1JJ4A

Human papillomavirus type 18 e2 dna-binding domain bound to its dna target
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
79
structure length
74
Chain Sequence
MTPIIHLKGDRNSLKCLRYRLRKHSDHYRDISSTWHWTKTGILTVTYHSETQRTKFLNTVAIPDSVQILVGYMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords E2 binding site DNA
publication title The structural basis of DNA target discrimination by papillomavirus E2 proteins.
pubmed doi rcsb
source organism Human papillomavirus type 18
total genus 19
structure length 74
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00511 PPV_E2_C E2 (early) protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jj4A00
2A3JA 2KXFA 5H1SV 2KRRA 1D9AA 2KT5A 1OIAA 1WF0A 4W92B 3MUMP 3CPWR 2DNMA 3P3DA 1WWHA 2NZ4A 2KI2A 2L08A 3DXBA 1U1OA 3CCES 4U67Q 1FHTA 2GHPA 4W90B 2X1GA 3CCVS 5JVHQ 1OWXA 3VAKA 1NU4A 1F9FA 1VQ6S 4WFNQ 2RNEA 2M88A 2ZJPQ 3DLLQ 3VAHA 1WF2A 3CC7S 2KG0A 2RRAA 1M90T 2MQOA 1WELA 1HD1A 3MI7X 4P6QA 1UW4A 1YTYA 1QM9A 2DNRA 3HHNB 4F02A 2DNNA 3CCJS 2DHGA 2CQPA 2DH9A 3MD3A 1M5VC 1QVFR 2FC8A 2HYIB 2J0QD 1X4GA 4FXWA 4BS2A 2JVOA 2MZ1A 3BS9A 4ZKAA 3MXHP 5DETA 5D78A 2AYMA 2DGSA 5LJ5Y 3UCUP 1K9MT 3H2VE 1DHMA 2MY7A 1VQOS 1D8ZA 5IQQA 2VOPA 1OPIA 2DNYA 2HGLA 2HVZA 5DDQC 3VF0B 1M5OC 2YKAA 2J8AA 3JB9k 1A9NB 2AD9A 1VBXA 2CPJA 4YB1P 1Q7YT 4TLQA 2HGMA 2MSSA 3EX7B 4RU2A 3S01A 1N88A 1R8PA 2CQ1A 1BY9A 2E5IA 3CUNA 2OTLS 1U1PA 3CMES 2N3LA 4TU9A 1S79A 2O3DA 4LIRA 2MMYA 2HZCA 1VBZA 2MZRA 3G8SA 5DDRC 3UCZP 5GADU 1U2FA 3TYTA 5LXYA 1UFWA 1YHQS 3H2UB 1VQMS 2RQ4A 4J5OA 2VOOA 2GO9A 4WFBQ 3CC4S 3CULA 2DO0A 1QVGR 1WI8A 2I38A 2CPZA 1JJ2R 2N7CA 2M8DB 4EGLA 2M7SA 4ERDA 2MY8A 3CCSS 2KG1A 2KXHA 2EK1A 1RK8A 5IFMA 3CCRS 3NNHA 3CCQS 2MKCA 1YJNS 5HL7Q 3TO8A 3NNCA 2DIUA 1U6FA 5HO4A 1JJHA 2CQ2A 3R27A 2JWNA 3UWTA 1Q82T 1H2TZ 1P27B 4IUFA 5GMKa 4OZ0A 2DO4A 2FHOB 2MZSA 2DNQA 4Z2XA 2K3KA 1VC6A 4WFAQ 5LXRA 2K8GA 1M5PC 4C7QA 2DHAA 3G6ES 1UP1A 2DGTA 2AYBA 2KRBA 2NLWA 1WG1A 2I2YA 3R1HA 1X4HA 2MJUA 3L3CA 3NNAA 2DH7A 4OZ1A 3G71S 1HD0A 3UE2A 3MUTP 3IWNC 1YI2S 2CQCA 3SDEA 1DZ5A 4WKRA 1SJFA 4A8XA 1PGZA 1SJ3P 2DNPA 3VAGA 4TU7A 2YTCA 3G96A 2HGNA 2KN4A 5D77A 2MQNA 2MJNA 1M5KC 2KU7A 2L9WA 1SJ4P 4CH0S 2DHXA 2FPHX 4IOCQ 1U1RA 2EVZA 3EGNA 3VAFA 2D9PA 2X1FA 3VAIA 2LQ5A 2ZJRQ 1ZH5A 3I56S 4YUDA 1IQTA 2KM8B 1FT8A 2OJ3A 2WBRA 1WI6A 2RUGA 4CQ1A 2Q79A 4PRFA 2MPUA 1X4AA 4M5DB 2XSFA 1VQPS 1P1TA 1VQ4S 2X1BA 3VAJA 1JJ4A 3NS6A 2MKKA 2DGQA 3OW2R 3VAMA 1HA1A 1KQSR 1B7FA 1DRZA 2L41A 2MKIA 2DGOA 1URNA 3BO3A 2M2BA 3LQVA 1YWXA 1HL6A 2M0GB 2KFYA 3CCLS 1DBDA 3LPYA 1H2VZ 2CPYA 1WHXA 3J7ZT 1O0PA 1VQ5S 2OSQA 2LECA 3THTA 2MXYA 3EGZA 3G4SS 2DNGA 3R1LA 4F26A 1SXLA 4IO9Q 4ED5A 2M4MA 5JVGQ 2XS7A 2AYEA 2XNRA 1A7GE 2JVRA 3PIPQ 1VBYA 3S7RA 1U1KA 2G4BA 1R8HA 3N9UC 1U1MA 2MKSA 2DB1A 4FXVA 1WHYA 5GVQA 1SJRA 5CYJA 2CPHA 1WHWA 2KXNB 2YH1A 2DNZA 1RKJA 1H2UX 1CVJA 4TU8A 2JRSA 3UD4P 2E5HA 1Q81T 2CQDA 2XS5A 2MGZA 5BJRA 1WF1A 1X5PA 1U1QA 1WG4A 2MQQA 2CQBA 1UAWA 2MQMA 2QA4S 1W2BR 1FXLA 5EN1A 1NO8A 1VC5A 1M1KT 5DDPC 2RVJA 1X4DA 5DM6Q 3TP2A 5DM7Q 2LMIA 2KH9A 2FC9A 1G2EA 3SMZA 2MZQA 2OSRA 2E5GA 2MQPA 1AUDA 2DISA 4UY8T 2LXUA 2MGZB 3HI9A 2LA6A 4C0OC 5CA5A 2BOPA 2UP1A 4LJMA 3THPA 3MUVP 2PE8A 3NMRA 2MHNA 1KOOA 1WEZA 1VQ9S 4Y00A 2RQCA 3MURP 1FNXH 3ULHA 3CXCR 3NS5A 2MB0B 3S8SA 2CQIA 3CC2S 1FJ7A 1S72S 3CF5Q 3P5TL 1YITS 1K8AT 1VQNS 4WIIA 2M70A 4QU7A 4WCEQ 2MQLA 2DHSA 2M9KA 1Q86T 4UQTA 1H6KX 2U2FA 3I55S 2RRBA 2DGXA 1KD1T 2D3OR 1U6BA 2CQ3A 2ERRA 2ZJQQ 1X4FA 3CCUS 5GAHU 2DH8A 2CPFA 2N82B 1KC8T 4C4WA 3SDEB 5DDOC 1WHVA 1X0FA 1PO6A 2KHCA 1FJCA 2ADBA 2DGWA 3P6YC 2AYGA 5LSLA 1K73T 5FJ4A 2DK2A 2MKJA 5GAGU 2OIHA 1U1LA 3UD3P 2J76E 2E5JA 2EK6A 1U1NA 3G8TA 3FEXB 3BO4A 3Q2TC 3MD1A 3CTRA 2XS2A 2DNOA 2DNHA 3BEGB 2F9JA 2YH0A 2CPDA 1X5TA 2B0GA 3V4MA 2CQHA 5IM0A 2KM8C 1NJIT 3ZZYA 2OTJS 1WTBA 1VQKS 3US5A 2F9DA 2DGUA 1X4CA 2LCWA 2DITA 1YJWS 3K0JA 1WEYA 2VODA 3U1MA 3UCGA 3D2WA 3G9CA 1N52B 2LA4A 2LKZA 3ZZZA 5IM0B 2M52A 2LEBA 1X4BA 1ZZFA 1XN9A 2LXIA 2DNKA 2XNQA 2FY1A 2RS2A 2VONA 5LJ3Y 2ADCA 5CXTA 4WF9Q 2V94A 3J7YU 2QEXS 5ITHA 3PIOQ 3B4DA 1SJQA 1YIJS 1VC0A 1FO1A 3CMAS 2E44A 3IRWP 3RW7A 1VQLS 2D9OA 2CPIA 2JX2A 2F3JA 4QQBA 1JMTA 5GAEU 3S6EA 2CQGA 3RW6A 2BZ2A 2CQ4A 4QU6A 2MSTA 2LEAA 2DGVA 2MYFA 1N54B 1WEXA 2RU3A 2G1DA 2M8HA 2N3OA 3VALA 3BO2A 4IOAQ 2KYXA 2CPEA 4V19X 2CPXA 2J0SD 2MZJA 4Y0FA 2RT3A 2XB2D 4YOEA 4PKDB 2RS8A 1X4EA 2U1AA 1X5OA 2DIVA 3CD6S 3U1LA 2LYVA 1KOHA 4CH1A 2DNLA 2CQ0A 3B4MA 4CIOA 4LMZA 2QFJA 3MDFA 1WG5A 2G0CA 1FJEB 4PR6A 5LSOA 1L3KA 4QPTA 2YWKA 1YJ9S 5MLCV 2MKHA 1X5SA 2PEHA 3CCMS 1N8RT 2MZTA 2SXLA 1ZZNA 3P49B 3MOJB 2CJKA 1VQ7S 1VQ8S 4F25A 3Q2SC 2X1AA 3FEYB 1OO0B 2KVIA 3SXLA
chains in the Genus database with same CATH superfamily
