2W4PA

Human common-type acylphosphatase variant, a99g
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
96
structure length
96
Chain Sequence
GNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYLPHOSPHATASE-1
publication title A Rigidifying Salt-Bridge Favors the Activity of Thermophilic Enzyme at High Temperatures at the Expense of Low-Temperature Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 23
structure length 96
sequence length 96
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2008-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2w4pA00
3HDSA 2ZDPA 3QGPA 1MWYA 3BM7A 4HH0A 4Q2LA 3K7RA 4HI1A 1W2IA 4A46A 2FB0A 5KAKA 4NPOA 5F0UA 2OFHX 3HHLB 1Y9OA 1FVSA 2XMTA 2ROGA 3FRYA 2K7JA 4EFAC 2XMUA 1VQYA 2ZDOA 3BB5A 4A48A 2K2PA 5B08A 5B0AA 3FMBA 1YRXA 1YG0A 3LO3A 4DL0C 2W4PA 1FD8A 1P6TA 1Y3JA 2G9OA 2KT2A 3BR8A 5B0CA 2K7KA 2KYZA 2OMOA 3GZ7A 5B0DA 3HF5A 4U9RA 1FE4A 4FNHA 2RU9A 2RILA 3MZIA 5K9FA 1KVJA 1GXTA 2HQIA 1RJJA 2QIFA 1TUVA 1YJVA 2QYCA 4Q2MA 5A6PA 3KKFA 4DPOA 5B09A 1MWZA 4Y2MA 3UDCA 1YJUA 2JDJA 3E8OA 3KNGA 1CC8A 4FNIA 3TRGA 1OQ3A 1Q4RA 5B0GA 3TOQA 5B0FA 2BUNA 2BBEA 3DCAA 5IXUA 2PD1A 2XMVA 1XBWA 5B0EA 4OIXA 1LQ9A 1JWWA 2GGPA 1Y3KA 1N5QA 4DN9A 2N4CA 1K0VA 1V3ZA 2IFXA 4Y2KA 2GCFA 2XMWA 3BN7A 1TR0A 2QLWA 4OJHA 1YJRA 2KT3A 2OD4A 2LQ9A 1WD6A 2KKHA 1AW0A 1TZ0A 1N5SA 2ACYA 4OJGA 5T7LA 1S6UA 3CJKA 3QMQA 2L3MA 1TL4A 3IWXA 2AW0A 2OAUA 3HX9A 1KQKA 2LDIA 1IUJA 1CC7A 5A6WA 4ZA1A 3WDOA 2GV1A 2OFGX 1S6OA 4HH1A 1P8GA 1SI9A 1URRA 2AJ0A 2HLTA 1X0PA 5T7LB 1TL5A 2RMLA 3CJKB 2ROPA 2HFNA 3LGMA 4OJ3A 1KVIA 2W4CA 4Y2IA 1VQSA 3KG1A 2HLUA 3TNVA 4F67A 1OSDA 1SB6A 2OD6A 1GXUA 2FHMA 2IYGA 2RSQA 1AFIA 1JK9B 3I9ZA 1OQ6A 1Q8BA 2QLXA 2FTRA 4QOTA 1FESA 1X7VA 5F0WA 2GFFA 4A4JA 2GGPB 3IWLA 1YJTA 1CPZA 2BJDA 4HI2A 3HHLD 2IYIA 2HFOA 4HL9A 2K1RA 2N7YA 1FE0A 1Y0HA 2GA7A 3KG0A 3LGNA 2ROEA 2XMKA 2EW9A 2N4DA 3DXSX 4OJ1A 3VTIA 1N5TA 1R6YA 1U7LA 1ULRA 2OP5A 2PGCA 2GO8A 3FGVA 4ZOSA 2LQBA 2K1RB 1Q53A 2W4DA 2Q3PA 1Q8LA 1QUPA 3BGUA 2BJEA 1AFJA 1N5VA 2VV5A 2AJ1A 2XMMA 4A47A 1APSA 1X8DA 2ASYA 2VH7A 1FEEA 2HIQA 3BF4A 2BYCA 2LXFA 2OKQA 2XMJA 3BDEA 3F44A 3HHLA 3HHLC 4NL5A 2AP6A 2CRLA 5B0BA 2FIUA 3HFKA 4YDXA 3MCSA 3T9NA 1OPZA 1FVQA 4YEAA 1SQEA
chains in the Genus database with same CATH superfamily
2V5HG 1L3UA 1TL1B 1TUGB 4NYZA 3DLJA 2ZVSA 4LQ9A 5I42B 4F2RA 5J2NB 1GMWD 7AT1B 3EVOA 2LU1A 3LWLA 3R8YA 1CJTB 1VC5A 5J2QA 4FPRA 1ZOTA 1A6LA 2MQLA 1NDLA 2BANA 1RAFB 5HJYA 2WCXA 3E8OA 2MKSA 3HT0A 1IWAA 2J6UA 2ZBQA 1DQAA 3NMAA 2L3MA 3M7VA 4U6PA 5T7LB 2R7OA 2EPIA 4OYXA 3BSCA 3KG1A 2CVIA 4ZK7M 3TUPA 5LSLA 4ZPVR 4DV0J 1XMQJ 5GAHI 2IC3B 5KFBA 4PG7A 1K0TA 1T8EA 3IR6B 4BWJA 2L48A 4ED8A 3VCDA 3U1NA 1VC6A 4FYVB 3WIVA 2BEFA 4J9UE 3BGRB 1U1PA 3FEYB 3TUJC 3MOJB 3UN5A 2M7SA 3ITHB 4AQYJ 1FDDA 4L76A 4LF8J 5ETPA 2E1CA 2PN6A 3KNAA 3RR7A 3HK2A 3AD9C 5LMUJ 5IWAJ 2R2SA 3EZ5A 4X64J 2C22A 4J91A 5KG6A 4B9NA 1DFDA 1RT2A 4FDFA 5L46A 1JWWA 4ED3A 2KVIA 4RWWA 1FJGF 4B17A 1B0PA 3ZZ0A 4XK8C 3CC4S 3Q0AA 3PX6A 2J7WA 1ZM3A 2RDJA 2VFUA 1I6JA 2DGTA 2GVDB 5F8JA 4F26A 1RU2A 3S6EA 5BYQA 1OWXA 4UT4A 2ASLA 4FYWB 1WF2A 1M5KC 4HR2A 4DDFA 3H40A 4USTA 1MW7A 2MDAA 5DG9A 1Y4ZB 3POTB 1CVJA 5HROB 2E7VA 1U45A 1BUXA 1JJ2R 1OMSA 3I5AA 2DJWA 3PW0A 3TZWA 5AJ3J 5DDQC 5CD4A 4Z37A 5HBMB 1HD1A 2BUNA 3D9BA 4OYBA 2B3TB 2YPYA 4JI7F 1H72C 5D78A 1KLNA 2PT0A 4MMOA 3H4BA 2QLWA 1DQ9A 2F3JA 3DDIA 3IWXA 3RAXA 3QIDA 5ETVA 3SDEA 2RMLA 3N79A 4PWUA 1RUSA 1HBOA 1AFIA 1B70B 1OQ6A 1MU2A 1XNQF 1FTRA 1NJYA 5A8RA 2CNKB 4ELVA 4CLSA 2YNGA 1N5TA 1ZAWA 1G6BA 1YITS 4K4VA 4IRDA 1M5VC 4ZPAA 1FRXA 2XSJB 4MH8A 3OVAA 4L74A 3M9NB 3I4HX 5C24B 1T9YA 4ED7A 2VOPA 5HJXA 4CLYA 3OXFA 1JKHA 1NSKL 3A8IA 2YH0A 1FEHA 2BJ8A 4FS1A 3FQLA 3EUNA 2Z2LA 1S0NA 1S7IA 5BR8F 3G96A 1B4SA 2ABYA 4F8RA 1CQNA 1HNXJ 1D9AA 3R5BA 3N5BA 4ZLNA 4EZ9A 3M05A 2OD4A 1N5SA 2J5AA 3W63A 2QL9B 4ZA1A 3I55S 1M5SA 5LSRA 1B7FA 3DGVA 3HHKA 1TAUA 1M90T 1YDLA 1UL3A 1FESA 3N9UC 3W5YA 3HZEA 3V6DA 3T6JA 1HWIA 3CJ5A 3CCWA 3CJ8A 3MCNA 1VRUB 6AT1B 5IC6B 3THPA 2OUGA 4DUZJ 3JSMA 5KFDA 3CJQA 4LRBA 1Q95G 3CMQA 4DPYA 4HH0A 2D3O1 3W2WB 1W2IA 5LXYA 2XM3A 4U96A 3DRXA 1HBNB 2UUBJ 3OJSA 1KHVA 2AYGA 4N8OA 4RL1A 3ZNUA 2Y1LB 4S0MA 3W8GA 1X4BA 1QE1A 2NUUG 1S1TB 1X4FA 3MMAB 4ZVFA 1H2VZ 3HVTB 4N5SA 3I4PA 2QLBB 1TFWA 2QV6A 3NGUA 3I9V9 2ZH3A 3H0PA 2F5GA 4B3TF 3UCUP 3KK1A 2KT3A 1KQFB 1JLFA 1S6UA 3PV8A 1TL7B 2DYAA 1Y5IB 4PQAA 1ZM4A 4F67A 2KJVA 4DUYJ 5HSPA 3R2CJ 2M2BA 3CDWA 4DLEA 2B4PA 4QIEA 5E3QA 3LGNA 4I2PB 1U48A 3LUYA 2FLOA 1S12A 3NAHA 3EVWA 1D09B 4C11B 4DR7F 4M5IA 3G6ES 1WG1A 1NNDA 3OL7A 5AE3A 3PHEA 4PWDA 3CTRA 4LF4J 4NLWA 5IT0A 1RP5A 3EZUA 2IRYA 3NY0A 1DURA 3BJYA 1NLKL 3EWGA 4A48A 1R43A 2CXEA 4JI6F 4JI3F 3KMSA 1EARA 2HNZA 1KD1T 4NLRA 3SCKE 2FPHX 1RAIB 4YS2A 4XDCA 4LF7F 2B8PA 2XYHB 2IBKA 1Q8KA 1GMVA 1S6QA 4OYIA 4DV7J 1OS5A 1FDAA 1M5HA 1EHWA 4JI4J 2PDAA 5EDWA 1RHUB 2DHGA 4B3SF 1X5OA 2DO0A 2I38A 5JVGQ 1LV5A 1IM4A 2FY1A 3G9CA 2AMCB 4LF5F 5MLCV 1SL0A 4B9UA 2XLIA 4PXCA 4A4JA 1K47A 2VQFF 4ZVSB 3EGZA 3CD7A 4DFKA 4I4BA 3SXLA 2PEBA 1F9HA 2FHJA 2N4DA 