4KSEB

Crystal structure of a hiv p51 (219-230) deletion mutant
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
413
structure length
401
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDGYELHPDKWTVQPIVTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV p51 subunit
publication title Selective unfolding of one Ribonuclease H domain of HIV reverse transcriptase is linked to homodimer formation.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
total genus 104
structure length 401
sequence length 413
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4kseB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kseB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kseB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kseB03
3V4IA 4J9LA 5L1JA 4K4ZA 1S9GB 5I3UA 5KFSA 2R8JA 3T5HA 1FKOA 3I0SB 3QYYA 1RT6B 2FVPA 2FLLA 1SV5A 4I7FA 4QWCA 1RT2B 3OL9A 4ZHRA 3KLFB 4WE1A 4J9MA 2DPJA 1IKXA 3N6MA 4TN2A 3G6YA 3GV7B 4KV8A 1S49A 1JLQA 2RKIB 3HVTA 3JYTB 4ZVEA 2IAJA 2W7PA 1BQMB 4DL3A 1S97A 3DYAA 3CJ2A 4KO0A 3RBDA 1S6QB 1UWBB 4O3SA 1S1TB 2ASJA 1K1QA 1S1WB 3MR5A 5C24A 3CJ5A 4RZRA 1RTDA 2FVRA 1RT5B 4RW6A 4NLUA 3PHEA 2RF2A 4NRUA 3DI6A 1N56A 4IQXA 3OSNA 3PR5B 5KFZA 2GIRA 2B43A 4RW4B 1MU2B 1XR7A 2R8GA 1QAJA 3KK3B 1D1UA 1C0TB 3TQ1A 4RNMA 5KFLA 3RAQA 4ED0A 5KFJA 1IKWB 3C6UA 4DG1A 3DOKA 2W9AA 1TL1B 4KHMA 4LSLA 3DDKA 2B6AA 4F50A 2ZE2B 2VG6A 3QO9A 1SUQB 5F8JA 2VA2A 1FK9A 2YNHB 1JLCB 2UVUA 2WHOA 4ZP8A 4QWAA 1IKYA 4K4WA 4YR0A 4QW9A 1DLOB 3H2LA 4IR1A 4IG0B 4IDKB 1JLFB 4MK8A 1N6QB 4KSEB 4K50A 4EBCA 4I2PB 3ITHA 3MFHA 4EEYA 2YNIA 4M95A 4NLRA 1QUVA 2JC0A 3BQ1A 3V6HA 3IGNA 1S1VB 3BGRA 5J2QA 4LQ9A 3H5XA 1VRTB 4URQU 1HQEB 1LWCB 5DLGA 4J9QA 3MEEA 3DLKB 2UUTA 5KFOA 4DL7A 3OLBA 5HP1A 4PWDB 5F8GA 4IRCA 1HARA 4ECSA 5J2MB 3CO9A 5C42A 4J9NA 4ID5B 5KT4A 3SFUA 2OPRB 3QZ8A 1RTHA 1FKPA 2GC8A 2C22A 2XWYA 3DRSB 5C25B 4NLDA 1DTQA 2C2RA 2ILZA 3MR3A 1HNVB 4IOBA 1HYSB 4WFXA 4EYHB 5DQGA 3QZ7A 4IFYA 4JV1A 2HNYA 3LAMA 5J1EB 4H4OA 4ED3A 3CDUA 2AX1A 1HPZA 4O3OA 3H5UA 3HVWA 5CYQA 2YKNB 1JKHB 3DRRA 2R2RA 5HROA 5DQHA 3H4DA 4MK7A 2E9ZA 1S6PB 1R0AA 3H98A 2D7SA 1RT3B 3GYNA 4NLVA 1C0UB 1HNIA 4TY8B 3BREA 3GV5B 3V6DA 2IA6A 2XGPA 1TQLA 2ASLA 1LWFB 3CDWA 3KK1B 1TVRB 4QPXA 5DG9A 4EBDA 5DLFA 4MKBA 1RT1A 1QE1B 4H4MB 4XPEA 4RW9B 4ZP7A 5JXSA 5KT5A 2OPQA 3M9NB 4F4YA 1ZTWA 5CYMB 2I1RA 2XCAA 2HNDA 4Y34A 4ED8A 3QLHB 5KFRA 4IRDA 4PUOB 4MIAA 2FJWA 4KE5A 4NLOA 3LP2B 4ED2A 2YNFA 3G86A 4X2BA 4O4GB 4RUCA 4MH8A 1J5OB 4G1QB 1HMVB 3LP0B 4O3PA 1S9EB 3I5CA 2V4QA 3HKWA 3Q8RB 2HNZA 4EBEA 2E9RX 3KLEB 5KG7A 1DTTB 4MFBB 4ZMMA 4U7CA 2YKMB 5KG2A 2W9CB 3I0SA 3V81B 1ZTTA 3NKYA 4QWDA 4TLRA 3KHGA 3BQ0A 4ECQA 4IG3A 5KFDA 3T5JA 5KFEA 4U6PA 3KLFA 2UVVA 5KG6A 4WZMA 2OPSB 5FDLA 3M8QB 4ED7A 4KKOB 3FFIB 1K1SA 3TVKA 1TKXB 3KLIB 4RW7B 5DGAA 1BQMA 3MEGB 3NAIA 3PW4A 4QWBA 5KFFA 2BE2B 3HHKA 3NBPB 3DLEB 3PW5A 2W9BB 2JEGA 3T19A 1S1TA 3KLGB 5L1KA 4EYIB 3LALA 4Q43A 3MTKA 3CIZA 3PVXA 1RT5A 3C6TA 3M8PA 4R8UB 5HLFA 5J2NB 2ATLA 3EZUA 3I0RA 4RUAA 3RBEA 2AGOA 3H59A 3T1AA 3Q8SB 1N48A 4NLXA 1IM4A 2BR0A 5JUMA 3E01B 5KFYA 1KLMB 4RW4A 4FS1A 1KHVA 3TAMB 2EC0A 1T03A 2ALZA 4XO0A 5K14A 2WOMA 4TXSA 1S1UB 3G6VA 2IJFA 1EP4B 3DMJA 4HKQA 1C0TA 2WK4A 5KT6A 3IRXA 2OPPA 2IM0A 4Q8EA 1IKWA 4KB7A 3OSPA 1TL1A 2IJNA 3DM2B 4I2QA 1S1XA 2WRMA 2ZE2A 1T05A 4Y2AA 4IFVB 3M9OB 3FRZA 1SUQA 1TL3A 2WB4A 5I3UB 1FKOB 4FBTA 2YNHA 5J2PB 3OLAA 2F8EX 4RNNA 3IG1B 3KLHB 1DLOA 2YNGB 2R2SA 4TYBA 3MR2A 4ZHRB 2J6SA 3PJWA 4IDKA 4WE1B 4WZQA 1JLFA 3SI8A 2FVSA 1IKXB 4O3NA 5KT2A 3H40A 1N6QA 4KV8B 1BQNA 1SH3A 1S0OA 2IAJB 2AX0A 4M94A 3DLGA 3DYAB 4ECWA 1TKZB 3KJVB 1RT4A 1S48A 4RNHA 4ZVGA 1SH0A 1C1BA 5EWGA 3BJYA 1S1VA 1VRTA 2GIQA 1RTDB 2FJXA 3DRPB 1ZETA 2CJQA 4Q0BA 5L1IA 1LW2B 4WXOA 4F4WA 1HQEA 3MEDA 2RF2B 1NHVA 4EO6A 1RT7A 5KT7A 4GC6A 1RTJB 3DI6B 2I5JB 3BR9A 4JUZA 5KFHA 2IM1A 4NZ0A 3IN5A 3DLKA 2AGQA 1S0MA 4Q45A 2E9TA 1T94A 5KG1A 3FSIA 2W8LA 3OHBA 5I42B 4Q8FA 1C2PA 4ICLB 2OPRA 4TQRA 1OS5A 5C25A 2WONB 3BSCA 4QW8A 3KMQA 5KFKA 5KFVA 3C6UB 4ZPDA 5EUHA 4DG1B 3DOKB 4PQUB 1HYSA 3KLVA 2W8KA 3V6JA 1RYRA 2J6TA 1LW0A 4URGA 2BANB 2UUWA 2B6AB 5L9XA 3T5LA 3BQ2A 2VG6B 5J1EA 4XPCA 4NCGB 2JC1A 4WYWA 3LP1A 4H54A 1D0EA 4ED1A 2BQ3A 3KHLA 2XC9A 4F4XA 1NHUA 2HWIA 2YKNA 1JKHA 4R5PA 3PZPA 2HMIB 1IKYB 3JSMA 1S6PA 3I5AA 1C1CA 4R0EA 1VRUB 1N4LA 1N5YA 2R2TA 1GX6A 1RA6A 4WXWA 1RT3A 5KFTA 1REVB 5KG0A 4RU9A 4LSNB 2V0NA 2XI2A 4O3RA 4QWEA 5KG5A 1TV6B 3ITHB 1RDRA 2D3UA 4ECZA 4IKAA 1LWFA 4MK9A 1LWEB 3VQSA 4ECRA 3D28A 1JLGB 1QE1A 5KFIA 4RW8B 3GIKA 2AGPA 2VA3A 3ICLA 4RNOA 2W7OA 4J9SA 4IR9A 3IS9A 3KNAA 2V4RA 3KOAA 3QLHA 2VG5B 4ZVHA 4ECXA 5HBMA 4J9PA 2VG7B 3QIDA 4ZPCA 2ZD1B 4O4GA 5KFGA 1XR6A 4ECYA 4G1QA 1HMVA 1S9EA 1YVFA 5F8IA 1CSJA 3KLEA 1DTTA 1JLEA 2W9CA 1IKVA 3V81A 5KFXA 1RTHB 1JLBA 2B5JB 3QIPA 3ISNC 1EETA 3CJ3A 2OPSA 4DL4A 2CKWA 4NLTA 1TKXA 4KBIA 4RW7A 4K4XA 1S9GA 4HYKA 2C2DA 1WNEA 3MECB 1S10A 2IM2A 4H4OB 2WTFA 2BE2A 1RT6A 1TKTB 4O44B 3DLEA 3GV8B 2W9BA 3PW7A 1HPZB 3KLGA 3RB0A 1RT2A 4KFBB 5CYQB 3DRRB 5HROB 2WCXA 5F8LA 2RDJA 4ZVFA 3I5BA 4FBUA 