1K47A 1WF0A 3GYXB 1H38A 2DNMA 1Q0NA 3MAAB 1U8SA 5F8JA 3MM9B 3A8IA 3UR3C 2IHR1 4QW8A 1MMNA 1X7VA 1U26A 1M5VC 3TZZA 2MLZA 3KDNA 2J0QD 2UVRA 1LW2A 3UCUP 3HVTA 1P9QC 4DR6F 2LQ9A 1N36F 5KFQA 3M30A 4C8KA 5L1JA 4UZBA 4KIAA 2MSSA 5FD1A 4LBIA 2HNZA 4ECUA 1S1UB 4KB7A 1YBTA 2E5IA 2R9LA 4DUTA 1NJYA 4QIFA 1OYDA 1QE1B 1D1UA 2HZCA 2ROPA 4F36A 3GPAA 1BXNA 2O1PA 4DU7A 1T94A 3CCZA 1FVQA 3D54A 3OXLA 5D0GA 4LF8J 4P75A 2CPZA 5KFKA 4WE1A 3Q89A 2NCKL 2NUHA 3BBFA 2VPWB 1YKWA 4ID8A 5HL7Q 3NNCA 3H42A 4LF7F 1Y0HA 4C8LA 5GMKa 4DG1B 2K1RA 4LFCJ 3NBPA 2DHAA 1UL3A 3L9ZA 5I3PA 1R89A 2NLWA 1NK5A 4FF1A 5DGAA 2V2KA 3KK1B 2HVHA 1UEKA 3IWNC 1P1LA 3KK3A 3MM5B 2FGOA 4DV6J 2R7QA 4DCOB 1RWUA 1VIXA 4C3LA 2DKOB 3B8HA 1UPPA 1HWLA 2ZHBA 1R0AB 1NZAA 1U1RA 1RTHA 1HHSA 3AB2B 2LQ5A 1XIQA 1T9UA 4LR7A 4DR2J 2CFXA 1P1TA 1HA1A 3HZGA 4KGKA 5HQ8A 4JV5F 2E1PA 3PG9A 3RRKA 2ZNZA 4J91A 4TLRA 4RW8A 3I4PA 1MMLA 2M0GB 2DPIA 1YGYA 5F8GA 3AJ2A 1SL2A 4QYZK 1TV6B 2ZVIA 3JTPA 2ALZA 2XHCA 3F56A 3GZ7A 1V3RA 4ZCIA 1FKOA 2N7YA 2A18A 3MMAA 4HYKA 4B9LA 2IFXA 5DLFA 2MGZA 4NYZA 4R5PB 5B0GA 2V8PA 3OXFA 1WSVA 3A3NB 5DQIA 2GMLA 1VC5A 1M1KT 2GA7A 2Q6BA 3ILJA 3GONA 1NK9A 3EDQB 3KYLA 1CQNA 4O44B 3ELHA 2N4CA 3T1YF 3LTOA 4QWBA 3K57A 2NZCA 3VV2B 1FJ7A 4DSJA 2V34A 1HW9A 1WOPA 1Y11A 3P5TL 1YJ7A 3DMJB 4JYAF 3KLEB 4GC7A 4LRFA 3OR1A 4OX9J 2HS4A 3LP2A 2U2FA 2VB6A 3K17A 3JSMA 4U7UK 2ERRA 3CCUS 5GAHU 2DR8A 2AKWB 1HNIB 4LBHA 1F0XA 1X0FA 3AXMA 1RAGB 2ILZA 1IKXA 4UOGA 5ETNA 2YQ3A 3NCRA 2AJFE 2LDYA 4CH7A 2CPDA 2FJEB 1HWUA 2XO7A 3HP6A 1RAEB 2V63A 1JQGA 4DL4A 2C3YA 4KFBB 4HHJA 4EZ6A 5KAKA 2ZUAA 4OJ3A 2J9CA 1R43A 3MEGB 3IGVA 3T1HF 1C0UB 1J27A 4KO0B 2VG6B 2H9ZA 3GMGA 2JLFA 2XMKA 3C6TB 3UNYA 1WDTA 3CJ0A 1JLAB 1W7WA 3VQSA 4WJBA 3VALA 4NLPA 3IRXB 5G0RA 1CJUB 3OHAA 3R5BA 2RIJA 3HD2A 2Z2LA 3GSDA 5B0AA 2QE5A 2JZ5A 3NGSA 1PBUA 3JQKA 3OR2B 1X9WA 4P2MA 3RAXA 1Y3KA 5LSOA 2YWKA 1ZA2B 3EXYA 2MZTA 2I5JA 2CJBA 1VDHA 3QLHA 1JWWA 1HNZF 1F3FA 2KT5A 3PFEA 3W62A 5L46A 5BXIA 1PAEX 5B0CA 4JI0J 3CCVS 3GP9A 4PG4A 2Y9HA 4CT8A 1FWKA 3HCXA 5SUHA 3VAHA 2B4OA 3MF5A 3OL8A 4QWEA 1T9TA 4LRAA 4OLOA 2FC8A 1U48A 1X4GA 4ZKAA 1RWXB 1S9EB 3PX0A 1GTHA 4JOUA 2EW9A 4Q5VA 1OYEA 2OPPB 4TXSA 4DZDA 1JLCA 3QRQA 3S01A 2E7WA 3G82B 1RT4B 5HP1B 3JQMA 4JV2A 2CWKA 4B3TJ 1YK9A 4J9SA 4N5SA 1S6PB 2HQFA 4IDKB 3WHIA 4TU9A 4DL7A 4EUVA 5A2QY 3MECB 3DI6A 2HAFA 1U2FA 4OZNA 1HBOB 2XLIA 5I42A 2RSQA 2JSXA 4L76A 3OTOF 2PIIA 3MR7A 3I82A 2B9WA 2XTJP 4A46A 2J9EA 4ZITA 3D6TB 2AHOB 3VR1A 3OTCA 2EK1A 5IWAJ 1WSRA 2KFNA 4CLUA 4YR3A 5HO4A 2GJ2A 3W9IA 3AAWB 1HIYA 3B6BA 5KFZA 1NHUA 2ZWOA 3G71S 5FIIA 4AXIA 3ZO7A 3RTVA 4NLRA 1C4CA 1IN0A 4Y3CA 4ILLA 4MJKA 2KN4A 4DCJB 1EQMA 1BQMB 1NUEA 1S10A 1Q8LA 4G1QA 1NJWA 4LREA 3KLHA 2HZAA 3EGNA 2X51A 2YNHA 1N48A 1GMVA 1FT8A 1IBLF 1U02A 5DQHA 3H20A 3O8WA 4P74A 3UVJA 2C42A 1NK6A 3IC1A 1T05A 4KH0B 3HMJG 3QZ7A 1VQ5S 4N7TA 4LF8F 2M4MA 4EBCA 2AYEA 2Y1RI 2Y1IA 4ZJOA 1BD6A 5AXKA 3DOLB 2HVIA 3HVRA 1G4CA 3DRXA 2ZHAA 1RKJA 5F0WA 4PCQA 1RI7A 1KLMA 4QYRA 3MM6A 2ZBPA 4M5HA 3E01A 2RKIA 4B3MJ 2V67A 4UOCA 5EN1A 1TZ0A 5DM7Q 1X4DA 2BE9B 1HR0F 4KH1B 4WP3A 4C0OC 5CA5A 2BOPA 3CMQA 2E9ZA 1MMDA 4A47A 4RNMA 2PMZD 2RQCA 3GJQB 4P52A 1SQGA 4DV6F 4PWWA 1WC3A 1LWCA 4J9UE 3HXMA 3QFWA 4L6V3 2ZH8A 4EU0A 2GMHA 1IM6A 1JLEB 2FGCA 4H4OB 5F9NA 4MKAA 4OHVA 2BJ7A 3Q8QB 1Q95G 2KT2A 2KTQA 1OY9A 2N82B 4I7FA 3LWLA 3K89A 2YX4A 3KHGA 2DPJA 2Z8QA 5ETLA 5ETPA 1CULB 3U1NA 2RHSB 2RE1A 2DNOA 2W2NP 4NEYA 2QA4G 2D69A 2YH0A 3DHWC 3QBCA 4HHUA 2IC3A 7AT1B 2AW0A 5KG2A 5E2QA 1BQNB 2QSFA 3HJFA 5IT9U 2DGUA 4DV5J 2VQEF 4N8OA 4R0JA 1XNRJ 2GAGC 5AE3A 3UCGA 2LDIA 2XLKA 1FKPA 4HTJA 3GIJA 1RWMB 3W2VB 1HQ2A 3ISZA 5LJ3Y 1SH0A 3AODA 1UZHA 4FBTA 2DRDA 2CVEA 3PRDA 1REGX 1NKCA 3QT7A 1FXDA 1HQEA 2RU3A 2N3OA 3T3FA 1HNXJ 3FBBA 3GG0A 1QD1A 2H4WB 3ZXWA 1HQUB 3KNAA 2F40A 3IWXA 4OHWA 4USJC 3WIUA 3TNVA 3U1LA 4NLYA 2W1BA 1DAXA 4JI7F 4FVMA 1E6YA 1FX2A 2LU2A 4PR6A 4OX9F 1YJ9S 2ZZTA 1X5SA 3SV4A 3OFHA 1NZ8A 4F67A 1HBUA 2CG8A 2Q1LA 1S1WB 4F25A 4EO6A 4F4YA 3Q83A 4MIAA 5ETRA 1Q16B 2QRRA 5F8LA 3NGDA 2R7SA 5HMZA 4K4XA 4IR9A 4WKYA 3T5HA 4M5IA 5L39A 3D66A 1HD1A 3TVKA 4X4QA 5H9FK 1B99A 3AB4B 3JTOA 3MD3A 2W2PP 3CJQA 1RA7A 2PDAA 3FFIA 4OL8A 2MY7A 1D8ZA 2BOAA 3DLEA 4ES1A 4ZLPA 2DNYA 5J2PB 4HI2A 1Q7YT 2NXEA 1RCOB 2CQ1A 1RAHB 3PM9A 1PYTA 5KFWA 3O5TB 1KEKA 4I4BA 4MK9A 3I5CA 1VQMS 2RQ4A 1FE0A 3CULA 1PCAA 1S76D 3RRGA 3RRHA 4YQWA 4ERDA 3KXDA 4K5RA 2R8KA 4NCGB 3V81A 3ITHB 3CCQS 5JMNA 2DXFA 1VIOA 4RLEA 1UJ6A 4FXDA 4XAKA 4NWBA 1IWAA 2BXJA 1S0OA 5BR8F 2BBEA 2HEKA 4NOHA 2VFVA 2VG7A 2FHOB 3CGIA 1VISA 2HHXA 2RAQA 5CZXA 4U7UD 3BN7A 2OLWA 1WG1A 1WD6A 2PT0A 1SC1B 4PQUA 3UE2A 4NXNJ 3FCWA 1PGZA 3P4UB 3C2PA 2ZBRA 2DNPA 3GU0A 4AQYJ 4NASA 3MOZA 5AE2A 4ZLNA 2Z4PA 4X62J 4ZVUB 4ECQA 2YXLA 4OX6A 1T7PA 2ZJRQ 2CZVC 3PKMA 3L4BC 1S6QB 4PYDA 3KLIA 2VASA 1FK9A 1N5VA 1ZYQA 2COLA 1HI0P 4B3TF 3I0SB 1XR5A 1F9HA 4B3OA 4NA1A 3GIMA 1CG2A 1NHVA 3H4DA 2CADA 1RWNB 3UN5A 4NYPA 3U27A 1UTAA 1IUJA 4M5GA 3AA9A 2JVRA 1U1KA 4OYXA 1K1QA 3R9LA 2B9YA 4ZCMA 5GVQA 5IWAF 2DNZA 3CJ5A 4QJVA 4FNIA 2R7VA 4KHRA 3HHLC 3TJAA 5B0BA 1MLAA 4JB8B 3ZZPA 4U8VA 1FDDA 3R8YA 3H7HB 2FLNA 5DDPC 4LQ3A 5C25A 1S1TB 2LXFA 1IVZA 3HI9A 1PJ5A 4K4YA 1NJXA 4QWDA 1WEZA 4LSLA 4ED8A 3MURP 2JH3A 5ETMA 2HK3A 2CQIA 4O4GA 4XPEA 4ECTA 2GQQA 2B56A 2YQ0A 1KTVA 5LOQA 4WP8A 4WIIA 4QZVB 2EPIA 5ETQA 3RU0A 1B7YB 1HLWA 3I55S 1ZOTA 2W9CA 4B9TA 3KMQA 1JLGB 3PW7A 2YNFA 4HHHA 2CPFA 3QWUA 1FJCA 4K7QA 4J9LA 3FK4A 