A;  4K4T A;  4DV1 J;  4J9O A;  1HQE B;  3MMB A;  4RBV A;  4HYK A;  1N5Y B;  2C42 A;  3HVT A;  1J2V A;  2B43 A;  2CG4 A;  2NSC A;  3CD7 A;  4RW8 B;  1SV5 B;  1VQN S;  4X4U A;  2MHN A;  4CO1 A;  3EDR B;  2KI2 A;  4O4R A;  4AT1 B;  4DN0 A;  3K5L A;  3OVB A;  5B0A A;  2HVI A;  3DM2 A;  2HKE A;  2N4D A;  1HBO B;  2NR0 A;  4D3H A;  2WVE A;  1O51 A;  1OYD A;  1FCA A;  1MWQ A;  2LQJ A;  3AD7 C;  2QN6 B;  3ELH A;  4RW8 A;  3K5N A;  1XMQ F;  2KFN A;  1TMJ A;  3LP0 B;  4KV8 B;  2F8E X;  2HK3 A;  5J2M B;  3HFZ B;  1RT7 A;  2MQO A;  2DPJ A;  2FLL A;  5IT9 U;  3N4W A;  1YJT A;  4M8L A;  3CVK A;  3S6E A;  2E7X A;  2DGO A;  1IKV B;  2CPF A;  5HQL A;  2C2R A;  4NMX A;  4KRW A;  1HIY A;  3U1M A;  1IWG A;  4USJ C;  1T03 A;  1W25 A;  3PCO B;  3JTO A;  4OJ3 A;  4LBP A;  5I3Q A;  1NKC A;  1M90 T;  4KHP J;  3W3S A;  5GAG U;  1U1O A;  2PSZ A;  2Y3Y A;  2PMW A;  2WSF C;  1JJ4 A;  2V8G A;  2DPI A;  3E51 A;  2MJU A;  2B3T B;  3R5D A;  5MAO A;  3KK3 B;  4LF7 F;  5C5J A;  5D0E A;  5B0E A;  1VYA A;  3HUL A;  1VJQ A;  3L09 A;  4MK8 A;  3IWX A;  3BDP A;  1S99 A;  2VF3 A;  2DNP A;  4FF4 A;  4ECT A;  1FJE B;  5HI7 A;  2G2O A;  1TKT A;  2MLY A;  4P2S A;  1VQO S;  1ZPW X;  3ZC4 A;  1LW0 A;  4X4P A;  2BR0 A;  2JEF A;  2VH7 A;  4LFA F;  4N76 A;  4UST A;  1B99 A;  3OR2 B;  4FKY A;  3X3U A;  2KFZ A;  5HAO A;  3OQ2 A;  4ZHR A;  3W1Y C;  1S9G B;  3M2U B;  4DPU A;  4DR6 F;  1TUG B;  4U8V A;  3L9Z A;  1N8R T;  2BMB A;  4X62 F;  1HA1 A;  2D74 B;  2OPP A;  3DDK A;  4KIA A;  2W9A A;  1TZ0 A;  4J5O A;  1WOO A;  4C8K A;  2V4R A;  3FRZ A;  3HLU A;  4OYO A;  3J7Z T;  4UY8 5;  1QLN A;  2HNY B;  2JJ4 D;  3AOC A;  4KR0 B;  2W2P P;  1F1B B;  2OLW A;  4OYP A;  4JYA J;  2XC9 A;  3MEG B;  1ZTT A;  4DR4 F;  3TEH B;  2L08 A;  4QWE A;  2OPQ A;  2BE2 A;  2F7V A;  4I1T A;  1WF0 A;  1YRT A;  4WE1 A;  2AF6 A;  2ZOM A;  2DXF A;  2V0N A;  4KO0 A;  4UOF A;  4UOG A;  5K9F A;  2E5I A;  5I42 B;  4PXB A;  5AT1 B;  4EBE A;  2HHQ A;  1DQ8 A;  4LR9 A;  3SCI E;  3IAM 9;  2DR5 A;  4UY8 T;  1SC1 B;  2CJX B;  2O67 A;  4CT9 A;  3CO0 P;  3F41 A;  3TOQ A;  2MXY A;  4EU0 A;  1RTI B;  3O3L A;  3TAQ A;  3BM7 A;  4RUC A;  4LRC A;  1FRL A;  1R8H A;  2CVE A;  1IN0 A;  5HVH A;  1HNX F;  3KLG A;  4ILR A;  3N01 A;  3CJ4 A;  2RQC A;  3UO0 A;  3AA8 A;  3D54 A;  2QL7 B;  1HPZ B;  1S1U B;  4J7C A;  1C0U A;  2CKW A;  4RNO A;  3QIP B;  3MXH P;  4WTY A;  2CNK B;  4TN2 A;  3ICL A;  2YNG A;  3VAK A;  2DIV A;  2V4J B;  4LF9 J;  4KGV B;  3W62 A;  1XNR J;  3DLG A;  5KFY A;  2R8J A;  2HFS A;  4AQY F;  4N8N A;  2KB2 A;  4TU9 A;  1GNK A;  1IKY A;  1SUQ B;  2H1Y A;  2HNZ A;  4QW8 A;  3FBE A;  5KFZ A;  3CCW A;  2AZ3 A;  1U0H A;  2YKN B;  5DQI A;  2IPO B;  2GQ2 A;  4OX9 J;  1WSR A;  3TX0 A;  1Y0H A;  5GAG I;  1HNW J;  3KLI A;  2QE5 A;  4JBC A;  4M5I A;  1VQM S;  2UUC F;  2UXC F;  4RW7 A;  2BBE A;  1VQ4 S;  4UQG A;  2ZBC A;  4AYB D;  4JOU A;  4FVC A;  1WC0 A;  3R7S B;  2HQD A;  4LF6 F;  1BQX A;  2HQI A;  3MED B;  1VQ8 S;  2R2T A;  3FZ2 A;  1X5O A;  1HNW F;  1KVI A;  3TAN A;  3U02 A;  4DX6 A;  1F60 B;  2OI2 A;  2RHS B;  3C15 B;  4GC6 A;  1JXL A;  3NG8 A;  1JLE B;  3ZTP