3UCZP

The c-di-gmp-i riboswitch bound to gpg
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 small nuclear ribonucleoprotein A
publication title Structural and biochemical characterization of linear dinucleotide analogues bound to the c-di-GMP-I aptamer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/rna
total genus 20
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2011-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3uczP00
1H2TZ 2HYIB 2M8DB 5GMKa 2J0QD 2MPUA 1QM9A 2RS8A 2LECA 4C4WA 1X4HA 3UD3P 3P3DA 5HO4A 1HA1A 1UAWA 1VQ7S 3UCGA 2MQPA 1X4GA 3THPA 1JJHA 2DGWA 5DM7Q 2G4BA 3B4DA 2DNQA 2RRBA 4QQBA 2MZTA 2L08A 2RRAA 3P6YC 2RQCA 2YWKA 3THTA 1JJ2R 4FXVA 1FT8A 1WHWA 2FC9A 2N3OA 3LQVA 2XNRA 2HGLA 4YUDA 1WF2A 4CH0S 2KRBA 3CCVS 3CUNA 1YJWS 1NO8A 4WFNQ 1S72S 2OTJS 1WF1A 3MXHP 1X5TA 2MKKA 1AUDA 1RKJA 4UQTA 2V94A 4A8XA 2MYFA 1K73T 3CCQS 2OIHA 1NJIT 2CPXA 1U6FA 3K0JA 3Q2TC 3VAIA 2YH0A 1U1KA 1ZH5A 1Q82T 1KC8T 1U1LA 2JWNA 1DRZA 3DXBA 3G6ES 1X4EA 2N82B 3TYTA 5IQQA 2MGZA 1SJQA 1WWHA 2CQ4A 3Q2SC 4PKDB 1VQMS 3CCSS 1PO6A 3US5A 2J0SD 4WKRA 2KG1A 1U1PA 3B4MA 3S7RA 2VONA 1X4BA 2DNLA 4J5OA 3G8TA 2B0GA 2ZJQQ 4LMZA 1R8HA 5LJ3Y 3BO2A 4IOCQ 2AYBA 2GHPA 2HZCA 3NNAA 1VC6A 5ITHA 3ZZZA 1YHQS 3PIPQ 2CPZA 4OZ0A 3CCRS 2DGTA 1WF0A 2ZJRQ 2JRSA 1VQ5S 2FC8A 2DNPA 3JB9k 1UFWA 2RVJA 4TU8A 2NZ4A 3RW6A 1SJ3P 3SXLA 3G4SS 3EGNA 1P1TA 2KYXA 2HGNA 2PE8A 2LKZA 3H2UB 3ZZYA 2MKCA 2MZJA 2CPYA 3CC7S 2CQ2A 1PGZA 2LXIA 2M7SA 2F9DA 1KD1T 4TLQA 3NMRA 1M5PC 2DHAA 2MQLA 2N3LA 1WEXA 3SMZA 2E5GA 1M1KT 1S79A 4CQ1A 2N7CA 4YB1P 1HL6A 2MXYA 2LCWA 2LMIA 5LXYA 2GO9A 4EGLA 2CQ0A 2AYEA 1QVGR 2M88A 3MUTP 2DISA 2EVZA 3UWTA 2CQ3A 2U2FA 2E5IA 3CD6S 2AD9A 1N8RT 2PEHA 3J7YU 2DIUA 5DDOC 2CPJA 1WHYA 3VAKA 2RS2A 2RNEA 2ADBA 1FJEB 2MJUA 2MQMA 3LPYA 4LJMA 2RQ4A 4U67Q 2DH8A 1YJNS 2QA4S 3G9CA 1FXLA 4IO9Q 2XNQA 1N52B 4BS2A 5LXRA 5GAHU 3VAMA 3SDEB 1X4FA 3VF0B 2MKSA 3MOJB 3CCUS 2BZ2A 2CQ1A 2JX2A 2KN4A 1A9NB 1G2EA 2YTCA 4TU9A 2LXUA 4PR6A 3IRWP 2DNHA 2MB0B 5FJ4A 3G8SA 1M5VC 1VQNS 3VALA 2A3JA 1OIAA 1UP1A 3EX7B 2QEXS 1KOHA 2LQ5A 3G96A 1X5OA 1YJ9S 3CPWR 1M5KC 2KXFA 2J76E 4WIIA 4TU7A 3EGZA 2KU7A 3BO3A 2DNRA 2XS7A 1VC5A 1BY9A 2L41A 5GVQA 2LA4A 4F25A 2CQPA 4QU6A 2MQNA 1VBZA 5IM0B 1U2FA 2I2YA 3L3CA 4WFBQ 2X1GA 2VODA 2KVIA 3CF5Q 1URNA 1X4CA 3BO4A 2HGMA 3MD1A 1NU4A 1VQOS 2F3JA 2CQBA 2XB2D 2M2BA 3ULHA 1VQ4S 2DO4A 2G0CA 3TP2A 1L3KA 2ADCA 2KHCA 2NLWA 2LYVA 4C0OC 2YKAA 2DH9A 1DZ5A 2X1FA 1YWXA 4Y0FA 4LIRA 4Z2XA 1HD0A 1VC0A 1B7FA 2DHXA 2KRRA 4P6QA 5GAGU 2MQQA 2MZ1A 3DLLQ 1QVFR 5DETA 4ERDA 4C7QA 1JJ4A 4ED5A 1WHVA 1IQTA 1X5PA 2D9OA 3BEGB 5LJ5Y 1A7GE 1OPIA 5LSOA 3HHNB 1N88A 1SJ4P 2AYMA 1WHXA 3MUMP 5EN1A 1H2UX 3IWNC 2DH7A 2OJ3A 1CVJA 3NNHA 2MY7A 2MZRA 5MLCV 1H6KX 4Y00A 1U1QA 1VQLS 5GADU 2ZJPQ 1VBXA 2JVRA 2OSQA 1D9AA 2EK6A 2G1DA 4QPTA 1YTYA 3NS6A 1U1NA 1DHMA 1U1RA 1WEYA 2E44A 3CULA 2X1AA 3OW2R 1M5OC 2MQOA 3MUVP 2I38A 3FEYB 3UCUP 2DNOA 3D2WA 4UY8T 3R1LA 5D77A 1OWXA 2O3DA 4WFAQ 3J7ZT 1U1MA 1Q86T 3UCZP 4OZ1A 5JVGQ 3TO8A 2KI2A 1WI8A 3MDFA 3VAJA 2JVOA 1YIJS 2CPHA 4WCEQ 2DGVA 3CXCR 3S01A 4WF9Q 2M4MA 3VAFA 1RK8A 4IOAQ 1WELA 2OSRA 3CTRA 2MSTA 1WI6A 4CIOA 1K8AT 2XS2A 1X4DA 3CC2S 1Q7YT 1YI2S 1F9FA 1VQ6S 2RU3A 2LEAA 3NS5A 2MSSA 2M70A 2KM8C 3CMAS 4QU7A 3MURP 3G71S 3UE2A 2FY1A 3FEXB 2RT3A 2K3KA 4W92B 5IM0A 2KXHA 2KXNB 3MD3A 3UD4P 1Q81T 2DNGA 2DHGA 2DNKA 1D8ZA 2CPIA 3CMES 1X0FA 1HD1A 4W90B 1ZZNA 4RU2A 1H2VZ 2MKIA 2VOPA 1WEZA 4V19X 3P49B 5HL7Q 2DHSA 2J8AA 5LSLA 1FNXH 2E5HA 2DITA 3CC4S 1XN9A 1X5SA 1N54B 2MJNA 3H2VE 3N9UC 2M0GB 1WG4A 2M9KA 2KFYA 3V4MA 2MKHA 2F9JA 4YOEA 2DGQA 3R27A 2CQGA 2MZSA 2KH9A 2CQCA 1W2BR 2CPEA 2E5JA 2WBRA 3BS9A 4F02A 2Q79A 1JMTA 1YITS 2XSFA 2CPDA 1ZZFA 1U1OA 3I56S 3R1HA 2X1BA 2D9PA 3CCES 2KG0A 5H1SV 4PRFA 1O0PA 1FO1A 2SXLA 1KQSR 1KOOA 2EK1A 1VBYA 2CPFA 2DNYA 4FXWA 2YH1A 5DDPC 1SJRA 2CQHA 1OO0B 2AYGA 1WTBA 1U6BA 3I55S 5DDQC 2M8HA 4IUFA 2XS5A 2ERRA 2QFJA 2MGZB 2MKJA 2DNMA 1R8PA 2RUGA 2MHNA 2U1AA 4F26A 2DGUA 1VQ9S 1UW4A 2DNZA 3HI9A 3RW7A 5DM6Q 2LEBA 3CCJS 1FJCA 2UP1A 5GAEU 1SXLA 2FPHX 2DGOA 2DNNA 4CH1A 2CQIA 5IFMA 3VAGA 2DK2A 2K8GA 3NNCA 2BOPA 2KM8B 2MY8A 2CQDA 1VQPS 1P27B 2DIVA 3VAHA 2DO0A 2KT5A 1VQ8S 5D78A 2MZQA 1SJFA 2D3OR 2VOOA 1M90T 2M52A 2DB1A 1WG5A 2L9WA 3SDEA 3CCMS 2OTLS 2CJKA 5BJRA 1X4AA 3S8SA 5CA5A 1K9MT 1WG1A 4M5DB 3CCLS 4ZKAA 2LA6A 3S6EA 5DDRC 3PIOQ 2MMYA 3U1LA 3U1MA 1FHTA 5JVHQ 1DBDA 5CXTA 1FJ7A 3MI7X 2HVZA 2DGSA 1VQKS 2DGXA 2FHOB 3P5TL 5CYJA
chains in the Genus database with same CATH superfamily
