2CPHA

Solution structure of the c-terminal rna recognition motif of hypothetical rna-binding protein rbm19
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
107
structure length
107
Chain Sequence
GSSGSSGQVPKKQTTSKILVRNIPFQANQREIRELFSTFGELKTVRLPKKMTGTGAHRGFGFVDFITKQDAKKAFNALCHSTHLYGRRLVLEWADSEVTVQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the C-terminal RNA recognition motif of hypothetical RNA-binding protein RBM19
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords RNA binding motif protein 19
total genus 11
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cphA01
1N54B 1R8HA 4ERDA 2DNGA 1VQ5S 2CQ1A 2FPHX 3MUMP 2F9JA 2OSRA 3J7YU 2CPFA 1X4AA 3P49B 3SXLA 2XS7A 3S01A 3D2WA 4Y00A 4LMZA 4CIOA 5CA5A 1QVFR 4PKDB 2DNOA 2HGNA 4RU2A 3BO3A 5D78A 2MHNA 2N7CA 1VQPS 1DBDA 1Q86T 3NNAA 1VQOS 2CQGA 2JVOA 2Q79A 4FXVA 4P6QA 5H1SV 2DH8A 3NNCA 1YITS 2DGSA 3CTRA 5MLCV 2G0CA 3ZZYA 5GAGU 3CCUS 1YWXA 2N3OA 4F25A 2E5IA 3VAIA 1NJIT 4QU6A 2DK2A 2J76E 5LSOA 4QPTA 2JX2A 2MJUA 1PO6A 1FJ7A 5ITHA 4IOAQ 4BS2A 1DRZA 2RQ4A 3V4MA 2L08A 2LYVA 1D8ZA 3G4SS 2RRBA 3L3CA 1OO0B 2U2FA 1HD0A 4Y0FA 1NU4A 2KFYA 2ZJRQ 2A3JA 4LJMA 1U6FA 1X5TA 2HZCA 1A7GE 2LA4A 2D3OR 2E5JA 3MUVP 3I55S 2G1DA 2OTJS 1P1TA 2MKHA 3CCVS 1VQLS 1Q7YT 2CJKA 5JVHQ 2HYIB 1WHWA 1SXLA 4CH0S 2M8DB 2LEBA 1M5VC 2PEHA 2DGVA 2MKKA 4WIIA 1U6BA 2KVIA 1HL6A 2DNQA 4QQBA 1O0PA 2DNRA 1X0FA 4WKRA 1DZ5A 2DNHA 2KI2A 3P3DA 1X4FA 3US5A 3UCZP 3G8SA 2CQCA 2YKAA 1AUDA 2RS8A 1M90T 5DM6Q 3IWNC 3VAJA 3LQVA 1M5PC 3CPWR 4A8XA 2DGUA 1WEXA 2DGXA 1WHXA 2K8GA 2VONA 1FJEB 2OIHA 2MZQA 1FXLA 3CUNA 3LPYA 3S8SA 3CCRS 2JRSA 1R8PA 2MQPA 2LXUA 4F26A 1Q81T 2X1FA 1VBZA 5IM0A 4C4WA 5GMKa 1X5PA 2DIVA 3FEXB 4V19X 2N82B 2DNNA 4F02A 5LSLA 4TU9A 4M5DB 3VAGA 1K9MT 2CQHA 5LXRA 1WI6A 3VAHA 1FJCA 2NLWA 2CPXA 1VC0A 1B7FA 3N9UC 1OIAA 2U1AA 5IQQA 1G2EA 3G71S 1XN9A 3R27A 1YJ9S 2VODA 5EN1A 1VQ7S 2LXIA 3I56S 2MZSA 1VQKS 1KOHA 1SJRA 2DH9A 3VALA 5GADU 4C0OC 2YTCA 1H2UX 1X5SA 4YB1P 1KOOA 2CQDA 1WHYA 3CC4S 3VAMA 1VQMS 3ZZZA 2LQ5A 3UCGA 1KQSR 3NS6A 2E5GA 2KHCA 1SJFA 1U1NA 1VC6A 4PRFA 2DGWA 3IRWP 3CCSS 1F9FA 1PGZA 2CPEA 3S6EA 1ZZFA 2YWKA 1FNXH 2K3KA 2MJNA 3CXCR 2XNRA 1SJQA 2D9PA 5DETA 2DHXA 2MGZB 3MOJB 3ULHA 2CQ3A 5BJRA 3CMAS 5GAEU 5D77A 3CCLS 5GAHU 1QM9A 1UAWA 2M9KA 3CC7S 2EVZA 2D9OA 2DHSA 4OZ1A 3THTA 2N3LA 3H2VE 1WI8A 1L3KA 1JMTA 4J5OA 1X4CA 4UQTA 2DGOA 1U1OA 4ED5A 2LKZA 2MKIA 3BO2A 2MZTA 2X1GA 1NO8A 2MQLA 1UW4A 1WWHA 2EK1A 3SDEB 3SDEA 3PIOQ 1RKJA 2LMIA 2RS2A 4U67Q 1M1KT 4TLQA 5LJ5Y 2M0GB 2X1AA 4PR6A 2UP1A 1YHQS 1WG4A 1KC8T 1CVJA 1X4BA 5LXYA 2DISA 2L9WA 4FXWA 2OTLS 2RUGA 1VBXA 2G4BA 1H2VZ 1U1QA 3EGNA 2KXHA 2KM8B 4WFNQ 1U1RA 2DHAA 2DO4A 3VAKA 1M5OC 2MB0B 1N52B 5HO4A 2RNEA 5JVGQ 2V94A 4IOCQ 1N88A 3CCQS 2DNZA 1VQ4S 5DDQC 1SJ4P 2MMYA 2MSSA 2M2BA 3MDFA 3UE2A 1WF0A 1S79A 3MURP 3JB9k 2AYEA 5DDPC 3NS5A 2MQMA 2RVJA 3Q2TC 2KH9A 2LA6A 1OWXA 2MQNA 2MYFA 3R1LA 2F9DA 2MXYA 4UY8T 2CPIA 2MY7A 2MZ1A 2ZJQQ 3RW7A 2OSQA 2KRBA 4CH1A 2GHPA 2J0QD 1ZH5A 2M70A 2KXFA 5LJ3Y 2M4MA 2FHOB 1FT8A 2AYMA 3B4MA 2J8AA 3CCES 2XNQA 1W2BR 2KG0A 3EGZA 1KD1T 1M5KC 2MKSA 1X5OA 3OW2R 3MXHP 1WG1A 3P6YC 2YH0A 1Q82T 3CD6S 1K8AT 2MKJA 2XS2A 4W90B 2DNYA 3NMRA 2MZRA 2YH1A 2LCWA 3P5TL 3G6ES 1WELA 3MD1A 5DM7Q 2MSTA 1U1PA 3CULA 5IFMA 1U1LA 2CPDA 2DH7A 1BY9A 2CQIA 2FC8A 1DHMA 1OPIA 2HGLA 2VOOA 1UFWA 3HI9A 1FHTA 2KU7A 1JJHA 3K0JA 3EX7B 1H2TZ 1VQ8S 3CCMS 3NNHA 3TYTA 2M52A 2QEXS 2F3JA 2ADBA 2LEAA 2I2YA 2M8HA 1ZZNA 2BZ2A 2JVRA 1JJ4A 1K73T 2CQBA 2DNLA 2LECA 1X4HA 3THPA 4WF9Q 1N8RT 1H6KX 4ZKAA 2ERRA 2SXLA 3BS9A 2DB1A 1A9NB 2MKCA 2RRAA 1VC5A 2I38A 5CYJA 1VQ6S 1FO1A 2EK6A 3U1MA 2E5HA 3PIPQ 2DO0A 4WFAQ 2CQ4A 2PE8A 4IUFA 2KRRA 2M7SA 3U1LA 4YUDA 2E44A 3S7RA 1SJ3P 2HVZA 2RT3A 2QFJA 4YOEA 1HD1A 2JWNA 1X4EA 2XS5A 2DHGA 2MPUA 1YJWS 2RU3A 1VBYA 2M88A 2X1BA 3BO4A 2MGZA 3CCJS 1VQNS 2ADCA 4TU8A 4CQ1A 2FY1A 2DNMA 5IM0B 5DDOC 1P27B 5FJ4A 4EGLA 1U1KA 2RQCA 2AD9A 3H2UB 2KYXA 3FEYB 2DITA 4WFBQ 3J7ZT 2QA4S 1HA1A 2KT5A 2MQQA 2FC9A 2CPHA 1S72S 2O3DA 3UCUP 3CMES 2XB2D 2NZ4A 4WCEQ 3DXBA 4TU7A 2CPYA 1RK8A 2WBRA 2CQ2A 2XSFA 2CPJA 4LIRA 4OZ0A 2ZJPQ 1WEYA 3MI7X 4W92B 1U2FA 2GO9A 3CF5Q 3G96A 5DDRC 3HHNB 1WHVA 4IO9Q 1WF1A 1URNA 2KG1A 1JJ2R 3G9CA 2MQOA 3B4DA 3MUTP 2B0GA 4QU7A 3MD3A 2HGMA 1YTYA 1U1MA 3Q2SC 2L41A 2J0SD 2KN4A 2KM8C 3VF0B 2DNPA 3BEGB 2CQPA 3R1HA 5HL7Q 2MZJA 1VQ9S 2CQ0A 2DNKA 2OJ3A 5GVQA 1YIJS 1X4DA 2DGQA 2KXNB 1YJNS 1UP1A 3TO8A 1YI2S 1IQTA 3VAFA 3UWTA 1WTBA 2VOPA 4Z2XA 3CC2S 3RW6A 1D9AA 5CXTA 2AYGA 2BOPA 1WG5A 2CPZA 2MY8A 3TP2A 3G8TA 2DIUA 3UD3P 2AYBA 3UD4P 1WF2A 3SMZA 2DGTA 4C7QA 3DLLQ 1WEZA 1QVGR 1X4GA
chains in the Genus database with same CATH superfamily
