4JI7F

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ji7F00
1CQNA 2UUCF 4LF5F 1IBKF 5LMNF 4X65F 4DUYF 1XMOF 4B3RF 2B7BB 2UU9F 4DV4F 4AQYF 2UXCF 1IBMF 1N32F 2RJZA 1LOUA 1HNXF 4B3SF 2KJWA 4DV5F 1IBLF 4LF6F 3ZZPA 4LF9F 4NXNF 2KJVA 4K0KF 2ZM6F 4JI3F 4OX9F 1B64A 2YY3A 4DV1F 1N33F 1FJGF 4DR2F 2BVZA 1VMBA 1XNRF 4YY3F 4DV7F 4NXMF 5AJ3F 4LFCF 4DV6F 2J5AA 2HHHF 4JI7F 3R3TA 4GKKF 4DR6F 2E5LF 4JI1F 4DV2F 4JYAF 2B7CB 4JI8F 4JI5F 1G1XA 4YHHF 5IWAF 2BXJA 4DR3F 1J5EF 1F60B 3T1HF 4LFBF 4JI4F 4DR1F 2VQFF 1G7CB 3OTOF 2UUBF 1FKAF 1N34F 4KHPF 1IJEB 4LF8F 2VQEF 1I94F 4DR4F 4X64F 4DR7F 4JI0F 4LF4F 4X66F 4DV0F 4LFAF 2UUAF 1XMQF 1RISA 5BR8F 1IJFB 4X62F 4JI6F 1HR0F 4LF7F 4DR5F 1XNQF 2F4VF 5LMUF 2UXDF 1N36F 1QJHA 2UXBF 4DUZF 4JV5F 1GH8A 1HNWF 3T1YF 1CQMA 4JI2F 4GKJF 4B3TF 4B3MF 4DV3F 1HNZF
chains in the Genus database with same CATH superfamily
4WFXA 2ZNYA 4EO6A 1Q8LA 1KP6A 3C14A 4ZITA 2ZEJA 3VTIA 1TV6B 1AYEA 3ZZOA 3PYGA 4FYDA 3CF5Q 3H98A 2H1YA 3TJ9A 5EWGA 1WHWA 5IM0B 1VOMA 3NS6A 3K8WA 4YY3F 4C3LA 2B56A 4DSIA 3SQOP 2HYIB 2EK1A 5KG0A 1U02A 4IDKA 5IXUA 4JI7F 4M5HA 4JI1F 1ZAVA 5IS2A 1MW7A 3G71S 2V63A 3B82A 2CDRB 1RHJB 4ID5A 3BBCA 3H5SA 1MN9A 1B4SA 1T3OA 3SMZA 2EFGA 2VQEF 3RYLA 4NEZA 2GGPB 2MQPA 3GIRA 3KLVA 3MDFA 3OTEA 1NXIA 3VAGA 3DM2A 1UW9A 1GH8A 1JXVA 4B9LA 3P49B 3AA9A 2ROEA 2KO1A 4HH0A 3IR6B 4DQIA 4URSA 1CS4B 5GMKa 4G1IA 3QAUA 5J1EA 1T9UA 1CC7A 3TOQA 2X51A 1U1MA 5D4NA 2DO0A 5EGYA 1HNIB 2J0QD 5GVQA 1H2UX 3OV7A 1KBRA 1XEZA 1PC5A 4FDFA 2XLJA 1FA0A 4KFBB 2XB2D 5CA5A 3FMWA 1YRUA 5D4PA 2H3EB 4RWXA 1UWAA 3KXDA 4CLZA 1WEYA 1UZDA 1VLYA 2XCAA 1KD1T 3BGUA 2DR7A 5E33A 3V4IA 2V5HG 4MKBA 3MEDA 4X84A 1NKEA 2F1FA 1RT6A 3FEXB 1NH8A 2B8PA 2M8DB 3JTOA 1RAHB 3DRRA 1N32J 2OSRA 2YH1A 2ZBIA 3SSSA 4X4NA 2NR0A 4ZVTB 4PG7A 3SV3A 4HLBA 1TMJA 2LU2A 2YKMA 5K8MA 1KONA 1O6XA 4UY85 1F9HA 3TQ1A 2W9BB 3CE8A 1MWZA 2D3UA 1U8WA 2X1BA 3OFEA 4OX6A 3UN3A 2RH3A 4Y2AA 3N79A 2DIVA 5LJ3Y 1XNRF 2R9LA 2QT7A 1KVIA 1RA6A 1E6YB 3IRXA 2IM0A 5C42A 3KG0A 5KG1A 5LJ5Y 4GMKA 5C24A 1HBUA 5AE1A 3GFYA 3OL9A 4OYPA 4IO1A 5HMXA 3OL7A 1B99A 4QQBA 3VGSA 4UOFA 2RU9A 2ASYA 3CXCR 4QYZK 3ZZ0A 1MLAA 2ZVSA 1WI8A 3WDOA 3QFHA 1K1SA 3DLKB 1FESA 5H1SV 4CTAB 5AXKA 4FNIA 2W4PA 3HSDA 3PW4A 5H9EJ 4K4SA 2CZ4A 3MMBB 1SB6A 4QR1A 4NLQA 4MK8A 3FSYA 4NCGB 1YBAA 1UKUA 2PA8D 1FEHA 2ZOFA 5GADI 3C16A 2WVCA 2HW3A 2RNEA 4MH8A 1PGZA 4DPUA 3N0VA 3M2VB 5DS7A 1W26A 3OR1B 5IWAJ 4OV1A 1Q8BA 4RW8A 3CC7S 4RUAA 3CMAS 1YK9A 5I3UB 3WX8A 3H5YA 4TYBA 4DX8H 4EBDA 1RAFB 3OVSA 5DQIA 1HMVB 2E5LF 1JLFB 4NA2A 1S72S 2MHEA 2JL9A 2AX0A 2IM3A 4WPAA 1EARA 1LK7A 2YWKA 1G3OA 4QCLA 5I42B 1MWYA 3MAHA 4JI4F 4M1KA 3BF4A 2HRYA 3DOKA 3EZ5A 3ZTRA 4JI0F 4F8RA 3SDEB 4RPFA 1VQLS 3C6UA 2G4BA 1WOPA 2B43A 5EX0A 3RW7A 4OJ3A 2RQKA 4GKJF 4IFYA 1HQEA 2RKIA 5J2NA 1YJVA 5B08A 1FJGJ 3TUIC 1OIAA 4PG8A 2M70A 4UZBA 2HFNA 5SUHA 1C1BA 2QGFB 1CVJA 2PI5A 2B9WA 3PFEA 1HWUA 2ZH9A 1CLFA 1T8EA 2CQ2A 4URQU 4P10A 4LFAJ 2RS8A 4M5NA 2JSXA 4P73A 3A8IA 3OTOF 1IKXA 2MZSA 3KLHA 4H4OA 5HMWA 3GLJA 1PAEX 1T05A 4F36A 2NXJA 4E2FB 1KLMB 3DLBA 2J8SA 4ETXA 4NL5A 3CUNA 3BV8A 2P9GA 4CT9A 2ZH7A 1BC6A 5KFPA 4P2FA 4OX9J 4ZIWA 1HBNB 1RTDB 1NUEA 2BJ7A 2AYBA 4DBQA 5EUHA 2B7BB 2IJRA 4J9RA 4DV5F 1RSCA 3OUYA 1TV6A 1R8CA 2QRRA 1TL3B 2I5JB 4PPZA 3QAEA 3CJSA 5ETSA 3SCKE 5KFEA 1CEZA 5IM0A 2IJFA 3PZPA 3NGUA 3HO1A 4G1PA 4IQMA 2VBWA 4U7UD 2J5AA 1YBUA 1S0NA 2BOAA 4B17A 1RTJB 4N77A 2QL7B 4CLFA 4X64J 3M32B 3TA2A 1IVZA 2BM0A 3UE2A 3QSIA 3KJFB 3T5JA 2KB2A 2VD3A 1FXDA 4LFBF 4RNOA 1G7CB 2VBXA 2BV3A 2VG6B 4DR4F 4TU9A 5HQMA 4K4VA 2FZKB 3PYDA 2GGPA 3HVWA 1U47A 3AY0A 3UN5A 5FJ4A 1ICEB 1X9SA 4KQZA 4BBYA 3BSCA 3SI8A 2BABA 2XO7A 1D1UA 1HYSA 1TL4A 3Q8RB 4RR5A 2MHNA 2D9PA 1UVJA 4WIIA 1YKWA 2DH7A 3DI6B 4GO7X 4CLKA 2DGSA 4J90A 1I1GA 4IO9Q 1U1RA 2JFDA 3DCAA 1S0OA 3CCSS 1RAJA 2JLGA 5HN0A 3DHXA 2XSFA 1IM4A 1HNIA 4GKKF 2MY8A 4KYZA 2KYZA 2YPZA 3MOZA 5JXSA 3Q89A 3VF0B 4KFBA 4I6YA 2AJ2A 1AUSL 1UCNA 2OEKA 4AT1B 2IM2A 1HD1A 3FBCA 3HP6A 2FD2A 3P45B 1NLKL 3LW5C 3MCSA 2CZ9A 3M8RA 1UETA 1S59A 4ZOSA 4OYAA 4DV4J 4LF7F 4PPDA 3PIPQ 2VV5A 3NNCA 3EDRB 1JMTA 2D41A 5A2QY 4DDFA 2R8GA 5F8IA 3N6NA 4LRCA 2X1FA 2RF2B 2L41A 2G1HA 4K4YA 2DXEA 1FXLA 2BR0A 2W9BA 1YITS 1FVQA 2E29A 3CJQA 2GO9A 4LIWA 3T1HJ 4CT8A 2NPIA 5KFXA 1UPMB 1E6YA 4ES3A 2ZOMA 3PACA 4EI2A 1FDBA 3GYGA 2Z56B 1CBKA 3TAMB 3I4PA 2XEXA 4DL0C 2I1RA 2P9EA 4RUHA 3BS9A 2G2YA 4L73A 4NZ6A 5HMZA 1XWLA 5KFIA 2E7VA 3RB3A 4ZP8A 1FDDA 2KFNA 3DLKA 4CTAA 1ZTTA 1RYRA 2BJ3A 4JI6F 3EICA 3CIZA 2DNQA 2UV8G 4C3MA 3H2VE 3LAKA 4NCGA 4KPYA 2QMUB 4WU3A 4LR9A 4ZPTR 3QJPA 4LFCJ 1JJCB 4WFYA 1SVDA 3FUYA 1ZTWA 2YWWA 5KFHA 3UCZP 4M5KA 4FS1A 4OI0A 1ACMB 4W90B 4PCQA 5L1LA 3M2VA 5FDLB 5L9XA 3OR1A 5F3TA 3OPKA 5A8KB 1S5ZA 5I3UA 4DU8A 1K9MT 1UTAA 4K8RA 2W7AA 4NRTA 5CD4H 1HMVA 4AXJA 5ETLA 1UVMA 1JLFA 1UEUA 4ER8A 4KT0C 1SKUB 2GV1A 3QWUA 1WELA 1NDCA 5I42A 2VOPA 3LAMA 1TL7A 1BWVA 1FNMA 3CEDA 4HHUA 3T9NA 4ZJQA 2P6TA 3FEZA 1TMMA 1X7VA 3GR0A 3I31A 1SC6A 5CHCB 5ETOA 4I6AA 1S12A 3NAIA 5DG7A 3FSIA 3AD9C 