3H5YA 3DOLB 3JYTA 2RKIA 4R8UA 3EPGA 5J2NA 3M9MB 1HNIB 4WFZA 2IMWP 2IC3B 1RTIB 1KHWA 3V6DB 3GIMA 4J9KA 3T5KA 2BRLA 2JEFA 4ZP6A 5KFBA 4Y2CA 4DL5A 1S6QA 1UWBA 4Q44A 1S1WA 4YP3A 3E01A 2O5DA 4IRKA 1KLMA 4NLWA 3D5MA 2OPQB 4F4ZA 3NGDA 1Z4UA 3N6NA 1EP4A 2UVWA 3PR4A 4ECTA 1XR5A 2FLNA 3N6LA 3UPFA 5KFWA 3RB3A 1JLAB 2RDIA 2D41A 1TP7A 3E51A 1MU2A 3BSOA 4IFVA 2HNZB 5D3GB 4DEZA 3GIIA 2C28A 3KK3A 4B3OB 5EDWA 1HQUB 5J2PA 4IH5A 4IG3B 3KK2B 3IG1A 4ECVA 3KLHA 3EPIA 2YNGA 4K4VA 1RAJA 5FDLB 1S9FA 3V4IB 3CVKA 5KG3A 3MR6A 1S0NA 2JEIA 1TKZA 5C5JA 3KJVA 1JLCA 3QGHA 3OHAA 1SV5B 4I7FB 2R8KA 4O3QA 5DQIA 4ZP9A 4IG0A 4IH7A 4IH6A 5KG4A 3IGVA 4MIBA 5KFMA 3DRPA 3M8PB 3C6TB 1LW2A 1JLQB 3HVTB 1SH2A 4I2PA 5HLFB 5KFUA 5EWEA 2DPIA 1RTJA 2I5JA 3I0RB 1T3NA 3QGIA 2AU0A 3NL0A 4KO0B 4URSA 4NLQA 3BSAA 3RB6A 5C24B 5I42A 2XGQA 4ECUA 2V9WA 4ICLA 1T03B 5K14B 2WOMB 3UDLA 4O4RA 2ILYA 4RW6B 4YQWA 3PW2A 3DMJB 3GIJA 1LWCA 2WONA 5F8HA 3IRXB 2OPPB 4TY9A 3KHRA 3Q8PB 2BQUA 3PJXA 4PQUA 4MKAA 2BRKA 3OL7A 4PWDA 2BQRA 4I2QB 1S1XB 2BANA 5J2MA 1T05B 4ID5A 4NCGA 4WFYA 3H4BA 1TL3B 3HVAA 2HAIA 2R8IA 4JV0A 3DRSA 4KHRA 3MFIA 4YMEA 5DGBA 4ED6A 3UQSA 2HMIA 3QGGA 4NRTA 1HNVA 4TQSA 3Q8QB 3GQCA 2UVRA 1VRUA 5EWFA 4LSLB 2AWZA 1JXLA 1REVA 2FLPA 1JX4A 4LSNA 1BQNB 3QO9B 3OL6A 1TV6A 4GC7A 3DLGB 2R2UA 1LWEA 3FQLA 1FK9B 2XI3A 1RT4B 1GX5A 4K4SA 4NLYA 1JLGA 4RW8A 3FQKA 1QAIA 1C1BB 3KHHA 3G6XA 4FS2A 4J9RA 3CDEA 4DL2A 4TY8A 1C0UA 3FDSA 4G3IA 4Q0BB 4NLPA 2VG5A 3MEDB 2AQ4A 1RT7B 2VG7A 3RAXA 2OH2A 2YNIB 3KK1A 1TVRA 2ZD1A 3CWJA 4NLSA 5KFCA 4K4UA 4H4MA 4RW9A 4TYAA 2ZKUA 3BSNA 3H5SA 3BGRB 5J2QB 5CYMA 2FJVA 2FVQA 3NAHA 5L1LA 2JEJA 4NLGA 2ASDA 2QV6A 4PUOA 2B5JA 1NNDA 2J6UA 2R8HA 3LP2A 3MEEB 1U09A 2D3ZA 1RA7A 1J5OA 4YR3A 3LP0A 5HP1B 1LW0B 5KFQA 4ZPBA 2JLEA 5C42B 4MFBA 2YKMA 3MECA 4WYLA 4K4YA 3CJ4A 3LP1B 1TKTA 4O44A 5DG8A 1FKPB 4KFBA 1DTQB 1S4FA 4R5PB 4JV2A 3JSMB 2IBKA 2IM3A 3M8QA 1C1CB 4KKOA 4YR2A 3FFIA 1N5YB 3DOLA 5F8NA 3KLIA 3MEGA 4IFYB 2HNYB 2IC3A 1RTIA 4Y3CA 3OL8A 3RB4A 5F9LA 5KFPA 3NBPA 4OL8A 3UR0A 3KMSA 2HWHA 2C2EA 5KT3A 4J9OA 1R0AB 3IS9B 1W25A 3GILA 2XCPA 1JIHA 5KFNA 5DG7A 4NYZA 1RYSA 4LQ3A 5HBMB 3V6KA 4DL6A 1JLAA 4EO8A 3CJ0A 2QE5A 1RT1B 4K4TA 3TAMA 4ZPAA 3SFGA 5F9NA 1S1UA 5D3GA 3NMAA 3LANA 1I6JA 2FVCA 1JLEB 4B3OA 1HQUA 2HNDB 1IKVB 5T14A 4RNFA 3LAKA 5F8MA 3KK2A 3ISND 1JLBB 4KAIA 5KFAA 3PW0A 3QIPB 2YNFB 1EETB 3DM2A 1MMLA 3MF5A
chains in the Genus database with same CATH superfamily
4K4ZA 3TZYA 2W4PA 2FLLA 1CBKA 1SV5A 1BWVA 3TP2A 3OL9A 1PJ6A 4TN2A 1UVJA 2IVYA 3KJNB 4G1IA 5A2QU 1S1TB 4PEOA 2NPFA 1RTDA 4A8QA 4P9SA 2RB7A 3H0PA 1UW4A 3BGLA 1ZBTA 4NA1A 1C0TB 1QTMA 1L3KA 5KFJA 1IVZA 3OJUA 3DDKA 3BBFA 3DHWC 2GVDA 2F1FA 1EZZB 1NUEA 2EKNA 4DV4F 4ZPWR 2XMVA 5D4NA 1KOHA 3JQKA 3PX0A 4D3HA 4L6V3 4UOGA 4JI5F 3BS9A 1WSRA 2C22A 3C14B 2WB1D 5B7WA 3WIUA 4WKRA 1EB0A 2EG1A 4PZVA 1NRKA 3OVAA 1RWPB 3X3UA 1HLWA 5DQHA 4MK7A 1TMMA 1HWLA 2DK2A 4NA2A 3O3LA 2ZJPQ 3J7AN 2DITA 1TQLA 4MKBA 4LF8F 5JXSA 3PCOB 4USKA 2Y8WA 3ZZTA 4ED2A 1EKRA 2W9CB 1OIAA 1ZTTA 1R8CA 1YJ9S 3A1YG 1PIEA 2D69A 2UVVA 1HWUA 3N01A 3KLIB 4FNHA 3SSSA 5L1KA 1NMEB 5LXRA 2MKIA 3M8RA 3K2YA 2V34A 3FZ2A 2ATLA 4GKKJ 4ZCLA 3RBEA 2KN4A 3H59A 2KFNA 4CLTA 4RW4A 2IJFA 3DMJA 4CTAA 4JI3J 1X9WA 3OR2B 1LWXA 1NAQA 3EJMA 4DV2J 2E5JA 3M1VA 4A8SA 2CPEA 2V63A 2FVSA 1SH3A 2IAJB 3IRWP 3DYAB 1TKZB 3T6BA 1N36F 1S1VA 2A3JA 1VHFA 4ZVTB 1HNZF 3KXDA 1RT7A 1FNMA 3CMES 2VB6A 4M8LA 5A8KA 3TYTA 4OLPA 2F40A 2ZFHA 3C6UB 3H20A 2DRDA 4URGA 4Y65A 2HWTA 3HFKA 4HH0A 3PTWA 3CC2S 2YKNA 3JSMA 4UT4A 2KRRA 5KG0A 4RU9A 3EVOA 3MAHA 2RS2A 4B17A 2FC9A 3TZZA 3KNAA 3SV3A 2EKYA 2SXLA 1S9EA 3D7SB 3W2VA 2IA0A 5CZVA 1OSDA 1VGYA 2BA9A 3R1HA 1FEEA 4DL4A 1FRLA 4RW7A 4IOAQ 1TKTB 4O44B 9ATCB 4H4KC 1RT2A 2RDJA 4YY3F 3DGPA 3EPGA 2RKIA 1HNIB 4WFZA 2HGLA 3Q24A 4DPXA 2HZVA 1MLAA 1JMTA 1X4BA 2Z8QA 1Z4UA 1N34F 2BKNA 3WQPA 3AJ1A 4C8MA 2J7UA 1ZA1B 2EBGA 3O6QA 4DEZA 4BLGA 2C28A 3FCWA 2YPYA 1S9FA 1YG0A 2ZZTA 1FE4A 2ZH7A 2QLBB 2LDYA 4IH7A 5KG4A 5KFMA 1SH2A 1LK5A 4K2XA 2U2FA 2AU0A 1SKUB 3JAMU 4DV1J 4KYZA 4KHPJ 2MZTA 4TVAB 3B54A 1FDNA 4D3GA 4CLUA 4LSZB 4TKTA 2QSWA 4JV0A 1XNRF 1V9OA 3O1LA 2CIMA 3NY0A 2OEJA 4K4SA 3RBZA 3W3SA 1BE4A 3MPYA 1OPZA 5GAGI 2VG7A 1J5EF 4OYBA 1UEKA 5CYMA 1YJWS 3NWGA 2CQHA 3WIVA 4I4BA 5H9FJ 5KFQA 2MLZA 4BS2A 2CG4A 1RADB 3CO0P 2CZ9A 2VZ9A 3M8QA 5F8NA 3ENVA 3H25A 4O23A 1R0AB 5B0GA 2XCPA 3X1LB 3VAHA 2PI4A 3GCXP 3M7VA 2U1AA 2HIQA 3SFGA 5D3GA 3KG0A 4C8KA 2FVCA 2RSQA 1VK3A 3K8VA 3KK2A 1JLBB 4OI2A 1XK8A 2BDPA 2XMMA 1S4EA 4EZ9A 2R8JA 3RYLA 4ZHRA 2R9LA 2XMAA 3N6MA 1KP6A 2YTCA 2HQDA 2ASJA 2M7SA 2X3DA 5HJXA 2XG8A 2NQPA 1I94F 3POTB 3L09A 5KFZA 2FB0A 3FEXB 5FIIA 1D1UA 4QR0A 5IWAF 2DNKA 1HI0P 4ILLA 5EGYA 3OTOJ 2DJWA 2PA8D 2YNHB 2WHOA 2X51A 3EDRB 1WEZA 5KAKA 2JC0A 3MWBA 2O1PA 1YGYA 3QFHA 5HMYA 4PWDB 4LF6J 3LH2S 1VCTA 1V5IB 1YI2S 2ZHAA 1VQ9S 1UP1A 4WFXA 4J5OA 4N8OA 4DSKA 2PGCA 4NX9A 1H72C 2XSJA 5HATA 4NLVA 3BREA 3R3TA 3CJKB 2JLFA 3HHLB 4XPEA 2W7AA 4ZP7A 1UL3A 5IQQA 2XCAA 3TQEA 3MMAA 4O4GB 3HKWA 2E5HA 5I3PA 4AFFA 1OQ3A 4U6PA 1RWNB 5DGAA 3PW4A 2JEGA 4NYPA 3CIZA 1L3SA 