3TUJC 2XY5A 4EFAC 1AXQA 1VQ5S 1D0EA 5F0WA 3AB4B 3OVBA 4A8YA 4USMA 3MUMP 4OIXA 1TELA 5F3TA 2OSRA 3ELHA 3TAPA 2W9CA 2OPSA 1Q4RA 4WXWA 5DGBA 5K8PA 3V4IB 5I42B 4F50A 3VCDA 2XS7A 1HBOA 4NCBA 3HJFA 2PEBA 4MIAA 3HSDA 3D2WA 4HACB 2PDAA 3AHPA 4DL7A 4CNYA 4LMZA 4PQUB 2R7QA 4KY3A 5L9NA 3J81Y 4ETZA 1Q7LB 4K7QA 5KFOA 2CJAA 1EETB 1YLXA 3EICA 3PYGA 2DYAA 1SUQB 3JXOA 3MMAB 5DG8A 1VQNS 2XY6A 2HZAA 2PN6A 4PKDB 3PNIA 4KB7A 1XMBA 3MM7B 1B64A 1EP4B 3C15A 3DM2A 4KSEB 4F4AA 1ZM2A 3I87A 5DJBA 1I6JA 1NDKA 2APOA 3TWZA 4ZLLA 2FIUA 3PHTA 4OX7A 3O6QA 2XC9A 3NNAA 3AA9A 4DV7J 3SZ2A 2CQGA 4K8RA 2I9SA 4RZRA 4ZVSB 3GG0A 2VBWA 1ZM3A 1YITS 4PCQA 3HSGA 4DJBA 2QA4G 2ZH8A 2W24A 2JNJA 3D28A 4HDHA 1YJTA 4IH7A 1J27A 4F25A 5B0CA 2PMWA 1HARA 2J76E 5J2NB 3VAIA 1XK8A 4DV3J 4ZJQA 2BANA 4EBCA 5LSOA 1RWWB 3M9MB 5J2NA 1PYTA 4DWIA 3S1TA 4ID8A 2IJNA 2HHVA 1F9HA 3ZTPA 1CULA 2GVDB 1FJ7A 1CULB 5C7PA 4DL6A 5M2PA 4DV5J 2XYHB 2VJUA 4DV1F 4ZN3A 3KK2A 3KJFB 3IGNA 4NCGB 3LF0A 3MAHA 2BW7A 1HNVB 1HWLA 1FXDA 1SJ1A 2CJBA 2HFZA 3A8JA 3D0HE 3DN9A 4C98A 4N5SA 3H5XA 3ISZA 1HHTP 2OEKA 1XNQJ 1Y7PA 1EQMA 1JWWA 3WQPA 2R8JA 1D8ZA 4LFAF 1BD6A 2L3MA 1TFWA 1ROFA 5KG6A 4KHPJ 3M2RB 3L3CA 4PQAA 2U2FA 3N5BA 5C25A 2FJVA 3BKFA 2HS0A 4Q0BA 2LXFA 2PIIA 3OV7A 3BQ0A 1NK7A 2LFVA 3GZ7A 2K1RB 5HROA 2YKOA 4M94A 2XMUA 4ED8A 3NGDA 3PYEA 5E3QA 1A7GE 3QNWB 3RAMA 2IVYA 1L3VA 2QSFA 2RHQB 3T19A 3PO4A 3D6HB 5LMUF 3PJWA 3I55S 4FF1A 3M6UA 2ZH6A 3V6DA 4JI6J 4A8QA 1M5VC 2KTQA 2CJKA 2BW2A 1T9XA 2QSWA 1NUEA 1WHWA 3BGRA 1Q5YA 4CDIA 3MM9B 4FPIA 4AQYF 3HFZB 1F3FA 1HL6A 2KJVA 4BC9A 3SQGA 2ZH2A 3MEKA 4DL0C 2PI4A 2ZZNA 4QYZJ 2NXCA 2P8IA 1X0FA 1P1LA 1TKZA 2RRNA 1B99A 5A8KA 1AT1B 1S48A 3C14B 3IAM9 3TA2A 4NLSA 3QRQA 3CJ4A 3DOLA 1FRIA 2KI2A 1VQSA 4RW9A 4JI4F 3MGJA 4KH1B 1F5BA 1HKAA 3TUIC 1FJGJ 4MFBB 3CJ2A 4F3MA 2KZMA 4PYAA 3G82B 2YKAA 3H42A 4DV5F 2IA6A 4DFPA 2C28A 1FRMA 3IR7B 1Y00A 1H38A 1M90T 3PEJA 4XAKA 2XWYA 2R3VA 3VAJA 1PAUB 2W9BB 2Y1IA 4X65J 3CPWR 3EGWB 4P2SA 4A8XA 4N56A 3GV5B 2ZFHA 3MF5A 4YR3A 2VA2A 1T9VA 1S9GA 1UWAA 3NCQA 4KFBB 4NZ6A 4ZP9A 1TL3B 1NSQA 5HJYA 4LF9F 1FXLA 4LREA 4Y2KA 1NLKL 3DLJA 4ZVHA 5KOXA 4OI0A 1FDDA 2XLJA 3CCRS 3W8GA 2VFRA 3KG4A 4M5HA 2X1FA 1YBAA 1VBZA 4DR5J 5IM0A 1QLNA 3C3LA 1Q8IA 2OELA 3QSIA 1WSRA 4NLUA 4P2FA 2EWHA 2J7WA 3LW5C 4E8UA 4IG0B 2DNNA 1JLCA 4ZVFA 4QWDA 2IRUA 1UPMB 4M5DB 4PWWA 5K20B 3MTJA 1HMVA 1SH3A 3OD2A 3FJ2A 4DSEA 3OVSA 1UJ4A 5LXRA 3GV7B 4YMEA 4GKKF 1WKJA 1GQEA 2BQRA 1K0VA 4UOCA 2XWXA 5DGAA 1V3RA 3OL9A 1VIOA 3QGIA 2ZKTA 4I0WA 2G2YA 4OYMA 4OYIA 3R7BB 5B0AA 3PFOA 1G2EA 2RHSB 3OVAA 3OXGA 2BE9B 4X2BA 3D54A 3R27A 5EN1A 3V6DB 1JLFB 1RT7B 2Z2MA 1N0UA 1TKTB 3UDCA 4I2PB 2LXIA 2YX1A 3HHLB 2HBYB 3J7Z5 3I56S 2AU0A 5A0YA 3UVJA 1TL1A 4EO6A 3M32A 3KLIA 4JV5J 3RR7A 3GYNA 4C0OC 4G6VB 2NSCA 5ETMA 1NJXA 5ETNA 5DS7A 5L38A 4J7CA 1VQYA 4F4XA 3R5CA 2H4YB 4LBHA 2HZVA 1WC3A 1NMEB 4L73A 1KOOA 1UW9A 2QZ8A 1WHYA 3ZTRA 4OI2A 3VAMA 4J91A 3R5GA 4RNOA 2HNYA 1YRXA 2N4CA 2X51A 2RQKA 3FCWA 4QW8A 3LP0A 3ZZZA 2OPRA 4F36A 5IT4A 2QIFA 3DOLB 2EKYA 2ZOMA 3NBPA 2DR8A 1R6YA 4O3QA 2R8HA 3JYTA 4K4WA 1U1NA 1SJFA 4JI0F 4PRFA 3BDPA 1WDTA 4CO0A 2DGWA 3AOCA 1F2GA 3D3BJ 1Q79A 2F5GA 3SFUA 2CZ4A 3MPVA 1F9FA 4YHHF 4LFAJ 1I51B 4B9VA 1BQNA 3DLBA 3KK1A 5K9FA 4X4TA 1XNQF 2YWKA 3MMJA 4XDCA 1Q5VA 3CXCR 3M7VA 4GKJF 2AMCB 4JI3F 4CRJA 1H3DA 1RHKB 2CQ3A 3CMAS 2A18A 3CMQA 3QFHA 3CCLS 1SL0A 3QBCA 4YDDB 1SKUB 3W1YC 2EVZA 3RBEA 8AT1B 1CLFA 5HJXA 1L3SA 3MTKA 4OZNA 3A8EA 4Q45A 3OLBA 2F65A 4I56A 1X4CA 2UVUA 3L9ZA 4M5NA 1UEKA 1LWXA 2QA2A 1S1TB 2EW9A 2H1YA 3RBXA 2ZNYA 2MKIA 2AJ0A 1REVA 1FE0A 1FI4A 2B6AB 2E5LF 2UU9J 2KZZA 3TZWA 3QRPA 2BV3A 1H0HB 3DRSA 4DPYA 2LMIA 3LWMA 4B9TA 2V50A 3KUHA 2RS2A 3B54A 1S99A 1VI7A 4FF3A 3OTCA 1KP6A 2EFPA 2B9YA 4K0KF 1Y3KA 3PHEA 2OLWA 3M8ZA 1NK6A 3DRRA 1WG4A 1X7VA 1URRA 3W65A 1YHQS 3GFXA 1KC8T 4A8OA 4ZVUB 2BKNA 5C24A 2Z57B 2FY8A 4Y3CA 4FXWA 5KG7A 3M30B 1VBXA 1T03A 3M8PA 2CG8A 3IRXB 4ZITA 1T8EA 2XG8A 4C9DA 2KM8B 1RT2A 5F0UA 1UPPA 2BA9A 4CI0B 5E3PA 5KFBA 2A6OA 4LVNP 1I1GA 4WFNQ 1U1RA 2AGOA 1QSLA 2NR0A 4PWDA 3D0IE 5U47A 5HBMB 1OQ6A 3EPIA 2DR5A 2IM3A 2VKRA 4DZDA 2NREA 1RWKB 1S1VA 2OGUA 4P9SA 2HFVA 3K8VA 5HO4A 2RNEA 5JVGQ 7AT1B 3PX0A 3FZ2A 4C8ZA 5D4NA 1G4CA 3FDSA 3CCQS 4IOBA 4DF8A 1ICEB 4RW8A 4Y6IA 3GU0A 5DDQC 2NSBA 4DU7A 4LFCJ 4EYIB 3MDFA 3KMQA 4LR8A 4D3GA 3DHWC 1FFGB 2OI2A 1MN7A 2RQMA 2V69A 5DDPC 2QE5A 1FXRA 5CYMB 2IY5B 2RVJA 1RA7A 2HQFA 2KH9A 5C42A 2LA6A 3ILJA 4ECZA 3Q2TC 4HACA 4CTAB 3H90A 2BABA 4MKVA 2ZH3A 1WUUA 2F9DA 2QO3A 3Q24A 3D1OA 4M5KA 2L9DA 4ED7A 2LQJA 2XO6A 3HZEA 1FEHA 1ELOA 4CH1A 1Q53A 4QYZK 1FDBA 2M70A 4YY3J 4IR9A 2KXFA 2FJDB 2M3DA 3CCZA 1FDAA 3EWGA 4FKXA 4BCAA 1FKPA 1U0SA 4C2MA 5KFCA 1OSDA 4CO3A 5KG2A 5FLXU 3C14A 2FHOB 1AFJA 1FT8A 4HT5A 4J9UE 2KG0A 3SI8A 3AOBA 2BJEA 2WK4A 2JLFA 3AD7C 3QGGA 2B51A 4G1QB 3GIJA 1WG1A 5ETSA 2Y1JA 3VGVA 2EFQA 1NK0A 2C22A 1JLGB 3QIDA 4YR2A 5F8IA 5KFNA 2HSEB 3GWCA 3IR5B 4JBCA 5D4OA 2MZRA 4FZVA 1F60B 1HBOB 3FVYA 4M5LA 3MCNA 2LCWA 4UTGA 1SCJB 4EUVA 3H40A 1C0UA 1KQGB 2A10A 1TQLA 3HVWA 3G6ES 1C0UB 3MD1A 5DM7Q 4MTPA 1RTDA 1U1PA 2FQQB 3VVTA 3KNAA 2H5IB 4L3NA 1U1LA 2CJYB 4DR7F 1XTZA 2CA9A 1SQEA 3KYLA 5LMNF 2R2TA 4WK3A 3Q8SB 4JOUA 2BQUA 1EP4A 4JI8J 5IT0A 2WSCC 1DHMA 2QN6B 4KPYA 1YZ7A 4DV6F 1U2RA 2FZCB 1YRUA 3LAKA 1T05B 3HI9A 1IBKF 1M1HA 2D1CA 4ZPTR 5HMYA 2D69A 3A13A 4DLGA 3AY0A 4CLPA 1WC5A 3LO3A 3JAMY 1RAOA 3D6TB 3QAEA 3OL6A 3K0JA 3V6JA 1H2TZ 1KFDA 3CCMS 3KFWX 4BHQA 3TJAA 4URSA 3F0NA 1SIWB 1QTNB 3GSIA 2ILYA 3GLJA 4DR1F 1KTVA 