4JI7F

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ji7F00
2KJWA 1GH8A 1FJGF 4DV6F 4JI1F 1CQNA 2E5LF 2YY3A 4DUZF 4LFCF 1XNRF 4NXMF 4X62F 2UXBF 2ZM6F 1IBMF 4DR1F 4YY3F 4KHPF 1IJEB 1CQMA 4LF4F 4JI2F 1IJFB 1N34F 1N36F 2B7BB 4DV3F 1N32F 4K0KF 4JV5F 1QJHA 1XMQF 4X64F 4OX9F 4DV2F 1HR0F 3R3TA 2J5AA 2BVZA 1XNQF 4X66F 4JYAF 2UU9F 4NXNF 4DR6F 4YHHF 2VQEF 4JI6F 4LF9F 2HHHF 1F60B 4LFAF 1IBKF 2UUBF 4B3TF 4JI8F 2F4VF 5AJ3F 2KJVA 4DV0F 4DR3F 4B3MF 4DR2F 4JI3F 2B7CB 5IWAF 4DR4F 4DV4F 2UUCF 1RISA 4DR5F 4LF8F 4DUYF 4DV1F 5LMNF 4JI0F 1B64A 2BXJA 4GKKF 1VMBA 5LMUF 4DR7F 5BR8F 3T1YF 4GKJF 1FKAF 4B3SF 1J5EF 2UUAF 1N33F 4JI4F 3ZZPA 4DV7F 1G1XA 4JI5F 1HNWF 4JI7F 4B3RF 1HNZF 1G7CB 3OTOF 1I94F 3T1HF 2RJZA 1IBLF 1XMOF 2VQFF 4AQYF 4LFBF 4LF6F 2UXCF 1HNXF 4LF5F 4X65F 4LF7F 2UXDF 4DV5F 1LOUA
chains in the Genus database with same CATH superfamily
2HVIA 3QFWA 3MUMP 1TKXA 1ZAVA 4DL5A 3MMJA 1D09B 2WK4A 2I38A 2VBZA 3BJYA 3U1NA 2VL1A 2JNJA 1H2UX 2KZMA 2WB1D 3T9ZA 3AJ2A 3TUIC 2IMWP 1HI8A 2KFNA 4O4RA 3O3LA 4HI1A 2C2DA 1SH2A 2KJVA 3CCLS 3TQEA 2J6SA 1HNZJ 2B9WA 2C3PA 4C9DA 3QT6A 2QC3A 2Z8QA 2HZAA 2ZUGA 4F3OA 3FSYA 2XMMA 2ZBPA 2AYGA 2VG6A 2YTCA 2A2CA 3G87A 4BDPA 2Z4PA 1M90T 2IJNA 1MU2A 3WZ0A 4OYIA 1FWKA 3EGVA 4MKVA 2NXEA 4CO2A 1LWFA 1Y3JA 2DGTA 4UTGA 3TEHB 4FXDA 4A8FA 2DGXA 1WC1A 2FVCA 2FLOA 2OI2A 3NS6A 4XK8C 1AUDA 4DG1A 2KT2A 1BLUA 4GVBA 2MQNA 1RWUA 2RHQB 3DRSB 3VQSA 1URNA 4DX6A 4ZVOB 4M63A 4EO8A 3KK1A 1FX2A 1I51B 4R25A 1T05B 4LMZA 1EP4A 3BQ2A 1YBUA 1EB0A 1H38A 2OTJS 1OS5A 3R5DA 3U1LA 2PGCA 3NL0A 3DCAA 4QIGA 4KFBB 1E6VB 5J1EB 4I0WA 6FDRA 1FKAF 3H42A 2ZM6J 5KFFA 3DRRA 1M1KT 2ACMA 3W1YC 1F3VA 1VGYA 4YB7A 4ZJLA 4DPUA 3I4PA 3VAIA 4F4YA 4LF7F 4QCLA 4F4WA 3UQSA 2X1AA 3R97A 1FRJA 2HHHJ 4KKOB 2CJYB 3ISNC 4PWUA 1AYEA 3R1HA 1HD1A 4C3KA 2C2EA 1S12A 1NJXA 3VAJA 3IG1B 1WUUA 2DTJA 1G4CA 1SKWA 1S4EA 3MM9A 4NA2A 3IRXB 1HMVB 1AFJA 2DBBA 3OT9A 3RTVA 1F60B 3T6JA 1TTHB 3GJRB 3HKZD 3HKWA 4LFBJ 3BSNA 2MKJA 3DXSX 3M6WA 3IRWP 3MGJA 1NH7A 4FXVA 3G96A 1WORA 4HH0A 2HVEA 1X4GA 2X1GA 3DLHA 4M5IA 1IBKJ 2R7XA 2AGPA 2FTRA 3QZ8A 4FF2A 2YQ1A 4IOBA 4XDCA 3T5KA 1OPIA 3TVYA 2OPRB 1DLOA 4M5DA 3RBEA 4OZNA 3BO3A 4KPYA 4E8UA 1D0EA 1RT7B 3WIUA 1UFWA 4KHPF 4Z2XA 3MDFA 3L7UA 2P8IA 3MECA 1T3OA 1JJHA 2QYCA 1NJIT 1CSJA 1Q5VA 2CQCA 2BE2B 1FVSA 4I7FA 2HHSA 2Z56B 1NDCA 1DFDA 3R3TA 3TEGA 3GILA 1HLWA 4H4MA 2ZDOA 4FPIA 1E6VA 5J1EA 3RB6A 5DQHA 4J9RA 2HGLA 1N5TA 1ELOA 4B3TF 4G1PA 2ZH7A 4U96A 5FJ4A 2W8KA 2JOQA 1RHUB 1Q53A 1LXJA 4F3MA 1F5BA 3IM9A 2CQPA 4GMKA 3GFYA 3CT9A 2PMWA 1XN9A 1TL1B 4DHVA 4R5PA 4KB7A 1VBZA 1FVQA 3LP1B 3IG1A 1KHWA 4DF8A 2P6TA 4DUYJ 2RE1A 2BANA 1JXVA 3I87A 4I2PA 1U6FA 1UPMB 2QT7A 4OZ1A 2H54B 2MHNA 5CD4A 2ZBRA 1KLMB 2CIMA 4B08A 4YB5A 3ENAA 2PA8D 2L9WA 2MGZB 4H4KA 1Q8LA 4TY8B 2LQBA 4MIWA 1WOSA 1ZTWA 4NXNF 4N56A 4EFAC 4WFXA 2RH3A 1H72C 2GVZA 3UR0A 1ZAWA 3M6VA 5J2MA 3VWSA 1WC0A 5F0UA 4O0NA 3G8QA 2J9DE 4CLLA 2BUNA 2IBKA 3E3XA 5F41A 2OPRA 3T1YF 2KFYA 2PO4A 3EPIA 1J5EF 2UUAF 1RT7A 4URQU 1RYRA 2EXUA 2Y9HA 4OX7A 4DSIA 2RUSA 4ECRA 2XI3A 2BM1A 1P9QC 5C7PA 4AFFA 2BE2A 3OPKA 4PG4A 8AT1B 3TR5A 1S7HA 3TA1A 4M5MA 4MH8A 3ZTRA 4F0MA 2HRTA 3CJSA 4LF9J 1SL1A 3HSGA 4DN0A 4ETZA 2V63A 5KFMA 1D8ZA 5L46A 1VQKS 2G9OA 4NCAA 4ZLJA 3M8ZA 1TAQA 1KVJA 3UCZP 5BR8J 2QA4S 3MM5A 2BJEA 2DO0A 5D3GA 1I6JA 1JLQA 4NLSA 4YB6A 2OIHA 3HLUA 5DQGA 2KU7A 3T3FA 1YZ6A 2ZHAA 3KKFA 3PKYA 2KTQA 3A3OB 2CPZA 2D3O1 2EVZA 4DZDA 2EW9A 5G0RA 3H5UA 1VBYA 2XNRA 2OD6A 3DLKB 4PG5A 1NSQA 2MGZA 2J0XA 3IS9A 1FRXA 1JLAB 2BJDA 1GAOA 3LPYA 2D1CA 1CJTB 3GR1A 4LFAJ 4HHHA 3B6BA 4YY3F 1TMMA 4DOZA 3SSRA 4X4QA 2CQHA 3FMWA 4RX6A 3H4DA 3CCUS 4DV4J 1RWMB 3DDNA 3H25A 5IT0A 4J9PA 1NHKL 4OV6A 4CH1A 3LUYA 4UT4A 3UN2A 4QJVA 3KFWX 5EUHA 3EJMA 2IBOA 4C2MA 3L7PA 3ONQA 5E7OB 2HK3A 2W2NP 3SDEB 4DUZJ 3AB2B 1ZM9A 3OTBA 2BOAA 1NU4A 7FDRA 1EARA 3PG9A 2DPIA 3SV4A 3DLBA 1FRLA 2E66A 4X4OA 2JRSA 3D7SB 4F25A 5KFHA 1MWYA 1NCLA 2HRYA 1JJ2R 2X1FA 3OUYB 3HFVA 1TVRB 1SJ3P 1SPBP 2YVSA 4X4NA 3F41A 3LP2A 1RCXB 3G2XA 5H9FJ 4EWTA 4QU7A 2ERRA 2NPFA 2K2PA 5J2PB 1OSDA 1IBLF 2A6OA 3PO5A 2OEKA 1LOUA 4IG0A 3TX8A 3RRKA 5I3PA 3DLGA 3I0RA 3MOZA 2ZWPA 1RAOA 4KBIA 4OJ1A 3BSAA 2B5JA 3OJSA 1NPPA 4X64F 3DOKB 4FVMA 2DK2A 2IJRA 3TA2A 2DNKA 4O4GB 2XZDB 1F3FA 5K20B 5LSRA 3C15A 4FF3A 2LXUA 5A6WA 3R7SB 4A8MP 1T95A 1GK8A 3BYPA 2HNDB 3TJ9A 1VCTA 4UUWA 1KVKA 1FXLA 3Q24A 2BKNA 5KT4A 2EI5A 3TVZA 4EBDA 1HFEL 3UCGA 3L95X 3FBBA 2MJUA 3DLKA 2PC6A 4Y2KA 4DV2J 4X65J 1J5OB 3S6EA 1VOMA 4RUCA 2R8IA 4JUZA 1R27B 1RBLA 2YNFA 1MMDA 3M6UA 2RNEA 3K2YA 4I68A 1HKAA 3DOMB 3QRQA 5HATA 1NSPA 2HIYA 1G3OA 4K59A 4PAAA 3VZIA 4MK7A 1YBAA 2VB6A 3F56A 3EE3A 2B9XA 4JI0J 1RT1B 1S9GB 1JLFB 3OLAA 3TAPA 3FCVA 4AE5A 1RABB 4KE5A 1RP5A 5K14B 3LOUA 2XBPA 2KZZA 1A6LA 2N4DA 1MROB 3DHXA 1LK5A 3KLEA 3M32B 3SQGB 4PG8A 2QMXA 3UN5A 3K0JA 4J9QA 1DARA 5ETPA 4PG6A 4KQZA 2H4YB 3B54A 2XCAA 1KLNA 4DR4F 2RIJA 1ROFA 3HT0A 3CUNA 1UWAA 4NLUA 2YWFA 1XK8A 2RQCA 1ZPWX 2FUG9 5HQMA 1KBRA 1DBDA 1SVDA 4CLTA 4FYXB 4IRCA 4BWMA 1N33F 