4KB7A 4A8QA 1RWXB 3C19A 1WACA 4G65A 1RYRA 5T14A 2LECA 2UV8G 3ENWA 2UUBJ 4RBVA 1JJHA 3CJ5A 1N32J 1GX6A 5LMUF 3LP1A 3MMCB 1NKCA 4X64J 2HS0A 4B3RJ 4DQIA 2W2NP 2XNRA 2EBGA 1S72S 4RR5A 2CG4A 4IQXA 4ETXA 2ZM6F 2ZKTA 4X66F 2ZUAA 3Q2TC 4QWBA 1WC3A 1ZH5A 1KS2A 4CI0B 4ZVRB 3TYTA 2N82B 1EP4A 3Q2SC 4N41A 3HSZA 1HW8A 3B54A 3QAUA 1SKWA 4I2PA 1RWPB 1VC6A 2MDAA 4M5KA 3NBPA 2XMJA 3CCRS 1UWBB 3SCKE 3D1OA 3Q22A 2OPPB 5F3TA 1N5TA 2XO6A 3LAMA 3ZZYA 3KG4A 1C1BB 2YXLA 1RTJB 3VVTA 2Z56B 4L75A 2DHAA 1VK8A 5LM7E 1WEXA 1GK8A 2FD2A 1S5ZA 3NOCA 3VZIA 1F1BB 1NXIA 2HAIA 4K5SA 2ADBA 2MEWA 2P9GA 4LUBA 2HFVA 2DH8A 1R8AA 4IO9Q 2BE9B 2KJWA 2QLBB 2ZDPA 3VF0B 1WC5A 2MKSA 3VGUA 5B0FA 1XMOF 2RDIA 3MFHA 3NWRA 2CDQA 2P2CB 5IQ6A 2XWYA 2V63A 1U25A 3IP0A 4KIAA 5KAKA 1XNQF 5KFUA 1FRJA 5GMEA 5SZTA 3QRPA 1RAAB 2LQ5A 4PXCA 3R5DA 3EGZA 4A8FA 1GXTA 1RACB 4DX7A 1S6QB 2L41A 1D9DA 4LBHA 4EMDA 2CQPA 1NJZA 1FKAF 2CJYB 4LF5J 4OIXA 3AFGA 4DL2A 1F3FA 3KDOA 2HGMA 3JXOA 3T1HF 2YNHA 2JL9A 1VQ4S 4EBCA 5AE1A 2YNGB 3TP2A 3OSNA 3W7BA 1KHVA 2XMVA 4CLFA 1C4AA 1KHWA 2FLNA 4Y0FA 1T9XA 4Z7YA 1KDNA 4B17A 2KRRA 5C5JA 1SL0A 4ED5A 3MM7A 1GAOA 2BUNA 2I5JA 2VA3A 1N88A 3W66A 1RISA 3W1YC 3NNHA 2EBEA 3QZ8A 2B9YA 1OSDA 2JVRA 1APSA 1RU2A 3GP9A 2HNZA 3MUVP 2Y1JA 5AXNA 3D1QA 2PDAA 3R1LA 5FLXU 4AL6A 2IM0A 1U1MA 5A8KA 3HP6A 2AWZA 4OX8A 4G1QA 3VCDA 1DTQB 3OVAA 3LALA 3D28A 1F9FA 1T9TA 2VQFF 2VG5B 2RU3A 3SCLE 4AQYJ 4CNZA 1RT7A 5DLFA 5HJYA 1E6VA 4W92B 2YWWA 2VQEF 1RQ0A 2IVFB 2C3UA 1IKXA 2IMWP 4PPZA 4ZHRB 2K3IA 1UZHA 1SC3B 2DY1A 5HJXA 1GQEA 2Z57B 1MU2B 3E01B 1F5AA 2FLLA 1T9VA 4DL6A 2DITA 3CC4S 4R8UA 2AZ1A 3IC1A 5E3QA 2VL1A 3H4BA 4LT6A 1RTZA 3MPUB 2MZSA 3JQJA 1ZYQA 4USIA 4WZMA 3JSMB 1GT8A 2RIJA 2GGPB 1U8SA 1VBYA 2YH1A 4JI2F 3UN5A 1YBUA 3GILA 4CLUA 2PA8D 5GAHI 1CC7A 3W8GA 1BQMB 4RW4A 1XNRF 3W9IA 3CCJS 3M2UB 4B9UA 2PC6A 2BOPA 2R2UA 3QFWA 1RA6A 3PW4A 4CYUB 5GMDA 2NYHA 2ACYA 1VQ8S 2R8KA 1AFIA 2D3OR 1OY8A 4USKA 4GKJF 1KVIA 1TKXA 3IAM9 2V69A 3DC2A 3G6YA 3A13A 2JEFA 3OFFA 3D68A 2W24A 4ECSA 2P8IA 4KGMA 1TVRA 2DGXA 1NDLA 2KYZA 1NDKA 2NXUA 3KUGA 2QMWA 4R0JA 3CJ4A 3GIMA 5KG5A 4E0DA 1AA1B 3V81A 1UAWA 3VR1A 2B9WA 2DGWA 1IR0A 2JH3A 2ABYA 3OT9A 3WBZA 2GMJA 4ED0A 3THTA 3MECA 1JJ2R 2FC9A 3ILJA 3AA9A 1YJWS 4FPIA 2IJNA 3HHKA 1JWWA 3BREA 1K0TA 3SSSA 4EEYA 3KK2A 1XWLA 2C2NA 1SJ1A 5BYSA 1R6YA 1N5QA 4ANDA 1CULA 4WP8A 1HBMB 1R8BA 2UUCJ 2GNKA 2UXDJ 2ZBIA 3QLHA 2XMWA 2OAUA 3EVMA 1UEKA 3NXZA 2YKPA 1EAYC 2HHVA 3ZTQA 1N0UA 5C25B 1UFKA 4ANCA 5CHCB 1G7CB 4PYDA 4CRJA 3IR5B 4PQUB 1JLEA 4K8RA 3J7A1 3BJYA 4DCJB 1S1VB 2V9WA 2V0NA 4X4OA 1RWKB 2ZH8A 1JLQB 2MKCA 5EUHA 4M5IA 1S10A 1FWLA 1LWEB 1EQMA 3AJ2A 3M32B 1LKZA 2IPOB 3SMZA 2AGOA 3VTIA 2B7BB 1HL6A 2MXYA 3KHLA 2MLZA 2GO9A 2BMBA 4RKUC 2EVZA 3ILIA 1LWCA 2HFNA 4TNOA 3BR8A 4B3MJ 4CTAA 5L1KA 3PJXA 2G2ZA 1Q5VA 4DPWA 3CDBA 4LR9A 2RNEA 1RLCL 3LPYA 4J9VA 2RQ4A 4A8KA 3QAEA 4DV1F 2W1BA 2W7AA 1B64A 2VJUA 2MQ8A 5GAHU 2R7QA 2ZH6A 3BGRB 1OQ3A 2AX0A 3ISNC 2RQKA 3OXFA 2UXCJ 1P6TA 4PR6A 1XNQJ 5HANA 6FD1A 2LQ8A 5A0YB 3BBFA 5ETMA 2Q3PA 1YJTA 3R5GA 2ZEJA 3BGLA 2J76E 4TU7A 3BH7B 4OYZA 4OZ3A 2NXJA 2XO7A 2CZ4A 3QQCD 3VHQA 1S0MA 1JNZB 3C16A 4CWBA 3P8BB 4FBUA 2A6MA 4M94A 2DO4A 2OLWA 2ADCA 4ZPCA 2YKAA 1GTHA 1DZ5A 3NEKA 1TP7A 2Z30B 5H9EJ 3F44A 2H4YB 1IKWA 2RJZA 1X5PA 4LSNA 4DX6A 3MM8B 4ZIWA 2F8HA 1WHXA 4YY3F 1OJ4A 4DOZA 2DH7A 3I5BA 3ILOA 2DRDA 2D3ZA 3D9BA 2WSFC 1VQLS 3EZOA 1D9AA 3NKYA 3NS6A 1I3OB 2BKOA 1RHMB 1HI1A 4I6AA 2KKHA 3PHTA 4ICLB 4DFPA 2EC2A 3OHBA 4CT9A 3DLKA 1UJ5A 4IR9A 5IT9U 3MDFA 2MLYA 1MSWD 2VQFJ 3R6GB 3TX8A 3WIUA 3LUYA 3GIJA 1VQ6S 2ZDOA 1NK4A 3NS5A 2BQ3A 4ANEA 4F36A 3F0NA 5LL6d 4FYYB 2O01C 4ZITA 2WAQD 1FERA 1RT2B 3RB0A 4LVNP 2RB7A 4Y2MA 1T9YA 3N79A 3A8EA 2CUYA 3KKFA 4MFBA 3AJDA 1RTDA 3LP1B 2ZITA 4WFYA 1YRTA 1NPPA 3KDNA 2F9JA 4ZP6A 4MK7A 4FP9A 1L3SA 4JI4F 3BS9A 4F04B 2XSFA 4F4XA 2D9PA 2KG0A 1KRPA 2Q66A 3KMQA 3DYAB 1QSYA 2JOQA 2VG7A 4RU9A 3EYZA 2CQHA 5HP1A 3AH6A 1RGVA 1Q8BA 5ETVA 4PAAA 1XNRJ 4IUFA 1EP4B 5F8NA 1Q78A 1VQ9S 1KN6A 2W9CB 4CO1A 2VPYB 1R0CB 4I2PB 3H90A 5IFMA 3IBFB 1XK8A 2JFDA 4CNYA 2XEXA 1KONA 3NBPB 3P45B 4GKJJ 4IKAA 4K4VA 4QWDA 4JI1J 3FCVA 2AP6A 1IKVA 1P8GA 2XULA 2WRMA 1HIYA 1RBLA 1PKUA 1TAQA 1R8CA 4DV5F 1MWQA 1AB8A 5K8PA 4ECYA 3PJ9A 4BWJA 5CYJA 1H98A 2HZVA 2FHKA 3SQGB 5IC6B 3WZ0A 4DR7F 1CJVA 1HA1A 4U9RA 3CJKA 2G4BA 2RH3A 4OHWA 4DR5F 1T05B 1A6LA 5AE3A 2RQCA 2OEKA 4RLEA 4DUYF 4CH0S 3FBFA 2OTJS 3DLJA 2C2MB 4DSLA 3K0JA 1HWLA 5L39A 1LXNA 1SUQA 2VU5A 4AD6A 1Q82T 2C2ZB 1LFPA 4NPOA 4DQQA 3NGUA 1GMUA 1X9SA 3AB4B 3LWLA 3E3XA 2KG1A 4DLEA 3UR3C 1Q53A 3TJ8A 1JLGA 2YWHA 1WOPA 5C24A 2O5DA 4ITSA 4NXNF 3PIPQ 2CPZA 1MLAA 2YNHB 2FC8A 4RWXA 1OSCA 1QAIA 4M95A 2GO8A 4JV5F 2IRXA 3ZZ0A 4DV6J 5ETRA 2B9EA 2QLJB 2ILZA 3FBCA 3JS9A 1KWMA 3J81j 3SI8A 2E7VA 2I5JB 1PJ5A 3BPSP 2DR8A 2BW2A 4MMOA 3K89A 2V8DA 1IQZA 2V4JA 3MUTP 3PXGa 1RHQB 1T03B 1W7WA 3UDVA 4O44B 1NNDA 4KE5A 3TVZA 4DV1J 2IBOA 3LW5C 3EM1A 1TFYA 1RI7A 4LJMA 1T7PA 2HNZB 1ZAVA 3BGFA 3OTCA 1Y4ZB 1NDPA 4PG5A 2H1YA 4ZJOA 4ZVGA 3PYFA 3R6LB 3EGVA 1A9NB 1LXJA 2PT0A 4DDFA 3CD0A 4G1QB 2VC1A 3FJ2A 1N5VA 1B4SA 2BM1A 1FE0A 1XJWB 1R0AB 2KXFA 4WIIA 2KU7A 5IV3A 4NA1A 1RT7B 1T0TV 2DCUB 1G3OA 1MMDA 2JEIA 3HKWA 1TL1B 2VODA 1X4CA 2EFPA 3TWZA 5B0CA 4NEZA 5KFJA 1IKXB 3CCWA 2F3JA 2CQBA 2DR7A 2G0CA 2VBXA 2WZ1A 1AUSL 4R8UB 5F9LA 4G6VB 2OMOA 4QZVB 2YY3A 2G13A 3TUPA 5CD4H 3TEGA 2ZH7A 1IBLF 3AXKA 4LQ3A 3CDAA 4QOTA 5J2NA 2GVDA 1K1SA 4F3OA 3NGDA 2J9DA 3A3PB 2JZ5A 3W5YA 3EVOA 2Z0GA 1U1NA 2VV5A 4RW4B 1FVSA 2C2RA 2I38A 4GVBA 2DNOA 4NZ7A 1M5HA 3KNAA 4EYIB 4IOBA 4LF8J 2FJAB 4QJVA 4HVZA 1PC5A 3UCZP 4EUVA 