4KSEB

Crystal structure of a hiv p51 (219-230) deletion mutant
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
413
structure length
401
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDGYELHPDKWTVQPIVTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV p51 subunit
publication title Selective unfolding of one Ribonuclease H domain of HIV reverse transcriptase is linked to homodimer formation.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Transferase
total genus 104
structure length 401
sequence length 413
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4kseB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kseB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kseB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kseB03
2BE2B 2W9BA 3G86A 4ED8A 3RB3A 4ECUA 4DG1B 3DI6A 4TYBA 1LW0B 1RYRA 3TAMB 2HAIA 5HROB 1UWBB 4J9KA 5DLFA 3RAQA 4KAIA 1LW2A 4I7FB 2ZD1B 1IKWA 3N6NA 3ISNC 2OPQB 2J6TA 3GIKA 5HLFB 1KLMA 1S1UB 1JLCA 1RTDA 2HWIA 4NLOA 5DQGA 5F8HA 4RW8B 4NYZA 3V6DB 3FRZA 4DL7A 3T5JA 3DLKA 2HNYB 4H4OA 4ED3A 4J9PA 4TLRA 3I0SA 3QO9A 1RT1A 3GV8B 1XR5A 4MIBA 4IRKA 3KLVA 3DLGA 4ECTA 4PUOA 1IKYA 1HMVB 2W7PA 2UVUA 3M9NB 4EYHB 4ED6A 1ZTWA 2B5JA 4QWAA 1RT5B 3PZPA 1N56A 5L1IA 2E9TA 4NLXA 3IRXA 5D3GA 3FQKA 2FVPA 2D41A 4WFZA 1IKXA 5KG3A 4DEZA 3BSNA 5C5JA 1TKXB 3DRRA 3FFIA 3CJ0A 4ZVFA 4YMEA 5KFXA 3EPIA 2JEFA 3I0RB 3QGHA 5I42B 3BQ2A 2IJFA 2OH2A 1I6JA 4IFYB 1RT4B 4QW8A 3CJ4A 3QYYA 2YKMA 2D3UA 3KHRA 1JIHA 3HHKA 5KG7A 3V6JA 5KT2A 4J9OA 3KK3B 3PW7A 2AX1A 1HPZB 4ZHRA 3H4BA 2B43A 4R5PB 3QLHA 4FBUA 3C6UB 4WXOA 1FKOB 3DRSA 2WRMA 1RT6B 1TL1A 1TKZB 4WXWA 4URGA 5C25A 3DOKA 5DLGA 3E01B 2GC8A 4PWDB 1JLBB 1S1TA 2UVWA 4G3IA 4WZQA 4GC6A 4RU9A 1T03A 3KLEB 2R8JA 2RF2B 2I5JA 4B3OB 4WYWA 3PW0A 2C22A 4PQUB 2IJNA 1JX4A 2IAJB 3M8QA 3H98A 4WE1B 4RZRA 3MEEB 3PJWA 3Q8PB 3OHBA 2JC0A 2VG5B 3UR0A 2UVVA 2D7SA 4GC7A 1BQNB 5L1LA 2HNZA 4R8UB 1JLQA 1KHWA 2YNFA 5J2QB 1RT7B 1CSJA 4TY8A 2OPPB 3LP2A 3LP1A 3OSNA 3KMQA 3PW4A 3KLIA 1RT3A 5J1EB 3KLFA 1QAIA 2AU0A 5KFUA 4J9SA 4F4WA 1RAJA 3JYTA 2OPSB 2IM2A 4KFBB 3IG1A 3H2LA 1SUQB 1TL3A 5F9NA 3TQ1A 3SFUA 1S1WA 1N5YB 3PHEA 2VG6B 1IKVA 1YVFA 2WONB 5KFFA 4LQ3A 4IG0A 4U6PA 2DPIA 1JKHB 2FJWA 1DTTB 2BRLA 1C0TB 4ZPCA 1C0UA 3KK2A 3EZUA 5DGBA 3LANA 1LWEB 5K14A 5DG7A 2WTFA 5KFJA 2YNIB 3FSIA 3DM2A 3HKWA 2BANA 2ASDA 4I2QA 2JEJA 4EBCA 4IR1A 3ICLA 1TV6A 2B6AB 1HNIB 4JUZA 4ZVEA 1C1CA 2QV6A 2QE5A 4TN2A 2XGQA 3MR5A 2WB4A 3Q8RB 4EEYA 4M94A 2OPRA 2ILYA 4KV8A 3MECA 3PR5B 4TQRA 5KFYA 4DL3A 2R2TA 5KT6A 4K4WA 4NLVA 4Y2AA 3H5XA 4J9LA 1HYSB 4K4UA 1JLGA 1TVRA 4NCGA 2ZE2A 5L1JA 2UVRA 4RW7B 1N6QB 3V81A 5KG6A 4O3QA 3N6LA 3BQ0A 4O4GA 3OHAA 3KHHA 4Q8EA 4MKBA 3NGDA 4IRDA 3TVKA 3IS9B 4J9RA 1DTQB 3FQLA 4DL5A 1BQMA 1TKTA 4H4MA 5C42A 4DL4A 4KO0A 3MEDB 1JLEB 3M9OB 2HNDA 3T19A 4ECXA 5DGAA 1RTIB 3HVTB 3H4DA 2E9ZA 3KJVB 1R0AA 2XWYA 1J5OA 4NLRA 1HQUA 3DDKA 3H5UA 4YR3A 2RKIA 1DLOA 4IFVA 4LSLB 4NLYA 5CYQB 1S9GB 4O44A 5KFNA 2V9WA 4WZMA 2W9BB 3EPGA 3NAHA 5KT5A 1HQEA 3CJ2A 3VQSA 1MMLA 3RB4A 3DI6B 2FJVA 1EETA 4K4SA 4MK8A 4NLWA 5DG8A 3MEGB 1S1VA 1LW2B 1RTHA 2R8GA 5KFWA 3M8PA 1RTDB 1JLCB 1JLAA 1EP4B 3NKYA 2XC9A 4ECWA 1FK9A 3PJXA 4IG3A 4LSNA 4IH6A 3OL9A 1S9EA 2ASLA 4I2PA 3DLKB 4H4OB 5J2NB 5EWGA 2C2DA 3QO9B 3T5HA 1RT1B 3KK1A 4KSEB 3OL8A 3LP0A 3Q8QB 3H40A 2BQUA 4NLDA 3DLGB 4KE5A 4KKOA 5KFSA 5KFPA 4RNOA 4IQXA 5JXSA 4PUOB 1IKYB 4ECVA 4RNHA 1S1XA 1RT2A 4IH7A 3MR6A 4O3SA 4DG1A 4ECYA 5KFLA 3QZ8A 1UWBA 2YNHA 2YNGB 5D3GB 1Z4UA 3KMSA 1IKXB 5KFVA 3KHLA 4K4YA 5EUHA 1SH3A 4NLGA 2UUTA 4I7FA 2ZD1A 3FFIB 1SV5A 3BGRB 5KFIA 4U7CA 1ZTTA 4Q45A 5J2MB 4ED1A 3NMAA 4O3RA 1GX5A 2ALZA 4F4XA 3ITHA 3M9MB 3V6DA 2FVSA 1RA6A 2YKMB 5C24A 3QGIA 4ECSA 4IR9A 4MH8A 1RTJB 4R0EA 4ICLA 5CYMB 2FVCA 2R8HA 2J6SA 3NL0A 3QLHB 3H5SA 2W8LA 2IA6A 4JV2A 1NNDA 1SH2A 3DRSB 3G6VA 4RUCA 1NHVA 1REVB 3LALA 4FS1A 1FKPB 1RT5A 2I1RA 1VRUB 4URSA 4YP3A 1JLFA 2ZKUA 1S1TB 3HVWA 4FS2A 3CDUA 4YR2A 4ZP9A 3ISND 4ID5B 4Q0BB 3PW2A 3IGVA 1S9FA 3NBPB 1T03B 1TKXA 2WOMB 1RDRA 5KG5A 2AGQA 4QPXA 3BR9A 3I0RA 3QIPB 4YQWA 1MU2A 2HMIA 3JSMB 5I42A 3M8QB 2WHOA 5KFGA 5HP1A 1RT4A 2R2UA 4XPEA 4IH5A 3RB0A 4RNFA 3GV5B 3QGGA 3KK3A 4MK7A 4NRUA 3CVKA 4JV0A 1HPZA 5F8MA 1JLQB 1LWCB 1N48A 3UQSA 1FKOA 2R2RA 4IOBA 3DOLB 3LP2B 3LP1B 5KG1A 1RT6A 1TKZA 3KLIB 1RT3B 4G1QA 5DQHA 4O4RA 1HNVA 4MK9A 4TYAA 4O3PA 3CJ5A 3E01A 2W9CB 1C1BA 4Q43A 1JLBA 5F8GA 3IG1B 4IDKB 5KG0A 4F50A 4ECQA 4J9MA 4MFBA 1S1WB 3KLEA 5FDLA 5KFHA 3KLGB 3DLEA 1IM4A 1ZETA 2R8KA 4B3OA 4WYLA 4RW9A 2JC1A 4H54A 1QAJA 5KFCA 3MFIA 2IAJA 4WE1A 4RW6A 4ZMMA 3MEEA 3GQCA 3SI8A 3OL7A 5EWFA 1SH0A 2VG5A 3LAKA 3RAXA 3DM2B 4Y34A 1S6QA 2BANB 1TQLA 2VA2A 2FJXA 4R8UA 1XR6A 1S0NA 1TV6B 5KT4A 4URQU 3DYAB 4HKQA 4EO8A 1C1CB 2VG7A 1RT7A 2BQ3A 2OPPA 2V4QA 2FLPA 2OPRB 4ZP8A 4NLSA 5J1EA 3MECB 4RNMA 1S4FA 5KT3A 2FLNA 3DMJB 2E9RX 5J2PB 2BRKA 3V4IA 2RDIA 2W9AA 1JLGB 1SUQA 4NCGB 2CJQA 3G6XA 4WFYA 2VG6A 3CDEA 3PVXA 1K1SA 3CO9A 2WONA 4ZPBA 5F9LA 5KFQA 2FLLA 4YR0A 4O4GB 2CKWA 2XI3A 1T05B 1DTTA 1C0TA 4RNNA 2FVQA 4QWBA 1LWEA 1BQMB 1TKTB 4H4MB 5C42B 