2ADBA 2ZHAA 5DQGA 5IS2A 3KLEB 2B4UA 2BZ2A 3SBMA 4N8OA 4B02A 1JXLA 4KGKA 4X64F 1AZSB 1AFIA 2GMHA 5KFTA 3R5DA 1FRHA 3T9ZA 3GPAA 1X4HA 3NRBA 1CQNA 4WP8A 2DCUB 3CJSA 4DV0F 1DAXA 2C3YA 4C11B 2HWTA 1H6KX 2Z30B 4A4JA 4DCJB 1F5AA 4ZKAA 5BXIA 3RU0A 1J5EF 4KQZA 3PW4A 5HSPA 3HF5A 2K3IA 4P52A 5E3RA 3DDIA 4RUCA 2DB1A 1TKDA 2MKCA 1NJWA 3CE8A 2I38A 2V34A 3OPKA 5CAAA 3DHXA 1T9UA 2ASJA 4PUOA 2FVSA 3HMJG 1GMWA 3B6BA 4KC5A 2WW4A 1RXOB 4AFFA 1JLAB 3DFEA 4WFAQ 4RU9A 4QWCA 3Q23A 1RLDA 1N6QB 2CQ4A 2EI5A 4HTIA 3IWXA 1TMMA 2PE8A 1FA0A 3I0SA 1OY9A 1UZHA 3ISNC 3MPYA 3NGSA 3R6LB 1WKLA 4LVOP 4TXSA 2J0XA 1U4BA 1TK5A 2GGPB 3WIUA 4RO0A 4UOGA 4OI4A 5ADZA 2RT3A 1D09B 3H4BA 1UCNA 2VG6A 3OJUA 3EPGA 1IBKJ 1EIYB 3HHLA 3J81U 3RR8A 3B8HA 2NXNA 1VK8A 3UVJB 2B5JA 5A0YB 3KLGB 1LWEA 3DRPA 2FLOA 1RHUB 1RBAA 1GXLA 1PC5A 2M88A 3TOQA 1X8DA 2W8LA 5FDLA 2VC0A 3CO0P 4F4YA 3KLVA 1NKCA 2AIRB 5FDLB 3W3SA 2Z58B 3UNGC 3AD9C 4CLUA 4ANEA 1PILA 4CQ1A 2R7RA 1S59A 3IGVA 4LFBF 1NKBA 3D9BA 3DC2A 1P27B 4MAKA 4EGLA 3HT3A 3N4WA 5EWGA 3SYZA 2RQCA 4NYOA 4U96A 1NHKL 3H2UB 2G13A 4USVA 2KYXA 2ROPA 2VU5A 3Q8UA 2GNKA 4OHWA 2VIHA 4FN5A 4IRDA 1REVB 2CPHA 4YN3B 5FIIA 1M1GA 1B3TA 3UCUP 3GJSB 1QJHA 2W2NP 3TAQA 2XB2D 4Z7YA 3U02A 4TU7A 2WBRA 1LEOA 3RRHA 1S0OA 2WVCA 2XSFA 3RJMB 3V81A 4CLZA 1S9GB 1HI1A 1XBWA 4DPTA 4HTJA 2EPIA 3DGPA 3KKFA 4LIRA 4ZCKA 1S1XA 3QFWA 3VZIA 2ZJPQ 1E6VA 1Q0NA 3MI7X 1HBUA 1F0XA 2CIMA 3W2WB 1BGXT 3ZZRA 4CM0A 4E98A 3Q22A 4A8WA 1ZBTA 4ZVPB 4O3RA 5KT3A 5SZTA 4DG1B 3R5AA 4ECSA 1S0MA 3QWUA 3W5ZA 1KLMB 3HHNB 1WHVA 2WB1D 1N56A 4XIUA 4FYWB 2V6AA 3CDAA 1JLCB 5DQIA 2KG1A 1JJ2R 2E1CA 1URNA 3TJ8A 5DG9A 2H5JB 4Q2LA 3W2VB 1IKYA 2P5VA 2QT7A 3B4DA 4JB8B 3C16A 2HVEA 2GMJA 2QC3A 2YKPA 1Q1KA 4HYKA 1Z2LA 2JLEA 2C1EB 5KFLA 4I69A 1YTYA 2XLKA 5IT9U 3U7JA 2H3EB 1NHUA 3IFEA 3CJ5A 2J0SD 1XEZA 3DDKA 4ES2A 3MOZA 3PW7A 1F1BB 4ZHRA 4C8KA 1VFJA 1GX6A 1RWNB 2V2ZA 4K4YA 4ZHRB 3R1HA 1QDUB 2I0XA 2MZJA 4DQSA 3G8QA 1N5TA 1R0AB 3TQEA 3FCHA 1RT6A 3W7BA 1HWKA 3G2XA 2AEFA 4F3OA 3CDBA 4USIA 1TL1B 2V8GA 1YIJS 1X4DA 2DGQA 2KXNB 1C1BA 5E5NA 2XGQA 3KJVA 4W90B 1UP1A 2YKNA 1YI2S 3M30A 4B3TJ 3MMCB 1EJ7L 1V9OA 3GSDA 1EX8A 1PG5B 1RBLA 3DOMB 3ET6A 1IBLJ 3P8BB 1FKOA 5D4PA 4ZCLA 2VOPA 4Z2XA 1FVSA 2HHUA 3IR6B 1MMLA 2GAHC 4IFYB 4UZBA 4OHYA 4PWDB 2MY8A 4P72A 4DR1J 4EZ6A 2W9AA 2F40A 1S7HA 2KKHA 2YKMB 3W9JA 3SMZA 3DLLQ 3DRYA 3WX8A 1QVGR 2ZH4A 1R8HA 4ERDA 2W7PA 3K57A 2Z0GA 3ZTOA 2DNGA 4KGZB 2NCKL 5K8NA 2FPHX 4HT7A 2ZE2B 2B6AA 2K2PA 4F0KA 5LJ3Y 2F9JA 3T1HJ 1HNZJ 4RW8B 3M6VA 2XYPB 4CO4A 2CPFA 4ZIVA 4LF5J 3ENWA 4TY8A 2NYIA 4QOTA 1X4AA 3E01A 4DQPA 3P49B 2RE1A 3R9LA 4TKTA 2CVEA 4HDGA 1U0HA 4LUBA 4LRDA 1D9FA 4B3SF 2E9TA 4X65F 2EEYA 4DHVA 3RAQA 8ATCB 4JV1A 4WP9A 1S6PA 1OQ3A 5K14A 4PXBA 4GMKA 3SQGB 3NL0A 1W25A 2I5JB 4FVMA 5J1NA 3OTOJ 2FVCA 1KLMA 1WC4A 2I5JA 1SKSA 5LT5A 2HGNA 4G1PA 5E41A 4J9KA 1TK8A 2AHOB 1Q8KA 5D78A 5EDWA 2MHNA 1VYAA 4C3KA 2GQCA 1JLBB 3LOUA 1Y3JA 1F9EB 2GZOA 2HFOA 5KG3A 4UZCA 2VFVA 1UL3A 3PDNA 4WPAA 3GIMA 4ECWA 2VFTA 1Q86T 2J6UA 1IKXA 1XNRF 4DR6F 2XZWA 1VQOS 4JI5F 4WFYA 1IKWB 4FXVA 4NE9C 2FLLA 4BWMA 2V8HA 3ILLA 3NNCA 2R7TA 3OTOF 4YEAA 2DGSA 4QZVB 5MLCV 4EWTA 2G0CA 5GAGU 3NGTA 1BWEA 4RKUC 3CCUS 4DV2J 4YDXA 2D41A 2QMUB 3IAS9 2E5IA 4IH6A 2BANB 2DK2A 4QU6A 1RAFB 1I3OB 4UOFA 4DCPB 4M95A 4XPEA 2VPWB 1QAXA 1O8BA 2YNGA 1SKRA 2JX2A 2MJUA 3UDEA 5F8HA 1TV6B 1C1CA 2V9KA 3ICLA 4OHVA 4DV4F 1VQPS 1PO6A 3EXCX 4J9LA 2NYHA 5L9XA 3EMTA 4LF7J 5H9FK 4C0BA 4OI1A 1DY3A 1VRUA 1LWCA 2RJZA 1RWUA 2UZAA 4P71A 3W60A 5F9LA 3RTVA 4BS2A 2RB7A 4OMFG 4NCGA 4KE5A 2Z56B 4OV1A 3TZYA 4DV7F 1HLWA 2DY1A 2QMXA 2EC2A 3O8WA 3T5HA 3RBDA 2HRTA 3HO1A 2BJ3A 3KWMA 3HKZD 4ZPWR 3ZTSA 2O5DA 3ET6B 2O01C 4I6AA 3SSRA 4X66F 1JX4A 4PXEA 5I3PA 4A47A 1OO0B 3P45B 1M5SA 2FD2A 1EB0A 2GQQA 3DXSX 4L72B 4N8NA 4JI8F 2K1RA 3TNVA 2ZC4A 2OMOA 1V5IB 2MLXA 4FNIA 2KFYA 3M8SA 2PA3A 1Y5NB 4LJMA 3U1NA 4W92B 1U6FA 4DQRA 8RUCA 3HHKA 3I0SB 2MLYA 2E5JA 2ZZTA 1SQFA 3Q8VA 1QTMA 2EG1A 2ATLA 3V4IA 1VMBA 2HPUA 1P1TA 1RABB 2MKHA 2MQ8A 5EX0A 3E01B 1VQLS 1Q7YT 4U95A 2PD1A 1REGX 3GQCA 1FKAF 4K4SA 2HYIB 3KOAA 2IC3B 2YNHB 3NAHA 4C3MA 4CO1A 2GMLA 2IDLA 2IC3A 2YNHA 1H7WA 1K1SA 2IM1A 2ZITA 3BPSP 3HD2A 3LANA 4FP9A 3GONA 5KFVA 5CCMA 4WWSA 2DGVA 2MKKA 2IFXA 2ZHBA 3PW5A 2HHHJ 2BRKA 2FVQA 1DTTA 2DNQA 2BRLA 3GTYX 3R6GB 4H4KA 2Q66A 4X4QA 2DNRA 2PA8D 2WVEA 4WXOA 4DSLA 2GJIA 2VICA 1TVRB 3CIMA 3QT7A 3ONQA 1N5YB 1DZ5A 2OD6A 3PTWA 1TUWA 2C3OA 4D3HA 3VGUA 3ZNUA 2DPJA 4A8SA 4QR0A 5DLFA 2HQIA 3G82A 4YB7A 3B82A 3ILOA 3US5A 5KAKA 2QA1A 3UCZP 4B3TF 3K8WA 2CQCA 3CJKA 2ZM6F 1RKIA 4KR0B 4AUKA 4ELUA 2RS8A 3AJ2A 4DN0A 5DM6Q 1KNZA 2YWEA 1ZS6A 2HWIA 3LQVA 1RLCL 2N7YA 3SQOP 3TA0A 3M1VB 3VR1A 4HH1A 1M5PC 2DGUA 3RGIA 1WEXA 2DHHA 1WHXA 2K8GA 4ZDNA 3VAKA 1FJEB 1CJVB 4OQJA 4DR4J 2Z2ZA 4Z7CA 4X4RA 3MFHA 4I67A 4K59A 1HNZF 5AT1B 2W7OA 3M2UA 1HPZA 2BJDA 4ZIWA 1J5OB 1N33J 1N32F 2RIJA 1MU2B 2HQCA 3JSBA 4DX5A 3BGOP 4ZP7A 3AB2B 3GMGA 3KG0A 2EG2A 5KFSA 1TL4A 1X5PA 4AD6A 2IVMA 4V19X 1B0PA 4C4WA 2Q6BA 2XMVA 2ZVIA 2JL9A 4LIWA 3GP9A 3WC2A 1HWJA 2F8HA 3W2VA 4TU9A 2V2VA 4YB6A 3VAGA 1DJ0A 4AL7A 