2CPHA

Solution structure of the c-terminal rna recognition motif of hypothetical rna-binding protein rbm19
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
107
structure length
107
Chain Sequence
b'GSSGSSGQVPKKQTTSKILVRNIPFQANQREIRELFSTFGELKTVRLPKKMTGTGAHRGFGFVDFITKQDAKKAFNALCHSTHLYGRRLVLEWADSEVTVQSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA binding motif protein 19
publication title Solution structure of the C-terminal RNA recognition motif of hypothetical RNA-binding protein RBM19
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 11
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cphA01
5GMKa 2MQPA 1PO6A 2M9KA 2GO9A 2ZJRQ 3K0JA 1FJCA 1YJNS 2LA6A 3SXLA 2KM8B 3DLLQ 2NLWA 1SJRA 3CCES 3VAFA 3R1HA 2M8DB 3J7YU 2M8HA 1QVFR 3SDEA 3CCJS 1R8HA 4TU8A 2DGWA 2MKIA 2MZQA 2MSSA 2V94A 4QPTA 4TU7A 2DNYA 2RU3A 1M90T 3FEYB 3P6YC 2MKHA 3Q2SC 3US5A 1N8RT 2VOOA 1FXLA 2L9WA 1WG4A 2DK2A 3VAIA 2JX2A 4UQTA 1WEXA 2LECA 1YITS 2DGUA 1R8PA 2E5JA 2G0CA 5IFMA 1H6KX 1KQSR 3V4MA 2CQIA 4OZ1A 3BO3A 3H2UB 1VQOS 1RKJA 3CULA 4QU7A 1H2VZ 3MD1A 2LMIA 2CPYA 1WF1A 3UWTA 1Q82T 3RW6A 2DGXA 3ZZZA 2ERRA 1NJIT 2VONA 4LIRA 2DHAA 2YH0A 1KOHA 3CC7S 1WI8A 1BY9A 1NO8A 3LQVA 3CPWR 3MXHP 2E5GA 1CVJA 2BZ2A 4WF9Q 4IUFA 1VQ8S 1WI6A 2DNLA 2CPXA 3HHNB 3VALA 2DO0A 2DIUA 2MSTA 1M5OC 4Y0FA 2DIVA 2KG1A 1UAWA 2YKAA 2LXIA 2JWNA 3D2WA 2I2YA 3MI7X 2DNKA 4WCEQ 2MMYA 5GVQA 2DGQA 3NS6A 2LCWA 2DGTA 2M0GB 2KRBA 1WHXA 2J0SD 2FY1A 2XNRA 1VC6A 3JB9k 1VBXA 5JVGQ 3VAGA 2DGSA 1ZZNA 2QA4S 2MZJA 4WFBQ 2AYBA 3S8SA 3CC2S 4Z2XA 1VQ5S 1VQLS 4YB1P 2KFYA 2AYGA 2KHCA 2DITA 2OTJS 2RQ4A 4PKDB 2KH9A 3NNAA 2D9OA 3CUNA 3UD3P 5DM7Q 2N7CA 5LJ3Y 3MDFA 1QVGR 2A3JA 2DNZA 4IO9Q 2CQ2A 5LJ5Y 3PIOQ 5DDPC 4V19X 1KC8T 1YTYA 1FT8A 1N52B 3UE2A 1M5PC 1M5KC 2LEAA 1FJEB 2RS8A 4CIOA 2CQHA 2MPUA 1JMTA 3IRWP 1WHVA 2MKSA 1U1LA 2MY8A 1X4HA 3CCVS 4C0OC 2HGNA 1X4BA 1QM9A 1K8AT 1FJ7A 2DO4A 2EK1A 2XNQA 3UCGA 4C4WA 4EGLA 3MUVP 1K9MT 5GAHU 3MUTP 4FXWA 2ZJQQ 2WBRA 1VQ7S 3UCUP 1H2UX 2NZ4A 3TP2A 1X4CA 2UP1A 2MZTA 1PGZA 3ULHA 2EK6A 1VQMS 2D3OR 2VOPA 5CXTA 1P1TA 2CQBA 3VAKA 4ED5A 1KD1T 5DDRC 2LYVA 3CC4S 2E5HA 2E5IA 2DGVA 5D77A 1B7FA 1WHYA 1WWHA 3P49B 2DHXA 2DNOA 3G8TA 1VC5A 3P3DA 2DNQA 3THTA 1VQ9S 3S01A 2RUGA 2CQGA 1WHWA 2KU7A 2DNMA 2RS2A 1X5TA 4WFNQ 3NMRA 4FXVA 1X5SA 1UP1A 3CMES 2KVIA 1WEYA 1URNA 1OO0B 2Q79A 4QU6A 1SJQA 2RNEA 2VODA 2DH9A 3FEXB 5GADU 2KM8C 4J5OA 2XS2A 3CMAS 2F3JA 3NS5A 2MKJA 3UCZP 3CD6S 4WIIA 1FHTA 2FHOB 2QEXS 3CCSS 2MKKA 3CCMS 1WF2A 1SXLA 2XB2D 4P6QA 2K8GA 2DISA 3R27A 1S72S 1JJ4A 4C7QA 3ZZYA 1F9FA 2RVJA 5DDQC 5FJ4A 2YWKA 1A9NB 2CQCA 4WFAQ 2M88A 2RT3A 2DH8A 2KG0A 1VC0A 2MQQA 2AD9A 2N82B 5GAGU 1X5PA 2CQ1A 1WEZA 2KT5A 2RRBA 3EGZA 1YWXA 1IQTA 4LJMA 3U1MA 2U2FA 4Y00A 1YJ9S 1VQ4S 2CPJA 1P27B 2ADCA 4W92B 3G6ES 2X1FA 1D9AA 2I38A 3U1LA 2GHPA 3MD3A 1DRZA 2XS5A 2RQCA 1U1KA 1VBYA 3EX7B 2OTLS 2MZRA 3S7RA 5LXRA 2JRSA 1VQNS 5MLCV 3NNCA 1HA1A 3VAJA 1X4FA 5DM6Q 4F25A 2LQ5A 1DHMA 4CQ1A 4IOCQ 2MZ1A 2L08A 2LEBA 1SJFA 3MOJB 2MZSA 1U1PA 2MJUA 2CPHA 5ITHA 2MKCA 3G9CA 3HI9A 2MGZB 4YUDA 3TO8A 1UFWA 2MQLA 4M5DB 2F9DA 3B4MA 1U1NA 3Q2TC 2U1AA 1U2FA 5IQQA 2MHNA 1OWXA 1U1MA 2FC9A 4CH0S 3VAMA 3VAHA 1YIJS 2DHSA 2DNRA 1OPIA 2CQ3A 4PRFA 1X4DA 4ERDA 2CPDA 3EGNA 2XS7A 5IM0B 2X1BA 2M7SA 5HL7Q 1Q7YT 1WG5A 1X4EA 1O0PA 3L3CA 3CCLS 1K73T 3N9UC 1NU4A 2X1GA 1Q81T 5DETA 2DHGA 2LKZA 2X1AA 2D9PA 2CPEA 2AYEA 2DH7A 2K3KA 2CQPA 3CTRA 3BO4A 2J0QD 4WKRA 2J8AA 2KI2A 2JVOA 4PR6A 1X0FA 2HZCA 3UD4P 1WG1A 1W2BR 1SJ3P 2DB1A 2DNGA 2J76E 1U6FA 3B4DA 1VQ6S 5CYJA 2CQ4A 2PEHA 2KXHA 1Q86T 4RU2A 2KYXA 2DNNA 2CPIA 5BJRA 2E44A 3I55S 2OJ3A 1A7GE 2B0GA 1SJ4P 3G4SS 3PIPQ 3S6EA 1H2TZ 2F9JA 2OSRA 2MGZA 2MB0B 1WTBA 2L41A 1L3KA 2O3DA 4A8XA 3TYTA 2KN4A 4IOAQ 5CA5A 2DNPA 1VBZA 5DDOC 5D78A 1OIAA 1XN9A 4F02A 5H1SV 3THPA 2YH1A 3H2VE 2MQMA 3P5TL 3LPYA 2HGLA 1X5OA 1M5VC 1FO1A 2M4MA 5IM0A 4U67Q 2OIHA 2RRAA 3VF0B 3CCRS 1KOOA 2LA4A 2MJNA 1G2EA 2CPZA 2KXFA 3BO2A 3SMZA 4LMZA 4TU9A 2FPHX 1U1QA 4UY8T 2KRRA 2AYMA 3CXCR 3CF5Q 1X4GA 1U1OA 2BOPA 2G4BA 1YI2S 3R1LA 2CQDA 1ZH5A 1YJWS 1N54B 4YOEA 3RW7A 4TLQA 2M2BA 1YHQS 1X4AA 2KXNB 4F26A 4CH1A 2CJKA 1S79A 2MQNA 1ZZFA 3CCUS 1D8ZA 2DGOA 2PE8A 2XSFA 1HD1A 2N3OA 3SDEB 1HD0A 2N3LA 1UW4A 3G8SA 1FNXH 1U6BA 2HGMA 2OSQA 4QQBA 2G1DA 2QFJA 1M1KT 1VQKS 1DBDA 4BS2A 3IWNC 2ZJPQ 5LSLA 1VQPS 3CCQS 2HYIB 3J7ZT 4W90B 5HO4A 3DXBA 2HVZA 4OZ0A 3MUMP 2DNHA 5JVHQ 2CPFA 2CQ0A 2LXUA 1WELA 5GAEU 3BEGB 5EN1A 2EVZA 3G71S 2JVRA 2FC8A 2MXYA 4ZKAA 2ADBA 2SXLA 1U1RA 1DZ5A 1N88A 2M52A 2M70A 1WF0A 1AUDA 1JJ2R 2MQOA 2MY7A 5LSOA 3G96A 1HL6A 2YTCA 1JJHA 3OW2R 5LXYA 3BS9A 3MURP 1RK8A 2MYFA 3NNHA 3I56S
chains in the Genus database with same CATH superfamily
