4JI7F

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
b'MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ji7F00
4YHHF 1XMQF 2UUBF 3R3TA 4NXMF 2BVZA 1XNQF 3ZZPA 4LF8F 4DUZF 4LFCF 4B3SF 4LF6F 4DV0F 4DR5F 1CQNA 2VQEF 1G1XA 4DV7F 1N32F 1N34F 4DR4F 2BXJA 1B64A 1HNXF 1J5EF 4X65F 4JI4F 4GKJF 4JI5F 4B3TF 4B3MF 4LF4F 4LF7F 2E5LF 1IBMF 4GKKF 4JI6F 1IBKF 4LFBF 2B7CB 2UXBF 1VMBA 2UUCF 4OX9F 4NXNF 3T1HF 1GH8A 4DR2F 4LF5F 4JV5F 1IBLF 1FJGF 2UU9F 4DR7F 3OTOF 1QJHA 1HNWF 4DV3F 1FKAF 4DR1F 2UUAF 5LMUF 2F4VF 2UXDF 4DV5F 4JI2F 4JI0F 5LMNF 4X62F 2VQFF 4YY3F 1N36F 2KJVA 2HHHF 5IWAF 1G7CB 4K0KF 2B7BB 5BR8F 4LF9F 4B3RF 1XMOF 4JI3F 4LFAF 2KJWA 4JI8F 5AJ3F 1LOUA 1N33F 4AQYF 4X64F 4DV2F 4DV1F 4DR6F 1IJEB 3T1YF 1XNRF 4DUYF 4X66F 1CQMA 1F60B 2ZM6F 2J5AA 4KHPF 2YY3A 1HR0F 4DR3F 4JYAF 4DV4F 2RJZA 4DV6F 2UXCF 4JI7F 4JI1F 1RISA 1I94F 1HNZF 1IJFB
chains in the Genus database with same CATH superfamily
4A8SA 5ITHA 1FFGB 3THPA 1J5OB 1CSJA 3MR5A 3CDUA 3SQOP 1CJVA 1VQMS 2UU9J 2RAQA 2CQCA 2M7SA 1RWVB 2GVZB 3QJJA 3WHIA 2ASYA 2H3EB 1U8WA 1JIHA 5EDWA 2AV5A 3DI6B 2IYIA 2ZH6A 1KD1T 1XMBA 1N33J 2ZC3A 3B6BA 4DS5A 4ZPAA 1DZ5A 4GMKA 1ELOA 4UT4A 3LAKA 3QRPA 3MAAA 5THWA 2V8GA 3LP1A 4DCOB 2BZ2A 2AP6A 3HHNB 4WXOA 4ZN1A 3O8WA 1I5OB 4PZVA 3D54A 5KT3A 4LR8A 3P6YC 3SYZA 3KUHA 4X4UA 3V6DB 4F2SA 2XSJB 4ECRA 2FZGB 1Q8KA 4ZIVA 5DG7A 4AL6A 1LW2B 3VGUA 2R8KA 2HGMA 5H9EJ 4OHWA 5SUHA 1FWLA 4ZVFA 2ZFHA 2DK2A 4LFBJ 3CO0P 3JS9A 1VK8A 3H4BA 3M6XA 4ZITA 1RCOB 1VBKA 1F9FA 3M2VB 3SI8A 1HQEB 4FS1A 4A8KA 7FDRA 2HKEA 1VIOA 2A10A 3TVZA 4DL0C 3JSMB 5D0GA 2BOPA 1XBWA 2V2QA 2D3UA 3DMJB 2XI2A 2CKWA 1TVRA 4KGXB 3VAMA 2YH0A 4M5GA 2K3IA 4PYDA 3DC2A 4X64J 3PDNA 3M2RA 2QSWA 2MLYA 2UXDF 3UCZP 2ZH7A 3L4BC 1OY6A 3H5SA 2ZZMA 4PRFA 1KTVA 1PC4A 3N6MA 4CWBA 2JLGA 2KJVA 2XY7A 4NLUA 3SXLA 3HULA 1M5OC 2HMIA 2R2RA 4C4WA 4RLEA 1K1QA 4NMXA 4LRCA 4DU8A 1NPPA 5A0YA 3R7NB 3FBBA 4MKBA 4RR5A 1SXLA 5BXIA 3IFEA 5KFMA 4YMEA 4LBPA 1Q5YA 5LMNJ 2RDDA 2KT3A 2QT7A 2GW8A 5A6WA 2R4FA 1DRZA 3KLVA 2XS7A 1P1TA 5LXRA 5HANA 1KFDA 1S72S 4ZVGA 3AOAA 4B3SF 3MM5B 3NRBA 3Q8YA 3I9ZA 2KYZA 4Y6IA 1P8GA 4K2JA 5HVFA 3PEJA 4R25A 1VQLS 3UE2A 1V5VA 1ZM9A 3SSRA 3TQEA 3SCKE 1FKOB 3JQMA 1JLQA 2BE2A 2RRBA 3CCTA 4K59A 2BBEA 5C25B 3R97A 2NS1B 2RMLA 3R5AA 2FB0A 1VQ9S 4OIXA 2VKZG 4MK8A 2BABA 5KOXA 2L08A 2RKIB 4USIA 2W7AA 2QFJA 2FLNA 1R27B 1XQIA 3DXBA 1E6VB 4OI2A 1SIWB 1DTTA 3FQLA 4NZ6A 1M5PC 2OIHA 5FDLA 4J90A 3MD1A 2OO4A 4NA3A 1UA1A 5HVHA 4OZ1A 4RUCA 4NCBA 3OPKA 5J2MB 1SUQB 2WSCC 1NO8A 5ETSA 4KPYA 1ZAWA 4A8MP 4OX9J 1VJWA 3I32A 1G2EA 1TAUA 3W62A 2DHHA 5ETVA 5F0UA 2CPIA 2ALZA 2J8SA 4ZLPA 4K5RA 2YWHA 2M9KA 3PRDA 3BSOA 1MNEA 2ZKTA 1NDKA 4KFBB 4NZ0A 2H5EA 2VIHA 2W2QP 4QJVA 4HACA 5KFTA 3P3DA 2V9KA 3BS9A 3KJNB 2ACMA 1NDPA 3BN4A 5C42B 2V34A 1SJ1A 3R1HA 2JFDA 3RR8A 1R8HA 1JLEB 2KM8B 2FPHX 4DV5F 2CQ4A 3CCZA 3H42A 5C2CA 3MPWA 2YXLA 2EKNA 1AT1B 3TA0A 1Z4UA 2I9SA 3G71S 4NLOA 4WIQA 3TZXA 5KG4A 2G0JA 3NS6A 1FRIA 3I0SA 2DPJA 2MKCA 3T1YF 3QIPA 1YJ9S 1HWLA 2I5JB 3CCLS 3TUIC 2RDIA 3LW5C 4PPDA 4DL7A 4L6V3 1UKUA 2ZBRA 1X4FA 2OEKA 2V50A 3TAQA 2IRXA 2O66A 2KZMA 2WB4A 4HDGA 2MGZA 2XMKA 2FC9A 2WW8A 3TWZA 2DRDA 3OW2R 2DGXA 4KGKA 1Y5LB 1RT5A 5LJ5Y 3I0RA 3AAWB 2UXBF 3D2WA 3GFYA 2FGCA 3PX6A 2LQ8A 3W7BA 4CRJA 1N4LA 2HIQA 1IBCB 2AEMA 4ZVEA 1H3DA 1VDHA 2VC1A 3IWLA 4CYUA 4JI1J 2ZNZA 3MUTP 4NA2A 2BYCA 4Q8EA 1GAOA 2PMHA 1FDNA 3AQPA 4X4NA 2RRNA 5M2PA 4TU7A 4CI0B 1WI6A 1M0SA 2ZZNA 1RHKB 3M32B 3RW6A 3LF0A 4C0HA 3M8SA 1J2VA 4IUFA 5L9NA 2JJ4D 2BVZA 2F8MA 2NSCA 5J1EB 4ECXA 5LMUJ 4LF6F 3D6MB 2HS4A 4KV8A 1PJ6A 1S1WA 1JWWA 4F4XA 2QYCA 1RT3B 2ADCA 2E5LF 2IIHA 3EUNA 1FRLA 2R7WA 3B4MA 2XLIA 2LP4A 2BQUA 1S57A 2KKHA 2ATCB 3QAEA 5J1NA 1AZSB 3WZ0A 2AYMA 1NK8A 2B6AA 1YJNS 5HP1B 2YKNA 3NCQA 2GFFA 1JX4A 2K1RB 3QZ7A 4JI8F 1D8ZA 2L48A 3P49B 3BB5A 2DEIA 2FZKB 1VJQA 3D66A 3ZTSA 3MCOA 5DG9A 1S7HA 1URRA 1HHSA 2MEWA 5LT5A 5E3AA 1VOMA 3CD5A 4KBIA 4DFPA 1WSVA 1C1CB 2HRUA 4KHRA 1Q95G 4CLYA 2WBRA 2ACYA 4FBUA 1WC3A 3MM8B 2B9XA 4OYAA 2DCLA 1NK9A 5F0WA 2QMXA 5D3GB 4ENOA 1BQMA 1YQHA 2UV8A 3BH7B 3B82A 5K14A 3OTCA 1U7LA 4GO7X 4X65F 2BRKA 1S9EB 3A8IA 1SIZA 2XO7A 4JYAJ 2IDEA 2E7VA 1NAQA 5I3UB 1IBKF 5IC6B 3CSKA 3EZOA 4JV5F 1QJHA 4OZ0A 3GJQB 3TVYA 3NS7B 1TKZB 1UWBA 3IRWP 4I69A 3T19A 4WKRA 4F2RA 2VFRA 1N34J 3N01A 4IQMA 3B54A 2JEGA 2XYPB 2JC1A 3HSJA 2WONA 3GZ7A 5HATA 2E5JA 3NAIA 4YS2A 2OSQA 4OYPA 4LSNB 5KFGA 3C19A 3P96A 2N7YA 2OJ3A 1S1UA 2XMWA 1XTZA 4J9KA 3BSNA 2BJ9A 4OX7A 2DO0A 1HPZA 3R7SB 1HBNB 4DS4A 3CJQA 2PMZD 4FXVA 1KKHA 1MN7A 3OUYB 3ENWA 1RWUA 4YY3J 1WC5A 1VBZA 3OJSA 2HAIA 3W2WA 4RNOA 4A4JA 4QYZJ 4GVBA 2BJ1A 4N41A 4CM2A 3GFXA 2X1BA 3M8QB 5B0FA 3BF4A 4DU7A 5JVHQ 2PDAA 3IP0A 4Q0BB 4RZRA 2QSFA 1YIJS 3AT1B 4FF4A 3G86A 4ZVSB 5KG6A 1RAFB 2ZBQA 3OFEA 5C5JA 4QCLA 1WDTA 3NOGA 4Q8FA 4TVAB 3QJLA 4C6AA 3UNYA 2FC8A 1RBOB 2D3O1 1N48A 3D68A 4P6QA 4WZMA 3AA9A 3PX0A 3THTA 2HHWA 3E01A 3AOCA 1K44A 2OPRB 4U7CA 1FKPA 1ZTTA 3DLEA 4OJ1A 3A8KA 1AW0A 2FVCA 4DR6J 1U24A 2DYAA 3GJSB 5T41A 5EGYA 4R8UB 3C6UA 