2VFVA 4L75A 2E1PA 4C98A 5KFTA 3TEHB 2WSFC 3JTPA 5LMNF 3IFEA 2HBRB 2MLYA 4U6PA 4DV7J 1SQFA 1DARA 2HFVA 3SV4A 4DL6A 2C3YA 1WG5A 2NS1B 3GSIA 2BJDA 4ECSA 1RUSA 1RCOB 1SUQA 2WONA 5CD4A 4CH0S 4X4PA 5D0EA 4AFFA 4WP8A 1RAOA 3TJAA 3ZTPA 3PJWA 5CCMA 2Q43A 2QMWA 3R9LA 3UWTA 2XS5A 1LV5A 1Y4ZB 4LF4J 1VFJA 1AA1B 2ZH4A 5CYQB 1HQUB 4C3KA 4EFAC 4FN5A 1X4HA 2FY1A 1VQYA 2M2BA 5E7OB 2CWXA 3UN2A 1N5QA 2AW0A 2KXHA 5F8HA 3K8VA 1T03B 2Q1LA 3EJMA 4B3SJ 3QGGA 1KLMA 1WF1A 4CZCA 1XJWB 2B6AB 3H2LA 4K7QA 1M5PC 2XZWA 2BX6A 3NS7B 2H48B 4WE1B 3UFCX 2C2EA 4QU6A 1L5UA 3NP5A 4HDHA 4U95A 1F9FA 3HX9A 1HBNA 1AUDA 1RTDA 1TK5A 1B0TA 9ATCB 4TVAB 1JLAB 3LWLA 1IQZA 3MM9B 4QIWD 4LF6F 2R2RA 1F2HA 1UWBB 1Y3KA 2I5JA 3DRXA 4I2QB 3G96A 4MTPA 4K2XA 2ZWOA 5KTQA 3M8ZA 1S1UB 2FC9A 1OO0B 2DD8S 2I6WA 3VV2B 4A8QA 2RB7A 3BQ0A 2QLBB 1RTJA 4J7CA 4C0HA 2UXDJ 3CCMS 3F56A 5J1NA 2E66A 5T14A 1EHWA 2DRDA 3H4DA 2VG6A 3ZZZA 4I64A 1HHQA 3WX4A 3RJMB 3FQLA 1SV5A 2XC9A 3MTKA 3G9CA 2HHUA 1SIZA 4ZLLA 1GNKA 2W01A 3SZ2A 3I4HX 2CQ1A 4JBCA 4I69A 4CO0A 4DSFA 4WFBQ 2DRAA 3W60A 3Q22A 4LMZA 4K50A 4DJBA 3IAM9 1L3UA 4USIA 5DG9A 2F3JA 3NCQA 1WC1A 2CQCA 2R8IA 2OMOA 3DI6A 2FJVA 2OIHA 2QYCA 1KHVA 4DL3A 3QRPA 2NSCA 3MPYA 4PKDB 1RHKB 2LQBA 4IKAA 3H8YA 5GAGU 1YJWS 4E8UA 2KVQE 3RBZA 4F4KA 2GW8A 4ELTA 3TAPA 4WP3A 2CKWA 2XHCA 1RQ0A 2FDNA 3K58A 2VQFF 2QFIA 4FF2A 4JV5J 1LW0B 1YDLA 4NX9A 2CVIA 4DX7A 3IAS9 3QT8A 3DDIA 1Z2LA 1XMQF 3NBPB 3W5XA 1IJFB 5ETKA 1JLEB 4OYWA 3HM9A 3M6UA 1Y7PA 3VAJA 3RR7A 2WB4A 3ZTQA 4QWAA 4RW4B 3ZFVA 4FP9A 2W2NP 1YG0A 2JLFA 1FX4A 2RF2A 3IM8A 2DHHA 1JLGB 3M2RB 4ECTA 3J7Z5 2W2OP 3LOUA 3JAMY 3US5A 4EZ6A 1VBXA 2MZTA 3TZZA 4R25A 2IAJB 2UUBJ 2R8JA 5J1PA 2FY8A 2ZHOA 2CQ4A 2G1DA 3ISND 3MFIA 1MWQA 5L1IA 1NK0A 2DNHA 2OLWA 1U49A 4WTOB 3TAMA 1QY7A 4J9NA 1VCTA 1LW2B 2YVSA 4DQQA 1NSAA 1N5TA 1IR2A 2UUCJ 5GAEI 1DHMA 1B3TA 1QDUB 4FZVA 2LEAA 4DN0A 5E3RA 3M8YA 1MMLA 3IS9A 3MEKA 5KFZA 2LYVA 1Q7LB 4GO5X 2ZD1B 4PXEA 4LVOP 2FVPA 2L08A 2ATLA 1N6QB 3OSPA 2VH7A 3CJ8A 2IPOB 3NY0A 4QIFA 2W1BA 4PZVA 3UQSA 1D3WA 4XPCA 4CO1A 3DGVA 1KS2A 3U1LA 5FDLA 5HROB 3C46A 3THPA 5A8KA 1TKDA 1WF0A 4H4KA 4OMFG 3CGIA 3ET6B 5DZ7A 1VQOS 2DCLA 1GT8A 4EWTA 3Q0AA 1WEZA 3DLGA 4ZN1A 2XS2A 3P5TL 1RWXB 1WJ9A 4DPWA 3CJ5A 1WF2A 1TVRB 3NGRA 2RHQB 3MTJA 4IH7A 3PX4A 2Z57B 1QAJA 4P2XA 4ZDNA 2K1RB 3QBCA 4HH1A 4M94A 4O44B 1RISA 4ERDA 5HSPA 3MEEB 1UEKA 5F8NA 2G2OA 3CULA 4ECXA 4A8YA 5KFRA 5KT5A 2VB6A 4PYDA 1Z1ZA 4IOBA 4OX8A 3JSRA 1X4CA 3M1VB 3OL8A 3AQPA 3RBEA 1IKYB 5K8NA 1XQIA 3ELHA 8RUCA 1HD0A 3HXMA 2UP1A 2IJNA 1P27B 4JP8A 3N5BA 3DNCA 3BM7A 1P1TA 1FHTA 4NXMF 2ROPA 1PBUA 2HHHF 4L3NA 1H73A 3Q8QB 3VZHA 4OHYA 3O2IA 1B7FA 3V6HA 1GMWA 2K7JA 1URRA 4B3OA 5A6WA 2KRRA 2FGCA 5CYQA 3V6DA 1HQUA 2B4VA 2DR5A 1BE4A 5K14B 2FHJA 4LF8F 1TAUA 4EBEA 4PYAA 1RWNB 3BREA 4NA3A 1XR6A 2PDAA 4AL5A 2DH9A 1FFGB 4ZK7M 3H20A 1OPZA 2J9CA 4USVA 1T03A 3GIMA 2UXBF 2VBZA 3E2EA 2B6AA 2RVJA 1CQNA 2Q79A 1JQGA 4WE1A 3O5TB 2A2DA 1XMOF 1RJJA 2XBPA 5AJ3J 1YJNS 3CMES 5E5NA 1AZSB 4Z2XA 3AQOA 1JLAA 3MM9A 1KSPA 3BH6B 5KOXA 2KG0A 4JYAJ 3AOBA 1UWBA 3OLAA 3W66A 3ILJA 3HCXA 1KQSR 2CQDA 4I2QA 3QLHB 1S1UA 2OFHX 4ED7A 4FPRA 2V4RA 5D0RA 4DFPA 1DFDA 2V8GA 4JI8F 1VRQC 4DR3F 3MR3A 3MXHP 2C2NA 3OR2B 4J5OA 3I6PA 3WIUA 4CO4A 3NL0A 3JQMA 1H38A 2E1AA 2EG1A 4X65J 4TY8B 1PKUA 1FEEA 5HJYA 1BD6A 4XO0A 1S9GB 1YI2S 4R8UB 4O3SA 5A6PA 2EBGA 1O5JA 3H25A 2FVCA 4KY3A 3R97A 2HZCA 1CG2A 2CXEA 3D3BJ 1SJFA 3HHLB 5IFMA 2J8AA 2Y1LB 5T7LB 2KM8B 5G4DA 2C1EB 2IY5B 1K0VA 4DHVA 4Q5VA 2E5IA 1BQXA 3QGPA 5ADZA 4IRCA 3MMAB 4ETZA 3M8PB 4TQRA 2RDJA 2JH3A 2F4VJ 5KT2A 1FJEB 3DMJB 1YJ9S 4RW9A 3DHWC 4KC5A 1DTQB 4C48A 1LW0A 3SCIE 1S97A 2SXLA 3MECB 4H4MB 4MT1A 4O4RA 3NBPA 1KR4A 3ENAA 1JLEA 4Q8EA 1AT1B 1VQ4S 2AZ1A 3OL6A 4RO0A 2DYAA 4XDCA 3FFIB 2W24A 2YKOA 1HNZF 2GZOA 2MKJA 4RW4A 4HI1A 4YB1P 2CG8A 2F9JA 4TU7A 3ENQA 4Y2MA 2VFRA 2DNOA 3CO9A 4OZJA 1JLGA 2HQCA 3DXSX 3M2RA 1QVGR 2QX0A 3DLHA 3J7A1 4ED1A 1GK8A 3LP1B 1YQHA 3H59A 2KI2A 1BXNA 1RKIA 2O67A 1U6ZA 1JXLA 3UDLA 4KGVB 2XO6A 2IAJA 4TYAA 1IKWA 4ZJOA 2F4FA 4KGXB 4P74A 4NZ0A 2UVUA 2BJEA 2Y1RI 5B0DA 2H4YB 2HSEB 2DXFA 3E8OA 2VONA 2DPIA 4FF3A 2CPYA 4OQJA 4B3MJ 2BZ2A 1LW2A 4J91A 4DV0F 4V1Ak 2KXNB 3R7BB 2QL9B 2OH2A 4NLDA 1RKJA 4PR6A 1D9AA 3GJQB 3Q8PB 4MK9A 2HKEA 1FE4A 3S8SA 2ZD1A 4OYOA 4MYUA 1CJVB 5IT4A 2ZH6A 3Q2SC 1FTRA 2AGPA 3HK2A 3TZWA 4C8KA 3UDEA 1RWWB 1GMWD 1QTNB 4DV1F 1SIWB 3L9ZA 1OQ6A 5CCLA 1TUVA 1RBAA 2FHJD 4RUBA 2G9OA 3I0RA 4IR1A 3QNWB 1SH3A 4H4KC 1C4AA 3ET6A 4OZ0A 1REVB 1WC3A 3N4WA 3G8SA 3R6GB 1J5EF 4IUFA 4K4UA 1FRXA 1HA1A 1TVRA 2HZAA 1U26A 3M4XA 3DLJA 4C0BA 2NCKL 4DZDA 4DR7F 5HQ8A 3NG8A 4P7TA 2K1RA 4O44A 3VHQA 5LMUJ 3EVMA 3FMBA 4DUZF 5DG8A 4ECUA 4HKQA 3S01A 5D0GA 1LWFB 1Z4UA 5LL6d 2HHVA 3MEEA 4FYYB 1S49A 3DOMA 3QFWA 1JNRB 2GQQA 4F4YA 4USHA 3M1VA 4G3IA 2ERRA 2HQDA 1IKYA 2YKQA 2QIFA 1ZAXA 4ZVQB 2DEJA 1PIEA 3QRQA 1R8HA 1A0OB 3EYZA 3ULHA 1SL1A 4RJVA 2RU3A 3CD7A 3PW7A 1DURA 2MKKA 3R3TA 4UOGA 2YNHB 5JUMA 4OYIA 2IRYA 3FRZA 2EFQA 4X66J 5IC6B 2IRXA 2ZJRQ 4TLRA 3RAMA 1XNQJ 