A;  2AYG A;  2RE1 A;  2NSB A;  3EE3 A;  3GIL A;  2ZEJ A;  5G4D A;  2BW2 A;  3D1Q A;  2QA4 S;  3Q8Y A;  3CGI A;  5KFP A;  1GX5 A;  4K0K J;  3CJK A;  4ZDN A;  4P52 A;  4PYA A;  2MYF A;  2VQE F;  3AOB A;  1HYS B;  2KO1 A;  3DRP B;  4ZIW A;  3PIO Q;  4OL8 A;  4UF4 A;  1RLC L;  2AYM A;  2HS0 A;  3PW0 A;  1XNQ J;  3EZU A;  4FYX B;  2NXU A;  3R8Y A;  1Q95 G;  3FVY A;  2QFI A;  5J2Q A;  1FD2 A;  3VVT A;  1YHQ S;  2QA1 A;  1NHU A;  1PCA A;  1Y4Z B;  2PD1 A;  4M5H A;  3Q24 A;  3BPD A;  2Z0G A;  4O0N A;  3AOD A;  4ZPA A;  4CIO A;  4HTJ A;  2ZUA A;  4KJI A;  3PO5 A;  4ZVS B;  4NLG A;  1NU4 A;  2HLT A;  2H51 B;  2XG8 A;  1R8C A;  1JXV A;  3AFG A;  5CAB A;  1TTH B;  2HHS A;  2XMV A;  2YQ0 A;  1FRJ A;  5J2N B;  4OLO A;  4MYT A;  3T19 A;  3V2U C;  2E5J A;  1ARO P;  4QIF A;  2L9D A;  2EFQ A;  4ECW A;  1NJW A;  1U8W A;  2CQ0 A;  2XWY A;  2R7Q A;  3BDE A;  1T9T A;  2Y0S D;  4A8Q A;  2HAF A;  2QZ8 A;  3OFE A;  4DV3 F;  1WTF A;  1C0T A;  2BRK A;  4DFP A;  1CUL A;  3ITH A;  5C42 A;  1SKS A;  1KSP A;  3CJ8 A;  1X4B A;  1N5V A;  2BYC A;  3D6F B;  3HJV A;  4G6V B;  4DX8 H;  5K8M A;  3LGH A;  1X31 C;  4GKJ J;  2A18 A;  4WYW A;  8AT1 B;  1U1P A;  3AT1 B;  2DY1 A;  5DQH A;  4FF1 A;  3HSG A;  4F0K A;  2LQ8 A;  2V69 A;  2LCW A;  3G82 A;  3L3C A;  1JWW A;  1CBK A;  2UVW A;  1RKJ A;  4Y3C A;  2WW8 A;  3MMC B;  4RW9 A;  1C4C A;  2AEM A;  1OYE A;  3P3D A;  2FUG 9;  3A3P B;  3WHI A;  4DR3 J;  4L75 A;  2DBB A;  2BOA A;  4F2R A;  1UVM A;  2CQI A;  3G87 A;  2AU0 A;  1A7G E;  2MY7 A;  3W2W B;  2HFZ A;  4CP5 A;  1TL7 A;  2F1F A;  1L3K A;  3CCZ A;  1FI4 A;  4M94 A;  2K06 A;  5IFM A;  4UW2 A;  1H0H B;  4ZN1 A;  2J0X A;  5F0W A;  3AQO A;  1NCL A;  2Z8Q A;  2CVI A;  2LQ5 A;  1NSA A;  1X7V A;  4E8U A;  4FN5 A;  2QIF A;  2RJZ A;  2HFU A;  2XCA A;  4IO1 A;  3FFI A;  5KT5 A;  3OJU A;  1FXR A;  4YME A;  3MEE A;  4EO6 A;  2LXF A;  2HVE A;  2FC8 A;  2D3Z A;  2EC2 A;  1RK8 A;  4LR7 A;  4GKJ F;  3R1H A;  3RB4 A;  1T94 A;  4ETX A;  4DR2 F;  2C3U A;  2RU9 A;  1T03 B;  2HHT A;  2HGM A;  2DNM A;  3NS6 A;  1X5P A;  3E2E A;  4KSE B;  4LRA A;  2XYP B;  3THV A;  2F4V F;  3PY8 A;  4Y0F A;  3TZZ A;  3M8S A;  4Q7A A;  2RSQ A;  3DI6 A;  3IWL A;  1HNI B;  4M5L A;  2K7K A;  3MM6 A;  2JC1 A;  4I56 A;  1HBO A;  3MMA B;  3M9N B;  2DT9 A;  3K17 A;  1FNO A;  1LW2 B;  3HHL C;  1SPB P;  4RU9 A;  1P1L A;  4DV7 F;  3GFH A;  1XTZ A;  1BHN A;  2LDI A;  1SV5 A;  1FT8 A;  4BWJ A;  2ROE A;  2RDJ A;  1DTT B;  1P8G A;  3NGU A;  2RS2 A;  1IR0 A;  2V9K A;  4P73 A;  1H2V Z;  3R3T A;  5D77 A;  5IC4 B;  4QOT A;  3GR1 A;  4CTA B;  2IIH A;  4LVO P;  2ZKU A;  1JJ2 R;  3RB6 A;  4KB7 A;  1PC5 A;  4RW4 A;  2XMM A;  3Q0A A;  2DHG A;  1U1N A;  4LRB A;  5ADZ A;  3N9U C;  6FD1 A;  1TK0 A;  2EBE A;  3KUH A;  5E3R A;  2CNN B;  5KOX A;  5CXT A;  2B4U A;  2IM2 A;  3J7Z 5;  1M5S A;  3W2V A;  3KG1 A;  1IXK A;  2QLW A;  3UNG C;  4KFB B;  3NWR A;  1VQY A;  5L39 A;  4B9N A;  1LEO A;  2FZG B;  5DG8 A;  4DSK A;  1F2H A;  2P6S A;  3MM9 B;  2ZJR Q;  4DUZ J;  1WG5 A;  4RZR A;  2CQ3 A;  3SBM A;  2IVF B;  2FGC A;  1UW4 A;  4LIW A;  4P2F A;  3RBE A;  5A2Q Y;  2Y8W A;  3EM1 