2W4PA

Human common-type acylphosphatase variant, a99g
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
96
structure length
96
Chain Sequence
GNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Rigidifying Salt-Bridge Favors the Activity of Thermophilic Enzyme at High Temperatures at the Expense of Low-Temperature Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ACYLPHOSPHATASE-1
total genus 23
structure length 96
sequence length 96
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2008-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2w4pA00
2LXFA 4DL0C 2FIUA 2QLWA 1S6OA 1SI9A 2HQIA 2IYGA 2XMTA 2XMWA 4OJ1A 4YDXA 5B0DA 2GV1A 2N4CA 1TUVA 2HFNA 2GFFA 5B0EA 3MCSA 1GXUA 3HFKA 3FRYA 1Q8LA 2HFOA 1QUPA 3TOQA 2RMLA 3WDOA 2K1RB 1Q53A 2BJEA 2OFHX 3BB5A 1AW0A 1OSDA 2K1RA 2OAUA 4OJHA 2IYIA 3UDCA 4F67A 5B09A 1Y3KA 2K7KA 2AW0A 5T7LA 2QLXA 2KT2A 1Y3JA 2XMMA 2EW9A 5A6WA 2N4DA 4A4JA 1KVIA 1CPZA 1SB6A 4ZA1A 4HL9A 1RJJA 2G9OA 2OD6A 2W4CA 1YJUA 1FESA 3BR8A 1N5SA 1TZ0A 1YJTA 5KAKA 3LGNA 4HH0A 4Q2LA 2KYZA 2ZDOA 2BJDA 1YJRA 2OD4A 1VQYA 3BGUA 2W4DA 3GZ7A 3HHLA 2QYCA 1CC8A 2VV5A 3E8OA 3IWLA 4NPOA 4DPOA 4A48A 1OQ6A 3I9ZA 2BUNA 2AJ0A 2K7JA 2GCFA 3FMBA 2HIQA 2W4PA 4A47A 2QIFA 2OFGX 3HHLC 1LQ9A 1OPZA 1KVJA 3T9NA 1TL5A 3MZIA 2CRLA 2XMVA 3KNGA 1YG0A 2LDIA 1N5TA 3K7RA 1X8DA 2GGPA 3TRGA 2ROEA 2GGPB 1XBWA 2IFXA 2LQBA 3CJKA 1P6TA 2HLTA 4YEAA 1AFJA 1JWWA 1FD8A 1W2IA 5T7LB 3LGMA 2HLUA 1AFIA 3HX9A 1X7VA 2GO8A 2PGCA 2ROPA 2AP6A 2L3MA 2BYCA 4Y2IA 4Y2MA 3BF4A 1U7LA 1FVQA 1X0PA 5B0GA 4NL5A 3KG0A 4ZOSA 5B0AA 1TR0A 3BN7A 4Q2MA 2PD1A 1FVSA 1S6UA 2ROGA 5K9FA 3KG1A 1GXTA 3HHLB 5F0WA 3F44A 1URRA 3CJKB 5B08A 2FHMA 1CC7A 1Q4RA 2RSQA 3HHLD 3QGPA 3VTIA 3BDEA 1FE4A 1VQSA 2RILA 3LO3A 4QOTA 2ASYA 1TL4A 1Y0HA 3KKFA 4DN9A 1P8GA 1ULRA 2XMKA 4OJGA 1FE0A 2VH7A 1K0VA 1MWZA 2OKQA 4FNIA 1Q8BA 3BM7A 2XMJA 2JDJA 2LQ9A 5F0UA 2ACYA 2GA7A 3IWXA 5A6PA 2KT3A 2OP5A 5B0CA 4Y2KA 5IXUA 2XMUA 3HDSA 4HI1A 4EFAC 4HI2A 5B0BA 2N7YA 3DXSX 1N5QA 2AJ1A 1JK9B 2FTRA 4U9RA 1SQEA 2FB0A 3DCAA 5B0FA 2K2PA 3TNVA 2OMOA 2RU9A 4FNHA 1FEEA 1IUJA 4OJ3A 1R6YA 2KKHA 1APSA 1KQKA 4A46A 1N5VA 4OIXA 1V3ZA 1Y9OA 1OQ3A 3QMQA 4HH1A 1YRXA 2Q3PA 2BBEA 3HF5A 1MWYA 3FGVA 1YJVA 2ZDPA 1WD6A
chains in the Genus database with same CATH superfamily
3U1MA 4OYIA 1HBOB 1S6OA 2XMTA 1RWNB 4RUHA 4OQJA 1F5CA 1IR0A 2DRAA 2WRMA 5B0EA 1RTDA 1GXUA 2AQ4A 4CQ1A 2V5HG 1DQ9A 3KLIA 1SC4B 3MGJA 3HKWA 4ZPVR 1QUPA 4AXJA 3KJVA 2HQFA 4LSNB 5DJBA 3TJAA 5LMUJ 4DFPA 4IDKA 2F63A 2ASJA 2OFHX 1TK5A 3CD0A 4NRTA 1REVB 4WK1A 2DNKA 4F50A 3JS9A 3BGRA 1YZ7A 2F9JA 3FCVA 2HFZA 3PEHA 3J81j 1HWKA 2KT2A 3SI8A 4DSEA 2ZBRA 4L74A 5LL6d 4A4JA 4WFNQ 2DXEA 2X7IA 5KG2A 1A0OB 1JLFB 2W4CA 2HVHA 5HMXA 4QIGA 5E0OA 3TW0A 3WQPA 4UZCA 2XWYA 4M5DA 2VIHA 2OUGA 5KFMA 4ECUA 1N48A 5C2CA 2BJDA 2G13A 2V34A 2X1AA 2B43A 5KFBA 1JMTA 2B4VA 2X3GA 3BPDA 3PEJA 5J2NA 