2KI2A 3VAJA 3MPDA 1TKXB 4NLXA 5KG0A 1TFWA 4X62F 3JTNA 4YR3A 1KVKA 1WI6A 4XDCA 3OQ2A 3MR6A 3DI6B 2LVWA 1PILA 2OUGA 2KXHA 3GG1A 2FLOA 2A18A 2DHGA 4HKQA 4OL8A 2UUWA 3HSGA 2F4VF 4ALZA 3NRBA 3V81B 4CO0A 1CS4A 2EG1A 2RAQA 4ILMA 3VQTA 2B7CB 2RF2A 2YQ3A 1FNXH 3MECB 1Y5NB 3ETOA 3IBCB 3IGVA 3MAAA 5EDWA 3H0PA 2DGQA 4N76A 4FKYA 4ED6A 5K8MA 1FCAA 3J7YI 3KK2B 3CCES 1TK0A 2A6OA 4NCGA 4DR2F 1CULB 3T5HA 4F4ZA 1S0VA 5IZHA 3QLHB 1XBWA 3LO3A 4U6PA 4J9SA 2ZHAA 4DV2J 5F8JA 2VFUA 4GC7A 1BGXT 3ZZOA 4KPYA 4O3SA 2CQDA 1JLEB 3SIPB 1FFGB 1FXRA 2BVZA 3G6VA 1RT3A 2LU1A 4HYKA 1RT1A 4ZKAA 3S6EA 3DU6A 1UVIA 1G6BA 3DRRA 1DTTA 2HVHA 1LW0A 3QMQA 4WTYA 1NSQA 2K7JA 2DY9A 1LWCB 4RW9A 3NGTA 1TU0B 2MQPA 1WKJA 1NZ8A 3AOAA 4LFAJ 2AQ4A 1TV6A 2PI4A 4IDKA 3A4TA 4Y34A 4J9RA 4CM2A 4WFNQ 1RKIA 3M6XA 3RBDA 2PA3A 1RA7A 2HLTA 4DR6F 4WWSA 2BANB 1JXLA 4ATNA 1F6TA 3HO1A 1IBCB 1NSKL 3M30A 5IQQA 4CCHA 3KNGA 1S1UA 3S7RA 3M8QA 4TY8B 4NXNJ 1QTMA 2B0GA 1QTNB 2DXDA 3C16B 3IWLA 3BKUA 5IWAF 2D69A 3J7Z5 1UFWA 2XYGB 2RVJA 5HQMA 2POKA 4LFCJ 1WNEA 3CO9A 3H8YA 2HGNA 2BRLA 4U7CA 4NCAA 2IAJA 3OL9A 4RNFA 3TAMA 5EHHA 2APOA 4NLWA 1Z4UA 3AJ1A 4C2MA 3HDSA 2FJBB 4LSNB 4J9LA 4YB1P 3IFEA 5KFGA 2DISA 4YEAA 3UWTA 3HHEA 3CDEA 2V8HA 3DDKA 4MK9A 3J7YU 2C2DA 3K8VA 3HSJA 3BF4A 4ED1A 2A10A 3SDEB 5B0EA 5ETKA 4KC5A 3K17A 3O5TB 2FVQA 1IKYA 2Z4PA 1M1HA 5KFVA 1JLBA 4ZLPA 2KN4A 1IBMF 4Q0BB 4M5JA 5F8MA 4P71A 4P7VA 5DLGA 4A4JA 4AUKA 4I56A 3ICLA 4I0WA 1SH0A 3FCWA 1WC1A 1UTAA 3LP2B 2FY8A 2VIHA 4ZVPB 1R43A 1H73A 5CYQA 5KFDA 2ZE2A 2VB6A 4DV7F 2PD1A 2GAGC 2KVIA 2HIQA 5JXSA 5L1LA 1VISA 1VQOS 4K4YA 1B7YB 4MFBB 1UCNA 1RTDB 8AT1B 1YWXA 4C0HA 1WHVA 5A76A 1IQTA 4J9UE 3R9LA 3HD1A 4FYWB 4UUXA 1UEVA 3OL8A 5I3UA 2EW9A 2GFFA 4A48A 3DKDA 4Y28C 2R4FA 4U96A 2E44A 1TKTA 1HYSA 4AT1B 1VRUA 4XK8C 5D77A 1OWXA 1KBRA 2O3DA 4PUOA 4RW8A 4OZ1A 1FDBA 3N5BA 4O3PA 4WCEQ 3SSQA 5H9EK 3ETMA 1B0PA 2CIMA 4Q45A 1Q7YT 1H38A 1X31C 3DMJA 4DXLA 5BYRA 3GLJA 2R7OA 5IM0A 2KXNB 1IJEB 4F7VA 1CJVB 2ZFHA 4PPDA 4BHQA 1BD6A 5E41A 3CMES 1SC1B 1IN0A 3IA0A 2XY7A 5D4OA 1J27A 3FSXA 1AZSB 3MF5A 1N54B 3C15B 3OFGA 2Y0SD 4UOFA 3MEKA 4WFZA 5ADZA 2AMCB 2RUSA 2X1BA 2SXLA 3IBWA 2EK1A 3HPOA 4LF4F 4EBEA 1RWMB 3GIKA 1O6XA 2H9ZA 3R7SB 2J9EA 3AD8C 2V50A 2CNNB 3OLAA 1KQFB 3GSIA 1JLGB 5C24B 4IQMA 4NXMF 1R27B 3H42A 2PN6A 4BC7A 3DCAA 2Q43A 2V4QA 2ASYA 1B70B 4OI0A 2M52A 1L3TA 4TKTA 3POTA 1WSVA 5F41A 5M2UA 3PRVA 2GA7A 5K8OA 4QIVA 3EZ5A 3CIZA 1S9FA 2L9DA 3OD2A 4G1PA 2XMUA 4DSFA 1U0HA 1ROFA 1URRA 4DSIA 2HBYB 5HN0A 2XG8A 3MPWA 3OHAA 2KJVA 4DV3F 3QGHA 2V4JB 2E5LJ 3P3DA 3THPA 2RHQB 2W8KA 3D66A 2QLXA 4JI0F 4DPXA 2QL5B 4FXVA 3F41A 4MJKA 3DLGB 3HULA 4DR6J 4WBFA 1VQYA 2H5IB 3LP0B 1HPZB 2OIHA 1U6FA 2ASLA 2UZAA 1UWAA 1I5OB 2VPXB 4K0KF 2KZZA 1X4EA 4PKDB 4C3LA 2HW3A 2DKOB 3IN5A 3PX4A 3NCPA 2WVDA 1RLDA 4ZP8A 2AYBA 4IOCQ 4PG7A 4ZPDA 3Q83A 4KHPF 4OZLA 4UY85 2FDNA 3HM9A 4CM0A 2YKNA 4O4GA 1L3UA 2VG6A 4IRDA 3QGIA 5D4NA 2B4OA 1C0TA 1QSLA 5K8NA 1HI0P 3PX6A 4O0IA 1J5EF 4M5DA 1YBAA 4AYBD 2MZJA 1SH2A 4NMXA 3H20A 3QJJA 1HNVA 2IDEA 5KFMA 2AJ1A 3V6DA 4DCOB 4EGLA 1DARA 1I94F 5J2NB 2GVDB 2GV1A 2RHSB 3QJPA 4TQSA 4OFZA 4DMZA 2V4RA 1NJYA 2QA4S 1U45A 1FXLA 2RE1A 4GVBB 3S1TA 3C14A 3GR0A 3DM2A 3OVSA 1N33J 5G0RA 4OV1A 4W4MA 4TU9A 1JQGA 4OYMA 3H7HB 2VBWA 4NYPA 3RAXA 3GJSB 1DQAA 3BN7A 2OPRB 3WQPA 1YJ9S 1NKBA 3CJRA 3TJAA 2IYIA 1HHTP 2IRUA 2AEJA 1VHIA 3DNCA 3DLHA 3L3CA 3Q23A 2V68A 1S49A 4C8OA 3VQSA 2OD4A 2QG9B 1CS4B 3DOMB 2Q6BA 4LFBJ 4TXSA 3U02A 4LSLA 1B99A 3MAAB 4OJHA 3WX4A 4DR3F 3Q8PB 1VC0A 3NMAA 1W26A 4P6QA 3DLLQ 3TZWA 2E9RX 4ENOA 2OO4A 1X7VA 4NMLA 3BPDA 1SJ4P 2AYMA 5D0RA 3OUYA 3MUMP 2IY5B 2MY7A 3THVA 1S6UA 4UUWA 2J7KA 1OMSA 3LAKA 1MMNA 4B9MA 3DDNA 3UCUP 1S0OA 2W25A 4JBCA 1IM4A 2YKMA 3QT8A 4ED3A 3HFKA 4F0KA 3G82B 4WFAQ 3CJTA 2F40A 3TO8A 5JVGQ 1RT3B 5KFLA 3IGNA 2GS8A 1WELA 5A8RA 1HBUA 1RXOB 1V3SA 1K8AT 3OXGA 2LEAA 7FDRA 2KM8C 3DRRB 5HMYA 2HFUA 3MURP 1DTTB 1LW0B 3LANA 2UVVA 2F65A 3M8SA 3UD4P 1KTVA 2KVQE 5A6PA 4QWCA 3DHXA 5HBMB 3FBBA 3T1YF 3CJ0A 1S7HA 4W90B 1H2VZ 4V19X 2CYYA 1TV6B 5KT3A 2B51A 3Q0AA 5J2PA 1E6YB 3VGTA 4ZVOB 5D0HA 4YOEA 5D3GB 4YB5A 3A12A 1JMTA 1YITS 4LF4J 2LU2A 2ZWPA 5KFWA 1FO1A 1S6OA 2B5JA 2DNYA 4QWAA 1JLAA 2BE7D 3DRSB 1U6BA 4AXJA 1EB0A 3B78A 1CEZA 2KDOA 3M30B 1R8PA 2RUGA 2Y8WA 4QYZJ 4RUCA 3X1LB 1RT6A 2LEBA 2DNZA 2BQUA 2FTRA 3VWSA 3ZTOA 4CH1A 2CQIA 4QIEA 2P9EA 3W8PA 1T11A 2K1RA 3PO5A 1TK8A 1K9MT 4ZLLA 3H5XA 3PIOQ 3TAMB 3K2YA 1FDNA 1NMEB 1N0VC 3KK1A 2IFXA 1RTIB 1GXLA 4DV3J 4KO0A 4ED8A 1AXQA 2M8DB 2HHUA 4C98A 5DM7Q 2RRAA 3MMJA 4DUZJ 4KGZB 2PGCA 3CDWA 5KFTA 1NO8A 4ZPAA 3TARA 4C8NA 3CIMA 5CZXA 2MKKA 2H5JB 2MYFA 4QBUA 1FK9B 2NYIA 1FKPA 2JWNA 2R7XA 4OI1A 2O67A 3I0RA 3IR7B 1YJ7A 1HNZF 3I82A 3ZZTA 4F50A 5CYQB 4KHPJ 2H5EA 2ZE2B 1RAEB 4LMZA 2FZKB 3FK4A 4G1IA 2HZCA 3MPVA 2ZVIA 3KLVA 2KFNA 2Z2YB 1WOSA 3CD7A 4WP3A 2NZ4A 1NSPA 2HBQB 1MN7A 3TVYA 3EGNA 1M5SA 9ATCB 2BW7A 2MLXA 2IJRA 5FD1A 2CQ2A 5D4LA 2F9DA 4TLQA 3A3NB 3I32A 3U1NA 1XEZA 4JI3F 4ECWA 2FB0A 2N7CA 4YR2A 3IG1A 1L3VA 3FBEA 5EGYA 2XGPA 3M2RA 2OPQA 1LOUA 3R5AA 1C2PA 1XTZA 2Y0BB 