2DR5A 3W2VA 1A0OB 3AHPA 4TVAB 2BYCA 2OKQA 3OTCA 3QAEA 1YK9A 2Z58B 2XY5A 1WEXA 2LKZA 3TO8A 2OTJS 2A1BA 3GR0A 1SJ3P 1HNIA 4LSLB 1UA1A 4ICLA 2XNQA 2R8HA 5DLGA 2AT1B 2B6AB 4PG8A 4E8UA 2ZH7A 1JB0C 1WHWA 4L73A 3PYFA 3HM9A 2IFXA 2BACA 5CD4H 4ZCKA 4WU2A 2ACYA 1TL4A 3BH6B 5SUHA 2YKNB 2Y0SD 1VJWA 1FTCA 3T1YF 3OL9A 1G2EA 2DIUA 2G2ZA 1T03A 4IG3B 2Q6BA 2QZ8A 4K2XA 3DOKA 1RTDA 3BQ1A 4LRCA 3TQ1A 2KU7A 1ULRA 2LQBA 2R7QA 5T14A 2AEMA 3GPAA 3D68A 2XMMA 1FI4A 3HT3A 7FD1A 2V2ZA 2HFVA 5F3ZA 1DY3A 2PC6A 3CJTA 3TUZC 5D15A 4EWTA 1LWCB 3ZFVA 3G6XA 1V5VA 2XSFA 4DS5A 1FXLA 4RWXA 3UVJA 3ZNJ1 2YNHB 5ETQA 1SQFA 1RACB 2BR0A 3DLKA 3W5ZA 5KG1A 1WC1A 2W2OP 5GMDA 2DNNA 5JVHQ 2V2KA 5DDPC 1T95A 2B51A 2LECA 3OUYA 2RQ4A 3H42A 3RTVA 2CQDA 4IFVB 2WB4A 3GV7B 3CW2C 3BGLA 2K3KA 2YKOA 4MKBA 2OMLA 2EC0A 1UTAA 3I6PA 4OL8A 3EE3A 1J5OB 1PC4A 1ACMB 1UZDA 4ZVEA 2PA8D 2UVRA 3QSYB 4M5DA 4LFBJ 3D6HB 2VG5B 1TV6A 3SYZA 3OW2R 4Q43A 3CJ0A 4M94A 4DL3A 3EPIA 3BKFA 3PRVA 1FD8A 5HAOA 3T5LA 2QSWA 1FWLA 1U6FA 3KLGA 1QTNB 5J1PA 1CG2A 1WACA 2RD5C 2ZJQQ 4ED5A 4CTAB 4OV1A 3MCMA 4ERDA 3MR6A 3OTOF 4GKKJ 3C6UB 1D1UA 1TMMA 3BS9A 1JX4A 5DDOC 3I5BA 5J2PB 5C42B 1XNRF 3VWSA 2F40A 3GV5B 3P5BP 1VQKS 1SH3A 2R7XA 1RWOB 4WXOA 2RRBA 2FGCA 1YZ6A 2AD9A 2W2MP 3RRKA 1TU0B 3M2UB 4RUHA 2A0FB 4ZOSA 1RXOB 4K50A 3OHBA 3LPEA 4ZVGA 3CDBA 2ASYA 2E1PA 2MKHA 4ED2A 2ZH8A 2RJZA 1VDHA 2P6TA 4KFBB 4NLUA 2XMTA 4PQUB 1S48A 4YR0A 4GVBB 2HRYA 5K8NA 2B4OA 4AXJA 1N6QA 3L7OA 3KJVA 2QYCA 3NP5A 4DU8A 1KC8T 3DRYA 2WOMA 1KKHA 5EX0A 2VJUA 2YWEA 1MROA 2FZGB 5J2QB 4H4OA 2BANB 3W9HA 5DDRC 2LEPA 3M2RA 1V3ZA 3FSYA 2WVFA 4I6AA 2ZH4A 2D69A 2MQQA 1VBXA 4DOZA 1S6PB 2V8GA 4KHPJ 1LKZA 2KXHA 3H5YA 3RAQA 4J9QA 4K2JA 2GNKA 4JV2A 4DR1J 4OI6A 1OPIA 2PE8A 4LBPA 2D3UA 2RNEA 4OHZA 3W9JA 3MM5A 2ZZTA 2G0IA 4LR9A 5KT7A 5KFMA 1QLNA 2DR6A 2B7BB 2ZZNA 2XQCA 4X4OA 1V6HA 4CQ1A 2DIVA 2O3DA 4GO5X 4L3KA 1FNMA 2AEJA 3M4XA 4CLFA 2V4JA 3QZ7A 2QIFA 5ETLA 4ZVTB 4PXEA 3FVYA 4WF9Q 4PRFA 2CIMA 3LOUA 4IKAA 2GIRA 1RT2B 1SIZA 3UWTA 1RTJB 1XTZA 2BW2A 4OYPA 2E5IA 5D3GA 2B9EA 2EFQA 2CG8A 3WX4A 2C3UA 4NMXA 1FO1A 4KHMA 1D8ZA 3PVXA 2KM8C 1VCTA 3HD1A 3T19A 1XC9A 4OZJA 1KWMA 1Q53A 3CCSS 2DNOA 3N6MA 3ISND 1BWEA 2CPIA 3P45B 4I56A 4DV3F 5HN0A 5E3PA 4U8YA 2HHSA 4J9VA 3FRYA 3H2VE 2AX0A 1V9OA 1BC6A 4X66J 3R1LA 1IQTA 3KHGA 4NZ0A 2XS2A 4G3IA 3GONA 4L75A 4WPAA 1RGVA 1LFPA 3L7UA 2ZM6J 3MEDA 5KTQA 3VZHA 4IQXA 4C8NA 2ZC3A 4V1Ak 4B3RF 4JP8A 2CA9A 2Z8QA 2WW8A 4RW7A 3MMBA 3MM8A 4JI2J 5ITHA 4IG0A 3SDEB 1LW2A 1HBOB 1B0VA 2QMUB 2HFOA 2YWFA 3N4WA 1WSVA 4P6QA 1MU2B 3PEHA 1YVFA 2W1BA 4ENOA 1WKLA 2XWXA 5A8RB 3HULA 2UUCF 3TI0A 2P9EA 2XBPA 1E6YA 2YNGB 1S76D 3KMQA 2GMHA 2I6WA 2BQ3A 5HP1A 3W9IA 2X7IA 1RT3A 1PBAA 4IFYA 3I5CA 4ZVHA 5A8KA 5B0AA 4NLOA 1P1TA 1NDPA 1JKHB 2QC3A 3HSGA 4WP8A 2HBZB 3CCUS 5KT4A 1YBUA 4KE5A 4LRDA 2IBOA 2NXJA 4LFAJ 4HT5A 1XN9A 3ZC4A 4U7UD 4QW8A 5D4OA 3MM6A 2IY5B 3UDLA 2Y1JA 4DR5J 2W2NP 4USUA 9RUBA 1OYEA 2K3IA 2X3DA 2DXEA 1WHYA 2F63A 3CF5Q 2M3DA 3NS7B 2E9RX 5E33A 2I2YA 1IBKF 3L09A 3NNHA 2ROEA 3VZIA 2XI2A 1FX4A 3D7SB 4UW2A 3V6DB 3GQCA 2R7WA 3ILJA 2E7WA 4F4YA 2RQKA 4A47A 2AJ1A 1VRTA 3C46A 3MEKA 1KLMB 4DQQA 4C3KA 3TA1A 4TQRA 3JSMB 4A8SA 3MI7X 4YQWA 4FXDA 5KG0A 1QJHA 3A4TA 1NB7A 4DFPA 2LEBA 1K8AT 1ZPVA 1WC4A 4G65A 2LQ5A 1U09A 2BE9B 4NA3A 1QE1B 3TJ9A 1RWUA 4UOHA 1RAOA 2WVCA 4OZ0A 1RAEB 4B9TA 1O0PA 3KHRA 3KK1B 4ECUA 3EM1A 1N36F 3IWNC 3SCLE 2MKCA 4CO0A 3QT6A 5BJRA 2RSQA 2F9DA 9ATCB 1NJWA 1S1XA 3Q8RB 1U1KA 2ZITA 5F0WA 4RBVA 2QO3A 1CPZA 4OI4A 3TVKA 3OT9A 2VPXB 2RIJA 4OJ1A 3G2XA 1O51A 4F3QA 2BJ9A 3GIRA 4F0KA 2UXCF 3W5XA 4OFZA 3A1YG 2B4VA 1YJ9S 3RRHA 1WI6A 5L1KA 1Y9OA 1QDUB 5C5JA 4PWDB 1MN7A 5C2CA 2KL8A 3GP9A 1WOOA 3GJSB 4DL0C 2CJ9A 4RR5A 2I1RA 3DI6A 3WC0A 2VDIA 3I96A 4IQMA 1CJUA 4RX6A 4ZITA 2Z2ZA 1Q4RA 4I6WA 4A8WA 2HNZB 4C48A 3CDAA 4B3MF 4C6AA 2OPSA 4YB6A 1X4GA 4KGZB 1J27A 1S6QB 3CO9A 3ZTQA 3OTEA 2ZZMA 1I51B 5GMEA 2M5YA 4QPTA 3UCGA 3E2EA 4JI0F 3I87A 2VF3A 3GFZA 2ZKTA 2NR0A 4X4NA 1TK0A 2JZ5A 3SFUA 3GR1A 2NQPA 4OX6A 3GFHA 3AODA 3EICA 5EWGA 4P2FA 2EKNA 2N3LA 4K8RA 4QZVB 2LXFA 3HHLA 2CQ4A 3W2VB 1HLWA 4ZIWA 3PY8A 3HDSA 4DG1B 1JXEA 2V8PA 2LMIA 3KHLA 4OLPA 3PJ9A 4FYYB 1HNIB 3AA9A 1ICEB 3D5MA 4Q8FA 3AOBA 4ICLB 2JDJA 2C2DA 4LFCF 2BA9A 1NAQA 1TTHB 3VAGA 3MECA 3CE8A 1LXJA 4A8FA 4KPYA 4ILRA 4OJ3A 3LP0B 2DHAA 3TNVA 1R27B 4DV0F 1XMQF 1S49A 3OVSA 3PYGA 3HKWA 1FKPA 1JNZB 3BKUA 3CD6S 4QOTA 4P7TA 2MY7A 5D8HB 2R4FA 1T03B 1HBMA 4OYAA 4TU9A 4N7TA 4FF1A 5E41A 3RB6A 2FJXA 3DOLA 2P2CB 3F41A 1J5EF 4ZN3A 1Q81T 2FVQA 2IDLA 3HHLC 3QT8A 4ZVQB 3HJVA 4HI1A 4AQYF 1UWBB 2QSFA 1WKKA 1PAUB 3UNGC 1R8AA 5IWAF 3K5NA 2KHCA 3D4JA 5DQIA 1U1NA 1RJJA 2DGUA 2FJBB 3NS5A 4F0HA 3UVJB 2IA0A 1UVIA 3RB0A 1IKVA 3HXMA 1BHNA 3O44A 1NDCA 2HS0A 3PM9A 3TEGA 2QJ3A 3DLKB 2BXJA 5CZVA 3WX8A 2LQ9A 1UVLA 5DJBA 2HURA 1NRKA 1IBCB 1RT4A 2D7SA 3QRQA 2HLUA 2FJAB 3OUYB 2XY6A 1FT8A 5IV4A 1VQNS 1RTZA 1GTHA 3AT1B 3R5GA 2YNIA 1Y7PA 3E3XA 4DF4A 3RZAA 3TZXA 4JYAJ 1QTMA 3JQJA 2N7YA 1SC1B 4K7QA 5J2MB 4ZCMA 2JL9A 4USIA 2JNJA 1YLXA 4YOEA 5A8WA 2EFPA 1F3FA 4NL5A 5L38A 5L39A 4DFMA 3Q2SC 2EFVA 