3UCZP

The c-di-gmp-i riboswitch bound to gpg
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/rna
molecule keywords U1 small nuclear ribonucleoprotein A
publication title Structural and biochemical characterization of linear dinucleotide analogues bound to the c-di-GMP-I aptamer.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2011-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3uczP00
4WFNQ 1W2BR 1RKJA 1X4DA 4W92B 4J5OA 3P5TL 2MHNA 2GHPA 4CH0S 3PIOQ 3BO4A 2CQ1A 2DGXA 3P49B 1SJ4P 1JJ4A 3UE2A 1WHXA 2E44A 2CJKA 2VOOA 1DZ5A 2KRBA 2HYIB 2YH0A 2CQGA 2LECA 1WF1A 3IWNC 2X1FA 2MJNA 1WF2A 2KH9A 2M70A 5GAGU 2RVJA 4C0OC 2N82B 3NS5A 4TLQA 4C4WA 2MKIA 1H6KX 3SDEA 4TU8A 2KYXA 2CQBA 3G4SS 2CPHA 3G8SA 2OIHA 3MXHP 1KOOA 1X4CA 2KU7A 3THPA 2B0GA 2X1BA 2L08A 3BO2A 2F9DA 1P27B 3EGNA 2LCWA 3VAFA 3S01A 2QFJA 2X1AA 2L41A 1M1KT 1M90T 1SXLA 3UD4P 3UCGA 1FJCA 2RT3A 4FXWA 1K73T 3BEGB 1RK8A 2DNMA 5BJRA 3UCZP 2DIVA 1N8RT 2DGWA 2CQ4A 2RS8A 3MURP 2ADCA 4LMZA 4C7QA 3G96A 3DXBA 2MQQA 2SXLA 2MZRA 1VQPS 2JVRA 1WI6A 3TP2A 4YB1P 1U1LA 3D2WA 3CCRS 1N88A 5DDPC 3BO3A 1YIJS 2CPIA 2DGUA 2KM8B 2DGOA 1VQ8S 3TO8A 1DHMA 2RRAA 5LXRA 2JRSA 2HGMA 1X5PA 1Q7YT 1YHQS 1UFWA 2OJ3A 2DHGA 2G4BA 1IQTA 2DNKA 2DNNA 3U1MA 2FHOB 2MGZA 2JWNA 4RU2A 2M2BA 2MJUA 3K0JA 4WIIA 3R1LA 1WF0A 2JX2A 1PGZA 2MQMA 2MZQA 4P6QA 2N3LA 3MD3A 4V19X 4WFAQ 1U1KA 2DGTA 2XS5A 1YITS 2DK2A 1D9AA 1JJHA 2LEBA 5GAEU 2YKAA 1FJ7A 3S7RA 3V4MA 2U2FA 2KI2A 1S79A 3CXCR 2XS7A 1X4AA 1HL6A 2DISA 3G8TA 2AD9A 2F9JA 1OIAA 1YTYA 2M0GB 1KC8T 1R8HA 2CPZA 1SJFA 1FT8A 4IUFA 1AUDA 2RQ4A 3MUMP 2RQCA 5ITHA 4QU7A 2CQ3A 2CPYA 3LPYA 5DETA 3JB9k 5LSOA 4YOEA 5EN1A 3TYTA 2MY7A 1JJ2R 1DRZA 2M4MA 4CIOA 5JVHQ 1VQKS 5DDOC 3FEXB 2YH1A 1SJ3P 4PR6A 2E5IA 1M5VC 4FXVA 3VALA 1NO8A 2DNGA 2MPUA 1VQ7S 1OWXA 3G9CA 1U1OA 5D78A 4F26A 4TU7A 2MZ1A 2FC9A 1VQ4S 1WG5A 3RW7A 4IO9Q 5D77A 1X5OA 5HO4A 2DNPA 1X4HA 2KVIA 2LXUA 1H2VZ 1UW4A 5GVQA 2CQCA 3B4MA 2RUGA 1OO0B 4UQTA 3P3DA 3I56S 3CCMS 2DITA 3RW6A 2DNOA 2MMYA 1N52B 2V94A 3CCES 1FHTA 2CPDA 3MD1A 2MGZB 1U6FA 2KG1A 2XB2D 3G71S 1U1MA 1VQ6S 3NNAA 2QA4S 2DNLA 2OTLS 2CPXA 3H2UB 3SMZA 2MSSA 2EK6A 3NS6A 2MQOA 2DH8A 2MKHA 1N54B 2M8HA 1VQMS 2KXHA 3J7ZT 3CC4S 4QU6A 1L3KA 1SJRA 1A7GE 2KHCA 3NMRA 3SXLA 1XN9A 1WG4A 3S6EA 5LJ5Y 3CMAS 1M5OC 1X5TA 2DO0A 2U1AA 3THTA 5DM6Q 1YJ9S 2DHAA 2I38A 1M5KC 4YUDA 4IOAQ 1ZH5A 3NNHA 2MKJA 1HA1A 5DDRC 2AYEA 2LYVA 3VAKA 2J0QD 5LSLA 2E5HA 1B7FA 2ZJRQ 2LKZA 3MDFA 5GMKa 1U6BA 2RS2A 2MQNA 2DGVA 2DNRA 1Q86T 1VQOS 1UAWA 1S72S 5DM7Q 5DDQC 4OZ1A 3CCLS 1Q82T 2PEHA 1K8AT 3H2VE 1WHYA 3VF0B 1PO6A 2Q79A 2N7CA 1KQSR 2G0CA 3R27A 2OTJS 3R1HA 3BS9A 3CC2S 1WEXA 3B4DA 5IM0A 2FPHX 1X0FA 4ZKAA 4CQ1A 1WHWA 2G1DA 3L3CA 3MUTP 2J8AA 3ZZZA 2NLWA 1D8ZA 3CMES 2AYMA 3LQVA 3FEYB 1HD1A 1X4FA 2MXYA 3UD3P 2CQ2A 4Y00A 2YWKA 2DNQA 2PE8A 2CQPA 4Z2XA 1UP1A 1VQNS 1WWHA 2OSRA 1H2TZ 2DB1A 1KOHA 2MKCA 2D3OR 5CYJA 3PIPQ 2YTCA 5CXTA 3CUNA 2KT5A 3CCJS 2KFYA 2HVZA 5LJ3Y 2KXNB 5LXYA 5GAHU 2MZTA 3N9UC 3DLLQ 4EGLA 1OPIA 1YI2S 3P6YC 2EVZA 3UWTA 5FJ4A 1H2UX 3CCSS 1O0PA 2DH9A 3MI7X 4F02A 2J76E 2DO4A 2CQ0A 2MQPA 2KM8C 1P1TA 4TU9A 2HZCA 2XSFA 4F25A 1WEZA 4BS2A 2DNZA 4LJMA 2VONA 2LA4A 3G6ES 3HHNB 4WF9Q 1X5SA 2E5GA 1U1RA 4OZ0A 5IFMA 2KN4A 2I2YA 2CPFA 2RNEA 2M88A 2E5JA 2XNQA 2DGSA 5JVGQ 4U67Q 1A9NB 2DGQA 3OW2R 2F3JA 1FJEB 5IM0B 3VAIA 1WI8A 2LA6A 2M7SA 2VODA 1YWXA 3UCUP 3CF5Q 3MUVP 3Q2TC 2HGLA 2CQDA 2HGNA 3J7YU 1VC0A 2DIUA 3ULHA 1HD0A 3ZZYA 2LEAA 3CC7S 2MSTA 4PKDB 3CCQS 1X4GA 1F9FA 3S8SA 2ZJQQ 1VQ5S 3US5A 3VAHA 4WCEQ 1Q81T 2DHSA 1X4EA 3VAMA 1U2FA 2L9WA 4LIRA 2DH7A 2FC8A 1ZZFA 2MKSA 4ED5A 5IQQA 2MY8A 1U1QA 5MLCV 3U1LA 3CD6S 3CTRA 2MQLA 1CVJA 1NJIT 1FXLA 2CQIA 2A3JA 2EK1A 1YJWS 1YJNS 2CPEA 1DBDA 3EGZA 2MZSA 2MKKA 4WKRA 3VAGA 2XNRA 2MYFA 4ERDA 2NZ4A 1K9MT 2CPJA 2LQ5A 4W90B 1QVFR 3NNCA 1WTBA 2CQHA 2UP1A 1G2EA 4IOCQ 1VQ9S 2FY1A 1WEYA 1WG1A 4WFBQ 2KXFA 2LMIA 2ZJPQ 1FO1A 1QVGR 3MOJB 1R8PA 3I55S 2LXIA 1FNXH 2GO9A 3HI9A 4CH1A 2AYGA 2M9KA 1VC6A 1JMTA 1QM9A 2BOPA 3IRWP 2N3OA 2ERRA 3Q2SC 4QPTA 2M8DB 1VBXA 2RU3A 2QEXS 2WBRA 2D9OA 2DHXA 2OSQA 2DNYA 1NU4A 2MZJA 5HL7Q 1WHVA 3CULA 1VBZA 3CCVS 3CPWR 1M5PC 2X1GA 5H1SV 2VOPA 2RRBA 3SDEB 2K3KA 1VC5A 2KRRA 1X4BA 2DNHA 1URNA 2MB0B 1U1NA 2XS2A 2K8GA 1KD1T 3EX7B 4QQBA 2O3DA 1U1PA 2BZ2A 2JVOA 1VBYA 2ADBA 2KG0A 5CA5A 2M52A 3VAJA 1BY9A 4A8XA 3CCUS 4PRFA 2J0SD 4M5DB 5GADU 4UY8T 1ZZNA 2D9PA 4Y0FA 1VQLS 1SJQA 1WELA 2AYBA
chains in the Genus database with same CATH superfamily