2YNIA 4KO0B 1C2PA 5I3UB 1HARA 2HNDB 4ZVHA 3KLHA 1R0AB 2IC3A 1J5OB 3QZ7A 1HNIA 2RKIB 1DLOB 4IFVB 1TP7A 4EO6A 4Q8FA 3DRPA 5DG9A 1HQEB 4QWEA 3BREA 4O3OA 4NLTA 1EETB 1N4LA 2IMWP 1HYSA 2YKNA 3OLBA 1S1VB 4RW4A 1S6PA 4MIAA 4HYKA 2R8IA 2O5DA 3BSAA 1IKWB 5HBMA 2C28A 4IRCA 1JLAB 3C6TA 3IS9A 1FK9B 1KLMB 1DTQA 4IG3B 4LSNB 3KHGA 3BSCA 5F8JA 1S9EB 4F4ZA 3MEDA 1JLEA 3E51A 3HVTA 4ZPDA 2RDJA 3KK1B 3I0SB 1LWFA 1QUVA 3LAMA 4LSLA 4TY9A 4QWDA 5CYQA 1S9GA 4KKOB 4ECZA 3RB6A 1QE1A 1VRTA 2BE2A 1S1XB 2HWHA 1RT2B 1S0MA 4LQ9A 3KOAA 2B5JB 2AX0A 3T5LA 2YNHB 5KFBA 1S49A 4ZP6A 1LW0A 4DL6A 3MEGA 3TAMA 5HROA 3IRXB 3GIJA 5KG2A 2JLEA 4RUAA 4ED7A 1SV5B 4NZ0A 2XGPA 3DRRB 4NLUA 2OPQA 3PR4A 2W8KA 3H5YA 5EWEA 1EP4A 3T5KA 3ITHB 5HLFA 1S10A 3QIDA 1S1UA 4K50A 5C24B 4WFXA 2XCPA 4NLPA 4RW8A 4ED0A 4J9NA 5J2NA 2XCAA 2HNYA 4ICLB 5KFZA 4ZHRB 5KG4A 2AGPA 1T94A 4ZP7A 2W7OA 4K4XA 3V6KA 4O3NA 5EDWA 1TL1B 3MR2A 1HMVA 2AGOA 2JEGA 5C25B 3DOKB 1JLFB 3OLAA 2UUWA 2C2EA 2YNGA 3CWJA 3PW5A 2FVRA 4X2BA 3HVAA 4XPCA 3I5BA 3BGRA 3GILA 3KNAA 4IKAA 2ASJA 3OL6A 1MU2B 2I5JB 5J2MA 2HMIB 1XR7A 4Y3CA 4K4TA 4FBTA 5HP1B 4ED2A 4Y2CA 4IFYA 3CJ3A 5F8LA 2VA3A 1RTJA 2V4RA 3I5CA 5CYMA 2HNZB 5KFAA 4TQSA 4R5PA 4XO0A 3MFHA 3C6UA 2YNFB 3I5AA 3CIZA 3CDWA 4TY8B 1D0EA 4G1QB 1GX6A 3MF5A 1REVA 1HNVB 1FKPA 1VRUA 3KLFB 1C1BB 3IGNA 1S0OA 2BR0A 4PWDA 3JYTB 4ID5A 4Q0BA 3NBPA 4MFBB 1TL3B 2WOMA 5FDLB 3DLEB 2D3ZA 4MKAA 3BSOA 1RYSA 2IM3A 2RF2A 1IKVB 3T1AA 4RW9B 3QIPA 2WCXA 4NRTA 5KFMA 3JSMA 1JXLA 4PQUA 4IG0B 4RW6B 3D28A 5L9XA 5KT7A 3NAIA 2BQRA 1C0UB 3KK2B 2ILZA 3N6MA 5T14A 4QW9A 5K14B 1S6QB 2R2SA 4NLQA 1LWCA 3GYNA 1BQNA 3H59A 3UPFA 4I2QB 2ATLA 1S97A 2VG7B 4OL8A 2GIQA 3DOLA 5KFKA 1QE1B 2F8EX 2XI2A 5J2QA 4KB7A 4ECRA 4ZVGA 2IM1A 3BJYA 4KV8B 2W9CA 3UDLA 3RBEA 2IBKA 2GIRA 4M95A 3V4IB 2JEIA 5JUMA 4IDKA 2OPSA 5F8IA 1KHVA 5F8NA 4KFBA 1TVRB 1RA7A 2ZE2B 3KLGA 3FDSA 3GIMA 3RBDA 1N5YA 2AQ4A 4F4YA 3V81B 4TXSA 1T3NA 1JKHA 4Q44A 3G6YA 4J9QA 1WNEA 4KHRA 3KLHB 4KHMA 1NHUA 2J6UA 2IC3B 5KFDA 1U09A 4DL2A 3DYAA 4EYIB 2DPJA 2B6AA 4EBEA 1HQUB 5DQIA 2V0NA 4O44B 2WK4A 3DRPB 5KFRA 1OS5A 2EC0A 1D1UA 3V6HA 3D5MA 5KFTA 3OSPA 3DMJA 4K4VA 5J2PA 1S48A 2YKNB 3GV7B 3MTKA 4RW4B 1S6PB 4EBDA 4RW7A 1N6QA 1RTHB 1T05A 5HBMB 3C6TB 3M8PB 2IM0A 4KBIA 1W25A 4JV1A 3MR3A 4QWCA 2C2RA 5I3UA 3BQ1A 2AWZA 4I2PB 5L1KA 5KFEA 3GIIA 3Q8SB 3SFGA 4K4ZA 1RTIA 5KFOA 3IN5A 1LWFB 3KJVA 3LP0B 4ZPAA 1K1QA 1VRTB
chains in the Genus database with same CATH superfamily
4NASA 4ECUA 1UWBB 4L76A 3EJMA 1M90T 2R7VA 3M2UA 1RHKB 1UA1A 2F4VJ 2J6TA 4EK2A 4PYAA 2KM8B 4DHVA 3PZPA 4EYHB 4ED6A 5L1IA 2V4JA 2NUUG 4LT6A 5KG3A 3PV8A 2IBOA 2JEFA 4C2MA 1HBMA 2YKMA 1JIHA 3PW7A 3MM7A 3OTEA 3ETOA 3U7JA 1NPRA 4I6WA 1TL1A 3OUYA 2I8EA 4IOCQ 2E29A 5AXLA 4L3NA 1ZYQA 2HBYB 2CA9A 2AU0A 4X4VA 5ITHA 2Y1LB 1YG0A 4FXWA 1MMNA 3TQ1A 3PHEA 4P74A 1C0TB 4ATNA 5K14A 1Y3JA 3FSIA 3PRVA 1TV6A 1AYEA 3Q24A 3R5JB 4X4PA 2MY7A 4C8YA 4GKKF 4K4UA 3R1HA 3OFFA 3UDCA 3V81A 3H42A 2VJUA 3FMWA 3A3NB 3KJVB 1R0AA 2MQMA 1S9GB 1RWMB 5BYRA 4PRFA 3JSRA 2QGFB 2CNNB 2F9JA 3LW5C 1H3DA 4DV2F 3TUJC 4P75A 1OY6A 1HBNB 4IH6A 3A8EA 2CVEA 4WP8A 4KSEB 1IKYB 2YXLA 2KG1A 1FEHA 2HZAA 4UY8T 1Z4UA 2RU9A 2OMOA 5T41A 3W1YC 3OFEA 2PO4A 4ZLLA 2G2YA 4P52A 2NUHA 5A0YA 2L9DA 1FKPB 4FPIA 3DFEA 1BWEA 4HTJA 4P9SA 2WOMB 2AGQA 3D66A 4NEZA 1KS2A 1MNEA 4KH0B 2DY9A 1HNXJ 3M8WA 4OI6A 5FJ4A 4E8UA 2H48B 2CFXA 3DOLB 4M5KA 2BE7D 2E7XA 5F8GA 1FJGF 3NWGA 5DO2A 1NJIT 3KG0A 4NMXA 2ZZTA 4WE1A 3JQKA 5C2GA 3GMGA 3BKTA 4RNMA 2FLNA 2MTLA 1R43A 2M9KA 2KRBA 2JL9A 3RBXA 2W4CA 5HQMA 2IC3A 3D2WA 4DUZF 3J81U 4YUDA 2R9LA 2XNQA 1MN7A 2PA8D 1U1PA 2DR6A 2BYCA 3L7UA 4G1PA 3E51A 2PIIA 3HM9A 1U8SA 1U26A 4HHHA 2Z4PA 3OXGA 1TK5A 4DR1J 3KOAA 1CJKB 4LRBA 1NJZA 3H7HB 4K50A 4WU3A 4RW8A 1ZAVA 2YQ3A 5C25B 2KKHA 1Y9OA 2C2EA 3IR5B 2DTJA 1EKSA 1YJVA 3UCUP 4X2BA 5H1SV 2ZHAA 1M5HA 4IFYA 2B4PA 2HPUA 1RP5A 4R5PA 3CJQA 4LIWA 3CDWA 3GSIA 1REVA 1HNVB 1TMJA 1TL4A 1YJNS 1RZMA 1XQIA 3EGVA 3L7OA 4RW9B 1F5BA 2VJVA 4YFUA 1BQNA 2ATLA 2ZJPQ 4KB7A 4I56A 2IM1A 1TVRB 1RA7A 2MHEA 3FDSA 1S7IA 2JVRA 3R2CJ 4X4SA 1ZBTA 2V6AA 5E2QA 5E7OB 1RUSA 4MJKA 3D9BA 4RW4B 2VPYB 1N6QA 2C3MA 4YN3B 3W9IA 3ZTQA 1SJRA 4LFBJ 1VQ4S 3IM9A 2V8GA 3Q8SB 5CH7B 2RILA 2V2ZA 2X3DA 1H98A 3NGKA 2KL8A 4K5RA 3RAQA 4F0KA 2WBRA 5EGYA 4I7FB 4CO1A 5U47A 1RTDA 3T5JA 2EFNA 3GP9A 1RT1A 1UZDA 3VAGA 3HK2A 1FJEB 1VQKS 3M9NB 4QWAA 9RUBA 4NYOA 1IKXA 1T9UA 3DRRA 3EPIA 4MMOA 2MKHA 1RT4B 1N56A 3HHKA 1U45A 3MM5B 5LOQA 4B9NA 3FCHA 4OV1A 4M1KA 2AF6A 2R3VA 4WZQA 4LF4F 3EX7B 3MMAA 2DVIA 1HLWA 1PIEA 3H98A 4U95A 3VALA 3PEHA 5CAAA 1JQGA 5LSLA 2YNFA 3OSNA 2YWFA 1U0HB 2F4FA 2DGTA 1UVKA 3PCOB 1UWAA 1RAOA 1YVFA 3FRYA 1KFDA 4DR7J 3MCMA 2HHUA 2ASDA 3MCOA 3ICLA 1Y5NB 3PX6A 1HNIB 3MR5A 2RS2A 2WB4A 4EEYA 1VJQA 2Y1JA 1SVDA 3R5AA 1MN9A 3D0IE 4A47A 3ENQA 2GGPA 3HHLB 4H4KA 2X1AA 4O23A 1K0TA 2YX1A 4C0OC 2XEXA 2HHSA 1Q8KA 4HH0A 1WDTA 1WC5A 4CZCA 3HSZA 1MW7A 2RE1A 4FYDA 1XEZA 3VQSA 1SPBP 5DG8A 2ZOGA 3FC9A 3MAAB 4RBVA 2GVDA 1EP4B 2IIHA 3CF5Q 1Y11A 2C2KB 3MR6A 4O3SA 1RKJA 4JBCA 2L9WA 1SH3A 3D1OA 4U7CA 2ADBA 1GX5A 4Y2IA 2EWHA 1GK8A 2MZTA 