A;  2MZT A;  1NPK A;  4ED3 A;  5JJB A;  4EWT A;  5F8I A;  5I3U A;  1FWK A;  1FNX H;  1URN A;  1I51 B;  3EGZ A;  2FZK B;  1SL2 A;  4BHQ A;  2WBM A;  2KT5 A;  7FD1 A;  1NXI A;  2OFG X;  5E33 A;  4O4G A;  4ED8 A;  1Q81 T;  2RQK A;  1M5O C;  3DLL Q;  3HJF A;  2JFD A;  1N32 F;  2XY5 A;  1FKP B;  3TZY A;  2ZOG A;  4C0H A;  1S49 A;  2MGZ A;  1RHK B;  2OML A;  5KFX A;  3O6Q A;  1JMT A;  4I7F A;  2ZBR A;  1H73 A;  2W4C A;  1UL3 A;  5F41 A;  2AX1 A;  3CJS A;  5AE1 A;  1X60 A;  4NCG B;  2HQC A;  5I4M A;  4MIB A;  1UJ5 A;  2ZNZ A;  1GTE A;  1WHX A;  1XIQ A;  1Z4U A;  2WON A;  2DH8 A;  3HFV A;  3CC4 S;  2CDR B;  2PC6 A;  5IT0 A;  2M52 A;  2VHG A;  1IQT A;  2ZJQ Q;  5ITH A;  5AJ3 F;  3HMJ G;  3UPF A;  3GB0 A;  1RWM B;  3MAH A;  3PVX A;  4QR0 A;  3T1Y F;  5G0R B;  1S6P A;  1VS3 A;  4OZ2 A;  3SSQ A;  4X66 J;  4J9K A;  3OR1 A;  4IRC A;  3V6D B;  3GFX A;  5C7P A;  3NMA A;  1IKX A;  1T11 A;  3R97 A;  4Z37 A;  2HND B;  1WD6 A;  1R0C B;  4N8O A;  2L41 A;  3IA0 A;  3LWM A;  3IS9 A;  4EZ6 A;  1CG2 A;  2VG6 B;  2X3G A;  4B3M F;  3CDE A;  3M6X A;  2FHM A;  2E44 A;  4Q8F A;  2D3U A;  1WG4 A;  3UQS A;  4WCE Q;  3SIP B;  3MOZ A;  1FRK A;  3MEK A;  1VC0 A;  2OPS A;  3LGM A;  4ECU A;  2HBY B;  2GJI A;  4ZCL A;  2VG7 A;  5KAK A;  4B9V A;  3AB4 B;  2D41 A;  3LPY A;  3VAH A;  5DDQ C;  1VIO A;  3M32 A;  3D1O A;  4U9R A;  2VOD A;  5F8L A;  1S1V B;  3PYF A;  4CZC A;  1XNQ F;  1XR6 A;  1WF2 A;  1S4E A;  1UWB B;  2ZD1 A;  2ZJP Q;  3UD4 P;  1S1W B;  2PA8 D;  3ISN D;  3WX8 A;  4IH6 A;  1KHW A;  2OUG A;  4M5G A;  4O3S A;  3G6Y A;  1RTZ A;  4NYZ A;  3IRX B;  1IBK J;  3M9M B;  4CQ1 A;  2CUY A;  2QYG A;  3CUN A;  2CPX A;  2PFF B;  3V4M A;  2OPR B;  2B8Q A;  3QYY A;  3EVW A;  1RBA A;  3KNG A;  3PRD A;  3VGT A;  1IKW B;  3CDB A;  5H9E J;  1UVL A;  3L95 X;  1SVD A;  3BO3 A;  5KFD A;  2MZJ A;  4ZJL A;  2VBZ A;  1BWE A;  4ES2 A;  1MWZ A;  4PQU B;  2CG8 A;  4ZPW R;  2VQE J;  2GVD A;  1X0P A;  3KUE A;  1QJH A;  4FKX A;  4E2F B;  1JLQ B;  1TU0 B;  2IM1 A;  4EUV A;  4YHH J;  1PO6 A;  2PI5 A;  1S10 A;  3DOL B;  1U25 A;  2NUH A;  1FK9 A;  4B3O A;  3EGN A;  5DDR C;  1Z2Z A;  4JI2 F;  4PR6 A;  4QW9 A;  3US5 A;  1UET A;  1JLQ A;  5KG3 A;  1LWC A;  2ZHO A;  1NEE A;  2ATL A;  2XHC A;  4OV1 A;  4QWA A;  1NB2 A;  4I64 A;  2R7V A;  2R7U A;  2FGO A;  3R2C J;  4YY3 F;  4ED7 A;  2BJE A;  3KMQ A;  3CE8 A;  5H1S V;  2RRN A;  1BUX A;  1KOH A;  3FC9 A;  1CS4 B;  3UCZ P;  1FWP A;  2H54 B;  1H98 A;  2FVR A;  4N77 A;  3BSA A;  3M6U A;  4K4V A;  4IRD A;  4LSN A;  2R7S A;  3MCM A;  3N79 A;  3K58 A;  2GAH C;  1S1X A;  2HMI A;  2BQR A;  2QT7 A;  2MKC A;  4ZA1 A;  3M8Q B;  1VHI A;  1RHQ B;  1RAF B;  5K14 A;  1TL3 B;  2OHD A;  3W5X A;  5K8N A;  4GVB A;  3HP6 A;  1RCO B;  3GR0 A;  1CPZ A;  5RUB A;  1L3U A;  3I4P A;  1XR5 A;  2W8L A;  2VON A;  4FXD A;  4IDK B;  4AL7 A;  3CJ3 A;  1K0T A;  4CLW A;  2U1A A;  1X4C A;  1YI2 S;  5KFA A;  1Q8K A;  3GII A;  4ZKA A;  5SZT A;  4X84 A;  1TVR B;  1FF2 A;  4KHM A;  3SDE B;  2W8K A;  1T9V A;  1HNV A;  2B56 A;  2JLF A;  3OTD A;  2EVZ A;  2ACM A;  2GVZ B;  4USI A;  2ALZ A;  3HHL B;  3BJY A;  4QYZ J;  2LEA