2UXBJ 2C2EA 2XNQA 2D7SA 3GJRB 3TNVA 3QRQA 1VRUB 3O8WA 3GG0A 2NSCA 5A8WA 4PUOB 5FJ4A 2M3DA 2Q1LA 1CJTA 3DMJB 2J6UA 2B4UA 1YJRA 4NLUA 5IM0B 5KOWA 2LXFA 1PJ6A 1XQIA 4F2RA 5DGBA 2XB2D 5KG6A 2XYPB 2NXNA 2YNIA 2XTJP 2HNYB 4M5MA 4JI7F 3N6NA 4DV0F 3RAMA 4UOGA 1XMQJ 1PYSB 4P72A 3BQ0A 1TL5A 5KFRA 3OR1A 1ITPA 1TKZA 3TX0A 3GV8B 1RAHB 1YX2A 4PWWA 4HL9A 1H2UX 1CVJA 1D1UA 2WB4A 3QT5A 5GADU 1VBXA 1VGYA 2IBKA 3W9HA 3TAPA 1DHMA 4FYDA 4U7UD 2XMAA 4LF6J 5AJ3J 6AT1B 2BDPA 3AHPA 1X9WA 2DR9A 1TUVA 2XI3A 4NWBA 3O6QA 2ZWOA 3J7ZT 5JMNA 4TVAB 4P73A 2ALZA 3CJ3A 4B3TJ 3POTB 2KT2A 4DR4F 3TRGA 4Q44A 3FFIA 3E51A 3KLFA 4OYWA 3OTOJ 1U0HB 1MN9A 3O2IA 4LF1A 3MD3A 2UUBF 2AU0A 4L73A 1N32F 3QWPA 2DEJA 4X64F 3BGUA 4B3RF 1OS5A 3GR1A 3EDRB 2JFKA 2X3DA 3OL7A 3MR5A 2CQCA 2CPEA 2Q79A 1YZ6A 1JJCB 3SQOP 1IXKA 3D6MB 3I4PA 3KLHA 3MZIA 2HHHJ 1SL1A 3R2CJ 3UN3A 4DQRA 4K59A 3UDEA 2LEPA 3IM9A 2OP5A 3SYZA 4EYHB 3VVUA 3MM6A 4EFAC 2OI2A 3T9ZA 1IJFB 4UOHA 2V2ZA 1YK9A 2GJ2A 1F2GA 4O4GB 2ZH9A 2VG6B 1REVA 3CCMS 1VJQA 1C0TB 1EKRA 3S8SA 2GQCA 4NYOA 1JXEA 4M5DB 1CC8A 3D7SB 4HACA 2W2OP 2E7XA 3TVKA 1DBDA 3N6MA 2HYIB 3V6DB 4ECQA 1Q8IA 1HFEL 4AE5A 2MPUA 2V2QA 4OJ3A 1IUJA 1GEHA 1T9UA 2QSWA 1X4GA 1RUSA 4KHMA 3AD7C 2ROGA 3HZGA 2HHWA 1IVZA 2N3OA 1QD1A 1HI8A 2P6TA 2Q6CA 4LRCA 2JSXA 1H3DA 3DM2B 5G0RB 4ELTA 4UQTA 5HLFA 2DRAA 2CVEA 1VLYA 2YKOA 2YH0A 4M8LA 1BQXA 2BJ3A 3NLCA 2BXJA 3D0IE 3J81Y 3DXBA 4CDIA 1FA0A 2VA2A 1YKWA 4LF5F 4ELVA 3FEZA 4YB7A 3CMQA 4NL5A 3JQMA 1K47A 3DU5A 2GHPA 8ATCB 2J9DE 4FPRA 2COLA 1V6HA 4C8YA 2ZJRQ 3TA1A 2VASA 3PFOA 2B3TB 1GH8A 4DG1A 2HQFA 3N4WA 4D3GA 2XLIA 3FNNA 2CFXA 4LSLB 3KJFB 1PGZA 2M7SA 4WE1A 1EARA 3BYPA 4I6YA 2E5GA 3M8PB 1I51B 2LMIA 3M8YA 4IG0A 1UPMB 2YWFA 4MH8A 4KJIA 1RZMA 4ZMMA 2EC0A 3BSAA 1X8DA 1A0OB 2C42A 1FJEB 1EX8A 1FEEA 4X65J 3NOGA 1YJNS 1S99A 3PDNA 4RNOA 1HW9A 4RNNA 1ZM2A 3G8SA 1VHFA 1M5VC 3VALA 1MROA 5GAEI 3ILLA 5E0OA 5DZ6A 5A8RB 1T3OA 1HBUB 3G96A 1X5OA 5KG3A 1JX4A 4HLBA 2KO1A 1CPZA 3Q8UA 5D4PA 4ZN3A 5GVQA 5DS7A 1H7WA 1S9GA 2AGPA 3FDSA 4USHA 3CF5Q 2X51A 4HH1A 4ZVQB 3TW0A 5U47A 3MM9A 3T19A 1R6VA 4L6V3 3CWJA 2R7SA 2H3EB 2DH9A 3ZNUA 3D54A 4FKXA 4PYAA 5L38A 1VIOA 2DHXA 4XTTA 4X4UA 2QA1A 1GMWA 4NLDA 1A7GE 2HHPA 2BE2A 1ZA1B 2B5JB 3OJSA 1W25A 4NLGA 2GIQA 2WK4A 4GRSA 2O1PA 4L74A 2AF6A 1RT6B 4B3SJ 1WJ9A 3UR0A 5J1EA 4ILRA 1M5OC 2IMOA 2L48A 4X4RA 4UY8T 3PTWA 2W4PA 4URSA 1YRXA 4FF2A 1WI8A 2K1RB 3GWCA 2B6AB 3R5JB 2FGCA 1QSSA 5CQGA 1X0PA 2UVRA 4JYAJ 2GIRA 3KK1B 3DOLA 3HHLC 3ADAC 3FSYA 3BSCA 4ZJQA 4KO0B 4ZLNA 2IC3B 3GV5B 2AX1A 2CPIA 4LRDA 3JQKA 3Q89A 5DQIA 2QX0A 2VOPA 5J2QA 3KOAA 2AJ2A 3KYLA 4TQRA 2NZCA 3N9UC 4LR8A 3QJLA 4N8OA 1LQ9A 5HVFA 5B09A 2WBRA 3MCMA 4PXDA 7AT1B 5DRKA 1S97A 2AJ0A 1L5UA 4C3KA 2FHJA 1MWZA 2UUCF 2CPFA 1CQMA 4NE9C 2UXDF 4P7TA 5KFFA 2XWXA 4M1KA 3KJQB 3KUHA 5IXUA 4AL7A 1MW7A 2DCLA 4CO2A 2W01A 4ED4A 2BJEA 1SKUB 5GAEU 4FVMA 2QLFB 3VAHA 2WW8A 4MKYA 2Z2LA 3DLBA 2OTLS 1SL2A 4P2MA 5CA5A 3KXDA 4BDPA 1FRMA 2JEJA 1UZDA 5G4DA 1KLMB 1VQKS 4LF7F 3NAHA 1PBAA 4KV8B 4B3MF 4RPFA 2PMZD 2RS8A 1I6JA 4C8ZA 3A8JA 2OPQB 2IDLA 2AZ3A 2RU9A 1NJWA 2RRBA 4Y6IA 3EMTA 4NLYA 2YWKA 2WW4A 1T94A 2UXCF 3CCVS 4I2QA 2OFHX 2VFRA 2HLUA 5A8WB 4FS1A 1S6PA 4Q5VA 1NJIT 4Y2AA 4TY9A 4YDXA 2CNKB 3M1VA 1CJTB 2CQ4A 4KH1B 3UDLA 4QIFA 3CCSS 3ZFVA 2ZZNA 2J0SD 3M6VA 2VKZG 2VONA 2QFIA 4L3KA 2V2KA 4IRKA 4CLKA 4MIBA 2OFGX 4TU8A 4NZ0A 5DQHA 3AXMA 1GFWB 5CYMA 4MKBA 4U8YA 3HFVA 1R3NA 4J91A 2JLGA 3H2UB 2N7YA 2QL7B 3OR1B 2NR0A 5B7WA 2EFNA 4WK1A 5C42A 3L7OA 5IV4A 4HEA9 3PHEA 4TYBA 1FTCA 2PEHA 1QLNA 2CPJA 1HNIA 2ROPA 4I69A 4L3NA 3HXMA 1FDAA 4BS2A 5LXRA 2W8LA 3IAS9 2CZ9A 3AODA 3KJNB 4N5SA 3EUNA 3R3TA 4H4KC 4O0NA 4LRAA 4L72B 5JUMA 1G2EA 1SC6A 4OI4A 5AE2A 3OR2A 5AXLA 4DV4J 2J6SA 3FFIB 4B3OA 1RHUB 1VC5A 2JDJA 3BM7A 4J37A 1FD2A 3QT6A 2R9LA 4DBQA 2EI5A 2AGQA 1RABB 3SBMA 2HVIA 5F0UA 1H72C 1SVDA 2HMIA 3I5CA 2HS4A 2H48B 2CJ9A 2HWHA 3Q8SB 2QYCA 1OYEA 4NLSA 1JB0C 2GHVC 5L1JA 5LT5A 2ZBRA 2DJWA 2Y1IA 3L95X 3W64A 2N4DA 2V9KA 4ERDA 1WDDA 3KWMA 4C8MA 3I96A 2HZAA 1LEOA 4A47A 2AV5A 3OV7A 3IWNC 2OJ3A 5MLCV 1NH7A 4K2XA 2BBEA 2ZJPQ 3K59A 1KNZA 1S7IA 4FXDA 5B08A 1PIEA 3MM6B 2MQOA 2UUTA 4PG8A 3P4UB 4JI1F 3PRBA 3IR6B 4GKKJ 1FE4A 2WOMA 4J9OA 2DGVA 3CXCR 3L7PA 4O3QA 3MPYA 3CO0P 2PMWA 4TLRA 4IFYA 4CIOA 3PVXA 4R5PA 4HACB 3T6JA 1F0XA 5DG7A 1RTHB 2MSSA 4QW8A 2I6WA 1Q7LB 3FEXB 5HK4A 1SI9A 2HHXA 4XDDA 2DNKA 1RCXB 2NXEA 3NL0A 1FRKA 2W7OA 1NHKL 3MM5A 2B4PA 3LPEA 2CNOB 5LSLA 5CAAA 2MJNA 1UWBA 3RBEA 2OPPA 3L9ZA 5IT4A 4NYZA 2F8MA 2BA9A 5I42A 1UMJA 2IRYA 3DGVA 4FF3A 4LVOP 3WX8A 1SJRA 4HI1A 2QV6A 3DGPA 5ETTA 1WOOA 5HAOA 5E3RA 2ERRA 2QFJA 2QYGA 1DURA 2XGQA 1GNKA 2R2TA 4QR2A 3T3FA 1V5VA 4R0EA 1SXLA 4UTGA 3M2VA 4PCQA 4DV6F 3QIDA 1WG5A 2EG2A 4DG1B 3G87A 2CJKA 4QWEA 1TKDA 4P52A 2WVBA 3U1LA 2B56A 4LF7J 4DPYA 5CXTA 1FF2A 2FHOB 1NKEA 2VFTA 1H2TZ 1R31A 3EZUA 4IG0B 3KJVB 1X4HA 5CCMA 5HO4A 4HI2A 5A2QY 1I1GA 4ZOSA 3GJTB 1JLFA 3W2WA 3PR4A 2WVFA 3KHRA 2YNGA 1FRHA 1GMWD 4MTPA 1RYSA 1KP6A 4LF9J 4ZN1A 1K73T 3KLIA 1ACMB 5ETSA 3TQ1A 3VAIA 1U1KA 2IVYA 1MROB 4X4SA 3OTEA 1J5OA 