4Z7YA 2HZCA 2JEFA 2H4WB 4W98A 2UUCF 1AZSB 4DPOA 1Y7PA 1OQ6A 2QL5B 1NCLA 3TJ8A 1SIZA 2BUNA 2AJ0A 3DRSB 4K8RA 2G1DA 1WELA 3EDRB 5CZVA 2IDLA 1VQMS 2D3OR 4LREA 5C24B 3PRDA 2RHQB 3AT1B 5E3AA 4ZLLA 2ZJRQ 1K47A 2Z2ZA 3TUZC 1RT4B 3QPIA 3IS9B 2GQQA 1QVGR 2BW7A 2IRYA 2LLZA 3GR1A 3QGHA 4QR1A 2KL8A 3PV8A 1S0NA 3OFEA 2HG4A 2G2OA 4OZ2A 3WX8A 4MIWA 5DQHA 1RLDA 3EDQB 1HPZB 4ICLB 5GAEI 2LQBA 5KFSA 1J2VA 1QTNB 3AXKA 4CT8A 5GAGI 1FD8A 4OHYA 4EEYA 3K0JA 2XSJB 2V63A 4DV4J 5G4DA 4NLSA 2NPIA 4PQUA 4A8MP 1XNRJ 1WC4A 4B3RJ 1GQEA 1O51A 3DM2A 3GSDA 3M2VB 4A8KA 5B0GA 4CCHA 4HACB 1U1LA 2JEJA 4QIWD 2DEJA 2MQNA 5EHHA 5JVHQ 1S10A 2OELA 2CYYA 2EVZA 4YR0A 2YNGB 1AT1B 1TV6A 2DNLA 1SL1A 2HYIB 1HD0A 1K73T 2J7WA 2MZSA 4R25A 3QJPA 3MMBA 2R7TA 3AOBA 3UN2A 3QO9B 4M95A 1MMLA 3VTIA 4KGXB 1S1XB 2RRBA 4M5HA 2PMHA 4IKAA 5CABA 2OSQA 3NLCA 2AV5A 3QT8A 5F8LA 4C8YA 3D1OA 4Y2CA 1OY6A 2CG8A 1TKZA 1FDDA 3MM5B 3VQTA 5F8GA 2E1PA 2W9CB 2VONA 2V67A 2CJKA 2FC8A 3OBIA 3HK2A 3GMGA 1S57A 3LAMA 3MEGA 5A6PA 6AT1B 4ZLJA 1HQUA 2Q6CA 2XMUA 3MAAB 4ZHRB 5ADZA 5HROB 2YH0A 4CWBA 2J6UA 4DS5A 1TVRB 3PYEA 1M5KC 2BJ9A 2FY8A 1V3SA 3HVTB 1SQEA 3NNHA 2FUG9 2CPEA 3GCWP 1RHKB 4WYWA 4BWMA 1N6QA 1JXVA 4CO0A 2GNKA 3PHTA 3THPA 4EWTA 4P52A 1IN0A 2ADCA 1XJWB 3Q22A 1PILA 5ETNA 5KFIA 3J7ZT 2CUYA 3A3OB 5IQ6A 3QWPA 3R5AA 4YDXA 3SCIE 1ZOTA 5KG0A 5HANA 2MZQA 2Y0SD 4ECZA 5KFOA 2U2FA 3E01A 2HZAA 5CH7B 3W64A 4CH0S 2A0FB 2RS8A 2E5IA 3K59A 3E2EA 2LEBA 5J1NA 4CLLA 1S0VA 2R7SA 1FK9B 2OI2A 4IG3B 5L1IA 4WK3A 1IKXB 1FKPB 2K7KA 3I56S 1K0TA 2B7BB 2FC9A 3A8IA 2WK4A 5T7LA 2XC9A 1RT3B 2A2DA 2C3YA 2IVMA 1HHQA 1E6YB 1RDRA 3CJ2A 3PRVA 4OYOA 4WFZA 5A6WA 3ZTQA 8AT1B 5KOWA 3H8YA 2GVZB 4LSLA 2JWNA 4U67Q 3QO9A 4OZ0A 3Q8YA 2KXHA 4I6WA 1OS5A 2VDHA 3MM7A 2OEKA 3CDAA 4RUBA 1SUQB 2KH9A 3DKDA 1TV6B 3D1QA 2KYZA 2ZDOA 4R5PA 4ZP9A 2JLEA 2OIHA 2ZNZA 1SH2A 3ENAA 5IZHA 3SFGA 5DDRC 4WFYA 4NZ6A 2NLWA 3OD2A 2WBMA 4OV6A 4OI0A 4TU9A 1CBKA 4LF2A 2D74B 2VG7A 3N28A 1Y5NB 2AF6A 4X4RA 1EJ7L 1WG4A 1FNMA 3IBCB 3JSBA 4CYUB 2JOQA 4XDDA 4DCJB 4OFZA 1VR6A 3F56A 1UWBB 1T9XA 4LR8A 5J2PB 4IOCQ 1CJKA 3U27A 3BBBA 2C3OA 3QRPA 3W66A 2XMVA 1EIYB 3HFVA 2R8GA 1N0UA 4KFBA 2GGPA 3UI3A 2J6TA 3I5CA 2QA4S 5C5JA 5AJ3J 1TQLA 2ZKUA 1TMMA 1QE1B 3JYTB 1UEKA 5T41A 1IBMF 1VS3A 3QAUA 3TAMB 3M30B 2HQGA 1T9WA 2ZE2B 4J90A 3IXQA 3DOKB 4KPCA 4C48A 1UVIA 2HW3A 1MROB 1WHVA 3PYFA 1TL7A 1D1UA 5D77A 2QLBB 1NK7A 4KKOA 3W2VB 4OLOA 3FEXB 3W8GA 1H38A 2G4BA 1NUEA 3DGPB 3UVJA 2VQFF 4FYWB 4FDFA 1HWUA 2WOMB 1SIWB 4G6VB 4Q2MA 3EGZA 4DL2A 3MURP 4F8RA 4YB5A 2DR7A 3I9V9 1S7IA 2WB4A 3MUTP 1N4LA 4KGMA 3TZZA 4N47A 2EKYA 4KGVB 1FO1A 5DQIA 2MB0B 4DBQA 2X1BA 2MZRA 3W5ZA 4C3KA 3D0IE 3KKFA 2E5JA 2AYEA 5CA5A 3DLKB 3FQLA 5KFTA 4HKQA 4CTAA 1KKHA 2DIUA 2FHKA 3ZZTA 4K4XA 1UVLA 2CNKB 1MWZA 3NBPB 3OFHA 2R7OA 3ENWA 3FC9A 1TUGB 3X3UA 4I64A 1T9UA 1HNIA 4CZCA 2Z58B 2C2DA 4C8KA 5KT7A 4O4RA 2MLZA 2NXJA 3GTYX 2DGXA 