4JI7F

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ji7F00
3T1HF 1HR0F 1FJGF 5BR8F 1N32F 1G1XA 1N34F 2J5AA 4AQYF 4JI2F 4DUZF 4LFCF 4LF7F 4DV1F 4YHHF 1RISA 4JYAF 2KJWA 2B7BB 2UUBF 1XNQF 4DV0F 2VQEF 2KJVA 4DUYF 4YY3F 1XNRF 4LF9F 2UXDF 2E5LF 1B64A 4DV7F 4DR5F 1GH8A 1HNZF 4X65F 5LMNF 1XMOF 1LOUA 4LFBF 2F4VF 4NXMF 1IJEB 4JI8F 4X64F 4DR2F 1G7CB 4OX9F 2UUAF 4B3TF 2UXCF 1IBKF 2BVZA 4KHPF 4K0KF 1HNXF 4DR7F 3R3TA 4JV5F 2BXJA 1QJHA 5AJ3F 1N36F 4DV3F 4DV5F 1F60B 2HHHF 4X62F 2VQFF 1XMQF 1IBLF 1FKAF 4JI4F 1IJFB 4DV4F 4DR1F 4LF8F 4JI3F 1CQMA 1VMBA 4DR3F 2UU9F 2UUCF 4NXNF 4JI1F 3OTOF 2B7CB 5LMUF 1HNWF 1J5EF 4LF4F 4JI0F 1I94F 4DR6F 5IWAF 4B3SF 4DV2F 4LF6F 3ZZPA 4JI6F 1N33F 1CQNA 4DR4F 2UXBF 4GKJF 4X66F 2YY3A 1IBMF 4JI7F 4B3RF 2RJZA 4DV6F 4LF5F 3T1YF 4B3MF 4LFAF 2ZM6F 4JI5F 4GKKF
chains in the Genus database with same CATH superfamily
4LUBA 2AF6A 3D4JA 4IR1A 1KHWA 3EGWB 3EVOA 1DURA 2QA4S 2KB2A 3FUYA 1QDUB 2DXFA 2YWFA 1HPZB 2FJWA 1GTHA 1IM6A 2E7WA 3RUBL 1R8AA 1U6FA 2XMKA 4OI2A 4I0WA 4YUDA 3M8PB 3JQKA 4L73A 2CJ9A 3W5ZA 2DGVA 1SV5B 1U24A 2J5AA 2MTLA 2WSCC 4USUA 3SFGA 1OQ6A 1EETA 2AEJA 1N5TA 2HRYA 3BO4A 3IWXA 4IDKA 3RRGA 1WELA 3AD7C 4I2PB 3WIUA 3OR1A 4LFCF 4X4UA 2MKYA 5RUBA 1WC1A 2CNNB 2GA7A 3TRGA 3W61A 2AMCB 2J0WA 2BJEA 2EFGA 3EVWA 5CZXA 1HQEA 3CCQS 2YX4A 5CYMB 1I94J 4N47A 4F8RA 5KG0A 2BW7A 1TL1A 4TN2A 3HXMA 3EE3A 3OSPA 3DU5A 4QJVA 5CYMA 1W26A 3T5HA 3PW7A 4DFJA 3PV8A 3QQCD 3EUNA 2KRRA 2QFJA 3W8GA 2RAQA 1B0PA 4A4JA 3C15B 2PD1A 2ROGA 3GU0A 2DY1A 2UXBJ 1F6TA 1EP4A 1RHUB 1GMUA 1OY9A 5DO2A 3AJ1A 2RUSA 1H6KX 2WSFC 4YP3A 4DR5F 2Q1LA 3BJYA 3ZZ0A 2DNKA 4KGZB 3P5TL 3K7RA 3BQ0A 2KDOA 4DX6A 4F4ZA 4UTGA 3ETMA 2MQQA 1S6OA 2XTJP 1IXKA 2HURA 4Q8EA 4TQRA 2GFFA 2MY7A 2FVCA 4AT1B 2AU0A 4QR0A 1HFEL 3A3PB 3MPUB 2MGZB 4J9KA 3WX8A 4KGXB 2UUAF 4PWUA 4CLSA 1RLDA 2ZBPA 1HNXF 5D78A 4H4KC 3K5OA 4YS2A 3I6PA 2EW9A 2HQDA 5T7LA 5DGBA 3MZIA 4CM2A 4GC6A 1IKVA 4B3OB 2G2OA 2B8PA 5JXSA 5KFIA 3MM7A 3TI0A 4PKDB 2BBEA 4CTAB 3OFFA 1KN6A 4B3RF 2FJXA 2JWNA 2P5VA 3KG4A 2U2FA 4FYVB 4ED0A 1I51B 1WC6A 4J91A 4LBPA 4UUXA 2AYMA 2D3O1 4LVNP 2L41A 4DR1F 3T5JA 4DJBA 3GONA 3ZO7A 1OPIA 4JI8J 3WDOA 2VF3A 1GQEA 3TVYA 4QIWD 5J2NB 4C11A 4C9DA 3P8BB 5HQ8A 2E29A 2G0JA 1NKBA 2E1CA 1HHQA 5J2NA 1EAYC 3FRZA 1UW9A 2G1HA 4OI4A 1LWFA 4WFAQ 2RSQA 3MUMP 1J2VA 2E66A 3K89A 2YXLA 4OV6A 3V6JA 1FK9A 2ZE2A 3O1LA 3PZPA 1DFDA 2V50A 4FNIA 1QE1B 4I4BA 4ECWA 2CZ4A 4B3RJ 2IY5B 3POTB 4P9SA 1DZ5A 4IOBA 4ZP6A 3IBFB 4IOCQ 4AL6A 3W2VB 1WOPA 4OLOA 4R0JA 3POTA 2IA6A 3NKYA 4USMA 3JAMY 1SQEA 3BGOP 5F41A 1DLOB 4OHXA 3EICA 1VQ7S 4CH1A 1UEVA 3ZC4A 1CJUB 3GYGA 1B99A 1S1VA 5LT5A 2XSJB 5KG7A 1X4EA 2CA9A 3MCMA 4LBIA 2FUG9 4ECQA 5B0FA 3WBZA 3VVUA 3JSYA 4RW8A 3FSYA 5KT5A 4KYZA 5G4DA 3MTKA 2WBMA 4FYYB 1Q86T 3LPYA 3NLCA 3QIPB 1ZH5A 1U1NA 2AW0A 3DI6B 3CCWA 4LR8A 1SJ4P 2I1RA 2JLFA 1LW2A 3DLKA 2P8IA 3WC2A 5HROB 2MKJA 5BJRA 3TWZA 5J2QB 1X60A 1KLNA 4IFVB 4Y3CA 1WG1A 4WF9Q 1RUSA 3KLIB 1BMQB 4DZDA 2DGOA 3CDAA 3OTCA 1WG4A 3M6VA 5K20B 4BHQA 1OWXA 2E9RX 1SUQA 3MEEB 2HSEB 4NL5A 4LBHA 3V6KA 3CJQA 4X62J 2VL1A 4GVLA 3LANA 4ZCIA 4F0MA 4F50A 2MZJA 1HARA 1Q8BA 4W92B 1HQ2A 2Y9HA 1YRUA 1XK8A 1LNQA 1S4EA 2HBRB 2XLKA 3HHLD 2F63A 3KNAA 2VG6A 3TOQA 3OPKA 4ETZA 1C0UB 2HS3A 3DLEB 4I7FB 4CDIA 4XPEA 3N79A 3MMCB 2HS0A 2V8GA 3NBPA 3ZZOA 2IM1A 5JMNA 5DG7A 3HD1A 2ZOFA 2ZZNA 3SYZA 4DSIA 3LGNA 5KOWA 2DEIA 3D54A 3I87A 1N52B 3LTOA 3MUVP 4B9NA 2OPPB 1KQSR 3F56A 4YY3F 3MCSA 2OELA 2CJKA 1XIQA 4C0BA 3I56S 4GC7A 2DNQA 3M32B 3NAIA 2Y3YA 3NOGA 2VD3A 4OX8A 2C28A 5MAOA 5FDLA 5ITHA 4DMZA 3KHLA 2AWZA 5B0AA 2XHCA 2J9DE 4HTIA 4RPFA 2ZHAA 3BO2A 3C3LA 4RWXA 1ZM3A 3MF5A 3Q22A 4DR4J 4QW9A 2Y1LB 1RLCL 3VV2B 4NPOA 3BB5A 4ZP9A 1A0OB 4OX9F 2RIJA 1PYSB 2GGPB 1AUSL 2KT2A 3FC9A 1VBKA 1P1LA 2KHCA 1XC9A 1FHTA 5ETPA 5GAHU 3RW7A 2DNRA 5CAAA 5A0YB 4DG1A 4ER8A 3MAHA 1S6UA 5IFMA 2VODA 2LU2A 2K7KA 2WVBA 1NK9A 3RB3A 4PXBA 1U6ZA 3DLGA 4DSLA 4CT8A 1PAUB 1KOHA 4HLBA 3QPIA 3PYDA 1IKYB 1HNVA 1NRKA 4X4PA 2Z30B 4WTOB 1M5VC 2MQPA 1FRIA 4ZIVA 1W2IA 4O3RA 4Q8FA 2AIRB 4C3MA 1JK9B 2RH3A 3CXCR 1LWXA 2FJDB 4LRFA 3FKBA 3T1HJ 1T02A 5KFZA 1JJHA 3OQ2A 5AXMA 4F7VA 2FLPA 4NLUA 3R6GB 1U02A 1EHWA 2WONB 4A47A 4FBTA 2YX7A 4DCJB 1X4CA 2LQ9A 2GS8A 4DLEA 5SUHA 4H4KA 5IT4A 1I6JA 2WONA 3OL7A 1NDPA 1T3OA 1WDDA 4CYUB 4JV1A 1UVNA 3QRPA 3BKUA 1PYTA 2ZFHA 4ALZA 5LMUF 1UL3A 1X31C 3NGDA 3PRBA 2BJ7A 2R7OA 4R0EA 2XLJA 3P4UB 3HZEA 4UZCA 4LF4F 2B9XA 3IM9A 4FN5A 5C7PA 4RW7B 3K2YA 1S9EA 4G1PA 4OYZA 3VVTA 4Y2MA 2F9DA 2HZCA 5C2GA 3THVA 1JLEA 5E41A 2UUAJ 4RW9A 1V6HA 2ZVSA 1NPRA 1FVSA 2F9JA 3BM7A 1F3VA 1ROFA 4P2SA 4JI6F 1VQ9S 3CSKA 2PFDA 1F5CA 2XMJA 1SH0A 4QZVB 4C8NA 4LF7J 1WOSA 2OGUA 4NE9C 5EGYA 4ZJQA 2WOMB 1U2RA 3IA0A 2IDLA 2YPYA 1VQPS 1JNRB 2DHSA 2JC1A 2VB6A 1N8RT 1VGYA 3ITHB 1IBMF 2FHJA 1YKWA 3P96A 1BQNB 2HVDA 4YN3B 1UAWA 2MLZA 2Q6CA 4Y34A 2VBYA 4C8MA 5HJYA 4M5GA 3OUYB 1APSA 3OHBA 1L3UA 2G0IA 2C42A 3MM5B 4OHWA 1E6VA 1GT8A 4LF8J 2W8LA 1E6VB 1R89A 1VISA 2J0QD 2UUBJ 4PRFA 2CNKB 2VPYB 2HPUA 3KJVA 4HI2A 