2IJFA 1WNEA 4DFPA 2C3UA 2A2DA 2L3MA 2MZSA 3PYGA 3UN3A 4KGZB 5GVQA 1RAGB 1IQTA 3O8WA 1I5OB 2NZCA 1PC5A 1O8BA 2AWZA 3NLCA 3HX9A 4NPOA 1KDNA 1WELA 5HMWA 5D6GA 5E33A 1HNVB 2HNDA 4QQBA 2J76E 4CLSA 1XMQF 4MKAA 2FYXA 1J5OA 3CDAA 5B0AA 2QJ3A 4OHZA 4IRDA 3M2RA 4U9RA 1NB7A 3CJKB 3MTJA 5KT5A 1A0OB 4HTJA 4WFAQ 3DOMA 1FJCA 4B3MF 4OIXA 1ACMB 1IKWB 1GXLA 2HQGA 4ZN1A 4ECSA 4WFYA 4OYOA 2WONA 2QZ8A 4F26A 2EC2A 4ZPDA 1U26A 1S9GA 4OQJA 4A48A 3FBFA 1U02A 1RAJA 1S97A 3MR2A 3M2VA 4OX9J 2Q6CA 5K14A 1VRTB 3U7JA 1FRMA 3G6YA 1MROA 2B9YA 2BJ8A 2JL9A 1TU0B 3QAUA 2CAJA 3LGNA 4FZVA 3M32A 3SQGA 2H1YA 4C0OC 2IY5B 3BM7A 2ZEJA 1S4FA 3TAQA 2UXBF 4GVLA 4DL7A 1YRTA 4P72A 1Y7PA 1VRUA 3S7RA 2KFZA 2IAJB 3K57A 1X4AA 1XJWB 4K5SA 4DL0C 2IYGA 3CPWR 1TL4A 3NBPA 3BGRB 2XMAA 3UR3C 2K8GA 3P4UB 2E5IA 3OL7A 3CNQP 3PRVA 2KXHA 2V9KA 2A3JA 4LQ9A 1PIEA 2MZRA 4AYBD 2PDAA 1WEYA 1GEHA 3FNNA 3CB4A 1VLYA 3TAMB 1UZDA 2ZNYA 3Q8VA 2LU2A 1CJUA 1HNVA 1RT6B 1B0PA 2HFNA 3AAWB 4DV5F 3GSDA 2OPQB 4FN5A 1RQ0A 4WYLA 1U6BA 1IKXB 2K1RB 2O66A 2YWEA 4CO0A 3ETOA 5KT3A 4Y00A 3D54A 3GCXP 3MWBA 3AD7C 4QIFA 1WKKA 3DRPA 2O1PA 5KFAA 1FI4A 1IKWA 3FBEA 4Z37A 3JAMU 2Z2ZA 5C5JA 5I3UA 3TZXA 3GE9A 2J5AA 2G13A 5F3TA 2OKQA 4CLZA 2L9NA 2UUBF 3N6MA 4EMDA 4UOGA 2CNKB 4M1KA 3KG1A 3SSQA 3BH6B 1IBMJ 4ITSA 4F8RA 1VRTA 2FIUA 5A8WB 4DL2A 2MSTA 3BKFA 1MWZA 3C6UA 3OL9A 1L3UA 2R2UA 3D0HE 4JV2A 2CJ9A 4ZVTB 3FEZA 5J1NA 4DV7F 3GIIA 1T02A 2D69A 2XMJA 4ED0A 3GFHA 2VC1A 2WB4A 1G7CB 5E3RA 1RUSA 4QWBA 3R5BA 4KRWA 5HLFB 5IQQA 3ILOA 3I55S 1TKTB 3AT1B 4O3PA 5KFWA 3FBCA 3PYFA 4DR6J 1PYOB 2QN6B 3RRHA 1AFIA 4QR0A 4HHJA 4JI2F 2YNIB 1WJ9A 1SC4B 4ZPTR 4HYKA 2K3IA 1CG2A 1HR0F 4DU8A 3LP0B 4J9UE 1NDKA 1XNQF 4RBUA 1R8CA 1TELA 5ETSA 4DQQA 5L38A 1FJ7A 1R6VA 1YJTA 1HNWJ 4CLKA 4DX7A 1GT8A 1RAEB 1RT6A 5U47A 2JEGA 4K0KJ 1B0VA 2E9RX 2HRUA 2XWXA 3RBDA 2JWNA 3GYXB 2LECA 2OPQA 5CCMA 2VIHA 3HSZA 3GSIA 5F8MA 4AL6A 1X4DA 2BQUA 3V81B 3TJAA 1S0VA 3IXQA 3TA0A 2ZITA 2ZJRQ 2XS2A 4DLEA 3P5BP 1WC5A 3T19A 3RR7A 3W2VA 4LF8J 2ZBIA 2IC3A 4R8UB 2RILA 1T9TA 2B56A 2JFKA 3Q8PB 5GADI 2BQ3A 3HHLA 4N77A 4TVAB 3UFCX 5CA5A 1M1HA 2IPOB 1SQGA 3HI9A 1K73T 2FLLA 3SZ2A 3LAMA 5I4MA 2CQ1A 5A8WA 3KLHB 2PI5A 2A18A 1N5YA 3A1YG 2CQ0A 3DGPB 2OEMA 4DLGA 1NSKL 4LSNB 1YG0A 3VGTA 5J2NB 1NK4A 3PFOA 2B8PA 1BE4A 1IKYB 1DJ0A 5HBMA 3B4MA 4PZVA 4FPRA 1TKTA 3KHRA 1S6QB 2HW3A 1FESA 4ED7A 1SC1B 1VC6A 4USUA 1U2FA 3T5LA 3KMSA 2NXUA 3CCWA 2YNIA 3KJFB 3R27A 3MURP 4F02A 2JEFA 2KHCA 3JSYA 1T94A 1S1TA 2P9EA 3J80U 3LP0A 4W92B 2YKOA 3JYTB 2BMBA 4YHHJ 3PXGa 4ICLB 4X62F 3ELHA 2R8GA 1Q0NA 1GMWD 3PHTA 4UW2A 1CPZA 4ZJOA 4JP8A 3OVAA 2VOPA 3MMAA 1V5IB 4P74A 3VAMA 4DQIA 1NH8A 2M8DB 5DDRC 1GNKA 3PRBA 2QL5B 4NMXA 3THPA 1RTZA 3EPGA 1MMLA 5AXLA 2F9DA 2NUHA 2GQQA 1SC3B 1NB2A 5C42B 3DHWC 3V81A 3Q83A 4OLOA 5IQ6A 3CEDA 4V19X 3M8PB 1S6OA 4RZRA 1UVNA 2ZHOA 4R8UA 3Q23A 2JFDA 4B3SF 4RUAA 1VJWA 1CJKA 5DZ7A 1YLXA 3FZ2A 2OPSB 1VHFA 3SI8A 1C1CB 3POTA 2W9CA 2XNQA 1FHTA 2ZD1B 1C4CA 3FFIA 3J7Z5 2XM3A 5IS2A 1WEXA 4CM2A 4HLBA 4N8NA 2G0IA 3DMJB 4K4ZA 2V67A 3M8YA 2DXFA 1FX4A 3KLHA 4YB1P 4DX8H 2XMVA 1AROP 1QVGR 5E5NA 4LSNA 4C6AA 2Y1LB 1RI7A 5EX3A 2VDHA 4JV5F 1CEZA 5GAHU 2CJQA 2P5VA 2FJVA 3PV8A 3QJLA 1IKYA 4WCEQ 3R8YA 1QUPA 1WI6A 2XTJP 3M8SA 1UJ6A 1S6QA 4K4UA 1HA1A 1HBOB 4DN9A 1S6PB 1NKBA 4IQXA 2PSZA 4P71A 3VALA 1YGYA 2NSCA 4DBQA 2UVUA 4LR9A 3SV3A 2YKAA 1H98A 1X5PA 2ROEA 4YR2A 2J8SA 3B82A 3JYTA 5SUHA 2Z2MA 4ICLA 1N8RT 5GAEI 2V8HA 1TP7A 1VQ6S 3QZ7A 1VFJA 2PT0A 3AA9A 4NYPA 2I0XA 2WSEC 1LWEA 2F7VA 1QSSA 5LMUJ 1Q1KA 5IT9U 1UFKA 2DY9A 2GO8A 5HSPA 5F9NA 2E5HA 2RDIA 5ADZA 2IM2A 1YWXA 4OYBA 4JI4J 4TQRA 2XY5A 3UDCA 1HW8A 2PE8A 1UWBB 3NOCA 2IIHA 1FRKA 3M8PA 1UVJA 3H2VE 2HEKA 2G4BA 2CPXA 1EX8A 1Z4UA 2RVJA 2VQEF 3VV2B 3CD0A 3V6DA 3KJVA 2YKNB 3OR2A 3KNAA 2Y3YA 2ZD1A 3VCDA 2FY1A 4UOFA 3N5FA 2NZ4A 3MM8A 4FF1A 3MPVA 4LF7J 1RHJB 3DMJA 1N88A 2Y1IA 5EGYA 3RB0A 4WU3A 4ELTA 1O5JA 3EICA 5F9LA 3FZBA 3GMGA 4B3OB 2MLXA 7AT1B 4N76A 4CTAB 4QYZJ 3NGDA 4M5GA 3CW2C 2MLZA 1S1XA 1SJ1A 4NWBA 5EX0A 1X4BA 4M94A 2W7OA 3MPWA 1UW4A 4OI2A 4KHRA 2I9SA 2W4CA 2XZTB 1N48A 2EK6A 1QVFR 4KGVB 4ID8A 2W7PA 1BWVA 3BGUA 3CJ4A 2NXJA 3EDQB 3RB4A 5B09A 4HACB 1S0OA 3VGSA 4DJBA 2HAIA 2UUWA 2VH7A 1U8SA 3E01A 4RLEA 3MCNA 2DRBA 1HD0A 2XSFA 3H98A 3FGVA 5K9FA 4N47A 4KHMA 2ACYA 4ZP8A 1VQYA 3W62A 4IR9A 4X4RA 3DLEB 2DEJA 3K58A 2BKPA 4QIVA 3W2WB 5D0GA 4EYHB 1UWBA 2LXIA 2VUGA 2K06A 1P6TA 1TKZB 1TUGB 4RNMA 4F2RA 1PYTA 3HVTB 1YK9A 1CVJA 1R8HA 4ZPBA 3R6LB 3EZOA 3MPDA 5KFQA 5LT5A 3D67A 2YKNA 4X4UA 1SJQA 4PYDA 2BM0A 2E1PA 1FNXH 4KR0B 1NK7A 1RU2A 5CXTA 2ZJQQ 3MM6B 2RDJA 1RWWB 2KKHA 4Y2CA 2J6UA 1NK9A 4UF4A 1HQEA 4F36A 4ZDNA 2OFGX 4G1QA 4LR7A 3CWJA 2BW7A 4YUDA 4DV1F 4C11B 5HQLA 1T9UA 2M2BA 1FA0A 2WOMA 1JKHB 3GTYX 2ZHBA 2JZ5A 2MKKA 2YKMA 3I6PA 4XIUA 2DNYA 3I56S 3SQOP 1NRKA 3UD3P 3MPUB 4RW8A 2AJ4A 1FCAA 2HBYB 5KFLA 3H2LA 1FTCA 1FF2A 4HACA 4PUOA 2DHXA 3RW7A 1D9AA 3J81Y 1T7PA 2MSSA 3BPSP 5GAHI 2ZH9A 4ZCMA 5F0WA 5KG0A 1JMTA 1PG5B 1WF0A 4CZCA 4EBEA 3ZZRA 3PYEA 1J5EJ 1FJGJ 3KLIA 