1RT5A 1S48A 1PBUA 2EFPA 3QYYA 3PIOQ 2E5LF 4HYKA 5B0BA 4QJVA 5F8HA 1LWCA 1RBLA 1N0VC 3ZNJ1 3V6DA 2YNFB 4OFZA 4RO0A 3I82A 1KLMB 2YXLA 2KH9A 2ALYB 3SDEA 2R42A 4OMFG 1NSAA 5EWGA 1KWMA 2FVCA 3NEKA 3EGNA 3WQPA 1DURA 3TX8A 2QFJA 4QYRA 5AT1B 2ATCB 2NYHA 3PTWA 2DGWA 3I32A 1WD6A 2AX1A 3LALA 2MQQA 3TUZC 5EGYA 5F3TA 3CMQA 5CHCB 3B6BA 1N88A 3GFHA 3HKZD 3MMAB 1Z2LA 4X4OA 2VASA 2VA2A 3W62A 4I69A 2UVVA 4WIIA 3TR5A 1LWFA 1LXNA 4UW2A 2MZQA 5I42A 3H2LA 2RIJA 3LP2A 4ECWA 1JLEA 2UUWA 2J9DE 4ELUA 4USHA 2DR8A 3EXCX 5DG8A 5HAOA 5L1IA 1TAUA 3I9ZA 2RQCA 2UUCF 3OTDA 4JV5J 2AWZA 3MEDA 2Y1LB 1REGX 5DS7A 2CJYB 1ZTTA 1TL5A 2VHGA 3M7VA 3W1YC 2R8HA 4ZVQB 1U2RA 1EB0A 3T1HF 4DFPA 5KFZA 2MPUA 2WVCA 3NWRA 3NRBA 1F3VA 2M5YA 5HVHA 3RAQA 1HYSB 2QL5B 1X4HA 2CQCA 1A6LA 1BQMB 4DX8H 1P8GA 3IR5B 2EW9A 2NXEA 2XSJA 3MMBB 2XZWA 4I6AA 4G3IA 2IVMA 3PDNA 1HQ2A 1WG4A 1QAYA 1WUUA 2ZH6A 1RHQB 5CD4H 2B9WA 3DYAB 3KLFA 2FQQB 4NA1A 2GVZA 4IOAQ 4OLPA 4OHWA 2CZ9A 3D0GE 3OR1A 3T5HA 1V5IB 2EC0A 1B7FA 5GMKa 1LNQA 4OYXA 1T9YA 3JSMB 3IMQJ 4YP3A 1S6QA 4DV7J 1FRIA 2GQQA 4FP9A 3DOKB 1N5YA 2D3ZA 2B56A 1H72C 4FF2A 2C2ZB 5KFWA 1T03B 2KTQA 2AYMA 1XMBA 2OAUA 4G1PA 3RJMB 3FEYB 1Q0NA 1U0HB 3H5UA 1YJTA 1ZA2B 3OBIA 3C19A 2KFYA 4DV2F 2HVZA 2E1RA 3UVJA 2V4JB 3ZO7A 3LF0A 1LK7A 3CCSS 3DLHA 2GQ2A 3POTA 5IS2A 3W7BA 2AGPA 2VZ9A 1VGYA 1NKCA 1RT2A 3KLGA 3BGOP 1HNWF 3DFEA 4LJMA 3HHNB 1VR6A 4X66J 3GJSB 4ECTA 3GMGA 2XZTB 2B6AB 3OW2R 4M5MA 3WX4A 2AJ0A 4FVMA 1MLAA 4B3RJ 4ZCIA 3PCOB 4KQZA 1HKAA 1U25A 3OL9A 3KMSA 2ILYA 4DV5F 2MKYA 2E1MC 4DQIA 3V81B 3AB4B 3WZ0A 1TL1A 1YJNS 4JI4J 2YBVA 2MHEA 5FIIA 3GG1A 3PEHA 4OLOA 3A1YG 5IC6B 3UQSA 4KFBA 4AL7A 2LQ5A 1AFJA 3HVWA 2LQ8A 2V6AA 5CCMA 2R8IA 4M5KA 3D54A 1FNXH 1RWXB 3HSDA 2AJ2A 4L3NA 1I94J 4TQRA 1LWCB 5K8PA 2N3OA 2F40A 2N4CA 3HKWA 3OTBA 2KFNA 2JOQA 3SDEB 5DQHA 4K50A 5IT9Y 5GMDA 3IO1A 2GV1A 1YRTA 3FFIB 4NZ7A 5IQ6A 3SYZA 4YR2A 2HNDB 4PRFA 3KNAA 4ZLPA 4DFMA 3CDAA 4I56A 4KKOA 1VQLS 2GA7A 4ID5A 1WSVA 3H4BA 4OYOA 4LBHA 1G6BA 4DR5J 4URSA 4A48A 1JJ4A 2VOOA 1OY9A 2OPSB 2NUHA 2OPRA 3NAIA 1KTVA 1KVKA 5A6PA 5JUMA 1VIXA 4OHZA 5J2QB 1S9GA 1X4CA 3BH6B 3BKFA 3VAFA 1LWFB 3FCVA 4WWSA 5I42B 1T0TV 4LF9F 2P2CB 4PXBA 1ZS6A 1GQEA 1RK8A 1BLUA 1N34J 2HRTA 5KG0A 1Y5NB 4YB1P 3TP2A 1JIHA 2LXFA 3AA8A 1U47A 1RWMB 2VH7A 4ICLB 4Q8FA 2XY6A 5GAGI 2ZM6J 5LXRA 4IRCA 2DNNA 4NZ6A 3HZGA 4ZMMA 1B3TA 2F8MA 3A3NB 1HHTP 2KI2A 3M30A 1YTYA 1OIAA 4LFBJ 2Q6BA 1RCXB 2WVDA 5AE2A 5LSOA 2GS8A 4K4YA 3J7A1 3KLFB 4ZVSB 1HI1A 2GVZB 3ET6B 1RWPB 4PR6A 3BBCA 1M5VC 3OR1B 4FXVA 3J7Z5 1RLDA 4IG3A 1NK6A 4O3QA 1YZ7A 3PRBA 2BE9B 1RAFB 4EEYA 1UW4A 3AHPA 2BW2A 4DPWA 2RUGA 5L39A 3QWUA 2QLBB 2MGZB 4ATNA 5ETVA 2OPPA 3T5LA 3DLEA 1N5YB 4YY3F 2VQEJ 2YKOA 4Y28C 4Z7CA 1SJRA 3UDEA 2GHVC 3R7NB 4B17A 1OMSA 2KVQE 4UZBA 3KJVB 4WFXA 1HA1A 3F41A 2J9EA 5LSLA 2F1FA 5JXSA 4DF8A 4PWDA 3R5BA 4KYZA 4FBUA 1SUQA 3POTB 4L73A 1K8AT 3MEGB 3VF0B 4ETXA 1RT2B 4X65J 3KLGB 2ZKUA 3R27A 2HWHA 4KV8A 1IKVB 2QLFB 2XMUA 2FPHX 2HNYA 2KT3A 2XMAA 2M3DA 4U7UK 1IJFB 3NWGA 4L74A 1YRXA 5GMEA 3U7JA 1UJ6A 5L1KA 5K5MA 3VVUA 1NZAA 4EBCA 2QT7A 3C16A 4JI7J 4U9RA 1UL3A 4Y6IA 9RUBA 2A2DA 4NMLA 1YI2S 3P6YC 2V9WA 3UWTA 3I0RA 3EWGA 3E3XA 4IKAA 5KT6A 1TL1B 3SCLE 2R7UA 4OYIA 2I2YA 2RNEA 2B9YA 4KFBB 3UPFA 4ED1A 5LMNF 2FZGB 1JWWA 1A9NB 2UUCJ 2F3JA 1S97A 2VODA 2M7SA 1B0TA 4LRCA 2DIUA 4TVAB 5DG7A 4WK3A 1J27A 3M1VB 4LREA 2QC3A 4DSEA 2DR7A 3FCHA 3CJQA 2V0NA 2CAJA 1H98A 2BMBA 5ETPA 2H3EB 5IQQA 2MEWA 2MLYA 4ZDNA 2NSCA 1DBDA 5DGAA 1JNZB 5IV3A 3MMCA 1RT6A 2ZH2A 4I67A 4KKOB 3NNCA 3KK2A 3RAMA 5KFAA 3J81U 4C98A 2NUUG 4P7TA 1VQ9S 4ID5B 2J5AA 4RL1A 2QFIA 3HI9A 3BSOA 1UEKA 1RU1A 4CLZA 4RU9A 3IRWP 2OPRB 5B08A 2IDEA 1AT1B 2FJWA 2WBRA 4XAKA 4QIEA 5HL7Q 3IS9A 3QT8A 4AYBD 1GXTA 5RUBA 1EP4A 2YWGA 1U6ZA 1VBYA 2R7SA 4NLRA 1AUSL 3QFWA 1HMVA 1BWVA 4C8KA 3I96A 5H9EK 1J5OA 4LSNA 2DT9A 2C28A 3AB2B 4ECRA 3DKDA 4NLWA 4AQYF 1G4CA 4B9MA 4TYAA 4OZ2A 2B9XA 2V5HG 2LU2A 2R7RA 3P4UB 1S4EA 3QAUA 4ES2A 2N82B 4U7UD 1MW7A 2CQBA 1RWUA 3PJWA 1RT7A 4P71A 3THPA 3GSDA 4HKQA 2BOAA 5H9FK 3CT9A 4RNFA 1V3SA 1T3NA 3BDPA 1Q95G 4URQU 1HNWJ 2RT3A 4ZITA 4NLXA 4O0NA 2HAFA 3M32A 1F9HA 2QYCA 5LL6d 2SXLA 3OJUA 3N28A 1WSRA 2L9DA 4DFKA 3CCRS 5K14A 3UN3A 2I8EA 4RW6A 3HMJG 1C1BB 5D6GA 1M0SA 2ZD1A 4DV5J 5F8JA 4F2SA 3U1MA 2FHOB 4IG3B 3JTPA 2MJUA 4LFCJ 1SIZA 4ILRA 2B7BB 2DGTA 2W2NP 4R5PB 2DISA 3G8TA 3KLHB 3DLEB 1QAJA 3KMQA 3A4TA 4PQAA 3RRGA 2XEXA 4DQPA 2A10A 4K4SA 1RACB 4K0KF 4PUOA 3M8PB 3ZXWA 4EUVA 3QJLA 1N48A 1U8SA 3A3PB 4ID8A 4F26A 3OTOF 2QSFA 5D77A 3T6JA 3EVOA 5DO2A 3OXGA 1I6JA 1Y5IB 2AJFE 3G71S 4DN0A 4KV8B 2VFTA 1FRMA 2VG7A 3ENVA 2VICA 3R6LB 4ENOA 3CC4S 3EGWB 5L1JA 2WOMA 3NMRA 1X8DA 2CNOB 2KZZA 2R8KA 2R7WA 4YUDA 3HJVA 2FHJD 4I2QA 2H9ZA 4A8SA 1I51B 2AYEA 3Q0AA 1WC0A 2IC3A 3QBCA 1U6BA 3F56A 5I3UA 3I0RB 4ZLJA 1P9YA 5F41A 3DRRB 3HFKA 4J37A 5F0WA 4GVBA 2PEHA 3QO9A 4NLGA 4WFZA 5E3AA 3GONA 3R5JB 5KFMA 3KK1A 2N7CA 3K5LA 1VBKA 1SKSA 3L3CA 3DU6A 3BJYA 3FSXA 4A4JA 3CMES 2JEFA 1RI7A 2MKCA 1N5VA 3W60A 1WKKA 2H54B 4Z37A 2HWIA 1D3WA 1N33F 4O3OA 3Q83A 2EVZA 2EFNA 1NMEB 5D4LA 5KFCA 3OJSA 3SZ2A 3GIIA 3SIPB 3DI6A 5KFQA 5LMUF 2LVWA 3JSBA 8ATCB 1U1RA 1Q1KA 1TVRB 1UVMA 1JK9B 5AXKA 2RH3A 3KK2B 3CJTA 4U67Q 1VRTA 2HQGA 2Z2MA 5IM0B 5IT9U 1JLGB 2MTLA 3J7YU 2XCPA 1D09B 5CQGA 4PQUB 1F9FA 4EK2A 1LEOA 3VAHA 3AFGA 3BKUA 1K1QA 4DR2F 2QMXA 3BB5A 3IS9B 3HHLB 2MQLA 1CVJA 3LP1A 3S1TA 2ZZTA 1ZAXA 3W64A 1UVKA 2RILA 2W4PA 3Q8RB 1HMVB 3K8VA 1K9MT 3IWLA 4YY3J 4DV1J 2HHPA 2FHKA 1Y10A 1H38A 1J5OB 2Q1LA 4LSNB 1GH8A 4QR2A 4ZHRB 2I0XA 2OEJA 2DCUB 5D4PA 2FVQA 1QJHA 4M63A 4UY85 4A8WA 2G2OA 4NPOA 1HWLA 2GIQA 3FZ2A 4EI2A 3OSNA 3GJTB 