2CPHA

Solution structure of the c-terminal rna recognition motif of hypothetical rna-binding protein rbm19
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
107
structure length
107
Chain Sequence
GSSGSSGQVPKKQTTSKILVRNIPFQANQREIRELFSTFGELKTVRLPKKMTGTGAHRGFGFVDFITKQDAKKAFNALCHSTHLYGRRLVLEWADSEVTVQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural genomics, unknown function
molecule keywords RNA binding motif protein 19
publication title Solution structure of the C-terminal RNA recognition motif of hypothetical RNA-binding protein RBM19
rcsb
source organism Mus musculus
total genus 11
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cphA01
1L3KA 4YB1P 1WELA 2CQ2A 4TU8A 2YH0A 2DIVA 2L41A 2MJNA 2LECA 4A8XA 1U1QA 2HGNA 1JMTA 2AYGA 3OW2R 2KG0A 2D9PA 2CQ1A 2DHSA 2CQ4A 2M2BA 2DGVA 2N7CA 1P1TA 1VBYA 1FJ7A 3P3DA 2J76E 1FJCA 3SDEB 3P49B 2G0CA 2Q79A 2KM8B 2MQNA 5JVGQ 2CPHA 2CJKA 1WHXA 2AD9A 3EGZA 1SJ4P 3ZZZA 3BO3A 2CPXA 3R27A 1H6KX 2MYFA 1UAWA 4ED5A 2AYEA 3H2VE 2LXIA 4WFAQ 2DH7A 3TYTA 3CCQS 1VQ6S 3CTRA 2MZSA 4UQTA 1ZH5A 5JVHQ 2JVOA 2WBRA 3MURP 3FEYB 3SDEA 1VQ7S 1VQ9S 4BS2A 2M88A 1URNA 4Y00A 2CQCA 2MZRA 2NLWA 3VAJA 3VALA 2DB1A 2K8GA 2CQGA 2KXFA 1SJQA 2M8DB 4FXWA 1YTYA 2KXNB 3VAIA 2DIUA 3CCLS 2X1BA 1WHYA 1U6FA 1N8RT 2M7SA 2MKIA 1WHVA 2RQ4A 1X4BA 1K73T 2MXYA 1X5SA 3R1LA 1SXLA 1HA1A 1JJ2R 2PEHA 3G6ES 1WG1A 2CPDA 5LJ3Y 5LSLA 5DDQC 3MI7X 1M5PC 3G4SS 1PO6A 5GADU 3MDFA 3CCVS 2F9JA 1WEYA 4LIRA 1X5OA 4LJMA 3DLLQ 1X5PA 1XN9A 1YIJS 3TP2A 2DNMA 5IQQA 2ZJQQ 4ERDA 5IFMA 5DDOC 3H2UB 5GAGU 3P6YC 3S7RA 1U1NA 2E5JA 3UCZP 2RT3A 1OIAA 1X4DA 4WFNQ 2HZCA 3NNCA 3IWNC 1U1OA 1KD1T 2YTCA 2DNQA 1O0PA 3MUVP 4CH0S 1Q81T 2YWKA 1N52B 1CVJA 1X4FA 1YJ9S 3CULA 4F02A 4M5DB 1UP1A 2DHXA 2MKJA 2YKAA 2DGSA 1VQ8S 1U1LA 3B4DA 4ZKAA 1VQPS 4WIIA 2RRAA 1G2EA 3J7ZT 2DO0A 2HGLA 1A7GE 1JJ4A 1X5TA 1U2FA 2X1AA 1VQ5S 2DGXA 3CC2S 2M9KA 2DNKA 2DHAA 2E5HA 2M8HA 2E5GA 3RW6A 2RRBA 1WEXA 2OJ3A 2GO9A 1SJRA 3I55S 3Q2SC 3EX7B 2OTJS 4RU2A 1JJHA 5D78A 2RS8A 3BEGB 5LXRA 1X0FA 4LMZA 2KFYA 2CPIA 2KI2A 2XNRA 1N54B 2CPFA 3NMRA 2VONA 2YH1A 1VC5A 5BJRA 2MKHA 2N3LA 2X1GA 2G4BA 1WEZA 3VAFA 1VC0A 3K0JA 2E5IA 1UW4A 4W90B 3CD6S 2LEAA 3UCGA 2AYMA 2DGQA 3LPYA 2DISA 2E44A 3DXBA 3CCMS 2LMIA 3MUMP 3UD4P 2B0GA 1M5OC 1DRZA 3VAMA 2J0QD 3BS9A 1WI8A 2MQPA 3CF5Q 3CCSS 2I2YA 4YUDA 2FY1A 3U1LA 2O3DA 5GVQA 1UFWA 4C0OC 1WF0A 2MKKA 1ZZNA 1IQTA 4CH1A 2X1FA 4F26A 3CPWR 1KC8T 3S6EA 2KHCA 3CCJS 2RS2A 1R8PA 2M4MA 4IOAQ 2LCWA 1QVGR 2U1AA 5EN1A 2XS5A 4YOEA 4WFBQ 2LA4A 2LKZA 2MQMA 3PIPQ 2MY8A 2JX2A 1S72S 2KU7A 2BZ2A 1OO0B 3S8SA 1WHWA 4PKDB 1U1KA 2KRBA 3NNAA 2DNGA 5FJ4A 3NS5A 1X4AA 2VOPA 5H1SV 2KYXA 2F3JA 1P27B 2CQHA 3UCUP 2MZ1A 5CXTA 2ADCA 1NJIT 2CQIA 2XNQA 3MD1A 2MY7A 3MD3A 2CQDA 5IM0B 1U1RA 3MXHP 3BO4A 2GHPA 3V4MA 1YHQS 5LJ5Y 3G8TA 1M5VC 3VAKA 1WI6A 2DGWA 2ADBA 1AUDA 2MPUA 3HHNB 5CYJA 4TLQA 1NO8A 3UE2A 3P5TL 2MJUA 2NZ4A 2KG1A 1BY9A 2KT5A 2KVIA 3CCRS 1U1PA 1SJ3P 1FXLA 5MLCV 2DNHA 5DM7Q 1OPIA 1VQ4S 5IM0A 3ZZYA 4U67Q 1A9NB 2ZJPQ 5HO4A 2XS2A 2DNOA 1K9MT 4IUFA 2MGZB 1VQLS 3UWTA 1M5KC 3Q2TC 2JWNA 2L9WA 2OSQA 3LQVA 2KM8C 2ZJRQ 1Q7YT 4UY8T 1VC6A 1FHTA 4WCEQ 2QFJA 4WKRA 3US5A 3CMES 2V94A 2MHNA 2FPHX 3VF0B 3UD3P 2OIHA 1RKJA 4TU7A 3G71S 5LSOA 1HD1A 2J0SD 3N9UC 1KOOA 4QQBA 2MQLA 2ERRA 3BO2A 2LQ5A 4C7QA 2DGUA 1WWHA 2MZQA 2MGZA 1YI2S 1WG4A 2M70A 1U1MA 2VODA 2XSFA 4OZ0A 1KQSR 3MOJB 2CPJA 4P6QA 2XS7A 5LXYA 4IO9Q 5DDPC 2A3JA 2DNPA 3IRWP 1FO1A 1WTBA 2QEXS 1D9AA 4OZ1A 1X4HA 3B4MA 2EK1A 3RW7A 2QA4S 1VQMS 1N88A 1K8AT 2M0GB 1M1KT 2HVZA 2PE8A 1X4CA 2M52A 3I56S 2DGTA 2JVRA 3ULHA 2CPYA 1M90T 1KOHA 1F9FA 2HGMA 3D2WA 2G1DA 1S79A 1WF2A 2F9DA 2DHGA 2LXUA 2VOOA 5DETA 4QU6A 1PGZA 4CIOA 1SJFA 4PR6A 1HL6A 1DHMA 3CC7S 3J7YU 2DH8A 2KN4A 3TO8A 1Q86T 4TU9A 2DITA 3MUTP 2DH9A 2MMYA 2DNZA 1WF1A 2FC8A 1VQKS 2RQCA 2I38A 3THPA 4QU7A 5DM6Q 1H2UX 2MKSA 2CPZA 2DNLA 1RK8A 5GAHU 2DK2A 3G96A 1X4EA 3CCES 1WG5A 1FNXH 1YJNS 3L3CA 2MZJA 4FXVA 3THTA 2N3OA 3SMZA 4W92B 2OTLS 2DNRA 5GMKa 1B7FA 5D77A 1DBDA 2FHOB 3CMAS 2XB2D 2RVJA 3EGNA 4Y0FA 1X4GA 1H2VZ 1HD0A 4PRFA 1NU4A 3G8SA 4CQ1A 2DNYA 2HYIB 4Z2XA 1QM9A 2N82B 5DDRC 2DGOA 1DZ5A 1YITS 1VBXA 3CCUS 2CQPA 3VAHA 2LA6A 2BOPA 2U2FA 2JRSA 4QPTA 4V19X 2CQ0A 2LEBA 2KRRA 2RUGA 3U1MA 2D9OA 2FC9A 1FT8A 1OWXA 3NS6A 2AYBA 4EGLA 2OSRA 3SXLA 5CA5A 2CQBA 2CPEA 3NNHA 2RNEA 3CC4S 1VBZA 2LYVA 4F25A 1QVFR 2EK6A 2MSSA 2MQOA 2MB0B 2MSTA 1YWXA 1ZZFA 2MZTA 1VQNS 3FEXB 1H2TZ 2DO4A 1R8HA 1U6BA 3R1HA 3G9CA 2MKCA 2CQ3A 5HL7Q 2D3OR 4WF9Q 2UP1A 1D8ZA 3HI9A 4J5OA 4C4WA 2L08A 5GAEU 2MQQA 1FJEB 2KXHA 3JB9k 1VQOS 1Q82T 4IOCQ 5ITHA 1W2BR 3S01A 3CXCR 3VAGA 3PIOQ 2DNNA 2KH9A 2RU3A 2EVZA 3CUNA 2SXLA 2K3KA 2J8AA 1YJWS
chains in the Genus database with same CATH superfamily
