2CPHA

Solution structure of the c-terminal rna recognition motif of hypothetical rna-binding protein rbm19
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
107
structure length
107
Chain Sequence
GSSGSSGQVPKKQTTSKILVRNIPFQANQREIRELFSTFGELKTVRLPKKMTGTGAHRGFGFVDFITKQDAKKAFNALCHSTHLYGRRLVLEWADSEVTVQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the C-terminal RNA recognition motif of hypothetical RNA-binding protein RBM19
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords RNA binding motif protein 19
total genus 11
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cphA01
4FXWA 3B4DA 1FHTA 2RQ4A 3UCGA 1M90T 2LEBA 3R1HA 2L41A 3ZZYA 5IM0B 2E44A 2A3JA 3CCMS 1F9FA 1H2TZ 4ERDA 4C4WA 3K0JA 4WCEQ 4TU8A 1M5PC 2DNLA 3VF0B 2M8HA 1M5VC 2OIHA 3FEYB 2MQMA 1VC6A 2E5JA 1FJCA 2LYVA 1K8AT 2CQ2A 2RRAA 1SXLA 2GHPA 4YUDA 3CCSS 1KQSR 1WEYA 2EVZA 3NMRA 2HGNA 2DB1A 1WI8A 1WELA 2M7SA 1U1LA 1QVGR 4U67Q 4ED5A 4QPTA 2QA4S 3VAFA 5DM6Q 2M4MA 2HZCA 5MLCV 3CC7S 5HL7Q 1H6KX 1UAWA 1N8RT 1VQ4S 2RNEA 2MQQA 5LJ3Y 1NO8A 3VAJA 4PR6A 2KVIA 5CA5A 1UP1A 4RU2A 2KU7A 2MHNA 2X1BA 2RUGA 2M2BA 1W2BR 2DGSA 2ZJQQ 3MUMP 2GO9A 1WHWA 2MB0B 2E5GA 1WEXA 2CQPA 2F9JA 1YJNS 3SDEB 4F02A 1YITS 2U2FA 3G8SA 3P49B 2CPHA 2DNZA 4WIIA 1YJ9S 2MQLA 2KXNB 2MSSA 3I56S 3UCUP 1VQ7S 3EX7B 4WF9Q 5D78A 5IFMA 2CQ4A 1RK8A 4LMZA 1YIJS 1SJRA 2DNYA 4WFBQ 1KC8T 1N88A 2AYGA 2BOPA 1VQLS 1O0PA 5GMKa 2MQPA 3H2UB 4ZKAA 3UD4P 1UW4A 2VONA 2KFYA 1ZZFA 2KG1A 1U1QA 2DNOA 1A9NB 1VBYA 3PIPQ 3SXLA 2MKHA 1P27B 2CQBA 4YOEA 2RS8A 1WI6A 3PIOQ 2KT5A 2VOOA 3RW6A 2LXUA 3U1LA 2DNRA 2DHAA 2J0SD 1U6FA 2JVOA 1DRZA 1DZ5A 2J8AA 2X1FA 2JX2A 2KRBA 4QU7A 2ZJPQ 2DO0A 3G71S 2DNPA 3G4SS 2HYIB 2DH8A 3CMAS 2CQ0A 1WHYA 3NS6A 2KH9A 2K8GA 1DBDA 1UFWA 1X4CA 3Q2SC 2CQGA 2MGZB 3G9CA 2MZJA 1X4HA 3BO3A 1X5SA 4Z2XA 1YI2S 5DDOC 3LPYA 2ERRA 2O3DA 2CPJA 3MD1A 5DM7Q 2KM8B 1PO6A 2PEHA 3MI7X 2LA6A 3NS5A 3NNHA 3TP2A 2X1GA 1P1TA 1WHXA 1U1KA 2CPFA 2DIUA 1VQ6S 3UD3P 3VAGA 2XNRA 2KXHA 2OTJS 2CQHA 1HL6A 4OZ1A 2MKKA 2G0CA 2N82B 2J76E 2UP1A 5JVHQ 2EK1A 2MZSA 4IOAQ 2DGVA 2ZJRQ 4W90B 1S72S 2MXYA 1FXLA 1RKJA 4FXVA 2RS2A 2PE8A 1X0FA 1K9MT 2DGTA 3BS9A 3CF5Q 4LIRA 3UCZP 2VODA 2KM8C 2NLWA 1XN9A 2LXIA 3CC4S 3S01A 5H1SV 4F26A 2MKCA 3P5TL 1JMTA 1G2EA 2XS2A 1Q86T 2DH7A 4CH0S 1D8ZA 5HO4A 1KD1T 4IO9Q 1OWXA 3Q2TC 2EK6A 2ADBA 1PGZA 3BO2A 5LSLA 1KOOA 2DIVA 3NNAA 4TLQA 1FJEB 3UE2A 1AUDA 2E5HA 2N7CA 2VOPA 3LQVA 3DLLQ 4OZ0A 2FY1A 1OPIA 1WF1A 2JWNA 3CUNA 1X4EA 3VAMA 1X5TA 1YHQS 5DETA 3EGZA 2DGWA 3S8SA 3J7ZT 2LEAA 5LJ5Y 2M0GB 3BEGB 1A7GE 2CQCA 2CPXA 2HVZA 1VBXA 3J7YU 3RW7A 5DDQC 1VQOS 1URNA 2RRBA 4WFNQ 3ZZZA 1SJQA 2QFJA 2KN4A 4CIOA 5GAHU 2BZ2A 3VALA 2DNMA 3BO4A 2DGQA 5ITHA 2D9PA 2OSRA 3CCLS 1U2FA 1VBZA 4UQTA 3THTA 4EGLA 2B0GA 2LECA 1WF0A 2I2YA 1VC0A 3G8TA 1U1RA 5IQQA 3ULHA 3L3CA 2MJUA 4YB1P 1QVFR 1R8PA 4CQ1A 1H2VZ 2AYBA 1FNXH 3MUTP 2AYMA 2MQNA 1VQMS 2ADCA 1YTYA 1K73T 1R8HA 2CPYA 1H2UX 2KRRA 2MJNA 2L9WA 2Q79A 3R1LA 2RQCA 2SXLA 3FEXB 1YJWS 1WG5A 2MY7A 1SJ3P 2L08A 1M5OC 2MZQA 2OSQA 3D2WA 3CPWR 2M52A 2JRSA 4Y0FA 3CCQS 2DNNA 2KI2A 3CCES 5CXTA 3US5A 1VQPS 2DGXA 2LKZA 5DDPC 1ZH5A 2V94A 2KHCA 5GAEU 1D9AA 5LSOA 4W92B 3B4MA 1VC5A 2MKJA 2DNGA 1VQ9S 3VAKA 1IQTA 2DNHA 1WWHA 2M70A 3MDFA 3DXBA 1L3KA 4IUFA 2YKAA 3MOJB 1NJIT 2XNQA 4P6QA 3I55S 1Q81T 1X5PA 2FC8A 5JVGQ 3N9UC 1M5KC 1WEZA 4UY8T 3HI9A 2DGUA 3S6EA 1FT8A 2DGOA 2N3LA 1WTBA 1U1MA 4BS2A 2MZTA 2MZ1A 2K3KA 2KYXA 1X5OA 3V4MA 3NNCA 4LJMA 4IOCQ 1X4AA 2KG0A 1Q82T 4F25A 4CH1A 3IWNC 1HD1A 2OTLS 1U6BA 1JJ2R 4PKDB 2U1AA 1VQNS 2XSFA 2YTCA 1FO1A 2D9OA 2HGMA 2XS5A 2MY8A 4QQBA 1S79A 1SJ4P 4TU9A 3P6YC 1ZZNA 2AYEA 2DHXA 2DH9A 2DNKA 2MYFA 2MQOA 2M9KA 2RU3A 1N52B 2RT3A 2MZRA 3CULA 1WG4A 3U1MA 1CVJA 1X4GA 2QEXS 4J5OA 2JVRA 2F9DA 5LXYA 2YH0A 2X1AA 2XS7A 3CCUS 3MUVP 2MPUA 2XB2D 2DISA 1WF2A 2G1DA 3H2VE 2J0QD 2DITA 3SDEA 5GADU 5BJRA 3UWTA 1SJFA 2CPEA 2CPZA 4WFAQ 4Y00A 4M5DB 5GVQA 1JJHA 1HD0A 3CXCR 1U1OA 1QM9A 1VQKS 1BY9A 3G6ES 2MMYA 4WKRA 2CQ3A 2CPDA 1VQ5S 2MKIA 2MGZA 3CD6S 2FHOB 3CTRA 2OJ3A 3CC2S 3THPA 5LXRA 3TYTA 2NZ4A 3SMZA 2CPIA 2E5IA 1VQ8S 4A8XA 1NU4A 2HGLA 2LA4A 1M1KT 1X4BA 1DHMA 3R27A 3S7RA 3TO8A 4TU7A 3MXHP 3HHNB 3MD3A 2WBRA 1Q7YT 5D77A 1OIAA 2CJKA 3JB9k 3CCRS 1N54B 2I38A 5CYJA 5EN1A 1OO0B 5DDRC 1B7FA 2MSTA 3CMES 2YWKA 1X4DA 2M8DB 2DHSA 4C7QA 3CCVS 2N3OA 2DNQA 2DK2A 3CCJS 1HA1A 2AD9A 1WHVA 2CQIA 1FJ7A 1KOHA 5IM0A 4V19X 2M88A 4QU6A 2F3JA 2YH1A 1U1PA 2DO4A 5GAGU 2G4BA 4C0OC 2LQ5A 3VAIA 3OW2R 5FJ4A 2CQDA 1JJ4A 3G96A 2FC9A 2LMIA 1YWXA 2DHGA 3P3DA 2LCWA 3MURP 2RVJA 1X4FA 3VAHA 4PRFA 3EGNA 2CQ1A 2FPHX 1U1NA 1WG1A 2MKSA 2KXFA 3IRWP 2D3OR
chains in the Genus database with same CATH superfamily