3MPUB 3JTNA 4M5DB 2O67A 1EQ0A 4NE9C 4C97A 1IBMJ 3W1YC 1S4EA 2LLZA 2J9EA 2HPUA 5SZTA 5A6PA 1YG0A 4I69A 2VODA 3QAUA 4LF9J 3MPYA 4WIQA 4F7VA 4ELUA 2F8EX 3PW5A 1MG7A 1Z1ZA 3W8PA 1NK4A 1YJRA 3M32A 3CPWR 4RBUA 3D1OA 2ZOGA 2VPWB 4UOFA 3OPKA 1QVFR 3LALA 1SJQA 1YJ7A 1HWLA 3FKBA 5DM7Q 1I94J 3DDKA 4ETXA 3MEGA 5JXSA 5FDLB 4F3OA 1REVA 1D9FA 2MLYA 4E2FB 4M63A 3N5FA 4WJBA 5DGAA 4UOGA 3H4DA 4MIWA 2HHXA 4NA2A 1BD6A 3NLCA 2DEIA 2VBWA 4TLQA 4EBCA 2U2FA 4V19J 5CAAA 3H2UB 5GAGI 4CLUA 1E6VA 3QZ8A 2AU0A 2FLNA 1C0UA 1S5ZA 3K57A 4XO0A 3BR8A 3BREA 5H1SV 4QIWD 2CFXA 4UUWA 5A76A 4KT0C 4U7CA 3KJVB 4EYHB 4YHHF 3N6LA 4ZCLA 1TK8A 2WOMB 2V9WA 1LEOA 3M8SA 1MROB 4DPUA 3CJKA 3M2RB 1YWXA 5KFSA 1PAEX 2ZBIA 4TU8A 1KQKA 2MSSA 1AB8A 3R7BB 4RW6A 2UXDJ 2D3ZA 4OI2A 2MQNA 1H2TZ 2KFZA 4DN0A 1XR5A 3CVKA 5KFRA 2DXDA 3J7Z5 2HHTA 2DHHA 3R7SB 4QWCA 2MJUA 3EMTA 3PYEA 2OEMA 4DUZF 3Q8PB 2KM8B 3AH6A 3AQOA 1Y5LB 1VI7A 4MIAA 4PG4A 3MM5B 4JOUA 1FVQA 2KB2A 4Y6IA 4X4UA 5IQ6A 1NK6A 4C7QA 1IBLJ 1XJWB 1XEZA 2WK4A 5ETKA 4F25A 3IM8A 3A8KA 3FBBA 2AQ4A 2CPXA 2K7KA 2PMWA 4GC7A 4HTIA 3ZTOA 3OQ2A 4UTGA 1RAAB 3MD1A 5LJ3Y 3N01A 4KQZA 2A10A 1HHSA 3CIMA 5HVHA 1VLOA 3CUNA 3C14A 2NPFA 5KFKA 1TAQA 2M52A 4NXNJ 3H98A 2WBMA 1IJEB 1U0HB 3TEHB 3A13A 3RAMA 1HI8A 4W98A 4Q7AA 4O4GB 1P8GA 3OSNA 2J6SA 2DGVA 4ZVPB 2CQ3A 4KH1B 2CPHA 3HO1A 5D3GB 3D1HA 4KR0B 1L3TA 2YWHA 3QRRA 2HAFA 4PR6A 2WVBA 2DEJA 5I3QA 2HHHJ 4NWBA 3B8HA 2VBZA 2Q79A 1XR7A 2MKIA 3S1TA 1CSJA 3M9OB 1APSA 2BKOA 1JXVA 5H9FJ 3EGWB 3T9NA 3GYGA 1N0VC 1CEZA 3CD0A 4ZHRB 4WZQA 4ED0A 2HRTA 1RLDA 1Q86T 3FRZA 3U02A 4CO3A 4RNNA 3IG1B 1FE4A 4BS2A 3PCOB 4NXMJ 5KFPA 4FYDA 2MQMA 3UE2A 4QQBA 2RAQA 4DV7F 2F4VJ 1OYDA 1VHFA 2H1YA 3UFCX 3CD5A 1XIQA 4MYUA 3MEDB 3L9ZA 1SPBP 4I7FA 5HK4A 1S6OA 4QR0A 2ZBRA 2CPJA 1S0VA 3O2IA 5IS2A 2EBGA 4RW7B 4ID8A 4DV1J 3MMBB 2BJDA 3MM8B 3HSZA 1NK8A 4IG0B 1VC0A 4DX5A 3C2PA 1LW2B 2B9XA 1IKWB 2XLJA 4DCJB 3ZZPA 3CJ2A 3T3FA 2A6MA 3FEZA 2VQEJ 3ZTRA 1FHTA 1E6YB 3CIZA 3T6BA 1SIWB 1OO0B 3QRPA 5HP1B 4DL6A 2OPRB 2KZZA 2M8HA 1RT3B 2VU5A 3LQVA 4IFYB 2OLWA 2EEYA 3H8YA 5A8KB 3KKFA 3KK2B 4YDDB 3JYTA 4LREA 3FSIA 3TOQA 4NLDA 2CQPA 4QR1A 3GMGA 2X1AA 2NYHA 3HJFA 3GIIA 1NU4A 2UUTA 1TR0A 2GVZA 2YNFB 2OTLS 3KOAA 1OJ4A 2JEJA 3MR3A 2FD2A 1A9NB 1R89A 1N32J 3L7PA 5IOLA 4DV6J 1HWJA 3FJ2A 3MM6B 5KFWA 1T05A 2IPOB 2BABA 1NCLA 3P49B 4LJMA 3P96A 3DM2B 5A2QU 4EYIB 2JLEA 3MMJA 4J37A 4F4KA 3Q8YA 5F9LA 3KUEA 4FYXB 4EO8A 4F2SA 4NX9A 4Y00A 2OPQA 3T5JA 3RRGA 2LU2A 4WXWA 1VRTB 3EXCX 3M9MB 1WJ9A 4NRTA 1AW0A 1X60A 1QY7A 3C6TA 3QBCA 3DHWC 3B4MA 2W7OA 1SJRA 3TX8A 1KFDA 3SQGA 2H4YB 3DCAA 2UZAA 2HW3A 3UN2A 2VFVA 2H4WB 4QBUA 3PFOA 3DU5A 4A8OA 2EFGA 1HNZJ 1DAXA 4I2PA 3K5PA 2HAIA 2DTJA 3SIPB 3UDEA 3RW7A 6FDRA 1HWKA 5A6WA 5LJ5Y 3LPYA 4IUFA 2DPJA 1TFYA 4HHHA 1EKSA 2CWKA 3BQ0A 4X62J 2J8AA 1N4LA 4ZPDA 1N54B 2IYIA 5KFNA 3UD3P 3ETMA 4KGXB 4NA1A 1S1XB 2OEKA 1C2PA 4ED1A 1HMVA 4M5JA 2DGXA 4DV4J 5AXKA 2XC9A 2KTQA 2IVMA 3OXLA 2J9CA 4E0DA 2HHUA 4O3PA 4F0MA 2R3VA 4NEZA 2KN4A 4ZMMA 1EZZB 1CJKA 2LA4A 3TUIC 5KT5A 2VFTA 2QFJA 1JJCB 3K58A 3DI6B 5B0GA 1CJUB 4OIXA 4WK1A 4GKKF 2V50A 2KVQE 2XMAA 1IVZA 2XEXA 3MTJA 2MYFA 2VA3A 5FLXY 2ZD1B 2OPSB 1DRZA 2Z56B 3MEEA 2HLTA 4QIFA 1UW4A 1WI8A 1QSYA 1WEYA 1VR6A 3FQKA 3G82A 2V9KA 1SB6A 3D6MB 2OD6A 3I9ZA 4DSEA 3THVA 2GJ2A 4M1KA 4LSLA 3QGIA 1FJGJ 1U8WA 1BY9A 5JUMA 2I5JA 1UFKA 2F4FA 3O8WA 1VS3A 5EWEA 3BGUA 3V6JA 1RT7B 3TZYA 4L3NA 1Q7YT 2OSRA 2OGUA 3JAMY 3G86A 3HHLB 2V2QA 4ILMA 5E5NA 2W4PA 4K4TA 2R7TA 2W9BA 3ADAC 3IA0A 3R9LA 1VYAA 1RSCA 1TUVA 1WKJA 4X4QA 4FPIA 2FZKB 1TUWA 4FNIA 4ID5A 3J7ZT 1Q16B 2XCAA 1F5BA 1PKUA 4WE1A 4WK3A 2GMLA 4B02A 3TYTA 4M5HA 4KHPF 2DKOB 1YHQS 3QLHA 3MECB 3M8PA 1HW9A 3MXHP 3H20A 1S99A 2BMBA 3PDNA 2IM1A 5D77A 4DQRA 3MUMP 2NYIA 3DHXA 3UD4P 4JI7J 4CH0S 4DF8A 4HI2A 2GO9A 5AXNA 1KOHA 1QVGR 1FKPB 4DR4F 3G8SA 4QWEA 2WHOA 2GO8A 2YKPA 2PMZD 3DRPB 1HBMB 4IH5A 4FKXA 2OPPA 3MR2A 4LMZA 2F8HA 2CJKA 3KUGA 3DOLB 4DR2J 3IC1A 4I67A 2B5JA 1RHQB 3A3PB 2AEFA 3TJ8A 5EHHA 2X1GA 5F0UA 1XNQJ 3S8SA 1HQEB 4WYLA 4X65J 1FKOA 4J9OA 2HQDA 4MKYA 4Y0FA 3WQPA 2C2RA 4CLKA 5GADI 1VQ6S 5D4LA 5ETMA 4NLTA 1DTTA 3D2WA 1XQIA 4DN9A 1IWGA 2JSXA 5ETNA 5FLXU 3FBEA 1IKVB 2FQQB 3BN7A 1RCXB 5AXLA 2F65A 5LT5A 4TQSA 2CQGA 2L9DA 4WKYA 4C8MA 2E9TA 5HMZA 4OZ1A 1QD1A 5BR8J 1TKXA 2L9NA 3NGDA 3MGJA 3OFEA 2LVWA 2VG5A 3ILIA 4OYMA 3HHNB 1RT4B 4WFZA 2NSBA 1SH0A 3BSNA 1SQGA 1H74A 1RTHA 1K9MT 2YNIB 1BQNB 1NPPA 3EDQB 1HKAA 1R8HA 3T1HJ 3HFVA 3TAMA 5AT1B 2KH9A 2FIUA 3JSBA 2QA4S 2GC8A 5CCMA 2VASA 1GT8A 3H90A 1PG5B 4JB8B 1CJVA 3C15B 5J2PA 2PMHA 5B09A 1MNEA 1NKBA 3C8YA 4HYKA 1HPZA 4OMFG 2AGOA 2D3OR 1AA1B 4PXDA 3IS9B 1HNVA 5IXUA 2ZM6F 1UVJA 4IR1A 4YB1P 3M2UA 3J80Y 3GG0A 1UP1A 2UVUA 3FZ2A 3GJRB 4DJBA 2RQMA 1Y11A 3M32B 4JI2F 5HMWA 3M8WA 2CJQA 3LGMA 1S9EB 4KTQA 3HVRA 2XGPA 2IHR1 4N41A 2EFNA 1D0EA 2M70A 1GK8A 2F1FA 2FUG9 1GXLA 1YTYA 4GVBA 4B3TJ 1OY9A 3J81U 1VOMA 2VDHA 2HHWA 1Q1KA 2D41A 3MEGB 1REVB 3FK4A 2Y9HA 5HQMA 1L3KA 3MF5A 2PEHA 3J7A1 2XGQA 4NLVA 3AJDA 2PI4A 3DFEA 1FXDA 4ECVA 2ZUAA 3J81j 1R6VA 2MXYA 3VHQA 3NGKA 3SV4A 2CNLB 3MHYA 