4CO1A 1WELA 4F04B 1I6JA 2K3IA 4YB5A 3O2IA 2AYGA 4RW6B 4ZPCA 1HI8A 2CQ1A 5CQGA 1VBYA 1FJ7A 5F8LA 3LTOA 4K4TA 3I0RB 2PA8D 1C0TA 2PMWA 4CTAA 1BE4A 2ZKUA 2VG5A 2RDDA 3AD7C 2XTJP 2IVYA 5D3GB 2CPXA 2WOMA 1LWFB 3EZOA 3MOZA 4LREA 4EO6A 2I6WA 1FNMA 2GMHA 4IYQA 4P72A 4FYVB 3ZC4A 2EG1A 3IC1A 2L3MA 5D4LA 2V2QA 3QGHA 3DGPA 4DSKA 2FYXA 1VRTB 4KE5A 3NAHA 5DDQC 1VRQC 4FYXB 4YQWA 5GADU 3JQKA 5A8WA 5KT5A 1X5PA 3IAM9 2HAIA 3KXDA 2AEJA 5ETKA 1XMOF 2AGQA 2RDJA 4ZMMA 4DSIA 1VIOA 1TL3B 3C2PA 3NNCA 4ATNA 2ZHBA 1Y00A 4DFMA 1BWVA 4XPCA 3DOLB 3OT9A 4OYMA 4M5DB 2CJYB 1FRKA 4NZ0A 3G2XA 3HHLC 4AD6A 1VQPS 2EI5A 1NDKA 3GIJA 3QJPA 2DNKA 4X62J 3GIRA 4HACB 2EEYA 1GH8A 4NXNF 2RS8A 2AV5A 1X0FA 4UOGA 4JI1J 1YG0A 2FLNA 2G4BA 5KT4A 2DGQA 4DEZA 3DLKB 4NLPA 3QGGA 2H5JB 4FPRA 5L46A 1M5OC 3BS9A 3GJQB 2GVDB 1MWZA 1AT1B 4O4RA 1SJ1A 3E2EA 2QZ8A 4H4MB 3PHTA 4C8LA 1NHKL 2EFOA 3HSGA 4IOAQ 1QVGR 2Y0SD 2U1AA 4FNHA 4DSEA 1ZBTA 4OJHA 5L1KA 3NNAA 4F36A 3A3OB 2KYXA 1YLXA 3W5YA 2CJQA 4HL9A 4LF8J 4X4QA 1LOUA 4RWWA 2EW9A 2MY7A 3BBCA 3V4MA 5A0YA 3D3BJ 4ICLA 4CNYA 1NK8A 2VASA 4GVBB 2WSCC 1UTAA 2OPSB 1CQNA 1H3DA 4NI2A 2ZWPA 1U1PA 4ID5B 1X8DA 5FIIA 1VQ4S 2IA0A 1RT2B 2VKRA 5KFOA 4KHRA 2CYYA 3H59A 5DQGA 5K14B 5C5JA 5U47A 2PI4A 1C4CA 1RKJA 5IC4B 3TAMB 1IVZA 1MN9A 2MZQA 2BJDA 4OZ0A 1KQSR 4KGVB 2CPJA 5KFYA 1LNQA 4ED1A 2UXBF 4OYIA 3P4UB 4B3SF 4EBCA 4JI4F 5HN0A 1R6YA 3HSJA 2JVRA 3ULHA 4ZPVR 5KG6A 1GFWB 1TL4A 2IC3A 2G1DA 1S79A 2J7UA 1ZETA 2F9DA 4ENOA 2ASYA 2X3DA 5T41A 3HF5A 1N6QB 3FKBA 5HBMA 2JDJA 2Z4PA 1NUEA 3CDWA 3MUTP 2RQCA 3GFHA 1WC6A 3KLGA 1KLMB 1FDDA 5KAKA 2I8EA 2H4WB 4X64F 4ECXA 3HHLA 1M5SA 1FRJA 2IJFA 1CJVA 2V9KA 4ED7A 2JC0A 4C8ZA 1DTTA 1B7FA 1NJZA 1X4GA 2HURA 2DNYA 5H9EK 5EWFA 3NXZA 3CCUS 3BBFA 5LT5A 1RAAB 5E3AA 1FT8A 3CCTA 3SQGB 2J7WA 4P52A 4MFBA 3KJNB 2C42A 3MM8B 5SUHA 4KV8B 1VQNS 5A8RA 2F8MA 1H2TZ 4I4BA 4RW7A 4MH8A 1D8ZA 1GK8A 4DLEA 1EJ7L 1ZA1B 3M9MB 3MAAA 4DV6J 4ANEA 3CUNA 3TEHB 1PSDA 2W7OA 2YKNB 1F5AA 2KG0A 1RWXB 1S6QB 4DN0A 1IBLF 3JYTA 1MN7A 5JVGQ 4UOFA 3G6VA 2JNJA 2CJKA 1YQHA 3EPGA 1ELOA 3N5BA 3G82A 3ET6A 1JLAB 3EDQB 3W62A 5K5MA 4NLDA 3M2UB 2MYFA 2BV3A 2VA3A 4MT1A 4CYUA 2JVOA 3I87A 2M88A 4RO0A 3QLHB 3JSYA 2I9SA 1OQ6A 2M8DB 1YTYA 1TUWA 3VAIA 1Y4ZB 5EWEA 1BLUA 1WHVA 4K59A 3QT8A 4YN3B 2QLWA 2PEHA 2UUTA 5F3ZA 1KS2A 2R4FA 5KFXA 4OL8A 4O3SA 5ETRA 4OYPA 4E2FB 1N4LA 2F8HA 5KFJA 4GVLA 1KRPA 1DTQB 2HNDA 2XMVA 2W4DA 1REVA 2Z2LA 1OIAA 1KTQA 5C25A 3UN5A 3Q8RB 1O0PA 2VZ9A 3A12A 2K1RA 1IBKJ 1UPMB 2CZVC 5IWAJ 2W9CA 4P74A 4PYAA 1F5CA 2KZMA 4KPCA 4DUYJ 4LRFA 5HP1A 2HGLA 1R8BA 1A7GE 1JNRB 2AJ2A 3ZZPA 1BQNA 1SH2A 4LMZA 2WZ1A 1N54B 1S1TA 4DL3A 3K0JA 4ZCKA 4CO3A 3MUMP 3AOAA 2XGQA 4B9MA 1YRXA 1FE0A 3U1LA 4ED3A 1OY6A 3KK2A 1CLFA 4LR7A 4YR2A 2X1FA 2A6OA 1W7WA 2RS2A 4UT4A 2BJEA 4Z7CA 2LKZA 4N76A 1CJKA 2JX2A 3I4HX 4IFVB 3BSNA 2V63A 2DRBA 5E33A 5IS2A 3ZTPA 2QE5A 3GPAA 2RILA 2NYHA 1QAYA 4USKA 1TL7A 3DRRB 4OZ3A 4LSZB 2MLXA 4QWCA 4FF2A 1KN6A 2OPQA 1HPZB 3PO5A 4ID8A 4ZVEA 3KDNA 4OI3A 2FLLA 1RTDA 3BGFA 2AU0A 2IBOA 2UUAF 2YNGA 2KG1A 4C8KA 1SI9A 3RBEA 1TK0A 3IGVA 1U45A 3QRQA 1CS4A 2IY5B 3KLFB 1D9DA 4MK7A 3A1YG 5HLFA 2QLJB 1VC6A 2D69A 1EKSA 3BGOP 1AFIA 1KVJA 3IR6B 1F1BB 4G1PA 2HHHJ 1NMEB 1IWGA 3MEKA 1RT3A 2DT9A 4NCBA 3BYRA 1YZ6A 2D74B 3BM7A 4K50A 3ZTOA 3OR1A 4CLZA 2UUCJ 5EWGA 2QA4S 1VJWA 1RUSA 2KT3A 4J9OA 4YB6A 3H40A 4F0HA 1R27B 1TVRA 2ILZA 2GIQA 3OVBA 2VOOA 5DLFA 1RACB 3SCKE 5KFCA 3QO9A 4DR4J 3TO8A 3VVUA 4TU9A 1UA0A 2DH9A 2I5JB 1JLQB 2E7VA 5HROB 2AX1A 5K8MA 2IYIA 4QU7A 1NDLA 4J7CA 4ZP9A 3OD2A 2W8LA 4W4MA 1RKIA 4LF4J 2UUBJ 4OLPA 2ZVSA 1UVJA 5HQMA 3SMZA 4DR7J 3R2CJ 1LWXA 1QUPA 3QRRA 1FVQA 1H2VZ 2VB6A 2C22A 2VF3A 3KMQA 5DDRC 1DZ5A 2VBYA 1HWJA 2OD4A 2G0JA 3H2LA 2RUGA 4HH0A 1J2VA 1XTZA 5KFFA 1HYSA 3R5CA 2HNYA 2CPEA 2RNEA 3CC4S 3PNIA 1AW0A 2D3OR 3M1VB 4DCOB 4ECRA 3DXSX 3G6XA 4ELTA 4JI0J 1MG7A 2NPIA 3MZIA 2DCUB 4K4YA 3BBBA 1FDNA 2K3KA 2J8AA 1YJWS 4YB1P 3SSRA 3MMCB 1EETA 3NEKA 1LWEB 3G8QA 1VYAA 1RCOB 2HVIA 1HBNA 3CJ5A 5LOQA 4ECQA 2GS8A 4ZLJA 2XGPA 1WC3A 2Q79A 4KGKA 2KM8B 2MQNA 3O44A 2UXDJ 3C16A 4DPWA 1N48A 4DMZA 5BYRA 1VS3A 4C8OA 1YZ7A 3K58A 2ZNYA 2AYEA 2LXIA 3ILJA 3MM5A 5DG7A 3PVXA 4LSLA 2GAGC 2VQEJ 1JLBB 2EPIA 1RA6A 4DSLA 2DYAA 2X1BA 3EICA 1N8RT 1KONA 2C2ZB 3AJ2A 4F2SA 2R7XA 1LW0A 5E2QA 3T5JA 5J2NA 3F0NA 1P9QC 5C7PA 1V3ZA 3D1OA 3S7RA 3K8VA 4WFNQ 2FVCA 2HZCA 3IWNC 2Y3YA 4A8YA 3M2VA 3PW4A 2FHMA 2BDPA 5D4NA 4C6AA 4C3LA 4DR1J 3KK3B 4LT6A 1B0PA 3CJ0A 2AKWB 2QFIA 3TUJC 3RG6A 2QJ3A 2VPYB 4LQ9A 4EZ9A 1WC1A 3M2RB 2DHAA 2RRBA 4HT5A 3I55S 5D78A 3BN7A 2BOAA 1U2RA 1B0TA 3PYDA 4PWDA 4EMDA 3POTB 3VWSA 3C15B 2QN6B 2B0GA 1FX2A 1NH8A 1T9TA 2UXDF 4IOBA 4N47A 5J1EB 2R7VA 4ILRA 2HMIB 2W4CA 1ZTWA 1OSCA 2O3DA 4I2QA 2Q6BA 1H72C 1HNXF 1Q8BA 2GV1A 2FJBB 5D0RA 4DZDA 5EN1A 4YOEA 4M95A 2ZDPA 4K2XA 1H98A 2KU7A 2CADA 2Y1LB 2AEFA 5HVGA 2ZZTA 3DRXA 2HHPA 4JI2J 3FBBA 4J9VA 1TV6A 3UDLA 5CXTA 2CQIA 2WHOA 3PYGA 4O0NA 1Y5IB 3FC9A 1U1RA 3MXHP 2ROPA 4X66F 2E1AA 4U9RA 2Z8QA 3I6PA 3U1NA 3KDOA 3KUEA 5HJXA 2DR9A 1NO8A 4LF6F 3P5TL 5G0RA 2IJRA 2OHDA 1YJRA 5B7WA 4TLRA 2RB7A 4BHQA 4IR9A 4OV1A 4C3KA 2J6UA 3UDVA 5KFNA 1FFGB 1NAQA 4BCAA 2W2PP 3GIKA 2A10A 3FK4A 3ENAA 1FKPB 2OIHA 1YJUA 3OSNA 1S49A 1T9UA 3BO2A 4C7QA 5JXSA 3T1YF 3LPEA 3FBFA 3BGRB 4M5HA 3GSIA 3M8YA 1T3OA 3LP0A 2ZUGA 5HVFA 3PHEA 2C2RA 1K8AT 2C28A 1C0UB 4XIUA 1N56A 2HGMA 1SC4B 2ZH4A 5IT4A 2V34A 3PCOB 5T7LB 4X4VA 3R5DA 3ENQA 4NXMF 4YEAA 3LUYA 2Q66A 2FC8A 1KHVA 3THPA 2EKNA 