3NL0A 2IA6A 1NNDA 2VASA 2Z2LA 1G2EA 4RUCA 4DFPA 1FF2A 1V3RA 3ISND 4NCBA 1T03B 2OFHX 3OQ2A 1IQZA 2A0FB 5DDQC 2EVZA 3EDRB 1OJ4A 5F8MA 1YZ7A 4NZ7A 2ZH7A 2NZCA 4O3PA 3E01A 3HD2A 4ZIVA 5CZVA 1IXKA 4CLWA 3I6PA 3B82A 4EWTA 5KFHA 3P49B 2X51A 3OW2R 4ZMMA 3TANA 5M2UA 3OL7A 2BANB 4Q2LA 4HKQA 5HMXA 1C1CB 2ZWOA 3AAWB 2KHCA 2F65A 1Y5LB 1G3OA 1JLGB 2CJQA 9ATCB 2C3PA 1K1SA 4ZPBA 1TZ0A 4A8SA 2FVQA 3RUBL 1BQMB 1S59A 3QZ7A 2BBEA 1F9FA 1VQ7S 1HQEB 1FRJA 4O3OA 1EETB 5K8OA 4WFNQ 3D54A 2XULA 1NZAA 5K8MA 1S9EB 3CCSS 3LA0A 3I0SB 1N33J 3LWMA 5HROA 2H65B 3SXLA 1RE1B 2JFDA 2E44A 1N36J 4PZVA 2U2FA 1YJ9S 2AJFE 1BMQB 1S12A 4ELTA 3EVOA 2FVRA 3C46A 5FD1A 1IN0A 5A8WA 1RTJA 1NCLA 3FVYA 4A48A 3MFHA 1KD1T 1OYEA 2BR0A 2EFVA 1TAQA 4WP9A 1R7IA 2CWXA 1TR0A 2DXDA 3MTJA 3JSMA 4MAKA 2VFVA 2BQRA 4PG7A 2ABYA 3H59A 2VC1A 3TJAA 4HR2A 2Z2ZA 4ECRA 4I6YA 3UDLA 2GIRA 4M95A 3GJTB 1BLUA 2DNYA 1WWHA 1ZPWX 2YVSA 4F3MA 5HMYA 4UOGA 1X5TA 1NHUA 2J6UA 1FESA 4PCQA 3TNVA 2FZGB 5KFRA 1HBUB 2C1EB 2LQ5A 3DMJA 4F36A 4WK1A 1K47A 4GO5X 3GV7B 1JJ4A 2MQOA 2ZBIA 4ZN1A 4JYAF 3NLCA 3MUVP 2BE2B 1UETA 3B54A 1WORA 2XSFA 3NG8A 3KFWX 4Z7YA 4CTAB 3PACA 1LW2A 3ENWA 1KQSR 1VMBA 3GFZA 4I1TA 2DJWA 1FA0A 3VAKA 3GV8B 3G96A 2RU3A 5HATA 2KH9A 4R25A 1RJJA 2RQCA 2CADA 1P8GA 2CZ4A 2HBRB 5D3GA 2D41A 4EMDA 3W63A 3FFIA 1WEYA 3CJ0A 5KFXA 1GT8A 3QGHA 2GO8A 3SSSA 1RWUA 2CQ0A 2DO4A 3H4BA 1WJ9A 1KQFB 3DOMB 2BOAA 1WD6A 1OPZA 3RR8A 1HD1A 4DV2J 4LFCF 4B3OB 2GVZB 2KZZA 4ZVOB 4RR5A 2ZH2A 3SV4A 1H7XA 3C15B 3CJ8A 2UU9F 2V68A 1FDNA 3QSYB 1MROB 4IG0A 1KWMA 3JTPA 3PIPQ 3T1HJ 1UVIA 4R0JA 1HNWJ 4JUZA 3TR5A 2PFFB 4DL3A 1HYSB 4HDHA 2W1BA 5KG6A 3GLJA 3M4XA 4WF9Q 3G87A 1DARA 1JLEB 1HQUA 4YR3A 1AFJA 4IFVA 4NLYA 4LSLB 1NK0A 5CYQB 3HT3A 3EPGA 3RTVA 5KT5A 2OTJS 1FJGJ 4GVBB 1RTHA 5E41A 1D3WA 2R8GA 4N8OA 2XMJA 5HAOA 3GCXP 1KVKA 4IH7A 3CJRA 4DG1A 2DNRA 3PYDA 2HBQB 2J0QD 1QVFR 3PFOA 4C3MA 2F7VA 3E8OA 3NOCA 3Q23A 3QATA 2KXHA 2ZOFA 5E3AA 3HVWA 3OXFA 1HI1A 5ETMA 1IUJA 3TEGA 3BR9A 1YI2S 2DHXA 1YRXA 2HAFA 4UZBA 4NRUA 5F41A 2RJZA 4NL5A 3HFVA 3G4SS 5LSOA 1RT3B 4G1QA 1KQGB 4CLYA 1ZETA 2QYGA 2DRBA 3Q86A 3NGTA 4X84A 1B99A 3BKFA 3OD2A 4M8LA 2FGOA 4LJMA 4K0KJ 2OPRB 4USWA 2Z56B 1RWVB 3V4IA 1PO6A 1SUQA 4OYPA 3CDEA 1X4HA 3I4HX 3CO9A 2XMUA 1FXDA 1T05B 4RNNA 1TKTB 4K7QA 3VVTA 4OZJA 4M5GA 3RRKA 2HVDA 1IBKF 1OY9A 4NA1A 3Q89A 1X31C 3DRPA 1WEZA 3UR3C 2JDJA 1N4LA 1X9MA 1HW9A 4N5SA 3EDQB 2CXEA 1ZM3A 1JLAB 3J80Y 4TY9A 3R97A 3LAMA 4FYVB 2O67A 4UT4A 3KJFB 2J9DA 4AT1B 2GJIA 4B08A 4LQ9A 3MM9A 2B5JB 2BEFA 4DUTA 4ZP6A 3M6WA 5AJ3F 5DM6Q 2VOOA 2XMVA 1NAQA 2HVEA 3WHIA 2XCPA 2ZDOA 2VODA 1RACB 2L9NA 2ZEJA 2ZBQA 3OLAA 3EVWA 4XPCA 3OPKA 1RWNB 1B4SA 2AYGA 1NU4A 1LKZA 4TY8B 2N4CA 4FN5A 2KZMA 1VRUA 3HJVA 2FY1A 4XDCA 1PBAA 4X4TA 3Q83A 2FHJD 4DV4J 1HW8A 2RMLA 1F3VA 1FNMA 1L3SA 2MMYA 1XMQJ 1GFWB 1KLNA 3M32B 3T6BA 2B9EA 3LH2S 4ZCMA 4WU2A 3UD5A 3GIMA 4OYXA 2KXFA 3FBBA 5D77A 1C4CA 1VFJA 1R31A 1U09A 3DYAA 1H73A 4DFMA 3RW7A 1HI0P 3D6FB 3I56S 4ERDA 1EARA 5GAGI 4LF4J 2AHOB 2BE9B 3OJSA 2HHVA 4K59A 2IFXA 2WW8A 3SFGA 5KFOA 1VQOS 2DNGA 4KYZA 4XAKA 2VOPA 2FUG9 3DI6A 4TYBA 1LW0B 3J81Y 4LF7F 3MUMP 2QLXA 4DLGA 3G9CA 1RADB 3AY0A 3J81j 2HFVA 3QO9A 4JI3F 3KLVA 5B7WA 4PUOA 2LA6A 1N88A 5LSRA 2BV3A 1JK9B 2VUGA 3FQKA 3M7VA 3K5MA 1X5SA 2KB2A 2IJFA 4QW8A 1X4CA 2HHQA 5A2QU 3K7RA 1FKOB 2HRUA 2PI5A 4Z2XA 1BE4A 2R7TA 2RF2B 3DU6A 2VU5A 1D09B 1OQ3A 1RLDA 3MEEB 3Q8PB 1JNRB 2HNZA 1DURA 3LP2A 3D3CJ 1ULRA 3N28A 2YKAA 4JI7F 2VDIA 2E7VA 4PQAA 3S7RA 2OHDA 2QLJB 2HK2A 3LANA 2W24A 2B6AB 2HK3A 3VQTA 1RBLA 1QY7A 3H5XA 3IBFB 1UFLA 4QIGA 3N6LA 1TFWA 4HT7A 4F02A 1OO0B 3U27A 4H4MA 3AJ1A 1IVZA 4KO0A 4ECXA 3KG4A 2BKOA 4UOFA 2CQPA 2XSJB 1VRQC 4U96A 1FRIA 5H9FK 1R89A 2DR9A 3TZWA 4AL5A 3AA8A 3BS9A 4JOUA 1XJWB 2CG4A 1YTYA 3H40A 4KE5A 4RNOA 4NXNJ 1GEHA 3PO4A 2HHHF 5FLXU 4B9SA 3ZZYA 2MQQA 2DB1A 5BR8J 3BV8A 5A76A 2HQCA 1VK3A 3M9MB 3J7ZT 3H5SA 4FKXA 3LALA 4URSA 1MSWD 5B0EA 1DBDA 1WUUA 1S9FA 2LU1A 1W26A 3LGHA 5K5MA 1CC7A 5JJBA 3J7AN 5I42A 2ZZMA 3R5BA 1AZSB 4JV0A 4OYOA 1HR0F 2HSEB 2LMIA 4JI5J 1TKZA 3MDFA 1ZM9A 3CJ5A 4F50A 3US5A 3KLEA 3DLEA 2UUBF 4WYLA 1VBKA 2ZBCA 4O0IA 1XR6A 2A18A 4BC9A 1FD2A 1N34F 5A8RA 2OPPA 1QD1A 1PC5A 2ZHOA 3CD5A 1Q78A 2C3UA 3NGSA 2CPZA 2AMCB 2CKWA 2R4FA 4A46A 4X62J 2AEMA 1C2PA 5B0CA 4Q5VA 3KLHA 3SSQA 2MY8A 3UN5A 3UDVA 3ET6A 4LRFA 2V2KA 2M3DA 1UPMB 1IR2A 3BBCA 4DV7J 1H2TZ 4P73A 5AE3A 3DXBA 1U6BA 2A6MA 2RHQB 1RHQB 3HVTA 5CZXA 2E1RA 3IMQJ 4ECZA 2EFPA 4PXCA 1D9FA 2XLKA 3UNGC 3Q0AA 3G2XA 4DL6A 3MEGA 4WFBQ 1BD6A 3L3CA 1B7FA 5LMUJ 4J9NA 2DHGA 2CJKA 3KG1A 3TQEA 4F4AA 2R7RA 4K4XA 5EDWA 2JRSA 3MR2A 2EKNA 2YNGA 2VKZG 3HVAA 2BABA 1IR1A 1MU2B 2HMIB 2KT3A 4FBTA 1RTZA 3QAEA 3CW2C 2ZUAA 3TW0A 3QT7A 3CD0A 2QSFA 1Y7PA 4ID5A 4CM2A 2O3DA 2D3ZA 3K57A 5KFMA 1KBRA 3CSKA 1CQMA 2XYGB 5B0GA 1KKHA 2B0GA 2XY5A 4IDKA 4RLEA 2E1MC 3NY0A 3MURP 3OTOF 3ILIA 1OMSA 2OAUA 1F0XA 4J9QA 1SJ4P 4EBEA 3MR7A 2QT7A 1F9EB 1AUSL 2ZBPA 2GNKA 5ETRA 3MR3A 2VFSA 4DV6J 4K4ZA 4PXDA 3KJVA 3GFYA 2H4WB 3TAMB 2CJ9A 2R7SA 1X4AA 3TUZC 4C4WA 1Q82T 4RL1A 1KLMA 2Y0SD 1B7YB 3FRZA 3SCKE 2HNYB 4U7UK 1VQSA 