2KXHA 3W63A 5J2NB 1Y4ZB 1ZS6A 1JWWA 2W2NP 5E3CA 3OTEA 2DGTA 2ZM6J 1Y3JA 4EWTA 3TW0A 3DM2B 3DLHA 3LGMA 2R7RA 3M9OB 2WB4A 5I3UB 5C2GA 4USTA 4FBTA 5J2PB 3NG8A 3QQCD 1REGX 3IAS9 3IXQA 4MKYA 3NWRA 2XMJA 2HHUA 5EWGA 1UVMA 2GIQA 1F2GA 3M8SA 3CT9A 1FXLA 4JUZA 3IN5A 3DLKA 4RBUA 3LA0A 3OHBA 1SIWB 1NPPA 2H54B 5LMNF 1C2PA 3MM6A 2GHPA 4ZPDA 4ELVA 2VG6B 5J1EA 1GQEA 2JC1A 3MD3A 4DXLA 3KHLA 3L4BC 3NP5A 1VRUB 1JK9B 3EMTA 5ETVA 4QJVA 1Q7YT 4O3RA 2MQMA 3ITHB 2PSZA 5FLXU 4MK9A 1LWEB 4DWIA 2CPFA 3IR5B 3CCRS 2Y0BB 4F3MA 4Y28C 1DBDA 3TVYA 3MUMP 4NXNF 1RGVA 3K0JA 5IXUA 3R2CJ 2KVQE 2YQ3A 3SDEB 3CJ3A 2PMHA 5A0YA 5KTQA 5EHHA 5CYQB 2F7VA 1AFIA 3AH6A 3HLUA 5L39A 5H9EJ 1U6FA 4MT1A 4LF7F 4WU3A 6FD1A 3BDEA 4OI1A 2NXNA 2PEHA 2AHOB 2K2PA 8RUCA 2YWGA 2CPYA 2FHMA 3HF5A 3ZFVA 3O2IA 4B9LA 1RWKB 1TUVA 2UU9F 4L3KA 2BJEA 4DV7F 1AFJA 3AB2B 2VFRA 3JTPA 4IG0A 4DX7A 3IGVA 3DRPA 2ZVSA 4LBHA 5I4MA 1TUGB 1IR2A 5AE1A 1WJ9A 2DT9A 3W7BA 2DNQA 4ECUA 1MROA 2WOMB 4WFAQ 4XK8C 4YQWA 3FSXA 3C8YA 1RAOA 2UUCJ 2OPPB 2V4JA 1DQ9A 3OL7A 1S1XB 3ULHA 4CO4A 4KHRA 1VJQA 4TQSA 1HNVA 1UVLA 4ZVOB 4F0MA 2ZH1A 1TV6A 4B9VA 2BM0A 5AXMA 1GX5A 5E3PA 1FNOA 3A8EA 1CULA 2KYXA 4QQBA 4G3IA 2AYMA 1NDCA 3KK1A 4YS2A 2W2MP 2QRRA 2FJVA 1M1HA 1NNDA 3NS6A 3MEEB 1KTVA 3CCSS 2AMCB 3BGFA 5DG8A 3W62A 1E6VA 4FXVA 3NMRA 4KKOA 4NCAA 2DVIA 4U67Q 3KG4A 5KT3A 2DH7A 5CAAA 4J9OA 1IBKJ 2G0CA 3GILA 3FEYB 4CO2A 2ZITA 1SB6A 1I1GA 2K1RA 3CTRA 2AEJA 1MNEA 4ZLLA 4E0DA 1WOSA 4ZS6A 1KQKA 2F8MA 4LF9J 5J1PA 1RAHB 1FKOA 1PBAA 2F63A 2MJUA 2FVPA 3A3NB 2HPUA 3G87A 3QBCA 2DPJA 3G6YA 4K0KJ 3GV7B 2NYHA 2C1EB 2ZH6A 3QWUA 4LR8A 4P10A 3EVMA 2GZOA 4OHWA 2CPDA 1ULRA 4PWWA 3RAQA 3M30B 4KHMA 3QO9A 4CZCA 3UN2A 1IKYA 3KDOA 1N6QB 1MW7A 5E41A 5ETSA 2ZZNA 2DGUA 1QUVA 3B82A 3FCHA 1IM6A 2VHGA 3K89A 4NZ7A 2B4UA 2MQOA 1NK8A 2DY1A 2LQBA 5DQGA 4B3RF 3QZ7A 4QU6A 5F41A 1NBEB 1BC6A 2GVZA 1S6PB 1CPZA 2IRYA 4WBFA 1HFEL 1RJJA 2G13A 3L7UA 2K3IA 4EBDA 2QX0A 3FJ2A 4NMXA 1ZTWA 1G6BA 1K8AT 5M2RA 2VOPA 4PUOB 2FJWA 2HKEA 2K8GA 4G1QB 3LP0B 3G2XA 4NE9C 3KLEB 3JSYA 2BBEA 1WF0A 4OHVA 2KI2A 4K59A 4ED7A 1YRXA 1G4CA 4DFMA 3FFIB 3G8TA 5KFFA 2JL9A 2MQQA 4YHHF 3C6TA 1P27B 4C6AA 2AGOA 5LJ5Y 3MR7A 4G65A 3C19A 3E01B 2ZNZA 1EP4B 3EZOA 3UDCA 3BYRA 3ZTPA 2XY5A 5EX3A 3PJWA 4X4RA 3R5DA 1S0OA 5B0FA 4ERDA 2DR9A 1RTDB 1HR0F 4LVOP 2CJQA 3SZ2A 1NHVA 4LVNP 1RHQB 4F8RA 2A18A 2CVEA 4TQRA 5JJBA 1VQ5S 4FYDA 2F8HA 2DEJA 1HYSA 1HWIA 3PDNA 4F4AA 5L9XA 4J90A 3BQ2A 2IRUA 3KKFA 3T1YJ 1FESA 2BQ3A 4F4XA 3DGVA 2G0IA 2YQ1A 1C1CA 2L9WA 4OX9J 2XO6A 5L38A 2LXUA 4XDCA 2N3LA 3R5BA 4DCPB 2OKQA 3W66A 1SJ4P 4KJIA 3BF4A 3QIDA 3P5TL 3UWTA 1S5ZA 5B0EA 1QAYA 1PAEX 1IQZA 1XWLA 2QGFB 4LR9A 4ETZA 2CKWA 1WF2A 1NJXA 2HS4A 2BE2A 1Y00A 2M8HA 2YY3A 1IJFB 4QIGA 1TL7B 1S0VA 3DOMA 2MZRA 3MHYA 2ZH8A 4N7TA 3BPSP 3PM9A 3MM5A 1MWQA 1NH7A 2DIVA 3J81Y 2D41A 4ANEA 2G2YA 2GA7A 2OLWA 2CPZA 4W4MA 4BCAA 5T7LB 2RRNA 3MOZA 2H9ZA 1JLCA 3IBFB 4IH6A 2GNKA 2QLFB 3HVTB 1RTJA 1CG2A 3HCXA 4URSA 5A8WA 4OZNA 3RB6A 3BSAA 2FDNA 1NZ8A 2MGZB 1U8SA 4RW6B 3DMJB 1Y7PA 2OEKA 3PACA 1JJHA 2BANA 4ID5A 3QFWA 4ED6A 3D3BJ 3M1VB 4F3QA 1VQNS 2MKYA 1M5KC 4LSLB 1REVA 3VGUA 1Y5IB 3MUVP 3B6BA 5BR8F 2GIFA 4DF8A 1TK8A 1G1XA 3WDOA 1IBMF 1RT7B 1X4AA 2XULA 4K4UA 4USMA 1U24A 2L48A 5A8KB 2FVQA 5L1LA 4LF5J 5THWA 3P45B 2CYYA 1EAYC 2QTWA 1RA7A 1LNQA 1KLNA 4DX8H 1N5SA 4PG6A 1VYAA 1FKPB 4W90B 3MURP 1DTQB 3JSMB 3AB4B 3EGZA 1NK7A 5KFPA 2GQ2A 3ZZPA 5HVFA 2A10A 3SQGB 1GH8A 1T8EA 3EGVA 4FF3A 2XTJP 5F9NA 2C42A 3W2VB 2HNDB 1GAOA 2QLJB 1VQYA 3V4IA 1YBAA 1CJVA 5KFSA 3RRHA 2MKJA 1RT2B 5K8NA 3JTNA 2XS2A 1S57A 1S49A 2RKIB 1ZM4A 1BQMB 3OR1A 3UFCX 3CJ2A 5CD4H 3RBDA 3TUPA 5HQMA 2VPXB 4NLUA 3PHEA 1XNRJ 4ENOA 2KM8C 4NWBA 1PCAA 4OHZA 1U1PA 2B7CB 2IMOA 2MJNA 4P6QA 4A8MP 1S72S 2EPIA 4B3SJ 1DLOB 1YBUA 4PRFA 4YEAA 2D1CA 3MXHP 4AD6A 4PQAA 3G4SS 4DLGA 1PAUB 4LQ9A 4IUFA 2BJ3A 5DLGA 2RQKA 3TX8A 4OJ1A 1TELA 2VDHA 4K8RA 4KQZA 1RWVB 1CQNA 4B9UA 2V2QA 2PT0A 4CLYA 2G2ZA 3H5UA 4PG7A 4DR5J 4BC9A 4ILMA 1FXDA 4TLQA 3QRPA 3V6DA 5HMZA 1HNXF 1LWFB 3Q2TC 4QPXA 2ZKTA 5IC4B 1R8BA 5CYMB 4KPYA 4C3MA 4DV3J 1HBUA 5L8RC 5KG7A 4QWDA 3V81B 4IG3A 2Q1LA 4WF9Q 1FFWB 4F0HA 3M8QB 3IP0A 5ETOA 4WP8A 2QYCA 1H73A 2DR7A 1K47A 2JFKA 3MTKA 3T41A 5CA5A 3L9ZA 2UZAA 1OYEA 2MSSA 3OJSA 2GFFA 2GW8A 3G8SA 1RHUB 3IRXA 3GFXA 1H2TZ 1PJ7A 3ENAA 2WSFC 2MLYA 1WOOA 1UA1A 3FRZA 1TL3A 1YDLA 4JI6F 1OO0B 3M2VA 4ZHRB 3K5MA 2VKZG 4M94A 2PI5A 5DM6Q 2I6WA 4ILRA 3BBCA 2XYPB 1T94A 2WSEC 2V5HG 3MAQA 1QUPA 4ELUA 4X4PA 2DNHA 3WX4A 5C25A 1XC9A 2UXDJ 2J6TA 3R2DJ 1H6KX 4NCGB 4OJ3A 4ZIWA 1ROFA 4DFPA 5KFTA 2R7QA 3AOBA 2XHCA 5KG5A 2D3UA 4IKAA 2NCKL 1X0PA 1NJIT 2VA3A 1S6OA 3LGNA 4J9SA 4PCQA 4ZVHA 2OELA 4J9PA 2IYIA 1RAIB 1HQ2A 1UWAA 1IKVA 4BBYA 3MM7A 2C2DA 1HHTP 3DLEA 2OTLS 2DCUB 3HHLC 1FX2A 2XSJB 1SKWA 2RMLA 2CQ3A 3BR8A 3EM1A 4DPUA 4ZP6A 5DDPC 1S6QA 1RK8A 4ZKAA 1XR5A 4F36A 3UPFA 4M5GA 1T9TA 4JI1F 4S0MA 4OV1A 2B51A 1JJ4A 5GADU 5AXNA 3CVKA 1UJ6A 1WF1A 3A13A 1D8ZA 4I7FB 3ET6A 4ZP9A 4MIBA 5HQLA 1PYTA 4ZVQB 3D3CJ 1X31C 1AUDA 4MIWA 2QJ3A 5F8HA 2GJIA 3CC7S 1S76D 4WFYA 2DXEA 1XBWA 5DGBA 1U1QA 1H2VZ 1U0HA 