3HM9A 3R5DA 2I2YA 2KG0A 4F4WA 3D67A 5A6PA 4ED3A 1F0XA 1R31A 3CIZA 1XMQJ 5LJ3Y 4RW8A 3RTVA 2O67A 3UN2A 4DBQA 2RS8A 2MQOA 1JKHA 2Y3YA 1RT4A 4ZJLA 1O6XA 4RBUA 3JB9k 4BC9A 3MCNA 4QPTA 1UFLA 2O3DA 5CH7B 4CTAA 1DTQA 4FXWA 1RTHA 4B3TJ 4HI2A 4IYQA 4PXCA 1YBUA 1BQNA 4P2MA 2FHJD 4EBEA 4A8FA 4ED6A 1XNRF 1FJEB 2VBWA 1U8SA 1RT6B 4P7TA 2HAFA 1VQYA 1R0BG 4TY9A 3NGDA 1S79A 4WXWA 1BE4A 4IO9Q 3DCAA 1K8AT 1VIXA 2DY1A 1EQMA 3TAPA 2NSBA 2E66A 1OPIA 2DNZA 5HROB 3J7ZT 2WZ1A 2N3OA 3D3CJ 4RBTA 3BSCA 1S1VA 4Q7AA 5LM7E 1XC9A 4PEOA 2ZHAA 5A8KB 3OR2A 2BDPA 4N5SA 4DPYA 3FQKA 2QLJB 5T7LA 3PVXA 2BEFA 3OTOF 4LVOP 3A1YG 2EK1A 4JI2F 1Y9OA 2DNGA 3ILJA 2HNZA 2RUGA 1VLOA 1HNZJ 2VL1A 9ATCB 4UOFA 3HHKA 5RUBA 4MIBA 3KFWX 4DL5A 5AXKA 3MMAA 4OV6A 3D1QA 2V4QA 2AMCB 3KLEA 3BM7A 4LJMA 1HKAA 3I5AA 1S76D 2BV3A 3PIPQ 1REVA 1T3NA 2JFKA 4UY8T 1T9XA 1RTDA 3HZGA 1S6QA 3Q8VA 4GKJF 1NZAA 4ZA1A 1R89A 1VQOS 2FVQA 2MHEA 3CC7S 4DQIA 4ZCMA 2XO6A 4IRCA 4KB7A 1JLGA 4O3QA 2OH2A 3T5HA 5DJBA 2XMVA 3IXQA 2YNIA 3AH6A 2DD8S 4QBUA 3F73A 1Q8IA 4DSLA 4DN0A 2B8QA 1RWKB 2Y1RI 4C3MA 3MHYA 2XZWA 1RAEB 3MECB 3QAUA 1HBUB 4C97A 1BWVA 2RQMA 4X66J 3EPGA 2LEAA 1AUSL 4QW8A 2DVIA 3K7RA 4TU8A 3W5ZA 4CNZA 2G4BA 2CA9A 4DV6J 3JXOA 2XS2A 3OVSA 2JEFA 3H20A 2XNRA 3W3SA 2VBZA 1KWMA 3PFOA 1Y5NB 2DB1A 1BMQB 4CO5A 2YX7A 2CPDA 4DV1F 3G96A 1WELA 3MR6A 2WVFA 3Q2TC 2HYIB 2HHQA 3IR7B 5HQLA 2DHSA 3EICA 4TU9A 2G2ZA 4OHZA 2UXDJ 4QU6A 1DJ0A 2VBXA 2HNYA 2Q3PA 1EP4A 3LP2A 3QBCA 4EWTA 1DQAA 2HWIA 4P7VA 2O01C 5C24B 4QW9A 5E0OA 4M5DA 2R7OA 1RYRA 2XS5A 5ETTA 4K4TA 4Y2IA 1N52B 2ATLA 2WVEA 2X1FA 1T9WA 3HP6A 3D5MA 4L76A 1F9EB 4ZLLA 2KYXA 3QLHA 2GHVC 2DHAA 4WFYA 1F2GA 1RT2A 2CJQA 1YRUA 3M2RB 3KK2A 2KDOA 5KFYA 3KK3B 3HO1A 5DZ6A 3OSPA 4B3SJ 1CJUA 4DL4A 3AD8C 1OJ4A 3VCDA 1QSLA 3ILIA 1C4CA 2IC3A 3TX8A 2HFZA 2HMIB 4B3RF 3MEKA 3J7A1 4O3NA 4ZCIA 3IS9A 3R2DJ 3LQVA 3N5FA 4ED0A 1CJKA 4H4OA 1TKXA 3CUNA 3PJWA 1RTIA 4HEA9 3KDNA 2XC9A 1WC0A 2QJ3A 2IVYA 2P9EA 3CMAS 4PPZA 1O8BA 3BQ2A 1IN0A 4FDFA 1YJTA 4P75A 5L39A 4PKDB 2QRRA 1FO1A 3EDQB 4ZLJA 3QSYB 1B3TA 3EM1A 1RP5A 4RU2A 3O2IA 3TP2A 3W63A 2IFXA 1T7PA 1IVZA 5GADI 1VHIA 3KWMA 4B3MF 2GCFA 1OS5A 3LANA 3K8VA 5KFQA 1FJCA 2VF3A 5EHHA 3KG1A 3KHGA 4CH7A 4IG3A 1HQUB 5JXSA 3HLUA 2RQ4A 2KXNB 2GQ2A 2OI2A 4MKVA 4PQAA 3BGOP 3EJMA 3MPDA 5M2RA 3QWUA 4A47A 3C8YA 1KVKA 4Y00A 2BMBA 3PZPA 1KRPA 1VQ4S 2NUHA 1LWFB 4OZNA 3SFUA 2B4OA 5FDLB 1VRTB 2YX1A 4BCAA 2O1PA 4DV5J 2IM2A 5K8MA 2OLWA 1S0NA 1CULB 2YWWA 4F67A 3KUEA 5GADU 3RB4A 4KSEB 1R0AA 1WDDA 3BSAA 3N28A 4B9UA 4WU3A 2QZ8A 2ZBIA 3SQGA 1V3ZA 4UUWA 2ABYA 3G6XA 4LF7F 3DLBA 5CYJA 2UUCF 2VJVA 1M5KC 3L7OA 4D3GA 5D15A 2VG6B 2VASA 2ZOMA 1NHKL 3T5LA 3Q22A 3QT8A 4C8YA 3TUJC 1TL3A 1NHUA 3RZAA 5HQ8A 4RU9A 2HWHA 1RJJA 2EFNA 4LMZA 3U7JA 4IDKA 4K4YA 2WK4A 3ZZUA 2FYXA 3N5BA 1EZZB 2XHWA 2UXBJ 4DUYF 4I67A 4ZP9A 1C1BB 4NLPA 2ZM6F 4WFZA 1JLBB 4O0IA 4F4KA 1RTZA 2DXEA 2VZ9A 3KMQA 2DNPA 1TUVA 4V19X 3Q89A 1W7WA 1R8AA 3U1NA 7AT1B 2YH1A 2HWTA 2F4VJ 1U0HA 4DR5F 3UPFA 2WB1D 5KFJA 2V68A 1PJ7A 4FF3A 1RHRB 1ZAVA 3MM7A 4I2PB 1S48A 2XHCA 5GAHU 4PWUA 3I0RB 4C8KA 1KHWA 2BOAA 2F65A 1M5SA 2YKMB 3UVJA 2DHXA 1UWAA 4F4ZA 2ZJRQ 3C14B 4K4UA 1S0MA 1LW0B 1HD0A 1NUEA 2CUYA 3CC2S 4X4VA 2WVBA 4MK7A 3G6YA 1NK0A 2LKZA 2ZDPA 4CYUB 2BKOA 2ZDOA 1SQFA 1JXVA 5G4DA 2QN6B 4J9UE 4DX5A 1VRUB 4KJIA 2NCKL 4ZHRB 4MMOA 2ZNYA 1HWKA 4J9PA 5HAOA 2J6TA 1GMUA 2KB2A 1NK6A 1I6JA 4HL9A 1IBMJ 3VGTA 2CAJA 1HNIA 4K4VA 1RKJA 1SH3A 4JI8J 2CQHA 2KVIA 1RBAA 1IKYA 1UJ4A 5ETQA 2QV6A 2CPEA 2OPQA 3SDEB 1JNRB 4L75A 4QYRA 5LOQA 4MT1A 1HD1A 5DZ7A 3GWCA 2VDHA 1GK8A 1CJTB 4O3PA 3QFWA 2MJUA 3T1HF 2Z58B 2H4WB 3NGTA 3QJPA 1CS4B 2ZH1A 2C22A 2KG1A 4FVMA 4QWCA 2MDAA 4IOAQ 4I56A 2HVHA 2CVIA 4X65J 4F0HA 4UQTA 3K17A 2HBYB 4LVNP 4TKTA 3PYFA 4WZQA 8AT1B 2EWHA 5D6GA 1DAXA 2M8DB 4ZPCA 4ECUA 1TL7B 4KHPF 4U8VA 2YY3A 2AJ4A 5K9FA 3WBZA 3MEDB 1W2IA 2DISA 1EAYC 3ZTRA 2PFDA 2MQQA 1CPZA 1KR4A 5I4MA 3UCUP 1RCXB 1X31C 2R8IA 1TL1A 1JLCA 3AD9C 5IQ6A 4J37A 4QIVA 3BO4A 1VQ6S 3A8JA 3KDOA 2X1AA 3DOLA 3DRSB 3KLIA 5A76A 1PC5A 3PY8A 1YZ6A 1PYSB 3GFHA 3QQCD 2AZ3A 1VK3A 5DDRC 3V4IA 2RE1A 1X4AA 5KT2A 2VFVA 1RHJB 3GPAA 3UDEA 5IT4A 1UWBB 2VOOA 5IM0A 2MZQA 3Q8QB 4F3OA 2D9PA 3QSIA 2KJWA 3H2VE 5HN0A 2CPXA 2WONB 4TQRA 2W8LA 2WHOA 2KRRA 1J5OA 1WC1A 3G82B 3NKYA 2UUTA 3HD1A 3PHTA 2XZTB 5HLFA 1HHTP 4N8NA 3FFIA 1LXNA 2WTFA 4C11A 3DI6A 3S7RA 1TKDA 5ETLA 4DN9A 2W9CB 1UA0A 3RRGA 4OI3A 1VQ7S 3MAHA 4TN2A 4LT6A 2HFVA 1N32F 4DR4F 2RB7A 2K3KA 2LXIA 2HK2A 5G0RB 4Y0FA 4GC7A 1TFYA 1UEKA 4ELUA 2XYHB 5KFHA 2IVMA 3TJ8A 2UU9F 3T6JA 4DFKA 3V6DA 4WFAQ 3PW0A 5T14A 4CLZA 3OVBA 9RUBA 1TK5A 2VONA 2UXCJ 2W7OA 5KFKA 3GLJA 1HI8A 5DDPC 2MQLA 1LW2A 3GIRA 4FXDA 1N33F 4RW9A 3NNAA 2D7SA 2BQRA 1DLOB 2HQCA 2OEJA 3BKTA 2WOMB 3TO8A 2YKOA 2BA9A 3M2VA 1S4EA 4DV7J 4HLBA 4LR9A 3E01B 4P74A 4UTGA 3JSMA 1WSRA 1ZTWA 1Q7YT 3DMJA 1FK9B 1MWYA 2KFYA 4UUXA 1U0SA 2DO4A 4RKUC 2EKYA 2AT1B 1ZYQA 4K4SA 1XNRJ 1CBKA 4DDFA 1VYAA 5KG2A 4DWIA 2BJ7A 4U8YA 2FGOA 4RNNA 2DR7A 4K0KJ 1S6PA 2G1DA 4S0MA 4LFBF 2P6SA 3HHEA 4X4SA 