4W90B 1IKYA 2MJUA 4DV0F 1D9DA 4DEZA 3HDSA 4UQTA 5E3QA 3RRHA 1PG5B 1NKCA 2DNZA 1QUPA 4FBUA 5I4MA 4ZKAA 4WXWA 1OY8A 2VQFF 3CD7A 1FTRA 2RB7A 1SKSA 1WC1A 2H3EB 3BR8A 2BUNA 3GFXA 1NJXA 2HQFA 3AD9C 4HTIA 2MZJA 3DHWC 3KLFA 2VBYA 1SQFA 3MAQA 1N5YB 3ZZZA 5GMKa 4DV5F 1C0UA 3KK2A 3EZUA 2EK1A 2YNIB 2MEWA 4JI8F 1I94J 3T9NA 3Q8RB 4KV8A 2M0GB 2MKIA 4NLVA 1Y4ZB 2XMKA 3S6EA 4AE5A 2IRXA 5D15A 4RX6A 2V67A 2DT9A 4IRDA 3FQLA 5LM7E 1T11A 4RBTA 3M9OB 2EFGA 4OYZA 4O44A 1RAAB 4KHPJ 3R3TA 3AH6A 3QT6A 3MMCB 3M8PA 2XC9A 3HXMA 3OL9A 4K8RA 2AJQA 1H38A 3ZTSA 2VD3A 2J8SA 2OD6A 2XB2D 1CJKA 5KFVA 1PJ5A 2D3O1 3Q8YA 4ED1A 4DI6A 4XTTA 3KKFA 2V69A 4RPFA 1WC4A 1KTQA 4ETZA 2PC6A 2MPUA 1XMOJ 2LP4A 1XNRJ 3ILJA 3QIPB 1UTAA 4HL9A 3RB0A 1DQAA 4MYTA 5B0BA 3RGIA 1QLNA 2ZWPA 3N5FA 4M5DA 1HNVA 1K44A 5AJ3J 2CRLA 3P45B 4RW9A 2JC1A 5EX3A 3G6ES 2G9OA 2BQ3A 2DKOB 5J2PB 3TARA 2BACA 4TU7A 2FC8A 3W5XA 4Y6IA 3PVXA 2DGUA 5KFQA 2FLLA 2XI3A 1EJ7L 5H9FJ 2ERRA 1N8RT 3WZ0A 3L4BC 5I3UB 2IJRA 4JI6J 2CVIA 4Q8FA 1HHQA 3LUYA 2YWWA 1Q8BA 2M8DB 3IA0A 4RW4A 3IXQA 5IFMA 2VV5A 1SC3B 1SL2A 4IRCA 4DR6F 3BSCA 3QFHA 5D4NA 2YWGA 1YJUA 1S0MA 1WKJA 5H9EK 1NO8A 2NCKL 1P9QC 3GIJA 2JLEA 3FEYB 3CXCR 2F63A 2J9CA 5I3QA 4U8VA 4ICLB 2DH8A 3ZXWA 3DDNA 2AGPA 1XIQA 1TMMA 3PY8A 2CQ2A 4RWXA 5IV3A 2XHWA 3OVSA 5IWAF 4DU7A 3I5BA 5T7LB 5LJ3Y 1V5VA 4ELUA 1Y0HA 2ASYA 3HSDA 4C8NA 4DX8H 3MM5A 4NXMF 1LXJA 3ETMA 4DX6A 1WACA 3MF5A 3SCJE 2AZ3A 4M5LA 4LF7J 4BBYA 4JI0F 1FHTA 3D6HB 3OR1B 2LFVA 3M1VB 2SXLA 4KC5A 1VBYA 2FJAB 1QJHA 3H2UB 4JI3J 2MDAA 2GIQA 2NSCA 2Q66A 1U0HA 2BVZA 3M30A 4DQRA 2AP6A 2F4VF 3LQVA 4KHMA 4L6V3 1NKEA 4DL2A 3OVBA 4QR1A 4YDDB 4C11B 2DY1A 3HHLA 4LREA 4GRSA 5HBMB 2BMBA 1LOUA 4QWCA 2C2RA 2I38A 1L3KA 3IN5A 2KT5A 2VPZB 2OEJA 1WG1A 3GJQB 2Y3YA 3V5RA 4YDXA 2YWEA 4AL7A 5DDRC 2HQDA 3CE8A 1NK4A 4QW9A 5F8HA 4PWWA 2HURA 2N3LA 1YDLA 1SKRA 2MQ8A 4A8OA 1RI7A 4OI2A 1HMVB 1KNZA 5ETVA 1CS4A 4WFZA 4DL0C 4TU9A 1UFKA 3CPWR 3UDEA 3CJ4A 3KHRA 4UY85 4USKA 1NH8A 3NXZA 4HVZA 2YX4A 4ES1A 5HQ8A 3EXCX 4LVOP 2NLWA 3DOKA 2GC8A 1TFYA 2UZAA 3M2VB 3BGUA 1T03A 2AEFA 2OGUA 4OHVA 3ILLA 4PKDB 1XBWA 2MZ1A 4DLEA 3MHYA 2PGCA 4CO4A 1RT7B 2QSWA 1X4BA 1FKAF 2CQBA 2QFJA 2K1RB 3NS7B 4OZ3A 2Q3PA 4M63A 1QAXA 5FIIA 1LWEB 1ZZNA 2BANA 2Y9HA 1C1CA 3AHPA 3A3OB 2KRRA 3AD7C 5A6WA 3GYXB 1GXTA 1JLGA 2V5HG 1VHFA 1JXVA 3OHAA 4DL5A 1BQMA 3MEDB 1G7CB 1RTIB 2HS3A 1HR0J 1NH7A 5KFNA 2DHAA 3ZFVA 1HQEA 1DZ5A 2FJVA 2VB6A 1EETA 4M5HA 4K4SA 3N01A 2V8HA 2UUBJ 4ILLA 1JLCB 2BA9A 2BJ7A 4PWUA 4DR2J 1HNXF 5GAGU 1S9EA 4H4OB 2OP5A 5EWGA 3LP0A 1S4EA 4DV1J 1Q8IA 1DJ0A 4FYYB 3K58A 1OSCA 4X4NA 2XZTB 4Q45A 5D4PA 1RA6A 4ECSA 1FRMA 2EK6A 4FVMA 1SH2A 4KGXB 4U9RA 4NE9C 1RT5A 2VL1A 4ZJLA 4ED5A 2UXBF 4QU6A 4RJVA 4YQWA 3EMTA 2WHOA 1SCJB 5HVFA 3KK3A 1JLQB 2Z0GA 1FRHA 2R2RA 2DRDA 5GVQA 2GA7A 2CQIA 5DQHA 4MK9A 5A2QY 1W2BR 4FF2A 1GH8A 4ECQA 2N4DA 4J9MA 3GCWP 4HI2A 4YOEA 4JP8A 4TLQA 1IJFB 4H54A 4FF4A 3NCQA 1VK8A 3K59A 4USMA 1VQ6S 1MMDA 1S4FA 5GAHI 3EICA 2W9AA 3G6XA 3M8RA 2WONA 2LEBA 4FF1A 3FEXB 2E1PA 4L72B 1HBUA 2QL9B 1KFSA 2MQPA 2F5GA 4MT1A 3UN2A 1LNQA 3M2UB 2JLGA 3C19A 3CC2S 4LSNB 3MXHP 5IOLA 3N5BA 1U2FA 1DRZA 4OYMA 3FSYA 2WZ1A 2BE2A 4CTAA 5CA5A 2V4JB 4ED7A 1BXNA 5SUHA 2HQIA 3T5KA 1A9NB 1PAUB 1KR4A 3M8YA 2UUAJ 2G0IA 4CLFA 3N79A 3JSBA 2H9ZA 1TL1B 2EW9A 2JEGA 1JLFB 2CQ3A 3G82B 1NUEA 1RCOB 1FO1A 1SIZA 3JXOA 5FLXY 4C8ZA 4AXIA 3IFEA 2LEAA 3R1LA 4DPWA 2V4RA 4DBQA 4TQSA 2B9WA 2VFTA 4PPDA 1F5CA 3DOMA 3NBPA 4MFBB 3BSOA 3T1AA 4LFBF 3VAMA 2ROPA 3D28A 2BJDA 5K14B 4OX6A 3LOUA 1LWCA 2HIYA 2QA4G 3C15A 1Z1ZA 5IC4B 4TVAB 3V81B 4DR3J 5G4DA 1MROA 4Q44A 2CJYB 4K2XA 2A10A 4E2FB 3FCVA 2LLZA 2DHHA 1S76D 1TUGB 1FD8A 2VQFJ 4QZVB 1S6PB 4USVA 2DRAA 3A8JA 5H9EJ 1CJUB 4YS2A 3KUGA 2HKEA 2VF3A 3PTWA 2YWHA 4WKRA 2DNKA 4ZPAA 1DAXA 1PCAA 2LQ8A 2HRTA 1VQLS 4OX8A 1IKWA 3MZIA 1SJQA 5G0RA 6FDRA 2A2DA 2CAJA 3WC2A 3PHTA 3FZBA 7FD1A 2CUYA 5A0YB 3K0JA 6FD1A 5C5JA 4DR7F 2HHPA 3BQ2A 2V63A 2HS4A 3DHXA 2AIRB 2M4MA 5KG7A 3R5CA 2XZDB 1S6UA 3D1HA 3F44A 4LR9A 2QA1A 2UUCF 1RLCL 3IC1A 3C66A 2HGLA 3GG1A 2OEMA 1UVJA 2EG1A 4WE1B 5D0EA 5L1LA 3KMQA 1B64A 4HI1A 2L3MA 1RT3A 5KFUA 1TL3A 5F0UA 3EGZA 3DU5A 2K7KA 2X1GA 1JKHB 5DG7A 1M1KT 1WG4A 4U7UD 1KDNA 4OYIA 2QV6A 2OPRA 2LCWA 4NYPA 3CJTA 2PSZA 4OMFG 1SKUB 2UVRA 4RW7B 2BW2A 2FD2A 1C4AA 2DR7A 2F1FA 3CNQP 3NGDA 4CO5A 1SC4B 2QIFA 1TKTA 4USUA 2LA4A 4DR5J 3H4DA 1U6ZA 5IQQA 3QWUA 1FX4A 1HWKA 3BGOP 3W2VA 2ZH3A 2QJ3A 4KT0C 1REGX 4P2FA 1LK5A 2R7WA 1YJTA 1JLAA 4KIAA 3QBCA 3SBMA 2Z2YB 2CYYA 3QZ8A 1UW9A 2RQKA 3KHLA 1Q0NA 3K17A 1R6VA 4J91A 4NLGA 2ZD1A 4IUFA 1QAYA 3UVJB 4F4XA 5THWA 2IYIA 4DUYJ 1GTEA 3AJDA 4BWJA 2FTRA 1PGZA 4N47A 1REVB 5E5NA 3E2EA 4YY3J 4FS2A 5K8PA 1TKXA 3LO3A 3DN9A 2LEPA 5DS7A 4QR2A 4ES2A 3QWPA 1JLBA 1S1WB 2VIHA 1TTHB 1TUWA 4USJC 4CLLA 2MLZA 3RAXA 4R8UA 1N33F 2CNLB 4NZ6A 3Q2TC 5J1EA 2XS2A 2HS0A 3AOAA 2BRKA 5IT9Y 1YWXA 3EGWB 2VG6A 2BJ9A 3MMBA 2MQNA 1FFWB 1PBUA 1FRKA 1WF1A 2RKIB 1TP7A 1GNKA 4OX7A 1NSPA 2NXNA 2RVJA 2DR8A 1KQKA 2D69A 3H8YA 2DCLA 1DTQA 3NGRA 5LJ5Y 2LXFA 1RHUB 2YNHB 1LW0A 3O3LA 4YEAA 4NZ0A 4F3OA 3DRRB 3I55S 4KGKA 1S10A 2ADCA 