A;  2CJY B;  4V1A k;  1YLX A;  1I3O B;  1GMV A;  2FHJ A;  2CDQ A;  3Q8S B;  3WIU A;  4KH0 B;  4LT6 A;  4YR0 A;  4Q2M A;  4NZ0 A;  4ALZ A;  1R31 A;  3Q83 A;  2XBP A;  4UUW A;  5ETL A;  3GON A;  5CCM A;  2GQC A;  2RRA A;  2OGU A;  3F44 A;  2E1C A;  3FBB A;  4DR4 J;  3BGR A;  2BKO A;  3I5B A;  1S1T A;  3OD2 A;  2DJW A;  4OZJ A;  2V50 A;  3KLH B;  4DFJ A;  1H38 A;  4HH1 A;  2IBK A;  1RTH A;  1SQE A;  3GJS B;  1KP6 A;  3UN5 A;  4F04 B;  5EUH A;  2A2C A;  3PYE A;  2DNG A;  3U1L A;  4J37 A;  2FJW A;  4X62 J;  4NLQ A;  2YY3 A;  4DR6 J;  2IHR 1;  2VFU A;  1V3S A;  1D1U A;  1DBD A;  2HAI A;  2DIT A;  3MCS A;  2CJK A;  3QJL A;  1MG7 A;  5L1I A;  1FE0 A;  3Q8Q B;  1PKU A;  2LVW A;  1NRK A;  2PI4 A;  5LMU J;  1VQP S;  1M0S A;  3CCU S;  4R8U A;  5FLX Y;  2GV1 A;  1DTQ B;  1EP4 B;  4A48 A;  3M8R A;  4ECY A;  3BGF A;  4Y2A A;  2ZZM A;  5CCL A;  5F9L A;  4K4S A;  2VBX A;  1KNZ A;  4KC5 A;  4AE5 A;  4IKA A;  4DSL A;  3I0R A;  2AJ2 A;  3MI7 X;  4O4G B;  1EKS A;  2M3D A;  1R6Y A;  1ICE B;  2GO9 A;  2GNK A;  2NYI A;  3HSZ A;  4I6A A;  4Y2I A;  4QWD A;  3JYT A;  5H9F K;  3QNW B;  2AJQ A;  4PZV A;  2FHJ D;  2YPZ A;  3CB4 A;  3VGS A;  2ZKT A;  1HBM B;  4FF3 A;  1OIA A;  3CF5 Q;  2HWI A;  1OO0 B;  1T95 A;  4EYI B;  4LFB F;  1RHR B;  4OIX A;  4HDH A;  4LF2 A;  4DSJ A;  3AAW B;  2C28 A;  1KLM A;  3KK2 B;  3LQV A;  4RPF A;  3RZA A;  3C2P A;  4JV2 A;  5M2R A;  4NAS A;  4I2P A;  2P9E A;  2EK1 A;  3BR8 A;  4ATN A;  1UVK A;  3KLV A;  1EJ7 L;  2AHO B;  3DLK B;  1NK5 A;  2CQ4 A;  4X64 J;  1JJC B;  3CCR S;  2DYA A;  4IO9 Q;  3W9J A;  3HHD A;  3E01 A;  3JSR A;  1YTY A;  2FC9 A;  2XHW A;  2B4P A;  4CO2 A;  3G2X A;  4FNI A;  5KFB A;  3J81 j;  2RKI B;  3KJV B;  3PW2 A;  1VQ9 S;  4PAA A;  1B0P A;  4NRT A;  3R7N B;  2Y1J A;  1NJX A;  1VLY A;  3CCL S;  1VQS A;  2RT3 A;  4XAK A;  4RKU C;  1RSC A;  1G6B A;  2B9X A;  2NPF A;  4ZOS A;  3ZZZ A;  3BH7 B;  5J1P A;  5KFW A;  2KVI A;  2BJ3 A;  1WOR A;  1DTT A;  2CQG A;  4HAC A;  1JLB B;  3LA0 A;  3CC2 S;  3HHE A;  3M8P B;  4ECR A;  1UZH A;  1RTJ B;  4P71 A;  4U96 A;  2IRU A;  4FVM A;  2WW4 A;  4K5R A;  2UU9 F;  2AV5 A;  4FDF A;  2W4D A;  2DGV A;  2LP4 A;  1Y9O A;  2J9E A;  2RML A;  4MFB A;  4HVZ A;  4F50 A;  2DNH A;  3MMA A;  4HTI A;  4NLR A;  3I4H X;  5GAH U;  5C24 A;  4DV6 J;  2Z56 B;  2SXL A;  4WP3 A;  4ZJO A;  1ULR A;  3A8J A;  4C0O C;  2XO7 A;  3HXM A;  1KQS R;  1RT2 B;  4IOA Q;  4QPT A;  1YSJ A;  2C1E B;  4A8M P;  2M8D B;  1RT6 B;  4X4R A;  3A8K A;  1IWA A;  1P6T A;  2JSX A;  3MWB A;  4QWB A;  3FNN A;  2KU7 A;  4DMZ A;  4K2J A;  4LF5 J;  3NBP A;  2R7T A;  3OTO F;  1U1Q A;  4DPT A;  3T6J A;  4UT4 A;  4J9P A;  3DRX A;  4JI6 F;  4DG1 B;  4Z2X A;  2W7P A;  2V63 A;  1SL0 A;  1DFD A;  4OHZ A;  3OPK A;  4Q0B B;  4USK A;  1VC5 A;  1VQ5 S;  4A8S A;  3KK2 A;  2ASJ A;  1QM9 A;  1TL4 A;  5EWE A;  1Y7P A;  2HBZ B;  2FLP A;  2MQM A;  3JTP A;  5HMX A;  1RT4 A;  1WKJ A;  1WOS A;  2LKZ A;  4RLE A;  4UZC A;  4YR3 A;  1RAG B;  2RS8 A;  5LSL A;  2QLF B;  3LP1 B;  3M30 B;  2GA7 A;  2I8E A;  1EQ0 A;  1FVQ A;  2IAJ B;  2VZ9 A;  4NPO A;  4NXM F;  4YUD A;  5AJ3 J;  1G2E A;  