4USJC 2HQCA 1TK5A 1Y00A 1X4FA 1NZAA 3HT3A 5B0BA 1CJVA 5J2PA 1SL0A 4WIQA 4ZA1A 5U47A 4O4GA 2CNLB 5C42A 1MROA 2OLWA 2DGSA 4ILLA 3AY0A 2HWHA 3FBEA 3I5BA 2HFVA 3MFIA 1N36J 3AT1B 4O4GB 4DV3J 1RQ0A 4FS1A 2YNGB 3A1YG 1UEUA 2DO4A 2UZAA 4N5SA 4WP3A 3B4DA 3EZ5A 2MKIA 1RWWB 1TL7A 2L08A 1UFWA 3UD5A 4OYXA 2H65B 1YIJS 4NOHA 2OH2A 4A8YA 3ENWA 4G6VB 4RUAA 1HHSA 1VRUA 3AH6A 2DRBA 1FD8A 2QX0A 2YNHB 4M63A 3HDSA 4UOFA 3U7JA 1HWLA 3AJDA 1Y4ZB 2RU3A 2DGWA 2CQPA 1RAFB 4CI0B 4I6YA 4WU2A 3AOAA 2EBEA 2FGOA 1TZ0A 1RAEB 4BC7A 1BQMA 3UDEA 4AL7A 4B9MA 2ZM6J 1SC1B 4KH1B 1XNRF 2UXDF 4FXVA 3T1YJ 4OHYA 4LSLA 4YR3A 1S48A 4RNNA 3CJ2A 4FPIA 4GO7X 2F8HA 2IAJA 3M8QA 4YB6A 2E1AA 1Y7PA 2ZUAA 2J7UA 3SXLA 3CCJS 3NNAA 1V3ZA 3R2DJ 1LOUA 4PCQA 1X0FA 3BYRA 4LFBF 2LXFA 1XNQJ 3MMJA 2HHUA 1FDDA 4AYBD 5LJ5Y 1AFIA 2FJEB 1YI2S 3EGNA 4UOHA 3NGKA 2WB4A 4XTTA 1IWGA 1P9YA 3O3LA 4ZK7M 4OYAA 3ONQA 5L8RC 4FYXB 4PABA 2BRKA 2E44A 3H2UB 1PKUA 4MK9A 3TYTA 4ANEA 3M8PA 3HFZB 4ZN1A 4ZHRB 1N5YA 4H4OA 2BOPA 2QRRA 2WVCA 4AQYJ 1ULRA 4QYRA 4C7QA 2FJAB 2QIFA 1PIEA 5KFGA 4WFYA 5AE3A 4NZ6A 4OI1A 4KH0B 3SIPB 1B0TA 2CPDA 4WPAA 2ZD1B 1WSRA 2ZOGA 3ZZUA 4ZP8A 1N32J 1LXJA 2A1BA 2AP6A 1VQKS 1S79A 4U9RA 1FJGJ 2RQKA 3UNGC 2GAHC 1N5VA 5KOXA 5HBMA 1UVJA 3GP9A 1GMVA 5HO4A 2RE1A 4DL6A 2YNIA 1XMOJ 2OMOA 5C25A 5HBMB 3G6YA 4RBTA 4U96A 4HVZA 4UUWA 3OL8A 4DR3F 3KLGB 3P5BP 5C25B 5A8WB 4PQUA 2CZ9A 1WHWA 3WQPA 4U6PA 4NXNF 4C8KA 2G4BA 2DITA 3DRSA 3HPOA 3L3CA 2HFNA 5F8IA 3MFHA 1YBUA 3MGJA 3PG9A 5KG1A 1HBNB 2G2ZA 2W25A 4ECRA 1GNKA 4WFBQ 1I94F 4F4AA 2LU1A 2XHWA 5IWAF 1HI1A 1HWKA 4IFYA 1N56A 1CVJA 4JI0J 3CVKA 1D3WA 3LUYA 2W24A 3CCUS 3GFXA 3BGFA 4KT0C 3LWLA 4LFCJ 1J5OA 2B6AB 5KFUA 3ZNJ1 2FJVA 4KO0A 4MYTA 5HP1A 3QZ8A 4DV6F 3DYAA 4ILRA 4WP9A 3US5A 4LF5F 2HFOA 4K5RA 1ZYQA 1LW0A 2H4YB 3MM7B 4W98A 3UDCA 4DL3A 4JI5F 2NYIA 1MNEA 3DDIA 4TVAB 2VOOA 2D3UA 3E3XA 4ICLA 1HWIA 2H48B 2CQIA 2YQ0A 1IWAA 1WF2A 2XEXA 1HBUB 1LQ9A 2GX8A 2W9CB 2MSTA 1J27A 1W25A 3BBBA 4IKAA 3UWTA 3W64A 3M8SA 3RB4A 4FBUA 4LF5J 3CW2C 3N5BA 1LXNA 2DGTA 4DX5A 4L74A 3PFOA 3AD9C 1MN7A 2JHEA 5E0OA 1QE1A 1RE1B 2PT0A 3H8YA 5KTQA 3G71S 3DCAA 2XO6A 2DR5A 1ZPWX 4UT4A 4F36A 2VV5A 2VKZG 2DGUA 3N01A 5CHCB 4JV5J 3LP1B 2ZH7A 1SH2A 4IH7A 4MK7A 2H1YA 3C6UB 4F3OA 3T6JA 5F3ZA 2VJVA 1NDCA 4A8XA 3C6UA 1UJ4A 3H7HB 1BWEA 4KC5A 1RWUA 3A8IA 4NCAA 2L9NA 1NK5A 3MMAA 1PJ6A 4RNFA 2R2SA 1NB7A 4K4VA 2IRUA 4DV7J 4ZJLA 2V8DA 4RJVA 4DV7F 4Q0BB 4BS2A 1WTBA 1X5OA 1CULB 3DU6A 2EI5A 2MEWA 2ZH1A 3DI6A 4C6AA 4O4RA 3TAPA 5LMNF 1HNZF 4A48A 1XWLA 2BX6A 2V4JA 2GMHA 1RTHA 2AD9A 5HLFB 2I5JB 2XYHB 4DR2F 3H90A 1V3RA 3KLIA 4KHMA 2O3DA 2YKPA 5D0GA 2IM2A 4ES3A 3IRXB 4KHPF 1HA1A 4JV5F 1JXEA 3FRYA 3PHTA 2DKOB 4JP8A 4MIWA 4XIUA 5DZ6A 5HMYA 2JEJA 4NA2A 1R8HA 3H4DA 1IUJA 1U09A 2CQ1A 2NS1B 2PA3A 5K8OA 2F8MA 2YTCA 1FJ7A 2RVJA 4LSNA 7FD1A 2MQNA 1B4SA 1RT6B 1UKUA 4P2FA 5GAHI 1HI8A 1F9FA 1DRZA 3FEXB 4IH6A 3UDVA 3VZIA 4LIRA 3D0IE 1FKAF 1F0XA 3HVWA 1VDHA 3ISND 4B08A 1DY3A 3DDKA 1EIYB 3QNWB 1YDLA 2AJ4A 1FKPB 4IQMA 4YDXA 1S1TA 4J9NA 1UA1A 1AA1B 1D1UA 2B5JA 4JI3F 2QFIA 4OI3A 2BE9B 2D7SA 2HNDB 2XI3A 1SIZA 1H98A 1NEEA 1U0SA 3EMTA 2DB1A 3TJAA 5HQMA 1VK8A 3HVTB 1YWXA 2RQCA 3MAQA 3GYXB 3N5FA 2UUCF 3OR2A 2ZJRQ 2D3ZA 1TELA 1TP7A 3TA0A 5L1JA 5ETNA 2MSSA 2I8EA 2HWTA 3A8JA 3HSGA 5L9NA 4RNOA 1BD6A 1VQSA 2VA3A 3R5BA 3IS9B 2QEXS 1JLQA 2NXNA 5GVQA 2V67A 3HSDA 3R7NB 3LAMA 5IT9U 3QFHA 2KXFA 3OFEA 2CYYA 4G1QA 1HNWJ 3DKDA 1NDKA 4RKUC 4XDDA 4HI1A 3UCZP 1SC4B 1H3DA 4A8SA 5CYQB 2XWXA 2V8HA 4HHUA 1F9HA 2WW8A 5A0YA 3K5NA 1PYOB 2C3UA 1HQUA 3GG0A 3IR6B 3KDNA 4WE1B 1SBRA 5CZVA 2QN6B 2V8VA 3RBZA 3OFGA 3H5UA 1KS2A 1S1WA 2FC8A 4L76A 2H3EB 1KOOA 1KFSA 4FF4A 3CCRS 4TKTA 1YVFA 4IO9Q 3SQOP 3L7PA 2HK2A 5E2QA 2CDQA 2GJIA 2HG4A 3ILJA 2AHOB 2OPSA 2V9KA 1WUUA 2BANB 3IAM9 2H51B 4OZJA 3CJKB 3M9OB 3FZBA 5EWEA 2HNZB 2IRXA 1LWEA 3I0RA 2AEMA 1VS3A 3H98A 2CQ2A 2BKOA 5LXYA 3PW4A 1WC4A 2C22A 1NJIT 4ED5A 1EKRA 2DRDA 2L3MA 5KFLA 1BC6A 4NYOA 3W8PA 4ZPDA 1VC6A 4B3SJ 1HMVA 3MEGA 4FPRA 3A3NB 3K17A 1TVRB 3FDSA 3MWBA 3LP0A 5E33A 1F3FA 3P45B 4LF4J 2HKEA 2RKIA 1RCXB 4ZVUB 4IQXA 4DV0F 4WBFA 2RKIB 1FRMA 4O0IA 2KJVA 5IT0A 2JVOA 2HQIA 2DIUA 3PDNA 3M2RB 1FTCA 3NXZA 1F1BB 1TK0A 2L9DA 2PGCA 1G3OA 1S1UA 4RW6A 2W2NP 1FEHA 2EFVA 4CLFA 1C4AA 2KT5A 4Q7AA 4DBQA 1A7GE 3HM9A 1FEEA 1XMOF 3M2VB 4X66J 1QD1A 3AXKA 3CE8A 2F4VF 4NLRA 3KMQA 4KGKA 1TL3B 1Q82T 5DG9A 3VGVA 3A3OB 5GMKa 2CVIA 1AYEA 1MWZA 2ZVIA 3OV7A 1TUGB 1Y11A 2MQMA 4B3TF 4NWBA 4DS4A 4CLWA 2DGXA 4QR1A 3V6DB 2HMIB 1KVKA 3QJJA 1IKXA 4OYBA 4TY8B 1ZETA 2LFVA 3H42A 3F0NA 4EGLA 1FDNA 4EO6A 1YTYA 4M94A 4WZMA 1U4BA 1IKWA 1FKOB 5A76A 1IKXB 2XNQA 4TY8A 4DUZJ 3U02A 4ZPCA 1MROB 3AB2B 3BV8A 1KHVA 1YSJA 1IKWB 1FKOA 5BYSA 1JLGA 2VFSA 3D1HA 3DRRA 4ZVRB 1RB0A 3W2WB 2FB0A 2GNKA 3NWGA 2O67A 4QWDA 2DH7A 4J5OA 2WAQD 1SL2A 1PGZA 3TAMA 1ACMB 2ATCB 3WIVA 2IVFB 2FLOA 1SQGA 2H4WB 1NLKL 2CG4A 1LFWA 2HWIA 1MN9A 3RR8A 3UD3P 2GHVC 2NUUG 2WRMA 4ZVQB 1SKSA 4UY8T 2KZMA 3PJXA 5K8MA 2R8JA 5EX0A 1YJWS 3MPWA 3GQCA 3UCUP 2CPJA 4ZVFA 3UW1A 