3VGUA 3LAMA 4F4ZA 3G87A 2HFZA 1RHJB 1Y9OA 1O5JA 1R7IA 3K5MA 3G96A 2KHDA 1U4BA 4OX9J 3THTA 3MPYA 4W92B 2YX7A 3TQ1A 1QTMA 2PGCA 2YWEA 1HD0A 5I3UA 5DZ7A 3PW5A 2G2OA 3SIPB 1DQ8A 2ZHAA 2KRRA 4CLFA 2PO4A 2J6TA 3NS6A 4Q8EA 3HT3A 2AYBA 2CJAA 2Z2ZA 3SXLA 4YHHF 2QLFB 1VBZA 5BYQA 4H54A 2R8IA 4USJC 2QA2A 2ZH7A 4URQU 1BGXT 2BE7D 1HNZJ 1TQLA 3BB5A 3BKFA 5GMDA 1S10A 3O5TB 2KH9A 2ZE2A 2RU3A 1RQ0A 1RT1B 4WP9A 1HMVA 1XBWA 2QC3A 2XMTA 4O4GB 3GILA 5A6WA 4DQPA 1WKLA 3TZWA 2J76E 4FDFA 4ECVA 5L9XA 2P5VA 4IFYA 3JTOA 4NMXA 1BHNA 5F8IA 2YNHA 3TR5A 2GMJA 1R8AA 3CD5A 3I9V9 3DLHA 3FBEA 3BSCA 5IZHA 1FRHA 2ZWOA 1VQ7S 3M8PB 3OVAA 4AL7A 4LF5F 2NPFA 2XZDB 1E6YB 2PIIA 1X4BA 4Q8FA 3NCRA 2GZOA 1P1LA 4OJ3A 1T9WA 2WCXA 1WG1A 3M9OB 3KFWX 2Y9HA 3DM2B 3FSYA 1NPPA 3QJLA 2Q3PA 1X5OA 3GIMA 4OQJA 1N32F 4ZCIA 3TP2A 2BRKA 3B82A 4RW4B 1KD1T 3OUYB 4WE1B 5D6GA 1YJ9S 2IM0A 5SZTA 4OI6A 2FVQA 1U1LA 1BQMB 2WVDA 4WIIA 2PFDA 1G2EA 5HJYA 1WC0A 2LEPA 1R0AB 2BJ7A 1JJ4A 4A47A 2V69A 4LUBA 1C0TB 4M5MA 1WEXA 4DHVA 2NQPA 1C1CA 1S0VA 3H20A 2WVFA 1OJ4A 2HQDA 3RBZA 2VG6A 1JXEA 4KKOB 3OR2B 2QYCA 2DISA 1H73A 1PYOB 4D3HA 1NJXA 1VRUB 4WBFA 1HQEB 3CF5Q 3CCSS 4YUDA 1SL2A 2CA9A 4WK3A 3GFYA 4C0OC 4EEYA 4LBPA 4J9KA 2IVMA 3G86A 3TJAA 1RDRA 1T9XA 4QPXA 2UV8A 1S7IA 4ZN3A 5A8WB 4Q2LA 2GAHC 1EAYC 3J7AN 3D0GE 2ZH5A 5KG0A 4RW8B 2BE2B 4KHPF 2CDQA 2ZC3A 2VQFF 2YXLA 3BO4A 1EP4A 3LP1A 3HVTA 4B17A 4WZQA 1LWCA 2WSEC 1AROP 1S9GB 4P2MA 4XDCA 4YR0A 5AT1B 3TARA 4M5JA 4CLYA 2P6TA 4QWDA 1I94F 3W2WB 3F73A 1HNIA 1LW2A 4QW9A 2R7UA 2ZJPQ 2E9ZA 3KWMA 4YDXA 5D4PA 4ZN1A 2ZJRQ 1Q7YT 5G4DA 1GXUA 2FB0A 3DDNA 3M8RA 2RKIA 3ZZOA 4OYWA 5D0HA 4B3MJ 4LFAJ 1HD1A 8RUCA 1OQ3A 2MGZA 1NZAA 2BQRA 2HVHA 2ZH6A 1HNVA 4JV0A 4AQYJ 3HVAA 5DDPC 2A3JA 2DNPA 5A8KB 1D9AA 4Y2AA 3L7PA 4JI8J 1TELA 4CLSA 2DR5A 3C14B 2WRMA 2YX1A 5EX3A 3ONQA 2XWYA 2M52A 1QAXA 1TKZA 3Q23A 3I82A 1F9FA 1HW8A 2BW7A 1WOSA 4JI3J 2NUHA 4WFYA 3NCPA 4M5KA 2OEJA 3J7YU 3DMJB 4Q5VA 3VZIA 3PTWA 4CT8A 5I42A 1NLKL 3RAQA 4XO0A 1WOPA 3V4IA 4DL6A 4IG3A 1KQGB 3SZ2A 1RK8A 2HHVA 6FDRA 2BQ3A 1REGX 4XDDA 1Y5NB 3PR5B 3V2UC 3PO4A 2V2ZA 4DS5A 3OXGA 1TFYA 2J5AA 3PW2A 5DJBA 2A18A 2RVJA 4HTIA 5ETVA 3I0SB 5F8GA 4JYAJ 3CJQA 1WNEA 1Q16B 3LP2B 2LA6A 4KPYA 3IRXA 4ZJLA 3X3UA 2BJ1A 3FCVA 1KVIA 4K0KJ 3WIUA 2HAFA 4WJBA 2CWKA 4IH5A 4CZCA 5LSRA 2XYHB 3WZ0A 5ETSA 4F25A 3TEGA 5E3RA 1SQFA 3SCLE 4ES1A 4LFAF 3UFCX 2VBZA 1UZDA 2OUGA 3LGHA 2HHSA 2IC3B 1YBTA 3NOCA 4ZVUB 1UVMA 1YX2A 3UVJA 1JX4A 3E8OA 9ATCB 4ELUA 2EVZA 3W9IA 5HBMB 3V6DB 1RAJA 2YH0A 2LECA 2HGNA 4USTA 1MU2B 1A0OB 1JLFA 3GB0A 3LGMA 4C0HA 1ZS6A 3Q89A 3EWGA 2XCAA 4N5SA 3PX4A 1DURA 3SDEB 2AP6A 2FHJD 4O44A 4TYBA 4A8SA 4DR6F 1NXIA 3TVKA 2YX4A 2G2YA 3RAMA 4M1KA 3I5BA 1EHWA 2VG7B 3TYTA 2E7WA 1VQ6S 4J9MA 3RB3A 3EMTA 3B6BA 4X65J 1YDLA 1W2IA 1VBKA 1W26A 2VPZB 4OHVA 4ZCMA 2KXNB 1HQ2A 4DV3J 3VHQA 5H9FJ 5A8RB 4E0DA 2ATCB 1PKUA 4Z37A 4CDIA 3VCDA 1MMDA 4DL2A 1D3WA 3H42A 3GR0A 2YY3A 4ED2A 1WJ9A 4J9SA 4QCLA 1Q79A 3JSMB 3GONA 2B4UA 3T5LA 4I69A 4DX8H 2FJEB 2GMLA 2WVCA 4DV0F 1NM2A 3FBCA 3OTOJ 5EDWA 4UF4A 5KFEA 2ZD1A 3BJYA 2CPIA 3C6TA 2B7CB 3VAFA 1V3SA 2E1PA 3CD6S 3CE8A 4QOTA 4CYUB 5RUBA 2LMIA 3MCSA 4NLVA 1DRZA 1UCNA 4HHHA 5CYQA 3BREA 1HWKA 5I3PA 1N36F 3U7JA 4DFKA 3AXMA 3Q22A 2JLGA 2W2MP 1R8PA 3CO0P 4HEA9 1RLCL 2B9XA 1LXJA 1A6LA 1S72S 3N5FA 1U24A 3R6GB 4PKDB 3HPOA 4XPEA 4HKQA 2QL5B 4FS1A 5CCMA 5C25B 4DX6A 2VFTA 1IWAA 2K1RB 3SEOA 2C2EA 4KGZB 5HMZA 3D0HE 3VGTA 1N5YA 2EFQA 4NX9A 1JLGA 1TTHB 5JUMA 3QT5A 3HFZB 2F4FA 3HHNB 5LMUF 4IQMA 4HYKA 4NASA 2A2DA 3A8EA 2KT5A 4PCQA 1Q95G 4JI6F 2B8QA 2GGPB 4U7UD 1HBUB 2R8HA 4PABA 4OFZA 3W3SA 4YS2A 2Z56B 1M5KC 4MK9A 4A4JA 2HS4A 2C1EB 2ZVIA 2HQFA 2HHUA 4D3GA 3AOBA 2IRXA 3FRZA 3US5A 3VF0B 2AJ0A 1PJ6A 3HMJG 2XMKA 2BR0A 4FBTA 2M70A 3NBPA 3PFOA 3I32A 1CJUB 4FKYA 3MOJB 2XS7A 2CJXB 3ETOA 2NXUA 2IDEA 3M30A 3D67A 1FO1A 1UVKA 2DBBA 4WK1A 1JQGA 4CRJA 3NRBA 4P73A 4LF9J 1MW7A 3N6NA 3JTPA 4C98A 1RYRA 3K17A 2Y8YA 1G1XA 2OPQB 2V4JB 1NBEB 3I96A 1FTRA 4A8QA 4JOUA 4EYIB 1HHTP 2E5LF 2GNKA 5C42A 3SBMA 3PY8A 4X84A 3QMQA 1SIZA 4ZHRA 1WG5A 2CVEA 2RHQB 4XTTA 5CCLA 4E98A 5D0EA 5GAEI 3BGLA 4KB7A 4A48A 2HHQA 4DDFA 2FDNA 1DBDA 4PRFA 3G8SA 3CJKA 4J9RA 2RSQA 1JB0C 4LR9A 2UVVA 1RT3B 1TKXA 2VFRA 3DOMA 1UWBA 2JFDA 3L9ZA 2W8KA 1GX6A 2BM1A 5AXMA 5H9FK 1J5EF 3OR1B 2POKA 3ITHA 2MQOA 4YR3A 5B08A 3W1YC 4LR8A 2Y1IA 1G4CA 2ZH2A 4Q0BA 4PG7A 3C6UB 1S6PA 1IKVB 1GXLA 2H51B 2C3PA 3JB9k 4HR2A 5B0BA 4R5PA 3CXCR 4C11A 2N4CA 2PD1A 2B5JB 2G1HA 4DSJA 5ETMA 4DR3J 2CQ2A 4K5RA 2F1FA 4EBDA 3H5UA 1TP7A 3K5OA 3JTNA 2H1YA 4GKKF 5F8HA 3MFIA 5B0CA 2HRYA 3KLHA 2NREA 5B0FA 4P2SA 4DI6A 1F9EB 3M6WA 3R27A 2NUUG 2DVIA 4KH1B 1R31A 5A6PA 2WBRA 1URNA 2BKNA 4ED8A 4WYWA 1SJQA 1C1BA 4YY3J 2DIUA 5T14A 2HNYB 2YKMA 2KO1A 4K5SA 4QIEA 4RUCA 4A8FA 3G4SS 4F3OA 3CJ8A 3DYAA 3TA1A 2F5GA 2HFUA 3EXCX 1V3RA 1S4EA 2NXNA 3V81A 2V68A 4ED6A 2ASJA 2DNQA 4I7FA 3MUVP 4FVCA 2C2DA 4B3OA 1X4FA 2OFGX 1IKWB 2AGPA 1LXNA 1NB7A 1NK0A 5KG2A 4ZKAA 1V5IB 2CKWA 1SC3B 4F4XA 1S48A 2ZH8A 2V2VA 2R2RA 4X4NA 2E5HA 4L74A 4RU9A 4NZ6A 4J9NA 5AXKA 3C16B 1F3VA 1AZSA 3W61A 3RR8A 3RRGA 1JJHA 3M32B 1XMQF 