2UUAJ 1YJRA 2DPJA 5AJ3F 2XG8A 3PW5A 3T5JA 2VA3A 1XWLA 3W2WA 1TK5A 3I0SB 2GAHC 2VICA 4OJ3A 1C4AA 1NK0A 2E7WA 3CGIA 5EWEA 3MAHA 3HVTA 1IVZA 5CABA 4NCBA 4FYYB 5IFMA 2ILYA 1X7VA 2G2YA 4PKDB 3HJVA 3FQLA 1RT4A 2RF2A 2D7SA 1UVIA 2J9CA 2YX7A 4JI7F 4DL3A 3T1HF 4HT7A 3KDNA 2GGPA 4I2QB 3AODA 3CCVS 1DQAA 1FK9A 4QIWD 2YY3A 5HVFA 3I82A 1EZZB 1XNRF 2UP1A 4F4XA 4O3RA 4OZ0A 2KXFA 4DV3F 2GQCA 2WHOA 4BS2A 4JI5J 3PW0A 1VBXA 4ZP7A 1KKHA 1OSCA 4C3LA 3MMBB 3OQ2A 4DFKA 4W90B 1VRQC 2JH3A 4QIEA 1H7WA 1PJ7A 3GIJA 3BDPA 4ZCKA 3KUEA 2L48A 1R0CB 2DGQA 3KLGB 1NEEA 3M30B 2CPHA 3QWUA 4FKYA 1FRIA 1QSLA 6FD1A 3RAXA 3RZAA 4JI3F 2XSJA 1R3NA 3G9CA 2AP6A 4ZHRA 4G3IA 2XY7A 1GX6A 1JLCB 4YY3J 4JI6J 5CYMB 2FJBB 3LWLA 5KFGA 3C46A 1LXNA 3K89A 2OPPB 4NZ0A 4ES2A 4IYQA 2VFUA 2ZUAA 2J7KA 3EXCX 4KO0B 3IO1A 5LL6d 1VBKA 1NBEB 1KN6A 4WYWA 2M88A 4PPDA 3IGVA 1P27B 3KTQA 3QIDA 4OYZA 2XI2A 2R7RA 1WG1A 4U8YA 3ZO7A 3KLFA 2JLEA 5DS7A 2WSCC 1IR1A 3R6GB 3BBCA 2E5JA 3UDEA 4M5KA 2Y0SD 5KOXA 1JLEB 1NKEA 4GC6A 3SXLA 4CI0B 3UE2A 4C8NA 3J7YI 2VASA 3EXYA 1CBKA 1QY7A 2PMZD 2HBQB 2DO4A 1ZOTA 1DY3A 3I96A 5HJXA 3GZ7A 3ZC4A 3J7A1 4B02A 2GZOA 2QLWA 3DU6A 1VK8A 4I67A 1WOOA 1F1BB 5CYQB 4DSLA 1OPZA 3NAIA 4LF1A 3T6BA 1U6ZA 2VG7B 4F4ZA 3MZIA 5KFRA 2E29A 4NA3A 1AA1B 4ZIWA 2OEJA 1D3WA 4X64J 2DHAA 5B0CA 1VQPS 5KFKA 3N6LA 4O3NA 1NSAA 2UXCF 3B78A 4LF5F 3QIPA 3C6TB 2QSFA 3W9HA 3M9NB 4DXLA 1GMUA 2FVSA 3KLGA 1N34F 1DQ8A 2V4QA 3GLJA 2IMOA 4OI1A 2GO9A 5T14A 4UUXA 2J9DA 1U4BA 4ZVSB 3NP5A 2DITA 2FVRA 2RU3A 2OSQA 2CQGA 3M9OB 4F50A 1JLCA 4Q8FA 4FNHA 1TMJA 2OPPA 5KG1A 4DCOB 3IA0A 2GIRA 5B0EA 4KO0A 4RW7B 3OL8A 4IOAQ 4K50A 3EUNA 3TZZA 2AEMA 4ZP6A 1G1XA 2HHWA 1KD1T 4WIIA 3TP2A 4WBFA 2NSBA 3HXMA 1WOPA 2HVDA 3H8YA 3MD3A 5GMDA 2UUCJ 3CVKA 2B9EA 1GH8A 3F44A 3HD2A 2BOPA 1N32F 1HWJA 2H48B 2M4MA 2WVEA 1TL5A 5IXUA 5HN0A 4PWWA 1LWCA 1I94J 5C24B 5I3QA 3KOAA 4PRFA 5JUMA 2UXDJ 1DTTB 2ZKUA 2C2RA 2N82B 4J90A 5F8JA 1GTHA 4EUVA 1N33J 3EGWB 2WTFA 2AD9A 2FJEB 5E3QA 2BBEA 3FCHA 3FK4A 1NZAA 2ZOFA 3PX0A 5ITHA 3W9IA 4NCGB 5GMKa 4ILLA 4ZN3A 5C25B 4OYWA 3ITHB 5DG8A 3U1MA 1HNIA 2AZ3A 4Y3CA 3RR8A 1R43A 3W60A 2OGUA 3CDWA 4KIAA 4IH6A 2V6AA 3M2UB 4MIBA 1WWHA 1XMQJ 2HWIA 2DT9A 3M7VA 5CZVA 1T9VA 4C7QA 3J81j 1M5KC 2K7KA 2J6TA 3ILLA 2EFVA 4W4MA 3Q86A 4LF2A 4MK9A 4FVCA 1CQNA 4IDKB 5GMEA 2GIQA 3EVWA 2EG1A 1RAIB 5B0BA 1RYSA 3MAQA 1C1BB 5IM0B 2DR5A 2ZFHA 1CS4A 5K8MA 4OZ3A 4OL8A 4X2BA 5LXYA 4YMEA 3R5CA 3A3NB 5DG9A 1OMSA 4O0IA 2YBVA 2COLA 1WACA 2KH9A 4ECYA 2BACA 5D4PA 1WC4A 1S48A 3GWCA 4JI1J 2QV6A 3C16A 3IBWA 1UJ4A 2OP5A 3IWLA 3R2CJ 2LEPA 2MY8A 2DKOB 1U1LA 2B51A 1RKJA 2E1AA 4ZVEA 3WQPA 2GVDB 1MN9A 2LQ8A 3IBCB 3N01A 4EEYA 1Q4RA 2VF3A 5DLFA 4KGKA 2O3DA 3R5AA 1XR5A 3L4BC 1K8AT 1ZA2B 2KG0A 2UXBJ 4NZ6A 2V34A 5L1LA 2AYMA 2G2ZA 2IM3A 3NS5A 1JXLA 3FMBA 1TZ0A 3HHKA 3D6TB 2DNRA 4DL4A 2DNOA 2VZ9A 1NUEA 1RKIA 3I5BA 3AXKA 2KM8B 4XO0A 5L39A 1DTTA 3KUHA 4Q2LA 2IA6A 5M2UA 5K5MA 1TKXB 4ECWA 5HI7A 4CCHA 3BPDA 4LR8A 5FLXY 2MLYA 3VVTA 4NCGA 2ATLA 5C25A 1V5VA 2K7JA 1JWWA 2DNZA 3CJTA 3RBZA 2VFSA 1FDBA 1IBKF 5CH7B 2XO7A 5LSOA 3M2UA 2QE5A 4ZVFA 5KFIA 3KLVA 1HHQA 1RT2A 4M8LA 1H73A 4WZQA 4K4TA 2ASDA 4RU2A 4B17A 2L08A 4BLGA 4YFUA 4PG7A 1VQ7S 2AX1A 2ZBCA 4OZ2A 2LYVA 3NWRA 4M5LA 4P52A 2O01C 4IDKA 1SJ4P 3F0NA 4FS1A 2G0JA 2JHEA 2HHQA 1C1BA 5IM0A 2CQ2A 3PFEA 3HT3A 2WCXA 5KFTA 4USTA 4RW9B 4OI3A 2V2VA 1SKUB 3KMQA 3GG1A 1U0SA 3W61A 2CPEA 5LMNJ 1LWFB 4TQSA 4P9SA 3WC2A 1KTQA 2FJDB 3D4JA 3MR3A 4IKAA 2UUBJ 2J0SD 3NGTA 3P96A 1N36F 1KRPA 4GVBB 2XB2D 4XPEA 3JQMA 2CWXA 5KFYA 4YDXA 3MEKA 1YJNS 1VK3A 3TNVA 4WK1A 4CLUA 4X66F 3FSIA 3KK1B 2ZH6A 2QLXA 2B4UA 5JXSA 4DV7J 3H7HB 4N41A 4JV1A 1VQLS 2QRRA 2C3YA 4DUYF 1UJ5A 4WXWA 3K5LA 5L9NA 5H9EJ 3G8SA 2E1CA 1X9WA 2IRXA 2RU9A 2F63A 4NI2B 1VQNS 4DU7A 3G6ES 2Y8YA 4KC5A 3JSMA 3DRRB 3OR1B 2XCPA 1P8GA 1ITPA 2BJ9A 2DYAA 3P49B 2HFUA 1HR0J 4KAIA 5FDLA 4USVA 1XNQJ 5F8NA 1V9OA 2UVRA 2GQ2A 4EBCA 2R7WA 2QA2A 5J1PA 4A46A 2IRYA 1S1UA 2MXYA 2FZGB 3K59A 2OMLA 2LEAA 1OY9A 4CYUA 3TX0A 3GONA 5L1JA 1RBAA 2VG5A 4YS2A 2LKZA 3LH2S 2BVZA 3W5ZA 2FDNA 3MM9B 1KQSR 1EETB 2W1BA 2KRBA 1X4EA 3QWPA 3Q2SC 3KG4A 4LF4J 4DR2F 2QTWA 3I32A 4OYAA 4RW9A 4RNFA 2Q6BA 3JS9A 1Q7LB 1QUVA 5H9EK 2NUUG 4IUFA 4B9UA 4IG3B 4Y6IA 3ZZOA 2KT5A 2N7YA 4L74A 1SXLA 1EHWA 2AEJA 3G4SS 5LJ5Y 1QTNB 1BQMA 2R8JA 3NMRA 1KONA 3BGLA 2RHSB 1SJFA 4AXIA 2M0GB 1KS2A 2E5LF 1DLOB 1YJUA 3GFXA 4M5DB 4RUBA 3DOLA 3DLLQ 5BJRA 4Y65A 1S7IA 1RHQB 3I9V9 5T7LB 2M3DA 2DJWA 1B3TA 1W7WA 3CDUA 3MECB 3ZTSA 2UUTA 3CC2S 4I7FB 1YRUA 3R7NB 1HWUA 2MEWA 4ER8A 4LREA 3PKMA 2XYHB 4PWDB 3QT5A 4H4MB 2FC8A 4NI2A 2AYEA 4LFCJ 3IN5A 3R7BB 2AEFA 1YJ9S 3OR1A 1WD6A 4ZCLA 3QT7A 2CQIA 2E7XA 1ZYQA 1DQ9A 1TFWA 2M8HA 2MKIA 2HS3A 3W5YA 5HL7Q 3D1QA 3ZTQA 4X62J 3RB3A 1CLFA 2CPFA 4WF9Q 3PW4A 5B0GA 4P73A 1JK9B 3NKYA 4U7UK 3L09A 4R5PB 4CO4A 4C8KA 2AU0A 3GV7B 1I1GA 4TU7A 1Q8KA 5CAAA 1F6TA 1EKSA 1HBNB 2V2KA 2BANB 1EETA 4DUZF 3ZTOA 4I2PB 5CZXA 1IJEB 3TUPA 3WBZA 2CFXA 5HMXA 2FVPA 4UQTA 2F9JA 4IRKA 1N54B 2F3JA 3MTKA 4CH0S 3OW2R 4URGA 1TFYA 