2CPHA

Solution structure of the c-terminal rna recognition motif of hypothetical rna-binding protein rbm19
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
107
structure length
107
Chain Sequence
GSSGSSGQVPKKQTTSKILVRNIPFQANQREIRELFSTFGELKTVRLPKKMTGTGAHRGFGFVDFITKQDAKKAFNALCHSTHLYGRRLVLEWADSEVTVQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the C-terminal RNA recognition motif of hypothetical RNA-binding protein RBM19
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords RNA binding motif protein 19
total genus 11
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cphA01
2DISA 1UW4A 2K3KA 5DM6Q 3H2UB 3LQVA 3CD6S 5GAEU 3EX7B 1FT8A 2RU3A 2DO0A 1WHWA 2CQ1A 2RS2A 3CCES 1FJ7A 1WG4A 3CCLS 1KQSR 3NS6A 1HA1A 1YJNS 1M90T 1JJ2R 3CMAS 1U1OA 2MZJA 1KOOA 2DNLA 2CQ2A 2KG0A 2B0GA 1YJWS 3HHNB 3UD4P 3N9UC 1N54B 3MD1A 1Q7YT 2MKJA 1NU4A 2KXFA 3P3DA 2DGOA 1WG5A 2CQ0A 2M4MA 3MUVP 3CULA 3NNAA 2E5GA 2MQMA 3UD3P 3G71S 2MZRA 4M5DB 1VC6A 2VODA 3Q2TC 2M8HA 3VAMA 4TLQA 2ADBA 5LJ3Y 2KYXA 1ZZFA 3ZZYA 4IOAQ 4F25A 1KD1T 2X1BA 2M7SA 1AUDA 2KRRA 4QQBA 2XSFA 1M5PC 2CQHA 1X5PA 1KOHA 4UQTA 1WEYA 3VAGA 5HL7Q 2VOPA 2CPIA 3V4MA 2DNMA 3U1MA 1M5VC 3ZZZA 2JRSA 1WELA 2CQDA 5DDRC 1VQOS 2MMYA 5GAHU 2MY7A 1YWXA 2E5HA 1F9FA 4CQ1A 4LIRA 2KT5A 4WF9Q 2ADCA 3TYTA 4C4WA 2FC9A 1R8HA 1HL6A 2CPDA 1M5KC 2CPFA 2GO9A 1R8PA 1WHYA 1VQNS 1VQPS 3TP2A 3R1LA 3PIPQ 2L41A 5IFMA 5HO4A 3H2VE 3CCQS 2DNPA 2XNRA 1VQ5S 5DDOC 2U1AA 3MDFA 3ULHA 3UCUP 1W2BR 2CPHA 2MGZB 4OZ1A 5FJ4A 1D8ZA 2DNYA 1CVJA 4WCEQ 1ZZNA 2DGSA 2XNQA 4PR6A 1UAWA 1N8RT 1XN9A 5LXYA 2BZ2A 4YUDA 1VQLS 2RT3A 3THPA 2DGWA 3CCUS 2HGNA 3FEYB 2DNRA 1WTBA 2AYGA 2KRBA 1G2EA 3BO4A 2XS5A 1X4DA 3G4SS 3FEXB 3G8SA 4BS2A 5GMKa 3VALA 2WBRA 2L9WA 2NZ4A 1ZH5A 3IRWP 1U2FA 2CQPA 4LJMA 2G4BA 2VONA 2DK2A 1JJHA 4Y00A 3EGZA 2LEAA 4UY8T 3G9CA 1WF1A 5IM0A 3CCRS 2DHSA 2LKZA 3CTRA 3CXCR 5GAGU 1PO6A 1SJFA 3UE2A 1WG1A 1FO1A 3BO3A 4ZKAA 2CQCA 2KFYA 1IQTA 3CUNA 2MZ1A 1X4AA 2KG1A 2MQQA 2DIVA 2G1DA 1VC0A 3EGNA 2MJUA 2JVOA 2KHCA 2MKCA 2AYBA 1D9AA 3S6EA 3OW2R 4RU2A 2N3LA 4WIIA 4ERDA 4A8XA 2KI2A 2MB0B 3LPYA 4FXWA 2CPXA 2MQLA 1VQ6S 2DGUA 2VOOA 2OTLS 2DNOA 2CPEA 1X4EA 1X4CA 3BS9A 3CCSS 1WI8A 2MSSA 1FJEB 1WWHA 5H1SV 2KM8B 3CC4S 1SJ3P 4FXVA 2YTCA 2DH9A 2YH0A 3CPWR 3MD3A 2LXIA 2DNQA 2QEXS 4F26A 2DGVA 2N7CA 3U1LA 1SXLA 5DDPC 1U1RA 4W90B 5GVQA 1QVGR 2FPHX 4EGLA 2Q79A 2MPUA 2D9OA 2J8AA 2M88A 4QPTA 1VQ8S 2V94A 3SXLA 1X0FA 5IM0B 1U6BA 4J5OA 2CPYA 3HI9A 5ITHA 5DETA 3PIOQ 1A9NB 2E44A 3CMES 3TO8A 1WF0A 5LSLA 5MLCV 2I2YA 1WHVA 2M52A 2CQBA 4P6QA 2MKIA 1OO0B 2X1GA 2YKAA 4V19X 1JMTA 3BEGB 3S8SA 4PRFA 1U1NA 1YIJS 1SJ4P 1YI2S 1FXLA 3RW7A 3MI7X 1Q82T 2HYIB 2KXNB 3SDEB 4W92B 1SJRA 1DZ5A 1K8AT 2J0SD 3MXHP 1U1KA 4YOEA 4IOCQ 1H2TZ 2EK1A 3DXBA 3S01A 1WHXA 2YH1A 2MHNA 2CQ3A 1OIAA 1L3KA 2K8GA 1P1TA 3P5TL 5D77A 4TU7A 1HD0A 2U2FA 1WI6A 3G96A 2I38A 1K73T 5GADU 3VAFA 3NNCA 2SXLA 1QVFR 2D9PA 2KN4A 3CCJS 2MKHA 2M2BA 2KVIA 1X5TA 2RUGA 4TU8A 2OTJS 1RKJA 2O3DA 3S7RA 4IUFA 4U67Q 2DO4A 2DIUA 1YJ9S 2MKSA 3K0JA 2KXHA 2JX2A 2CQGA 2DGTA 4LMZA 2G0CA 3US5A 3SDEA 3UCGA 2F9JA 3B4MA 2F3JA 2MKKA 1QM9A 2LCWA 2CPJA 2KH9A 2DB1A 1Q86T 2N3OA 1X4HA 5LJ5Y 3J7YU 2RRAA 2DHGA 4WFNQ 4QU6A 3DLLQ 1H2UX 1P27B 1M5OC 2CJKA 3UCZP 2MQPA 1VQKS 2N82B 3CCVS 2M0GB 2DH7A 1PGZA 2M70A 2FC8A 1VQ4S 1RK8A 1X4FA 3VAJA 2J76E 4PKDB 1O0PA 2LQ5A 2MZTA 3G6ES 3I55S 2DITA 3MUMP 1FNXH 5JVHQ 1VBYA 3VF0B 1VQ7S 2DNGA 4CH1A 1YITS 1VBXA 1H6KX 2RS8A 2J0QD 2AD9A 3CF5Q 2PEHA 2MY8A 2KU7A 5CXTA 1VBZA 1K9MT 1U1PA 4WFAQ 1VQ9S 2CQ4A 5CA5A 1NJIT 3BO2A 2ZJPQ 1OPIA 1BY9A 3L3CA 4YB1P 2DHXA 2UP1A 1S72S 3P49B 1SJQA 2E5JA 1A7GE 1OWXA 1X4GA 2F9DA 1H2VZ 3I56S 1YHQS 4WKRA 2DGXA 2L08A 1UFWA 2LEBA 2XS2A 3Q2SC 2ERRA 3SMZA 2AYMA 3NNHA 2MJNA 2OIHA 3MOJB 2MXYA 2RNEA 3D2WA 2LA4A 3R1HA 2MZSA 1NO8A 2GHPA 2DNKA 5LXRA 3VAKA 2OSQA 1VC5A 1JJ4A 3VAHA 2LYVA 2M9KA 2QA4S 3UWTA 4IO9Q 5JVGQ 1U1MA 4C7QA 1FHTA 3J7ZT 2NLWA 2ZJQQ 2OJ3A 1Q81T 2RRBA 5BJRA 3CC2S 1DRZA 2RQ4A 1DBDA 4ED5A 2HVZA 5D78A 2A3JA 2HGMA 2E5IA 2JWNA 2LMIA 2YWKA 3B4DA 2DH8A 4WFBQ 3MURP 2DNHA 2M8DB 5EN1A 2CQIA 3P6YC 2LXUA 5DDQC 2JVRA 1UP1A 3R27A 2CPZA 4OZ0A 1U1QA 5CYJA 2XS7A 1KC8T 3G8TA 2AYEA 2XB2D 1S79A 2X1AA 2D3OR 3CC7S 4CH0S 1X4BA 1M1KT 2EVZA 2HZCA 2MGZA 2FY1A 2RQCA 2MYFA 2KM8C 3JB9k 3NS5A 4QU7A 2BOPA 2PE8A 2ZJRQ 1U6FA 2HGLA 2RVJA 2MZQA 1X5SA 1VQMS 2QFJA 2DNZA 1N52B 2FHOB 3CCMS 4C0OC 2MQNA 3IWNC 4F02A 1WEZA 2MQOA 4CIOA 3THTA 2LECA 2DNNA 1HD1A 1B7FA 4TU9A 3RW6A 1U1LA 1WF2A 2X1FA 1X5OA 1WEXA 4Z2XA 2OSRA 1DHMA 1URNA 5IQQA 1FJCA 1N88A 2MSTA 3NMRA 1YTYA 5LSOA 2LA6A 4Y0FA 3MUTP 2DGQA 3VAIA 2DHAA 5DM7Q 2EK6A
chains in the Genus database with same CATH superfamily