3CCTA 5K8PA 4DV1J 2OPQB 4KHPF 2HHQA 4J9OA 4U95A 3SQGA 4DL6A 4K4TA 2KM8C 3N5BA 2E1CA 3HKWA 2LCWA 5KOXA 5HMWA 1TAUA 1EHWA 1TKTB 3CIMA 4FF3A 3U7JA 3FJ2A 1REVA 4A4JA 4M1KA 1C1BA 4NZ7A 4B3MF 2KKHA 1KVKA 3UD5A 1JXVA 3A8KA 1JMTA 2BZ2A 3DLKA 2YKNA 4UQGA 3KUHA 4IOAQ 1SVDA 4GVBB 3FKBA 1NSQA 4ICLA 4YOEA 2YWWA 4YY3J 4RL1A 3EM1A 1U47A 1X9MA 4EYIB 5HBMB 2HIQA 4IH6A 1P6TA 3ILOA 5HJXA 4DDFA 3M8WA 2QFJA 2YKMB 1WG5A 3GFYA 1L3KA 3A8EA 3CCMS 1SV5B 3OV7A 3QGHA 4MKBA 3C3LA 2SXLA 1VBKA 3MM9A 1BWVA 4MT1A 1TMMA 3FEYB 2HRYA 2J6TA 5H1SV 5M2RA 4USUA 3VGTA 1RHUB 5D4NA 4C48A 1YRXA 1H98A 5A0YA 3ILIA 4NZ6A 1D3WA 1I3OB 1Y5NB 4NA2A 4W90B 2PSZA 5CCMA 5HI7A 3D6FB 1IJFB 2HFNA 2OPRA 1N5TA 2DNNA 2W2OP 4JV1A 3AQOA 1RHRB 2JJ4D 3KK2B 1XNRF 2AJ1A 4HVZA 2WAQD 3P8BB 1AA1B 2GGPA 4IG0A 1P9YA 2QSWA 5D78A 1EKRA 4DQRA 3H2VE 1QE1A 3VTIA 1GK8A 3MCNA 5CQGA 4WTYA 4CCHA 4USWA 2YKAA 2GIQA 1XNQF 4J9VA 3D3BJ 2IAJB 4XK8C 4BCAA 2BKPA 1UVKA 1BY9A 3R5AA 1HNXF 4X4RA 2N3LA 1OS5A 3HSGA 5KFYA 2RDDA 2AGOA 4WFBQ 1QSLA 5D8HB 2NXNA 3OVAA 2HBZB 1FRXA 1OQ3A 2HMIB 3DNCA 4DG1A 2HWTA 1ZM3A 1RT5B 1U25A 5E3CA 4P2SA 2FVRA 1NKBA 3PACA 1XBWA 1I6JA 2IIHA 3KK1A 4ELUA 4DMZA 3K5MA 3MM5A 5AE1A 4DHVA 4DR4J 1RXOB 3AY0A 3QNWB 1MWQA 1VC6A 2WK4A 3R6GB 4C7QA 2BX6A 3H0PA 3TAPA 1TU0B 2RB7A 1R0AA 4KGVB 2UVUA 2PMHA 4ZP8A 5D0EA 3MM7B 5A76A 3DHXA 2DT9A 3ETOA 4ANCA 2GX8A 1D9FA 1UVJA 2JEJA 3IO1A 3EE3A 5F41A 4LUBA 2ACMA 4DX7A 4R8UB 2RUGA 5F9LA 3H5XA 4M5DB 1J5EF 2BQRA 1T02A 1TKXB 2IM1A 2RUSA 4CT9A 5DZ6A 1HL6A 4U8YA 3QJLA 3W3SA 1WHXA 4N56A 2UUBJ 2WCXA 4NCAA 3MMBB 1KBRA 2V50A 1Y4ZB 4E98A 5KFFA 2G2OA 3C15A 3P45B 3M4XA 1RWKB 4AFFA 2FJBB 2XY5A 5CYJA 4CO3A 2LQJA 5KG6A 2IYIA 1DURA 4DV7J 3C14B 1TL3B 3QATA 5I3UA 4O44A 1HYSB 3OVBA 3R5CA 4C8MA 4LF9J 2AIRB 1NO8A 5C24B 2OAUA 3M8SA 2OSRA 2BQ3A 3D4JA 4UY8T 2J7UA 1JIHA 2YPYA 5CYMB 3DMJA 5KT6A 4NXNF 3SI8A 5DG7A 2QMWA 1HKAA 3JAMU 4C8ZA 3NS5A 2H5JB 4X4PA 5IT4A 4X62F 3CF5Q 3K8VA 1FNOA 2ZKTA 1JJCB 3N6LA 5KT2A 5F8MA 2MQLA 3JSRA 1NH7A 4PWDA 4LF5F 1UPMB 1K73T 4WK1A 1RTJA 4ECVA 1LXNA 2OFGX 4KFBA 5FDLA 5E3AA 3CTRA 5LMUF 4ILMA 4K2XA 3I9ZA 5KG7A 3OLAA 1TVRB 2NSBA 3MEGA 2OTJS 1UEVA 1HWIA 4KO0A 4X4SA 2VG6A 3D1HA 2V4JA 1Y9OA 4DV3J 3EZ5A 4WXOA 3C6TA 1ROFA 4ELVA 4DLGA 4OYAA 3MM8A 2ZDOA 5HSPA 3D3CJ 3BDPA 2M52A 2LEBA 1JLAA 4A8WA 4NLUA 2I0XA 2E66A 3PW4A 1NDLA 2IVMA 3W61A 2UZAA 4F3QA 3K7RA 1VQLS 1XR6A 2C3MA 4W98A 2CQGA 4I2QB 4TY8B 3OR2A 2HS0A 4F4KA 2KL8A 5DG9A 1X4EA 3OBIA 3V2UC 2YNIA 3KLFB 3FSIA 4DR5F 1UA1A 3GYGA 3QT8A 1UZDA 3MMCB 4JI1J 1B0VA 1OO0B 2KVIA 4FF4A 1G6BA 4P7TA 3M2UB 4ID5B 3CPWR 3P3DA 3OTBA 5IOLA 3HFKA 1OWXA 3EZUA 3LANA 5KFIA 1F9FA 3QFHA 2W2MP 3PJXA 2EFPA 3T41A 1S9EA 2CJQA 2ATCB 5AXNA 1NBEB 2V9KA 1WELA 4ZK7M 3QGIA 2OPPA 2FJWA 3JTNA 1FRHA 2V8DA 4ZPCA 2WVFA 3HULA 1NK8A 2RHQB 4BWMA 1F5AA 1RT6B 2MZ1A 5E3QA 2OI2A 5DETA 3TOQA 1S6PA 1NJZA 2DEJA 5IQQA 4UUXA 3M32B 2NXCA 3MECA 2J8AA 3WX8A 2QA1A 3PEHA 2AX1A 3NL0A 1LWFA 4WXWA 5AXLA 4OHZA 3C16B 1DLOB 3M8PB 2QLXA 4J5OA 5IZHA 2MKYA 2CJYB 1CS4A 5D0HA 2DO0A 2MLYA 1T9YA 2RRNA 1NB7A 5HQLA 4C11B 3HZEA 2UV8G 5BYSA 4CP5A 1V5VA 4DR1J 1UJ4A 2ASJA 3M6UA 3UQSA 2XMMA 1WC0A 5HMYA 3GIKA 2DRAA 1Q5VA 2FZCB 4LF6F 1AT1B 1RA6A 3EGVA 3LAMA 1O8BA 2FTRA 3V6DB 2HAIA 8ATCB 4CLZA 2DXDA 3R97A 5DJBA 4A8XA 1WUUA 1JXLA 1SJ3P 2AJ4A 1IKVB 1MN9A 2MJNA 2CNKB 2BE2B 2HQGA 4KYZA 4IFVA 1TKZA 3NWRA 1N5YA 1KLNA 1N0VC 2X1FA 4KKOB 2MPUA 2X1BA 4U9RA 2GMJA 3VAMA 1JX4A 2QJ3A 5D3GB 5LSRA 3ONQA 4WFYA 3PW5A 2ZOFA 3QAUA 5LMNF 3WZ0A 5A6WA 4LF4F 2ROGA 1VK3A 1ZAWA 2DNGA 3MR5A 3B54A 7FD1A 1J2VA 2ZE2A 2G4BA 3ET6B 4D3GA 4DV4F 4GKKF 2CPHA 3BKTA 1H2UX 3UD4P 3RUBL 4J90A 1Q81T 4NL5A 2CQDA 3I5BA 2VL1A 1U1QA 1WC6A 4DCPB 1W2BR 3CO9A 3N28A 4NA3A 1LFPA 2KZMA 2MQPA 2DY9A 4DXLA 4USTA 3CB4A 2OFHX 3PKYA 1KS2A 1WTFA 4RNOA 2VBZA 4JP8A 4HT7A 2VC0A 3TEHB 3W8PA 4ED6A 2K06A 3GTYX 1SI9A 2HFUA 4QU7A 3OXGA 2NPIA 4G1IA 4O3OA 5HJYA 1TL4A 2G13A 3ZZUA 5K14B 2DH8A 2XEXA 1DY3A 1EETB 3Q24A 3SDEB 2YWEA 1BQNA 4EMDA 4NPOA 5D0RA 3MTJA 4LQ9A 3GQCA 1NK4A 4DUYF 2FHJA 2UUBF 2GIFA 1CJVB 1PC4A 1NPPA 3W2VA 3VGSA 4JI6J 1FKAF 1IKYB 1HI1A 2LA4A 4ZN3A 3GJSB 4DV7F 1N0UA 4OYPA 2FY1A 4K4VA 3EUNA 1HQUA 4G65A 3PIOQ 1F3VA 4LF9F 3IR6B 1DTQB 1IBMF 1TUGB 2ZBCA 2ZFHA 1FDNA 2IDLA 2G1DA 1XQIA 4V19X 4P9SA 1L3UA 4P72A 3P5BP 3I0RA 2LYVA 3W1YC 3IXQA 1S1WA 3RBDA 4LRCA 5HMXA 4HDHA 2FVQA 2PEHA 3ICLA 2B4PA 4NLTA 1RZMA 3TX8A 1ZZNA 1VRUB 4NI2B 1FJGF 4Q2MA 5T14A 1IBKJ 3RJMB 4RUHA 2KXFA 1BMQB 2FQQB 1ZPWX 1EJ7L 4DR7J 5KFNA 2HQCA 2B4UA 2X1GA 4M5NA 4ZPBA 5GAHI 1S0VA 3OPKA 2UXBJ 1NNDA 6AT1B 2MQOA 4E0DA 5C42B 1IR1A 5HK4A 3D5MA 5C2CA 3NOGA 5L9XA 5FLXY 3W2WB 3R3TA 2CPJA 5KFPA 4ZS6A 4B9VA 1N88A 4MYTA 1U1PA 4EZ9A 5DRKA 1S9GA 2QFIA 4HH0A 3PV8A 3EPIA 2KZZA 5LXYA 4U96A 4FP9A 4I2PB 3ITHA 1S1XA 3KJVA 4PXEA 2R3VA 4WU2A 3DRRB 1WACA 2N7CA 1TK8A 5M2UA 5E7OB 3N6NA 1DTTB 3AHPA 4I6AA 5AT1B 2OP5A 2MKCA 4R25A 3ENAA 4JI1F 3H5SA 3M9OB 1F60B 2GQ2A 3R27A 2X3DA 2IVFB 3DYAB 4EYHB 2AV5A 1BGXT 1MROB 3VZIA 5IT0A 1JXEA 3G6ES 3X3UA 4O3SA 2QIFA 1X4HA 3L3CA 1D8YA 4OQJA 4ED3A 4I56A 4XIUA 3OSNA 4KGZB 4AL7A 3ZTQA 1NXIA 1VRQC 3PYFA 4B08A 4C0HA 1NM2A 2L9WA 