1KKHA 1M1GA 4DR5F 2XNRA 4CM2A 3CWJA 3KJVA 3KHGA 2YH1A 3ILIA 2E5IA 3A4TA 2GIFA 2E44A 3UD4P 4LSLB 4NA2A 4WP3A 3N0VA 3VZHA 3TUZC 3T9ZA 3OL7A 3N28A 1QSSA 2AGOA 1WF0A 1IJFB 5HQLA 2NSCA 1FERA 4NLQA 2W2NP 1H7XA 2B43A 4B08A 3NS5A 2A0FB 3AB2B 3KNGA 4XAKA 2ILYA 2B51A 2ZBRA 2HPUA 4J37A 3GJRB 2O1PA 2HWTA 4AYBD 3R5AA 3D66A 2CIMA 3G8TA 4OX6A 2DHHA 4ZPTR 3KNAA 4UQGA 1O8BA 3RBXA 4KO0A 4GMKA 3MECB 3CJSA 1SJ3P 2GQCA 5MLCV 5DM7Q 1IR0A 1F2GA 4PPDA 5IM0A 3DLGB 3IBCB 2ZBCA 2DY1A 4RNOA 1MMNA 2ZZNA 2JWNA 4UY8T 3QFWA 1IKYA 3DLBA 1MROA 4DR2J 1XQIA 1IBMJ 5HI7A 2OELA 2XLJA 3OTBA 4IO1A 3N6MA 4JI5J 4B02A 1R0BG 3F56A 2V50A 2E29A 2D41A 5ADZA 4LFCJ 3OSPA 1N5SA 1U7LA 4DN9A 4N41A 4ZPDA 5HK4A 1RT5B 4G1QA 1Y11A 4E8UA 4ER8A 4OI4A 2CPYA 1DY3A 2FJWA 1JWWA 1WF2A 1AA1B 3PJ9A 3FCWA 1PGZA 3C3LA 1RWPB 3V6KA 1Q8IA 2H4YB 3UI3A 3FNNA 1DHMA 4HDHA 1PILA 1ITPA 4U95A 4MK8A 2JC1A 2B6AA 2XSJA 3QQCD 3OPKA 5F9NA 4F3QA 2KT2A 2CFXA 1FDAA 1X4EA 4DV7J 1Q5VA 5DLGA 3IG1A 2IYGA 3CJ4A 3PRVA 3U27A 3CMAS 1AYEA 2QMUB 3FJ2A 3EGNA 1F2HA 4NLGA 1BWEA 5HMWA 1FKOA 3W5ZA 2O01C 2JEJA 1TKTA 3GG1A 4J90A 2QMXA 3PZPA 2CQ0A 1WUUA 2D9OA 2MTLA 3IWXA 3I31A 3N6LA 2UXCF 2ACMA 1IKXB 3MEGA 3RUBL 1N33F 4ZVTB 1TL1B 1LV5A 2MZTA 2RQKA 2HK3A 2DO4A 1ZAVA 5KFPA 2QYGA 2R3VA 4ZP8A 3D7SB 5E5NA 3O8WA 4WF9Q 3FRYA 2OH2A 3IXQA 2XMUA 1F5BA 3W2VB 3GLJA 4EU0A 4NRUA 5KT2A 3J80Y 2YPYA 3MM6B 4DL7A 2F7VA 1JMTA 4WXWA 2EG2A 2V67A 1X9SA 2YVSA 1Q4RA 4WU2A 2RF2A 3HSDA 4DFPA 3R7BB 4BC9A 5AE3A 1X7VA 2CZ4A 5KT6A 4RW6A 4TY9A 1H6KX 4ZVQB 1QE1B 3VTIA 2Q43A 2DH7A 3CCQS 2XHCA 3H4BA 4BS2A 2Z0GA 3I0RA 1ZA2B 3QJJA 2D3ZA 2KXFA 1HLWA 1NRKA 1XERA 2IAJB 4R8UB 4LFBJ 3MPWA 3JAMU 4X4UA 5CAAA 5D3GA 1NK4A 2XMJA 4WPAA 4ECUA 1LWFA 5HATA 3EPIA 2NXEA 2QA4G 1PC5A 4RUHA 4ERDA 4EBEA 1U1NA 2ZE2B 4L73A 2D7SA 2ZM6F 4CH0S 2R42A 4CLLA 3PKYA 2IM2A 2CNOB 1VRTA 2UU9F 3IP0A 2BE9B 1VQ8S 3GE9A 3V5RA 1FXRA 3P8BB 2HFVA 3MM7A 4KH0B 4Y6IA 3JXOA 4ZVGA 3B8HA 3VR1A 5FDLB 3PX0A 4ZITA 3K89A 5J2MB 1GMWA 3KMSA 1HHSA 1TL3A 3EX7B 1VK8A 3CNQP 4PXCA 4M5DA 1VC5A 5F8MA 1VC0A 2DEJA 2V5HG 3ISNC 5L1IA 2PT0A 4DV4J 3AY0A 4MIWA 1HR0J 1WSRA 3KHHA 3MPVA 4N56A 4MJKA 1AFJA 2EXUA 2NS1B 3CPWR 1KC8T 4DQRA 4ANDA 4KGMA 4KSEB 3SSSA 3IA0A 3DLKA 2MQMA 4QR1A 1Q5YA 1RT6B 1OO0B 2GJFA 2GVDA 2WTFA 2XY6A 4HT7A 2V6AA 4OYOA 1OPZA 1OY9A 3HSZA 3GIIA 4H4MA 3UCUP 3MEEB 2XI2A 4JI7F 3DN9A 4EUVA 3RJMB 2CQDA 1FCAA 4DL5A 2NCKL 2R8KA 1RTJB 4MKYA 1VDHA 1Q8LA 2BKOA 3KLIB 2K7KA 4DV2J 4USMA 3ZZYA 5KOXA 3OJSA 2XS2A 1D8YA 1WACA 4G65A 3GFZA 4WFXA 3HFVA 4LF2A 3PJXA 4WKRA 2RU9A 4UW2A 2OPRB 2V94A 4CWBA 4URGA 4WZMA 4JV5F 4DL4A 4GVBA 2O5DA 1TFWA 2OPSA 3SV3A 3NLCA 3M4XA 4ID5A 1P8GA 3KLVA 1KOOA 2ERRA 5EUHA 2DGUA 1RT2A 1U47A 3DRPA 2QG9B 5GAHI 5IC6B 2WSFC 3K57A 5K14A 3K8WA 1DLOB 5K9FA 4EFAC 2VUGA 4CO2A 2M0GB 2HVZA 3HZEA 3TAMA 2DEIA 3HJFA 4PQUB 3PW0A 2W7AA 5AJ3J 3IMQJ 4PR6A 2YNFB 4ZS6A 1LWCB 4OHWA 2P9EA 1VQKS 2J6SA 1RWOB 2OLWA 3TX8A 4DG1B 1S6OA 2G0IA 4LF7J 4N8NA 1RBAA 4FXDA 3VGSA 5ETOA 1SB6A 2B4VA 2MZJA 2HKEA 1N34F 1N6QA 2YPZA 1TAQA 4LSNB 1XWLA 2HYIB 4Z2XA 1KLMA 2KJWA 1B0VA 3OL8A 3EVOA 1YITS 1I51B 1TK5A 2VH7A 1QTNB 3QAUA 3BQ1A 1WOOA 4H4KA 5A2QY 4V19X 2LEBA 3CJ3A 3EYZA 4X4TA 2QGFB 1OWXA 3D28A 2GHWA 4BC7A 1HNWF 2FVPA 1ZZFA 2EFVA 3BH7B 1S9FA 1U6BA 3EXYA 1PJ7A 1S0NA 3FUYA 3A13A 4ZP6A 1TKZB 5GAEU 2MQQA 2KXHA 4QIGA 4OHXA 5KFQA 1NJYA 3SQGA 3T1HF 4DCPB 1EQMA 3MFHA 3IM9A 3MM8A 4KV8A 5I42B 5KFHA 3V4IB 4IG3B 1B7YB 4F4AA 1JLEB 4JV1A 1U09A 4DXLA 1YRUA 3GV5B 3BGUA 5GAGI 2VKZG 2JLEA 4R0JA 2A2CA 4WU3A 1RBLA 2ACYA 3MURP 3Q8VA 4IG0B 1S6QA 3FSXA 1VQ9S 5BR8J 4KHMA 4X4SA 1UVIA 2CQGA 4OJGA 2VPXB 4MIBA 4FXWA 3MMBB 3CCLS 4RUBA 1JLAA 2RQ4A 1PIEA 3N4WA 2ZEJA 4CLPA 1JK9B 3M2UA 4ES2A 1S1VB 3CEDA 4ZCLA 2J7KA 4CLKA 1T0TV 4NCGB 3BV8A 3LH2S 4DPOA 3MDFA 1Y10A 1WEYA 3QLHA 5FD1A 4DV5J 4NPOA 2P9GA 2ALYB 3UVJB 2OPPB 3T6BA 2PC6A 2F4VJ 4OZNA 1JLFB 4ANCA 5C2CA 4I2PB 1WDTA 4ECWA 4X4PA 4CCHA 4X62F 4TN2A 1DTQA 3ZTQA 1VLOA 4ZK7M 3LALA 2VFSA 2OTJS 5LMNJ 4JI1F 2F65A 3OFEA 4UZCA 1VISA 2KI2A 1LK7A 4MAKA 5KFAA 3LO3A 5BJRA 1WD6A 2X1GA 3MM9B 1RT4B 3UCGA 2BABA 4PG8A 2FY8A 4TKTA 3KK1B 1WI8A 5GADI 5I4MA 2E1CA 3Q8YA 2MKKA 4OLOA 3SFGA 1YSJA 4NMLA 4OYXA 1NSKL 5KFSA 3IM8A 2WVEA 2LCWA 4EZ6A 4USWA 1S99A 1QUVA 1FE4A 1PG5B 1S1WB 2VV5A 4G1IA 3MMAB 1J5OB 5FJ4A 4LF8F 1K1QA 3RRKA 2HRTA 1JIHA 2XNQA 3MD3A 2XBPA 2XEXA 4ZVRB 2GHPA 4LBHA 7AT1B 1R8CA 4IFVA 1WI6A 2DGWA 2FHKA 2MPUA 5CYJA 1RTHB 4DX5A 2MJUA 1BY9A 4RW9B 4V19J 3RRHA 1KNZA 2QX0A 1A9NB 1TKDA 2O66A 1HPZA 2V8DA 3CIZA 2AF6A 1SQGA 2KM8C 2OGUA 1KLNA 4WCEQ 1SUQB 5L38A 1VI7A 4NWBA 4TU7A 5F8NA 5LSOA 2J0SD 2GCFA 4ILMA 2MQLA 3KLFA 3RB4A 2LQ5A 4PG4A 3I4PA 3H5YA 2HQGA 1FEHA 4RBUA 2P2CB 5EHHA 4WWSA 3N01A 1VQMS 2CG8A 4Q45A 4DOZA 4CLTA 3D0IE 4C0BA 1KOHA 1S12A 2KDOA 1SH3A 1U48A 4U7UK 1N5YB 2HG4A 2DH8A 4K4VA 1WC4A 2MMYA 3TOQA 2DNZA 3SI8A 2GA7A 5C2GA 3LA0A 2DNLA 5M2RA 1RWKB 2CJ9A 4LRBA 2AEMA 1G3OA 1IR2A 1I1GA 3UPFA 3DOKA 3UD5A 1FD2A 1RAIB 2R7OA 2I5JA 1JLQA 4QWEA 5HROA 2GVZB 2FUG9 4F50A 2R2SA 1U8SA 4F7VA 4H4OA 2Z30B 1X0PA 1FWPA 1SVDA 4P7VA 2U2FA 3NBPB 5F3TA 1GMWD 4LRAA 1MSWD 2KVQE 3NS7B 3NNHA 3NG8A 4FBUA 