3B4DA 3BKUA 2CZ9A 5KFZA 4P2SA 3DLLQ 2W25A 4DZ6A 2BJEA 1GMWA 3CWJA 1ELOA 2ASJA 1NJYA 4FPRA 3TP2A 1SJ3P 3WC0A 3FBEA 5CQGA 4B3SF 4YHHJ 2EG2A 1KRPA 2YNFB 3ZTRA 3W9HA 2XQCA 3K8VA 3AJ2A 2RF2A 5ETLA 3NEKA 1JXLA 3EVMA 8ATCB 4QIEA 1BUXA 1T9WA 4GVLA 2F8EX 2XI2A 1RKIA 1WSRA 2NXUA 4ZVGA 2W9CA 1WF0A 1KHVA 4G1IA 5RUBA 3GPAA 2MLXA 2BM0A 1GMUA 1Q8LA 2HGNA 3OTBA 3R7NB 2J5AA 2VKRA 4CT8A 2CPXA 2B6AA 2FYXA 2F9DA 3J80U 1PKUA 2CQ1A 1V3SA 3BM7A 2DR5A 1B0TA 4LF5J 1W25A 4JV1A 4CLUA 1LWFB 4DZDA 4CYUB 4CDIA 2BKNA 2CQHA 1WOSA 2L08A 1SBRA 1L3TA 4J9KA 4KAIA 1BY9A 1SXLA 2HQ3A 1FE4A 3GIKA 3MUTP 4J9PA 4ER8A 2FB0A 5HL7Q 3ZO7A 2FJDB 1UVLA 2W7PA 4L75A 3AXKA 2CPDA 5DETA 1VBXA 3T1HF 3CJKB 1HNWF 4ZHRA 1WC0A 4WXOA 5HMWA 2W2MP 3E01B 3HSGA 3KDOA 3FCWA 4C6AA 4J9VA 2GZOA 1AZSA 1FNOA 3NOGA 1SL0A 4GC7A 3F41A 1R0BG 4RO0A 1FT8A 2ATCB 2KVIA 2V9KA 2OPSB 4U8YA 4ZPCA 2FHKA 5DJBA 3G71S 4IOAQ 4X4QA 4EBCA 3DGPB 3PR5B 4TQRA 5K20B 2XS5A 2UXBJ 4WP3A 2B56A 3KHHA 4MKBA 4PYDA 2PMHA 1PYOB 1E6YA 5K9FA 2W9BB 4NLWA 5ETPA 4Z37A 4EZ6A 2IMOA 3SMZA 4DMZA 4WK3A 1ACMB 1Z2ZA 2ASLA 1IBCB 5KFSA 5JXSA 1H6KX 4ECVA 3TJ8A 5A8WB 2X3GA 2FVSA 3PX4A 1RTJB 2RRNA 1UAWA 2WSFC 4K0KF 5KAKA 2HEKA 1NHVA 1H72C 4IYQA 4WTOB 4ZP9A 3FKBA 1MU2A 2HMIA 3JSMB 5KFGA 1BGXT 2R2UA 1UZHA 1N48A 3POTB 2G2ZA 4IOBA 2A1BA 1SB6A 3GYGA 2X1FA 4Q43A 2CWKA 1T8EA 2W7AA 1BWVA 4JV2A 4DCPB 1SH0A 5DDPC 3T1YJ 1U47A 5KT4A 3QSIA 1R8HA 4NLSA 3DMJB 1NBEB 3VAIA 2OFGX 4UTGA 5F9LA 1K8AT 4O4GB 1X7VA 1DTTA 1R27B 2ZC3A 5C42B 3TX0A 3O8WA 2ZH1A 3CJSA 4YB5A 3I4PA 1NM2A 2RDDA 4DPUA 3HULA 3A8IA 3W8PA 5HVHA 4AD6A 4M5NA 3K5NA 1WC3A 3IS9A 3MCSA 1T7PA 1M1HA 3UNYA 1RT2B 5F3TA 2DEIA 3M6UA 1EQ0A 3TAMA 1XNQJ 1SV5B 2HFNA 5E33A 4LMZA 4DV4F 3GU0A 4NLUA 1XTZA 4A8MP 1XMQF 4C7QA 2BM1A 5J2NA 2HNYA 2LECA 2NR0A 3L9ZA 1CJVB 1CJTA 2J0WA 3UD4P 4E98A 4OV6A 2IDLA 2ACMA 1N0VC 3BGRA 4JI4J 3CGIA 1HBOB 3SQOP 3QFWA 5J2MA 2N7YA 1RU2A 4DFJA 3A3PB 2XLIA 2CG8A 1WEXA 1S7HA 3B8HA 1AFIA 1KP6A 3SDEB 3OR2A 2V2QA 4AL6A 3CT9A 4IG0B 1X8DA 4EI2A 4RW6B 4NX9A 5L9XA 1D8ZA 5T14A 2HGMA 3SSRA 1I3OB 3HHNB 2VH7A 5IT4A 2IBKA 3CB4A 2ACYA 4C3LA 1N5SA 3KLGA 1N5YA 1FWLA 1CC8A 4DX7A 1IQTA 5D0GA 4OI4A 3G6YA 2WW4A 1S72S 4KHRA 2DIUA 4C98A 3QPIA 2BOPA 3PRDA 1HQUB 2V0NA 1K9MT 2UUCJ 2PI4A 1FFGB 3TWZA 3LPEA 2FC9A 2YKNB 4Y2MA 2OSRA 1RTHB 4YB6A 5GAHU 2PEHA 3G8TA 3I9ZA 2GAHC 3TA1A 3JQMA 3PIOQ 1NK9A 4DG1B 1WSVA 3HF5A 3MMCA 3D3BJ 2ZM6J 3MPDA 2NXCA 2JJ4D 5L9NA 1XR5A 1SJ1A 2V2VA 4MIBA 3KYLA 2R42A 4X4UA 3KDNA 1Q5VA 1VGYA 2IRUA 2PT0A 3HSJA 4GMKA 4UF4A 2E9TA 3BSNA 1NK7A 1BC6A 3VVUA 1T02A 3MCNA 2DCUB 1I6JA 2XLJA 3WQPA 3K5LA 1FVSA 1IBLJ 4ZA1A 4F8RA 2ZH6A 1JNZB 5DZ7A 2HVZA 2OEKA 2OELA 4C97A 2CNKB 4ZCKA 3J7Z5 2E66A 4PQUB 3WX8A 4RZRA 2GIFA 4AQYJ 4WJBA 2QN6B 5J2QB 1QAIA 2ZVSA 1RAJA 2KDOA 1SUQB 1X9WA 1IKVA 1WF2A 2MKJA 2ROEA 3S8SA 4FNIA 5KFJA 1N5TA 2QMXA 4QR0A 4I2QA 5CHCB 4ZDNA 2Z30B 2JZ5A 4PG6A 4NXNF 2NQPA 2QE5A 1IR0A 1R8BA 1JJ2R 1V3ZA 5BR8F 4N76A 3BQ0A 3W5YA 4LR8A 4CLPA 5HK4A 3CO0P 3T19A 2JFKA 1F2GA 4PXEA 1X4EA 1FDAA 3H5UA 1YITS 2XMMA 3CCWA 2HWTA 2J76E 3MM9B 3PKYA 3KWMA 5D4OA 4DS4A 3WIUA 3CCUS 3GZ7A 1UEUA 2UV8G 2J0XA 3NKYA 3M8SA 3DLKB 5D8HB 4DSKA 3Q8QB 4JI5F 3I9V9 4G6VB 1JMTA 2DGOA 3GTYX 2BJ1A 4K4YA 3F56A 3CUNA 2GHWA 4L74A 2RAQA 3V6DA 3UD3P 1MG7A 3NMRA 4ICLA 2E5LJ 2QC3A 3BBFA 1VRUB 2PN6A 5KG5A 1N32J 1X4GA 3BN4A 5T7LA 4NA2A 4X62F 2MQLA 4CQ1A 3M8QB 2MZSA 2IY5B 1XK8A 2YKQA 2C2MB 3KLIB 1AXQA 4F25A 3H20A 3F73A 1BHNA 4DV7F 4B3MJ 1P27B 2DNOA 1HD0A 2R7QA 3DM2B 4Y34A 3JAMU 3DYAB 3VAFA 4LF9J 3ULHA 1OQ6A 5KT3A 2I0XA 1NDCA 2KJVA 4DOZA 1R0CB 2AKWB 4YR0A 1HKAA 3D7SB 4RUBA 2XY7A 4WBFA 5LMUF 1R6YA 3SIPB 2KVQE 4FYXB 4B3SJ 1VCTA 4WCEQ 2E1AA 4C11A 2GCFA 1KVJA 1FDBA 3OLBA 4LF1A 2VBXA 2QTWA 2CJXB 4C3KA 4ITSA 5HBMA 1WHXA 3K8WA 4HACB 2MSTA 3KK1B 4L3KA 2DGVA 4RBUA 1MLAA 4KKOB 2JH3A 4KTQA 4CLTA 4OLOA 2Q6BA 2F40A 5BXIA 4J37A 5EWEA 2UV8A 4A4JA 2B9YA 5KG4A 4ZP7A 2W7OA 4LFAJ 1YHQS 1HMVA 2UUWA 2FJEB 2DNHA 3CCQS 3KNAA 3OL6A 1D8YA 1RAGB 2VA3A 3RZAA 2FZCB 3I5CA 2HNZB 3UCGA 3CIZA 1D0EA 3VZIA 2GFFA 2MKSA 2VDHA 3GE9A 4Q0BA 1M5OC 3M2VA 2VQEJ 1N52B 3HKZD 2CPJA 3DLHA 4BS2A 3NNAA 4ILMA 1FNXH 3H25A 4DV6F 1S6QB 1U24A 4NLQA 3CMES 4NI2B 3BO2A 4OZ1A 3BJYA 3A12A 3RBEA 4OZ5A 2LQJA 2D74B 2K1RA 3D0HE 3RBDA 4W4MA 4ZLPA 3LTOA 1UJ5A 4V19X 2FQQB 4X4RA 3IM8A 5KFDA 3I87A 2JX2A 5DQIA 3V6HA 3OSPA 3CCVS 2KFNA 3OVAA 4EBDA 4F26A 2HRYA 2GX8A 3D1QA 5KFEA 2E5GA 1RTIA 2YPZA 1K1QA 4NOHA 4I68A 5DLFA 1CULB 2PD1A 2GV1A 2HWIA 1JLCA 4DL7A 5AXKA 3OTCA 4H4OA 4ZLJA 3VGVA 1Q53A 3VWSA 4I4BA 2CZVC 3RB6A 3P5BP 3AT1B 4UQGA 4N7TA 2UXDJ 2BXJA 5I42B 4ZVRB 5KOXA 2KO1A 3ILOA 2MB0B 1LQ9A 4J9OA 2AX1A 4ZK7M 2NYHA 3GG0A 1I94F 4F4KA 4F67A 4ZPVR 2NS1B 2WRMA 1TKZB 4X66F 4PWDB 4G3IA 2FHOB 3IAS9 1TL7B 4B9VA 1APSA 1NB7A 3KLEB 4F04B 3IWLA 1VC6A 2I5JA 1U6FA 2MHNA 4WYWA 4LF8J 3MD1A 2M2BA 4CO2A 1JLQA 2OPPB 3PW4A 1OIAA 4KHPF 4J9SA 3JYTA 2IM2A 2A2CA 3RR7A 3T9ZA 4M5JA 4KGMA 4NPOA 1Y10A 2BRLA 5C7PA 4IR1A 3UE2A 2XGQA 3BO4A 3IWXA 2R2TA 3ET6B 4K4WA 4DSJA 3EM1A 3TVKA 4XDDA 2K3IA 3CCLS 3SEOA 5DGAA 3HVTB 1VC5A 4WZMA 3FBFA 2RQMA 1X0PA 1XMOF 5GMDA 1ZAWA 1XNRF 