3FKBA 2D3O1 2OGUA 1XN9A 1URNA 2M3DA 1C0TB 4B3TJ 1S77D 5K14A 2V6AA 4TKTA 2IFXA 4LBHA 2CRLA 3D6HB 2GHWA 1GQEA 3DU6A 1KDNA 3BR8A 3ISZA 3NWGA 1OJ4A 1NHKL 4UQTA 2Q3PA 2RRNA 1T9XA 1OY9A 1HLWA 2XWYA 3OJUA 3FC9A 4GRSA 4YY3J 1X5SA 4ICLA 4CH1A 3I5CA 4ITSA 5D8HB 1REGX 2A2CA 4Y65A 4JI7J 1AZSA 3H42A 4JI1J 3PEHA 4OZNA 2RMLA 4Y28C 5EHHA 1KNZA 4DR2F 2VL1A 3AAWB 2MKCA 1ZAWA 2KH9A 3QLHA 3A12A 2XYGB 2OUGA 1ZH5A 5EWFA 4I2PB 1ZM9A 1WKJA 3SFUA 3ETMA 4DL7A 2EEYA 3HD2A 3OR2A 2GHVC 3PO5A 2R7OA 4Q7AA 2DJWA 2QN6B 4CWBA 2PD1A 1CC8A 4DPOA 4HL9A 3HULA 1N0VC 2EK6A 5BR8F 4X62F 2CUYA 1B0VA 1JJ2R 2R7TA 2ZUGA 5DQHA 1TR0A 1S9GA 2IMWP 2A6MA 2RUGA 4R8UA 3HSZA 4QIVA 4ZKAA 3M6VA 4NLOA 3V6KA 2Y8YA 4B9NA 3JSBA 3BGFA 2V9WA 4DSKA 1VLOA 4OHXA 2AIRB 4RW6B 1X4BA 3HHLA 2R7SA 3WHIA 3SCLE 5T7LA 1N33F 4LSNB 3FJ2A 2LKZA 3KK1B 3S1TA 1XR7A 1I51B 1WSVA 1NMEB 2HS4A 4WCEQ 1G2EA 2DKOB 3MMAA 3R5CA 5AXNA 3M8PA 2NXCA 7FDRA 2D3OR 2DNMA 3Q8UA 4O3PA 2R8HA 3MHYA 4A8SA 1YX2A 1DTQA 3B8HA 2J0SD 2WW8A 1RB0A 1MNEA 1X5TA 2UUAF 4CNYA 4M5DB 4OI4A 3MECA 4H4MA 3HSGA 1UW4A 2M8HA 4C8ZA 1RADB 1R3NA 5CYJA 1KWMA 4OJ1A 1RT2B 3FFIA 1S0MA 5HBMA 3OHAA 1SL2A 3J7AN 1XNRJ 3H90A 4AQYF 5IV4A 4NXNJ 1HI8A 3CC2S 3DC2A 4DQPA 1ZM2A 3NKYA 1FKPB 3IMQJ 3O1LA 4ZLNA 1M5KC 3AFGA 3K0JA 2V2KA 4NYZA 2H9ZA 4HEA9 1U09A 3LP1A 1NJZA 2GA7A 2NZCA 3HVTB 2P6SA 5I3QA 3D4JA 1PAUB 4JOUA 2X1AA 3WBZA 2BEFA 2YWGA 1JWWA 2D1CA 1F1BB 2NXEA 3R5GA 2OPSB 2VOOA 4OYZA 3EGNA 1OSCA 4LR8A 5J2QB 4KHRA 4LRDA 4K5RA 1A7GE 1NDPA 1XERA 1K8AT 4F26A 2PMWA 4OFZA 1LNQA 4FF1A 2KT2A 1QJHA 1S57A 5AXLA 2CJAA 4DSJA 3Q8YA 1JIHA 1WUUA 3LGHA 1V6HA 2AGQA 2WW4A 3QATA 5CQGA 4RNNA 4RNMA 2E5LJ 1G4CA 3VQTA 3T41A 1SJ1A 5F3ZA 2YKNB 2YNFB 5KT3A 2GO8A 1RLDA 4ZPBA 2A10A 4JI4J 5L46A 1SJRA 2VFTA 3DLLQ 1APSA 2FVQA 1PILA 2A6OA 5E3PA 1IBCB 2BJ9A 3M8QB 4AL6A 4JI0J 2I9SA 3O6QA 5M2UA 1N52B 1REVA 2VKRA 4MKYA 3JS9A 2YKPA 2R7WA 2VHGA 4CM0A 3VAMA 1AXQA 4C9DA 2I38A 3KWMA 2QA2A 1WTBA 3L7PA 3IP0A 3VAKA 2P9CA 5KFLA 1RT1B 3CW2C 3ZZTA 4ECVA 3TNVA 4OZLA 3HKZD 1DQAA 2LA4A 2V8HA 3BGRB 4X4TA 2HHWA 1LWFA 1GAOA 3T1AA 1LWCB 3MUTP 2HEKA 3G86A 4F2RA 2EBEA 2FJEB 5DGBA 4WIQA 3DU5A 3CCTA 3P6YC 1U1OA 3I9ZA 4PABA 4J9SA 4TY9A 2KKHA 3MR6A 1FT8A 4WFAQ 2PFDA 3SQGA 3RW6A 2KFZA 2ZH1A 2BBEA 1AFIA 5MAOA 3RR8A 3ITHB 4LRFA 2P5VA 4W92B 5JVHQ 4MJKA 2XCPA 3L09A 3OTOJ 2X3DA 2J7UA 4ZPDA 2YNHA 3D7SB 5DQGA 4YHHF 2J6SA 2MDAA 2MGZB 3KTQA 4YDXA 5ETMA 3WC0A 3MR7A 1NAQA 2GIRA 4LT6A 2V4JA 4C11B 1NSPA 5B0BA 4WK1A 4Y00A 3AH6A 3Q8SB 3UDVA 1C0TA 1Q95G 3QQCD 5F8GA 3R1HA 2W2PP 4NMXA 3MOJB 3QPIA 2B5JB 2H5IB 2WOMB 2U1AA 1WORA 4KSEB 2FIUA 4DV5J 3HHLD 1U2CA 1PYOB 1UJ6A 2PT0A 1B0PA 3KUHA 4DUYJ 5D4LA 1R0AB 2UU9F 1C0UB 4XAKA 2DR8A 3K5NA 1KFDA 1FK9B 2ZKUA 2PC6A 3HKWA 5KT7A 3LALA 5K9FA 5D15A 1GFWB 2GQCA 3DRPB 4LFBJ 4OI3A 3P3DA 2OELA 2J9DA 1A6LA 4DR6F 2BOPA 4DR4J 2BW7A 1Q81T 2BE2B 3MM5B 2NSBA 2E1MC 4X4UA 4U7UK 3GG1A 2E7XA 4DR1F 3PNIA 2J0XA 5U47A 4OV6A 3TX8A 3W61A 2H4WB 1U8SA 2GC8A 4J9KA 3L7UA 2HHXA 2WVFA 4ES1A 1XMBA 3A3OB 1EKSA 4TXSA 4Y2IA 4CYUB 5B0AA 3BDPA 1LKZA 5LMUF 4C4WA 4NOHA 3FBFA 1SH0A 5KG6A 1XK8A 1RZMA 4F0MA 2AGOA 2AZ3A 1D8YA 1FD8A 1RA7A 3NGTA 2HVEA 4OL8A 4B3RF 2EVZA 2OPRB 1VBKA 2RUSA 4BWJA 1X9MA 2R7RA 4LF9F 2DTJA 4GKKJ 4RW6A 3HHLC 1QUVA 1RE1B 3T3FA 2WB1D 1FDNA 2D9OA 4ZP6A 1RCXB 2Z2YB 4UT4A 3PW0A 2E7WA 4LSNA 3GILA 4USUA 3CJ3A 3KK1A 2ZDOA 1Q16B 2B51A 3GG0A 3HF5A 2GVDB 1E6VA 4LF7J 3M30B 3LUYA 1TL1B 4RNFA 2ILYA 4J9UE 1IR0A 1I94F 5CH7B 3RB4A 1NKBA 2J9EA 3CCZA 3QRRA 1CJTA 4ZVRB 4UF4A 2MB0B 4PUOB 4ZP7A 3PR5B 3I5BA 1SCJB 2K7KA 4M5DA 1GMUA 3D9BA 2W8LA 1U6FA 5ITHA 3KOAA 1NK6A 1RT2A 1T11A 2GJ2A 1VK8A 2VA2A 5CYMB 3KJVB 2DB1A 1MMNA 1X8DA 4J9VA 2GIQA 4DCJB 4YR3A 2Q6BA 3CC4S 4P72A 4FPIA 1IN0A 4R0EA 3A13A 1FKPA 2IA6A 3ADAC 1M5VC 1PYSB 1WC4A 3R7NB 2AEJA 3KK3A 5B0CA 4Z37A 3PY8A 3W5YA 3DFEA 2PSZA 3GYNA 1UFKA 4I56A 3LANA 1F6TA 2V2QA 1WI6A 4PXBA 3A3PB 2CJYB 3HVTA 4C97A 3NOGA 4N8OA 2AJ0A 2PO4A 1KVJA 1BLUA 2C3OA 3NGDA 1HWLA 4JI6J 1DQ9A 2OPSA 1BMQB 3QYYA 1TELA 1WACA 2ZH5A 4PQUB 2W8KA 5J2QA 2DNYA 3QZ8A 4AL7A 1RWVB 3AOCA 2Y1IA 3W8GA 4RU2A 3EZUA 2E5GA 3BQ2A 5K8PA 3T1YF 2QV6A 4BLGA 4OX7A 2PEBA 2GAGC 4DSEA 1Q8KA 2LP4A 4DG1B 8ATCB 3UR3C 4J9QA 2UUWA 4BWMA 1PO6A 2U2FA 5AE3A 2XLIA 4HVZA 1NZ8A 2XTJP 2Z2LA 4MKAA 4BC9A 2YKNA 3JTNA 2YNFA 1F5AA 2N4DA 4NLUA 4C6AA 3Q2TC 4FKXA 2FVRA 4QW9A 4C7QA 1ZA2B 4CP5A 5D3GB 1G1XA 5KG4A 3M8QA 4J9LA 2DO4A 1ZZNA 3Q83A 2MZ1A 4IFVB 3K5OA 2IC3B 3IWXA 4FXDA 1NM2A 1U45A 1V3RA 5LMNJ 4KV8B 2JVOA 4CO3A 1HWIA 2QA1A 3OVBA 3D1HA 1AROP 5L8RC 4V19J 1RT1A 3N6LA 2CVEA 4LQ3A 3U1MA 3HT0A 3HFKA 1H2TZ 2ZJQQ 3E51A 3BGRA 1TP7A 1LWCA 3S7RA 1SL0A 1XIQA 3ZZPA 1FWLA 4NXNF 2GHPA 2FGOA 4ZPAA 2W7PA 2QA4S 1NZAA 2B4PA 3TARA 3D68A 3PXGa 1VMBA 1QUPA 3ITHA 3OXLA 1NKCA 1JLQB 2DT9A 2I8EA 4ZVPB 3GPAA 3HHDA 3TA0A 2MGZA 1TKXB 4QWBA 1KHWA 4ZVUB 2Z0GA 1O8BA 4C11A 2AX1A 1NPRA 2VUGA 3CSKA 4DFMA 3IXQA 3EVOA 4W98A 2WAQD 3TWZA 2HFZA 2MLXA 3B6BA 1T02A 4UOCA 2WOMA 1N36F 4LF6J 1WKLA 4ZJLA 2QZ8A 1N88A 1ZETA 2RDDA 3OJSA 2AJFE 2V50A 2F5GA 4LF5F 2NUHA 