2MDAA 3W5XA 3PRDA 3CD7A 3HHEA 3G9CA 1K1SA 1RAFB 2AWZA 2VDIA 2IA6A 1DAXA 3BSOA 4DV6F 1L3VA 1W2BR 1JJCB 1S5ZA 5ETQA 5MAOA 1JKHB 4UZBA 2EFGA 2MEWA 5CH7B 3HD2A 5C42B 2DHSA 3M1VA 2Y1JA 3D6MB 1P6TA 1RB0A 1RCXB 3GYXB 2BBEA 3Q8UA 2B56A 1FTCA 1V9OA 4EWTA 3KG4A 1JLCB 3MMCA 1Y0HA 2YKPA 3OV7A 1GQEA 1LWEA 2VJUA 2HBRB 5CZVA 5C24B 3UR0A 3CTRA 1ZH5A 4Y34A 2IVFB 4NL5A 1L3UA 3RBDA 1U02A 2WB1D 2NLWA 1UWBB 3HT0A 1RISA 3OBIA 3D6FB 3HULA 3ZZRA 2J0WA 5HMXA 2AJFE 2XLIA 3ITHB 1RU1A 3OVSA 5HVHA 1IM4A 4Q0BB 3A8JA 1RSCA 2V0NA 3QZ7A 4C97A 3TZZA 4DV1J 2FJVA 1CULB 3M6UA 2I0XA 2VJVA 2B9EA 2DNMA 1HQUB 5IFMA 1G6BA 2HQCA 4R5PB 3OFGA 2E5JA 3UCZP 3HFKA 5AE2A 2DXDA 1IBKF 4JB8B 3GJSB 3CULA 5IWAF 1BC6A 4YB7A 4J91A 3HKWA 2XY5A 4DUYF 2RRAA 3T6JA 1MWYA 1VQ5S 4DSFA 3CC2S 2M9KA 1LQ9A 4FN5A 3Q2SC 4GKJJ 5LXRA 2RH3A 3J80U 1S0MA 2KFZA 5ETLA 3I5CA 3KK3A 3FEZA 4KFBB 2EBEA 3CCMS 3BQ0A 1U26A 3I9ZA 3M2RA 4PG6A 4DL0C 5KG4A 3KLEB 3KUGA 3HLUA 4HVZA 1RWVB 3POTA 2HBQB 3C15A 4QJVA 1FFSB 3CVKA 1NZ8A 2MLYA 3BN4A 2WBMA 2XYPB 3DYAB 3H5XA 3OLBA 2KFNA 4ECZA 1WHWA 4CO4A 2HMIA 4RJVA 3IAS9 3PKMA 2AJ1A 4PPZA 2YKQA 3NWGA 2ZFHA 2BKPA 2VDHA 1SV5B 1KP6A 1YVFA 2HHWA 3H98A 1APSA 2RIJA 1M5VC 1WDDA 4ZVSB 1AUDA 2BANA 1XNQJ 4TLQA 1HFEL 3TZXA 4C8YA 2DNHA 3MCOA 4LVOP 1OYDA 2EFPA 4XK8C 4DUZJ 5KFZA 3CD0A 5KFIA 1VQLS 1UJ5A 1E6VB 4DPXA 2WONB 2JJ4D 4L72B 4PYDA 2R9LA 1XNRJ 3P5BP 2BJ3A 2HHHF 4QQBA 3DLJA 3EUNA 1B3TA 4NEYA 3Q24A 1U1MA 5D4OA 4M5LA 1S77D 5LXYA 1NPRA 5F9LA 1Q78A 2UUCF 3L7OA 1X4HA 5KFWA 4L75A 2CZ9A 5E3CA 1FKPA 2GC8A 1B64A 3CMQA 4IH7A 3PEJA 4QR2A 3RB6A 2IM1A 3TA2A 4LIWA 4MIAA 2JHEA 3BGRA 4TQSA 1NDPA 2HIQA 4NE9C 4OZ5A 4DR4F 1H38A 1HL6A 1FJGJ 3DLEB 2DITA 4KQZA 1F60B 3RTVA 4TNOA 3UN2A 1TUVA 1C0UA 3OTDA 4LF4F 3OL9A 5GAHU 2UUBF 2DK2A 1H7WA 1FNXH 1HKAA 5T7LA 4DR7F 5HANA 4GC7A 2DNRA 1NH7A 1DARA 4B3RJ 1FK9B 4LF1A 4TYAA 1UPPA 1NU4A 3K5NA 1YRTA 3DFEA 1UVLA 4ED0A 5CABA 4K4ZA 2FC9A 2CG4A 5K8OA 1XR6A 3QBCA 3UNYA 1ZPVA 3PFEA 3M05A 3LWMA 2HNZB 2MSSA 2MB0B 1YWXA 2UUWA 3NGTA 4Y3CA 4O0IA 2X51A 2YBVA 4OZJA 4EI2A 2UP1A 3HI9A 4CT9A 3A3PB 4I6YA 5E41A 1VQOS 4JI0F 3EM1A 1JNZB 4RLEA 1L3KA 4HHUA 3TUPA 3QWPA 2B6AB 1EIYB 2GW8A 2HFOA 3E01B 3MR3A 2ROGA 1D1UA 2C3MA 1ZOTA 1RZMA 2ZUAA 3HD1A 1RT1A 1NK6A 1OMSA 3HHLD 2CNNB 8AT1B 4O4GA 2DD8S 2QRRA 1FKOB 6AT1B 2JZ5A 5B0AA 1IBCB 5DQHA 2VQEF 2XC9A 4PUOB 2MZRA 3BSAA 3VALA 4C2MA 2GJIA 1PC4A 1WHYA 3MEGB 1IQZA 4DX7A 3L7UA 3SSQA 4FYYB 1M5PC 3AD9C 4F67A 3M8PA 3DLLQ 1UVNA 5A2QU 1U0SA 4C8NA 5GAGU 3ZNJ1 2I1RA 1E6YA 1XMOJ 2C3OA 4WP8A 1S1UB 4F0MA 4OX7A 3E51A 2P9CA 5I3QA 4IKAA 4F02A 4CH7A 1VGYA 3DRSB 3VQSA 2B9WA 1M0SA 2MKJA 2DGSA 4DR1F 3DM2A 2R7TA 1RTIB 3QAEA 1ZPWX 3M8QB 4JV2A 1HARA 2DY9A 2QSWA 2OJ3A 4RW4A 1OYEA 4RBVA 1SJRA 3T41A 3GWCA 2E66A 3OUYA 4NXNJ 4WE1A 2KFYA 3KG1A 3MCMA 4IDKB 4UUWA 3KOAA 2CUYA 4Y2IA 1BQMA 4PAAA 2LEAA 1SKRA 2AYMA 3LPYA 3DXBA 1R0AA 4M5IA 3ISZA 4PZVA 3BF4A 5D8HB 1Z2ZA 1RTZA 3R5GA 3K2YA 1IQTA 4CH1A 3CDAA 1F9HA 4KKOA 3KHRA 2WB4A 3OR2A 2PDAA 5H9EJ 2FJDB 1WKKA 4IQXA 4Y2MA 1VRUA 1HQEA 2ZITA 1XJWB 2DNGA 2HK2A 2ZBPA 5H1SV 1NPKA 4JI2F 2CQHA 2ZZMA 3E3XA 3GYGA 3HXMA 4FF1A 3FFIB 4LRDA 3IN5A 1M1HA 1KQFB 3BPSP 1CJTB 3MM7B 2YNIB 4F3MA 4RW8A 2BE2A 4I67A 3EGWB 3SCIE 1EZZB 1RE1B 3W9JA 2PMZD 1GT8A 2DNOA 2KB2A 4IUFA 4ITSA 1SL0A 3UWTA 3Q2TC 1S9GA 2HS0A 3LQVA 4Y65A 3D5MA 3T19A 2V8HA 2AJQA 2QO3A 2FLOA 3W2WA 2R8GA 1PAEX 4Q7AA 5IT9Y 1WWHA 4K4UA 1TAUA 1WG4A 3HCXA 2VODA 1S1XA 2F63A 3QIPB 5KFVA 2UXBJ 3C19A 5J2QA 4UUXA 2OMLA 3T9NA 1FRMA 5D0GA 4B3SJ 1P9YA 2WW4A 1X4CA 4AXJA 4JI4J 1ZYQA 4K4XA 1TL5A 5CYMB 2B9YA 4KIAA 5A8KA 1SKWA 3CC7S 2W9BB 2EC0A 3IO1A 3C14A 3WC2A 1S57A 2M3DA 3NWRA 3AXKA 1TU0B 3H8YA 4OX9F 4X64J 4HDGA 3JS9A 3WC0A 3EJMA 3DMJA 2OTLS 5ETPA 4IR1A 2XB2D 4Y0FA 1T05B 1N5VA 3R6LB 1UW9A 5DQIA 4RWXA 2QTWA 2H5EA 1VCTA 3DRPB 4RKUC 2OP5A 3TUIC 3KG0A 3GG0A 3I0SA 5F0UA 3T1AA 1WTFA 2CAJA 1IJEB 2R2UA 3LP2A 1R3NA 4B9VA 1HNZF 4C4WA 4UOHA 1FFWB 3TRGA 5ITHA 3VAGA 1BD6A 4CTAB 4ZPBA 2ZBQA 3ADAC 2JOQA 2AT1B 2VG5B 2UVWA 2LFVA 1U1QA 1X9MA 2Z57B 2WOMB 2KJVA 2XQCA 4F0KA 4X2BA 4ZOSA 3ILOA 4YP3A 4TY8A 3FZBA 1IBLJ 2IRUA 1RP5A 3V6DA 4PWWA 2VC0A 2LQ8A 3HK2A 3W9HA 4USUA 1MU2A 1MWQA 2GFFA 2NXCA 2IJNA 3BO3A 1BXNA 1O6XA 3DGPB 1UAWA 4W98A 1NJWA 1CC7A 5L9NA 3SDEA 2LVWA 1FVSA 3M7VA 4I56A 2YQ1A 3AD8C 4B9UA 2M7SA 3R1LA 2APOA 3Q8QB 2VG7A 4R0EA 3ZZTA 3R9LA 3BR9A 4JBCA 1I5OB 3MI7X 5FLXY 4KT0C 4LJMA 4LBIA 4BWMA 2HZVA 2RT3A 1X4DA 2LU1A 2YWFA 3KUHA 2YTCA 5L1LA 2Z2YB 1ZM3A 4L3KA 5HSPA 1EQ0A 2JEIA 2DHXA 1KR4A 2PSZA 3J7ZT 5CD4A 3H4DA 1NHVA 3EGVA 4NYPA 1U25A 1U2FA 3DKDA 2DGXA 5IV4A 2L48A 2M8HA 2YKOA 1FEEA 3JSMA 2WW8A 3JSBA 3ZNUA 2OAUA 4ZVHA 4Q44A 2VONA 1GTHA 4QWBA 2OKQA 3F41A 1FDBA 5K8NA 2M5YA 5DG9A 1TK8A 4A46A 4MMOA 3PR4A 4FKXA 4TXSA 2Z58B 2IHR1 4F26A 5KFGA 5LM7E 4QYRA 2BM0A 1NK5A 4Y2KA 1VHFA 3NP5A 5A0YB 1NKCA 4DU7A 3A8KA 3MR5A 4ICLB 1T9VA 2VOPA 2HBYB 1XR7A 3QIDA 3W8PA 2MZ1A 1S97A 4NI2B 4ZJOA 2AJ4A 4AFFA 3MD1A 2H54B 3K7RA 2FGOA 3IS9A 4ALZA 3CSKA 1YHQS 3CGIA 2Z2MA 1H74A 3FZ2A 3GYNA 3IFEA 4DZ6A 2UUAJ 3SV4A 3JSRA 2NZ4A 1MMLA 2J9EA 1S7HA 2KVIA 2BJ8A 3D1HA 5B0DA 4GO7X 3UW1A 1QY7A 2EKYA 5B0GA 