4R8UB 3ONQA 4ZK7M 4ECVA 1XMQJ 1YSJA 1WC5A 1EETA 3B4DA 1PYSB 2OEMA 4B9UA 3UCGA 3DLJA 1UL3A 3EZUA 3OFHA 1FA0A 3N6LA 4N5SA 4KHMA 4ECZA 1RWWB 4KV8A 4OZ3A 3PRVA 4PG8A 3BJYA 1QE1A 5J2NA 3PJ9A 1BMQB 2ZVIA 1WNEA 1RTDA 3K0JA 1HYSB 5J2MB 3R2DJ 2C3YA 1PYOB 1Q95G 3VF0B 2W9CA 4RW9B 2IJNA 3CJKA 3ET6B 3AXMA 3KLFA 2HQIA 1EP4B 3PVXA 4B3MF 2MQMA 4URQU 4JI5J 4LF1A 1DQAA 4DI6A 2YY3A 2W2NP 2R7UA 4Q0BB 1FI4A 4UY85 6FDRA 5KFPA 4ER8A 2YWFA 2CQ2A 4KBIA 4GRSA 2YPYA 1KDNA 4L75A 5HMYA 3KDOA 3OXGA 4TLRA 2WW8A 3MM5B 3GILA 3HCXA 3NGTA 3CDWA 1IBKJ 2GHPA 4YUDA 5RUBA 3ZZPA 2OI2A 1WEYA 3CCSS 2HZVA 3HHDA 2Q43A 3PYEA 1OMSA 5ETKA 3KJVB 2ZEJA 2B56A 3C14B 2MTLA 5I3UA 1QVGR 1C1CB 4DSLA 2OP5A 3CCZA 3BM7A 1KD1T 3V6JA 2IHR1 1O5JA 1UVIA 3LAMA 5HBMB 3MFIA 2M4MA 2HZCA 4ZP7A 1TVRA 1RTJB 5EUHA 5KFOA 1H6KX 3HX9A 3TUIC 1EARA 1MMNA 4WIQA 2JEJA 3HVWA 3LGMA 3I0RA 3I82A 3VAJA 3NG8A 4KYZA 1HPZA 1HR0J 2KVIA 5GAHI 1FKPB 3GFYA 4E98A 4DJBA 1TAUA 3B54A 3PW7A 1P9YA 1HNZF 4RU2A 3R5GA 4R5PB 5AXNA 2RF2A 2Y1JA 1C0TA 3D9BA 1W2BR 2DGSA 3BH6B 4KQZA 5KT6A 2ZJQQ 1UWBB 4X65F 3MUMP 1J5EJ 2DY1A 3FCHA 4PG5A 2IIHA 1WEXA 2GV1A 3KHRA 1QSLA 4B3OA 3G8QA 2AJ0A 4HDGA 1N6QA 1YITS 2U2FA 3IWLA 2CPHA 4U95A 3K7RA 2UUBF 2MQLA 3VVTA 1MNEA 3KWMA 4EO6A 2W7OA 3RRGA 4DLEA 2R7TA 3HD1A 5B7WA 1YZ7A 4N76A 3T1YF 1MW7A 3I56S 3UCUP 5KAKA 1OQ3A 3A12A 1VQ7S 4NCGA 4WU2A 4XDCA 2Y9HA 4ZCKA 3EX7B 2AZ1A 2WCXA 4EYIB 5SZTA 4WF9Q 2R8IA 2BJ7A 3O5TB 1YIJS 3ZO7A 3ETOA 3PXGa 4X62J 4WFBQ 5B0FA 2HQGA 1MMLA 3MEDA 3AB4B 3CJTA 3DOMB 4HACA 4WFXA 5GMKa 1MSWD 4F7VA 4FN5A 2H4WB 4YS2A 3SEOA 4RNNA 2UUCF 2QA2A 2VG7A 1GQEA 4CT9A 1HQUA 3OPKA 4ECRA 3UD4P 2VONA 1ZZFA 1XNQF 1HBMB 1R31A 1CJUA 2V8HA 3FUYA 5KG0A 3IP0A 2ALZA 1U1QA 1GMWA 4ZPDA 3E01B 1T7PA 2G2YA 3FSXA 1FCAA 1DTTB 1P27B 4A8SA 4X4VA 4IH7A 2VG6A 5HATA 4TKTA 1RXOB 4DV3F 4FPRA 5H9EK 4LFCJ 3Q83A 1T11A 5KFMA 3NGUA 2O01C 1IBLJ 2DNRA 2XY7A 5IV3A 2BOAA 1U6FA 2JVOA 2ASLA 4R25A 2PI5A 2J8AA 5KFRA 1O8BA 2HAFA 4WE1A 2XLKA 4C8MA 3E2EA 1C0TB 2KRBA 4NOHA 3LW5C 4UOHA 5CYQB 3W62A 4DUZJ 2HQFA 4CT8A 3Q8YA 4JUZA 2HQDA 2Z2LA 1UPMB 2DH8A 3DRRB 5GAEI 5HQMA 4X4UA 1H74A 2DPIA 2MDAA 1IWGA 3L7OA 1WHYA 2XMTA 2C3MA 2CIMA 4KB7A 4NLOA 4GKKF 4LBIA 2KH9A 1DBDA 2YWHA 3QZ8A 4N77A 5J2QA 4IYQA 2HHWA 2BJ3A 3OTBA 2CQGA 3RBDA 2R3VA 1LWFB 4DPOA 4WK1A 1NK4A 1TV6A 1T9XA 4Z2XA 3T5KA 2AEMA 2HHHJ 1VLOA 2NXEA 1E6VB 1S97A 1HBNB 2FVPA 2GNKA 2CPJA 1FJGF 1VRTB 4U8YA 1ROFA 3D6FB 3M8PA 4ECYA 1HBUA 2XSJA 3QPIA 4D3HA 3HHKA 1RWNB 4NLYA 2PEHA 5E7OB 1IJFB 3TJAA 2LA6A 5L39A 1N34F 2BKOA 2OHDA 4TXSA 3NNHA 1EKSA 3G87A 4I2PA 3R5BA 1U1KA 3W64A 2DIUA 2JOQA 3TW0A 1OSCA 4NPOA 2HHPA 3UD3P 4OX9J 1IR1A 2KXHA 2ZZTA 2CVEA 1MROA 3R3TA 2VFUA 4DBQA 2G0CA 2MKKA 4KR0B 2E66A 5E0OA 3LH2S 4ZVFA 4EU0A 2N82B 4YP3A 2O1PA 1PYTA 3POTA 3K59A 3Q89A 4DDFA 3M32A 4F4WA 2VA3A 2QYGA 3VQTA 1D0EA 4IOAQ 2ZBQA 3M8WA 1F5AA 2W1BA 3TZXA 1RTDB 1SCJB 4W90B 4LFBF 1Q79A 5L9NA 3HK2A 2G0JA 4FXVA 2RS2A 1XERA 2PE8A 2FB0A 1X0FA 1LW0B 2BMBA 3DLKA 2NUUG 3BS9A 3OTOJ 3LGNA 5A8RB 3QAUA 5CAAA 3UCZP 2ATLA 5IOLA 1S7HA 2WRMA 3CC4S 4O3RA 4R8UA 4FBUA 1DFDA 1NPRA 2VICA 4LIWA 4NLRA 4LFAJ 4CWBA 2QE5A 5D0EA 3TA2A 3W2WB 2DH7A 2XS2A 3A1YG 2ZUAA 3D0HE 3NOGA 3U27A 3UR3C 1DQ9A 1ZPVA 5HO4A 2XGPA 1QTNB 2W9BB 4TQSA 4J9SA 2EFOA 2GGPB 2HLTA 2RE1A 3QNWB 5BYQA 3OHAA 2YNIA 1ZTWA 2BEFA 3A3NB 3CCWA 4DPYA 5D6GA 4AL6A 1PGZA 3W65A 1WC0A 1IBMJ 1TUGB 2EKNA 1UTAA 2ZH9A 3BO2A 2NREA 2I1RA 3M32B 1ZAXA 1HQEA 4CLYA 2WONA 3NNAA 4ICLB 4TLQA 4CLZA 2ASJA 1FJEB 1CPZA 4NLTA 1AUDA 2J9DA 4W4MA 1JB0C 1MU2A 2QX0A 3H5XA 4LREA 2AZ3A 1C0UA 2FZKB 4DWIA 4USWA 4PQUA 1HYSA 2PMWA 4RUBA 4X65J 2H48B 2UXBJ 2WZ1A 4NYPA 3TVZA 3V4IB 1SUQA 3M05A 2YKPA 3VAMA 2V0NA 5KG5A 1UWBA 2FJAB 1X5TA 5DETA 1N5QA 4HLBA 3J7ZT 1RHKB 2D3ZA 1JLBB 1VIXA 3CDEA 3NLCA 2LEAA 4FZVA 5JMNA 3EPGA 2ZOMA 2UUTA 1RTZA 5CCLA 3KK3A 2VB6A 1U0SA 3T19A 4IRDA 3D3CJ 4CM0A 2CPXA 1UJ5A 3M2UA 3KLHA 5CYMA 1FRKA 4DSJA 1YKWA 5DDQC 3VCDA 1R27B 1URNA 4B3SF 1Y7PA 3KNGA 4X66F 2CXEA 2GHVC 5EN1A 4DF4A 2QFJA 1IM4A 3QFHA 1HNWF 4YMEA 3VALA 3CW2C 1D3WA 1GXTA 4DX5A 1FE4A 1S12A 3KLHB 2G0IA 2WB4A 3CNQP 1AROP 4OFZA 3LWLA 2H5JB 2OPPA 3TAMA 1RT7B 2JEIA 4KAIA 1EJ7L 1T9UA 1SQGA 2WB1D 2Y1LB 4EBCA 4UQTA 4FF2A 4L6V3 4C8LA 2LECA 3B78A 3LP1A 3ZTQA 1WC4A 1GX5A 2B9EA 1HQEB 2AU0A 1RI7A 3PFEA 2V69A 3ILLA 5A2QY 5IWAJ 4JI3F 1TL7B 4ELUA 4FBTA 2ACMA 1U1RA 2Y0SD 1BWVA 1FXRA 4JP8A 1RUSA 3IR6B 3L3CA 4DR4J 2CZ9A 1KONA 2QYCA 1OSDA 4Q43A 4PXDA 1PC4A 3W2WA 1N5YA 1QVFR 1NKCA 1TZ0A 3KHLA 2JDJA 4YDXA 4P73A 4CYUB 2HIQA 2R2RA 4IG0A 1T3NA 1K73T 3W5ZA 3R5AA 4PXCA 4ILLA 3TJ9A 5KFQA 2IMOA 1WUUA 4P2MA 3SV3A 4FVCA 4G1PA 1AYEA 2V9KA 1RWUA 2KRRA 4EFAC 2P6TA 4PQAA 1H3DA 1IKYB 2L9WA 2Q79A 1N5SA 3DRPB 5L1KA 3D54A 5HANA 3IR7B 4RPFA 4NE9C 1CSJA 2SXLA 4AXJA 2JC1A 5K20B 2RQCA 1VBYA 5ETQA 2BJ8A 5IT4A 1GH8A 7AT1B 2Z8QA 2DTJA 2L08A 1RT4A 2IRUA 3NGKA 3UPFA 1SJ3P 4WP9A 5DG7A 2OSQA 2APOA 3D2WA 1PBUA 2D3OR 4DR1F 4AFFA 1Z1ZA 4DOZA 1IKWB 4C11A 2OFHX 4O3OA 3HFVA 1RQ0A 3FBCA 5KFTA 1N0VC 2BABA 1N34J 5CXTA 4QJVA 2DGXA 2IM2A 2F7VA 4ED3A 1U48A 1B0TA 2CRLA 1N48A 2DPJA 2V94A 1ZH5A 3JYTB 3KNAA 4LFCF 1K0TA 3DI6B 4JI8F 3OVSA 3V5RA 1RAEB 1SL1A 4GC6A 5H9FK 3VAKA 1S9FA 2KZMA 1N0UA 1TL5A 3PG9A 5HBMA 3KUGA 4DCJB 9RUBA 1VRTA 2HQCA 3P4UB 1RAHB 2GIQA 4RW4B 3NKYA 4O3QA 1TKZA 5F8IA 3BQ0A 1HHSA 1NSPA 3D0GE 3GIIA 3P8BB 3DM2B 2LDYA 3TVKA 1NJIT 2XNQA 1GXLA 3CJQA 4PABA 1CBKA 1X5PA 5JVGQ 3TZZA 1O51A 2LQBA 2GAHC 4FF4A 3UDLA 3IR5B 4UY8T 3HDSA 1HKAA 3KJFB 4HT7A 2IVMA 1D8YA 2ZM6J 2PFFB 4N41A 2N3LA 3LO3A 1U1MA 4ZVGA 