3CJSA 4ZP7A 2EC2A 2MHNA 1S6PA 1NK7A 1E6VB 3PKMA 1C0UB 1GH8A 4I68A 1S97A 2W8KA 1BMQB 4YMEA 4NLYA 2CAJA 4LF1A 3D3CJ 3B78A 4RW4A 1SL1A 5L8RC 4KGKA 4OYWA 3ENQA 2FC9A 5KFAA 4ELTA 8ATCB 4JI3J 4OI3A 1CC7A 3W60A 1L3SA 1FRIA 4ZJLA 3CJKB 2HFNA 3GYXB 2ZEJA 4RW6B 1FRMA 3S7RA 2AHOB 2R2TA 1Q82T 3OR2A 1WWHA 2GQ2A 4PG5A 1EQMA 4WFYA 1T3NA 2DR8A 2OP5A 3R5AA 5CYQB 4X2BA 1T9TA 1HIYA 4B3SJ 4DSLA 1AYEA 2ZE2A 1OY8A 3VAHA 3HD2A 4J9MA 2WVEA 1T9XA 2ZDPA 1T3OA 3BM7A 4LF5J 3V6KA 2L9WA 2V8VA 1VQ9S 1HQ2A 2VQFJ 3D6FB 2OEJA 1C1CA 1RTJA 1M1HA 1ZPWX 2J76E 4AXIA 4NYOA 4IH7A 3MMCA 4FN5A 3EGVA 3DGPA 1XWLA 4MKAA 1RA6A 2W24A 2CQ0A 2YWWA 2I9SA 3K89A 4I2QA 4N77A 5B0FA 3J80U 1VQOS 2KRRA 2UVWA 4YB5A 1UVMA 4C0BA 4C8YA 2R2UA 3G8TA 3O5TB 3NL0A 3C14B 4NOHA 1NEEA 3CWJA 2H54B 2QYGA 3R7NB 5KG3A 2HGLA 1PGZA 2DISA 1W7WA 3LP1A 4NI2A 1HARA 2Y1IA 4HHUA 3TJAA 3QIPA 2JEIA 4UZCA 5DO2A 3T1YJ 1N56A 3H59A 2CPYA 3GJQB 5EGYA 1X4CA 2V69A 2W7AA 4EMDA 1FRHA 2MLXA 2ZDOA 1FRLA 4C8KA 4AFFA 2ZWOA 3WZ0A 4ILLA 4Z7CA 4FF2A 1N33J 2IM0A 4N76A 1U2CA 4M8LA 2XLKA 4QW9A 4K4XA 5HVGA 3KYLA 3P3DA 3EJMA 5DZ7A 3H5UA 7FDRA 2HBYB 1U1QA 2NLWA 3D66A 2XZTB 2W25A 4C9DA 4ZP9A 4TN2A 1B0TA 5RUBA 4C2MA 3TR5A 4XIUA 2CADA 1XMOJ 2H51B 4RZRA 4I7FB 4OI0A 4ECRA 3IP0A 4ED4A 4P73A 2FGOA 1NH7A 4KGVB 2C28A 1U2RA 2E9ZA 2Q3PA 1U1OA 5ETSA 4MIBA 3GWCA 2HVEA 4NCGA 1PCAA 2HRUA 2PI5A 2YQ0A 1F9FA 2XHWA 3CULA 5CYMA 2DGOA 4DS4A 1TKDA 2UP1A 2LXUA 4RU9A 5K5MA 3RB3A 1RHJB 2HEKA 5CABA 2HQIA 5B7WA 2VBYA 3M2VA 2YXLA 4U8VA 4P74A 3MCOA 2BBEA 5HVFA 3JYTB 4RO0A 3SSRA 3CCTA 4GKJF 1NJXA 4OYZA 1Y5NB 1X9WA 2DO4A 4PUOA 1YZ7A 2L08A 1ZS6A 3HX9A 4P71A 4C8ZA 2GVZB 3D54A 1KLMA 2CQ1A 1OSDA 1BQXA 3V5RA 2QLXA 1T05B 4QWAA 2CPZA 2XWYA 3PNIA 1S57A 1BXNA 2GA7A 4K0KJ 5CXTA 3IR7B 2KFNA 2Y8YA 4JI8F 2F8MA 4J5OA 1C1BA 2JHEA 2HVHA 1TELA 1REGX 2C42A 4P2SA 4DWIA 3R1HA 2OPQB 3ETOA 3J7YU 4CNYA 3JS9A 3OV7A 5KAKA 1MMNA 2VG7A 3VGTA 5J1NA 1QAJA 3HMJG 1X4HA 4YB7A 1LFWA 1WC6A 2XYGB 3ILLA 5M2UA 3AD7C 1DTQA 3JXOA 3ZO7A 1T0TV 3C6TB 4AUKA 2B7CB 2RVJA 1CQMA 1SV5A 3SQGB 3FCVA 2IDEA 2JC0A 4OV6A 1B3TA 2HHPA 1IXKA 3F73A 4CM0A 2C3MA 3AOAA 4EGLA 4LVOP 5C2GA 3QT5A 3VR1A 4ZP6A 1KTVA 1TKZA 3ULHA 1RWVB 2M9KA 1LWFA 2YX1A 3QGGA 4IRCA 2YWGA 1J2VA 2CYYA 1KR4A 2ZHOA 1GX5A 2C2ZB 2EBEA 2XZDB 2DNHA 4R8UA 4NLSA 3H7HB 1QAYA 3NOCA 3SQOP 3JSYA 4TY9A 2NXUA 1HMVB 4CNZA 4LRAA 3R5JB 2CUYA 2VIHA 1YJWS 5K20B 4LF9F 2HK3A 1S77D 1VQ5S 2NCKL 1Q5YA 2ZBPA 3MZIA 3BDPA 1EIYB 4USWA 1ZYQA 1CJKB 2UUWA 1HFEL 4UOCA 1DARA 2HG4A 2MZRA 1RTIA 2MEWA 3VQTA 3W65A 4XDDA 3JB9k 3BBBA 2XMWA 3RG6A 4Y2CA 3BSAA 4Y3CA 2DCUB 2ZC4A 1EKRA 2ZFHA 2OAUA 1UJ5A 3R27A 4N47A 5CZXA 4FXVA 1B99A 3E01A 4Q5VA 4BC9A 1FXRA 4FKYA 3MEEB 3V2UC 4PABA 2DY1A 4DG1A 1JLEA 4B9VA 4ZDNA 4OX7A 3G82B 4B9SA 2Q6CA 4D3HA 4M5GA 5F9NA 2AX1A 3M6WA 4DSIA 2J0WA 3B6BA 2ZH2A 1KN6A 2G0JA 5F8LA 2WONA 3OFFA 1NDKA 1NHVA 2I5JB 1Q0NA 2KG1A 2HZAA 2CRLA 3HFKA 2QLJB 1VBYA 1U02A 4CI0B 2IVFB 5C7PA 3LA0A 2QL5B 2DH8A 2VPYB 1RABB 1QM9A 2AWZA 4A8XA 2RT3A 2BJ3A 1FFSB 3LP0A 4Y2MA 2W9BB 4PXBA 4DSFA 5KFVA 1RT5A 2MHEA 2MQOA 4F4XA 1AUDA 3OTDA 2YVSA 1HQUA 4DV2J 1B7YB 1GMWA 2Z0GA 4AT1B 4ID5B 4DX7A 1TMJA 3K8VA 2J6TA 1T7PA 2UXDF 3SMZA 5DM6Q 4WE1B 1BQMA 2XO6A 3WC2A 4I0WA 4ZLPA 2P9CA 3T5KA 4WP9A 3IN5A 3QLHB 1W25A 3M8PB 2RS2A 1DBDA 5GAHU 4PWWA 1UWBA 2AYBA 3FBFA 2GGPB 1QUVA 1DZ5A 1X31C 4ZPBA 2DBBA 4QWDA 4B3RJ 3ZTPA 1LXNA 5DQGA 3C19A 2WVDA 1WDTA 2RB7A 1NXIA 3EXYA 2OPPB 1IBLF 2BQUA 4PZVA 3VAKA 2B5JB 4Z7YA 2EFOA 3PZPA 4W92B 4TYAA 2KYZA 3GZ7A 3KJNB 2HQ3A 2UUCJ 4Q44A 4RNOA 1UKUA 1FKOB 3RBZA 1YJUA 4RBTA 2XO7A 1G3OA 2CQHA 2IM3A 1VMBA 4G1QA 3MPVA 1GTEA 2PIIA 1LK5A 3Q22A 5J2MA 1PBUA 3SV3A 1DTTB 5K14A 3WDOA 1JQGA 2ASJA 2CVEA 4QIGA 5DG7A 1JLAA 2BJ1A 1RI7A 1FERA 2FYXA 3D0HE 3KFWX 1CULA 3GFXA 1TKXB 2HHHF 3NWRA 5K8PA 3ICLA 4J9PA 1UJ4A 3OVBA 4QR2A 2ZH1A 1UW9A 4LSNB 2G2OA 2RRAA 1U49A 2VOOA 1RTHB 3L4BC 2AKWB 5I3PA 4K5SA 1SVDA 1X4DA 4LF6J 5J1EA 3PHTA 3TAMB 3K7RA 2FB0A 5FD1A 4PYDA 1FVSA 1ROFA 1PJ7A 4NXMF 3G6YA 2DGWA 1SH2A 4Q2MA 2ZHAA 5HI7A 5KOWA 2F4VF 1CJVB 1WG5A 1HA1A 1UCNA 3PO5A 4UF4A 2RS8A 3OBIA 2JWNA 1HPZB 5FDLA 1HNVB 4Z2XA 2R42A 2N3OA 2ZOFA 2V4QA 4LUBA 3ZZTA 1U1LA 3DLLQ 4FBUA 1HNWJ 2ASDA 5LSOA 3QATA 3LP2A 4Y2IA 4DV1F 2R8KA 4DR6F 4O4RA 3ENAA 3FCHA 4KIAA 3MURP 4RNFA 3NG8A 1TKTA 5KT3A 3I31A 1FA0A 2G0CA 2V6AA 3GSIA 1UPPA 4RKUC 2BDPA 1YBTA 2CPEA 3AD8C 1WORA 5KFCA 3UI3A 1U26A 3NCQA 4JI1J 1MWYA 3NGRA 1FK9A 4C0OC 1CLFA 4X4PA 5GVQA 2RHQB 4A8MP 4YR2A 2DRAA 4FVCA 4OHVA 2JX2A 2UXCJ 4EI2A 2OELA 4P10A 3QO9A 3MDFA 1WUUA 2DCLA 1PSDA 1Y3KA 1N5QA 3RBDA 1WTBA 3NKYA 4FS2A 1OY6A 2FC8A 5HMYA 1HYSA 4H54A 4H4MA 3IGNA 3IO1A 4TKTA 4RW4B 4DV6F 4P72A 1U1MA 1RT1A 1NSQA 2FHJD 2QG9B 1VQMS 3I56S 5D6GA 2DB1A 1WC0A 1QSLA 3R5CA 2BJ7A 2VJVA 2HBQB 3KG4A 5LMNF 1N34F 3AY0A 1MMDA 1UAWA 1BLUA 3OR2B 4ZS6A 4HHJA 1Q5VA 2DPIA 3HKZD 2YKQA 1X5TA 3BGOP 1S0MA 2CKWA 4JI0J 5K8MA 4HTJA 2ZE2B 2MSTA 1ZM2A 2K7JA 1U0HA 3TQEA 4O23A 3MM9A 2DNPA 3LO3A 3BO3A 4O4GA 2GHVC 3NNAA 1C1CB 3VAMA 2HNYB 3MMCB 2F7VA 3DGPB 4TY8B 1V5IB 1W26A 4R0EA 2M8DB 1HNZF 1I3OB 2VFSA 4I2QB 3D6TB 3QT7A 1KOOA 2AJ2A 5KG4A 