2WSCC 1F9FA 2CNKB 1Q95G 2MKKA 3J80Y 5CH7B 1ZPWX 1C0UA 3FDSA 4ALZA 5B09A 3LWLA 2MPUA 3LP2A 1AXQA 3MM6B 3NOCA 4AQYF 3K5NA 1R7IA 1SJRA 4WYLA 4NEYA 2IBKA 2IM3A 5A8RB 3FUYA 3MD1A 3W9IA 1Q5VA 3NGTA 3RB4A 4KR0B 2QEXS 3D4JA 1KEKA 1FHTA 2NR0A 1RYSA 1KBRA 5BYQA 2B9EA 3V6KA 1EARA 3EZ5A 2UU9J 1H7XA 4DV7J 4LFAF 2YKPA 4RU2A 3LAKA 5LMUF 4I56A 4AT1B 3SXLA 4NYOA 1H74A 4YB5A 3R6LB 5IT9Y 4QR2A 3L3CA 3OD2A 5C24A 3FBBA 3CGIA 1RT5B 3P6YC 3N5FA 3DHXA 5HAOA 2DHGA 1FJGF 1L5UA 2LEPA 2QN6B 2BE7D 4ED0A 1FTCA 1KTQA 1VQ8S 2QFIA 1WC6A 4PG4A 4C7QA 5ETTA 3MMBA 4P2FA 3GONA 1URNA 4IG0B 4DR6F 3ZZ0A 4OZJA 5A2QY 3MMJA 2XLIA 1HQEB 2V4JB 5A76A 5BYSA 5HP1A 1QAXA 1HNVB 3HVRA 4IFYA 1V5VA 1HPZA 4X66J 2IJRA 1JKHB 2Q6CA 5HJYA 1CULB 4A8WA 3DRYA 1TL5A 2IA6A 5SZTA 3SCLE 3KK1B 1Q8LA 2ZDPA 3I9V9 1FXRA 5K5MA 4CO1A 3QLHB 4IRDA 4KE5A 4NLOA 1QSYA 1HMVB 2QA1A 3TZWA 4EBEA 4X65F 3CJRA 2H51B 4IR1A 3CULA 1WKJA 6AT1B 2IVMA 4KKOB 1BUXA 3N28A 4P74A 2W9BB 2Z4PA 3KLGB 1S1TA 3GSIA 1SL1A 3NCQA 3CF5Q 2K1RB 2ALZA 2VOOA 4AUKA 1C0TA 1QDUB 3MM9A 3VWSA 3UW1A 1KQGB 1FKOB 2QL9B 3OLAA 1JNRB 2DHHA 2CNLB 3D0HE 7FD1A 1WTFA 5DDRC 3I96A 3KTQA 4CLKA 4Z7YA 2RILA 3VHQA 3HT0A 2ZC4A 2FJXA 4C0OC 4WXOA 1LFWA 3W64A 1B64A 4GC6A 5KFHA 2I5JB 3U7JA 2NZCA 3DU6A 4P2XA 1S0MA 3IWLA 2MKCA 4JB8B 4DPWA 4ICLB 1MN7A 5KFKA 3C14A 4OFZA 2KG0A 1NKEA 3HSJA 2Z57B 3EICA 3SSQA 1IKYB 3UI3A 1N4LA 3B78A 1IBCB 4OJHA 1RDRA 4CCHA 1N52B 1RAFB 4RW8B 2B7BB 3ICLA 4Y2KA 3N79A 3HX9A 1FO1A 5HBMA 4PAAA 4HLBA 5KFGA 1WWHA 1YX2A 1SCJB 1JLEA 2W9CA 2NSCA 1YK9A 3W1YC 4YHHJ 4CWBA 3AA8A 4K4XA 2VD3A 2GVZB 1V3SA 4KFBB 3JB9k 3H5YA 4EGLA 2VODA 2P6SA 2C2KB 2YWKA 1X4GA 1ZH5A 1S1WA 1QSSA 3PJ9A 3NGDA 3OR2A 2QFJA 3BSOA 3E51A 4P7VA 2LQ8A 1HQUB 1CJUA 5D0EA 1SKRA 3C46A 1RACB 3MR6A 3C66A 1S0NA 5J1NA 1TKZA 3OHAA 5DQIA 1U8WA 3C6TB 1JLQB 5D0GA 1YZ7A 2OFGX 1PKUA 4EZ6A 2ILYA 1F3FA 1LWCA 4GKKF 2YBVA 2HAFA 3T1HJ 1Q16B 3UR3C 1FX4A 3ZTOA 3H4BA 3UQSA 2FPHX 2ZDOA 2I2YA 2UVRA 1R6YA 3D2WA 2AWZA 2XEXA 3FGVA 4GC7A 4X62F 3LPYA 4DV2F 3C15B 4DL2A 1UKUA 5DDOC 3CJSA 2AQ4A 2G9OA 3CWJA 1UA0A 3JAMY 3VAGA 4ED4A 2DGXA 1IJEB 2LEAA 5DRKA 2DCLA 4MFBA 4DN9A 1TKTA 4O44A 1B7FA 2W24A 3MAAA 1C1CB 1FFGB 2CDQA 4CLLA 1BGXT 3KMSA 4N5SA 2HGMA 3IM8A 1SJ1A 1SQEA 1T3OA 2DO0A 1RZMA 4JI7J 3RJMB 3WBZA 2R3VA 2J8AA 3OFGA 3C16A 4DL3A 2AW0A 2JH3A 3MR5A 1YITS 3I32A 2FHJD 2RDDA 2PD1A 4XTTA 3D1OA 1IKWB 3DOKA 2GHVC 4GRSA 2W9AA 2HFUA 3OFEA 3NNAA 2ZUAA 3ONQA 2V8GA 1YRUA 1JLCB 2UVUA 2R7SA 1Q8IA 4K4WA 1FKAF 1JXEA 3M8ZA 1JLFB 4N77A 1SL2A 1TKDA 4MK8A 2AT1B 4USHA 2E7WA 2HURA 1PJ5A 3JSRA 4M95A 3M6VA 2CJBA 4LUBA 5A8WB 2V94A 2PMZD 4URQU 3AJDA 4J9QA 2XQCA 2CNNB 4HT7A 4DV1F 3HSGA 4ID5B 2XHWA 3CCTA 1SC6A 4NLDA 2C2RA 1FI4A 3BKTA 1U7LA 1YTYA 2GO9A 4C8NA 1R8PA 4O3OA 1DHMA 2E9ZA 5HROA 4KTQA 1S77D 1R0AA 3GYNA 1FRJA 5DG9A 4USIA 1QE1B 5LSOA 1U1RA 2OPQA 5C7PA 3N0VA 3J81U 2I1RA 2DD8S 3P4UB 5AXKA 2VC0A 3HZEA 4RLEA 1UPMB 1XMOF 5A6WA 1DTTB 3GFHA 2F3JA 4DZDA 4OZ0A 3HM9A 5F0WA 3R5AA 3R7BB 2KH9A 1Y3KA 1N5TA 2X1AA 2DGOA 5JUMA 2ZH2A 1CS4B 1RAGB 5K14A 3KNGA 3G6VA 1M5VC 4M1KA 3NGUA 1WSVA 4I2QA 5A6PA 3AXMA 3M8YA 1CJVB 2XB2D 1X5SA 2YNHA 1AT1B 2HFNA 2R2SA 2J6SA 4KRWA 1PYSB 2FTRA 2D3O1 1B0PA 2AJFE 4HEA9 2FUG9 4EO6A 5HQ8A 3BR9A 2F9DA 1OS5A 1NK6A 2ZNYA 1RWWB 3SYZA 4PQUB 1DFDA 3PRBA 3UCZP 1HNXJ 2HWIA 4JV5J 3PZPA 4ZVPB 4RKUC 1GX6A 1RA6A 2FZCB 4ES1A 2E29A 1LXNA 1JLGB 3M6UA 4LIRA 4NASA 2RQCA 4K5SA 4O4GA 4RL1A 3D6TB 1CSJA 2GV1A 2VBZA 4IQMA 3AD9C 1VLOA 5IT4A 1IUJA 1S9GA 3PW7A 1Z2ZA 2G1HA 3RB0A 2B56A 3QNWB 3V5RA 5J2NA 2N7CA 5FLXY 3V6DB 2WAQD 4Y2CA 1UAWA 4Q44A 1ELOA 2M8DB 3LWMA 1MSWD 2X1FA 5AE3A 2B4VA 1XTZA 2JSXA 4DR7F 5J2PA 4IG3B 5H9FK 3BGOP 2KT5A 3TUZC 3GG0A 4OX7A 2DH9A 1RHJB 4ZPTR 2R8KA 4OQJA 3CSKA 4DS5A 1K0TA 3QPIA 2V9WA 4PABA 4O4RA 3L7OA 1LQ9A 4XIUA 4DUTA 3IRXB 2DRBA 4JBCA 4MKAA 2BRKA 3GU0A 2KFZA 2XWXA 3HD1A 1TL3B 3HVAA 2M5YA 3OBIA 2KFYA 2EVZA 3M2VB 1VRUA 2CQIA 4WWSA 5IOLA 1JXLA 2E44A 2ZJRQ 1R31A 2MY7A 1YLXA 2B9WA 1LWEA 2ZBCA 2XI3A 3HPOA 4DR1J 1NJWA 2YNIB 4IO1A 4LRCA 3VTIA 3I6PA 1T02A 2LLZA 5IT0A 4OZLA 3J7ZT 3BZQA 3SDEA 2MKSA 4FXDA 1VHIA 2I38A 3ZZOA 3GG1A 3NBPA 2ASYA 2HWHA 3W60A 4JI1J 1OY6A 1OY8A 2F5GA 1CJKA 3M4XA 1SPBP 2AJ1A 3NMAA 3LANA 3LQVA 4O0NA 1IKVB 3VZHA 3RZAA 4KAIA 4UQTA 5ETRA 2YNFB 3MM7B 3TJ9A 2LYVA 3BO3A 2A6OA 4WE1A 4QCLA 3HHNB 4ZVEA 1WEYA 3TA0A 2DY9A 3R9LA 1S6QB 1WC1A 3CJ5A 3BYPA 3SMZA 1FFSB 5HVGA 4IQXA 2CUYA 2XNQA 2R8GA 1ZAWA 2VPYB 1HW8A 3RW6A 1TL1B 1LFPA 3TJAA 1WACA 4ANCA 4ZP8A 1SQGA 3ET6B 3THPA 2VFVA 3GB0A 3QGPA 4J37A 3TEHB 1D8YA 1SJQA 1KVIA 3L95X 2XS5A 1T9XA 3MEEA 2B9XA 4K5RA 2UUTA 3TUJC 2K06A 5F8GA 2HHXA 1FWPA 2AP6A 3CO9A 2OI2A 3UCUP 4ETXA 4A48A 4ZK7M 2B8QA 2UUCF 2KKHA 4P2MA 2V68A 4LFCF 3GCWP 2C2NA 5LOQA 1C0UB 1U1OA 2KXNB 1FJ7A 4OZ5A 3CDWA 5LMUJ 1VQKS 5D4LA 1KNZA 2EK6A 1APSA 4OIXA 3LP2B 1NXIA 1RKJA 3ISZA 3EUNA 4O3PA 4QYZJ 3Q8RB 4ZMMA 3TRGA 3G9CA 3IAM9 4YDXA 4DR2J 2FJBB 2EEYA 3HHKA 3R5GA 1FJGJ 3LALA 4PYAA 3I82A 3M8PA 4PXCA 1WC3A 3P3DA 3Q8SB 1KHVA 1IBKF 3NRBA 2VPWB 3S01A 4PG5A 3WX8A 1CJTA 3D6FB 4FYXB 4UY85 1QVGR 1SQFA 3J80U 1TMJA 4LF9F 4WZQA 1N6QA 1BQNA 1C1BA 5H9EK 