3MUTP 4B3SJ 1U09A 2FHJD 2FHJA 3BB5A 4IG3A 1ZAXA 5D4LA 3P5TL 1OIAA 1L3VA 4Q44A 1D9DA 2HS4A 1KNZA 4Y2IA 2GVZB 3NNAA 3AOBA 3MEDA 2BXJA 5J2MB 2QFJA 2JVOA 2GFFA 2EFQA 2W4PA 2OO4A 4IFYA 1FKOB 3HVAA 2IVMA 1BWEA 3M8RA 4JV5J 3HK2A 5T7LA 4MTPA 7FD1A 3B8HA 2VFRA 4WU2A 4CNYA 3SBMA 4TKTA 4ZVQB 1N5SA 3J81U 3QQCD 3TOQA 4C3MA 4PWDA 3VGUA 3W3SA 5LOQA 2RRBA 3FRZA 2RMLA 3VQTA 2VD3A 2QLBB 5G4DA 3GIKA 1C0TB 4YR0A 3IFEA 4DV2F 4OHWA 1ZA1B 2PMHA 2MJNA 4AT1B 5HJYA 4DEZA 2P2CB 1JLGB 1PGZA 4G1IA 4MMOA 4ANEA 3CULA 2MDAA 2IHR1 4K4XA 3MM5B 1RWVB 1S5ZA 5IV3A 2ASJA 5D3GB 4EYIB 2HHPA 3ULHA 1JLQB 1MLAA 5IWAF 1Q82T 3JQJA 2N3LA 4JI0F 2IFXA 3AY0A 4RBVA 1RGVA 4EGLA 3QSIA 2FJXA 2ADBA 5F8LA 2AF6A 1HBNA 2POKA 2XMKA 4LBIA 2HBRB 1Y10A 5D15A 3PRDA 2YH1A 5G0RB 1WI8A 2DR9A 2C2ZB 3AHPA 3MEGA 3H0PA 5F8GA 1BXNA 4MAKA 2OHDA 4DV6F 1GXUA 3IS9B 3R5JB 2VQEJ 3AA8A 4Q0BB 3I9ZA 1E6YA 3MMCB 5KG7A 2D41A 2VPWB 3T9NA 3I4HX 3DI6A 2JC0A 3PNIA 4TXSA 3H90A 5KAKA 3HZGA 2FGCA 4K5RA 2V4JA 2F40A 3N6NA 4KYZA 1Y3KA 3EYZA 3QAEA 4L73A 1Y5NB 4TYBA 1Y4ZB 2EFGA 1PSDA 2E44A 1FKOA 4J9VA 4ZK7M 4LRBA 2P9GA 3JTPA 4ANDA 4E98A 3Q8QB 2B0GA 3PACA 2R4FA 3SCJE 2BJ7A 3FJ2A 1HARA 2H9ZA 2AJQA 3IGNA 2CKWA 4FYVB 2MQOA 4LRCA 3R2DJ 1REVB 2GA7A 3LP2B 5KT6A 1C0TA 3EVMA 1RT3A 2B6AA 3PCOB 3BQ1A 2DR7A 4PCQA 4GO5X 3FSXA 4IH5A 4IG0B 4ELUA 5KG5A 3DLGB 5C2CA 3I0RB 1JLGA 4DS4A 2DNHA 2B5JB 2JEIA 1RADB 4IO9Q 4LSZB 2VHGA 3ZZZA 2C1EB 4B9NA 1BQXA 1UVLA 3KG0A 3MFIA 4OYMA 1LW0A 1RJJA 3BREA 1FO1A 4GC7A 3Q89A 3C15B 1AXQA 1P1LA 4BHQA 1GMVA 2YPZA 4CH7A 4NXMJ 3QJPA 3RYLA 1B7FA 4O3SA 4LRDA 3R1LA 5KFDA 5DGBA 2NR0A 2QYGA 3AFGA 2HVZA 1WSRA 1VMBA 2ABYA 5A8RA 1VQOS 4KGXB 2D3UA 4IQMA 4Q0BA 1HPZA 1QE1A 3A4TA 2QA4G 4J9MA 1UEVA 2OD4A 5A2QY 4NASA 4OHVA 2KT3A 3MMCA 2YNFB 1S0NA 2A1BA 2YWGA 4XPCA 4LRFA 2V68A 2HQFA 5HAOA 2DR6A 3H2UB 4WTOB 1O51A 3M4XA 4N8OA 1SQFA 1JIHA 2QO3A 1T9WA 2BEFA 2M9KA 1IR2A 1OJ4A 3KNGA 2I8EA 1R6YA 6AT1B 1S77D 3D66A 4QPTA 3BGOP 5A76A 1RA7A 3IR7B 4DV1J 3NXZA 4AQYJ 2PD1A 2X3GA 1WHYA 1YVFA 3KLEB 5DM6Q 3GPAA 3UNYA 2Y0BB 1Z2LA 1P1TA 1RACB 4YP3A 4DL6A 1Z2ZA 1QSYA 3MF5A 5E3AA 1REVA 1XIQA 4HI2A 1RDRA 2EWHA 2AT1B 2H5IB 2UV8A 3ZFVA 4QU6A 2V2ZA 3KK2A 1KFDA 3GV8B 4MYTA 5KG6A 4CT8A 2UU9J 3PX4A 2DGSA 1QDUB 1K0TA 8RUCA 1NAQA 4ECZA 1R7IA 2CJXB 2BQRA 4PXCA 3DU5A 4PEOA 4DV0J 3W9JA 1M0SA 2G0CA 2QFIA 1V3ZA 4NLWA 4J9LA 1TL7A 2KVIA 4C8ZA 2YH0A 1WDTA 3C8YA 2JVRA 4GKJJ 2EFNA 4CO1A 4OZ5A 1IBMF 5ETMA 5AJ3J 2R2RA 1K44A 2V94A 1U1MA 2DGOA 3ZZ0A 1IM4A 4WIQA 3HULA 2OTLS 1FNOA 2JSXA 1KSPA 3MEEA 2F4FA 2J8AA 3M2RB 4V19J 4WK3A 3VVUA 4JI7J 3C19A 2FPHX 3EGNA 1Q7YT 3PTWA 3IAM9 2QLJB 1VQ9S 9RUBA 1RHMB 1KQGB 5H9FK 1QLNA 1U49A 1TV6A 3ADAC 3CMES 2WONB 1GXTA 3UDVA 1WF1A 1XNRJ 4Y28C 2Z58B 4OV1A 4XDDA 4AUKA 5DDPC 1OYDA 2G1DA 2YKPA 3QATA 3QGGA 1UA0A 2GHVC 4QYRA 3M2VB 3VAHA 2EBGA 2CQ3A 3WX8A 3BEGB 2FJAB 3NMAA 4NLYA 3QO9A 1JXEA 5LSLA 2WW8A 2RQ4A 1XTZA 3DRYA 4K0KF 4DFJA 4JI3J 1JLBA 4CQ1A 1VRUB 1I3OB 3MPYA 3M05A 4FBUA 1FEEA 2O5DA 4XAKA 3N0VA 5B0FA 3P8BB 5F3ZA 2GJFA 2J7WA 1Y0HA 1NHVA 3NBPB 3QYYA 4BC9A 1LW2A 5KG3A 4MIAA 2DD8S 1IBCB 3PX6A 4KV8B 4QZVB 4KH0B 3PO4A 4LF8F 1RAAB 1OYEA 3NGSA 1IQZA 3MAAB 4ECQA 2I1RA 4G65A 2DVIA 1H0HB 4DR7F 1YQHA 1YDLA 1H2TZ 1O6XA 4RNOA 3MR6A 1RXOB 2EK1A 3ZZPA 5HP1A 2H5EA 4DQRA 3SCIE 2Z2LA 4TLQA 4EK2A 4EZ9A 1RTIB 1CJUB 3CCZA 4X4SA 1XMOF 2VQFF 2HPUA 1FD2A 4ELVA 3CCSS 1R0AB 4OX6A 1T9YA 3MUVP 4FYDA 1IM6A 5FLXU 1FFSB 2NYIA 4D3GA 3HZEA 2H51B 2GHWA 4BWJA 1TKDA 3JSRA 2Y8WA 2ZH2A 3DRPB 3PJXA 3NCRA 2WBMA 2R7QA 3CD7A 5I3UB 1PBUA 1HI1A 2LQJA 3NOGA 3QT8A 1VLOA 4ZPWR 1MMNA 1CJVB 2YNHB 1SIZA 2LDYA 2F4VF 3CCMS 2HWTA 2KYZA 4WPAA 3AQOA 2PI4A 2UXCJ 1W26A 1S10A 4I4BA 3H5YA 1LV5A 4ZIVA 1ZETA 2RUGA 2RS8A 3KUGA 3KHLA 2QEXS 3C6UB 2IDEA 4OJGA 4ZPCA 4YOEA 3V5RA 2BJ3A 3NNCA 4Y34A 2UVWA 1F2HA 2RJZA 2LP4A 2OFHX 3LGMA 4RWXA 4HDGA 4ZPVR 2IVFB 4JB8B 1U1OA 3W7BA 1B7YB 2DCUB 5D78A 4PQUB 1K1QA 2RB7A 4O3QA 1LFPA 2HMIA 2FD2A 1U47A 3THTA 1MSWD 1UEKA 2AKWB 5LM7E 2NREA 4KV8A 1F9EB 2DHSA 3BDEA 3MAAA 2EFPA 3PW2A 2MZJA 1IR0A 2HGMA 3PR5B 1IWGA 4C48A 1X5OA 3OHAA 4URSA 4DR1J 2MY7A 3CIZA 5HVGA 4KT0C 2YPYA 1RTIA 2DNPA 3RW6A 1Q79A 3JAMY 2CVEA 4ZS6A 4UZCA 4ZCIA 2ZZNA 1S9EB 5ETTA 1FT8A 2DXDA 1R0AA 1FWLA 3GQCA 4I6WA 3DXBA 3O2IA 3IP0A 3EZ5A 3N9UC 3ZXWA 1N32J 1YBTA 4ZLNA 2WZ1A 4PPZA 4Y2MA 2V8DA 2HQCA 3TUJC 4IR1A 4RW4B 5A0YB 3W2VB 2IC3B 1NDPA 1CJVA 1YJVA 2YNHA 3C14B 3I5CA 3LWMA 1NKCA 2BRKA 1IJFB 3OXLA 3HHLB 2MMYA 4JV0A 2W8LA 1T9XA 4B3RJ 1YZ7A 2CJAA 2KI2A 3BV8A 2XS5A 1RWNB 2V8PA 2NPIA 2ZBQA 1N5YB 4A8SA 2ZNZA 2HNYA 1HHTP 4F4KA 3MI7X 2D9PA 3QGPA 3HFKA 4OI6A 4UY85 1VC0A 4X4TA 3P3DA 3D3BJ 3ENWA 1EQ0A 4RW6B 3BF4A 3CMAS 4GKKF 1D1UA 5LMUF 5HBMB 2HHVA 3DDIA 1RTJA 5HMYA 1U1KA 4PQUA 1MN7A 4JI4F 4NLXA 1U7LA 4IO1A 4P2FA 3H5SA 1HQUB 1NDLA 1PCAA 2V69A 3TJ8A 3UCUP 1UL3A 2B4PA 2W7AA 4QWCA 4AL7A 1ZH5A 1N52B 4NRUA 2C42A 2AW0A 2C3MA 1R8PA 2KXNB 1S1TB 1U1RA 4MKYA 1H7XA 1SQEA 2MQQA 3FKBA 2CG8A 9ATCB 3OTDA 2AV5A 2BABA 1M1GA 3VGVA 2MTLA 4RUHA 2FHMA 2DB1A 2CNNB 2EEYA 1SC6A 2W9BB 3MMAB 2X51A 