3GB0A 1KP6A 5D0HA 5KFQA 3PX0A 1UPMB 3CMAS 1IUJA 2ZNZA 3KLVA 3FCWA 2XTJP 3THTA 3R2DJ 4X62F 3TP2A 1DLOA 2EK1A 4C3LA 4LFCJ 3PYDA 3OHAA 4LR8A 3LGHA 2CNOB 4J90A 4ZHRA 1Y00A 4HDGA 3JQMA 2E7XA 4EEYA 4BHQA 3LP1B 4NI2B 3IRXA 4DV4F 2XMKA 3IG1A 3DXSX 1TQLA 4MT1A 3SEOA 1BGXT 3V4IA 1S7HA 5I3UA 5ETRA 5D4NA 3QIPB 2E5JA 5KOXA 1OPZA 1WF1A 3UN3A 5GAEI 1GFWB 4KH0B 4WKRA 1HBUA 3QGHA 1YBAA 4L6V3 2XNRA 2DNZA 3Q24A 1J5EJ 1R3NA 4DPOA 3VGVA 4O44A 4C3MA 5KFFA 3NCPA 3KK3A 2E1RA 3RW6A 3NOGA 4DSJA 2DD8S 4CO4A 2IAJB 4USMA 2XS5A 1PO6A 4ANDA 1U4BA 2BOAA 3IAS9 4PG6A 4JI5F 2ALZA 1IKWA 3ZZUA 4QU6A 5F3TA 2V4RA 1TP7A 3W61A 2NSCA 1ZETA 4HDHA 3IGVA 4USJC 3DOMA 2WTFA 3CCJS 2EG2A 2OPRA 2HGMA 2XI3A 3D67A 2MMYA 1LWEA 2CJYB 2VPZB 1VISA 4ZVOB 1S10A 3KK2A 1Q8LA 2VH7A 2EI5A 2VICA 4P2MA 1S1UA 2H3EB 5L1JA 3ZZZA 2MZQA 4NCGB 3CC7S 2YNFA 2GJIA 3IRWP 2J0XA 1R8BA 5CYMB 2J0QD 1T9UA 2QN6B 1O8BA 3VAJA 4WZMA 3CXCR 3ZZOA 1VHIA 4LIWA 1X4EA 3KDNA 3DM2A 1DQ8A 3M2VB 2JFDA 1U6BA 3OR1A 1MLAA 3HI9A 3SSQA 1SC6A 3ONQA 1TZ0A 2EWHA 2YKMA 3T41A 4QYRA 3OL6A 1SKUB 1GX6A 4K4SA 1M1GA 4RUAA 4PUOB 4YY3J 4M5MA 4IR9A 1NK0A 3V6HA 4B3OA 3Q86A 1PC5A 2FHMA 2IYGA 5E3RA 2JFKA 3DYAA 1X7VA 4M5KA 1PILA 2BKPA 1FKAF 3JTPA 3RU0A 4LBHA 1S1VA 5KG2A 2JC1A 4DR2F 2ZWPA 1AT1B 4ITSA 1FDBA 1GAOA 4X84A 3FDSA 3KLHA 1RU1A 2YX4A 1C1BB 3W3SA 1SKSA 1KFSA 3HP6A 2CJAA 4X65F 1DJ0A 4DUTA 3KJFB 2MZJA 4K5RA 3BB5A 1UJ6A 2VG7B 1Y3JA 1NO8A 2UUAJ 3VQSA 2IIHA 2VFRA 4DQSA 1T94A 3UNYA 5EUHA 3UDCA 1RYSA 2FJVA 2DRDA 4DEZA 4EZ6A 1EP4A 3PEJA 4P9SA 1H2UX 1DTQB 4XPCA 4WFAQ 1N48A 3GYNA 3AB4B 4J9KA 2ADBA 2U1AA 1SV5B 1H7WA 1SJ1A 2POKA 4WFBQ 1RT6A 4CT8A 1KVIA 2W4CA 4DR3F 4IDKA 4EUVA 1RWNB 4YHHJ 1WC3A 2EK6A 1TVRA 3W64A 3VGSA 4FZVA 2ILZA 4GVLA 1TKZB 3T1HF 2FVPA 3DXBA 3DMJA 1LWFB 5HMXA 4B9LA 2HHVA 3I0SB 4K59A 4WIIA 1GEHA 4R8UB 3MFHA 2CJBA 3HSDA 1EETA 1M1KT 3F0NA 5E3AA 2Y8WA 1U0SA 3KUHA 2ZJRQ 2A6OA 2NS1B 3ZTSA 4EFAC 1P6TA 2ZD1A 2X1FA 3DC2A 4MJKA 1UWAA 2J0SD 1RZMA 2GIFA 5IQQA 3KNGA 3IBFB 2C3YA 2OJ3A 2H5JB 3IAM9 3IFEA 4YP3A 1ELOA 3IMQJ 4JV5F 1RTIB 1JLQA 2R7RA 1ZBTA 4OZ5A 3ZXWA 2UXBJ 1HR0F 1RT7A 4NLXA 4EBDA 3BEGB 2BRLA 5F8IA 2RH3A 3WIUA 5F8NA 3Q23A 3E01B 1L3VA 2VKZG 2HS4A 4L72B 3D1QA 4IOAQ 3DKDA 3JSRA 3ISZA 1JLEB 3GIMA 4NCBA 2RF2A 3I82A 2R2RA 2WONB 3F56A 2AP6A 2AYMA 1K1SA 3UR0A 1RK8A 4N56A 3PKYA 5LL6d 1AUSL 3MPDA 1NK5A 1LOUA 1RAGB 3FMBA 3OJUA 3KLFA 1ZTWA 1WHXA 1U2FA 3FFIA 1HD0A 2YWKA 4WFNQ 1VLYA 2WBRA 4DU7A 3PTWA 4CLTA 5H9EJ 1T02A 1KDNA 3PR4A 3CNQP 2XB2D 1RT5B 2W9AA 4UQGA 4DLGA 5IV3A 1HQUB 5F8GA 3U27A 4ZIVA 3DRPA 3CB4A 5D0GA 1NBEB 2HNDA 4AD6A 4CYUA 1X0PA 3GE9A 1Z4UA 3BO4A 1BQMB 1YRTA 2JRSA 2QA2A 2VC1A 4M5NA 2JOQA 1JLCB 4Q0BA 1SKRA 1KONA 1K44A 1HQEA 4M5LA 3AQPA 1RE1B 2CDQA 3CCMS 3LAMA 4LF8F 2GQCA 2PFFB 4X4TA 4KYZA 2FJWA 4I1TA 1AFJA 5LMUF 3T1AA 4X64F 4J9LA 4YDXA 3MCSA 1FNOA 4XTTA 3DLGA 3BN4A 4A46A 4USKA 2JVRA 5DRKA 3TW0A 2ROGA 3DDNA 3N28A 3W7BA 3CCVS 4R5PA 5A0YB 2WAQD 1N0UA 3RBXA 1FJ7A 2RU9A 3QJLA 5K9FA 5GMKa 4HVZA 3BPDA 3FZBA 4DZ6A 3DN9A 3V4MA 5AXMA 3DLBA 4ECQA 4USHA 4Y2AA 3GIJA 3M1VA 1BQNA 4A8QA 5D0RA 2KZMA 4USVA 4G1QB 5G4DA 5CH7B 3DRRB 5ETOA 3AXMA 4AL6A 3A12A 5CYJA 3P5TL 4P52A 5L1LA 5K14B 1O5JA 4PPZA 4RJVA 3VV2B 1RWPB 4WFXA 1JLAB 4CO2A 3MOZA 2E5LJ 1RDRA 4DL5A 3A8JA 4IH6A 3HHEA 3C15A 1CULB 3ENWA 4OZLA 5KG7A 4EO6A 3CJRA 2B56A 5AJ3F 4LF2A 3IS9A 3PACA 5I4MA 1S1WA 5C25A 2W2PP 1ZA1B 1K73T 1ITPA 3P8BB 1N52B 5IC4B 3DRSB 4C4WA 4KAIA 4K4UA 4QYZJ 2ATCB 3H5SA 1UEVA 2DNQA 2AYEA 1C0TA 2RRNA 2DGSA 5J1EB 2W8LA 2IJNA 2K2PA 2KT2A 1WC5A 2C3OA 2M4MA 1GMUA 2UV8A 1N33F 5GAEU 4RW9A 2FJDB 4WU3A 2IRXA 3UO0A 2Z30B 1S9EA 3FC9A 2Y1RI 1CC8A 3WHIA 5KFUA 2W7PA 1KSPA 4PKDB 3EVMA 4UY85 4BBYA 1GNKA 2DGQA 4N8NA 5EN1A 3OLBA 4Y65A 2MLZA 2LYVA 4KB7A 1XMOF 1NJZA 3MM7A 1PIEA 2C3PA 3BSOA 4NYPA 2GHPA 1S9FA 2X51A 4TU7A 3CDEA 4WTOB 2YPZA 2RE1A 2H5EA 3LP2B 4OHWA 5KFHA 3BQ2A 4F3MA 4F04B 4ZKAA 3O1LA 2W4DA 4HKQA 2O1PA 2HFSA 2VV5A 2AJFE 1S79A 5THWA 2XMJA 1RHMB 1TKTB 2RDDA 2W01A 1YGYA 3BPSP 4NZ6A 1HNXF 1AZSA 3U7JA 2RHSB 3ISNC 4LIRA 1FK9B 2K8GA 3KJQB 3Q8SB 3ILOA 2ZJPQ 2LP4A 3H5XA 2BE7D 3M6XA 2XMVA 3QO9B 3LTOA 2BOPA 2V8HA 3TA2A 5KFLA 1YIJS 2NZCA 2ZH9A 2O66A 4AL5A 5CYQA 1F0XA 1HYSB 4ES2A 4HLBA 2E5GA 2RKIB 4B9MA 4H4MB 3R97A 1R31A 1IKYA 3GILA 4MFBA 4DX6A 3I0RA 3KWMA 2DH7A 2Q43A 1RT1B 1PJ5A 4K0KF 3FEXB 3MUVP 4PPDA 2DR9A 3HHLD 3ENVA 2K1RA 1WDDA 4DSKA 4MK7A 2UUBF 5G0RB 2UVVA 4KRWA 1F5AA 1FWKA 1FEEA 3MAHA 3SCJE 2MY8A 1YKWA 2HZVA 2FVCA 2GS8A 4OLOA 1U8SA 1RKIA 2VG6B 2V63A 3DNCA 3MUTP 2SXLA 2GJFA 3KHHA 1YRXA 4Q8EA 3HVAA 3QFHA 2HMIA 3MM9B 3MWBA 1OQ3A 4IOCQ 4DUYF 4RNHA 4IOBA 3FSXA 5AE2A 2DNLA 4DX8H 3MR7A 2EG1A 2MZSA 5DS7A 2UU9J 4ECZA 3D3BJ 2FJEB 2AW0A 3RBEA 1SI9A 1IM6A 3PXGa 3BO2A 3EZOA 4LF4F 3MAAA 1DLOB 1ZZFA 3BBCA 2BX6A 2EW9A 1R8PA 4KV8A 4F50A 5LXRA 4TYBA 4A8KA 3B54A 3IRXB 5KFJA 4CWBA 3V4IB 2N4CA 4ZVUB 2IVYA 2GMJA 5I3UB 1R0CB 4MYTA 1JLBA 5KFIA 4DR4J 3VALA 4JI4F 5B0CA 1SUQA 5DG8A 1HBUB 4DI6A 1NKCA 4ZJQA 4EU0A 4GRSA 4OYOA 1Z2LA 1Q8IA 5HQLA 4MK9A 2KDOA 4O44B 1RYRA 2GX8A 1H0HB 3KK3B 4YFUA 4F4WA 1O6XA 4ECYA 4MAKA 4OZNA 1LW0A 3CGIA 5U47A 