4HR2A 4BWMA 2J5AA 5FDLA 2H4WB 5KG4A 1EETA 2MGZA 2LDIA 3N01A 1U1PA 1KKHA 2G2YA 2ZJQQ 1NK8A 1C1CA 3DFEA 1BQNB 4DX5A 2HRYA 3PZPA 2RKIA 3V4IA 3OBIA 1BLUA 1V3RA 2XYHB 3PYGA 5J1PA 2F4FA 1U2RA 1KD1T 3UNYA 3QIPA 2CJQA 2NPIA 1S79A 5LXYA 1JXVA 2BE2B 4K50A 3ONQA 1WORA 2CQ3A 1BXNA 1TL3A 3UI3A 1EIYB 3NWGA 3H2LA 3VAKA 2MQMA 1HMVA 5J1EB 3G9CA 1GMVA 4F4YA 3K5NA 4LF8F 2XSJA 3W60A 2B8QA 3R5CA 2KZMA 3M05A 3CCUS 7FD1A 1FNMA 2FHJD 1RE1B 2MB0B 1QJHA 5LOQA 2PI5A 4WKYA 4OX7A 3VGSA 2A3JA 2CJBA 2BKPA 2IJFA 2GGPA 3C2PA 4P2XA 1VI7A 3CCTA 3T5JA 3GYNA 4F25A 5E2QA 2MQNA 2H54B 4OHYA 3BO4A 1G1XA 4IFVA 1N36J 1HQEA 3ULHA 3FC9A 1IR2A 5J2MA 1WKLA 3M2UA 2D74B 5J2QB 3RB3A 1UETA 4CYUA 4ZVUB 4DX8H 4DSJA 2C3MA 5L1IA 2MZ1A 2EXUA 4WXOA 1OPIA 5LSOA 5F8IA 5EN1A 4NEYA 1XERA 1YLXA 3M8WA 1PSDA 2HAFA 2DVIA 1FJGF 2OSQA 4DV2F 5F9NA 5KT5A 1MNEA 2G9OA 2AIRB 2W9AA 2AEFA 4OYXA 5HVHA 1RJJA 5DO2A 3ENVA 3EDQB 4UT4A 1D8YA 2C22A 2FLPA 1H74A 1TMJA 3ZC4A 1RCOB 2ACMA 5T41A 5KFOA 4I4BA 2F63A 4USMA 2M4MA 4IOAQ 1FXDA 4IH6A 2OSRA 2D3UA 2YX1A 3CMAS 3T6BA 4QW9A 4CT8A 2Z2MA 4QR1A 2EFVA 1Q81T 3Q8QB 3K5OA 3BKFA 4LFAF 4X4QA 1FNOA 3SSRA 1DY3A 5C25A 4RU2A 1Y9OA 1WEZA 3P49B 3LH2S 2J8AA 3KG0A 4CLWA 4ZPWR 2ZH2A 3KK3A 4I2QB 3CNQP 3F56A 4K4XA 1BHNA 3OSPA 1U1OA 3R1HA 1S6PB 2UVWA 4ES3A 2R42A 4X4PA 4YHHJ 2Y3YA 1XR5A 4KY3A 3T41A 2ILYA 1P1LA 2MHNA 2ASDA 2GZOA 3TEHB 1UW4A 5DM6Q 1F5CA 2ZH3A 1RWOB 1OQ6A 1RWWB 5RUBA 1YG0A 2A1BA 4GO5X 4F4WA 4OX9J 1SC4B 4LFCF 1IWGA 1SJFA 3TZYA 1YRUA 2XHCA 3JSYA 3BGRA 3MM7B 5CYMB 2ALYB 4Q2MA 3IS9A 1UJ4A 2MMYA 4YB6A 1CG2A 4DWIA 4C3MA 3MR3A 2HVZA 1VRTA 2KT3A 1QUVA 3MCSA 1CQNA 4HHHA 5C42B 3C8YA 4O3NA 1XR6A 4NA3A 2PSZA 2R7UA 1S59A 2XHWA 1SB6A 3UCGA 2BABA 2A2DA 2MKYA 4MIAA 1HNIB 1XIQA 4HTIA 3P96A 4QQBA 4F8RA 4NLRA 5A8KB 1FD8A 1ZETA 2BQRA 1WHWA 5E7OB 1WF2A 3GSDA 1Y7PA 5KFSA 4Q43A 3D4JA 3BBCA 1HBOA 1X5TA 2HG4A 2R8JA 1UVKA 2QRRA 3RTVA 2E1MC 4IRCA 3Q86A 3OR2B 1D09B 3GYXB 3W63A 1NK9A 3QGPA 1D3WA 4F4KA 3BV8A 1E6VB 1N34F 2LP4A 1KC8T 2L3MA 2WVEA 4JP8A 1D0EA 2I1RA 5ETNA 2DYAA 1SJQA 3EPIA 1VQMS 2DBBA 3ET6A 4U95A 4C6AA 4ID5A 1U48A 1ZBTA 2N4CA 1J2VA 1BWVA 1TZ0A 4OZ0A 4DS4A 2WBMA 4ES2A 4IR1A 2QE5A 2HMIB 1N4LA 3OXLA 1RHKB 3K8WA 4KT0C 2ZH1A 4YDDB 1C4CA 4JI5F 3M8RA 2HRTA 3W62A 2ZOFA 2CZVC 1MMLA 1Y10A 3T5KA 4NCBA 5H9FJ 1X60A 1QVGR 3QSIA 2UU9J 3LGHA 4DU7A 4ES1A 2KB2A 3MEDA 2NS1B 2Z2ZA 3KLGA 4UW2A 3VAMA 1RT2A 1X4FA 4KBIA 4OHXA 3ZTPA 1YQHA 2BZ2A 1ZS6A 3QO9A 3LF0A 3EPGA 2F1FA 3GE9A 3ISND 2IA0A 1TVRB 2WOMB 1R7IA 1IR1A 3UDCA 5KFKA 3PNIA 3GB0A 4IFYB 4R5PB 3DYAA 4WP9A 3P5BP 3MMAA 1RU1A 1VBZA 5K20B 4ED2A 4WFBQ 2X1GA 4P2SA 4QIGA 5F8HA 2XMKA 2CNLB 3C6UA 2UUAJ 2EWHA 3MM5B 2DPJA 2W9CA 4J9QA 3PX0A 2M2BA 4PQAA 1EKSA 2ZZTA 1YJVA 3T9NA 2DXFA 3J80Y 2CJXB 3BGOP 2R8HA 2YQ0A 4RO0A 2CKWA 3GJQB 4CLPA 5B0AA 5I42B 4DLGA 3NY0A 3PEJA 1BWEA 2HBZB 3CD5A 4ZPTR 4FF4A 1FJGJ 9RUBA 3DGPB 2YBVA 3L09A 3Q8RB 4BCAA 3SQGA 5KFCA 1Q16B 3M2VB 3OTBA 3D1HA 3IXQA 3HVRA 3PRDA 1S9EA 3D2WA 1KVJA 3R8YA 3MEGA 1T05A 1FWPA 4ETZA 1FX4A 3BR9A 3M7VA 3TA2A 3TI0A 2QGFB 4FS2A 1YIJS 1IBKF 3GIRA 4B9LA 2OH2A 3N0VA 1QAJA 1HQUA 1T02A 1X4DA 1ZTTA 2HS3A 4RUBA 1K0VA 4CTAB 5A6WA 2QZ8A 2E5LF 3BDEA 3TANA 4PZVA 2GC8A 3DRPA 3D6HB 1S1XA 1D8ZA 2XC9A 1S0NA 1AROP 2V2VA 1Y0HA 2ZBQA 2B4VA 2IYGA 4NX9A 1JLFB 4AFFA 3W2WB 2IM3A 1ZM3A 4H4MA 1S1WA 2OPSA 3J81U 2MKHA 1VOMA 2YWGA 1XC9A 4RNMA 2KH9A 2E9TA 4IYQA 3KLIB 4GMKA 2BJ7A 4MYUA 1FDDA 4DEZA 1KSPA 2K7KA 4F0MA 4XPEA 5ETQA 4NLTA 3QRRA 5D6GA 1J5OB 4WYWA 3Q8VA 3I55S 5FDLB 4DL5A 1EETB 2MGZB 1X9MA 2DNMA 2KL8A 2WONA 5B0BA 3N6LA 2DNNA 1T03A 4IO1A 4O44A 2FJEB 1UPPA 1C1CB 1HNXJ 2RKIB 2R8IA 3V4IB 3FGVA 2HURA 2ZUGA 2DB1A 1IKWB 1X4AA 1FTRA 5DDRC 3GZ7A 3WC2A 1FHTA 4OMFG 4K4TA 2QLWA 1NSAA 2FVRA 2GJFA 3QIPB 4QCLA 2VH7A 5KG2A 1UFLA 2RILA 3MAQA 1M0SA 2W2PP 1IWAA 1R0AA 3BSOA 3M6UA 1EZZB 2GAHC 1FFWB 1LW2A 1Y00A 2C3OA 5KFIA 1VQ7S 1TL3B 1JKHA 1ZAWA 5LMNJ 2HHTA 1TL1A 1HMVB 3DLKB 1GXUA 1N33F 2L9NA 4BBYA 2XSJB 3CGIA 2KRBA 1QE1A 4J9PA 3NCRA 3DN9A 4JV2A 1RKJA 1T95A 1WUUA 3EJMA 2QO3A 1N34J 4IH5A 3M9OB 4ECTA 1V3ZA 3JAMY 3ZTSA 1WKKA 3FMWA 5E33A 1AW0A 1WWHA 5E5NA 4FZVA 2HQDA 3US5A 2DD8S 3SV3A 3GPAA 3BB5A 2DNLA 5AT1B 4JI6J 2VBYA 3LGNA 4IFVB 4H54A 4LFBF 1HQEB 5DGAA 5J2MB 1HHSA 4JI5J 3GU0A 4A8OA 4DL4A 1P1TA 1KFDA 3KUEA 4HT7A 2VG7B 4ILLA 1SKRA 5HP1B 5M2PA 2FUG9 1Z1ZA 2HKEA 1ZM9A 4M5NA 3DI6A 2U2FA 4DN0A 3HK2A 2DIUA 2ZOMA 1CJUA 4WZQA 5I3PA 4CZCA 1N52B 1F60B 5LMUJ 1IKVB 1GX5A 4URQU 1T8EA 3LTOA 3MOJB 5CZVA 5KOXA 3E8OA 2R2SA 4NZ6A 1FFSB 2GW8A 2LXUA 4WIQA 2QMXA 2ZM6J 1OIAA 4X66J 1SV5A 4I7FA 5L46A 5KFBA 2Y1RI 1DLOA 3TZZA 1AT1B 4PXEA 2ZNZA 3CJKB 4Y65A 1Q95G 4Q7AA 2RMLA 1NU4A 3EE3A 4TYAA 5AXMA 2XI2A 3DLEA 1U2CA 3GYGA 3D0HE 2NLWA 3WHIA 1SQFA 3KFWX 3DXSX 4DPUA 4FF1A 3KK3B 2CWKA 2HK2A 3MWBA 1N5SA 1LWFA 1SUQB 2LFVA 4NRUA 1ZAXA 2VFSA 2D9OA 3BEGB 5HMXA 2Z58B 2KHDA 2EKYA 2ZVSA 2W4CA 1RBOB 2HPUA 3RG6A 2W9BA 5EX3A 3KTQA 1NHUA 2HVDA 2M5YA 2B43A 2EK6A 3JSRA 2AEMA 2FHMA 3CULA 3MTKA 4NA2A 3OW2R 5D0EA 3GFYA 5I4MA 2ZNYA 5M2RA 2YX7A 4ZK7M 1DAXA 4DSKA 3W65A 4EZ9A 1IBKJ 4TN2A 4HHJA 1S1TA 6FDRA 