1S5ZA 1HIYA 1OYEA 2WSCC 1U0HB 2B4UA 1VISA 2DR7A 1X5OA 3OLAA 1EKRA 1BHNA 1NPKA 2I5JB 4EEYA 1LK7A 2CNOB 1V3RA 3QJPA 1NRKA 2KG0A 2XHCA 1VCTA 1NHUA 3X3UA 1T9TA 3A8KA 5LMNJ 3JTPA 1U6BA 2QSFA 2V34A 1JLBA 4FDFA 1JJ2R 2U1AA 2QL9B 3HP6A 3FBBA 1RJJA 1RTHA 2MY8A 1NMEB 3GV5B 1HNZJ 2FJWA 2QLBB 2WK4A 4A8YA 2PFDA 5B0CA 4U7CA 3M9NB 1ZZNA 1A6LA 1MMDA 2AYEA 2OPSB 3DRXA 4DR7F 2MYFA 4PQUB 5M2UA 3C6TA 1RU1A 2MQOA 2C2NA 2M9KA 3HLUA 1H0HB 2XYGB 2MZRA 2V5HG 2I9SA 3MPWA 5D15A 3KLVA 4ED2A 1Z2ZA 3QT6A 1HQUB 4MT1A 4K59A 2MLXA 1S0MA 5KFGA 5J2PA 2ATCB 1TFWA 4GVLA 1RLCL 2HNYB 3M9OB 3DMJA 5IT0A 1TMJA 5KOWA 4N56A 3BYPA 4K4YA 2HZAA 3VZIA 3OL6A 4B9VA 2X1AA 2W8LA 4OI6A 2ZBIA 2YNGA 4ECSA 2HAIA 4DV6F 4MYUA 4DV2J 2NUHA 2VKRA 1LW2A 1YBAA 4N8NA 2DISA 4F4XA 2VKZG 1UW9A 1S9EA 4RW6A 1FD2A 1MWZA 1Q8BA 4F50A 3SFUA 2DITA 1T03A 1PG5B 2V2QA 3OT9A 3UWTA 3KLIB 3ZNJ1 2WOMB 1UWAA 2V67A 4ES2A 4ID5B 4JV1A 1U8SA 5D0RA 2D7SA 1TFYA 3HSDA 4BLGA 2CPEA 2CPZA 3ILJA 5BR8J 4WFAQ 1TKXB 3QGIA 3BGLA 1HD0A 2HURA 4OI3A 1RSCA 3MR3A 3CJ0A 3NY0A 3QATA 3ZZRA 1REVA 3V6KA 1QM9A 1JXLA 4U7UK 2B8PA 5K5MA 4ZIVA 2E1MC 2VDHA 2OMOA 1JKHA 1H7WA 2AWZA 2HFUA 3G6ES 2CPDA 4DV5F 1VQ5S 4H4OA 2Q6CA 4PZVA 3MM6B 1N33F 2OJ3A 4E0DA 2FYXA 3H4BA 1C1CA 2XZDB 2BRLA 4XAKA 4G1QB 3PRBA 1XNRF 4NI2B 5HSPA 3SMZA 2CPIA 3HHLA 1RT6A 3M8RA 3CULA 1HPZB 2D69A 4A8XA 4LUBA 3UI3A 2LA4A 4FYYB 1M1KT 3WIUA 4HVZA 3R27A 3EXYA 2ZDOA 2ZWOA 4GKKJ 2ZH7A 3BGOP 5D77A 2C1EB 1J5OB 4JYAJ 1CG2A 3CCRS 1Q78A 5CYJA 2ZNZA 2VQEF 1YRTA 2O5DA 4CLSA 3T5JA 1CEZA 1X4DA 2M8DB 2IRYA 2DHSA 3H42A 4RBTA 5KFCA 2ROEA 3JYTA 3QIDA 4DV4F 2FJVA 2V6AA 2N3OA 2ACYA 2C2ZB 3PO4A 2DK2A 3DI6A 4OI2A 3GJQB 4O44A 2VL1A 2QZ8A 4YDDB 4ZITA 5I42A 3EWGA 2Z57B 3CD7A 3GIMA 3JSMA 3I5BA 3M30A 1NKEA 3JAMY 4NRTA 1CJTA 2C3PA 2QLXA 3FZBA 3AFGA 5E3PA 4DL0C 3QSIA 2HHXA 3QGPA 5U47A 2ZOGA 4S0MA 4V1Ak 4C0OC 2NZCA 3I9ZA 4LSZB 2D41A 4X4OA 2R2SA 1QAIA 4IQMA 2IMWP 1R0AB 5L9XA 2F40A 3H5SA 4ZJOA 2UU9F 2JLGA 2VBWA 3MECA 2FVQA 1TL3A 2DY9A 3OHBA 2B9YA 2YQ1A 4UQGA 3IFEA 1KP6A 2LCWA 4HI2A 1IKYA 3DRPA 3OV7A 2RVJA 3K5NA 3PO5A 2Z2MA 2NR0A 3TOQA 3VAHA 4M5MA 2RDDA 1HBMA 3PW2A 1V3ZA 2IC3B 1U1NA 1SIWB 2GQ2A 1SKSA 2PC6A 3AT1B 4FXWA 2FJEB 4TYAA 2VJUA 2O67A 1OS5A 4HHJA 4OHZA 2XO6A 3Q8VA 4ECQA 1EIYB 2MLYA 3AOCA 3KYLA 1FHTA 2NYIA 3AH6A 1PJ6A 1YRUA 3OR1A 4OYMA 5CZVA 4ECWA 3R1HA 4B9TA 2FD2A 3ENQA 4TY8A 4C6AA 2A3JA 3CCMS 5KFYA 2R7OA 2H1YA 1TKTA 1S0OA 1UZDA 3VTIA 2J0XA 5HLFA 2DR5A 4LF5J 4TU8A 4OYWA 4RUHA 3QZ7A 1WORA 2DNLA 1IKXB 2V4JA 2IDLA 4FS1A 3LGHA 4JB8B 2VV5A 2R2TA 1N32J 3T6JA 4R0EA 4DQIA 2A18A 3KLGB 3A8EA 2OIHA 5D8HB 2HVDA 4I69A 4USIA 5E3AA 2B3TB 2E5JA 1VC6A 1L3VA 1WC1A 2ROGA 4GVBB 1XWLA 1U8WA 3PACA 4XO0A 1XC9A 5KG7A 1N6QB 2IBOA 1K8AT 2K7JA 2L9NA 3Q0AA 4KSEB 1UCNA 2HEKA 2NXNA 4IG3A 4KO0A 4FF3A 2K06A 3ADAC 5T7LB 3IRXB 1RLDA 1W2IA 3MCNA 4MMOA 1XQIA 2PI4A 3EVWA 1U09A 4C8NA 2AV5A 4U9RA 2HGNA 2P9GA 2YKMB 1WI8A 1WELA 2M7SA 2RHSB 3DRSB 1U1LA 1UA1A 4EZ6A 3QJJA 7FDRA 2DRDA 4O4RA 3MPVA 4DPXA 3H0PA 5DM6Q 5M2PA 1S10A 4ILRA 3TEGA 2HQ3A 5HL7Q 2CJAA 1JLAB 1NK7A 1N8RT 1D09B 4ILMA 5KFUA 2CWXA 4F2SA 2VF3A 4F36A 1JXEA 2MQQA 3HVTA 5KFNA 1GAOA 2W8KA 2DD8S 5ETOA 4OQJA 4PR6A 2FVCA 5CA5A 1UP1A 3C15A 5KFIA 2ZH1A 4EZ9A 4HTJA 1HFEL 1DY3A 1VI7A 5CYQA 2ZH6A 4DR3J 1SUQB 1NSQA 2ABYA 4AQYJ 4G1IA 4ED8A 4DQSA 3W61A 2GMJA 4A8OA 2GCFA 5LL6d 3K8VA 1WOPA 3E01A 1X7VA 1XMBA 4EBEA 2MB0B 2Z2ZA 1HARA 2F9JA 3IWXA 2UVWA 2EG1A 4TY8B 3W8GA 4K4VA 3CDAA 1TL1B 3H8YA 1YJRA 2E7WA 2B4OA 3BSAA 1UETA 3UN3A 4C8ZA 2DNZA 1C0UB 5A76A 4QR2A 4ZJQA 2I0XA 3CCTA 3NGRA 4PYAA 3RB4A 2F4FA 4DR5J 1YJ9S 1BQNB 3M2RB 2W9CB 5HLFB 1U47A 3RR7A 2MSSA 1J27A 2QSWA 4IFYA 3MEEA 4OYIA 1ZM3A 3WBZA 1F60B 4DV5J 1EAYC 2GA7A 4CM2A 2W2MP 4O0NA 2FQQB 3GJRB 3K5OA 5IFMA 1JLEB 2HNZA 2YNIB 3WX8A 1SJRA 2DNYA 2XCPA 1JX4A 2UUAF 5CZXA 3SZ2A 1KC8T 2BVZA 2AYGA 2BOPA 3WC2A 1TTHB 3DYAB 3W9HA 4O3NA 5EHHA 3T1HJ 3RZAA 1KRPA 1O0PA 2AKWB 3M2VA 3GSDA 2MQPA 2VG5B 1UW4A 2ALYB 1RHJB 4B9NA 2GVDA 2KYZA 3HKWA 5C24A 1Y5IB 4UOFA 4J9PA 1NHKL 3E3XA 1LFPA 2GAGC 1T0TV 5E3QA 2KG1A 1Y5LB 4USTA 5HP1B 2JLFA 2BANB 2PN6A 1PCAA 2FJDB 3HHLD 1Y4ZB 2XTJP 3AOBA 3SQOP 3SXLA 3PIPQ 3JSMB 4NX9A 3PHEA 5JXSA 4RNOA 4RNMA 4LSLA 2HHVA 4KGVB 4IFVB 4YOEA 3PIOQ 3L4BC 4JBCA 3CJ8A 1HNXJ 2CJYB 2GC8A 3D68A 3I0RB 3OVBA 1AZSA 4JI4J 5C5JA 2RKIB 1L3SA 2X1FA 1IBCB 2B8QA 1SC6A 2ZWPA 3L7PA 1I5OB 1JLGA 1MN9A 1S77D 2K1RA 2ZJPQ 4X4PA 2IAJB 2FZCB 2ZD1A 3G71S 3RUBL 1IBKF 1FERA 4B02A 2XM3A 4HH1A 1SBRA 4AXIA 3RYLA 3LAKA 2VQEJ 2QA1A 3TARA 2V8VA 4A8WA 1P9QC 4W98A 4ETXA 3TX8A 1F6TA 2IAJA 3ZTOA 5F9NA 2RSQA 4JI5F 2LU1A 1XIQA 1Y10A 1J5OA 2MGZB 3G9CA 3MEGB 2HNDA 3PCOB 4P75A 1RT7A 1URRA 4OYBA 2OPPB 2CNLB 4ANCA 1M5SA 1Y5NB 3A13A 3LPYA 1FE0A 2EFNA 3MPDA 4QYRA 3W1YC 5AE2A 2UU9J 1K47A 1I94F 3BZQA 1DARA 1X9MA 2Q3PA 4J37A 2KM8B 1REGX 1HNVB 3KK2A 5JUMA 4KHPF 2ZHOA 4FYWB 1REVB 3LA0A 1BXNA 3MI7X 4EI2A 1ZPWX 2P8IA 5AXKA 2Q6BA 5F3TA 2YBVA 2NS1B 4NLPA 1F9HA 4NLSA 1PJ7A 4YR3A 2XNRA 5LT5A 3RU0A 2J76E 4ZLJA 4CTAB 3BBFA 4WTOB 3T5HA 1T03B 1RT4B 2L9DA 4P72A 1S0NA 3TJ8A 4IFVA 3AAWB 4Y2IA 2LFVA 1QE1B 4MKVA 4CLWA 2BJEA 3V81B 1W26A 