1M0SA 2HRTA 3UVJA 2AKWB 5EUHA 3K0JA 2PMZD 1UJ4A 3AQPA 3SCKE 1IBMJ 4ZPAA 4I67A 3TARA 3OL7A 1GFWB 5A0YB 2M8DB 4ECXA 5IWAF 1SB6A 1IKXB 8ATCB 3O1LA 4TVAB 2IC3B 1EAYC 4USUA 4DX5A 3A3OB 3FBFA 3BQ1A 4QIEA 5CCMA 2CQIA 2FHKA 2YNGB 1N36F 5HMWA 1Y5IB 3IRXB 3OD2A 3TX0A 3QQCD 3ZXWA 3A8IA 2LMIA 4QJVA 3UWTA 2I8EA 1ZA2B 3QJPA 1MN9A 2DHAA 1WI8A 4A4JA 1CVJA 2BZ2A 2DXFA 3KG4A 3CDEA 3PX6A 3K5NA 1JLCA 2UVVA 2PN6A 2FHJA 2CNKB 4L3NA 5IT4A 1QE1A 5MAOA 4FZVA 1HNZJ 4L3KA 5GVQA 3WBZA 1S9GB 3M8SA 2GQCA 2FY1A 1N56A 1YDLA 2QA4S 2CJBA 4NA1A 5D3GB 4X2BA 3H98A 5BR8F 3QSYB 4R25A 5I42B 3RRGA 2RQ4A 1YJTA 2D1CA 2JLEA 4Q2LA 2KH9A 4F3OA 4DV6J 4RUCA 4ZOSA 3ZZ0A 3SEOA 3MDFA 1FNMA 3QLHB 3AB2B 1UVJA 3QAEA 5K8OA 5HQMA 2W1BA 3HD2A 3EYZA 2LEAA 2JOQA 3LP1A 4PPZA 2IA0A 5LMUF 5G4DA 2EK1A 2WW4A 2V68A 1RAEB 3I5CA 1LK7A 1I51B 1SIWB 2VG6A 4EBEA 4I7FA 4F4AA 2OAUA 5D4PA 1H2UX 1QTNB 2NZ4A 3RR8A 3P45B 1XR7A 4I6AA 2XYPB 2VQFJ 3MM7A 1OPZA 2COLA 3KLFA 4USVA 3VAKA 3DRRB 2R4FA 3ET6B 1FESA 3P49B 3Q8RB 4MTPA 4USMA 1RBOB 2GHVC 2HK3A 5L1KA 2CVEA 4WU3A 3TAQA 3FEXB 2XS2A 4J5OA 1FE4A 2B9EA 2HQGA 4KKOA 5HBMB 3CD6S 1KTQA 1DFDA 4LR9A 1JLFA 2X3DA 3L95X 4BLGA 5DDQC 3MEDB 1HHSA 2V34A 3MTKA 2CQ1A 3KJFB 5CHCB 4FVCA 2NR0A 5AJ3J 1N0VC 2HQ3A 1RT2A 1CBKA 3PEHA 1Q8IA 3CO0P 3W9JA 3DNCA 4E0DA 4DN9A 2RQCA 2XC9A 3OXLA 3NGRA 1TAUA 1SQEA 1T03B 2R2UA 3NRBA 1IJFB 5ITHA 1BMQB 1YJRA 2NPFA 2W7OA 5M2UA 3Q2TC 1OWXA 5AXNA 4B9UA 2XLJA 3MMCA 3UN5A 1X4DA 1JWWA 1TL3A 5AE2A 2X1BA 2OEKA 4KPCA 4AUKA 2LKZA 4OYMA 5LT5A 3BO4A 5SUHA 3C19A 1YKWA 5GMEA 1WDTA 4FYXB 1RWXB 1S6QA 1Y10A 4QR1A 1FF2A 4PYAA 4I2QB 3NY0A 4E2FB 3ONQA 3H5XA 1L3VA 3KNAA 2HPUA 3WZ0A 1K47A 2WVBA 2CYYA 3GJRB 1OIAA 4DUYF 5H1SV 4HKQA 4YY3F 1HPZA 2HNYA 2ZITA 3IC1A 1LNQA 1D3WA 1UKUA 5K5MA 2RRAA 3LO3A 4C8KA 2HHXA 4DR4J 3SMZA 2FHMA 2VICA 1YZ7A 4NZ6A 2EBEA 2UUAF 4ID5B 3CF5Q 2M5YA 3H20A 1PJ6A 1WC0A 3IR6B 3UVJB 4JI3J 2E7WA 4NLGA 2OGUA 3NGUA 4JB8B 4Y28C 2BKOA 5C42A 1BD6A 1HD0A 1QAXA 1NKEA 4QQBA 4AXJA 2A2DA 3CJKA 3CCQS 5HO4A 4P74A 4Y34A 3TJAA 2CPFA 5GAEU 3Q86A 2JVRA 4P10A 1S12A 3R9LA 2F4VJ 1P9QC 5EDWA 4JV5F 2YTCA 2LU2A 3QWUA 2OELA 1JLCB 1YJNS 4PXDA 1R0BG 4DHVA 2GS8A 2MHEA 3HFZB 4C8ZA 2UV8A 1NK4A 1HHTP 1FRJA 2ZH5A 1QE1B 1FX2A 1LWCA 3TW0A 2MSSA 4F36A 3T5JA 1CSJA 2L9NA 1TR0A 4IYQA 1RAIB 2WBMA 2XMJA 3AH6A 1ULRA 3T1YF 4ZPWR 4DV0F 1XC9A 1RYRA 2YX4A 1RGVA 4N56A 2VONA 3N4WA 4RWWA 4GVBA 1BY9A 3MXHP 4GC6A 1XERA 5KFSA 4GKKF 3KG1A 4M95A 5ETVA 1WUUA 3LP1B 2B4OA 4B17A 1TP7A 3BYPA 3G8QA 2DRBA 4ZVPB 2J0SD 4DR3F 2I9SA 4EU0A 2N4DA 2VG6B 3UDCA 1ZZNA 1SC6A 2MZJA 2V63A 3TNVA 3MR2A 4ZPVR 2Q3PA 4DR6F 2D3ZA 2HNDA 1KQKA 4DUZJ 3LWLA 3MM7B 4DN0A 3NNAA 3KLFB 4XDCA 2A3JA 4ZIWA 3NKYA 1EARA 4IRCA 4RU9A 2IMWP 5KT5A 1RT1A 1WACA 5KT4A 1R8CA 3CCVS 4KKOB 3M8WA 4QWCA 1NKBA 4LF5F 3K2YA 2B51A 4KYZA 1U0HA 1JLFB 4K59A 2V8PA 3DOMA 2DJWA 4FXWA 2YKPA 2UV8G 3TP2A 3MOZA 3TANA 2ACYA 2H65B 4OHZA 2C2MB 3G8TA 1IBCB 3UN2A 2Y1LB 3C6UA 2WTFA 3W8GA 1Z2ZA 4B3SF 1S6UA 3KNGA 3L4BC 3EXYA 1UP1A 4BC9A 4LF9J 1OO0B 2H5IB 1JX4A 3PDNA 4DL3A 2IPOB 4OI1A 3NEKA 2ZC4A 1ELOA 1WNEA 3B54A 3MMCB 1S72S 3EVWA 2G13A 1RAAB 1TL3B 4JV0A 4B02A 2RT3A 2V8GA 3QGIA 1YRUA 3EGZA 5F0WA 3LGMA 2KJWA 3PY8A 1S6QB 2GJIA 4FPIA 1U8WA 1GXLA 1OSCA 2FYXA 1LFWA 4IFYA 2V8VA 4H4OA 2HQDA 4NCGA 4CO0A 4NEZA 5F8GA 2YWEA 4U9RA 2F9DA 4ZK7M 2MEWA 1IBKF 1VR6A 1HPZB 2HNYB 1OY6A 1SKUB 3T3FA 1UMJA 1X4EA 1VK3A 2CDQA 3SFUA 1NU4A 3D0HE 4K5SA 2HVDA 4EYIB 4ETZA 4K4ZA 2KI2A 4GRSA 3UD4P 2DB1A 1HQ2A 2YNFA 2J76E 3D7SB 1XEZA 2KYXA 4LFAF 3DLBA 2ZBPA 3NGSA 2FJAB 4OL8A 3DC2A 5C42B 3HJFA 2B0GA 2NUUG 4TKTA 3I32A 4J9LA 4KHRA 4I68A 1CLFA 4X62F 4NLVA 3CJKB 4M5DA 2NUHA 2QL9B 3OL6A 3OTDA 4EO6A 1UZHA 4FYDA 4GMKA 3SSRA 4EBCA 3BGOP 1VI7A 1WKLA 2QO3A 4TLQA 1UVLA 1HNXJ 5LOQA 4MIAA 2IBOA 1LWCB 3CJ0A 1NH7A 3BM7A 4O3PA 4DS5A 1T9UA 1TK5A 4XO0A 1YBUA 4DR5J 3HSDA 2CQ0A 4TN2A 4FYVB 4OJ3A 5EN1A 4OZ2A 3G71S 1CJKA 1VJWA 4JI7J 5K8NA 1HIYA 5K20B 4GVBB 4DPOA 1JIHA 4F2RA 1RWNB 2BEFA 1JK9B 4ZCMA 3D9BA 3D4JA 1DARA 2WK4A 3KLVA 3ZTPA 4QCLA 3BH7B 1S0VA 3SDEA 3PX0A 3D68A 1U7LA 2C2KB 3MECA 4DL0C 4HI1A 2KJVA 4CT8A 3DDNA 2L9WA 2F8HA 5HP1A 3TAMA 1C1CA 1R0CB 2BE9B 3MMBA 1TUVA 3HKZD 4ES3A 2HNDB 2DD8S 4ZVRB 1RB0A 2WCXA 4F67A 3CCWA 2HQIA 4CO1A 3DLJA 3PYEA 1EKRA 4I56A 1HKAA 2KT2A 5FDLA 1VRUA 2GGPA 1VQ8S 4AL6A 3VALA 9ATCB 3SCIE 1RT1B 4KH0B 2Q43A 3D2WA 4ED2A 4LF4F 2HFSA 2YXLA 1U0HB 4FP9A 1Y11A 1KEKA 4AXIA 4A8WA 2ZH7A 4O3QA 3DOMB 2DGSA 3J81j 1REGX 1W7WA 2JC1A 4A8KA 3L7UA 4PKDB 1WKJA 3DN9A 4ZIVA 4OIXA 3HHLD 1DURA 3OV7A 2MLZA 5BYRA 1HARA 2KL8A 3PG9A 3RRHA 3C6UB 3BPDA 1OYEA 4YQWA 2AEFA 1RHKB 1JXVA 2R8IA 1ZM4A 4QWEA 1K8AT 2ZM6J 3DFEA 2XNQA 2BRLA 2A2CA 1AZSA 3FGVA 4X65J 4ZVUB 4ECVA 3IA0A 1R0AA 1IBMF 5H9FJ 1MU2A 2C3MA 2BYCA 5DDRC 4MK8A 2A10A 3O3LA 2DT9A 1WWHA 1N34J 2YWFA 4O4RA 2RUGA 2I5JA 4IFYB 2HWHA 1N6QA 4H4OB 2RHSB 1WEYA 4QU6A 4NCGB 1QTMA 3PO4A 2IAJA 3N5BA 3L7OA 3NS5A 4WIIA 1QAYA 5D0GA 1KHWA 5ETOA 4L6V3 3ZZYA 2MQQA 2FLLA 2N82B 2L48A 1WEZA 5KFVA 1ZPVA 4DU8A 1RWWB 1VQ4S 2FDNA 4M5GA 2FVCA 2YNFB 1IQZA 3UD5A 2KZMA 2IBKA 4J9NA 1HNZF 1KBRA 4F4ZA 3HVRA 4DV2J 2WHOA 4DPWA 4ALZA 5DM6Q 3IGNA 4LSZB 2HFOA 4LSLA 2MKCA 5F8JA 3HT3A 3HKWA 4M5DB 4QIFA 4RLEA 4IQMA 3KHRA 2CQ3A 4PRFA 1Q78A 2BQ3A 4HT5A 4O0NA 3NOGA 4DMZA 1WG5A 4PXEA 3N9UC 1EB0A 4DV1J 3HVTA 4RUAA 1MLAA 3H7HB 2J8AA 1ROFA 5CYJA 8AT1B 2ZH8A 4MKBA 2DNNA 4O3RA 4V1Ak 3CDUA 4OJGA 2XCPA 4EEYA 1JXLA 2YX1A 5HJYA 2QLWA 2MKYA 1HW9A 2Z2YB 2QIFA 5F8LA 3QIDA 2VL1A 3M9MB 4KHPJ 1FWKA 4IR1A 1GMVA 2ZZNA 3OVBA 