1RWWB 1KEKA 1CS4A 1QAXA 5IFMA 1X4AA 5KG5A 4I64A 3TAQA 4ETZA 1V3SA 3Q8UA 1GQEA 1FJCA 2Q1LA 2A3JA 3DOMB 2KXFA 3AJ2A 4EK2A 2NZ4A 5F41A 2B9WA 4CH7A 2HKEA 4RNMA 1H6KX 1LWEB 2HIQA 2V0NA 1XR6A 3PJWA 1FWPA 3BZQA 4FF4A 1RA7A 1ZZNA 1SQEA 4OX9J 3QGPA 3CEDA 2CG4A 2MPUA 1YJNS 4K4YA 1S1UB 1IJFB 5E0OA 2C1EB 4O3SA 2B8QA 1NUEA 2BKNA 3UR3C 1S4FA 2CZ9A 2MGZA 4CLPA 2HQGA 4DV2F 4O3RA 4ZVRB 1XBWA 3KLIA 5D0EA 1T9VA 3K17A 1VQPS 4C8OA 3T5HA 3Q2TC 1U25A 2GCFA 2AGPA 2YQ3A 5T41A 2HQCA 2MKKA 2F9JA 2DH9A 3OR1B 3K2YA 1IQZA 3CJ3A 1S72S 2CWXA 4NZ7A 2YKMB 3D28A 5HL7Q 1TL5A 1T9WA 5ETTA 2BE2A 3L3CA 2G13A 4YN3B 2G1HA 3TANA 1WTFA 4DV5J 5L1IA 3UCZP 4B3OB 2LCWA 1VFJA 3DYAB 1H3DA 4UUXA 2BM1A 2E5HA 4QU7A 1G1XA 4KO0A 1S1VB 1F5CA 1RHRB 1PYOB 2P8IA 3KLHB 3UQSA 2GZOA 3LH2S 1KTQA 4MTPA 3AOCA 5DETA 2AF6A 1ZM9A 1HL6A 4GMKA 4DL4A 4RPFA 4DCPB 3KDOA 3B4DA 1UZHA 1PYSB 1LQ9A 1Z2ZA 3KLEA 4ALZA 4RW8A 1EP4B 4O0IA 3N6NA 2PSZA 4ZCIA 1U47A 2E1AA 6FD1A 3A3OB 1AROP 3AA8A 1C4CA 4HACA 2HWIA 3NEKA 4LFBF 1GXUA 2HS3A 2V8DA 2LDYA 3MPWA 1RT6B 4ATNA 2HFUA 4IDKB 2MZTA 5KFYA 2JEGA 1TVRB 4CO5A 2V2VA 1HWUA 4PAAA 3VTIA 3ELHA 1VQ8S 2EVZA 3AJ1A 2W9CA 3PG9A 4O3QA 4KJIA 1NPRA 4LF6F 1VBZA 3DMJB 5B0BA 4DMZA 3V81A 4YEAA 5EX3A 4Q45A 4UY8T 1EETB 1SC3B 2ZVIA 2AGQA 5B08A 4PYAA 3FBCA 2GIQA 1S9GA 2A2DA 1N5YA 4KKOA 1F3VA 2RDIA 2CPDA 2LEAA 4KSEB 2OI2A 1F2HA 2ZNYA 3HHDA 3JTOA 5ADZA 3W62A 4WCEQ 3GTYX 3PR5B 1JIHA 3BR9A 1HNWF 3I32A 4C8LA 1JLQB 1RISA 2ROPA 3N0VA 2DVIA 2MQPA 4KBIA 1KS2A 3EPGA 4CO1A 4P2XA 2VKRA 2QRRA 2YQ1A 1KVKA 1Y0HA 3MTKA 2EXUA 3R6LB 4OI1A 1U7LA 1JLFB 1TL3A 4KHRA 3X3UA 2E1MC 1H7XA 1QAIA 4KPCA 3T9ZA 5IZHA 3O6QA 3UD5A 1YSJA 2XHCA 4JI1F 5KFZA 1U24A 1CBKA 2HQFA 4PEOA 1FNXH 2MQ8A 3TA0A 2RF2B 5GAGU 2FLPA 3Q89A 2MKYA 1U6ZA 3NS6A 4Y34A 4ZLJA 3G4SS 2G2YA 3NRBA 1JXLA 1NZ8A 2G9OA 3CT9A 1VIXA 2RU3A 4DBQA 5E2QA 3TVYA 2XYPB 2KRBA 3KLFB 5F8MA 5BXIA 3FFIB 3C16A 4DR1F 2GGPA 4OZ3A 1JLGA 1NB2A 2CPFA 3R6GB 1WNEA 3OL8A 3QMQA 2AZ3A 3AAWB 2HZCA 1NSAA 2QX0A 1RADB 4HH1A 2MZ1A 4URSA 1OIAA 5LM7E 3HFZB 2QFIA 2COLA 3K5MA 3RUBL 2HNDB 2QEXS 2VBXA 4CYUB 2VONA 2JEFA 1WOPA 2FY8A 4Q0BB 3KG0A 4Y28C 3VGUA 4ED6A 2X3GA 2NPIA 3CCZA 5CHCB 3RR8A 4MK8A 2XCPA 3BDEA 2GAGC 5CA5A 1V3RA 3M30A 3EX7B 3MFIA 2KFYA 1SC4B 3PRDA 2XMUA 3DLGB 2QLFB 1VQLS 2M88A 1RWMB 2OMOA 4W4MA 2NXCA 4FNHA 4F4AA 2OHDA 4DQPA 1GXTA 4R5PB 1YJVA 1QSSA 2CZVC 4W90B 2J9DE 3M6VA 1M0SA 2Z57B 2WSFC 4LSNA 3Q8QB 2BM0A 2ATLA 1JNRB 5HLFA 2XULA 1N88A 3M8ZA 1A7GE 3M1VB 1R0AA 2CQ2A 3B82A 3CC2S 2CNNB 4CDIA 3QNWB 3OD2A 3JAMU 4R25A 1VQ4S 2IRUA 3C3LA 3CCES 1U1RA 4GKJJ 2Q66A 1IKXA 1H73A 4X66F 1R6YA 4RLEA 1BE4A 1ZAXA 5JJBA 1F1BB 1YI2S 3HSJA 1FRJA 3QFWA 2LA6A 1LK7A 1UEKA 1HHTP 2YH1A 4ZJOA 2FVSA 1S1WB 5C25B 3TAPA 1XK8A 5E7OB 2KT5A 2G1DA 1SKWA 3K8WA 1PYTA 3DOKB 2WB1D 1RTDB 5MAOA 4JI8J 1C0TB 2LFVA 2E66A 1WHVA 2A18A 2JLFA 2BRKA 1WSRA 4RW9B 1RBAA 4F4ZA 1EB0A 2MB0B 2M0GB 3M8QA 1NK9A 1D9DA 4QCLA 1T11A 2IM2A 5BYRA 3LANA 3GCWP 1SJFA 3DLHA 1SL2A 3RJMB 2DK2A 3MM7B 2I8EA 2ZKUA 3HPOA 1AXQA 3W66A 1JK9B 1FFWB 3Q83A 2V34A 3KXDA 1Q79A 2E44A 4AYBD 3G6VA 2H65B 5K8OA 4F36A 1HHQA 2DNRA 2N82B 4DR7J 3QJPA 2HVZA 3DLEA 1VK8A 1G4CA 2C2KB 2D9PA 1D8YA 3NCRA 3DU6A 3BV8A 2VA2A 2BV3A 4XPEA 2C2MB 4LFAF 1SCJB 4H4KA 1ZAVA 2J7KA 1VK3A 4LVNP 4ZLLA 1AZSB 3C66A 4DR5F 1KNZA 3PIPQ 1XERA 3QYYA 3RB4A 1D3WA 4JI6J 1NM2A 4URGA 4P7VA 1VBKA 8RUCA 1C4AA 3VAFA 4HEA9 5DGBA 2C2NA 5B0EA 2KG0A 1TV6B 1NPKA 3ET6A 2ADCA 4LF7J 3SSSA 2VC0A 2XY7A 4CM2A 4FXWA 3E51A 1EJ7L 3NBPA 4YY3F 4U67Q 2MKJA 2AJ0A 3GG1A 1FFGB 3CCLS 5IM0A 3M8YA 3KLGB 3UW1A 2P6SA 5JMNA 4IRKA 4EBEA 5L9NA 1IKYB 4AL7A 2B9YA 4K4WA 1Q8BA 4MFBB 3R3TA 2GFFA 3PIOQ 3TZZA 4M95A 3I0RB 3TARA 2NREA 3VAIA 4G6VB 2OIHA 1R7IA 4U7UK 2OSQA 1P9QC 4FF3A 2K1RB 5KT2A 2FZCB 4I6YA 3SI8A 2HNYA 1TL1A 2C2EA 3OLAA 4CT9A 3OFGA 3GJTB 4TY8A 4ANEA 4NPOA 4ZPWR 4PCQA 2V67A 5I42A 5J2NA 3UPFA 2UUAF 4H4KC 3GIKA 1WOSA 3GCXP 1CJTA 3GFYA 4OX8A 4NRUA 3NGTA 5B0DA 2R9LA 3PW7A 4OQJA 2G4BA 3BH7B 3ZZRA 1K1QA 2KI2A 1M5OC 4NLPA 4WWSA 1EAYC 2AV5A 2HMIB 2LQ8A 1NSPA 2QGFB 1RLCL 2WRMA 2IJRA 3HZGA 3SCIE 4JUZA 1MSWD 5T7LA 3NAIA 2OFGX 1N6QB 2W2QP 3HCXA 3PJXA 1F9EB 3SFGA 2YY3A 3NXZA 2IC3A 4H4OB 1X5PA 2HGNA 2FDNA 5F8HA 3VVUA 4LRFA 3CMES 3MAAB 1YX2A 2BVZA 2DHSA 2HWTA 3BGRA 1FF2A 4KV8B 3P4UB 4O3NA 3ITHA 4Q2LA 2IAJA 2ZH6A 3LWMA 5CQGA 3AFGA 1JJ4A 4NMLA 5E3CA 3VVTA 2VZ9A 2HBRB 1JLBB 1RWKB 1SXLA 5CCLA 1SUQB 3NNCA 2PD1A 4YUDA 3H25A 4ES1A 1KQGB 4DQIA 2HVDA 2CQBA 1BWVA 4OJHA 2UXBF 5AE1A 3OTBA 1X5SA 4J7CA 2LQJA 3EDRB 2JJ4D 4UQTA 1UEUA 5KFOA 3PW2A 2X1BA 2V4JB 2HSEB 2QMWA 1LW0B 4X4VA 1VQSA 2E29A 3PO4A 5H9EK 2CQIA 1RKJA 4QWBA 4KC5A 2YX7A 3AB2B 4DL7A 1CS4B 1NHKL 1SJ4P 2GVDA 4QJVA 4JV1A 2QTWA 4F02A 2VHGA 3FGVA 2CZ4A 1PJ6A 1NH8A 2UV8G 2DNYA 4P75A 3GLJA 3POTA 5HROA 2Y3YA 1LNQA 4AE5A 3QWPA 1ZTTA 5M2PA 5A2QY 2Y0BB 2QL7B 4U9RA 5HBMA 2WW4A 5M2RA 3IBCB 2DR7A 4NEYA 4WTYA 4DHVA 4DFJA 5D4PA 2V94A 2MGZB 1P27B 4TXSA 4KGMA 2GAHC 2IMOA 3KLIB 2HWHA 1F6TA 3OTOJ 4LSZB 1MN9A 1UETA 2ILYA 3QJJA 1OSCA 1XNRJ 5KT6A 2BE2B 4DXLA 1RB0A 5BYSA 4V19X 2L41A 1FE0A 3CSKA 1RAHB 2DNGA 4TNOA 8AT1B 3R5DA 4CLZA 