4OI2A 2VICA 3AD8C 3FRYA 2YKAA 2NREA 1R0AA 1C0UA 4IG0B 3MM8B 1TZ0A 2KJVA 2M9KA 4M5JA 3P8BB 5JVGQ 1FRJA 3J7YU 1FK9A 4H54A 4I67A 3CJ0A 4KKOB 1M5OC 2H65B 4AE5A 4CLYA 4R5PB 4Q2LA 2DNGA 5E3AA 5EN1A 2VJVA 1HBOB 3KHHA 4I6WA 3G4SS 3DRPA 3KUGA 3NRBA 3U27A 2N7YA 1YLXA 4ZCIA 3TEGA 2CADA 2BE2A 5EX3A 1H7XA 1UVLA 4FYXB 3DLEB 3KHLA 3TQEA 2ZZTA 1HBMB 1OY6A 4WBFA 4QYZJ 4Y34A 5GAGI 1SC4B 3VGUA 5GAHU 4YEAA 2VF3A 2QJ3A 1RHMB 3AXMA 4IRDA 2JEJA 4N5SA 4CYUA 3PVXA 5HATA 3D5MA 5KFUA 3EVWA 5F8JA 1FRLA 4NMLA 5G0RB 2OPRA 3HT3A 2VFUA 2ZE2B 3JQJA 2RS2A 4O3RA 5KFCA 4JV0A 1R8AA 4X4VA 4RWWA 3FSXA 3BYPA 3C66A 3JXOA 2JC1A 2QLWA 3M6WA 5KFMA 4I68A 3PR4A 2VQFJ 2F8EX 3EE3A 2POKA 1NK9A 1GEHA 4DSLA 4DQSA 1RP5A 3EX7B 2DGWA 2HBYB 4FNHA 1Q78A 2B7CB 4MMOA 2FLNA 1VC6A 1XMQJ 2N4CA 3GSDA 1RHQB 5L9NA 1ZM3A 2CPJA 2JEGA 5AXMA 2GVDA 3M30A 4NEYA 1TL1A 1Y3JA 2V9KA 3CO0P 3CD0A 1VRUB 2G2ZA 3R6LB 3PHTA 2DGUA 3BO4A 4OLPA 4JUZA 2KDOA 1B70B 4PUOA 1C1CB 3D6MB 4UOHA 1VQ8S 3B4DA 2V2ZA 3MM6B 5D6GA 3OFFA 4QYRA 2ASLA 1TK8A 4DUYF 2FZCB 2DY9A 2CJKA 5CYMA 2IA0A 3KJVA 3MMCB 2C42A 3IN5A 2NYHA 5IQQA 1VQNS 3IO1A 4QBUA 2HRTA 3DRYA 3L3CA 2CJQA 1UJ5A 3C14B 2MLZA 1RBLA 2ZITA 4OYBA 2CQHA 5DGAA 3MPUB 1KTVA 2EKYA 1XTZA 3IR7B 1SQGA 1TU0B 1NBEB 1MG7A 5DRKA 4YP3A 2K8GA 2FJDB 4XTTA 4OHWA 2BQRA 1L3TA 3NS5A 4DLGA 3MI7X 2UVWA 3W3SA 4PWUA 2MQLA 4KJIA 4PQUA 3BBBA 2A0FB 2YX4A 1RWKB 4RLEA 3M8WA 4N41A 5FD1A 1HR0F 2VU5A 4DL4A 4I0WA 2AEMA 2R3VA 2HK3A 1P9YA 4JI2F 1CS4A 2UVVA 1Y00A 3EPIA 1IR1A 4LR7A 3BB5A 3DM2B 2KVIA 1JK9B 4DG1A 2UXCF 1IBMF 2FJBB 1S4EA 4K0KF 2LQ8A 4WF9Q 4A8WA 1R89A 1IKVB 3I55S 1FI4A 5C7PA 3NGKA 3MD1A 2CWKA 2C2KB 2MPUA 2VPXB 1Y5LB 2CFXA 4UUXA 2OO4A 2DIUA 3SEOA 3UD3P 3SXLA 3OVAA 1F3VA 3QIPB 2D69A 3D0HE 2IDEA 1UAWA 4PG5A 3PDNA 2V34A 3JSYA 2JLEA 1S7IA 3EGZA 1F9EB 3BN7A 3PCOB 4IFVA 2MTLA 3MUVP 3ZTSA 4EGLA 4A8XA 3UD5A 4KV8A 1KOOA 5LXYA 1X9WA 5HAOA 1U0SA 2VC0A 4B02A 4ZHRB 5K5MA 1HNWF 2IBOA 2MZQA 4A4JA 3V4IB 1EZZB 2OP5A 3MEDB 2MXYA 1O51A 3I0SB 2XMVA 1FD2A 3J81Y 4NXMJ 2G0IA 4I4BA 1QVFR 1H0HB 5IOLA 2HHHJ 3EGVA 1SJ3P 1U1LA 2XI2A 3FDSA 4JI3F 4E0DA 3MEGB 1VS3A 2YKMB 4C8YA 1UPPA 5M2RA 4N56A 1RACB 3FGVA 3GIJA 3H4BA 2HMIB 1LWEB 4ANDA 4LF8J 1N0UA 2ZZNA 4W4MA 1JLQA 4DV2F 2V2VA 2CNKB 2FLOA 2M4MA 2MJUA 4HT5A 3EXCX 3PX6A 3GV7B 4IH5A 3W2VB 5D4OA 4V19X 1K0TA 1N48A 2JEFA 1TKXA 1VC5A 2UXBJ 3MMBA 4F4ZA 1HQ2A 3BR9A 3HPOA 4DWIA 1FJCA 1RU2A 2Q66A 1H6KX 1P1LA 1NK5A 2E9TA 4P71A 4NWBA 4WFNQ 1XMOJ 4GVLA 2Y3YA 3RAQA 3GQCA 2XMUA 1N5SA 5DLGA 3T9ZA 4KTQA 3KFWX 4WK3A 1FRKA 3CT9A 1RT7B 3W7BA 3PHEA 2XG8A 1ZOTA 3CB4A 4O4GB 3PX0A 3DN9A 1JLBB 4IG0A 3Q86A 2CQGA 3MM8A 3EUNA 5ETRA 2FJAB 1EX8A 4JI8J 2HVDA 3GV5B 4DR3J 4KKOA 1S48A 3I9V9 4MIBA 1ZA1B 4R5PA 3NCRA 2H51B 1YTYA 3E01B 1HBOA 2GJFA 3CDBA 4NPOA 4ZLJA 1U0HB 1J5OB 1RABB 1WHXA 1Y10A 4JI5F 2DISA 3SDEA 1F5CA 1GTEA 4YOEA 2XI3A 2OPQB 4Q2MA 2CPXA 1WDDA 1RHUB 1PJ7A 3VAIA 2RQMA 3T5LA 3CD5A 5DLFA 3DLEA 3FZBA 2CNLB 1LQ9A 3MR2A 1HBMA 1JJ4A 3GIKA 4BDPA 3KJNB 5J2MB 4OZ2A 1ZYQA 3ENVA 1YSJA 4DR5F 2ZZMA 1T94A 4OYMA 3N9UC 1TKZB 2JNJA 4XK8C 2F9DA 1RK8A 3PO4A 3C6UB 2R7UA 3HLUA 4K2JA 2ZH8A 5HL7Q 4HACB 1TUGB 4DL2A 1RU1A 3NEKA 1EAYC 1WC0A 2A3JA 2VZ9A 1TFWA 3R5JB 2KG1A 2ZUAA 1WC6A 2QE5A 3H2UB 2ZFHA 1S1XB 2YQ3A 4FYWB 4DV6F 3CJRA 2IHR1 1T9YA 1KC8T 3RB0A 2QLFB 3W9IA 3A8KA 3MURP 2GJIA 1HI1A 1NJXA 2C2DA 1D0EA 4ZP9A 2YX1A 3RBDA 1LWXA 4IOCQ 1R8PA 1S6PB 5KFFA 2RD5C 1M1HA 1S0VA 3FZ2A 1HNZJ 1VRUA 3I56S 2ASDA 4DCPB 2NXUA 1YRTA 3J81U 1LFPA 3OFGA 4JB8B 1WEXA 3DDKA 1TQLA 1NNDA 1VQSA 1C1CA 2BQ3A 1Q79A 4HHHA 1S1VB 1TL3A 2MKSA 4ES2A 4USWA 2DNLA 3MM6A 4TNOA 1VC0A 4ZLPA 2UVRA 2R2TA 1WG4A 2JEIA 1S79A 2C22A 3BH7B 3BZQA 1RI7A 4N47A 3M32A 4CI0B 2XMWA 4B9SA 3MF5A 2HVZA 2KHCA 3Q23A 1EQ0A 4ANEA 3D2WA 3OUYB 2KYXA 3TUJC 3AODA 4M8LA 4F3MA 2HFOA 2A18A 3D1QA 3GFZA 1WD6A 2OPPB 1N56A 4DV0J 2BJ1A 2XMJA 2QL5B 3TUZC 3O3LA 4PQAA 4UZCA 1V3ZA 3K2YA 1WC5A 4L72B 4KHPF 4G1QB 3M9MB 3CNQP 1ELOA 3KNGA 2JFKA 5IZHA 4R0JA 4Y0FA 4IR9A 1UZHA 4OLOA 1H3DA 1BWEA 1R7IA 5KFWA 1MSWD 2MYFA 2FJXA 5HVGA 4ECWA 2GMHA 4A46A 1PC4A 4DV1J 2QG9B 3W63A 1WOSA 2C3UA 1VR6A 1S6QB 3KDOA 5HVHA 4FBTA 4O0NA 2G0JA 2HK2A 2ADBA 2PA3A 3J80Y 2NYIA 2KJWA 1IBLF 4N8NA 1RWOB 2OSQA 4EUVA 1HYSB 4A8FA 3QT6A 1OYEA 1D8ZA 3QO9B 4WKRA 1IKVA 3OW2R 3RGIA 1J5EJ 5KFKA 3R2DJ 1IXKA 1Y9OA 4NE9C 1NU4A 1XBWA 1DZ5A 1EETB 4DI6A 3P5BP 2W9AA 1NDKA 1HHSA 4DR7J 2L3MA 3UI3A 2W25A 3QIPA 2LDIA 4JV1A 2XMKA 3AD7C 4P52A 2ROGA 2VC1A 2RQ4A 1X4AA 2IYIA 5E2QA 1S1WB 4DUZJ 1FKAF 2ZBQA 3GJRB 1HWJA 2LA6A 3AXKA 4ILMA 2HGMA 5H9EK 2KZZA 4D3HA 2GS8A 4P2MA 1HHTP 4NI2B 2YXLA 2DNZA 4B9UA 4EMDA 2PFFB 1MN7A 4ZCLA 5L39A 3C15B 4PRFA 4ZHRA 2YX7A 3HSJA 3P96A 4LF1A 2WBRA 2X1GA 5DDQC 4WXWA 4NCBA 2YWFA 3I0SA 2Z8QA 2OEJA 1T7PA 2EI5A 1X0PA 3ZO7A 3Q8VA 1NPPA 1SH2A 4GVBB 1V3SA 4CLWA 3BSAA 1V9OA 3MEGA 3BGOP 3Q24A 3FK4A 4DEZA 3LP0B 5KG2A 3I32A 1JXEA 4WTYA 2HMIA 1LWEA 3LQVA 1FFWB 3UCGA 3PKMA 4DX5A 2CNOB 2VDIA 1ZM4A 3NAHA 3W2VA 4P2SA 1NPKA 2KFYA 4CH7A 3C6TB 2MZRA 5F9NA 4DMZA 2V94A 2RT3A 3VVTA 4M5IA 4ZIVA 1U4BA 2XGQA 