1UFKA 4MMOA 5DDOC 3R5AA 1VQ4S 1G2EA 1B0VA 2WBRA 3E8OA 1T9UA 2EWHA 2CPFA 1V5IB 2AZ3A 5KG2A 1L3TA 3V81A 3PYEA 5HL7Q 4B9UA 4JI0F 2QZ8A 2HZVA 2VOPA 2CFXA 3OXFA 3AHPA 1UCNA 3D66A 4P10A 5DS7A 3R9LA 1RWXB 3DMJA 3KXDA 4NLTA 4OL8A 4PEOA 1LWCB 3JSMA 3UVJA 4AXIA 3C15A 3OVSA 1IR1A 1RKIA 1N33F 3HZGA 1GMWD 3TZWA 2C2NA 3JSMB 2YY3A 3KUEA 3DLLQ 2W1BA 2IRYA 3TAQA 1QY7A 4JI1J 4P71A 2FQQB 3TJ9A 4PUOB 2OEJA 3Q8RB 5E3CA 4RO0A 3R97A 4HL9A 4Q45A 1JLCB 4FZVA 5KG6A 4R5PB 2Z2LA 5F8LA 2HK3A 4FKXA 1H2VZ 2AX0A 3MDFA 3CCSS 4GO5X 3IGNA 3FNNA 4P7VA 4O44A 4PWWA 1TKTA 3UE2A 2FYXA 4ZN3A 4NI2A 4ED1A 1S7HA 1TKTB 1TL5A 3OJSA 2D74B 3JQMA 5BR8F 2MJNA 3GJRB 2OPRB 1EX8A 2GIFA 3H5SA 2HLTA 4NI2B 5K9FA 3MOZA 3EYZA 1QUVA 2Q43A 2VFRA 4HHHA 2W7PA 1QTMA 2BMBA 2CPHA 2VONA 2UUWA 3QBCA 5AE2A 4ES1A 4JI2F 1Y3KA 2E1PA 5M2UA 3BQ1A 1IBMJ 4Y2IA 4DUZF 3IWLA 1TL7B 5KG4A 3HHDA 2M8HA 3HCXA 5HJXA 3ZTPA 4Q43A 2C2EA 4JI6J 4MH8A 1ZOTA 2BM0A 2PSZA 2WK4A 4WWSA 1RHMB 2HVZA 2MLYA 5D4OA 3VGUA 1UVKA 4ELUA 3VAKA 3PX4A 4F25A 1C1CB 1LKZA 4J9QA 4JV2A 1T7PA 5D3GB 1BQMB 2BYCA 1LWFB 1CJTB 2B4OA 3H5XA 2GJ2A 3BH7B 4P74A 2NXEA 4F67A 4LSLB 5ETQA 3F44A 2VUGA 4LVOP 1PG5B 1Q79A 1U8WA 1FX4A 1UEKA 1SXLA 2B0GA 3NS5A 2JSXA 3TR5A 1F5BA 1G4CA 5I4MA 3RBXA 2RS2A 3OL9A 1R43A 2KG0A 4O3SA 2LMIA 2I0XA 1PJ5A 3NAHA 2M52A 1R8PA 3D0GE 4NXMF 2GMJA 4JI8F 5M2PA 3JSRA 2XMAA 3UQSA 2UUTA 2VICA 1U47A 2IBOA 3GR0A 4M8LA 3M9MB 4OHZA 4CZCA 3KK2A 2DTJA 1WJ9A 4ZHRA 3MHYA 1OY8A 1N5YB 3UI3A 3QGPA 1RHQB 1ZAVA 4RW4B 5HQLA 3KK2B 1MU2B 3OL6A 2YKNA 1N36F 3HMJG 5KFEA 2XY5A 4N7TA 3AAWB 4CH0S 2DHGA 1LW2B 3ICLA 1F60B 1VR6A 2CVEA 4P52A 4N76A 1RAHB 3BH6B 3MM9B 2R2RA 2XS7A 3ET6B 1SJQA 2BRLA 2BUNA 4B3TJ 3FFIB 1S77D 2K8GA 1IBLF 4DFPA 4QIEA 5LSOA 1RAAB 3AOBA 4JBCA 1RT3B 3BKFA 2QLBB 4EZ9A 3DOMB 5DDRC 4L75A 1SC6A 2DHHA 1VQLS 2F4VJ 4NZ7A 4KTQA 2QGFB 1KWMA 1VI7A 2OSRA 1H2TZ 3KWMA 4UW2A 1RBAA 4LF8F 3THPA 4ELVA 4OI0A 1P27B 2RF2A 5F8JA 2HFUA 2DNOA 2KO1A 1RACB 4A8FA 3MR7A 3VQSA 1QSLA 4WTYA 4NCBA 2D9OA 2FJBB 3IBWA 4ZIWA 4ED7A 4YY3J 1J5EJ 2AV5A 3GIMA 5C24A 4Y0FA 3ELHA 2HFSA 3CC7S 4AXJA 3S6EA 3TNVA 4C2MA 3KNGA 5DDPC 1F5AA 3TUPA 5IT9Y 3PTWA 2BR0A 3PX0A 4IFYB 1EB0A 1NHKL 3I5CA 1YX2A 1Z1ZA 2VPZB 6AT1B 3KG0A 3FSXA 4Y2CA 4EO8A 4R25A 5IC6B 3KUHA 1KNZA 4NXMJ 4KO0B 1RDRA 3PRVA 1YG0A 4FF1A 4NCGA 2YBVA 2RRNA 3R5JB 4URGA 5T7LB 3RYLA 4F3MA 5K8NA 2XGPA 2LLZA 3T1YF 5AXLA 3C16A 4LIWA 3J80Y 2ASJA 3LF0A 1BQXA 2AJFE 2C3PA 4NRTA 1RAOA 1RJJA 2BOAA 3SZ2A 3BYPA 1K1QA 2FLLA 1HBMB 3R5GA 3TP2A 2PO4A 3GJSB 2ATLA 1WC3A 3FMBA 3TARA 1WEYA 3R5DA 3VGSA 2DH8A 2CNOB 1HW8A 2YKAA 3I0SB 1K44A 3I96A 1UJ5A 3CMAS 2B5JB 1LK5A 3L7UA 2DR6A 1D0EA 3KK1B 2JH3A 3BSOA 2XB2D 1D9FA 3H4BA 2W4DA 2EK1A 1U2CA 4IG0A 4XK8C 3PX6A 1RGVA 3HULA 2M8DB 1ITPA 1BHNA 2GV1A 4DV1F 2N3OA 4Q2LA 2VJUA 2B4PA 5GMDA 3WX4A 1FE4A 1T9XA 3E01A 3HP6A 3KYLA 1Z2LA 4JYAF 1R31A 2DR8A 3S8SA 4URSA 2ASLA 3ENQA 1OPZA 2BE2A 4P2XA 5EHHA 2JC0A 1S0OA 1WEXA 3NCQA 3CCZA 1NZ8A 3GCXP 5IXUA 2XBPA 2ACMA 1E6YA 1FD2A 5LMNJ 1P8GA 1ZZFA 4KAIA 3CWJA 4NLYA 3ADAC 7AT1B 1B7YB 3A13A 3PKYA 3M8RA 4DZ6A 3UFCX 5B7WA 3BSAA 3KK3A 4I2QB 2C1EB 3D6TB 3K58A 2ZITA 4FVMA 2V4JB 4URQU 3UNYA 3CCLS 1NUEA 2E5GA 4FF2A 4P7TA 5A2QU 3CJ0A 2HHVA 1RT4A 1R6YA 4DPWA 2ZUGA 2IJFA 1U2FA 4OMFG 3KG1A 4QR2A 4E98A 4UQGA 5F8NA 4DF4A 1B3TA 4PG4A 3W62A 4EFAC 5KT6A 2V4QA 1S6PB 1XMBA 1I3OB 1ICEB 2M9KA 1FRLA 3HHEA 2UXCF 2XSFA 3W9JA 3R3TA 3UN2A 2XGQA 5AT1B 2FZGB 3W9IA 3DDNA 1Z4UA 4WXOA 2COLA 3CULA 4U95A 3KDOA 2ZH5A 4OJHA 4OZ3A 3OUYA 2QTWA 4JI2J 4A46A 3CDBA 2QO3A 4XAKA 3MM5A 4RUBA 1IM4A 3CF5Q 1BE4A 1FRJA 4MFBA 3C66A 3TX8A 3MEDB 2RT3A 3SDEB 2GVZB 2J9CA 1YJRA 1M5SA 2W01A 2WSEC 2KU7A 2FHKA 1GEHA 1WEZA 3QLHB 2ZHOA 4TU7A 4FKYA 3N6MA 5GAEU 2ZKUA 2GVZA 1U45A 5A8WA 3CMQA 1K0VA 4USTA 2CQHA 1NSPA 4DLGA 3RR7A 4L3NA 1CQMA 4KFBB 3RG6A 1S9FA 2CDRB 2V34A 1RU1A 3Q8YA 1S0VA 1BWVA 4KFBA 2CWXA 3OT9A 4DQSA 1WI6A 3JYTA 2AYGA 3R1LA 2R8IA 2NZ4A 1R8BA 2NPIA 2C2DA 4OYPA 1TFWA 3D1QA 3OTOF 2RHSB 4JOUA 3D2WA 1QTNB 2YWWA 3V5RA 3TO8A 4HT7A 2JEFA 4EK2A 4QBUA 2DH9A 2QG9B 2ALZA 1Q95G 5JJBA 2DHXA 4M5DB 2YNHA 3O5TB 5D6GA 1TK8A 1KSPA 2Y1JA 5KFFA 3D28A 1Q8LA 2P2CB 3T9NA 5D0RA 1RTJB 2LYVA 3IR7B 4OYWA 2KH9A 2BJ3A 2XZDB 2WHOA 1RTJA 3LPEA 2W2MP 2VZ9A 4WE1A 1MMDA 2UUCJ 1RT7A 3CMES 2JDJA 1LFPA 2HNYA 2MLXA 2HQ3A 2QV6A 4QPTA 3ZTRA 4DUTA 4CP5A 4ECTA 4DL5A 5J2QA 3MPDA 5K14A 5M2RA 2MY8A 3ZZRA 1OS5A 4Y6IA 4KHRA 4P72A 1O8BA 3KLFA 5KFMA 1D8ZA 1WHYA 3MEEA 1HHTP 2ZH4A 4DR1J 5J1EA 3IWNC 1NO8A 3D1OA 1XN9A 1LEOA 3DXSX 4MYUA 1IBCB 4WK1A 4B3MJ 2FHJD 1L3KA 3DOLB 4TYBA 3C19A 2U1AA 1KEKA 2QJ3A 2UP1A 3I0RB 3QGIA 2VG6B 4M5KA 1MSWD 2AJ2A 2YNFA 2MKCA 2AGOA 1TV6A 2X1GA 3PO4A 1OY6A 1SC3B 3D68A 3O6QA 4IO1A 2IBKA 1TV6B 3THTA 2AYEA 2FDNA 5KFCA 2E1RA 1Q7LB 4RR5A 3IN5A 1X9WA 2ZH8A 3OR1B 1HWJA 5DQIA 4U67Q 1AZSA 3GV7B 2DGQA 4ED3A 1HBOA 2EXUA 2AEFA 2NSBA 4PG5A 2DNMA 5CQGA 4ECSA 2HBYB 1X4DA 2E7XA 4DPUA 3ZNUA 1S12A 4C11B 5F9LA 4X64J 5DM7Q 3NMRA 5ETLA 1VQ6S 5CCLA 5LL6d 4J9RA 3M2RA 3NL0A 3G82B 3MECB 3UVJB 3N0VA 1KRPA 4K4ZA 2BKPA 3M32A 2LA6A 