3MEGB 3W2WB 1U7LA 1O5JA 3NS5A 3Q8UA 2N3OA 4LSNA 2C2DA 2C3YA 3AB4B 2HHWA 4OX9J 4RNHA 1VIOA 5AE1A 1U02A 2JWNA 2H4YB 2YNGB 1KC8T 2MLYA 4DQIA 3ONQA 3C8YA 4YB1P 3VAHA 1Q7YT 5A8KA 4LBIA 3DRSB 4KQZA 1DQ9A 4CO0A 1R8PA 1JLFA 1S1TB 4FVCA 3CDUA 4ID5B 3G82A 3I0RA 3GV5B 4OJHA 3QGGA 1G6BA 2QG9B 4MK7A 1HPZA 4JI6F 2HHXA 1RT6A 1NPKA 2VONA 4IDKB 4MFBA 2MKCA 2V8PA 1IM4A 4CH7A 1OYDA 3MFIA 2IAJA 4ES3A 3FEZA 4KRWA 5EWFA 2VG5A 3VGTA 4WFAQ 3B78A 4CNYA 1RABB 2V4QA 2FLPA 1RWOB 3FK4A 1B0VA 3B6BA 4OHZA 3SYZA 4NCGB 3ZZUA 4P7VA 4DDFA 2ROGA 4DQQA 1J5EJ 2QL5B 1HWLA 2QMWA 2F8MA 2E7WA 1RBAA 3C2PA 4J90A 2HNDB 2QA2A 4EO6A 4QCLA 3P4UB 4NLTA 4KGVB 3A1YG 1S6PA 4LF6F 3BSAA 4AYBD 1CJUA 1R3NA 3IBWA 1KLMB 3JTNA 3CIMA 1FWPA 3V4MA 1S57A 5E3PA 1S1XB 2HWHA 1P1TA 3W66A 3IR7B 4RUAA 3GR1A 4FZVA 5C24B 4B3RJ 3AQPA 5IS2A 4EZ9A 3BH7B 2I6WA 3FMBA 5CYJA 1T94A 4UUWA 4O3NA 3K2YA 1NSKL 4B9MA 2GQQA 5DRKA 3ZZTA 1QM9A 4ZPWR 3GILA 4C8LA 3M6VA 1YLXA 4ED2A 5AXMA 5HI7A 3OBIA 5CYMA 4XO0A 5ETQA 2CIMA 3KLFB 1YX2A 4MKAA 2IM3A 1FFSB 3GIRA 3NAIA 1C0UB 3KK2B 2GQ2A 3UPFA 2VG7B 5GADI 1U0SA 4KR0B 4KV8B 4P71A 3VZHA 3PG9A 1JKHA 3NGUA 2AW0A 2HHTA 1WKKA 4O44B 3UO0A 1LFPA 3QRPA 4DPTA 2HQGA 1LEOA 5IM0A 2XWXA 1CQNA 4RW7A 2OJ3A 3KJNB 3ADAC 2N82B 3M8PB 3D4JA 4PPZA 5E3RA 2L48A 1YGYA 2BX6A 4DF4A 1I5OB 2H5JB 1JXEA 4FDFA 1GMVA 3A8KA 2ZHBA 1M5PC 3MM8A 3KXDA 4C8OA 1VQYA 4PR6A 4FYWB 3BPDA 2Y0BB 4ED3A 4CNZA 2VPXB 3ISZA 5B0FA 4ECTA 4WPAA 3GFHA 2UVUA 4FNHA 2AYEA 1LFWA 3IRXA 4V1Ak 3MWBA 3AXMA 3UVJA 4OJ3A 2G0JA 4LVNP 3NWRA 5KT2A 4C0BA 2B43A 3C6UB 4M5DB 2D1CA 1YJ7A 4DJBA 4PAAA 2IRYA 1U25A 3OFHA 2F3JA 1AT1B 1NZ8A 1ZS6A 3X3UA 2AD9A 4LBPA 3I31A 1VQMS 3W3SA 1RAIB 5F9NA 1S1WA 1S5ZA 1B0PA 4KPCA 4LQ3A 2DPIA 4DU8A 4DR2F 4AFFA 5DGBA 2JNJA 3HKWA 1NKBA 3NNCA 4DV1F 4ZVEA 1Y00A 3O5TB 1CVJA 4P72A 3ZNUA 2MGZB 4FKYA 1RWWB 2W2PP 2ZE2A 2EFQA 4LUBA 4A8WA 1D9AA 1X4DA 3D68A 2E9ZA 4NLRA 2V50A 4ECWA 2RKIA 1R8CA 2RUGA 4DFKA 7AT1B 4IQMA 4X65J 1Q81T 2Q43A 4I2PA 3T5HA 3QMQA 2D9OA 2OI2A 4GKJJ 4N77A 1N54B 3UW1A 2HVHA 4ZVPB 4ECYA 1RBOB 3FUYA 1UWBA 2YNHA 2ZH4A 1S99A 2UUTA 5KFIA 3PNIA 1YZ6A 4IR9A 1WTFA 3QGIA 3BO3A 1A6LA 4B9TA 1ZA2B 2YKPA 4LF2A 3P5TL 4Q7AA 3DLBA 2PMWA 4YP3A 2CDRB 2D3OR 5E3CA 1DHMA 5DM7Q 1SKWA 3GR0A 3HI9A 2RT3A 3HZGA 4XPEA 4ZS6A 3D6MB 4N8NA 2VFUA 3CTRA 1WOOA 3M30B 4JB8B 3IG1B 5B0AA 4N41A 2PDAA 2R8KA 3W64A 3TVZA 3WIVA 3GQCA 3SI8A 2FIUA 4DR4J 4JV5J 1TQLA 2QYCA 5D0HA 3OFGA 3MECB 4QIFA 1DY3A 1U8WA 1NK8A 4OZ0A 4UUXA 2MKKA 3TRGA 1C0TA 1U2RA 3UFCX 4P6QA 3PYEA 2FY8A 5F0WA 2UUAF 1CBKA 2ZJQQ 1IM6A 2ZVIA 3HLUA 4GO7X 3WDOA 4DPYA 2EBGA 5JMNA 1K0VA 3CULA 3BREA 1YBUA 3C16B 1WELA 3DNCA 3QAUA 1GXUA 1VLYA 1FK9B 3KHGA 1S0VA 1B70B 3TA2A 3VR1A 3TZXA 1LWFA 1S9GA 4CYUA 1UVMA 3VCDA 3BGLA 3O1LA 3QGPA 1S49A 1CS4B 5HMZA 2XGPA 1HBNA 2WBMA 4ZCLA 1Y5IB 3ITHB 6AT1B 3MM6B 2WVEA 3DOKB 4DR3F 5BJRA 2VFRA 3TO8A 3CJKA 3MPWA 4FF3A 1FDDA 4OIXA 4I67A 5L38A 1FKPA 1U1LA 1YBTA 3IGNA 1SC6A 1O0PA 2WOMA 2W2OP 1FI4A 4M5MA 3GYNA 1U1MA 5IT9U 4OL8A 3DOLA 3R7BB 1ZAXA 2JEIA 5JUMA 2OPSA 2P6SA 4F7VA 1JJHA 1EX8A 4MYUA 4TXSA 1T3NA 3MEKA 3PO5A 1VQ8S 2HVIA 3HVRA 2R7XA 4CH0S 1UKUA 2DPJA 3DGPA 2LQ9A 4BLGA 1D1UA 3JAMY 4X66J 2UXCJ 2CQDA 3UCZP 2G2OA 5HANA 4ILRA 1H2UX 2RRBA 2Y1RI 2MJNA 1FRLA 3LP0B 3IRWP 4DCJB 4CI0B 4OZNA 2W9BA 3A13A 3G86A 4JI1F 4WWSA 1O51A 4CCHA 3THPA 4W98A 3OXLA 3N6NA 1XC9A 2CJBA 3T6JA 2QRRA 1S1UB 2E5JA 1VOMA 2B4VA 2DXFA 1XWLA 2VZ9A 4RU2A 4IRKA 1J2VA 2I9SA 2YY3A 1T3OA 1RT5B 3TOQA 4TKTA 1IWGA 2X7IA 3PYGA 3SCIE 4ZVFA 4YMEA 1NHKL 2XHCA 1WHVA 3KK3B 1E6VB 2NSBA 3QJPA 3BF4A 1FXRA 2K3KA 5C25A 4ZVSB 5DLGA 2Z57B 5EHHA 1Y3KA 4DPXA 4RU9A 4N56A 2BW7A 2R8JA 2Q6CA 5CD4H 4YB7A 4DQSA 3W8GA 1JX4A 4NMLA 3IBCB 5ADZA 3OTDA 1NSAA 2CPHA 4DR5F 2D7SA 3DRYA 3POTA 3SQGB 1F5AA 5HJXA 3ZNJ1 5L8RC 3H2LA 2K06A 2WONB 3VF0B 5CABA 3SZ2A 3LGNA 4ZLNA 3E3XA 4HHJA 3KUHA 5KT6A 3NNHA 2EC2A 1TVRA 4QOTA 4Y65A 4O4GA 2KJWA 2ZKTA 4J9RA 4DUYF 5C42A 4DL4A 2KT2A 1VJWA 3DDKA 3HHLD 1S77D 2MXYA 1RWXB 4YY3F 3CJ2A 4OZLA 4MK8A 3EGNA 2PEBA 2E5HA 3THTA 4ANCA 1TELA 3W7BA 4PEOA 4NA3A 1M5VC 2YTCA 4ZJOA 3S1TA 4ED4A 3OL8A 3TYTA 3DLGB 5KFPA 5M2PA 3AD8C 1RT2A 1U4BA 3ELHA 4W92B 4GKKJ 3PFEA 5EUHA 1LWXA 1RHMB 4I7FA 1SV5A 4C9DA 3NMAA 2DHSA 4LR7A 1DQ8A 5ETSA 2DD8S 4LSZB 2R8HA 3QLHB 1XERA 2LYVA 2VPWB 1YK9A 1CJVA 2KFYA 2DXEA 2ZKUA 2F8HA 3DKDA 2C3OA 3PW2A 3IAM9 3NBPB 2ZH9A 4PG4A 4LF6J 2PE8A 4OJ1A 3Q22A 1HBOA 4I69A 1RT4A 4IH5A 2E5IA 1LWCB 4KH1B 3P6YC 3LP1B 5D0RA 1NK6A 1F60B 3SDEA 2COLA 3I96A 4J7CA 4CLKA 2RNEA 2DIVA 1X0FA 1T9YA 4RW6A 1Q5YA 1WI8A 1RAFB 4TNOA 3MD3A 2QO3A 4LRAA 2XYPB 1GAOA 2E9RX 1VLOA 4MKVA 2JOQA 1FERA 4DQPA 5DDOC 3OJUA 3O6QA 1J5OB 1HNIA 1DLOB 1UPPA 5DG9A 4QWEA 4QBUA 2YKNA 1S1VB 2YQ0A 4RWWA 2IYGA 1IKWB 5G0RB 3QNWB 3JB9k 1H74A 4IG3B 4ZPDA 1I51B 4YHHF 5EX0A 1QUVA 4QWDA 4CM0A 1L3VA 1QVGR 1YJWS 4WIQA 4S0MA 4AUKA 1KVIA 3GWCA 3MAAA 2P8IA 2W2QP 3MPVA 2CJAA 1EP4A 4WFXA 1UMJA 4NLPA 3U1LA 4ED0A 5IC6B 2GO9A 4DUZJ 4HHUA 3LWLA 4F0HA 2X1BA 2K8GA 1A0OB 4QU7A 3U1NA 4ID8A 2QX0A 1IWAA 1Q7LB 2MYFA 5HP1B 2A3JA 5F8LA 5ETKA 2C42A 1QTMA 3I5AA 1GX6A 3GB0A 1C1BB 2WVBA 5HJYA 4M5IA 3CCMS 5M2RA 