1EET A;  1XQI A;  3PFO A;  5E3A A;  3NOC A;  5K20 B;  1S72 S;  2MLZ A;  1EP4 A;  3BV8 A;  4KGZ B;  3I0S B;  4TU7 A;  1C1B A;  3RBX A;  2ZH7 A;  2OSR A;  2FLN A;  1RE1 B;  1HWL A;  2YKM B;  4NI2 B;  1REV A;  2B8P A;  1P1T A;  1S7I A;  2C2O B;  3ILJ A;  4URS A;  1NK6 A;  3RR8 A;  5L1K A;  2J9C A;  5HL7 Q;  1D8Z A;  4ZVG A;  1APS A;  3MPW A;  5CD4 A;  3O44 A;  4MTP A;  1ZM2 A;  2IAJ A;  3G82 B;  4HDG A;  4BBY A;  1KFD A;  4RNM A;  3NMR A;  2YNI B;  4TYA A;  1YX2 A;  3M30 A;  4KTQ A;  4PWU A;  2RF2 B;  4DR1 F;  3AH6 A;  2P8I A;  2VDI A;  3BN4 A;  5D15 A;  5HRO B;  2DIS A;  4G3I A;  1VBY A;  1DQ9 A;  4N5S A;  3D0G E;  3VWS A;  2BQU A;  3KLH A;  4K7Q A;  3H2U B;  1S1T B;  2QMU B;  4MIW A;  3OUY B;  5B0F A;  1X0F A;  2V2Z A;  5L38 A;  5KFN A;  4I2Q A;  3TWZ A;  1NH7 A;  3NCP A;  4MK9 A;  2NZC A;  4DZ6 A;  1M5K C;  3ZZO A;  1T9Y A;  2XMJ A;  4NLW A;  2Z58 B;  4FXW A;  4PXC A;  3PIP Q;  4LQ9 A;  5L9N A;  1X9W A;  5FDL A;  3PM9 A;  4ZLL A;  1NDK A;  1N54 B;  2JFK A;  4MT1 A;  2GVZ A;  5J1E B;  1RT2 A;  2ZDP A;  3ONQ A;  1SJ3 P;  3I87 A;  4Q8E A;  1Q82 T;  3OUY A;  2C2N A;  4JI5 F;  4W90 B;  3QAE A;  4YOE A;  2W2N P;  1U1M A;  2AJ1 A;  4NZ7 A;  4O3Q A;  1QAY A;  3RB0 A;  1S77 D;  3CJ2 A;  1QD1 A;  5KG7 A;  2M8H A;  5I3P A;  3QO9 A;  4ZIT A;  5KFE A;  1KWM A;  4ZVE A;  4ZVU B;  1ZTW A;  4USU A;  3Q8P B;  4PRF A;  3K0J A;  3W5Y A;  3SV3 A;  4ED5 A;  1HMV B;  5HAT A;  3SFG A;  2NQP A;  2R7X A;  2ZZN A;  1U6F A;  2B5J B;  1WI6 A;  4LSN B;  3UW1 A;  4C3K A;  3ZO7 A;  2MDA A;  5K8O A;  3P49 B;  2YKM A;  3H4B A;  3GJR B;  1DJ0 A;  1WEZ A;  3EJM A;  5JMN A;  4DSI A;  4XO0 A;  2CPZ A;  5KFH A;  3ZTQ A;  5CAA A;  5DGB A;  4DL7 A;  2HUR A;  1IBM J;  2VG5 A;  2HYI B;  2H9Z A;  2YPY A;  3DXB A;  1T9X A;  1NJZ A;  2MMY A;  1SH2 A;  3DLK A;  1JIH A;  1TUW A;  4ZMM A;  5FII A;  1G3O A;  1VK3 A;  1QUP A;  2BAC A;  3NNH A;  1FK9 B;  3NNC A;  3DOL A;  1VMB A;  4HHU A;  4M63 A;  4C9D A;  1P9Y A;  4QR2 A;  1FHT A;  1PYO B;  4XPE A;  3HHL D;  1TK5 A;  4AL6 A;  1PIL A;  2NLW A;  3K2Y A;  1M1K T;  4ANC A;  1ZM9 A;  3MZI A;  1QVF R;  2W01 A;  4FF2 A;  2B7B B;  4OYB A;  4W4M A;  4F3O A;  4DDF A;  1CSJ A;  1SC6 A;  3UR3 C;  4U6P A;  2X7I A;  2IM0 A;  2MQQ A;  1JLF B;  2PN6 A;  4NA2 A;  5KTQ A;  2NPI A;  1FWL A;  2A10 A;  4JI7 J;  2OPR A;  2QLX A;  4EBC A;  1SJF A;  2J0W A;  4IQM A;  5DZ6 A;  1YRX A;  5CYM A;  5ETS A;  2UXB J;  4NE9 C;  4Y65 A;  2P9G A;  4HL9 A;  1N56 A;  1SJ4 P;  3MR3 A;  4LF1 A;  2V4J A;  3MAA A;  2KN4 A;  4G1I A;  3POT B;  1UVJ A;  1UP1 A;  2CPD A;  1PIE A;  4FNH A;  2EFV A;  1U48 A;  4KHR A;  4NLP A;  3MTJ A;  1IQZ A;  2NUU G;  4X65 F;  3UI3 A;  1UFK A;  4DV7 J;  2OPS B;  4FXV A;  4ZLP A;  4K4Z A;  4KE5 A;  2R3V A;  4H54 A;  1YJV A;  2RKI A;  3BGR B;  3NXZ A;  2FVS A;  3WC0 A;  5ETQ A;  1Q16 B;  2ADC A;  1QTN B;  2FJE B;  2YKO A;  4MJK A;  5GMD A;  2OEL A;  5I42 A;  1OMS A;  2VD3 A;  1MMN A;  1WSV A;  4HR2 A;  1U45 A;  4I67 A;  1J5E J;  3VAG A;  2CNL B;  4KBI A;  2FY1 A;  1XER A;  1TV6 A;  5T7L B;  2QA2 A;  2Q79 A;  3M6V A;  3QAU A;  2FIU A;  5G0R A;  5L46 A;  1NZ8 A;  1U02 A;  