4NWBA 2DNYA 5KT7A 1FKPA 2X1GA 3UFCX 2VPZB 2K3KA 1U1NA 3JAMY 4WBFA 2ZE2B 4NYOA 1SPBP 1BWEA 1SI9A 2F4FA 3VVTA 3QT7A 2C2NA 3QSYB 3LWMA 2VBWA 3MZIA 1TAQA 3ZFVA 4IRKA 3GP9A 1RHMB 1R0AA 3M32B 3C8YA 1HNZJ 4USMA 4K5SA 5HVGA 4WK1A 4WTOB 2KRBA 1IBKF 2CVEA 4DS4A 2CQGA 3GWCA 2LECA 5K14B 3GV7B 3EZUA 4RW6B 4LRDA 4CRJA 5IWAJ 3DRSB 5AE1A 2W4CA 1LFWA 4DR7F 1NB2A 3E8OA 1T11A 2HK2A 3TZWA 2EFVA 5KFFA 3ELHA 4ZPCA 1F1BB 4PAAA 4EZ9A 1N8RT 4C97A 1MROA 3NOGA 4S0MA 2GGPA 4B02A 2ZH1A 4F0KA 3G96A 4M5NA 3TAPA 2RHQB 1WI6A 3EVMA 4PG6A 1BQXA 4JOUA 3BO3A 4WYLA 5K8MA 4Q0BB 2DGOA 3HPOA 2B43A 2HGMA 1MMDA 2C42A 2JWNA 1FNMA 1VISA 5IV4A 5J2PA 2FLPA 1YITS 1FK9A 1OS5A 1D9AA 2LEBA 3LANA 2U2FA 3CXCR 1S1VA 1SJ1A 4JUZA 3HHLD 2AD9A 2BKPA 4FF3A 3MUMP 2WOMB 2QA4G 3IBWA 3KLIB 5DDOC 4DR6F 2H5IB 4I2QB 2YQ0A 1RWKB 4IQMA 1H7WA 2KZMA 1S4FA 2DNGA 4OI0A 1JNRB 3E2EA 2WZ1A 4TU7A 5C7PA 4B3SF 4GVBB 4LSLA 2EPIA 2MMYA 2VG6A 3QO9B 3CCES 4J9QA 3HSJA 3TOQA 3D7SB 3OLAA 3NNAA 1WDDA 5C42A 1DTTB 3CB4A 3UNGC 3R7BB 1VQMS 2MKHA 3H90A 4X4SA 3NGRA 4KBIA 4KAIA 2O66A 2H1YA 3RBEA 1H0HB 1VHIA 2JSXA 1ZH5A 1HNVA 2HRUA 3NP5A 4K2JA 2ZJRQ 4RLEA 4JI1J 1UVNA 2V8GA 3J7AN 4OZ1A 1HI8A 5AXLA 5BYQA 2OLWA 2G0CA 3DI6B 3OUYA 1LW0A 2P9CA 5D0RA 2XY5A 2HHVA 4CQ1A 2MLZA 3MUTP 1D8ZA 4ZVRB 3HM9A 3DM2A 4ZP7A 1TV6A 3PHTA 3PW4A 4UT4A 2HVIA 4C6AA 5CYJA 1X60A 4IDKA 1JLBA 3AAWB 3E01A 3QSIA 4OYAA 1XMOF 1JKHA 3KYLA 3DLLQ 3K5MA 1OPIA 4ECYA 4A8OA 2BJ1A 3PO5A 3LH2S 4OYMA 3LP1B 3KJQB 1M1GA 4NLSA 4RW8A 4MTPA 3MEEA 3GPAA 2YNIA 1X5SA 3QMQA 4FN5A 6FD1A 1N4LA 1SBRA 1Q16B 2MLXA 2HQIA 1BD6A 3L7UA 1S10A 1AFIA 1C0TA 3O5TB 3UCUP 2VU5A 5DQIA 4DFJA 4PKDB 3M2VA 1NNDA 2IRYA 1DARA 3GLJA 4DLGA 1HLWA 2HHQA 1GFWB 3U1LA 1FXLA 4M5GA 1WC1A 2C2MB 1WKJA 4UOGA 1CC8A 4CM0A 5KFNA 5ADZA 4B9SA 4NL5A 4NYPA 2PMHA 4CO2A 4KT0C 2G13A 4RBUA 3OHBA 2CQHA 3K58A 1SH0A 1XIQA 3U02A 1T02A 4TYBA 3GE9A 1FO1A 2CA9A 1JMTA 4JV2A 3M6UA 2FY8A 1VBXA 2C2KB 4QCLA 4F4AA 1PYOB 2VOPA 2RRBA 2DNHA 1KD1T 2NR0A 3EX7B 3NGSA 1FE0A 1U1PA 4ZS6A 2ADBA 4NI2A 3BREA 3DDNA 1HQEB 2VJUA 1K44A 1YJ7A 2HRYA 1F9EB 4ECVA 1E6VA 2ALZA 2WCXA 3MM5B 2BJ9A 2C1EB 4DV0J 4RPFA 1R8CA 1NDCA 5KAKA 5E0OA 1LWEA 1X9WA 1IBMF 3M6WA 1ULRA 3QATA 1NHVA 4XDCA 2MJNA 4NLPA 4BBYA 2YQ3A 4OV6A 4C4WA 5ETSA 1N33J 4YHHF 2JJ4D 1UVLA 3G4SS 2E1AA 3RBXA 1SB6A 2C3MA 2FJAB 2PGCA 2DR5A 5J2PB 5EX3A 2RU9A 5J2NA 4D3GA 1XMQJ 2IJFA 4HR2A 3UI3A 1GMWD 3MURP 2J8SA 1YQHA 3OFHA 4B08A 2FDNA 1TMJA 2VC1A 2HAIA 5F8IA 4J9UE 1VQ8S 2FGCA 1IBLF 2LDYA 2BANA 4MH8A 3OHAA 1FFGB 4DSIA 3BF4A 3MM8B 1RTJB 1FF2A 4LIWA 3D1HA 1RABB 2BUNA 3AXMA 1DQ9A 4OX7A 3QJPA 4LSLB 2VG6B 4KO0B 2ABYA 1K0VA 3RR7A 1X4AA 3J81j 5C42B 4DBQA 1SJFA 4YDXA 1B0VA 1LK5A 4DU8A 2QL9B 5KOWA 2BJEA 2IJNA 1JJ2R 1DRZA 2M4MA 5JVHQ 1VQKS 3P8BB 4QR1A 2JLFA 1HNVB 2ROGA 4TY8A 1UWBA 3M9OB 3SV4A 2HVDA 3M8SA 4YS2A 4E98A 4X4PA 1IXKA 4A8FA 4CT8A 4NLVA 5DLGA 2CPXA 1MSWD 1LW0B 2UXDJ 3NS6A 4ANCA 2XTJP 3FSYA 4N8NA 3ZTPA 2RD5C 3QQCD 2GJIA 3UR3C 2XBPA 3IWXA 4DPUA 2DO0A 2IAJA 2W7PA 1RWVB 3DM2B 1TV6B 3PW5A 4XIUA 4WP8A 3N0VA 5M2RA 2MKJA 3TZYA 2XO6A 2H51B 4FPIA 2OD4A 2J0QD 3E01B 1JKHB 1L5UA 1B64A 2HWTA 3KNGA 2B3TB 2DGVA 4F4XA 4DR7J 2FZCB 1F3FA 4RW8B 5L1LA 3C2PA 2O5DA 3QAEA 3I5AA 1AYEA 4RKUC 2C3PA 1C0TB 2GZOA 2OSRA 5HMXA 4ED4A 4USKA 1W25A 1NK4A 3HSZA 2QA1A 2GQCA 4N5SA 2IYIA 3BPDA 1TK5A 4EZ6A 3JYTA 4OZ5A 4KGZB 1NH7A 3CE8A 2WRMA 1RWNB 2GIFA 3IR7B 2HZCA 2X7IA 4BS2A 2HNZB 3RB6A 3D66A 4L3KA 3M2RA 1YBUA 4I1TA 4KPCA 2A2CA 3QRPA 2JNJA 3FZBA 3MTKA 1UA1A 2B5JA 3MUVP 1HBOA 4M94A 2RE1A 3M9NB 1OSCA 2ASDA 3S8SA 3FBCA 2WAQD 2C2OB 3ILJA 2HLTA 1Y0HA 1SVDA 4OHVA 3EPGA 3CD6S 2DD8S 3G2XA 1NJIT 2BRKA 1Y3KA 3DRYA 4B3SJ 1YJWS 2CPEA 3LA0A 4LF8J 4X64J 1ZPWX 1XJWB 4JI8J 4GKKF 2IRUA 2XG8A 4CLTA 3M8RA 4RWXA 4HACB 1WTBA 2XGPA 4AXIA 4HL9A 1E6VB 3OVBA 1QE1A 1R8PA 2LXIA 3C14A 2AYGA 4NRUA 5KG1A 1EHWA 2DHXA 2APOA 3CCVS 2F4VF 1RJJA 4EWTA 4N76A 3T6BA 4NLUA 3A8IA 5D3GA 4A8XA 1BQNA 2DR6A 4M5LA 4EYIB 1ZZNA 5J2NB 4QWCA 1GX6A 3MFHA 4K4WA 1KNZA 4X2BA 1HHSA 4OZNA 1S1XA 3WIVA 2DEJA 2BYCA 5CYMA 1JLFA 2BW7A 1IM6A 2ZC4A 5DG9A 2Y1JA 4FVCA 2H5JB 5GAGU 1XMOJ 4V19J 2IM0A 2BANB 4Q5VA 3AT1B 3AJ1A 5L46A 1WC5A 1NKBA 3TA1A 4HDGA 2D3O1 3HDSA 2GO8A 2XI3A 2L41A 2J9CA 5GADI 2FHMA 3TA2A 1K73T 2J6UA 1N5TA 2DIVA 4J9MA 4LMZA 1TP7A 1JXLA 1TZ0A 2BA9A 4N47A 5D4NA 4X4UA 5KG6A 4Y34A 1JXVA 5DDPC 1ZM4A 2UVRA 4OZ3A 1S1TA 2ASJA 5HQ8A 2OELA 4FS1A 1KP6A 1KRPA 2PO4A 4BC7A 4C8NA 3T5JA 3TEHB 3ZZRA 4C0HA 3GG0A 1XNRJ 2DHHA 2NZCA 2EG1A 4O3NA 2XS5A 1B99A 2DK2A 3CNQP 3G8QA 2QYGA 2HBZB 2YPYA 2FJXA 2HMIB 4DPTA 3QT6A 1KC8T 3ISZA 4H4MA 3CDEA 1S1UA 4IUFA 2O1PA 3VWSA 1NK8A 2YX1A 1S0NA 3I0SB 2GIRA 4NE9C 2IAJB 2HK3A 3TYTA 1UMJA 3C6UA 3HT3A 1VDHA 5C25A 1VQ7S 3OFGA 3SQGA 5L8RC 3NG8A 2ZOGA 1PG5B 2YVSA 3DN9A 4MK9A 2RB7A 1AROP 3TAMA 3P3DA 2ZOMA 2DNOA 3D67A 3MD1A 3UW1A 2RHSB 1HW9A 4LF6J 4H4KA 4L75A 1U1MA 2W2QP 2M8HA 5AE3A 3CCWA 2W8KA 1VLOA 4ETZA 2YWFA 2H4WB 5LOQA 5DM6Q 3KG1A 1TKDA 4U8YA 3ILIA 1IBMJ 4WXOA 3DRXA 4DS5A 3MPVA 4AL6A 3RGIA 4YHHJ 1GAOA 2XLJA 3BR9A 4F7VA 4D3HA 1WACA 2DCLA 2W1BA 3NGTA 3JYTB 1UAWA 1NSKL 