5F9NA 1K9MT 1D9DA 4F4KA 3BR9A 4IH5A 3T1HF 2CQHA 4DR2F 2AGQA 1RP5A 4EMDA 1FDNA 3O5TB 1IBLF 1JNZB 4DUYJ 1FJCA 1OY6A 1F2HA 2LQBA 1YVFA 2ACMA 1NNDA 1BQMB 2IA0A 2O66A 4HI2A 4HI1A 3OUYA 2ALZA 1IUJA 4O23A 3BH7B 1VC0A 3BSCA 3W9IA 3M4XA 1SH2A 3N9UC 2AJ4A 1OIAA 2BYCA 2C3MA 2U1AA 3FKBA 4KHMA 5IQQA 3W64A 3NGRA 1H98A 1WNEA 4I2PA 5J2QA 1X9SA 1AZSA 1JLFA 1RT7A 1VRQC 2CNNB 1U7LA 4P10A 2MZSA 3FBCA 3BREA 1KOHA 1SJRA 1SC1B 4NYPA 2HK3A 2VJVA 2RF2A 3TW0A 1SC3B 4OX9J 2KB2A 4EYHB 3GCWP 2YTCA 1X5SA 4YB1P 3QIPA 3QQCD 4Y2IA 1X9MA 1FRLA 2DEJA 1W26A 3M05A 3C8YA 1HR0F 3CC4S 1Q95G 1RAGB 2DY9A 3KLHA 3CGIA 3OT9A 3FEZA 1TL7B 3T5LA 1N5YA 2F4VJ 4OYXA 3T1AA 1X31C 1U26A 5A2QY 2LEPA 3NGKA 4MKAA 4V19J 1IR1A 3BSAA 3IRWP 3CJKB 2LEBA 3MM6A 3CCSS 3DU6A 3MM6B 3T9NA 5AXLA 1MW7A 4CLTA 2FJEB 2CAJA 4OZJA 5B09A 4IR1A 1ZZFA 4NLWA 1FWKA 4NASA 4CNZA 4K4UA 3RB6A 2ZC3A 2K3KA 2MJNA 2QLBB 3FRZA 1SJQA 2DXEA 3CJRA 3NEKA 2R42A 4DOZA 5KFQA 4CLSA 5DETA 2MGZB 1EAYC 3TARA 2K7KA 4GVBB 2O1PA 5GAEU 2IM2A 2VG7B 4GVBA 1PKUA 4JUZA 3VHQA 4NXMF 2WSFC 4U9RA 5GAHU 2O67A 2QL5B 5K14B 2M9KA 3CC7S 2KFZA 2W1BA 1RTIB 3QLHB 1BE4A 4OZ1A 4JI2J 2N3LA 3H2VE 5A76A 5HMZA 4ED1A 1DTQA 1MROB 1IKYB 2HNZA 2F63A 4ZP8A 3SEOA 4OJ1A 1BLUA 2DGOA 2HNZB 3UFCX 3QJPA 4ED5A 4KYZA 3BO2A 3FSXA 3BN7A 1NO8A 4Q5VA 1G7CB 4RJVA 1IVZA 1UW4A 3GJQB 1WWHA 5HLFB 3SCKE 3PRDA 4WU2A 4JI1J 1JNRB 3WC0A 3PIOQ 4QIWD 5J1EB 3ZFVA 1GT8A 3C6TA 5F8LA 4U67Q 2DR7A 1ZA2B 3CT9A 4ES1A 1HW9A 3LP2A 2X1AA 3PEHA 4PR6A 3MCMA 4C6AA 4KO0A 1X9WA 4JYAJ 2W2PP 2COLA 3EDQB 2YNGB 4TYBA 4TQRA 2UP1A 5KFPA 1VOMA 1KR4A 2HKEA 1S10A 2BMBA 5A8RA 2CDQA 1SKWA 2OTLS 2WOMB 5C24B 1JXEA 2OKQA 2A6MA 2WB4A 5D0GA 2HAIA 1H2VZ 1SL2A 1L5UA 1LWCB 3C15B 3DM2B 5A6WA 5AJ3F 1LXNA 2B8QA 1FNMA 1S76D 2DR9A 1NSKL 3UQSA 4PG8A 4LF4J 3H25A 5KT5A 1RT2B 4JYAF 1NDLA 2CJ9A 1H7XA 2JC1A 2QYGA 5D15A 2OPQA 4YQWA 2BM1A 4CYUB 4CT9A 5HQLA 2FVPA 3C2PA 2KYZA 1FF2A 2HS4A 4EZ9A 4OX6A 1M5OC 2ZOGA 1CJTA 4DLEA 3QO9A 3SV3A 3DLGA 4MMOA 5HQ8A 1JLEB 4B17A 4XDDA 2GIRA 2R4FA 1ACMB 2P9GA 5CQGA 2E66A 2Y3YA 3Q86A 4QR1A 4DPUA 4RW6A 4MIBA 3T5JA 2MMYA 2MSSA 2VASA 1XNRJ 1CC7A 1NDCA 1RT3A 1WF0A 3UE2A 1S79A 2UUAJ 2CZ9A 3MURP 4ANDA 4DQIA 1T9YA 3NS5A 2YKNB 1AYEA 1S4FA 2QJ3A 4LBIA 1TAUA 4ED6A 4I64A 1NK9A 3KHHA 3MCSA 2MY7A 2MZ1A 2VBYA 2FYXA 4OJHA 3NCPA 1RYSA 5KG1A 4FBTA 1ZH5A 1AA1B 2GX8A 3IBWA 3KG1A 4I4BA 2VZ9A 2ZOFA 4DMZA 1YJUA 3FBFA 3H5SA 3O44A 4H4MA 2F8MA 1GX5A 3B4MA 2J8AA 2VG5A 2XHCA 3VGSA 3MR6A 1W2BR 3EGZA 1DQ8A 1JLAA 3WDOA 3WX4A 2MDAA 2J5AA 2XZDB 3R7NB 1N6QA 1X5OA 1S6UA 1KTQA 5KG4A 1IWGA 3UI3A 2VKZG 2OUGA 5CD4A 3OW2R 3MXHP 2L48A 1P9QC 2HRYA 4J9RA 1Q82T 1NPPA 2FDNA 2NPIA 4GVLA 4QIGA 1K8AT 2XS2A 1MNEA 1FWLA 4NA2A 4M5JA 4MT1A 4R25A 2AGPA 3B78A 3TANA 2DBBA 1UEUA 4U7CA 2ZZMA 3D5MA 4LT6A 3LP2B 2ZEJA 1K44A 3LP1A 3MEGB 1YBTA 1HWIA 3EGVA 3AXMA 1Q8BA 1WELA 2H54B 3MM9A 3QATA 3W66A 4C97A 4B3MF 1GMWD 3I82A 4DUYF 1NH7A 2CPDA 3DRXA 1RT4B 4CM2A 1QSYA 1IM4A 1X60A 1RT4A 3NGUA 4I2QB 1LXJA 3I5AA 3TAMA 5FD1A 4B3SJ 2V8VA 2V2QA 2YWFA 4NA1A 5A8KB 1JLBA 5HQMA 4B9UA 4WZMA 3K17A 1CS4B 4P74A 3V6HA 4K4TA 2J9DE 2I6WA 4NLXA 1FHTA 4PYDA 3ZZPA 3G6YA 1U47A 4X84A 5LOQA 1S0VA 3QT5A 2G2OA 1TK0A 3NS7B 3QPIA 4YS2A 1D1UA 4L76A 1GMVA 4X4VA 1W2IA 2G0IA 3BM7A 3NNHA 1DFDA 4XK8C 5J2PA 3I5BA 2CVIA 2HIYA 3NG8A 2AZ3A 3V5RA 2M52A 4O4GB 2F3JA 3TZZA 5L8RC 1Y5IB 2E7VA 3D1HA 1HNXJ 1S1XB 1RT3B 2CXEA 2M8HA 2QFIA 2N7CA 1MWQA 2JVRA 4DQQA 1ZZNA 1JJ4A 3LTOA 3M8QA 4LR7A 3POTA 3QJJA 2KFNA 4ZPDA 2UVRA 2FGCA 1VRUB 1AUSL 2CQBA 2DNLA 2H4WB 1SC6A 3O1LA 2FJAB 4L3KA 2IVFB 5CHCB 3CCTA 3THPA 3MR5A 4GO7X 4FVCA 4OL8A 1EHWA 1NSAA 4DN9A 3CCWA 1DTTB 1RISA 3LWLA 1TR0A 1I5OB 3ETOA 2RRAA 5AXKA 1QAJA 2OEMA 3OFGA 5BYRA 3W61A 4NL5A 4LFCF 1Q16B 2PSZA 4M1KA 5D0EA 2YNFB 4DUTA 2NUUG 2G9OA 1N32J 1WOPA 5HATA 3Q8QB 3VVUA 2AJFE 1ZAXA 2WVFA 4CO2A 4IUFA 3MFIA 3MPUB 5CYQB 4X64J 1S6OA 1RBOB 2E44A 4YUDA 2XCPA 2HVZA 4FYYB 5J2QB 4YOEA 1T3OA 1E6YA 3QWPA 4B08A 2B5JB 1X4EA 3KLGA 4G3IA 2V5HG 4BBYA 4LR9A 3IO1A 2RU3A 1CJKA 2HK2A 2EBGA 1UFLA 3CJTA 3EDRB 1LOUA 3RUBL 2XY7A 4PAAA 1FKOB 5G4DA 3OR1A 5KFZA 4ECRA 5JMNA 4TU8A 2HHTA 1R8CA 5F8MA 5T14A 1RCXB 3L7PA 3A8KA 4B9SA 5FJ4A 2YWGA 2CG4A 1XC9A 1U1KA 3JTNA 1RACB 4WP3A 5HMWA 5D3GB 3K7RA 2AD9A 4RW9B 2W4CA 1P8GA 1Y4ZB 3FEYB 2DITA 3JTOA 1V3ZA 3DKDA 5I3QA 2GHWA 3NWRA 2QA4S 1HA1A 3AFGA 2MQQA 2FC9A 4I7FA 4KRWA 2O3DA 3UDVA 2J6SA 2ABYA 4M5GA 3CMES 5A8WA 4WCEQ 3DXBA 3FBBA 2CPYA 1RK8A 3OTBA 1N34F 1WOOA 1FWPA 1B7YB 2CPJA 4DCOB 4XO0A 4X4OA 1IQZA 4EBDA 4ILMA 4HVZA 2UXBF 4ZPVR 1JLQA 1WEYA 2WTFA 2DKOB 1VISA 1JLQB 3WHIA 1VDHA 1U2FA 1MWZA 1KS2A 4PABA 4F2SA 4WKYA 3R8YA 2MB0B 3DLKB 5DDRC 1R6VA 3K5LA 2E5LJ 2UU9F 4LF7F 5KOWA 5D6GA 5BR8J 4NX9A 4NLGA 3OSPA 1S7IA 3FRYA 4RBUA 2W2OP 2JEJA 5CZXA 2HVHA 1YJVA 2Q43A 4NLTA 1HHSA 5CH7B 2B0GA 4O3OA 4DL3A 1C4AA 2JLGA 4CYUA 1FTCA 2AZ1A 1XMOF 2C3UA 5ETTA 5T7LA 1N33F 4ZVGA 3OL8A 1SIZA 3ZO7A 1OPZA 1GFWB 2OP5A 4UW2A 2BE2A 3FFIA 4J9SA 2L41A 2AQ4A 5THWA 1VS3A 3U27A 3VF0B 3ITHA 4ECYA 5K8MA 1PYOB 3ITHB 2G1HA 2BJ7A 4F3QA 1UTAA 3K5NA 5HL7Q 3QYYA 2YXLA 2DNKA 4R5PA 3PX4A 2OJ3A 1BQNB 4RUBA 3R7SB 3MR2A 3W9HA 1PBAA 