3DLBA 3ZTSA 4K0KF 2EFNA 3K59A 4F4WA 4C8LA 2CJAA 2DHXA 2CADA 4NOHA 1BLUA 4N47A 3TA2A 3CUNA 1R0BG 2OP5A 4R5PA 1S6PA 4R0EA 2COLA 4UQGA 4WXWA 3A8IA 2LFVA 1I3OB 2LKZA 4I1TA 2J5AA 5AJ3J 2AGPA 5KFIA 4RNOA 4X65J 2YWWA 3M32A 3SBMA 2V4RA 2Z2YB 2V8PA 2ACYA 4G1QA 3KLEA 3GWCA 5K8OA 2KT2A 2VV5A 3UN5A 2OMOA 3TUIC 5ETKA 1S10A 3CD7A 5CCLA 1KRPA 1HPZB 3BO2A 4V19X 4KGXB 1DAXA 4FYVB 2E5LJ 4J9KA 1H0HB 3B4MA 3BM7A 2C3OA 2RQ4A 3E01A 1CQMA 4FNIA 1F3VA 2E7XA 1EP4A 1FRMA 3N6LA 4QZVB 1Y11A 1MU2A 1XQIA 3KK3A 3V4MA 5HI7A 3W2WA 2E66A 1S7HA 5GMDA 3SCIE 5GAHU 3QGHA 3N9UC 1R3NA 2GAHC 3DDIA 3K57A 2HVIA 3OFHA 2NS1B 2XGQA 4WP3A 1TL4A 4XAKA 3UDLA 1OYDA 2MY8A 3P8BB 3MM9B 3A12A 1KONA 1HBNA 3GZ7A 4NRTA 4FF2A 2ZC3A 1JQGA 1EJ7L 3ETOA 2G0JA 3ZNJ1 4RUBA 2MLXA 3RAXA 1NJYA 3BSNA 3H5SA 3DXBA 3CDAA 4OYIA 5B0BA 2DIUA 2YX7A 2CQ1A 1RSCA 2Y1RI 1NSQA 2R7OA 3EXCX 1TL7A 2PE8A 3PRDA 2DNRA 5DJBA 3T1YF 2ZBQA 3OVBA 1FWLA 2YQ0A 4OX9F 3LPEA 5HBMB 4CO5A 2A0FB 3TI0A 1NK9A 1JLEB 1DJ0A 1N5QA 2Z2ZA 5T7LA 4IOCQ 4I6AA 2NSBA 3HHLD 2ABYA 5RUBA 3IBCB 4PPDA 3HVTA 2C3UA 1S97A 1S1WB 3AODA 2MGZA 4Y0FA 4RW6A 2QYGA 2RF2A 3DI6A 1N56A 1O0PA 4A46A 3GSDA 1XNQF 3HZGA 3QSYB 1XMQJ 2DXFA 4X62J 1CJUB 4DOZA 3Q22A 4LSLA 4F50A 2ZE2B 2V67A 1N33J 2L9DA 1X9MA 4MAKA 3GPAA 2H48B 4KSEB 3LOUA 4GMKA 1CLFA 1F0XA 3TO8A 3HJVA 5IV4A 3N4WA 4UZBA 1RAEB 3BN4A 1LWCB 4OYMA 4AE5A 1T9YA 3ZTQA 3UD5A 4J9NA 3SFUA 3H8YA 1RTHA 1FKPA 3UD4P 1DTQA 1NO8A 4E98A 2MQNA 2VJVA 2VQFF 2DR8A 2R2RA 4N8NA 1U1MA 3SQGA 3OXFA 1IBLF 4OYAA 2M70A 2ASLA 1N88A 2CQBA 4EK2A 4F4YA 3RG6A 3PHTA 4KY3A 2HNDA 4ED8A 2ZWOA 1U02A 3FSYA 4MH8A 1RLCL 1OPIA 2E9RX 2AKWB 4MFBB 4LF5F 3MAAB 1NU4A 1FDAA 4C9DA 1BQMA 4ZJOA 2UXBJ 2FD2A 2OD4A 3PYEA 5B0DA 1P1TA 2QG9B 4Q8EA 1UZHA 3NGKA 2QO3A 1VR6A 1T05A 4IFVB 3IG1B 1DLOA 2YNGB 3PEJA 3C16B 1TR0A 1UVKA 3OPKA 3UNGC 3UCGA 3DRXA 2DNPA 2VASA 4NZ0A 4Q2LA 1S12A 4RWWA 3I4PA 3AD7C 5EUHA 4QOTA 3DOKB 2HHSA 1LW0A 4CDIA 4HHHA 5D77A 2HMIB 4CH0S 4DF4A 4DUYJ 2FYXA 1Z1ZA 2ROEA 1LWFA 2HQ3A 1XMOJ 2NZ4A 4DFJA 4B3SF 3GIKA 1X9SA 4DDFA 2P9EA 2ZVIA 4C98A 2VFUA 1U25A 3EGNA 2B4PA 2VFTA 3BV8A 3V81A 4OZ1A 1GNKA 4OLOA 3S7RA 3B4DA 3R7NB 1SJFA 4FF4A 4A8YA 2XY6A 4K2JA 5HROB 3CCVS 2LA6A 2IC3B 1HA1A 1I51B 3G82A 1UWBA 3DCAA 4DBQA 2XZDB 4IRKA 4DR5F 1G7CB 2OPQB 1BHNA 2QT7A 2B4OA 1VC5A 3M2UB 1JLAB 2RDIA 3AQOA 2GMJA 4FKXA 2YH0A 4B3OB 4DV3F 1Q7LB 2B3TB 4TU8A 1JNZB 1QM9A 3O44A 4LBIA 3FBEA 5HANA 1V3ZA 2CPIA 2HS0A 5KFUA 1OY9A 1NKBA 4NI2A 3GJRB 4MKVA 5K14B 2R4FA 3GIJA 3QATA 1HBMA 4I2QB 2PN6A 4GO5X 3FC9A 2VIHA 3HSZA 4NCGA 4M5DA 5DM7Q 3MFIA 4HDHA 3Q8QB 3A8JA 3FNNA 4X4QA 3DDNA 2M2BA 1YJUA 3HXMA 4L73A 5E0OA 4DUZF 2RU3A 1FDBA 3KHHA 1PO6A 2MMYA 2UV8A 4PYDA 2OH2A 2HRUA 4RW9A 2HS3A 3CD6S 1QLNA 3D54A 4FPRA 4USJC 5AT1B 1NSPA 1JXVA 1HD1A 1AB8A 1S4FA 2UXDF 2XMWA 2HNYB 5F9LA 1UVIA 2CQ4A 2M0GB 4A8OA 3NGSA 2MEWA 4DR7J 4NYZA 4YB6A 3VCDA 3HT3A 3KFWX 1FRIA 1S1UA 1PSDA 2ZJQQ 1UTAA 3MCSA 1PBUA 3VF0B 4UOHA 3KYLA 4OYOA 1FJCA 3OVSA 1S9GB 4Q2MA 2AJ4A 5CHCB 3I0SB 1N0VC 3SCJE 3V2UC 3W5XA 4I7FA 2NXCA 1M5SA 2NLWA 1RP5A 2ZUGA 5BYRA 1WG5A 4PPZA 3PR5B 2ZH4A 2B43A 4DSJA 1RKIA 2XY7A 2DNLA 1VBKA 2UV8G 2V8VA 1C4AA 2RUGA 2VDIA 2NXJA 3I87A 6FDRA 2HFSA 4GVBB 4QW9A 1UJ5A 4F7VA 2UP1A 1N0UA 4ZA1A 4NLRA 1RWUA 1PC5A 1RWMB 1O5JA 2V2ZA 3GP9A 1U2RA 1RLDA 1VC6A 2VQEF 2GC8A 3MR3A 5A8RA 4ZJQA 4JV1A 1FWKA 2XZWA 5CABA 3TARA 4HHJA 3EDQB 3GV5B 5HN0A 1T9UA 3CPWR 3PIPQ 2I9SA 4FN5A 3U1LA 4NXMF 3FBCA 1WDDA 2F4VJ 4U9RA 3LF0A 1HWJA 2L9NA 5LXYA 4TLRA 3KUHA 3UVJB 1ACMB 1IXKA 4QWBA 4EMDA 3NBPB 1VQPS 5GMEA 1GK8A 5CD4A 2AV5A 4J7CA 1RT5A 1KFDA 2CDRB 2GJFA 2KDOA 5BXIA 1CJKB 4E8UA 2BR0A 1HI1A 2KB2A 3AOCA 4W92B 3QAUA 5IS2A 3QJJA 1OSCA 1CEZA 4RNNA 3P5BP 2CWKA 2KG1A 4WE1B 2HGNA 4ECWA 2BKOA 2HQCA 1U0SA 2E1RA 2HQFA 3LUYA 1LW2B 1HQEA 3W65A 4EU0A 2DBBA 4LFCJ 1ZZNA 3PV8A 2ZWPA 2X3GA 2QZ8A 2EFVA 3KLVA 4XPCA 3ZZUA 3CJQA 4ED1A 2XC9A 1JKHA 5JMNA 3I5AA 5LT5A 3HP6A 2FZGB 2LEBA 3GJTB 2MZSA 2LQ9A 1X4EA 2RAQA 2RHQB 3KJQB 3IWXA 2DGQA 3IS9A 2HG4A 3KOAA 3QLHA 2VG5B 3CD0A 3QMQA 1R43A 3QT5A 4N56A 3I56S 1HMVA 2EFGA 1AA1B 1Q0NA 2DH8A 1E6YB 2AYEA 5ETQA 1EETA 4DR4J 2WW8A 4LF4J 4KC5A 4A8KA 4YOEA 4M5JA 2W9BA 3KLGA 2WCXA 1ZM2A 3DKDA 2ZH5A 1KHWA 2FGCA 2JEFA 5E3QA 5AE2A 4X66F 2O5DA 5ETLA 4F4ZA 3CNQP 4X4SA 3K5OA 2JVOA 2MQ8A 1WD6A 1MG7A 4ZLJA 1SC4B 2QSFA 2WVCA 3GIIA 3KJFB 1BWEA 4K4VA 3J7YU 2UUAJ 1HHQA 3UE2A 2JEIA 1O8BA 3M8PB 2Q3PA 2O66A 2I5JA 1ZA2B 3Q8YA 3ZC4A 4NLQA 2POKA 4ICLA 2RRBA 3THTA 2BQUA 5GADI 1CJTB 5J2MA 1RHMB 3MI7X 4WTOB 5D0HA 1B0TA 4L76A 1UJ4A 1UFKA 4F25A 1LK7A 1N32J 1BQNB 1FK9B 4NLYA 3QAEA 4DQSA 4RW8A 1C1BB 2HZCA 4V1Ak 2BYCA 5E5NA 2PFFB 1UEUA 4ZDNA 2E1MC 3CCJS 2JHEA 5HO4A 4M5LA 3BGRB 4UOCA 1UMJA 4LREA 1YJRA 4C2MA 2VL1A 1J5OA 2HRTA 4M5MA 1VQ4S 2R7WA 2DO4A 1ZOTA 4ZLNA 1RAAB 4U8YA 2PFDA 4K4YA 4DPOA 2NUUG 1N54B 4KFBA 4R5PB 3TVZA 2CXEA 4WIQA 2R7TA 1OWXA 3BGUA 3A8KA 3JTOA 2N7YA 2ZZMA 3D9BA 1W25A 3M32B 3E2EA 3K7RA 4DL6A 1F9EB 3TAMA 2OSQA 1HQUA 5T14A 1P8GA 4MMOA 3PW0A 1WHVA 2NXUA 4X64J 2C3PA 4JI2F 3QYYA 5AXLA 5IQ6A 3VGVA 1IWGA 4KV8A 1JLQA 3PEHA 2OD6A 2UXCJ 1HWKA 1VQSA 4RZRA 1NK5A 2FVRA 4AXIA 1U2FA 