3CJTA 3MTKA 2IA0A 3C6UB 4ED4A 3CDBA 4HTIA 4F3MA 1C1CB 2Q79A 3PYEA 1FXRA 2XSFA 1VQPS 1JJ4A 4NLQA 3W9HA 1KQGB 2O67A 4X84A 1T3NA 1TK5A 1Y5LB 4B3SF 1DBDA 3LPYA 2ZH9A 3J7ZT 1O0PA 3THTA 3O6QA 2MEWA 4ED5A 1ZBTA 2NSCA 3NKYA 4MK8A 2ZC4A 1HPZB 5IC4B 4D3HA 3AH6A 2EBGA 2BMBA 2VPXB 3OUYB 2EI5A 2QL7B 2MQMA 2P9GA 5K9FA 4HR2A 2LMIA 4K5SA 4JV0A 3LO3A 3SMZA 2VFUA 1K1SA 5KFRA 2YX1A 4DJBA 3CO0P 4USKA 2PE8A 4ZPVR 4PG5A 5T7LB 3Q0AA 3KG1A 2Y8YA 2ACYA 2CJAA 3DOMB 2E9TA 3GG1A 1U4BA 1JLGA 1S72S 3V4IB 1VRTB 2RDIA 3EICA 2DHSA 4ITSA 4FKYA 2NXUA 2OPQA 4LF7J 1RLDA 3DDKA 4OFZA 1NCLA 6FDRA 4E2FB 1NPRA 4H4MA 4XO0A 3MR2A 1XMQJ 4X4TA 2GC8A 1G7CB 1Y10A 3Q2TC 3UDVA 3R7NB 3VVTA 4K0KF 1R27B 2H4YB 2CQHA 4W4MA 2HQ3A 4B9NA 5CHCB 2IPOB 4CYUB 2UUWA 4LF1A 3R6LB 4E8UA 1YJWS 2CAJA 2GS8A 5B08A 3EWGA 4ZLJA 2VG5B 1TFYA 2BE7D 4OYOA 4JV5J 2P6SA 5ITHA 3RBEA 1YIJS 3TR5A 3RW7A 2V68A 1WKJA 1YRTA 4TKTA 3PO5A 5GAEU 3M9NB 5ETOA 1RT7B 2LEAA 3THVA 5J1EB 1Q4RA 5B09A 2HURA 3Q8YA 2YKMA 4Y0FA 4LVNP 3HKZD 3N4WA 4DWIA 4FVCA 1SV5A 1YDLA 2XG8A 2V5HG 2AT1B 4LMZA 1C4AA 3OSPA 1QTNB 3DLHA 3ZZ0A 2MKHA 3M8ZA 1ZETA 3MOJB 1I5OB 4F4AA 5F3ZA 3KHHA 2EXUA 4UW2A 2HKEA 3LUYA 1CJKA 3E8OA 3DXBA 3CCES 4RW6B 1NK7A 3KK2A 3DGPA 4J9PA 1OSCA 4CLTA 1VYAA 3C46A 3M8QB 3I87A 2V4QA 2DJWA 1KFDA 4JYAJ 4JI6F 2DHGA 2DH9A 2QT7A 2FDNA 2IAJA 4RWXA 4ECYA 4DX5A 2PGCA 2P9CA 2LQ8A 1FDBA 3DM2A 2XYHB 4OV1A 5A8RB 4O3PA 2FZKB 2VF3A 3TVZA 4L75A 3N5FA 1FRJA 4NYOA 2ZH6A 2FIUA 3RYLA 4Q8FA 4WFXA 2R8GA 2HNDA 2MZRA 4CO4A 4F4ZA 3M2VA 5GADU 1RACB 3CJSA 3SQOP 5ETVA 4YB6A 3FZBA 2HFZA 3T1HJ 3IS9B 2V8GA 1PIEA 4URGA 3NNHA 4G1PA 4ILRA 1YRUA 2VKRA 2HQIA 2EFQA 1IBKF 2AWZA 4F8RA 2PFDA 4YN3B 3MM7A 1RE1B 3TQEA 3LGMA 2H5IB 1S77D 3RB4A 5A8KB 2QV6A 5KFJA 4OZ1A 2AJ2A 2UXBF 2CQCA 4CTAA 2H65B 3H5YA 5KFXA 1N6QA 2OH2A 3PRBA 4C8YA 1B0TA 3IBFB 1R31A 1MWZA 4R8UA 4M5DA 4DQSA 4OIXA 2IYGA 2KU7A 1TKXA 1Y7PA 2O66A 2XI2A 3G6YA 1RT2B 4KTQA 4AT1B 2WBRA 2D1CA 3MZIA 3MMBA 2DGQA 2JFDA 2FY8A 1S57A 3NLCA 3HLUA 3PEJA 1YWXA 3HFZB 2ZWPA 4PUOB 4P71A 1U8WA 1LW2B 3BR9A 1AROP 4Y2IA 2ZM6F 4ES2A 2FVCA 4A8FA 1S0MA 3M30B 1WDDA 2BJ9A 2UXCF 3I31A 1VBYA 2LFVA 2V2VA 3QAEA 4DV2J 5C24A 2HNZB 2OD6A 4F50A 2QLWA 3HSJA 3ZFVA 2H54B 4FF2A 1XERA 5KG5A 4LFBJ 2QG9B 4O4RA 1UAWA 4OX7A 5CYQB 5E41A 3OLBA 2WSFC 4Q43A 4TY9A 3M2RA 2YNGB 4CRJA 2WRMA 2C2DA 3EDRB 3F0NA 1IJEB 5J2MA 3N01A 3JQJA 3W63A 2CUYA 5THWA 1CLFA 5CZVA 1KP6A 2DR6A 2MB0B 3S8SA 2YPZA 5GMDA 3HHKA 4TYAA 4DI6A 5F0UA 3MPWA 1NSAA 3SSRA 1F9EB 2M70A 1Q86T 3NGUA 3NBPB 2KHDA 3IM8A 2ZH1A 2VPYB 1U09A 4ZHRA 2VDHA 3KK3B 2APOA 2ADBA 4A48A 1S48A 2MKJA 3NXZA 2A6MA 2JHEA 3UD3P 3A4TA 2E5JA 2EK6A 1U1NA 3BO4A 1O51A 1HWJA 4R0EA 3A13A 4EI2A 2DNHA 4UY85 4YR0A 1HNVB 1X5TA 4F4XA 5C7PA 4PG6A 3MR3A 4OI2A 1GX5A 1RTHB 4OJ1A 1M5SA 1VQKS 2ALYB 3KUEA 4MTPA 1T9WA 1TK0A 2J0XA 5M2PA 4ZVFA 1PC5A 1NK0A 2DITA 2Q6CA 3UDEA 1LW0A 1ZM9A 1XTZA 5D6GA 3A3OB 5IM0B 1IBLJ 4C8NA 1X4BA 4RW8B 4TY8A 5HATA 3KG0A 2QLJB 2VONA 3HVAA 3FZ2A 3MCMA 4IO1A 2E44A 5E33A 2CPIA 5IS2A 1EKSA 9RUBA 2D7SA 2DGVA 3IM9A 4CZCA 2M8HA 5KT4A 4PABA 3KLFA 2QTWA 4CWBA 2IDEA 4N76A 3MMCA 2YWGA 3FDSA 1SKSA 4ID5A 1G3OA 2VUGA 1UVMA 3HM9A 2IMWP 2C2RA 2VJUA 1ZA1B 3CDEA 2OEMA 3PYDA 4USIA 4FKXA 2XMJA 1HR0J 4MYUA 1XMQF 1WWHA 2XM3A 4OYBA 2A6OA 4NLOA 1C0TA 2CYYA 5IXUA 3BF4A 2CZ9A 3D0GE 2UV8A 2J0WA 4DQQA 4CLPA 3CC7S 2HFOA 2YKQA 1UW4A 3M32A 1PYOB 4KHMA 2HFSA 1QVFR 1T0TV 2FJDB 2KDOA 2VD3A 1IKXB 3MXHP 3OD2A 2P9EA 4ZOSA 3DU6A 2CWXA 2J9DA 2B8PA 1DLOA 1A9NB 4HACA 1X8DA 3MPYA 1EB0A 3DRPA 1D09B 3BN4A 1S79A 2PA8D 1FERA 3G8SA 5DDRC 4PWUA 5K8MA 1WC5A 2VQEJ 2AMCB 2VOOA 4RUBA 5BYRA 3W7BA 3IWLA 2M8DB 4NXMJ 3IGNA 1Q8IA 3Q23A 3EGWB 2KXHA 4FNHA 4YP3A 2V6AA 4K4UA 2ZH5A 3L09A 2W4PA 2QC3A 3PRVA 3TUPA 2JLGA 3PJ9A 3V6DA 2KB2A 2BW2A 3LGNA 3HDSA 3GV8B 1JKHA 3S1TA 2DNQA 2ZH7A 2ZNYA 5LXRA 2K8GA 2MTLA 2BE2A 3MPVA 4YHHJ 2F65A 3ISNC 1OPZA 5B0EA 2XCPA 4JI7J 2I5JB 1KQFB 2HHHJ 3QLHB 1T03B 5F3TA 2JEGA 4KKOA 1QAYA 3X1LB 2MQNA 3MFHA 1TFWA 3AD7C 1KN6A 4RW9A 4DPWA 4Y6IA 1BC6A 3E51A 2IJFA 1QSSA 3VAIA 1WOOA 3I56S 2XWYA 1IQTA 4OJHA 2BRLA 5U47A 4CQ1A 2CJ9A 3GJRB 3KJNB 4QIGA 1I51B 9ATCB 3F73A 4MH8A 1FRLA 1OJ4A 2UUAF 1YBAA 4X64F 5CAAA 3CCLS 1RQ0A 3N79A 1KR4A 1RYRA 4MMOA 1BWEA 3G4SS 1BQXA 4F26A 2OPSA 4EWTA 1RT3B 4GRSA 3PTWA 1RAFB 3UN2A 2A2DA 4V1Ak 1JLCB 1FX4A 1NSPA 1HWKA 2W9AA 2W7AA 2V2ZA 1CVJA 2B9EA 1GAOA 1RTIB 2JRSA 3L7OA 1BE4A 2XQCA 2C3OA 5BJRA 3OFEA 3O1LA 1WG4A 1SKRA 4Z37A 3QO9A 5I42B 3G2XA 2BV3A 2FD2A 4YB7A 2XI3A 4DF8A 3RR8A 3PJWA 1N5QA 1QTMA 1CEZA 3GFZA 3A12A 3SCJE 1AB8A 2DTJA 2HLUA 2W9BA 3MEKA 4NX9A 4IG3A 5J2NA 1MG7A 2XMWA 1WKLA 2HG4A 3CD5A 2QA2A 5K14A 5EWEA 4OZ2A 4ZCLA 4ALZA 2AGPA 4DPTA 4JI8F 3CJ8A 1FCAA 3EXCX 1RBAA 2D3OR 5BR8J 1Q78A 4BWJA 3FMWA 2W01A 1CJVA 3FSXA 5F8IA 1YJVA 2KHCA 4IR1A 1KQKA 1RBOB 2Z0GA 4V19J 2AGQA 1IKYA 4GO5X 1SQEA 2R7WA 3PR5B 2B0GA 3KLHB 1NJIT 4QWCA 3D1QA 1NLKL 2E5LF 3NS7B 1X4CA 1GXTA 1FA0A 4DV2F 2EEYA 2CG4A 3G9CA 1NEEA 3L7UA 5KFMA 4DV0F 1QJHA 2LXIA 1T05B 2F8HA 3HHLA 3DRSA 2XNQA 4Q8EA 4LFBF 2VICA 4QR1A 2JX2A 4OYZA 1HW8A 4QQBA 4IH7A 3VCDA 2H1YA 2BKOA 3AA8A 1KVIA 2XWXA 3GWCA 4UT4A 4O3QA 