1HI0P 4DV6J 3ZZOA 1Y5LB 2V4QA 1QUPA 2D3UA 2CRLA 1IQTA 3LGMA 3BF4A 2ZDOA 4OYAA 2OHDA 2GFFA 4OZ2A 4DBQA 3AJ1A 3CSKA 4IFYA 3VQTA 1G6BA 1LQ9A 2MHEA 3OJSA 2UUCJ 3RW6A 1KVIA 4ZPAA 3MMBA 4QIEA 4IDKB 2ZBIA 2EFGA 1RSCA 3UD3P 4ECQA 2V8PA 5CCLA 1WJ9A 3CDWA 3ZC4A 1HQEB 1PJ7A 4RX6A 4NZ7A 1LKZA 1N54B 2FJBB 1VGYA 2LQ9A 4HHJA 2XEXA 4UUWA 1GH8A 2H65B 2RD5C 3GR0A 3HD1A 1CQMA 1TTHB 1YJRA 1U02A 4N7TA 5JJBA 2ZKUA 4RNNA 1RAJA 3J7YU 1LW2A 1FERA 5A8WB 2Y0SD 4K5RA 4QR2A 1TKXA 2OFHX 4HLBA 1UVLA 1FE4A 4OZ3A 3CEDA 4DUZJ 3RZAA 5CYMA 4ZLNA 3FUYA 4KAIA 2GIQA 4Q44A 3HPOA 1UVMA 3S01A 1B70B 3KUEA 2GAGC 5ETLA 2BDPA 3W2WA 4CIOA 4ZVEA 3I9ZA 4K5SA 4C8LA 2ZWPA 4Q2MA 5EGYA 3MM8B 1U09A 2HURA 4H4OA 5HVGA 2UUTA 3SV4A 1FEEA 3KDNA 5KFIA 4ZOSA 3BO3A 5EWEA 2H9ZA 2HHPA 3I32A 4NLYA 3RRKA 5KFWA 3JAMU 4EO8A 1T3NA 2Y8YA 4Y65A 2UUAF 1Y10A 4J9QA 4OZ5A 4O0NA 3PKYA 2JVOA 2Q79A 2XHWA 3GYGA 1GTHA 5H1SV 1S9EA 2Q6CA 2XSJB 3TX0A 4OYBA 3CTRA 4DEZA 5L1IA 3FFIB 4LF8J 2YNIB 3Q0AA 4O44A 3PV8A 1FNOA 4GRSA 3VZHA 2OH2A 3T41A 4KV8A 1TZ0A 1SV5B 4QPTA 4ZP6A 4LRAA 1EQ0A 4RBTA 3MEDA 5IQ6A 1PJ6A 1UEVA 3H8YA 4USKA 4TN2A 2FTRA 1C2PA 3KJVB 4O0IA 1QSSA 4DX6A 4DSKA 4KGMA 1OYEA 4CTAA 2V9WA 1RT1B 2VB6A 2IRXA 3GJTB 2RQ4A 3MWBA 3W63A 3PACA 2ZBRA 3OUYB 3TQ1A 1IBMJ 2RDDA 1XQIA 3HZGA 5ETPA 1CJUA 2L08A 3HKWA 4OJ3A 2IDEA 2OMLA 3CJ0A 4OI6A 4PXCA 4C48A 5EHHA 4B9MA 5IT9Y 1HD0A 2VG5B 4ATNA 3DLGB 3HHDA 1UKUA 3PG9A 4NRUA 4Y0FA 4IKAA 2YX4A 4FYVB 3VQSA 4I68A 2A3JA 2DXFA 4AQYJ 5HROB 5HANA 1X5TA 3IM8A 4FS2A 2QLJB 3J7AN 4M8LA 1TUVA 2HS3A 2Z2LA 3OR2B 1JLGA 3IG1B 4NRTA 4RW7A 3KLFA 3FSIA 4DR3J 4RNHA 5IWAJ 2R8GA 2OTJS 1TKXB 1V6HA 2XULA 4PZVA 3DLHA 3MAQA 3BQ1A 3UW1A 1UFKA 2FHMA 5JVHQ 1S6QA 4KPCA 4EBEA 1SXLA 4CH0S 2M8DB 2JSXA 1YSJA 4QWEA 1UA1A 2AF6A 2GCFA 5M2UA 1OMSA 2WBMA 3G87A 3GE9A 2PEHA 3UN5A 2AWZA 4WIIA 5AE1A 2HFUA 3T1YJ 4LF8F 1UA0A 3CDUA 3N6NA 3TVYA 4QQBA 4ZVQB 3JQJA 3L09A 4UY85 3TX8A 2RKIB 4R8UA 4H4MB 2LU1A 3I4PA 3IS9A 3ISND 3MEEB 4P2XA 3LP0B 2LP4A 2DNHA 2B4PA 4ZA1A 4DI6A 5GAHI 3SSQA 1YX2A 1KFSA 4MH8A 2CFXA 3M6XA 3DMJB 4WIQA 1BWVA 1WC6A 1ZTTA 4G1QA 2C2MB 1RWOB 2P2CB 1RT5B 3G8SA 2HMIA 4OFZA 4W98A 1BUXA 3DYAB 5LSRA 3HP6A 4O3PA 3IWNC 3KK3B 1R43A 3M1VA 4AXJA 3CNQP 1TFYA 3C19A 4KV8B 1X0PA 2Y1LB 4GO5X 5CZVA 3NOGA 2DGXA 1HQ2A 5IOLA 2HIQA 3GCXP 3QZ7A 4NCAA 3LPEA 4RL1A 3DGVA 1PC4A 1RI7A 1T02A 2GVZB 3C6UB 2J9DA 2W7AA 4USUA 5I4MA 3CJQA 3S8SA 2BXJA 2B9EA 4K50A 1R8PA 2MQPA 2LXUA 4F26A 3FK4A 1VBKA 2ATCB 2QLWA 2YBVA 2D74B 2J9EA 5GMKa 3FEXB 4DX8H 2KHDA 3ENVA 3V2UC 1NB2A 1YBUA 4ZCIA 1NHVA 4F02A 4ILRA 2HHWA 4WYLA 4X4NA 1H72C 9ATCB 5KFHA 4PEOA 4LF6J 1VJWA 3HSZA 3DI6B 4HR2A 3H2LA 2YX7A 1KQFB 3VAHA 2HHSA 1MLAA 3T1YF 2B7CB 2NLWA 1LFPA 4HHHA 2KJWA 3ENQA 2CPXA 1BQMA 3RBZA 1UETA 1B7FA 2KL8A 4NLDA 1GTEA 3D7SB 4JI7F 2BKPA 5B0EA 2XBPA 1XN9A 1YJ9S 2JDJA 3FNNA 1D8YA 1Y9OA 1VQ7S 2VG6B 4LQ3A 1R0AA 3IBFB 3CD7A 3EM1A 4H54A 2HVIA 3TUPA 5K8OA 1UWBA 1VQKS 3VALA 3BGRB 4F2RA 4JI1F 5GADU 3D67A 1QD1A 3EZUA 4N77A 2VQEJ 2BQ3A 4DX7A 2UXCJ 1YRTA 2XMMA 2PMZD 3W62A 1ZM9A 4B3OA 2ROEA 1XMQF 4ILLA 3TA1A 2ZNZA 3JSYA 1GXTA 2GJ2A 2PFFB 3F73A 2H51B 2QLXA 3HVAA 4JI6F 4LRCA 4BLGA 2UVWA 1CEZA 2WAQD 3BZQA 4XPCA 3QMQA 1S1VB 3QT6A 5AXMA 1NJZA 3PJXA 3UCGA 2UUCF 1S4EA 1N36F 5KFUA 1KQSR 2ACYA 1T7PA 1VC6A 3ZZUA 2VBXA 3TR5A 4I1TA 4RR5A 1S1UA 9RUBA 2YKQA 3OHAA 4DL5A 2L9NA 3N6MA 1DLOA 3QRRA 2A2DA 1KHWA 3K5PA 5BYSA 2W9CB 2HLUA 3S6EA 3CJ8A 5KFMA 3V81B 2XYGB 2XO7A 3P5BP 4DL2A 3DGPB 1F6TA 3GJRB 3H20A 2DHXA 2HBRB 3MOJB 1NKEA 2BKOA 2AX1A 4OYOA 3QZ8A 2FB0A 1Y11A 1WSVA 4C8NA 2CJQA 1JKHA 1QM9A 3HHLD 2BX6A 2NZCA 3T6BA 3AT1B 1HWUA 2QL7B 4WU3A 1NPKA 1AB8A 3QGHA 2NXUA 1FRKA 3OHBA 4J5OA 3D4JA 4CO5A 4GC6A 4LF5F 3I31A 3LGNA 5FLXY 3PRBA 2BVZA 3BBCA 1EKSA 2LKZA 2RILA 4IFVB 4J90A 5DZ6A 5CABA 2AEMA 2MZTA 2X1GA 4IFVA 4CWBA 1HBMA 1U48A 1IKWA 2V63A 5ETOA 4NLVA 4F04B 4FS1A 2IIHA 4J9VA 3SDEB 3WZ0A 5LMNJ 2HHXA 5KFGA 3DRSB 3SDEA 1XERA 1LNQA 1GEHA 1RKJA 4DR7J 2PO4A 2YNIA 2XGPA 1RTHA 1OSCA 3BB5A 2UV8A 1RB0A 4NEYA 2M0GB 4TLQA 5B0FA 3OQ2A 4ECVA 1ZTWA 1LWFB 2X7IA 3BPDA 4Y2MA 1MWYA 4RPFA 2ZWOA 1RU2A 3MR7A 4LFBJ 2Z4PA 1C1CB 3GIIA 1EETA 3LA0A 3MEDB 4LSLB 1CVJA 1VJQA 3DU5A 1NPRA 4J9MA 1CG2A 2R8KA 3D68A 4F8RA 2L9WA 4MKBA 4BWJA 3BSNA 4YP3A 4K4ZA 1KEKA 2WOMA 4RWXA 1U1QA 1OS5A 2WSEC 3EGNA 1SVDA 4HL9A 2KXHA 1VRTB 4AL5A 2OPPB 4TQSA 4UUXA 4NPOA 5KFYA 2DHAA 2IJFA 4USWA 1BMQB 5G0RB 3EYZA 4EI2A 3P4UB 1RUSA 1HW8A 2N4DA 3OTDA 2E1PA 3GFZA 3QO9B 1WORA 4IDKA 4TY9A 2ILZA 1CJTB 4CH7A 4X4UA 2HAFA 2WONB 3N0VA 4NI2A 4IOCQ 1N88A 3AQOA 3T3FA 2P9CA 3CD5A 3UR0A 2JFKA 4K2XA 3PO5A 4JI4J 3E2EA 1FJGF 2M2BA 3TUZC 4QIFA 3JSMA 1HQUB 1DQ9A 2HQ3A 1HQUA 3TRGA 1KONA 2MQMA 3CJ3A 2B4OA 1U0HB 3L4BC 3MMCA 1OWXA 2VFUA 4NLOA 3R1LA 1RGVA 2WHOA 2MXYA 5JUMA 2A1BA 2CPIA 3EZ5A 4UY8T 3W5YA 2ZJQQ 4BC7A 1SUQA 3I6PA 3MMAA 1KVKA 2OSQA 3QSYB 4O3SA 2FUG9 3QLHA 2VQFJ 1Z4UA 2ZBPA 2M4MA 3KXDA 1NK8A 2FZKB 2Q1LA 5D4LA 2Q3PA 3M2RA 5KFRA 4A46A 2ZUAA 4ZVRB 1DURA 4WE1B 1O6XA 3KJNB 4ZPBA 1M5KC 2C2OB 2HQGA 2IRYA 2B4VA 1EZZB 4USHA 2C2RA 1HI8A 2IYGA 2OO4A 1RDRA 2AT1B 3D3CJ 1L3UA 2LDYA 4XTTA 3VTIA 4GC7A 1KLNA 4O44B 