1Q8LA 1OPZA 2YPZA 3FC9A 3NCPA 3FEYB 2MY7A 2JEJA 1P6TA 3HXMA 4FYXB 1Y11A 4CQ1A 4DXLA 4Q44A 5BR8F 3ETMA 4CTAB 5IOLA 4I68A 3HSGA 3BKUA 2NQPA 1RTHB 4F0MA 4DF4A 4FPIA 2MQPA 1UW4A 4X64F 2J9DE 2PFFB 5ETPA 4KC5A 1NCLA 4NLXA 2GS8A 4W98A 3W61A 2GQCA 2HIYA 4JI2J 4G1QB 1YK9A 1WKKA 4JI6J 3FMBA 1TU0B 3FCHA 2V8VA 2CQ0A 3S8SA 3VQTA 5C25A 3D3BJ 3BGLA 2J76E 4XDDA 3HFKA 3GV8B 4WP8A 4LBHA 3JQJA 5K8PA 3MFHA 3OR2B 2BJEA 2OSRA 3BBBA 3X1LB 3G6VA 5F8GA 1YVFA 2W01A 3VAHA 2RRAA 1E6VA 4WP3A 4ZPBA 1O5JA 1WC6A 4PWDB 3PO5A 3M30B 1MN9A 1RACB 1S1TB 3EPIA 5J2MA 1SUQA 2G9OA 4FVCA 3HJVA 2FDNA 3FEZA 4W92B 3ITHB 5EWGA 1VC6A 1U2CA 1KLMB 2QL7B 4FN5A 4ECZA 4J9MA 4NE9C 4RJVA 2GHWA 3UWTA 2AKWB 4GKKJ 2DIUA 2GV1A 4MIWA 1AB8A 2Y1JA 1M5HA 1L3VA 4NMLA 5C42A 4BWJA 2ZOFA 1U6FA 1JLGB 4LUBA 3MMBA 1S7IA 1JLEA 3GIIA 3NMAA 3HD2A 1WACA 3TI0A 3BR9A 2AW0A 2HQFA 1VMBA 4OX9F 1LNQA 3FMWA 2R2SA 2MKHA 5KFRA 1MMDA 4MYTA 4C8MA 2P8IA 2I5JA 2ERRA 3W1YC 4HH1A 1FXLA 1T03B 2VFUA 2V9WA 3M05A 1S1XB 5BJRA 1K0TA 2EFQA 1NSPA 2V2KA 3QNWB 3L7PA 4M95A 3FBCA 1R6VA 1JQGA 3GQCA 2IAJA 1RUSA 2DR9A 4IR1A 2R7RA 4HVZA 2EEYA 3VQSA 5J2NB 2NYHA 3QMQA 3RJMB 3H90A 3EX7B 1R8PA 1TTHB 2B43A 2RVJA 2K7KA 3OJUA 1RHUB 1IBLJ 3LP0B 2HRTA 1H7WA 3W66A 4KH0B 2Z2ZA 1A6LA 4DQRA 1NDLA 3ZNJ1 1S77D 1OY9A 2Q1LA 2L41A 4CP5A 2CZVC 1HNVB 2ZKUA 3QLHB 4EO6A 1WOPA 3EWGA 2PI4A 3KK2B 4WF9Q 5ETNA 2E5GA 3H5XA 2M70A 1JB0C 3HHLB 1RU2A 1ACMB 1CJUB 3TOQA 3CCMS 1X0FA 3M1VB 3M32A 3Q2SC 1ZOTA 2YQ1A 2IC3B 4Q45A 5H1SV 4EUVA 2XSFA 3RU0A 1SCJB 4CO3A 1PGZA 1WD6A 4G65A 2E1AA 2XM3A 5KFZA 1ZA2B 1F5BA 2W2PP 4C8LA 1X5TA 4JI1F 4X4OA 2BJ8A 2HVZA 3CJ4A 1RT3A 4IFVA 3OTDA 2E5HA 1NDCA 1T9TA 1VFJA 1B0VA 1AZSA 3T5JA 5J2QB 1NH7A 3BGRA 3SSSA 1HNXF 4CO1A 1SKWA 1SVDA 2JLFA 5HP1A 2QL9B 3M4XA 2NPFA 3KYLA 1S5ZA 4P2SA 2V2VA 4IG3B 1UVIA 5LMUF 2VKRA 1I1GA 1G6BA 2ZUAA 5L1JA 2OPPB 3OXGA 4OYOA 1H6KX 1YJUA 5IWAF 2X51A 1C1CA 1H38A 2EG2A 2AX1A 4OYXA 4LF7J 1UVJA 2KI2A 4DX8H 8RUCA 4ICLA 3MM8A 4PXBA 4YR3A 4K5SA 1UEUA 2CJBA 4OZ2A 2MKSA 4L74A 3W9JA 1UZDA 2C2EA 2MQ8A 4C3LA 1Q8BA 4YOEA 1FWPA 1WHWA 1RWMB 5LSRA 2H51B 1I94F 1S9EA 1Z1ZA 2F9JA 2XULA 2UV8G 3B78A 5I3UA 1IM6A 1FE0A 4AE5A 3DLJA 4OYZA 3CC4S 5ETOA 1D8YA 3CCUS 2DRAA 4DUYJ 3MM6A 1SPBP 3JTOA 2DHGA 2J7KA 2ZM6J 1TKZA 1U1LA 1NJYA 2HQDA 2J7UA 3CJKA 4Q43A 1HA1A 3ENVA 5H9FK 2Y0SD 4Y34A 3UDLA 2GMJA 4HI1A 3K58A 3T9ZA 2VHGA 1WF0A 1F9HA 2HHUA 2DNLA 1N6QB 5HMXA 2F3JA 4BBYA 4DV4J 1CC7A 5D78A 4DR5J 3L95X 1LK7A 4LRDA 4FBTA 3A13A 1FDDA 1FNMA 4IDKB 1S6OA 2QE5A 2NR0A 1U48A 1HBNA 5GMEA 2MSSA 2H5IB 3X3UA 4CNYA 5B08A 3OUYA 1YI2S 1TZ0A 3IA0A 3MURP 2FHMA 3R6GB 3RYLA 4RWXA 1XR6A 4WBFA 4J9NA 3E51A 2ZHOA 1M1HA 2YWEA 3TEGA 2CDRB 2EC0A 3D28A 4Q0BA 5E33A 4LSLB 4ES1A 1MWZA 4WTYA 1T9YA 2Y9HA 3ONQA 1NSQA 1JJ2R 2BJ3A 1BQXA 3MOJB 1PYOB 2FVPA 4DSIA 3N6LA 4PYAA 6FD1A 2D3ZA 1IKXB 1RU1A 1NB2A 4YDDB 2V4JA 4J9VA 4DL2A 4PCQA 1YX2A 4YY3F 3EZUA 3N9UC 4QR1A 2KO1A 2MZ1A 2B4VA 3H59A 1QUVA 3F56A 2OPRA 1NM2A 3FCWA 2LA4A 2RQCA 4MFBA 4TY8B 3T1HJ 4KE5A 2JWNA 3HVWA 4FYYB 2DH8A 5KG1A 3GP9A 3MMCB 2GX8A 4PUOB 4R8UA 1KP6A 1TMMA 1N8RT 3TYTA 1HNIB 3NMRA 2ZH5A 1UW9A 2DCUB 2RQKA 4ZVUB 4KYZA 5DS7A 2Z2YB 5HO4A 5CCLA 4USWA 2ZH2A 4V1Ak 1SL2A 4ES3A 4KHPJ 3I5BA 3H4DA 3UD3P 2PSZA 3MZIA 1S97A 1E6YB 2QC3A 2QMUB 3PJXA 3HT0A 1RAJA 3QGPA 3IM9A 4KH1B 4CH0S 3JAMU 3ET6A 1RT6A 2A6OA 1U45A 3HJFA 2DR8A 3NG8A 3R5JB 4WIIA 2RD5C 1A0OB 1KTQA 3FCVA 5KFCA 1GMWA 3HI9A 2EG1A 5HROA 3BPSP 2LFVA 3RBEA 1UVNA 4XTTA 4NEYA 2RDJA 5A8KA 4ER8A 1KS2A 5JUMA 4LRAA 1X4GA 3UD5A 2BR0A 3OR1B 2FJDB 1TL1B 4NZ7A 1UJ6A 2FJEB 3GSIA 1WOOA 1OYEA 2VPYB 3MAQA 2EPIA 4AL7A 4L3KA 4AYBD 2Z30B 3OVAA 4B02A 2FJXA 3TZYA 1VCTA 4DV2J 4KY3A 3VZHA 4ATNA 3BDPA 1FXRA 1RB0A 5L8RC 3AB2B 5A2QY 4O4GB 1N32J 4DR4J 4I7FA 4FNHA 2FJBB 2Q43A 4NXMJ 1WF2A 4RPFA 3A3OB 4PG6A 3QZ8A 5HQMA 3MEEB 4ECVA 2XMMA 5BYQA 2XMUA 1NKEA 4HKQA 1YKWA 1QVFR 3G8TA 5HLFB 4L72B 3FFIB 2E1PA 1HNZF 1G3OA 4Y28C 4KO0B 2V2ZA 4C11B 2ILZA 2CPHA 3MOZA 4QQBA 1V3RA 3NNCA 3DLGB 4HT7A 2ZH8A 2LMIA 1X5OA 2DNYA 3RBDA 3MECA 1HBUA 1W2BR 2LQJA 4RNMA 3GFZA 1SB6A 4DPXA 2C2ZB 2BE9B 2GJIA 3AJ2A 4L3NA 2FIUA 4A46A 2R7XA 1WTBA 1OSCA 3NGRA 2NXEA 2JZ5A 4M5LA 3OQ2A 3BGFA 3HMJG 3POTB 1FKAF 3IWNC 3LGHA 3CCVS 4YP3A 2W8KA 1RAAB 2AJ0A 3P5BP 4ZPVR 4RW9B 2K06A 2Q79A 3MI7X 3CVKA 3FSYA 1O51A 5C24A 4B17A 4X66F 4I6YA 1EQ0A 2VQEJ 2A2DA 2JC0A 4K4ZA 1D9DA 4DV6F 2HLUA 3R5BA 2QA2A 2N3LA 5FLXU 2FLLA 3UI3A 4CLTA 4WE1B 4E98A 5BR8J 1SBRA 3D7SB 5E5NA 4ED7A 2H65B 3MM9B 5KFVA 5KFFA 4K8RA 5HK4A 5U47A 2IM0A 2HS0A 3LAMA 2MSTA 3G9CA 3KK3A 1FF2A 4KR0B 3Q0AA 2F8EX 1XR7A 1S6PB 4JI5F 1HHQA 5I42A 3M2UA 3H25A 1XWLA 3OHBA 4JBCA 4E0DA 2YWFA 1X0PA 1UAWA 3IR6B 5CYMB 3G6ES 1AXQA 5E2QA 3NP5A 4C0OC 1FNOA 5B0GA 5C2GA 5CYQB 4NLQA 3GU0A 2LDIA 3ZFVA 3HKWA 3CWJA 5AXLA 5B09A 2W9BB 4WP9A 1NSAA 1B99A 2V6AA 4JI7F 4O0NA 1WEZA 1L3KA 4HHUA 3RB0A 4OHYA 2AJQA 2A3JA 2L9DA 3I82A 2E44A 1QAYA 1OIAA 4CO4A 4NYPA 2R3VA 4FPRA 1Q5VA 5KFAA 2GVDB 3AJDA 2XWYA 2U1AA 1FRKA 3MEGB 1HQUA 2EFVA 3RAMA 2LXFA 2R7TA 1K47A 1G1XA 2VQFJ 4URQU 2V4RA 4X84A 2MKIA 