3DHXA 4I6WA 2HHXA 5KFKA 2J7UA 1NUEA 4JV5F 2F8EX 3J7YI 3EZOA 4DPYA 1PAUB 4DSFA 2DTJA 3AD8C 2I1RA 1X4FA 4Y00A 2PE8A 1HPZA 3LGNA 3U27A 2B5JB 1HBOB 2W9BA 4Y2IA 4NEZA 4KGKA 3D6HB 1UFKA 2AJQA 5LXYA 1EQMA 1CJKB 1WOPA 4DG1A 5HROB 1U49A 4XO0A 1AXQA 4FDFA 2I9SA 2V8HA 4QR0A 5SUHA 3MI7X 1KN6A 4F02A 3Q24A 4ZJQA 4K4UA 3OXFA 2KM8C 1YBTA 3TW0A 2CNLB 4JV1A 3SSQA 4GC7A 1SL1A 2CPFA 4BDPA 5E41A 1IM4A 1SQFA 2DGQA 1QE1B 4LVNP 4P73A 3EVWA 2WSEC 3GJQB 1HD0A 1SC6A 1HARA 2HKEA 2WBMA 3C14B 4ILLA 3CDWA 3ZZ0A 3ZTQA 2AEJA 2QSWA 1JX4A 1QD1A 3U1NA 2V2QA 2FB0A 3VCDA 3NCPA 2MY8A 1AW0A 1JLAA 4H54A 2HFUA 2JC1A 2AJ4A 1FX2A 1BQNB 2ZNZA 3EXYA 3LGHA 4ERDA 2POKA 3M4XA 4DHVA 2CPJA 1RWWB 3TANA 2B7CB 4Y2MA 2KXFA 1KLMA 3MOJB 1S1XB 3IN5A 1NK0A 1QM9A 1VYAA 4GKJJ 2PC6A 2CYYA 3AQOA 2JHEA 3OVSA 3BBFA 2J9DA 1M5PC 3KUEA 4X66F 5ETTA 2M52A 3VAJA 3CCUS 2HHTA 1UFLA 1JLQA 3A8JA 4I68A 3NAHA 4UUXA 4DZDA 3PYGA 1RKJA 3BR8A 1QTMA 2IMWP 1PCAA 4LF7J 4B3TJ 3BO4A 2ZITA 3QGHA 4DL5A 1SJ4P 2H65B 3FKBA 4J9KA 4DU7A 2C2DA 1S1TB 4QBUA 4UUWA 1NSQA 2MKIA 4JI4F 4RNHA 1R31A 2BE2A 3N5FA 2YWHA 1CULA 2YX4A 1GXLA 4QZVB 2XI2A 3RAXA 2B0GA 1U26A 3HP6A 4IG0B 2P9EA 4CLKA 5D4OA 3TZZA 3UD4P 5K9FA 1B4SA 2CNKB 1IR2A 2NPFA 3OD2A 2B4OA 3EPIA 3GCXP 2LQBA 5C5JA 1T9TA 3AA9A 4M5JA 3DXSX 1S1UB 2CDRB 1RT3A 3R7SB 2AW0A 2WHOA 2VJVA 1U1LA 4YQWA 2XGQA 1YIJS 2DGUA 3C6UB 3R5AA 2IVYA 3TO8A 4E8UA 4DR1F 4FNIA 3F44A 3N79A 1Q7YT 1UFWA 5C25B 3FDSA 3CEDA 2W01A 3SQGB 1VOMA 1OPZA 5KFPA 5KFEA 2ZUAA 5ETOA 2WB1D 2GJ2A 2D41A 3O6QA 1PGZA 4WFAQ 1S0OA 4K2XA 3HHDA 4GKKJ 3M8WA 3CJ0A 3SBMA 1YGYA 1DAXA 3RG6A 1S6UA 1Y11A 3CCZA 2R4FA 3JB9k 2FJVA 3M8YA 1U48A 3JSMA 2JDJA 3MGJA 3DGVA 1U1OA 3J80Y 1RXOB 2HQFA 3DOKA 5E5NA 1WG5A 1X5OA 1UETA 4HTJA 4L6V3 1XEZA 4YR0A 4N8OA 7AT1B 2DITA 2PMZD 1N34F 4G65A 1IUJA 1MWYA 1U0HA 3KDNA 1NK7A 2BM1A 5LSRA 3AODA 3JQJA 2BVZA 3V2UC 3BBBA 3S6EA 1TKTA 2V34A 4FYVB 2V4JA 2PD1A 1F5AA 3QGPA 3IBCB 2AGOA 1KEKA 2R7OA 4OQJA 1H7XA 1RADB 2C2RA 2NPIA 1MN7A 1WHYA 1RUSA 3W5YA 4Y2KA 5A2QY 3B4DA 3PKMA 2PSZA 1X0FA 4HI2A 2I5JA 4FF1A 1T9WA 4FNHA 5FD1A 3PYFA 2CQ2A 4FZVA 5IOLA 4Q44A 1UVJA 4URGA 3O3LA 4OL8A 5CXTA 1XBWA 2ILZA 1NEEA 4CLPA 2YKNB 4OHXA 4ZPWR 1KKHA 2DH9A 4OV1A 2CRLA 1JLAB 4ED0A 5KFGA 2CQ0A 1ZTWA 3DC2A 1S76D 2ZH7A 5H9EJ 4RNMA 2YKMB 5DRKA 1PKUA 4J9OA 3LP0B 5JVGQ 3EM1A 2AEMA 1NPKA 1VCTA 2CQDA 4C3MA 3FMWA 3IAM9 4HVZA 3A8EA 3W65A 2IFXA 1U2FA 2A18A 3FFIA 3TVKA 2HNDA 2MKSA 2FYXA 4X65F 4QWDA 1KBRA 3BGRB 4P2FA 4DN9A 4DQQA 1GNKA 1KTQA 4YB6A 4WKRA 4ZVHA 3W2VB 1PC5A 1JLQB 2OPSA 2EFGA 3W8PA 2BABA 4JI7F 3HO1A 4RNOA 2ZJPQ 2ZH3A 1T95A 3NGDA 5J2QA 4B3OB 4CLYA 2MZJA 3TAQA 3L4BC 2ZZMA 2HFVA 2BXJA 4MKBA 5F8NA 1WDTA 1NPRA 2BE2B 2G0IA 4QQBA 1CULB 2BZ2A 2JVOA 2KG0A 2PMWA 1HW8A 1HI0P 3HHKA 4A46A 1Q8BA 5HLFA 2OP5A 3DMJB 2ZBPA 1GXUA 4ICLA 1R43A 2OFHX 3MM7B 4TXSA 4LBPA 4QW8A 1QAXA 2DGXA 2LU1A 4F4YA 1RT3B 3UE2A 2B9EA 1DZ5A 2OMOA 1VRUB 1FKOA 3KK3B 1Y9OA 1WF1A 4NXMJ 1WF2A 2RVJA 4TLQA 4C8MA 2XMJA 1TL7A 1TMMA 2K7KA 1YX2A 5B0EA 2QX0A 2AX0A 4RX6A 4BWMA 4IOBA 1FJCA 4RW9A 4OIXA 2G2ZA 3UD5A 3MM6A 2WB4A 4LSZB 4ZCKA 4A8QA 3ET6A 1GK8A 1YVFA 2JEJA 3GCWP 1S6PA 5HMWA 1UWAA 2BJDA 2BKNA 1QSYA 1KQFB 2QMUB 1SL2A 3CGIA 2FD2A 3OL6A 1HNXJ 3FBEA 2IM1A 4USVA 1V3ZA 3KXDA 3CD0A 2MGZA 2Q43A 6FDRA 2BJ8A 2J7KA 1XR7A 2Y8WA 3D5MA 2JX2A 1F5BA 2IIHA 1V3RA 1UVIA 1GTHA 4QW9A 3Q86A 1D0EA 3B82A 3K57A 1D9FA 1KS2A 3CIZA 3N4WA 4B9NA 1GEHA 3KJVA 4DJBA 2DVIA 2OD6A 2ZOFA 2EFOA 5B0DA 4J9PA 2PI4A 4F36A 1S57A 1TKTB 4DSJA 3RBDA 4YOEA 1R8AA 3DLGA 4NA3A 4UZCA 3JQKA 4NYZA 3CJKB 3P45B 4RW7A 3MTJA 2R3VA 5K8NA 1NO8A 3MEGA 3TEGA 1UW9A 2FLLA 1FA0A 2AP6A 3K17A 2VBYA 1IKVA 3B54A 4IO9Q 2LXUA 5GVQA 4DSLA 5GAEI 1RHUB 2CPDA 2Q3PA 1U6FA 2ZFHA 1SV5B 3IP0A 4PG4A 4DOZA 4C8YA 1UZDA 2EK6A 1QUVA 2I5JB 3T3FA 4NRTA 1A7GE 4ZPAA 1XN9A 2W25A 3ADAC 4TN2A 3MCNA 1EARA 2CJAA 1R6VA 1IWAA 2W2PP 2WSFC 2AJ1A 1R7IA 4DR3J 4WZQA 3NNHA 3SSSA 5DDRC 5KFIA 3Q22A 2FJEB 3D3BJ 2E5HA 1FI4A 4LFCF 3H5SA 4PWUA 1ICEB 3R6GB 4CT9A 4M5IA 1REVB 3N5BA 2DNRA 5A8KA 2V9KA 1FCAA 2JL9A 2VL1A 4ZVTB 1RAEB 1T94A 3G82A 3AY0A 3BS9A 4KPYA 1XK8A 4J9LA 3MOZA 4RZRA 3H98A 3NBPA 3M1VA 3UD3P 1X31C 2XWYA 3UDCA 1VQNS 2F63A 2KJWA 1QSLA 2L3MA 1H74A 4DL7A 3CCJS 2KXNB 3BGLA 4DR1J 2MZTA 1FX4A 2DRAA 1FD2A 3C15A 4ED8A 1PJ5A 4BC9A 1X0PA 1RAHB 2DO4A 1IN0A 1R0BG 3AJDA 4CLUA 1QSSA 4F04B 4ZP8A 3PYDA 5F3ZA 1RKIA 5BR8J 2Z8QA 1TUWA 4IR1A 2VQFJ 2IA6A 1J5EF 1YWXA 4MK8A 4CLLA 1HBUB 1FRXA 3Q8YA 3ZZYA 1K1SA 1I1GA 3QGGA 1E6YA 4ZN3A 5CCLA 4F0HA 2E29A 2FC8A 2Z58B 4BLGA 2AEFA 1NDLA 1IR1A 2FHJA 2JZ5A 4F0MA 3EGZA 3ZTOA 3GFZA 5EX0A 3PYEA 4NOHA 4C8LA 2YNHA 1RB0A 1N56A 2MQ8A 2GJFA 3RB0A 2R8GA 4U8VA 3QGIA 4OI1A 1ZETA 1NJZA 3IG1A 5HMZA 2FY1A 5KFYA 5HLFB 2IHR1 3I55S 4DCJB 2ZKTA 1M5SA 3KHHA 1FKOB 4QPTA 2RU3A 2RSQA 4CZCA 1VBZA 4LQ3A 1TL7B 5D0GA 2UUBF 2O3DA 1ROFA 1DTQA 2RAQA 5CA5A 4ZPBA 2ROPA 1FXDA 4CLWA 4JBCA 4O4GB 4RW9B 4YB5A 3D28A 4WFNQ 4WU3A 2VFUA 4W92B 3MM6B 4CH0S 1C1BA 1GT8A 4CWBA 4DPXA 3TVYA 1S6PB 2YH0A 2V68A 5HQLA 2Z56B 2A1BA 2UXBJ 3MAAA 1EX8A 1RP5A 2KYXA 4DEZA 3UNYA 4R5PA 2KU7A 2Y1RI 3SFGA 1RAGB 2C3YA 