4ANCA 2JZ5A 3P5TL 4DL4A 1M5VC 2HWIA 1CJKB 2HHHJ 4OYPA 1KOOA 2VG5A 1QSYA 4MMOA 2NSBA 4LMZA 1U1QA 1RAGB 1ZH5A 3GFYA 2HZVA 4LRDA 2M2BA 5CYMA 1H74A 1L5UA 4ZPDA 1BWEA 2DGOA 1YG0A 2XSFA 3SDEB 5D4LA 1UW4A 1U6BA 2OSQA 3MECB 1VQYA 3K59A 2LQ9A 4KGKA 5HI7A 2GCFA 2XMWA 1IKWA 5HP1B 5AJ3F 3TAMB 1C1CB 3BEGB 4ZVFA 2MXYA 4FVMA 2SXLA 1DZ5A 1UWAA 2AEJA 1C4AA 1MNEA 4ICLB 5LSOA 5F9LA 3HHEA 4HTJA 5HQ8A 3KJQB 1KKHA 1RT6A 4DX8H 5FDLB 1S0NA 1VRUB 2GGPB 3Q24A 4USWA 3QIPA 2DPJA 4USKA 4ZPCA 1WSRA 3H8YA 2M8HA 2B43A 1C0TA 4CO3A 2MKIA 4CNYA 4QPTA 4QBUA 3QMQA 4N8OA 3IR7B 3CGIA 1MN7A 2O66A 4KGZB 2BJDA 1JLAA 3M7VA 4WTOB 3TZWA 1NHVA 2E66A 3HX9A 4C3MA 1WF1A 4DUTA 3Q8PB 5DG9A 2ERRA 1NHKL 4U95A 1KVJA 3FDSA 5HMYA 3GCWP 2DVIA 2VZ9A 3KFWX 4DWIA 4WF9Q 1AW0A 1TKZA 4KV8A 1LQ9A 1M5OC 2DIVA 1PC5A 2YKAA 3DU6A 1FRIA 3Q83A 4DR4F 4M63A 2OMOA 5HVHA 4NLOA 2WOMA 5A8RA 1AZSB 1VBXA 1FXRA 1RABB 4BHQA 4JI3F 4XDDA 1TMJA 1S9FA 4ECRA 2CFXA 1R0AB 3MWBA 1MU2B 1JKHA 2CZ9A 3J81Y 1G4CA 4JI0J 4A8OA 2DR8A 4YB7A 2I5JB 1N6QB 5F0UA 3QGGA 1M1GA 2CQHA 2IAJB 3IMQJ 3GSDA 3IRWP 4K7QA 1YBTA 2YWGA 4UZCA 3OT9A 2HSEB 4P73A 2F4VF 4DFMA 2JNJA 5EHHA 3F44A 2IM2A 3A4TA 2HLTA 4ZJLA 2ROPA 4LVNP 3QRRA 2D3OR 4ED5A 2J7UA 1CJTA 3UNYA 3AOBA 4FS1A 2V2VA 4YR2A 1NSKL 1VC5A 2ZWPA 2Z57B 3AD8C 3GV5B 3CJQA 4WFNQ 2LQBA 4LSLB 2EEYA 2R7OA 2QFIA 3MMJA 3WIVA 1AB8A 2J6SA 3VVTA 2XWYA 4FKYA 2FHOB 4ZPBA 1GX6A 2HIQA 3CCSS 1NDLA 4P6QA 1FD8A 2NS1B 3GJSB 2D74B 4H4KC 3OSPA 2CQCA 2ZNZA 4F4KA 5EWEA 1YWXA 3HVTB 4ZCKA 1P6TA 4FPRA 2U2FA 1D9AA 1SQFA 1HI8A 1S0OA 4DSKA 3F41A 2MZRA 1RWMB 4QW8A 1HA1A 4LRFA 4F25A 4NYPA 2L08A 4U7UD 1WKKA 1HNVA 2F4FA 4M5NA 4CH0S 2P6TA 2IVYA 3GYNA 3W7BA 2OHDA 2F5GA 4NZ7A 2VG5B 4O4GB 2X1GA 2AJ4A 2X1AA 2CPEA 3BSOA 1SPBP 1IWGA 3BGRA 3UO0A 3H2LA 1JLGA 1ZTTA 1HNWJ 4OMFG 2FJEB 5CYMB 3G6VA 5J2PA 2BE7D 4WYLA 1UVKA 3FMBA 1C1BA 3D0IE 1IN0A 5L9XA 3DKDA 4M5IA 3ILLA 2GW8A 4LSNA 3Q89A 2G9OA 2H3EB 4I1TA 4WP3A 1FRMA 3KJNB 2KN4A 3JSRA 3PYDA 3KLHA 1IKWB 2YH1A 2WVEA 2HGLA 5KOWA 4ZP6A 2QMWA 3H5SA 1FRXA 4U67Q 4WPAA 2XM3A 3DRYA 3W64A 1FD2A 2CPZA 4LR7A 1CQNA 2KRRA 3JTNA 3MAQA 2G4BA 4LF9F 4RWXA 1RT6B 3OBIA 1AYEA 4FDFA 1NJYA 4DV5J 2ZH1A 1YHQS 3OFFA 5F3ZA 3DOKA 2KXNB 3QIPB 2Y8WA 3AJ1A 1C0TB 1FTRA 2ZJPQ 2YKQA 3GTYX 2C1EB 4MKVA 2DNHA 1JLAB 3ELHA 2FC8A 2M52A 2F8EX 2FGCA 3AODA 3MCSA 3GR1A 4KO0A 1VIXA 1HYSA 1TKTA 3QRPA 1SI9A 1TKZB 4KV8B 4HACA 4LFBJ 3G82A 4DZ6A 1E6VA 5G0RA 4RW7A 2JH3A 3Q8SB 2GJ2A 4ITSA 3PKYA 5D6GA 3CCES 1QVFR 2HFZA 4OZJA 1SVDA 1N8RT 4DQPA 3LUYA 3TUIC 1GX5A 2WOMB 1PJ5A 2VG7A 5A8RB 2LECA 5IFMA 2ZBRA 1H6KX 1XNQJ 2C3PA 3V4MA 1K0TA 3MPWA 3BO3A 1VQOS 3RTVA 4QU7A 3CJ8A 2CPYA 3RBDA 3RW6A 2H1YA 2H4WB 3HHLB 1JKHB 3HDSA 1VOMA 3TJ8A 3D1OA 1R8BA 3ZTSA 1WD6A 2VU5A 1RI7A 4LBHA 1U2RA 1NB7A 4HDGA 4PQUA 2DO0A 3W63A 1FKOA 2EC2A 3GFXA 5H9EJ 3W1YC 2V8HA 4WU2A 1NXIA 1I94J 3KLIA 2JEIA 5KG4A 1AFJA 1Q8BA 1K1SA 3OHBA 2HZAA 4FF3A 4OLOA 5F3TA 2ZFHA 4ZS6A 3MEKA 5KFXA 5DQIA 4Z2XA 3HZGA 5M2RA 4WTYA 3CNQP 1T94A 1HNXF 5IT9Y 2HRUA 3PACA 3OFGA 1VYAA 1T0TV 1CJTB 4IO9Q 1NK0A 2VFTA 1JB0C 4AT1B 2VQEJ 2YBVA 1PBUA 1N52B 4DR5F 1M5KC 4AL5A 5D0RA 3GE9A 1SKSA 2WONA 2E29A 2W2OP 4A8MP 5IWAJ 4JI7F 4C97A 2B9WA 5A8KA 4CM2A 1FXDA 2QRRA 2J9EA 2UP1A 2MZTA 1KONA 3T1HJ 1PGZA 1N36J 3DRXA 5A76A 2HURA 2KFNA 2RKIA 2W9BA 2DGVA 4ED4A 1OJ4A 4OYXA 1JXEA 3ILOA 3M6UA 5ADZA 5CZXA 3DCAA 1RAJA 4PUOA 4ECQA 4Q44A 3I96A 4OV1A 1FHTA 3NGDA 3QATA 4JOUA 2XY7A 4M5LA 4LF2A 3T19A 4DL6A 3N0VA 5KFYA 4YN3B 5I3QA 3ADAC 2V69A 4HVZA 2CVIA 3M9NB 3BGRB 1L3TA 2UUBF 2GMJA 2PD1A 1RAHB 2ZHAA 2EFNA 1JLGB 2FJDB 2BR0A 2AZ3A 2YQ1A 4DSFA 5J2PB 3S7RA 1SC1B 4HHUA 1YQHA 2RILA 1C1BB 4EUVA 1DHMA 3DDKA 2CPHA 4LSNB 3ENAA 4OQJA 5HK4A 3TO8A 3JSMA 1G7CB 1XMBA 3M05A 3LW5C 5HQLA 1XJWB 3X1LB 5DQHA 4RKUC 3KLHB 3K5PA 3G6XA 4F50A 5KTQA 2BV3A 4Q0BA 3J7YI 2CDRB 2ATLA 1B64A 2E5LF 3CTRA 2PT0A 1SJ3P 2W2MP 3PEJA 4ILLA 3C2PA 4M1KA 1VQ6S 4DPTA 4ED0A 5KG1A 2ZM6F 3DLEA 3I55S 1RLCL 4X65F 3DLGB 2CADA 3M30A 3IO1A 1B7YB 4IOAQ 1XN9A 4K4YA 5F8NA 3TUPA 1Y3JA 4UOHA 4LF6J 2BM1A 5IC4B 5ETSA 1N34F 1P8GA 1QAJA 4NEYA 1G2EA 4NMXA 4TU9A 5LSRA 4NLRA 4KO0B 4PG7A 4HHJA 1X4GA 4N76A 3R1LA 4YOEA 1HYSB 1TKTB 1S4FA 4HACB 3G82B 1E6VB 1SH2A 3PVXA 2VKZG 1FRKA 4RW7B 5G0RB 2AGQA 1V6HA 3H5UA 2N3OA 4KY3A 3WDOA 2KKHA 4QZVB 4OX7A 5IV4A 1A0OB 4BS2A 2BANA 4RBUA 3Q23A 2VG7B 5KG6A 2OO4A 1RHQB 2UXBJ 4FXDA 1U1RA 2DRAA 4DV2F 1JJ2R 4MT1A 3J81U 4CWBA 1HL6A 1MSWD 1FKPA 3RYLA 1TFWA 2IFXA 4HTIA 1C2PA 2M9KA 1SL0A 1BQMA 4DCPB 2RRNA 4PQUB 3PYGA 1PAEX 1FKOB 4LF8J 1X9MA 2D3O1 3R1HA 3KLIB 1N0UA 2DGWA 2VC0A 3RUBL 2F1FA 1Y9OA 2HHUA 4DV1F 3NLCA 1PYTA 3KMQA 7AT1B 1D0EA 2KTQA 1WC5A 3C6TA 2E9TA 2EC0A 2YQ3A 1H2VZ 5K14A 4FBTA 5L1JA 4B9SA 4HH0A 3VZIA 1EHWA 3CEDA 3SV3A 1NJIT 2B4PA 4A8YA 3CPWR 3OTBA 4KHPF 1Z1ZA 3OVSA 4IUFA 2B7BB 4OI3A 3RAMA 1UAWA 1F5CA 2HFVA 5L38A 4J9QA 1IKVA 1RWPB 5DLFA 1NB2A 2WONB 3OTCA 5B0FA 3PW2A 4USTA 2V67A 5A8WA 3I9V9 1VC6A 5A8KB 2BMBA 4NA2A 1UJ6A 1VQLS 3R6GB 4HYKA 5T14A 1JLEA 2WAQD 3W60A 4P52A 1XNRJ 1NAQA 4QPXA 4OHXA 2WVDA 5BXIA 3IBFB 4OI4A 1U2CA 1KRPA 2RKIB 3ZTQA 2W9BB 2DNZA 2O01C 5KG3A 4EO8A 3HZEA 2JDJA 1IR2A 2QJ3A 