5AE2 A;  5ETN A;  2AD9 A;  3DDI A;  1HL6 A;  3CUL A;  1OY8 A;  4F4Z A;  1NSK L;  3NAI A;  2HFO A;  4YB7 A;  3E8O A;  2GMH A;  2VAS A;  3CD0 A;  2DRD A;  2W24 A;  3MEG A;  1FDA A;  3ZZR A;  2WON B;  2HHW A;  1WEX A;  3RG6 A;  1NDC A;  1U6Z A;  2OAU A;  3LUY A;  3EVM A;  1GT8 A;  3H4D A;  4LF6 J;  1GXU A;  2JDJ A;  1ZAW A;  1RAA B;  3AQP A;  3M8Q A;  4QPX A;  3DXS X;  4QJV A;  3GIR A;  2G0I A;  1Y5N B;  2HQF A;  3A3O B;  3HKZ D;  3SZ2 A;  2YWK A;  4P2M A;  4A4J A;  3WDO A;  4ETZ A;  1SKW A;  4KHP F;  3TRG A;  4OYZ A;  2DCL A;  3VHQ A;  4R8U B;  3BF4 A;  1CVJ A;  4IR9 A;  4LFC J;  3OFH A;  3SYZ A;  1LNQ A;  4P75 A;  1HD0 A;  4MIA A;  2F4F A;  1LW0 B;  4IOB A;  1XMB A;  3MHY A;  3CDU A;  2XMU A;  3EYZ A;  5C25 B;  1HWI A;  1H6K X;  7AT1 B;  1LWC B;  1TR0 A;  3DGV A;  2F65 A;  1I5O B;  3A12 A;  3I6P A;  5D78 A;  3ISZ A;  4DPY A;  3FEZ A;  4A8W A;  4I68 A;  3P45 B;  3UN2 A;  3CME S;  4IFV B;  4YB6 A;  2PMZ D;  3H5Y A;  1RTH B;  2DD8 S;  4A46 A;  2DR8 A;  2QL9 B;  5DM7 Q;  4H4O A;  1X4F A;  2BJ8 A;  5IWA J;  3R9L A;  5IV3 A;  2DNN A;  5IS2 A;  2WTF A;  2ZH4 A;  1T7P A;  3MM7 B;  5EN1 A;  1HWK A;  2M0G B;  4C97 A;  3MD3 A;  3I5A A;  5CH7 B;  3UWT A;  5HN0 A;  1VBK A;  3DLH A;  2BEF A;  2HBQ B;  2W9B A;  2VU5 A;  1L3S A;  5HMY A;  1EZZ B;  2WHO A;  5HLF A;  1PBA A;  2LLZ A;  5F3T A;  5DLG A;  1JLA A;  2CIM A;  3TX8 A;  3RRH A;  2UVU A;  3HT3 A;  3FQK A;  1HNV B;  4DPX A;  3SDE A;  3S8S A;  1TVR A;  4CNZ A;  2O1P A;  3CC7 S;  5D4O A;  4FS2 A;  1YQH A;  2VV5 A;  4OX8 A;  2EG2 A;  2QLB B;  4M5D A;  2OP5 A;  3TVY A;  1T02 A;  2IYI A;  1S1W A;  4E98 A;  3C8Y A;  3DLB A;  1UWB A;  2ZD1 B;  3IWN C;  3DM2 B;  4A8X A;  4FS1 A;  2H65 B;  3JQJ A;  3L7U A;  3MUT P;  1Q5V A;  2J8S A;  3M32 B;  3H20 A;  4J9L A;  4ED0 A;  4NA1 A;  3RAM A;  3TAR A;  2KZZ A;  2IVM A;  2UUT A;  3SXL A;  3SI8 A;  3BBF A;  4NRU A;  2RIJ A;  1CS4 A;  1RWW B;  4DLE A;  3JB9 k;  2K1R B;  2DXE A;  3PDN A;  4MKA A;  2ZBI A;  1KQF B;  2QEX S;  3RGI A;  1TFW A;  4OI3 A;  4LSZ B;  5A8R B;  1O5J A;  1U6B A;  2DTJ A;  3M2R B;  5KFC A;  4PUO B;  1FEH A;  4QR1 A;  4ZIV A;  1ZA1 B;  3J80 U;  3QQC D;  3HK2 A;  2BUN A;  3J80 Y;  1RAC B;  4EMD A;  1BE4 A;  2RNE A;  1HBN B;  1PJ6 A;  1LKZ A;  1C4A A;  1S6P B;  4KYZ A;  5D4L A;  3VZH A;  4X4N A;  1YRU A;  5EX0 A;  3OLB A;  3JSM B;  4B3O B;  2YTC A;  1O8B A;  4DV0 F;  1S0N A;  3W60 A;  3J7Y I;  3I82 A;  3N6M A;  1WHV A;  1O6X A;  5CA5 A;  3KDN A;  2V8H A;  1KD1 T;  5KFL A;  3OBI A;  5IM0 B;  1NKE A;  3IN5 A;  4ELV A;  1QTM A;  3MCN A;  5GAE U;  3I5C A;  2XO6 A;  1KEK A;  3KHG A;  3IFE A;  2DNR A;  3SCL E;  4AD6 A;  1JJH A;  2VPZ B;  5CYQ B;  2F3J A;  1YBA A;  2CJA A;  2RD5 C;  1N33 J;  4PWD A;  1RHM B;  5IXU A;  3ILI A;  3MMC A;  5HVG A;  4KQZ A;  4CLK A;  4TY9 A;  3QZ8 A;  3Q23 A;  2Z2M A;  3TJ9 A;  3FDS A;  3GSD A;  3L7O A;  4XDD A;  2R8H A;  2A6O A;  1N6Q A;  4B9M A;  2EG1 A;  3ZTR A;  1VLO A;  4DV5 J;  4DR7 F;  2FTR A;  3IBC B;  5BYQ A;  3FSI A;  5KG0 A;  4DHV A;  2V68 A;  1X9S A;  2P6T A;  4HEA 9;  5LOQ A;  5GAD U;  3IXQ A;  3D9B A;  1CUL B;  3ITH B;  2CA9 A;  1C0T B;  