1KFDA 5DJBA 2QE5A 3GLJA 1S10A 4I64A 2NXJA 2E5LF 2IMWP 6FD1A 3FK4A 3DM2A 2E5LJ 1RWMB 4PXDA 3IG1B 3M2VA 3PACA 3QT7A 3GV8B 4O3QA 3MD1A 1VK3A 4ES2A 1RWKB 2BJDA 3IG1A 3MD3A 1S59A 4DV0J 3C6TA 2WTFA 2AGPA 1VBZA 3QRQA 2ZNZA 3GG1A 4TLQA 5DDQC 2Y8YA 3ZFVA 4WYWA 1IJEB 4ATNA 4RBVA 2J7KA 1O6XA 4HYKA 4PQAA 2I6WA 5CABA 5IV4A 3Q8VA 4NLGA 2FGCA 2YWKA 2UVRA 8AT1B 2KFNA 4J7CA 2DJWA 1KTQA 1U1MA 3B4MA 4NLOA 2PEBA 5FLXY 2EC2A 1EKSA 3DGPA 3OJUA 3TVKA 1JLGB 4DV5F 4N41A 3DNCA 3QWPA 4IRCA 1GX6A 3MMBB 5L46A 3RZAA 1QUPA 4PXCA 3GIRA 4LQ3A 4FNHA 2NUHA 2WVDA 2EVZA 1FNOA 2LECA 3VTIA 2CXEA 3CJSA 1NJYA 3HO1A 1FJEB 4OJ1A 3TUJC 4DEZA 2HRTA 2MHEA 3CEDA 2DNLA 4Z7CA 1VQ8S 4M5MA 3OVAA 2W9CA 3FSIA 4WKYA 3VAFA 3B78A 5F8MA 1W2BR 3QO9B 1REVA 1VC5A 3FCWA 3J7YI 4K8RA 2LEAA 4KBIA 3W1YC 4RZRA 3PNIA 1REVB 3CJ5A 4D3GA 2YPZA 2ZWPA 3CJRA 3I9ZA 1SQFA 4DV6J 2Y8WA 3TEGA 2K06A 2B4VA 1WORA 1N54B 1R7IA 2F4FA 2ZE2B 3KTQA 2VPWB 3BO3A 3K57A 1JX4A 1I1GA 4O3PA 4CNZA 1B70B 1TU0B 5JVGQ 4UOGA 1VFJA 3C8YA 1RT1A 4PZVA 5F0WA 4C0HA 2XWYA 4ZS6A 1SKRA 2W9BA 2DNYA 1KQFB 5HAOA 1LWCA 5KFSA 5L1KA 1RP5A 1U1RA 3PO5A 1N6QB 2X1FA 2UV8G 4XPCA 4CM0A 2HFZA 2GVDA 2P9GA 2V2VA 3MR5A 1QAXA 3MMAB 5HSPA 3ITHA 4RU9A 2AKWB 3MR2A 2YKMA 4NEYA 4D3HA 1NK4A 3HT0A 2WVEA 4DQPA 1WKKA 4DI6A 4WCEQ 3P6YC 1DQAA 4F04B 2E5HA 1HNIA 2MKKA 2QA4G 2A6MA 2R2UA 2UV8A 4HEA9 5T14A 1LV5A 2POKA 1Q5VA 4GKKF 2BM1A 5KFQA 3FFIA 5FJ4A 1XEZA 1GAOA 1QVGR 3CDUA 2XI2A 3CJ3A 2CPEA 2C3OA 1U49A 1FJGF 1YK9A 3IXQA 2Z2YB 3ISNC 5E3RA 3N6LA 4JYAJ 2KI2A 4ZJOA 3GJTB 4KKOB 1RT2B 4U7CA 3UCGA 5CD4H 4BDPA 4NMXA 4B3OA 1RAGB 3ZZYA 1JB0C 2DPIA 1GXLA 4ZCKA 2KYZA 5AJ3J 2BKNA 1M5KC 5EN1A 2UVWA 3JTPA 4LF7F 2FVSA 4KGMA 2XULA 4PXEA 4DPTA 9ATCB 4NASA 3HKZD 2XYPB 3AODA 2R9LA 1K47A 2HBQB 3QWUA 4I7FA 1NAQA 2VG7A 2BJ1A 5AXKA 1Q0NA 5G0RA 1JKHA 2N4DA 2Z8QA 2VPXB 4DR6J 1S1TB 3HF5A 3OLBA 2RRAA 3D67A 3NGUA 3L9ZA 4EYHB 1FNMA 3V4IA 1JKHB 1T05B 3A8EA 2M7SA 2A0FB 2EFOA 3UR0A 2R8KA 4LFBJ 2NCKL 2ZH3A 2ZBIA 4DUYF 4CLPA 1U1LA 1HNZJ 2V0NA 1VJWA 1TL4A 1WHXA 3T41A 3FMWA 3HSZA 3U27A 4A8KA 2NXUA 1GXTA 2EKNA 1VBYA 2BDPA 2FC9A 1JJ4A 2EFPA 3OBIA 1JIHA 1Q53A 4P6QA 3G8SA 1JLFA 1ZZNA 3C16B 1FTRA 4CLZA 1KTVA 2BZ2A 4RLEA 1NCLA 3W60A 3KHGA 3BDEA 3BDPA 5F8HA 2DNZA 4C3LA 1WWHA 4BWMA 4ZCMA 2O5DA 4RW4A 3ZXWA 2MQ8A 4RW8B 1CEZA 3HFKA 4KPCA 1MWYA 2ZC3A 2GGPA 5CYQA 2XMWA 1WC5A 2XS2A 4OHVA 3ILOA 2EEYA 4G65A 4M5JA 3I55S 3GIIA 2OHDA 1JJ2R 2B3TB 2JEIA 4K0KJ 1RTIB 4YR2A 1XMQF 1TKZA 1GTEA 1ZTWA 1NH8A 3NGRA 4C4WA 5E7OB 3OHAA 1IJFB 2JX2A 1W7WA 2Z56B 3SI8A 1IR2A 4X4VA 3N6NA 1SUQB 4TNOA 5BXIA 2M5YA 1R6VA 2VIHA 5JVHQ 2GQ2A 4YDDB 3W7BA 3D5MA 4QWCA 2VG5B 2Y0BB 4JB8B 1VMBA 1YHQS 1NK6A 4C8OA 1AFJA 4ECXA 2UU9F 1FVQA 2DYAA 3FZ2A 3EGZA 2VG5A 4B9VA 1LWEB 2B9WA 3QSYB 3OTBA 1T94A 4AFFA 3G6VA 4ED6A 1S0NA 1HKAA 1KP6A 4LRAA 3GV5B 4JI1F 2HGMA 3ISZA 1S97A 4Q0BA 2OUGA 1HBNA 4ZVGA 4NLSA 3SSRA 1SJFA 3DC2A 3QYYA 3T6BA 3K59A 1S9GB 1HMVB 2K2PA 1SJ1A 2BABA 4Z7YA 2J6TA 2XY7A 1Q4RA 1NSQA 4DQQA 5A2QY 4QPXA 5DGAA 2KTQA 3A12A 1IVZA 2I5JA 3MM6A 3G8TA 3DHWC 2RD5C 4RW7A 2ZOMA 2Z58B 3G8QA 2R7VA 4Z37A 3S01A 1VLOA 3MI7X 4EMDA 2MGZA 1HWUA 4RW9B 3QT6A 5A8RB 2XS5A 3VAJA 4H54A 4QIGA 4RUHA 5LMUJ 1S1UB 2I38A 4RW6B 3J7A1 4F2SA 1T9YA 1T95A 3LAKA 1K8AT 1PAEX 5FDLB 1H2UX 2DCUB 2LEPA 4OZ2A 1N34J 3B8HA 1U0HA 2XG8A 2ALYB 2UXDJ 5CYJA 2B4UA 4CO1A 4DR3J 2GCFA 4CTAA 1C1BB 2GO8A 1SI9A 1MWQA 2LQ8A 4MFBB 2C2OB 4BC9A 5I3UA 4J9MA 3G6XA 1BLUA 3T1HF 2RS8A 2XO7A 1NHUA 3GILA 2BQ3A 2VASA 3UN3A 4KY3A 5I42A 1RBOB 3MEKA 4I69A 2FZCB 2ZJQQ 2DISA 3I82A 3GJQB 3IRWP 2NQPA 2CRLA 2GO9A 3IM8A 2FY1A 4DG1B 1EETB 4O23A 3VAMA 1QSYA 3T5KA 3IO1A 3AXMA 3B6BA 3DN9A 2B8QA 3HHLB 1ZA1B 4YQWA 2HEKA 2B9EA 5DQGA 1DARA 2E5JA 2QMXA 2VFTA 4WKRA 1QAIA 1M1GA 3HHLA 3OR2B 1CC8A 3W2WA 2PMZD 4QIFA 4CH7A 4ZMMA 2EFNA 2RMLA 4HDGA 1RISA 3F41A 3W2VA 3WC0A 5LJ3Y 4WJBA 3S7RA 3GIKA 3K5MA 2EK6A 1GK8A 1Y10A 3T1AA 4ZOSA 4FXDA 1FDAA 1MG7A 4X2BA 3HX9A 1C2PA 4ANCA 3TANA 1JLQB 3W5XA 1ZAWA 2UUBF 1EQMA 2DNPA 2OKQA 3M30B 4NA1A 2XSJA 5ETKA 4QQBA 5HMZA 1XNQF 1RWPB 3H0PA 5HK4A 3RW6A 1NPPA 3HLUA 2GAGC 1CJKA 4LF9F 1RAJA 1RWOB 2FHMA 2Z57B 3VWSA 3C2PA 5A8KA 3GFYA 2R8HA 2J6UA 2EBGA 3QIPA 4IR9A 2X3DA 3TA2A 1X4AA 3KLHB 2Y1IA 3OXLA 2VQEJ 1GH8A 5A8KB 4L72B 2RDIA 2FIUA 3BZQA 1DTQA 2GMLA 2ZKTA 2A3JA 4ZVEA 3EPIA 4DS5A 3GSDA 3KLFB 1S6PA 4ZPWR 2PMHA 3QAUA 2HQGA 1U6BA 2KVQE 3RBEA 2YWEA 3GB0A 3JTNA 2OFHX 2JRSA 3BF4A 3RRKA 3SCLE 4KV8A 3KHHA 3VAGA 4V19X 2ZNYA 5EX3A 5D4LA 3LO3A 4OYIA 3SQGB 4ZLPA 1HYSA 1AW0A 2BANA 1KQGB 4TQSA 3Q2SC 1L5UA 3EDRB 1HYSB 4NYPA 4K4YA 1UVMA 3GFZA 2QA1A 3OTDA 2JLGA 2HVIA 3QLHA 5KFBA 4X4QA 2P9CA 4X62F 2C2MB 4R8UA 4EI2A 3MR3A 1TTHB 5L1LA 2H54B 5I3PA 3BGRB 2ROPA 4RNHA 4R8UB 1UFLA 1UA0A 1VQMS 2W7AA 4PG6A 2CQ3A 3CO0P 4HHJA 4I68A 5D0HA 2E5IA 1HBOB 3W63A 4QYZK 1OYDA 2OPRA 2IC3A 2PDAA 4U7UK 3A4TA 3GCWP 4O0NA 2DXEA 2HNDA 2V2ZA 3CJ4A 5E3PA 5BYRA 3I4PA 3FVYA 3BREA 3U1LA 3EPGA 3MTJA 2ILYA 4DFKA 4KGVB 1DTTA 2UVUA 3DLHA 2P9EA 2J7WA 3S1TA 2OIHA 1IQZA 1S76D 4L6V3 3C14A 2HVEA 5LSLA 1JMTA 1UWAA 4Y2AA 