4LIWA 4FPIA 4DU8A 4F2SA 4DI6A 2YKOA 4C4WA 2P5VA 1F9HA 2FJDB 1MU2B 2KT3A 3R8YA 3KK3B 4YDDB 3UO0A 2GQQA 3W2WB 4DG1A 2N3OA 2APOA 2B6AA 2AYGA 1ZM3A 5F8JA 3M2RB 9RUBA 4JP8A 2BXJA 2Z2MA 3C15A 4XDDA 4YR0A 1V3RA 3DC2A 5D6GA 4U7UD 2R7XA 4LR7A 2GGPB 4AXJA 3V6HA 3OXGA 1VRTB 2C2MB 2J0SD 4M63A 1HBNB 1D09B 2XWYA 5C2CA 5B0CA 3T1HF 5D15A 3ETMA 4OYWA 3GFYA 2QMUB 3CDUA 1C4CA 2OFHX 2Z56B 2BACA 3HVWA 2PDAA 4X4UA 4WKYA 1Q82T 1G3OA 3P96A 2BVZA 2HK2A 4Y34A 3PFEA 4LRAA 4P72A 1BD6A 1VQMS 2OAUA 4B9TA 3BQ0A 5DS7A 1RCXB 4ZIVA 4P73A 3D1HA 3TJ8A 5KFEA 2KZMA 1G2EA 4DPTA 1PG5B 4HDGA 2VPZB 3H90A 3QJPA 1XNQJ 4EYIB 3W5YA 4F2RA 4ZOSA 2KO1A 3EZUA 4KGMA 1FDDA 2HEKA 5G4DA 1IM4A 1CVJA 1KLMB 3QRRA 2HBYB 5HSPA 3OFFA 5KT6A 1IKWA 3OSPA 3NNHA 2IJNA 1EQ0A 1X7VA 2E1AA 4JI7F 3KLHB 3MPUB 1K44A 1JLFA 3H40A 2CJXB 1BY9A 2AX0A 1S7IA 1GMUA 3KJVB 3VAJA 4Q0BA 5GAEU 5L1IA 2LMIA 2RF2B 3DI6B 4J91A 3SQOP 3HHEA 3PX4A 1RHKB 2KTQA 3MPDA 1VRQC 2VQFJ 2V6AA 2WONB 4QW8A 2JZ5A 3KMQA 3P49B 1V6HA 2ZOFA 1IBLJ 1X5OA 2MDAA 4WYWA 2UUBJ 5IM0B 2G4BA 1Z2LA 4EFAC 1OJ4A 1ZZFA 1J2VA 2HHVA 4LSNB 2XI2A 3BH7B 4QWEA 3QJLA 1QE1A 2HFVA 4IR9A 4ZITA 3OUYA 1A0OB 1KDNA 1WC5A 2ZD1B 1VOMA 1UFLA 5EN1A 1YVFA 3GJSB 2ZOMA 5H1SV 5F8IA 4RX6A 1DTTA 1L3VA 5KFXA 1RTHB 2B5JB 2WVDA 3G96A 4GKJJ 3UDEA 5B0AA 1WNEA 3MECB 1O51A 1U6BA 2B9YA 5F3TA 3TEGA 3I5BA 3JYTA 3M9MB 5I3QA 1RTIB 3HFVA 3T5KA 3U1MA 3PIOQ 2KL8A 1CS4A 4B08A 4GO7X 1R27B 2AJ2A 3FCVA 3N6NA 2UVWA 1VJWA 2HFOA 3I55S 1Q78A 2FLNA 3FRYA 2KHDA 4NMLA 3CE8A 5B08A 1NHKL 2LXIA 3GIRA 3EPIA 4JYAJ 3PYGA 2KJWA 3NEKA 3LW5C 1GT8A 3KWMA 1F5CA 2BJDA 4WIIA 2QA4S 2B8PA 4P71A 3AQPA 4WP9A 2MTLA 2L41A 2AIRB 2C3YA 3BO4A 3AAWB 3KHRA 4PQUA 3NS5A 2QLWA 1T05B 3K17A 4ZJLA 1GXTA 1UEVA 3Q0AA 1HHSA 1AROP 3M6XA 3BDPA 3CCWA 2OIHA 1RBLA 1JLGA 1Y0HA 3DN9A 1TK0A 1NSKL 2DNYA 2YVSA 3NNCA 4NLSA 2V9KA 4H4MA 2HSEB 4B3TF 3VAIA 2R8HA 1W26A 1EIYB 4CRJA 1D9DA 1LW0B 2EW9A 5C42B 4C11B 4HH1A 3UDVA 4I64A 4A47A 4LFBF 2JJ4D 2BJ7A 3IO1A 2AYBA 1B7YB 3UR0A 4JV5F 3NCPA 4YFUA 5K20B 3CB4A 4LRFA 4ES2A 3E8OA 4EO8A 1RT1B 2R7UA 5F8MA 4OX8A 5KFAA 5KG2A 5HL7Q 2I8EA 4J9LA 1NKCA 5L1JA 1VBXA 5CXTA 3T5HA 3A3OB 3OTDA 2KM8B 2VFSA 3KLFB 1R0CB 4ZCKA 3SCKE 4J9MA 1IKXA 2MZ1A 1TFYA 1OMSA 1WTBA 2PEBA 3G82B 1UWBB 3PFOA 4CT8A 3R5CA 1XIQA 4NRUA 4DX5A 1NB2A 2ZHBA 3PKYA 2GIRA 1WKLA 4DUZJ 5KFLA 4CLFA 3CD5A 3RR8A 3VGTA 2O01C 1SUQB 4UUWA 5ETNA 3U02A 2BABA 3VVTA 4QWAA 4M5KA 4EBCA 3LGHA 2YNIA 2QMWA 1AZSA 4NI2B 1MMNA 4CLPA 2A2DA 1VI7A 3RBXA 1HBMB 2VUGA 1DQ8A 4M5DB 1YBTA 3AJ2A 4IOBA 4WK3A 1M0SA 4CO0A 3LAMA 1GTHA 2H4YB 4ED3A 1ITPA 1LXJA 2Z0GA 3PKMA 4IO9Q 2KZZA 1A7GE 2D7SA 1RT3B 2JDJA 1QSLA 1FRHA 2H5IB 4KGKA 5ETMA 4RO0A 3W5ZA 4CNZA 2XGPA 1RI7A 2GAGC 2ZH3A 4DV0F 1EHWA 4FP9A 3WC2A 4RW9B 3CCLS 1P9QC 1K0VA 2Y1IA 4DR1F 2J0XA 5JVGQ 2YNFA 3G86A 2FQQB 2HNZA 3D67A 3NKYA 5KFDA 2AD9A 5KG6A 1YZ6A 3HSDA 5FDLA 1TKXB 5ITHA 2MHEA 4OV6A 1U49A 3UNYA 1RU1A 2LU1A 3CEDA 4ZN3A 4QIVA 1N48A 3MDFA 1VMBA 1FVSA 2J76E 4OYXA 2EC0A 1T03A 1S1UB 2HW3A 4ZVSB 3H42A 1TL1A 4UZCA 4CLSA 1F6TA 4RJVA 2F8EX 3RTVA 4OYZA 3SIPB 2A1BA 2FIUA 2VQEJ 3BJYA 1EKSA 2BM1A 4QPTA 1JJCB 4HL9A 4OI3A 3MEDA 4Q45A 2E9TA 1QTNB 3HMJG 1F2HA 1HKAA 1TAUA 1VIXA 2DNMA 3T5LA 2IPOB 1JJ2R 3LP1A 3BEGB 3I4HX 4KIAA 5D78A 1PILA 4FYYB 4NXMJ 2BW7A 3HO1A 3D28A 4OZ3A 4QIWD 1NJZA 3IWNC 2G2OA 3QIPA 2IYGA 3OXLA 3PNIA 4YUDA 1HW9A 3CMQA 4CM2A 3GIMA 4HACB 2BRLA 3TAPA 1Q81T 2JX2A 3Q83A 3PR4A 3AA9A 4CLWA 3HJFA 1UFWA 2Z58B 2ADBA 2WVBA 4JI8J 2MXYA 2WVEA 3T9ZA 1KOOA 2HHWA 1T0TV 1FRXA 2HVEA 4PXDA 1YJNS 1R6VA 5HMWA 3ZZRA 3S6EA 5DO2A 4DR2F 4I2PA 3NL0A 4KO0B 3GTYX 1P9YA 2WW4A 4DV5F 2QIFA 2BQRA 4CT9A 3F0NA 4F3OA 2J9EA 4M5HA 2BW2A 3DLJA 5EWFA 4ZLPA 2FLPA 4UOFA 2RS8A 3FQLA 2XMKA 5DDQC 2CA9A 1TVRA 2I0XA 1TAQA 1T7PA 5J2QB 3WHIA 2QV6A 2J6UA 2OGUA 1U09A 2LXFA 1RWOB 1NPRA 5KOXA 2HHHF 2EFPA 1WC4A 3CJ4A 4JI0F 4JOUA 4YR2A 4DS4A 5EX0A 1ZAXA 1SC1B 2EFQA 3VAMA 3OW2R 3IS9B 2RJZA 1IWAA 3CJ0A 1WG1A 5AJ3F 4K4TA 2R7VA 2A2CA 2HBQB 1S79A 1HD0A 4RNFA 4B3MJ 1T11A 3EX7B 1SKSA 1EETB 3CCES 2M9KA 2HLUA 1Y5NB 2GQCA 3G6ES 4CYUB 2AEMA 1XN9A 4YB7A 2N82B 2W7PA 1FD8A 1WUUA 1K1QA 4Y6IA 3SSRA 4NA3A 2E5LF 1W2IA 3G8QA 2GHWA 4DSFA 4C8ZA 2X7IA 1HBOB 4QYZK 2AJQA 4OHXA 3TANA 3J7A1 3NXZA 1WORA 1T95A 2KHCA 3GYXB 2OTJS 4IDKB 3CC4S 2FLOA 2ZEJA 4YB1P 2E1CA 2H5JB 1KS2A 1HARA 5J2MB 1WHXA 2LQJA 5LSRA 2OPRB 4B02A 3I31A 4CH7A 4EYHB 2WBMA 1VQ7S 3GMGA 2MKHA 4H4OA 3D6MB 3O5TB 2O67A 1ZM9A 1X60A 3G71S 1FVQA 4B9NA 5DLFA 3M9NB 4JI2J 3MPWA 4MIAA 5BJRA 3M8WA 1J5OB 1MMDA 1NLKL 4O0IA 2V2VA 1NZAA 1WI8A 3KHGA 3R1LA 2CQCA 2EXUA 2OPSB 4LF1A 1FERA 2C3MA 4P75A 4R8UB 1IQTA 4NLXA 1X5PA 2N4DA 3TAMB 4P52A 4TXSA 4R25A 2RRAA 4HKQA 2WK4A 3NCRA 3C3LA 1H98A 2ZE2A 4Y2AA 2HYIB 3AD8C 3E3XA 2DTJA 3SI8A 1XERA 4KV8B 3D0GE 3WC0A 1RT4A 4RNHA 2CQ2A 2D9OA 3D6HB 4TNOA 5KT7A 2DKOB 3RU0A 2IM1A 4G6VB 3FBFA 5I42B 4Q8FA 2PO4A 1A9NB 4DG1B 2W8KA 4OI6A 2UUWA 2B6AB 3AXKA 1KVJA 1XMQF 4Y2IA 1N5YA 2NYIA 1D3WA 2V0NA 3R6GB 1N33F 3VQSA 3PXGa 2W7OA 1Y9OA 1FA0A 4X84A 2J7KA 2W2QP 1R8HA 1XR6A 4ECYA 5SUHA 3BBBA 2DR6A 1VQ6S 4GVLA 1SJ3P 2EFOA 2D3OR 4KBIA 2DNZA 1U45A 3HULA 5G0RA 