3R8YA 1EX8A 3UE2A 4PUOB 2KT3A 1X4HA 2HBRB 3OFEA 2BM0A 3QO9A 2NXNA 2J9DA 1PYOB 1S48A 3TA1A 3CJ5A 5K8PA 3QT8A 2Z2LA 3FZ2A 2R8KA 2YVSA 3UCUP 3SBMA 4ZVTB 4NRTA 3DHWC 4F4XA 4DU7A 3EZUA 4PWUA 4UUWA 1NPKA 2EFOA 1Y4ZB 3ILJA 5DRKA 4J9SA 1U49A 2IDEA 3G2XA 1VRQC 2RNEA 2PMHA 2DH9A 4KT0C 2KM8C 1T05A 5ETPA 3JSMB 2R7TA 2F3JA 3MEEA 4UTGA 4J9VA 5T41A 2FLNA 2R7QA 1OSDA 3JQKA 1H73A 2ZH6A 3BQ0A 3UR0A 1A9NB 2XULA 4Q0BB 1MG7A 1QUPA 1BQNA 1DQ8A 1H0HB 2GZOA 1PC4A 4DR6J 3KLGA 3UPFA 1MWYA 3P96A 1YJ9S 1XQIA 3P4UB 3CJTA 3BN7A 3MM6A 1NJWA 1DRZA 3BBCA 4OHVA 3RAXA 1X31C 2WVCA 5MLCV 1YJ7A 3DLEB 3D54A 2LQ5A 1LXNA 5EGYA 4Q7AA 3JXOA 2LEPA 3ZO7A 3M30B 2WW8A 2OUGA 4O0IA 1N5SA 2QC3A 4LF5J 2QL7B 4I6WA 3SV4A 4TXSA 2O67A 3EGNA 2XS7A 1SKRA 2Y0SD 3MR7A 4JI0F 3Q8VA 3EE3A 5I3PA 2DR5A 2LFVA 2CRLA 3MCNA 1CULA 2DNGA 5D4OA 1DJ0A 4NYZA 2AT1B 4CLKA 5ETMA 4ZVGA 2JHEA 4M5JA 4MFBA 2BA9A 1UEVA 2B7CB 3AOAA 4YFUA 2BANB 2CNLB 4A8XA 3TYTA 3G87A 1NM2A 5D78A 5LM7E 2RMLA 3CD7A 4IG3A 3FCWA 4ILMA 3LPYA 5EWFA 3RG6A 1UA1A 1KWMA 3LA0A 3U1NA 3CCRS 2ZEJA 2MTLA 3PRDA 3BO2A 2OPQA 3N5FA 2VKRA 1FKPB 1Q95G 3CXCR 1U1OA 2Z2ZA 4NMLA 3CB4A 5GAGI 2E1CA 2JEFA 4P7TA 1BQMB 1X4AA 2UVRA 1QLNA 2FHJD 1OQ6A 3BPSP 4NL5A 4RNOA 4DQQA 1GMUA 4DBQA 2QTWA 1RWUA 4ZLJA 1D09B 3CW2C 2UVUA 1XBWA 5E7OB 3MGJA 3Q8QB 3AOCA 5IT9U 1D9DA 3C6TB 3D5MA 1RA7A 5K14B 2YWHA 4Z7YA 5KT6A 4ED3A 4YB5A 2MY7A 1HBNA 2K3IA 3MURP 1S10A 3NNHA 3BQ2A 4D3HA 3OR1A 2J8SA 1VBKA 1NUEA 4LFAJ 1R3NA 1SBRA 3M1VA 1IKVB 1GNKA 4WFYA 1R8HA 2MZQA 3J80Y 3FEYB 4FKXA 4QOTA 3E01A 5A8WB 2VOOA 1WG4A 5KFGA 4J9KA 3CDWA 2XCAA 5BYSA 2GAHC 4K8RA 1RTJB 2AZ1A 3H2UB 1RKJA 1JLEB 1RISA 1HNWF 4GKJF 1V9OA 1Z2LA 2DGXA 4K50A 3V6DA 1YRXA 4PABA 2GNKA 4ZMMA 3LQVA 1CC7A 4IH7A 4A48A 5A6PA 1KTVA 2CPXA 3CJ2A 1D8YA 2MSTA 3R2DJ 1FEHA 3K8WA 4CLSA 1WC6A 3MR5A 3PKMA 3QO9B 4YEAA 3HP6A 2LQJA 3THVA 2BDPA 2YX7A 3EGVA 2M0GB 3Q8UA 2E1RA 4NX9A 3NCRA 1NK5A 1FDDA 1T9XA 2BJEA 7FD1A 1TQLA 2F63A 4DV5F 2IJFA 1TVRA 1EZZB 4QIVA 2D9OA 2WRMA 4QIGA 3GJTB 1S7IA 1U47A 3MPVA 1NNDA 1V3RA 2GX8A 1FT8A 2D7SA 3FEZA 3TVZA 4S0MA 1T05B 1U1LA 2MY8A 4DX6A 3MEEB 2AMCB 3IGVA 4DFPA 2DCLA 3DHXA 2OKQA 2FTRA 1UEUA 3QYYA 1BQNB 3K57A 4JI1J 3KG0A 5DGBA 3KLGB 4J91A 4U7UK 4LFBF 1SL1A 4BDPA 2HG4A 3OHAA 5ETTA 1B7FA 3I0RA 1WDDA 1VQ9S 3FZBA 2UXDJ 4OI2A 3UW1A 3CVKA 1REVA 3PZPA 3CMES 1XNQF 2RE1A 2VDHA 3A3PB 3W9HA 2QEXS 4TLRA 1FA0A 1HBOA 3LOUA 2DISA 4DX7A 3HF5A 2ASDA 1S7HA 4WFAQ 2M88A 3MHYA 2B4UA 2AD9A 4P9SA 4X4VA 1S1VA 4QYRA 1X5PA 2ZOGA 3E2EA 5CABA 4I2PA 1IUJA 3KOAA 1NK8A 2AJQA 3P8BB 1CULB 3G6ES 1I94F 2DXEA 2OEMA 5LXRA 3NNCA 3WC0A 4MFBB 1NSPA 3F56A 4PG4A 1OS5A 3U02A 1U1PA 1UWBA 5BYQA 3G9CA 3VGSA 4OI0A 2VC1A 1RACB 2ZVSA 1WTFA 1UTAA 1U1NA 4CO4A 1U2FA 2MHNA 2W4CA 2QE5A 4IG3B 2DNRA 3WHIA 2XZTB 4K4XA 1RTIB 3HD1A 3PV8A 2VQEF 2OPQB 2DYAA 4WKRA 2G2YA 4RW4A 4RNHA 1HQEA 1URRA 4X4PA 4JI2J 1ZPWX 2OI2A 4RNMA 3LAMA 2XI3A 3ZZUA 2G0JA 3DI6A 2FVRA 2YNHA 3S6EA 4ED1A 3IAS9 4ZLNA 1S97A 3T1HF 4OLPA 1S4EA 4H54A 2CXEA 2IYGA 3TOQA 3PHTA 1CPZA 4X66J 5KFQA 4H4MA 3EUNA 2DXDA 2GA7A 4AE5A 1S1TA 3TI0A 4W98A 4B3OA 2XLIA 1RAOA 2FJBB 1HBNB 4EWTA 1KFSA 3AA9A 2AX1A 2C2NA 3OR1B 2NREA 4JYAJ 4JP8A 1I6JA 3BKUA 3OLAA 4CH1A 1O8BA 1G1XA 1S79A 4JI5J 2MQNA 2NXJA 1D8ZA 4NXMJ 3M1VB 2AU0A 4DR1J 2EFVA 3MCOA 3NS7B 1RT7A 3SCLE 4C8MA 3E01B 2XEXA 4DSLA 3DXBA 3NGTA 3DGPA 2QN6B 3HLUA 5T7LA 1IVZA 2ZDPA 2HWTA 5E3PA 4ZKAA 2ADBA 3DM2A 3MM5A 3NAHA 2CJ9A 2H4YB 4NLSA 5DS7A 3V6DB 2XG8A 3ZTOA 5KG5A 3BS9A 1PO6A 1N5QA 4OYAA 2ZJRQ 3PRVA 3QBCA 2XO7A 4ZVQB 3L7PA 5E3CA 3LGHA 1SL2A 2RU3A 2QYGA 4DFJA 2QLXA 2UUWA 2R7XA 3L9ZA 2HKEA 4ECTA 4C11A 3K17A 2HHVA 1T95A 3QT7A 3HPOA 2YQ0A 1LV5A 3FBBA 1TVRB 5EX0A 1K44A 3BB5A 1Q82T 1RCXB 2ALYB 1BHNA 1KOHA 1FDNA 3LANA 1Q0NA 5I3UB 3JAMY 4YMEA 3J7AN 2DIUA 2EG1A 3SSSA 2FB0A 3PJ9A 2Y9HA 4LF6F 2HQCA 1E6YA 3GV8B 2GC8A 3NL0A 4M5HA 4H4KA 4C3KA 1ZAVA 3FQLA 4U7CA 2CIMA 4CO2A 1LK5A 2O1PA 2DTJA 4HR2A 3JSYA 3ZZTA 4C0HA 4B9LA 2QLJB 3HT0A 2W25A 4K4UA 3I0RB 4LF1A 1Q4RA 1RAFB 2AQ4A 3MPUB 3B82A 2K7JA 1M5PC 1F6TA 2MPUA 4XTTA 5IS2A 2K2PA 2UXBF 4I4BA 2J0XA 2YWWA 1AROP 4C0OC 2R9LA 1X4BA 3DXSX 4C4WA 1HBOB 4KH1B 1NDKA 5B0DA 3I4PA 5DZ6A 3VGVA 3VV2B 2A6OA 1S1VB 1PKUA 1XMQJ 4FNIA 4I2PB 2HBZB 4LF8F 3DMJA 1VQMS 7FDRA 5B08A 5HN0A 4RW8A 1RT5A 4DPUA 3S01A 4IR9A 2XGQA 2Q6CA 4MIBA 3EPGA 3DOLA 3R3TA 3FK4A 1X5SA 4I6YA 1UWBB 5CH7B 1XMOJ 2C2ZB 5DQGA 2OH2A 2I6WA 4ANEA 4DLEA 5JMNA 5CD4H 3R27A 3CCZA 2YWKA 4X64J 4G1PA 5HVGA 4DCOB 2KG0A 2H48B 2E7VA 2R3VA 1HQEB 1KVKA 2IRXA 4JV2A 1TKXA 3PX4A 2BRKA 3KHLA 2OTLS 2YPZA 3CD5A 3SFGA 2B4VA 4CLYA 3MOJB 3DI6B 2YNHB 2ZUGA 3AHPA 4Y3CA 1ZS6A 2ZHOA 2ZOMA 2BE2A 4RBTA 4Z7CA 1XNRF 3ENQA 2PA3A 1EQ0A 2HNZA 5AXKA 1T3NA 1TTHB 4OYOA 1YIJS 4NLTA 4I0WA 2UZAA 4H4MB 1S1TB 2KVQE 3FSYA 4PR6A 3DGVA 4OZ3A 2RDDA 2DKOB 3RB6A 2LU1A 3MR3A 4ELUA 1OMSA 5HAOA 4ED6A 2MLXA 3J80U 1UCNA 4P71A 2AJ0A 1AA1B 3ICLA 3OL9A 2OJ3A 3OTEA 3G4SS 1RT7B 4UQGA 2MB0B 1RSCA 1WTBA 4IQXA 2L41A 1L3KA 1TL7A 4MK7A 3GIMA 5B0BA 3DGPB 1RE1B 1ZAXA 5T7LB 3ZNUA 2FVPA 2M4MA 1R89A 1UFLA 3DM2B 3MM5B 4C6AA 4C3LA 3OXFA 4JI4J 1T02A 1MMDA 3GCXP 1Y00A 5LL6d 2RHQB 1MROA 3SQOP 