3CJ8A 2PI4A 4PQUB 3CT9A 2GIQA 1FWKA 2HIYA 2HLUA 2IJNA 1KDNA 1UPMB 3CJTA 1YJNS 3NCRA 1S0MA 3IS9A 2R7RA 1DLOA 3MPYA 1N33J 4X4NA 1U7LA 4DV2J 5KT2A 2ROEA 3J81Y 1BGXT 3VZHA 4CLKA 1IN0A 2W8KA 4DR4F 4UOCA 3R7BB 4OYOA 1SH3A 4IG3A 1RSCA 5J1PA 5ETTA 2XZTB 4FF3A 2RJZA 2M4MA 2CJAA 3JXOA 5K14B 4ID8A 3K5LA 2ZHBA 2RU9A 3TA1A 3M6XA 3DRPA 5H1SV 3KHRA 5THWA 2IYGA 1PCAA 2VC0A 3DYAB 1RWVB 2R2TA 1FE0A 2MZQA 1S57A 2K1RA 1RWNB 2OJ3A 3TUZC 1RK8A 2K3KA 2OEMA 4Q44A 4F02A 2A10A 2GHWA 3TAMB 4DV4J 4B17A 4ICLB 3NP5A 1Q78A 2CJBA 4F4XA 2OP5A 2QYCA 4N8NA 3GSIA 3FBBA 1S7IA 2XMVA 3IP0A 3R5CA 2DR9A 1AZSB 4LF1A 1H7XA 1OYEA 4O3NA 1ZTTA 1Q7YT 3M4XA 4I2PA 4PPZA 1Q5YA 4K59A 2QA2A 1HI0P 2HVHA 2KXNB 2ZH9A 3PXGa 4UZBA 4E8UA 1VJQA 4X4RA 2OPPA 2YNIB 2DY9A 1CSJA 4TLRA 3G9CA 3MECA 3PJ9A 1JLEB 2RF2B 3CIMA 2G9OA 3AJ2A 1TL1B 3QIDA 4DU7A 5B0DA 3HI9A 3GIJA 2DD8S 2D1CA 2NSCA 2C2KB 3SMZA 4CNYA 4Q2MA 4F0KA 3CUNA 4AUKA 2H5EA 1EJ7L 1JQGA 2QLJB 4M5IA 2C2ZB 1DQ8A 3M05A 4DCOB 4PUOA 4MK8A 1V9OA 5B09A 1M5PC 1EP4B 3RRHA 1HNIB 3Q8PB 4A8WA 1PJ7A 2V5HG 3NGTA 3NG8A 1R0AA 1SCJB 3OVBA 1XTZA 4NLQA 1Y0HA 5FD1A 2XQCA 5CH7B 1R0AB 3CCVS 5IC4B 4EBDA 2DPJA 4OJGA 2BE7D 4MKVA 5L9XA 3QZ7A 4IRDA 1FRXA 3QMQA 2ZDPA 1XMQJ 4OX7A 2VQFJ 1NK0A 3BPDA 4YHHJ 2CIMA 1ZM2A 3W9HA 1J5OB 4V19J 1TMJA 2ACYA 3PCOB 2IJRA 4G1IA 5ETRA 1AB8A 4JUZA 3H5YA 1T03A 1UMJA 3DLGB 2PN6A 1GFWB 4QW8A 1QAYA 3RGIA 1VRQC 2HGNA 1IKYA 1HNVB 2CJXB 3IR5B 1S4FA 3L7OA 4K4XA 4ID5A 4MT1A 5H9EK 1CG2A 1MW7A 1PILA 1YZ6A 4JI4F 2ADCA 4K4UA 3JAMU 1HPZA 1FFSB 2G2YA 1S72S 4W4MA 4DWIA 4ZLJA 1C4CA 2MJUA 1XJWB 3CD7A 4ITSA 4CO2A 2D3OR 5HMWA 5GAGU 3KK1A 5KG5A 2AQ4A 1T9WA 1S1XA 1WTFA 3SEOA 1NM2A 5KFXA 1RU2A 3FQKA 5GAEI 1EARA 3BKTA 1FI4A 4MTPA 2IM0A 4EBCA 4LMZA 4QYZJ 2HHSA 4IDKB 1FWLA 1C0TB 4CCHA 3KOAA 2KG1A 1UP1A 4DV5J 1PBUA 1RT5A 4DUYJ 4X4TA 1QLNA 3UD4P 3V81B 5CCMA 1R0CB 1HNWF 3EXCX 4WYLA 3MPVA 1RT5B 2W9BB 2M2BA 1U48A 2G13A 1H0HB 3D0HE 3UO0A 3L95X 2JVRA 1HNXJ 2XCPA 2GZOA 2VU5A 3GE9A 3BR8A 3IC1A 4DR6F 4DN9A 5IWAJ 2HHQA 3OW2R 3ZZPA 4DR2J 5GMEA 3G86A 4HT5A 3QT5A 2CKWA 4TU9A 1UETA 2DK2A 3AFGA 2JL9A 2LA4A 2VDIA 4BBYA 2BQRA 8RUCA 4LREA 3VCDA 4NXNJ 2HHWA 4TYAA 1ZM9A 3PM9A 2OI2A 3CCTA 1RHJB 1T11A 1U26A 4B9LA 2NZCA 2KRBA 5HANA 2HGLA 4OZ1A 3SV4A 3MM9A 4M95A 2QT7A 3DLKB 1RTIA 3DRYA 3D9BA 5H9EJ 1OSCA 1NJZA 1S1WB 2EPIA 2AJ1A 3TZZA 2NR0A 2ERRA 2OPQB 2KKHA 3E2EA 3N9UC 4FYWB 4P73A 2FPHX 1N4LA 2W2OP 2FZKB 4WK3A 2OPQA 3D6MB 1BXNA 5HI7A 1SIWB 2DIVA 1CJVB 1VIOA 3DHXA 1N32F 2ZH6A 2RQMA 2G1DA 3NNHA 1FXLA 4LRDA 3V4MA 2DCLA 2W4PA 2CPZA 3QT8A 3GYNA 2KM8B 3KLGA 1SJ3P 5J2MB 4K2JA 1YJUA 2ZBCA 4F26A 1FCAA 1RA6A 5J2MA 2FLNA 1R8CA 2DNNA 3SDEA 2B51A 4Z2XA 5HN0A 2IIHA 3P3DA 5G0RB 4KHPJ 4DR7J 5HATA 2RILA 5LXRA 3LP2A 3M2UB 1S9GA 4LR9A 5HMXA 4PG8A 5D3GA 3O44A 4BWJA 5AE1A 3LP2B 2KJWA 3M2UA 3G4SS 1AT1B 1RXOB 4DPXA 1WF1A 3A8KA 3MM6B 3SV3A 5D8HB 5KFDA 1NNDA 2XNRA 2AX1A 2DXDA 4HH1A 1NH7A 5IS2A 1OO0B 4WIIA 3HVTA 3QGHA 3KLEB 5EWFA 2JFDA 3D3CJ 2YWHA 2FD2A 2PEHA 1WDTA 2WCXA 4KSEB 5B0EA 1M5HA 1X5PA 3KLEA 1QAJA 8ATCB 4CWBA 3VF0B 2M0GB 2WB1D 4X65F 4ZKAA 1ZS6A 2SXLA 3BSNA 1H7WA 3PW2A 3Q83A 4OV1A 2CADA 2PIIA 2J6SA 4J9SA 1G7CB 5KFHA 5GADI 1TKDA 2QLXA 4LF6J 3I32A 2KHDA 4J37A 2FHOB 3O8WA 1OQ3A 1PC4A 4DR7F 2QL7B 4CLTA 4C48A 2X7IA 4XO0A 2MZ1A 4LT6A 1BUXA 3Q8QB 1ZBTA 3LGMA 1SV5A 1URRA 4FP9A 2XMTA 4DV3F 4F4YA 2V4RA 2R3VA 5KT7A 2ZD1A 3M8ZA 2R4FA 2O01C 2HHXA 2VQFF 3PFEA 3FBFA 4OQJA 2QL5B 2DT9A 2L48A 2KT3A 2Q3PA 3KJQB 1GMWA 4FVCA 4LSZB 3J7Z5 1KC8T 5C2CA 3M8WA 5KFWA 2ZZMA 3VR1A 1DHMA 3EDQB 3OSNA 5CD4A 4LR7A 2F65A 2F5GA 3VHQA 2OPSB 4NLDA 3RTVA 3RAMA 5E3AA 2HAIA 1X9MA 4K4WA 1ZA2B 3LWMA 4YR0A 3MUTP 2AJ0A 4ANDA 4J9UE 1JLBA 4CLUA 3NMAA 4AD6A 3NEKA 2KXHA 1X7VA 1N88A 1S5ZA 2R42A 3IGVA 4C98A 3BGLA 3HHKA 4CLYA 5B08A 4JI7J 1WC0A 3U1NA 3MM8A 2HIQA 5HVGA 4W90B 1X5TA 2H9ZA 2H5JB 2R7WA 3M1VB 5HLFA 1CBKA 3BS9A 3SFUA 1PSDA 2YX1A 2W9AA 3AB4B 2BA9A 2VDHA 4KIAA 2BW2A 4NCGB 3AA8A 2ZWOA 2F8EX 3IAS9 4ZDNA 5DLGA 2M88A 3IRXA 4USIA 4DSKA 3PEJA 2OTJS 3PR4A 3HHNB 2CPIA 2XM3A 2OFGX 4JI7F 3H25A 4B9SA 4DX7A 5HVFA 3J80U 4FDFA 3J81j 4DL4A 1KQKA 1IKVB 4IOAQ 3GTYX 3CTRA 3CD0A 4KQZA 4LSNB 3C6TB 1RABB 2GC8A 4YEAA 1IR0A 5FIIA 3QATA 4DHVA 4N56A 5DRKA 3NY0A 4ZVSB 2DR7A 3HK2A 1WI8A 3H2LA 2E9ZA 1H74A 2UVVA 5A6PA 4GVBA 1VRTA 2V94A 5L1IA 1ZAXA 1B7FA 2V9WA 5AXNA 2XYGB 4KB7A 2OO4A 3H2VE 2ASDA 1D9DA 1VRTB 4EBEA 3D3BJ 2OD4A 1GX5A 2JOQA 5JUMA 2MKHA 1H72C 3JS9A 4BCAA 1HIYA 1WG5A 2NLWA 4RBUA 4AQYF 1FT8A 2RUGA 1CPZA 2AGQA 1FK9B 1FO1A 1NSAA 2QLFB 4USHA 3UN5A 1I5OB 5EUHA 4K5SA 1T3NA 2QSWA 4M1KA 4YHHF 4QCLA 2CQBA 3X3UA 2BE2B 5KFVA 4B9TA 2HW3A 2C2RA 4YMEA 3LA0A 2RNEA 5KFOA 2B7BB 1KR4A 2K3IA 1XR5A 2YKOA 3N28A 1VRUB 3QO9A 1CS4A 4H4MA 4WP8A 5F0UA 5J1NA 1CJKB 1T8EA 2KFZA 4ZPBA 3OTOJ 1WACA 2OAUA 1S49A 3PVXA 4JI5J 4NLWA 1P9QC 5IOLA 2RDJA 1HL6A 4CYUA 1S6QB 1Q81T 3PEHA 2IM3A 4K4TA 3ILLA 3PYFA 4PPDA 2MQOA 5DG8A 1S6QA 1DTQB 4J9LA 1F9EB 1D09B 1HQUB 1B64A 3LW5C 5B0GA 5IQQA 1VHIA 1WOOA 5HROA 4UY85 5LM7E 3GWCA 4A8MP 4EZ6A 1OJ4A 1N6QA 1NMEB 