4IFVA 3D6FB 4ZVGA 2F4FA 2HQDA 3LAKA 2J9CA 1S9GB 1MN7A 3P5BP 4LVOP 3M8QB 4ZPTR 5C2GA 2KM8B 2QRRA 3Q8SB 3GLJA 1NM2A 4RW7B 4QW8A 1YTYA 3KNAA 1VLOA 2ZBCA 2B7CB 2YNHB 1N8RT 2CPJA 3R7NB 3Q24A 2HAFA 4YMEA 4EI2A 3CCES 4CI0B 3PTWA 1FKOB 1U09A 3FBFA 4FYXB 3PJ9A 3G4SS 4XTTA 2YWGA 4PXBA 2QMUB 2IC3B 3K5NA 1KQKA 4B3TF 3DRPB 2HS3A 1YK9A 4OIXA 2O3DA 4C8LA 1VQNS 2Q3PA 1HWLA 3PXGa 2BBEA 2P9EA 3FSIA 1Q95G 2CIMA 3FGVA 5GVQA 4BHQA 3ELHA 5G0RB 1RT6A 4KFBB 1NPKA 2N7CA 5HMZA 1RWMB 2HRTA 3RR8A 4OJ1A 4ZP7A 5BJRA 2OPPA 1WG5A 2R2RA 2BJ3A 3KK2A 3OTDA 1VBYA 4IUFA 3RBZA 3VGTA 2DXFA 2EC2A 2Z2LA 2IM3A 3FSYA 4ZK7M 1RCOB 1RB0A 2Q6BA 1RBOB 3LP0B 3CJ8A 3PRBA 4ES3A 1FJ7A 3BB5A 5DGAA 2OAUA 1FDAA 4MK8A 3RB3A 1CULA 2LP4A 2YQ0A 1VQ5S 1A9NB 5B09A 1XIQA 2J7KA 2V4RA 1UTAA 3MR5A 3SDEB 4A8QA 3NNCA 1RCXB 2XO6A 4Q5VA 4EYHB 5MAOA 1R31A 3C19A 2G0JA 4KB7A 2Z4PA 3NS6A 4R5PB 4H4OB 1Y00A 1MN9A 3CJ5A 3QFWA 2MTLA 1H7XA 3EE3A 2WTFA 1WOSA 1LWCA 2HRUA 3S1TA 1GMVA 2DNPA 2V8GA 5H9EJ 1N5SA 3KLGA 2RQMA 5L9XA 1CJVB 5KAKA 3H2LA 5KFCA 4HH0A 2W7OA 1EKSA 1FWKA 5K14A 4LF8J 1IJEB 2CQGA 3IG1B 4PUOB 4B3SJ 5HO4A 4LQ9A 3QT6A 5K20B 2PMWA 3GILA 3AY0A 3QIDA 2N82B 4DWIA 2K7JA 1Y11A 2CQDA 2OPSA 1XR5A 2Y1RI 2VOPA 2NXUA 3CDWA 2XEXA 2EEYA 2HSEB 2OPSB 4MAKA 2GHPA 3R5CA 3DGVA 4DV7F 4ED7A 1LQ9A 1M1HA 2KHCA 2UU9F 2CJXB 3CEDA 3KLVA 3FBBA 3IO1A 4M63A 2IVFB 1GMUA 2ZH3A 2HFUA 1N5YA 1PG5B 4L73A 4Z2XA 3EXYA 2GGPB 2B4OA 2A6MA 2FHOB 3M1VA 3CJKA 1PSDA 3CCQS 3ISZA 3QQCD 1Z2LA 2D1CA 4KE5A 1AFJA 1W2IA 3LUYA 2HLUA 3QGIA 3PIPQ 4JI0F 5KFUA 2W7PA 2PGCA 1R8AA 1ZBTA 3KJNB 3OTOJ 4Q44A 2AP6A 1R0BG 1H7WA 4Y2IA 4OHZA 4DR5J 4DQQA 2CJ9A 3RBDA 5B0AA 4CO4A 3BN7A 3KXDA 3PG9A 5JJBA 4ZVTB 3AQPA 1HQ2A 3FZBA 1B7FA 2BZ2A 1DHMA 2JJ4D 3C15A 1PBAA 3LF0A 2RQKA 2C3PA 3S01A 4NLVA 3T5HA 1KQGB 5K8PA 3PX4A 3QIPB 3LO3A 5KFKA 3KUEA 3NCQA 3T6JA 4K59A 4P6QA 4WXWA 3ZTOA 2B8PA 3V4MA 2XNQA 3JTNA 4A8XA 3SCKE 3GIMA 2J8AA 4XPEA 2GX8A 3O3LA 1PJ6A 2FHJA 4PABA 5J1EA 1VBXA 2FLNA 2HHXA 3QLHB 1FKPA 4U8YA 5CZXA 3DOMA 3DNCA 2OPQB 2ACYA 5HK4A 2F8EX 3DLGB 3TUJC 1NK8A 3W9HA 4F4AA 2C2MB 2XZTB 2FLPA 1ACMB 2DO4A 2YWWA 1WF0A 3H4BA 3EVOA 2DVIA 2JZ5A 2AJ1A 4IH7A 4WU2A 1HNVA 3AHPA 4CO2A 2IJRA 4ZDNA 5L1JA 2V2KA 3MPDA 4J9UE 3CC7S 5CYQA 4O3RA 2UXDJ 1UWAA 4DLGA 3EMTA 1N5VA 2VC1A 2YQ3A 4HEA9 2DHSA 2KYXA 1LEOA 3OUYA 2ZDPA 3KTQA 2LXFA 3RAMA 1HBMA 2HS0A 4JI0J 1F9EB 2CQ3A 1KVKA 1EAYC 1SXLA 5LSLA 1RACB 4C7QA 1TUVA 5DDOC 5D3GB 3OPKA 2W2PP 4KGKA 4MKBA 2EXUA 2CZVC 3DOLA 2CZ4A 5F3ZA 4DOZA 1RAJA 1SKWA 2Z57B 2BJEA 3KLEA 3JB9k 3FK4A 2WVFA 5AXMA 2E9TA 3NGKA 4BWJA 4DPYA 3B78A 2YWEA 4DV0F 4F4XA 3QLHA 3EYZA 2BOPA 1XN9A 4DV5F 1U1NA 5CCLA 3GYXB 3UCZP 1FFGB 2QLXA 4YP3A 1FRLA 2ZE2A 1H0HB 1Y3JA 1PCAA 3GYGA 4ZPCA 1DLOA 3BR9A 3LWMA 1BWEA 2IBOA 2NS1B 3KG4A 1RHJB 1DLOB 4ZA1A 3W9IA 4WFBQ 4LF9F 3ZZUA 1XR7A 2OD6A 1XNQF 2VA2A 4X62J 2D41A 2DNRA 2GIQA 2L08A 1FRKA 2RT3A 2R8IA 2P6SA 1Y5IB 1SBRA 