3DRXA 1N5VA 1UW4A 4DV0F 3T1HJ 3L7OA 5ETNA 3QFWA 4CO2A 4ED4A 2WK4A 3JS9A 4KGMA 4TNOA 2K7KA 2RQMA 3HHLC 2DY9A 5G0RB 3OL6A 3F73A 5LMNF 2H3EB 2VG6A 4FNIA 2W2PP 2GFFA 1NB2A 1FVSA 1KFDA 2G1HA 3W1YC 3OTOF 1HNXJ 2ZBIA 3CD6S 4A8FA 5D0GA 3TUIC 3EX7B 1FT8A 1VLOA 2B6AA 4DR1F 3K17A 1RT7B 2DO0A 4J9MA 3DRPB 3LUYA 2WONB 4WWSA 4P74A 2OGUA 4KPYA 4QWBA 4OZNA 1YJRA 2QL9B 2CZ4A 1FJ7A 3E01A 5C42A 3K5PA 1WG4A 2DEIA 3CW2C 3I5CA 5HROA 2BQUA 1KQSR 3V6DA 1JK9B 4NXNJ 1N5SA 4OHVA 1CBKA 4LFCF 3TUPA 1M90T 1SL1A 4G3IA 2DNLA 2CQ2A 3BYPA 2KG0A 1UJ4A 1FCAA 4R5PB 1YJWS 1N54B 3CJQA 3MD1A 4GVBB 1JLEA 2MKJA 5C2CA 3P3DA 4Q5VA 2V4JA 1WG5A 2FD2A 2R7OA 2ZVIA 5GMEA 4BDPA 4KIAA 4JI1F 4JYAF 1S6PB 2XI2A 4B9NA 4MKYA 1JKHA 2D3O1 1NBEB 5AE2A 1DQAA 5KFLA 2Z57B 3PJXA 3C6UB 1D0EA 1U02A 4GVBA 2IM1A 4NLTA 2M5YA 2R7QA 3UD3P 2WVDA 2V34A 4ECXA 3I5BA 3GTYX 1HMVA 2H5JB 2IRYA 3Q0AA 4DFKA 1N34F 4LF4J 3V81B 3SCKE 1O6XA 4B08A 2MZRA 3M7VA 4YHHF 1VC6A 2VODA 1FEHA 1RQ0A 4UF4A 1PYTA 1T11A 2ADBA 2NPIA 3DN9A 1KONA 1ZZFA 2KYXA 1IR2A 2RSQA 4KGXB 1T03A 2E9TA 2X1BA 4B9VA 2KJWA 2YNIB 2EC0A 4ID5B 4E98A 3W2WA 2RF2B 4OZ3A 4CLTA 4FPRA 4HI2A 1Q95G 1M5PC 2JNJA 4C2MA 3M8WA 3OFFA 1KLNA 3NG8A 5KG2A 5DZ6A 1RHJB 2HK3A 1FFWB 3GJTB 4RW4A 1YBAA 2IM3A 2C42A 2I1RA 2HNZB 3M2RA 1GMUA 1SQGA 2LXFA 4IFYB 2VOPA 1MMDA 2DNMA 3U1MA 3M30B 4LF9F 1SIWB 3D1HA 2JRSA 3N79A 1V3RA 2Q3PA 2CQDA 3Q8VA 3SFGA 4WK1A 1GXUA 4J9KA 1WC3A 4XDCA 4QWEA 1FE4A 1WOSA 2E5HA 2VDIA 1S0VA 1F9FA 3CB4A 4ANEA 3RG6A 3M8PB 3UD5A 2JLFA 1NUEA 4BC7A 3T9NA 1U26A 2VJUA 3PXGa 2VA2A 1WUUA 3DLBA 4PG8A 1CS4B 2D7SA 5J2MA 3D0GE 3RZAA 3ENWA 1WHYA 3K8VA 3NGSA 1FJGJ 4NLXA 5KFAA 1CG2A 3MM9A 1JKHB 2HBZB 3DI6B 3PIPQ 5DQGA 1S6PA 2I9SA 2DNPA 2V4JB 4LFAJ 5MAOA 1VQ5S 1J27A 4DEZA 2WVFA 2D41A 2CDQA 4DG1A 2OAUA 3ULHA 5A2QU 2B3TB 4UQGA 4F2SA 4I69A 1FNMA 3FEZA 1VRTB 1W2BR 2MGZB 4G1QA 3BGOP 4L73A 1DTQB 4OZ1A 3WC2A 3DNCA 4B9MA 4MKVA 1D8ZA 3KK2A 4HH1A 4WZMA 2H5EA 1RT4B 3M8ZA 3GG0A 5A76A 3R7BB 5DO2A 1FRJA 3KLEA 1N8RT 1XN9A 2MTLA 2HK2A 2CADA 2Z8QA 3EZOA 4K2JA 1VQLS 2J6SA 4DQIA 2HGNA 1HBUB 5B0FA 3OL7A 3FEYB 2AYGA 2KRBA 1G2EA 4I7FB 4BHQA 1X4DA 3TAMB 5CYQA 3NOGA 3G4SS 4K4WA 3GJQB 1YBTA 4J9RA 4TYBA 3G8SA 2OI2A 2CNOB 4BS2A 4KYZA 2EFNA 3DGVA 3SCJE 3VCDA 2HBYB 3FVYA 4X66F 4A8MP 4NE9C 5KFIA 1FKPA 3GCXP 2NZ4A 1ZH5A 2O01C 3EGWB 4NLVA 4OHXA 3IRWP 1HPZA 2M3DA 4YB7A 3JSMA 1LNQA 5KFHA 5I3UA 3M8YA 3QNWB 3CDUA 3GYGA 2ZFHA 1S9FA 1NZAA 4P7VA 1SH2A 1UZHA 3CDAA 4ZJLA 3BSCA 2FVPA 1F0XA 3KUHA 5KFSA 3AQOA 3JYTA 2C2RA 2QSFA 4IRCA 3CCRS 4NLRA 1JLAA 1IWAA 4ECZA 1H74A 3J81j 1HFEL 2E9RX 1XC9A 3L95X 2LLZA 1JLQA 3DLJA 4RPFA 3H42A 1O8BA 4Y28C 4CDIA 1AZSB 1R89A 5HJXA 3OJUA 4LF9J 1WG1A 2HS3A 3MR7A 3PM9A 4K4VA 2CIMA 2CQCA 1N48A 3ZZRA 3PKMA 4YR0A 3DLHA 3WIUA 1Q5YA 2XWYA 1S4FA 3M4XA 2FZKB 3ONQA 2XC9A 1XR5A 3TANA 4I1TA 4WU3A 2MQQA 2DIVA 1C0UB 1WD6A 1CC8A 3GIJA 2W25A 3NP5A 3K5NA 3J7A1 4DSEA 3KUGA 2QYGA 2G1DA 1TKXA 2MJUA 1JLFB 4J9LA 2KHCA 4HTJA 2WBMA 3TVYA 2AYBA 2J0XA 1R7IA 3CJSA 3K2YA 4ED3A 1XR7A 2C2EA 4ZVOB 1U45A 2UUAF 4I56A 2IC3B 4LSNB 1TU0B 3FGVA 1LKZA 2N3LA 2R7SA 4QIVA 3BKTA 4CYUA 3JAMU 1V3SA 2ZKUA 4ECWA 4DSLA 4A8YA 1WKJA 3AFGA 1RAAB 2MB0B 2CPXA 3FMBA 3C8YA 4P75A 1RLDA 3MEGB 2ZVSA 2DNOA 1TKTA 3AY0A 3RRKA 1X4EA 1X4CA 4NLDA 5H9FJ 4FYVB 4DFMA 1XK8A 1KWMA 4AXJA 3BS9A 1WI8A 3EJMA 1GXTA 1C1BB 2APOA 4HDGA 1HNIA 2VHGA 4K4TA 3KHRA 4B3SF 3T1HF 2OFGX 2DH9A 2HIYA 3SQGA 1G3OA 4LBIA 4OX9F 1R0BG 4KKOB 1CLFA 1S6QB 2JLGA 3ENAA 4URQU 2BVZA 4ZCKA 4W90B 2C22A 2EKYA 1P1LA 1TAQA 4LF4F 1RBLA 1QDUB 2KDOA 2ATCB 3I4PA 4ITSA 5B0GA 3D0IE 2BW7A 3I4HX 4NYPA 1BQXA 2KFZA 4LVOP 1XR6A 1HQUB 5FIIA 3HVTB 2YXLA 4WPAA 2YKPA 4MFBB 1BXNA 1KKHA 3R2CJ 2D9OA 1EARA 1UWBB 4PCQA 1YKWA 4S0MA 1AA1B 4LFCJ 4FPIA 3EZUA 4YEAA 2XULA 2MLYA 3PNIA 2XI3A 4J5OA 2CPYA 4ZLPA 5J2QB 5C24A 3TOQA 3HI9A 5IV4A 4NMLA 5HMXA 1WC5A 1A9NB 2H51B 1F3FA 4OI0A 1KLMB 2OEMA 3FSXA 3NNCA 4BWMA 4F7VA 4NLQA 1MN9A 1WF0A 3MPVA 5F9NA 1L3TA 4Q0BB 3A4TA 1CS4A 2QN6B 4WP8A 2M52A 1N5TA 1KQFB 2BE2A 4U7UK 4JI7J 5HBMB 3WDOA 4DR5F 5LOQA 1OO0B 4CO3A 4UT4A 1JMTA 4LF8F 1RHUB 3HD1A 3BJYA 2FHKA 2EFOA 4QW8A 1BLUA 3RW7A 1J5OB 1Q82T 5E2QA 2KT3A 5BXIA 5IWAF 2YNFB 5KFVA 2HPUA 1VRQC 3QT7A 3T5LA 3DOKB 4HR2A 4ID5A 4ED1A 4B3OB 2OPSB 5E3QA 4NLWA 1VOMA 1RKIA 4MYTA 1U1KA 2CWXA 2UV8A 1WTFA 3LF0A 3MEEA 4P7TA 3MEDA 3H20A 3FJ2A 3W5XA 3VGUA 3QZ7A 1RUSA 3BGFA 1VDHA 5D0RA 2DKOB 1HLWA 3WHIA 2VICA 2AJQA 2AU0A 3DXBA 3V81A 5D6GA 4AT1B 2I6WA 5EHHA 3CJ2A 3H59A 3P5TL 1EETA 1HD0A 3LH2S 3C6UA 4TU7A 1UWAA 3JTNA 4A8KA 5BYQA 1W26A 2K7JA 2QO3A 3D6TB 1P9YA 3VAFA 1YZ7A 4F8RA 2MKHA 4IDKA 3HT3A 2M2BA 2EW9A 2ZH2A 3AB2B 3K0JA 5SZTA 1IKXA 1D9DA 4DV2J 4OJ3A 4TU8A 4O44B 1HWIA 2PGCA 3DM2B 2A18A 4LF5F 4PYDA 1YQHA 3EYZA 4IDKB 5E3CA 3MMCB 1LWXA 1HBOB 3T9ZA 4X65F 3DOMB 1W7WA 2VPXB 1FK9B 2XYHB 2LDIA 2ZITA 4GRSA 2JX2A 1YJUA 3BBFA 3ITHA 3LP2A 4LR9A 1JLEB 1WORA 2G0CA 1GT8A 5KAKA 2Q1LA 3US5A 2KVQE 3QGPA 3EGVA 5ETVA 4R5PA 2F9JA 2BOAA 4ZVFA 1S6UA 3B4MA 2F3JA 2ABYA 2BX6A 2MKKA 3KHGA 3W63A 4IOBA 4N7TA 1NHUA 4NCAA 1HW9A 2XTJP 2KB2A 1WSVA 5K20B 5HROB 2LCWA 2AT1B 2B7CB 1IWGA 4FF4A 5I4MA 5G0RA 1Q86T 1HR0F 1B70B 2Z2YB 4YB6A 2WONA 2D69A 3FMWA 1YBUA 4LUBA 3DYAA 4RX6A 4U9RA 3JTPA 4OI6A 5ETMA 4F3OA 2E9ZA 4B3OA 1WKLA 1AW0A 1RISA 4JI8J 2KKHA 1M5OC 4DX6A 4B3RF 3BSNA 4Z7YA 3F56A 3CCVS 2M0GB 2NYHA 3QAUA 1HHQA 1PGZA 4DS5A 2M70A 4J91A 1T9XA 3NLCA 4UUXA 2ZD1A 4P2MA 3NAHA 5AE3A 2IJFA 1MU2B 2J76E 2OEJA 2OPPA 5JMNA 1AT1B 5LM7E 1IKYA 3W3SA 5IZHA 1O0PA 2FQQB 2MZTA 2ROPA 3KJNB 4A47A 3K58A 2BEFA 3H2LA 