2DCUB 1GXUA 2BQUA 3EGVA 2MXYA 4DV3J 2OPRA 1M1GA 4KFBB 3MR5A 2J7UA 1YK9A 5FLXU 1RU2A 1WC3A 2DGTA 2CDRB 4P9SA 1SC1B 3OXLA 4X62F 3O2IA 1SI9A 1FX2A 2UV8A 1V5VA 4LIRA 4NLQA 5KFWA 2VODA 2NLWA 1XN9A 2WVFA 3Q8UA 3OL7A 3K5LA 4H4KA 1TMMA 3BBBA 3S01A 1QDUB 4ZVOB 2ZH8A 5L1IA 2GZOA 2MKCA 4I0WA 4RW6B 4IOBA 4F26A 5A6WA 4EMDA 1H38A 4LF5F 2QIFA 3HO1A 1G2EA 4DLGA 4RZRA 2ZHBA 1J2VA 4EK2A 1N5YB 5T14A 4CI0B 5B08A 1DQ8A 1OWXA 3SSSA 3CIZA 5L1JA 3Q2TC 2LEBA 2EK6A 1S1VA 1VIOA 1VK8A 2C3UA 3DLEA 3EGWB 3DMJB 2DYAA 2POKA 3JXOA 4OZJA 5LSLA 3VGVA 2DIVA 4X4SA 2AF6A 2BUNA 3FBEA 4NLDA 2DVIA 3GB0A 4WXOA 3M1VA 2ZVSA 1FRIA 2QMUB 1M5HA 1L3UA 2BYCA 3QRRA 1Y9OA 4K2JA 3FSYA 1GTEA 5BYSA 4X4NA 2NPIA 3C6TB 2LQJA 4OZ0A 4NCAA 1E6YA 3LOUA 5HROA 3MCOA 1UVNA 5AT1B 2B9WA 1NLKL 1CJVA 2VFSA 2Z30B 2YKQA 3MF5A 3DLKB 3MWBA 2CKWA 3DCAA 4DUZF 5AXMA 3O44A 3QYYA 3K5PA 2H54B 3RAXA 1KLNA 4H4KC 3GJTB 3H25A 1YHQS 2DGWA 4K4XA 3TVYA 4ELVA 4KPYA 3THVA 1C2PA 3GFZA 5LJ5Y 1PAUB 3D66A 2DBBA 4CLPA 2M0GB 3W66A 4DCPB 3NL0A 3OJSA 3KTQA 3K89A 4I4BA 4USJC 1A7GE 2HHSA 2CQCA 1KVJA 5GADI 3TX0A 2V8GA 3U7JA 3UR0A 5D4PA 4JV5F 3IBCB 2HVZA 5LMUF 3RW7A 4UUWA 4KKOA 5IV4A 2E1CA 2RRBA 4WFNQ 3ZZZA 1GEHA 1SQEA 4FPIA 4B17A 4CIOA 5GAHU 2DJWA 2HK2A 3DM2A 3PW5A 2CAJA 3W8PA 5ITHA 4DUYJ 3OL9A 1HBNA 4U8VA 2XY6A 3VVUA 1LQ9A 2H51B 3CO0P 3MR2A 3IXQA 5D4NA 3OUYA 1JLGB 4B9LA 2F4VJ 1K0VA 2NSBA 4F0HA 2COLA 3T9NA 4DPTA 3FFIB 3GTYX 5D4LA 4N7TA 4NA3A 3THTA 1NK8A 4Q0BA 1EQ0A 4EGLA 3CIMA 4UT4A 3TEHB 1RWMB 1PBAA 1YG0A 2FVRA 3E51A 2XMWA 1RHUB 3DN9A 1VHFA 1TKTB 2Z2YB 2JEFA 3HJVA 4JI4F 3SCLE 1LWEB 3TA1A 3HF5A 1OQ6A 3FVYA 4OMFG 1CJKB 2MJUA 5J2NB 4WFZA 3ULHA 1Q1KA 2V8DA 4BC7A 3R5DA 4CZCA 2RKIA 2PO4A 2XZTB 1H2VZ 3KG1A 4CQ1A 3B6BA 4OZLA 5HQLA 3MUTP 1T94A 3ELHA 1LXJA 2P9EA 2IA0A 1S9GA 2VG5A 3D1QA 3GPAA 2YQ3A 3UD5A 1OPZA 1VGYA 1RT1A 5FDLA 1DLOB 4O3SA 1U26A 3OTOF 2Y8WA 2VDIA 3D28A 4NEYA 5K8MA 1RBOB 3AD9C 2PIIA 4TQRA 2IYIA 3I9V9 2B9XA 4NYZA 3K2YA 3GG1A 2GVZA 3AY0A 3GFXA 3PJXA 3MECB 8ATCB 3MMAB 3KJQB 1RGVA 2H9ZA 3CMQA 2OO4A 1B7YB 4ZLLA 2M5YA 4M5GA 3FEXB 1YJWS 1HR0F 1WG5A 2XI2A 3WZ0A 5F0UA 1HMVA 5IQ6A 5KFFA 4MK7A 5HVHA 2VIHA 2UXDJ 1CJTB 3F73A 3GYXB 3M7VA 3G6XA 2IM3A 2Z58B 3T9ZA 4A47A 4GC7A 2KDOA 4AL7A 5J1EA 3A3OB 1SC4B 2HS4A 2DNNA 4RUAA 5KT7A 3CCES 1APSA 3BR8A 1KHVA 2WTFA 1VQPS 2LKZA 2R7QA 4QYZJ 3ITHB 3EE3A 3NWGA 2KHCA 4HHUA 2FHJD 1D9AA 2E1AA 2JZ5A 3OR2A 3Q86A 4UOGA 5LSOA 5GAEU 1IKVB 3NP5A 3BSOA 2MKJA 5THWA 4LF6J 1S76D 2DNGA 1VQ9S 4DR6F 4Q7AA 2NXUA 2IPOB 3RRKA 3QFWA 3I6PA 3K57A 2M70A 3Q23A 3MDFA 4QIGA 5A8KA 4B3RF 2JH3A 1L3KA 4Y6IA 2RU9A 4DX6A 5GMEA 1UVMA 1RAFB 3O3LA 3HSJA 5A8WB 2FC8A 2G2ZA 1D1UA 3T1YJ 5E5NA 1WEZA 2J0WA 3PEHA 4J9OA 1WKLA 2DGUA 1K44A 1S7IA 2DGOA 4DV7J 4K4TA 4FNHA 5KT4A 4LF4J 1Q7LB 4ENOA 2HBQB 5K8PA 3IA0A 1SKRA 2QN6B 2K3KA 3DRYA 2KYXA 1ACMB 2JNJA 3M2UB 3RBZA 4KRWA 3BSNA 1QSYA 2Y8YA 1VBKA 4LJMA 4IOCQ 5H9EJ 4C8YA 4EUVA 3FBFA 5M2RA 1FEEA 4CH1A 1HD1A 1KR4A 1IKVA 4K2XA 4LSNB 1RYRA 3ZTRA 2GMHA 1QAXA 2VBZA 3LWMA 3RJMB 9ATCB 3HMJG 2Y0BB 1WACA 5T7LA 4USMA 1T95A 2L48A 4LVNP 4QQBA 1SVDA 4NLWA 1NH7A 3GIKA 1S79A 4P7VA 1FRHA 4NRUA 1SJ4P 1YRXA 3P6YC 4RO0A 1I3OB 2EFQA 3GIRA 4OX8A 3W63A 5IT9U 5IS2A 2F8HA 4DPWA 3TANA 3CSKA 4HDHA 3SBMA 2RU3A 3T1HF 2KT2A 1IM6A 1N52B 4P10A 1XMOF 3KLGA 3GLJA 3DOMA 2EPIA 3LUYA 4HACB 3GIJA 5B0EA 3GFHA 2CJBA 3C8YA 2OPSA 4DPUA 2UUWA 1FNOA 4IRCA 1B4SA 4WP8A 3C16B 4J5OA 3W2VB 3QLHB 2PEBA 4NYOA 5KG4A 4J9KA 2PMZD 5CD4A 2F9DA 2YKNA 1RAGB 3PZPA 3HSZA 4Z7YA 5LXYA 3OL8A 2XS7A 3W3SA 4A4JA 5L38A 4URSA 4NXNF 4Q45A 2Z56B 3ILIA 4LSNA 4CLKA 4KC5A 1RA7A 5KFAA 4KE5A 4DFKA 2XB2D 3DOLA 2G1DA 4CLUA 4X4RA 3IBWA 1RAIB 5DO2A 2BJDA 3MAHA 4CNZA 3N5FA 4OLPA 3MAQA 3SDEA 2J5AA 4DUYF 2DRAA 4J9UE 2W4CA 5BJRA 3AODA 3FCWA 3ICLA 3M30B 2B7CB 2QL5B 3C3LA 5F0WA 4LBPA 2CNKB 5DZ6A 2C22A 1FD8A 2GJIA 2IVYA 4ZLPA 2YX1A 3NMAA 6FD1A 2CJQA 3OD2A 1FKPA 2AX0A 4IDKB 5CH7B 2NSCA 2B4VA 3SSRA 5LOQA 1SH2A 4DV4J 2MMYA 1SH3A 4KH1B 2C2DA 1IXKA 2CQ3A 3P45B 5F8LA 4WKRA 2MGZA 1VR6A 3M6WA 4RBUA 4X64J 1ZM2A 1NEEA 3FQLA 3THPA 1RT3B 4NA1A 3S1TA 2C3OA 4QW9A 2W7AA 1KLMB 4UW2A 2OGUA 2UXCF 2OEKA 1NK6A 2B4PA 3GV8B 1WKKA 3M8PB 2W4PA 1CC7A 2IRXA 1WDTA 2CZVC 2HGLA 3I0SB 3BREA 4NLUA 1X4BA 1DHMA 2XSJB 3MTJA 4LRBA 3MXHP 1F2GA 1Z2LA 1Q5VA 4KY3A 5BXIA 3HHNB 3MD3A 4G1QA 4K50A 3IG1B 3K8WA 2KTQA 1OIAA 1KVKA 3JB9k 1C4AA 3B82A 3TI0A 1N54B 1WOSA 3PW0A 1LWFA 1OO0B 2MSTA 4NASA 4WE1B 1EP4A 4XDDA 1JQGA 1N4LA 3UW1A 1AZSB 2P5VA 4RW9A 4RU9A 1R89A 4M5DA 3NGSA 3UO0A 3H20A 3N4WA 2J9EA 2R4FA 1FFSB 1RE1B 1KQGB 2DNQA 3CJSA 5B0GA 5CD4H 4L76A 4F4ZA 4O3PA 1N36F 4J9MA 3PKMA 2HVIA 4QOTA 3PR5B 4RNFA 2VD3A 3W60A 4WK3A 1LFWA 1X9SA 3U02A 2AIRB 2VASA 4P52A 4QU6A 5F8NA 2WOMA 2F3JA 1FX4A 4ZP8A 2YH1A 2X3GA 2RJZA 4I2QA 2BBEA 4ZPWR 5DRKA 5FDLB 2XBPA 2DO4A 5E3RA 5GAGU 1NJYA 1FTCA 3MMJA 2G4BA 1S9GB 4B3TF 3PM9A 3OW2R 3DYAA 2JHEA 5FJ4A 3P96A 2ZE2B 5FD1A 3PY8A 2V4QA 4DL6A 2Y3YA 3UQSA 3G96A 1XTZA 2VH7A 1F9EB 3UVJB 1IN0A 2MQ8A 1RP5A 3P3DA 1FTRA 4RLEA 5EGYA 3FEZA 1FRLA 3DDKA 1SL0A 4FKYA 2XMMA 1X4FA 4TY9A 4BDPA 5F3ZA 2CQ1A 4NCGB 2KKHA 4DV2F 1S6QB 3KG4A 2EWHA 3IM8A 5LMNF 