2KVIA 4Y3CA 2ASDA 1D8YA 2J0WA 3CGIA 1VQYA 3K58A 1T11A 3GZ7A 4L72B 2W9BA 1DQAA 1NB2A 2PDAA 2JVOA 4DG1A 4UOCA 3UR3C 3MR7A 4X65F 3I9ZA 2COLA 1LXNA 1NJZA 1LFWA 2DR9A 3C14B 3QRQA 1RT2B 3DHWC 5F9LA 1SKSA 3DLGA 4C3LA 2FQQB 2LQ8A 2OLWA 1IKYA 3HSGA 3SMZA 3ZO7A 2VFUA 3B4MA 4NLRA 2UP1A 5DQGA 3MUMP 2Z8QA 2Y3YA 1ZM4A 3J7YI 1FNXH 3MR2A 4J9VA 2QFIA 1LWEA 1XBWA 2HNYA 2R4FA 3MPVA 4DX8H 3I87A 3M6UA 1ZS6A 1U1OA 1U8WA 4YEAA 3RJMB 3QZ7A 1VDHA 4YOEA 1T3OA 5HSPA 2ZUGA 5AE1A 3PO4A 3ZZZA 2NSCA 3CO9A 4MYUA 2PEHA 4FZVA 4LRDA 3TEGA 4CLWA 4N56A 1O8BA 1WWHA 3MEDB 4NI2B 3UWTA 5J2PA 4K0KJ 1QAIA 4JV5J 4Q8EA 2W9AA 1FK9A 2BYCA 3OTOF 1FCAA 3VCDA 4ETZA 2XBPA 2KRRA 1IBLJ 4DUZJ 3CDBA 2UXCF 1H2UX 3IR6B 1MLAA 1TR0A 2DBBA 1CG2A 5K9FA 3LW5C 3AJDA 2DNGA 5ETMA 2IA0A 3HJFA 5D0GA 2Q66A 4ANDA 4LRCA 1CC7A 3CTRA 3QGPA 4RW8A 4TYAA 3H5UA 3SEOA 3UO0A 2CQCA 1M5PC 1LWCB 3P4UB 4J9KA 1BMQB 2LMIA 4WXOA 3DLHA 1XNRF 1SUQA 2OSRA 3MAHA 1S4FA 4MKAA 4EZ6A 2H9ZA 3T1AA 1FE0A 4RUAA 1U4BA 4FP9A 4J9NA 1T03A 4ES2A 1YRUA 3VGSA 2YKOA 3AA9A 3LPEA 4DL3A 3QWUA 3PKMA 4DFKA 2NZ4A 1D09B 5EX3A 1RAIB 5GAEU 3CCMS 4OYWA 2NSBA 2FY1A 1ZAWA 2KG0A 2KFNA 3FRZA 1YLXA 3EZUA 3QATA 3H25A 1ZA1B 4NXMJ 1E6VA 2ABYA 4J9MA 3UQSA 1D3WA 3B4DA 1BQMB 3M6XA 1RWWB 3AB2B 3TUIC 1ITPA 3G2XA 3O8WA 2OMOA 5A8RA 2DIVA 4Q43A 2GQ2A 1R3NA 2C1EB 1QY7A 4HT5A 5J1EB 2KKHA 4ED1A 4PUOA 5GADU 1QE1A 3JYTA 1RA6A 3I5AA 1LK5A 4UOHA 3CSKA 3BO3A 3ETMA 1S1UB 5L1KA 3GWCA 5GMKa 4GKJF 5IT9Y 2GO8A 2P2CB 2R8KA 2UUWA 4YN3B 5KFPA 2MXYA 2L9WA 5THWA 2FIUA 4ECTA 5ETTA 4A8YA 2IYGA 1OPIA 1TMJA 4DMZA 4K5RA 1Q8KA 4B3TJ 2GFFA 1VRTA 5KFAA 1SVDA 2PEBA 1HBUB 2P6TA 2IY5B 2BANB 2I1RA 4I2QB 1S76D 4JOUA 3R8YA 3D6HB 5E3RA 3W61A 2OTJS 2C3UA 3LP1A 1IXKA 5KT6A 1RHMB 2K1RA 5CAAA 3WZ0A 2B6AB 2E1MC 4YFUA 3P6YC 2FVQA 2I8EA 1HI8A 2IJNA 2VKZG 4CLYA 5I3UB 4WWSA 1SCJB 4CDIA 3GFYA 5LMUF 1KVIA 2JNJA 1FI4A 4I4BA 4PEOA 3NMRA 4W90B 1F2HA 1F6TA 1RJJA 4OYAA 3CUNA 5KG6A 1S1UA 1YJ7A 1R6VA 2O67A 1WTFA 4G1QA 5BR8J 3GSIA 2VL1A 1TZ0A 3FJ2A 3NGUA 3G8TA 1MMNA 1N52B 4GKKJ 3AOCA 2ZJQQ 3H42A 2VPXB 4HDHA 4P10A 3D28A 5KFLA 3DOLB 2CPHA 4CNYA 2KT5A 5L46A 4XIUA 1N36J 2HHSA 2B9EA 5D15A 1D9AA 4L6V3 2UVRA 3C2PA 1S9GA 3G87A 4OHXA 3AFGA 4GMKA 3VALA 4J9SA 3HHLC 4OYZA 3MDFA 1LWEB 2CQ1A 3AOAA 3FBCA 1X5PA 4LF5F 2WHOA 4HDGA 4RZRA 2FVSA 4NXNF 4BDPA 2MGZB 3DRRA 5HJXA 4DS4A 2IJFA 3VR1A 2B9YA 4IR1A 2VFVA 2Q1LA 3FMWA 3ZZOA 1F60B 2BQ3A 4DCOB 2GMHA 2E5LJ 8ATCB 1NK6A 4URSA 4K50A 2MSSA 1RAFB 2DD8S 1HNVB 4ED6A 2GJIA 3MM8B 3SYZA 1U47A 3HO1A 4KJIA 4ERDA 4OZ1A 1JNZB 5EN1A 4DI6A 2GJFA 4N76A 3CW2C 4DG1B 3HXMA 4NLUA 3IRXA 1UPMB 3HHDA 1FVQA 2AEJA 2WOMA 3NAIA 2GVDB 2W24A 3KG0A 1VRTB 2QC3A 1HNIB 4ZITA 2AYMA 1ZETA 2RF2A 3I96A 1PKUA 3SXLA 1DJ0A 3SSRA 1UVJA 1S6UA 4YUDA 4LR9A 3KG1A 1MW7A 2QA4G 2E1RA 3F44A 1URRA 1T9YA 2V8PA 4KIAA 3UCUP 1JJ4A 4FKXA 4PXCA 4U8VA 4ZCMA 3D0GE 5KG4A 1C0UB 2P9CA 3MM6A 3OFGA 4QOTA 4UZBA 4R8UB 3FCHA 