1RBLA 4N77A 4YOEA 3KJNB 1FXRA 4KV8B 2GVDB 1RCOB 1UZDA 2BJ8A 3LALA 4OJ3A 4UF4A 1D8YA 3MCNA 2GW8A 2Z2ZA 2ZEJA 2XMUA 1YJ7A 4RX6A 5BYQA 3CD5A 2KFYA 2AYBA 3DLJA 4USWA 2N3LA 3HVAA 1OMSA 2A2CA 4ZP7A 3SCKE 1WNEA 2V63A 4S0MA 2ZC4A 1RT6A 2HAFA 4NLPA 5KT3A 3CCMS 1RTZA 2MYFA 3RJMB 3ZZZA 2YKNB 3Q8SB 3H40A 3MAAB 3M7VA 3CC2S 2UXCJ 4O44B 1C0UA 2IA0A 2V68A 3DLEA 3DLBA 3MAAA 3VALA 1KBRA 2OD6A 4A8QA 1FKPA 2Y1RI 3H20A 3AOCA 3NBPB 4RNMA 1VYAA 2IC3B 4PG7A 3KJVB 1YQHA 3BQ2A 3MEGB 1HR0J 2MXYA 2ZH2A 1KKHA 2L9WA 4K2XA 4C97A 2VBWA 3RB6A 3DOMA 2E1MC 1N0VC 3L4BC 3JYTB 1SL1A 1MMLA 1JXVA 1VCTA 2Q79A 4NLVA 4OZNA 4U8VA 4PWDB 3CO9A 1JNZB 2CPYA 2N7YA 2OEKA 3D6FB 4GRSA 3V2UC 3OLAA 2PMWA 2JEGA 2QYGA 3PRDA 4GKJJ 1T9TA 4WFXA 1EQ0A 4NA3A 4L3KA 2CG8A 3CNQP 4X4SA 3M9NB 1OIAA 2MQLA 2IPOB 2QSFA 2RQ4A 1SKUB 1R0BG 3JQJA 4CT9A 1QSSA 2B56A 2EFQA 3N4WA 4CO5A 4USKA 1Y5NB 4MIAA 1WKJA 4YB5A 1DJ0A 2LQBA 4OX9J 1FA0A 1X4BA 1CJTA 3PIOQ 3G6ES 1KLMB 2ZBRA 3HD2A 1TUWA 3UDLA 3FCHA 4ZCLA 2BEFA 5D4PA 1NKEA 1A6LA 1KLMA 4Y00A 1EZZB 4AL5A 1RHRB 2PC6A 2CQ0A 3DRPB 4B02A 3K8VA 1XR7A 4RL1A 3DGPB 2F7VA 2GQQA 4NZ0A 1NJWA 5HP1B 3EZUA 5DQHA 1JWWA 1FNXH 2ZBQA 2XMMA 1X8DA 4DSJA 1URNA 1LW0B 5F3TA 4QWAA 4ID5B 2PE8A 3HJFA 3E51A 2DO0A 1T0TV 2W2QP 2QMUB 5KFKA 4ED2A 2VFUA 3T9ZA 3ZZTA 3SCIE 4JI4J 1SJRA 2RRBA 3DOLA 4PWDA 4KPYA 3LGHA 4ELTA 3HKWA 4P75A 1MU2A 1N34F 1HBUA 4C0OC 1YJ9S 2HHTA 3ZTOA 3HJVA 1CLFA 5GADU 1AROP 2A2DA 4OZLA 1C0TA 4F4KA 1Y3JA 4ZVHA 4ZITA 2QC3A 1TKZB 5KFPA 4PYAA 3BN7A 2FVQA 1U1OA 4F4WA 1FF2A 1RT3A 2EKYA 1H73A 1V3SA 1V5VA 1DAXA 1VOMA 4DOZA 2VH7A 5FLXU 4ECYA 4WFZA 2HHPA 1HQEB 5K8PA 2CQGA 2CPXA 2VBZA 2RDDA 4TU8A 1N48A 1QM9A 3FGVA 3BEGB 1TMMA 3AD8C 4ECUA 4DQIA 3J7ZT 3FEZA 2J76E 3Q8UA 3V6HA 3K5PA 1XBWA 3TX0A 5E5NA 2YKMB 3CB4A 2HQFA 3DRSB 1TAQA 3U1MA 3F73A 1XERA 4J9VA 4E0DA 1U1PA 3W66A 4FYDA 3PKMA 4EU0A 5SZTA 1FX2A 2AJQA 2P6SA 3LOUA 4I2QA 4R5PA 1O51A 2GHPA 3VQTA 3ENVA 4DPYA 4YFUA 4OZ5A 2NYHA 3HVRA 1FFGB 6FDRA 5D0EA 2BACA 4Y65A 2DNHA 2XCAA 2W7OA 1IBLJ 2LQ5A 1R3NA 1UZHA 1XR6A 4MJKA 2ADBA 4ECZA 1H38A 4CRJA 3CPWR 2O66A 4J9OA 1RKJA 4MKAA 1T03B 1YRXA 4DL2A 1RTDB 2FVPA 4WFNQ 3PY8A 1T9VA 2CQCA 1DQ9A 2KYXA 5C5JA 4K7QA 5IQ6A 1U0HB 1X5SA 1Y5IB 2R7SA 3W3SA 2APOA 1UVLA 4DDFA 2CUYA 1REGX 2KVIA 2YNGA 3LQVA 1FRKA 2PI5A 2ASYA 2Z4PA 3RAQA 4DPOA 2MHNA 4DV4F 5I42B 1ZPVA 3GZ7A 4N8OA 5LOQA 1XQIA 3O2IA 1DBDA 3J81U 4WZQA 4ILMA 3I0SA 1K9MT 1P6TA 4ZPVR 4DL0C 5B0CA 5MLCV 4FS2A 3V4IB 1K0TA 2LKZA 4ED8A 1FXDA 5K5MA 5KT4A 3R1HA 2IFXA 4ED4A 4LF9J 3BSCA 4LRBA 4DL7A 3T19A 3JTOA 4DF8A 3K8WA 3BBFA 3GR1A 2B7CB 1NXIA 4PAAA 2VA2A 3B82A 1J5EF 1SKWA 5DZ7A 3RU0A 2J0XA 2R8GA 4F2RA 3EGVA 1JJCB 3UPFA 2J9EA 2DNGA 3DMJB 3L09A 2J8AA 3CC4S 4K4SA 9RUBA 1NKCA 2YKQA 3IBCB 5ETMA 4DV2F 1UJ6A 2V2QA 4HTJA 4IUFA 1X0PA 1E6YB 3CDWA 3KKFA 1FRHA 1S1VB 1KD1T 2MB0B 1CQNA 1KONA 4OX6A 4GKJF 4X66F 2V69A 1BY9A 2KN4A 3BPSP 3VAHA 3J7AN 3FQLA 1UTAA 2DBBA 3GPAA 4MIBA 3SSSA 4FXWA 3KK3B 4XDCA 3CCES 2VBXA 2XY6A 5DM6Q 1K73T 2OTLS 1Y5LB 4H4OB 2LDIA 3R8YA 3BBCA 1CC7A 4HR2A 2HNYB 3M8YA 4QWEA 1RTHB 1WD6A 2P6TA 5BR8J 4QOTA 3Q89A 2EG2A 2IHR1 5L38A 2DEJA 2V2KA 4C3KA 5KFJA 3I5AA 4ZPAA 4Y2KA 1X4GA 4HACA 1FFWB 2NXCA 4IFVA 5D15A 1ELOA 1HR0F 4NYZA 1PC5A 2CQ4A 3CD6S 3RB0A 4HACB 1LK7A 3LH2S 3KUGA 1SVDA 1R27B 1ZM4A 2FVRA 1G1XA 2CJQA 1U25A 2GQCA 5EDWA 2CJYB 1JLBB 2IVYA 5KFNA 3ULHA 2HRUA 2PA8D 2DRAA 1F2GA 1RI7A 2HNZA 4GMKA 3TJ8A 4F0HA 2ZJPQ 1A9NB 2JFKA 4P2MA 2E7VA 3MM8B 3ENAA 1F2HA 1Y9OA 3Q86A 4RUCA 1X9SA 1UVIA 4C8ZA 2CQDA 2VKRA 4OLPA 1Q16B 4CO0A 3TQ1A 2XZWA 2H5IB 3IFEA 4IYQA 2VC1A 4J90A 3PW0A 2KZZA 2IMOA 4ZVPB 1O0PA 2NREA 3G87A 1YBTA 3OTEA 1VBXA 2WVFA 4OZ0A 3G96A 4V1Ak 3M6UA 2VQEF 2HZAA 4X65J 3TEHB 1RA7A 4NMLA 5IM0A 1RADB 1TAUA 1FWPA 2R7QA 2B6AA 3FJ2A 4PR6A 4EUVA 2N7CA 1Q8IA 4KRWA 1JLFB 3VAIA 5KFAA 4NRUA 4F3QA 3PW5A 2UU9J 2LP4A 1M1HA 3DM2B 3EM1A 5ETVA 3KMSA 1WHVA 1TKXB 3BGUA 3I31A 3Q23A 1U1KA 4ERDA 1L3VA 4LRCA 1NHVA 1FJCA 1YGYA 1NDLA 1TKXA 1CJUA 4NX9A 3Q2TC 4PYDA 2KL8A 3T3FA 1HBMA 3OFHA 1TL3A 4ETXA 1TFYA 1IBKF 3DFEA 4K0KF 2B43A 3R6LB 1N5QA 4QIVA 2V8PA 4LQ9A 1L3SA 3HSJA 3RBDA 2BXJA 1HLWA 2N82B 3V6DA 4O3OA 3SBMA 1QJHA 4OYMA 2HMIA 1PO6A 2XC9A 2X51A 2LXIA 3BN4A 5H9FJ 4DCPB 5IM0B 4QWBA 4IG0B 5KFRA 5DETA 1M90T 1NK7A 3SCJE 1X4HA 4C8YA 1NSKL 1Z2ZA 3AQPA 3NS7B 4OIXA 3BR9A 2ABYA 3DRRB 2HS4A 3LP1A 4CLLA 3ILIA 5I3QA 4JI3J 2O1PA 3E01B 2YVSA 3PYGA 4TY9A 3NS6A 4NEZA 2QMWA 2M3DA 4CO3A 3QSIA 1Q8KA 2JJ4D 1UWBA 4UQTA 1VQ5S 3M30A 3FBCA 4M5HA 4JV0A 5T41A 2LCWA 5KFTA 3TQEA 7FDRA 1UWBB 5KG3A 5C24B 4LJMA 4OFZA 4WU3A 4Q5VA 2F40A 2ZZTA 4KE5A 3R2CJ 2WZ1A 2C3MA 1RAIB 2A6OA 2D9PA 1RZMA 2RB7A 3OD2A 3KFWX 3X1LB 3MMCA 2A18A 2GIRA 4I1TA 5D77A 1UW4A 1CULA 4IH5A 4HKQA 3M1VA 3MR6A 1FESA 1HD0A 3EWGA 5ETOA 1TVRA 2JLEA 3PJWA 5LSRA 5IZHA 1FDBA 4B3SF 5A8RA 2YH0A 3MCOA 1VQYA 4M5LA 2MDAA 1S99A 1MLAA 3FEYB 3PR5B 1RYSA 3P49B 4ZPTR 3ETOA 2Z0GA 3G2XA 2PFFB 1HD1A 5KAKA 2ZDOA 3SQGA 4CO4A 2F3JA 3B54A 4I56A 1AXQA 1VIXA 2I9SA 4YB1P 4MKBA 2J9DA 3EX7B 4DR5J 1C1BA 3EXYA 3NOCA 2X3GA 3W65A 5I3UB 