2I0XA 4ENOA 4KR0B 2QEXS 4DR2J 3O44A 4AXIA 3TRGA 1RT7A 4A48A 1LK5A 2DGXA 4WKYA 2WSCC 4O4GA 5B0GA 2B9YA 4OIXA 1HFEL 2CIMA 2PMHA 1JLBA 1B64A 4ZVEA 2YY3A 4DZ6A 4IH6A 3PYFA 2VFSA 2P2CB 3CPWR 3AA8A 4LRAA 3U7JA 3HFZB 2RILA 4LIRA 3EWGA 3E01A 1HIYA 4WU2A 2BM1A 3ISNC 1U0HA 1J5OA 2LEBA 3CJ2A 4OZ5A 5BR8J 3TVZA 4X62J 1FCAA 1N8RT 2OPQA 2Z2ZA 5HI7A 1OWXA 1EKRA 4MIAA 1UEVA 4PWDB 2X3GA 1P9QC 3VAFA 5ETQA 3W2WB 2IIHA 5J2MA 3J80U 1TL7B 3T6BA 3SBMA 3U1NA 5RUBA 1UFWA 2K06A 5E3QA 2AT1B 2QA4G 1EP4B 3FCWA 2DGTA 2AYEA 3NMRA 3OT9A 1A9NB 3KUEA 3FNNA 1TKZA 1NHVA 1N33J 3PKYA 4LQ9A 1NCLA 2F65A 1VQ6S 1Y11A 1YGYA 2RJZA 2HG4A 4RNHA 4HACA 4LJMA 2HVHA 2Q6CA 2BRKA 1BUXA 3NXZA 1U6BA 1YHQS 1SI9A 1JLCB 3K7RA 3OLBA 2XZDB 1CULB 2ZH2A 3GTYX 2LQ5A 2AWZA 1S1XA 3OTDA 4DXLA 2JHEA 1VHFA 5KT4A 1OMSA 1JX4A 1SUQB 2WONB 3HFVA 5F41A 2UUAJ 3H0PA 1QLNA 4NLGA 3F0NA 1S6PA 1ZPWX 2B9XA 1S9EB 2Y0BB 3G8QA 5SZTA 4NRUA 4L76A 1TL5A 2AHOB 1K47A 4AQYJ 3MUMP 2BW2A 3TI0A 1UVNA 3IWNC 2CYYA 3LPYA 4K4WA 1SC3B 4C2MA 2LVWA 3BEGB 4F50A 1YVFA 3BJYA 2R7XA 2HHTA 1S1VA 4DL5A 4YB6A 1N5VA 2PMZD 1NH7A 2W2MP 1UFLA 2Y8WA 2HS0A 2C3PA 3M9NB 4ILLA 2BQUA 1OPIA 1U1KA 4M5GA 3A8JA 4RU9A 2OD6A 1R8BA 4OI6A 1RWPB 3J7ZT 3MD3A 5LOQA 3QWPA 1KQFB 3FBBA 2N3OA 2DH8A 3A8EA 4KO0B 1VQ9S 2DGQA 1HNVB 4F25A 1VDHA 1S1TB 4NCAA 3GU0A 1H98A 5B7WA 4U8VA 3JYTB 3OFHA 2OPPA 2HS3A 2BKOA 5E0OA 3IM9A 2WCXA 2ABYA 4J37A 3BQ1A 3EMTA 4G1QA 2Z2MA 2I2YA 4XDDA 2AJ4A 4K4XA 4C8NA 5KFJA 5IQ6A 4EK2A 4HHJA 2R2SA 4CLLA 2OTJS 3HI9A 4RBUA 5KG5A 4DV3F 1SV5B 3UDCA 3KMQA 2JWNA 3VGTA 1S9FA 1T3NA 1EIYB 2R8KA 1S6QA 1X31C 3A3NB 2XYHB 4ECRA 1WHVA 4ZPCA 4PAAA 1IQTA 3CTRA 1Q1KA 3KKFA 3QO9A 2JZ5A 1SC1B 2BANB 4KIAA 1J27A 1VISA 1SBRA 3ZNUA 4MKVA 4A8KA 2YNGB 3ONQA 4NLPA 1N5YB 1EETA 1Y5NB 1VRTB 3W65A 3M2UB 2HNDB 5A76A 3H40A 3QGIA 2ZVIA 1SKSA 2VPWB 2EKNA 1FRMA 4EYHB 3BGLA 3I96A 2KT3A 3GMGA 4FF4A 2FVSA 4X4QA 1S1WA 4AUKA 4EEYA 3D0GE 5HJXA 1VQMS 4DUTA 3R5AA 4L74A 3HD1A 4M5MA 4CO2A 2ALZA 3VZIA 1RLCL 4NI2A 1FE0A 3MAQA 3PTWA 1T95A 3C15A 4B9MA 4DU7A 2R42A 5F0WA 1RT4B 3R5BA 1HWKA 2MKIA 3AB2B 2RAQA 2DNPA 5J2PB 2KTQA 2HQFA 1S6OA 2WVDA 4RBTA 1S76D 3IWLA 5KFDA 1JNZB 4YHHJ 1VI7A 4GVBA 1M5HA 2XNQA 3BKFA 2QFJA 2ADCA 4NYPA 2RQCA 3DDNA 3LP0A 4CO5A 1WHYA 3THVA 2LXUA 5KFQA 5LSOA 3V81B 3IR5B 3D6TB 2HRUA 6FDRA 2D3ZA 4UQGA 4MYTA 5F9LA 3OBIA 3NWRA 5C2GA 2LLZA 5KFGA 1I5OB 4CQ1A 1GXTA 4ALZA 4ECZA 4CLUA 3C6TA 2PEHA 2UU9J 2DVIA 2VODA 1KN6A 2MY7A 1N6QA 1UJ4A 3SSQA 1Q86T 1ROFA 2HBQB 2OKQA 1Y5IB 4MFBB 2RRBA 2GMJA 2YTCA 5HROA 1S6UA 3IS9B 5KOWA 3RRGA 4DR6J 2AMCB 3BPDA 1Y0HA 2ZM6J 2MMYA 2MQ8A 2XMTA 3CJTA 5HLFB 2A1BA 2DR6A 3IGNA 2F8MA 3GB0A 2J6TA 4DR1J 3M6XA 2IMOA 2HQIA 2LU1A 3RG6A 2VASA 3TR5A 2GIFA 1QSSA 4KE5A 2AQ4A 1M1KT 1YZ6A 2CPZA 3MPDA 2PIIA 4ECQA 4LREA 2J7WA 1DQ8A 3CDEA 2MQNA 3W9HA 4YS2A 2AP6A 2UUTA 3DLGB 3G6ES 4DS5A 1DY3A 4B3RJ 1NK4A 4WFZA 6AT1B 3BSOA 4PWDA 2FTRA 3W2WA 4EYIB 4NA1A 1NJIT 2ZHAA 4QR2A 4LF9J 3EM1A 3N6MA 3DOLB 3L4BC 1LFWA 1YRXA 3SSRA 2VBYA 1EP4A 2QO3A 1KOHA 2L9WA 1VK3A 1N32F 1FFSB 3CVKA 4ZS6A 3V6JA 2QSFA 1VBZA 2OMLA 1L3SA 4QIEA 3BPSP 5I3PA 1ZS6A 2FHOB 2VJUA 3MPVA 5ETPA 1JLCA 5KFBA 1CULA 3RAXA 1MROB 2VKZG 4UTGA 1SKWA 5HP1B 2BACA 1I94J 1RYSA 2XGPA 4AD6A 1FX2A 2IM1A 2C2OB 2WBMA 3MGJA 1GTHA 2V8DA 1ULRA 2H5EA 2L9NA 3BKUA 1RT5B 2NUUG 4CLTA 4YUDA 3C3LA 4B3OB 1S9EA 3V6DB 3T6JA 2XQCA 2DBBA 4Q44A 4P7VA 2MKHA 3G6YA 4LVNP 3VALA 5A2QU 3H7HB 3PEJA 5A0YB 3CDWA 2V69A 4QWCA 2RIJA 4WZMA 1SQEA 3RB6A 3E3XA 1FXRA 2YH0A 3NGSA 1BGXT 1QSYA 3KLGB 4DFJA 4BHQA 4F0KA 3NNHA 4ED8A 1NJYA 2BKPA 4QOTA 5LT5A 4KO0A 2B0GA 1HNVA 1MMDA 1WOOA 1S1TA 5IT9Y 2XMMA 5IWAF 4WZQA 2GFFA 1K44A 5EDWA 4F4AA 1NK8A 1NRKA 1MU2B 3JYTA 4TY8A 1IM6A 2HFUA 3WZ0A 2B4OA 5GADU 3T1YJ 2HIYA 4C8MA 3CIMA 4ZA1A 3LPEA 2PE8A 4ANCA 3A4TA 3CMQA 5I4MA 2LEPA 3BO2A 2CJXB 3GJSB 2CPHA 5CABA 1RTIB 2EFNA 1KFSA 3TX0A 4RKUC 4ID8A 4ZCKA 1SXLA 2GVZB 1CQMA 3ILIA 3B4MA 1RAIB 2HHSA 2K2PA 5CZVA 4QPXA 3LO3A 3NLCA 2GMLA 1R27B 3PJ9A 5ETNA 2OJ3A 1RWMB 2O3DA 1ZBTA 3BYRA 3ZXWA 5E41A 1T9VA 4ED6A 3PW5A 4P9SA 2RSQA 2DGOA 1FJGF 3K5PA 3W5ZA 2FLPA 3WQPA 6FD1A 2BANA 1FTCA 3DMJA 4WJBA 4HYKA 4RW7B 2YNGA 1TUWA 2BJ8A 1YJUA 3ILOA 1N5YA 3TW0A 1VRTA 2PN6A 3RTVA 3M2UA 2HNDA 2ZNZA 1YJTA 2DR9A 4USMA 3GFHA 2F7VA 2KRBA 1IJEB 2ZOGA 2AYMA 4YR0A 4MIWA 3BN4A 4P75A 4LFAF 2RDIA 2EFVA 4DF8A 2DRBA 4DS4A 5KFAA 3IRWP 1NB7A 1QSLA 2LFVA 4RW9B 5C5JA 3TO8A 5D0HA 2ZH3A 2AKWB 4B08A 2W7OA 2CG4A 1C2PA 5AE2A 4J9PA 3ZNJ1 1RT4A 3UVJB 2L48A 2QLXA 2VG7B 5J2PA 5BYSA 2J7KA 5BXIA 2FJWA 2WVBA 2MZJA 2DITA 4LRBA 1WSRA 2DXDA 4OX9F 4DPYA 3L95X 1SKRA 3D1OA 2IYGA 3K5LA 1X4DA 3OQ2A 1S99A 1NSQA 2CAJA 3KG4A 2B9EA 2XY6A 5GMDA 2K3KA 2C2RA 2KXFA 2CPIA 4LSZB 1R0BG 5DZ6A 1D9FA 3M05A 2WRMA 1QAYA 3KNAA 1YWXA 3JB9k 4NZ7A 3BDEA 4BC7A 3QGHA 1UMJA 2QTWA 1C4CA 3V81A 2F40A 1N54B 3J7YI 2ZBRA 4X4OA 1N36J 4O23A 3MCNA 1FRIA 1IKWB 3ICLA 2EFPA 4IYQA 3RRKA 4X64F 5KAKA 3V4MA 1PBAA 1PSDA 4LF5J 5LXRA 5DO2A 3HJVA 5L1JA 1EJ7L 3W64A 1FNOA 2CQ3A 1FO1A 4WXOA 1CJVA 3DYAB 3PM9A 1GXLA 2FC8A 3LP2B 1P8GA 5B0EA 5KFOA 