3C16 B;  4ZPC A;  3HVA A;  3G71 S;  3PW7 A;  4B3M J;  4HKQ A;  1D3W A;  2PT0 A;  1WKL A;  1WAC A;  1HQ2 A;  3QBC A;  2GML A;  4TNO A;  4BWM A;  4C2M A;  1F9F A;  5IQ6 A;  2O66 A;  1U2F A;  2X3D A;  3GIK A;  3OFG A;  1L3T A;  2DRB A;  1AZS B;  3BYR A;  1D9A A;  3MF5 A;  1PJ5 A;  4ZP9 A;  3QSY B;  1IKX B;  3GPA A;  4CWB A;  3V6D A;  4JV1 A;  4TU8 A;  1RT1 B;  1XN9 A;  4LSL A;  2EFG A;  3CT9 A;  3ZXW A;  4CLS A;  2Z2Z A;  1J5O B;  5GAE I;  3W5Z A;  3T41 A;  1YVF A;  1A6L A;  4OI4 A;  2AGO A;  1UEU A;  2OJ3 A;  5A76 A;  1C2P A;  1KVJ A;  1LW2 A;  1Y10 A;  2DNY A;  3CED A;  3JSY A;  3K5O A;  4JB8 B;  5B0G A;  2M5Y A;  4WYL A;  1HNZ J;  2I2Y A;  2ROG A;  3VQT A;  1HNI A;  3NGS A;  4F25 A;  3B6B A;  3D6H B;  1WC4 A;  3QGG A;  4I7F B;  2XSJ B;  2WRM A;  3MTK A;  3FBC A;  3PYG A;  5KFT A;  3KYL A;  2ZH5 A;  2HIY A;  1FDN A;  1V3R A;  1ROF A;  2Q1L A;  4JI0 F;  4IQX A;  2ERR A;  3WBZ A;  2R2S A;  2EXU A;  4A8K A;  1BQN B;  2RQM A;  2DNL A;  2G9O A;  4DZD A;  1F0X A;  1M5V C;  2YX1 A;  3RU0 A;  4DPO A;  1SCJ B;  5DJB A;  2AJ0 A;  4OZ3 A;  2XMA A;  4EBD A;  1DRZ A;  4XDC A;  3NY0 A;  1TKD A;  1WC3 A;  1H74 A;  2CJQ A;  3QFH A;  4B3R J;  2NXE A;  3MM9 A;  3THT A;  3AJD A;  2KZM A;  1HLW A;  4K4Y A;  3M1V B;  2YNH B;  3OLA A;  1XK8 A;  4KFB A;  4RW7 B;  2CQB A;  2DVI A;  2OD6 A;  1XMO F;  1IBK F;  3D67 A;  4B02 A;  2Q66 A;  2UXB F;  2DH7 A;  1UMJ A;  4FYV B;  3ETM A;  2IFX A;  2LA4 A;  4ZCK A;  3ENQ A;  3TA0 A;  3W2W A;  1HI0 P;  2POK A;  1UPP A;  1ZM3 A;  3CDW A;  5HO4 A;  3OJS A;  3C6U B;  5JVG Q;  2NZ4 A;  2Y9H A;  3TW0 A;  1LFP A;  1GMW D;  1Q0N A;  1YDL A;  3AOA A;  3KDO A;  1YZ7 A;  2ZIT A;  1QSS A;  1RAJ A;  3ET6 B;  4ZLN A;  5A6W A;  2AX0 A;  1KKH A;  2V8V A;  2V8P A;  4DV2 J;  5IT9 Y;  1WHY A;  1B64 A;  1TL1 A;  1LWF A;  3MM5 A;  4RL1 A;  4QBU A;  2OH2 A;  1S0O A;  3L4B C;  4OYA A;  1Z1Z A;  2F63 A;  3R5C A;  1N5S A;  2GZO A;  3SSR A;  2UP1 A;  2E5H A;  2FHK A;  4B3T F;  1OSD A;  3VZI A;  1HNZ F;  2HFN A;  5ETT A;  4PG5 A;  1TAU A;  2DGQ A;  2RIL A;  3FSY A;  1TKZ A;  5ETR A;  1C1C B;  2HLU A;  2VFV A;  2H4Y B;  4L74 A;  3KNA A;  4O23 A;  2J9D A;  4USH A;  4F02 A;  1PAE X;  2ZVI A;  3JXO A;  1K1Q A;  1MRO B;  4RO0 A;  1NH8 A;  1EAY C;  5LMN J;  5LM7 E;  1REG X;  9ATC B;  2XGQ A;  5J2N A;  4OI1 A;  1TKZ B;  4TKT A;  3GFY A;  2CQ1 A;  3UDV A;  3T1H F;  1RQ0 A;  4OI6 A;  2OSQ A;  2OKQ A;  1S6Q B;  2RDI A;  3EGW B;  4NCB A;  3N0V A;  4QIG A;  2EFO A;  3K8V A;  4QWC A;  4HI1 A;  3CPW R;  1TQL A;  1ZS6 A;  1ZM4 A;  4NLS A;  4PG6 A;  3GCX P;  4RNH A;  1ZAX A;  3FUY A;  3CD6 S;  1FRH A;  1MN7 A;  2WVB A;  3ZZT A;  5KFI A;  4CO3 A;  1H2U X;  2NYH A;  3VV2 B;  1N32 J;  2DCU B;  2YXL A;  3SQO P;  1CJT A;  3D68 A;  5JVH Q;  3TUZ C;  1D09 B;  3V5R A;  3PO4 A;  1M5P C;  2XSF A;  2YH1 A;  4RW6 A;  3CJ0 A;  4ZLJ A;  5GMK a;  5E0O A;  5HK4 A;  5KT3 A;  2GCF A;  2UUC J;  1F3V A;  1NZA A;  1S48 A;  1WKK A;  2IYG A;  4UQT A;  4RNF A;  2XQC A;  1CJT B;  4WFB Q;  3R2D J;  2HRT A;  3DHW C;  4CCH A;  3UDC A;  3NS5 A;  2CWX A;  1QE1 B;  2Y1R I;  3M9O B;  2E66 A;  3G8Q A;  2NRE A;  2XUL A;  