1KLMB 4NE9C 1VRUA 3E01B 1RJJA 3GIRA 2HHPA 3D6HB 3MDFA 3LOUA 2E9RX 2IY5B 4QPXA 3J81Y 2B43A 2XMUA 5KFHA 5H9EJ 1RAAB 1R6YA 4C3KA 2OGUA 2X1AA 1D9DA 4UZCA 4PG8A 4OHYA 2LLZA 1CJTB 4YR2A 4KE5A 1SL1A 1OIAA 4W92B 3WC0A 2XGPA 3AD8C 5C42A 1LWCB 2L08A 3AOAA 1U1OA 1UCNA 2R8IA 1ZTWA 3BGRB 4I1TA 1NKEA 3LP1B 5IV3A 2M88A 3DLLQ 4WWSA 1RISA 4RBUA 2W4CA 4ZP7A 3LPEA 3UNGC 4I67A 1UVLA 3HHNB 4K4SA 2NUUG 2IM3A 3W2WA 3H2LA 1EARA 4M95A 1UFLA 2JVOA 2AYMA 2BVZA 1DHMA 2JOQA 4MKVA 3GILA 1HBNB 3K2YA 1U0SA 5K20B 4XDDA 5D4PA 4BLGA 3QGGA 5AJ3F 4O23A 4I2PA 1QAJA 4KHPJ 4WYLA 3EZOA 3CJKB 2CNLB 1TL5A 3TZXA 2IA6A 2VHGA 3MCSA 4ECWA 3GV7B 4J37A 2BACA 4JI4J 5IT9Y 4RJVA 2BRKA 2AJ0A 3EMTA 2M7SA 1C2PA 2KG1A 4DUZF 1HQEB 3TZWA 3LW5C 5K8OA 1KHWA 3K5PA 3Q86A 3TO8A 4WIQA 1H2TZ 1MN7A 4IUFA 2BUNA 2F5GA 3V6KA 2ZC3A 1HHTP 2J8SA 3SCIE 3KHRA 2Y1JA 2MZSA 1R0CB 2P6TA 3LA0A 2EG2A 1B64A 3GFXA 3NCQA 3HHEA 2KRBA 4LSNB 1E6YB 3EVOA 4ZVOB 2V9WA 4XPCA 2QZ8A 1HBUB 2CIMA 1C1CA 4B3RJ 2EFOA 1YG0A 2K7KA 1GH8A 4F7VA 1L5UA 4PZVA 3MEEB 2QL9B 1GX6A 5KG3A 4RX6A 1ZH5A 4C98A 4KQZA 4KAIA 2R2UA 2FLPA 1H3DA 2V8HA 3FFIB 2HS3A 1HPZA 4DR3F 2MXYA 3EGZA 1XEZA 3GE9A 3R1LA 5JVGQ 1N32J 5ETSA 4NXMF 1WOSA 1S12A 1IBCB 2DB1A 1R8BA 3ZTRA 1LEOA 4ZIWA 2OMLA 2KXNB 1XNQJ 2FJAB 4J9MA 5RUBA 2QMUB 3OFFA 2XZDB 1X5PA 2X3GA 2MQQA 3T5LA 5T7LA 4CLLA 3TP2A 2XC9A 5A6PA 3L7PA 4DFJA 3R5JB 2MLXA 4F0MA 4IQMA 1YJTA 3V4IA 3KJFB 2UP1A 4YHHF 1UEUA 1RAIB 2HSEB 1VRTA 3V81B 4J9KA 3J7Z5 3W8GA 1RWWB 2HHHF 3D0HE 1HMVA 1L3VA 3D1OA 4G6VB 2XMTA 3FQKA 2FHJD 4RNNA 3L95X 4BC7A 2VG7B 4WCEQ 1JB0C 3FQLA 5HN0A 3DOKB 1N33F 4C6AA 3HJVA 4PQUB 3OL9A 1X4FA 3WDOA 4OI3A 2RF2A 2ZHOA 4CYUA 1VGYA 2K2PA 4G3IA 4ZVRB 3JYTB 3MD1A 3VWSA 3BEGB 4MKYA 1EIYB 2LQBA 1Y00A 2VG5A 2EFGA 3TW0A 2PC6A 1GMWA 4QYZJ 4QOTA 5F8HA 1WEYA 3D2WA 1B0PA 2G0JA 1RT7A 2B7CB 1ZZFA 1J5EJ 4B3OB 1V3SA 3JS9A 5J1EA 4RBTA 3J7YU 5K5MA 3LH2S 4UOHA 4USVA 3GCXP 3VQTA 3WX4A 1SUQA 3VGUA 3BQ1A 4I64A 3WC2A 3E3XA 4ZVGA 4OX8A 4O0IA 4DS4A 2RT3A 1U0HA 3M6WA 4JI5F 2HVEA 2AF6A 4L72B 4DSLA 1EQ0A 2BANB 4CIOA 2OELA 4ZP6A 2HHSA 2WSCC 2G2ZA 2YKPA 4RR5A 4UUWA 1B70B 4KR0B 3KLGB 1VQ7S 4WZMA 4LSLB 3SXLA 2C22A 2A3JA 2XGQA 2WONB 4AUKA 2R2RA 3M8QA 3TEGA 1LQ9A 2VC1A 1MU2A 3FRZA 1FHTA 1NMEB 1KKHA 5D4OA 3OL6A 2HNYA 2Y0BB 4C97A 1LNQA 1AFIA 1HARA 1UA0A 4F4WA 1IQZA 1WF2A 2KG0A 3BSNA 3ZZOA 3BQ0A 2DNRA 3MFIA 2YNFB 1CC7A 4ZDNA 2Y1LB 2CQPA 2Z56B 3LP0A 3MEDB 4BS2A 1YVFA 1VMBA 3KHLA 4YMEA 3JSBA 4LF5J 1HNWJ 2E29A 2VBYA 3VZHA 4ZJQA 2BJEA 3BH7B 3GIIA 4C3MA 5LMUJ 1EZZB 4DQPA 5F8NA 4JI2J 2OTLS 4DX8H 5G4DA 4IFYA 1KDNA 2HVDA 3IS9A 3ZNUA 4ZIVA 3DDIA 4I69A 1SCJB 4DN9A 3J7AN 1REVB 2Z30B 3R7SB 1PSDA 4F0HA 2I38A 4QWAA 4QIWD 2BR0A 4O3RA 3CCSS 2YKNB 3ETMA 3MAHA 3DKDA 3OJUA 3RBXA 4Y2MA 2WBMA 1Q1KA 3G6VA 3K5LA 2CQ2A 2JWNA 1Q82T 1AYEA 4WFZA 1U49A 1NDKA 4OI6A 2PFFB 1UFKA 4Z2XA 2ASLA 1SC4B 3C8YA 2HIYA 1JLBA 4DL2A 2L48A 1KTQA 1WNEA 1RT2A 5KFAA 1LKZA 1Q8BA 2LEPA 4DLEA 4DR5J 4CLFA 5A0YB 3FBEA 5KFUA 2PI4A 1PG5B 3BKUA 1NPKA 1TL1B 3GB0A 4PUOA 4ZJLA 2OPRB 2I9SA 2M5YA 4DEZA 3VAJA 1VHFA 3KOAA 3OW2R 3HVWA 4M5JA 4OI0A 2DR7A 3M9MB 3TAMA 1LXJA 4X66F 3BO3A 3D9BA 1RADB 4DPUA 4LRDA 2GHVC 2GGPB 2CPYA 2VA3A 4IG0B 4S0MA 3H40A 2ZKUA 1EP4B 4F3OA 4JI4F 1JLFB 2XS7A 1A7GE 3ZTPA 1FEHA 5CYQA 3AT1B 3R5GA 2L3MA 1E6VA 2MKSA 2RILA 1KSPA 1VFJA 2YNGA 4X4VA 3T6BA 1FRKA 3CDWA 2BM1A 1T8EA 4RW7A 3M05A 5EX3A 4NLVA 1J5OA 2MHEA 3V6HA 4CNYA 5DM6Q 2KFZA 2F4VJ 2KH9A 1FWPA 2MDAA 1AUDA 4RW4B 3H5UA 3EPGA 4LJMA 1GQEA 3MUVP 2CXEA 3RAMA 4DSFA 2ZBQA 4Y00A 1FNXH 3ULHA 4OYMA 4EO8A 2AX0A 3M6VA 4P10A 4B3RF 3MAAA 4LT6A 4Q7AA 2Z2ZA 3NGTA 3KLVA 4NLDA 2HHUA 2WW4A 2RMLA 3ZTSA 3OJSA 1PKUA 4PEOA 1HNVA 2ZJQQ 2DBBA 4DOZA 4LF6J 2AYGA 4IKAA 4FBUA 3IA0A 2FZGB 4HLBA 3V4MA 5IM0A 3HT3A 3ZTOA 3U02A 1WTBA 1IWGA 1N32F 1S1UA 4L3KA 4FYVB 3N6MA 5HROB 3DXSX 5IC6B 2W8LA 2R2TA 1N52B 5EHHA 3CVKA 3T1AA 1KFSA 2V69A 1GTEA 3IR7B 1UVNA 3ISND 2AZ3A 4OV6A 2R7OA 2D3O1 3RW6A 3NCPA 5LMNJ 4LF4J 3C15B 3R2CJ 3BO2A 4ETXA 3SV3A 3EYZA 2CPXA 2RS8A 5BYQA 4CO1A 5B7WA 5CABA 4M63A 4DV4J 3ZZTA 1Z2ZA 2C2MB 5I3UB 4GKKJ 3FC9A 3SEOA 3HT0A 1RTDB 4J9NA 1P8GA 2VPZB 4OLPA 2ASDA 2G0CA 1FJEB 1I1GA 4DBQA 1XWLA 3NGKA 3MHYA 3SFGA 2L9DA 4UF4A 5KOWA 1TUWA 1V5IB 5AXMA 2DCLA 3RZAA 3QRPA 3FSYA 1N34F 2V0NA 3AJ1A 3C19A 2BKNA 2NYHA 2RNEA 1T9XA 3JAMY 4EEYA 1S59A 1TR0A 4YB5A 3CCJS 2I8EA 4PWDB 3FRYA 2RU9A 2FHMA 1RYSA 1RTJB 3BGOP 5FDLB 5J1NA 3I96A 4CI0B 1TV6A 1SQFA 3H98A 2J7WA 5A8WB 4MIBA 3DC2A 2AD9A 3AOCA 1PAUB 4YB1P 3BSCA 1UVIA 2HLTA 4DUYJ 3EX7B 1VQSA 2V4JB 1R8PA 2RJZA 1S5ZA 3MM8B 4PPZA 4R5PA 1ICEB 3UCZP 1PYSB 3H2UB 1Y3JA 5GAEI 1RWVB 1U2CA 4MK7A 2GO9A 4Y2KA 4KSEB 3R2DJ 2DXEA 4HKQA 2AEFA 5KG1A 4JUZA 2B6AB 5KFCA 3CCRS 1U7LA 3QYYA 1BLUA 3WIVA 1IBMJ 4URQU 1S99A 3WQPA 1T03A 3KLEA 2YNIB 2QO3A 1BHNA 3W60A 2AQ4A 3NNAA 4CO0A 1S0NA 3MUTP 2UUTA 2R42A 3NOCA 1HNIA 4WKRA 4KC5A 3FEZA 3VAGA 3LALA 3J80Y 1YQHA 2H5EA 5H9FJ 4KY3A 2PI5A 2IRYA 1FJGJ 4RKUC 1UETA 2BEFA 2Y8WA 1WJ9A 2W4DA 1GMUA 1HNWF 5L8RC 2YVSA 4QBUA 2QYGA 4ZLLA 3NS6A 3DGVA 1VLYA 2NR0A 3NRBA 4JI2F 2ZH4A 1RT3A 1IKWB 1URNA 1C0UA 1IXKA 1R8CA 2OSQA 2UXDJ 4Z7YA 4ED0A 1RTIA 