3AD7C 5HP1A 4YS2A 2APOA 3UE2A 1JJCB 3MFHA 3M8SA 2WB1D 3I4PA 4LF1A 4ZKAA 3H20A 1J5EF 2VH7A 1O0PA 2FZGB 2OKQA 3R5BA 3WBZA 2HHQA 3R9LA 2RDDA 3DDIA 2HWIA 3GFZA 2RAQA 3L7UA 2V9WA 2X3DA 2QSFA 3QT5A 2HBZB 2XQCA 1CEZA 4DF4A 1UZHA 2A3JA 3UD3P 1RE1B 2Y1JA 3OHBA 3DMJA 3HVRA 3Q89A 4QR2A 1HNZF 3PZPA 1LKZA 3DXSX 3U1NA 2R7WA 4NYOA 2DB1A 2HWHA 3PACA 1H3DA 2RU9A 3FBEA 2RDIA 3THVA 3TARA 3QSIA 1YRTA 4NLGA 1IBKJ 5SUHA 4M5NA 4Q7AA 4N8OA 2MKIA 2R7VA 2OJ3A 1NO8A 3OXFA 4WP3A 1YWXA 1PYSB 4ELVA 4B3RF 1AA1B 3MMCA 4DV0J 4JI4F 2B9WA 2DYAA 1PGZA 1FA0A 5D4LA 2IM2A 1UEUA 1JLBB 2EFNA 1RT4A 3LP1B 1YI2S 2XS5A 2J9EA 2CDQA 1JJ2R 2YNIA 3EZOA 5C25B 4DL6A 1I5OB 1ZAVA 3VVTA 4DPTA 4X62F 2KM8C 3EGNA 3CCVS 5K5MA 4P7VA 4NI2A 3VAGA 4DR3F 4ECWA 4Q0BB 4X64F 4NCBA 4DSFA 3DN9A 1TL3A 2LFVA 2P5VA 3L09A 4GO5X 4L76A 3ILLA 5ITHA 1HBMB 1RAOA 2EW9A 5M2UA 1E6YA 2QFJA 2LU2A 4BLGA 2D7SA 1JLEA 1XEZA 2WZ1A 3OTCA 2HHHF 1U1PA 1GK8A 2CWXA 3OLBA 4JYAJ 3JSMB 3WHIA 3KK3A 1H74A 2KU7A 5ETVA 1JX4A 1SC3B 4FVCA 1LXJA 4LR7A 1S7HA 2GIFA 1RT2A 1X4HA 2EFVA 4ZPWR 3Q86A 3MEEA 2QN6B 4ZLNA 1PIEA 3R3TA 2ALZA 1WHXA 3MEEB 1EB0A 2WONA 1GTHA 2BKOA 2VZ9A 4ZVUB 4O0NA 3KJVB 2ATLA 5AXNA 4X4NA 4FPRA 1A6LA 1LNQA 2H3EB 2H5EA 1WC5A 5HMYA 4N7TA 3FZ2A 2UXDF 1RZMA 3LA0A 2NYHA 3ZTRA 2OO4A 3TAQA 2DNZA 2CRLA 4AE5A 2CQBA 2LDIA 4ZJLA 1VIOA 3BBCA 4A8WA 3C6TA 4CT9A 3F0NA 1B0PA 3H90A 4F0KA 2BX6A 5LXYA 5IC4B 2HLTA 2K8GA 1SC6A 2KB2A 3ZNJ1 4LQ3A 3UW1A 4PXEA 4ILRA 5F8IA 4JV2A 3LGMA 1IBMJ 1YITS 4G3IA 3KLEB 2FJXA 3DGPA 3TR5A 1NSQA 1X0PA 1IKWA 2EK1A 2QJ3A 4KKOB 3W2VA 5EGYA 3IWNC 1RTJA 1U25A 1KLNA 4PG7A 1FJGF 1HHSA 3I5BA 1UFWA 4I2PA 4RKUC 4ZVHA 3V6HA 2HHVA 3PR5B 1RKIA 2V6AA 3CCSS 4JI2F 2GJ2A 1NH7A 4W4MA 4UW2A 4TQRA 3SZ2A 1FWLA 1YQHA 2FHMA 3Q83A 3R7BB 4DQSA 1B99A 2UUCJ 3DLEB 1JLBA 5IFMA 2A2CA 1FE4A 4QU7A 2HS4A 3N6MA 1FFSB 1QJHA 1TL4A 1VI7A 2MQLA 4C8ZA 4K4VA 4FKYA 1S72S 2BEFA 1ZH5A 1JIHA 4ICLA 2ZC4A 1W25A 3OL6A 1FF2A 5HL7Q 4PWDB 4QBUA 3D3CJ 1Q8IA 3U1LA 2DGTA 3BKTA 3L4BC 1S1TB 1CS4A 3RAQA 2BJ8A 1R0AA 3K89A 5F0UA 3JAMU 1BC6A 3UR0A 3DI6A 3RYLA 5CXTA 3CDEA 2HHHJ 4X66J 4C3MA 4CM0A 3TJ9A 5IXUA 2W9BB 4I6AA 4M5IA 5EX0A 2MLYA 3HMJG 4UQGA 3ITHB 3BH7B 3L95X 4USVA 2V4JA 2P9GA 4O3PA 4HI2A 2AZ1A 2R3VA 3DRSA 5DZ6A 2DGVA 3M30A 5CYJA 4NA1A 4YR2A 1TL1A 4WYLA 2BQRA 4DU8A 1L3TA 5CD4A 3BSOA 2K3IA 1LOUA 4OI4A 3DC2A 4OJ3A 3M8RA 5L38A 1APSA 2KG1A 1HW8A 2HMIB 4UOGA 5A2QY 2EI5A 1Q78A 1N36F 3WX4A 2XCPA 1OIAA 3HI9A 3QFHA 5DM6Q 2ZH6A 3CCRS 2C2KB 4H4MB 1T9TA 1UZDA 2FLLA 2LDYA 4KV8B 4HR2A 3PW0A 4LF7F 1WKKA 4ZCLA 1RHQB 4GRSA 4AD6A 1RT1A 2C42A 4EYIB 2VFRA 3BYRA 1GMWA 2CNLB 2FJBB 2RF2B 3PDNA 4MK9A 2XGQA 2BDPA 4F0HA 3BGFA 3LP0A 3NXZA 1VJQA 4WTOB 1NDPA 3T1YF 1HKAA 4OJHA 3PY8A 1RWXB 4F67A 1S6PB 4NLOA 4DQIA 1OY9A 2WW8A 3HLUA 1X9SA 4PG5A 2JLGA 4ITSA 3MM7B 2B0GA 2QZ8A 5LJ3Y 4FF1A 1F1BB 3DYAA 5H9FK 1JNRB 2XYGB 4EBCA 4DQRA 3JQJA 4DSKA 1RAEB 2CKWA 2IPOB 3PFOA 5A8WA 