2XY6A 2OLWA 1KVIA 3CCUS 2BXJA 3ZFVA 1HD1A 2PA8D 4NLWA 1G3OA 1KLMA 4DR2F 1WORA 4I7FB 3NBPA 1VQPS 2ZZTA 3I6PA 2LQ8A 1OY8A 4C11B 4JUZA 4N8NA 4G1IA 2XMVA 3HHKA 4UY85 2VFRA 1VIOA 4LR8A 2LP4A 1BUXA 3L09A 3I56S 1HMVA 2HS3A 4LT6A 4CRJA 2VIHA 3IFEA 3DU5A 2BJ3A 4RUHA 1X60A 3D1HA 2CWKA 4UF4A 1U48A 3O8WA 4G1QA 2HBYB 5K9FA 1GEHA 4HEA9 5CD4A 1E6YB 2HVEA 2DNYA 2ZVIA 1R8PA 2IVFB 1J2VA 1O5JA 4J9OA 2R2SA 1RT2B 5B7WA 3NWRA 4DSEA 2P2CB 1GMWA 4MYUA 4P2MA 2UXCJ 4LBIA 2ZC3A 2HMIA 4RR5A 3D66A 4B9TA 2IY5B 3TA0A 2QA4G 3PYFA 3X3UA 2QX0A 3JYTA 3CE8A 3HHNB 5D8HB 2HRYA 5RUBA 3DRPA 3QFWA 1DAXA 1UFKA 1WC1A 4WCEQ 3GB0A 3W66A 5CZVA 2MMYA 2AJFE 1TAQA 2BVZA 2XNRA 4XPEA 5KG2A 4ELVA 3HCXA 4WFBQ 3CC2S 3ILIA 3HHDA 5H9FK 2KHCA 4WK3A 3F0NA 1GAOA 2OTJS 1S77D 3DMJB 5J1EA 1S1XA 3GILA 3FMWA 2EI5A 5K8MA 3OLBA 4RW8B 1B70B 1RT5B 4LFCJ 3TUJC 1WOOA 5KFOA 3DOLB 2GIQA 1NJXA 4CLZA 4QWDA 4YDXA 3I82A 3O6QA 1B3TA 1L3SA 3G86A 1ZAWA 1SCJB 3MUVP 4N7TA 2GIRA 5E5NA 5GAHU 1VHFA 2DCUB 5KFZA 4Q8EA 3M2RA 3RBZA 1BE4A 4ES1A 1TKXB 2FJVA 5CCLA 2IDLA 4FYYB 1RLDA 1F5BA 4TY8A 2CQGA 2OEJA 2W2PP 3M8PA 2WSFC 2HS0A 4JV1A 1SUQA 3TEHB 2J6UA 3H4BA 2QZ8A 3FKBA 2BE2B 3HJVA 4J9PA 4F0MA 3GU0A 1DTQA 2HNZB 3CCMS 1TELA 2XB2D 3M6VA 1JJ4A 2NSCA 4OX9J 3R97A 1HHQA 2IVMA 2VPWB 3R5JB 1KR4A 4UOCA 1HWKA 1YSJA 4KQZA 4KRWA 3EMTA 4RW9A 2ZH3A 2UU9J 4U6PA 3TUZC 1CC8A 1X4FA 3D6MB 3SSQA 4CQ1A 1FJGJ 3WQPA 2LEBA 5E3RA 4O3OA 3K5OA 3FSXA 3R7SB 4ENOA 1TL7B 2DY1A 4Z37A 2B9YA 1YJVA 1JNRB 4OZ5A 4WZQA 3CT9A 2NXEA 4ERDA 1V5VA 3T41A 3ZC4A 1HWLA 2V0NA 4XAKA 1U25A 1O0PA 3GIRA 2Y1IA 2J0QD 2JVOA 4TQRA 2BKPA 1MROB 4EZ6A 4NYOA 2XGPA 3ISZA 3KDOA 3W8PA 1KQGB 1T8EA 4QYZJ 3M8YA 1KLMB 3NBPB 4JI1F 2O3DA 3CIMA 4JI6J 1WJ9A 5E41A 4J9RA 2E9RX 3IP0A 2NZCA 3PM9A 2P6SA 1ZA1B 4F4YA 5THWA 4KGVB 2UXDF 3TR5A 3ZZOA 4KR0B 1HMVB 2B6AA 4EYHB 1YJWS 3BR9A 2UUBJ 3WX8A 5D0EA 3N79A 4F26A 1B0PA 3M6WA 4ECZA 1ZZFA 4G1QB 3ET6A 1YBAA 2A18A 3AT1B 1AUSL 2XLKA 1RKIA 1M1KT 1VQKS 2ZNYA 5IXUA 5LSLA 3Q22A 3RB0A 2HYIB 2ZWOA 4EK2A 2XWXA 2CNOB 4PEOA 2A0FB 3PW5A 2BKNA 1FFGB 1AUDA 3G96A 1RBLA 2CZ4A 2HMIB 4DV7J 2E5LJ 2FQQB 3HXMA 3BSAA 2E7XA 4LRBA 1X0PA 3JYTB 3VCDA 1KFDA 1T9WA 1PILA 3IWLA 4E8UA 1SC4B 1TV6A 3DRPB 2ALZA 1TKDA 1NJZA 3QRQA 3EPIA 1M90T 3R5BA 3P6YC 3OL8A 3O44A 5L8RC 2GVZA 5CQGA 1KQSR 2V50A 1FWLA 2NPIA 2VBZA 3PHEA 4JI2F 5J2NA 5J1EB 1S1XB 3E3XA 3KMSA 4LIRA 1NO8A 4PYDA 3EXCX 3B6BA 3OXGA 2JC0A 2ASLA 2I2YA 3JS9A 1LKZA 2UUTA 4X66F 3PW0A 1Q8LA 5J2QA 3M9OB 2RF2A 3W2VA 4FYWB 1YRTA 1NKCA 3H25A 3IR5B 3OPKA 5KFKA 5F41A 4ID8A 4JYAF 2KFYA 2Q1LA 2HVIA 3MAAA 1N5VA 3GZ7A 1IJEB 2XMKA 4CT9A 4JI5F 1DQ9A 4TNOA 4NXMF 3B8HA 5DM7Q 4DR1F 3EGWB 1HW8A 3PIOQ 4Y2CA 4TY8B 3HO1A 4J7CA 1TUGB 3M8PB 3HVWA 4ZVEA 3M6XA 3GLJA 2VJUA 1SUQB 4C8NA 1WHVA 5I4MA 3IAM9 3KLEA 1DTQB 3UCGA 3QWPA 1C0UA 1PJ7A 2BUNA 2OP5A 2X7IA 3KK2A 1K0VA 4OJHA 2A6MA 3QJJA 1PIEA 1NH8A 3U27A 4RW9B 3ULHA 2VV5A 4P72A 2EK6A 5CXTA 3QZ8A 4XPCA 4X4SA 4Q8FA 3BKTA 4BWMA 3KK3A 3D67A 4QWBA 4QWAA 4B08A 3I31A 4EMDA 2HHPA 3VR1A 1GXUA 1EETA 2WVFA 1KHVA 3PJXA 2ILZA 4FXVA 1ICEB 2Q79A 3WX4A 5GADU 2QGFB 3AB4B 1Y7PA 4ZN3A 1WF2A 4EBDA 3TAPA 1VMBA 4ZLPA 4X4TA 4IRDA 1U45A 2FLOA 4O44A 5GAGU 4LRAA 4Y00A 1S0MA 5KFBA 2MQ8A 4NLYA 3CJSA 2I38A 2RAQA 3MD3A 3D28A 2J5AA 5E2QA 2ILYA 4WXWA 3LALA 3HSGA 2MZSA 2LDYA 4YUDA 3NXZA 1SV5A 2MQLA 4CNZA 3MMBB 3IM8A 3TVKA 2VA2A 2HFNA 1BLUA 4NLUA 4F8RA 2V2QA 2CPDA 1VLYA 2M3DA 3CCLS 3TJ9A 2HEKA 1KLNA 3GPAA 2B3TB 1D1UA 1TL4A 4X4UA 3OVAA 3OJUA 2AF6A 3WIUA 5F8HA 2B6AB 3W62A 5KFFA 2KXHA 5HROA 3PRBA 3LP2A 1EIYB 5D15A 1VGYA 4CLFA 1A7GE 3BBBA 4DXLA 5DG8A 4Q2MA 4X4OA 3I5AA 2K1RA 4MKYA 2G2ZA 1YVFA 2CJYB 1XMQF 1W25A 2GIFA 3UDLA 1S5ZA 2MQMA 2R7UA 3D3CJ 3FQKA 1HFEL 1RHRB 2A1BA 1J5EJ 4IG0A 2BW7A 2JEJA 4UY8T 4EI2A 2AYMA 2RD5C 4DS4A 1B4SA 1N54B 1XMOF 4OFZA 4C98A 2J7WA 1HWIA 1TV6B 2QMXA 2ZBIA 2FY8A 4HI2A 2NYHA 1TUWA 2MDAA 3NG8A 1FNXH 4X64F 4L75A 2G1DA 4WFXA 3UQSA 2IHR1 5L9NA 4W90B 2W2QP 4K4SA 2WZ1A 1HLWA 4K0KJ 2J7KA 2GVZB 4OYBA 3Q0AA 2IJNA 3FJ2A 3QPIA 2EVZA 1V3SA 5J2NB 3W9IA 3KKFA 1JJHA 3VQTA 2MQPA 3GYGA 5KG7A 2V5HG 3IG1A 2GAGC 2HHWA 5L1LA 5H9EK 2GO9A 4F4WA 2PMWA 2KM8B 3HULA 3TX8A 3J7Z5 4J90A 1U4BA 5J2QB 3F73A 2RF2B 3US5A 2R8GA 3FBEA 3W2VB 4MYTA 1QSLA 2E5JA 2VF3A 4NXNJ 4GO5X 4OZ1A 2K06A 1V5IB 3MAAB 3MD1A 4A46A 2ZBCA 4B9VA 3K8VA 3QFHA 3BZQA 3N6LA 2XSJA 2FUG9 4LF7J 5E3QA 2C22A 2OFHX 4B3MJ 5C24A 3PR5B 1DTTA 1FTCA 2V6AA 2DNKA 4UZBA 3KLEB 2QMUB 3K5MA 1C0UB 4A8SA 4ECYA 4JI4F 5JVGQ 1B0TA 3W2WA 5L46A 3KK2B 4FF4A 2AHOB 1H7XA 3V4IA 5HMXA 1RT4A 4TY9A 3KK3B 5ETLA 2ZHBA 3U7JA 2OPRA 4RL1A 1F3FA 3QSIA 4PWWA 3RR7A 1EETB 4DPYA 4DV4J 4CIOA 1I1GA 1RHUB 1PSDA 1FJ7A 2KB2A 3POTA 2PEBA 2R2TA 3D6HB 5KFAA 1X4CA 4O44B 3D3BJ 3MEGA 3RGIA 4WXOA 3TQ1A 1P1TA 2FJWA 4GKJJ 1NEEA 4UOFA 2LYVA 3CC4S 1CJUA 1UA0A 1AXQA 5DJBA 3RBXA 3THTA 5AE1A 4DEZA 4P7VA 5AXLA 1WC4A 2NXUA 2HS4A 1NLKL 1U26A 1SV5B 3BGUA 4GO7X 3UCZP 3EVMA 3V5RA 1BWVA 2MKKA 3SQGA 1HI0P 2K8GA 2UXCF 2RVJA 1RZMA 1UPMB 2R42A 4PG5A 2XHCA 2N4CA 1YK9A 2Q66A 4J9UE 1IQTA 2IRUA 2CPJA 3HFVA 4Y6IA 5FD1A 1NK6A 2GHPA 5HROB 4B9MA 1U1KA 3UFCX 1QY7A 4M5KA 3LP2B 2GO8A 4CYUA 1FEEA 