3GILA 3KLHA 2L08A 1S1WA 2F9DA 3IA0A 4CO1A 4DV1F 3PY8A 4M5DA 1VS3A 4FKXA 4ED6A 5DZ6A 3H8YA 4PEOA 4LBIA 1IQZA 4WJBA 5LT5A 4C11A 3K5OA 1P9QC 3M8PA 2YKPA 2HFNA 2CJXB 2UV8G 2JC0A 2LEPA 1HWKA 4F67A 2EG2A 1FJGF 4I7FB 5KT3A 2Y0BB 3PZPA 3DLGB 4OJGA 1FEHA 2XMTA 4RW7B 1K47A 4YN3B 4ECZA 4I4BA 3GIKA 1F0XA 3TJ8A 4LFAJ 1FWKA 4TY9A 1P6TA 2QG9B 4OYPA 4C3LA 3TARA 3MD3A 4DUYJ 2AQ4A 1HNZF 2XS7A 4FKYA 4DX5A 2V8VA 4JYAJ 2PI5A 1UEUA 2AT1B 4ZVGA 2RQ4A 2W24A 1NZ8A 2PN6A 4O3RA 3LPYA 5DETA 1XNQF 2P8IA 4CIOA 3PX6A 1U0SA 5IWAF 3DRRA 3I6PA 3O1LA 1LW2A 5J2MA 2FVPA 2KO1A 1FD8A 3FCWA 5A2QU 4ELTA 3DOLA 2HHHJ 4ZJLA 3KHRA 1MG7A 2EKNA 3N6MA 4JI0J 5HK4A 1HBNA 2DNPA 5A8KB 2W9AA 2Y9HA 3K59A 3Q23A 4DV4F 1OO0B 7FDRA 2XQCA 3G82B 1X9SA 5HBMA 3CJ8A 1UTAA 4M8LA 4P2SA 2DH8A 4DUTA 3NBPB 3SXLA 3CMAS 3THTA 2UUAJ 3V6KA 2I38A 3CWJA 1M5KC 4DCPB 1S0VA 1OQ3A 2LYVA 4LRAA 3TJAA 4ZCMA 3SCKE 5KFDA 3C15B 3DRPA 1FTRA 1TVRA 3MECB 1UCNA 4A8MP 2UVUA 4CYUB 5IM0A 1C0UA 3N6LA 5M2UA 3EMTA 2EXUA 1JLGA 4KIAA 3ZZZA 2NQPA 1I3OB 4PQUA 3TJ9A 2ZBRA 2DNQA 1FDNA 3W3SA 2F7VA 2GMHA 2ZH8A 3DDIA 3PIPQ 3HHLA 2ACYA 3CJ3A 2ROEA 1NK5A 2J6TA 5KG2A 4C9DA 1N6QB 1NJXA 2DYAA 1D1UA 4WFYA 3BH7B 1E6YB 1S7IA 4G1IA 4C3KA 3H20A 3X3UA 5D8HB 1PYTA 2MQPA 4JI5F 1U02A 3MEKA 4PPZA 4NASA 2DNZA 3G6ES 2YNHB 2OGUA 3KTQA 1FFWB 4ZHRA 2QL7B 1EJ7L 3IG1B 5A8WA 1U8WA 5KT5A 2LA6A 3E51A 4C2MA 4RNNA 2PDAA 3ILLA 2LEAA 2A6OA 4JI1F 1U7LA 1N0UA 3T1YF 2ZE2A 1CSJA 2E9ZA 1SH2A 2KYZA 1ZZFA 4UOFA 3PVXA 4ED5A 4KH0B 1VIOA 3L7OA 4DQRA 4B9UA 1DTQB 3OL8A 3BSCA 2W9CB 1XR6A 4OZLA 4W90B 2VPYB 1G2EA 4JI3F 5AJ3J 1NCLA 2WONB 2CZ4A 4W4MA 2K3IA 2DY1A 3IRXA 4LUBA 3DRSA 3ZTSA 3EICA 4M95A 3L9ZA 3BKTA 5HQMA 3R97A 3RB3A 1UKUA 3MAAB 2RQKA 1Q8KA 5L38A 2XLKA 2G0JA 4QIWD 3VTIA 1YDLA 1S1WB 2HFSA 2CUYA 2VG5A 1RT4B 4M5DB 5GADU 3BYPA 4NCAA 3PHEA 4Y0FA 3D6MB 3N01A 4CDIA 3I9V9 4Q0BA 3P5TL 4KGXB 2E1PA 2MHNA 2OMLA 4Y3CA 4C11B 3QPIA 4CM2A 3MAHA 2HVEA 2GCFA 2EFQA 3PX0A 1JJCB 2IRXA 4K4ZA 3UDLA 4JI6J 3GFXA 4MJKA 4LF4J 2EWHA 3W9JA 3PRVA 3ONQA 2ZBIA 2QO3A 1H6KX 1RT1B 4TU8A 2X1BA 1Q7LB 3BO2A 1P27B 1M1KT 4USWA 2PT0A 1SXLA 4LVOP 3CD7A 5CYQB 5B09A 4IH5A 1NXIA 2KFZA 3BEGB 2FZKB 3UCZP 3NXZA 2RS8A 1BC6A 3KLIA 4JI2J 1J5EJ 3DXBA 2DXDA 2JVRA 3VHQA 2LLZA 2WW8A 4IRDA 3ZZUA 3FGVA 1KQKA 5HJYA 3B8HA 4CTAB 1NH8A 5J2MB 1X5PA 1LW2B 1NK9A 1UJ5A 2RJZA 4B9TA 2W2OP 4ZVOB 3DOLB 3SFUA 4QYZJ 5KFBA 3HCXA 1DTTA 1RWOB 1HBNB 4P6QA 1EKSA 2PIIA 3IM9A 1VJQA 3TUPA 4ZPDA 1JJHA 3S7RA 3V4MA 3W61A 4DV0F 3C3LA 3MR2A 5HBMB 4U96A 2VV5A 5C2GA 3B78A 4AUKA 3OFEA 1FVQA 1RHRB 3W8GA 2FVRA 1R3NA 5K8OA 4QU7A 5E33A 2D7SA 9ATCB 3C6TB 2K06A 3MM9A 2DEIA 4ECUA 3NLCA 2MY7A 4B9LA 5KG4A 1O6XA 2HZVA 2XZDB 3FEXB 4B3MF 2JFKA 5F9NA 2E9TA 3G9CA 4DPOA 2MZ1A 2GVDA 4IFVB 3ZC4A 3J81Y 3O8WA 3DRPB 5ETKA 1XMQF 3FMBA 4W98A 2UUBJ 1JLCA 2HBRB 4UQTA 4ILMA 2C3OA 2UV8A 2ATLA 2HS3A 1R8BA 1U09A 3AD9C 2OPQA 4GO5X 3HXMA 1ZBTA 4ZVUB 3H2UB 1C0UB 1FRJA 4PG8A 3GQCA 4KGVB 1S99A 3AXKA 2KXHA 1ZM9A 2KHCA 2IJRA 4HI1A 1VK8A 3NY0A 1FFSB 3LUYA 2V50A 4DV3F 1YJ9S 4DL4A 5J1NA 4P2MA 2ASLA 3IFEA 1GMWA 4QIGA 4G6VB 1F2HA 1DY3A 2GX8A 2RS2A 3M6VA 3WC0A 1V9OA 5KFVA 4CCHA 3VGTA 1IR0A 5F8MA 4DUZF 1ZPVA 1VLYA 4F8RA 3QIPB 2VC0A 2MXYA 5A8WB 2CQPA 1UP1A 4K4TA 4OI2A 1WWHA 3SV3A 4ZJOA 2D3OR 1WKLA 1FJGJ 3HLUA 4LR8A 2B4VA 4Q2MA 2CADA 4C8OA 3OT9A 5A8RA 1IJEB 1YK9A 4P75A 2GMJA 2EEYA 1UPPA 2UXDF 1YRUA 4F4ZA 3UN2A 1WEZA 4WF9Q 3GIRA 4PYDA 1NHUA 5L9XA 1CJVB 4DR4F 4OX9J 2HFOA 2Z0GA 5F0UA 2FJDB 2AGQA 3T1AA 2HGNA 1XNQJ 3MMJA 2BV3A 3IRXB 5KFTA 2OHDA 1PYSB 3VAMA 2XYPB 5ETLA 1HQEA 5CZXA 4UQGA 1EAYC 4KHMA 4KHRA 1M5HA 4MIAA 4O44B 2J7WA 4DV4J 4QOTA 3MM5A 2VG5B 2Z30B 1N36F 4YR3A 2XNRA 2MYFA 1FDAA 2NZ4A 4RBTA 2IDLA 2BACA 4X4VA 1S77D 1WG1A 4ZOSA 4NLYA 2HBYB 2HG4A 1BHNA 2ZWPA 3D9BA 2NSBA 4MFBA 1NU4A 1WHVA 3D1QA 3NOCA 3RRKA 1TU0B 1FWLA 1C2PA 4KTQA 4RUHA 4WKYA 4USIA 3M2UB 2J0SD 3CJRA 1UA0A 4BCAA 3I87A 1UPMB 5FDLB 5HI7A 3CJ4A 3RRHA 3TUJC 4NXNF 4C48A 3A13A 5CAAA 3SI8A 2CJKA 1L3TA 3MM8A 1RTJA 3TA0A 1Z2ZA 2M70A 4C0OC 3RU0A 5B0AA 2XYGB 4LF8F 2CPHA 4KO0A 2OIHA 4X64F 1LFPA 1KOOA 4JI8F 4ECSA 1JXEA 2R7TA 2G9OA 2X1AA 4JI5J 1CJTA 1APSA 3UCGA 4M1KA 1QAIA 3HD1A 4ZLNA 2DKOB 4PZVA 4RUCA 2ADCA 1VQYA 4CO4A 3D2WA 3MM9B 1RT5B 3I4HX 3PR4A 4J91A 3T1YJ 2B51A 2DHGA 2CIMA 1RBOB 1NPPA 3V6DB 2GVDB 4DXLA 1JLCB 1FJ7A 4LRFA 1NJYA 2QJ3A 3VV2B 2OPQB 2P6TA 3DHWC 3BQ1A 3QRQA 1OQ6A 2VPXB 1WJ9A 4JI3J 2GW8A 5CD4A 2VA3A 2PEBA 2NXCA 2AV5A 2CQ3A 2B8PA 3FRYA 5KFUA 4YDDB 2GMLA 1S9EA 3QZ8A 1SJ3P 5IT0A 3W2WA 4OYWA 1VI7A 2V63A 3MWBA 5T41A 4ECXA 2AZ1A 1NSPA 4ED2A 2JLGA 2V94A 2P9GA 3DOMA 2P5VA 2QA4S 2DXEA 3K89A 1GTEA 3CJ5A 1S5ZA 1XTZA 1L3KA 3LP2B 3Q8VA 3QFHA 3CDBA 1JLEB 2OFGX 3F73A 1X5TA 5B0GA 4TQSA 4CH7A 3A12A 4EBDA 3W63A 3NL0A 2IM3A 4DMZA 4ANEA 5D0HA 3KLEA 2UUTA 3MEDB 1RHJB 1XNRF 2RDIA 4WTYA 4OJHA 2LKZA 3OFFA 2MQNA 5A8RB 2HNZA 2D74B 5E3PA 3AOCA 1VQOS 5DM7Q 3CCLS 2VDIA 3BPSP 5E3RA 1HR0J 4IQXA 2UZAA 3HT0A 2OTJS 1XERA 3EE3A 4UF4A 3W9HA 2J8AA 1IKYA 3ENQA 2NLWA 1RA7A 2R7QA 1TR0A 2GFFA 2XSJB 1HD1A 2JFDA 5HSPA 1R0CB 4CLFA 4WP9A 4O3PA 3NCQA 1KOHA 2N7YA 