2FVSA 5KG3A 1M90T 2QO3A 2MMYA 4OZ3A 1Q82T 2GZOA 2ZEJA 3J80U 1TMJA 3EGZA 3CO9A 2XYGB 7FD1A 1YSJA 2D1CA 1Q4RA 4TQSA 1LWFA 2AJ1A 2YNGB 5B0AA 1NBEB 3D0HE 3R1LA 1VRTA 2YKQA 2CADA 3MUVP 4F04B 1WEYA 5AE3A 1ITPA 1M5VC 3Q23A 5E3PA 2QLWA 1IXKA 2R8HA 2AGQA 2MLXA 1CULA 5F3TA 2OFGX 2EI5A 1FFSB 1HBMB 2RSQA 3LOUA 3UR0A 5IT9Y 4ZCKA 5J1PA 3J81U 2PN6A 1RAIB 1HBOB 2J6SA 5CA5A 4FNIA 3F44A 1RZMA 4NI2B 2LQ5A 3MR2A 4BS2A 3HT3A 2VG6A 3MMBB 5KFLA 4DG1A 1NB7A 1SL0A 2HHXA 4K4WA 2HHHJ 4DL6A 5KFEA 2R7QA 3TANA 2XLJA 2BW7A 4X4RA 4CDIA 1FD2A 4NLYA 3PO4A 2LVWA 4EYIB 1C1BA 4EFAC 4ZVRB 2V8HA 3IO1A 3ZZYA 1JLBA 2R7VA 3ZO7A 2KM8C 3I6PA 4P52A 4N76A 4LSZB 3TNVA 3H2LA 1K73T 4DL3A 3R27A 1KN6A 2C1EB 3P5TL 1BUXA 4HT5A 1T02A 3M7VA 4YR2A 2IAJB 5KG5A 3BZQA 1TV6B 4NOHA 1J5EJ 4N56A 2M5YA 4N7TA 1VQ5S 4LREA 3DLHA 4USHA 2MB0B 1YBTA 2N4DA 4I2PA 2ZD1A 2OTLS 5LL6d 2YKMA 5HMWA 1HFEL 4U9RA 1UZHA 5DLFA 4PG8A 2IRYA 4OZ5A 5L38A 2BKPA 3OLAA 3C14A 2B8PA 2FVRA 2HFNA 1LW0A 5IT0A 1VQNS 2HFOA 3CD6S 4KGMA 3M8RA 4ZDNA 5AE2A 1RAGB 4K2XA 1VRUA 2CPJA 3LGNA 3BBFA 2Y1IA 5I3QA 2B9WA 4F25A 2HQGA 2F4VF 2ZH4A 4ZHRA 2A1BA 3TA1A 2YNFA 3AB4B 4HH0A 4RNHA 3IR5B 2VG5B 1HNXJ 4NLTA 5HSPA 1UMJA 2XMJA 1Y4ZB 4QIFA 1Q0NA 1AA1B 2AWZA 2OKQA 2DNMA 4IRDA 2EXUA 2QYGA 1Q79A 3DRXA 3SDEA 5IWAJ 2J7WA 2I1RA 4IFVB 4OI6A 3PYEA 1OQ6A 2X7IA 1CJTA 4HTJA 4LIWA 2F1FA 3HFVA 3OLBA 1UVKA 1UVLA 3TUZC 1RWOB 4MH8A 5E7OB 4YN3B 1CS4A 1N36J 3BGRB 1UCNA 1JJCB 2CG8A 4CZCA 2XQCA 3AY0A 5DGAA 1IBMF 3P8BB 3AJ1A 4DX7A 1I94J 3MPUB 4KAIA 5DGBA 3O5TB 4YR0A 3MXHP 2QA4S 4ED4A 1MLAA 1MWQA 1FDAA 1NMEB 4I6AA 4NLVA 4URSA 3KJQB 2R7SA 2C28A 1ZA1B 1TL7A 1JK9B 2FJVA 2B3TB 2J0XA 3MEDA 1AUDA 4K4XA 4ICLB 3DHXA 3O6QA 3QWPA 1H2TZ 3NL0A 1Q53A 3RAXA 2VICA 4Z2XA 4EZ9A 4QIEA 2GMLA 2E1RA 4QOTA 1YRTA 3PYGA 2XZDB 1S4FA 3DOMB 1RT1B 2OD4A 3DU5A 3VF0B 1TAQA 3DRSA 3GG1A 5EUHA 3P4UB 4USKA 5SZTA 5E41A 4RO0A 4ETXA 2C3MA 3MM6B 5B0DA 3M8PB 2D3OR 2YKAA 2YTCA 1KNZA 3CJKB 1U1RA 2W7PA 1TUGB 4TLQA 1WTFA 1TUWA 3ZTOA 3U1LA 4OZJA 2ZHBA 4W90B 4EBDA 4DR7F 3KLGB 1S0OA 3FZ2A 1QLNA 3G82A 3DYAB 4AXIA 4F7VA 3EMTA 3W2VB 1UFWA 4F3QA 1XK8A 4EBCA 2OPSB 1U1MA 4F4AA 4ILLA 3H7HB 1IR0A 2IVFB 3H5YA 3H0PA 3QPIA 2Z4PA 2W9CA 1IKVB 1CQMA 1NH8A 5D0HA 2CIMA 2XMTA 4QPXA 1G4CA 1HYSB 3IC1A 2GAHC 4JI4J 4YB7A 2BRLA 2XTJP 3D0IE 1N5VA 5K8OA 3EDRB 2V8PA 5D0EA 2V69A 5G0RA 2DGUA 2X3DA 3L7UA 2ZBPA 1YG0A 2I6WA 1C0TB 3GTYX 1KBRA 3BO3A 4LF2A 2HRYA 3HK2A 1SL1A 1FEHA 2E7XA 1VQPS 4G1IA 3NGSA 4MTPA 4JP8A 2EFGA 1DLOA 2GGPB 1YJWS 2ZC4A 4B9SA 3MCMA 4TNOA 2WOMA 2V4JB 2I0XA 1FJ7A 1AYEA 5B0CA 3L09A 4ANDA 2KHCA 1GNKA 4H4KA 5D4OA 4O44B 1S49A 2RIJA 3NBPB 2EVZA 1U25A 1WJ9A 5B0BA 1FK9A 5BYSA 3BKFA 3KG0A 4MFBB 5ADZA 3MTJA 2R2UA 2BKNA 2UXCF 5FLXY 2RS2A 3SCJE 1UPMB 1H0HB 4NX9A 3EVOA 4TYBA 2FLOA 4L73A 4NXNJ 3CDBA 5F9LA 2XG8A 4WK3A 4ERDA 3PW7A 2M4MA 4U96A 1HNWJ 4DR1J 1C4AA 4DV7F 2LU1A 2QFIA 1N5SA 4FKXA 4DSJA 3NS5A 3CTRA 3I31A 2F8HA 3ZTQA 3DRPB 4PWWA 2IBOA 3GJRB 2DNRA 1GQEA 2E5IA 3TARA 3NCRA 1RYSA 1DY3A 3D0GE 4U7UD 3E2EA 2CQPA 4YEAA 4JI0F 3ET6B 5A8WA 4I0WA 3HVRA 4NLWA 4WJBA 4K0KF 4G1QA 1RDRA 2JEIA 3SCLE 1U2RA 1HWIA 5A8RB 2B5JB 5IQQA 1F60B 1JLFA 2E29A 4C48A 2N4CA 2H4YB 2RHQB 3DU6A 4OX8A 3G4SS 2UVWA 2DJWA 2GO9A 4DPOA 1V9OA 2CZ9A 1X4DA 3PHEA 2QTWA 3LPYA 3NNHA 3JSBA 1Y3JA 1HWJA 5KFUA 2OMOA 2J0SD 5F3ZA 3W64A 2DXFA 4PWDA 2AIRB 1RBLA 2AQ4A 2GIQA 1KQKA 2ASLA 2OHDA 3HKZD 1CLFA 1H98A 3M30A 4JI6F 1S1TA 1D09B 5HJYA 3QT6A 3J80Y 4R5PB 1U49A 1FJGF 3CJ0A 3Q8PB 5LSOA 2YNHB 3C46A 3ITHA 2GJ2A 3HDSA 2HLTA 2B0GA 1KLMA 2PA3A 4OJGA 2HFUA 4H54A 4I7FB 2PE8A 5CZVA 2X3GA 3EGNA 2K2PA 4DZ6A 1BXNA 4QR2A 3T1AA 4QWEA 3GR0A 1JXLA 2R8GA 1YJ7A 3H2UB 3GYNA 3M9OB 5DETA 2KT2A 4M5HA 2CFXA 3QFHA 4JV0A 5K20B 4KHMA 1BC6A 2B51A 2ZE2B 5F41A 3DM2A 1TL4A 1A9NB 1PJ5A 4QR0A 4ZOSA 1L3TA 5D4LA 1XN9A 4QIWD 5L46A 1R3NA 2D69A 1RLCL 2IRUA 3IAS9 3KG4A 1BY9A 1GMWD 2QA4G 1XMOJ 4GKKF 1T03A 2OTJS 1T94A 2P2CB 1S1XA 2LQ9A 2JHEA 4NCGB 2DIVA 3SSQA 2F5GA 4PQUB 4C8OA 4X62F 2KRBA 4XDCA 1B7FA 5J2NA 2BANB 1R43A 1KQGB 1LKZA 1EARA 1KSPA 2CQDA 5DQIA 4JI5J 3AFGA 5D4PA 2B9YA 3W5YA 5KFNA 4LQ3A 2RNEA 4I64A 3FZBA 4NEZA 3AA8A 1NPKA 3GV5B 1RHMB 4XIUA 3OSNA 3LP0A 1CC8A 1QVGR 4A48A 3Q8SB 3DGPB 2PC6A 3M8ZA 4KPCA 2CQ1A 1U02A 1IR1A 1N0UA 1HMVA 1TKTB 3VV2B 4B3OA 1HNVA 1ZZFA 1SV5B 5HBMB 4NWBA 4EO8A 4DQSA 2COLA 4Q2LA 3K59A 3HHLA 5EX3A 4P73A 2BXJA 3HSZA 4QIGA 4X2BA 3KHHA 1Q81T 5I42B 3M1VA 4JI7J 1R8CA 3M2UB 4UZCA 2MXYA 4O3RA 3KJVA 1LFWA 1IBLF 3T41A 1QSYA 2KH9A 4GVLA 2UUAF 2E1MC 1D0EA 4YUDA 2VFSA 2Z2MA 1YGYA 4DR3J 3RGIA 3DOKB 4KKOB 3OFHA 5M2UA 4OYMA 2LA6A 1LQ9A 2POKA 2L9NA 3FSIA 2NREA 2RUSA 4BDPA 2E9ZA 3BQ1A 4DFMA 5AXMA 2CNLB 3UN5A 3TQ1A 3QO9B 2C2DA 1X4BA 2AZ1A 3UW1A 4DCJB 5J2QA 2XY5A 2XY6A 4NA1A 2DPIA 4B9VA 2MJNA 4DR2J 1PO6A 4NYZA 2LCWA 3MFIA 1LWCB 2Z8QA 3RRHA 3FRZA 1P1LA 3I5CA 4V19J 2CYYA 2IBKA 4PG7A 2WAQD 3M6WA 1KQFB 3QT5A 2JVOA 2CQ3A 1N54B 1IR2A 2OPPA 3EE3A 1IQTA 3SV3A 4D3HA 1B0TA 4M63A 1H74A 1GH8A 4MKAA 1U09A 2C3OA 4CT8A 4P10A 2OELA 3FVYA 4WYWA 3PXGa 2GA7A 1WG5A 2EC2A 1JMTA 3CDAA 4NLRA 