1LWCB 3R6GB 1TKXB 4HYKA 5CH7B 3QSYB 4XK8C 4DPOA 2RDJA 2FB0A 4LSLB 3EMTA 1VQ7S 3QJLA 3DDIA 3ZFVA 4A8SA 1A0OB 5J1PA 1JLBA 3FCWA 4DN0A 1BQMA 2E7WA 2I0XA 2BJDA 2AV5A 2PEHA 3MCOA 4U8YA 1VBZA 3M2UB 3PX4A 5GMDA 3OR2A 1HHSA 3HVTA 4YMEA 4H4OB 4USTA 2RHSB 5DZ7A 4WFAQ 2LEPA 2W2NP 4JV5F 1FD2A 2HQGA 3C16A 3PRDA 1FFSB 4DDFA 2CQ4A 4KGVB 4ICLB 4AFFA 1RAOA 4K0KJ 3QGIA 2W2MP 4WIQA 1SL0A 2AWZA 3J7YI 4B9SA 4YDDB 4RLEA 1OPZA 3L3CA 1FRXA 5AXLA 1OSDA 3IM8A 5F8GA 5EWEA 1UJ6A 3DU6A 3SSRA 3DDKA 4ECVA 4ZIVA 3MCMA 1NJZA 1RWXB 2E5JA 1UFKA 3HJVA 1MWYA 3JSMB 2Y0SD 3PRBA 4JI3J 3TAPA 2F9DA 4CNZA 3IS9B 2DTJA 1H2VZ 2UVWA 1JXEA 3D3BJ 4A48A 4LF1A 2PD1A 3ZTRA 3I0SB 4WJBA 3Q2SC 2HNDA 1PKUA 3MEGA 3GV8B 3PG9A 4JUZA 3MMBB 2OIHA 5K9FA 1FEEA 2ZUAA 5B0DA 2F40A 2MXYA 2LA4A 1TVRB 2HS0A 3Q23A 2MZSA 3D3CJ 3ILIA 1BQNA 1AYEA 1NO8A 3R1HA 1SKWA 1DJ0A 4C8MA 4QYZJ 2UVVA 2PSZA 1RYRA 4OQJA 2FLPA 3C16B 2CYYA 1GTHA 1OY9A 1BWVA 2E7VA 4F0KA 2VBYA 4DV0J 2VQEJ 2V8PA 3OHBA 2RD5C 1RYSA 4H4OA 1NDPA 3VAHA 4NZ6A 2CDRB 2W4CA 3EM1A 2M9KA 4ES2A 2QA4S 4RNMA 1VRTA 4C7QA 3HHDA 5FDLA 2NLWA 3ZZUA 3TI0A 2IIHA 3P4UB 1IUJA 2GVZB 3QMQA 2ZOGA 1DRZA 4K4XA 4GKJF 1NKEA 4Q2MA 4FKYA 4OZ2A 2HQ3A 3H8YA 4KC5A 2MLXA 1TV6B 1U0SA 4OFZA 1F5BA 3PJ9A 1F5CA 2E5IA 1NDLA 2DCUB 2YX1A 4RUCA 2IRUA 3OL9A 2WSFC 4OJ1A 2CUYA 3BKFA 2UU9F 4F4YA 3MURP 2DNHA 2XHCA 4NZ0A 3VR1A 4PG6A 2VB6A 3OXLA 2CXEA 5F8MA 3U02A 2J7KA 3NCRA 2DR5A 4B9TA 4GKKJ 5IT4A 4F0HA 2IMOA 5DDQC 1IKVA 3TX0A 1UP1A 5CHCB 3CDEA 2RILA 3DRYA 4OZ0A 5IOLA 1NK8A 1Q16B 4RNHA 3J81Y 2R7XA 4DPTA 1XJWB 3IBCB 1FERA 5CD4A 2PA3A 4BWJA 4X4OA 3PO5A 3A3OB 5CYJA 3JXOA 1U09A 2CZ9A 2YKMA 4H4KC 1KC8T 5DS7A 3PJWA 2X1AA 3CC7S 5HJYA 4HDHA 3OVSA 4GO5X 2R4FA 1FX2A 2Y0BB 2CA9A 2E5LJ 2JEGA 4I64A 1TV6A 1UL3A 3FSIA 4NLYA 3OSPA 2MYFA 3M6VA 4Y34A 5T14A 2VPZB 3AOAA 3JB9k 4YY3F 2BOPA 1TL3A 3LA0A 2NCKL 2YNIA 4FYYB 1U8WA 2MZQA 4QIEA 1OY8A 1X5SA 3NAIA 4KHMA 4EO8A 2HLTA 3CJ4A 2GVDA 2OLWA 4UOHA 2ZC4A 2B43A 4N47A 2MQNA 4F02A 1S1WA 4XAKA 4ZP7A 2ZZNA 1RT3A 2A6MA 3MMCA 4LFBF 3THTA 3ZXWA 4K4UA 5IT9Y 3IO1A 1DLOA 2DNNA 2UXBJ 1HD1A 2Y9HA 4ILMA 2FJEB 2X1FA 1BQNB 1X5OA 1Q78A 4OHWA 2BKOA 2OSRA 3KWMA 4TY9A 3NS7B 2KTQA 3VGSA 3BGUA 1KR4A 2GAGC 2RH3A 1RU2A 1V6HA 3BSAA 3FCHA 4IH6A 1GK8A 3JQMA 4KSEB 4OIXA 5IQQA 3SCIE 2CAJA 4N76A 2HVIA 5D15A 2HEKA 2OP5A 5DJBA 2GMHA 2HNDB 5LSOA 1VIXA 2FZGB 1RACB 3I0SA 2DGQA 2VL1A 3VAIA 1AUSL 2DHAA 4UY85 1E6YB 2EK6A 1UPPA 3KNGA 3J7Z5 1REVA 4L74A 1RT6B 1LEOA 4NA1A 1M1HA 5H9EJ 4ZPWR 3DFEA 3MTJA 1F1BB 4URGA 4GVLA 4Q2LA 4LRFA 3MEDB 2J9CA 5ETRA 5KFUA 2F1FA 3GIRA 5GAEU 2BYCA 2NSBA 3C14B 3CNQP 4F4WA 2EFVA 2BJ3A 1C1CA 3FFIA 1WHWA 2CQ1A 1RAIB 4ZVPB 4JI7F 3BQ1A 2VG6B 4JI5F 5AXNA 1AFIA 2DRBA 3CCLS 4DV1F 3TZZA 3BZQA 5L1KA 4DS4A 2A2DA 2FJWA 3CJ3A 3AA9A 5D3GA 1RAJA 2UV8G 2HS4A 3CMAS 1LW2B 2MZJA 5B0AA 3W8GA 5JJBA 4EFAC 1Z4UA 3N9UC 3QIPA 3Q86A 3HZEA 5F3ZA 5IQ6A 4C48A 5KTQA 5KT6A 2ZHAA 2UUBJ 2Q43A 2PFDA 2YPZA 3G2XA 3OTCA 5M2PA 2C2MB 5J2QA 2BJ7A 1S7HA 2PDAA 2E5GA 1FRKA 5BR8J 1UVNA 1HMVB 2MQMA 3PEJA 1RI7A 2JZ5A 1WJ9A 2NXCA 2LQ8A 3OD2A 1ITPA 1R6VA 1UWBA 3I82A 4ECSA 1UVKA 4JI6J 3PYGA 5DG8A 3PCOB 2ZZTA 2J6TA 3W9HA 3WX4A 1IM6A 2HHPA 2WVBA 2XZWA 3VAMA 4I2QB 2CRLA 3B54A 2QG9B 3AH6A 4JI5J 2KHDA 3HHKA 1R0CB 3NWRA 3P45B 1B7YB 3ZTPA 1XMBA 2DBBA 1KD1T 2ZBPA 1BHNA 1LQ9A 4ANDA 1MG7A 2VKZG 1URRA 1RGVA 2KRRA 4N8NA 4CNYA 2QRRA 3PYDA 1MWZA 3KG4A 1XMOF 2WAQD 4GMKA 1KBRA 4DQQA 2XBPA 4LF5J 2IMWP 4CLLA 3FK4A 2OUGA 4C8OA 2AEJA 3M1VB 4FP9A 2EG1A 2HHHJ 1WEYA 4N56A 3CJTA 2UUWA 3MMAA 5K5MA 3FRZA 3MAQA 1HNWJ 4JV5J 1IKWB 1HNVA 3H0PA 4TQRA 1EP4B 1S0MA 5C7PA 3UDCA 4CCHA 4QR1A 4CLSA 2HQCA 3LP2B 1SQEA 2YBVA 3ETMA 3ZZZA 4TN2A 3Q8RB 1FK9A 1YX2A 3AODA 2OPQB 5DDRC 3ZTSA 5J1NA 2NYIA 5LMNJ 1YWXA 3N5FA 3AD8C 1VR6A 3HHEA 4OI3A 3HSJA 2CJYB 4M5JA 1KHVA 4ZJOA 4LIRA 4CQ1A 4AQYF 1RTHA 3UVJB 4PEOA 2ADCA 1UTAA 4HACB 3KKFA 4B9LA 1R8HA 3X1LB 3BF4A 1TL7A 4DR6F 5KFCA 3IBFB 2VQFJ 3E51A 3PV8A 3D7SB 2V9WA 4ZA1A 5U47A 2C3OA 2Y1LB 5EX3A 4C3KA 4B3MF 2H48B 4EI2A 2DR9A 2DD8S 5HMYA 5IV3A 3K5OA 1NSAA 4HTIA 4NRUA 4J9UE 4M5HA 4CLKA 5DDOC 4B3MJ 1S49A 1GH8A 1Q8KA 3UCUP 2BA9A 2L9DA 1S1TB 1WKKA 5AXKA 1LW0B 3CD7A 4QIWD 4OV6A 4PXBA 3MFIA 5M2UA 4Y3CA 2R8IA 3NWGA 5THWA 4ZJQA 4CO5A 1IJFB 3TA0A 5KT4A 2CVEA 2JFDA 1HNXF 1JLQB 3A8IA 2YKMB 3TVKA 2B51A 1WC0A 2BACA 2BZ2A 5D0EA 4DUTA 4YUDA 4HT7A 3CCUS 2DGWA 2RKIB 2B9XA 2W8KA 3FUYA 2IDEA 4OHZA 3JYTB 2BJ1A 3QT8A 2J9EA 5J1EB 1N34J 4NXMJ 1S5ZA 2CG4A 1S1UB 3FEXB 4O3RA 4DSJA 2ZH5A 4OMFG 5D4PA 4TYAA 2B5JB 5KG3A 5KG1A 2HSEB 2LFVA 4Q44A 1UEUA 3V5RA 1VQSA 4RWXA 3F44A 1IN0A 4LJMA 4N77A 2G4BA 4KJIA 4QWCA 4F4AA 3O44A 5BYSA 8AT1B 3M8RA 1SKUB 3GJSB 1KLMA 3AJDA 2ZH4A 3LANA 4QPXA 3GSDA 3VV2B 3D4JA 4IG3A 3DRRA 5SUHA 2QLFB 5I42A 1SH0A 1S6OA 3M2VA 5HQ8A 5IM0A 1RHMB 2Z30B 4O3PA 1VLYA 3CTRA 5LMUJ 1CQNA 2ASDA 3W9IA 3PW0A 5FDLB 4NLOA 1S1VB 2YWHA 4DI6A 4O23A 5GAGU 3AD7C 3GYNA 1P6TA 2CJ9A 3UE2A 4EBEA 2DCLA 1FO1A 4G1QB 5L1LA 3NBPB 5E41A 3BO3A 2HMIB 1NB7A 2QC3A 4TXSA 1FDNA 3CUNA 1Q8IA 4OI4A 4OI1A 2Q6BA 3E3XA 4RW9A 2MZ1A 3RR7A 2JEJA 2V5HG 4OX8A 3GIKA 1ICEB 4H4KA 2XSJB 1DTTA 2LDYA 3GE9A 3ILJA 