2HEKA 5JJBA 4Q2LA 2YTCA 1SL0A 2IA0A 5LJ3Y 2XO7A 5GAHU 4X62J 1T9XA 4FXDA 1FRKA 2KL8A 4EYHB 1HFEL 3NKYA 4LF6F 4F3QA 5DLFA 4HACA 4DX7A 5C2CA 3DU5A 3HX9A 4OZJA 3KKFA 3G6YA 4P72A 3GR1A 1S6QB 4DV6J 3DLJA 1KSPA 4OJ1A 3GU0A 4CO0A 2W4DA 3Q2TC 1MMNA 1RISA 3CCQS 2AF6A 4HHJA 2E5LJ 1RA6A 2ZJQQ 2Z4PA 1VQ5S 3US5A 1SKRA 1L3SA 3KG0A 4B3MJ 4MFBB 1X4EA 2DR9A 5MLCV 4P7VA 4K4XA 3EJMA 3UVJB 3H42A 1AB8A 2EK1A 1YKWA 4X4NA 2AMCB 4LF2A 4ES1A 1BXNA 3WX8A 4EU0A 1RDRA 2HQCA 4R0EA 2UP1A 3D0HE 4ZP9A 1T9VA 2K2PA 2HS4A 4ZVEA 2LMIA 3DGPA 2FVSA 3C66A 4DV3J 2M9KA 2HHWA 2BOPA 2J0XA 2E9RX 4CO3A 2ASYA 3Q2SC 5B7WA 4OI6A 4Z7YA 1ZOTA 3IGNA 2FUG9 1VC5A 4P52A 3FEZA 4OHYA 2PA3A 4RBVA 2R2UA 4DQSA 4PG5A 3FNNA 3PX4A 2IVFB 1H3DA 1CJTB 4DUZJ 1UZHA 1LQ9A 4RR5A 3TNVA 4DWIA 2PA8D 4J5OA 1QUPA 2CQ1A 3QLHA 2BR0A 5IXUA 1ITPA 4DL3A 2DRBA 3R5GA 3OTCA 2G1HA 1TK0A 3GFYA 4IH7A 1FDDA 5E3CA 3A8KA 2IM2A 1RLCL 2JEIA 5E7OB 3DNCA 3T1HJ 2HMIA 3QJJA 1RTIA 3AD7C 3SQOP 4HHUA 3I0SA 3D6TB 4AXJA 2V2VA 3WC2A 2N4DA 5BJRA 2QLWA 1OYEA 2BBEA 4DR4J 4C7QA 3PG9A 2KB2A 3W9IA 4GKJF 2QLJB 2Q66A 5HN0A 2DPIA 1YG0A 3VGVA 1Z1ZA 3EGVA 2RRAA 3DDKA 1S9EB 3TUIC 3ETOA 3W2WB 2DNKA 4X4TA 1Q5YA 4DI6A 3H40A 1R89A 2RRNA 3R1LA 2HQ3A 1G1XA 1YJVA 3EDRB 1V6HA 2H5EA 1IBCB 3HK2A 4USTA 4V19X 5IT4A 2O67A 5GAEU 1SIWB 1N36J 1S9GB 3PW2A 1TK8A 3DOMB 4LF7F 4B3TF 4ZK7M 1FT8A 1NDKA 2VBZA 2E7XA 4MYUA 3FJ2A 1KVJA 1F5CA 8AT1B 3BDEA 1R6YA 2QE5A 3KLEB 4Q7AA 3VALA 4WIQA 4DV2J 5D0EA 2Q6CA 2CZVC 3VQTA 2LQJA 3I56S 3NGUA 1AZSA 1C4CA 1RTHA 3D6FB 3BGFA 2GHWA 2DXFA 3JAMU 4QU6A 1IKYB 1CLFA 4NXNJ 4NEYA 2QTWA 2F5GA 3M30B 2KHDA 1CJKA 5HROA 1PJ6A 2NCKL 3HHEA 1S6OA 3LWLA 2XYHB 1P1LA 2VPWB 2C3UA 4EFAC 3G6XA 1GMVA 4I6YA 2A6MA 3QRRA 4DF4A 3MDFA 3H7HB 4O23A 1SC3B 4R8UA 3GIJA 2ZH5A 4GRSA 3CD5A 3ZZTA 8RUCA 3OXLA 3CC2S 3Q8UA 4JV0A 4C8ZA 4O3SA 2OPPB 2R9LA 2WW4A 3JTOA 4HH1A 1WTFA 2XULA 4ZCLA 1B0PA 2V67A 4R0JA 3X1LB 3CUNA 4N56A 3HVTA 1RTDA 3N9UC 3M05A 2K1RA 1Q79A 3D68A 5FJ4A 1O0PA 4YEAA 2LFVA 2HURA 4IR9A 4OI3A 1Q5VA 4NZ0A 3GV5B 4PWDB 1FESA 3D1OA 1SUQB 2E5GA 4LQ9A 4OZ0A 5IFMA 2VDHA 2DJWA 2M88A 4GO7X 4CNZA 1RU2A 2YPZA 1PBAA 1EIYB 3ICLA 2QGFB 3M6XA 3UO0A 2HNYB 3TQ1A 3CF5Q 3LW5C 2HGLA 3DGPB 3ULHA 1SH3A 3I5CA 2MSTA 4HH0A 1MNEA 1RAJA 2UVWA 4FPRA 4MKYA 1LOUA 2DH7A 1U1QA 3C16B 3KUHA 4KC5A 1S12A 2A3JA 1WOSA 3PW7A 2WSCC 1T3OA 3FRZA 2V2ZA 2XHWA 1N32F 1VRQC 5IC4B 3OR2A 4LF9J 4EMDA 2VF3A 4ANDA 2ZDPA 3QLHB 4N7TA 4PYAA 1XC9A 4IG0A 3G86A 4Q45A 3R2CJ 3CPWR 5IZHA 2IBOA 4FYYB 1X4BA 5KFLA 2XS2A 2B4UA 1FWPA 2EC2A 4H4OA 4MMOA 1RTIB 3AJ2A 4PXDA 1FRLA 4UTGA 2PFDA 4NCGA 1TKXA 4FYDA 2AYBA 2HIYA 3MMCB 4RWWA 2D69A 1RT6B 4CLSA 3TZXA 2ZDOA 2YKQA 3FBBA 2HYIB 1EKRA 3IWNC 2X1FA 3FC9A 2CWKA 2XC9A 2Y8YA 4PCQA 2R7XA 4MK7A 2VFRA 1URRA 5A76A 1NB7A 3MXHP 3CSKA 3H25A 1L3VA 1TFYA 3S01A 3EZ5A 2YWEA 5G0RA 3CCTA 1EP4B 2XMVA 3VGUA 4Y2AA 3OVAA 2C22A 3K5NA 2EI5A 1VQPS 2ZH4A 4WPAA 4O4RA 3CJSA 3JXOA 4X4QA 2KM8B 1DHMA 1HQUA 1PAEX 4AE5A 3ILOA 3NMAA 4USUA 2W8LA 4JP8A 2G4BA 2XMKA 1KVIA 1Y3JA 2GC8A 2M2BA 1MU2A 2QV6A 4FYXB 2MQMA 2Z2YB 3BSNA 4RW4A 4CNYA 1U1KA 5KFXA 3PFOA 1RT7B 3MR5A 1AZSB 1PJ7A 5HP1A 4K7QA 4ECQA 2LQ9A 2YNGA 1RTHB 2F9JA 2M0GB 1XR5A 3HHLC 1KHWA 2J0WA 4GVLA 1O8BA 3BZQA 2B4PA 3UDVA 4E0DA 4NXMF 2CPYA 1NKEA 2DPJA 1LWXA 4MAKA 4PPDA 5EN1A 2X3GA 4DL6A 4IH6A 5THWA 4I0WA 1FKAF 3TWZA 3NCRA 3O2IA 4ZVPB 3THVA 3RW7A 3IXQA 4R8UB 2KVIA 1RZMA 4G1QA 3B4MA 3CCMS 3M9MB 1T9UA 2ZD1B 3RW6A 3RYLA 1N52B 1W2IA 4KRWA 3ZTRA 1VQ6S 2DNLA 2OTLS 1BE4A 4NMXA 2MQOA 1N54B 1RYRA 1PSDA 3PFEA 1M5OC 3KWMA 2YKNA 1HNXF 5D15A 3OPKA 5LMNJ 4N41A 2QN6B 3HVTB 1RTDB 5LM7E 2QMWA 2K1RB 4NX9A 4WYWA 5KFJA 2OH2A 2FLOA 1AA1B 2JH3A 3PKYA 4PUOB 2VD3A 2YKMA 2HIQA 2B8QA 3GIMA 5KTQA 3LP0A 5F8GA 4XPCA 4F3MA 2WVEA 4OX8A 4EO6A 1TL3A 1WEXA 4F2RA 3LAMA 1B70B 2RQMA 2RDDA 1T05A 3OSPA 3LQVA 2Y3YA 1FERA 5ETQA 2VG7B 1EETA 4ALZA 3BGRA 5J1EA 3MF5A 1RSCA 4EGLA 2E7VA 3LTOA 2QA2A 1WORA 1LKZA 4L76A 2BKOA 4HDHA 1KFSA 3W2VA 5SZTA 3RZAA 4DL0C 3HULA 2HS0A 3KHGA 2IC3B 1KONA 2CDQA 3RB4A 1P1TA 2XSFA 5I3UB 4PXEA 2VONA 2XCAA 4LF5F 2IBKA 1Q8LA 1SQEA 3T41A 4CI0B 3KK1B 3IAS9 4B3OA 4DR3F 2W7OA 5EWFA 3OR2B 1FJEB 1YSJA 3W5ZA 1WI8A 2Z57B 4MKAA 4J9RA 3JSRA 1RAOA 4CP5A 4AQYJ 3K2YA 1BGXT 1TFWA 1O5JA 3DLBA 5T7LA 3GTYX 2BQRA 2GNKA 3CIMA 4H4OB 2MZSA 3DMJA 1T7PA 3MM7A 3BN4A 3G87A 2GAGC 3DLKA 1PILA 4NCGB 1TKXB 1VRUA 3KK3A 1N5QA 3FBFA 2XWXA 4M5HA 3TRGA 3MCOA 1K0TA 4ZVFA 1U45A 2HZAA 2GO9A 2BEFA 3KHLA 4U7CA 4NA2A 2H48B 3H5YA 2V69A 2CWXA 2ERRA 1VRTB 5I3QA 1CS4A 2M8DB 3WIUA 3HF5A 3N6NA 1HNIA 2CFXA 1NDPA 3NGKA 1URNA 2K8GA 4A8YA 4XPEA 5BR8F 3R5DA 2VQFF 1XWLA 4QIFA 5G0RB 1LXJA 2ZBQA 2D9PA 1SJQA 1V5VA 1NRKA 4LT6A 3RUBL 2YQ1A 3R8YA 3T9NA 1MWQA 2VBXA 2E44A 2NXNA 5A0YA 4ED7A 4JB8B 3I31A 2MDAA 1H73A 1HQUB 3NS7B 2AHOB 2F8HA 5CZVA 3Q8PB 3L95X 2ZUGA 2ZNYA 4LRBA 4K0KJ 3G8SA 3GR0A 3PJ9A 3PM9A 2VB6A 5EHHA 3WDOA 1MU2B 2KKHA 2QIFA 3HVRA 3FK4A 3ITHA 1UJ4A 1FKPB 4RW4B 1S59A 3OTOJ 3QWPA 4PXCA 4WE1A 5HP1B 1WC4A 2YNGB 2E1CA 5DQGA 2V2KA 1QY7A 3CJKA 4P74A 1Z4UA 2MZRA 1TUVA 5KT2A 3MAQA 1KR4A 2CPIA 4RUAA 1R0AB 5C24A 5E2QA 3GZ7A 