2GC8A 1GXTA 2G0CA 4DSKA 2OMLA 1SH2A 3IG1A 1UTAA 1LWXA 2C2NA 2GJFA 2ZZTA 5F8IA 1F3VA 4OQJA 1X5PA 2V0NA 4M5IA 2DT9A 2J6UA 2RJZA 4IG0B 2LYVA 2KL8A 3WX4A 5CD4H 2P5VA 3PIOQ 1EKSA 1RISA 3AD7C 4QWBA 3K8WA 5KFXA 2VB6A 4AT1B 4DF8A 1F5CA 1N0VC 4C8NA 4DPWA 3RAQA 1N56A 4DG1B 1XJWB 4ID5B 4C8ZA 1N6QA 2RU9A 2UUWA 2UVUA 3WIUA 5GAHI 4OI0A 4NASA 5KFSA 2AEJA 1GMVA 1SJQA 2PT0A 2W4PA 4CO2A 2VODA 3SIPB 2LEBA 3HF5A 2RHSB 4QU7A 2P9GA 1QAIA 4UW2A 4ID8A 3VAJA 2DGOA 3ZZ0A 4F50A 3VAFA 1NU4A 4G1PA 5E3QA 2JNJA 1PKUA 2EBEA 3HPOA 4CLUA 3D9BA 4A8YA 4DSFA 2L9WA 3TA2A 4DV4F 1IKWA 1JXEA 2IMWP 2HBQB 2DITA 3U27A 2Y1LB 3LTOA 2PO4A 2MKYA 4LSLA 3E8OA 1RWNB 2ZD1B 3UD4P 4WCEQ 3KOAA 2WCXA 3OFFA 4X4TA 1IKXA 4N77A 1CQNA 5LXYA 2DNQA 2AYBA 3CJRA 2LEPA 2DXDA 1DFDA 3L9ZA 1FRMA 5MAOA 3KMSA 2V63A 3CCRS 1IWAA 2DNKA 3UN3A 2Y8YA 1FFWB 2NXNA 3ILLA 3K57A 4ECYA 3LH2S 3KLHB 1NLKL 4CLPA 5F9NA 2ROEA 3ELHA 1FESA 4TY8A 4OYBA 2W9AA 2YNFB 4DMZA 4IH5A 3SMZA 1X5SA 3Q86A 3PV8A 3MMCA 3DDNA 2ILYA 4PUOA 3OTBA 2HNDB 3PR4A 3C6TA 2JRSA 3ZXWA 3RW7A 1WHVA 3M9NB 1FD8A 3ZTPA 4J9LA 1T05B 2HG4A 1K1SA 3HVTB 3CCES 2HK3A 4OLOA 1VGYA 5HMYA 1FE4A 5CD4A 1SI9A 4IOCQ 1QY7A 3PW2A 2JVRA 1RK8A 3J7AN 4FYDA 4LF8F 4R0EA 1E6YA 1OQ3A 2D74B 2Z2LA 3KTQA 3FGVA 3S6EA 2APOA 1OYDA 2QG9B 5IXUA 3TRGA 3CEDA 4E8UA 3Q8RB 5B0EA 3PRBA 4C2MA 4YQWA 1S9FA 2DGVA 4P2XA 3EXCX 3CJ2A 3CB4A 3DFEA 3DLKB 3TX0A 3W60A 3RG6A 4ED5A 3QATA 3K0JA 3SFGA 1T8EA 3CMES 4NRTA 2FHOB 2M3DA 2HZAA 3DGVA 1U6ZA 2IJNA 3AODA 2JSXA 4YB1P 5E3RA 3C15B 2B4UA 3UO0A 3BPDA 1Y5IB 5HL7Q 1JLAA 2KXFA 5IFMA 3OR1A 2VG7B 1U4BA 2V8DA 2YWGA 4DR7J 3A8EA 4RW4A 4NPOA 1RKIA 5IV4A 4CLFA 2IMOA 4YDXA 2GHPA 3FDSA 4AL5A 4PG5A 4YHHF 1YWXA 4ECWA 2NZ4A 1P27B 3BYRA 4M94A 3VZIA 4ANCA 2RILA 2G2YA 3PM9A 3WC2A 2QA1A 2E1CA 2BX6A 1SC3B 4CO0A 2XGQA 4F36A 3V81B 3MR7A 4LF4F 2MPUA 1GTEA 4O4GA 3VAIA 2ZWOA 4RW7B 1O0PA 3BR8A 4X4QA 4LF5F 3PJ9A 2L3MA 3MD3A 2AGOA 2VU5A 1RSCA 3IWXA 1HI0P 1HR0J 3MEEA 5H9FJ 4USJC 4EK2A 1WEXA 3CNQP 3ZZRA 3PRVA 4LBIA 3DHWC 3AQOA 2MHNA 3VWSA 3THVA 1LOUA 3I4PA 4DV2F 4KO0A 3R2CJ 1IJEB 2RF2B 4UOGA 1RTJB 1YBAA 3DLGA 3CJ5A 3C16B 2NXUA 1SJ3P 3SZ2A 3BN7A 5KOWA 4DEZA 1QTMA 3FSXA 2CPYA 1LEOA 1WHXA 1VHFA 4QWDA 4NXMF 1XNQF 3KK1B 4DUZF 4IH6A 3T6BA 1OMSA 1KFSA 5EWFA 1EETB 1MU2B 3POTA 1S9GA 2C3UA 2CNKB 3IRXA 4UOCA 1QE1B 2IDLA 2HQ3A 1AFJA 4EU0A 1WUUA 4XO0A 3CGIA 2VD3A 4ECQA 1GXLA 1GTHA 1VQSA 1GFWB 2IHR1 3RBZA 1IM4A 4Y2AA 2ZBCA 3FBEA 3GILA 4ETZA 1T95A 2QLXA 4LFAF 4F26A 4OJ3A 5H9EK 3CW2C 4DCPB 4WE1A 2V67A 4N47A 3ULHA 2WRMA 1YJRA 4F02A 1GXUA 2YWKA 3MM9A 2ZH9A 2XMAA 3EGVA 4JI0J 2KHDA 5KFDA 2H54B 1VC0A 4GC6A 5GVQA 1U1OA 3R7BB 3DRRA 2O5DA 1ZAXA 4MJKA 4H4KC 4ZP7A 3LUYA 2EK6A 2VQEF 3D1OA 3J7Z5 3H40A 4K7QA 2DKOB 5J2PB 5CYMA 4C0BA 2PEHA 2JLEA 2KT5A 4U67Q 2B7CB 1ZM3A 5CYQA 4XAKA 3KLFB 2MZRA 2F9DA 2VPZB 1LXJA 1NJZA 6FDRA 3VVTA 4XPCA 3W9HA 4KT0C 3SEOA 1N5QA 2FJAB 2QIFA 5A8WB 5F8MA 2W9BA 1FCAA 1VR6A 4E2FB 2C3PA 2HZCA 5KFIA 3SBMA 3AXKA 4NLSA 1RE1B 2IM3A 1KQSR 4ZP6A 3UR3C 1Q1KA 5B7WA 3NGKA 1FJGJ 2GVDA 1BD6A 1JLFB 2H48B 3IN5A 4K50A 3CJ3A 3MEGA 3O44A 4O4RA 1SC1B 1KOOA 3FK4A 4IR9A 4UY85 4ZMMA 2XCAA 4LR7A 3KHLA 4ES2A 4ELVA 2JL9A 2ASDA 3ISZA 3PX4A 2YNGA 5F8HA 3Q83A 4IO1A 4WKYA 3C3LA 1MROB 1MG7A 2DGSA 1NZ8A 1S99A 1RT7A 2YVSA 4CLLA 1WF1A 2MTLA 1R6YA 1HBMA 2W25A 2VQFF 2VJUA 3TEHB 1MSWD 3W9IA 1HBOA 1U47A 4Q2MA 3LPEA 2BW2A 2W24A 2XNQA 3F41A 1J27A 4JV1A 2YQ3A 3L3CA 4NI2A 2HEKA 1RWXB 3VAKA 2G0IA 3FBFA 5CQGA 4ZPDA 1OO0B 3UFCX 4DPUA 1OSDA 4X62J 3RUBL 3JYTB 4W4MA 4ZVQB 1NJXA 2F4FA 4ED2A 2A6MA 1ICEB 2KFZA 3DM2B 4USMA 1QD1A 4LFCF 4ELTA 3FNNA 1N5YB 2BUNA 2F7VA 1Y00A 3I9V9 3MMJA 4ED8A 2HVIA 1T9UA 2JOQA 4LF1A 2J8AA 2G1HA 5KT4A 3D1HA 3D6HB 5IC4B 3A3PB 4RNFA 2MZJA 2HVDA 1CJVB 4H4MA 3EGWB 3GIKA 3EVWA 3C2PA 5DQHA 1HLWA 2M2BA 2WSEC 4I6WA 1SH0A 2DRBA 1RA7A 3BV8A 2IYGA 4PXDA 2ADBA 1PCAA 3NOCA 4USTA 1PBAA 4KGVB 3PR5B 1TV6A 2HHHF 3D6TB 1FEEA 1DQ9A 4ZPWR 1WG1A 3KKFA 4ZVPB 3IGVA 1ZZNA 3M8WA 3MAAB 3I4HX 3LO3A 2FZCB 3LP1B 1W26A 5KFWA 3LWLA 3R9LA 2GNKA 2CJXB 2R9LA 2YX4A 2UUAJ 2J9CA 2P9CA 2PI5A 5LSLA 1V6HA 1ZS6A 1WC4A 1QAJA 1LV5A 1EIYB 1HMVB 5KFPA 4B3OB 4GO5X 1R8BA 6AT1B 4ZN3A 3BO2A 3AHPA 2OP5A 3N6NA 3OT9A 3FUYA 2CJAA 2AGPA 1P9YA 1HW9A 2GIFA 2VV5A 5KFOA 1J5EF 4DUTA 2MYFA 4ZK7M 2LQBA 2HHPA 5DG8A 1KVIA 2P6TA 2VG5A 2XGPA 2DGWA 1RWPB 4LRFA 1LWEA 3KJFB 3KJVB 2GO8A 4KIAA 2AJ2A 1NEEA 2VUGA 4NCAA 2R7UA 2KFNA 3TZZA 5K5MA 4OI1A 4EEYA 1HL6A 3AOBA 4HTIA 1TVRB 3CDWA 2M88A 2ZOGA 1S12A 3MGJA 4I2QA 3CULA 4O23A 4USUA 3HHLC 3MDFA 5EWEA 1NK5A 4N8OA 4IFYA 2NXJA 3I55S 4FF2A 3DRYA 3GMGA 1SKUB 1X7VA 2ZVIA 2XLKA 3MCSA 2C3YA 1SQEA 4ZVOB 1D9FA 2VOPA 2J9EA 3GSDA 3OFGA 2NXCA 3FKBA 2UUBF 1FRHA 2GIRA 1ZPVA 5A0YB 1IUJA 1JJ4A 1I3OB 4BLGA 2Y8WA 4P71A 1KLNA 1PIEA 2VPXB 1GT8A 1PSDA 1VS3A 4A8WA 3IBFB 3TJ9A 3V6JA 5IS2A 2XWXA 2VC0A 2W4CA 2BACA 4OMFG 5D8HB 4P9SA 3GONA 3LALA 2W1BA 4F3MA 1CVJA 3CIMA 1SQGA 2DY9A 4ZVHA 3WQPA 3BQ0A 5KT5A 5CXTA 1DARA 4BC7A 2AEFA 1DBDA 2N7CA 3VGVA 3CCSS 3ZC4A 2D9OA 1N36F 1PYTA 3JSRA 2HPUA 2R2TA 3DOMA 1RT1A 2QLFB 3PKYA 