4IUFA 3PRVA 5KFRA 1P8GA 1F6TA 3VGVA 3BB5A 3DRRB 4F67A 1UA1A 1I94J 2JVOA 1QUPA 1K44A 2BR0A 1ZOTA 1C1BA 2QE5A 3I5AA 2AGPA 1S10A 3FNNA 1I3OB 1R31A 2KI2A 4A8XA 3QRQA 1RT5A 1N33J 3RBXA 3PTWA 3T1YJ 3LGHA 5E0OA 2IA6A 4C9DA 1B0VA 2AJ4A 3M6UA 3OFEA 4FXWA 2RAQA 1RXOB 1L5UA 3IMQJ 4NYZA 5H9EK 1VISA 3NKYA 4UZBA 3IP0A 3NGUA 4RW8B 3IR6B 3H25A 3H98A 1G6BA 2OTLS 2VOOA 2R7VA 5D4LA 3BDPA 4JI8F 2WRMA 1KP6A 2GMJA 9RUBA 2UU9J 3GZ7A 4IH5A 3CCSS 2VG7B 5HAOA 1TELA 2V6AA 4XPCA 2BW2A 1LWEA 3IM9A 2DXDA 2CJBA 2Z0GA 1S1XB 6FD1A 3L9ZA 2XYPB 3LP0B 1T02A 5C25B 5F3TA 1RHQB 1G1XA 4W98A 2GIQA 3KXDA 3CPWR 4FXDA 2QEXS 3M6WA 3M2UA 1SIZA 4PZVA 4F26A 4Y2AA 2N7CA 1S1TA 2J5AA 5GAGI 1SXLA 3C6TB 3ELHA 2WVCA 1LFWA 5B0CA 5DDPC 4ED8A 3T5KA 2CNLB 5HP1A 3O5TB 4UOCA 3VTIA 1TK5A 2P9GA 3E8OA 3CEDA 2ZKTA 3CJ5A 4X84A 5D0HA 5E33A 5CAAA 1QVGR 3HX9A 4MIWA 4P2SA 1U1RA 2QGFB 2FPHX 3FBCA 4TLRA 5BYRA 1AZSA 1ZPWX 3H5UA 5CYMA 4CT9A 4EGLA 2UUAJ 2NXNA 2JC0A 2FY8A 5FD1A 3DRSA 2OH2A 3SI8A 2J8AA 2OPPB 2J7WA 1X0FA 2R7WA 2HVHA 1TVRA 1RWVB 2DRDA 2ZNZA 2WSCC 4YDXA 4B02A 1RTDA 1PAEX 2DEJA 3QJPA 1XMQJ 3PIOQ 1RDRA 1C0TB 1QUVA 4K59A 5K8MA 3M32B 4N8OA 4AXIA 4RBUA 3HP6A 3HT0A 5LSLA 3OR1A 4MYUA 3NGDA 2EC2A 2I2YA 1EP4A 1YDLA 3NEKA 3DYAB 4CTAA 1IKWA 4FS1A 3CJ0A 4P6QA 2QA2A 5HI7A 5T41A 1E6VB 2QA1A 2ZDPA 1SUQA 4JI6F 4CI0B 3V6DB 1S97A 4AL5A 4PRFA 4FNHA 2D74B 4KRWA 1SJ4P 3TJAA 4DZ6A 5CABA 4LBPA 3SQOP 4AQYJ 2FVCA 1VJQA 3R3TA 4UUWA 3ZTQA 2HYIB 4CO1A 4P10A 3DRPA 1TUWA 4RNFA 4TVAB 1EIYB 1EJ7L 4O0IA 2FDNA 3FBFA 4DSFA 1K8AT 2XYGB 3ITHB 3MXHP 3IA0A 1IR0A 1ZM9A 2AJ0A 4KPCA 3OR2B 1TMMA 4X66J 1Y4ZB 3NMAA 1H0HB 1PC5A 1XBWA 3C46A 2MHNA 2ILYA 4DG1B 2CQ3A 1EKRA 2QL7B 2GZOA 3OUYA 1RP5A 4JI1J 3D6HB 3JSRA 4OHYA 1Z1ZA 4B3TJ 1CULA 5F8LA 3G96A 4KE5A 5GADU 2FJXA 3QBCA 1QVFR 1D3WA 3PDNA 2IYGA 2JOQA 2ZBCA 3LGNA 3CCJS 3GIIA 4DQPA 5F41A 3N6NA 3A3NB 3PACA 5KT3A 1HI1A 4ECTA 2OTJS 1RKJA 2O3DA 2X3DA 5D3GB 3NXZA 3EVWA 2PO4A 2BBEA 4KT0C 5KFPA 1HWLA 2DIUA 3HVWA 1VFJA 5EUHA 4AL6A 5CCLA 3LGMA 5L9NA 2KXHA 1DARA 3K57A 2HWHA 4IQMA 4LMZA 1VHIA 2GS8A 1IJEB 3DOKA 1R8AA 3UCGA 3OVBA 2FGCA 7AT1B 1U6ZA 2YNFA 3C6TA 1JLCA 1PAUB 4OYXA 4ZVQB 1N5YA 1FKOA 1M5SA 4RW4B 1T05B 4FYWB 1D9FA 1RAGB 4U7CA 4EYHB 1CJTB 4ZPAA 1VK3A 2VA3A 1N36J 1S1XA 4EYIB 1IVZA 5DG9A 1YJVA 2BE2B 1C1CB 3QT6A 1NAQA 4ILRA 5AJ3F 2XGQA 3MTKA 2IPOB 1SKRA 1NPKA 1P27B 3QT5A 3G6YA 2CJKA 2VFTA 4DF8A 2YQ0A 3ZZPA 4DMZA 2B9EA 5CZXA 2N82B 3EVOA 3PYFA 3GU0A 1HBOA 4IRKA 1TTHB 2LU1A 2FJBB 3QGGA 4U8VA 4YB5A 4EBDA 1VQ4S 3KOAA 1RK8A 1F2GA 2AJ1A 1X4FA 3TA2A 2ZM6F 1JX4A 4O44A 4X64F 3GILA 1E6YA 5ETKA 3W5YA 2FLLA 3MR2A 1Y10A 1F60B 2GHWA 2QTWA 3OR1B 2XHWA 3CO0P 1FFGB 3SCLE 3PFOA 5KOWA 1R27B 1RT3B 2DVIA 4NA2A 1NM2A 2DHHA 2HNYB 3MUMP 1TR0A 1YITS 1SQFA 4WP9A 1QJHA 2VBWA 3R7NB 4EU0A 3MECA 1OSCA 2RS8A 5AJ3J 2BE7D 4CO0A 2QT7A 1GAOA 3PW5A 2C28A 3CF5Q 2CWKA 4YQWA 2MY8A 3WC0A 4DR6J 4N5SA 1K9MT 2GNKA 3D67A 3UO0A 2VC1A 3PEHA 4B3RJ 1UVLA 4CM2A 3I0RB 1FTCA 4IFVA 3KLIA 3M8QA 4NEZA 4ECUA 2A10A 1EAYC 2VDHA 5J2PB 2OPSA 3B6BA 3CD5A 1NJWA 3HLUA 3OTBA 1QAYA 2YNGB 4NWBA 3DKDA 3IXQA 2ZJPQ 1RAHB 1Y7PA 4P2XA 4ZN3A 4YB1P 2UVUA 4ILLA 2UP1A 2PFFB 1FRIA 5I42B 1IXKA 1Y0HA 2XG8A 1S72S 5M2RA 1TKDA 2EBGA 2V2ZA 2Q6CA 5C25A 4BC9A 1VYAA 3TJ8A 1A7GE 1BUXA 1H7XA 1U49A 3G8QA 3IWXA 1X4GA 4LRBA 4QCLA 4DL6A 3OJSA 2P6SA 1FX4A 4ES3A 3RB3A 1X9SA 3MR6A 1J2VA 3RYLA 5ETSA 3IN5A 1YHQS 5A2QY 2L08A 3KK1B 1JXLA 2LEBA 2XS2A 2HVEA 1LFPA 3SMZA 4TKTA 3VZIA 3OQ2A 3NNHA 2B7BB 4PR6A 2LVWA 3MOJB 2L48A 3DC2A 3GMGA 4P72A 5HVGA 2J6UA 1KNZA 3D2WA 4MKBA 1IBMF 1FJCA 1SC6A 1S0OA 1GMWD 1HQEB 8ATCB 4PXCA 2GHPA 2DNKA 2EI5A 2F7VA 5E5NA 3P5BP 1S77D 1CJKA 2B8PA 3BDEA 1NSKL 3HSDA 5LXRA 5DLFA 4I6YA 1KQKA 1VC5A 2Y8YA 2R7UA 3K89A 2KT2A 2YWFA 3AD9C 4IFVB 3HHLB 5BR8F 4JYAJ 4GC6A 1NKBA 2C3YA 1U1MA 3R5BA 2ZUGA 3V2UC 1DTTB 3KK3B 1EQ0A 3DLKA 2E7XA 1Q81T 2YWEA 2RRBA 3AJ1A 1GTEA 5E3PA 4DV6J 4ENOA 3LP1A 1DBDA 4ED5A 4Y6IA 4OLPA 3L7PA 1UPMB 3KHLA 1ZETA 2HVZA 4HL9A 4KKOA 2F4VJ 1RA6A 3EWGA 3LW5C 3B4DA 3E2EA 1PJ7A 2PN6A 1NJYA 4WFYA 1S76D 1R0AA 2GIRA 3MM7A 4OZLA 2DH8A 4DV2F 4WFBQ 3GFZA 3QO9A 3SBMA 2VBZA 3MM5B 4KV8B 1X31C 2RU9A 4DV5J 2P8IA 4RNOA 2CQIA 2ACYA 3P6YC 2DT9A 2JVRA 3D6MB 3MMBA 2BRKA 3BGRA 4IG3B 2PEBA 4QBUA 1SC4B 4I68A 1T9VA 2CPZA 2MDAA 2RQKA 3LTOA 3NGRA 2VG5A 4CLZA 2ZH6A 2KO1A 3H90A 4KV8A 3W64A 2YVSA 2FVQA 1XTZA 3EUNA 2BJ9A 3IBWA 2XS7A 3D28A 3KLHA 1Y5NB 2BXJA 1N5QA 2EBEA 3B82A 2P9CA 1X8DA 4HI1A 2D3OR 3KNAA 1KVIA 1RCXB 4LBHA 4F3MA 1JLFA 3A3PB 2CNNB 3U7JA 2XWXA 3GJRB 3NY0A 2G2YA 2HZCA 2MGZA 3THVA 2BKPA 2RQCA 2KM8C 4DL5A 4E2FB 3HVRA 4QU7A 1S48A 1BQMB 1RB0A 2ZJRQ 4DUYF 1EQMA 2ALZA 1U6FA 4IQXA 4OL8A 1FI4A 5LL6d 2HGLA 4ZDNA 1N56A 4RO0A 4TQSA 2ZDOA 4IYQA 4DR4F 3DGPA 2V2QA 3OSNA 2DNZA 1YRXA 1NPPA 1ACMB 2EWHA 5A6PA 4DV7F 1WEZA 4ELUA 1IM4A 4DCOB 2GAHC 3JQJA 2FJDB 2R7RA 2E1AA 2HIQA 3KYLA 2LECA 3PHTA 3UDVA 2F4FA 7FDRA 1U1LA 1WF2A 3M9NB 1GNKA 1OMSA 4NCGB 4FBUA 3BPDA 1WEXA 4Z2XA 2V2VA 4EZ6A 1TP7A 4PXDA 1YJ9S 4HHUA 3AXKA 4RBTA 3O1LA 4NLUA 1ELOA 5JXSA 1MNEA 2MSTA 3U27A 3NMRA 2R7TA 3MUTP 3I96A 3A12A 4Y2MA 5I3UB 1KDNA 1TL7B 1OQ3A 3J81U 3PR4A 