3HSDA 1SXLA 3HD1A 1R8HA 5GADI 5HQMA 3NMAA 1WHYA 3IRXA 1CJUA 4TN2A 1LWFB 3IR5B 4O0NA 2A0FB 2ATLA 2E5HA 3W66A 1CS4B 3K8WA 2WTFA 4P73A 1JLQB 3NMRA 2FLOA 1LK5A 4ETZA 1VI7A 2YBVA 4ES3A 5KFTA 2C2ZB 4L73A 1L3TA 4N77A 2D41A 3SCLE 2RRBA 3CJ4A 4L3NA 1F1BB 2CQ3A 2QGFB 3R5DA 2VBXA 3QZ8A 1VLOA 2XO6A 2GHWA 1WHVA 1PO6A 1URRA 4X4UA 2ABYA 1RBLA 1CC8A 3BREA 1FDAA 4MFBB 2C2KB 4IFVB 2KT3A 5A2QU 2F9JA 1TKZB 2XYPB 2CKWA 1N5YB 2HRTA 2IJRA 4HL9A 4DFKA 4Y65A 2B8QA 3G82A 1RT4A 5HP1A 4FS2A 5KT5A 3CEDA 4IDKA 2BJ8A 2CZ4A 3Q8SB 1S9FA 1MNEA 8RUCA 2IMOA 1HBOA 2DNKA 1GT8A 2R4FA 4WF9Q 3RAQA 5CXTA 1MW7A 1VC0A 3IRWP 3J81U 2F3JA 4B3SJ 2F4VF 3UDLA 3S6EA 5DQGA 2ZE2B 1H72C 4N41A 4IYQA 4ZP9A 2MZJA 2HZVA 2IBKA 2F7VA 3DU5A 4LFCF 2XB2D 4PKDB 1G1XA 1ITPA 2U1AA 1RT1B 2DHHA 1FEEA 4Y34A 4FYYB 3H59A 5L9NA 2C2NA 2CQ0A 2PO4A 1CJTA 5J2QB 5HLFB 3WBZA 1N8RT 3BGRA 2CJKA 1RHJB 1YZ6A 3Q2SC 1RDRA 1SL0A 3LP1A 4OZ3A 1BQMA 4IRCA 1D9AA 2R2SA 4B17A 3PX6A 5C5JA 4DR2F 2KVQE 2KI2A 2LU1A 4WBFA 2BA9A 1TELA 2EFNA 5JVHQ 1S49A 3GJTB 2QLBB 2CA9A 1VJQA 3I32A 1LOUA 4LRBA 3UI3A 2NYIA 1HBNA 2BQUA 1XJWB 1Z2LA 4RU9A 4AL6A 5KT3A 3BS9A 3CJKA 4Q0BB 4LBPA 2XBPA 3O3LA 2Z58B 4PYAA 1K0TA 3DLGB 4LIWA 3JB9k 3RB3A 2IM2A 1F6TA 2KO1A 3DOLA 4C8OA 4K0KJ 1FRIA 2XSJB 4DSEA 3BGUA 2EBEA 4DU8A 2R7UA 1XMBA 3TYTA 1YZ7A 2EG1A 4ECRA 2BABA 4A8YA 3QRRA 2WVBA 3CIZA 1QVGR 1WI8A 2XY7A 3HSZA 4EGLA 4ED7A 4AL5A 2MY8A 2W24A 1TQLA 3BYPA 2HBQB 1F5BA 4LSNA 1JJHA 3I9V9 3OL7A 1OSDA 4RWWA 3I0RB 4OZ0A 3QMQA 2DO4A 1PBAA 2WOMB 3W9JA 4WFAQ 1JLEA 4H4OA 1KHVA 2UU9J 3JXOA 4NLGA 4CLSA 5D4LA 2MJUA 1HD0A 3IG1B 3HO1A 3MEEA 2BDPA 2DR9A 1DZ5A 4IH5A 1SJFA 2NQPA 5EGYA 4DX6A 3TX0A 4NMLA 1CULA 5DO2A 4FPIA 5ETKA 5E3RA 5I4MA 1A6LA 1X0PA 3I6PA 5HVGA 1WORA 5T41A 1UWBB 4ED2A 4CM0A 4YUDA 3V6JA 4MIWA 3K58A 3UW1A 1RLCL 1KQSR 1L3SA 2W2QP 1ZM4A 1AW0A 2DGOA 4OJGA 3W5YA 2O5DA 5HANA 3W64A 1XMOJ 3SBMA 1VOMA 3M1VB 3TVYA 2YX7A 2XCAA 2YWFA 2GJFA 1S9GB 2Z2YB 2XS5A 1X31C 2VA2A 2JFKA 1GNKA 3FGVA 1H7XA 3UR0A 1RWPB 1X60A 1S1XB 3KJVB 2H3EB 2RVJA 2FC9A 1HBMB 3GCWP 2DISA 4C0BA 5IQ6A 1HHQA 2LA6A 4TQSA 4U7CA 4BBYA 3BB5A 4TNOA 4JI0F 4DSKA 3DOKA 3QJPA 3CC2S 3KFWX 4M5MA 3OTDA 2R8JA 3OTEA 4MAKA 1K8AT 3PX4A 3FNNA 1ULRA 3A8JA 2QMXA 3JYTA 3M8YA 2FUG9 2DGXA 5JXSA 1U6BA 2Z2MA 3QPIA 4ER8A 3HX9A 1U1LA 2J76E 3HHLD 3FEXB 2XS2A 2UXDF 2GNKA 3K5NA 4KGXB 3OVSA 5J2PA 3LF0A 3AD9C 2F9DA 3POTB 2VQFJ 3QT6A 4HT5A 5ETTA 1AZSB 3PYGA 5E5NA 4ZCKA 1R0BG 5LT5A 5KFSA 2LKZA 4DZ6A 4EK2A 1XN9A 3BSOA 1OQ6A 4H54A 1WKKA 2K7JA 2QEXS 3GR0A 3B4DA 1NDCA 4N47A 2ILYA 1FTCA 4NCGA 1XR7A 4KGMA 2MYFA 1WEXA 2DVIA 4URSA 2ZM6J 2BANA 4CO2A 4NLWA 2JL9A 2CRLA 3GYNA 5HVFA 2UXCJ 2XY6A 3BBCA 2DIVA 2FB0A 1FTRA 3KLGA 3CJRA 3CD6S 1S1VB 4PXBA 4CH1A 3PFOA 3HHDA 1FD8A 2WONA 4QPTA 3DCAA 1DJ0A 4OZ5A 4QIEA 4DPYA 4PG7A 3IMQJ 2MQ8A 5EDWA 2J6SA 3MUMP 1XC9A 2NZ4A 1BUXA 1TL7B 3QIPB 2PA3A 1IM4A 1NU4A 3TWZA 5I3QA 3MEDA 4A8MP 3W5ZA 1S6QA 4EBEA 1H0HB 1O5JA 2RRAA 5L1KA 3PVXA 4BDPA 4F02A 4C2MA 3I0SA 2JC1A 5KFLA 1V6HA 5KT7A 3MCOA 4H4MB 1EAYC 3IBWA 2R7RA 1SC6A 2HGLA 2D74B 2HW3A 3O44A 2OHDA 2YY3A 4LIRA 1T9VA 2CDQA 3KNGA 4KT0C 1YHQS 2XLJA 4F04B 3CC4S 2ZD1B 2VFTA 1PJ6A 2ROEA 1V3ZA 5KFOA 1S1TA 1JJ2R 3TZYA 1KVJA 2D3ZA 2GVDB 1RB0A 1NSKL 3ZNJ1 3I5AA 2ZZNA 1YJNS 2DR5A 2H48B 1U45A 4YFUA 1F2HA 2PMWA 3TRGA 4K59A 3PR4A 4Q45A 2C2OB 1UP1A 1LWEB 2I2YA 1RWOB 1YI2S 1V9OA 3OFGA 1TL1A 4YDXA 4ZA1A 4TU7A 1A0OB 2HGNA 3SSSA 1N5SA 5HAOA 2K3IA 5GAGI 1CJKB 3BPSP 1SJ4P 4DV5F 2DHXA 4ANDA 3DGPB 1SIWB 2XMVA 1WI6A 3TAQA 1X4AA 3CDUA 1Z4UA 1B7FA 1EP4A 1TKTA 1DRZA 1JLFA 2MKIA 4EFAC 4B9UA 3LQVA 2ZZMA 2PEBA 1YJRA 4JI3J 3T6JA 2OD4A 4CNZA 3DM2B 2AU0A 3RGIA 4PPDA 1SKUB 3N9UC 4GVBA 4FXVA 3TA1A 1S7HA 4ZVEA 2VFSA 4RW4A 1WF1A 2HNDB 1NHKL 3M2VB 5HBMA 1K0VA 4KRWA 2EC0A 3W65A 1RGVA 4GO7X 1G2EA 2Y3YA 1S4FA 2POKA 4QIVA 2UU9F 1TTHB 2B5JB 3R7BB 3THPA 1QUVA 2B3TB 2MHNA 3UN3A 3SYZA 4ECXA 3CD7A 3HPOA 3K59A 3PNIA 4ENOA 1YITS 3E2EA 2VZ9A 1OY6A 2G0IA 3G87A 3IAM9 2M3DA 3TI0A 1KD1T 1YSJA 1GMWD 3D0IE 2RD5C 3NWGA 1SB6A 4RUAA 1FI4A 4I0WA 1NDPA 4CTAB 4NRTA 5CD4A 4KV8B 1N6QB 3KWMA 2LP4A 3RB6A 3ENVA 2XULA 5HROA 4NCBA 4DL0C 3KTQA 3CJ3A 3IN5A 1H7WA 4ZVPB 5EWGA 1XMOF 4QR2A 4EBDA 2KJVA 3DLJA 3BH6B 4P2FA 3PHEA 3K0JA 5EX0A 4K8RA 3VHQA 1M5HA 4L74A 2D3UA 2CNNB 1SJQA 1MSWD 1FO1A 2UUAJ 4X64J 1YJUA 3Q8PB 4TYBA 2HMIA 2FVSA 5B0FA 1RTDA 3IFEA 1RT5A 4X4OA 2KYXA 2CPEA 1ELOA 1RUSA 2P2CB 2QN6B 1O6XA 3NG8A 2GVZB 4F2RA 4CDIA 2WVEA 3DRYA 4B02A 1SC3B 2VU5A 3H8YA 3B4MA 5JJBA 3M2RB 4ZVSB 3GR1A 4AQYF 4H4KA 1I94J 4FPRA 2N4DA 4FN5A 4WTOB 2G9OA 2VBWA 3P49B 5J2MB 3QJJA 2KRRA 1W26A 2JLEA 2FVPA 4ZN1A 3HF5A 1SIZA 3LAKA 1R3NA 2GHPA 1QLNA 2ZVSA 1CPZA 3Q8RB 3F44A 2ZH2A 2ZOGA 2BJ1A 4WFNQ 4DSIA 1M90T 4P6QA 3MWBA 5A8WA 4ZHRB 4IQXA 2EFVA 4OI4A 2VQFF 4JI8J 4I6YA 1VK8A 5DLGA 2ZITA 3EJMA 2QLFB 2O01C 1ZM2A 3FBFA 3EVMA 5LJ5Y 4DS5A 2G1HA 2CJXB 3PXGa 1Q53A 5ADZA 1RSCA 2GQCA 3MPDA 2OMOA 3QWPA 3DN9A 1KNZA 1VQYA 4ZPDA 3T5KA 4RU2A 4HEA9 4TVAB 3CUNA 2ZOMA 2DCUB 3DFEA 3HVTB 4ZPWR 3J7YI 1YBUA 2O3DA 4OYIA 1LW0B 3C14A 1TL3A 4CLWA 2B6AA 2E5LJ 1HYSA 4BC9A 5GMEA 4PXCA 4DV0J 5DZ7A 3QT5A 5CYMA 5DG8A 4WPAA 3J80U 