1D9AA 1JLQB 2BE2B 4NYOA 3HHLD 1QDUB 4G3IA 3IG1B 1ROFA 2E7WA 3I56S 2HFSA 1TK0A 2J5AA 2ALYB 2ZJQQ 2A2CA 2AYGA 1TFWA 3RR7A 4HDHA 2F63A 4I4BA 3M8PA 2KN4A 2A18A 4JOUA 4LRBA 1SJRA 2ZJPQ 3GG0A 4EZ6A 2HZVA 2W2OP 1DTTB 1GX5A 3GE9A 4F8RA 4IQXA 1C0UA 4F0KA 3OHAA 2FLPA 3KLGA 2YKPA 4WK1A 1X60A 1ZETA 3OD2A 3DYAA 3R8YA 3W2VA 1VRQC 4PXEA 2HS3A 3B8HA 3T1YJ 2OPSA 2CG4A 5IV3A 5L1KA 4KQZA 5ETRA 1URNA 5GMDA 3ETOA 1IKVA 5L1IA 4HACB 1FWKA 3NWGA 3HX9A 2B7BB 1RWWB 1HYSA 4BHQA 1TK8A 5BYRA 5E3CA 4M5NA 3RB3A 2UP1A 2NYIA 1FVSA 3DNCA 4M1KA 4DOZA 5DDOC 2ZWPA 1YZ7A 1C0TA 3V2UC 3G8SA 1IKWB 1DQ8A 4NLGA 2N82B 3I0SB 1IJFB 3PG9A 3DXSX 4WWSA 3RBXA 3QIPB 4F4YA 2BQ3A 3OL8A 5DDQC 4QYZK 4J5OA 2JDJA 1S6UA 4A8QA 3M9MB 3LGMA 3W8PA 2HURA 2WVDA 4DV0F 1X8DA 2MQMA 2ASJA 2GGPA 4OL8A 2V94A 4JI4F 3W5XA 2K7JA 2CJYB 3CPWR 4KTQA 1KONA 5F8NA 3BGUA 2IA6A 4O44A 2MGZB 3NBPA 3CCJS 3PFEA 5DM6Q 3WC0A 4LF8J 1UPPA 4WTOB 2IY5B 4MYUA 2C42A 2Y0BB 3CCWA 1RT5B 3I96A 3K5LA 4GRSA 4IRKA 2VDIA 4A8XA 1KDNA 5AJ3F 4DQPA 3UDCA 3CJ8A 4AQYF 3C6TB 2B56A 3TR5A 3MF5A 1VQKS 4LF6J 1W25A 1JNZB 4ZS6A 2DR5A 4OLPA 4A8OA 5CCMA 4Z7YA 1RGVA 2E5LJ 1HIYA 4PR6A 2VH7A 2V5HG 3OL7A 4RUAA 4ILRA 3T9NA 5KT7A 3DRPA 4IH7A 2G13A 1BHNA 4CLSA 3F0NA 3VVUA 1U2FA 2ZH3A 4O3OA 3QYYA 4CT9A 3KXDA 1YJVA 1IQZA 5D77A 4FYVB 3GR1A 3H98A 4P2FA 1X4EA 4NXNF 3H8YA 4OYWA 4YHHJ 2CJKA 2C2MB 1KVJA 3CDEA 4KV8B 1HNWF 4DR1F 5A8RA 4IOBA 5DRKA 1S1WB 4RW6A 2B5JA 3EYZA 1NSKL 1N5TA 1H2VZ 5MLCV 2FD2A 4RUBA 2VFTA 3US5A 4LF9F 1QAXA 4LF4J 1HQ2A 2EFPA 4JV2A 4TXSA 2B6AB 2DEJA 1JLAB 1L3UA 1RI7A 5JVGQ 3J81j 4LF5J 1U1QA 1F2HA 3VR1A 1KEKA 4U7UK 2UVVA 4RW4B 2YKNB 3TUPA 3AXMA 2M8HA 1IBKJ 1PG5B 1UEVA 2RH3A 5L9XA 2DR6A 4WU2A 5KTQA 3VHQA 1NHVA 2C2RA 4JV5J 2PIIA 5F8LA 4R5PA 1MW7A 3LWMA 2YNHA 4ZVTB 3EXYA 2OD6A 1EHWA 2PD1A 1UETA 2CQBA 1QSSA 1UVMA 2MZTA 1L5UA 1RABB 4CIOA 3HSDA 1BQMB 4OHVA 1XNQJ 3IGNA 5K14B 5KG0A 4DUZJ 4Y3CA 1K0VA 1EJ7L 2DBBA 4XPEA 2G2OA 1X9SA 1UL3A 4J9QA 3PTWA 1YHQS 3M6VA 4JI3F 2VA2A 4U95A 1TR0A 3U1MA 3GB0A 2AD9A 5AXNA 3MR3A 2I38A 3E3XA 3QRRA 1I51B 3PYDA 2ZE2A 2YPYA 1S0VA 2DNOA 4WFBQ 3TAMA 3HZEA 2W2NP 1FHTA 4HYKA 3ENQA 1F6TA 3W65A 3PCOB 1Y0HA 3UCGA 3DN9A 2XBPA 4LFAJ 5EN1A 3FRYA 1U1NA 1HARA 3MWBA 4PG4A 3VALA 1N88A 2GVZA 1R7IA 4NCGA 2VBYA 3IMQJ 2YBVA 1S1UB 2NUUG 3HFZB 1S9GB 2XI3A 4PQUA 1R0CB 5JJBA 3IRXB 1FNXH 1F5AA 1HPZB 4AXJA 2RT3A 2BANA 1S59A 4P72A 2MLZA 3NLCA 1X9MA 4LQ9A 4DV3F 3CJTA 4WFNQ 2AYEA 1APSA 2GMHA 2KVQE 2ROGA 2H9ZA 1H73A 3W2WB 2HQIA 4GVBB 2HVEA 5KG7A 3JTNA 3DGPA 2CDQA 4AFFA 1XEZA 3CE8A 2A0FB 1XR5A 2QL5B 2HSEB 1XMOF 1FDBA 3IBCB 4ZJOA 2LECA 3PACA 3A12A 2XSJA 5F8JA 1TKTA 1FI4A 3OBIA 3SCIE 1SV5A 5HBMA 4KRWA 2OFHX 2QLBB 4U6PA 3VTIA 4ZPTR 2AHOB 2PA8D 3CCQS 1RADB 4URGA 2AF6A 3KUGA 3ILOA 2HHSA 3DDIA 3DRRB 2EW9A 2BM0A 1HQEA 2HBRB 2QGFB 3VGSA 2C2OB 1RA6A 1SKSA 1B64A 2DTJA 1ZM2A 1FKPB 1RXOB 2DNNA 3N0VA 3DOKA 4KKOA 2KZZA 3DLEB 2E9TA 1U6BA 4DLEA 4CCHA 1KHVA 5C7PA 3B4DA 3MPVA 1NXIA 1M1GA 3C6UB 3WDOA 1SC4B 1WOSA 2EFOA 3TZWA 1LFPA 4B9TA 3PW5A 2M0GB 5AE1A 3HCXA 3TJAA 3QO9A 2LDYA 5DLGA 4QZVB 2KU7A 1M1KT 1RAOA 3OXFA 1ULRA 2LXUA 2R42A 1B4SA 4RW8B 3GIJA 3U02A 1JKHB 3A4TA 1RT4B 4DFJA 3OL9A 3NWRA 2Z0GA 1LWCA 1RAHB 1B7YB 4DR3F 1DTQB 2FY1A 3ZZOA 1QUPA 3BBCA 1BQNB 4M8LA 4EMDA 1VLYA 5FJ4A 3IAM9 4ZP8A 3ZZTA 4ZIWA 5HMZA 3OTOJ 3N4WA 3MM5A 2PMWA 1RLDA 4JUZA 1FRXA 1WKJA 3Q24A 3KNAA 4OI4A 3GJTB 1T9VA 2WBMA 1UP1A 2IJRA 4OV1A 2D41A 5HJXA 3GCWP 1FKOA 5CAAA 3D6FB 4DR2F 1RT7B 3K5OA 1S1VB 2BE7D 4LIRA 3N79A 3R5GA 5ETMA 4LFCJ 1WG4A 5LMNF 3V5RA 3LA0A 3T5KA 3CXCR 2PEBA 1AROP 2RKIA 5ETKA 5T7LB 4GKJJ 4IG0A 2ZUGA 2NPIA 4R0JA 2VPWB 3R6LB 1FVQA 1WKLA 3NEKA 2WVCA 1NKBA 2QX0A 3ISNC 2HW3A 2Q6CA 1H72C 1ZH5A 2RU3A 4EGLA 2CJ9A 2HGLA 2HNZB 1NNDA 5CZXA 5A2QU 1PAEX 4ID5A 1GX6A 5AT1B 1ZM4A 1FT8A 2KXHA 2KTQA 3EZ5A 4RL1A 2U2FA 2WSFC 3MMAB 2HHTA 3KLEB 1BLUA 2Q6BA 2JX2A 4HHHA 1REVB 2MKJA 1WORA 3NGUA 1RTDB 2HGNA 4KFBA 1S6QB 2DGTA 2QEXS 4FS2A 2CRLA 5HI7A 2XB2D 2AX0A 1PILA 1X4CA 4H4MB 1VBXA 4WYLA 4DV1J 2CVEA 4EI2A 4C7QA 3VAGA 1GEHA 1K9MT 1RQ0A 3ENAA 2YNIB 3S1TA 3PKMA 3HHDA 4M5JA 4ZCLA 4XK8C 4Y2CA 4FF1A 2ZVSA 3GCXP 1UJ5A 1FTCA 2OAUA 1DHMA 4YB5A 4ZKAA 4AD6A 4UF4A 2Z57B 1VI7A 1NKCA 3ISND 1X4HA 2HHVA 3OTEA 4YFUA 4OHXA 3V4MA 4RX6A 3UNGC 4B9LA 3KHRA 4J7CA 2FQQB 2XEXA 3OV7A 3CD7A 3C66A 1OWXA 1CG2A 3ZZZA 4EYHB 3PNIA 3KLHA 3G8QA 1MMNA 2BJDA 2HNYB 1F1BB 3K2YA 4OYIA 1EP4B 4NLDA 4Z37A 3Q8UA 3LP2B 5K8NA 2EBGA 4B3RJ 4DX6A 1U1PA 2AJFE 1Z2LA 1T11A 4M5DB 1LWEB 2PGCA 2HNDA 2UUBJ 2GAGC 4PABA 4DJBA 1YITS 1VBYA 1TELA 5DO2A 1TP7A 5DQGA 5CHCB 3BDEA 1T05A 3K89A 2OUGA 5GAGI 1EB0A 1G7CB 1YLXA 2F40A 2DNHA 4I2QB 3HVTA 4Y2MA 1RT2B 3CMQA 4MAKA 1YTYA 4IFYB 1V3SA 1SJ4P 4OX6A 3PEHA 1B0PA 4B3MJ 2DH9A 4Y2KA 2CQIA 3IS9B 2J0WA 4OZLA 2FJWA 2IPOB 3W8GA 2AU0A 1U1KA 4FYWB 4ALZA 1CJKB 1VISA 4ECTA 4H4OB 2Z56B 1TKXB 1ZPWX 1RHQB 3QIDA 2HBZB 1RTIB 5J1EA 2CPZA 1PBUA 2K8GA 2J9DA 4ZLNA 5FD1A 4TLRA 3DLKA 3JAMY 4OFZA 3M6UA 2IJFA 2I8EA 3OL6A 3GYGA 4RWWA 2OEMA 2FTRA 1NRKA 5GAEI 3J7YI 4MK9A 5GAGU 1VC5A 4UZBA 4NRUA 4OJHA 1L3SA 