4KR0B 1Q8KA 2WK4A 3O1LA 1PBUA 2X3GA 3B78A 2H48B 2JL9A 3OFHA 2HLTA 4B3MF 3MPDA 5GMEA 5A76A 1XK8A 2HRUA 2YWGA 4ZVFA 3J81Y 2GGPA 1HBUA 1OS5A 4USIA 2ASDA 1AUSL 2V4RA 1YI2S 2XSFA 3BPDA 4AQYF 2C2KB 4NLTA 3EZ5A 3WDOA 4IO9Q 3DU6A 1WTBA 4JI8F 2XHWA 4DBQA 3TNVA 3AJDA 3KLGB 1KSPA 3KTQA 3MGJA 4QIVA 3HHLB 4JI3F 1CJUA 4QU6A 3TWZA 1CJVB 4WTOB 4CLWA 1QSLA 3WHIA 3HVRA 1DTTB 4GO5X 3ILLA 3PG9A 4NYOA 3GTYX 2F40A 1QJHA 4Q43A 1YJNS 3Q86A 2V4JA 3HJVA 4RNFA 2Y8WA 3QRPA 4MFBB 4I6WA 3H0PA 5F41A 3EE3A 4JYAF 4PEOA 5DZ6A 4ZLNA 2W24A 4F8RA 5KT3A 4RW7B 1ULRA 3TAQA 2CQPA 4ZA1A 4K0KF 3MAAB 1SPBP 1X9WA 1QDUB 3BKUA 3J7YI 1SC1B 3CDBA 3QPIA 2DJWA 2MKCA 1UFLA 2FVRA 4YFUA 4USHA 5J1PA 1FJEB 4ZIVA 3SFUA 1JXLA 1Q82T 1NSQA 1RHRB 3JYTB 1CG2A 2DNNA 2KYZA 2YWWA 4TU8A 3G82B 3ET6B 1HWLA 3TZYA 4A8MP 4NYZA 2PFFB 1N5QA 5DG8A 4FYDA 3C6UA 1IKVA 2FIUA 1GMUA 3MMJA 2BW2A 3P3DA 1KHWA 2FJXA 4DWIA 1VJQA 4RR5A 2D3O1 3R3TA 3P49B 1RU2A 3DOKB 2B5JA 2W25A 1RJJA 1WHXA 3QWUA 2GQQA 3FMWA 3M6XA 4ED5A 4WFAQ 4H4OB 4X65F 2C2MB 3OXFA 2J9DE 5DGAA 4CLUA 2HNDB 4DV3F 1REVB 2W4PA 1U6FA 2LLZA 1H0HB 1K73T 4YDDB 2L9DA 3LGNA 2CPDA 5LSLA 1QSYA 2VFVA 2W9CB 4OMFG 2HBZB 3CCVS 1TZ0A 2YQ0A 3TVZA 5HP1B 1BQXA 3TJ9A 2ZJQQ 3GCXP 4WXOA 5DDOC 1GXTA 2Y1RI 2MQ8A 1BQNB 1SIWB 1PCAA 1Q81T 2VPWB 3NAIA 1S9EA 1S1TB 2BYCA 2JSXA 2V8VA 4AL6A 3OTOF 2HW3A 2BXJA 5KOWA 4N8OA 2R8JA 3UNGC 4EK2A 2G13A 3RW6A 3PYEA 3KK2B 2LDIA 3R7SB 1IKWA 3NMRA 2CPFA 1NHUA 1VHIA 3M8ZA 2MKHA 3NGSA 1VLYA 1CJKB 3OXLA 5F0WA 3GR1A 3PV8A 2I2YA 2FY1A 3AOCA 4MYTA 4ES3A 1ZZNA 3M32A 1HNXJ 5F8JA 1TL7B 4NRTA 4ECYA 3LOUA 3PIPQ 2XMWA 3GV8B 1CEZA 4WTYA 3S8SA 1X31C 1F6TA 4FPIA 2KRBA 3GP9A 1RTDB 1U6ZA 2YNGB 4OJ1A 3HDSA 3AB4B 1RT7A 2RMLA 1CS4B 3W64A 3PM9A 1OSDA 3CCZA 4X66J 2E9TA 1PBAA 1Q53A 5JJBA 4B9SA 5HLFB 2JH3A 2AMCB 2ADBA 2V8GA 2AX0A 2V2KA 3QNWB 1NKBA 4LF6J 1OY8A 1SQEA 2DR7A 1CC8A 1R0CB 2HVEA 2PI5A 2D1CA 5KFRA 4QZVB 1HI0P 2QT7A 2OSQA 2Q6CA 2CRLA 2ZH1A 2L9NA 1U8WA 2OEMA 3CT9A 4NA1A 3MECA 3DLGA 1TVRB 1FA0A 3WBZA 3FQLA 4P10A 3T1YJ 1L5UA 2IRYA 3QO9B 4PG5A 3IRWP 4F4KA 1I3OB 2QEXS 2R7QA 3ZTRA 2K2PA 4LF9F 3DI6A 1KWMA 3W66A 3J7Z5 1VQYA 4MTPA 3VV2B 2LXUA 3FMBA 3IGNA 2XCPA 4J9QA 4CIOA 1UEUA 1NEEA 2RQMA 3NGDA 1Q86T 4NXMJ 2ASLA 2FHJA 1WF1A 3DU5A 1RT5A 2BANB 4A8KA 2HVDA 3S1TA 5DM6Q 1DJ0A 1H2UX 2CPZA 1SBRA 4I6AA 4NOHA 3OJUA 3EDRB 3L3CA 4FXVA 4ECTA 5HQ8A 1HYSB 3TAPA 4J9UE 3TVYA 4CNZA 4OIXA 3DC2A 4U8VA 2N82B 2DGOA 2XG8A 4M5NA 2LDYA 1PYTA 2ATLA 3K59A 2BOPA 2JRSA 2ZOMA 2VIHA 4EGLA 4WYLA 5CA5A 1WSVA 4YHHJ 3ZZUA 1EETB 2JEFA 1QD1A 3FEXB 5K8PA 2RAQA 5HL7Q 1HBNB 4OI2A 5IT9U 4RNNA 1VR6A 5E3PA 1HBOA 1IKXA 4M5GA 4DR3F 2G2ZA 2BACA 1Z2LA 4OYAA 1S6UA 1TL1A 4BLGA 3OW2R 3MR7A 5KG3A 2N4DA 4OV6A 1FESA 1RYSA 4OI1A 3MM5B 1U0HA 2ZH9A 3RB0A 3MEDA 3W2VA 3PXGa 4Y2CA 2A1BA 3MM6A 2PMHA 5KG1A 1BMQB 4U96A 3CB4A 1UA1A 3RR7A 3TJ8A 3N79A 4ZIWA 1LW0B 1ZTTA 2C3UA 2Y0BB 3HHKA 3PJWA 5J2NB 2HIYA 3NGRA 4KRWA 3MAHA 3D3CJ 4LRCA 1HW9A 3L95X 3PX6A 4YY3F 1S59A 4LF5J 2XM3A 2MXYA 1SXLA 1QE1A 3M2VB 3G6ES 2ZDOA 5LJ3Y 4I0WA 1IUJA 2HLUA 3CDEA 1NDCA 2CNKB 4HTJA 3CCWA 3ENVA 3BQ2A 1XN9A 1YIJS 3SQOP 1N32J 4X4OA 3CW2C 4ZJQA 4OZ2A 1Q1KA 3AFGA 1TMJA 2IAJA 4R8UA 3OL6A 1T11A 4I64A 4RX6A 3L09A 1U1OA 1RAOA 3WIVA 2BUNA 4ED4A 1GMVA 2YWKA 3NY0A 4KBIA 4PWDB 1V6HA 2LP4A 2GO8A 3W8GA 5EGYA 3ZFVA 3AODA 3BEGB 4I2QB 1EKRA 2VBWA 4PWUA 1ICEB 3C66A 3K5PA 1B99A 3NOGA 3OQ2A 3QSYB 2BX6A 5FDLA 2VFUA 1FX4A 1F0XA 1QAJA 3VAMA 1WC5A 4ELVA 2CWXA 2R7SA 4DPYA 5J2MA 2E7XA 1GTEA 2X7IA 1SKUB 2W01A 1UFWA 1TV6B 3S6EA 3WQPA 4A8WA 4C9DA 2XS5A 2P6SA 1UZHA 4L76A 1X4AA 5G0RB 2VICA 3TANA 1KFSA 1D9FA 4KHPJ 3RGIA 5KFUA 4I1TA 1RABB 3IR5B 1N0VC 4WKYA 2VQFJ 2QIFA 2EFNA 4U8YA 3GJTB 1Q7LB 4C48A 3FGVA 5FLXU 1RT6A 5LJ5Y 3U02A 3QSIA 1FD8A 4DUTA 2VA2A 2H3EB 4MKAA 2UVUA 3MEEA 3CCRS 4QWAA 1I94J 5AXNA 1OPIA 3ZZ0A 3AQOA 3UQSA 3TW0A 4JUZA 3LANA 4M94A 3W7BA 3K5LA 1HBMA 2L9WA 1UJ4A 3LP0B 1RTJA 1B70B 2B4PA 4DR2F 1FKAF 1IBMF 3QGIA 3KLIA 3G71S 1SCJB 2LXFA 4JI5F 4DFJA 1RHKB 4QIWD 4DQQA 4LFCF 4NLXA 1T8EA 2RE1A 4OZ1A 2OPRA 3FDSA 2ZHOA 4AUKA 4OHYA 3AA9A 3BDEA 2AZ3A 4CM0A 1NB2A 1WKJA 1DQAA 2DGTA 3H7HB 5EX0A 2V8PA 3HO1A 5HMYA 5J2PA 1X60A 3QGPA 5M2PA 1VFJA 1T03A 2O67A 1DLOA 2FZCB 2W2QP 4MYUA 5I3UB 4O3PA 4U6PA 2LQJA 4DV7F 4PQUA 3AA8A 3RAXA 1DQ9A 3LW5C 2BEFA 1ZM2A 2N3OA 2YNFA 5KFKA 3NL0A 2W9AA 1KTVA 3HHDA 2FVSA 4USVA 2FHOB 4K2JA 4KC5A 1NNDA 4ZDNA 3OLAA 4DG1A 1RI7A 3AHPA 3DRYA 3VAHA 2J9CA 1CQMA 2XMAA 4UOCA 3GQCA 4K4WA 4LSNA 3I5AA 1S1XB 2GIRA 2OSRA 1RWMB 1HMVB 2HSEB 2LYVA 5J2QB 3R1HA 3J81U 4BWJA 2DCLA 1PAUB 2DKOB 3C8YA 4IFYB 1VIXA 2SXLA 3HM9A 4B3TJ 2L41A 2FZGB 2EWHA 2YNHB 3DOLA 4B9NA 4DF4A 2D9PA 1TMMA 2M2BA 2DGVA 1D09B 3R8YA 1KEKA 5KFLA 3KJQB 3OHBA 4G3IA 2QA1A 3GMGA 4RL1A 4FNIA 4HACA 4DR6J 3JQJA 3FVYA 2A6MA 4ZLPA 4L6V3 3EGZA 5KFTA 2W7PA 3KJFB 2NXJA 1NSPA 2C3YA 5D15A 2IMOA 1JLEA 2MZSA 5JVHQ 1KBRA 5LL6d 3VQTA 1VOMA 4Y00A 1GEHA 3RZAA 2GX8A 4NLRA 3AJ1A 4LFBF 1FI4A 4RBTA 2DPIA 3JAMY 2MKIA 4RNHA 1HIYA 2JEGA 1UL3A 1JJ2R 4ILLA 4MKBA 5AXLA 2PEBA 4IG0A 3V6JA 2F9JA 4MKVA 4FP9A 1NK9A 4QR0A 3MMBA 2QL7B 1YJTA 1C1CB 4GRSA 3SYZA 1S1VA 2V9WA 4NLYA 4NCGA 5E0OA 