5BR8F 2FJWA 2RUGA 3K5LA 3M2UA 2WVCA 2D3O1 3QYYA 1YJTA 1NZAA 3MMAA 1YSJA 3A8KA 3CMQA 2B56A 1HR0J 5E5NA 3HHLA 5E3QA 2W4DA 1Q82T 4X2BA 4M5LA 2GQCA 1BHNA 3I32A 3I0RA 3N79A 4KBIA 3TI0A 4J7CA 4YB7A 2RRNA 2GW8A 5CQGA 2B4UA 4NRUA 4I67A 1XWLA 1RBLA 2GZOA 1NPRA 3D68A 3GV5B 4EGLA 1JLQA 4IFVB 2I2YA 4V19J 2GC8A 4R0JA 2IIHA 1JLCB 4Y2AA 3RW7A 4A47A 1U2FA 1PJ5A 3T9ZA 2CNNB 1PJ7A 1S1TA 1N33F 4DR5F 3V81B 2WSFC 1N5TA 2CQ2A 4G65A 4HHHA 4USIA 3HKZD 2FVPA 1ROFA 2ROEA 3DHXA 5KFRA 2ADBA 3MTKA 1OYDA 1U45A 1FTRA 3NEKA 5ETKA 2XY5A 3RRHA 1U6FA 2JEGA 4U95A 1R8PA 1KC8T 4KT0C 2HQCA 2JX2A 1N88A 2BOAA 4BC9A 2JVRA 2L9DA 1TVRA 4BC7A 5GADI 2G1HA 2YKMB 3OQ2A 1AFIA 4PQAA 2DH8A 2GHVC 3N4WA 4N41A 2UXBJ 2L48A 4IO9Q 2M70A 5B7WA 5LOQA 5J1PA 2CG4A 4LFAF 1VQ8S 1RXOB 1T02A 2B6AA 1P9YA 4ALZA 1C4AA 2PA3A 2BMBA 5BXIA 2EG2A 4TQSA 4DV6F 2JFDA 4ZP6A 1IKWB 3GG1A 2W9CA 1CJTB 4DV6J 4LIRA 2ROGA 2UZAA 1WSRA 4DX5A 2MQMA 1S97A 1VBZA 1WC6A 2ALYB 2FGCA 2ILYA 2P8IA 3FEYB 4FBTA 4M5MA 4D3GA 5HI7A 2Z2MA 1XMBA 1RYSA 3KK1A 3BJYA 1UJ4A 4MT1A 3G86A 3FUYA 3PCOB 4CM2A 3CJ4A 1UW4A 4ATNA 1RT3A 1NMEB 1S99A 3SV3A 3D54A 1FRIA 1T05A 3OVAA 1ZM3A 2H51B 1KTVA 3D6MB 1S77D 1FRJA 2XMJA 4HYKA 3D4JA 4KAIA 1IBCB 2LEPA 2ZWOA 4PWUA 3RRKA 5FIIA 3MTJA 1VC6A 1BUXA 2HHWA 2GA7A 1HARA 4I6YA 2XLJA 2OP5A 4O44A 4TN2A 1ZM9A 2HIYA 1SKUB 4PQUB 4Y65A 1NDLA 1VYAA 1L3KA 4Y28C 5MLCV 1JK9B 4DUTA 2KRBA 1KP6A 5D0HA 1NPPA 2BJ1A 4K0KF 1WDTA 1IUJA 1CVJA 4PWDA 1R6YA 2JC0A 1KLMB 1HPZA 4RWWA 2ZBIA 3EVWA 5FDLA 4F25A 4AL6A 3W65A 4ED2A 3PVXA 4DU7A 1UPPA 2B5JA 3BYPA 5GMDA 4OI1A 3SFUA 2NCKL 3PHEA 3EX7B 1RAHB 3HHLD 2FZCB 2HNZB 1RADB 4RU9A 1LW2A 5KOXA 4K4SA 5HROA 4I7FB 1VQOS 2Q79A 2N4CA 4DUYJ 3IC1A 3HHKA 1NJWA 3SIPB 2QYGA 2ZZTA 1VQ9S 1HNWF 3HFKA 3MCMA 3OSPA 1RGVA 1VRQC 1RQ0A 3EICA 4RPFA 2D3UA 5A0YA 3SQGB 4B17A 1TL7B 2V4QA 2BABA 1MROA 1ZA2B 3M6VA 4TVAB 1Q79A 2HURA 4WTYA 1N34F 4JI5J 4FF3A 1IVZA 1NJXA 3KYLA 4WFXA 2YNIB 3VF0B 1Y3KA 2XI3A 3ISNC 3OR2A 1URNA 1RLCL 2DNNA 2AKWB 5DO2A 5DS7A 3SBMA 3FEZA 3A3NB 5HAOA 2YNFB 3TEHB 4RNOA 3I55S 2E9RX 3CO0P 1ZPWX 4UOFA 2HMIA 2YKAA 2D9OA 2B5JB 2CPDA 2HNYB 2PSZA 2RVJA 4FYDA 1A7GE 4RW6A 5I4MA 1NSPA 2MJUA 3LGNA 1XMQF 3KJFB 1VQLS 4IRCA 1YIJS 3A8EA 3H2UB 4U7UD 4L3KA 4NPOA 4IG0B 1T9VA 3CE8A 4F04B 1IKVB 3KMSA 4DV2F 1RTIA 4YQWA 3RB4A 4BS2A 2PC6A 8RUCA 3P49B 2VPYB 2W4PA 5SZTA 1FJEB 4M5GA 4F3QA 2LEAA 2AEFA 2XHCA 1DURA 3NBPA 3NRBA 2F65A 2VOOA 3OL9A 5IM0B 3A8JA 3T9NA 1S1WA 1G2EA 1NK4A 2XSFA 1BQNB 2DH7A 4ZN1A 1IBLF 2GO9A 3KLFB 4DR6F 4RWXA 7FD1A 2BQUA 3P3DA 3PKYA 1X4EA 4DXLA 2MZTA 2RKIA 2H5IB 1K8AT 3W7BA 1G3OA 5EUHA 1QVFR 1IKXA 1RKJA 1F5BA 1Y4ZB 1SJ1A 4K4UA 2QE5A 1S6QB 1AUDA 2XMAA 5D4NA 4JI3J 4GC7A 2YX7A 1KDNA 1WF2A 2L3MA 2ZH1A 3UFCX 2IMWP 2XG8A 2IRXA 2BKPA 4USWA 3CIZA 3VGVA 4NE9C 2ZVIA 3GFXA 4GO7X 2FJEB 4DR4J 1O5JA 1Q0NA 3TO8A 4AFFA 4BBYA 3TWZA 5CD4H 1YJNS 2HNZA 5KFZA 3EVMA 4ZVQB 4IYQA 2F8MA 1X9MA 4OX9J 2YBVA 