1ZM3A 1UA0A 1Y11A 1XWLA 1KVJA 4E0DA 3FBEA 1B64A 2HFVA 3M2RB 2BQRA 2E1PA 5AT1B 2R2SA 3ET6B 2Z58B 1RWPB 3HXMA 1ROFA 1HBMA 4WTYA 3IR5B 1T7PA 4LF6F 2HZAA 3KLFA 1LK7A 5IWAJ 1W25A 3HKZD 1ZM4A 3H2UB 2PT0A 1HI8A 1RZMA 3KHHA 1SPBP 4X4RA 4ZMMA 5L8RC 2H1YA 2YKOA 3FFIB 1DQ8A 4RR5A 4OYOA 2RU3A 1TFWA 2EKNA 4H54A 1QE1A 4NCBA 2RS2A 3G6VA 1IBKF 5DGBA 3LWMA 3M8QB 3D6FB 1U25A 4G1PA 1PJ6A 2IAJB 1FWPA 1IBKJ 1YZ6A 1E6VA 3TZWA 4QIFA 4DWIA 4M95A 4A46A 1HYSA 4M5IA 1N36F 4EBCA 1U1OA 5KFMA 1KOOA 3QRPA 2ZBRA 1RHKB 2B0GA 2L3MA 2YPYA 4LSZB 4AUKA 3UD4P 3HHNB 2V4RA 1Q7YT 1NU4A 2DXEA 2G2OA 2DGOA 2KXFA 3MUVP 2M4MA 2Y1IA 2C2DA 4H4MB 1LV5A 3QYYA 4DOZA 1NSPA 3CULA 3IAS9 3DHWC 4KAIA 2FLOA 2HAFA 2JJ4D 4DSKA 3D1QA 3NNAA 4A8QA 3IFEA 2UXDF 2O66A 1QAJA 1IKXB 1O51A 4ZVTB 1TFYA 2UUCJ 4X65J 2UXDJ 4OJGA 2Q66A 2ZHBA 3OXFA 2KZMA 1NHVA 5L46A 1B0TA 3OLAA 1U7LA 4E8UA 4DCPB 4WYWA 3A8JA 3AOCA 2V50A 4D3HA 3TX8A 2HHTA 4F25A 4ZVGA 1EETB 1OS5A 4Q45A 2M7SA 3R8YA 4HHJA 4CH7A 3L7UA 4IFYA 4QQBA 5LMUF 3QWPA 2OFHX 3N6MA 4ELVA 1X5PA 3VZHA 2HFOA 1KOHA 1FRHA 1GXLA 3CD0A 4RKUC 2UXCJ 5ETPA 5KG0A 1C4AA 5HL7Q 1T8EA 1JLCB 1FXDA 2VFVA 3FCVA 1N5YB 3QFHA 4PABA 2COLA 5K14B 2FIUA 1YSJA 2V8DA 1X7VA 4CLPA 4R8UB 1MMLA 2CPIA 5A8RA 3DOLA 3HVAA 4IKAA 3V4MA 1Q0NA 4ZCMA 3TZXA 1M5VC 1J5OA 5HMWA 5K8OA 1WELA 2EPIA 4RW8A 5KFJA 1RWNB 3MGJA 2JFKA 1S7IA 1I94F 1PYOB 2CFXA 5HBMA 4ANCA 2PC6A 1RLCL 1RT6A 1DURA 1RT5B 2KT5A 1NZ8A 3TYTA 4C4WA 3RRGA 1HWKA 1HL6A 4CLWA 2CPDA 4DR2J 1XNRJ 2GO9A 1R8PA 1NHKL 3I6PA 3TP2A 1VQPS 2H54B 3RJMB 4OV1A 5IC4B 2H9ZA 5IFMA 4M63A 5RUBA 5EX0A 5HO4A 4HEA9 4W4MA 2XNRA 4KGKA 4F3QA 2U1AA 4RW9B 5KFBA 1Y5IB 1FDAA 3GCWP 3L09A 4L72B 1SVDA 1XMQF 4ZN1A 3OVAA 2CPHA 4KTQA 1HWUA 2QX0A 3T5HA 3Q89A 4HVZA 4BLGA 5CCMA 3AJ2A 5FJ4A 2DNYA 4WCEQ 1NMEB 1ZZNA 2A0FB 1F5AA 1U47A 2GVDB 4KGZB 4OJHA 2R8KA 1RSCA 2W1BA 1JB0C 3TAQA 3TQEA 2NUHA 3UNYA 4C8KA 1TL3B 4EO6A 3THPA 2ZNYA 3J7AN 2HHQA 2DNRA 2J9DE 1CJVA 2ZH7A 1LK5A 2VASA 4O4GA 1WTBA 2J0WA 3BO4A 2PA8D 4YS2A 2BANA 2G0JA 4C3MA 1YLXA 4DPWA 2AZ3A 3GR1A 3SQGB 4X62F 1SL2A 1CPZA 4CWBA 2R9LA 5GMKa 1RTIB 3C15B 4U6PA 3OT9A 4KO0B 4P9SA 4UTGA 2WBRA 3MM5A 4J9PA 2FVSA 4OI2A 2MHEA 1HKAA 2JDJA 2XCAA 2CQPA 1R0AB 3QIDA 1UVJA 1L3VA 1IBLF 3IC1A 3M32A 4ATNA 2C2OB 4RWWA 4NXNF 2O5DA 2W9BB 1JJHA 3SV4A 5JUMA 2AX0A 3MM8B 2GW8A 3MM6A 3QATA 4UY8T 3G9CA 2AGOA 2DJWA 2ZOMA 4ZPDA 3PVXA 2DHSA 2LKZA 4DV3J 2H5IB 3GPAA 4DPUA 5B7WA 3DLKB 1HBNB 5CQGA 1FKAF 1UEKA 2YKNA 1ZAVA 2AIRB 2R2UA 3POTB 4DR7J 2Z2LA 2DXFA 5HN0A 1TL5A 1ZTTA 1RWKB 5H9FK 1K47A 2ROGA 3BSOA 2VKRA 3OTOJ 1TAUA 2KFYA 4M94A 1X0PA 2XMUA 5A0YB 2WW4A 1H38A 1SKSA 4DR1J 2RUSA 1R43A 2KG1A 4DUYJ 4K5SA 3D5MA 3MMJA 3JQKA 1RT2B 2MKCA 4QU6A 1D9AA 3LP0A 1IKYB 2ILZA 3S6EA 1LWEB 3OFHA 4RNNA 4RU2A 2HHWA 2CJXB 1WOPA 1D09B 1HBNA 1RCOB 1B99A 4NX9A 4WIIA 4A8OA 3N4WA 3H40A 4ERDA 4GKKF 2VG5B 3CDBA 4K4ZA 2RDIA 3EPIA 4JI4F 3LPYA 5L38A 4PXEA 2AP6A 3GWCA 3N6LA 2NPFA 3V6HA 2HWIA 1PCAA 2QMUB 3QLHB 5J2NB 3PZPA 4EZ9A 2VH7A 3EDRB 2DGUA 4MAKA 2PMHA 4F4KA 4J90A 5KFWA 1JNZB 1HBUA 1SC3B 2R3VA 3D66A 4OYPA 1FXRA 4FF2A 1KHWA 3IS9A 4X4QA 2MSSA 4M5MA 1WWHA 4F04B 1FJEB 2BV3A 2YNHB 4NI2B 4DZDA 5H1SV 4GKJJ 2ZZMA 4LF7J 3LPEA 2FGOA 1CQMA 2PIIA 2YTCA 4QWAA 3H4BA 2YH0A 4NLPA 1HHTP 3MD3A 3BM7A 2ASJA 2BUNA 2W9CB 3UR3C 4DJBA 2B4PA 2NUUG 4CT8A 4QYZK 1T9WA 2QV6A 4LQ3A 4YFUA 4K0KF 4DXLA 1N4LA 2N7YA 3ICLA 3GB0A 5GVQA 1FRMA 3R5GA 1GQEA 4DU8A 2XQCA 3IGNA 3OL8A 1RT1B 4OX9J 4Q8FA 4LR8A 3HJFA 1S1VA 2GJ2A 2BRLA 3C3LA 1ZA2B 1WC6A 2RE1A 2O67A 4QPTA 1VQ8S 4DUZF 2HRTA 1WNEA 5F8HA 4G1IA 5IM0B 3B78A 1WC4A 3M8PA 4M5NA 3H7HB 4QYRA 4FN5A 5F0UA 4DL0C 3BV8A 1DY3A 2DPJA 5ITHA 4DR4J 3RR8A 2JLEA 3G86A 3R5DA 5DETA 2CG8A 2E44A 2WB4A 3MM9B 1MWQA 2FHJA 3IRXA 1EX8A 2X3GA 3DOLB 5LSRA 3QIPB 3CSKA 3D9BA 3GG1A 2DR8A 3QRRA 1R8CA 2IRXA 4PQAA 2CQBA 1CSJA 2RMLA 3AXMA 3CJRA 3DLGA 3M6XA 3CCWA 2MKIA 1K1SA 4BCAA 3MPUB 2YKAA 3Q22A 3RB4A 2ASLA 5L1JA 2QFIA 4NEYA 5DLGA 1K0VA 1VQYA 1YIJS 1DFDA 3R5JB 4ZOSA 1FXLA 2WTFA 3MI7X 5HVFA 2YX7A 3TVZA 3TQ1A 5IT9U 3M30A 4ZP6A 2GX8A 2V67A 2WVEA 3N28A 3WIVA 3SDEB 3C14A 5K14A 1SJRA 1T9TA 2HNZA 1U0HB 1BWEA 2J0SD 3FKBA 4DL4A 1QLNA 4KQZA 1KEKA 4J9OA 1H2TZ 4DX5A 3UPFA 4FF3A 1VCTA 2BJEA 2VZ9A 1JIHA 4X4SA 1S57A 3FSYA 2GQCA 5L1IA 3GQCA 4IOAQ 3T5JA 3DLGB 3HZGA 4PQUA 3U1NA 3WQPA 1REVB 4OYAA 3FZBA 1OIAA 2QZ8A 2K8GA 1P1TA 2P2CB 1HARA 4J37A 3DDNA 1PSDA 5D77A 2U2FA 2C3PA 5E3RA 4CP5A 1WI6A 2I38A 5A8WB 4MJKA 1VMBA 2GCFA 1QSLA 3HK2A 3DOMA 2D9PA 2I5JB 4RZRA 3H4DA 4WE1B 1X5TA 1ZAWA 2P6TA 2RUGA 1Z2ZA 3CT9A 3NRBA 4J9VA 3RUBL 3TUJC 3ZO7A 2ZHOA 1PG5B 2F4VF 1UJ5A 1UKUA 4EWTA 4WE1A 1HYSB 3K7RA 1ULRA 4DR2F 5HLFB 2PI5A 2KM8B 5KFXA 4U67Q 4URSA 4Y2IA 5GADI 4ZCLA 1TKZA 2CQGA 3SIPB 4G65A 2GJFA 2B56A 2F8EX 4XTTA 1Q4RA 1IBLJ 2NXJA 4GC7A 1VRUA 4FDFA 3BH6B 1CJTA 1QM9A 1GMVA 1VHFA 2HG4A 1ZBTA 2IAJA 4A4JA 2AQ4A 2CPJA 3M1VA 1SB6A 1V5VA 2QMWA 2V68A 3MEEB 3NGTA 4WFXA 2W24A 1PBAA 2FHMA 2N3OA 2XY7A 1X4HA 5LJ5Y 2RRAA 1KQGB 2NSCA 1N0VC 1NXIA 2VBXA 2XLJA 3SZ2A 5KFQA 1C4CA 1H2UX 2YX4A 3AA8A 3DLLQ 1EB0A 2O1PA 2MQPA 4KB7A 1RBAA 4OYWA 3SEOA 5GAHI 1NNDA 4RJVA 5T7LA 2IBKA 5L9XA 