2VA2A 1KVIA 3S1TA 1DAXA 2R8KA 3CJ2A 1S9EA 2KL8A 5HO4A 3JTNA 1SKRA 3O1LA 1JB0C 4BBYA 4DR3F 4L76A 3SFUA 2FVQA 4F2SA 2M7SA 3BS9A 4RW4A 3LGHA 2VJVA 4C8LA 3JSBA 2M70A 5A0YA 1B64A 1VISA 2RDDA 2ZVSA 3UD4P 1PKUA 1YITS 1WHXA 3FDSA 1NZ8A 5HVHA 3IWNC 2YWHA 1CJKB 3C14A 3POTB 2W9CB 4QWEA 3S8SA 2Q79A 3UDLA 1Y9OA 3FFIB 1RSCA 3DNCA 4JBCA 4QPXA 1VQMS 2AGOA 2DIUA 1MG7A 3BR9A 2DRAA 4EZ6A 3OSNA 2Y1RI 3O5TB 2HFSA 5DQIA 3DKDA 4TY9A 4DPWA 2CVIA 3D9BA 3DRSA 1Z1ZA 5IV4A 2HFOA 3G82B 3ETMA 4MFBB 2GMHA 3HVRA 1WG5A 2FHOB 5JJBA 2E1RA 5E2QA 3TZYA 4P2XA 1H74A 4RW6A 3EDRB 1T05A 4F0HA 4WXOA 2Z2YB 3J80Y 3AD8C 1KFSA 3K5OA 1EJ7L 4FYWB 2GIFA 3KDOA 2V4RA 1F2GA 1Y00A 1HQUA 4DDFA 3QBCA 8ATCB 2VJUA 1S72S 1U25A 3V6JA 1U8WA 4P7VA 4MJKA 3H4BA 2JDJA 4KFBA 1YRXA 4B9MA 3NGRA 1OQ6A 2XMWA 4QW8A 2FLPA 2KG1A 2FC9A 2VBWA 3GIMA 3U02A 2J9EA 5B08A 4PXDA 4I69A 3LA0A 1N36J 4C8YA 4EI2A 4Y2AA 1GMWA 1BC6A 2V50A 1DRZA 2W9BA 4OZLA 2V2QA 3EGZA 2CUYA 4X66J 3AB4B 3JQKA 3H59A 4I6YA 1Q8IA 4KKOA 1LWEB 5BYQA 2HS0A 5KG4A 3SCLE 4KPCA 2CQBA 3CDEA 1FWPA 4CLPA 2MKHA 1UVKA 4Q8EA 5EWFA 3IRXA 3G71S 1HMVA 5F8IA 5DRKA 3KWMA 2FZCB 2H65B 2WW4A 2AQ4A 2MQ8A 1LEOA 4LUBA 1SI9A 3V6DB 3KJVB 4ZITA 3HPOA 5CD4H 2C2KB 2KVQE 3OR2B 1RZMA 3K5PA 1PAEX 3HHDA 1TL3B 3MM8B 4ES3A 2W9AA 3E51A 3D1OA 3E8OA 3C66A 3RG6A 1NHUA 2RAQA 1R31A 1N5QA 1YTYA 1ZS6A 4DWIA 4WZMA 3G82A 5D4OA 4NZ7A 3TANA 4MFBA 5F8HA 1RCOB 1HW9A 3BBFA 1S76D 2ALYB 4CDIA 1PJ6A 1FJGF 4B9SA 1S1XB 4LT6A 3KJQB 1T0TV 3IAS9 3CTRA 4CIOA 1WG4A 4DR2J 1T03B 2VPXB 2ATCB 2XEXA 3CSKA 4RU9A 1VR6A 3FUYA 3OVSA 1F5CA 5D4NA 1XEZA 5JVGQ 4ED4A 2QMUB 4HKQA 2B8QA 3SFGA 1SB6A 4KGMA 1YJWS 3MM7B 2KHDA 5IT9Y 4QOTA 2E7VA 3E01B 1HL6A 2UV8G 1S1VB 4FKXA 3X1LB 4A47A 5HMZA 5HK4A 4M95A 3OLBA 4P2MA 1V3RA 1XMBA 2HWHA 3BR8A 2E5LJ 3QGIA 2N3OA 4WFZA 1TL1A 2H5JB 4JI5F 3M8WA 2AJFE 2YQ3A 3LP1A 1RLCL 2HBZB 3K8VA 1RTDB 1EAYC 5D0HA 3LW5C 2K3KA 3BYRA 5ETRA 2LEBA 4ILRA 2MQPA 2GHPA 4U6PA 1FXDA 2HGNA 4DPYA 3VTIA 3HMJG 1EQMA 5D8HB 2ZWOA 5J2QB 5KFSA 1KLMA 2ROGA 1TUVA 2L41A 3G86A 4CP5A 3HSDA 4TY8A 4KJIA 2ROPA 4ID5B 1TL3A 1RHRB 3WIVA 1VQ4S 1L3KA 4JI6F 1GX5A 4MKBA 4LIRA 4HL9A 5KFJA 2IM0A 3HP6A 2A0FB 1RA6A 1HQEB 1QD1A 4UZBA 4USMA 5BYSA 4G1QB 5AE3A 4GRSA 2XZWA 2CADA 5A2QU 4DCJB 2DNLA 3UW1A 3JTOA 2HZCA 3A8JA 4K4VA 3BQ0A 2EKNA 2WOMB 2ASLA 2HG4A 2WAQD 2RSQA 1NM2A 4A8QA 4FF4A 1X0FA 3CC4S 1RWOB 1W25A 1UVMA 2YKMB 4ZLPA 2QL7B 2VFVA 4U8VA 5ETOA 1NPKA 1T03A 4HDHA 3HDSA 2WVDA 1U1NA 2O67A 5AXKA 4KY3A 3IBFB 4RW8B 5MLCV 4ANCA 4DZ6A 4F7VA 5M2RA 2FZKB 2DISA 2B4OA 4PUOB 3MM7A 2B7BB 2AX0A 2P6SA 2NXCA 3BSCA 3JB9k 5KOWA 2AZ1A 5I42B 1FXRA 3E2EA 4LIWA 2XYPB 2ASYA 2R9LA 4NEYA 1S1VA 1KEKA 1VS3A 2CPYA 2DEIA 2V0NA 1VQSA 2QG9B 2XC9A 3HHNB 2N7CA 4HH1A 4ED2A 3KLIB 4K2JA 4KHPJ 1NMEB 4OLPA 1V3SA 1XERA 3NY0A 4TLRA 3UWTA 4DR5F 1S6UA 1RTDA 3ZZTA 2KYXA 1N5VA 2CDRB 2RKIB 1X31C 2HLTA 4CM0A 4QYZK 5KFZA 3UPFA 4ZKAA 5J2QA 1X9SA 1W2BR 4B3TJ 2XGQA 1RT4B 3D6FB 2RF2B 4DF4A 2XHCA 1NK8A 3H5XA 4F4AA 2G1HA 1JLAA 3PR4A 2ZC3A 1PAUB 5ETQA 2GGPB 1AUSL 4ID5A 1CJTA 2BE7D 5HROB 4RWWA 4PQAA 1DHMA 1FK9B 2W4DA 5IZHA 4C0BA 3HF5A 3DM2B 1QJHA 2I5JB 3CE8A 2Q3PA 5IWAJ 3PIOQ 2V8GA 3S01A 4WE1B 2PFFB 5ETVA 3TVKA 3SDEA 5K8OA 1YX2A 3SCKE 3TQ1A 1B70B 2M52A 1M5VC 2CA9A 3UO0A 3BKTA 4JI8F 4X4VA 1OY8A 3CJQA 4S0MA 4NLGA 2CRLA 1QAIA 5BYRA 2MB0B 3RRGA 2VBYA 4MK8A 2G2OA 1YJ7A 4OX8A 2H4WB 2UUCF 2XSJB 4YR3A 1G2EA 3KHGA 4DV6J 3OXFA 3OUYA 2VU5A 1TVRA 4Z7CA 2HHUA 4NXNJ 3JXOA 1FE4A 4ZHRB 4CNZA 4IFVB 3BBBA 4DPTA 4B9VA 5J2PA 1S1WB 1I94F 1UFLA 1WKJA 5I42A 4LF6F 2OAUA 1HNXF 4NYZA 2UXDF 3WX4A 2BA9A 3MR5A 2DGVA 2QL9B 4K8RA 3T1YJ 2OELA 3O44A 4ECXA 2AGQA 1KP6A 4WKRA 3DOKA 4G6VB 1FKPB 3KLFB 3VAFA 3FC9A 4QR1A 4DPOA 1IXKA 1UZHA 3TUZC 4O4GA 2AYBA 1ZM3A 1R0BG 5A6PA 2IA0A 5IT4A 3MCMA 2RKIA 1X5TA 1C0UB 5GADU 3RAMA 1C2PA 2HFVA 4B9TA 2J0QD 1GQEA 4Y0FA 5CYJA 4OI0A 4Q45A 5AE2A 2HFZA 1PBAA 3OFFA 3G6VA 2IVYA 5FD1A 3V2UC 5HROA 2DY1A 3GJTB 4KH1B 3R9LA 3PVXA 2QMWA 4LBPA 5KFBA 3M1VB 3GCWP 2Z0GA 1WKLA 3DM2A 2I5JA 1T11A 2CZ4A 5L1KA 4WE1A 1RT1A 4OZJA 4A8KA 3QIPB 2R2SA 4JI1F 1FDAA 1JLFA 3DRXA 3EX7B 2OLWA 4LSLB 3QMQA 4WKYA 5MAOA 3V6KA 3QNWB 3ILJA 3CDBA 3GV5B 3QSYB 4ECUA 3THVA 1QAXA 3NGUA 4IFVA 2Q1LA 4ATNA 4P75A 1PYSB 1DURA 3GG0A 3CJ0A 2ZH3A 3NGKA 2VONA 3OJUA 1S1WA 2LVWA 3SMZA 2Q66A 4M5JA 2HZVA 1QM9A 3PY8A 1VIOA 3KYLA 4J7CA 4BC7A 4CO3A 4FP9A 5HANA 4HR2A 4ED3A 1SKSA 2GMLA 2XS7A 1S0MA 5A8KB 3VR1A 3PIPQ 2YWKA 3Q22A 4ERDA 2DHHA 1FKPA 3OTOF 5AXMA 3QRRA 3MHYA 3LALA 2LQ9A 1D9FA 2C2OB 1YI2S 1C0UA 2B4VA 1S57A 3TW0A 4DMZA 3GYGA 2CDQA 1U0HB 1ZM4A 2NS1B 3WC0A 4NEZA 5LJ3Y 3IM8A 2IM1A 1OY6A 1IBLJ 2HHTA 4DQSA 1LWCB 2LCWA 2R3VA 1JNZB 3D0GE 4YQWA 4JYAF 2GS8A 1SV5B 3CJKA 3HJFA 2RQMA 2H3EB 5THWA 3NS7B 2OSRA 3M1VA 3AH6A 1G6BA 2C28A 1LNQA 5LMNF 1U45A 1QAYA 1HNIB 3ICLA 5H1SV 3HD1A 2DHGA 4K4YA 4HT5A 4A4JA 3ENQA 4LSLA 4ZJQA 3BKUA 3NCPA 4WFNQ 2BV3A 4L6V3 1SH0A 2OUGA 3A12A 3RU0A 4RBTA 5GAEU 3ISZA 1FD8A 3AOCA 4NE9C 1FDDA 2IAJA 4I1TA 1CS4B 4J9OA 3OV7A 1Q95G 2HQIA 3M9MB 4Q5VA 2XMTA 1SCJB 3RGIA 1PC4A 4N5SA 