3I5AA 3TAPA 2KXFA 3GSIA 3TRGA 2HRTA 4GO7X 1AW0A 5FLXY 2AJFE 3MR6A 3RBEA 2HNZB 4RW8A 2BM0A 2QTWA 4DZDA 1M90T 1VLYA 1H98A 1TL1A 1VDHA 1RWOB 2QV6A 2L41A 1TU0B 2HRYA 3ZNUA 4C0BA 4I2QB 3KUEA 4DZ6A 1VS3A 3JQKA 1RTIB 1RTHB 1BQNA 3M2RA 4OZ5A 4QWDA 1Y0HA 5ETRA 2YNHA 2J6UA 4ERDA 4C4WA 1RA6A 4WCEQ 4OLOA 1BC6A 1LWCB 3KOAA 1GNKA 3T1AA 1QAYA 1FDDA 3FRYA 2C2KB 3MTKA 2UUCJ 5EDWA 3TAMB 3ZXWA 5L1LA 5HK4A 3I87A 1LOUA 1NDCA 2CG4A 3PX6A 3BN7A 2PT0A 4ED0A 1M0SA 4QZVB 3HVRA 5ETVA 2KVQE 4FS2A 3GCXP 2RRAA 1SXLA 4OJ1A 1NZAA 1XNRJ 4K4UA 3J81U 3M6XA 3GMGA 3IG1A 4MAKA 2EVZA 1Q0NA 4MIWA 1HNVA 2E7VA 4FYVB 3F41A 3IM9A 4Y34A 4F3MA 4U67Q 1R6VA 4ED5A 4ETZA 2QA4S 4OI0A 1CS4B 2VU5A 5MLCV 1U49A 3AOAA 3CC7S 4YB6A 1UAWA 3RRHA 1WTFA 4RW4A 4LF8F 3BGRA 3IO1A 2GIRA 2OH2A 3HPOA 2CUYA 2YKMA 4YHHF 3CDBA 4MK8A 1H72C 3NOCA 3MOZA 1LWCA 1NO8A 3FDSA 4JV0A 3ITHA 4UF4A 5LJ3Y 1QUVA 3ET6A 3KLFB 3CJKB 5HVGA 1OY9A 2CDQA 2KU7A 2HHHF 2NXJA 4FKXA 2RUGA 2Y1RI 2M2BA 3N01A 4QR1A 4UOCA 4ZVPB 2GGPA 1B0PA 2KFZA 1NAQA 2K1RB 2GO9A 3F44A 4Q8EA 2WVBA 2AMCB 2E5GA 3MCSA 2B5JA 5HI7A 1RCXB 2BKNA 1BQXA 1ELOA 1ZAWA 4FYXB 4KV8B 2QA4G 2IJFA 1YJNS 4F02A 3OR1B 2F8EX 3G8SA 3BGUA 2GIFA 3GR1A 3H4DA 1YJTA 5H9FJ 1DTQA 1AA1B 2BDPA 4IR1A 3JAMU 3G82B 4JI1J 2BE9B 4OJGA 5C7PA 1RAAB 4RW7A 3KG0A 4OV6A 1S59A 2YPZA 5J2MA 1RYSA 3H90A 3O1LA 4CO2A 1L5UA 1BLUA 2DR9A 3BSCA 1JLFA 5D78A 4A8MP 2CQ4A 1HNIB 3CE8A 3CJ5A 3DFEA 3KDNA 1R8BA 3QSYB 1BWEA 3DGVA 4MJKA 1KNZA 3NEKA 3V81A 1FRMA 1N88A 2F65A 3PHTA 4RW7B 2X3DA 1GMWD 3UNGC 5K8NA 1SL2A 4USKA 3JSYA 1SPBP 3DOLB 3G82A 3N6MA 4OX6A 1NUEA 4ZPAA 3H2UB 5AXLA 3PTWA 4C3LA 1FKOB 1RHMB 4ZVQB 1HNIA 1MROB 1U25A 2YX7A 2KFYA 1HHTP 1UEKA 4DXLA 3D3BJ 5FIIA 3SQGB 2B5JB 1NPPA 4YR2A 1BUXA 3EDQB 5KFSA 4F4AA 3QLHA 1NK0A 2FLPA 4ATNA 2R8GA 2CQBA 1DTQB 3A4TA 4AE5A 2P9CA 2ZM6F 2R7VA 2RS8A 3LALA 2KT5A 1OYDA 3QAEA 5DGAA 1XR5A 2VOOA 1KS2A 4G65A 2D74B 3DXSX 3J80Y 1FDBA 1IWAA 2DHAA 2NCKL 2J0SD 4G3IA 2K2PA 1EB0A 3CD0A 3PYDA 1IR0A 2JX2A 1FK9A 3CJRA 5E2QA 4DG1A 2FIUA 2VJVA 1ITPA 4OJHA 5D4OA 3HXMA 4K4WA 5MAOA 3BGFA 3T3FA 1VQYA 2DO0A 4ZVSB 1UZHA 2B6AB 2WAQD 3ZZUA 5I42B 1S57A 1LKZA 3IS9B 3KHHA 2ZBCA 4DSIA 2IVFB 3CMAS 2CQ0A 1YLXA 1RT2B 4KH0B 4MTPA 3RG6A 4ECUA 3EXCX 1BQMA 4KKOB 3H5UA 3TR5A 3D6TB 3NXZA 2LQ9A 4I6AA 3AA9A 4J90A 4WBFA 2B43A 4MFBB 4Y2KA 5IC6B 2CJ9A 3JQJA 3Q2SC 4LRDA 1NB7A 4DR6J 3ENVA 1F5CA 1X4HA 1JLCB 2RB7A 4FP9A 1X5SA 3BO3A 4OJ3A 2ERRA 2O3DA 3KK3B 4NCBA 3EUNA 1PC5A 3MD1A 1VHIA 2QLJB 4Q2MA 4ZN3A 2EG2A 4ZP6A 4NI2A 3J80U 2E7XA 4C97A 5AJ3F 1PO6A 4NL5A 1QTMA 1BQMB 1WSVA 4C0HA 2FVSA 4GKJF 2X51A 1AFJA 3AXKA 3TQEA 2FZGB 3NS5A 4LF9F 2XWXA 3R8YA 1QAJA 1E6YB 4ID8A 4CH7A 2CPFA 4QR0A 4HI1A 3V4IA 4NXMF 4PYDA 3VAGA 1JK9B 2B6AA 2N7YA 3MGJA 1S6PB 2CQHA 2PSZA 3D0IE 4K7QA 4OZ1A 4XTTA 3I5CA 4Q44A 1KBRA 4JV2A 2EKYA 2WW4A 2UP1A 5LM7E 1LW2B 3QIPA 4BCAA 3CO9A 4ED4A 4PG6A 2EK1A 3M1VB 2MZSA 4ZCIA 4BC9A 1JJCB 2XLIA 1UVLA 4ICLA 1DTTA 4V19J 3KHGA 2YNHB 5C2GA 5L8RC 3N79A 1X0PA 2FJXA 5IWAF 1RTIA 2DHHA 3KJNB 1Q8KA 4K5RA 1SV5B 4DFJA 1LNQA 4DV0J 1RKJA 2DR6A 2KT3A 4K8RA 4L3KA 3SIPB 5HQ8A 2UUAJ 4X66J 3R6GB 4NXNJ 4UZCA 3KMQA 3KKFA 1G6BA 2RIJA 4LF8J 1F5BA 1NK5A 2ZE2A 4IH5A 3SV4A 4ZVRB 2OEJA 4I6YA 2G13A 4YHHJ 1UVKA 3PV8A 4DX8H 2BW7A 4J9LA 5SUHA 1Q86T 2VFTA 2C42A 1B70B 1C1BA 1D8ZA 4Y2MA 2DXEA 2HWHA 3BF4A 3QT7A 4M8LA 5A8RA 4IO9Q 1MWQA 5DG9A 2HNYA 1F1BB 1FEHA 2ADBA 3UNYA 5J2PB 3EDRB 5A6PA 4JI6J 3PW4A 4Q8FA 1NKBA 5C25A 3TWZA 1KOOA 5E33A 2CWKA 2YVSA 1XK8A 4O4GB 4LVOP 3P5BP 8RUCA 1NM2A 2XQCA 2E5HA 3F0NA 3NAHA 3PDNA 3M8ZA 2VOPA 1HBOA 3LQVA 4J7CA 3NGDA 3DLLQ 1JNZB 3L09A 3VGUA 1OPIA 1LWEA 1WF1A 2JWNA 2V68A 2XY5A 2I5JA 3CUNA 3ZFVA 1X4EA 2VFVA 1VYAA 2A1BA 2DCLA 4U6PA 1R8AA 3AHPA 1RT5B 4PUOB 3EGZA 5EX0A 1N5TA 3S8SA 2UVRA 1PIEA 2PGCA 3FMWA 5C42B 5DS7A 5KFHA 3TAQA 1U2CA 2LP4A 4PXBA 1TK8A 1RTJA 4DQPA 2R7SA 4GVBA 1ZA2B 2YNFA 1T05A 1FDAA 2OFGX 1VBXA 2Z0GA 2OUGA 3E8OA 4HL9A 4WTYA 4YY3J 1YI2S 3QQCD 4MK9A 3V6DA 5F8JA 1TK5A 3IAS9 3IMQJ 3ISND 1RT6B 3RAMA 2BZ2A 2DNMA 3NCRA 4OV1A 4P71A 1S0VA 2XYPB 2BM1A 3CCLS 3JS9A 1U2FA 4C2MA 3EPIA 1LWXA 2XLJA 3EYZA 1DAXA 2IY5B 4LR8A 1HLWA 1U24A 3OLBA 1AFIA 3JTNA 1JKHB 2LXFA 1HMVB 1LV5A 3KFWX 4IQXA 4B3TJ 1TK0A 5B0DA 3NRBA 2JEGA 3GR0A 1WF0A 1B0VA 2HFNA 4RR5A 1VC0A 5HMXA 3KLEB 4KHPJ 1RDRA 1K1SA 4PWWA 3SYZA 3QT5A 2F8MA 1Z4UA 3G8TA 1IKWA 5D0GA 4C11B 5IQQA 4A46A 4LFAF 4QIEA 1HWIA 2EW9A 3IGNA 2H5IB 5D0HA 4NLVA 2AJ1A 2C2MB 1BD6A 2VFRA 1FNXH 1T9VA 4DL3A 2VG7B 1HW9A 2AYMA 2MQNA 3CWJA 2XYHB 3DDIA 2XEXA 1VQMS 2ADCA 2ZBPA 1YTYA 3G86A 4ZLNA 4RBVA 3UFCX 1NDLA 1B99A 1R8HA 3DLEB 4CRJA 3BKTA 5DQIA 1VRUB 3WC0A 3J81j 2ZKUA 1H2UX 1UEUA 2XZWA 3BBCA 3EMTA 4YR0A 2FLLA 4M94A 2MJNA 2AHOB 3DLGB 2F5GA 2VPWB 3R7NB 4OHVA 4LF7J 2XWYA 3W5YA 2PA3A 4P2XA 1NNDA 2MY7A 3LP1B 1HI1A 2JC0A 5AJ3J 1M5OC 2HFVA 3FQKA 3OTDA 4F0MA 1YBUA 2J6SA 3GWCA 5A0YB 2CZ4A 1F3VA 1ZAVA 3UN5A 1YGYA 1X8DA 3N0VA 1R8CA 3EICA 4KFBA 3HHEA 3CCQS 3BV8A 1R3NA 4A8QA 4ECXA 2GFFA 2IA6A 3US5A 3UDEA 2QL7B 1JNRB 2ZC3A 4QIFA 4WPAA 3ETMA 1FVSA 5IXUA 2V8PA 5DDPC 3HZEA 4R5PA 5KFJA 3HT3A 3H5YA 3MMBB 4DR3F 4JI7F 1TP7A 2QMWA 2VQFF 5BYRA 