1YHQS 5DGBA 2W7AA 2AIRB 4RJVA 1SV5A 2VKRA 3ENWA 3K0JA 5HJXA 1TKZA 2BJ7A 2RF2A 4G1QB 1S9FA 4TLRA 1F2GA 1TELA 2IYGA 4A8KA 1HL6A 2V8PA 5EDWA 1N32J 1RBAA 1YJUA 1Y4ZB 2V4QA 1RTZA 4P2XA 2VUGA 3JS9A 2VKZG 2UXBF 1VK3A 1O51A 2CJ9A 4AL5A 1MROB 2GGPB 1REVA 5CABA 2YH1A 3P5BP 4QWAA 3KDOA 2FJBB 2IMOA 4LR7A 4NLTA 4QIVA 5HATA 1IKWA 2ZC3A 1KQGB 4HT5A 2KG1A 4KE5A 4OI4A 4XK8C 1TL3B 2V8DA 4Q43A 3J7ZT 1T05B 1FK9B 2HSEB 3PNIA 5LMUJ 5GAHI 1S1VB 2DHAA 3FVYA 3MPYA 5ETNA 5H9FJ 1EETB 4LFAF 5J1EB 3VAKA 3V6JA 2XMWA 1W7WA 4HLBA 4HEA9 1ZA1B 4DUYF 1U4BA 4DLEA 3BM7A 1DLOA 4DR2J 1R27B 4MYTA 4JYAF 4KGMA 4OYBA 4I64A 2DY9A 4QWBA 5BYRA 2FGOA 3VZIA 1HBUA 1WHWA 3MFIA 4F4KA 2KDOA 3TX0A 2ZEJA 4ELVA 1J2VA 1VJWA 2K7JA 2YWKA 4Z2XA 2QLXA 4K5RA 1H2TZ 3L09A 2HHHF 4FYWB 4WZMA 1VFJA 1RGVA 1CBKA 4O0IA 1FE4A 4JI0F 2XHCA 3EUNA 2ZHOA 3SCJE 3GJRB 5T7LB 4X4RA 1WOOA 1ZAVA 1QTNB 1QDUB 3WHIA 4TU9A 4IFYA 2BX6A 2KN4A 2UUAF 4KJIA 3DLKB 1KLNA 2XNQA 3OUYB 2YX7A 4OJ3A 1FNOA 1HBMA 2OKQA 1UEVA 4Q8EA 3VGSA 1Q53A 3MR7A 1X4GA 1EZZB 2OI2A 1CS4B 3IR6B 2L9WA 1IBKJ 1HNIB 2X3DA 4KHPF 4IDKB 3H59A 1JLBB 2ZZNA 4O4GA 1S0MA 4K4VA 1DJ0A 2MKKA 3PJXA 3SCIE 3BYRA 4QYZK 4KH1B 1FTCA 4Y65A 3MPDA 5FLXY 3G6VA 4AD6A 3MEEB 4QPXA 4FBTA 3L7PA 2YNIB 1QVGR 5ETMA 5A6WA 5A0YB 3R9LA 1JQGA 3R5CA 3Q89A 1YBAA 3CULA 4YB7A 1N5SA 5DJBA 2XLIA 2KRRA 2E7WA 3M2VB 1ZM3A 3ITHB 1RE1B 4N77A 1C1CA 1ZAWA 2Y1IA 2RUSA 4WE1B 3AOBA 1CPZA 4LF1A 1W2BR 4ZA1A 4I7FA 3CDUA 4E2FB 2L48A 3Q8SB 3LOUA 1TQLA 1WHXA 1Y00A 3IGVA 5C24B 1B7YB 1TL4A 2GAHC 4X84A 3KLVA 1T8EA 5AXMA 2RDJA 2COLA 4DR6J 2Z2LA 4PG7A 4J9NA 1G3OA 2LCWA 1TKZB 4QWEA 1CQNA 2RF2B 1M90T 1HWIA 5AJ3F 3QNWB 3GV8B 4LF5J 1FVSA 1KHVA 1BMQB 1OY6A 2BQ3A 2JEGA 2D3UA 5BXIA 4NI2B 2CQ4A 1MN9A 2H4YB 4F50A 4GC6A 1M1HA 3CO0P 4FF4A 3UN5A 3JTNA 4C0BA 1TUGB 3ZZOA 1LWEB 2JRSA 3ISNC 2J6SA 4J90A 1IQTA 1CJUA 1W26A 3VQSA 2OEKA 4K59A 1RAIB 4UOCA 1RHKB 4OX6A 1IKWB 4EO8A 2C2EA 2N3LA 2P6SA 5KG5A 2YKAA 2VFSA 1WC3A 3PO4A 2IPOB 1R8HA 2CPZA 2NXUA 3W66A 4JI6F 4MT1A 3D3CJ 1CC7A 3RTVA 4NLOA 3T19A 4LF4F 1SKUB 3PV8A 1SQGA 4HTIA 4ZPVR 4I2PA 1NM2A 3KG4A 3MR3A 3LGMA 3OTEA 2KT2A 3MECA 4KB7A 5AXNA 1Q4RA 2NYIA 2FC9A 1VQ4S 4CYUA 7FD1A 2A0FB 4CO5A 1D8YA 1DLOB 2UXCF 2UU9F 2XB2D 4JI2F 4F4WA 2MSSA 5KFOA 1HWUA 4AT1B 2LDIA 1N6QA 2RKIA 1BUXA 2OUGA 3MPUB 1SKWA 1KFDA 4YFUA 1YJRA 3BN7A 2CNNB 3HSGA 1RQ0A 3MR6A 3R3TA 3C46A 4HT7A 2ZVIA 3KUGA 5ETRA 3ISND 2AU0A 1YLXA 3P96A 3PACA 3GSIA 3H2VE 1OSDA 2XMMA 4L72B 4KR0B 3ETMA 4TY8B 2R2TA 3I4PA 1UWBB 4V1Ak 3R1HA 3EDQB 4IFYB 2DBBA 4ZKAA 4MIBA 3FQKA 4HHHA 2HW3A 4PWWA 1IKXA 3O44A 4J9VA 4XTTA 2R7VA 2FIUA 1OYDA 1CQMA 5KFRA 2DB1A 4YMEA 1PIEA 4P10A 1HBMB 1Y7PA 3K8WA 2KT5A 4LR9A 1ELOA 2W9CA 3CJ2A 3JQMA 2PFFB 3GYNA 4GMKA 2J76E 1FDBA 4OYZA 3GYGA 2V4RA 4ZIWA 1KDNA 2WONA 1XQIA 4MIWA 3A3OB 2LA4A 1SCJB 2EBGA 5I3PA 1RAAB 3KJFB 1FXRA 5F9LA 2E5JA 3CVKA 2DGSA 2HVHA 2NREA 4F3OA 4TKTA 1F6TA 2ZWOA 3CC7S 3K7RA 1Q78A 4MKVA 1ZM2A 2DHSA 4ZLLA 1RT4A 4LIRA 2EKYA 2OEMA 4UOHA 2CQIA 1HIYA 4ES3A 1X7VA 2VFVA 3DCAA 4ZP6A 3V4IA 3LPEA 5K20B 3VAGA 3IC1A 3PXGa 1C1CB 3J80U 2CG4A 3Q8QB 1QVFR 1LV5A 2R2SA 4IOCQ 2HHUA 1WEYA 3M2RB 5DZ7A 2ACMA 3SEOA 3T9ZA 1RT1A 3HFZB 3MCMA 4J7CA 1RCOB 1Y5LB 2D9OA 2YY3A 3PW0A 3LAKA 5M2PA 5B0FA 2BRLA 5CH7B 4BHQA 5KFHA 1NAQA 3OL7A 2AKWB 5CYQA 2MB0B 1IBLJ 3M8QA 2W2MP 4TNOA 1BY9A 2CKWA 1WNEA 2QRRA 4OX9F 4UY8T 4NLQA 3H5XA 1SC1B 2D1CA 5HMYA 3HVAA 1X9MA 2XY7A 1X4DA 2F65A 4ER8A 2GHPA 4CTAA 3T5KA 3P49B 4BWJA 2ZHBA 2ZHAA 5KG7A 2NS1B 3TI0A 5HANA 4P9SA 1QLNA 3NS5A 2FLNA 2EBEA 1CJUB 3OQ2A 1DQAA 3MCSA 2HPUA 3BSAA 3PR5B 2IY5B 3GB0A 4DV7F 2WVFA 5F8LA 2ZH9A 2LP4A 1D9DA 1HHQA 1S7HA 4DL2A 3C6TA 1IWGA 1U24A 4FXWA 2Y0SD 3MHYA 2DNMA 2QZ8A 5D3GB 1C4AA 5B0CA 3D4JA 4DDFA 1S49A 5E3QA 3KFWX 1ZYQA 2YNFA 4I2PB 4IFVA 3V6HA 4DX6A 2E66A 3ENAA 2OJ3A 5CYMB 1JLFB 5JMNA 4DCOB 1YZ6A 4RU2A 2WK4A 2OO4A 4FS2A 4KHPJ 5J1PA 1WF0A 2CXEA 3JSYA 3KOAA 3QZ7A 3BV8A 1S79A 4R25A 1AUDA 1GMUA 5ITHA 3CO9A 2RKIB 2Z2ZA 4J9SA 4WP3A 3PRDA 1EQ0A 4B3RF 4DZ6A 4KY3A 3QIDA 2XM3A 4WU2A 3MMAA 1CG2A 3FQLA 2E5IA 5KG3A 2R2RA 1OWXA 3R2DJ 3HFVA 5EWEA 2G2YA 5D78A 3MPWA 1U2CA 5HO4A 1F60B 1H2VZ 2RMLA 3QIPA 4DSKA 6AT1B 3VR1A 1FHTA 2CJQA 3EYZA 2VIHA 1L3UA 3SMZA 1PC4A 1IVZA 2CVIA 2ZBCA 3HD2A 1IKXB 1DFDA 5LJ5Y 1NBEB 4PABA 4WXWA 5KOXA 2U1AA 3IM8A 2ZVSA 2L9NA 3GYXB 3ZNUA 3UR0A 4H4MB 1I94F 1MWZA 2BDPA 1I5OB 2WVBA 3QT5A 3W5XA 1OJ4A 2YWWA 1NJWA 1HYSA 1NHKL 1Q86T 1A0OB 2BQUA 1BQMA 1S72S 5DDQC 1Q82T 2X51A 1CJVA 1PO6A 2Q79A 3MMBA 1KQSR 2HFZA 2BE7D 3OLBA 3F0NA 3RBZA 3TVZA 1FEEA 1OY8A 2G1DA 3TAMB 4B9VA 1HWJA 4U6PA 4DR5F 4K8RA 3BQ0A 3DYAA 3I5BA 3D0IE 4EBEA 5EUHA 2I6WA 4IYQA 4KSEB 5I4MA 2NXJA 1VQSA 4ED3A 4ZN1A 3RR8A 4O44A 3HJFA 3PEJA 1H2UX 3AH6A 1G7CB 2KJVA 3VZHA 5L9NA 2CG8A 5FLXU 4USJC 2F4VJ 5U47A 1GX5A 1DQ8A 3K5PA 4F25A 3V4IB 1NLKL 3BGUA 1T03A 4IO1A 1JB0C 4Y2CA 3ZZPA 3H4DA 1VMBA 3VAIA 1CEZA 3CW2C 1VC0A 4A47A 3V5RA 4NCBA 2CJBA 3BQ2A 5MAOA 4H4KC 1SC4B 2ZM6F 1TTHB 1VHFA 4WCEQ 1Q81T 1HPZB 3M2UA 3AQPA 3AOAA 3SSRA 2BJ3A 1HR0F 2W9BB 5G4DA 2HBQB 2WTFA 3CTRA 4DG1B 5FDLA 3KJNB 2HLUA 3M8QB 4ITSA 2UXCJ 2HQDA 3HZEA 2UU9J 2JLEA 1WC6A 2BM0A 5T14A 4ZIVA 2O01C 2R8JA 4LFBF 2B6AA 2AZ3A 4AFFA 4NLDA 2HHSA 5KT4A 1FRHA 4WFBQ 3FUYA 1MMLA 4ZPTR 5KFSA 3WBZA 4CH1A 4X62F 1VC6A 3IBFB 5HVFA 2QEXS 3OV7A 2OSQA 2DRDA 3FSIA 5H1SV 1RYSA 3V81A 2FTRA 3H0PA 4XDDA 5BYSA 4U95A 3TQEA 4DV6F 3M8ZA 1Q8IA 3LO3A 4RUBA 1WELA 2VQEF 1ACMB