1NK6A 4CT9A 4E2FB 2ZDPA 3BGRA 1ZBTA 2DGWA 2CQDA 5A8KA 3BH7B 4NX9A 2VC0A 3C16B 2KM8C 4ED1A 2VPZB 1FTRA 3W64A 1RISA 2MQLA 1OWXA 5DM7Q 5ETLA 4NYOA 2NYHA 2A6MA 1NLKL 3TAMA 4ALZA 4LQ3A 4PXBA 1O0PA 1LK7A 2ZH1A 3J7AN 2NQPA 3H20A 1U0HA 1HNZF 2PEBA 3ZZYA 3OXGA 3W66A 4DR4J 2XGPA 4CO5A 1S9FA 1UETA 1IKXA 3IR6B 2K1RA 4PR6A 2JEJA 3TO8A 3CCTA 1VQ8S 1SV5A 4DQPA 4R0EA 4OHYA 4LF4F 2J7UA 1UCNA 4ZVPB 1PJ5A 5CQGA 2XWYA 5C2GA 1X8DA 2IYIA 1L3SA 4I64A 2YKQA 4DR7J 1K0VA 2XO6A 3HHLD 3WHIA 3T41A 1NPRA 3KJNB 2PA3A 4NLPA 2R7OA 2ALZA 3CIMA 3K5NA 2VKZG 1XMOJ 2VQFJ 3AQPA 2VPYB 3O6QA 2PEHA 1RT2B 2E9TA 2A10A 3DYAB 2VDIA 1V6HA 3AJ1A 3VAKA 2R7VA 3K17A 2WVBA 2FQQB 3OTEA 3NCQA 3A13A 1HQ2A 4RNHA 4DI6A 1U1PA 3LTOA 1X0PA 5HLFA 2ZJPQ 4B3MJ 5KT7A 1Q81T 3C2PA 3OFEA 2V8VA 3BZQA 2QIFA 5D0EA 1IWAA 4LFCF 4Z7YA 2ZM6F 1PILA 2F4VJ 2VODA 1T3NA 3ET6B 4WP8A 4DSFA 2VV5A 2APOA 4RR5A 1H6KX 2DNQA 3N4WA 1YSJA 3GR0A 5BXIA 1FFWB 3CD6S 1MWQA 2HHHF 3ILIA 2ZZTA 5M2PA 3W65A 1L3TA 2BR0A 1U48A 3GYNA 2MPUA 1KHVA 3H40A 4RPFA 2CZ9A 3CF5Q 2BDPA 2E5GA 2F65A 4HVZA 5KFCA 1QAJA 1U24A 1RE1B 4PXEA 1Q8BA 2MYFA 1WDDA 4A8OA 3ENVA 3ZNUA 1WHVA 3MOJB 2UVVA 1YIJS 1WHWA 3JSMB 1HBUB 4YN3B 2L9DA 4PYAA 4LFBF 4O23A 2ZVIA 4USIA 3K5MA 2GJIA 5FDLB 3PM9A 4RNNA 3D68A 2UZAA 2I6WA 2BZ2A 4J5OA 2C22A 2W2PP 4NL5A 5IOLA 1WF2A 3GIRA 4UQGA 4CLYA 1S1UB 2DH8A 4CYUB 3D28A 4ED8A 1WTBA 3OFHA 1CC8A 3DYAA 4Q7AA 2VG5B 4NLQA 3DGPA 3CCJS 4DV5J 2F8HA 5DJBA 4C8OA 4L3KA 5DG7A 1VC5A 2WRMA 1JQGA 5J2NA 4LVOP 3RJMB 1RWKB 3MD1A 1VYAA 2HNZB 1N0VC 1J2VA 4RO0A 2XQCA 1GFWB 3Q8SB 4R0JA 1VQ5S 4TU8A 1S79A 1WC3A 4YEAA 1RT5B 3AD9C 4TNOA 3ET6A 5L1IA 4L75A 2BYCA 1NXIA 3CCRS 4ZVRB 1BQMB 2JX2A 5L8RC 2F8EX 2QX0A 1FRHA 1K9MT 3T1AA 4ES1A 3UVJB 5EWGA 2ZE2B 3DOLB 5B0DA 4I6AA 1N0UA 4P10A 1TAUA 4QBUA 1HHSA 2HHXA 4X4PA 4FNIA 4GKKJ 1EIYB 1B0TA 2W24A 1HBMB 3IC1A 2PIIA 4LVNP 5C42A 2RS2A 2EC0A 4JI2J 4J91A 4EO6A 1HBUA 3DLJA 1GTEA 1S59A 1SJRA 1RAHB 2DR8A 4X84A 1LFWA 5KFUA 1NNDA 2FHKA 2OPSA 1C1CA 3D6HB 1UA1A 1RBOB 3A8KA 4H4KC 2W25A 5KFVA 4L72B 3AJDA 1NO8A 2LA6A 3ISND 3HM9A 3NWGA 2QLFB 2GX8A 3TI0A 2GMJA 1X4HA 2HURA 2XMUA 1K47A 2KJWA 2LFVA 1Y5IB 5DO2A 3G6XA 2ZKTA 3EVOA 4NLTA 1REGX 3OVBA 1BMQB 4A8WA 3LAKA 2HQDA 4DR3J 3FEXB 3CO9A 1UAWA 1XBWA 4H4OB 5EDWA 2HNZA 1OQ3A 3HVWA 3RAQA 1HBOA 1S6PA 5LXRA 2ZH8A 2AIRB 4LF9F 4LBHA 4DSKA 1RT5A 4WP3A 1HYSB 2MQMA 3CCES 3K7RA 2JJ4D 4USWA 3NEKA 4DCPB 4C97A 5E0OA 4RJVA 1BHNA 5CCLA 5BR8F 4DSEA 3MEDB 2XLJA 2KRRA 4V1Ak 4K4WA 3J7YU 1SBRA 2CPJA 3UVJA 2ZE2A 4IFYB 2VBXA 1HIYA 1EKRA 1SUQB 4OFZA 2ZH4A 2N4CA 3UI3A 4ZOSA 2C3OA 1APSA 1JNRB 2CJKA 3F73A 2RT3A 2W2MP 3FVYA 5DDQC 3RUBL 2GJ2A 3CD5A 1N56A 2FGOA 1HBMA 4NXMF 1LWXA 3TYTA 3D1HA 3OD2A 3M6XA 3HSJA 3NNHA 1NJYA 2YWWA 2I2YA 3US5A 4W98A 5KFXA 1SIWB 3QGHA 4LFAF 3Q2TC 4F3QA 2DGUA 1HWKA 1LQ9A 2LU1A 3A8EA 3A8IA 4UY8T 4P7TA 3GJSB 3LANA 2EFOA 4DV4F 3BN7A 1BUXA 1ZM2A 2YX1A 3KXDA 2M5YA 4ECVA 1LKZA 1Q16B 3C3LA 4RKUC 4CLFA 3QLHB 1KR4A 1SH3A 2HQ3A 4C4WA 4B3OA 3TRGA 2MZ1A 2MHEA 3IR5B 4CTAA 3DGVA 1QTMA 4H4OA 4AQYF 2NLWA 2GC8A 3MEGB 3BO4A 1M5HA 3BGFA 2YNGB 1DTQB 1B99A 2R2TA 2MZQA 1E6YB 3LQVA 4C98A 3PW7A 3HHEA 4OJHA 2XY6A 1HYSA 5KTQA 4DSJA 3DI6B 2F8MA 2PN6A 3FEYB 4O44B 2V4JB 5JVHQ 2UU9F 1VJQA 3KHHA 3ZNJ1 3N5BA 4P6QA 4F0KA 4ZVUB 5DDOC 2BRLA 2EPIA 4DFMA 2HSEB 4DV0F 5E3PA 1UW9A 1SUQA 1KC8T 3VZHA 1K1SA 2FY8A 3PZPA 2AJ0A 3CJ8A 1TK0A 3V4IB 4ZPAA 4HEA9 4GKJF 3GJQB 2RD5C 3DLEA 2R42A 5AT1B 3B4DA 3Q8YA 4FDFA 1TKZA 3V4MA 2DIVA 4K4SA 3D3CJ 3W63A 5DZ6A 1TUWA 1RT3B 4X65F 2B6AB 2EG2A 4JOUA 1BGXT 1KQFB 3Q0AA 3QJJA 4NLVA 3DN9A 4L3NA 2OJ3A 2X3DA 1UTAA 3EMTA 2VFTA 1KOHA 2BKOA 2LLZA 1BD6A 2B3TB 2JLGA 1AW0A 3P45B 2MKCA 2D9OA 2MKYA 4TYAA 1JX4A 1R89A 3MM6A 4N7TA 4C0HA 2HKEA 4QWDA 2CQ4A 1LW0B 3PHEA 2XYGB 3QLHA 3EZUA 5KFPA 4CWBA 1URRA 3U27A 3OL6A 3CO0P 1RK8A 2B7CB 2LQ5A 1VDHA 4Q2MA 1M5PC 2GNKA 4C11A 2V5HG 4UOCA 1JKHA 1UKUA 4NLDA 1H3DA 1AT1B 1Y5LB 2DXEA 3SIPB 2YNGA 5A8RB 1HWIA 1DTQA 1TK8A 3HFZB 2U1AA 5CHCB 5SZTA 1HPZB 1FFGB 1QE1B 2F5GA 1ZPVA 4YDDB 3EM1A 1R8AA 4Q43A 1R8BA 4C8MA 4TU9A 4USJC 4O44A 2R7TA 2F1FA 4WWSA 2GCFA 1RB0A 3OTCA 1VIXA 5E3CA 4U67Q 5L9XA 3PDNA 2LA4A 1UEUA 1ULRA 1XC9A 1RU1A 1JJCB 3UNGC 3OBIA 3CXCR 4B9LA 5T41A 3V4IA 4LRAA 2J0WA 4TN2A 2Y1JA 5KFEA 1RLDA 2SXLA 3HO1A 2GW8A 3MR7A 1HI0P 4OI4A 4WP9A 5KG2A 4GO7X 4J37A 3J7ZT 3I0SA 5FIIA 1JJ4A 1X60A 1F9HA 3T5HA 3MCSA 4ECTA 1X4CA 4J9KA 3KK2B 3GU0A 2AJ2A 1TQLA 4EU0A 1X5SA 3D0IE 2DH7A 1OO0B 2EBEA 4CRJA 1MNEA 2BW2A 4I2QA 3TWZA 3AOAA 2R7SA 3CCQS 4M5HA 2DH9A 3BO2A 1AB8A 1TL7B 5HQ8A 1FE0A 3M8QB 2JLFA 1RHKB 3HCXA 4DS5A 5EN1A 2CNLB 4OX9F 1M5SA 3MMBA 4DR5J 5KT2A 4USHA 4O3OA 1AZSB 1Y11A 3DFEA 5GAGU 3D5MA 2RRAA 3M30A 4ILMA 3MEEB 1FERA 5D77A 1BQNB 2RQKA 3IWXA 2HIQA 2YXLA 4NRTA 4P2SA 2LDIA 1NJZA 4NA1A 1PO6A 2Z57B 2NXNA 2AMCB 4AXJA 2FLNA 2X7IA 1N6QB 1TV6B 4F04B 2WVCA 5KFOA 1BY9A 5CYMA 3PEHA 4ZLLA 3TARA 4HTIA 3NAHA 3CC7S 1CULB 1L5UA 1KQKA 2CYYA 5K8NA 3QRPA 2Q43A 2HK2A 4ZA1A 2C2NA 2BJ1A 1S49A 4OHXA 2IDLA 1T8EA 4USKA 4DR1F 4JI8J 1RAFB 1CQMA 3BN4A 3QO9B 2ZH5A 4WFBQ 