1XMOJ 3U7JA 4ZVTB 2R8GA 5L9NA 1KQGB 3GTYX 2YNFA 3EVWA 3CTRA 3IS9B 1ICEB 1YGYA 4FN5A 4CH7A 2HRUA 5HI7A 3K57A 2M70A 3L7UA 2BANA 1VRTB 3E2EA 4BLGA 4WTOB 4NLPA 1W2IA 4U7UK 1S4FA 5KFZA 1S57A 4OYOA 4TY8A 3T1HJ 3V6KA 2CG8A 3HZEA 4DUZF 3DOKA 3H2VE 1O51A 4DL3A 1DFDA 5F8GA 3FZ2A 1HBOB 1ZZFA 4C11A 2NREA 2C1EB 1MG7A 4PRFA 3GONA 3WIVA 1KOOA 3QZ7A 3IRXA 3HSDA 3A3OB 4DZ6A 2FJWA 2J6TA 1S76D 3A1YG 1R0BG 2MKJA 4RW7A 3ET6B 3ZZPA 1UW9A 4ID5B 2DGUA 3CJQA 4C8KA 1O8BA 1SIWB 4LBIA 1KTQA 4DJBA 4PEOA 5D78A 1Y3JA 2IM1A 1UJ6A 3SDEA 3ELHA 3D67A 1WG1A 4YQWA 2DXEA 3C3LA 4Q2LA 4Q0BA 4DF8A 1FJ7A 3GCXP 3PW5A 4DF4A 4OI3A 1Q8KA 4RW6A 3LP2A 4C4WA 2ZHBA 2VQEJ 1VFJA 4A46A 3U27A 2RDJA 2UXBF 5GAGI 3MEDB 2BYCA 2GCFA 3KLGB 2XZDB 1FT8A 3LQVA 4NLQA 1PJ7A 4ZIVA 3MXHP 2BJ8A 3QO9B 2BEFA 4N77A 3MAHA 2XM3A 1UA0A 3QPIA 3G6ES 4JI2J 4Z37A 4A8SA 1B3TA 4JV1A 2X3GA 1YSJA 3EXYA 3MMAB 4WKRA 4DFJA 3PO4A 4YR0A 2E29A 2RF2B 3PR5B 3SCIE 3ZZZA 3C6UB 2G2OA 1VQ5S 3JB9k 5THWA 3H25A 2R7RA 3NP5A 1SJ3P 1XMQF 2HFZA 3SEOA 5HQ8A 1WTFA 2LKZA 5F0WA 3CEDA 1RT4A 4NCGB 3GFXA 2AT1B 3OFEA 5KFYA 1NCLA 3Q24A 3W3SA 4IH7A 4CQ1A 1U0SA 4KGVB 4DHVA 3I4HX 3PV8A 5JJBA 1PG5B 2HSEB 1PBUA 1JLCA 2ZH4A 4J90A 2HIYA 2AD9A 4LF6F 4QYRA 5AJ3F 2B9XA 4RNHA 2HFSA 4USTA 4DL0C 3PACA 1S9EB 2HFOA 1AZSA 1RT1B 3X3UA 3MEGB 2JX2A 4B3TF 2XY5A 1FVQA 3IRWP 1JK9B 3C15A 1VDHA 2WSCC 3CJ8A 1UP1A 4IG3A 4HDGA 3OTOF 1HQUB 5F8LA 1M5KC 1Y5IB 5KFXA 1HR0F 1FI4A 2GVZA 2J0WA 4RW9B 1PYOB 5H9FK 1U02A 3ZNJ1 3DRPB 3W2VA 1S1XB 2ZBCA 4IDKB 4CO4A 2BRKA 1VK3A 3A8KA 3QGGA 2E7WA 2KHCA 3UD5A 1NK5A 4O3RA 3R7NB 4FVCA 4H4MB 1S1WB 2OPSB 4NOHA 4PWDA 3B82A 1U26A 1NPRA 5GAGU 2HHHF 1NPKA 4KH0B 3HHNB 2J7WA 4H4OA 2VD3A 5HSPA 1S1UB 3M8QB 5D15A 1OPZA 4RL1A 4K5RA 4DZDA 4OJ1A 5K14A 2WVCA 1S4EA 1VYAA 1AFJA 2LQJA 4WU3A 2WONB 5EWFA 3HX9A 2X1AA 3ITHA 3RU0A 2BKNA 1H0HB 2X7IA 1KQKA 2E1CA 3QATA 4FYXB 2VUGA 3DRXA 4NLOA 1Q86T 2IAJB 1QDUB 2JVOA 1PYTA 2IIHA 4LRBA 3KLEA 2ZKUA 1VMBA 3R2DJ 3DLGA 4WK3A 3LP0A 1HPZA 5A2QU 4HH0A 1LFWA 2FY1A 2RT3A 2K3KA 5KFHA 2D41A 2V34A 2FJXA 2DNGA 1LW2B 3TUZC 1JKHB 3F73A 1LK7A 1IKYB 4JV0A 3PW7A 1LWXA 3M4XA 4OQJA 1JLBB 2VDIA 3TQEA 5GADI 1X5SA 1NAQA 4EU0A 2LQBA 3C6TA 1QE1B 4PABA 2AKWB 3KMSA 2PFDA 5HMZA 3MR2A 3I56S 1KEKA 3CJ2A 2NCKL 1TTHB 2HWIA 2EEYA 4RWWA 4YY3J 2DEIA 4A8YA 3EGWB 1NJXA 5J1NA 4DQSA 3UN2A 1FESA 3FSIA 2DGOA 4RX6A 2YWEA 3VAGA 2DK2A 2VPWB 3HMJG 3RR8A 2MY8A 5K5MA 2DO0A 4DFKA 1TQLA 4UF4A 3VZHA 5ETOA 3AAWB 5IS2A 4OZ5A 5KT7A 2VPZB 5KG1A 2BM0A 3MI7X 2KFZA 1NDCA 2DGSA 3DHWC 5I3UB 2OPRA 3V6HA 3UO0A 5HMWA 3I31A 1TKTB 4P75A 1S77D 5D0GA 5HROA 4X65F 1HYSB 3KHGA 1Z2ZA 1CJUB 5B0GA 2JLEA 3LA0A 3B4DA 2L08A 2IM2A 4RW8B 3MTJA 2HK3A 3NS7B 1SIZA 3DOMA 5DG9A 2XY6A 1AUDA 4KPCA 4P74A 3CDUA 2QL9B 3CCQS 4JI4J 2QTWA 3MMBA 4Z7CA 3LWMA 1ZTWA 1SV5B 4I7FB 3NAIA 2QMUB 3PJWA 1DLOB 4I6WA 3FUYA 2XCPA 3G8TA 2EFOA 5LJ3Y 4G3IA 2E1AA 4BC9A 2ASJA 2VZ9A 3G6XA 4EBDA 2JRSA 3SZ2A 3HVAA 2VC0A 2DNPA 3DLEB 3W61A 1R89A 2XZTB 3R7BB 3SXLA 3I5AA 3G82A 2QIFA 4LIWA 3OFHA 1IM6A 1LWFB 3DDIA 1VCTA 3NMRA 4DV5J 1M1KT 2YPZA 2XQCA 4KRWA 3RZAA 2CQ0A 4GC6A 3FZBA 2W9BB 2E5IA 3MHYA 4DR7J 2C2OB 4B3SF 1HKAA 3GQCA 3FKBA 4U67Q 2CAJA 4OHVA 2Y1LB 5HBMA 1ULRA 3BN4A 2EPIA 2JJ4D 4DR5J 1P9YA 4JB8B 4DUYJ 4OLOA 1S1TB 1E6YA 1VQNS 4U8VA 5D3GA 2G0IA 4JYAF 2OEMA 2YPYA 4FNIA 4J7CA 2IHR1 2YNFB 1HR0J 3MOZA 4L76A 3HJVA 5IT0A 2FIUA 1RP5A 3WC0A 1VS3A 2JC1A 2VKRA 3DRSA 1DQ8A 5F3ZA 4WU2A 2I8EA 2FVSA 2CRLA 4N8NA 3I9ZA 4KFBA 4Y3CA 3T1AA 3I0SA 2G0JA 2LYVA 3ZTRA 4DI6A 2ZC3A 2GQ2A 3DOKB 1DJ0A 4JV5J 3MR7A 1HBNA 3H98A 2MQQA 1Q79A 4JI8F 2D1CA 5DJBA 4C11B 1U47A 4F3MA 1WC0A 2ZD1A 3IRXB 2CA9A 4ZJLA 3BZQA 3NGRA 1RTIA 3D6TB 3PCOB 2XZWA 4DQPA 4RW7B 3GFZA 1F5BA 4RUAA 3HVTA 2YKNB 3JTPA 5DQGA 4KGKA 3OL6A 2D3O1 4LSZB 1F9EB 2V8GA 3GMGA 4KYZA 1HNVB 2CPHA 3CVKA 1PCAA 1Q8LA 3VAFA 5T7LA 4NRTA 3O44A 3W9JA 4FBTA 3M6WA 2XS2A 1BE4A 1RT5A 2Y8YA 1C0UA 5LSRA 3IM8A 1FK9A 3R97A 3W5XA 1WC6A 4PG4A 1T3NA 3RYLA 4RW6B 4YMEA 2R2RA 3PG9A 2DTJA 1CBKA 3C14B 1CJKA 1SCJB 2GMHA 3K7RA 4CO5A 2E5HA 4UOCA 2R7TA 3TUIC 2NPFA 3G86A 3A8IA 5KTQA 1NHVA 2GQQA 3R5BA 2CQGA 3MEEA 1HWKA 4ECVA 2HHQA 4A8MP 1KFSA 4O23A 5KT2A 2W2QP 5C2GA 5DDPC 3SFUA 1IBLJ 4OZ2A 2WTFA 4ZLJA 4KKOA 2R7VA 4I64A 1SH3A 4F26A 3HI9A 2FPHX 2BV3A 1N56A 3T5LA 5ETLA 1EJ7L 2K8GA 1RDRA 2KM8B 3ZO7A 1VQPS 3K5PA 3IMQJ 4UZCA 3MCOA 3ZZRA 1Y5LB 1VIXA 2VF3A 3CCLS 2J9CA 1RT4B 2OEJA 3OUYB 1VRQC 1NRKA 3U1MA 1SQEA 2VBZA 5JVHQ 4X62J 5FLXY 2KTQA 2FVPA 3M8ZA 3P5TL 3TUJC 4EK2A 4ECZA 5E3AA 1T9WA 3JYTA 1NB7A 4FNHA 1JLCB 3FQLA 3UD3P 1UVNA 3PEHA 2F4VJ 2HQ3A 2YKMB 3UW1A 4EO8A 1QAYA 1MWYA 1Q5YA 1AYEA 1UVLA 4DS5A 1SKSA 3CUNA 1Y3KA 1UEUA 3B6BA 2HNYA 4DV4F 3D3CJ 5HQLA 2CPXA 4OZNA 1U8WA 1JIHA 1TL4A 4MYTA 4C8LA 1HNWF 4XO0A 3AQPA 2K2PA 2VDHA 4ZVHA 4USJC 4HTJA 4IG3B 4ER8A 1OY9A 4ZVEA 4DR2J 2ZOGA 4LR7A 2J8SA 4XIUA 3RR7A 2GVZB 1H7XA 3PKMA 2V8VA 1RAIB 4OZJA 3BO2A 5BYQA 3NNAA 2JHEA 1N5YA 3W2VB 2DR6A 1N6QA 5ITHA 3HHLA 3J80U 4ZPVR 1B0TA 3H5SA 5J2PB 1RWVB 3BYRA 4KTQA 2E1RA 4ZVFA 3PKYA 3G4SS 2KYXA 2PE8A 1WC4A 3CC7S 4PWDB 3HJFA 2LXIA 1JLAB 5BXIA 4F4AA 2N3LA 4K4WA 