2VPWB 3K8WA 3QBCA 5D3GA 3OJSA 3MFIA 4OX9F 5KT2A 1J5OB 3BDPA 1GH8A 3ICLA 3W5YA 4DN9A 1HNXJ 1D8ZA 4O4GA 5KG5A 3CCUS 3DYAB 4CYUA 2BE2B 4C11A 2DCUB 3PJXA 4YHHJ 3RB6A 4QR0A 3J7A1 1C1CA 4P71A 1EQMA 3T41A 4DR1J 1T7PA 2QTWA 3IWXA 4ED3A 2QMXA 1T8EA 3AODA 1RYRA 1SH0A 5B0CA 3RAXA 4CRJA 4EFAC 3BKFA 4ED5A 4FS1A 1HFEL 3DXBA 4ECSA 1S6QA 3F41A 4CO1A 5BYQA 4FNHA 2B3TB 3WIVA 4ZPDA 3C6UA 3LQVA 3ZC4A 4DDFA 1IWAA 1LW2B 3FCWA 4KC5A 1G7CB 3ZTPA 2RQCA 1VJWA 2HGNA 2NYIA 2Z56B 4OZNA 2EFGA 5IT4A 4ED0A 1RT7B 3OL8A 3G8SA 4PR6A 4KPYA 2MKYA 2I5JB 3JQKA 3AJ2A 1U2RA 3ET6B 3MMBB 3BQ0A 1U1QA 2XMWA 2V2VA 4PG8A 3LP2B 3QT7A 4JI4J 4TYBA 1U1KA 1T94A 3I82A 3DFEA 4E98A 1V3RA 2HRYA 1UCNA 4OI3A 1F5AA 1BLUA 3QZ8A 2K1RB 4OZ5A 1Q53A 4ZJQA 4J9RA 1KHWA 4URGA 4QYZK 1FXDA 2BACA 1JKHA 1V6HA 2HNDB 3NCPA 2RRAA 2IYIA 2GAHC 4ZVEA 1CS4B 1R0AB 2EFPA 2HGLA 3JQMA 4Y0FA 3GIIA 4H4MA 1TFYA 2J8SA 3IBFB 3T19A 2RHSB 4B3OA 1IQZA 1H2TZ 2CAJA 3H5SA 4HL9A 3Q23A 2F7VA 2V8HA 2W2QP 3M9NB 3WC0A 3I4HX 1QUVA 3TAPA 2E5GA 3D5MA 3SSSA 3K5PA 1H2VZ 3I6PA 4JI5F 3A3PB 2D9PA 1QLNA 4IR9A 3T3FA 4PCQA 2J6SA 3G8QA 1VQKS 4QYRA 4RLEA 4WU3A 1JLQB 3MWBA 3R7SB 1RWPB 1UW9A 3DMJB 4P75A 5C42A 2FDNA 3OL7A 4ECQA 2EK6A 1WI6A 2V4JB 1RT5B 1FKAF 2UUBF 3IGNA 3C8YA 4HTJA 1I3OB 3CC4S 4LFBF 4KHRA 2BXJA 2R8HA 3KHHA 2ZOMA 3H40A 2RD5C 1WACA 3V6DA 3NWRA 1EHWA 1T05B 3D0HE 1PAUB 1Q81T 1M5SA 1NRKA 2M4MA 3IN5A 2F3JA 5L1LA 2FYXA 2RKIB 2GMJA 2PO4A 3D67A 1NH8A 4V1Ak 5K14B 1HMVB 1S1VB 1WEZA 4FS2A 3K8VA 1HWJA 3KWMA 3FDSA 3LGHA 2IRUA 4WPAA 3ZNUA 4F36A 3BBFA 4HTIA 2HZVA 1NZ8A 1S9EB 3KUGA 3GV7B 5FDLB 1R27B 3DLEA 3PJWA 3V81A 4LIWA 5I3UA 1S0MA 1NHUA 3NAHA 1ZTWA 3U7JA 2B8QA 1ZZNA 5IWAF 2DEIA 1U6ZA 3M8PA 3IBWA 1TKTA 1X4BA 2PFFB 1Q7YT 2CPXA 1TTHB 1CULB 3N0VA 3I0SB 3GPAA 4KO0B 4RBTA 4Y2MA 3IR7B 2AWZA 1OY8A 1QSYA 3LANA 1RTDB 4JV1A 1HBUA 2BM0A 3CD7A 2AGQA 1WEXA 3EGVA 2AEMA 2I5JA 2MKJA 2WSEC 1HBOA 4RO0A 3J81Y 1GEHA 3L9ZA 2C2RA 2J0QD 5JMNA 2DR8A 2DNYA 2VFTA 4B9VA 1G6BA 1VISA 3S8SA 4USUA 3V6JA 1X5OA 1XC9A 2ASYA 3MMAB 1Q5YA 2ZC3A 2MGZA 4P74A 1ULRA 3RUBL 1QDUB 2MPUA 3CWJA 4CO3A 2R9LA 2VASA 2FJVA 1BY9A 2M8DB 5FD1A 2VBZA 2Y8WA 2MQ8A 5HVGA 2IC3A 4LF6J 4C97A 4QWBA 1DTQB 2FZKB 3EGWB 2LQ9A 4PPDA 4EZ9A 1DQ8A 3BGLA 4NEZA 1NKEA 4GVBA 2DHXA 1IWGA 5DRKA 4JV0A 5LSOA 4AQYF 2MHEA 3POTB 5J2NB 1N32F 2DGWA 2G0CA 3HDSA 4HI1A 3J7YU 2EKNA 1U0HB 4U9RA 1KQFB 1B0VA 4M94A 4MKVA 2OMLA 3CMES 1VQ4S 2XLIA 4FXDA 3R97A 3HD1A 1H6KX 1BE4A 4XO0A 2UU9J 3QJLA 5KFYA 4DPXA 1YRXA 4AUKA 4DCPB 2M52A 5KFGA 3K5MA 2Q43A 3E51A 2FD2A 3HD2A 4LSZB 1RTHB 5FLXY 4X4QA 3DRRB 3UNGC 2QLWA 4ZLPA 3BQ1A 3VAHA 1NKBA 1QAJA 2O5DA 3TZXA 1U24A 2JH3A 1X31C 2ZM6J 2HFNA 4XDCA 1RTJB 2CPYA 4I69A 1F2GA 1DTTB 2YKNB 3SV4A 2EBGA 3HJVA 1P1LA 3T5LA 3T1YJ 2JSXA 5DLGA 3GIRA 1M5OC 3V6KA 3OW2R 3D66A 4S0MA 3GJRB 1OWXA 4ANCA 3G9CA 4B08A 3VQSA 2JC1A 2DGQA 3UDVA 4QWCA 3H59A 1H72C 3KJQB 3R5JB 5CCMA 1SC1B 3D7SB 3ZZRA 1WI8A 