1F2HA 2K1RB 2XY5A 3B4MA 3SIPB 4FNHA 4KGMA 1OPIA 3CO9A 4DFKA 2M7SA 1OY9A 4NASA 4IG0B 1Q81T 4DI6A 2DHGA 3R7NB 4UOGA 4LFCF 4DZDA 1Q8KA 4ATNA 2AYEA 1LWXA 2R2RA 1X0FA 4WZMA 3CDBA 4OZNA 2AGPA 1FRLA 2PGCA 4ZA1A 1RP5A 5KFWA 3PIPQ 2OSRA 4X4RA 1RT3A 2CJAA 4YS2A 1Z4UA 1ZETA 1RJJA 4WE1A 3OTOJ 2Y0BB 2FIUA 5CA5A 5B0EA 4KGXB 2IA6A 5DLGA 3M8QA 4Y2KA 1YJUA 3JSBA 2BW2A 4URQU 2WSCC 4E98A 2MJNA 3VWSA 1YGYA 2CNNB 2VBYA 2F7VA 2CQDA 2VH7A 3IG1B 3KHGA 3BDPA 1Q1KA 3PFEA 3UNGC 2CJKA 1UVIA 2RH3A 2PI4A 4OX9F 1FVSA 4X4NA 4M94A 2ZZMA 3JTOA 4DL7A 3LWMA 4DV3J 2RU9A 2EFQA 2DRDA 3C46A 1CS4A 3GIJA 2UU9F 4DSIA 3DYAA 2EKNA 3BKFA 4RNFA 3FRZA 4ECSA 2D41A 2CJXB 2V9KA 1N88A 3R5CA 1WF0A 1FE0A 4HH1A 2XQCA 3PCOB 2XSJB 1FJGF 5LXYA 1ZOTA 2KZZA 2EWHA 3OFHA 2CA9A 5C24B 1W26A 2XYGB 3QAUA 1F2GA 1DTTB 5KOXA 3DLLQ 1CEZA 1VQSA 1ZBTA 1PG5B 1VRTA 3RB3A 4NI2A 3W5ZA 3UI3A 4UW2A 1N48A 2Z0GA 2JX2A 4UQTA 3W2WB 4Y2IA 4NRUA 2NXCA 3QT6A 4RPFA 3V4IB 2BABA 3ZZPA 1RT4B 1EP4A 1SJ1A 2YKOA 3ISNC 3AXMA 3CC7S 2OPRB 2E5GA 2G0IA 1LW0A 3S1TA 4L72B 4L73A 4IRKA 4JI6F 1TU0B 1HNVB 5HLFA 4OJ1A 2KG1A 3CWJA 1JJCB 3BSCA 3AXKA 2P9GA 2AX0A 1NSAA 3OUYA 1ZM3A 1RXOB 2LDIA 1QD1A 1HNIA 3NS6A 1T7PA 2F40A 2JJ4D 2KRBA 3POTB 3PFOA 2FZCB 4LREA 4KAIA 2AYGA 2DITA 3HMJG 3MEGB 1HWJA 4WP9A 3AD7C 5KG0A 3UD3P 2KDOA 5J1PA 1CJUB 2E1MC 5LJ5Y 3NOCA 4NCBA 1RTZA 2DR7A 2BJ1A 3UDVA 4DCJB 3A12A 2HGNA 5KFLA 3BBFA 2C42A 3SQGB 2W4DA 4ANDA 1G6BA 4CZCA 3A8EA 4DDFA 5KFJA 4DV7F 1BGXT 2ZJQQ 1VQ7S 1RUSA 3UDEA 2ZOFA 4DQRA 1BC6A 2PI5A 3DOKB 5HSPA 5J1NA 5KFPA 2VOPA 4NE9C 4FBUA 2W9AA 2R8JA 4ICLA 3K7RA 1A6LA 3MPYA 1KSPA 3KUHA 3CDAA 2DNQA 4CYUB 1F60B 3H59A 2G1HA 3LGNA 2HQFA 2IM1A 2MKJA 4YHHJ 3BREA 2QA1A 4BCAA 1IBLF 1S99A 1SXLA 4C8OA 1F9FA 5IV3A 1RQ0A 2ZKTA 3W5YA 3G6YA 5FLXY 1RHJB 4C8LA 4BBYA 1VK8A 1F1BB 4K5RA 3T6BA 3K5LA 1F9EB 3V81A 3EVOA 3EZ5A 4CLWA 2YY3A 4CLLA 4J9MA 4ZJOA 1VBYA 2ZH4A 2QL5B 4DJBA 3AJ2A 3KXDA 3AAWB 1SJFA 4CLUA 1RT3B 3AA8A 3RRKA 1Y5LB 3GMGA 1UFWA 4AQYJ 3HK2A 3EWGA 4WE1B 2U1AA 1UL3A 1SIZA 3VAMA 4C0BA 2J0WA 3VAHA 1FFWB 3M8QB 2XMMA 4PPDA 1GH8A 1F0XA 1IXKA 5F8MA 4JI8J 4YB6A 5HL7Q 3K89A 1UZDA 5A2QY 1Q7YT 1MWQA 5KFHA 2CQPA 1WG1A 5KFTA 1L3UA 2E44A 3M4XA 1RTDA 1IM4A 1SJ4P 4LIWA 2F9JA 3R5GA 3HSZA 4RUBA 2F65A 3N6NA 2YKNA 4YR3A 4IKAA 2DNPA 1CS4B 2EBGA 2IM0A 1S6PA 3PJWA 2J6TA 3BJYA 3MR6A 3DYAB 4ZDNA 5IM0A 2OIHA 1T9TA 2H51B 3D6FB 4URSA 4HT7A 2KXFA 2RDJA 2FZKB 5GMDA 4ES2A 3BGLA 2UUCJ 3ETMA 4Y65A 2WSEC 4YR0A 2DEIA 5DO2A 3CIZA 2B9XA 2PE8A 1NPRA 1VRTB 4ILRA 2ACMA 4NI2B 2QFJA 2HHTA 3ITHA 1XK8A 4FF2A 3J7ZT 2QLBB 2ROGA 4CI0B 4NPOA 4DV6F 2HHQA 5KFIA 2MQOA 4NA3A 1EP4B 4NLXA 4DSJA 1RK8A 4Q45A 4Q5VA 2OPSA 5GMKa 1NSQA 8RUCA 3QZ7A 4URGA 1NRKA 1LW0B 1LXJA 3PO5A 1F5AA 4GVLA 5HLFB 1SH3A 3SXLA 4ZVOB 2NLWA 1EJ7L 1CG2A 1H3DA 1UVMA 3OUYB 2E9ZA 2MKHA 1HNIB 1VHIA 3Q2SC 2ZBQA 2NCKL 2C2OB 4G3IA 4DLGA 1WEXA 1XWLA 2V9WA 1YITS 1U24A 4TQSA 5E33A 4B3RJ 2VQFF 2PSZA 2HFUA 3C16A 1NK7A 5F8IA 4K2JA 4UUXA 1M5SA 5ETQA 4IO1A 4O4GA 1KDNA 4NCAA 4CTAA 4ZN1A 3QGHA 3KK1A 2PC6A 1IM6A 2W7PA 3MM8A 4ZPTR 3I0SA 2IYIA 2HBQB 2DPIA 2CZVC 2B8QA 4PAAA 1RA6A 4ER8A 2YNIA 1GQEA 1J5EF 2EXUA 4DR2J 1BQXA 1KQFB 1JLBA 4O23A 3GJQB 3MTJA 2AYBA 1XR5A 2QT7A 1P9YA 1B99A 1RWVB 4M8LA 2BJ7A 2W01A 1UPPA 1WC3A 1N33J 5B09A 3RB4A 2IM3A 2CQ2A 1Q5YA 1MMNA 4V19X 1IKYA 2OD4A 1KC8T 1FCAA 2VFSA 2RSQA 4MIWA 4K0KF 4OYWA 2AEMA 3TVYA 3N01A 1FJEB 3NWGA 2BX6A 1LFPA 6FD1A 3WC2A 3LP0A 1ZM9A 4P2XA 1U6ZA 2H5EA 4WK1A 3BV8A 2Y8YA 2FJXA 3AQOA 1Q16B 4K2XA 4WFZA 5DGAA 1T3OA 2HLUA 3CSKA 5AT1B 3V81B 2GVDA 1S76D 3C3LA 3GR0A 3MCMA 3LF0A 2E5HA 4L76A 4FN5A 3EICA 2DNOA 4DF8A 1WHWA 2KU7A 1URNA 4NXNF 1XIQA 1UETA 2R8HA 1GTEA 1RWOB 4C7QA 4LF7F 4R5PA 2PDAA 2K7KA 2DH8A 3PTWA 1VC0A 4B3MF 4J37A 5D4NA 1IR1A 3UR3C 3U1MA 1KN6A 5HJXA 2VPYB 1P27B 4W92B 2AW0A 3RU0A 3CJ4A 4U8YA 3HHLA 2JEGA 3VAJA 4XK8C 2EG2A 1S9EA 2W24A 1RTDB 1Q7LB 3J7A1 2JFKA 1XR6A 4HL9A 2MJUA 2RJZA 5EWGA 2PO4A 2YKNB 2ZE2A 4K4TA 5IQQA 4QR0A 1S6PB 2OFGX 1VLOA 5IM0B 2V2ZA 1YZ6A 3L3CA 2LLZA 1K73T 1RU2A 2K3KA 2DH7A 1VS3A 4HDHA 2HZCA 4DV4F 1EKSA 1TL5A 1R27B 1P1LA 3B4DA 2OPPA 1SQGA 2PEHA 3GG0A 4ZP8A 1W2IA 2Z30B 1N32J 1MW7A 3PNIA 3D6TB 4ED8A 4CM0A 1ACMB 1KS2A 1QAIA 3IWXA 3TWZA 2GFFA 3ITHB 2VD3A 1TZ0A 1FWPA 1Q5VA 5JUMA 4MH8A 1VBZA 3THPA 2P5VA 3DLKA 1NZAA 2XMTA 2R7RA 2RQKA 2IJRA 3BGFA 1FDAA 1WOPA 2OPSB 3RW7A 3MF5A 3GYXB 3BSNA 3T9NA 1XTZA 3N28A 3FNNA 4R0EA 4TYAA 2JL9A 3IWNC 2GJFA 5C2GA 2C2RA 3BN4A 2Z8QA 1S1WA 3ENVA 4HLBA 2RB7A 5U47A 3CCTA 1WELA 2EFGA 1B0VA 4DUZF 3GSIA 4LVOP 3C16B 3MMAA 4KHMA 2Z56B 3FC9A 2MYFA 5CAAA 1MWZA 1C4CA 4CTAB 3KK1B 3GONA 3MM8B 2LA6A 3I0SB 4IOBA 2DR9A 4QR2A 3HM9A 6FDRA 3T5LA 3RZAA 2YNIB 2I1RA 4P2SA 4C9DA 4RW6A 5LMNJ 1I3OB 1JLBB 2VJVA 3NP5A 5L39A 4PQAA 3MM6B 5A6WA 1R6VA 2XBPA 1UJ5A 3TQEA 3ZZZA 1X7VA 4Y2AA 2C3OA 4AD6A 2YH0A 1NDPA 3T6JA 2WB1D 1IKYB 1LW2A 3C15A 2DNLA 2CWXA 4F0KA 3OTOF 2BQRA 4KE5A 3TA2A 4KJIA 3R6LB 2LXIA 2JWNA 3W65A 3I5BA 4V19J 1PYSB 3LP0B 3V6JA 1GT8A 5KT7A 4AFFA 4KPYA 2CUYA 4OHWA 1HBMA 4CP5A 3BR8A 2QSFA 3UN3A 2W8LA 2LCWA 5FLXU 1X8DA 2IRYA 2Z58B 3DLGA 4UT4A 4PG8A 1HR0J 3S8SA 2JLGA 4N47A 1VQ5S 5KAKA 