1PGZA 1NM2A 1KC8T 4HR2A 4FBUA 3DOLB 1XJWB 2J9DE 1NCLA 2IMWP 2IBOA 3CXCR 3F56A 1U1NA 4CQ1A 5E3RA 3RB3A 4X4NA 4IFVA 2HHTA 4ZPVR 3L7PA 3IG1A 2CWXA 2YNGA 4DV4J 5C5JA 5HMXA 1SV5B 4Z2XA 1T3NA 4WK1A 2PC6A 2GJ2A 2UXBF 2CFXA 5MLCV 4JI5J 2HQGA 4RR5A 2DNGA 2IIHA 5GAGU 2R42A 3PJXA 3SV4A 4M5NA 2BMBA 3HDSA 5GAHI 3DRSA 2HMIA 3QGGA 3IMQJ 2QMXA 3R5JB 2GVDB 4LF8J 2O3DA 4FS2A 4Q0BB 1Q79A 2VBXA 4H4KA 1VC0A 3MM8A 1A6LA 5M2UA 3CJTA 4NLGA 2JOQA 2C2ZB 5K8PA 1X5TA 4YR3A 2YKMA 3HFZB 2RNEA 3ELHA 3FKBA 3HKZD 1SIZA 4FVMA 4C0HA 4DPYA 1B3TA 1B0VA 3OL8A 2IC3A 2CG8A 2V8HA 1UW9A 2C2EA 3FEZA 4DSIA 4HT5A 3OUYB 1U4BA 4DUYF 1JB0C 3BB5A 3M2UA 1L3UA 1JLAA 1DARA 2LCWA 4B3OA 3JSBA 3ZZZA 4AL5A 2LQ5A 1MMLA 4DFKA 3IA0A 1M5HA 2MQLA 1H38A 1N36J 1X4HA 3IM9A 1HNZJ 3JYTB 3ENWA 2LDIA 2DHAA 2RUSA 3S8SA 5JVHQ 4Z7CA 3MUTP 3OSNA 2E5IA 4RW4B 4QR1A 2IY5B 1WOPA 4HTJA 4CTAB 4RNMA 3TA1A 2HBRB 4ZVUB 4N76A 4NEZA 4U8VA 2YH1A 3EWGA 2QL5B 1AW0A 3UN3A 4BDPA 3BKFA 1PYOB 4B3TJ 4DQRA 4UUXA 3BQ1A 3IGNA 1S1VB 3D68A 1NDPA 1S59A 4CO3A 3VQTA 2K7JA 2IDEA 4LFBJ 1M1KT 4DQPA 4YN3B 2Y8YA 2YWFA 4YY3J 2CVIA 1VQLS 7AT1B 2FHKA 2HNYA 2YKNB 3DRRA 2HBZB 1W2BR 1M90T 1N34J 3ZXWA 1H2UX 4H4MB 5KT5A 3NS7B 3DNCA 3CCUS 2QA2A 4U95A 3N5BA 4TU9A 4RUCA 1S9EB 3I5CA 2V4QA 2D74B 2EK1A 4U7CA 3I0SA 3Q8VA 4WCEQ 3GR0A 3OV7A 1WHWA 3TVKA 1K1SA 4RW7B 4CP5A 2PIIA 4BWJA 3TX0A 4HI2A 3DGPB 5HLFA 2KVIA 4CM0A 2BJ1A 4PXEA 5KFYA 1X4FA 4XO0A 1LOUA 2KYZA 1QJHA 1GXUA 4DQIA 1RCOB 2XBPA 3RGIA 2YX4A 4GVBA 5CYJA 1Q53A 2KXFA 2RE1A 2N4CA 5KT2A 1IKXB 3VZIA 3CMAS 1J5EJ 1SVDA 1ZETA 4DL7A 1MN9A 4LF2A 2AGQA 3MCNA 2VJUA 2P9CA 4FXWA 3W8GA 1YJ7A 4TU7A 2ZBPA 1DQAA 1NSAA 4F26A 4JI4F 4DV0J 1X8DA 5DZ7A 4ECZA 2XMUA 4OHYA 4UY8T 1AZSB 1RABB 2NXEA 1EX8A 3PYDA 1UCNA 4WFBQ 2VG7B 3ILOA 3IFEA 3OTBA 1GTEA 2J0QD 2IHR1 4U96A 3ISNC 1RHRB 3UVJA 1RWXB 1F1BB 2HLTA 4NLTA 2V2KA 1RT6A 1NDLA 1KN6A 2VU5A 4C8YA 3GJQB 3QT6A 4CLZA 1Q1KA 1I94J 1K9MT 4DX6A 4DR3F 4NLWA 2NUHA 4DLEA 1SBRA 5IWAJ 4ECTA 3EE3A 4X4VA 1NPKA 2XNRA 2YPZA 1ZPVA 2HNZB 3R7SB 5D3GB 1M5OC 3KK2B 2F4VF 4ECVA 2ZOGA 4CNYA 4MYUA 5FDLB 3Q8UA 2FJEB 3TR5A 4DCJB 4QBUA 1YHQS 1RQ0A 1LW2A 1K73T 4DN0A 1T03B 4L3NA 3US5A 1B4SA 2DGWA 4OMFG 2E5GA 3O8WA 3LTOA 2P2CB 4CI0B 2HAIA 4YMEA 4QYRA 4KT0C 1WG4A 3GQCA 3SEOA 5K9FA 1H7WA 1PC4A 1GFWB 3FQKA 4F02A 4TY8A 4ITSA 4NLPA 2VG5A 1GMVA 3MEDB 3PG9A 3JS9A 5L46A 4BC7A 5KFCA 2Z30B 4TYAA 2ZKUA 2WBRA 3MMCA 1R89A 5D4PA 3NAHA 2EBEA 3TAQA 2DEIA 1FD2A 1E6YA 5E2QA 3U27A 2D3ZA 3PO4A 2OO4A 5DZ6A 3LP1B 3HK2A 1X4DA 4USVA 2FHJA 2CJKA 1NK0A 3ILJA 3MEGA 4Y3CA 2BEFA 4HTIA 4N41A 4P2SA 4ELTA 1HL6A 3W61A 5ETPA 4PR6A 3AFGA 2DNNA 3MMAB 3GYGA 3QIPB 3KUGA 1U1KA 2Z2LA 2EWHA 3M05A 4DR4F 1SXLA 4DV5J 4LF4F 2V69A 5FD1A 2XS7A 5D8HB 1UZDA 2G1DA 4O3SA 1BMQB 5LMNJ 2LU2A 4RWXA 2EI5A 4ID8A 2XZTB 4LMZA 2OSRA 2W01A 3DLLQ 2MZQA 1XR7A 5CCMA 3GFZA 4CIOA 2M3DA 2RH3A 1FK9A 1VQOS 2ZBRA 4I0WA 3GLJA 4I6WA 4CH1A 1VBZA 3GE9A 2UUAF 4I2PB 2Y9HA 2Y3YA 4NXNJ 3BGRA 2HHHJ 5GVQA 2W25A 2D9PA 1BXNA 4JI0J 3K8WA 4V19J 3F73A 2MSTA 3DLKB 3QT7A 4IRCA 4I69A 2W4CA 2BJ9A 2LVWA 4LF7J 5J1EB 1ICEB 3VALA 5LJ3Y 1RE1B 1KQFB 4DSEA 1FCAA 2FY8A 1Q5YA 2H5EA 3H98A 1N32F 4QU7A 1TVRB 2K7KA 3MZIA 2CZVC 5E33A 1M5PC 2H4WB 3K58A 3PX6A 2JRSA 1LEOA 4ANDA 2AZ3A 1URRA 4Q5VA 3T5JA 4I67A 4WZMA 5A0YB 2YWHA 3PW5A 2LECA 4Q43A 3HD2A 3PVXA 1U2CA 3I0RA 2AEFA 3T1AA 1VDHA 2HFZA 1Y5LB 2XLKA 1SL0A 2CZ4A 2IM0A 3A4TA 4KB7A 1FF2A 4W98A 2A6MA 5CQGA 1KD1T 4G1PA 2XM3A 3M2RA 1KVKA 1RXOB 1RISA 3FMBA 3MR2A 4ED5A 4X64F 3DLGA 1HIYA 2GGPA 1RB0A 1VRTA 4BWMA 3DRPB 4QIFA 2M4MA 1HNWF 1FRKA 3HI9A 2UXCF 4NPOA 4Y00A 3H7HB 2W8LA 1ZYQA 1MROB 4DV6F 2CNOB 4A8FA 4OX6A 8AT1B 2ALYB 3B8HA 1GEHA 4H54A 1D0EA 3AHPA 2ADCA 4DQQA 4X4OA 3R27A 1KQSR 1TV6B 4C8OA 1H3DA 4ECXA 2B0GA 2V8DA 4NZ6A 2P9GA 3GR1A 4USUA 2RIJA 1KFSA 2CJYB 4LJMA 4HYKA 4H4OB 1U1LA 1CC8A 1WKKA 5E7OB 1E6VB 2F65A 5D0RA 4ZVFA 3VAKA 2OHDA 4MYTA 4DSLA 4B9MA 5KFBA 4KH1B 4YP3A 1AUSL 4E2FB 1KLMA 3KDNA 4KGZB 5D4OA 3EYZA 1FE0A 2X1GA 1I5OB 2W2OP 5CZXA 5U47A 2VONA 2BKPA 3KLHA 3PO5A 1RAJA 3T9NA 1KSPA 2AJ0A 4KH0B 3MEKA 3VR1A 3KJVA 4WTYA 3IC1A 2Y1JA 5T41A 2ATCB 4J9UE 3PYFA 5EWEA 4FZVA 1U47A 3NGRA 3Q2SC 1O6XA 3BN7A 4DU7A 2HRYA 2WONA 3F41A 4TY9A 1YJTA 3Q8PB 1F5AA 1HI8A 3J7YI 4B3RJ 1P6TA 2J9DA 5IM0A 2YWEA 1JX4A 4LSNA 3QO9B 1TU0B 3OL6A 1RT4B 1QAIA 4KPCA 4DCOB 4ATNA 4J9RA 3CDEA 4C0BA 1U48A 2HQIA 2ZD1A 1DRZA 2HHQA 3KG1A 1N8RT 2JEJA 2ASDA 4C97A 2B5JA 4EI2A 3MECA 2ZHOA 2F4FA 2ROGA 1XEZA 2ZBIA 3MPVA 2HVZA 2CQ0A 4FKYA 2JFDA 2NPIA 3RAMA 1N5YB 1NK4A 3KLIA 5IZHA 1RTIA 1T9VA 2UUBF 3ZNUA 2DGSA 3M6WA 3EVWA 1WI6A 5DG7A 4LQ3A 2E1PA 4LRBA 2RVJA 4F04B 4ZPAA 1I6JA 3J81j 3NOGA 5HK4A 3JXOA 2QA4G 4OZ2A 5G0RB 1BQXA 4C3LA 1HR0J 2XLJA 4GKJF 4RBVA 2IAJA 3DYAA 1B99A 2XYGB 3QSIA 5F3ZA 1RUSA 2HHPA 2J9CA 2BUNA 2RQMA 2GMLA 3RRGA 1B70B 3TQ1A 4Q7AA 3VV2B 1DURA 3MOJB 3C6UA 3VVUA 5HVHA 1U26A 3D66A 1QY7A 4JI3F 3W9HA 2BX6A 4JYAF 4I68A 4DHVA 1GXLA 1R8AA 2DRAA 4WPAA 1TTHB 3RR7A 5DETA 5F0UA 2GX8A 3Q23A 3OLBA 4ECSA 5C42A 4C11A 1VBYA 1XMBA 5KT4A 5L9NA 3DRSB 4P7TA 2ILZA 4FF1A 3RUBL 1HYSB 5E3AA 1UVNA 3MCMA 1N5VA 3H4DA 1HNIA 1UETA 2BJ8A 