1HQ2A 1KQKA 2HLUA 3BPSP 4DL2A 1VC5A 4Y28C 1IQTA 1S48A 3R2CJ 1B3TA 5CQGA 1JLCA 1WWHA 3DDNA 4WYLA 5EWFA 2CVIA 4RUCA 1U4BA 3BDEA 1GTHA 1I1GA 1RWVB 1XBWA 3SCIE 3VR1A 4FF1A 4HH0A 1GT8A 4DCOB 2YKAA 3FZ2A 1XNQJ 3MOJB 4JI1F 1OY6A 4CO4A 4P6QA 5KT3A 1FF2A 3I55S 4FVMA 4F8RA 3N9UC 3L7UA 4JI6F 1QJHA 4PWDA 5KFBA 4IG3B 2W7PA 2YXLA 3S6EA 5A8KB 4DV1J 2R8KA 3MAAA 4OHWA 4ZVUB 4ZN1A 3C6UA 2MZ1A 4ZVHA 2ZH4A 1CQNA 1KFDA 4QBUA 2YQ0A 2RQMA 2KJVA 1UJ4A 2V50A 3I4PA 3IC1A 3V4MA 2IFXA 4DG1B 1SKUB 1YQHA 3NNCA 2QGFB 1RHRB 1JXVA 1P1LA 4IKAA 2GS8A 4F3OA 5J1PA 3H98A 2OTLS 1S1WA 3KXDA 1ICEB 1VJQA 2H4YB 4WXWA 3NCQA 4IH6A 1ZOTA 5DQHA 1YJUA 4PKDB 2K7KA 5ETSA 2YTCA 2AJ2A 3V2UC 4OL8A 2HGMA 1S6OA 1R43A 3MM5A 2CA9A 2HHTA 2XG8A 2EBEA 3DHWC 4ES3A 3KK1B 4LFBJ 4B9SA 4TU9A 4JOUA 2C28A 1FESA 1NJWA 3PRDA 2DHXA 2DH9A 4R0JA 1U2RA 3NBPB 4MYTA 2W9BA 1S1TA 3MM7B 1S6QA 4A8FA 1XMQF 3ZZOA 3BB5A 2IYGA 1S1XB 2FHJA 2A6OA 1I51B 1ZM4A 4ZHRB 5KG2A 4YY3F 3OSPA 2GVZB 1WG4A 1CVJA 4DMZA 3M8SA 4XIUA 3HD2A 2CYYA 1X4GA 2JLEA 2QEXS 1LW0A 5IT9Y 5KFEA 2BANA 5CCMA 2OPRB 3IN5A 3K5MA 1SQFA 3A8JA 4DL5A 3Q8QB 3SFGA 4DQQA 2YH0A 4UZBA 1ULRA 5K14A 3HJFA 1TL3B 1NSKL 2W24A 1FFGB 4JI2F 3CCUS 1UFLA 4OI4A 4I56A 4NZ0A 1R7IA 1RT1B 3POTB 3MUVP 2KHDA 1WF2A 4ES1A 4I6WA 3GYGA 3EVOA 4XPEA 1X31C 2J0QD 3ISNC 5B0BA 2EC0A 3MR7A 4DL7A 2NQPA 5GADU 3G2XA 4L73A 1T02A 3Q8PB 3BKFA 4M63A 3SCKE 3Q8SB 3GQCA 1WOOA 4LRAA 2XO7A 1Q8LA 1SJFA 2EC2A 2JFKA 4IFYB 2W9AA 5DJBA 1ZTTA 1S1UA 1RADB 4M5DB 3B8HA 1HWLA 4F0KA 1JJHA 2J7WA 2LVWA 3KK2B 1KTVA 3DOKA 2WVDA 3CXCR 4QCLA 1U1OA 1BY9A 3ISZA 4P7TA 4F4YA 4EWTA 3FFIA 2XMAA 1CLFA 4USHA 5LSRA 2J9CA 4IO1A 3MEGA 1XEZA 2Z4PA 1FFWB 2FHOB 3PFOA 3FNNA 4LQ9A 1T05B 1CS4A 1TV6B 1TKDA 1WD6A 1FWKA 4KGMA 4CO3A 3CC2S 3BGRB 3BN4A 3DC2A 5LXRA 2R9LA 1L3TA 1D9DA 3LP2A 5G0RB 2XCAA 3OJUA 3V6DB 1RB0A 3C6UB 2JL9A 2OKQA 2YKOA 4OX7A 4USVA 2NZ4A 3GG0A 3QWUA 1VQ8S 1NU4A 1RZMA 3OQ2A 4WU3A 5JJBA 1UJ6A 2J6TA 2EXUA 3MMCB 3S7RA 1N56A 4TU7A 4LF6F 1ZA1B 4WWSA 4ZP9A 4F2RA 4F4KA 1NBEB 1NH8A 1V5IB 2HSEB 2OLWA 2WBRA 3MM6A 4G6VB 4UUXA 5KT5A 3K58A 1Q7YT 3PYGA 2GJ2A 5L46A 1WSRA 2BW2A 2I6WA 2VHGA 5J2QB 2AQ4A 3V6HA 3HZGA 3D7SB 3OFFA 3UN2A 5DDRC 1B7FA 1HBOB 5K9FA 4X4QA 3RAQA 4U7UD 3CMES 4ANDA 4DV7F 2BE2B 1YZ6A 1RT5A 3F56A 4K0KF 4DV6J 5F9LA 5B0AA 5HJXA 5DGBA 3CCJS 1BGXT 1O6XA 2ZZNA 4GKJJ 4PPDA 1MN7A 1OJ4A 2ZITA 4RKUC 2AD9A 4LF4F 1FJ7A 1KOHA 5IM0A 2ILZA 2OPQB 4OYOA 3HSGA 4Y65A 4DSFA 3KLIA 3TUZC 1NXIA 4IG0B 2MLZA 3EZOA 5K8OA 1MU2B 1YVFA 2N4CA 3QMQA 4CYUA 1LXNA 1Y11A 4CLTA 3VAIA 4DFPA 3H7HB 2LEPA 5BR8F 1IKXA 4FXDA 2VQFJ 4DF8A 4ZVTB 3DHXA 1JJ4A 1WDDA 2AT1B 2FC9A 2WVCA 2YKNB 2LMIA 1VJWA 3DLGA 5GAGI 1KSPA 3C46A 1UEVA 2YNGB 4B3MJ 1HNWJ 1SB6A 4RL1A 2DHGA 4M5NA 1ZS6A 3VZHA 5ADZA 4QWAA 3MURP 2HK3A 4Y3CA 4ALZA 5KT2A 3MFHA 1N33J 3PKYA 1A0OB 1PJ5A 3ENWA 3EGNA 3GONA 4RW8B 3SQGA 5CABA 2V4RA 2FPHX 2QC3A 4NMLA 3L9ZA 1WG1A 1H73A 1UFKA 2GO8A 2MKSA 1X60A 2ZH2A 3D5MA 4KT0C 3IRWP 1EX8A 2FY8A 1K1QA 2H3EB 4N8OA 2AJ4A 2KL8A 4AYBD 2HVHA 4OI1A 2E29A 1Q53A 4CTAA 3FSIA 4B3OB 2RQ4A 3NAIA 4C9DA 1QD1A 2VC0A 2EI5A 4JI0F 3IGVA 2OPQA 3VGSA 4DR5F 2LLZA 4LR9A 3ZZYA 5IM0B 2E44A 1YBTA 4IRKA 1RISA 4MIBA 3GCWP 3ILOA 1N5VA 1F9FA 1H2TZ 1HWJA 3W7BA 2GQQA 4DV1F 3HHLC 1XMOJ 4H4MB 2P2CB 3VHQA 2UVUA 2V63A 1R0AA 4KGKA 2KJWA 1UKUA 2M8HA 3O8WA 4ITSA 1VRQC 2E1PA 1M5VC 2DRBA 5I3QA 4P2SA 4JYAF 3FEYB 4F04B 2KZZA 3LP0B 2HFOA 1HW8A 1YX2A 2XULA 2HRUA 1F2HA 1FJCA 3PNIA 2CADA 1FWLA 2G1HA 2LYVA 2RRNA 3K17A 3MM8B 2EEYA 2WVEA 3AJ1A 3H59A 2UXCJ 2C2EA 1KQSR 3ZC4A 2ZFHA 2AGPA 2BJ1A 3TNVA 3NMRA 2HS0A 2WSFC 2AX1A 5KFDA 2ZNYA 2VA2A 1KWMA 2CG8A 2DB1A 3QO9B 4I68A 3W5XA 2QRRA 4A48A 5F8GA 4X64F 4WYWA 1RWKB 3A3PB 5HJYA 3G6YA 3C2PA 5ETTA 1HNXF 3X1LB 4QPTA 3VAFA 1KLMA 3A8IA 3MM8A 4E2FB 1VQ4S 2A0FB 2LU2A 1HHQA 2RNEA 2J9DE 3AB2B 3GZ7A 5KG3A 5KG1A 4J9QA 5AE3A 3OXFA 3R7SB 1RBLA 2I8EA 2ZKTA 5EWEA 1RWPB 2D3UA 2V4JB 4RWXA 1X9WA 4KTQA 1IJEB 4ED1A 1G1XA 4LT6A 1FWPA 3DOKB 2QMXA 3M6VA 2PMHA 3QO9A 1V9OA 3VWSA 3ZTSA 3MPYA 2BA9A 2MHNA 2RUSA 1Y3JA 2X1BA 3ENAA 1FKAF 4IDKA 4M1KA 3DLHA 4PUOA 2HHQA 2UV8G 2KFNA 2BRKA 1G7CB 1WHWA 2ZC4A 4Q2LA 5HP1A 1UA0A 4XK8C 2CQPA 4QIWD 1XR6A 3LPEA 2IM0A 4DS5A 3Q8RB 2DT9A 3SDEB 2D3O1 3SSQA 4I7FB 3W9JA 1N36J 3PJWA 4KHRA 4O4GA 4QIVA 3P49B 4LSLB 2CFXA 4I1TA 4WIIA 4H4MA 2YWWA 3M2VB 4GMKA 4PWUA 3UDVA 5DG8A 1W25A 1TUWA 2KXNB 1R0BG 2YWGA 4DEZA 4FNIA 4MIAA 5DZ7A 1GMVA 3BR9A 2R7RA 1NK9A 1T8EA 2GQCA 4WFYA 1ZBTA 2EBGA 2HVEA 1GMUA 1RK8A 3DGPA 1FKOA 4ECTA 1I94J 4LMZA 1KVIA 3D1HA 3IAM9 4MKAA 5C24B 4MKYA 4EO8A 1P8GA 1VQLS 4PPZA 2XMVA 4PEOA 1S1XA 5C2CA 2PA8D 2RQKA 2XC9A 4A8KA 3MM7A 4ZKAA 2R8JA 1IUJA 2X7IA 4ED7A 1T3OA 3HFZB 1QSSA 3LANA 2MEWA 3MEDB 4RJVA 4TVAB 4U96A 5G4DA 4DUTA 1N32F 3FK4A 2FLNA 1JLEA 2E1RA 2VUGA 5CHCB 1A9NB 2DNOA 3KK1A 2FHMA 4ZDNA 2HG4A 1V3SA 2MKHA 3QGGA 1VRUA 4CNYA 4CP5A 2RAQA 3FGVA 3LF0A 3JQMA 3MM9A 1HBUB 4F3QA 1KN6A 1WI6A 3HT0A 2DKOB 2VPYB 4B3SJ 3RW6A 2LXUA 4DSKA 3U1LA 4Q5VA 2XGQA 4BHQA 3IBFB 4OYPA 2C2RA 2BE2A 2BQRA 1DRZA 1DZ5A 2F1FA 1S4EA 3DU6A 2CNNB 1U02A 1KKHA 2MHEA 2WHOA 5ETLA 4NXMJ 4QU7A 1UVJA 2UXBF 4QWBA 2CJXB 2DNPA 3G4SS 