4CRJA 2E1RA 4CM2A 1WWHA 5HANA 1U7LA 2WZ1A 2HQGA 1NHUA 1TFYA 1RBOB 4MFBA 1GMVA 4ZPVR 5AT1B 4NLVA 3OSNA 1SJQA 2ZKTA 1SJ4P 3ETOA 2MEWA 1TTHB 5GAHI 5IT9U 3PJXA 4ELVA 4NASA 1JKHB 2YNIB 3QJJA 1BQNB 1VJQA 2WHOA 5HLFA 4L6V3 4Z7CA 5F0UA 4U9RA 3UO0A 1UL3A 5DM7Q 2D74B 1Q0NA 4PXCA 3AOAA 2LCWA 4F04B 3JSMB 4Q0BB 2BDPA 1RAEB 1TKTB 3M7VA 4ZVFA 2UV8A 4PXDA 3I0RB 2V68A 2JVRA 2PGCA 3KHRA 3R7SB 2F63A 1N34J 3I82A 3M9OB 2R7VA 2DHXA 3DXBA 4OZ3A 2IVFB 4NLSA 3QSYB 4C8LA 4ECYA 4K4TA 3RUBL 3G82B 2GX8A 3PRVA 2XMAA 4FBUA 2DPJA 3G8TA 5KFSA 2FLLA 3TAQA 2N7CA 4K4ZA 3DOLA 3MCOA 4NLWA 1OSDA 3EZOA 2GNKA 4DV4F 4I1TA 1W7WA 4KRWA 5A8WB 2ILZA 3AJDA 1HNXJ 4S0MA 5LSRA 4F02A 3DOMB 4U96A 2E9RX 2BMBA 4Q43A 2VPZB 3B78A 4NYOA 2XS7A 2BVZA 3HHNB 1MROA 4YDDB 1R6YA 4OYXA 5HP1A 5BJRA 1EB0A 2HQ3A 4Y2CA 3CCVS 3SCJE 3T1HF 4J9OA 4Y3CA 1RT5A 3FVYA 2OFGX 2ATCB 3IG1B 8AT1B 4O3OA 4QR0A 3IA0A 2ZWPA 2J0WA 1VQKS 2VDHA 1BQMB 4KH0B 2M5YA 1PJ5A 5KG3A 2V8PA 4ZVGA 2K3IA 3OXGA 4LUBA 1QE1B 4QW8A 4KHMA 5A0YA 1RXOB 3PV8A 5D78A 2P8IA 3TA1A 3CCUS 2O01C 3HVAA 1ITPA 3LGNA 1OS5A 3JAMU 3HMJG 1RT3B 1FRHA 1T0TV 5MLCV 2ZM6F 2J9DE 2MKYA 4I2PA 2YQ1A 4ICLB 2JC0A 3GCXP 1CJUB 1PG5B 3MMJA 4LFCF 2FB0A 1FKOB 3BBFA 3KLGA 1B7YB 3L7OA 2FUG9 3ZZUA 1X5OA 3VGVA 2BKNA 2HNYB 2O1PA 1Q4RA 2E44A 2DNRA 4RBVA 3T5HA 2HURA 1X4EA 3NOCA 1U24A 4ZN3A 1VQPS 2HZVA 1HR0J 2J6UA 2HAIA 1KVKA 1MU2A 2JDJA 3QMQA 5FLXY 3GE9A 3NCPA 4JI2J 2VG5B 1JB0C 3B54A 3DGPB 4KGZB 2MSSA 4FXVA 2BE7D 4ZVHA 4RZRA 2JOQA 4ATNA 2FHMA 2CNNB 1R0CB 5D77A 2UXCJ 1IBMJ 1RTIA 4KB7A 1XR5A 4J9MA 4K0KJ 4PWWA 2GVZA 2R2UA 4G65A 1KTQA 1H2VZ 3KYLA 3AJ1A 2AJQA 2KM8C 3POTB 4MK7A 2YWHA 3A1YG 1LXNA 2DNKA 2DNNA 3C2PA 2UZAA 1U2FA 5F8MA 4F3OA 1WTFA 4MAKA 2E5JA 2KZMA 1OYDA 4NLTA 5M2PA 1S10A 4NLYA 3SYZA 4OHVA 3OD2A 2G0CA 4CCHA 2H5JB 2IVYA 3MM7B 4BS2A 4DV7F 1VBYA 3KG1A 3UW1A 4F7VA 3GV8B 2HWTA 2V0NA 3HZGA 3KLFB 2WSEC 2EC2A 4EBCA 1F2GA 3PYEA 4RW7A 1DTTB 4F67A 1AB8A 3G6VA 4QZVB 2BXJA 2DK2A 2AF6A 4OJHA 1VIXA 5JJBA 3BO3A 4ED2A 3AJ2A 1NJWA 1HNWJ 4AYBD 1R6VA 3CCJS 2EG2A 4LF4F 4I7FB 2E1CA 5DETA 2NQPA 3FBEA 3IGVA 2ZDPA 3VQSA 1WDTA 4FXWA 3MAAB 2E5HA 3X1LB 2YWEA 3LF0A 5LSLA 4JI3J 1I3OB 4B9TA 4WWSA 3KLIB 1RTZA 2XNRA 1H74A 2CPEA 2OTLS 4ED5A 4B3SF 1M90T 3ZC4A 2ZBPA 3UVJA 4U8YA 4F3QA 3T19A 2VG7A 3FCVA 4DV2J 5HBMB 5HK4A 3GZ7A 1I6JA 1M5SA 1RTHB 3LGMA 3DRSB 2Y0SD 2KHDA 1HPZB 4ED0A 4KH1B 2KT5A 2AJ1A 4O0IA 2V4QA 2LXIA 1NSKL 5FIIA 4QWEA 4YMEA 2CQIA 2HHQA 2MSTA 1F60B 3RU0A 1D9DA 7AT1B 1HI0P 5KFNA 2HHPA 3R27A 4QJVA 3MR5A 1RDRA 3M8SA 3F73A 1TAQA 4QPTA 3KK2B 3G2XA 3PW2A 2UXDF 2KU7A 4X2BA 3D28A 4Y2KA 1KLNA 3DYAA 2NPFA 3LP2A 2F8HA 4OI1A 5BYQA 2W4DA 2XLKA 2EFOA 1YZ7A 3GWCA 4DN9A 4YB5A 1IBKJ 3CCQS 4KGKA 5K8OA 2BRLA 2C3MA 5CZXA 1IWGA 2NZ4A 3W62A 2DGVA 1RWUA 2ACMA 4JI5J 2CQBA 2DHSA 1WKKA 2XSJB 4D3GA 4HTIA 4DPTA 1JKHA 2YNIA 3HDSA 2J76E 1BQNA 1KQKA 2D7SA 5FLXU 5THWA 1KKHA 3KHGA 1R43A 3VR1A 3CJ4A 2EW9A 1FWKA 3JSMA 4Q0BA 4DR5J 1TKTA 2JJ4D 4ZPWR 5C25B 3D3CJ 4ZVSB 2OD4A 1R31A 4K59A 1CJKB 2OHDA 4X4RA 2XWXA 3G82A 3BKTA 4JV5F 3V2UC 2M88A 2JRSA 3SIPB 3HHKA 2XYPB 2DCUB 1DLOB 2FYXA 5A8RB 4RX6A 1LOUA 5KFYA 4WYLA 4DV6J 3CWJA 5DM6Q 5A8WA 2HAFA 2YQ0A 3JQKA 4WP9A 1FWPA 2FZGB 3IC1A 3AHPA 4C8OA 2CPDA 2CA9A 4DX6A 4XPEA 4CIOA 3D6FB 3TUPA 2HNZB 4USJC 1ZZFA 2W4CA 3SQGB 4XIUA 1SPBP 3CCRS 3VAHA 5HO4A 3HVRA 1FJ7A 1YJ7A 2M7SA 4ILRA 5DDOC 2BYCA 1BHNA 3K89A 1X4FA 2QYGA 4ELUA 2B5JA 3EXYA 4TN2A 2UUBF 3D66A 1U1PA 4IQXA 3IG1A 1X4GA 4DOZA 4ED3A 2V4JB 4JV2A 3UNGC 1F0XA 4HI2A 3LWMA 2HLUA 3MZIA 3MWBA 1BQMA 3KLEB 1J2VA 3ENWA 3G6XA 2W2QP 1DJ0A 1RAAB 3GP9A 2UUCF 1QE1A 4C0OC 3GCWP 1V5IB 4DFKA 3PIOQ 3TJ8A 3FEYB 4F4WA 5CXTA 2HIQA 3NNAA 2HBZB 4ZCMA 1RT3A 3R5DA 2CJBA 1QAXA 2Z4PA 7FD1A 3MM5A 3G87A 2XY7A 2MQMA 1LXJA 4CDIA 2E9ZA 1CJUA 3KDNA 3QJLA 2C2MB 1HW8A 2EWHA 1X0FA 4GC7A 5GAEU 1DAXA 3MCMA 4KHPJ 3ZZYA 1FKOA 4O3QA 4X4SA 4A8MP 3DKDA 2HNYA 3CJKB 4LSLB 1Q82T 5CAAA 3OTBA 1YBTA 1UVIA 1AFJA 3T5KA 2KN4A 2Z58B 1NDLA 1UVKA 5L38A 2W9CB 3C8YA 4KBIA 4FVMA 1N34F 3CD6S 2B8QA 2VQEJ 1FNXH 4YN3B 1XC9A 1F3FA 1VGYA 2VG5A 3DGPA 2ALYB 4LBIA 3R1LA 3AT1B 1S4FA 3ILLA 4IG3B 1IBLJ 1HKAA 2R7QA 4HDGA 2HWHA 2M52A 3GFXA 2B4UA 3PRDA 2ZC3A 4CLSA 3MPWA 3POTA 3VCDA 3OXFA 1HNXF 4M63A 1CSJA 4U67Q 4EU0A 3UNYA 1FERA 4EO8A 4K5SA 3QT7A 3SFGA 2BE9B 2LMIA 4BCAA 3H5UA 3MM7A 3UCUP 1IUJA 2BA9A 2WVEA 1W2IA 2MQOA 3TANA 3HHEA 3KLFA 3OHBA 3K17A 4RL1A 5ETVA 1DTTA 4HTJA 2ASJA 3LA0A 2GAHC 4N7TA 4YR2A 2NLWA 2CQ0A 4KGMA 2APOA 4OZ1A 2VIHA 1E6VB 4I7FA 1W2BR 4UUWA 1UA1A 2MQQA 1UP1A 4UY8T 2LECA 3MAAA 4EZ9A 4LBPA 2QSWA 4WYWA 2BUNA 3VWSA 1CJTB 1O0PA 5LM7E 1WNEA 1DBDA 3KLIA 5GMEA 2FQQB 4P6QA 1PCAA 5E3CA 2QMXA 4TLQA 4ZMMA 3PFOA 2OI2A 2Y1JA 5L1KA 1HARA 4G6VB 4QU7A 3O8WA 3WIVA 4Z7YA 1U1QA 4L3KA 5DDPC 3TZYA 3V5RA 2N3LA 1Q53A 4IDKB 1RTHA 5AJ3F 3DRSA 1BY9A 3I87A 5IT0A 1HPZA 1KQGB 2G13A 4GC6A 4QIGA 2X7IA 4JYAF 5HMYA 4PG6A 4FS2A 3GONA 2MJNA 4ID5B 3THTA 4KAIA 3MFHA 3KK3B 4QWDA 2FPHX 3IBCB 5K20B 1ZPVA 4E98A 3TZXA 1M0SA 1WG1A 2C28A 1RAGB 4IRKA 2DEIA 3W9JA 5EWEA 2NXNA 3HZEA 1QD1A 