1TL3B 5FDLB 3D6TB 2J0SD 4LF5F 3C14B 2AYMA 4PQUA 3QRQA 1KSPA 1CLFA 2R2SA 1SL1A 3N4WA 1WTBA 3FSXA 5J2QA 1KONA 4H4KC 2QLFB 3I32A 4ALZA 5CCLA 2P5VA 1M5KC 2AQ4A 2CPEA 2MKYA 2M8HA 4I64A 2NYIA 2O1PA 2EBEA 1T9VA 5IV4A 4DN0A 3W2VB 3CMQA 2NXJA 1AUDA 3HZEA 3C6TB 5GAEI 1T95A 4LRDA 3BQ1A 5K8NA 3HJFA 4USIA 1N0UA 2CQGA 4I0WA 1VRTB 1QE1B 4OHYA 3TI0A 3EE3A 4ED8A 3RB3A 4KJIA 1RYRA 2HAIA 3M2RB 2LQBA 2ZD1B 3HX9A 2OPQB 2G0CA 5HLFB 4NLOA 3DLKA 1VBZA 2GQCA 3I0SA 4UOCA 3EUNA 4C8MA 2LKZA 1ZTWA 4BHQA 2FVPA 3IR6B 3HHEA 1TKXB 1ZPVA 4A8QA 2BDPA 1G4CA 3TAQA 3JSYA 1JLBB 2J7UA 2UVWA 4GC6A 3PW0A 3M8QA 4B17A 1EHWA 2JC0A 3UR0A 2W4PA 3FNNA 4R8UB 4OQJA 1WKLA 2IHR1 1CSJA 3RRGA 1VS3A 3KLIA 5J1EB 2ZNYA 3AODA 3HP6A 1RWPB 2WSCC 1BQXA 4KFBB 2VG6B 1PYTA 3CD6S 2KYXA 3MMBB 3VTIA 1HL6A 3OT9A 1GQEA 3DM2A 2JEJA 2NXEA 4DF8A 1N5VA 4CWBA 2ILYA 4Y2AA 2VBWA 5GADU 1FX2A 1X5OA 4O3QA 2XBPA 3QT5A 1DTQB 1NDPA 4OJGA 2RD5C 4QIVA 3J7A1 2XMAA 4MKYA 5HN0A 1OPIA 5ETTA 4WKYA 2AYBA 2Z8QA 3P3DA 2FDNA 2DO0A 2OLWA 5KFWA 3TEHB 1RQ0A 3D0GE 4HACA 1HQ2A 3PXGa 3KK1A 4F2RA 2NZ4A 2BQUA 4KKOA 3JS9A 1PSDA 2XTJP 3MOJB 4KPYA 1HBMB 2ALZA 5L46A 2QMUB 2YKMB 3T1YF 3MM7B 2B4UA 2FVCA 3G6VA 3U1MA 4ZITA 2JVOA 2I1RA 3GJSB 4FXDA 1HWJA 3OUYB 4OHXA 3IGVA 4DS5A 3PRBA 4B9UA 2FHJA 1PJ7A 3P96A 3UQSA 2IVYA 3X1LB 1NSQA 1URNA 3BGFA 3MMJA 2W9CB 1FEEA 4ZOSA 1ZOTA 2B8QA 4OYAA 1ZA1B 4B3OA 2GVZA 4C48A 3LAKA 3AOCA 1S6QA 2FJXA 1RCXB 4NI2A 1S0NA 2LU2A 1TV6B 1UEVA 1LXNA 1EKRA 1HFEL 2KXNB 1YQHA 3NP5A 1XNQF 1WC6A 1A7GE 4WFYA 4HT5A 2DNNA 2KU7A 3HCXA 2P9CA 1R0AB 5ETOA 1KN6A 4UOHA 3P8BB 3W60A 1H2VZ 3ZZOA 2CNOB 1HYSA 2HFZA 3R2DJ 4DXLA 4JI4F 2ZC4A 4QQBA 5HSPA 3DRXA 2L41A 3JQJA 1JJCB 2OD4A 1TAUA 4K5SA 3R7SB 1JLEA 1NLKL 2GAGC 4LSLA 2AJ1A 5CYQA 2RUSA 1W7WA 4X4OA 2M52A 4GVBA 1CULA 3N9UC 4WTYA 4QPTA 3GONA 2MSSA 3PR4A 3H5YA 3R5DA 2WVCA 2J9EA 4ZHRB 2ZJRQ 2EI5A 4LBHA 4DV3F 4IKAA 2HBZB 2A6OA 1QSLA 1HWUA 2UP1A 1P1LA 3G8SA 4JI1J 1S0OA 2DNLA 4PWDA 3J7YI 4BCAA 1HA1A 4ENOA 1TL7A 2I2YA 2V34A 2YBVA 2FZKB 3M8ZA 4QYRA 3N0VA 2RIJA 4ANDA 2LVWA 4X64F 5F8IA 3R5GA 2HZCA 4F4YA 1NB2A 4F0MA 1URRA 2DK2A 1EB0A 2M5YA 1WHYA 4IO9Q 4A8XA 2ZM6F 1WNEA 4C8KA 2IC3B 4P2XA 2XMTA 1E6YB 1H7WA 3BBBA 2KTQA 1OS5A 1S79A 3VGSA 3D5MA 3RBZA 3PEJA 5LT5A 2PA3A 2B7CB 1U1NA 1T05A 2DH7A 1V6HA 1YRUA 3ZZPA 3NS6A 5KOWA 4JI2F 1UFWA 4EGLA 1VYAA 3GIIA 2GMLA 1U1RA 2E1CA 1IBLF 1SQEA 2M7SA 2K7JA 3H2VE 4K2JA 3A4TA 3W2WA 4A8YA 3AQOA 4AQYF 5DQGA 4RW8B 4NYZA 4B3TF 1I1GA 1DFDA 5CCMA 3K89A 1NRKA 3TUIC 2HLUA 2B5JA 4CT9A 3DXSX 4P7TA 5JVGQ 4ZN3A 4PABA 3W65A 1VQ5S 4IFYB 2OMLA 2D3UA 2G1DA 1GMWD 3VV2B 4R5PB 2GHVC 4JYAJ 3DRSA 2XO7A 1RAHB 2ZITA 3C3LA 1S1TA 2IDEA 4Z7CA 3NRBA 2M88A 1RK8A 1O8BA 2IJNA 3WX4A 3PJWA 2HZVA 2WVFA 1BQNB 3NCRA 1Q16B 4TY8A 1VQNS 2ZOMA 3VGUA 4P10A 3QRRA 3HFKA 1NPPA 2KN4A 2AV5A 1U1QA 4I6AA 1DTTB 2WTFA 4PG8A 3M32A 4M94A 1H0HB 2AT1B 4J9LA 3PKMA 4NCGA 4U67Q 5L1JA 3O2IA 3DCAA 1N6QB 2IVMA 4LFCJ 3R9LA 3IS9B 1M0SA 2HNDA 2E5LF 4EUVA 1T9XA 2DH9A 1F2HA 3MAHA 4V19J 1UA0A 3RB4A 2UU9J 2C2ZB 2IA0A 1N32F 1SC1B 3BPSP 1VC0A 1RTDB 1SQGA 5LXRA 3FJ2A 3PJXA 4Y2KA 5J2NB 4OFZA 1RT1B 4NLDA 4IQXA 2ZNZA 2BZ2A 1F1BB 4QYZK 1CJTB 1S1XA 1PYSB 4NEYA 3ZC4A 3TJ9A 2V8VA 1TU0B 1IKXB 1YSJA 4KGZB 4B3MF 1Q79A 3W5ZA 3BGRB 2LXUA 3MGJA 3M05A 2HFSA 1ZTTA 5J2MB 4A8FA 5C24A 1G1XA 4LF9F 1X4FA 3MI7X 4FS1A 2XY6A 1VQPS 1RDRA 3MMAB 3OR2B 4DSLA 4DSIA 2RS8A 2N7CA 4ZJQA 1FCAA 2ALYB 1FKOA 1FRXA 2H51B 1AA1B 1RWKB 5KG0A 1PILA 3KLGB 1VISA 1QAJA 3CEDA 1QSYA 2G13A 2H5IB 3HO1A 4BC7A 3MEEA 4CRJA 4ZVUB 5AT1B 4URQU 2VG7A 2Y8WA 4DN9A 3GSDA 3PM9A 4ZPTR 1X5PA 2GGPB 2RQ4A 3UWTA 4UZCA 4QWBA 1KEKA 1UEKA 2O01C 1NXIA 2VBZA 2YWKA 3CCZA 4LFAF 2QLBB 1NEEA 2H5EA 3HHDA 1ZM4A 1GTHA 3U02A 2IMWP 2O5DA 4Y28C 2GVDB 2DEJA 3T3FA 4F4ZA 3QT8A 2XSJA 2AX0A 5KFBA 2VQEF 3DDIA 4EU0A 1L5UA 2W8KA 4Y0FA 2WVDA 2DBBA 1IBKJ 2BJ8A 3V6KA 2LXIA 2CQ4A 4FXVA 2GMHA 1R8AA 4LRCA 1U48A 3Q2SC 3BYPA 1ZH5A 4K4TA 2XZWA 3I82A 4Y3CA 3PX0A 4OI1A 4Y2CA 1MWQA 2EFOA 2FJBB 3EWGA 3C6UA 2DGSA 2ZZNA 3UI3A 3RYLA 3K5OA 1RYSA 4J5OA 1IKVB 5AE2A 3FGVA 3AOBA 1S97A 4I2QB 4B02A 3B4MA 3GJRB 2DITA 5KFKA 2GS8A 1HI8A 3CC4S 5IZHA 4CLZA 3AFGA 1VDHA 2KYZA 1HNZF 1FTCA 2GHPA 2OIHA 1TKDA 3RG6A 2KG0A 3W62A 1UL3A 1MWZA 5HO4A 3TVYA 5J1PA 4XIUA 5KFTA 2MGZA 3MPUB 4DWIA 1S48A 1PAEX 5LMNF 2UXDF 3ZZ0A 1JB0C 4ZVQB 5BYSA 4KBIA 3VHQA 2Q79A 3LGMA 1U2CA 1F3FA 1WG5A 4C0HA 5A6PA 2AJ4A 2DGXA 1TUVA 3R6GB 3QQCD 5HROB 3SCLE 2DISA 2QA4S 4LF8F 1YKWA 4OHWA 2EXUA 3V6DB 4TLRA 2ZH8A 2MZQA 4OYBA 4KY3A 4ZVTB 3NCPA 2K2PA 1IBMF 2H1YA 2P9GA 3HMJG 4BWMA 4XK8C 1AROP 3HT0A 2ZH5A 2OH2A 3QYYA 3V6JA 1UJ6A 2AEJA 3IO1A 4URGA 3ENAA 2OTLS 4P2MA 1YJRA 1KTVA 5J1NA 1Q86T 2VC0A 3OHBA 2P6TA 1FE0A 1KHWA 3LPYA 2RH3A 2FPHX 4F4WA 1NK5A 3IG1A 2IVFB 1T9TA 3SFUA 4ZIWA 5C2CA 3F0NA 5KFFA 2NPIA 4U6PA 3CCTA 3H90A 5KTQA 8AT1B 4OX9F 2OUGA 3BDEA 3MECA 5KFYA 3CMAS 3QJJA 4RUHA 3FBCA 2Y1IA 1U1KA 3D67A 1EAYC 2O66A 3SV3A 5B0DA 3KUEA 2GJFA 1YIJS 3HFZB 1FXLA 1WHWA 1ZM2A 2YPYA 2V9WA 2AZ1A 2GJ2A 3NAHA 1F6TA 1MMLA 4BDPA 3RU0A 4HH1A 1RU1A 2FLOA 5DZ6A 3C16A 1LW2B 4JI7J 2KM8C 1FK9A 1Q95G 2EEYA 2YKOA 5GAEU 1OSDA 3DLJA 