3MURP 4B3MF 1BQNA 3PIPQ 2UXBF 2EG1A 5L39A 2CWKA 3QFWA 5A6WA 1JLCA 3ZTQA 1U1QA 3QRRA 4KJIA 4GVBB 1NPKA 2LDYA 1YZ7A 2YH1A 2BJ9A 5H9FK 2KM8C 1NB2A 3HHLC 2CAJA 4GKKJ 4DU8A 2D41A 1OSDA 2GJFA 2E9TA 2I2YA 4C8LA 4DX8H 4MKYA 2MZTA 3OXGA 1RT2A 2K7JA 1TR0A 1WKLA 2F1FA 1M0SA 1YJVA 3MMBA 2CZVC 2OSQA 3FCVA 4USVA 3WZ0A 5J2PB 3EZOA 4EYIB 4X84A 3SSQA 3QGGA 4YB7A 5ETSA 3RAXA 5D4NA 3NWRA 2Z2MA 1UPPA 4CIOA 4DSFA 2W2PP 4ZLNA 1RHKB 3DOKB 1P1TA 3I9V9 3IMQJ 5IV3A 4EWTA 4DFMA 3JSBA 3K0JA 5DLFA 3KJFB 4I67A 1CS4B 2FTRA 2OMLA 3DOKA 1MMNA 4H4MB 1C1CA 2YWGA 4HDHA 3NNCA 5F9NA 1S1XB 2DVIA 2J8SA 2W4CA 4A8OA 2BQUA 1KVIA 4AE5A 2QL9B 2Y0SD 1T05A 1U8SA 2JNJA 4G1QB 4ENOA 1YLXA 2YQ3A 3DGVA 4LFAJ 4IG3B 2B9YA 3TW0A 3KLHA 1M1KT 1N0UA 2R7UA 1JLAB 1Q1KA 2J0SD 1FERA 1RT7B 1N5SA 1RT4B 4RWWA 2WW4A 2M70A 1G6BA 1TQLA 1PBAA 2JZ5A 4DXLA 1JLAA 3VGTA 5CXTA 3NRBA 1GXUA 1RT1B 3NGSA 2C3YA 3M8QB 5GAGI 3Q24A 1K1SA 1S9EB 3PHEA 4CQ1A 4TXSA 1VHFA 3MXHP 1YITS 3QAEA 3ZTSA 4X64F 3C46A 1HW9A 1TUVA 1YRTA 2X1BA 2G0CA 3QJLA 1WF0A 2VHGA 1VC0A 1M5OC 1O5JA 5J1EB 2Q66A 2R7TA 2BVZA 2N4CA 4EEYA 3JB9k 1RYRA 4I6WA 2MMYA 2WOMA 1VQOS 3Q0AA 2NPFA 3TZYA 4WXWA 5AJ3F 4ZVTB 4QU7A 3DXBA 3EVMA 2MKSA 3CJKA 3QJPA 2FY8A 1NJXA 4MAKA 2IVMA 2YNFB 3CDEA 3CGIA 3MEDA 3M6WA 1YBAA 4X4OA 2QLWA 2HHHF 3BGRA 1SPBP 3TZXA 2MPUA 3T5LA 3AA9A 2HYIB 3ET6A 3R7SB 1WSVA 2IDEA 3J7YU 2D69A 1VQNS 4QU6A 2Q6BA 3CIZA 4I6AA 3D7SB 3DRXA 2VFVA 3NCPA 3LP0B 4KKOA 2DHAA 4M5NA 1NK8A 2RHQB 1DTTB 4Y28C 3TUIC 3KLVA 3GFHA 2IYIA 3I4HX 3G82A 5KFYA 2LVWA 3C14B 4KR0B 2HBZB 3TVZA 5C42B 5F8GA 2HHHJ 4U7UD 1NBEB 2YQ1A 5E3QA 2LEBA 4G3IA 2EC0A 4OI6A 2AT1B 4LF2A 3MOJB 3HFVA 5CA5A 2AZ1A 3AQOA 4ZVOB 3EJMA 4M5DA 5HVHA 2VG7B 3W5YA 3UR3C 3WHIA 1KVJA 1IBKJ 3GMGA 1VLYA 5ADZA 2ILZA 4NLXA 4DSEA 1YJTA 4LF6F 2XLIA 2V6AA 1IQTA 4DV1J 2MZSA 1QVFR 4DQRA 3R27A 4IRKA 1D9AA 2BV3A 4ZLLA 4K50A 3H59A 1SB6A 4HH0A 3D6HB 1JXLA 4U8YA 4ECVA 2LXUA 2X1AA 1AUDA 1RTDA 2IAJB 5EWGA 4J9PA 4DN0A 2R7XA 2LQJA 2K1RB 4BLGA 4E2FB 2ZM6F 4RU2A 4LFAF 1XNRJ 2MZRA 1NU4A
chains in the Genus database with same CATH topology
4LUBA 2AF6A 4IR1A 1KHWA 3EGWB 2QA4S 1DURA 2KB2A 2YWFA 2FJWA 1HPZB 1GTHA 2E7WA 1R8AA 1U6FA 2XMKA 4OI2A 4I0WA 4YUDA 3M8PB 2CJ9A 2DGVA 1SV5B 1U24A 2J5AA 2WSCC 3SFGA 1OQ6A 1EETA 1N5TA 2HRYA 3IWXA 4IDKA 3RRGA 1WELA 4LFCF 4I2PB 3OR1A 4X4UA 3TRGA 2GA7A 2J0WA 2BJEA 2EFGA 5CZXA 1HQEA 3CCQS 2YX4A 5CYMB 4F8RA 4N47A 5KG0A 1TL1A 4TN2A 3HXMA 3OSPA 3DU5A 4QJVA 5CYMA 3T5HA 3PV8A 3PW7A 4DFJA 3EUNA 2KRRA 2QFJA 1B0PA 4A4JA 2PD1A 2ROGA 1EP4A 5DO2A 3AJ1A 1H6KX 2WSFC 4YP3A 4DR5F 2Q1LA 3BJYA 3ZZ0A 2DNKA 3P5TL 3K7RA 3BQ0A 2KDOA 4F4ZA 2MQQA 1S6OA 1IXKA 4Q8EA 4TQRA 2GFFA 2MY7A 2FVCA 2AU0A 4QR0A 1HFEL 2MGZB 4J9KA 2UUAF 4PWUA 1HNXF 5D78A 4H4KC 3K5OA 3I6PA 2EW9A 5DGBA 5T7LA 3MZIA 4GC6A 1IKVA 4B3OB 5JXSA 5KFIA 3MM7A 3TI0A 4PKDB 2BBEA 4CTAB 3OFFA 1KN6A 2FJXA 2JWNA 2P5VA 3KG4A 2U2FA 4ED0A 2DR5A 4UUXA 2AYMA 4LVNP 2L41A 4DR1F 3T5JA 4DJBA 1OPIA 3WDOA 4C9DA 1GQEA 3TVYA 4QIWD 5J2NB 5HQ8A 2E29A 1NKBA 2E1CA 5J2NA 3FRZA 4OI4A 4WFAQ 1LWFA 2RSQA 3MUMP 1J2VA 2E66A 3PZPA 3V6JA 1FK9A 2ZE2A 3O1LA 1DFDA 4FNIA 1QE1B 4I4BA 4ECWA 2CZ4A 3POTB 1DZ5A 4IOBA 4ZP6A 4IOCQ 4AL6A 3W2VB 4OLOA 4R0JA 3POTA 3NKYA 3JAMY 1SQEA 5F41A 1DLOB 4OHXA 1VQ7S 4CH1A 1UEVA 3ZC4A 1S1VA 5LT5A 2XSJB 5KG7A 1X4EA 4ECQA 2FUG9 5B0FA 3WBZA 3JSYA 4RW8A 3FSYA 5KT5A 1Q86T 5G4DA 3MTKA 2WBMA 3LPYA 3NLCA 3QIPB 1ZH5A 1U1NA 2AW0A 3DI6B 3CCWA 1SJ4P 2I1RA 2JLFA 1LW2A 3DLKA 3WC2A 5HROB 2MKJA 5BJRA 5J2QB 1KLNA 4IFVB 4Y3CA 1WG1A 4WF9Q 3KLIB 2DGOA 3CDAA 3OTCA 1WG4A 3M6VA 2E9RX 4BHQA 1OWXA 1SUQA 3MEEB 3V6KA 4NL5A 2VL1A 4ZCIA 3LANA 4F50A 2MZJA 1HARA 1Q8BA 4W92B 3KNAA 1YRUA 1XK8A 2XLKA 3HHLD 2VG6A 3TOQA 3OPKA 4ETZA 1C0UB 2HS3A 3DLEB 4I7FB 4XPEA 3N79A 3MMCB 2HS0A 2V8GA 3NBPA 3ZZOA 2IM1A 5DG7A 2ZOFA 2ZZNA 3SYZA 4DSIA 3LGNA 5KOWA 3D54A 3I87A 1N52B 3MUVP 4B9NA 2OPPB 1KQSR 3F56A 4YY3F 3MCSA 2CJKA 4C0BA 3I56S 4GC7A 2DNQA 3M32B 3NAIA 2C28A 4OX8A 2VD3A 5MAOA 5FDLA 5ITHA 4DMZA 3KHLA 2AWZA 5B0AA 3BO2A 2J9DE 4HTIA 3C3LA 2ZHAA 4RWXA 1ZM3A 3MF5A 3Q22A 4QW9A 4NPOA 3BB5A 4ZP9A 4OX9F 2RIJA 2GGPB 2KT2A 1P1LA 2KHCA 1XC9A 1FHTA 5GAHU 3RW7A 2DNRA 5A0YB 4DG1A 3MAHA 1S6UA 5IFMA 2VODA 2LU2A 2K7KA 1NK9A 3RB3A 4PXBA 1U6ZA 3DLGA 4DSLA 4CT8A 4HLBA 1KOHA 3QPIA 1IKYB 1NRKA 1HNVA 4X4PA 1M5VC 4O3RA 2MQPA 1FRIA 4Q8FA 1W2IA 4C3MA 1JK9B 2RH3A 3CXCR 2FJDB 1T02A 5KFZA 1JJHA 3OQ2A 5AXMA 2FLPA 4NLUA 2WONB 4A47A 4FBTA 2YX7A 1X4CA 2LQ9A 4DLEA 5SUHA 4H4KA 5IT4A 1I6JA 2WONA 3OL7A 1T3OA 1UVNA 4JV1A 2ZFHA 5LMUF 4ALZA 1UL3A 3NGDA 3PRBA 2R7OA 4R0EA 2XLJA 3HZEA 4LF4F 2B9XA 4FN5A 4RW7B 3K2YA 1S9EA 4G1PA 4FXDA 4Y2MA 2F9DA 2HZCA 3THVA 1JLEA 5E41A 4RW9A 1V6HA 2ZVSA 2F9JA 1FVSA 3BM7A 1VQ9S 1ROFA 4P2SA 4JI6F 1CVJA 3CSKA 2XMJA 1F5CA 4QZVB 1SH0A 4C8NA 1TFYA 5EGYA 4LQ3A 2WOMB 1U2RA 3IA0A 1VQPS 1N8RT 1JNRB 2DHSA 2JC1A 2VB6A 1IBMF 1VGYA 3ITHB 2FHJA 3P96A 1BQNB 1UAWA 2Q6CA 4Y34A 2VBYA 4C8MA 3OUYB 1APSA 3OHBA 1L3UA 2C42A 3MM5B 4OHWA 1E6VA 1GT8A 2W8LA 1E6VB 1R89A 2J0QD 4PRFA 2VPYB 2HPUA 3KJVA 4HI2A 