1U48A 1U1NA 4M95A 3PG9A 1VYAA 5KT6A 1N4LA 1Q5YA 3KK2A 1K73T 4OJGA 5IC4B 3CDAA 2RRAA 1GX5A 3S6EA 4F0HA 1CPZA 3CDUA 4N76A 2ZJPQ 4DF4A 4X65F 4CNZA 3P4UB 3N5FA 3OTCA 2ZBCA 4ED4A 1HW9A 5J1EB 2Z30B 2AEFA 4YFUA 2XY5A 2JX2A 4RUCA 1KEKA 5T41A 2QC3A 3IBWA 5D3GA 2HWIA 3CCWA 1OQ3A 2XSJA 3GYXB 2WK4A 3C19A 2DY1A 5HQLA 2L9DA 3TYTA 2DHGA 4Y6IA 2IC3A 5F8LA 1EQMA 3TVKA 5H9FK 2AV5A 4Q45A 1TK0A 2GCFA 2CDQA 1QM9A 3ZTOA 3QT5A 5C25A 1RT6B 2EPIA 3HJFA 1KRPA 1H72C 2CZVC 2GQ2A 1VJWA 1DRZA 3DRRB 2IVMA 1CJKA 5HVFA 4O3NA 2F4VF 3K59A 4GKJJ 2IBKA 3ZZRA 3J81j 9RUBA 2KL8A 2O5DA 1Q5VA 2WTFA 1VIOA 2HGNA 1DLOA 4LF2A 2LXFA 1FF2A 5A8RA 3AB4B 1UA0A 3F41A 4M5LA 3EPGA 1Q8IA 5KG7A 1W25A 2CQPA 2RE1A 2XZTB 3FCHA 1IWAA 3IRXB 5C42B 2CPFA 1VQ7S 2CJ9A 3RBXA 5C24B 2HNZA 1HBUB 2AU0A 2LDYA 1L3VA 2N82B 1FDAA 3FQKA 5ETTA 3N01A 1LEOA 3KJQB 4Q8FA 1VQ5S 5B09A 4NLXA 4TQSA 3WC2A 2OAUA 4FKYA 1NEEA 3U02A 1AW0A 2COLA 2ACYA 1S7HA 3KMSA 5H9FJ 3TP2A 2R4FA 4HT7A 1U2RA 1NK7A 4FVCA 2ZC4A 3D54A 2V8VA 4DLEA 4B3MF 3KLEA 1X5PA 4DQRA 4DPXA 3C16B 3CCLS 1IBKF 3N28A 4F4XA 1OY8A 4ZVOB 5DDRC 2O66A 1FVSA 4U7CA 1Q7YT 5C2CA 3K5MA 4USTA 3R2CJ 4RW8B 4TU8A 4DCOB 3EGWB 2YPYA 3F44A 1V5VA 2C2ZB 3X3UA 1JJHA 1L3KA 2H54B 1NO8A 1P6TA 2HLTA 2RHSB 2EXUA 4KPCA 1RHRB 2B3TB 4USKA 3GJTB 3CJKA 1VHIA 2M0GB 4LSLA 2VA3A 2IRUA 4OHZA 2YBVA 2W9CA 2HVIA 1K1QA 1T9WA 2XM3A 3DOKB 4UW2A 2XHWA 4DV3J 2PI4A 3D67A 1RGVA 1NB2A 3UD4P 1HL6A 4F2SA 3RZAA 1PJ6A 4IFYB 1QTMA 1HQEB 5G0RA 2RKIB 5J2NB 5KFVA 1YJRA 3GR1A 3D0IE 1G6BA 5BYRA 2ZE2A 4IG3A 3QZ7A 1GX6A 4IOAQ 4A8OA 4YQWA 3LTOA 3IBFB 1T9TA 4URGA 1C1BB 3BSNA 2DHAA 2AD9A 2AYGA 1F5BA 1GXUA 2HFSA 1M1GA 2IDLA 5DJBA 4A47A 1Z2ZA 5JMNA 3LH2S 3W1YC 1H7WA 3W8PA 2Y9HA 3CCES 2HGLA 2XULA 3RRHA 2OEMA 3TVYA 3UPFA 1PYTA 2EC0A 3VVUA 3NMAA 2V67A 4NLRA 1X60A 1IKXB 4YB7A 4CLPA 4B9VA 3KLHB 5IV3A 2FHKA 4H4OB 2ZHBA 3QIDA 2LQ9A 4PG4A 3H5XA 3UR0A 2HPUA 1T05B 1QAIA 3EDQB 4HR2A 4X66F 2LQJA 3I5AA 4FYVB 1D09B 2QLJB 3K57A 1XNQF 3R8YA 2VPYB 1YIJS 1U25A 4PEOA 3MMCA 4B3TF 3GIIA 3PRBA 5B0FA
chains in the Genus database with same CATH topology
2EBGA 1O5JA 4QPXA 3LO3A 4WFXA 3H25A 3NLCA 2ZNYA 4EO6A 2GMLA 2FVCA 5D6GA 3OFFA 4QYRA 2ASLA 1R27B 1TK8A 4DUYF 1Q8LA 2HZCA 2CJKA 2OJ3A 1CG2A 3VTIA 1TV6B 5CYMA 2O3DA 3ZZOA 1SJFA 1ZBTA 2IA0A 3KJVA 3MMCB 3HHLB 5IFMA 5E41A 2J8AA 2C42A 4FYDA 3CF5Q 3H98A 3IN5A 5T7LB 4ED6A 5IQQA 3PW5A 2KM8B 5EWGA 1WHWA 5G4DA 1VQNS 5IM0B 1K0VA 3IO1A 4QBUA 2RSQA 4DHVA 2DGOA 1FJGF 1VOMA 3DRYA 3K5PA 2CJQA 3NS6A 1UJ5A 4Q5VA 3L3CA 3K8WA 2E5IA 4YY3F 2FLPA 4C3LA 2B56A 4DSIA 1BQXA 2HYIB 6FD1A 2EK1A 5KG0A 2BANA 4IDKA 5IXUA 4JI7F 3QGPA 1FTCA 5ADZA 2ZITA 3DMJA 4WJBA 4HYKA 2CQHA 4RW7B 4JI1F 5DGAA 2YNGA 1KTVA 2EKYA 1ZAVA 1XTZA 5IS2A 1MW7A 4IRCA 1YJUA 3IR7B 3G71S 3MMAB 4ETZA 1N5YA 3TW0A 3B82A 1VRTA 2PN6A 3M8PB 5DRKA 4ID5A 3RTVA 3M2UA 2HNDA 4TQRA 2RDJA 4YP3A 2K8GA 2JH3A 2ZNZA 3H5SA 1YJTA 2DR9A 5KT2A 2FJDB 1FJEB 1T3OA 3SMZA 3DMJB 1YJ9S 4RW9A 4OHWA 2BQRA 3GFHA 3DHWC 4KC5A 2F7VA 2KRBA 1IJEB 2EFGA 1DTQB 2ZOGA 3MI7X 3NS5A 2VQEF 4DLGA 2UVWA 3RYLA 3W3SA 2AYMA 1LW0A 4PWUA 3SCIE 2GGPB 4YR0A 1S97A 4MIWA 2MQLA 4KJIA 2SXLA 4PQUA 3BN4A 2MQPA 2YX4A 3MECB 4H4MB 4LFAF 2RDIA 2EFVA 4DF8A 4RLEA 3KLVA 2DRBA 3MDFA 3OTEA 4N41A 3VAGA 5KFAA 5FD1A 4DS4A 3IRWP 1NB7A 1HR0F 4O4RA 3DM2A 3NBPA 1QSLA 4DL4A 4RW9B 4I0WA 1KR4A 1JLEA 5C5JA 4Q8EA 1GH8A 4B9LA 1VQ4S 3TO8A 4JI2F 3OL6A 3P49B 2ZH3A 3AA9A 4XDCA 2UVVA 2ROEA 3FFIB 2W24A 2KO1A 1Y00A 2YKOA 4B08A 1HNZF 4HH0A 3EPIA 2W7OA 3IR6B 4DQIA 2MKJA 2CG4A 4RW4A 1C2PA 4HI1A 5AE2A 4YB1P 3BB5A 4J9PA 2F9JA 3DM2B 2KVIA 1RT4A 1JK9B 4DG1A 2UXCF 4TU7A 3ENQA 4Y2MA 1IBMF 2VFRA 2DNOA 3CO9A 4OZJA 2L48A 2QLXA 4URSA 2FJBB 2VG7B 5GMKa 5J2PA 1JLGA 5BYSA 2J7KA 4G1IA 4K0KF 3QAUA 2FJWA 3DXSX 3M2RA 2MZJA 5J1EA 4A8WA 1QVGR 4WF9Q 1R89A 2DITA 1CC7A 4OX9F 3DLHA 1IKVB 3L95X 3I55S 1SKRA 3D1OA 3J7A1 2IYGA 4ED1A 3TOQA 3LP1B 1YQHA 2X51A 3K5LA 1U1MA 3H59A 1X4DA 5D4NA 2DO0A 2KI2A 5EGYA 3NGKA 1RKIA 3MD1A 2O67A 3OQ2A 1S99A 1U6ZA 1HNIB 1JXLA 2MPUA 2J0QD 2VPXB 1H2UX 1Y5LB 3KG4A 5GVQA 3UDLA 2CFXA 2XY6A 4UUXA 2C2RA 2K3KA 3OV7A 2KXFA 2IAJA 2OO4A 4TYAA 2CPIA 1IKWA 1XEZA 2DIUA 3SEOA 3UD3P 1D9FA 3M05A 3SXLA 1PC5A 2XLJA 2WRMA 3OVAA 1FA0A 1QAYA 4KFBB 3QIPB 3KNAA 1YWXA 3JB9k 4NZ7A 3BDEA 4BC7A 3QGHA 4NZ0A 1UMJA 2UVUA 2XB2D 2BJEA 5CA5A 3FMWA 1C4CA 3D0HE 1YRUA 2Y1RI 5D4PA 1UAWA 4PG5A 2F40A 1N54B 3PDNA 3J7YI 3V81A 3JSYA 4X4OA 5B0DA 4RWXA 2JLEA 4O23A 3E8OA 2VONA 2DPIA 1FRIA 1WEYA 1IKWB 4FF3A 2CPYA 4OQJA 3EGZA 1VLYA 3BN7A 3ICLA 2XCAA 2EFPA 1KD1T 4IYQA 3BGUA 3RRKA 4X64F 4IFVA 2DR7A 5KAKA 2BZ2A 1LW2A 5E33A 3V4MA 3MUVP 4EGLA 3V4IA 4A8XA 1PSDA 2V5HG 4MKBA 3MEDA 4X84A 4DV0F 5LXRA 2F1FA 1NKEA 1RT6A 3FEXB 5DO2A 1NH8A 2KXNB 2M8DB 3JTOA 5L1JA 2OH2A 1FNOA 2CQ3A 4NLDA 1FO1A 3DRRA 4KV8A 1RKJA 1KOOA 2OSRA 4PR6A 2YH1A 2ZBIA 4WXOA 5LXYA 3SSSA 1X9WA 4X4NA 2NR0A 3DYAB 1D9AA 3PM9A 2VC0A 1GXLA 4B02A 4ZHRB 3Q8PB 2FC8A 3LP2B 5K5MA 1P8GA 1HNWF 4PG7A 5B0EA 4MK9A 5KFOA 2IBOA 2MZQA 4A4JA 3V4IB 2OP5A 1FE4A 3MEDB 3SV3A 2E1RA 2MXYA 4HLBA 1WWHA 3S8SA 