2JOQA 3NMRA 4RW4A 5HAOA 2YH1A 2HEKA 1GXUA 4KGXB 4YB5A 3KMSA 1RWVB 4F0HA 2IJRA 2QLFB 3LP1B 3P5TL 5RUBA 1LWFA 4KO0B 1CBKA 1K0TA 1FRXA 3M9OB 1XMQJ 1A0OB 3PVXA 4OI3A 5IFMA 1C0TA 4CLYA 1VLYA 5J1PA 1Z2ZA 1BY9A 1VHFA 1UZDA 2HGLA 4N41A 4RWWA 1HNVA 1SI9A 1CS4A 2RKIA 3KJQB 3IC1A 4R8UB 2R7SA 3AA8A 4R0EA 3BGUA 2AJ1A 4HH0A 2RU9A 3K58A 4S0MA 2KU7A 5LM7E 4JI2F 2C3PA 2POKA 2Y1RI 3EXYA 3D6FB 2QGFB 4ID5A 4USJC 2FHJA 4I7FB 4M5IA 5KT2A 3MCOA 3AJDA 3EX7B 1AW0A 1S77D 5HMXA 5B08A 5IXUA 1GAOA 4F7VA 5KFEA 2QEXS 1OJ4A 4ZVOB 1NEEA 1P6TA 3IG1A 1TV6A 2FJWA 3CD0A 4C8OA 4ELVA 2D7SA 3OLAA 3BR8A 1HBNB 4LF2A 2J0WA 4X62F 1RTZA 1MG7A 1HBNA 2WRMA 1SBRA 1R31A 4HKQA 2D3ZA 2UXDJ 2LECA 3QJLA 3R3TA 4LF1A 4GKKJ 4TNOA 1MU2A 2CNOB 4ICLB 4WF9Q 1NM2A 4ENOA 4OLOA 4DDFA 2ASLA 2JC0A 1N8RT 5HP1B 3H5YA 1LW0B 2SXLA 3BS9A 4OHXA 1A9NB 2WVBA 4JI7J 3IWLA 1HNWJ 3E3XA 1ZPVA 1FO1A 2Z2YB 3HDSA 3MEEA 3T6JA 2NPFA 2PC6A 5F41A 3J81j 1JXVA 4P7TA 3PIPQ 3FQKA 3NCRA 2DO0A 3K5OA 1QE1B 3QGPA 2FHKA 2KT2A 2IBKA 3OL7A 3I5CA 2B9WA 2R7UA 3H98A 1PJ5A 1NB7A 3GYXB 1DARA 2BM0A 3K2YA 4MJKA 5KFDA 2R7VA 2D3OR 2BR0A 4L75A 1HNWF 2IHR1 2ROGA 3KK3A 2FVRA 2JEFA 2CKWA 2DHGA 1UJ5A 4RBVA 1C1BB 4ECUA 2MPUA 4P7VA 1VBYA 1TL3A 1RCOB 2X1BA 5AE2A 2MGZA 1TMJA 3QT8A 3M8RA 3CCJS 4PG5A 2ADCA 1FK9B 1YZ6A 1NDPA 2HBQB 2HFNA 1R8AA 2B9XA 2LQ8A 2P9EA 2YWHA 2X3DA 4PXDA 5IM0B 5F8GA 1S12A 5D3GA 4WFZA 2GO8A 1QAIA 2W8KA 4MFBA 2VDHA 5E0OA 3FBEA 3ZTQA 4WFBQ 3J7ZT 3QAUA 2RDJA 4CLFA 1V5VA 2DRBA 2VQEF 1NZ8A 2AP6A 2KT5A 2RAQA 3DI6A 4OYZA 3VGTA 3DYAA 4ED4A 2V4JB 1DLOB 1GMUA 4USTA 2W9BA 5CXTA 3JQMA 1JK9B 1WD6A 5J2PB 4DSIA 5SUHA 2LLZA 1FD8A 4LSNA 3HSJA 1ZM4A 4RUAA 4ZCMA 2R2SA 5H9EJ 3OTEA 4IQXA 4EK2A 5I3UA 2GVZA 3C6UA 1AROP 1HBUB 1V3SA 3BKTA 2R7OA 3R2DJ 1RJJA 3POTB 1MMDA 4O4RA 3CF5Q 4ECTA 2HHQA 4DR2J 1BXNA 3DLKA 2Y9HA 5AE3A 2VFSA 1S97A 3HCXA 5J2MB 3KHGA 1OY8A 3TVZA 4C11A 3KDOA 3J7A1 4IO9Q 1G3OA 2VD3A 1O5JA 5IV3A 2PGCA 1R89A 3ADAC 3PFEA 3X1LB 1SQGA 3IM9A 2DRDA 2LU2A 3MUTP 4QU7A 4DPXA 2AX0A 4I6YA 3KLHB 2EKNA 1ZYQA 1KKHA 1Y0HA 2BJ1A 2HNDA 2VUGA 2M5YA 3H7HB 5G0RA 2HNDB 3HULA 4Y2AA 4ANCA 2K06A 3MR3A 3T5KA 3J7YI 5BYQA 2UUBF 2DVIA 2RH3A 1I94J 2HVDA 5J1EA 2QRRA 3M8YA 2KN4A 1R27B 2FJXA 1APSA 1RTHB 1K47A 2DNPA 2EFVA 4DFJA 3PW0A 3KNGA 3BEGB 2V67A 1XMOJ 5IV4A 2CQPA 2W4PA 1TKTA 2CQ0A 2OAUA 3TZXA 1T95A 3TI0A 3BYRA 4O3NA 4LF4F 3JSMB 3NY0A 2KVQE 5IWAF 4MYTA 1NXIA 2FHJD 3GFHA 2VV5A 2XMKA 5GMDA 1FVQA 2EFNA 4UF4A 3OXLA 2HQDA 3TO8A 3J80U 3GG1A 3ZNJ1 4N76A 4U7UD 3BKUA 4JI0J 4P75A 2MKYA 2V2KA 3SIPB 3UWTA 3VV2B 3H5UA 5L1JA 2B7BB 1FK9A 3PKMA 3CC2S 2JH3A 4F0MA 3CDEA 3MM5B 1YK9A 4CLLA 3K59A 4J9PA 3D6MB 1HHQA 2QV6A 1WG5A 1LK7A 2W2QP 3G8TA 3TP2A 1LFWA 1RTJA 1U25A 2DIUA 2HW3A 3Q83A 5KTQA 4DF4A 2JEGA 4B9LA 2IMWP 4C7QA 3I96A 3HHLC 1MROA 2AYGA 1IBCB 3JYTB 1YQHA 1X4GA 5EUHA 1HYSA 1NJYA 2VH7A 4CLWA 3EUNA 4NLQA 2CQ1A 1HBMB 2VL1A 4Q0BB 2ZE2A 2I1RA 1M5HA 4PG4A 1U6ZA 2AKWB 3RG6A 4DPWA 3HJVA 1RAAB 3OXFA 1A6LA 2VC1A 3TEHB 3AAWB 6FDRA 3UR3C 1BC6A 5E3CA 4QBUA 4Q43A 5KG5A 4LSNB 2B43A 3SXLA 1L3TA 3N6LA 2RSQA 1ZOTA 1RAHB 2QG9B 1KRPA 3K5MA 4Y00A 4EU0A 1R3NA 3R2CJ 2E1AA 4PQUA 5CA5A 2C2EA 2IAJB 3RRGA 5A8RB 1QVFR 4B3MJ 3MPWA 4C3LA 3I0RB 4P73A 1PSDA 4J9NA 1NBEB 2F8EX 1RWXB 2DNOA 3I0RA 2YQ0A 3DCAA 4WFXA 3TAMB 3MM7A 4RU2A 1FKPB 2I8EA 5CD4H 1DTQB 2Y8WA 4OZLA 3PM9A 4ZJLA 5D0RA 1DBDA 2VPYB 4NMLA 1XR6A 3C16B 2ALYB 1RZMA 5HBMA 1J5EJ 4P6QA 4DR5F 2DH8A 5HLFA 5K5MA 4OYWA 3RB4A 2R9LA 3ZZYA 3WIVA 3C6TB 3C46A 2WONA 4MIWA 5ETVA 3DNCA 1YWXA 4RW4B 2N3OA 7FD1A 2ZH5A 2XTJP 4X4SA 3HVTB 4DFKA 3IMQJ 1NJIT 4DSJA 2PI5A 1ZAVA 2E9ZA 1KSPA 4G65A 4AL6A 5A6PA 2EFOA 1SH0A 3DRRB 2C2DA 2QX0A 1RA6A 1F3VA 5ITHA 2MTLA 1U8WA 2GIFA 1IKVA 2LVWA 3FMBA 4TLRA 5E3AA 4OJGA 3W5XA 3RB0A 1DRZA 4IOAQ 1RHJB 1FX2A 5GAGI 4CZCA 4EEYA 2HWHA 3EE3A 1IR2A 2RMLA 2ZUGA 3LUYA 3PXGa 2DCLA 2OEJA 3V4MA 4X62J 3IA0A 1TU0B 4OX8A 2V8DA 4PPZA 2LYVA 1LW0A 4M63A 4M5DA 2C2KB 2GQ2A 2RRBA 3JQKA 3G4SS 1HQEA 2EBEA 3BH6B 5D0HA 2DXDA 2UV8G 3SSSA 4PUOB 4ED0A 2IPOB 2J7KA 2YNFA 1NU4A 2E9RX 2ZJRQ 4QWAA 4L74A 4RW6B 5KFKA 2HZCA 3G6VA 2LA4A 4QCLA 1T94A 2HG4A 2WW8A 3AXKA 3RB3A 3MUVP 2XLIA 2G1DA 3D1QA 4TY8B 2EC0A 3NLCA 2WZ1A 3CIZA 4QYRA 4H4KC 3CCVS 2J9CA 3SCJE 5HI7A 4NXNF 1E6YB 5C42B 4A8KA 5AJ3J 2BJ9A 2IMOA 3EVOA 3PW2A 1XR7A 4QIVA 2XCAA 1NSPA 1QY7A 5HN0A 1N0VC 4R0JA 3OFHA 4ER8A 2RF2B 4FBUA 4HHUA 3RYLA 3V6KA 2F4FA 2NUHA 1U6BA 1I94F 1WACA 2KVIA 2EXUA 3MECB 3GILA 4H4OB 2P6TA 1O0PA 4IG3B 4IG3A 1DQAA 4GKJJ 4WKRA 2J7UA 5B7WA 3PZPA 5JXSA 1RAIB 1VHIA 3W8PA 3NBPB 4DV3F 3DMJA 1VR6A 3P3DA 3HFVA 1H74A 5KFFA 1X4FA 1YDLA 1RT5A 4WJBA 2HMIB 2BJ8A 2J8SA 1FCAA 3TEGA 2LDIA 2FGOA 2QYCA 3HLUA 3I4HX 1AUDA 3PR4A 1IJEB 1KWMA 4AXIA 2CWXA 4ZK7M 4ZN1A 3NMAA 1KQKA 2RUSA 4FYXB 1IJFB 4NLRA 3NP5A 2H48B 4WTOB 2D3O1 4ED2A 3HK2A 4Q7AA 2VONA 2NXJA 3CW2C 2CADA 2OFGX 1RTDB 2JEIA 2OIHA 1GNKA 2MZQA 3LGHA 5L46A 1NK5A 3CUNA 3LPYA 5ETRA 2JRSA 3L95X 4I2QA 2ZH9A 1BHNA 5B0BA 1PBUA 1CPZA 1Q81T 4LRBA 3JTPA 1RTIA 3F41A 5F8NA 4IO1A 2Y0BB 4LQ9A 4KTQA 1TAQA 2DIVA 1M0SA 2N82B 3FC9A 1N5QA 4KGVB 2AV5A 1QUVA 5LSLA 3AODA 3G6XA 4LRFA 3UDLA 5L1LA 2A0FB 2XI2A 1S1TA 