2VG6B 4DPUA 2VL1A 3W60A 4B9LA 4DV0J 4TY8B 1X5TA 2HQ3A 2OPPA 3R5BA 3RYLA 2QLBB 4DCJB 4OYZA 4B3TF 2FTRA 2AIRB 1T3NA 5IT0A 3PACA 1WEZA 1UW4A 4I2PA 4O3QA 2CJBA 4DV4F 4ZVPB 2NYIA 1HR0F 2FLPA 2Q1LA 2W2OP 5E3QA 3DDIA 1K44A 1N0UA 4F4YA 1C4AA 1HI1A 1LKZA 2H5IB 1N36J 3ICLA 1U49A 2AZ1A 4OI0A 2PA3A 3MM9A 2QMWA 2M4MA 1YJVA 2WAQD 3A3NB 5B0EA 1RT4A 4WFBQ 1EP4B 2XLKA 3LP1B 2LA4A 3HVTB 4OHZA 3OTEA 2MY8A 1MNEA 4QBUA 7FDRA 3PEHA 3KK1A 3GZ7A 4IRCA 2ZKTA 4NLSA 3MWBA 2F3JA 4K8RA 3BKTA 2D3UA 2B7BB 2XWXA 1HNIB 1LW2B 2AW0A 3J7A1 1MLAA 5L39A 3MTKA 1S1WA 4CO0A 3MMAA 1J5OA 2G9OA 5LMUJ 2QL9B 2RKIB 4DJBA 2BQUA 4DV2F 4JI6J 2EBGA 1LFWA 1T02A 4U67Q 1FWLA 3O3LA 2MGZB 2GJ2A 3OTCA 2QSFA 4FF4A 2WVBA 3BH6B 2XI3A 4HI2A 1HNVB 1FHTA 1XIQA 3J81j 3CO9A 1RTHA 1ZM9A 4AE5A 4A8OA 5B09A 4RW9A 3JQMA 1TUGB 2B3TB 3ENWA 4FYWB 4L3NA 5JMNA 2XZWA 3BYPA 1M5HA 4DF8A 1RHUB 1SUQA 4RNMA 3CDUA 1F3FA 3PW7A 2AQ4A 3V6HA 1M90T 4UY85 4N7TA 4IRKA 5AJ3F 3D54A 5DETA 3IS9B 3PDNA 1T9YA 1L3SA 4NLWA 2YKNA 3AT1B 2QLXA 1RWNB 2DR8A 2MLZA 4EYHB 2I38A 2E5LJ 4HHJA 2IPOB 3D4JA 3IWLA 4LF7F 4Z7YA 1UWAA 3IRXB 2OI2A 2HHTA 5HAOA 2XZTB 2GHVC 2VU5A 2E9RX 2J9DA 1R89A 2RUSA 4O3NA 2BA9A 2CXEA 5L8RC 8ATCB 1VBXA 4TVAB 1XR5A 4ZVOB 4IRDA 4QPTA 3R2DJ 1W25A 1NKEA 4DPTA 1CPZA 1Y7PA 2GVZA 4YMEA 1J5EJ 2MSTA 3T5HA 2HFSA 3P96A 2UZAA 2B4OA 4J9PA 1KFDA 3Q8PB 4O44B 2NR0A 3M9NB 1D0EA 2ZH3A 3LF0A 4U7CA 3PYFA 2DIVA 2MJNA 4Q2MA 4A8XA 4PXDA 3R7NB 2BRLA 1HWUA 2OO4A 4IH6A 1P1TA 2N7CA 1EARA 4GKKJ 2XYGB 3BDPA 2G0CA 1EB0A 1HWIA 1IN0A 2OMOA 1RHMB 1RWUA 3F44A 1JKHA 2AD9A 3ZZZA 2DXFA 3H2VE 9RUBA 4K7QA 3QT6A 3NGKA 5BR8F 2CQCA 4P75A 1RAHB 1SL1A 3VAJA 2DB1A 4C3MA 1JLCA 4N77A 1L3TA 2ZC4A 4QIFA 4G6VB 5C24A 1PO6A 1IXKA 1G7CB 2XY7A 4DV5F 3NCQA 1K0TA 4P2XA 3B54A 3VVTA 5CZXA 3P6YC 5L1JA 3ZXWA 1PYSB 5KFMA 3MR2A 2ZBIA 2F4VF 2ZD1B 4S0MA 1WORA 2ALZA 1CVJA 1AB8A 1FF2A 3DRRA 5DS7A 4DQIA 2RJZA 3C6TB 1RGVA 2KL8A 3B4DA 1CULA 3HP6A 3NMAA 1HQUA 3VGVA 1NSAA 2X1AA 3GFXA 5CYQB 2E5GA 2IDLA 2CVIA 4ZP7A 2W1BA 4RPFA 5LMNF 3UN3A 3MR6A 2HHXA 1XMQJ 4DR5J 3IBFB 3LWLA 2IFXA 2N3LA 4EO8A 1FRLA 5ETNA 7FD1A 1TR0A 2R2TA 1Y3JA 2KKHA 1YBUA 1XEZA 1UMJA 5GVQA 1RAGB 3X1LB 2KHCA 3KKFA 3NGUA 4ZPAA 1FWKA 3DCAA 1S76D 1UEVA 1V5VA 4KFBA 1JLGB 1IM6A 3Q83A 4K4SA 1U2CA 3AQPA 2BZ2A 1ZAXA 4V1Ak 1URRA 3UDEA 3KLEA 3D9BA 1QLNA 2ADCA 1J27A 1S9EB 1UEKA 3MPUB 4NLOA 1C2PA 3WX8A 3GSDA 4F4WA 1Q0NA 1LK5A 3M6VA 3GCWP 1YKWA 4C8MA 2HWIA 1KVKA 1YGYA 3UE2A 2IBKA 4X4RA 3OFFA 4M8LA 5HO4A 1SV5A 4ETZA 1S0OA 1KDNA 3HVWA 2EC2A 2N7YA 3M30B 4OYBA 1R6VA 4BBYA 4NLUA 3CMES 2JFKA 2MHNA 1Z4UA 3UR3C 4OZLA 4FZVA 3N9UC 5IV3A 4DQSA 1SKSA 5M2UA 1E6VA 1SH0A 2GQ2A 3MAQA 2WONA 2VBXA 2LU2A 3W63A 2J8SA 2NSBA 1T95A 3QYYA 2KZZA 1FNOA 2AHOB 4NCAA 4ECSA 3I56S 5E7OB 1YK9A 3CJ2A 4NZ7A 1RT7B 4ZHRB 3D2WA 1RBOB 3H25A 3H5SA 1SJFA 1GNKA 4ZPWR 3FQKA 3HKZD 1EX8A 1RLDA 1UFKA 3CJKB 2MKSA 2DXEA 4QW8A 3CCES 4ZLLA 2ZOFA 3KYLA 3M8SA 5THWA 1TKXB 5KTQA 1XMBA 3DOMB 3DLEA 5D77A 4UTGA 5BXIA 1O51A 2KTQA 1RA7A 1UKUA 1QM9A 5IQ6A 1KQKA 4KY3A 4PQAA 1S6PB 4QYZJ 3CIMA 4PXEA 2PN6A 4HLBA 1JLBA 3M8WA 3Q0AA 3D1QA 4C11B 2V4QA 2UXCJ 2ZNZA 2CDRB 1T94A 2CQBA 2K7JA 1N33J 1FK9A 3T3FA 1R43A 2ZOGA 3DI6B 3HX9A 1HHQA 2CNLB 5K20B 3AH6A 4IOCQ 1B4SA 3S01A 1Y3KA 1RADB 3PIOQ 3KLHB 2HNZA 6FD1A 4KTQA 3GU0A 2H9ZA 5J1NA 2CQ4A 1UJ6A 4CP5A 1FJCA 2RRNA 2OD6A 4DS4A 2XO7A 1Y5LB 3QATA 4AL5A 2CPHA 1C1BB 2C2OB 1GAOA 2FZKB 2B8PA 1ROFA 1SJ4P 3ETMA 2LQ9A 4FS2A 2YKMB 2R7WA 2QV6A 4TQRA 2COLA 4UQTA 3E01A 3FEYB 3NKYA 5J1EA 2DRAA 2K8GA 1FRIA 1ZM4A 2HS3A 2BMBA 3V81B 1LFPA 1X5SA 4NA3A 4I7FB 1HA1A 4B3OB 1SC6A 3ISND 2HQIA 4HH1A 5DGBA 3TA0A 2K06A 1CSJA 5DO2A 4DV1F 3DGVA 4LIRA 2DR6A 4PUOA 3RU0A 5IQQA 3H2UB 1HBOB 1CBKA 4KYZA 1AZSB 1ZAWA 2ZM6J 3O6QA 1N52B 1UP1A 3KJVB 2YKAA 2UU9J 2UVRA 4O3RA 3THVA 2RHSB 3EVWA 1QAIA 2DO0A 2VHGA 2HWHA 1U0HB 5DRKA 3MEDB 3EVMA 2XMMA 3P45B 1UETA 2P8IA 4GKJF 2GO9A 1S1UA 4WFZA 4RU2A 3A8IA 1ACMB 3DRSA 1VMBA 1Z1ZA 3UDCA 3MF5A 2E1MC 3KHLA 4W90B 1K0VA 4B9TA 3FSIA 5BYSA 1RTIA 3M8QA 2J0QD 3CJRA 2MQPA 3L4BC 4AT1B 3MHYA 4RUAA 5CHCB 4P71A 5KG5A 2DRDA 3FCHA 4IDKA 3CCJS 4P7TA 2DTJA 2LQBA 2HFNA 3BZQA 4CO5A 3DHXA 2IM3A 5KFDA 2RDIA 1U1KA 4FVMA 3TX0A 5KG7A 4I68A 1AXQA 4PXBA 4OX8A 1P27B 4LVNP 2JLFA 3DHWC 4KO0B 1LEOA 2YWHA 3QFHA 5ETTA 4URSA 4J9LA 1NJIT 2H65B 3UO0A 4JI7J 3H90A 1NCLA 1BUXA 5IM0B 2FJAB 4Y28C 2OFHX 3PRBA 4WIQA 2RD5C 2IIHA 5AE1A 4GC6A 3VAKA 3D6HB 4JP8A 1XNQF 4NEZA 1IKYB 1RAEB 3ZO7A 1MROB 5KT7A 3QZ8A 3R5JB 1FXLA 1RWWB 3ZTSA 4O23A 1VK3A 4M63A 4DUZF 3FFIA 1K9MT 1CJTA 3EZUA 2YNIA 2FD2A 2YQ3A 2QFJA 4P9SA 1XNRF 2MKYA 2FPHX 2DPJA 3UD3P 2FGCA 4JV5J 4QYZK 3BR8A 4HI1A 4G1QB 2ABYA 2HZAA 1YJ7A 2C2NA 3MTJA 3R97A 4H4KC 1T7PA 4P2FA 4P6QA 1NK7A 3IR7B 1FXDA 3LAKA 3B4MA 2EK1A 3RW7A 2FQQB 1N88A 5IXUA 1M1KT 1K47A 3T5KA 2J0XA 2PE8A 2XSJB 4DLGA 2XO6A 3D68A 2DHGA 3GV7B 3HZGA 3QIPA 3IG1B 4AXIA 1FJGF 2KN4A 2VD3A 4RZRA 3QT7A 1GX5A 2BJ9A 4KAIA 1N5TA 2E1RA 2VC1A 4FF3A 1TKTB 4F2RA 2IMWP 1S4FA 5CYMA 4CI0B 1FRXA 2HEKA 3TI0A 3AAWB 3ELHA 3WX4A 2ROEA 1N34J 2W9BA 1HBMB 4O3OA 5GMKa 4B3RF 5KFBA 1PJ5A 3TQEA 1XC9A 3DDKA 4CQ1A 2BVZA 2UV8G 1YBAA 5CD4H 1RXOB 3U1MA 3C46A 3W65A 1RHQB 3Q8SB 2F8EX 1HNWJ 4KGXB 3CJTA 3OHAA 1QVFR 2EK6A 4R25A 2NZCA 1R8HA 4LQ3A 1T05A 5IOLA 1VQSA 2CQ3A 3DNCA 1JXVA 3IBWA 3SCJE 4J5OA 3MCNA 2L08A 4ETXA 2OEKA 2MHEA 3G6YA 5J2PB 1DFDA 2XULA 2R7RA 1IR1A 4BDPA 2RF2B 3T1HJ 3D6TB 4KJIA 1T03B 4DU8A