1U7LA 1O51A 3I0SB 2XMVA 2LU2A 2YKMA 2ZD1A 1FD2A 3J81Y 1NHUA 1TFYA 5K8MA 1KONA 4MFBA 4MYUA 4UY85 3TQ1A 4I4BA 4ZPVR 1QVFR 1H0HB 5IT4A 2ZH6A 4NLVA 2W9BB 3CE8A 3OSNA 1SJ3P 1MWZA 3Q2SC 1FTRA 1U1LA 1SJQA 2ZKTA 1SJ4P 2XI2A 2D3UA 3ETOA 2AGPA 3HK2A 5GAHI 3FDSA 2X1BA 3OFEA 4C8KA 4OX6A 4JI3F 4E0DA 3PJXA 3MEGB 4DV1F 1SIWB 1VS3A 2RH3A 2YKMB 4Y2AA 4ELVA 4C8YA 1JKHB 2YNIB 3N79A 5M2RA 4N56A 1BQNB 3QJJA 2WHOA 5HLFA 1OQ6A 5CCLA 4L6V3 2DIVA 3FGVA 5LJ3Y 1XNRF 2R9LA 1TUVA 5F0UA 4U9RA 2QT7A 3GIJA 3H4BA 2FHJD 2HMIB 1KVIA 1UL3A 1LWEB 1RA6A 1E6YB 2G9OA 3I0RA 2IM0A 3IRXA 4IR1A 5C42A 1SH3A 3KG0A 1N0UA 4H4KC 5DM7Q 2ZZNA 5KG1A 2D74B 4GMKA 5LJ5Y 1JLQA 1C4AA 4PXCA 5C24A 4DV2F 1HBUA 4OZ0A 1REVB 5AE1A 3GFYA 2FLOA 2LCWA 2M4MA 3N4WA 3G8SA 2MJUA 4HT5A 3EXCX 3JSMB 3PX6A 4IO1A 5HMXA 2BDPA 3OL9A 1J5EF 1TKTB 3OL7A 4ZVFA 2UV8A 3GV7B 4IH5A 3W2VB 4IUFA 5D4OA 4QQBA 4PXDA 4V19X 1K0TA 1N48A 4K4UA 3I0RB 2JEFA 1TKXA 1FRXA 2JVRA 2PGCA 2RU9A 3KHRA 1VC5A 1HA1A 2ASYA 3MMBA 3CXCR 4F4ZA 1TVRA 3I82A 1U26A 3BR9A 3M4XA 3DLJA 4C0BA 3HPOA 3M9OB 4DWIA 3ZZ0A 2R7VA 2ZVSA 1FJCA 2DHXA 1WI8A 3WDOA 2Q66A 1K1SA 3DLKB 1FESA 1H6KX 1P1LA 5HQ8A 5H1SV 4CTAB 3DXBA 1NK5A 2E9TA 2IVFB 4NLSA 5AXKA 4NWBA 4WFNQ 4FNIA 4ECYA 4C8LA 3NG8A 4K4TA 4P7TA 2W4PA 2K1RA 3PW4A 5H9EJ 3RAQA 2GX8A 4O44A 4FBUA 4K4SA 2CZ4A 3MMBB 2DPJA 1SB6A 4QR1A 4NLQA 3FMBA 3GQCA 4DUZF 2XMUA 5DG8A 4ECUA 4HKQA 3G8TA 5KFSA 1N5SA 3S01A 4MK8A 5DLGA 1LWFB 2FLLA 3FSYA 4NCGB 1Z4UA 5LL6d 3TAQA 3MEEA 2HHVA 3T9ZA 1YBAA 1S49A 4KTQA 3KFWX 3DOMA 1UKUA 2N7CA 1JNRB 4K4ZA 3DOLA 2GQQA 2PA8D 4WK3A 1FRKA 3CT9A 1FEHA 2ZOFA 5GADI 1RT7B 4NLWA 3W7BA 1OSDA 3PHEA 2XG8A 1ZOTA 2GNKA 3CB4A 4DV4F 4O4GB 4F4YA 4USHA 4I1TA 3M1VA 4KRWA 5A8WB 4G3IA 2HW3A 2ILZA 2RNEA 5LSRA 2ERRA 4MH8A 1PGZA 3PX0A 1IKYA 3DN9A 1JLBB 4IG0A 3N0VA 2YKQA 4F02A 2QIFA 2CQGA 3MM8A 2E9RX 3M2VB 5DS7A 3EUNA 1ZAXA 2FJAB 3OR1B 4Q43A 3GV5B 4OV1A 1Q8BA 4KKOA 2VPZB 1S48A 3B78A 4NYOA 3I9V9 4MIBA 4RW8A 4RUAA 3CMAS 3CC7S 1R8HA 2XS7A 2BVZA 5I3UB 4R5PA 3NCRA 3H5YA 4TYBA 3EYZA 3ULHA 4DX8H 1SL1A 3HHNB 4EBDA 2RU3A 1YTYA 3E01B 3OVSA 3CD7A 3PW7A 1MROA 1HBOA 4YDDB 1DURA 2MKKA 3CDBA 3R3TA 5DQIA 2YNHB 1R6YA 1HMVB 2E5LF 4NPOA 5JUMA 1JLFB 5HP1A 5BJRA 1J5OB 4NA2A 1S72S 2IRYA 3FRZA 2MHEA 1WHXA 2EFQA 2JL9A 2AX0A 2IM3A 4JI5F 2DISA 2HQ3A 1LK7A 2YWKA 4Y2CA 2IRXA 2ZJRQ 3CCVS 1G3OA 3SDEA 4QCLA 3SCJE 5I42B 1F5CA 4TLRA 1MWYA 3T1HF 3RAMA 3MAHA 1GTEA 4JI4F 4YOEA 2XI3A 4J9OA 2OPQB 4Q2MA 4Y3CA 1RT5A 2CPXA 3FVYA 4M1KA 1XN9A 2OFGX 1URNA 3BF4A 3IG1B 3VAIA 2RQMA 2M3DA 1C0TB 3T5LA 3CD5A 1S77D 5K14A 3DLEA 5DLFA 3FZBA 2HRYA 4O3OA 4QR0A 1LQ9A 3MR2A 3DOKA 1HBMA 3EZ5A 1JJ4A 4TKTA 3IA0A 4JI0F 2IFXA 3GIKA 4BDPA 4F8RA 3SDEB 2CRLA 1VQLS 5J2MB 2J0WA 1ZYQA 3C6UA 1VQKS 3ENVA 2GHWA 1YSJA 1GQEA 3DU6A 2G4BA 4DR5F 1BQMB 2B43A 2M5YA 5KG3A 3BR8A 2ZZMA 5EX0A 3RW7A 3ISZA 3NWGA 1T94A 4OJ3A 4ZVGA 2RQKA 2K3IA 4GKJF 4IFYA 1HQEA 2RKIA 2Q3PA 3OXGA 2RRNA 4UQTA 3N9UC 5J2NA 1TKZB 4LUBA 1QE1B 1YJVA 4XK8C 2F9DA 5B08A 1RK8A 2XWYA 4QW8A 3OJUA 3PO4A 4KHMA 3C6UB 5A0YA 2R7UA 3HLUA 1X5SA 4ICLA 5D78A 3I5CA 4CH1A 3PV8A 4ITSA 5D8HB 2ZH8A 3TA1A 5HL7Q 2A2CA 3CCUS 4Y65A 3TUIC 2O01C 3HVAA 4DL2A 1OIAA 3LGNA 1OS5A 4PG8A 3HMJG 1RT3B 1FRHA 2A3JA 5MLCV 2ZM6F 2M70A 2J9DE 3PEHA 4OZNA 2HFNA 2VZ9A 4I2PA 5SUHA 1TFWA 2RMLA 1C1BA 4Y28C 5EHHA 1KNZA 4Q0BB 4ICLB 2JC0A 4DR2F 2VL1A 1CVJA 2KG1A 2PI5A 2QE5A 3H2UB 2ZFHA 3AAWB 1S1XB 2B9WA 2MKCA 2YQ3A 3MMJA 3PFEA 1HWUA 4LFCF 2FB0A 1FKOB 3KLGA 2ZH9A 4DV6F 1ZAWA 3L7OA 2FUG9 3ZZUA 2KH9A 1X5OA 1CLFA 3QLHA 2HNYB 1T8EA 2IHR1 2CQ2A 1KC8T 3RB0A 1ZH5A 5EWFA 2O1PA 4I2PB 1Q4RA 1ZM9A 2E44A 2DNRA 4URQU 3MURP 4RBVA 2GJIA 1HI1A 1NJXA 2RS8A 3T5HA 1X4EA 3SFUA 2C2DA 1D0EA 4ZP9A 2YX1A 1U24A 3RBDA 1VQPS 2J6UA 2JSXA 4DL7A 2HAIA 3OR2A 2GHVC 1MU2A 2JDJA 1R8PA 1S6PB 3QMQA 5KFFA 4IOCQ 3OTOF 3PO5A 1IKXA 2R7OA 5FLXY 2MZSA 3GE9A 3NCPA 3KLHA 2RD5C 4Q7AA 4H4OA 2DJWA 2VG5B 5HMWA 1JB0C 1S0VA 2PD1A 3FZ2A 1CC8A 4DPOA 2MSSA 1VRUA 4FXVA 4HL9A 3I56S 1T05A 2ASDA 4ZVHA 4RZRA 2NXUA 1YRTA 2JOQA 1N0VC 2EK6A 4ATNA 5BR8F 1LFPA 2FHMA 1KLMB 4X62F 3DLBA 3OFGA 5D77A 1WEXA 4ETXA 1RTIA 3DDKA 4KB7A 1XR5A 1TQLA 4NL5A 1NNDA 3CUNA 4J9MA 1B0VA 2P9GA 4CT9A 1VQSA 1JJ2R 1C1CA 2ZH7A 2R7TA 1BC6A 2ZUGA 5DQHA 1TR0A 2BQ3A 1Q79A 5KFPA 1S9GA 2IMWP 1S1VB 2R2UA 1TL3A 2MKSA 2RUGA 4R8UA 1KTQA 4ES2A 1H2VZ 4QIVA 4ZKAA 1HBNB 2DNLA 3M6VA 1RTDB 3KYLA 3AJ1A 3MM6A 4TNOA 2AJQA 4NLOA 3POTB 4MK7A 4ZLPA 2KM8C 3V6KA 1VC0A 2AYBA 4DBQA 2UVRA 2YWHA 5EUHA 3A1YG 2B7BB 2R2TA 1LXNA 2DNKA 2DNNA 4J9RA 3C2PA 4B9NA 1WG4A 2JEIA 2UZAA 1S79A 3JSBA 1U2FA 5F8MA 3BGFA 2V9WA 4DSKA 4DV5F 2C22A 1WTFA 4MAKA 2E5JA 3BZQA 3OUYA 4F3OA 2KZMA 1TV6A 1RI7A 4OHXA 4RW6B 1R8CA 2QRRA 1TL3B 1X4BA 2I5JB 3HHLA 4NLTA 4PPZA 2R7SA 5M2PA 3QAEA 1S10A 4N47A 3SCLE 3M32A 4CI0B 4NLYA 2XMWA 5T7LA 3SYZA 4OHVA 4B9SA 3SCKE 2G0CA 5KFEA 3MF5A 4CCHA 1N33F 1CEZA 4LSNB 2HVZA 2IJFA 2IVYA 2KHCA 3FJ2A 3MM7B 5IM0A 3Q23A 3PZPA 3HO1A 4G1PA 4BS2A 4DV7F 1VBYA 4IQMA 3KG1A 2LKZA 3UW1A 2VBWA 3D2WA 3KK1B 3OUYB 2J5AA 2KYXA 3S1TA 3TUJC 3GV8B 1XR7A 2V0NA <