chains in the Genus database with same CATH topology
4WFNQ 1RT5A 2WCXA 3MMCB 4WU3A 1S48A 2VFUA 4RWWA 3MM5B 1RT6B 4W92B 3MM6B 4CH0S 1R8CA 5KAKA 2EFPA 3QYYA 3PIOQ 2E5LF 5E0OA 2ZDOA 1LWEA 2YKQA 1C1BA 1GT8A 4HYKA 1X9WA 5B0BA 4QJVA 5F8HA 1LWCA 1IBMF 3M6WA 3TVYA 1N0VC 1ULRA 2HYIB 1S6PB 2YH0A 3V6DA 2YNFB 4OFZA 1NHVA 4XDCA 3IWNC 2X1FA 3I82A 2MJNA 1KLMB 4NLPA 4BBYA 2XC9A 2YQ3A 2KH9A 2A1BA 4C4WA 4PCQA 4YHHF 2R7XA 4MK7A 2JJ4D 3SDEA 2VFRA 1UVLA 1RP5A 2KYXA 4DEZA 1URRA 3G4SS 4OMFG 4R5PA 1NB7A 3MXHP 2KU7A 2Y1RI 3SFGA 2E1AA 2C3YA 3CSKA 1SB6A 2FVCA 5EWGA 2C3MA 3H25A 3GILA 3KLHA 1L3VA 1TFYA 2L08A 1S1WA 2F9DA 3EGNA 3IA0A 3S01A 2FJAB 1DURA 3TX8A 2PGCA 4CO1A 2QFJA 2DR5A 3EZ5A 2YWEA 4DV1F 3PY8A 4M5DA 1VS3A 5G0RA 5J2PB 4ED6A 4QYRA 5EX3A 2RU9A 5J2NA 3H8YA 3CCTA 4D3GA 1EP4B 2XMVA 1IQZA 2IJFA 4WJBA 2DGWA 5LT5A 3I32A 1WD6A 3UI3A 3MURP 2AX1A 4Y2AA 4C11A 3K5OA 1P9QC 1YQHA 3OVAA 3M8PA 2YKPA 2C22A 3LALA 3OFHA 3K5NA 2HFNA 2EI5A 2MQQA 4B08A 3TUZC 5EGYA 2FDNA 2UV8G 1VQPS 2JC0A 5F3TA 2ZH4A 2LEPA 1HWKA 2VC1A 2HAIA 4O4RA 4F67A 5CHCB 2EG2A 4X4QA 5F8IA 1N88A 1FJGF 4I7FB 3GFHA 5KT3A 2KM8B 3DLGB 3PZPA 1VQ8S 2FGCA 4OJGA 1DHMA 1FEHA 1HQUA 2XMTA 1IBLF 3HKZD 4AE5A 2LDYA 4RW7B 3MMAB 3NMAA 2BANA 1Z2LA 2W8LA 4MH8A 2G4BA 4X4OA 2XMKA 1KVIA 1Y3JA 2GC8A 3OHAA 2VASA 2VA2A 4ECZA 4I4BA 3GIKA 3BF4A 4DSIA 1F0XA 3MM8B 2M2BA 1MU2A 1RTJB 4I69A 2UVVA 4TY9A 4WIIA 1FF2A 4LIWA 3TR5A 1P6TA 1LWFA 2QV6A 1LXNA 2MQMA 4UW2A 4C3LA 3D1HA 2MZQA 3TARA 3MD3A 3BSNA 4RW4A 4CNYA 5I42A 1U1KA 2BUNA 3H2LA 5KFXA 1DQ9A 3PFOA 4OX7A 2RIJA 4LSLB 2VG6B 3LP2A 3QJPA 4KO0B 1RT7B 3MR5A 4ECWA 5HP1A 2AQ4A 1JLEA 2ABYA 1HNZF 4ECQA 2UUWA 2XS7A 3RR7A 1K0VA 1X4AA 5C42B 2LQ9A 2YNGA 1RTHB 2V8VA 2F9JA 2J9DE 4DBQA 2M0GB 1XR5A 3HHLC 1SJFA 2PI5A 4ELUA 1UEUA 1KHWA 4YDXA 4USHA 1B0VA 2J0WA 2DR8A 4ZVGA 3EXCX 1LK5A 5DG8A 5L1IA 1O8BA 3BZQA 1TAUA 2RQ4A 2W24A 3I9ZA 2B4PA 2RQCA 2UUCF 5KOWA 2PN6A 3OTDA 2AWZA 3MEDA 4E0DA 4NXMF 4O3RA 2CPYA 3LPYA 1NKEA 2DPJA 4MAKA 5DETA 1XNQF 4PPDA 2BJEA 5EN1A 2IJNA 1JJ2R 5DS7A 1DRZA 2M4MA 1ZTTA 1TL5A 4CIOA 5JVHQ 2X3GA 3PX6A 4DL6A 1VQKS 5IWAF 2R8HA 4IH6A 3DRRA 5THWA 3I6PA 3O1LA 1LW2A 5J2MA 1U2RA 4I0WA 2FVPA 3T1HF 1FKAF 2KO1A 1FD8A 4QR1A 4DFPA 5KFZA 4ELTA 3NCRA 2MPUA 3DOLA 3O2IA 2JLFA 1HNVB 2ROGA 3NRBA 3KHRA 4TY8A 1UWBA 3M9OB 2M5YA 3N6MA 3SV4A 3THVA 3RAQA 3RW7A 1HBNA 1HYSB 2DNPA 1X4HA 3IXQA 4R8UB 2KVIA 5A8KB 4G1QA 3M8SA 2W9AA 3K59A 3Q23A 2CQCA 1A6LA 1BQMB 4DX8H 3B4MA 3CCMS 1OO0B 3M9MB 4E98A 2ZD1B 4DV4F 3RYLA 1P8GA 3IR5B 4X4PA 3RW6A 1IXKA 1N52B 7FDRA 1W2IA 2EW9A 4A8FA 2XSJA 1X9SA 4CT8A 4KRWA 3MMBB 5HBMA 4NLVA 5DLGA 1VQ6S 2DNLA 2OTLS 2CPXA 1MSWD 1LW0B 3NS6A 4M8LA 2XZWA 4P2SA 4I6AA 2MQOA 2DH8A 3FSYA 1N54B 4N8NA 2RD5C 4G3IA 1RYRA 2IVMA 2GJIA 3UR3C 1PSDA 3PDNA 2XBPA 3NBPB 3PFEA 3SXLA 1WG4A 3IWXA 1M5OC 3CMAS 3KWMA 1QAYA 2DO0A 2ZH6A 2IAJA 3THTA 5CD4H 2W7PA 2YKNA 1HNXF 3V6KA 2B9WA 2I38A 3DM2B 3CWJA 1TV6B 3DYAB 3OPKA 3KLFA 3PW5A 4NA1A 1M5KC 4XIUA 4IOAQ 4OLPA 4OHWA 3N0VA 5M2RA 2MKJA 3D0GE 3OR1A 3T5HA 4N41A 1OQ3A 1S0VA 2OD4A 2LYVA 3HVTB 1RTDB 2J0QD 2EC0A 3E01B 4ZCMA 1B7FA 2QMWA 1JKHB 1L5UA 2K1RB 1B64A 4NX9A 2HWTA 4WYWA 3SCKE 5KFJA 3KNGA 5GMKa 5KFDA 2OH2A 2B3TB 2FLOA 2DGVA 2JH3A 3PKYA 3DRPA 4PUOB 2VD3A 3JSMB 2YKMA 1FTRA 1TVRA 4F4XA 2HIQA 4YP3A 3GIMA 3MECB 1S6QA 5KTQA 3LP0A 5F8GA 4RW8B 4XPCA 5L1LA 1FRIA 4F3MA 2GQQA 4FP9A 4OX8A 4EO6A 4A8MP 1TL3A 2UVUA 3DOKB 1WEXA 5IM0A 1C0UA 3N6LA 1N5YA 4F2RA 2D3ZA 3LAMA 5M2UA 2B56A 3C2PA 4FF2A 1JLGA 2RQMA 1T05A 2O5DA 4KIAA 3ZZZA 5KFWA 3OSPA 1T03B 2NQPA 2KTQA 2AYMA 3LQVA 1XMBA 2OAUA 4PQUA 4G1PA 3FEYB 3QAEA 3I5AA 2DNQA 1FDNA 1FERA 3W3SA 4RKUC 2F7VA 2C3PA 1C0TB 2VG7B 1YJTA 3H5UA 2GMHA 2OSRA 2ZH8A 5HMXA 1W25A 3PIPQ 3HHLA 1NK4A 2ACYA 3CJ3A 1EETA 2ROEA 1NK5A 3OBIA 2J6TA 4ALZA 2KFYA 5KG2A 2HVZA 4DV2F 1N6QB 2QA1A 4C9DA 3BGRA 5J1EA 2E1RA 3MF5A 1NJXA 2GQCA 1D1UA 4EGLA 2V4JB 4N5SA 2IYIA 3LF0A 1LK7A 4WFYA 2QA2A 1TK5A 1E6YB 3CCSS 1LKZA 4G1IA 2GQ2A 3POTA 4C3KA 3DLHA 4EZ6A 3JYTA 5IS2A 4HDHA 4OZ5A 1KFSA 3W7BA 2AGPA 3W2VA 2VZ9A 1VGYA 3H20A 3X3UA 1NH7A 3CE8A 5SZTA 3RZAA 5D8HB 4DL0C 2WRMA 1NKCA 2MQPA 2HS0A 3KHGA 4JI5F 1RT2A 2IC3B 1KONA 2CDQA 3KLGA 3MEKA 4PPZA 3RB4A 1P1TA 3IR7B 1HNWF 2HZCA 2XSFA 5I3UB 4PXEA 4BS2A 2DNZA 3DFEA 2HNZB 4LJMA 2XCAA 3G6ES 3RB6A 2IBKA 4LF5F 2VONA 3HHNB 2YNHB 3M2RA 3KTQA 4ZHRA 4LF8F 4I1TA 4ECTA 1Q8LA 3GMGA 1SQEA 2A2CA 4CI0B 3KK1B 2B6AB 3IAS9 3IG1B 5A8WA 4B3OA 4DR3F 2W7OA 3OW2R 5EWFA 3FZBA 3OR2B 3MTKA 1FJEB 1YSJA 5KT5A 1WI8A 2LA6A 3E51A 4C2MA 4RNNA 1UA1A 2B5JA 2PDAA 3WX4A 2AJ0A 4FVMA 3MUVP 4MKAA 1HBOA 4J9RA 3JSRA 4M94A 2LEAA 4JI1F 2RE1A 3M9NB 4ZCIA 1OSCA 1U7LA 2ASDA 3S8SA 4KQZA 1N0UA 3T1YF 2ZE2A 1U25A 3OL9A 2WAQD 3KMSA 2ILYA 1BGXT 3K2YA 1TFWA 2HLTA 4DV5F 1CSJA 1Y0HA 1O5JA 2E9ZA