chains in the Genus database with same CATH topology
4CO1A 1WELA 2BACA 1Z2LA 1RAJA 2YH0A 5MAOA 2LECA 1JKHB 1I6JA 1S6UA 1TL1A 2K3IA 4YB5A 2HGNA 2EFGA 3O2IA 1MU2B 1JLFA 2AYGA 4RW6B 3OW2R 5CH7B 4ZPCA 1HI8A 2CQ1A 3GB0A 5C42B 5CQGA 2DHSA 3LGMA 3M1VA 4C0HA 2Y1JA 5KG3A 2XCAA 2N4DA 4N5SA 1FESA 3PX4A 1VBYA 1P6TA 1FJ7A 1RYSA 1DURA 4OI1A 3MM5B 3GYXB 3SDEB 5F8LA 2AP6A 2FHJD 2BBEA 4O44A 4TYBA 2ZH9A 4K4TA 3I0RB 3RB0A 3MEDA 2PA8D 3W2VA 4A8SA 1C0TA 4DR6F 2B56A 4CTAA 1FTCA 1V9OA 3PXGa 3TVKA 2ZKUA 4Y2CA 4EWTA 2YX4A 2VG5A 1JLCB 3KG4A 3MMCA 4M1KA 2A1BA 3MM6A 1Y0HA 3RAMA 2PMHA 2YKPA 3OV7A 2IVYA 5KG1A 1GQEA 5D3GB 3CB4A 1LWEA 2CPXA 1UA1A 3RR7A 2WOMA 3I5BA 2VG7B 3N79A 1LW0B 1ZTTA 1LWFB 5CZVA 3TYTA 5C24B 2E7WA 1VQ6S 3UR0A 4J9MA 2C3UA 3CTRA 3HHKA 3MOZA 3PJWA 5J2NB 4EO6A 3RB3A 4Y34A 1ZH5A 2IVFB 1FNMA 4KRWA 1W2IA 3MAHA 4NL5A 2GMHA 1L3UA 3RBDA 4IYQA 1HW9A 3L95X 3ZC4A 3PX6A 2EG1A 2WB1D 2NLWA 2VPZB 4OHVA 3IC1A 4YY3F 4ZCMA 1UWBB 2L3MA 2KXNB 1RISA 3OBIA 5D4LA 3ZZRA 2J0WA 5HMXA 2MXYA 2AJFE 3QGHA 2XLIA 1SXLA 3ITHB 3DGPA 5H9FJ 5A8RB 4DSKA 1QE1A 3OVSA 3M2VB 3G6ES 2ZDOA 5LJ3Y 4E0DA 4I0WA 1IM4A 1VRTB 1IUJA 2HLUA 3CDEA 4KE5A 3NAHA 5DDQC 4Q0BB 4Z37A 4YQWA 2V0NA 3VCDA 5GADU 3QZ7A 4C97A 2FJVA 4HTJA 5A8WA 3CCWA 1MMDA 3ENVA 3M6UA 5KT5A 2I0XA 3BQ2A 1X5PA 1XN9A 1YIJS 2DNMA 3IAM9 1HQUB 1D3WA 5IFMA 4X4OA 4DL2A 3GR0A 2YY3A 1G6BA 4R5PB 1Q1KA 2HAIA 2IAJA 3OFGA 1XMOF 2AGQA 4R8UA 2RDJA 4ED2A 3OL6A 2E5JA 3UCZP 4ZMMA 4J9SA 4I64A 4DSIA 1VIOA 4RX6A 1TL3B 3HFKA 3C2PA 3NNCA 3L09A 4QCLA 1Q79A 4ATNA 3JSMB 1Y00A 2ZHBA 1U1OA 5AE2A 4DFMA 1IBKF 2BUNA 4XPCA 3DOLB 2YWKA 3CULA 5IWAF 2B4UA 4KBIA 4M5DB 3T5LA 1BC6A 4I69A 4PWDB 4YB7A 1V6HA 4DX8H 1FRKA 4NZ0A 3HKWA 2FJEB 2GO8A 2XY5A 2GMLA 3HHLC 4DUYF 1VQPS 2RRAA 2EI5A 4DV0F 3GIJA 5EGYA 3T6JA 1MWYA 3QJPA 3ZFVA 1VQ5S 4DSFA 5EDWA 3CC2S 2M9KA 2DNKA 1LQ9A 4FN5A 5KFEA 1GH8A 3Q2SC 4NXNF 2RS8A 3BEGB 5LXRA 4I2QB 2AV5A 2RH3A 2ZD1A 2VBWA 1X0FA 3BJYA 2CPIA 4PWUA 1YG0A 3C6TA 2FLNA 3C66A 5KT4A 2G4BA 2B7CB 3K5PA 3VAFA 1S0MA 2KFZA 3OQ2A 3I5CA 1V3SA 3KK3A 3FEZA 3CD6S 2DGQA 3CE8A 4DEZA 3DLKB 4KFBB 4NLPA 2EBEA 4QOTA 5FDLA 3CCMS 3QGGA 2LMIA 3MCSA 2VFUA 3BQ0A 4NLVA 1U26A 4FPRA 1F0XA 3I9ZA 1M5OC 3VAMA 1DRZA 1QAJA 4ELVA 3BS9A 3M2RA 4PG6A 2R7SA 4DL0C 1MWZA 5CYQA 4O4RA 5J2MA 5KG4A 3BREA 2E7XA 1HWKA 1GTEA 1SJ1A 3KLEB 5I3PA 1N36F 3U7JA 1UFWA 4DFKA 1TV6B 3HLUA 3E2EA 2QZ8A 4H4MB 3Q22A 4C8LA 3S6EA 4HVZA 4A8WA 3POTA 2JLGA 1R8PA 4C9DA 2EFOA 4IOAQ 4QJVA 4HEA9 2Y0SD 1QVGR 2U1AA 2XS5A 2B9XA 4FNHA 3CVKA 2P6SA 3BN4A 1LXJA 2WBMA 4DSEA 1A6LA 1ZBTA 3DYAB 1S72S 3H5XA 3OLBA 2KFNA 3N5FA 1U24A 4OJHA 4ECZA 1UVIA 1WHWA 4CO4A 4PKDB 3HPOA 4XPEA 5L1KA 2HMIA 3NNAA 4HKQA 1X4AA 3IAS9 3PKMA 1BWEA 2KYXA 2AJ1A 5G0RB 2CJQA 4HL9A 3TANA 4PPZA 1KFSA 4FS1A 5CCMA 1D9FA 2YKQA 5C25B 5KFUA 2VFTA 3NWGA 4I1TA 4X4QA 2ZFHA 1T03B 1LOUA 4RWWA 2K1RB 2EW9A 3SEOA 3IR5B 1N0VC 2MY7A 2C2EA 5HMZA 4WKYA 3D0HE 2QIFA 2EFNA 1N5YA 1SV5B 2EFQA 4NX9A 3V4MA 1JLGA 1Q7LB 5A0YA 2HHWA 1YVFA 3H98A 3FGVA 1APSA 1RT6A 5JUMA 5LJ5Y 2RIJA 1M5VC 4ICLA 3U02A 4CNYA 1NK8A 1AUDA 1FD8A 2VASA 3HHNB 2BANA 2VA2A 5LMUF 4IQMA 4HYKA 4TLQA 2WSCC 2A2DA 1HFEL 1CQNA 2OPSB 4MKAA 1H3DA 2KT5A 3A8EA 3MEEA 4PCQA 2UVUA 3CCRS 4JI6F 1U1PA 4QWAA 4C8YA 4ID5B 2DNHA 2GGPB 1X8DA 1HBUB 5AXNA 1OPIA 3ZZ0A 3AQOA 2R8HA 3UQSA 5FIIA 1VQ4S 2IA0A 4LVOP 2EFPA 4OFZA 4XK8C 3TW0A 1RT2B 4JUZA 5KFZA 3LANA 3CD0A 5KFIA 2VKRA 1VQLS 4M94A 1UJ5A 3W3SA 1M5KC 4MK9A 3W7BA 1E6VB 3K5LA 4A4JA 2HS4A 5KFOA 1HBMA 2L9WA 1UJ4A 2HHUA 4D3GA 2WONB 3LP0B 1RTJA 2JJ4D 4L72B 2IRXA 4KHRA 2CYYA 3FRZA 3H59A 5K14B 2B4PA 3US5A 5DQGA 5C5JA 2R9LA 4DR2F 1FKAF 5U47A 3VF0B 2PI4A 1C4CA 1RKJA 1IBMF 2AJ0A 3QGIA 3KLIA 3G71S 2HHHF 2LXFA 4JI5F 3HMJG 2XMKA 2BR0A 3TAMB 4QQBA 3DLJA 3EUNA 2MZQA 4DFJA 4FBTA 2BJDA 2M70A 3NBPA 3PFOA 3Q24A 3I32A 1U1MA 4QIWD 5D4OA 4DQQA 4OZ0A 1KQSR 1S77D 4LFCF 4NLXA 3MOJB 2CPJA 2XS7A 3ETOA 5LXYA 1T8EA 2NXUA 5F9LA 5KFYA 3M30A 1Q78A 2UUCF 2RE1A 4ED1A 1FO1A 2UXBF 1UVKA 4OZ1A 2DBBA 2OPRA 3L7OA 1X4HA 3FDSA 2ZHOA 5KFWA 4AUKA 4WK1A 4OHYA 3AA9A 5E3CA 4B3SF 1FKPA 3BDEA 2GC8A 3NRBA 4EBCA 4JI4F 5HN0A 1DQAA 1R6YA 1B64A 1MW7A 2DGTA 5EX0A 2JVRA 3ULHA 3N6NA 4ZPVR 4IH7A 5KG6A 3JTPA 1TL4A 2IC3A 3PEJA 4QR2A 4C98A 1RYRA 3HO1A 3RB6A 2G1DA 5HMYA 1S79A 5J2PA 2J7UA 1ZETA 2IM1A 3TA2A 2F9DA 3QGPA 4LIWA 1G1XA 2ASYA 4MIAA 2OPQB 5M2PA 2JHEA 3BGRA 4TQSA 2V4JB 2HIQA 1VFJA 4OZ5A 3HF5A 5T41A 1N6QB 5HBMA 4DR4F 2JDJA 1T03A 1H38A 1HL6A 2Z4PA 2O67A 3I96A 1FTRA 4A8QA 3CDWA 4JOUA 3DLEB 1DLOA 2DITA 4KQZA 3MUTP 1F60B 3RTVA 4EYIB 4TNOA 1HHTP 4MYUA 1TUVA 3GFHA 2GNKA 2RQCA 2E5LF 5C42A 3KLGA 3PY8A 1C0UA 4X84A 3OTDA 5I3UB 4O3PA 3QMQA 4U6PA 2LQJA 1KLMB 1SIZA 4LF4F 3OL9A 1FDDA 5GAHU 4DV7F 2UUBF 4PQUA 2DK2A 3AA8A 4ZHRA 1H7WA 5KAKA 1WG5A 2I8EA 2CVEA 4X64F 4ECXA 3HHLA 3RAXA 1FNXH 1DQ9A 1M5SA 5CCLA 3LW5C 4E98A 1FRJA 2IJFA 1ZM2A 2V9KA 2N3OA