2CNNB 1IWGA 3C15A 3GV7B 2DH7A 1B70B 2YQ0A 4J9SA 2VG7A 3DLLQ 3UQSA 2B9EA 5FIIA 4CM0A 1NJWA 1LK5A 4BWMA 4MKYA 2B4PA 1PAUB 2K1RA 4ECSA 5JMNA 5CABA 2C2KB 5IZHA 1S10A 3WIVA 2CWXA 2NZCA 3GIMA 1BGXT 4DI6A 4J91A 4B08A 4RBVA 3JTPA 2QMWA 4YB6A 3M8YA 2OGUA 1BWEA 1Y10A 3V81A 1QTNB 2UUCJ 4DSEA 3ZZPA 5D3GA 5I3PA 1NK4A 4AUKA 5HVGA 4RW7A 1REGX 5GAEU 3J7YU 1C0UB 1D3WA 1DURA 5IT9U 3BREA 2CWKA 1FA0A 2FY8A 1WI8A 3QGIA 3IM8A 3QGGA 3CT9A 1FX2A 2DGQA 3A3NB 3V6HA 1R0AB 3ZNUA 3SQGB 1Q7LB 1KC8T 5GMKa 4TYAA 4UQGA 3GYXB 2RF2A 1RTJA 3NXZA 3K5NA 4DV0J 2BM1A 3C16A 1FRJA 1Q78A 4J9RA 2VA3A 2X1GA 2UZAA 4Y65A 3BH6B 1HW8A 1SC6A 5L1LA 3RRKA 3G2XA 1EKRA 1FERA 1Q86T 3KK1A 4WPAA 4CH1A 1TL3B 4LSNA 4ED1A 1OY8A 3OXLA 1HR0F 1C2PA 4JYAF 3G87A 1EETA 1MU2A 8ATCB 3QGHA 1UFKA 1T0TV 2CQGA 3MTKA 4CLWA 4C9DA 1QE1A 4JB8B 3O1LA 5AJ3J 4AQYJ 3MPYA 1WNEA 3RB6A 2WW4A 3NAHA 2CPFA 3K5MA 1A7GE 3BYPA 4M5MA 1XIQA 1N34F 1HI1A 2FHJA 4DHVA 2H5JB 2W2MP 2E9RX 3HVAA 1WWHA 1TL5A 3M8QA 1Q16B 3D4JA 1U0HB 3P45B 2UVRA 1TQLA 1NJIT 2MY8A 3JQKA 3TVKA 1FTRA 3MM7B 1SJFA 3DDKA 1NPRA 1X9WA 2IM1A 1P9QC 3ICLA 1HWUA 3UVJB 4NL5A 4ANEA 5D4NA 4C98A 2GQQA 1AFIA 3CF5Q 4HHJA 4UOHA 3EVMA 2M52A 5J2PA 3FJ2A 4IKAA 1SKRA 4FZVA 2MZSA 2CXEA 3R5CA 4X4PA 4LF9J 3K5PA 1H7XA 3KLFA 4CLKA 5KAKA 4C3KA 4FP9A 1KOHA 1WHYA 1Y7PA 4ZJQA 3H5UA 1ZBTA 3DKDA 2MKKA 3WX8A 5D0RA 1IKYB 3I87A 3SV4A 4B9NA 3CD0A 5EX0A 4Z7CA 2FUG9 2OPQB 4RW6B 1Y3KA 4QWAA 3MUMP 4DZDA 4USVA 3BJYA 1T3OA 3JSYA 1QM9A 1NK7A 3QRQA 2ZITA 4DR6F 3BEGB 2LU2A 4ILMA 5DM7Q 4HR2A 3QT7A 2W4DA 1D1UA 1U26A 4RUHA 2NLWA 1MMLA 1YDLA 4MIAA 3FEXB 3KNGA 1XMQF 1MROA 3T3FA 3IBWA 3R3TA 4JI3J 1EX8A 2SXLA 4O3SA 3TW0A 2FHKA 5KFBA 4FKYA 1FX4A 4DLGA 1V5IB 2XCPA 4WFXA 4B3TF 1Z2ZA 2LLZA 1JLCB 2H1YA 1H2UX 2MQNA 2R8JA 5KT6A 4ITSA 1CEZA 4KGZB 3S01A 2JH3A 4PAAA 3NY0A 1JJHA 3J81Y 4DQQA 3DOLB 2J0QD 3KLIB 4J9OA 1FXDA 3O3LA 4I1TA 3JYTA 3V4IB 1F3FA 4M5KA 2ROPA 3PW4A 2CQ2A 3UDVA 1YRXA 1XERA 2IA0A 1VQ8S 2CNOB 4DPTA 2CZ4A 3TAMB 1N5YA 5IM0B 4DV3J 4B9MA 3ADAC 4Q5VA 3CJSA 4G6VB 3V6KA 2Q66A
chains in the Genus database with same CATH topology
3SDEA 4A8SA 2MQQA 2J7WA 5ITHA 1LV5A 3THPA 1CPZA 2I1RA 1J5OB 1CSJA 1KR4A 3MR5A 5I4MA 4IFVB 3CDUA 4OI6A 3UCUP 1HMVB 5KFPA 4B3OB 4GO5X 2R8IA 1OQ6A 1R8BA 1VQMS 1TL1A 2CQCA 4HTJA 3BO2A 1JLCA 2M7SA 3AHPA 2F1FA 2OP5A 4LIWA 3N6NA 3OLBA 3QJJA 1UVKA 2CJAA 2ASYA 1UVLA 3TUZC 5IQ6A 4J37A 4MH8A 5E7OB 1JIHA 4QIVA 2AGPA 3BO4A 1VQ6S 1HW9A 3BGRB 2VV5A 5KFOA 5EDWA 1J5EF 2MYFA 4ZK7M 2LQBA 2X1AA 4CZCA 3DOLA 3AY0A 2AV5A 2HHPA 3DI6B 3DRSB 5DG8A 1KVIA 3KLIA 5DGAA 2P6TA 1IBMF 1PC5A 2IYIA 2ZH6A 3PY8A 3AJ1A 1KD1T 1XMBA 2VG5A 2XGPA 2DGWA 2ZC3A 4DS5A 1LWEA 3GFHA 4KAIA 4ZPAA 3KJVB 5DGBA 3O5TB 1VK3A 2GO8A 4YR0A 2QA4S 1DZ5A 4KIAA 3MXHP 4GMKA 1ELOA 5DDRC 3V4IA 1NEEA 2VUGA 1FDAA 2RE1A 3LAKA 1X4AA 4NCAA 5KT2A 2VFVA 2R7UA 2KFNA 5K5MA 4OI1A 5IT4A 4EEYA 1HL6A 5THWA 4I6AA 1UWBB 4NLVA 4URSA 2VOOA 2V8GA 4HTIA 2R7SA 3LP1A 1TVRB 3CDWA 2C28A 2BZ2A 2AP6A 5IM0A 1JK9B 2M88A 3HHNB 2ZOGA 2FJVA 4WXOA 2MZQA 3MGJA 3Q8QB 4F3OA 4I2QA 2B3TB 2J0XA 4O23A 3CULA 3MEDA 3O8WA 1AUDA 2D9PA 3HHLC 4K4XA 3MDFA 2KJWA 3H2VE 5HN0A 2CPXA 2WONB 4TQRA 5EWEA 2W8LA 2WHOA 1NK5A 3D54A 4ICLB 5KT3A 3DHXA 3O6QA 3QWPA 3P6YC 2KRRA 3SYZA 1J5OA 4N8OA 1H2TZ 3NL0A 1Q53A 4X4UA 4IFYA 3RAXA 3V6DB 4F2SA 2XSJB 4Z2XA 4ECRA 3I55S 4EZ9A 4FF2A 3NKYA 3DRYA 4QIEA 3GMGA 2GMLA 2E1RA 1X7VA 2UUTA 4QOTA 1YRTA 2XLKA 3MCSA 1S4FA 2C3YA 5DG7A 1RT1B 1SQEA 1LW2B 4AL6A 2R8KA 5HLFA 1HHTP 2HGMA 4N8NA 5H9EJ 3FFIA 1D9FA 2VOPA 2J9EA 4OHWA 2OD4A 1LXNA 3GSDA 5SUHA 4ZVFA 3DU5A 2WTFA 2ZFHA 2DK2A 3VF0B 3OFGA 1TAQA 4C11A 2UUBF 1FRHA 1VK8A 3DI6A 3DRSA 3S7RA 1TKDA 2GIRA 3GG1A 5EUHA 1ZPVA 3M6XA 4DN9A 5A0YB 3H4BA 2W9CB 1UA0A 3RRGA 1IUJA 4OI3A 5E41A 5SZTA 1F9FA 3M2VB 3SI8A 1VQ7S 1HQEB 1JJ4A 3MAHA 4TN2A 4FS1A 4A8KA 7FDRA 4LT6A 4ETXA 1KLNA 2C3MA 1VIOA 2A10A 2VPXB 1GT8A 1PSDA 1VS3A 3MM6B 3TVZA 4DL0C 4A8WA 1N32F 3JSMB 3V6JA 4DR4F 5B0DA 2RB7A 2BOPA 3M8PB 2XWXA 1XBWA 2YKAA 5IS2A 2K3KA 2YTCA 2D3UA 2D3OR 2VC0A 3DMJB 2W4CA 2XI2A 2CKWA 1TVRA 2LXIA 5G0RB 3VAMA 2BACA 3CJKB 4Y0FA 1U1RA 2YH0A 1KNZA 2W7PA 4OMFG 2K3IA 4GC7A 1TFYA 5D8HB 4TLQA 1WTFA 3LALA 3DC2A 4F3MA 3U1LA 3PDNA 1CVJA 4ELUA 3CIMA 5KFHA 3M2RA 4OZJA 4ZVHA 2QSWA 3BQ0A 2IVMA 2ZHBA 4W90B 4EBDA 2UU9F 4DR7F 5KT5A 3KLGB 5CXTA 1DARA 4BC7A 1S0OA 1DBDA 3FZ2A 3T6JA 2N7CA 4DFKA 2UXDF 3UCZP 3V6DA 4WFAQ 1QLNA 3PW0A 5T14A 2ZH7A 3OVBA 3DYAB 3H5SA 3CCSS 2ZZMA 3ZC4A 4AXIA 2D9OA 1TK5A 2VONA 4PRFA 1KTVA 2W7OA 1PC4A 3N6MA 5KFKA 2JLGA 2KJVA 2XY7A 1N36F 3JSRA 4NLUA 3SXLA 1HI8A 2HPUA 3W2VB 1UFWA 3DOMA 4F3QA 2R2TA 5DDPC 1RT1A 1M5OC 2MQLA 1LW2A 2HMIA 3PKYA 1XK8A 2R2RA 1D9AA 4C4WA 4RLEA 4EBCA 2OPSB 1JLQB 1K1QA 2BE2B 4NYOA 4FXDA 1U1MA 1N33F 4ILLA 3HHLD 4RW9A 3NNAA 2D7SA 2BQRA 1IR0A 4G3IA 2IVFB 1DLOB 3IG1B 3H5YA 1ROFA 3QPIA 2E7WA 3I56S 2WOMB 2Z4PA 5A0YA 3TO8A 2W9CA 2YKOA 1TK0A 1IKVB 4MKBA 1CQMA 2BA9A 3M2VA 1NH8A 1SXLA 2J5AA 2CIMA 2XMTA 4QPXA 2ZJQQ 2A2CA 2AYGA 4HLBA 1TFWA 3RR7A 4HDHA 1HYSB 3IC1A 3IFEA 3E01B 5KFMA 4YMEA 3JSMA 4YB7A 2BRLA 