2WB1D 3C19A 2DH7A 5HATA 2V69A 1WDDA 4CRJA 5EWFA 2HHSA 4CYUB 4KHPJ 2EFQA 1H73A 3OHAA 3DMJB 1MSWD 3BREA 3EXYA 1XMOJ 3KLVA 3VWSA 4DX7A 4PKDB 3HSGA 2LQ5A 3ISND 3MAAB 2AMCB 1RT2A 3PW7A 3OBIA 3G6ES 3I55S 2DITA 2ZEJA 1KFSA 1QSYA 4L76A 3W2VB 1FNXH 1VBYA 2HWTA 3VF0B 2DNGA 3QWUA 4CH1A 1C0UA 2JEFA 1TL1A 4AL7A 4UOGA 1H6KX 1Q79A 2Y3YA 9ATCB 2J0QD 5KOXA 5A0YA 3BQ2A 5I3PA 2WHOA 4O4RA 4HLBA 1XNRF 2KU7A 5CXTA 5K8PA 5DQHA 3B8HA 2FVRA 1FWLA 2GQQA 3OPKA 2C3MA 4DN9A 4Y65A 1U1PA 5IC6B 1YGYA 2BKNA 3W9JA 4PUOA 3IWNC 4DR7F 2X7IA 3KDNA 1FDDA 2C1EB 1VQ9S 2XMMA 2OMLA 3LWLA 1XERA 1Z2LA 1LOUA 3PW4A 4R0JA 5CA5A 4PWWA 1NK6A 2XO6A 1NJIT 3BN4A 1FD8A 4PG5A 2WW8A 4ZVHA 4KH1B 3RBZA 1KRPA 2VIHA 1OPIA 4IRDA 1ZM2A 4L75A 4P2FA 5KFOA 2W9CA 2D3UA 3VQTA 3Q8PB 1VI7A 1U48A 2WOMB 2W01A 3QZ8A 3P49B 2EXUA 3CJ8A 5IXUA 1HNIB 4DX8H 1PJ5A 3Q83A 4ZP9A 4ZHRB 5A8KB 4WTOB 3PYEA 2HW3A 1H7WA 2AKWB 3I9ZA 3KMQA 1FKPB 4WU2A 2DGXA 2V0NA 4Q7AA 1UFWA 2B9YA 1RTIA 3C15A 3CO9A 3ADAC 4RW6B 3HKWA 3M8SA 2ERRA 3OTEA 4PAAA 2MJNA 2QMXA 3ETOA 2BANB 3UFCX 2IJRA 3TAMA 3W5ZA 6AT1B 1ZS6A 2ACMA 3QAEA 2RNEA 6FDRA 3LAKA 3MR3A 1OY6A 3MFHA 2W7OA 3TEHB 4DR3J 2IC3A 2EFPA 3DRSB 1T9YA 2HHUA 3V6KA 2Z56B 4C11A 1RT4A 3OLBA 4PUOB 2OSQA 2JHEA 3HHLA 1JJ4A 4MK8A 2LYVA 2UUBF 3GV7B 4LF8J 2K2PA 2RHQB 3UN2A 5JVGQ 3J7ZT 1RJJA 2EEYA 2QLWA 3BYRA 3FBBA 2ZJQQ 4JP8A 4C8LA 1EKSA 2JSXA 2NQPA 2VFUA 3CC2S 2NXUA 5C5JA 2Z2MA 2J8SA 2RQ4A 4HT5A 2AJFE 3KK3A 4B3TF 2HFZA 1YG0A 2DPIA 1H98A 3POTA 2XMJA 2HGMA 3O8WA 2LMIA 1FVQA 1PC4A 1VK8A 2QIFA 3NCPA 4QJVA 3W7BA 3ZZOA 3NL0A 1Y5LB 4ZLJA 1MU2A 4AYBD 1AB8A 3VVTA 3ISZA 2M8DB 3D54A 4C98A 2B5JA 2QL5B 2B4UA 4USKA 1B3TA 5EN1A 1F2HA 2VFSA 3C66A 3ZC4A 4M5KA 1KS2A 4IG0A 1S1UA 4UW2A 3ZNUA 5EWGA 2JL9A 3VVUA 2DRAA 3R27A 2F63A 5J1EA 1J5EJ 4C8ZA 3KTQA 1HPZB 3KUEA 4C6AA 4LR7A 4NPOA 5D4OA 2IVFB 4JV2A 3CCZA 2W7PA 5B0BA 1EHWA 5J2PA 4KO0A 3G8TA 2IY5B 1S79A 1GMWA 2IJNA 4CH0S 1X4BA 4ED6A 1NK0A 4PWDB 3OFGA 5E3AA 2ZH1A 3CC4S 4R0EA 1PBUA 1RA7A 3O3LA 1LW0A 2FHJD 4O4GB 2E1RA 5B09A 4GO7X 1GEHA 2E66A 2YKQA 3MECB 5ETOA 1HQ2A 1Y9OA 3P96A 4LT6A 4ZVEA 3GFXA 3ZZ0A 3Q8SB 1BC6A 3FDSA 3HFZB 3IAM9 2OO4A 3NBPA 1VQMS 3BPSP 4LF2A 5KT5A 4ZP8A 3KK2B 3IR7B 1NK7A 3I0RA 1DTQA 1R3NA 2QSWA 4KY3A 2MQOA 5HLFA 3HFVA 1JJCB 3GR0A 3KLGB 2A1BA 4DQRA 3TRGA 4FF1A 4DQSA 3DM2A 4TU9A 1M0SA 2OKQA 4J7CA 4NA3A 1RWUA 3MEKA 2XMKA 2NREA 3M2VB 3PW2A 1DHMA 2ZWPA 1URNA 3LOUA 2I5JA 1PIEA 5D8HB 4FS2A 2F8HA 2IVMA 2OPQA 1F9HA 5A8WA 1YTYA 2KFNA 3UN5A 3HSZA 1BGXT 1RU1A 4IO1A 3RB6A 2QYCA 1X9MA 1XQIA 2XMTA 3WX8A 3K5MA 1S12A 1VS3A 2DISA 4QW9A 3TUZC 3RTVA 1XNQJ 4RW7A 2K3KA 5LT5A 3N5BA 2DY1A 4DCJB 3EDQB 5DM6Q 3MPDA 5IT0A 3KMSA 4LRAA 5ETQA 4NXMF 2GV1A 1XEZA 4JI3F 5KFDA 3LQVA 3KJVA 5DQIA 1U0HA 4MKAA 4IR9A 4L3NA 4R8UA 3T6JA 3UNGC 4ICLA 3IWLA 2B6AB 2W8LA 5DG7A 1NDKA 1W2IA 2X51A 4A8WA 5FLXY 1H72C 4C8YA 3FC9A 3R5AA 4V1Ak 3CCES 4DV7J 1CC7A 3KLFB 2FJVA 3SYZA 4YR3A 4HH0A 3AAWB 4PG4A 3NS6A 1T05A 4M5DA 4ES1A 1HA1A 3M05A 1YJNS 1JJ2R 5CZVA 5ETLA 2W7AA 4FKXA 1FA0A 2HAIA 4X4NA 4CLFA 1TL1B 2BMBA 2DR6A 2V8HA 2CQ0A 3SV3A 2HBQB 3V6JA 1JXVA 1NH8A 2G2ZA 2OD6A 1MW7A 2AEMA 4X62J 2ZBQA 2B4OA 1Q5VA 5AXMA 4CZCA 3RB0A 1IBMJ 1TK8A 1TK0A 3N01A 2E1MC 3HULA 1N32J 3CIMA 3G71S 1NKCA 4RUBA 1B4SA 1LXJA 2HHXA 1U2RA 3DLEA 2GJIA 2IYIA 5FLXU 2XLIA 1KTVA 4MFBA 5KG5A 4ZVSB 2C2KB 4M5DB 3IGVA 3Q2TC 2M8HA 3MOZA 3I9V9 4MK7A 2HHHF 4TLQA 3R9LA 3WZ0A 4C3LA 4R25A 3HF5A 1WSRA 5LJ3Y 2KZZA 1IQZA 2YY3A 3KG0A 3KDOA 3ZZYA 3JSBA 4FYXB 4EMDA 5HSPA 3RBEA 1YJTA 2Z4PA 3G82B 1XIQA 1AUDA 1MLAA 2VU5A 1Q7LB 3OUYB 1HNVB 2LQBA 4NLGA 4K4SA 3MAHA 5EGYA 2FY1A 2IM0A 2XSFA 1B0PA 2CQHA 4DL3A 2C3UA 4Y2KA 4C97A 1Y00A 1D8YA 1NH7A 3TWZA 1N33F 1ZA1B 3A8KA 4UQTA 3ZTOA 3VAGA 4K2XA 4OLOA 4NI2A 3KLHB 3PX6A 3CIZA 4ECRA 4NASA 4DR3F 1HR0J 2V4QA 1RT7A 4NYOA 2C2ZB 1MMNA 2G0IA 1N32F 4Y2CA 5F8JA 2E5LF 4Z7CA 1TKTB 3W61A 4CM0A 2YWWA 3CE8A 4DLEA 4KH0B 5HANA 1VQOS 2MMYA 2CZVC 2MY7A 2NZCA 3MCSA 5GAHU 3X3UA 2MLZA 3ET6A 2XM3A 1NK4A 4LF6J 1WDTA 4MIAA 4DBQA 1ZYQA 1N6QB 3DLEB 4WF9Q 2MEWA 2OHDA 4OYZA 2FC9A 2HLUA 3MHYA 4X4UA 1NDCA 1QAXA 3KJFB 4QOTA 1M5KC 2CPFA 2P9EA 2GO8A 1M5HA 1JLGB 3A8EA 4B3SJ 1VQNS 4LFBJ 1LXNA 3R1LA 2ATLA 2IM2A 2L41A 3MZIA 1RWOB 3DHXA 5KFEA 4ID8A 3K59A 3CCQS 3H2VE 1NK5A 1RABB 3R2DJ 2G9OA 4LREA 4JV0A 4OYMA 1G7CB 2VV5A 1UZDA 3MDFA 4DPYA 1Y3JA 4OZ5A 3BQ0A 5HP1B 4OZJA 1GX5A 4PQUB 4U7UD 4ZVUB 4ZLNA 4USIA 4ZLLA 5CYMB 4JI0J 2GHVC 5KFYA 2UXCF 2AW0A 2B4VA 4G6VB 2FZCB 4L3KA 4ZVRB 1CVJA 4YP3A 1SJ3P 2VFRA 2DGSA 2XNQA 3DGPB 1LWFA 1UAWA 2IA0A 2CKWA 2H4YB 3AOBA 1NPRA 2VC0A 5A6WA 2OMOA 4RU9A 5LXYA 3GYXB 2IBOA 2RT3A 4I4BA 1Q8LA 4MMOA 2CVIA 3KJVB 3LO3A 4FVMA 4BBYA 4HHHA 1TUVA 5ADZA 1KSPA 2UUCF 2XS5A 3RAXA 3KFWX 2ZOFA 4Q8EA 1UVIA 1IKVB 2WZ1A 2FJAB 3Q8YA 2R42A 3R97A 3W66A 2DR7A 1V5IB 3VALA 1MROA 1RHRB 2E29A 2HQDA 3MCNA 1VGYA 2L9WA 1VIOA 2YWGA 1U2FA 1G4CA 2AGQA 2VONA 2WSEC 1WOOA 2V8GA 4Q0BA 2GIFA 2QA4G 1U2CA 3PHEA 4DR5J 3HHLD 3UN3A 3PY8A 2GGPA 2OEKA 4JOUA 2DK2A 3EVMA 4Y00A 1FTRA 2LEAA 3EGZA 2FTRA 4I7FA 1WF1A 3K8WA 3I87A 2GVZA 3R6LB 3UQSA 3CXCR 3RBDA 2V8VA 4NLSA 2LQJA 4JV1A 1DLOB 3DU5A 1O5JA 3QGHA 4JBCA 