1LK5A 1EARA 1UJ6A 3H0PA 1FD2A 4DV0J 4K4XA 1NCLA 5E7OB 5GADI 3L7UA 5KT7A 1WI6A 2AJQA 2V4JA 4NZ0A 2FLPA 1TL5A 3HHEA 2BE7D 1SPBP 4OLPA 2YQ1A 4A8MP 3P96A 4QPXA 1NZAA 3G71S 2VODA 4ZS6A 3MAAA 3A3OB 1RT6B 4ED3A 2DH9A 1H73A 1T0TV 2KO1A 1UWBB 1PYSB 5IC4B 4DG1A 2ZVSA 3J80Y 3KLIB 1ITPA 1CJKB 3NKYA 3FQLA 1JB0C 4NLPA 4ECXA 1HNIA 2E1MC 1T03B 5HP1A 1H2UX 4UQGA 1R0BG 2IBOA 1RHQB 4DFMA 3M9NB 2CQDA 1XIQA 2OD4A 3M2VB 3PJ9A 3QIPB 2R7WA 4JI3J 4KHPF 3M2VA 4ITSA 2GA7A 1VQMS 3N79A 5F8JA 2ZD1B 1RTJB 1VLOA 2LQ5A 3JSRA 1JIHA 2X3GA 3MPDA 2VQFF 3OSNA 4DR3F 1S1WA 4DS5A 1Q78A 2OPRB 4OYPA 4YHHJ 3BGLA 1K1QA 4AE5A 5DO2A 5KT6A 2BE2B 3NS6A 2E5GA 2P6SA 2KHCA 7FDRA 1HYSB 2QMWA 2JFDA 4HEA9 3PX6A 3BGFA 3ENAA 5HK4A 1U45A 4DR6J 1PGZA 2CPEA 4ZJOA 3KK1B 2XMAA 2R2UA 2FLNA 4KBIA 4PWUA 4YFUA 2QTWA 1CSJA 1FNXH 1RE1B 1HR0J 1IBMF 2XNRA 4KKOB 1IR0A 1KBRA 2D9PA 2CJXB 4FPRA 3UD5A 1S0NA 3GV8B 5IC6B 5LL6d 3OBIA 3ULHA 1SB6A 1NRKA 2YVSA 4AYBD 3SCIE 5BJRA 5D77A 4RNMA 2UUBJ 3E8OA 1S49A 2B56A 2PMHA 2IAJA 3GIRA 1UVKA 1UAWA 3MMBB 4KIAA 3AQPA 2Z8QA 1Z1ZA 4JP8A 3MHYA 2D9OA 2DHSA 3SFGA 3THTA 5B0GA 1WI8A 1L3KA 3HXMA 1JMTA 2CUYA 2XM3A 4IRKA 4UQTA 4TVAB 2F7VA 5T41A 3D66A 4DSFA 1U1OA 1HMVB 4DXLA 2AW0A 2MLZA 1TP7A 2MQLA 4F4WA 3Q8RB 3IBCB 4B3RJ 2EK1A 2QL9B 1C4CA 4Q8FA 2HLTA 4WYWA 3Q8YA 2W2MP 3NOCA 2XQCA 5I42A 3GB0A 3JS9A 1RQ0A 1M1KT 4FF2A 5LJ5Y 1T11A 1N48A 4G1IA 4A8FA 2H5EA 4FF4A 2ZBQA 1ZAWA 3SCLE 4ELTA 2PFDA 1RHMB 3UO0A 1UVJA 3HM9A 2ZH7A 1X4BA 4BDPA 4LSLA 5LXYA 1FFSB 2DISA 4PG7A 3IRXA 3PCOB 2RUGA 2G4BA 2A2CA 3CWJA 3FGVA 1CC8A 3FMWA 3UN2A 5GAEI 1S57A 2ZHOA 1IXKA 2OPPA 4IQMA 1IWAA 1KDNA 4FNHA 1MN9A 1VCTA 1RADB 3AH6A 3DLEA 3ZZ0A 4PPDA 3A4TA 1VK3A 1JJCB 4UOHA 4OHZA 2DO4A 1FTRA 2UVVA 4U7UK 1S1WB 2DRAA 1N52B 2CWKA 3CVKA 4RNFA 4MKYA 2DD8S 4IRCA 1WDDA 4WK1A 3CO9A 2V94A 3M6WA 4M5MA 3PYDA 1JLEA 1KHVA 3H59A 5EWFA 1S1UB 5GMEA 5EX3A 2DNZA 4LF6F 3DOKA 2DEIA 1N5VA 2VHGA 3VWSA 1LW2B 4LSZB 4R5PB 1SJ4P 1VQ4S 1IM6A 3ILIA 3JB9k 2AYEA 2GHVC 4C0HA 5DLGA 2W25A 2XMJA 5BR8F 2MEWA 5KFXA 2VPZB 5IZHA 3O2IA 4LBPA 1IKVB 3BJYA 4KJIA 3DOMA 2MQNA 2MYFA 3KK2B 2ZM6J 4B3RF 4CCHA 4U6PA 4P2MA 3RW7A 3BBBA 3MM8A 4U8VA 1NH8A 2KRBA 1ZPWX 2YQ3A 3BYPA 3C66A 3R5BA 2GHPA 4X4PA 2J0QD 4LF9J 4DR4F 4FYDA 4KHRA 2J6TA 2GS8A 1NAQA 1YJ7A 1T9WA 1TKZB 1YG0A 4L6V3 4Y34A 4ZPCA 5E33A 4E0DA 1U8SA 4K4VA 2AYMA 2VF3A 5C25B 4ZLJA 3CCES 2XNQA 2E29A 1LV5A 3NAIA 1KD1T 1WTFA 2DJWA 2MKSA 1RYRA 3BQ2A 2ZDPA 1UVIA 1JQGA 1XJWB 2RDIA 2YH0A 5ETQA 3P6YC 3CD6S 2W01A 2MKJA 3BDEA 2DNYA 4DZ6A 1B4SA 2G2ZA 1HIYA 1PIEA 4CP5A 4FXDA 3HVTA 1WOSA 3EVWA 2BACA 4ALZA 4JV2A 1S6QB 1OYDA 4Y28C 4AT1B 5C2GA 2BBEA 1WKKA 3HT0A 5AXNA 3MEGA 2MSTA 4KFBA 1RU1A 1T9TA 4E2FB 2XZTB 2ZH1A 3CULA 3FZBA 4B9NA 2DH7A 2GC8A 2NS1B 4QW9A 5F3ZA 4QJVA 2KDOA 3IP0A 1HPZB 1QAYA 2YPYA 5D8HB 2YWWA 1FX4A 2JZ5A 1RT1A 2E1RA 1FFWB 2FC8A 1OPIA 2HFSA 2BOAA 1UFWA 2CQIA 2ZBCA 4MK9A 3IS9B 5E2QA 3Q8PB 2VOOA 4DV4J 5L1KA 1B0VA 4NXNJ 3EVMA 1N34J 2BUNA 4ZMMA 1TUGB 3UPFA 5LMUJ 1JJHA 1UMJA 1WC1A 3BBFA 3FCVA 4ID5B 2DT9A 4OX9F 4K2JA 1RWMB 2R2RA 4DV2F 2C2NA 4DS4A 1MSWD 4C8MA 1VQ8S 4NWBA 3A8IA 1R8BA 4NOHA 4DU8A 4JV5F 5A2QU 1YGYA 2GJFA 2PT0A 4O4GA 1FRJA 4NI2B 1B0TA 5HVFA 3TYTA 3RAXA 3DOKB 4RLEA 3OR2A 4RW7B 4NMXA 2YY3A 4X66J 3PR5B 3KLFB 3THVA 2LEAA 2I2YA 4C8YA 1CJVA 1D3WA 2XI3A 1BQXA 1E6VB 1UVNA 3KLEA 1K73T 2B8PA 4A48A 3M8QB 1P9YA 2F1FA 1O51A 1RAEB 2AJ2A 2GV1A 5J2MA 4JV0A 1U24A 4ICLA 1IN0A 2ASDA 1CJUB 5DQHA 4U8YA 3MECA 2ERRA 1R0CB 1FESA 2VBZA 1HNXF 3GR1A 2B3TB 1VC5A 2V0NA 5CYJA 2NXEA 3F44A 1VQ6S 2YPZA 3O3LA 1TVRA 2EK6A 2C42A 5M2RA 3U1MA 1TL7A 1N4LA 2UUWA 4WE1A 2E5HA 5DRKA 1QE1A 3HVRA 4ES3A 3LAMA 4F67A 2WCXA 3X3UA 1S9FA 3D0GE 3KUGA 3KTQA 2K7JA 3K89A 3ZZTA 1YJNS 1RWPB 2KRRA 2M7SA 3ETMA 2UXDF 3U1LA 5H9EK 4JI5J 4N47A 3I9V9 2JHEA 2WVDA 3OFFA 5CYQA 3S7RA 1SJ3P 1KN6A 2QFJA 2C2ZB 3HX9A 2JWNA 1HD1A 6AT1B 4WTYA 2XS5A 1LWEB 3DRPB 2VA3A 3NXZA 4UT4A 2W4DA 1W7WA 3OFEA 1YJWS 2CNKB 5KFJA 1HNIB 3BO4A 5DZ7A 4NYZA 1XWLA 1N36J 3ZXWA 1C0TB 5C2CA 1HFEL 4J37A 3MM5A 1J5OA 2FY1A 2NQPA 2DNMA 2VPXB 1JKHB 2CDRB 4WZQA 5DDOC 2V4RA 2DPIA 2AEJA 4DUZF 3HFKA 1T05A 2ASYA 2E7WA 3WBZA 4KT0C 4DPOA 1F5CA 1RHRB 5H9FJ 1J2VA 4WBFA 3EZOA 2HBZB 2CNLB 3LALA 4YR0A 4DV1J 4NXMJ 1S72S 1YKWA 4KH0B 1S5ZA 1R7IA 1N5SA 5B0DA 5L39A 4DL4A 2NZ4A 5ETKA 1NK4A 2OPSB 4W4MA 5DG7A 1PCAA 5MAOA 5C5JA 3N28A 2CQ2A 1WC0A 4CT8A 5HVHA 3BSOA 3DDNA 4F4ZA 3PY8A 1XR5A 2KT3A 4CLKA 4KKOA 2G0JA 1Q8LA 3GFYA 4OZ0A 3BN4A 3H4DA 5I3UB 2R7XA 4Z37A 4J9OA 1S6PB 3BV8A 3F56A 2GO9A 3M2UB 4NA3A 1VIXA 2VG7A 4Q8EA 3EJMA 3G96A 3M32B 5KG0A 3R97A 1ZA1B 4IYQA 1U49A 4MK8A 3TJ9A 3TVKA 3IN5A 1SL1A 3UN3A 2GW8A 4MK7A 3CB4A 2CZVC 1SC4B 3L7OA 3M8PB 3N01A 3NWGA 4FKYA 1GK8A 4IG0A 1WF1A 4PG6A 4TYAA 2V68A 3G9CA 1VRTA 3A1YG 3M8WA 2MQOA 1ULRA 2UXBJ 1KVJA 5KT4A 1IKXB 2HNYB 2ZD1A 3MD3A 3DLEB 2HGMA 2FZGB 3A12A 1S9EB 2XSJA 4FDFA 2XMWA 5T7LB 3UNYA 2DTJA 3KHRA 1U1MA 4RUHA 3Q2SC 2E7XA 2UXCF 1PAEX 2KM8C 4QWBA 2HRUA 6FD1A 5KFAA 3Q89A 3LH2S 2XMTA 2BEFA 4NEZA 2GGPA 3AD8C 3A3NB 1SV5A 2IM0A 2IYIA 3MAAB 1VQ9S 4YY3F 3PYFA 4ZVTB 4OV6A 5GVQA 1ZETA 1G1XA 2VDIA 2GVDA 3G86A 2JJ4D 3A3PB 4URGA 3PRVA 3KHLA 4B3OB 3E51A 3VAFA 3AOAA 4MYUA 3GIKA 1WTBA 3IXQA 4V1Ak 3OR1B 1D9AA 4ZLPA 2R8IA 2BOPA 2CYYA 2F4VF 3FSYA 2OPQB 2CPZA 4Y2CA 1MMNA 2DR6A 2YKMA 4K0KJ 2AYBA 1U2CA 4ETXA 1WF2A 4I6WA 4URQU 3UD4P 3R5JB 3N5FA 2DGTA 3MZIA 1WEZA 1EKRA 2HHHF