4USJC 1TK5A 1Y00A 1X4FA 1NZAA 3HT3A 5B0BA 5J2PA 1SL0A 4ZA1A 5U47A 4O4GA 5C42A 1MROA 2OLWA 2DGSA 4ILLA 3AY0A 2HWHA 3I5BA 3MFIA 4O4GB 1RQ0A 4FS1A 2YNGB 3A1YG 1UEUA 2DO4A 2UZAA 4N5SA 3B4DA 3EZ5A 2MKIA 2L08A 1UFWA 2OH2A 4NOHA 4A8YA 3ENWA 4G6VB 4RUAA 1HHSA 1VRUA 3AH6A 2DRBA 1FD8A 2YNHB 4M63A 3U7JA 3HDSA 1HWLA 1Y4ZB 2RU3A 2DGWA 2CQPA 4CI0B 4I6YA 4WU2A 2EBEA 2FGOA 1TZ0A 4AL7A 4BC7A 1BQMA 4B9MA 4N76A 1XNRF 2UXDF 4FXVA 4OHYA 4LSLA 4YR3A 1S48A 4RNNA 3CJ2A 4GO7X 2F8HA 2IAJA 3M8QA 4YB6A 2E1AA 1Y7PA 3SXLA 2J7UA 3NNAA 3CCJS 4YOEA 1V3ZA 4LFBF 1LOUA 4PCQA 1X0FA 2LXFA 2HHUA 3MMJA 1FDDA 4AYBD 5LJ5Y 1AFIA 2FJEB 1YI2S 3EGNA 3NGKA 2WB4A 3O3LA 4ZK7M 3ONQA 5L8RC 2BRKA 2E44A 3H2UB 4MK9A 3TYTA 3M8PA 4ZHRB 1N5YA 4H4OA 2BOPA 2QRRA 1ULRA 4QYRA 4C7QA 2FJAB 2QIFA 5KFGA 4WFYA 5AE3A 4NZ6A 4OI1A 1B0TA 2CPDA 3ZZUA 2ZD1B 2ZOGA 4ZP8A 1LXJA 2A1BA 2AP6A 1VQKS 1S79A 4U9RA 2RQKA 3UNGC 1N5VA 5KOXA 5HBMA 1UVJA 5HO4A 2RE1A 4DL6A 2YNIA 2OMOA 5C25A 5HBMB 3G6YA 4RBTA 3OL8A 4HVZA 4UUWA 4DR3F 3KLGB 5C25B 4PQUA 1WHWA 4U6PA 4NXNF 4C8KA 2G4BA 2DITA 3DRSA 3HPOA 3L3CA 2HFNA 5F8IA 3MFHA 3MGJA 5KG1A 4ECRA 1HBNB 2W25A 1GNKA 4WFBQ 1I94F 1N56A 2LU1A 2XHWA 5IWAF 1HI1A 1HWKA 4IFYA 3CVKA 1D3WA 3LUYA 2W24A 3CCUS 3GFXA 3BGFA 4KT0C 3LWLA 1J5OA 2B6AB 5KFUA 2FJVA 4KO0A 4MYTA 5HP1A 3QZ8A 4DV6F 3DYAA 4ILRA 3US5A 4LF5F 2HFOA 4K5RA 1ZYQA 1LW0A 3MM7B 3UDCA 4DL3A 4JI5F 2NYIA 1MNEA 2VOOA 2D3UA 3E3XA 4ICLA 1HWIA 2CQIA 1WF2A 2XEXA 1HBUB 1LQ9A 2GX8A 2W9CB 2MSTA 3RB4A 1W25A 4IKAA 3UWTA 3M8SA 4FBUA 3N5BA 1LXNA 2DGTA 3PFOA 2JHEA 5E0OA 1QE1A 2PT0A 3H8YA 5KTQA 3G71S 3DCAA 1ZPWX 2VV5A 2VKZG 2DGUA 3N01A 5CHCB 3LP1B 2ZH7A 1SH2A 4IH7A 4MK7A 3C6UB 3T6JA 5F3ZA 4A8XA 3C6UA 1UJ4A 1BWEA 4KC5A 1RWUA 4NCAA 2L9NA 1NK5A 3MMAA 4RNFA 2R2SA 1NB7A 4K4VA 2IRUA 2V8DA 4DV7F 4Q0BB 4BS2A 1WTBA 1X5OA 3DU6A 2EI5A 2ZH1A 3TAPA 3DI6A 1HNZF 4O4RA 5LMNF 4A48A 1XWLA 2V4JA 2GMHA 1RTHA 2AD9A 5HLFB 2I5JB 4DR2F 1V3RA 3KLIA 4KHMA 2O3DA 2YKPA 2IM2A 4ES3A 3IRXB 4KHPF 1HA1A 4JV5F 1JXEA 3FRYA 4XIUA 4MIWA 2JEJA 5HMYA 4NA2A 1R8HA 3H4DA 1IUJA 1U09A 2CQ1A 2NS1B 2PA3A 5K8OA 2F8MA 2YTCA 1FJ7A 2RVJA 4LSNA 7FD1A 2MQNA 1RT6B 1UKUA 5GAHI 1HI8A 1F9FA 1DRZA 3FEXB 4IH6A 3VZIA 4LIRA 3D0IE 1FKAF 1F0XA 3HVWA 3ISND 4B08A 3DDKA 2AJ4A 1FKPB 4IQMA 4YDXA 1S1TA 4J9NA 1UA1A 1D1UA 2B5JA 4JI3F 4OI3A 2D7SA 2XI3A 2HNDB 1SIZA 1H98A 1NEEA 1YIJS 4I67A 2DB1A 2RQCA 2C2DA 1VK8A 3HVTB 1YWXA 3MAQA 3GYXB 3N5FA 2UUCF 3OR2A 2ZJRQ 2D3ZA 1TP7A 3TA0A 5L1JA 2MSSA 2I8EA 2HWTA 5L9NA 4RNOA 1BD6A 1VQSA 2VA3A 3R5BA 3IS9B 2QEXS 1JLQA 3LAMA 2KXFA 3OFEA 2CYYA 4G1QA 4RKUC 4XDDA 4HI1A 3UCZP 1H3DA 4A8SA 5CYQB 2XWXA 2V8HA 2WW8A 5A0YA 3K5NA 2C3UA 1HQUA 3GG0A 3IR6B 4WE1B 1SBRA 5CZVA 2V8VA 3OFGA 3H5UA 1KS2A 1S1WA 2FC8A 1KOOA 1KFSA 4FF4A 3CCRS 4TKTA 1YVFA 4IO9Q 3L7PA 5E2QA 2CDQA 2GJIA 2HG4A 2OPSA 2V9KA 2BANB 3IAM9 3CJKB 4OZJA 3M9OB 3FZBA 5EWEA 2HNZB 2IRXA 1LWEA 3I0RA 3H98A 1VS3A 2CQ2A 5LXYA 3PW4A 2C22A 1NJIT 4ED5A 2L3MA 5KFLA 1BC6A 4NYOA 4ZPDA 1VC6A 1HMVA 3MEGA 4FPRA 1TVRB 3FDSA 3MWBA 3LP0A 5E33A 2RKIA 4IQXA 4DV0F 2RKIB 1FRMA 4O0IA 2KJVA 2JVOA 2HQIA 2DIUA 3PDNA 3M2RB 1FTCA 1TK0A 2L9DA 2PGCA 1G3OA 1S1UA 4RW6A 1FEHA 2EFVA 1C4AA 2KT5A 4Q7AA 4DBQA 1A7GE 3HM9A 1FEEA 1XMOF 3M2VB 3CE8A 2F4VF 3KMQA 4NLRA 4KGKA 1TL3B 1Q82T 5DG9A 5GMKa 2CVIA 1MWZA 3OV7A 2MQMA 4B3TF 4NWBA 4DS4A 3QJJA 2DGXA 4QR1A 3V6DB 2HMIB 1IKXA 4TY8B 1ZETA 4M94A 4EGLA 1FDNA 4EO6A 1YTYA 4WZMA 1U4BA 1IKWA 1FKOB 1IKXB 2XNQA 4TY8A 3U02A 4ZPCA 1MROB 3AB2B 5BYSA 1KHVA 1YSJA 1IKWB 1FKOA 1JLGA 2VFSA 3D1HA 3DRRA 4QWDA 3W2WB 2FB0A 2GNKA 3NWGA 2O67A 1SL2A 2DH7A 4J5OA 2WAQD 1PGZA 3TAMA 2IVFB 2FLOA 2CG4A 1LFWA 2HWIA 3RR8A 3UD3P 2GHVC 2NUUG 2WRMA 1SKSA 4UY8T 2KZMA 3PJXA 5K8MA 2R8JA 5EX0A 1YJWS 3MPWA 3GQCA 3UCUP 2CPJA 4ZVFA 3UW1A 4MMOA 5DDOC 3R5AA 1VQ4S 1G2EA 1B0VA 2WBRA 3E8OA 2EWHA 2CPFA 4B9UA 1L3TA 3V81A 5HL7Q 4JI0F 2QZ8A 2VOPA 2CFXA 3OXFA 3AHPA 5DS7A 3DMJA 4NLTA 3JSMA 1LWCB 4AXIA 3OVSA 1RKIA 1N33F 3HZGA 3JSMB 3DLLQ 2YY3A 2IRYA 3TAQA 1QY7A 4PUOB 5E3CA 4HL9A 4Q45A 1JLCB 4FZVA 5KG6A 4R5PB 2Z2LA 5F8LA 1H2VZ 2AX0A 3MDFA 3CCSS 4GO5X 3IGNA 3FNNA 4P7VA 4O44A 1TKTA 3UE2A 4ED1A 1S7HA 1TKTB 1TL5A 3OJSA 2D74B 5BR8F 2MJNA 2OPRB 3EYZA 5K9FA 3H5SA 2HLTA 1G1XA 3MOZA 1QUVA 2Q43A 2VFRA 2W7PA 1QTMA 2CPHA 2VONA 2UUWA 5AE2A 4ES1A 4JI2F 1Y3KA 5M2UA 3BQ1A 4Y2IA 4DUZF 3IWLA 5KG4A 3HHDA 2M8HA 4Q43A 2C2EA 4MH8A 1ZOTA 2BM0A 2PSZA 2WK4A 5D4OA 2HVZA 3BO4A 4DWIA 1B7FA 4WKRA 1UVKA 4ELUA 3VAKA 3PX4A 4F25A 1C1CB 1LKZA 4J9QA 4JV2A 1T7PA 5D3GB 1BQMB 2BYCA 1LWFB 2B4OA 3H5XA 2GJ2A 4F67A 4LSLB 3F44A 2VUGA 4LVOP 5A2QY 1Q79A 2B0GA 5I4MA 1B64A 1SXLA 3NS5A 2JSXA 3TR5A 1F5BA 2RS2A 3OL9A 1R43A 2KG0A 4O3SA 2LMIA 2I0XA 3NAHA 2M52A 1R8PA 3D0GE 4NXMF 2GMJA 4JI8F 5M2PA 3JSRA 1U47A 3UQSA 2UUTA 2IBOA 3GR0A 4M8LA 3M9MB 4OHZA 4CZCA 3KK2A 2DTJA 4ZHRA 1N5YB 3MHYA 3UI3A 3QGPA 1ZAVA 4RW4B 3KK2B 1MU2B 3OL6A 2YKNA 1N36F 3HMJG 5KFEA 2XY5A 4CH0S 3AAWB 2HHQA 2DHGA 1LW2B 3ICLA 1F60B 2CVEA 2XS7A 3MM9B 2R2RA 1SJQA 2BRLA 2BUNA 3FFIB 1S77D 2K8GA 1IBLF 4DFPA 4QIEA 5LSOA 4JBCA