4I4BA 2KT3A 3M8PA 2KN4A 2QT7A 1ZTWA 1Q7YT 2GW8A 3DMJA 3D0IE 2A18A 1N5VA 5K8OA 5A6WA 2R4FA 4JOUA 1FK9B 1DRZA 1SJRA 5G0RA 1MWYA 2KFYA 2DGUA 3GG0A 2ZJPQ 4EZ6A 4UUXA 1DTTB 1GX5A 3KLVA 2XS7A 1P1TA 5LXRA 3GE9A 4F8RA 2DO4A 4IQXA 1YG0A 4RKUC 1C0UA 1KFDA 1S72S 4ZVGA 2EKYA 3OHAA 1ZYQA 1C0TB 3MM5B 4B3SF 4K4SA 3BO3A 2FLPA 4DDFA 3KLGA 2HRYA 3NRBA 3HK2A 2YKPA 3I9ZA 4WK1A 2KYZA 5KG2A 1SL1A 1FEHA 2E7XA 4DWIA 2FGOA 4Y6IA 1P8GA 1ZETA 4RNNA 2DR7A 3DYAA 1S6PA 2G1DA 1VQPS 4G1IA 3PEJA 4R25A 1VQLS 3UE2A 3W2VA 1ZM9A 4LFBF 4PXEA 4MTPA 2P6SA 2HS3A 3SSRA 3HHEA 4X4SA 3SCKE 1FKOB 3B8HA 2OPSA 1JLQA 2BE2A 2CG4A 1Q8LA 1OPZA 2RRBA 3CCTA 4K59A 2BBEA 5C25B 2EFGA 2NS1B 2RMLA 1DLOA 2GGPB 5L1KA 1YJWS 2ZC4A 3R5AA 2FB0A 4KQZA 4B9SA 1VQ9S 4OIXA 3NCPA 4TNOA 2WOMA 1URNA 2V4JB 2I0XA 3ETOA 3FEYB 1FJ7A 2MY7A 5B0CA 1P6TA 1IKVA 3L09A 2JEJA 3HXMA 5L1IA 2VKZG 3NWGA 4MK8A 4CQ1A 4Q44A 2BABA 5KOXA 3HX9A 2B7BB 2L08A 2RKIB 4USIA 5BR8F 2W7AA 2KHCA 4BHQA 2QFJA 1R27B 1TK8A 2FLNA 1HYSA 1GNKA 4H4KA 4CTAB 4I68A 5D4OA 5BYRA 2NQPA 1RTHB 4O44B 1S49A 2RIJA 5E3CA 3NBPB 4DF4A 2EVZA 2MQPA 1UW4A 3DXBA 4X64F 1U25A 1E6VB 2J9DE 5B0BA 2PFFB 1FK9A 5BYSA 3RB3A 2UP1A 4OI2A 1SIWB 2NYIA 3KG0A 4KC5A 4MFBB 4NLXA 5ADZA 1DTTA 3FQLA 1FVSA 4NZ6A 1M5PC 2OIHA 5FDLA 3DNCA 4M1KA 4DOZA 5DDOC 3MTJA 3MD1A 2OO4A 2R2UA 2GQCA 4NA3A 1C0TA 1UA1A 2UXCF 4OZ1A 4RUCA 5FLXY 2RS2A 4NCBA 3V2UC 3OPKA 1IKWB 4G1QB 1DQ8A 3G8SA 5J2MB 1SUQB 2WSCC 3SCJE 4NLGA 1NO8A 2N82B 1H0HB 4NX9A 4KPYA 4TYBA 1ZAWA 1IJFB 3I0SB 4A8MP 3FMBA 2FLOA 3DXSX 1VJWA 3I32A 3QIPB 4F4YA 2BQ3A 3CDBA 3OL8A 1G2EA 5DDQC 5F9LA 4J5OA 2XG8A 1TAUA 3FCHA 4WK3A 4ERDA 2JDJA 3PW7A 1S6UA 4A8QA 2M4MA 3M9MB 2V8VA 2CPIA 3LGMA 5F0UA 2ALZA 2CQ0A 4ZLPA 3S8SA 4K5RA 4DV0F 1X8DA 2YWHA 2M9KA 2MQMA 3VQTA 5C25A 2ASJA 1C4AA 4DV7F 2GGPA 2LU1A 3PRDA 3BGLA 2J76E 4XDDA 3HFKA 3BSOA 1MNEA 4OL8A 2ZKTA 1N5SA 3GV8B 4KFBB 4NZ0A 2H5EA 2V94A 4JI4F 4DSJA 2K7JA 4QJVA 3NS5A 5K8PA 5KFTA 3MFHA 3OR2B 3P3DA 3CTRA 2V9KA 3BS9A 3I31A 3CPWR 4KTQA 2BJEA 2OSRA 1KONA 2F8HA 3X1LB 5F8NA 3BGUA 3DRPB 3BN4A 5C42B 2IBOA 1SJ1A 3R1HA 2JFDA 3G6VA 5F8GA 3RR8A 1YVFA 2DNRA 1GQEA 2IA6A 2E5IA 4O44A 2MGZB 3TARA 3NBPA 3VAHA 3NCRA 3CCJS 2RRAA 3PFEA 1RYSA 1E6VA 5DM6Q 3WC0A 1R8HA 1JLEB 2KM8B 3D0GE 4ZPBA 2FPHX 1O5JA 4PWDB 4DV5F 3E2EA 2CQPA 4YEAA 2CQ4A 4JI0F 4MYUA 3CCZA 5A8WA 4I0WA 2C42A 3MPWA 3PO5A 3CCWA 1RT5B 3HVRA 4NLWA 4WJBA 3I96A 3M30B 3K5LA 4K0KF 4IRKA 3TA0A 1S1TB 1Z4UA 2I9SA 3EPIA 3G71S 4NLOA 4A8XA 4G1QA 1RDRA 2JEIA 5KG4A 5AJ3F 1SUQA 3NS6A 3SCLE 5J2MA 1FRIA 3UDCA 4DQPA 4AQYF 3C6TB 3I0SA 2DPJA 2B56A 2G9OA 4FVCA 3TR5A 2MKCA 1U2RA 1HWIA 2FDNA 3MF5A 5A8RB 3T1YF 3FEZA 3QIPA 4W92B 1YJ9S 1HWLA 3ITHB 1VQKS 2I5JB 3CCLS 3TUIC 2B5JB 5IQQA 1W25A 5EWGA 1F60B 1JNZB 4ZS6A 2DR5A 1JLFA 1VC6A 2E29A 4OLPA 4A8OA 1KLMB 2RDIA 5CCMA 3LW5C 4PPDA 4FN5A 2N4CA 4DL7A 4ECZA 4L6V3 1UKUA 4J9MA 1RGVA 2GHWA 3UWTA 3DU6A 4OX8A 1X4FA 4PR6A 2VH7A 2V5HG 2DIUA 3G4SS 2GV1A 4MIWA 2UVWA 3OL7A 2DJWA 4RUAA 2GO9A 4ILRA 3T9NA 2Y1JA 3TAQA 1M5HA 5KT7A 4DPOA 1V9OA 2IRXA 1L3VA 3DRPA 4IH7A 4NMLA 5C42A 4BWJA 1X4DA 2O66A 3PHEA 2ZOFA 1U6FA 2G13A 2WB4A 2VA2A 2KZMA 1JLGB 4HDGA 3LPYA 2MGZA 2XMKA 3JSBA 1Y3JA 3NNHA 1HWJA 2FC9A 4LUBA 3MMBA 5KFUA 2OMOA 2WW8A 2J0SD 5F3ZA 1JLEA 3GIIA 2ZH3A 1U2FA 3NMAA 3OW2R 4PWDA 2DGXA 4O3OA 2AQ4A 2GIQA 4KGKA 3QYYA 1KQKA 4CT9A 2ASLA 1Y5LB 3HKZD 1WACA 1CLFA 1H98A 1RT5A 1YJVA 5LJ5Y 3TI0A 1IQZA 3BR9A 2AW0A 5D77A 3M30A 3GR1A 3I0RA 4JI6F 3H98A 3AAWB 2UXBF 1X4EA 1VMBA 1S1TA 3D2WA 4OX9F 4NXNF 3J80Y 3H8YA 3GFYA 2CJKA 2FGCA 3PX6A 1KVJA 3FMWA 4R5PB 1U49A 1FJGF 2R2SA 3W7BA 3CDEA 3CJ0A 2MKHA 4KV8B 5KFRA 1MMDA 1HNWF 3Q8PB 4DR1F 4MYTA 5A8RA 5LSOA 1N4LA 4IOBA 5DRKA 2YNHB 4C8MA 3C46A 1S1WB 3ITHA 2I5JA 4RW6A 2HIQA 2B5JA 3EYZA 2ERRA 2GJ2A 1N5TA 4HH1A 4ZVEA 1FXLA 3HDSA 1H2VZ 2HLTA 5MLCV 2B0GA 1KLMA 1T03B 2PA3A 4OJGA 2VFUA 1H3DA 2V9WA 2FD2A 2VC1A 3IWLA 4H54A 3M05A 1S1XB 2ZNZA 2VFTA 3MUTP 5BJRA 4NA2A 3US5A 1QAXA 4I7FB 4LF9F 1K0TA 2BYCA 4Q8EA 2EFQA 1GAOA 2PE8A 5CZVA 2PMHA 2V2KA 3L7PA 2EFPA 2X3GA 4M95A 1FDNA 3EGNA 4JV2A 2K2PA 3AQPA 4X4NA 2RRNA 4TXSA 5M2PA 2B6AB 1JLAB 4QR2A 1RI7A 1L3UA 4TU7A 3T1AA 5JVGQ 4CI0B 4QWEA 3GQCA 3GR0A 2IAJA 1WI6A 1U1QA 2DR9A 1JXLA 2R8GA 2R7RA 3H2UB 4IR1A 3GYNA 1M0SA 3VR1A 4HVZA 1KEKA 2ZZNA 3M9OB 3VQSA 4U7UK 3M32B 5DETA 2UVVA 5J2NB 2KT2A 4RW4B 3RW6A 2YKNB 3LF0A 4C0HA 2CFXA 3QMQA 3M8SA 3EX7B 4JV0A 1J2VA 1R8PA 2M8HA 2B43A 4IUFA 2RVJA 1UEVA 2RH3A 5L9XA 5L9NA 4WU2A 4KHMA 2JJ4D 5KTQA 2K7KA 1BC6A 2BVZA 1NHVA 2C2RA 2B51A 2ZE2B 5F41A 3OJUA 3DM2A 2F8MA 2PIIA 2NSCA 3LP0B 1TL4A 1A9NB 5J1EB 4ECXA 5F8LA 4R5PA 4QR0A 4LF6F 1H7WA 4ZOSA 1L3TA 5D4LA 1XN9A 2HS4A 4KV8A 4QIWD 1A6LA 1MW7A 4DQRA 3LWMA 1R3NA 2YNHA 1S1WA 1S77D 3EXYA 2OD6A 2IRUA 3IAS9 1JWWA 2Q1LA 2L41A 2PD1A 4F4XA 2QYCA 1RT3B 3KG4A 1BY9A 1UETA 2ADCA 2CZVC 2E5LF 2CQBA 1QSSA 1UVMA 3EUNA 1FRLA 2QA4G 1HNVB 2R7WA 2MZTA 3B4MA 2ZKUA 1T03A 1L5UA 1T94A 3QLHB 1S1XA 4CIOA 2XLIA 2LQ9A 4EO6A 2JHEA 2BQUA 1BQMB 2PI4A 2KKHA 3QAEA 5J1NA 4OHVA 4NCGB 3KK2B 4WF9Q 3WZ0A 2DIVA 3IGNA 5K14B 2E5GA