4OYBA 4NLVA 3BDPA 1RWNB 2R7WA 3AY0A 1XR7A 4H4OB 1HARA 2AYEA 2BJ1A 3V2UC 3FRYA 3CD6S 2B8PA 5K14B 1N8RT 4D3HA 3AQOA 2ZC4A 4B02A 1ZOTA 4KQZA 4Y2IA 5AXKA 3KHHA 3ITHB 4RBUA 4B9TA 1REGX 4GKKF 4YP3A 4CLZA 4UQGA 1FX2A 3HLUA 2EFGA 2YTCA 4EO6A 4R25A 4LREA 3AOBA 5KFPA 2RRNA 3KLEB 2CVIA 2QEXS 3EX7B 4E98A 3OLBA 1UL3A 3OTDA 3GV7B 1BY9A 4QIWD 4ZP9A 3CE8A 1V5IB 2I2YA 3HF5A 3BH6B 5KFEA 4KSEB 1VQSA 5CCLA 3UQSA 3MD1A 3RRGA 2BX6A 4NI2A 2HBRB 3IWXA 2WHOA 5IWAJ 2QT7A 1YDLA 4JI8J 2X1FA 2FJDB 3C6TB 2Y9HA 1UA1A 1F9HA 1FKPB 4B9VA 1QVFR 4XPCA 5LJ5Y 2DT9A 4YN3B 3I0RB 4MIWA 4JUZA 3CB4A 3QT7A 2RD5C 3V5RA 3FMBA 5CD4A 5BR8F 2NUUG 4QPTA 4HT5A 1Q1KA 1WEYA 4EZ6A 2CWXA 3QNWB 1P9QC 3FEYB 5ETPA 4F67A 4DN9A 1RAGB 3SCJE 2FGOA 3RB6A 2YVSA 3TZXA 4ELUA 4KHRA 3TR5A 1U7LA 4KR0B 2GX8A 4HDHA 8RUCA 1IBMJ 4WXWA 1TAUA 1S12A 2LLZA 1BUXA 3IG1B 2XBPA 3FVYA 1LV5A 4N7TA 2MSTA 4PWUA 2NSBA 3HT0A 3M2RB 3G71S 1VJWA 4QYZK 2P9CA 1ELOA 3SFGA 2HQCA 1X0FA 4DV7J 3W5ZA 4DUTA 5HROB 2YQ1A 2DHHA 2J0XA 2E9ZA 1D9FA 1FKOA 2DHSA 1HQ2A 5C2CA 1TK5A 4I67A 2I0XA 2HNDA 3JAMU 3V6JA 1TR0A 4LF9F 3V4MA 1B0VA 1WSRA 1W2BR 4F02A 5IC4B 1RHJB 1TL7A 1O0PA 3MMBB 1FRXA 4H4KA 4EI2A 2AYGA 1WTBA 3B8HA 1NEEA 4K4ZA 2NUHA 2XS5A 3M8PA 3VGVA 1UVJA 3G2XA 4ZS6A 1FJCA 1HLWA 2HEKA 1NB2A 3AB2B 3NNCA 2YNIB 4OV6A 4QPXA 4ED7A 4MK8A 2ZHOA 1RSCA 2DIVA 3HHDA 4ZDNA 1KLNA 2KT5A 2DPIA 1Y11A 4E8UA 1JNRB 3UFCX 1TKZB 2LA6A 3RRHA 1NK7A 4OLPA 3G8QA 4OJGA 2DRBA 4HHUA 1PC4A 3AD9C 3BO3A 5IT9Y 2OGUA 4ZCKA 4B08A 2J0QD 1QM9A 5B0DA 2CJAA 4USVA 4AL5A 1QAXA 3AOCA 4M5HA 3UVJA 4DPOA 3I6PA 5DG8A 3ENQA 1U6ZA 1CLFA 3TAQA 2MZTA 2HQGA 5L9XA 3P6YC 4Y2KA 1WDTA 3PY8A 1QY7A 2HGLA 4YFUA 1HWUA 2P6SA 1K1QA 1HNWJ 4A8XA 4FYVB 3KLFB 2JC0A 4CLSA 1EHWA 3O1LA 2HWTA 3PM9A 2RDDA 1DRZA 1OY6A 1UVMA 1HWIA 3SV4A 3PW0A 1TUGB 3HVWA 3B4MA 1FEHA 3O3LA 3RJMB 1N36F 1YHQS 4KFBB 2UV8A 4NXMJ 3I0SB 4OI2A 4AXIA 5DZ7A 2ATCB 3RW6A 4K4UA 4E2FB 2BJ9A 3KLHB 3CT9A 4ZVSB 4KGXB 1HBNB 4NASA 5HVGA 3BQ1A 2YX4A 2B6AA 2MQLA 4WYLA 2Z8QA 1PAUB 1NUEA 2LCWA 4DR1F 3GIIA 2ZD1B 1RWUA 1WD6A 2M88A 4OYAA 2BJDA 2RQMA 5IOLA 4PG6A 4ECUA 3RBZA 5C7PA 5DDOC 3IO1A 2IC3A 1WHYA 4RJVA 2RS2A 3QWUA 1O5JA 3HVTB 3MMCA 2FYXA 3OVBA 3J7AN 1REVB 3H59A 4JI0J 3MGJA 2HQIA 4EWTA 1DQ9A 1SPBP 2DNHA 4LRFA 4I1TA 5KG7A 4OI6A 5T7LB 1KOHA 4OYIA 3CPWR 2C3PA 1RT5B 1C0UB 2WCXA 4N56A 4K0KJ 4DFMA 4USUA 3RBXA 2GJIA 3PYDA 4QU6A 1U2FA 1LK5A 3H40A 1URNA 4RZRA 3TOQA 1CJKB 2JNJA 5KFAA 2VICA 5EWEA 4C0OC 4O4RA 1YJUA 1ZPWX 3WDOA 2FVCA 5HLFB 1C1BA 4OX6A 4WJBA 1RTJA 4LIRA 1TUWA 1J5EJ 1HD0A 1NK6A 1B7FA 1N48A 3MEEB 2OKQA 3FCHA 2W7PA 4YHHF 1NM2A 1Q0NA 5BR8J 1KLMA 2MZRA 4Y00A 4ZCMA 1I94J 3N5FA 4KKOB 1YTYA 2G1DA 4KV8A 1U1RA 3K58A 2VHGA 4OX9F 2XMTA 2QC3A 2EKNA 4OHZA 2O66A 4V1Ak 3TJ9A 1BMQB 4WE1B 2GMLA 2A2CA 1SBRA 3S01A 4X4VA 2XCAA 1RAJA 3NCQA 4CLTA 4USWA 1S48A 5E3PA 4QU7A 1S6QA 3RAQA 3RUBL 3DRYA 3HHLD 4ZCLA 4ECXA 4P2FA 3JYTB 2QN6B 3D6FB 3L4BC 1HD1A 2LQ9A 1TMMA 1ZZNA 2V67A 2MKIA 5HL7Q 5KT6A 4V19J 2F7VA 1XN9A 1FRLA 3UPFA 1WG4A 2M9KA 3HCXA 3R27A 5L8RC 5KFNA 4DR3J 2CPDA 4CLYA 3QYYA 3EWGA 2R3VA 1KQSR 3K5MA 1RADB 2H51B 2FQQB 1OO0B 1S9GB 4LQ9A 3HD2A 5DDQC 2M8HA 1U24A 2ZBPA 1G4CA 3HT3A 4ZA1A 3MM9B 2CADA 2HVEA 3I87A 4M5GA 3QBCA 1N5YB 1N6QB 2F5GA 3HHLB 4DL7A 2BACA 1P27B 4K2JA 4M5LA 1RAOA 4CO3A 2MZQA 2L9WA 1DTQA 2MHEA 2P5VA 5BJRA 1SQGA 4JOUA 1VR6A 3N28A 2QA2A 2I9SA 1ZA2B 2VG5A 2XLJA 2UVUA 4J9NA 3BQ2A 1TELA 4F0HA 4Q8EA 3D3BJ 2UU9F 2OMLA 5GMKa 3TA0A 3CW2C 4ZHRA 4FDFA 4Y2CA 3AA8A 2GHWA 1MU2A 3E01A 4CP5A 4CLLA 3T1YJ 2PO4A 2DNQA 1RAFB 3FQKA 4YUDA 2C3YA 4ECRA 2F8EX 1WF1A 3MCNA 3JSMA 2LDYA 2V94A 1QUPA 2AJ4A 2CDRB 3DOLB 4DU8A 2JLFA 2AHOB 4B9SA 1U1LA 3GCWP 1BQMA 2C2KB 5I3QA 4ZCIA 3LGMA 4RBTA 1PO6A 3RRKA 3FRZA 5CH7B 1X4BA 4J5OA 2UUAF 1R8HA 4C48A 3D0GE 4J9KA 2WB1D 4QR0A 4DPTA 2DGTA 1WF0A 1NK0A 2OHDA 2BOAA 4NI2B 1XMBA 1EQ0A 5EX0A 3BKTA 2OELA 4MT1A 2E66A 2V5HG 4ID8A 2CPYA 4YS2A 4PXBA 5D8HB 3M9NB 4DR1J 1M5PC 4K4SA 5HATA 3GFHA 2GIFA 3MFIA 4S0MA 1RTHA 4M63A 1HHQA 2ROEA 2QA4G 2FZCB 4X4TA 1ZM4A 3H4DA 4DCPB 2RSQA 2MJUA 3ZZUA 1NH8A 2MTLA 2XLKA 2IVMA 3ZXWA 3OJUA 2V8PA 2CQ1A 1YBTA 4O3OA 3Q8YA 4DSEA 1U4BA 2A0FB 5CABA 4N47A 3NGKA 1HBMA 4B9NA 3LOUA 2E1PA 3QSYB 4A8WA 2PFFB 2AJQA 1M1GA 2DNRA 4WFXA 2VFVA 2XS7A 1U49A 2LA4A 5K9FA 4UZBA 4X4NA 4K7QA 4X84A 3RB4A 1HNZJ 3ISZA 3C66A 3H5YA 1YZ7A 4I68A 4F2SA 3C46A 3HKZD 2WSEC 4PQUA 2G1HA 1KR4A 3RGIA 4X2BA 4GVLA 1Z2LA 1L3KA 2YKQA 1FRIA 1FKOB 3K5LA 1CSJA 1S1VA 2HNDB 1JLQA 1OYDA 5MAOA 4Z2XA 1HWJA 1LWEA 3M32A 5DETA 4C7QA 3M1VB 1JJ4A 1TL7B 2QJ3A 4C9DA 4RUHA 2AJFE 4JI3J 2EFQA 2J7UA 2JEGA 2W2MP 5FIIA 4MKVA 3NG8A 2PMHA 1H6KX 1RB0A 1U1QA 5EWGA 4ZPBA 1YVFA 1NBEB 4MKAA 2IA6A 4WPAA 1BC6A 1NZAA 3KJVA 2VJVA 4W98A 4XAKA 2NXCA 2PEBA 3BBBA 1HNXF 4P10A 2XMMA 3JSBA 3H5UA 3NGSA 1RHRB 3KG1A 5A0YA 4WF9Q 2ATLA 1RK8A 2H65B 1UKUA 3CC2S 5E3CA 1YI2S 3BSNA 1PAEX 3UE2A 3EXCX 4J9MA 2FZGB 5KFQA 4AQYF 2C28A 2OD6A 5LMNF 2BR0A 3UVJB 5KT4A 2AW0A 3JTOA 3VV2B 1F3VA 3HFZB 1V9OA 1BQNA 1ZPVA 1RBAA 2M0GB 3CSKA 3OPKA 4URGA 2KFYA 5SUHA 2NQPA 4JI7J 4GO7X 4C97A 4DV0J 3I9V9 3PYEA 2HHSA 2E5JA 3AT1B 1F2HA 2FJVA 3MM8A 5H1SV 4B3OB 1FWKA 2V6AA 4P9SA 2CXEA 4FXWA 4Q8FA 3D5MA 1NLKL 4F3QA 2QSFA 4KAIA 4LBPA 2W4DA 4OYPA 4LF2A 2U1AA 3QFHA 4JI6F 2ZZMA 3RW7A 2UP1A 1VBKA 4ICLA 1LNQA 3PFEA 3UNGC 2ZH5A 2K06A 3M9MB 2VOOA 1U09A 1M90T 4ZP7A 3PW2A 4MAKA 3ENAA 1K44A 3CJSA 1Q4RA 4C0BA 3CCZA 1VLOA 1GTEA 2DR5A 3EICA 4DR4J 2PIIA