2XSJA 2I0XA 1I1GA 2BJEA 1HW8A 5C24A 4OHYA 1NMEB 2Z4PA 4KO0B 2YBVA 4DR6J 3LW5C 3L95X 3VF0B 4WBFA 1W2BR 1N8RT 1L5UA 1UVNA 4JV0A 5GADU 1WEZA 1KVJA 2R8GA 4RU2A 2AIRB 3TVZA 4ZPTR 1P1LA 4ECXA 2GHWA 4QYZK 4YR3A 2WSEC 1HI0P 2QA1A 2H48B 2BQRA 1TK5A 2RQCA 4JYAF 2VUGA 1RHKB 3EGNA 1S59A 1WD6A 1IR1A 3KLEB 4RW8B 1I5OB 4U95A 3PW4A 3I0SA 2HHQA 3FMWA 4RUBA 1URNA 4DZDA 2D9OA 2XG8A 3QPIA 3M6UA 1H38A 1FDNA 2E5LF 4HACB 4X4SA 1VRUA 2ZH5A 2AJ4A 4HL9A 2QA4G 1IBMF 3LAKA 3M8RA 1X0FA 4B08A 3CCRS 2PGCA 2Z2MA 1RQ0A 4RUCA 3EYZA 3W2WA 2KHDA 2R7UA 2O01C 2HYIB 2W9CB 1HBNA 2YKAA 2HIYA 2KXNB 3IXQA 3V81B 5LMNJ 1N34J 1S1TA 3MMAA 1MWQA 1Y10A 3SZ2A 4CCHA 3HVTA 1H98A 1FD2A 4LR7A 1KQSR 2ERRA 2CDRB 4CZCA 1F60B 4ECTA 4GC6A 3CDUA 4IO1A 2CQCA 3OFHA 4ANCA 1S9GB 3K5OA 1N5YB 4KKOB 1I94F 1TL7A 3RGIA 5IT4A 2H9ZA 3H2LA 2GV1A 4A8YA 3K5LA 4ZP8A 5HO4A 2B4UA 3MAQA 5KFTA 1NHUA 3IWLA 4C11A 4FBTA 2A2CA 4ECWA 5HANA 1LWXA 3PFEA 1B64A 2BZ2A 1X8DA 4DPTA 1TL3B 2P5VA 5IT9Y 1ZH5A 3OXGA 1RAJA 3MD3A 4K4ZA 2QMXA 4O3OA 2QE5A 2H5IB 1P9YA 1IR2A 4DV3J 3K59A 1FCAA 1WELA 2HFZA 5DQHA 4LT6A 5FIIA 4CIOA 4C98A 3OSPA 2MJNA 4IO9Q 1JLCA 1HI1A 2R7VA 3TRGA 4NASA 1G7CB 5DZ6A 3CJ4A 2WSCC 1UFWA 4ES3A 3FNNA 4J9SA 4UZBA 4BWMA 3C16B 5KFGA 2KKHA 1F2GA 1JLGB 4HT7A 3O3LA 2ZOMA 5L9XA 2IJFA 2KJWA 5HATA 4KY3A 2ZHBA 3Q8VA 2GW8A 3NGSA 2O5DA 2R8JA 2J9DA 1UA0A 1RCOB 3NMRA 2Z2YB 2JVOA 2OO4A 4TLRA 3WBZA 5A0YA 2DRBA 3MR5A 4JI5J 3G87A 2MTLA 4DPXA 4X4RA 2APOA 4MKVA 3BF4A 3F44A 3A8EA 3US5A 1FX2A 4WYWA 5H9FK 4NLQA 4BLGA 4NXNF 3BYRA 1VQYA 3M30B 2B6AA 2FVRA 3DRRA 2N7CA 2RILA 2DNMA 4QIVA 4LQ3A 1R0BG 1WF0A 3QWUA 2V68A 2B43A 2C2OB 3LF0A 1X9MA 2UU9F 1ZA2B 4IYQA 1JMTA 2YKNA 4OJGA 4CH1A 2K06A 3ZZYA 2AJQA 4ZN1A 4IG3A 3G8QA 3D0IE 1NKEA 4DCOB 2ALYB 1KRPA 5HLFB 2RUSA 1RBOB 3DRSA 1R0AB 4URQU 1Q78A 2GQQA 2JLGA 5KFXA 1M5PC 2IA6A 1YJTA 3JQKA 4QPXA 4FP9A 3PRBA 4ECSA 2R8IA 1IBKJ 4O0NA 1R8CA 4C0HA 4BCAA 4OZ2A 5IT9U 1KHWA 3NWGA 1IKXB 4NLGA 2NXEA 3HVWA 1RBLA 1VIOA 2DHXA 3A3NB 1RWXB 3KTQA 4G1PA 4JBCA 3CCQS 1WG4A 2FHKA 2HVIA 4XAKA 2IMWP 1LWCA 4E98A 3J7YI 2OFHX 3GSDA 3PX4A 2AZ1A 2PA3A 4OHXA 2YNHA 4D3GA 3J81Y 3GV8B 4CLWA 1NZAA 1VRQC 3TX0A 4DL2A 2EKYA 2R7SA 1YQHA 2ACMA 3BGFA 2XS7A 2NXNA 4G1IA 3HLUA 1MMLA 4WP3A 1UMJA 3U1LA 1NJIT 2RUGA 1S0OA 1FJEB 4Y2KA 1FRKA 4LBIA 2DXFA 1Q7LB 4R0JA 3M8QB 3CO0P 3AXKA 4IFVA 1JJHA 2FLLA 1URRA 3SBMA 3BBFA 2CJXB 2FHOB 5HQ8A 3QSIA 1YRUA 3BYPA 1VGYA 2PFDA 2PO4A 2VQEF 1N36J 2D74B 3IR5B 1J5OA 2OH2A 4J9NA 3TWZA 4GO7X 4BC7A 5LOQA 2J7UA 4DPWA 1UFLA 1QUPA 2VB6A 2J8SA 4OX9F 3G71S 3U1MA 3RYLA 4DR3J 1X9SA 2VD3A 2LXIA 4CRJA 3FUYA 2ZUGA 3DLEB 3QQCD 2D1CA 1DHMA 2JH3A 4NCAA 3GU0A 3HF5A 2RKIA 3UDVA 2KYXA 1N32F 2VL1A 1UVKA 1IR0A 1XMBA 2NUHA 2BW7A 1MWZA 1SBRA 5A8WB 4CTAA 2QT7A 3X1LB 3C6UA 2XZWA 1K0VA 4CLLA 2DT9A 1EX8A 1KBRA 5G0RA 5DLFA 4B3MJ 3ET6B 3S01A 5C42A 2HK2A 2ZBCA 2LDIA 5EWFA 1VJQA 2B0GA 2YTCA 4BDPA 4CP5A 3NBPB 4DV5F 3P6YC 4ER8A 1IN0A 2DY9A 2VG6A 2DITA 4ZPCA 2FTRA 5IM0B 2DNKA 2WZ1A 4JV5J 4J9RA 4FVMA 3BKTA 3J7AN 3IBWA 1HR0J 2KO1A 3D0GE 1N5VA 1VQ7S 4KFBA 3K0JA 3IM9A 5FJ4A 2P9GA 4PQUA 5KFEA
chains in the Genus database with same CATH topology
3QGPA 3CEDA 2V5HG 2CG4A 1TL1B 2MPUA 1YJNS 1L3UA 4HI1A 4NYZA 4AQYF 4K4YA 1UWBB 1S1UB 3DLJA 1IJFB 5E0OA 1YJWS 2QSFA 4O3SA 4LF9F 3UNGC 2ZVSA 1S77D 1VQ5S 1R8AA 3UR3C 4LQ9A 5I42B 4F2RA 5J2NB 1S4FA 5IWAF 2LU1A 3MZIA 3K5NA 3BDPA 2KHCA 1ZYQA 3LWLA 5DQIA 1U1NA 1RJJA 1VC5A 2DGUA 5J2QA 2MGZA 4FPRA 2FJBB 3NS5A 1ZOTA 1A6LA 2MQLA 2BANA 2WCXA 2UUWA 3E8OA 4DV2F 2IA0A 1HFEL 4UOCA 4O3RA 1DARA 1UVIA 3RB0A 1IKVA 2HG4A 1XBWA 2MZRA 3KLIA 2MKSA 1RTIA 3HXMA 3VQTA 3O44A 1VQPS 2HS0A 4C8OA 3PM9A 3T5HA 4XDDA 3JB9k 3Q2TC 3DLKB 1U25A 2GCFA 2XMWA 2AGPA 4Y2CA 3BSAA 2BXJA 5CZVA 2YQ3A 2J6UA 2LQ9A 4Y3CA 1DQAA 5T41A 3NMAA 2MKKA 1UVLA 2F9JA 2DH9A 3OR1B 2L3MA 3K2YA 2DCUB 2ZC4A 5DJBA 2ZFHA 1IQZA 1UJ5A 2OAUA 3R27A 4N47A 3CJ3A 5CZXA 4FXVA 1NRKA 4U6PA 1S72S 3E01A 4NZ7A 2YKMB 3D28A 5T7LB 5HL7Q 4Q5VA 1TL5A 1RT4A 2R7OA 2EPIA 2D7SA 4BC9A 2BE2A 3BSCA 3L3CA 3KG1A 2HLUA 2FJAB 3OUYB 1FXRA 2CVIA 2G13A 4ZK7M 2XY6A 3MEEB 3V2UC 5LSLA 1FT8A 3TANA 4ZPVR 1VQNS 1WTFA 4DG1A 1GTHA 1JLEA 5GAHI 2YNIA 4ZDNA 5L1IA 4OX7A 3UCZP 1Y7PA 3E3XA 4DF4A 4B9SA 2Q6CA 3RZAA 4B3OB 2LCWA 4D3HA 1QTMA 5F9NA 2IC3B 2N7YA 2AX1A 1VFJA 5KFBA 3M6WA 3DYAB 1H3DA 4DSIA 2J0WA 5J2MB 4ZCMA 2ZH2A 1KN6A 4UUXA 4PG7A 2BM1A 2E5HA 5F8LA 2JL9A 4USIA 2WONA 3OFFA 1K0TA 4QU7A 1G1XA 1T8EA 4KO0A 3IR6B 4BWJA 2L48A 4YOEA 5A8WA 4ED8A 1S1VB 1NHVA 2EFPA 1F5CA 2I5JB 3U1NA 3VCDA 2KG1A 1VC6A 4NL5A 2CRLA 3HFKA 5L38A 1VBYA 5L39A 4CI0B 2IVFB 3BGRB 1U1PA 4DFMA 3Q2SC 3KLHB 3FEYB 2EFVA 3TUJC 3UQSA 3MOJB 3LH2S 3JTNA 4M5DB 2DH8A 1KTQA 2O67A 2VPYB 4MTPA 2M7SA 3ITHB 4C97A 2LLZA 1FDDA 5DETA 1QM9A 2AF6A 2HPUA 2J9EA 1ZM9A 5SZTA 1HL6A 2AWZA 5A6PA 1YG0A 4I69A 4A8XA 2VODA 3QAUA 2RT3A 2E1CA 4GMKA 2PN6A 3KNAA 3MPYA 3RR7A 3HK2A 4DL4A 3LP0A 4Y2MA 2R2SA 2W9BB 4PXBA 3EZ5A 4DSFA 4ELUA 5KFVA 1RT5A 2MHEA 2MQOA 2C22A 2F8EX 4F4XA 1AUDA 5KG6A 3OTDA 4B9NA 1DFDA 1RT2A 3B4DA 2YVSA 1HQUA 1LQ9A 3PW5A 1JWWA 4ED3A 2KVIA 2Z0GA 4RWWA 4ID5B 1Z2ZA 1FJGF 3KLEA 4ALZA 