2C3YA 1GXTA 4RJVA 3T5KA 2GVDB 5GAEI 1O6XA 1F9HA 3HFKA 4MJKA 2AWZA 4QW9A 1EQMA 2NYIA 3IN5A 4DV3F 5DG7A 4KTQA 1YTYA 4F3QA 2WB4A 2UVWA 3P5BP 1UW9A 3VVUA 2RS8A 1H7WA 3R5DA 2DO4A 4AYBD 5A2QU 4N5SA 1K9MT 3A13A 5KFUA 3MUTP 3KUGA 3IM9A 1J5OA 1S59A 2WBRA 4R5PB 3W3SA 3TRGA 3GFZA 2R7SA 1RCOB 3M2UA 3RJMB 2CG4A 2JLFA 4WWSA 2VASA 2HAIA 1Q53A 3LTOA 5ETNA 1ITPA 3NCQA 3LAKA 1WHYA 1FK9A 2DHXA 3P3DA 1IR0A 1S9EB 5ETRA 4ETXA 4DR7J 2DNMA 3NMRA 1HQUA 4OZLA 3MZIA 2Z2MA 3CMAS 2ZE2B 4R0JA 5KFCA 3GP9A 3IXQA 5IT0A 2AV5A 2XHWA 5C7PA 3AJDA 3IBCB 5CYQA 2QA2A 1M1HA 4DF4A 2KYZA 3PXGa 5AE3A 3V2UC 2E1AA 4LJMA 2VHGA 3C8YA 1MMLA 2OPPB 3GIKA 4B3TJ 2B8PA 3MFHA 1FKAF 3M8RA 3EX7B 3GFHA 5FIIA 3HSJA 5C5JA 2QG9B 3OSNA 4NLPA 1NCLA 2W2NP 2BACA 4IH5A 1DLOA 2FC9A 2VPXB 1OYDA 3FSIA 1FRHA 3DLKB 4WP8A 3A8JA 3CJ3A 4PCQA 3K58A 1FERA 1Y0HA 1S57A 1CJVA 3E51A 1IWAA 1HBUA 2BBEA 5KT2A 2H9ZA 2CKWA 4CLTA 3GG1A 2YPYA 1JQGA 1WOSA 2VDIA 2RQMA 1CQMA 2ZH2A 2X3GA 4M5MA 2HVHA 2JFDA 3T1AA 4NLQA 1QJHA 2MGZA 4RZRA 1NBEB 2Y1JA 1S1WB 1FNOA 5C2CA 1LWFA 2XZWA 1O51A 5IZHA 5B0AA 1GMWD 2GQ2A 1T9VA 3MMAB 4KSEB 4F0HA 3M8ZA 3NMAA 2POKA 2BOPA 3TZZA 3ISND 5BR8J 5IC6B 1H72C 4YHHF 5D0HA 4DOZA 1R8AA 3VTIA 3TZXA 6AT1B 3GQCA 2QLFB 2R7WA 3VGUA 4RW6B 2MLYA 3B78A 3MFIA 1R6YA 3MUMP 5JVHQ 3KWMA 1WSVA 1VDHA 3EZOA 4F04B 1LEOA 4DPXA 4OI6A 1QSSA 2M70A 5LMUJ 4IDKA 3M32A 1BXNA 2RIJA 3FRYA 2BJ8A 1KNZA 4ZVSB 5GAHI 3H5YA 1REVB 4AQYF 1SC3B 1LW2B 1FJCA 3C15B 2XYHB 1F3VA 2RUSA 3EM1A 3VAFA 2V4JA 3CCJS 9RUBA 1SKWA 3CJRA 1LWEA 4JI8F 4F7VA 2V94A 1HBMB 2ZUAA 1TK8A 1FXLA 3AFGA 3QNWB 2GQQA 2DK2A 3QJLA 4IH6A 2DGUA 1APSA 4NZ0A 3C14A 3ZZRA 2G2OA 1U09A 2Y1RI 3CULA 3RAQA 2GMHA 3DLHA 4O3NA 2VA3A 4QIWD 3EJMA 5J2MA 5B0CA 2W9CA 2W4PA 5M2PA 1RBAA 4ZLLA 2V4RA 2O5DA 1WI6A 4Y0FA 1Q79A 3PW7A 4ZHRA 3MI7X 4TYBA 1VJQA 3N6MA 3H4DA 2HHSA 1RWKB 2DGTA 2XZDB 4KIAA 1WHXA 2VFUA 1SH0A 5KFDA 3VAGA 2HK2A 1J5OB 1TFYA 2UUCF 4RW4B 3M2UB 4B9NA 4OV6A 1FDBA 2VPZB 5KFMA 1AFIA 3CUNA 3H90A 5KFRA 1FK9B 1VFJA 2DHHA 3I87A 4ZCIA 4A8QA 1TL1A 4MKAA 4PXBA 1U02A 3C66A 1HQUB 1OQ3A 2C2EA 1JMTA 1JLQA 3BYRA 5DZ7A 2ATCB 2FVQA 2J9CA 3V6KA 4EGLA 2DY9A 3JQJA 1RADB 3JQMA 4B3OB 2FLPA 2FD2A 2FVSA 4RNNA 2E1PA 3AY0A 1N5YA 3O5TB 1PAUB 2QSWA 5CYQB 1NDCA 4DL2A 3TZYA 2C28A 4DUYJ 1HWUA 3QGPA 1S49A 4YY3J 2V2KA 2FZGB 4L74A 2XMUA 2E5IA 2EKYA 1DY3A 4LBPA 3BF4A 3LH2S 2UUAJ 1X5TA 2KVIA 2KO1A 1SJQA 4Q43A 4B3RF 4G65A 1DLOB 3KJVA 1FI4A 4ZCLA 3DRSA 2HHHF 4I69A 4OX8A 3MAHA 1PCAA 2HIYA 2AGOA 3KYLA 4W4MA 2VUGA 3ZNJ1 3OR2A 2GMLA 1CJVB 2KT5A 2X51A 2QYCA 1RTJA 1HBUB 4MK9A 2ADCA 3GIIA 3AD9C 3I9ZA 3U1LA 3DDIA 4O3SA 2H54B 1KP6A 4CCHA 4LQ3A 1VQNS 2YKMA 4QYZK 4JV5J 2MZ1A 3VHQA 4WIQA 3HI9A 2MGZB 1HI1A 2W8KA 4CDIA 5HMZA 4PZVA 1U1MA 1LWFB 5JJBA 4R8UA 2Q6BA 2PFFB 1RTHA 3QT5A 5HATA 3GWCA 2DEJA 1N33F 4IFVA 2D9PA 2CJQA 1W2BR 3V6HA 2RDIA 2DBBA 2Y3YA 4LRCA 3PR4A 3M2VA 1H98A 3T1YJ 4C2MA 1ZM2A 4DV0J 4DL5A 4KFBA 2IMOA 1N5TA 5SZTA 3O2IA 2ZD1A 3SI8A 2CG8A 1ZYQA 1J27A 1UVNA 4GKKJ 2AIRB 2AJ2A 2B5JA 2ASYA 4NWBA 2CAJA 5DDOC 3W61A 1X5OA 4FS2A 1FO1A 2AJ1A 4DG1A 4IDKB 3M32B 4DR3J 3MM9A 2FPHX 4C48A 2D69A 4I64A 4ED7A 1YI2S 2N7YA 4A47A 2LXFA 3R7BB 4D3GA 4NOHA 3IS9A 4YP3A 3T9ZA 5B0GA 4F3MA 3HVAA 4LUBA 3ETOA 2V4JB 4EFAC 4DQIA 3G8SA 4ZP7A 1LWEB 2HGMA 3EDQB 4ECUA 1DBDA 4OX6A 2HW3A 3I4HX 4JBCA 1NZ8A 4OZ0A 1TK0A 5IQ6A 2XMAA 1U0SA 3C14B 3FCVA 1S1UA 4CO5A 4P75A 3IBWA 2JSXA 2VFVA 4N77A 5J2MB 2P9EA 2H5JB 2W9CB 1M5HA 4PWDA 3TEGA 4K4WA 5L1IA 1R7IA 4WYWA 3D0GE 1NMEB 1DQAA 3A1YG 3NCPA 4X84A 1SJRA 1FX4A 2BJ9A 4ZHRB 5C25A 4PXCA 3J7YU 2F8MA 4TU8A 2L9DA 2AP6A 3E8OA 4TU7A 1QDUB 1H38A 4PG6A 4OYZA 4B3SJ 3VAIA 4P2FA 1RU1A 2G0CA 1AT1B 3FFIA 4USJC 4CH7A 1Y5NB 3BDEA 1VCTA 2XI2A 1N32F 5E3AA 5GADI 3LPEA 1LOUA 1RTIA 2V4QA 2VBWA 3KHHA 4EZ9A 1D9FA 2XO6A 5KFNA 1TL1B 4MAKA 2ZKUA 2DR6A 1RDRA 1T9YA 3EDRB 4BC7A 5A0YA 1JLQB 2ZDOA 2KFZA 5F9NA 1IKXA 4WJBA 2IC3A 2DGQA 1Y3KA 4NLDA 2GHWA 1FFSB 2APOA 1NK9A 3JB9k 1T11A 2OD6A 1N5YB 4YB1P 2YNGA 3IRXA 2VB6A 1IBKJ 2N7CA 5LJ3Y 1QVGR 1YLXA 3BH6B 5DDPC 4WKYA 3H42A 3KTQA 1ZTWA 2MKSA 2W7AA 1NHUA 1QM9A 3A3NB 4ZJQA 3KJVB 1S9GA 3D1QA 3DRSB 2P8IA 1VISA 1RYSA 3H0PA 5D3GA 4X62J 3ENWA 2FGOA 3OR2B 5I42A 1R31A 2B56A 2CQBA 2GV1A 1KD1T 4X4QA 5KFEA 3QLHA 2ZH9A 5D77A 4G6VB 5LMNF 2J9DE 2YKMB 3MPDA 2RS2A 1FVQA 2BQUA 4KC5A 4RBVA 2VODA 2ABYA 2L3MA 2PIIA 4RX6A 4USIA 4U96A 4C8YA 4N41A 4ELTA 4LQ9A 4R8UB 1RTHB 2VBXA 3R2CJ 5FJ4A 3OJSA 3JAMU 3VZHA 4IFVB 2RRBA 4KBIA 1U8SA 2XTJP 3T5HA 4HHHA 2PFDA 1R43A 2QV6A 2X1FA 3DRRA 3HHLC 5EX3A 2XS5A 3M2VB 2EW9A 3KDNA 2ROEA 4KFBB 2JRSA 3KUEA 3ZTRA 2OMLA 1X9WA 5KT3A 4IOCQ 3JTPA 3FCHA 3R5AA 2ZD1B 3SYZA 5ETKA 5I3UA 1HR0F 5IOLA 3FUYA 5HBMA 2B5JB 1YX2A 4XIUA 2LVWA 4CLPA 4FF1A 3PW4A 2DHSA 1PBAA 3MEDA 1GTHA 4WBFA 2V8DA 4DG1B 1N4LA 4ZITA 5AXMA 1K1QA 5DETA 4GC7A 3MM9B 3CD0A 2ASJA 3NGKA 1X9SA 3RBEA 1U6FA 4ZVHA 2CQ4A 1Q86T 4RU2A 3FVYA 2CPIA 4A8FA 5BJRA 3IS9B 1V3ZA 1T03A 4YDDB 3FBCA 1TMMA 1H2TZ 3SZ2A 4Y2MA 5JXSA 4ECWA 3W5XA 4DQSA 2C2DA 3CMQA 4OYIA 4ZP9A 4RO0A 4F02A 3VGTA 3H2VE 2IIHA 1IBLJ 5HVFA 4LF4J 3VQSA 1S1UB 2BOAA 3VF0B 2R7VA 4KB7A 2LA4A 1I5OB 2EFPA 3NAIA 2P9CA 2I0XA 4DR7F 1UEKA 2KHDA 4PWDB 4U8VA 3Q8YA 2C3UA 1QUVA 2Z4PA 1S6OA 1RHMB 3OQ2A 4I2QA 5C25B 5HANA 4OHYA 4BWJA 5E0OA 2N3LA 3GV7B 4AL7A 4USHA 3H40A 3SCJE 2HVZA 3M2RB 3A8KA 2NQPA 3FFIB 2LXUA 2D3UA 1JNZB 4B3TF 4K4VA 2HAFA 1GK8A 1NPPA 2EPIA 3OW2R 4ID5A 4F2SA