chains in the Genus database with same CATH topology
3TUJC 2XY5A 4EFAC 1AXQA 1VQ5S 1D0EA 5F0WA 3AB4B 3OVBA 4A8YA 3MUMP 4OIXA 5F3TA 2OSRA 3TAPA 2W9CA 2OPSA 1Q4RA 4WXWA 5DGBA 5K8PA 3V4IB 5I42B 4F50A 3VCDA 2XS7A 1HBOA 4NCBA 3HJFA 4MIAA 3D2WA 4DL7A 2PDAA 3AHPA 4PQUB 4CNYA 4LMZA 2R7QA 5L9NA 3J81Y 4ETZA 1Q7LB 5KFOA 2CJAA 1EETB 1SUQB 3MMAB 5DG8A 2PN6A 4PKDB 3PNIA 4KB7A 1XMBA 3MM7B 1B64A 1EP4B 3DM2A 4KSEB 1I6JA 1ZM2A 3I87A 5DJBA 2APOA 2FIUA 2XC9A 4OX7A 3O6QA 3NNAA 3AA9A 3SZ2A 2CQGA 4RZRA 2I9SA 3GG0A 2VBWA 1ZM3A 1YITS 4PCQA 4DJBA 2QA4G 2ZH8A 2W24A 4IH7A 3D28A 4HDHA 1YJTA 5B0CA 4F25A 3Q8RB 3VAIA 1NK8A 1HARA 2J76E 5J2NB 1XK8A 4EBCA 2BANA 5LSOA 5J2NA 3M9MB 4DWIA 3S1TA 4ID8A 2IJNA 2HHVA 1FJ7A 4DL6A 5M2PA 4DV1F 3KK2A 3IGNA 4NCGB 3LF0A 3MAHA 1HNVB 1HWLA 1FXDA 1SJ1A 2CJBA 2HFZA 3D0HE 3DN9A 4C98A 4N5SA 3H5XA 3ISZA 1HHTP 1Y7PA 1JWWA 2R8JA 1D8ZA 4LFAF 1BD6A 2L3MA 1TFWA 1ROFA 5KG6A 3M2RB 3L3CA 4PQAA 2U2FA 3N5BA 5C25A 2FJVA 2HS0A 2LXFA 2PIIA 3OV7A 3BQ0A 1NK7A 3GZ7A 2K1RB 5HROA 2YKOA 4M94A 2XMUA 4ED8A 3NGDA 5E3QA 1A7GE 3RAMA 1L3VA 2IVYA 2QSFA 3T19A 3PO4A 5LMUF 4FF1A 3PJWA 3I55S 3M6UA 2ZH6A 3V6DA 4A8QA 2KTQA 2CJKA 2BW2A 2QSWA 1WHWA 3BGRA 3MM9B 4AQYF 1HL6A 2KJVA 4BC9A 3SQGA 2ZH2A 3MEKA 4DL0C 2PI4A 2ZZNA 4QYZJ 1X0FA 1P1LA 1TKZA 2RRNA 5A8KA 1S48A 3IAM9 3TA2A 4NLSA 3CJ4A 3DOLA 1FRIA 2KI2A 1VQSA 4RW9A 4JI4F 3MGJA 1F5BA 3TUIC 4MFBB 3CJ2A 4F3MA 2KZMA 2YKAA 4DV5F 2IA6A 4DFPA 2C28A 1FRMA 3IR7B 1Y00A 1H38A 1M90T 3PEJA 4XAKA 2XWYA 3VAJA 2Y1IA 2W9BB 3CPWR 3EGWB 4P2SA 4A8XA 4N56A 3GV5B 2ZFHA 3MF5A 4YR3A 2VA2A 1S9GA 3NCQA 4KFBB 4NZ6A 4ZP9A 1TL3B 4LF9F 1FXLA 4ZVHA 4Y2KA 3DLJA 5KOXA 4OI0A 1FDDA 2XLJA 3CCRS 2VFRA 3KG4A 2X1FA 1YBAA 1VBZA 5IM0A 1QLNA 3C3LA 1Q8IA 4NLUA 4E8UA 3OUYA 2EWHA 2J7WA 3LW5C 4IG0B 2DNNA 1JLCA 4ZVFA 4QWDA 2IRUA 4M5DB 3MTJA 1HMVA 1SH3A 3FJ2A 4DSEA 3OVSA 1UJ4A 5LXRA 3GV7B 4YMEA 4GKKF 2BQRA 1GQEA 1K0VA 4UOCA 2XWXA 5DGAA 1V3RA 3OL9A 1VIOA 3QGIA 2ZKTA 4I0WA 5B0AA 4X2BA 3PFOA 1G2EA 3OVAA 3OXGA 3D54A 3R27A 5EN1A 3V6DB 1JLFB 1RT7B 2Z2MA 1N0UA 1TKTB 3UDCA 4I2PB 2LXIA 2YX1A 3HHLB 3J7Z5 3I56S 2AU0A 5A0YA 1TL1A 4EO6A 3M32A 3KLIA 3RR7A 3GYNA 4C0OC 4G6VB 2NSCA 1NJXA 5DS7A 5L38A 1VQYA 4F4XA 3R5CA 1KOOA 2QZ8A 1WHYA 4OI2A 3VAMA 4RNOA 4GC7A 2HNYA 1YRXA 2N4CA 2X51A 2RQKA 4QW8A 3ZZZA 3LP0A 5IT4A 2OPRA 2QIFA 3DOLB 2EKYA 2ZOMA 3NBPA 2DR8A 1R6YA 4O3QA 2R8HA 3JYTA 4K4WA 1U1NA 1SJFA 4JI0F 4PRFA 1F2GA 4CO0A 2DGWA 1Q79A 3SFUA 2CZ4A 3MPVA 1F9FA 4YHHF 4B9VA 1BQNA 3DLBA 3KK1A 5K9FA 4X4TA 1XNQF 2YWKA 3MMJA 4XDCA 3CXCR 4GKJF 4JI3F 1H3DA 2CQ3A 3CMAS 2A18A 3CCLS 4YDDB 2EVZA 3RBEA 1CLFA 1L3SA 3MTKA 4OZNA 3A8EA 4Q45A 3OLBA 4I56A 1X4CA 2UVUA 2QA2A 1S1TB 2EW9A 2MKIA 2ZNYA 2AJ0A 1REVA 1FE0A 2E5LF 2B6AB 2KZZA 2BV3A 1H0HB 3DRSA 2LMIA 3LWMA 4B9TA 2RS2A 1S99A 1VI7A 4FF3A 3OTCA 2EFPA 4K0KF 2B9YA 1Y3KA 3PHEA 2OLWA 1NK6A 3DRRA 1WG4A 1X7VA 1URRA 1YHQS 1KC8T 3GFXA 4A8OA 5C24A 4Y3CA 4FXWA 5KG7A 3M30B 1VBXA 1T03A 3M8PA 3IRXB 1T8EA 2XG8A 4C9DA 2KM8B 1RT2A 5F0UA 2BA9A 4CI0B 5E3PA 5KFBA 4LVNP 1I1GA 4WFNQ 1U1RA 2AGOA 1QSLA 2NR0A 4PWDA 3D0IE 5U47A 5HBMB 1OQ6A 3EPIA 2DR5A 2IM3A 2VKRA 2NREA 1S1VA 3K8VA 5HO4A 2RNEA 5JVGQ 3PX0A 3FZ2A 4C8ZA 5D4NA 3FDSA 3CCQS 4IOBA 4DF8A 4RW8A 4Y6IA 5DDQC 2NSBA 4EYIB 3MDFA 3KMQA 4D3GA 3DHWC 2RQMA 5DDPC 2QE5A 1FXRA 5CYMB 2RVJA 1RA7A 2KH9A 3Q2TC 5C42A 2LA6A 4ECZA 4CTAB 2ZH3A 2BABA 2F9DA 2QO3A 3Q24A 3D1OA 2L9DA 4ED7A 2LQJA 3HZEA 1FEHA 1ELOA 4CH1A 1Q53A 1FDBA 2M70A 4IR9A 2KXFA 2FJDB 2M3DA 3CCZA 1FDAA 4BCAA 4C2MA 5KFCA 1FKPA 5LJ3Y 4ECTA 5KG2A 1OSDA 4CO3A 2FHOB 1AFJA 1FT8A 4HT5A 2KG0A 3SI8A 2BJEA 2WK4A 2JLFA 3QGGA 2B51A 4G1QB 3GIJA 1WG1A 2Y1JA 1NK0A 2EFQA 2C22A 1JLGB 3QIDA 4YR2A 5F8IA 5KFNA 3GWCA 3IR5B 4JBCA 5D4OA 2MZRA 4FZVA 1F60B 1HBOB 3FVYA 2LCWA 3H40A 4EUVA 1C0UA 1KQGB 2A10A 1TQLA 3HVWA 3G6ES 1C0UB 3MD1A 5DM7Q 4MTPA 1RTDA 1U1PA 3KNAA 4L3NA 1U1LA 4DR7F 1XTZA 1SQEA 3KYLA 5LMNF 2R2TA 4WK3A 3Q8SB 4JOUA 2BQUA 1EP4A 5IT0A 2WSCC 1DHMA 4KPYA 4DV6F 1U2RA 1YRUA 3LAKA 1T05B 3HI9A 1IBKF 2D1CA 4ZPTR 5HMYA 4DLGA 3AY0A 3JAMY 3LO3A 3OL6A 3QAEA 3K0JA 3V6JA 1H2TZ 1KFDA 3CCMS 3KFWX 4BHQA 4URSA 1SIWB 2ILYA 4DR1F 1KTVA 2ADBA 2ZHAA 5DQGA 5IS2A 3KLEB 2B4UA 2BZ2A 4B02A 4N8OA 1JXLA 4KGKA 4X64F 1AFIA 2GMHA 5KFTA 3R5DA 1FRHA 3T9ZA 3NRBA 1X4HA 1CQNA 2DCUB 4DV0F 1DAXA 2C3YA 4C11B 2HWTA 1H6KX 4A4JA 4ZKAA 1F5AA 1J5EF 3RU0A 4KQZA 3PW4A 3HF5A 2K3IA 5E3RA 4RUCA 1TKDA 2DB1A 2MKCA 1NJWA 3CE8A 2I38A 3OPKA 3DHXA 2ASJA 4PUOA 2FVSA 3HMJG 4KC5A 4AFFA 1JLAB 3DFEA 4WFAQ 4RU9A 4QWCA 3Q23A 1N6QB 2CQ4A 2EI5A 4HTIA 3IWXA 3ISNC 2PE8A 1FA0A 3I0SA 2JEFA 3MPYA 4TXSA 4LVOP 1U4BA 2J0XA 1TK5A 2GGPB 5ADZA 4OI4A 2RT3A 3H4BA 3EPGA 2VG6A 3OJUA 3RR8A 3HHLA 3B8HA 1VK8A 5A0YB 2B5JA 3KLGB 1LWEA 3DRPA 2FLOA 1GXLA 1PC5A 2M88A 3TOQA 1X8DA 2W8LA 5FDLA 2VC0A 4F4YA 4B3OB 3KLVA 1NKCA 5FDLB 3W3SA 3UNGC 1PILA 4CQ1A 2R7RA 3IGVA 4LFBF