3LGHA 2CVIA 4QCLA 2F63A 1U6FA 2WHOA 2OEJA 5C2GA 3MPUB 4WE1B 1DQ8A 1ZAXA 2C1EB 2K3KA 2HBYB 3FCHA 5CH7B 2A10A 5JUMA 2C28A 4ZPTR 1H74A 1NB2A 4DV1F 3PW0A 3PW2A 2Y0SD 1YX2A 1RHMB 2K1RB 1XK8A 3G96A 2JEIA 4ATNA 1S97A 5KFGA 1M5KC 1D0EA 4WP9A 1VHIA 1Q5YA 1TVRA 1EX8A 1IKWA 2EVZA 1C0TB 1GXUA 3LWMA 4PRFA 1RTZA 1VQ4S 2HWHA 3BV8A 1H73A 4B9SA 4M5LA 4X4NA 2L41A 2UVWA 4USMA 1TP7A 1QAXA 1W2IA 2IRUA 1U2RA 3AFGA 1H2VZ 4X2BA 3H4BA 4I68A 2XMAA 2NXJA 4ZVHA 4M8LA 4GMKA 2C3UA 1UW9A 4I2QA 4YS2A 4C9DA 4HACB 1S4EA 2FJXA 3QGPA 4YY3F 1PILA 1U1MA 4FS1A 3DRPB 1SJRA 1QY7A 2B4VA 4QR0A 3UO0A 2YH1A 1QAIA 1F2GA 1JLQA 4CLKA 5AJ3J 5KFBA 4A8QA 2CQBA 2VFRA 3TUJC 4Q44A 4RBVA 1FKOB 3MMAB 4GKJJ 2VIHA 2MGZB 3TUIC 4LR9A 1KOOA 1FESA 4KBIA 3NGRA 3M2UA 2Q66A 2G2YA 4DUZJ 1WC4A 4OYWA 1GFWB 2B7BB 4DPXA 1B3TA 5KG4A 1JKHB 2WVCA 1GXLA 4NMXA 3BR8A 1ACMB 2M9KA 3CNQP 1H6KX 4AYBD 1MWYA 2C3PA 4CO5A 2OEKA 4MFBA 7FDRA 4C4WA 1RCXB 2DGWA 3ADAC 5FJ4A 3PO4A 1RT6A 3OR1B 4Y2CA 3LP2B 3NAIA 3RR7A 4RO0A 4RW9B 3JSMB 3HFVA 1RAJA 2LVWA 5LL6d 4NRUA 4JI3F 5B0DA 4ED1A 2IBOA 3KG4A 3KDOA 4GC6A 3B78A 2ASYA 4WYWA 1FFWB 1R6VA 3RB0A 1RHQB 2VODA 3C16A 5MAOA 4FYDA 3J81j 3ZZZA 4DFPA 3M8PA 4K4WA 2RS2A 4ZPAA 3PDNA 2ADCA 2V94A 4F2SA 1JNRB 1RABB 2D9OA 2WVDA 4C11A 2W7PA 2R8HA 1RT1A 2CDRB 2YWHA 2OPSB 4QU6A 3UFCX 5KFEA 1N54B 4DR3J 1QUPA 5J2QA 5HLFA 2J0SD 2UVVA 4DR4F 2UUCJ 1TMJA 1YLXA 2WSEC 2GZOA 5EWFA 4HDGA 3QO9B 4HI1A 5G0RB 2BM0A 1RAOA 3TQ1A 3W5XA 2HK2A 3M7VA 3BYRA 2J6UA 2X7IA 3QIDA 2IRXA 3TA0A 2W9BB 1VQ8S 1IKVA 1S6UA 3ZZRA 5CD4H 4IG3B 5J2NB 3CW2C 2V8VA 3QSYB 3HK2A 3MGJA 4KPCA 1K44A 1VCTA 4M5KA 3D28A 3D6MB 3VAKA 2H51B 1X9SA 2IJNA 1S6OA 2ZJPQ 2B51A 4Q0BA 1FFGB 3MR6A 3MI7X 1YTYA 5KFDA 5D3GA 2ZDPA 2HHTA 4WZQA 2AEMA 3DLGA 5K8NA 5J1PA 1OY8A 2HPUA 2HYIB 1N33J 3ZC4A 4OZJA 3KJQB 2DGSA 2OKQA 1K9MT 2VJVA 1LK7A 2XSJA 4AXJA 1OPIA 4LSZB 3G86A 1M5OC 2DD8S 3IAS9 1VBXA 3ET6A 2HGMA 1CBKA 2E1MC 1NAQA 3CE8A 2RQMA 3CMES 1Q79A 1M0SA 3GFHA 1R7IA 2BYCA 2MMYA 3VGVA 3O2IA 1R8AA 2KJWA 3HHLB 3DRSB 4ZVQB 4ECSA 2GW8A 3D67A 3MAQA 1RU2A 2B9XA 3DI6B 4PAAA 1I94F 1DFDA 2WOMA 5IFMA 4PQAA 2JDJA 4RNHA 2BJDA 2DIUA 4DPOA 3UWTA 2IM0A 3IBCB 3H25A 4Y28C 3IG1A 3M8RA 1P27B 3PY8A 4TQRA 3T19A 2DGTA 4JI5J 2AYBA 4ZVTB 3R1HA 2ZEJA 2HHVA 4NLSA 2A2CA 1EETA 3SDEA 4IRKA 1UWBA 2R7TA 2YTCA 4H4KC 4LR8A 4IRDA 4CLYA 4DV3F 4X65J 2GAHC 3OT9A 4IOCQ 5D15A 4AE5A 1FD2A 2EC2A 3I4HX 1W25A 3FBCA 2ZUGA 2KM8B 4ELTA 1AFJA 2FYXA 2BW7A 4LFAJ 2GJIA 2MKKA 2RH3A 1LFWA 2I1RA 3TA2A 3TJ8A 4G1QB 2HWIA 1B4SA 3M1VA 3EVWA 4DL5A 2YNHB 4DF4A 2LECA 1WC1A 1DTQA 3TUZC 1PJ7A 3NEKA 4IO9Q 2HFVA 4RNFA 3UVJB 2XNRA 3PIPQ 4OZLA 3S7RA 4LVOP 5DS7A 1Q8KA 2HQDA 4RUCA 5L1IA 1WHWA 3FVYA 2QX0A 1HBMA 1SBRA 3RG6A 2OO4A 3KKFA 2W7OA 3PCOB 1FXLA 3TJ9A 2C2EA 1SKWA 3SFUA 3BSAA 2Z57B 2AZ1A 2MZQA 2GFFA 3BM7A 3MM6B 4OHXA 4NI2A 3AXKA 2RKIB 1CSJA 2F8EX 2VV5A 1AXQA 2I6WA 1HFEL 4P7VA 4QW9A 2NPFA 1VS3A 5SZTA 1VQNS 1U6ZA 1DQ9A 4UQTA 3M6XA 3UDCA 5FLXU 2E1RA 3B82A 4DFMA 4DQIA 5HVHA 3MMJA 3VVUA 3SZ2A 1KC8T 3D68A 4N8NA 5LM7E 3P6YC 2DK2A 5GAGU 2E7VA 3POTA 4WU3A 3G8TA 4KPYA 1AZSA 1T3OA 2E1AA 4I7FB 2L9NA 3US5A 4YEAA 2NREA 4Z7CA 1M1HA 4ECZA 2YKOA 3U1MA 1M1GA 1UJ5A 1RU1A 2IC3B 1HI8A 5DGBA 4DR6J 4A8KA 5E3PA 3CDAA 1N36J 4X66J 1CQMA 3DRRA 4DR1F 5E0OA 3P96A 4GKJF 4FDFA 2CQ4A 2XYGB 1FKPB 1DTTA 1S1VA 1RP5A 2V2QA 4P2XA 2OUGA 4DN0A 3DYAA 2KYZA 1X5OA 3JSYA 1LWXA 4K4ZA 1MROA 3CJ2A 4KJIA 1KOHA 1JNZB 4OI1A 1U24A 4HH1A 3ENQA 2YQ1A 1ZTTA 1IR2A 1TL7A 3QIPA 4USHA 3K5OA 3NAHA 3PHTA 4M94A 1FF2A 2QYCA 2WZ1A 3FUYA 3D7SB 2E7XA 1QDUB 4RPFA 4ZMMA 3DDNA 1HMVB 2AP6A 3CT9A 4U67Q 3C6UA 2R7XA 4FZVA 1UWAA 3Q22A 3CCWA 1AUSL 1VQ6S 5L38A 2EKYA 2ZH3A 3DLBA 3QSIA 1QSYA 2J7KA 4K50A 3V5RA 1QM9A 4RZRA 2RF2B 3BZQA 1KONA 4FXWA 1VQOS 2VOPA 2DEIA 2HVZA 5DDQC 3VF0B 4PXDA 4AD6A 4TLQA 2W8KA 2ZD1A 2FLLA 2EWHA 3H90A 2AEJA 3BPDA 1SH3A 2JEFA 1OMSA 3DLEB 2FJVA 1VBZA 2GVDA 3OUYA 2UUCF 3F41A 1UFWA 2V4RA 3J7A1 8AT1B 1NRKA 1SH2A 1N56A 4CM2A 5CCLA 4Q2LA 2RDJA 4J9RA 1Z1ZA 2GIRA 3BBBA 3A1YG 1SUQB 1RK8A 4O3NA 2IVYA 1Y5IB 3CSKA 1LWEA 3DOMA 3FMBA 3BQ2A 2J9DE 1U0HB 2PD1A 3GSIA 1T95A 3OHBA 1M5PC 4A8OA 1TKDA 1KRPA 2VDIA 3PZPA 1KWMA 2HRUA 2DH7A 3T1YJ 1DARA 1FNMA 2F8MA 2J5AA 2ZBIA 1JK9B 1UKUA 2AJQA 5D77A 2VH7A 1ZAVA 3BDEA 3TANA 1MU2B 2P8IA 4CH0S 1T11A 2FPHX 3T9ZA 3VAFA 4WK3A 3AQPA 2D9PA 4A8SA 2HNYB 1N34J 2OJ3A 2Q3PA 4IOBA 4J7CA 4Y2AA 2XZTB 2M2BA 2JC0A 2KFYA 5IV4A 3LP0B 5KTQA 3KUGA 2GV1A 3C66A 3KLIB 1FK9B 2BJ3A 6FD1A 1FE4A 4XTTA 3UPFA 2F1FA 1GEHA 4UOFA 4NEZA 1NH8A 3CD0A 2XZWA 2DRBA 4TU8A 4IFYB 3N0VA 3BGFA 2B5JA 1Q7LB 2A1BA 3RBZA 2QA4S 4NLXA 2E5GA 1FRMA 2LXUA 1LV5A 1SPBP 3QQCD 3CWJA 1SJ1A 4XDCA 1DQAA 5KFVA 4YDDB 4DR7F 2HBRB 1VQ9S 1ZS6A 1FFSB 3CXCR 4DL3A 3IP0A 5C25B 2F4FA 3GLJA 2PN6A 2DY1A 4RW6A 1FWLA 4U6PA 4KV8A 3SCKE 4X65F 2JNJA 1TUVA 1RHKB 5H9EK 3BJYA 1JLBB 3KMSA 4O4GB 3BGLA 3T9NA 2CNOB 4LFAF 5DDOC 1HNZJ 2EKNA 5KG0A 5LSLA 4B9MA 1APSA 2GCFA 2OIHA 2XHWA 1RKIA 3FCVA 5L1LA 2W9CB 3SIPB 3SSQA 1IR0A 3G6XA 1F5CA 2WW8A 5A8RA 3ZZYA 3GV5B 3A3PB 2RQKA 3TARA 4OMFG 2P5VA 3SQGB 3TAMB 1TAQA 2FHKA 2WB4A 1VJWA 1UMJA 4J9QA 1N4LA 2VKZG 3CMAS 2GVZA 3AJDA 5EUHA 4F0KA 3T5JA 2MSTA 2NS1B 2HHWA 3AOBA 4JBCA 3G8QA 2QL5B 2DYAA 4NZ0A 3OQ2A 1C1BB 1E6VB 4LF2A 4FYWB 4ANEA 3OTOJ 4RW7B 4UTGA 3ENWA 3DLKB 1VR6A 2DNLA 3ILLA 4I6WA 1J5OB 5A8KA 1ZPVA 2W25A 2WB1D 3Q8VA 4GVLA 4ICLB 4BHQA 4K2JA 1S7IA 5MLCV 3Q8UA 3BKFA 3NP5A 4FYXB 2Q43A 3NY0A 2GO8A 1FVSA