2AJ1A 3N28A 1JLEA 1JLBB 3DDKA 4CLWA 2IRUA 2XLIA 4WJBA 2E9ZA 1KWMA 4BCAA 2BE9B 3GB0A 4QWAA 3WDOA 1RWPB 4OYXA 1RTHB 2CWKA 1Q5YA 2DCLA 4MT1A 3PEJA 1IN0A 2YQ0A 1LW2B 3A3PB 4LF6J 1IUJA 1XR7A 1FDNA 4RL1A 1HNXJ 2R8HA 1ZZNA 5RUBA 1P9YA 5CYQA 2WSFC 3RBXA 2VG7A 2RRNA 3L9ZA 4AD6A 3D6MB 3MFHA 3LO3A 5DETA 1DZ5A 3M8QA 5HP1B 4B3RF 4KSEB 2V9WA 4NLOA 4D3HA 5DLGA 3C6TA 4I56A 4NLRA 2R7UA 3R5GA 3Q8RB 3MCOA 4U95A 1N4LA 1AZSA 2DRDA 2LMIA 4F67A 2CPIA 2ZOMA 1F5AA 3PJWA 4MYUA 1U2CA 3PYDA 2HAFA 3GP9A 1BQNA 4DUTA 2MZTA 1YHQS 4LJMA 3VAGA 4OYPA 3T1HJ 4HHUA 4K7QA 3W8GA 4DR6F 1TR0A 4K2XA 1N6QA 2CXEA 2ZC4A 2KO1A 3G8TA 2CNOB 4U7UD 4DV3J 1CULA 3GFZA 4NOHA 2CJBA 2DNGA 4RW7A 2FJWA 3KK3B 1F0XA 3CJ3A 3X3UA 2XLKA 2DNNA 2PFDA 3FQKA 3SYZA 4KTQA 4FS2A 2D74B 3V6HA 4QW9A 2GV1A 1FNMA 3UD5A 5IC4B 4U7CA 5JMNA 3NG8A 4J9NA 2C2MB 5AXNA 2FB0A 1HNWF 5AE1A 4DX5A 4ED6A 2OMOA 3CJ5A 1YKWA 1A9NB 1WTFA 2ILZA 2VKRA 4A8XA 4ZMMA 3W5XA 3IMQJ 3DC2A 2CPDA 2E1MC 4ETXA 1ICEB 1RTHA 1IKVB 2HMIB 1X9MA 3OSPA 1NJWA 1A7GE 3L7OA 2HVHA 1SL2A 5IC6B 5C24A 3I5AA 2ADCA 4J9SA 4WTYA 1M5OC 1WC6A 1J27A 1KTVA 5B7WA 1ZTTA 3PJ9A 2EKYA 1H2VZ 2NCKL 4A8YA 4AL5A 5EHHA 2CG4A 1X4FA 2JC1A 3AXMA 4ENOA 1Q78A 3OTOJ 1KOOA 3MXHP 1F9FA 3VHQA 1UPPA 3ITHA 5DGAA 2OH2A 4QR2A 3LPEA 2QSWA 3NRBA 2W2OP 4NMLA 2XULA 3L3CA 5KFNA 3HHLC 4ED5A 1Q86T 2X1BA 3FCWA 2CZVC 1S99A 2D3OR 2HYIB 5ETNA 3CJRA 1SL0A 4E0DA 4H54A 2W01A 3K8WA 3I31A 1WSVA 1ZZFA 1HWLA 1W2IA 2AHOB 3FRYA 4IOCQ 2VOOA 1RWXB 4JYAJ 1WEZA 2VG6B 4DPXA 4FBTA 2U2FA 4FXWA 1FJEB 2W2QP 1FEHA 1MU2B 2MKSA 2GAGC 4UOHA 3ZTPA 3CMQA 2DNMA 3EWGA 4IH7A 2YX4A 3KK3A 2KB2A 3OFGA 4LF5J 1D8YA 1XR6A 5GAGI 3SSSA 4YHHF 3QFHA 1UP1A 2WBRA 2KDOA 4ZP9A 4ZVGA 2QA1A 2QGFB 4PABA 4DG1B 1VHIA 1VI7A 2BX6A 3N79A 3VF0B 2ZZMA 1MW7A 1NK5A 2B43A 2HNYB 4ZVHA 1N34J 5E41A 1UMJA 3W8PA 2GVDA 2ZOGA 3LF0A 2Z30B 3Q8UA 4XTTA 2XHWA 3TZWA 1XQIA 3ZZUA 2WVFA 1U2RA 2HLUA 1EP4B 2D3ZA 1RTJB 5ETKA 4M5NA 3P6YC 2KN4A 2P9CA 3OHBA 5D0RA 5K8PA 1B4SA 2LXFA 1IKVA 1CC7A 3QPIA 3BSOA 3SEOA 4OMFG 3D2WA 1U1QA
chains in the Genus database with same CATH topology
3LALA 3FSXA 2HVIA 2LQ9A 1D9FA 1LWEA 4IH5A 4IG0B 4ELUA 2F7VA 1QSSA 1YI2S 3MUMP 1C0UA 1Q1KA 1TKXA 2B4VA 5KG5A 2GO8A 3TW0A 3DLGB 4DMZA 1ZAVA 3I0RB 5F9NA 2E5HA 4DL5A 2RDIA 1JLGA 5ADZA 2IM2A 1YWXA 4DS4A 3MMJA 2WK4A 2CDQA 2DNHA 2B5JB 1ZM4A 2I38A 2NS1B 2JEIA 4TQRA 3WC0A 2VBZA 2XY5A 4IO9Q 3BJYA 3U1NA 3UDCA 1HW8A 2VL1A 2PE8A 5LJ3Y 1UWBB 2IM1A 1H2UX 3ZZZA 1FRKA 4B9NA 2KZMA 3M8PA 1BQXA 1UVJA 3H2VE 2WB1D 3T9ZA 4DQSA 2HHTA 3AJ2A 3TUIC 1LWCB 2LCWA 1UVLA 3KG0A 2IMWP 1JNZB 3D0GE 4YQWA 4JYAF 3MFIA 1HI8A 2G4BA 2CPXA 1Z4UA 1LW0A 2RVJA 1RJJA 3BREA 1FO1A 2KFNA 1SV5B 3CJKA 4O4RA 4GC7A 2VQEF 3O3LA 4HI1A 3CD0A 1AXQA 3HJFA 3V6DA 1P1LA 3KJVA 2C2DA 1SH2A 2RQMA 4BHQA 5THWA 4CH7A 3QJPA 2KJVA 2YKNB 2OSRA 3OR2A 3RYLA 3KNAA 1B7FA 3CCLS 3M1VA 4O3SA 2ZD1A 3VCDA 2FY1A 2B9WA 2J6SA 3R1LA 5KFDA 5DGBA 2C3PA 2NR0A 3N5FA 4C9DA 3AH6A 1G6BA 2NZ4A 3MM8A 4FF1A 3MPVA 2C28A 2HVZA 2Z8QA 5LMNF 2ZUGA 1N88A 3DMJA 2Y1IA 1U45A 4F3OA 1VMBA 2ABYA 2XMMA 3FSYA 1QAYA 5A8RA 5EGYA 1VQOS 1HNIB 2D3UA 3ICLA 4IQMA 3RB0A 2AYGA 4WU3A 2VG6A 5H1SV 2YTCA 1HPZA 4ELTA 4Q0BA 1QE1A 2A2CA 2QA4G 1O5JA 4J9MA 5F9LA 2DHGA 4BDPA 1UEVA 2Z4PA 1M90T 4K4YA 2OD4A 2IJNA 4HT5A 5A2QY 4OHVA 2KT3A 3MMCA 4A4JA 2YNFB 3ENQA 1S0NA 4LSLA 1MU2A 3FZBA 3GMGA 3WZ0A 2A1BA 2YWGA 4XPCA 4B3OB 3NCPA 4WFNQ 2BV3A 4L6V3 3H2UB 4N76A 4CTAB 1SH0A 1O51A 4QYZJ 3M4XA 3NGDA 4N8OA 4CO2A 1LWFA 1Y3JA 3RU0A 4RBTA 1JIHA 1S1XA 2QO3A 1SJ1A 2DGTA 4NWBA 5EX0A 4FXDA 2M9KA 4A8FA 1X4BA 3KNGA 2I8EA 5GAEU 2DGXA 4M94A 2FVCA 2FLOA 1R6YA 3NS6A 4XK8C 2W7OA 1AUDA 3MPWA 3ISZA 4DG1A 2KT2A 1S77D 1BLUA 1UW4A 4OI2A 1FD8A 4KHRA 2MQNA 4QPTA 2I9SA 2W4CA 1RWUA 1FDDA 2IAJA 4I1TA 3DRSB 1N48A 4J9OA 3VQSA 3OV7A 2EK6A 1URNA 2HQIA 1QVFR 1RA7A 3M9MB 3IR7B 4ID8A 4M63A 4Q5VA 4EO8A 2W7PA 2XMTA 3KK1A 1PC4A 3BGUA 4N5SA 1NK6A 2PD1A 4CT9A 2X3GA 3CJ4A 1WHYA 1YVFA 3KLEB 2ZDPA 3RB4A 3BGRA 5DM6Q 1ZBTA 5B09A 2DGWA 4R25A 1T05B 4LMZA 1Z2LA 1EP4A 1S0OA 1P1TA 3BQ2A 4DJBA 4YP3A 4DL6A 1Z2ZA 2CQDA 1H38A 5A8KA 2OTJS 4NX9A 1OS5A 2HAIA 1QSYA 2VC0A 2UUWA 3MF5A 5E3AA 1REVA 3R5DA 2KM8C 2VH7A 1RDRA 1U8SA 4HI2A 2EWHA 4ED1A 2VPZB 3E01A 1FTRA 3U1LA 2PGCA 4RLEA 3NL0A 1RISA 2MQLA 2DRBA 1HD0A 2UV8A 3ZFVA 4QU6A 3DCAA 1OWXA 5DM7Q 2XSFA 3KK2A 4NYOA 3H98A 1KFDA 4QIGA 4KFBB 1E6VB 5J1EB 4I0WA 3FGVA 3GV8B 4MYTA 3TAMA 5KG6A 5K9FA 4ALZA 6FDRA 1FKAF 4N47A 4CT8A 4KHMA 4LQ3A 2ACYA 4PXBA 1O0PA 1LK7A 4ZP8A 2ZH1A 2DGSA 3PX4A 1K0TA 1VQYA 5KFFA 1NAQA 4ECZA 3DRRA 4IR9A 4X4RA 2NQPA 1M1KT 1R7IA 3DLEB 3H20A 2BQRA 4PXCA 1VGYA 3K58A 4QIVA 4YB7A 3DU5A 1HNZF 3I4PA 3VAIA 3W2WB 1M0SA 4EYHB 1UWBA 3ZZYA 3OXGA 2G0CA 2LXIA 2VUGA 4F4YA 1P6TA 1TKZB 1V3ZA 4RNMA 4NLWA 4F2RA 4LF7F 4QCLA 2XGPA 4CO5A 4J9LA 4F4WA 1S9FA 3HVTB 2KVIA 1UETA 1IKXA 3IR6B 2K1RA 3UQSA 4PR6A 2YH0A 4C8ZA 2X1AA 3C8YA 2JEJA 3TO8A 1CVJA 3CCTA 1R8HA 1VQ8S 2JVRA 4ZPBA 1FRJA 1SV5A 4DQPA 4KKOB 2EFNA 4R0EA 4CO1A 4OZ5A 1IBMF 4OHYA 3ISNC 4LF4F 4PWUA 2R2RA 2J7UA 3R1HA 5KFQA 5LT5A 1HD1A 2YKNA 