2HZVA 2MQ8A 4LRCA 4UZCA 3ENQA 2OPRA 5D4NA 2KYZA 1SJFA 1PO6A 1S1WB 1RT1A 4QWDA 3EPGA 3AHPA 2OPRB 5KFNA 1MN7A 1S9GB 4P73A 4USVA 2VQEF 1TUGB 2H65B 1R8BA 4IH7A 4ZCIA 3LP1B 1RAFB 3ISNC 4ZKAA 1X9WA 4MT1A 4C8NA 2ASYA 3CJKA 1IQTA 1X4AA 3CJKB 1FF2A 2C2NA 3CCTA 3RGIA 4JB8B 2XZDB 2GA7A 4IR1A 3C2PA 4K50A 4USHA 4PWUA 3TARA 1I51B 1S9GA 4DU7A 3TA1A 1VC0A 3EGNA 4ZPVR 2XLKA 2AJ2A 4ZS6A 3A13A 1S9EA 4NRTA 3W60A 2YNHA 3FQLA 3OW2R 1CJKB 4DLGA 5C2GA 3MWBA 5J2MB 1RWWB 5KFTA 3GFYA 3S1TA 5F8IA 4ECQA 4WK3A 4F2RA 1K1QA 1HQEA 3D0HE 4ZHRA 5A8KA 4F4ZA 2XMVA 2V63A 4C0HA 3BBBA 1QTMA 4I6AA 1HNZJ 2AF6A 2MQLA 1YJ7A 4ZPBA 3UI3A 1VQ6S 1CEZA 4AD6A 1HNWF 4OX6A 3VHQA 3HDSA 3NCQA 1QAIA 2UXBF 4ZK7M 2RIJA 4KHRA 1RBOB 2CPEA 3KK1A 4F4XA 3NOCA 1UVMA 3TEGA 1U8SA 3UDEA 2VF3A 3HFKA 2HVDA 2BM1A 2BM0A 3W65A 4NZ7A 2DYAA 2CJAA 3MPWA 4DF4A 3OTDA 4FXVA 3T1YF 3GONA 4RUHA 1HI0P 2YQ3A 1SJ1A 4X4VA 1JQGA 3GIMA 4DL7A 5K8NA 2LXIA 2DNQA 3D68A 2DGVA 5KG7A 2PMWA 1NLKL 3U1LA 2V2KA 1T0TV 2ROEA 2YNGA 2RKIA 2RF2A 4XPEA 4FYDA 3AQPA 4ZIWA 4MTPA 1PILA 1LWFB 1TL4A 1ZTWA 2XO7A 2POKA 2UUTA 3UDLA 4ZPTR 3KLIB 4FVCA 4I2PA 4QZVB 3V4IA 5L39A 2HKEA 3MAAA 1EZZB 4N41A 2EFGA 4C11B 1JLGA 1Q8BA 3RRHA 2Q79A 2MPUA 3IG1B 3ILLA 2M88A 2NXEA 3DMJA 4ETZA 5HVHA 2V94A 5ETTA 3P8BB 3SXLA 2BDPA 1JWWA 1X60A 4O3OA 1TQLA 1Y3KA 2R8JA 1SI9A 4WYLA 4YN3B 2FYXA 1U6BA 4PPZA 3MM6B 4FBTA 1REGX 4PPDA 1CJUB 4DV1J 5AE1A 8RUCA 2KJVA 2HURA 3CMES 3TO8A 1SBRA 3T41A 4ETXA 2N4DA 5MLCV 2R8GA 4B9UA 2XY6A 1WHVA 4USJC 3W62A 2W2QP 1RTHB 3UVJA 3CVKA 3Q24A 1VBKA 2K1RA 4LF7F 3LAMA 3EE3A 2FUG9 2KL8A 3BKUA 3D1OA 2X1GA 2VQFF 2A6OA 4V19X 3JSYA 3BEGB 2LU2A 3S8SA 3TW0A 1U1NA 2Z2ZA 3ZZTA 3E01B 5C42B 5CYQB 1UMJA 5KT7A 1YI2S 2R2TA 5B0EA 3AB4B 1BE4A 4K8RA 1VRUB 1YRTA 1Q1KA 2K3IA 1QE1B 3MPYA 3PR5B 2VJVA 2CNKB 3T1AA 1SCJB 2KXNB 4DV6F 1I5OB 2D3ZA 4W92B 3H5YA 1DZ5A 2HFNA 5HQLA 1TKZB 1XNQF 1QD1A 4YOEA 2VPYB 4HKQA 3Q8QB 3I31A 4KFBB 2JC1A 1HBMB 1QTNB 2EK1A 4P71A 3MR5A 1OQ6A 3QQCD 4MIBA 1HW8A 3HMJG 1PYSB 2K1RB 1WHXA 3S01A 3UR0A 4J9QA 2YH1A 4XIUA 3CGIA 4JI2J 3N0VA 4O3SA 1L3KA 3GLJA 3BR9A 2RJZA 1R6YA 2BABA 3JAMY 4WBFA 4JI0F 2WCXA 4PYAA 3PO4A 2W4PA 3MF5A 2CJQA 4DSIA 1SH3A 1K73T 1KTQA 2YQ1A 1NJXA 1C0TA 2SXLA 3DI6A 1CJUA 3O2IA 4O0NA 3BGLA 2KN4A 4X4TA 1YVFA 2AHOB 1RTJA 3O6QA 1H3DA 4RL1A 2FLNA 3CMQA 2KVIA 5DRKA 4ALZA 4XDDA 1F3VA 4O3QA 3KG1A 4WZQA 2JH3A 2ZD1B 2QLXA 3KJQB 4FZVA 4Z37A 1LW2A 3S7RA 1Q53A 4OYIA 1GX6A 3FQKA 3T19A 4AE5A 1S0NA 3TZYA 4ECYA 4JI4J 1RTJB 2ZC3A 3F0NA 3RU0A 2UZAA 2DO4A 3QPIA 4I2PB 3V4IB 4C0BA 3QSIA 2MKSA 3HCXA 1CULB 4WXOA 4ED7A 2DGTA 2XEXA 1C2PA 4RBVA 1U24A 5A8RB 3SDEA 4ELTA 4JI2F 3TR5A 5KFFA 4J9SA 1P9QC 3JTOA 4UOFA 2AZ1A 1OYEA 2HFUA 3GSIA 4M5LA 1J5EF 1FRLA 4KFBA 1L3UA 1U4BA 2OELA 2GMLA 2DB1A 3H5SA 2V9KA 2XMAA 2KH9A 4L6V3 1RADB 3DCAA 3TNVA 3J7YU 4USMA 2DHGA 2IFXA 1DQ9A 2VG7A 3W2WB 4WFNQ 4QR2A 3R5CA 1I1GA 4X64J 1NSQA 1T3NA 2IVYA 5EDWA 2E1CA 3OV7A 1T03B 3NGKA 2HQIA 3UCZP 3HM9A 2ZH8A 1VQKS 2HRUA 2OD4A 3BBCA 3BGRB 3M9OB 4O3NA 4RW7B 1SUQB 3BH7B 4CO4A 5C24B 2Y1JA 2PI4A 2FC8A 4LFAF 1HWJA 3W8PA 4CTAB 2RRNA 1FE0A 3VAJA 3CWJA 2UVRA 4RUAA 1WACA 2IHR1 3MM7B 4YHHJ 2RB7A 1BMQB 2XCPA 3KLGA 2IDLA 2P5VA 1S9EB 4LQ9A 2ZH9A 4M8LA 1OJ4A 4LVNP 1TMJA 4ZPCA 1UEVA 4USUA 4H4MA 1RTDB 3TJ9A 1QY7A 5JVHQ 3G87A 3HPOA 4DFJA 3PX0A 2XSJA 4NMXA 1FDBA 4CLYA 1VBXA 3H5XA 3BR8A 3T6BA 4TY8B 1A6LA 2W2OP 2Y1RI 2AD9A 2HHVA 1BD6A 1RE1B 4WFZA 3IG1A 4WKYA 4IOCQ 1D1UA 2HQFA 1T9UA 2HMIA 3HO1A 1S6QA 4CLUA 3GV5B 2GC8A 5KFZA 5HMZA 1NEEA 1L3SA 4PWDA 3T3FA 2BJ8A 3ENVA 4QR0A 1QSSA 4WXWA 4X4PA 1VJWA 2W9AA 2G13A 3BO2A 3DXSX 2HBRB 4M5GA 4J9NA 1BY9A 3J80Y 2JEIA 1FESA 2DHXA 3EICA 5CD4H 3RAMA 3HD2A 3R7SB 3WBZA 4IG0B 1YK9A 2GGPB 3EZ5A 2R2RA 1SJQA 4ER8A 1M1GA 4YY3J 2N4CA 1OWXA 3FZ2A 4K5RA 1YRUA 4F0MA 5DGAA 1SV5A 3I56S 1SV5B 4WKRA 4OX7A 3K5LA 3IRXB 1FJGF 2F65A 1T3OA 4D3GA 1S4EA 4ZITA 2A2CA 2AYMA 1S59A 1UW9A 2QLBB 4B17A 1HNZF 3LALA 4QIGA 4I6WA 4DV4J 2LQ9A 1AFJA 1ZAXA 5F8NA 4DV4F 3GFHA 4ED2A 2HRYA 3AT1B 4NCGA 1UCNA 1UETA 4F50A 2NS1B 3VAKA 3RAQA 1RWMB 1APSA 1IR1A 2VUGA 4YR2A 4P52A 5KT2A 3ZNJ1 2MKYA 1HQUA 2ZE2A 1T94A 2XY5A 4U96A 2VPWB 4IO9Q 3UWTA 4V19J 1FHTA 3SSSA 1AROP 2F8MA 2OJ3A 1WC1A 2NR0A 4DPXA 4TY8A 5E7OB 5BJRA 1JLAB 1RAEB 4KHPF 3QJJA 4DV5F 1KN6A 4U95A 3MM8A 2HNYA 4K7QA 5B08A 2AEFA 3PFEA 5HQMA 2W9BA 2A3JA 5D78A 2JWNA 2ZWOA 2YWKA 3CDWA 2VD3A 4RW6A 3SSQA 2ALYB 1NK9A 2AX1A 5F9LA 1UFLA 1V3ZA 4LIWA 5KFGA 2Y8WA 1OYDA 4LRDA 4HACA 4DV3F 3ILOA 4MK9A 3BN7A 4EUVA 1V9OA 1N6QA 2F5GA 3F41A 1DAXA 1N0UA 4KR0B 1SC1B 3FRYA 4USWA 3QLHA 2LXUA 5KFKA 5J2NA 1KVKA 1CJVB 2R8HA 2LP4A 1RTZA 2I8EA 3QO9B 1U1QA 4EK2A 4DFPA 5I3QA 4LSNA 3KLEB 5GAEI 1MROB 2XB2D 2AYEA 2W4DA 1T95A 3MMAB 2J7UA 1K0TA 1M1KT 2WOMA 2B9WA 1F9EB 1NRKA 5HK4A 2EVZA 4KBIA 1ZPVA 1FKOB 2L9NA 2XMWA 3GP9A 3L4BC 2ZM6J 4XO0A 3NS5A 3G6XA 2H4WB 2PE8A 2BQ3A 4PG7A 3G82A 2RVJA 2BE9B 2B8QA 3Q8UA 3I32A 4ED0A 4MH8A 2XZTB 3J80U 3M9MB 4M1KA 3W2VA 2QFJA 1N52B 2FHOB 3CCMS 1FNOA 1LWCA 4C0OC 4I2QA 4WP3A 2ZE2B 3SFUA 5IS2A 3EXCX 3OXGA 4NOHA 1FWKA 4I67A 1AXQA 4CIOA 2YKNB 2HFSA 2QLJB 4K4YA 4DUZJ 2J9DA 2QJ3A 1TZ0A 1HIYA 1I6JA 1B7FA 3RW6A 1JLBB 2PMZD 3UW1A 4DL2A 5KG6A 1GFWB 4LSLA 2ZH3A 2EG2A 2GQ2A 2D1CA 2RDDA 1S99A 1JNRB 5T7LB 1NCLA 4I0WA 4NL5A 5F0WA 1N88A 4DHVA 7FD1A 4Q43A 4F36A 2LA6A 4Y0FA 5G4DA 4X2BA 1IBCB 3PKYA 4OYBA 4EEYA 5DM7Q 2XGPA 5KG4A 3VQSA 2K06A 3A1YG 3VGTA