chains in the Genus database with same CATH topology
2HS3A 4LT6A 5GMKa 1M0SA 3QZ7A 1HYSA 3IFEA 4URGA 3DU5A 5EUHA 1NRKA 4RUHA 1LW0B 1TKTA 3D1HA 3K0JA 1SI9A 1TKZB 4KV8B 2PMZD 1LXJA 3O8WA 1UJ4A 1F5AA 1U48A 3PO5A 3AQPA 1E6VA 3SCKE 5HLFB 1SH3A 4RW7A 2JH3A 5G0RA 3Q8SB 4ZPAA 3SXLA 4G1QA 4I67A 3TARA 2GJ2A 2NLWA 4ITSA 5K9FA 5D6GA 3PKYA 1CG2A 5A0YB 3OL7A 3CCES 2M8DB 1QVFR 2HFZA 1H3DA 4HEA9 1UVMA 4ECXA 1E6YB 1SB6A 5IWAF 1IKXB 3OUYB 4OZJA 3O1LA 2E9ZA 2DNYA 2IC3B 2MKHA 1HNIB 3Q2SC 1N8RT 4DQPA 3LUYA 3TUIC 4G3IA 1GX5A 4DLGA 2WOMB 1WEXA 1XWLA 2VG7A 5A8RB 2LECA 2V9WA 1YITS 1R8PA 2IVFB 5IFMA 1U24A 1H6KX 4TQSA 2C3PA 3V4MA 4QIEA 5E33A 5CCMA 3BQ1A 1J2VA 1O5JA 4J9OA 1K0TA 2CQIA 2R2SA 3MPWA 2FHKA 3BO3A 2YNGB 1RT2B 5B7WA 1VQOS 2VQFF 2PSZA 1N36F 5HMWA 3RTVA 4DSEA 4QU7A 1Y5IB 3IRXB 2LMIA 2CPYA 4QJVA 3UWTA 2I8EA 4MYUA 1NK7A 3RBDA 3RW6A 5F8IA 3HHLB 4UUXA 1JKHB 2ZC3A 2HMIA 3HDSA 1VOMA 4B9TA 3D1OA 1M5SA 1R8BA 3QJPA 2DHAA 1WD6A 3TA0A 4IO1A 4O4GA 1RI7A 1WI8A 2QA4G 4NCAA 1U2RA 4A4JA 1NB7A 1CVJA 2BZ2A 4CTAA 3X3UA 3KG4A 3CDEA 3JYTA 3K5NA 1JLCA 3QGHA 4HDGA 2PC6A 3KK1A 3CE8A 3PX6A 2UVVA 3HHNB 4PQUA 5D8HB 2DO0A 2W7PA 2HRYA 2PN6A 1FKOA 2FHJA 3GFXA 3MM8A 3I0SA 4ZPTR 5H9EJ 2IYIA 2V8HA 4WU2A 3DRPA 2DPIA 4L3NA 2CZVC 1DAXA 5IT4A 3KLIA 2JEIA 5KG4A 3GB0A 4WCEQ 1QE1A 5MAOA 1AFJA 1RA6A 5CZVA 1Q8BA 4FZVA 1K1SA 2MMYA 2AJFE 2YNIA 3OHBA 1TAQA 5GVQA 1GQEA 3WBZA 1J5EF 4FF3A 4OLOA 2BVZA 1S9GB 3M8SA 2GQCA 2XNRA 1BQXA 4XPEA 2FY1A 1KQFB 5F3TA 1JLBA 2ZFHA 4ZS6A 3MEKA 4O23A 5KG2A 4ELVA 1N56A 5KFXA 3MTJA 2QA4S 5DQIA 2CJBA 4WFBQ 2AYBA 1XR5A 2QT7A 4NA1A 4Z2XA 3CC2S 5D3GB 4X2BA 3H98A 3HHDA 5BR8F 2KHCA 3HZGA 4WK3A 5M2RA 4WTYA 1GAOA 1T94A 4R25A 5I42B 2OTJS 1HNXF 5IT9Y 4M8LA 3RRGA 2RQ4A 1S77D 1YJTA 2D1CA 3DMJB 2HRUA 2JLEA 3PACA 4Q2LA 2KH9A 4F3OA 5J1EA 4RUCA 4ZOSA 1S1XA 3GILA 3OFGA 3FMWA 3ZZ0A 3SEOA 3MDFA 2EI5A 1FNMA 5B09A 5K8MA 3OLBA 3QLHB 3AB2B 4IO9Q 3RB4A 1NK0A 2IM3A 2CQ2A 2VFTA 1JB0C 1UVJA 1MMNA 4V19X 4RW8B 1IKYA 2OD4A 1RT5B 3QAEA 1KC8T 5K8OA 1FCAA 2VFSA 3TUJC 5KFOA 2RSQA 1N52B 2GIQA 3DOLB 4MIWA 4K0KF 1NJXA 4DR5F 3EYZA 3TVYA 4QWDA 2LEAA 3N01A 1FJEB 1M5KC 3NWGA 4AL5A 2JOQA 1LFPA 6FD1A 4YDXA 3WC2A 3LP1A 3I82A 3LP0A 1ZM9A 3GE9A 1SKSA 1U6ZA 2WONA 3O6QA 2H5EA 2E29A 4WK1A 4PPZA 1L3SA 2IA0A 4A8MP 3G86A 5LMUF 5G4DA 2EK1A 1ZAWA 4JI7F 2FJXA 3AQOA 4C97A 3MUVP 3I5CA 2GIRA 1Q16B 1LK7A 2B9WA 5E5NA 4K2XA 5GAHU 1VHFA 5A8KA 4WFZA 2DCUB 1SIWB 2VG6A 1FXDA 4EBEA 4I7FA 5DGAA 5KFZA 1T3OA 2QRRA 2OAUA 5D4PA 1H2UX 2NZ4A 3RR8A 4Q8EA 1XR7A 4I6AA 3M2RA 2J9EA 2HLUA 2UP1A 4ES1A 2MZTA 3CSKA 1KONA 3V81B 1PGZA 3DRXA 3MM7A 1S76D 3C3LA 3GR0A 1OPZA 2COLA 3KLFA 3LF0A 2KFNA 1TKXB 2FJVA 3VAKA 3DRRB 5CCLA 2RKIA 2W9BA 2E5HA 2R4FA 2DGVA 4FN5A 1FESA 1JXEA 3P49B 2DNOA 1F5BA 4DF8A 4TY8A 3Q8RB 4MTPA 2CQGA 3M6UA 1WHWA 2KU7A 3M8PA 2GHVC 2WSFC 2HS0A 5L1KA 1URNA 5ADZA 2CVEA 4NXNF 5CZXA 4WU3A 1SUQA 4JV1A 3DCAA 3TAQA 3FEXB 2J6UA 1RAJA 4PUOA 4ECQA 4J5OA 1FE4A 4Q44A 3H4BA 3I96A 2XS2A 4KKOA 2QZ8A 5HBMB 3CD6S 2BE2B 4OV1A 4J9PA 1FHTA 3NGDA 1UETA 4JOUA 1KTQA 1DFDA 1JLFA 3L95X 1DTQA 2HNZB 3CCMS 2XY7A 2XB2D 3M6VA 2R8HA 1GTEA 1JJ4A 2NSCA 4C7QA 3T19A 5DDQC 4DL6A 2IVMA 1HHSA 3MEDB 2VPWB 3N0VA 5KFYA 4LF7F 4R5PA 2PDAA 1KR4A 2K7KA 2DH8A 4UOCA 1VC0A 5I3QA 4J37A 4B3MF 1HWKA 1YSJA 4HVZA 3MTKA 2CQ1A 5D4NA 2CVIA 4KQZA 5CHCB 4KRWA 3UR3C 3U1MA 4RW9A 1KN6A 3M9NB 2ZH3A 2VPYB 4FVCA 2NR0A 1N0VC 2HQ3A 1RT2A 1P27B 3BGRB 1L3TA 3PEHA 2UUBF 2GMJA 4W92B 1Q8IA 2PD1A 4U6PA 2ZHAA 2EFNA 2AW0A 3TUZC 1JLGB 2FJDB 3DNCA 3RU0A 2BR0A 3CJ4A 4E0DA 4DN9A 2RQCA 2XC9A 4DSFA 5J2PB 3OXLA 3HHLA 3S7RA 2JEGA 1TAUA 1YQHA 1SQEA 3VAJA 1T03B 2RILA 4XK8C 2EG2A 1C1BB 1CC8A 1X4FA 4EUVA 1S9EA 3SSQA 2W24A 1DHMA 4CQ1A 3NRBA 2R2UA 1RTDB 1Q7LB 3DDKA 3J7A1 2JFKA 2LEBA 1XR6A 4HL9A 1IJFB 2MJUA 2CPHA 2RJZA 4LSNB 5E3RA 4O3OA 5ITHA 1YJRA 3K5OA 4OQJA 2NPFA 5EWGA 2W7OA 3TO8A 3JSMA 1G7CB 5M2UA 2PO4A 1XMBA 3M05A 3LW5C 2YKNB 3FSXA 2ZE2A 4K4TA 3Q2TC 3X1LB 5IQQA 5DQHA 4RKUC 4Z37A 1OWXA 2B9YA 3KLHB 1YJVA 4QR0A 1JNRB 4OZ5A 1S6PB 5AXNA 4B9UA 2XLJA 3MMCA 2OFGX 3K5PA 4WZQA 3CT9A 1X4DA 3G6XA 4F50A 4ERDA 1JWWA 1TL3A 5AE2A 3ZC4A 5KTQA 5IM0B 2BV3A 2X1BA 4Q0BA 1HWLA 3KYLA 2V0NA 4XAKA 3J7YI 1U25A 1O0PA 2LLZA 3L3CA 1K73T 2ATLA 4AUKA 1B64A 2LKZA 2E5LF 2K3KA 2DH7A 5LT5A 3BO4A 3CTRA 2Y1IA 2J0QD 1VS3A 4HDHA 2JVOA 2HZCA 5SUHA 4TQRA 2PT0A 4DV4F 1SJ3P 3PEJA 4ILLA 1TL5A 1R27B 3C2PA 1P1LA 3B4DA 4M1KA 1VQ6S 2OPPA 2PEHA 3GG0A 1S6QA 4ZP8A 1MROB 4EZ6A 4QR1A 1W2IA 1FF2A 4ED0A 5KG1A 1MW7A 4NYOA 3PNIA 4I2QB 2ZM6F 2XGPA 3ISZA 1KQGB 3DLEA 3I55S 4ED8A 1T8EA 4X65F 3ONQA 3H5XA 4QYZJ 1KS2A 1L3VA 3DLGB 1QAIA 3KNAA 3IWXA 2HPUA 1KLMB 2GFFA 3M30A 3ITHB 3WZ0A 3IO1A 2VD3A 3NBPB 4JI1F 1TZ0A 2O3DA 3CIMA 4IOAQ 2CYYA 5JUMA 4MH8A 1VBZA 1OIAA 1XN9A 4DUYF 5H1SV 4HKQA 3THPA 5E41A 4J9RA 2P5VA 4YY3F 4K4YA 1HPZA 2E9RX 2HNYA 5F8NA 2ZITA 1Y3JA 3IC1A 3PM9A