2W4DA 5KFLA 5D3GB 1WI6A 4O0NA 2QFIA 3FFIB 1XMBA 1CEZA 1LV5A 4O3RA 2NREA 3L09A 3BEGB 3ITHA 4MH8A 1JWWA 4R0EA 1O6XA 2J6SA 2Z2MA 2W8LA 3MM6A 3BDPA 3PYFA 2BJ3A 1CG2A 4YR2A 4Q0BB 2G1HA 2ZFHA 1J5EF 5EN1A 3BN7A 2J7KA 4ZCIA 4D3GA 1RSCA 4RNFA 4OLPA 4USHA 5D4LA 5KG1A 3UN3A 4O4RA 1LK7A 3THVA 3T41A 2J7WA 1RB0A 2HHHJ 4PG5A 2OSQA 2XYHB 3IP0A 1VHIA 1HHTP 5KFCA 2RRAA 1KOHA 3CCJS 1HWIA 2MZRA 4Q2MA 4ZP8A 5E0OA 4DV3J 3TUPA 3TX8A 4PXBA 1RHRB 4CLSA 1NDLA 2QL7B 3G8QA 4CH1A 1Z2LA 5IQ6A 8RUCA 4B3RF 5L1KA 2YNIA 1Q4RA 4ZVHA 1HARA 1AB8A 1VIXA 4IFVB 3HD1A 1J27A 4ANEA 2W01A 1PJ6A 1UJ4A 1TL5A 1SI9A 4QYZJ 1UCNA 4HYKA 3DGVA 1P6TA 2DYAA 4OI0A 2HFUA 3R27A 4B9LA 1N34J 1UVNA 1PC4A 4X64J 3KTQA 5F3ZA 1RGVA 3QIDA 1S1UA 4FP9A 2EKYA 1P9YA 2XG8A 2AGOA 1NDKA 3TAPA 3BZQA 3PW5A 1M1GA 1FJCA 5MAOA 2D9PA 2I5JB 2M70A 1XR7A 5B08A 2P2CB 1HIYA 4JI2J 2J9DE 3V2UC 1E6VA 2JSXA 2GW8A 2B4OA 4MTPA 4G1QB 1CPZA 3JYTB 2DGQA 1SJFA 5CXTA 2ZDPA 2WCXA 3QIPA 4NRTA 2J8AA 4RKUC 1ITPA 3S01A 1X60A 2ILZA 3N6MA 1U1OA 4B3TJ 1QDUB 5HQLA 2HG4A 3SQGA 1V5IB 1VQ9S 2AJ2A 3EZ5A 5GMEA 4E0DA 4DR1F 7FDRA 3V4IB 3KJQB 2GMJA 3EYZA 2QZ8A 5IXUA 1TK0A 2H54B 2DNMA 5D6GA 2OO4A 2WK4A 3DRPB 2R7OA 3H0PA 5J2PA 1OWXA 3PJ9A 3FZ2A 2Q1LA 3CC7S 1N5QA 3VAJA 2KFZA 1K73T 2IM0A 2B8PA 5I3UA 2AWZA 1UW4A 4EFAC 5IT0A 1HHSA 4ETXA 2CDQA 3L95X 2WAQD 1WDDA 2FGCA 2HW3A 1B3TA 3ENVA 3QJLA 4QJVA 3ISNC 3OTOJ 4DPOA 2C2OB 2QEXS 4OZ2A 5A8KB 2G4BA 3DLGA 2C2NA 4OI3A 3RAMA 4NLXA 4LIRA 2JHEA 3I0RB 1HPZB 2VICA 3QLHA 1RT6B 2VHGA 2YQ1A 3EXYA 2KI2A 4Y00A 1Q1KA 3DC2A 2C22A 2IAJB 1F9HA 3PDNA 4HLBA 2VG5B 2UVVA 1W2IA 3LP1A 2PFDA 2YH0A 4DV0J 4G65A 1FJ7A 4D3HA 4X65F 3L7PA 3OR1A 3M1VA 2FJWA 4WIIA 2YH1A 3J7YU 1EZZB 2PMZD 2DNPA 4TN2A 4GKJF 2KHDA 3ZTOA 2U1AA 1RHJB 3K5PA 3ZZRA 2AJ0A 5BYQA 1L3UA 3WBZA 1V9OA 4Q8EA 3TA0A 3EZOA 2QLWA 2HLTA 2XWYA 1J5OA 4J9UE 1DLOA 1EIYB 2XM3A 3DI6B 3TZYA 2Z58B 3OV7A 1S1VA 3KNGA 2XO6A 2HIQA 3RJMB 4IG3A 4DV5J 2XMWA 3IWNC 3AB2B 3QO9B 4JI8J 2R7UA 1EQMA 2DGWA 4PUOB 2JLFA 5AXNA 3KMSA 3O44A 1AW0A 4F2SA 1SIWB 3JTOA 3R6LB 2FHMA 4DR4F 4JV5F 2IPOB 2BKPA 1UP1A 3Q8VA 2CPFA 2CPIA 5CYMB 2B9XA 4ELVA 1FWKA 5JVHQ 1VR6A 2P9EA 4QPXA 3CDAA 4CIOA 1X9SA 3R8YA 1TK8A 3MPYA 5HP1A 2LDIA 2EPIA 3CVKA 5I3PA 3CDBA 1KOOA 4NCAA 2V94A 3RW6A 3LP2B 5D78A 4TYAA 3HPOA 3M6XA 1C1BA 1FVQA 1U49A 5FDLA 3C14A 1RAEB 4HEA9 1GXLA 5LL6d 2VA2A 4DCOB 4A8KA 4EO8A 1RT7A 1YBAA 3HHLC 5HVGA 2RDIA 5IM0B 1XN9A 2APOA 2RSQA 3W9JA 3BH6B 2XNRA 1LWEA 4H4MB 4KO0B 5B09A 1IJEB 3BB5A 3BYRA 4DX5A 4UW2A 2ZBRA 4QIWD 5MLCV 2NPFA 3MM8B 3CCRS 4MIAA 5ETNA 2R8IA 2YX7A 2C28A 2B7BB 3C6TA 3TZZA 4TU8A 4MIWA 5F8JA 3MEDA 4AXJA 2RDJA 1MWYA 1QE1A 1VRTA 5LXYA 3MOZA 2B51A 3T5LA 1M5SA 4DSEA 3M2RA 3IRXB 5KG2A 3ZTPA 1HNZJ 3LF0A 2OPQA 5HLFA 1T0TV 4DSFA 2XCAA 2RHSB 4IO1A 2ZUGA 2CQCA 4L73A 5LMNJ 2HFOA 3W61A 4DR6J 2POKA 3CJ3A 4F3QA 4CO3A 5KFAA 2XS7A 1YRTA 2UXCF 3CCES 4CP5A 5CD4A 2V8DA 4HDGA 3DLEB 1NMEB 2OKQA 1WOPA 2B3TB 1QSSA 2WSEC 5KT7A 1ZZFA 4USTA 2LDYA 5A8RB 1S6OA 2W2NP 1RISA 2DNQA 5F8NA 4KFBA 1IBMJ 2CPYA 2ZE2B 3AA9A 5IWAJ 4NWBA 2WB1D 1ICEB 1N36F 5SZTA 3KLHB 4EYIB 4NXMJ 1RXOB 2EC0A 1NJWA 4K4VA 2Y8YA 5L39A 3MTKA 2HYIB 4JI0J 4OYWA 1ROFA 1VI7A 4I2PB 1QTNB
chains in the Genus database with same CATH topology
3PIOQ 4OHYA 3GFYA 3TI0A 1NK9A 4ED8A 3RB3A 4ECUA 4DG1B 4KJIA 1RYRA 3TAMB 2HAIA 2CJ9A 1UWBB 3HF5A 3M2RB 3MMCA 2R7SA 1X4AA 1M90T 2LQBA 2R7VA 3M2UA 1UA1A 2ZD1B 3TUZC 4C4WA 3HX9A 2OPQB 1Q82T 2J6TA 2G0CA 5HLFB 1KLMA 2Y0SD 4NLOA 3FRZA 2KM8B 3SCKE 3DLKA 2HNYB 2GQCA 1VBZA 2JJ4D 5L9NA 3I0SA 4UOCA 4U7UK 1XR5A 1SJ1A 4MIBA 4DHVA 3KYLA 1VQSA 4X4UA 4W90B 1IKYA 3EUNA 4C8MA 4EYHB 2LKZA 1ZTWA 1VGYA 4ED6A 3PZPA 2IRUA 2MJUA 4BHQA 2PT0A 4GMKA 5L1IA 4DV0F 1D9DA 2V4JA 2E9TA 2NUUG 3BSNA 2FVPA 4LT6A 3IR6B 3HHEA 5KG3A 3HDSA 4UQTA 4DEZA 3PV8A 1TKXB 1NK7A 5E3QA 2IBOA 2JEFA 1BC6A 3RRHA 1T02A 2DCUB 4C2MA 1I6JA 1HBMA 2XLJA 2YKMA 1ZPVA 1NKCA 1JIHA 3K5LA 3PW7A 2DNZA 3MM7A 1FVSA 4A8QA 3OTEA 1QUPA 3ETOA 2BDPA 4FBUA 4ZA1A 3U7JA 4I6WA 5I4MA 4F8RA 1TL1A 4ZKAA 3TAQA 2ZH6A 4WXWA 1JNZB 3JSYA 2HVZA 1JLBB 3OUYA 2J7UA 2UVWA 2VQFF 4GC6A 3CD7A 4C97A 3J7Z5 4ZCKA 1FTRA 2RB7A 2E66A 3PW0A 4PQUB 2I8EA 4IOCQ 3M8QA 4B17A 2E29A 4RZRA 5AXLA 1SKSA 2JC0A 4L3NA 3UR0A 1ZYQA 2W4PA 3BR8A 2BUNA 3FNNA 3GFXA 4R8UB 4OQJA 4WJBA 1NJXA 2IHR1 5J2QB 1CSJA 3RRGA 4HTIA 2MZJA 1VS3A 3KLIA 3DHWC 5J1EB 3KLFA 2ZNYA 1QAIA 2AU0A 4X4VA 3HP6A 2VBYA 2ZVSA 1RAJA 2WSCC 5ITHA 1BQXA 2KDOA 4KFBB 1YG0A 4FXWA 1MMNA 3MAQA 1SUQB 3TQ1A 1X9WA 3PHEA 1N5YB 2VG6B 1IKVA 1WF2A 3CD6S 2KYXA 3ZZZA 3MMBB 5GMKa 3VTIA 1HL6A 2MKJA 1C0TB 4DV5F 1C0UA 3KK2A 4ATNA 2ROEA 3EZUA 3S8SA 5K14A 4FNIA 1Y3JA 2EK1A 1GQEA 2YNIB 3FSIA 3DM2A 5KFJA 1N5TA 2QMXA 4QR0A 4I2QA 4JI8F 2JEJA 5CHCB 4ZDNA 1TV6A 3Q24A 4PG6A 2JZ5A 4DF8A 4NXNF 2NQPA 1N5VA 3T9NA 2QE5A 1IR0A 3Q8RB 2ILYA 4KV8A 3PKMA 4X4PA 2M0GB 2MY7A 2MKIA 4C8YA 4GKKF 1R8BA 2VBWA 4NLVA 4Y2AA 1JJ2R 4K4UA 3R1HA 1V3ZA 3OFFA 1Y4ZB 3UDCA 5BR8F 2XMKA 5GADU 4N76A 3V81A 3S6EA 4AE5A 1X5OA 4O3QA 2IRXA 3BQ0A 4RX6A 2DT9A 4IRDA 2XBPA 1DTQB 3FQLA 4RBTA 4OJGA 3M9OB 3T19A 2RD5C 2JFKA 3FMWA 4QIVA 4PXEA 1F2GA 1X4EA 3KJVB 1R0AA 1FDAA