4C3KA 4X4UA 1SJQA 2C2EA 2V94A 5CQGA 1U1MA 3VAJA 2BM0A 2DGOA 2XWYA 3ZZ0A 1IM4A 1NJXA 3IG1B 1X8DA 2DTJA 2IYIA 1FNXH 2OTLS 1L3SA 4I64A 1SKWA 4KR0B 1FNOA 3MM9A 2YKQA 2JSXA 3IRXB 4NA2A 1NK7A 1K0VA 1HMVB 1KSPA 5CXTA 2ZJQQ 3MEEA 3MM6B 1AFJA 2DBBA 2RDJA 3HHLD 2KKHA 2J8AA 4Y2CA 3RTVA 2J6UA 1F60B 3T6JA 3M2RB 4V19J 1NK9A 4WK3A 1HQEA 2PA3A 4ZDNA 2OFGX 4NLPA 2R7OA 2FPHX 3EGNA 2ALZA 1Q7YT 4G1QA 3IAM9 3HKZD 3CIMA 3K5NA 2VKZG 3HKWA 1VQ9S 3AQPA 3BSNA 2MKJA 2VPYB 3CWJA 3DXSX 3O6QA 3M6WA 2PEHA 1RT2B 3IRWP 2E9TA 4YUDA 1KQGB 4DV1F 2A10A 4C11B 1QLNA 3DYAB 1NH7A 3MGJA 2M2BA 1FA0A 1U49A 1V6HA 4FXVA 1TV6A 2WOMA 1JKHB 3AJ1A 3G96A 3CMES 3VAKA 2WONB 2R7VA 4HH0A 1GXTA 1WF1A 2JZ5A 2ZHBA 4Y28C 2MKKA 3OTEA 3NCQA 4OV1A 4XDDA 1X4GA 4AUKA 2X1GA 2YKMA 3DLHA 5DDPC 2R7XA 3I6PA 4RNHA 2AGPA 2G1DA 2FTRA 3QZ8A 2YKPA 4FF2A 4XIUA 1U1PA 4IOBA 2DNYA 1X0PA 3I56S 5HLFA 3QGGA 1UA0A 2GHVC 4QYRA 2ZJPQ 3M2VB 1NRKA 4GO5X 4XDCA 3UD3P 5KT7A 3VAHA 2EBGA 3T5KA 2CQ3A 1Q81T 4RW8A 1OPIA 3TVYA 3C2PA 3OFEA 2V8VA 2OPRB 3BZQA 1DLOA 3BEGB 2AJ4A 2QIFA 1FCAA 4M5DA 3RBEA 4OZNA 3BO3A 4KPYA 5KFLA 4E8UA 3H2LA 4LFCF 1FTCA 1FF2A 2FJAB 1D0EA 1RT7B 2DHXA 4PUOA 2ZM6F 3NMAA 3RW7A 1PILA 1UFWA 3QO9A 4NLYA 1JXEA 2VODA 4KHPF 4Z2XA 5LSLA 2WW8A 3MDFA 1D9AA 1T3NA 2RQ4A 3J81Y 1T7PA 1XTZA 2MSSA 3DRYA 3MECA 1T3OA 4DSFA 1JJHA 5GAHI 4DFJA 2VV5A 4K0KF 1JLBA 2APOA 2QYCA 1NJIT 2ZH9A 1CSJA 4CQ1A 2CQCA 1VRUB 2BE2B 1FVSA 4I7FA 2HHSA 3MPYA 1H6KX 1DFDA 2DNQA 3N4WA 3R3TA 3M05A 4ZCMA 1YSJA 3GR0A 1FEEA 4FBUA 3GILA 5F0WA 5KG0A 3CD6S 4H4MA 1JMTA 2ZDOA 2O5DA 4XAKA 1WF0A 3N0VA 5B0FA 4CZCA 1E6VA 5F3ZA 5J1EA 3RB6A 4EBEA 3ZZRA 5DQHA 3KLIA 2HHHF 4J9RA 1YJRA 2HGLA 1N5TA 1ELOA 2J7WA 4B3TF 1Y0HA 1NHVA 4G1PA 5M2PA 3NBPB 2ZH7A 3QYYA 5FJ4A 4BC9A 2DPJA 5AJ3F 1LW2A 2XG8A 1L3TA 5KG3A 2BR0A 1U48A 4MIAA 3GYNA 2JOQA 2DD8S 2MPUA 1KHVA 2W8KA 3PW5A 3H40A 1Q53A 3PX6A 1LXJA 4KV8B 3T5JA 2VA3A 3CF5Q 4QZVB 1XWLA 3W2WA 1TK5A 2BDPA 3PO4A 4F3MA 3I0SB 2E5GA 4LF8F 1F5BA 1IQZA 2CQPA 4OJ3A 4ECQA 1C4AA 4GMKA 2I1RA 1NK0A 2E7WA 4HVZA 3CGIA 5EWEA 5KFCA 2DVIA 1H0HB 3MAHA 1QAJA 4DR7F 3HVTA 1U24A 4NCBA 1YQHA 5IFMA 2ILYA 1X7VA 3GFYA 4PXEA 3CT9A 1Q8BA 2MYFA 4PKDB 1H2TZ 3FQLA 4A8OA 4RNOA 3MR6A 3ENVA 1RT4A 1WHVA 3MOJB 2EK1A 3ZZPA 2RF2A 1XN9A 2D7SA 5HP1A 2H5EA 1TL1B 4DHVA 4DQRA 2J9CA 3SCIE 2YX7A 1YIJS 2UVVA 4JI7F 1WHWA 2Z2LA 1UVIA 4R5PA 4KB7A 1VBZA 4DL3A 4TLQA 4EZ9A 1RTIB 3JSMB 1FVQA 3CCZA 3T1HF 1HBUB 4X4SA 2L9DA 3LP1B 4HT7A 1XMOF 2VQFF 2HPUA 4LFBF 4O23A 1U1QA 2GGPA 1KHWA 3IG1A 4I2QB 4DF8A 1FD2A 4USIA 2P6TA 3K5MA 4ELVA 2GJIA 5FDLB 2RE1A 3CCVS 1DQAA 2BANA 3CCSS 1R0AB 1FK9A 4OX6A 4QIWD 3PM9A 3I87A 2YY3A 4RNNA 4I2PA 1U6FA 2QT7A 3I82A 4OZ1A 3MUVP 2MHNA 4FYDA 2UZAA 1XNRF 2BZ2A 4J5OA 2UP1A 2C22A 4F4XA 4O3RA 4NL5A 4OZ0A 1WF2A 4UQGA 1KLMB 2KXFA 4DV3F 2GQCA 2NYIA 4D3GA 2CIMA 2WHOA 4B08A 1S1UB 3HZEA 4BS2A 4YB5A 2GHWA 3PW0A 2PA8D 4BWJA 1TKDA 3JSRA 1VBXA 2L9WA 4ZP7A 2ZH2A 3DRPB 3PJXA 3NCRA 2DH8A 2WBMA 2R7QA 3CD7A 4H4KA 1OSCA 4C3LA 2MGZB 3MMBB 1Q8LA 3D28A 4TY8B 4ED8A 2LQBA 3OQ2A 1WTBA 4MIWA 4DFKA 3OFHA 1ZTWA 1CC8A 3DYAA 4W90B 5I3UB 1HI1A 4Q7AA 2JH3A 2VG5B 4NXNF 4QIEA 4NLQA 3DGPA 3CCJS 1H7WA 2LQJA 2F8HA 3GIJA 3BDPA 4ZPWR 5DJBA 4C8OA 1MMNA 4ZCKA 4N56A 2L48A 2YNHB 2DGQA 1SIZA 5DG7A 3KLGB 4EFAC 1NEEA 1VC5A 3M30B 2CPHA 2LDYA 2WRMA 3QWUA 4WFXA 5J2NA 1FRIA 4LVOP 1QSLA 2F4VF 3CCMS 6FD1A 3RAXA 3MD1A 2HWTA 3RZAA 2KYZA 2RH3A 4JI3F 2XSJA 2HNZB 3UR0A 3AQOA 1N0VC 1J2VA 2PI4A 1ZAWA 3M6VA 3Q8SB 5J2MA 3VWSA 4R0JA 1S10A 4I4BA 3H5YA 5F0UA 3G8QA 2J9DE 2BUNA 1LV5A 3E3XA 2IBKA 5F41A 1R3NA 1ZETA 2RUGA 2OPRA 2RS8A 4TU8A 2AP6A 1VQ5S 1S79A 3G9CA 4ZHRA 3KHLA 3T1YF 2KFYA 2QEXS 4G3IA 2PO4A 3C6UB 3EPIA 2XY7A 1J5EF 1GX6A 2UUAF 4OJGA 4ZPCA 1JLCB 4YOEA 4YEAA 1RT5B 1RT7A 4URQU 1RYRA 5CYMB 2FJBB 4TNOA 5KFGA 3LWLA 4OX7A 3V5RA 4DSIA 3C46A 1LXNA 3NNCA 4Y34A 2OPPB 4NZ0A 4ECRA 2XI3A 4ES2A 2UVWA 2BM1A 2RJZA 5L1IA 1P9QC 4IYQA 2VFUA 4AFFA 2BYCA 2J7KA 2BE2A 2OFHX 3EXCX 3LGMA 3OPKA 4PG4A 4KO0B 3IO1A 4RWXA 3CCRS 1BQMB 2JX2A 4HDGA 4ZPVR 3TR5A 5LL6d 2IVFB 5L8RC 1S7HA 3TA1A 1KN6A 4MH8A 4WYWA 2F8EX 2M88A 1U1OA 3W7BA 4PPDA 1FRHA 1SL1A 2DCUB 3IGVA 1P27B 5D78A 3KTQA 4PQUB 1K9MT 1K1QA 2RB7A 4O3QA 3QIDA 3T1AA 4DN0A 4ES1A 1LFPA 2HMIA 2XI2A 5EWGA 2ZE2B 2R7RA 4ETZA 1WG1A 2FD2A 3DOLB 5B0DA 1U47A 4I6AA 3KLFA 3THTA 1MSWD 2JLEA 5KFMA 1D8ZA 1N0UA 1VQKS 2G9OA 5DS7A 1TAUA 2WSCC 2NREA 4NCAA 4KV8A 2E5JA 4QBUA 1HHSA 2DHSA 2HHXA 4X4PA 3BDEA 4FNIA 2Y0SD 5KOXA 1TAQA 1JLEB 2EFPA 1KVJA 3PW2A 1NKEA 4GC6A 3UCZP 3SXLA 1B0TA 2W24A 2MZJA 1IR0A 2HGMA 4CI0B 3PR5B 1HBMB 3UE2A 2QA4S 3MM5A 3IC1A 2PIIA 4LVNP 4C8NA 5C42A 2BJEA 2RS2A 2DO0A 3J7YI 5D3GA 1X5OA 3OHAA 2VASA 4URSA 1I6JA 3EXYA 1QY7A 2EC0A 1JLQA 4NLSA 4YB6A 2PMZD 3HLUA 2DO4A 2OIHA 1ZOTA 2MY7A 3CIZA 3I96A 4KT0C 4EO6A 3GZ7A 1RTIA 3ZC4A 1HBUA 3DLJA 3J7A1 5DQGA 2DNPA 1GTEA 1SJRA 4B02A 2QLWA 4DL4A 3RW6A 1Q79A 3JAMY 2CVEA 4ZS6A 3DU6A 2DR8A 4ZCIA 2ZZNA 2KU7A 1VK8A 4X84A 1LFWA 1S9EB 4I67A 5CYQB 5KFUA 3T3FA 4DSLA 1FT8A 1NNDA 1OPZA 2FHKA 2OPSA 3NAIA 1R0AA 3T6BA 1C1CA 3GQCA