1AT1B 4JI7J 2HYIB 3DRSA 2FTRA 3AA8A 1SC3B 1Y3KA 3HHLB 1NDKA 2BXJA 3MEKA 1BE4A 4PWDB 2ZOFA 3MMCA 1NJXA 4YN3B 2QJ3A 3NS6A 2C2OB 2FJBB 2K8GA 2GJFA 2E5LJ 2Y1IA 5D3GA 3O6QA 3H40A 2XMUA 1UFWA 4KPCA 2BX6A 2HWTA 3T6BA 3PX4A 1X4CA 3J7Z5 2FDNA 2R7WA 1HI8A 2MZJA 1VOMA 4NLGA 1Q8IA 4GO5X 3UDCA 5DDOC 4X4TA 4AQYF 4K4ZA 3FJ2A 4L74A 3OVAA 1NSAA 5I3UB 5D3GB 5DM7Q 1M1HA 3R5CA 4Y2AA 3KJVA 4PCQA 1TR0A 5A8WA 1IBLF 4YQWA 1MWYA 3FRZA 2DXDA 2XMJA 4JV5J 2HKEA 4DU8A 4MKBA 3TP2A 3OR2B 1JLQA 2X1GA 2NYHA 1P1TA 1WHXA 3CD5A 1EZZB 3WHIA 2F4VF 1VQ6S 1CJUB 1FK9B 2ZD1B 2FLOA 4ZMMA 2OTJS 1F0XA 1HL6A 4K4SA 1D9FA 1SIZA 1Q4RA 1ZYQA 1R0CB 2XI3A 2LDIA 2W2PP 3AD7C 3BPDA 4M95A 2WONB 3M6UA 3R7BB 5JVHQ 4Z37A 1RABB 5C42A 2HFSA 3MM9B 3N6NA 4DU7A 3I31A 5F8HA 2DGVA 2ZJRQ 1XR7A 3M8YA 1S72S 3U1NA 4WZMA 1P6TA 3R6LB 3FC9A 1FXLA 1CULB 1S1UB 1K9MT 1LEOA 5J1EB 3DKDA 4OYXA 4TN2A 5LMUJ 3C66A 4PG4A 3CF5Q 4FYDA 2IJRA 4YB5A 1RAOA 3CT9A 4CO0A 4YEAA 2IDEA 3W9IA 1EETB 4RWWA 2KM8C 2GVDB 1MLAA 3VGTA 1ZM9A 2LXIA 2AEJA 5H1SV 2ZH5A 3P5TL 1JMTA 2H65B 5J1NA 2L3MA 2EFVA 4AD6A 2OD4A 4DR1J 1S1TB 4L3NA 1KQFB 4CH0S 4CO1A 1SJ1A 2M3DA 1FRJA 4ZIWA 3UVJA 4K5SA 1JLFB 3OTEA 1OY8A 3VV2B 1SKWA 4LR7A 1QY7A 3CGIA 4ZCMA 3BKUA 1YDLA 2ROPA 4C8KA 3TUPA 5DLGA 4J91A 2XHWA 3C16A 3W2VA 3KLEA 1RCOB 2ZHAA 4EYHB 2HBYB 2ASYA 1C4CA 2RDIA 4XPCA 4O23A 4ELTA 2JJ4D 3FKBA 4NZ6A 3UE2A 5GMDA 2V2ZA 1RKIA 1FXDA 4DSEA 2B51A 2N7CA 4ZS6A 3M9MB 2VC1A 5HAOA 1U0HA 3DU5A 2Q1LA 3NBPA 4HR2A 1S4FA 2NXCA 4I2PB 4ZCLA 1IBMF 2FY1A 3TZWA 2ZUGA 4JI8J 4KGZB 2A2CA 3SI8A 3QBCA 2HPUA 1LK5A 3R97A 2OMLA 3GJSB 3L95X 5HMWA 1Q16B 2UVVA 2K3IA 1PAEX 1JLQB 2PDAA 3C14A 4DN0A 5DQGA 4O44B 1S1WB 2PD1A 3QGHA 4IR9A 1QLNA 2BV3A 1PSDA 3RTVA 3PX0A 4NA2A 2OELA 2W25A 2GHWA 3QIPB 1XJWB 3QRPA 1PILA 2RHQB 1E6VA 3H2LA 2ZDPA 3BEGB 3HVTB 3MCMA 4AUKA 4B9MA 1TELA 2UXDF 4BBYA 5KFVA 1DURA 4NEZA 4D3GA 3CEDA 3MAAB 3J81Y 4DS4A 4H4OB 3DLBA 3J7YU 4I64A 2AP6A 1V6HA 4M5JA 2AGOA 2HBZB 4C98A 1VQOS 4ZJLA 4K0KJ 4DQRA 1SJQA 1T9YA 4ZPBA 3RB0A 3J7AN 4E8UA 2KN4A 1CC8A 3HKZD 1U6ZA 1S49A 4HT5A 4ZPVR 3BO4A 2DGQA 5E41A 1CQMA 1GX6A 2H5EA 2D9PA 1CJVB 1TAQA 2GX8A 1G3OA 1QUPA 2OSRA 4Z7CA 3Q24A 4TNOA 4OHYA 5E3CA 4ZOSA 1VBZA 3LP0A 3WIVA 1R6YA 3GE9A 1JIHA 1ZETA 1HWKA 4J9RA 3MMBA 1DJ0A 4NMXA 2B0GA 1S9EB 1U45A 2BR0A 1NB2A 2MKYA 2I2YA 2HMIA 3CJ2A 5C25B 1IQZA 1RBAA 2V2KA 2BKPA 3BDPA 1WKJA 4LF9J 2F63A 5ETMA 4ID5A 2DXFA 3AQPA 2GMLA 3OBIA 4J9VA 1FVQA 1C1BB 3R5JB 4LBHA 4YB1P 2QT7A 1R8PA 4C3MA 1AUSL 1VMBA 2AYBA 1VQSA 2EFGA 2YWEA 3FCVA 2UUBJ 2NPFA 3M8QB 2V2VA 2QLFB 4L72B 4WP3A 4H54A 3D4JA 4M5KA 2HIYA 4C48A 4QWEA 1G4CA 1S99A 5KFLA 2W2QP 2CPYA 1SH0A 3PEJA 3D6MB 3ZZTA 2BJ9A 3EJMA 1EHWA 4LRCA 4MH8A 3R1LA 1PKUA 2A10A 1FNMA 2P6SA 3MPUB 5A2QU 3RB6A 1KTQA 3D6HB 2HMIB 4C8OA 4N47A 4ANEA 1TL4A 3RR8A 2AGQA 2MZQA 2DEJA 3J7YI 3BH7B 4I7FA 1UPPA 4NZ7A 2IM1A 3BYRA 4USUA 3HVAA 1WC6A 2M52A 3AQOA 4YFUA 3CPWR 5I3PA 1T9WA 4OIXA 3NCPA 1CJKA 2JRSA 4Y0FA 4TYBA 3DGPB 3TZYA 3GV7B 2KI2A 5KFXA 2FUG9 1W7WA 3C15B 3CJ4A 2JFDA 2RF2B 3N28A 4ZA1A 3D67A 1VK3A 2ILYA 1IVZA 4EBDA 3B4MA 3N5BA 4QYZK 4UTGA 3EVMA 2DNHA 2OAUA 2J8SA 2QLWA 4DR2F 3KMSA 3I4HX 3TUJC 3QWPA 3OFEA 5KFZA 3WQPA 3KUHA 1TVRB 3DXBA 3WX4A 3DNCA 1I6JA 4CCHA 4P74A 2R7XA 1YJVA 4RNHA 4IUFA 4KJIA 1TUVA 5AE1A 4ZPCA 1Q81T 1KEKA 1M5KC 3QRQA 3OFGA 3HI9A 4LF2A 2HS3A 1GK8A 1NCLA 1RT3A 1FT8A 1TKZB 4OZ2A 4QW8A 1WTBA 2HHUA 1EQMA 2MZTA 1RAJA 4BWMA 2YNFB 4BS2A 4CLLA 4HEA9 3VQSA 2HNDB 2HBRB 2DEIA 1NDPA 5T41A 5F8MA 2VPXB 2ZH3A 4RX6A 4PAAA 1X4AA 4WKYA 1Q82T 1RHQB 3MHYA 4M5IA 2LQ8A 4F25A 3IWNC 2BE7D 2G2OA 1JWWA 4DHVA 3PR4A 3NWRA 2XMKA 4CO5A 1MG7A 2VPZB 4URGA 2FGCA 4DN9A 1Y00A 4QWCA 5KTQA 2XSFA 1VQNS 1FO1A 3CB4A 2D9OA 3JSBA 2XS5A 1Q5YA 5HMZA 2DR8A 2VG6B 3EZ5A 4OX9F 2AJQA 4J9NA 1B64A 2W2OP 3PYFA 1RACB 2DNKA 3EM1A 5B09A 5HVFA 3TQ1A 4KIAA 2IC3A 2RT3A 4OYAA 3AJ2A 3TA0A 4HTIA 3CVKA 2ZZMA 1H7XA 4JI2J 3CDUA 2VZ9A 3NS7B 5K14B 3U1MA 5DLFA 1M5PC 3GU0A 3GP9A 1IR2A 2Q66A 3D1OA 2JVRA 3RGIA 4DR7J 1S1VB 4P2FA 4LF7F 3MEEB 3T41A 4C3KA 2BQ3A 3J7A1 4ZVEA 2YX4A 3OTCA 1FRXA 3SCJE 4B3RJ 6AT1B 3QT8A 2VBYA 2MPUA 4NWBA 2HFZA 5HN0A 3Q22A 1NHVA 3AJDA 2O66A 3H2VE 4PXEA 2RD5C 2A6MA 2QG9B 4HYKA 1J5EF 1TQLA 3CJ3A 3GYNA 3I96A 2ZBRA 4X84A 1CULA 3OSNA 2UZAA 3HFKA 4M5LA 3BQ2A 1TL7A 4YB7A 3I32A 1SV5A 2VBXA 5IZHA 2E9TA 2W4DA 4Y00A 1NZ8A 5GVQA 4WZQA 4M5HA 1VFJA 2R2UA 3HULA 2RMLA 1HWUA 2G9OA 2OD6A 1VQKS 4Y2CA 3OUYB 2J7KA 3G6VA 5CYMB 3RBXA 2MKIA 4KGXB 2R8HA 2FGOA 2N4DA 2V9WA 1F3FA 3CTRA 3CD6S 5KG6A 1S6PA 3JTOA 3ZTPA 3HM9A 3AD8C 4I67A 1WJ9A 3M4XA 4AT1B 1JLAA 3R9LA 5ETNA 5KOXA 2E9ZA 2BACA 3TYTA 4ZPTR 3ZZ0A 4O0IA 1HI0P 3QJLA 4HKQA 2E5IA 1UMJA 3DRRA 4AL5A 3FMBA 4OYZA 2IBKA 2QFIA 1RT2A 4QPXA 2W01A 3C19A 2R42A 3IRXA 2KB2A 3TO8A 2EFPA 1GFWB 1S6UA 2FHKA 3LP2B 4KO0B 4WJBA 5G0RA 4B08A 3BQ1A 2CJKA 2HWIA 2E5LF 3LTOA 4MFBA 2QO3A 4OZNA 3WDOA 4PRFA 2ASDA 5HROB 2RH3A 2I38A 4OHXA 3T5LA 5A0YA 5ETPA 4F67A 1AXQA 2YWKA 5KFKA 4C7QA 3CCVS 1TKXA 1NJZA 1YJ7A 3I0SA 4JI3J 3IS9A 3JSRA 5IC4B 4W92B 1HA1A 4LRFA 8AT1B 4DL4A 1U7LA 4JI0J 4X2BA 1WHVA 2CQIA 2AW0A 2GW8A 4BWJA 4V19X 1FJGJ 2M88A 2WBMA 4NLXA 4DFMA 1RWXB 7FD1A 1U1PA 1FDNA 3M8QA 5EWGA 2KO1A 2LQ5A 2RDJA 2CQDA 4PG7A 4HHHA 2B7BB 2D1CA 4DV0F 1KHWA 4ED6A 3MZIA 3RB3A 4CDIA 5I4MA 2E9RX 4DX7A 1YWXA 2JSXA 4CLFA 2WSEC 4DR2J 1KFSA 3MMAA 4DR4F 2AEFA 1AB8A 2HW3A 5EX3A 4LQ3A 2A2DA 4ZHRA 2RILA 5F41A 1DLOA