chains in the Genus database with same CATH topology
2LLZA 4FF4A 4YR2A 1G6BA 4KE5A 4P7TA 1SL1A 5EDWA 3M2UB 2J6SA 4ID5B 1OIAA 1WF0A 4W92B 3GYXB 3WC0A 1H38A 3MUMP 3CPWR 2DNMA 3P3DA 2XGPA 1XC9A 5C42A 1LWCB 3OTBA 2NZ4A 2L08A 1U1OA 3HFKA 1U8SA 2R8IA 1ZTWA 3QIPB 5F8JA 2PA3A 3BGRB 1OWXA 1IM4A 3EZUA 3LANA 5KFIA 1NU4A 3MM9B 1F9FA 4I1TA 5I3QA 1NKEA 3MEDA 3PJXA 2EFPA 4A8MP 1S6QA 3LP1B 1S9EA 2CJQA 2M88A 4EBEA 3DLLQ 1H0HB 1RISA 1O5JA 5AXNA 4RBUA 2W4CA 2RRAA 3UR3C 2V9KA 4ZP7A 1WELA 3UNGC 2IHR1 4I67A 4ZK7M 4QW8A 5L1KA 3QGIA 3PVXA 4BDPA 2NUUG 4C2MA 2OPPA 2FJWA 1UVLA 3HHNB 1MMNA 2IM3A 2JC1A 3I0SA 3JTNA 1FRHA 1X7VA 3W2WA 5KFLA 2V8DA 3H2LA 4ZPCA 1U26A 1V6HA 1M5VC 5KT7A 1NK8A 4BWMA 1F5AA 4H4MB 2J0QD 2UVRA 4M95A 1RT6B 3IBWA 1UFLA 2JVOA 1LW2A 2MZ1A 5E3QA 5DETA 2AYMA 3TOQA 3UCUP 3HVTA 1P9QC 1S6PA 2BVZA 1DHMA 2R7RA 2JOQA 1NJZA 4DR6F 2LQ9A 5IQQA 1SC6A 4UUXA 1N36F 5KFQA 3GILA 1HBNB 3K2YA 3M32B 3M30A 2HGLA 4XDDA 4C8KA 3MECA 5D4PA 2D74B 2J8AA 5L1JA 3QGGA 2QA1A 5AJ3F 4O23A 4I2PA 4KIAA 1QAJA 3PEHA 2HW3A 2MSSA 5FD1A 4WYLA 2HNZA 4ECUA 1S1UB 4KB7A 3CJKB 3O44A 2YY3A 2R9LA 2AX1A 2E5IA 3NL0A 1LWFA 4WXWA 5AXLA 1TL5A 4LIRA 1NJYA 4QIFA 1QE1B 1D1UA 2HZCA 4OHZA 2ROPA 2CDQA 2O1PA 2IA6A 3KNGA 1DLOB 1T94A 3M8PB 4KT0C 3CCZA 1FVQA 3D54A 1YHQS 2QLXA 3MCSA 2XLJA 4J5OA 5IZHA 3OXLA 4ECWA 3GV7B 4J37A 2BACA 3CC4S 2ZD1B 2VFTA 5IT9Y 2DO0A 2ROEA 1V3ZA 5KFOA 1S1TA 2CPZA 1JJ2R 2BRKA 2RRNA 1NB7A 2AJ0A 4C11B 2M7SA 5KFKA 1KVJA 4WE1A 2D3ZA 3HZEA 1C2PA 2KG1A 4OHYA 2UV8G 2NUHA 5BYSA 3I5AA 4DUZF 2VPWB 1HQEB 1UJ4A 3LW5C 2ZZNA 2ASJA 3M6UA 4ID8A 3UQSA 5K8OA 2XMMA 1KHWA 1YJNS 3K5PA 5HMYA 5HL7Q 3TO8A 3NNCA 3GIKA 2DR5A 1H2TZ 4IUFA 2BUNA 1U45A 4LF7F 4YFUA 1Y0HA 3V6KA 4C8LA 3TRGA 2DRAA 2ZC3A 1HHTP 4K59A 5GMKa 3SCIE 4DG1B 3PR4A 4Q45A 2K1RA 3KHRA 2Y1JA 2MZSA 2P6TA 4LF6F 2EG2A 1B64A 3GFXA 3NBPA 2DHAA 1UP1A 1UL3A 3NCQA 3HHEA 1RA6A 5I3PA 1R89A 1LWEB 2KRBA 2NLWA 3LAMA 1E6YB 4LSNB 2I2YA 2V9WA 1NK5A 1O8BA 2FTRA 4FF1A 5DGAA 2V2KA 3KK1B 2HVHA 3IWNC 1P1LA 1YI2S 1V9OA 3KK3A 2HAIA 3OFGA 3V6DB 1TL1A 4XPCA 3MM5B 4YDXA 2FGOA 4A8XA 5DJBA 2QZ8A 1JXLA 1SJ3P 1HBUB 2AJ4A 4ZA1A 2CIMA 1C1CA 2R7QA 4TU7A 1RWUA 1IKVB 2EFOA 2HGNA 1YG0A 3SSSA 1N5SA 2K7KA 2MJNA 1GH8A 1VIXA 2K3IA 4C3LA 5GAGI 3B8HA 2BE2B 1L5UA 1HWLA 2ZHBA 4IFVA 1R0AB 1SJ4P 1TKZA 1NZAA 1N5YA 1KLNA 4DV5F 2DHXA 3MEEB 1U1RA 1RTHA 1N0VC 1GX6A 1HHSA 2X1FA 3AB2B 1SIWB 2LQ5A 5KG3A 4RX6A 1ZH5A 4KKOB 2XMVA 1WI6A 2CFXA 4C98A 2MPUA 3TAQA 1X4AA 3CDUA 1P1TA 2X1BA 4U9RA 1KSPA 2GMJA 4KQZA 1Z4UA 3VAMA 1HA1A 1JX4A 1EP4A 1TKTA 3HZGA 1DRZA 4KGKA 5HQ8A 1B7FA 4JV5F 5D3GB 3RRKA 2ZNZA 1JLFA 2MKIA 4KAIA 4EFAC 2R2UA 2FLPA 1H3DA 3ONQA 5LSRA 4B9UA 4WFYA 4TLRA 4RW8A 3I4PA 3PW5A 3LQVA 2ZOFA 3QAUA 2ZZMA 1MMLA 2M0GB 2DPIA 2V8HA 5LMNF 3FFIB 5A6WA 3WZ0A 2HS3A 4LF4F 2ROGA 1VK3A 1YGYA 1HPZA 5F8GA 4DR3F 1ZAWA 2MXYA 3EGZA 1XEZA 1YJRA 3GE9A 3AJ2A 2DNGA 3R1LA 1SL2A 1TV6B 3MR5A 3T6JA 2OD4A 4CNZA 5JVGQ 3DM2B 7FD1A 3JTPA 2AU0A 4PPDA 2ALZA 4NXMF 1J2VA 2ZE2A 3F56A 2G4BA 3GZ7A 3N9UC 2DB1A 4D3GA 1V3RA 4FXVA 4ZCIA 1FKOA 1R8BA 4DV4F 4GKKF 3TA1A 1S7HA 2N7YA 2CPHA 2OMLA 2A18A 3MMAA 2KXNB 4ZVEA 2FJAB 4J9MA 1H2UX 4HYKA 4B9LA 2VFSA 3UD4P 1Q81T 4NL5A 2IFXA 2CQDA 3OFFA 5DLFA 3I5BA 4RW4A 2MGZA 1WF1A 2HNDB 4NYZA 2VL1A 4R5PB 5B0GA 1X5PA 2X3GA 3M2VB 1U1QA 2MQQA 5HBMA 3T5LA 1K0VA 3OXFA 1W2BR 5T7LA 5DQIA 2GMLA 1VC5A 4KRWA 3CO9A 2GA7A 2Q6BA 1M1KT 2EC0A 3TP2A 2XC9A 1RGVA 5A6PA 4GO7X 3N28A 1G2EA 4NA3A 1LFPA 3L7PA 1NK9A 2KZMA 4DFJA 1S4FA 2POKA 4IQMA 2MQPA 1YJTA 4QIVA 3V4IA 2UU9F 3CB4A 2UP1A 2B5JB 4YHHF 2OFHX 3PKYA 1UEUA 1OO0B 1KS2A 3KYLA 1CQNA 4O44B 3THPA 1WTFA 1VRTA 3V81B 1QUVA 2B3TB 2MHNA 4J9KA 4RNOA 3J7Z5 2N4CA 3T1YF 3SYZA 4ECXA 4QWBA 3K57A 3CD7A 2VBZA 2HHHF 3D0HE 3HPOA 1HMVA 1L3VA 4HT7A 3K59A 2VC0A 1FJ7A 3PNIA 4DSJA 3D1OA 4G6VB 2XMTA 1HW9A 3P5TL 3FQKA 1YITS 2FHJD 3DMJB 4RNNA 3L95X 4BC7A 3E2EA 4ED6A 4JYAF 2VG7B 2VZ9A 3KLEB 4GC7A 1SI9A 3OR1A 4QU7A 4WCEQ 3OXGA 1JB0C 2HS4A 3LP2A 2U2FA 3FQLA 2NPIA 3IAM9 2M3DA 4G1IA 4O3OA 3TI0A 2VB6A 5HN0A 1KD1T 1TL4A 1YSJA 2G13A 3D0IE 2RD5C 3DOKB 3NWGA 1N33F 1SB6A 3ZZUA 3JSMA 4RUAA 4PQUB 4U7UK 2ERRA 4I0WA 3OL9A 3CCUS 1X4FA 3WDOA 5GAHU 5K14B 2DR8A 2DH8A 2XEXA 3Q24A 1EETB 3SDEB 1HNIB 4CTAB 1F0XA 4NRTA 4OI3A 1X0FA 2YWEA 2RF2A 2ZHOA 4KV8B 1BQNA 1N6QB 3KWMA 4NPOA 1VGYA 2ILZA 2K2PA 3RB6A 1IKXA 3MTJA 3ENVA 4G3IA 2XULA 3JYTB 5HROA 4LQ9A 3GQCA 3MD1A 3VWSA 4DUYF 1NK4A 2YQ3A 3NCRA 4NCBA 2AJFE 4DL0C 3BEGB 3KTQA 2LDYA 2FHJA 4CH7A 2UUBF 2CPDA 2FJEB 1HWUA 1PC4A 3CJ3A 3IN5A 4MKYA 2XO7A 2LQBA 1H7WA 3HP6A 1Y00A 2VG5A 5EWGA 3W2VA 2EFGA 3TW0A 1XMOF 2PC6A 4QR2A 4EBDA 4DL4A 4QYZJ 2C3YA 2KJVA 4QOTA 3DLJA 4KFBB 4HHJA 1FKAF 4EZ6A 1IKYB 5KAKA 5F8HA 1HI1A 3PHEA 3K0JA 4OJ3A 1WEYA 3D2WA 1B0PA 2J9CA 2LA4A 5EX0A 1RT7A 2B7CB 1ZZFA 1R43A 3MEGB 4DV7F 4B3OB 1V3SA 3IGVA 1N0UA 2FY1A 3T1HF