2VKZ G;  1CJV B;  3QWP A;  2KTQ A;  3QT8 A;  3UCG A;  4AQY J;  2R4F A;  1R7I A;  1S9E A;  3HZG A;  4WIQ A;  2K3K A;  2MKK A;  3KK3 A;  1H7X A;  2IJR A;  5CZX A;  5DG7 A;  3D3C J;  5C42 B;  2R8G A;  1ITP A;  4M5N A;  3GLJ A;  3GCW P;  3MR7 A;  4P74 A;  4R5P A;  4P7V A;  1PYS B;  1X8D A;  3W8P A;  3QRP A;  4USW A;  4PCQ A;  3LAM A;  4TY8 A;  3FRY A;  3UVJ B;  4LBH A;  3Q86 A;  4WFX A;  1FJG F;  3FK4 A;  5ETM A;  3N6L A;  4J9N A;  1S97 A;  2Z57 B;  4NYP A;  3U7J A;  2J7K A;  5KG6 A;  4YR2 A;  2HHU A;  4B3R F;  2QG9 B;  3BGO P;  1TAQ A;  1RT7 B;  5KG1 A;  1U0H B;  2YKN A;  4JV0 A;  4KV8 A;  1SKR A;  3LP0 A;  1ELO A;  4ECZ A;  2KVQ E;  3M8W A;  3SQG B;  3P6Y C;  4JI4 J;  1FJ7 A;  2HRU A;  3CJ5 A;  1PJ7 A;  4DCO B;  9RUB A;  4I0W A;  4I6Y A;  2HQG A;  2YKP A;  2CXE A;  3V6K A;  1L3V A;  2G2Z A;  3B82 A;  5HMZ A;  5LJ5 Y;  1T3N A;  3IG1 B;  8ATC B;  2E1P A;  3NCR A;  1HPZ A;  1NBE B;  1S1U A;  2MEW A;  3B8H A;  1TL1 B;  1P27 B;  3QLH B;  4MKV A;  4J9S A;  1ZAV A;  3V6J A;  3MR5 A;  2LU2 A;  3HVT B;  2I6W A;  4CYU A;  3GP9 A;  1U49 A;  3MMB B;  1WEY A;  1FFG B;  3JSB A;  2GHW A;  4GRS A;  1FNM A;  1GTH A;  4QIW D;  1JB0 C;  5HQ8 A;  1RT1 A;  4LSL B;  3SQG A;  3QZ7 A;  1SQF A;  4K5S A;  4RWW A;  4KY3 A;  1IM6 A;  1WDT A;  2E29 A;  1DZ5 A;  3DHX A;  3R6G B;  1G1X A;  1IBC B;  1OQ3 A;  3C6U A;  3OTC A;  2HHV A;  5F9N A;  4IUF A;  3NGT A;  2CQH A;  1RXO B;  3R5B A;  3GE9 A;  1SC4 B;  2QTW A;  4K4X A;  4ZPD A;  1YJR A;  3W7B A;  3W66 A;  3LAN A;  1YIT S;  1H2T Z;  3GIM A;  1UW9 A;  3UNY A;  1URR A;  3FBF A;  3C15 A;  3KLF A;  1SH3 A;  3OTE A;  1Z2L A;  4YP3 A;  1BMQ B;  1VFJ A;  4ERD A;  4R5P B;  4WP8 A;  3PTW A;  4X64 F;  2XI2 A;  4Z7C A;  3PYD A;  5KFR A;  4DV5 F;  2ZUG A;  2K7J A;  3ISN C;  4DV0 J;  4KT0 C;  3R1L A;  4JI1 F;  2HNY A;  1LFW A;  2ROP A;  2VOP A;  2OTJ S;  4Y34 A;  1Y5L B;  3O1L A;  2RRB A;  1Q86 T;  2MPU A;  5LSO A;  2YVS A;  3J7Y U;  2VIH A;  1FER A;  4C8M A;  4C8Z A;  1U47 A;  3M2U A;  4F4W A;  1X9M A;  1UA0 A;  2B9W A;  4RW6 B;  2E9R X;  5SUH A;  1IKY B;  1SUQ A;  2HNZ B;  3CJT A;  5E3Q A;  1XBW A;  3BKF A;  1RWN B;  4WK3 A;  2QC3 A;  2WVC A;  1V5V A;  2B9Y A;  1H7W A;  1RJJ A;  2V2Q A;  3C66 A;  3R5G A;  5GAH I;  1VIX A;  3BSC A;  4OX7 A;  4OZ5 A;  2HVZ A;  4ZCM A;  3I9Z A;  1KHV A;  1IUJ A;  2ZVS A;  4NEY A;  5KFJ A;  2KXN B;  3VAL A;  3SV4 A;  1K0V A;  1F5B A;  4DR5 J;  2QJ3 A;  2MZQ A;  2UVV A;  1RKI A;  1U2C A;  1KVK A;  2IDE A;  3FCH A;  4KGK A;  1L5U A;  3PX6 A;  2W4P A;  1HI8 A;  4MAK A;  3KLG B;  4P2X A;  1S6Q A;  5IOL A;  4LF5 F;  3VAF A;  3C46 A;  1HBN A;  1N88 A;  4OYI A;  3CXC R;  2IRY A;  4H4K C;  1LWE B;  2CWK A;  4LRF A;  1DQA A;  1S4F A;  2QV6 A;  1FFW B;  2DR6 A;  3DU5 A;  4A47 A;  1AZS A;  3JAM Y;  4X65 J;  3WC2 A;  3ZNJ 1;  4JI8 F;  4QU7 A;  2UXD J;  4BCA A;  3HT0 A;  2XS5 A;  3PEJ A;  1KR4 A;  1VCT A;  1JNZ B; 
#chains in the Genus database with same CATH homology
 1WJ9 A;  2Y8Y A;  3QRR A;  4DZD A;  4QYZ K;  5CD4 A;  5H9F K;  3QRP A;  2Y9H A;  2Y8W A;  4U7U D;  3QRQ A;  5H9E K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...