chains in the Genus database with same CATH topology
4R8UB 3ONQA 4ZK7M 4ECVA 1YSJA 1EETA 3B4DA 4B9UA 3UCGA 3DLJA 1UL3A 3EZUA 3OFHA 1FA0A 3N6LA 4N5SA 4KHMA 4ECZA 4KV8A 4PG8A 3BJYA 1QE1A 5J2NA 1WNEA 1RTDA 3K0JA 5J2MB 2C3YA 3VF0B 2W9CA 4RW9B 2IJNA 3CJKA 3KLFA 3PVXA 2HQIA 1EP4B 2MQMA 4URQU 1DQAA 2YY3A 2R7UA 4Q0BB 4UY85 6FDRA 5KFPA 2YWFA 2CQ2A 4KBIA 5HMYA 4TLRA 3OXGA 2WW8A 3MM5B 3GILA 3CDWA 2GHPA 4YUDA 3CCSS 3ZZPA 1WEYA 3HHDA 2Q43A 3KJVB 2B56A 5I3UA 1QVGR 1C1CB 4DSLA 2OP5A 3CCZA 3BM7A 3V6JA 2IHR1 1O5JA 1UVIA 3LAMA 5HBMB 3MFIA 2M4MA 2HZCA 4ZP7A 1TVRA 1RTJB 5EUHA 5KFOA 1H6KX 3HX9A 3TUIC 1MMNA 2JEJA 3HVWA 3LGMA 3I0RA 3I82A 3VAJA 3NG8A 1HPZA 2KVIA 5GAHI 1FKPB 3GFYA 4E98A 4DJBA 1TAUA 3PW7A 1HNZF 4RU2A 4R5PB 5AXNA 2RF2A 2Y1JA 1C0TA 1W2BR 2DGSA 4KQZA 5KT6A 2ZJQQ 1UWBB 4X65F 3MUMP 4PG5A 3FCHA 2GV1A 1WEXA 3KHRA 1QSLA 4B3OA 3G8QA 2AJ0A 4HDGA 1N6QA 1YITS 2U2FA 3IWLA 2CPHA 3K7RA 2UUBF 2MQLA 1MNEA 3KWMA 4EO6A 2W7OA 3RRGA 4DLEA 2R7TA 5B7WA 4N76A 3T1YF 1MW7A 3I56S 3UCUP 5KAKA 1OQ3A 1VQ7S 4NCGA 4WU2A 4XDCA 4ZCKA 3EX7B 4EYIB 2WCXA 4WF9Q 5SZTA 2R8IA 3O5TB 1YIJS 3ETOA 3PXGa 4WFBQ 5B0FA 3MEDA 1MMLA 3AB4B 4WFXA 5GMKa 1MSWD 4FN5A 2UUCF 3SEOA 4RNNA 2QA2A 2VG7A 1GQEA 4CT9A 1HQUA 3OPKA 4ECRA 3UD4P 2VONA 1ZZFA 1XNQF 1HBMB 1R31A 2V8HA 5KG0A 2ALZA 1U1QA 1T7PA 4ZPDA 3E01B 3FSXA 1FCAA 1DTTB 1P27B 4A8SA 4X4VA 4IH7A 2VG6A 4TKTA 4FPRA 5KFMA 2O01C 2DNRA 2XY7A 1U6FA 2JVOA 2ASLA 4R25A 2PI5A 2J8AA 5KFRA 1O8BA 4WE1A 2XLKA 3E2EA 4C8MA 1C0TB 2KRBA 4NOHA 3LW5C 5CYQB 4CT8A 4JUZA 2Z2LA 3DRRB 5GAEI 2DH8A 4X4UA 2DPIA 2MDAA 3L7OA 4KB7A 1WHYA 2XMTA 2C3MA 2CIMA 4NLOA 4GKKF 2KH9A 1DBDA 2YWHA 3QZ8A 4N77A 5J2QA 4IYQA 2HHWA 3OTBA 2CQGA 3RBDA 1LWFB 4DPOA 4WK1A 1NK4A 1TV6A 4Z2XA 3T5KA 1E6VB 1S97A 1HBNB 2FVPA 2GNKA 2CPJA 1FJGF 1VRTB 4ECYA 1ROFA 3M8PA 1HBUA 2XSJA 3QPIA 4D3HA 3HHKA 5E7OB 4NLYA 2PEHA 1N34F 1IJFB 5L39A 2LA6A 4TXSA 3NNHA 4I2PA 3R5BA 1U1KA 2DIUA 2JOQA 3TW0A 1OSCA 4NPOA 2HHPA 3UD3P 2KXHA 2CVEA 1MROA 3R3TA 2VFUA 4DBQA 2G0CA 2MKKA 4KR0B 2E66A 5E0OA 3LH2S 4ZVFA 4EU0A 2N82B 4YP3A 2O1PA 3POTA 3K59A 4DDFA 3M32A 4F4WA 2VA3A 3VQTA 1D0EA 4IOAQ 1F5AA 1RTDB 4W90B 4LFBF 1Q79A 5L9NA 3HK2A 4FXVA 2RS2A 1XERA 2PE8A 2FB0A 1X0FA 1LW0B 3DLKA 2NUUG 3BS9A 3LGNA 5A8RB 3QAUA 3UCZP 2ATLA 1S7HA 2WRMA 3CC4S 4O3RA 4R8UA 4FBUA 1DFDA 4LIWA 4NLRA 2QE5A 3TA2A 2XS2A 3W2WB 2DH7A 3A1YG 3D0HE 3U27A 3UR3C 2W9BB 1DQ9A 1ZPVA 5HO4A 2XGPA 4TQSA 4J9SA 2EFOA 2GGPB 2HLTA 2RE1A 5BYQA 3OHAA 2YNIA 1ZTWA 4AL6A 3CCWA 5D6GA 1PGZA 2ZH9A 3BO2A 2NREA 2I1RA 3M32B 1ZAXA 1HQEA 2WONA 3NNAA 4ICLB 4TLQA 2ASJA 1FJEB 1CPZA 4NLTA 1AUDA 2J9DA 1JB0C 1MU2A 3H5XA 1C0UA 4DWIA 4PQUA 4NYPA 3TVZA 3V4IB 1SUQA 3M05A 2YKPA 3VAMA 2V0NA 5KG5A 1UWBA 2FJAB 1X5TA 5DETA 1N5QA 4HLBA 3J7ZT 2D3ZA 1JLBB 1VIXA 3CDEA 3NLCA 2LEAA 4FZVA 3EPGA 2ZOMA 2UUTA 5CCLA 3KK3A 2VB6A 3T19A 4IRDA 2CPXA 1UJ5A 3M2UA 3KLHA 5CYMA 1FRKA 4DSJA 5DDQC 3VCDA 1R27B 1URNA 4B3SF 1Y7PA 3KNGA 4X66F 2GHVC 4DF4A 2QFJA 1IM4A 1HNWF 4YMEA 3VALA 1D3WA 1GXTA 1FE4A 3KLHB 2WB4A 1AROP 4OFZA 3LWLA 2OPPA 3TAMA 1RT7B 2JEIA 4KAIA 2WB1D 4EBCA 4FF2A 4UQTA 4L6V3 4C8LA 2LECA 3B78A 3LP1A 1GX5A 2AU0A 1HQEB 1RI7A 3PFEA 5A2QY 4JI3F 4ELUA 4FBTA 1U1RA 2Y0SD 1FXRA 3IR6B 3L3CA 1N5YA 1KONA 2QYCA 1OSDA 4Q43A 4PXDA 1PC4A 3W2WA 1QVFR 1NKCA 1TZ0A 3KHLA 2JDJA 4YDXA 2HIQA 2R2RA 4IG0A 1T3NA 1K73T 3R5AA 4PXCA 4ILLA 5KFQA 2IMOA 3SV3A 4FVCA 4G1PA 2V9KA 1RWUA 2KRRA 4EFAC 2P6TA 4PQAA 1H3DA 1IKYB 2L9WA 2Q79A 1N5SA 3DRPB 5L1KA 3D54A 1ZETA 3IR7B 3RR7A 2RQCA 1CSJA 2SXLA 4AXJA 2JC1A 5IT4A 1GH8A 2Z8QA 2DTJA 2L08A 1RT4A 2IRUA 3NGKA 3UPFA 1SJ3P 2OSQA 2APOA 3D2WA 2D3OR 4DR1F 4AFFA 1Z1ZA 4DOZA 1IKWB 4C11A 2OFHX 4O3OA 1RQ0A 5KFTA 1N0VC 2BABA 5CXTA 4QJVA 2DGXA 2IM2A 2F7VA 4ED3A 1U48A 1B0TA 2CRLA 1N48A 2DPJA 2V94A 1ZH5A 3JYTB 3KNAA 3DI6B 4JI8F 3OVSA 3V5RA 1SL1A 4GC6A 3VAKA 1S9FA 2KZMA 1N0UA 1TL5A 5HBMA 1VRTA 4RW4B 2GIQA 3NKYA 4O3QA 1TKZA 5F8IA 3BQ0A 1HHSA 3D0GE 3GIIA 3TVKA 3DM2B 2LDYA 1NJIT 2XNQA 1GXLA 1X5PA 5JVGQ 4FF4A 1O51A 2LQBA 3UDLA 3IR5B 4UY8T 3HDSA 4HT7A 2IVMA 1D8YA 2PFFB 4N41A 2N3LA 3LO3A 1U1MA 4ZVGA 2WSCC 2B4UA 2DR7A 1X5OA 3OLAA 2I5JB 4EEYA 1LK7A 1V3RA 3QJPA 1NRKA 2KG0A 1NHUA 3X3UA 3JTPA 1U6BA 2QSFA 1JLBA 1JJ2R 2U1AA 3HP6A 1RJJA 1RTHA 2MY8A 3GV5B 2FJWA 2WK4A 4A8YA 5B0CA 4U7CA 3M9NB 1ZZNA 1A6LA 1MMDA 2AYEA 2OPSB 3DRXA 4DR7F 2MYFA 4PQUB 5M2UA 3C6TA 2MQOA 2M9KA 3HLUA 1H0HB 2MZRA 2V5HG 2I9SA 3MPWA 3KLVA 4ED2A 1Z2ZA 1HQUB 4K59A 1S0MA 5KFGA 5J2PA 1TFWA 2HNYB 3M9OB 3DMJA 5IT0A 5KOWA 4N56A 4K4YA 3VZIA 3OL6A 4B9VA 2X1AA 2W8LA 4OI6A 2ZBIA 2YNGA 4ECSA 2HAIA 4DV6F 4MYUA 2NUHA 2VKRA 1LW2A 1YBAA 4N8NA 2DISA 4F4XA 2VKZG 1S9EA 4RW6A 1FD2A 1MWZA 1Q8BA 4F50A 3SFUA 2DITA 1T03A 3UWTA 3KLIB 2WOMB 4ES2A 4ID5B 4JV1A 1U8SA 2D7SA 1TFYA 2CPEA 2CPZA 4WFAQ 1TKXB 3QGIA 3BGLA 1HD0A 4OI3A 3MR3A 3CJ0A 3ZZRA 3V6KA 1JXLA 1REVA 1QM9A 4U7UK 5K5MA 3G6ES