chains in the Genus database with same CATH topology
2OPRA 4KB7A 4A8QA 2VFTA 1H2TZ 4DSIA 1WACA 1R31A 1RYRA 3EZUA 4IG0B 5HN0A 3V6HA 2XG8A 3MPWA 3OHAA 2KJVA 5T14A 5HMWA 3QGHA 3KJVB 4DV3F 2V4JB 3I31A 2LECA 1X4HA 2UV8G 3ENWA 5CCMA 3P3DA 5HO4A 1TKTB 1S77D 4RBVA 5HROA 4X65F 1HYSB 3THPA 4HI2A 1JJHA 3KHGA 3CJ5A 5A2QY 1Z2ZA 2W8KA 1I1GA 5B0GA 1GX6A 4ZOSA 2JLEA 5LMUF 3B4DA 1JLFA 2L08A 3W2WA 2IM2A 2QLXA 3LP1A 3MMCB 4RW8B 4JI0F 1NKCA 3PR4A 2HS0A 4FXVA 4DQIA 3KHRA 3MTJA 2XNRA 3F41A 1SIZA 2YNGA 3DOMA 4MJKA 2EBGA 1S72S 1FRHA 5DG9A 3DLGB 4MTPA 1RYSA 2XY6A 1AUDA 2CG4A 4IQXA 1VQYA 3CDUA 4ETXA 2ZM6F 2ZKTA 1HPZB 3KLIA 3LP0B 3CCQS 1K73T 2OIHA 4X66F 3MMBA 1U6FA 2ASLA 2UZAA 3TQ1A 3Q2TC 4QWBA 3VAIA 1U1KA 2IVYA 1MROB 4X4SA 3LWMA 3OTEA 1ZH5A 1ZTWA 1J5OA 4BWMA 1KS2A 2J5AA 5FDLA 4CI0B 5KG4A 2VPXB 4K0KF 1EETA 1SV5B 2KZZA 1X4EA 2N82B 3TYTA 1EP4A 2MGZA 4I7FB 3Q2SC 3NAIA 4PKDB 4N41A 3PJWA 1DLOB 2LDIA 1HW8A 4C3LA 2HW3A 3N01A 4I6WA 3IN5A 3PX4A 3NCPA 1U1PA 2XCPA 3QAUA 3G8TA 1SKWA 2EFOA 2ZJQQ 4I2PA 4ZP8A 5LJ3Y 4IOCQ 2AYBA 4G3IA 4PG7A 2E1AA 1NK8A 4BC9A 1VC6A 4ZPDA 2MDAA 2VZ9A 2ASJA 4KHPF 4OZLA 3NBPA 2XMJA 3G6XA 3CCRS 4EBDA 1C1CA 3DFEA 1BQNB 4UY85 1UWBB 2FDNA 2JRSA 3SZ2A 2HRYA 3HM9A 3PZPA 2RKIA 3HVAA 2VC0A 3V4IA 2DNPA 2YKNA 4O4GA 3SCKE 3DLEB 1L3UA 3D1OA 3Q22A 2VG6A 1R89A 2OPPB 3QGIA 4IRDA 3OBIA 5D4NA 2B4OA 1C0TA 3SXLA 5F3TA 1BLUA 1QSLA 5K8NA 1V3RA 1HI0P 3PX6A 4O0IA 1J5EF 4M5DA 1N5TA 1YBAA 3I5AA 3LAMA 3ZZYA 4AYBD 3KG4A 1C1BB 2QIFA 4LIWA 5J1PA 3OFHA 2MZJA 1RTJB 1SH2A 1U2RA 3H20A 1LWFB 1KD1T 3NMRA 3QJJA 1HNVA 2DHAA 1VK8A 3QIPA 2CJQA 1WEXA 1M1KT 2NPIA 5KFMA 1S79A 2AJ1A 3V6DA 5LXYA 4KRWA 3RZAA 2FD2A 2BE2B 4EGLA 4K50A 3ONQA 1DARA 1I94F 2CQ0A 3VZIA 5J2NB 4GC6A 2HAIA 3FZBA 2GV1A 2W9BB 2CQ3A 3BDPA 2E5IA 3MHYA 1TL3A 3UI3A 3QJPA 4K5SA 4B3SF 3NWGA 4TQSA 3H2LA 4OFZA 3VAKA 2ADBA 2P9GA 4DMZA 2V4RA 3GQCA 2MQMA 4LUBA 1HMVA 1NJYA 5J1EB 4U67Q 2DH8A 3G9CA 1R8AA 2QA4S 1U45A 2RE1A 4OHVA 4IO9Q 5HBMA 1FXLA 1ULRA 4F4YA 3BN4A 3K5NA 2KJWA 2ZDPA 2EPIA 4LF8F 3S1TA 3VF0B 2JJ4D 3GR0A 2XSJA 3R5CA 2MKSA 2KZMA 3DM2A 3M05A 3CCUS 3OVSA 5B0FA 7FD1A 5G0RA 1FNMA 4OV1A 1XMOF 2FHJD 4OLOA 4TU9A 2RDIA 3MFHA 2MB0B 1S1TB 1E6YA 1QJHA 2VBWA 4NYPA 2CDQA 3RAXA 1VQNS 5IQ6A 2PI5A 5D3GA 1DQAA 4WKYA 4OX7A 2XWYA 4JYAF 2A3JA 1U25A 3BN7A 4FNIA 2OPRB 4KIAA 2CJBA 5KAKA 2IHR1 2YNFB 1XNQF 5KFUA 1FRJA 3MOZA 5SZTA 2LQ5A 1YJ9S 1NKBA 4PXCA 2IJFA 2GGPA 3C2PA 5IT0A 2FIUA 1RP5A 3WC0A 3R5DA 3EGZA 2IYIA 1HHTP 2IRUA 1VI7A 3CCTA 1VS3A 1GXTA 2JC1A 3T5JA 4A8FA 3GYNA 1S6QB 2L41A 4F25A 1D9DA 3DNCA 2CQPA 2VKRA 3DRSA 1NJZA 5E2QA 2MQNA 1FKAF 1DQ8A 5F3ZA 4WU2A 2I8EA 3DLHA 3L3CA 4OHYA 3Q23A 2CRLA 2FVSA 4N8NA 3I9ZA 4OIXA 4DL2A 1S49A 4KFBA 4Y3CA 3BO4A 4C8OA 2HGMA 1G1XA 4IFVA 3T1HF 3T1AA 2YNHA 3I0SA 2JL9A 3VQSA 2OD4A 1HQEA 1VQ4S 3ULHA 4EBCA 5AE1A 2YNGB 3TP2A 3OSNA 5J2MA 3M2UA 3W7BA 1KHVA 2D74B 2XMVA 5J2QB 2LYVA 2Q6BA 3RB3A 1UETA 1C4AA 2ZC3A 4TXSA 1KHWA 2GQ2A 3DOKB 3U02A 2FLNA 1DJ0A 4LSLA 4DX8H 4DSJA 4Y0FA 1HBNA 4OJHA 3H98A 3WX4A 4DR3F 3Q8PB 2C3MA 1VC0A 3NMAA 4B17A 2KRRA 4P6QA 5C5JA 1Q79A 2MQQA 2MZ1A 5L1IA 3DLLQ 4JI8F 1SL0A 4WXOA 2D1CA 2E9RX 5DJBA 4ED5A 3MM7A 2OO4A 4C11B 1GAOA 1X7VA 2BUNA 2I5JA 2VA3A 4NMLA 1U47A 4F3MA 1OPIA 5LSOA 5F8IA 1N88A 1SJ4P 1RISA 2AYMA 3OUYA 3MUMP 5EN1A 2ZD1A 3IRXB 1XERA 3NNHA 2MY7A 2EBEA 3BZQA 3QZ8A 1PSDA 1RTIA 3THVA 1S6UA 4UUWA 2DVIA 2B9YA 1OSDA 2J7KA 1FJGF 2JVRA 2OSQA 4DV2F 5F9NA 5KT5A 1MNEA 2G9OA 2XZWA 4RW7B 4DQPA 3LAKA 1APSA 3GFZA 2W9AA 1MMNA 4B9MA 1F5BA 4RUAA 3HVTA 3DDNA 2YKNB 2HNZA 3MUVP 1RJJA 3JTPA 5DO2A 5AXNA 3UCUP 2Y1JA 3ENVA 1S0OA 2W25A 3D1QA 5DQGA 4JBCA 1IM4A 4KGKA 2PDAA 3OL6A 3R1LA 1D8YA 2YKMA 4AL6A 2C22A 4ED3A 3HFKA 2FLPA 2IM0A 1U1MA 2V8GA 3GMGA 5A8KA 4WFAQ 3HP6A 3ZC4A 2F40A 3TO8A 5JVGQ 5T41A 2AWZA 5KFOA 4I4BA 4OX8A 1RT3B 1HNVB 4G1QA 2CPHA 3VCDA 1DTQB 5KFLA 3CVKA 3IGNA 1Q8LA 2M4MA 3VAFA 1FXDA 4IH6A 4IOAQ 1WELA 5T7LA 3OVAA 2OSRA 5A8RA 3LALA 4NRTA 3O44A 1HBUA 1V3SA 4FBTA 1K8AT 3M6WA 3OXGA 2XS2A 2D3UA 1RT5A 3D28A 2YX1A 1C0UA 5LSRA 1F9FA 2VQFF 2VG5B 2RU3A 2LEAA 3SCLE 4CNZA 7FDRA 1RT7A 3DRRB 5HMYA 2KM8C 3MURP 3CMAS 1DTTB 3T6BA 1LW0B 1FK9A 5DLFA 4QW9A 3LANA 2UVVA 4CT8A 2Z2MA 4QR1A 2EFVA 1E6VA 4PG4A 4W92B 3M8SA 2VQEF 3UD4P 1KTVA 1RQ0A 1T3NA 1Q81T 2IVFB 3RYLA 4RW6B 2C3UA 3Q8QB 3K5OA 5A6PA 4QWCA 3DHXA 5HBMB 4YMEA 1IKXA 2R2RA 4PPZA 3CJ0A 4ZHRB 3T1YF 2IMWP 1S7HA 2K3IA 4LFAF 4X4QA 2DTJA 4W90B 1FNOA 1GQEA 3SSRA 5C25A 1MU2B 3E01B 4RU2A 1F5AA 1H2VZ 1Y9OA 2GMHA 2FLLA 1WEZA 3K7RA 4V19X 4DL6A 3P49B 2CYYA 1TV6B 3LH2S 2J8AA 4CO5A 5KT3A 2E5HA 2DITA 3KG0A 4UOCA 2B51A 3CC4S 2R7TA 4R8UA 3TUIC 2NPFA 4ZPWR 3G86A 3Q0AA 5J2PA 3IC1A 5KTQA 2ZH2A 1NHVA 3KK3A 2GQQA 5E3QA 1E6YB 2VL1A 3H4BA 4YOEA 5D3GB 3R5BA 4LT6A 4I2QB 2CQGA 4YB5A 2MZSA