chains in the Genus database with same CATH topology
3DRXA 1N5VA 1UW4A 4DV0F 3L7OA 4CO2A 2WK4A 4KGMA 4TNOA 5G0RB 2K7KA 2RQMA 3HHLC 3OL6A 3F73A 5LMNF 2VG6A 4FNIA 2GFFA 1FVSA 1KFDA 3OTOF 2ZBIA 3CD6S 4A8FA 3TUIC 3EX7B 1FT8A 2B6AA 4DR1F 1RT7B 2DO0A 4J9MA 3DRPB 3LUYA 2WONB 4KPYA 4QWBA 4OZNA 1YJRA 2CZ4A 1FJ7A 3E01A 5C42A 3K5PA 1WG4A 3I5CA 2BQUA 5HROA 1KQSR 3V6DA 1JK9B 1N5SA 4OHVA 4LFCF 1M90T 1SL1A 4G3IA 2DNLA 2CQ2A 2KG0A 1YJWS 1UJ4A 1FCAA 4R5PB 1N54B 3MD1A 1JLEA 2MKJA 4BDPA 3P3DA 4Q5VA 2V4JA 1WG5A 2FD2A 2R7OA 4K4UA 4JYAF 4KIAA 4JI1F 1S6PB 2XI2A 4B9NA 4MKYA 1JKHA 5AE2A 1DQAA 5KFLA 3PJXA 3C6UB 1D0EA 2IM1A 4NLTA 2M5YA 2R7QA 3UD3P 4ECXA 4DFKA 3I5BA 3Q0AA 1HMVA 2IRYA 1N34F 3V81B 3SCKE 4B08A 2MZRA 4YHHF 1VC6A 2VODA 1FEHA 1RQ0A 2ADBA 2NPIA 3DN9A 1KONA 1ZZFA 2KYXA 2RSQA 1T03A 2E9TA 2X1BA 4B9VA 2KJWA 2YNIB 2EC0A 4ID5B 4E98A 3W2WA 2RF2B 4FPRA 4HI2A 1M5PC 4C2MA 3OFFA 1KLNA 3NG8A 5KG2A 4RW4A 1YBAA 2IM3A 2C42A 2I1RA 2HNZB 3M2RA 2LXFA 4IFYB 2VOPA 1MMDA 2DNMA 3U1MA 3M30B 4LF9F 1SIWB 3D1HA 2JRSA 3N79A 1V3RA 2Q3PA 2CQDA 3SFGA 4WK1A 1GXUA 4J9KA 4XDCA 4QWEA 1FE4A 2E5HA 1S0VA 1F9FA 3CB4A 3M8PB 4BC7A 2JLFA 3T9NA 1U26A 3PXGa 2VA2A 3DLBA 4PG8A 2D7SA 5J2MA 3D0GE 3RZAA 3ENWA 1WHYA 3K8VA 4NLXA 5KFAA 1CG2A 3MM9A 1JKHB 3DI6B 3PIPQ 5DQGA 1S6PA 2I9SA 2DNPA 2V4JB 5MAOA 1VQ5S 4DEZA 2D41A 2CDQA 4DG1A 2OAUA 3ULHA 4UQGA 2B3TB 4F2SA 4I69A 1FNMA 3FEZA 1VRTB 1W2BR 2MGZB 4G1QA 1DTQB 4OZ1A 3WC2A 3DNCA 4B9MA 1D8ZA 3KK2A 4HH1A 4WZMA 2H5EA 1RT4B 3GG0A 5DO2A 1FRJA 3KLEA 1N8RT 1XN9A 2J6SA 2Z8QA 4DQIA 1VQLS 2HGNA 1HBUB 5B0FA 3OL7A 3FEYB 2AYGA 2KRBA 1G2EA 4I7FB 4BHQA 1X4DA 3TAMB 5CYQA 3G4SS 4K4WA 4J9RA 4TYBA 3G8SA 4BS2A 2EFNA 3SCJE 3VCDA 4X66F 4A8MP 3FVYA 5KFIA 1FKPA 2NZ4A 1ZH5A 2O01C 3EGWB 4NLVA 4OHXA 3IRWP 1HPZA 2M3DA 4YB7A 3JSMA 5KFHA 5I3UA 1S9FA 3CDUA 2ZFHA 1NZAA 4P7VA 1SH2A 3CDAA 3BSCA 2FVPA 1F0XA 5KFSA 3JYTA 3AQOA 2C2RA 4IRCA 2QSFA 3CCRS 4NLRA 1JLAA 4ECZA 2E9RX 1HFEL 1XC9A 3L95X 2LLZA 1JLQA 3DLJA 1O8BA 4Y28C 1R89A 3OJUA 1WG1A 2HS3A 3PM9A 4K4VA 2CIMA 2CQCA 1N48A 3ZZRA 3PKMA 4YR0A 3DLHA 3M4XA 2XWYA 1S4FA 3ONQA 2XC9A 1XR5A 3TANA 4I1TA 4WU3A 2MQQA 2DIVA 1C0UB 1WD6A 1CC8A 3GIJA 2W25A 3NP5A 3K5NA 3J7A1 4DSEA 2G1DA 1TKXA 2MJUA 1JLFB 4J9LA 2KHCA 4HTJA 2WBMA 3TVYA 2AYBA 2J0XA 1R7IA 4ED3A 3K2YA 2C2EA 1XR7A 1U45A 2UUAF 4I56A 2IC3B 4LSNB 3FGVA 1LKZA 2N3LA 2R7SA 4QIVA 1V3SA 2ZKUA 4ECWA 4DSLA 4A8YA 2MB0B 2CPXA 3FMBA 3C8YA 3MEGB 2ZVSA 2DNOA 1TKTA 3AY0A 3RRKA 1X4EA 1X4CA 4NLDA 5H9FJ 4DFMA 1XK8A 4AXJA 3BS9A 1WI8A 1GXTA 1C1BB 2APOA 4HDGA 1HNIA 4K4TA 4B3SF 3KHRA 3T1HF 2OFGX 2DH9A 3SQGA 1G3OA 4OX9F 4KKOB 1CLFA 1S6QB 2JLGA 4URQU 2BVZA 4ZCKA 4W90B 2C22A 2EKYA 1P1LA 1TAQA 4LF4F 2KDOA 3I4PA 4ITSA 5B0GA 3D0IE 3I4HX 4NYPA 2KFZA 1BQXA 4LVOP 1XR6A 1HQUB 5FIIA 3HVTB 2YKPA 4MFBB 2D9OA 1UWBB 4PCQA 3EZUA 4YEAA 2XULA 3PNIA 2XI3A 4J5OA 2CPYA 4ZLPA 5J2QB 5C24A 3TOQA 3HI9A 4NMLA 5HMXA 1A9NB 4OI0A 1KLMB 3FSXA 4BWMA 5F9NA 4NLQA 1WF0A 4Q0BB 3MPVA 1L3TA 2M52A 1N5TA 1KQFB 2BE2A 4U7UK 5HBMB 3WDOA 4DR5F 1OO0B 4CO3A 1JMTA 4LF8F 3BJYA 2FHKA 2EFOA 4QW8A 1BLUA 3RW7A 1J5OB 1Q82T 5E2QA 2KT3A 5IWAF 2YNFB 5KFVA 2HPUA 3T5LA 3DOKB 4ID5A 4B3OB 4ED1A 2OPSB 5E3QA 4NLWA 1VOMA 1RKIA 4MYTA 1U1KA 2UV8A 3MEEA 1WTFA 3LF0A 4P7TA 3QZ7A 3MEDA 3H20A 3FJ2A 4IOCQ 3BGFA 2AJQA 2AU0A 3DXBA 3V81A 5D6GA 5EHHA 3CJ2A 3H59A 3P5TL 1EETA 1HD0A 3LH2S 3C6UA 4TU7A 3JTNA 4A8KA 5BYQA 2K7JA 2QO3A 3VAFA 4F8RA 2MKHA 4IDKA 3HT3A 2M2BA 2EW9A 2ZH2A 3AB2B 5SZTA 1IKXA 1D9DA 4OJ3A 4TU8A 4O44B 1HWIA 2PGCA 3DM2B 2A18A 4LF5F 1YQHA 3EYZA 4IDKB 5E3CA 3MMCB 1HBOB 3T9ZA 4X65F 2VPXB 1FK9B 2ZITA 2LDIA 3K0JA 2JX2A 1YJUA 3ITHA 3LP2A 1JLEB 2G0CA 1GT8A 5KAKA 2Q1LA 3US5A 3QGPA 4R5PA 2F9JA 4ZVFA 1S6UA 3B4MA 2F3JA 2ABYA 2MKKA 3KHGA 4IOBA 1NHUA 4NCAA 1HW9A 2KB2A 5HROB 2LCWA 2B7CB 4FF4A 5I4MA 5G0RA 1Q86T 1HR0F 4YB6A 2WONA 4LUBA 3FMWA 4RX6A 4U9RA 3DYAA 4F3OA 4B3OA 3JTPA 4OI6A 2E9ZA 1AW0A 1RISA 2KKHA 1M5OC 4B3RF 3BSNA 3F56A 3CCVS 2M0GB 3QAUA 1PGZA 4DS5A 2M70A 3NLCA 4UUXA 2ZD1A 3NAHA 5AE3A 2IJFA 1MU2B 2J76E 2OPPA 1IKYA 3W3SA 5IZHA 1O0PA 2MZTA 2ROPA 4A47A 3K58A 3H2LA 1LWCB 1TKXB 4HYKA 5CH7B 4XK8C 4DPOA 2RDJA 2FB0A 4LSLB 1VQ7S 3QJLA 3ZFVA 4A8SA 5J1PA 1JLBA 4DN0A 1BQMA 2E7WA 2I0XA 2BJDA 2AV5A 2PEHA 1VBZA 3M2UB 3PX4A 3OR2A 1HHSA 3HVTA 4YMEA 4H4OB 4WFAQ 2LEPA 4JV5F 1FD2A 4DDFA 3PRDA 2CQ4A 4ICLB 4AFFA 3QGIA 1SL0A 4B9SA 2AWZA 3J7YI 4YDDB 4RLEA 1OPZA 3L3CA 1FRXA 5AXLA 1OSDA 5F8GA 5EWEA 1UJ6A 3DU6A 3SSRA 3DDKA 4ECVA 1NJZA 2E5JA 1MWYA 3JSMB 2Y0SD 3PRBA 3TAPA 2F9DA 4CNZA 3IS9B 2DTJA 1H2VZ 2UVWA 1JXEA 4A48A 2PD1A 3I0SB 4WJBA 3Q2SC 2HNDA 3MEGA 3GV8B 4JUZA 3MMBB 2OIHA 5K9FA 1FEEA 5B0DA 2MXYA 2F40A 2LA4A 1TVRB 2HS0A 3Q23A 2MZSA 3R1HA 1BQNA 1SKWA 1NO8A 1DJ0A 4C8MA 4QYZJ 2UVVA 2PSZA 1RYRA 4OQJA 2FLPA 2CYYA 1GTHA 1RYSA 2VBYA 3OHBA 2RD5C 4H4OA 3VAHA 4NZ6A 4ES2A 2W4CA 2M9KA 2QA4S 4RNMA 1VRTA