4OYPA 3MM8B 2ACMA 4PG8A 1D9AA 1RT1A 3OTCA 4C3KA 3U1NA 5KFRA 3FVYA 2J0WA 3BKUA 4UTGA 1FEHA 2WZ1A 4BHQA 4FVCA 4F0KA 2YKMB 3MTJA 2VBWA 3ZTRA 3KLFA 3PY8A 4I6YA 2IDLA 4RUHA 2Q66A 2CPHA 2ERRA 2BE2B 3T19A 3DOMB 3MM5B 4NCBA 1YSJA 4ZVRB 2YX1A 2WRMA 1SUQA 1SI9A 5BR8J 2OEMA 2Y1LB 4RPFA 2OUGA 2W2PP 1IBMJ 1GMWA 2DXDA 2H1YA 1S48A 4ZVGA 2PMWA 3TOQA 2Q79A 1RTJB 2P8IA 4OI4A 2FJAB 4ER8A 5M2PA 3ILLA 3FMWA 3BSCA 3UD3P 5KFVA 1MWYA 4FDFA 2EG2A 2BANB 1LV5A 2AZ1A 4KHPF 2F9JA 3OT9A 2CPXA 2CPJA 3W8PA 2R2TA 1RT3A 1REVB 1LKZA 5GAEI 2RHSB 2OMLA 4HI1A 3H2VE 3QWPA 2FC8A 1TZ0A 2VKRA 2KRBA 4B9SA 4QIEA 4EUVA 1YIJS 1Y10A 4M5IA 1JLBA 2BZ2A 1T9WA 2YKQA 5MAOA 1TKXA 4F4KA 2IM2A 2RT3A 2WTFA 3GV8B 3DRRB 5F8LA 1IR0A 4HHUA 1RBAA 3ZZYA 2HK3A 3D0IE 3D5MA 3POTA 2VICA 2PA3A 2MQPA 3CJ8A 1TP7A 1RU2A 2CRLA 1WEXA 4IH5A 4USWA 4ZCMA 3V4IB 1NB7A 5KG3A 5KOWA 3DU5A 3JQJA 5HLFB 3W9JA 3OR1B 2OJ3A 1VIOA 3RRKA 1FTRA 1OQ6A 3FK4A 4JI4J 1TFWA 4KGVB 4PWDA 4RBTA 1SC3B 2DGVA 1WDTA 2R8IA 4PWUA 2JVRA 2R2UA 1QVFR 4IYQA 4AL6A 1F60B 3OTOF 4DJBA 2BV3A 2MB0B 2DNOA 3CJKA 3HHLA 1U6ZA 2C2OB 2FZKB 3T3FA 2FHOB 2JNJA 4MJKA 2CAJA 2XMTA 2BOAA 4ZPBA 3WZ0A 4F67A 2IVFB 3H2UB 1F5BA 5LM7E 1VISA 4DR3J 2L08A 1VLYA 2HZAA 3DFEA 4LF6F 4HACA 2EC2A 4OL8A 4LT6A 1AYEA 2BE9B 3FZBA 1VK8A 1L3TA 1JIHA 3AY0A 5KFNA 2DHSA 3JQMA 2V50A 3OQ2A 2RD5C 2QE5A 3CCZA 2GS8A 2NREA 4JI6J 2VBYA 2XYHB 1S99A 1HBUB 3DXSX 4UW2A 4AYBD 1NEEA 3DM2A 3ILIA 2YKAA 3MF5A 3LO3A 5I3UA 3QT8A 1D9FA 2H3EB 1RT6B 3ZO7A 4QWCA 4WU2A 4MTPA 1KWMA 2W1BA 4KO0A 2K3KA 1NDKA 1VFJA 2WVFA 4Y2MA 1QAJA 2Q43A 1X4CA 1M1GA 1DY3A 2VG6A 4JI8F 4A8XA 4PXBA 4ZCIA 5IC6B 1YRTA 2VA2A 4OI0A 5K8MA 2M52A 2ZM6F 2DISA 3H2LA 4K50A 3ITHA 3MFHA 4EEYA 1UPPA 4AL7A 2ZH9A 5J2QA 3H5XA 3BH6B 3Q89A 5KFOA 3T6JA 3I9ZA 4Z37A 2QLXA 1Q8BA 5LL6d 3QZ8A 2VF3A 5C25B 2XSFA 1DZ5A 1P1LA 1W7WA 1IR1A 1FNXH 4WFNQ 2AX1A 5CYQA 2KU7A 3D1QA 2H65B 3R97A 4TY8B 2DR5A 3MCOA 2E7VA 2VC1A 3MMCB 3IBWA 2RU9A 2CQPA 1X0FA 3TWZA 4X2BA 3EXYA 2VH7A 4ECQA 4CYUA 3IR6B 3K5PA 2J8SA 3MEGB 3NAIA 2XO7A 3DLEB 3AT1B 1CC7A 3QRQA 2JWNA 4WJBA 4RUAA 4R0JA 5IV3A 3TNVA 2IRXA 4FS1A 2WOMA 3IR7B 2GCFA 2OPPA 1HBOA 1KKHA 1S1XA 1QD1A 1ZAVA 2M88A 3S1TA 1S6UA 4B3MF 4TYBA 4IDKA 2MZJA 3CIMA 4O3NA 2CQDA 3TZXA 3THVA 3F44A 1SH0A 4PKDB 1FT8A 4HVZA 7FDRA 1TK5A 4L74A 4FYWB 4L75A 3KUEA 4AQYJ 1TUWA 3K5LA 5KG1A 3FSIA 3CW2C 2OPRA 2GO8A 3RW7A 3V6JA 4LRDA 1NHUA 1U0HB 2QC3A 1IN0A 4LFAJ 4X4TA 4ECRA 3CCQS 3CCMS 1NH8A 4ZPCA 1EQMA 2AF6A 3NLCA 1YQHA 2Q6BA 2OPSA 2MHNA 2CQGA 3HHDA 4UF4A 4OJGA 4R8UA 1WELA 2MYFA 4DL5A 1Q4RA 2ROPA 3CDBA 1RTZA 2Y0SD 3BPDA 2LP4A 5GMKa 5LSLA 2QL7B 4U7UK 3VAFA 4L72B 1WHYA 1MWZA 1Q86T 5KFWA 3AOAA 2HIYA 2FY1A 5EDWA 2W4DA 3M30A 4J9VA 4DR6J 2HVHA 2BOPA 1HNWJ 1VS3A 2L3MA 3J7Z5 1Q8KA 4O3QA 4LBPA 5FJ4A 4DMZA 2YXLA 4DV6J 3A3PB 2DPIA 3I0RB 3QGIA 5C24B 5I42A 8ATCB 4NL5A 2HVDA 3PW2A 2GMHA 3C2PA 1KR4A 5IFMA 2JLGA 1YWXA 2DB1A 1WC0A 4K7QA 3VGSA 3DLGB 2LA4A 3ENQA 3MMBB 1RBOB 2CJ9A 3G6XA 2DYAA 4C48A 1FJEB 4ZN1A 3Q86A 3MGJA 4PUOA 1J27A 2J7WA 2IFXA 3LP0A 5HP1B 1GMWD 2JLEA 1YJVA 2X1BA 2FGOA 4JV2A 4DL0C 3PRVA 3FFIA 3DOLA 4A4JA 4IFYB 4ES3A 5IT9U 1YKWA 3ADAC 2KJVA 4DZ6A 3EGWB 3ISND 5ADZA 2P6TA 1RYRA
chains in the Genus database with same CATH topology
4DFKA 1FJCA 3OVSA 3IA0A 4K4ZA 1S9GB 4Q2MA 3SXLA 2AJ4A 1M5HA 2MQLA 3I0SB 5CHCB 2W4PA 1N0VC 1H38A 1X4HA 4NYOA 3SCJE 2FLLA 3V2UC 1SV5A 4I7FA 3TP2A 4YB5A 3OL9A 1M5SA 4TN2A 1UVJA 3JYTB 3ENWA 2IVYA 2NLWA 1RP5A 4G1IA 5IT9Y 1S1TB 4QR2A 3L3CA 5C24A 2DHAA 2LDIA 2NPFA 3CGIA 3S8SA 1RTDA 2ZUGA 1RT5B 3P6YC 4A8QA 5BYRA 5JVHQ 3N5FA 3MUTP 1WG5A 4PPZA 3OSNA 2E5IA 3PR5B 2RB7A 3DHXA 2ZH4A 2DHGA 1FJGF 2B43A 1UW4A 4RW4B 4DSJA 3BGLA 1RKIA 1ZBTA 4NA1A 1L5UA 4QR1A 2XY7A 2DNLA 2LEPA 2UV8G 4HTJA 1C0TB 1QTMA 4CTAB 2V8VA 4RNMA 3TA1A 1L3KA 5KFJA 1FTCA 1C4AA 4ED0A 1KTQA 2RUGA 3OJUA 4N76A 3DDKA 1VQ8S 3DHWC 4PG4A 2YH1A 3I87A 4C7QA 6FDRA 2F1FA 3MMBA 1AW0A 1URNA 4QW9A 1UJ5A 4IG0B 4BDPA 4DR6F 3ZZ0A 2UP1A 4OZJA 1N0UA 4DQRA 4DV4F 4UUXA 5A2QY 4ZA1A 4NLRA 1RWUA 1PC5A 4ZPWR 3MMJA 3BQ1A 2XLIA 3IGNA 1S1VB 2XMVA 5D4NA 1O5JA 1KOHA 4CO3A 3VQTA 1HQEB 2K7JA 1U2RA 3PX0A 2V4JB 4D3HA 5BYSA 1VC6A 2VQEF 5HP1A 4L6V3 1M1KT 4JI5F 4DQPA 3BS9A 2GC8A 2C22A 1QAXA 2YWFA 3MR3A 1HNVB 2CVIA 5A8RA 2WB1D 3HVRA 1VQLS 5B7WA 4IFYA 2FHKA 2HNYA 4JV1A 4WKRA 2EG1A 2XZWA 1NRKA 3OVAA 1HPZA 3TARA 3X3UA 2YKNB 1JKHB 3DRRA 2Q6CA 5DQHA 4MK7A 4HHJA 2DK2A 1HWLA 4NA2A 4A8WA 3O3LA 3DRYA 1W2BR 3GV5B 2ZJPQ 1TL5A 2IA6A 1M90T 5SZTA 2DITA 1TQLA 3SCLE 5HN0A 3KK1B 3CPWR 1H2UX 1Q8LA 4MKBA 3PIPQ 2ZDPA 4H4MB 3I9V9 5KT5A 1FXRA 5JXSA 4LF8F 3DNCA 5K5MA 4CO1A 3CCUS 2QA2A 2I9SA 4FN5A 3U1LA 4NXMF 3QLHB 3N5BA 4IRDA 4KE5A 4NLOA 4TU9A 4U9RA 3ZZTA 4ED2A 4RUCA 1QSYA 3LF0A 1HMVB 2QA1A 1S9EB 1HWJA 2L9NA 3I5CA 2V4QA 4EBEA 2D74B 4X65F 5LXYA 2EK1A 2W9CB 4U7CA 1OIAA 3I0SA 1ZTTA 4IR1A 3CULA 1R8CA 4TLRA 4WCEQ 1YJ9S 3GR0A 3A1YG 2IVMA 2UVVA 4KKOB 1HWUA 1WHWA 3OV7A 3TVKA 1K1SA 3N01A 3KLIB 4RW7B 3N28A 1IXKA 2PIIA 4FNHA 4QWBA 4BWJA 3SSSA 3NBPB 1VQPS 2W9BB 2Z4PA 3KLGB 1S1TA 2AV5A 5L1KA 5LXRA 2MKIA 4HI2A 3M8RA 3K2YA 1SL1A 1RT5A 1KFDA 5HLFA 2KDOA 3FZ2A 2ATLA 2KVIA