1Z1ZA 4RW8A 1NK4A 1EP4B 1YJRA 3K8VA 4O0IA 3N6NA 2J6TA 1T7PA 3M32A 2UXDF 3SMZA 2PSZA 4ZCIA 1U47A 5DM6Q 2E1AA 4WE1B 1BQMA 4B17A 6FD1A 3CPWR 4RBUA 3WC2A 4I0WA 1AROP 4ZLPA 1B0PA 3AA8A 2P9CA 1C4CA 3D1OA 3T5KA 2HWIA 3ZZ0A 4XK8C 3IN5A 2ZOGA 3CC4S 3QLHB 3Q0AA 3PX6A 1W25A 2J7WA 3M8PB 2RS2A 2VPWB 1DBDA 4LFBF 1GXUA 2HS3A 3OPKA 5GAHU 1QVFR 2V8DA 3LALA 1SJQA 1UWBA 2LDYA 3MPWA 2AYBA 1HWLA 1RT6B 5DM7Q 1ZM3A 4ATNA 2GGPB 3DDKA 4ETXA 4IDKB 3MEGA 5JXSA 5FDLB 2RDJA 1QUVA 2MZTA 1REVA 2VFUA 5KFYA 2JEGA 4F3OA 1D9FA 1TVRB 1DZ5A 4M63A 4CO5A 1HWUA 1I6JA 3VTIA 3N5FA 4ZPBA 1VQ8S 2EVZA 2DGTA 2DBBA 4WJBA 4QWDA 5DGAA 5F8JA 4F26A 1LXNA 3S6EA 5BYQA 3AJ1A 5DQGA 3H4DA 2W9CA 4MIWA 1OWXA 2HHXA 4O3QA 4KJIA 2ASLA 2RB7A 4NA2A 4LF6F 1VBZA 1BD6A 1WF2A 1M5KC 3NLCA 3DMJB 5B0BA 4DDFA 2VBWA 3EXYA 4DMZA 3H40A 3V81A 4YEAA 2OPPB 5EX3A 4Q45A 1IBLF 1MW7A 2BQUA 2MDAA 4TLQA 5DG9A 4UY8T 1Y4ZB 3VAKA 4EBCA 2U2FA 4V19J 2B5JB 3H2UB 5GAGI 2EFOA 3POTB 3PZPA 5HROB 1CVJA 1E6VA 1EETB 4W92B 3QZ8A 2AU0A 2FLNA 1U45A 2AGQA 1C0UA 5B08A 1JJ2R 3K57A 4TYAA 4XO0A 3BR8A 2KYZA 3GZ7A 2GIQA 3BREA 3I5AA 2DJWA 4QIWD 5H1SV 2CFXA 2HQ3A 4Q44A 4UUWA 4RNOA 1UKUA 1FKOB 3PW0A 1S9GA 2A2DA 4KT0C 4U7CA 1N5YA 5DDQC 4KKOA 1YJUA 4Z37A 5HBMB 2RDIA 4RBTA 3KJVB 1HD1A 4EYHB 2BUNA 4YHHF 2CPDA 3N6LA 2XO7A 4ZCLA 2B3TB 1TK8A 2LEAA 2WOMB 4KSEB 4JI7F 1G3OA 5D78A 2V9WA 2CQHA 2ZNYA 2IM3A 3HHDA 1VMBA 3JTOA 1KLNA 4G1QA 3M8SA 5ADZA 3MPVA 2PT0A 1GTEA 2PIIA 1LK5A 1MROB 4MMOA 3H4BA 3Q22A 5J2MA 2QLWA 3SV3A 4WCEQ 3PR5B 1DTTB 1JIHA 1DQ9A 3BR9A 1HNWF 2F3JA 5K14A 3CJKA 3M2RB 3IWXA 3I32A 1YWXA 5KFSA 2ZBIA 4TU8A 1KQKA 2MSSA 4RW6A 4C8LA 3WDOA 3RAXA 2ASJA 3QIDA 1JLQB 2CVEA 4QIGA 2D3ZA 1RISA 3SDEA 5DG7A 2RMLA 4OI2A 2ROPA 3N0VA 2MQNA 1H2TZ 2DVIA 1JLAA 2KFZA 4DN0A 2MQPA 1XR5A 3N79A 4PWUA 3CVKA 5KFRA 1HBOA 4KBIA 1RI7A 1FERA 1KS2A 1AFIA 1OQ6A 3EPGA 1MU2A 3D0HE 3KFWX 3J7Z5 3GFXA 4CO1A 1TKXB 2HHHF 5K8PA 4J9PA 3ICLA 1XNQF 1FTRA 2HHTA 1NJYA 1UJ4A 2QRRA 2VKRA 4QR2A 5A8RA 4QWCA 3OVBA 1Y0HA 2ZH1A 4ELVA 3MTKA 4LSNB 2MJUA 2YNGA 4DUZF 1N5TA 1U7LA 1ZAWA 4OI1A 3Q8PB 2KM8B 2RRAA 1JLFB 1G6BA 1TL3A 4KHRA 1YITS 3X3UA 2E1MC 3AH6A 1H7XA 1U49A 1QAIA 2VOOA 3T9ZA 3AQOA 4K4VA 5IZHA 3O6QA 1RTHB 4IRDA 1M5VC 1Y5LB 1YSJA 4ZPAA 4JI1F 5I3PA 1U24A 5KFZA 1VI7A 1FRXA 2XSJB 4MIAA 4MH8A 3OVAA 4K5SA 3MM5B 4PG4A 4JOUA 1FNXH 1FVQA 1X4DA 2KB2A 4Y6IA 3TA0A 5IQ6A 3I4HX 2RF2B 5J1EA 3M9NB 4X4UA 5C24B 3TAMB 5GAGU 1NK6A 4C7QA 3K7RA 2FB0A 2FLPA 5FD1A 4ED7A 1FVSA 1XEZA 2VOPA 3NS6A 1U6ZA 1ROFA 2WK4A 3OXFA 4Y34A 3G4SS 1JKHA 3NRBA 4F25A 1JXLA 2AQ4A 2G9OA 3CT9A 2CPXA 4NXMF 2K7KA 1VIXA 4GC7A 4HTIA 3OQ2A 2YH0A 4DBQA 2DGWA 2RU3A 1SH2A 3G6YA 3MD1A 1FEHA 5LJ3Y 5E2QA 4FS1A 4Q2MA 3TVYA 3FQLA 3EUNA 2Z2LA 2ZHAA 5HI7A 1S0NA 2KRBA 3KLFB 5KOWA 3N01A 2F4VF 5F8MA 4KQZA 5BR8F 2A10A 3G96A 1WG5A 1HA1A 3PO5A 1HHSA 3CIMA 3FFIB 4DR1F 2ABYA 3CUNA 2RS8A 3OBIA 2GGPA 2JWNA 1HPZB 4F8RA 2NPFA 5FDLA 5KFKA 1JLGA 1TAQA 1CQNA 1HNVB 2M52A 4Z2XA 1D9AA 3R5BA 3H98A 2N3OA 2ZOFA 3N5BA 4EZ9A 2WBMA 3M05A 2CPFA 2OD4A 1WNEA 1IJEB 1N5SA 3OL8A 2V4QA 3QMQA 2J5AA 3RAMA 4LUBA 1HI8A 3AAWB 2HZCA 4Q7AA 3ZZTA 4ZA1A 4O4GB 3I55S 1M5SA 1U1LA 3DLLQ 4FBUA 4HH1A 1P8GA 5LSRA 2MZ1A 4URSA 1OIAA 2ASDA 1B7FA 5LSOA 3OSNA 2J6SA 2DGVA 2CQ3A 3HHKA 4Y2IA 3LP2A 4DV1F 1TAUA 2COLA 2R8KA 4DR6F 3K5MA 4O4RA 2HNDB 1M90T 2QEXS 2VBXA 2CPHA 3HO1A 5D3GB 1UL3A 3D1HA 4KR0B 2JEFA 1FESA 3FCHA 3N9UC 1L3TA 2VONA 2YWHA 4KIAA 3HZEA 4PR6A 3MURP 3V6DA 3T6JA 1HWIA 3CJ5A 3CCWA 4Q0BB 3KG0A 4RNFA 5I3QA 4NWBA 4Y28C 4ED6A 1VRUB 3NG8A 2X3GA 2NPIA 3B8HA 2VBZA 1TKTA 5KT3A 2Q79A 3CCZA 5CHCB 3I31A 1XR7A 3THPA 1FA0A 2MKIA 3JSMA 3RR8A 3S1TA 5KFDA 1CSJA 2G0CA 3M9OB 1APSA 4RKUC 2BDPA 2CPEA 4MK8A 2XCPA 3BDEA 5H9FJ 5KFCA 3EGWB 3T9NA 3UI3A 1U26A 1V3RA 5CA5A 3NCQA 1MWYA 3M30A 4HH0A 3EX7B 3W2WB 1W2IA 1N0VC 3MFIA 5LXYA 1CEZA 3CD0A 1FK9A 4ZHRB 2KFYA 4C0OC 4WZQA 4ED0A 3DRXA 3PRDA 1HBNB 2XMUA 1Q86T 3DLGB 1CLFA 3FRZA 4X4PA 3U02A 5GVQA 3OJSA 1VQLS 4CO3A 2M88A 4A8MP 1KHVA 4RNNA 2AYGA 4N8OA 2OMOA 3IG1B 4YR2A 2DRAA 1FE4A 4FNHA 4FVCA 4BS2A 4DQPA 1GXTA 4R5PB 1X4BA 2JX2A 4OHVA 1YJVA 5KFPA 1QE1A 2NUUG 1QSSA 4FYDA 1S1TB 3QO9A 2MQMA 1X4FA 3MMAB 3UE2A 4ZVFA 4QQBA 3MDFA 1H2VZ 2CZVC 4W90B 3HVTB 4DV7F 2J9DE 4N5SA 3M6VA 2DCLA 3I4PA 1TFWA 1PSDA 1VHFA 2QV6A 1Y3KA 1N5QA 3RBDA 3UFCX 1WTBA 3I9V9 3NKYA 2ZH3A 4FS2A 3CD5A 2FC8A 1M0SA 5HMYA 1HYSA 2WSFC 4LSNA 4MYUA 4B3TF 3UCUP 3KK1A 2KT3A 4H54A 3Q8QB 2BM0A 4H4MA 1KQFB 3IGNA 1JLFA 3IO1A 1S6UA 3PV8A 4TKTA 3MEDB 2ATLA 4RW4B 1JNRB 4DV6F 1Y5IB 2XULA 4I7FA 4PQAA 5HLFA 1N88A 1U1MA 1A7GE 3M1VB 1R0AA 1S6OA 2CQ2A 4QR0A 1RT1A 1ZM4A 3B82A 3CC2S 2FHJD 2CPJA 4F67A 1S0VA 1VQMS 3O2IA 5IS2A 5D6GA 3I56S 4R25A 2KJVA 2EBGA 1VQ4S 4RW7B 4ID8A 2IRUA 3C3LA 2DB1A 1QSLA 3MMBB 3CCES 2M2BA 1U1RA 3R5CA 2BJDA 3CDWA 4DLEA 2B4PA 3MM8B 4QIEA 2Q66A 1IKXA 5E3QA 3KG4A 5LMNF 1NK8A 4IG0B 3LGNA 4I2PB 1U48A 3LUYA 1N34F 2FLOA 3AY0A 4X66F 3NAHA 1VC0A 1MMDA 1UAWA 3C2PA 1LW2B 1R6YA 4RLEA 1ZAXA 4C11B 2B9XA 1BLUA 4DR7F 3OR2B 3G6ES 1WG1A 1IKWB 4ZS6A 5JJBA 2XLJA 1NNDA 4HHJA 3OL7A 1YI2S 3ZZPA 5AE3A 2DPIA 3CJ2A 3T3FA 3HKZD 1FRJA 2YKQA 2LA6A