3FKBA 2VA3A 4DSIA 1SB6A 2G2ZA 3LPYA 4Q45A 3C3LA 1DAXA 4EMDA 3KK1B 1K1SA 2ZITA 4LFBJ 1D9FA 1QAYA 1FRMA 4FPIA 1C0UA 1TL1B 4DL4A 1EKRA 4NWBA 1REGX 3BGUA 5CYQB 2AU0A 3R6LB 3OXGA 4P2XA 4P2MA 4YHHF 4LFCF 2FHJD 1FRXA 3ENVA 2M88A 3US5A 3KDOA 4TNOA 1AUSL 2BA9A 3KOAA 3PFEA 4A8OA 2QT7A 4LF6F 4NXMF 1ZAXA 1EP4B 1M1GA 1RT1B 1Q1KA 4TY9A 1TKXB 1FFWB 3MD1A 5KFQA 1TK0A 4ZCIA 1RWOB 5ETPA 3J81U 3UD4P 4USTA 1YJWS 4ELUA 2XI2A 1YG0A 5L39A 4CNZA 2X51A 3VAMA 1FD2A 3TRGA 2ZOGA 3KDNA 2DNQA 3C6UB 2IHR1 3OJUA 3MUVP 3C6TB 2ZZMA 2DNHA 1B64A 3R6GB 4RW8B 2YX1A 3NMAA 5J2MA 3QIPA 2VBXA 4JI3F 5LSRA 2XM3A 4RX6A 2IAJA 1JXLA 2X1FA 3OHAA 2LVWA 2ZBQA 3R27A 3AAWB 5DG9A 2ZHBA 3PW2A 3O44A 1LK7A 2V2ZA 3HFZB 1U7LA 1UETA 3VAKA 3GB0A 4LBIA 2V0NA 1S12A 4E0DA 2IM1A 1C1CB 1IJFB 4DL7A 2UXCJ 3E01B 1KQSR 1S49A 1VMBA 3CNQP 5B08A 2AGPA 5JVGQ 1N54B 2RSQA 2DRBA 1V5IB 2BKNA 2NXEA 3K17A 3IM9A 3AD8C 4KR0B 1K9MT 4AXIA 2ZFHA 2I0XA 3MM9B 1FX4A 1P8GA 1VK3A 2IBKA 2NR0A 1FJGJ 3RRGA 2RQ4A 1BXNA 3BPSP 5CHCB 4K4WA 1NK9A 4LF4J 3TYTA 2KTQA 4GC6A 2CJYB 2QLJB 4MK7A 5CYMA 2CXEA 3W8PA 5JUMA 3C14A 1YKWA 4X4OA 1RBAA 3CDUA 4DSLA 1XNQJ 3DDKA 4B9NA 3OTEA 2A10A 2JFKA 4TU8A 2R7RA 4D3HA 4JI7F 4E2FB 1F0XA 2JRSA 1ZZFA 2YTCA 3UN3A 3NGDA 1NJYA 1FHTA 2N7YA 2QA2A 2OPQA 1TUWA 1VIXA 5D4OA 3JSMA 5E2QA 4B3MF 2E66A 1GTEA 1RT7A 2K2PA 2Y1LB 2N3OA 2CPIA 2UVUA 3Q2SC 3IG1A 4XPCA 1CJUB 5DDPC 2H54B 3RW6A 3ZZYA 1S1XA 2M3DA 2ZOFA 5HP1B 5KFWA 2FPHX 2MEWA 4PYDA 3R1HA 1BQNA 1WORA 4I0WA 3M6WA 2IMOA 1F9FA 1HA1A 4DLEA 2CPFA 5LT5A 4Y34A 2QX0A 2E7XA 3MECA 2ZD1A 3M7VA 1TKXA 2GVDA 1GXLA 4B02A 2WVDA 3FRYA 4MFBA 3VHQA 3W2WA 2U1AA 2AT1B 3LTOA 2YNGA 4QYZJ 2DKOB 4DR3J 4DR6J 1AB8A 4O23A 3GU0A 4EUVA 4MH8A 2LXUA 4IOBA 3N5FA 1HWIA 2NXNA 3DM2B 3HZGA 4TXSA 3UDCA 3BZQA 2ZHAA 1SL2A 4N8NA 4KTQA 4W92B 3LH2S 3MMCB 2UUAJ 2NQPA 3R2CJ 2YPZA 4F26A 1YZ6A 4DV3J 1PO6A 2PI5A 1T03B 4J37A 4NLQA 2VG5A 2ATCB 2YVSA 2XO7A 4MIBA 3CMAS 1B7YB 1HW9A 3CJQA 4FN5A 3UDLA 1YJUA 3A13A 3A1YG 3AXMA 3PR4A 4ZVSB 4R8UA 1D0EA 4Q2LA 5DETA 2MSTA 5A8RB 1XK8A 2Z30B 2KO1A 4OZ3A 4NMXA 4OV1A 2Y8YA 2XLKA 2HK2A 4PWWA 2PT0A 2VB6A 2LKZA 2MLXA 1NK0A 1E6VB 4USJC 4GKJJ 2UUTA 1HNZJ 4CH7A 2GCFA 3MR6A 3R5DA 3J7AN 1B0TA 3C46A 2D3ZA 3BO4A 4KV8A 4AQYJ 1N32J 4B3MJ 2I6WA 2H48B 4I7FA 5E3CA 2ZH5A 1U1MA 1KRPA 3AJ1A 2OFGX 2CJAA 4MKYA 2ZZNA 1KVJA 1TL5A 4OL8A 1JLGB 2GMLA 2R7QA 1RTZA 3CJTA 1VC0A 1RHRB 5F8NA 2HVEA 3KHGA 1RTHA 4TY8A 3RZAA 1M90T 1NSKL 2DY9A 2VFSA 2RIJA 4KHPF 3GJTB 3M4XA 1Q16B 5T14A 4PXDA 1UVKA 2M9KA 4A8SA 1JB0C 1YBAA 2HBRB 3RG6A 1HD1A 1JWWA 4OZJA 2B51A 4JI1J 3HX9A 1KN6A 1KS2A 1RAGB 4LSNA 3PX6A 3JXOA 1KWMA 3ADAC 3H5YA 2DNMA 3PW5A 3B6BA 4R0EA 2HQ3A 1KHVA 3BGRB 2F5GA 4DN0A 2BM1A 4KGZB 5D6GA 3UVJB 1FDNA 5E3PA 1Q86T 2PD1A 4Z7CA 1FVSA 4RW9B 2M8HA 2MQQA 1FDBA 1Q5VA 1PAEX 1NHKL 1S79A 4C6AA 3CCLS 2I38A 3GG0A 1U48A 1RU2A 2ZD1B 5F41A 2CWKA 3MOZA 4CLKA 3TAMA 2XY7A 3M8YA 1TP7A 4NLPA 4NOHA 4F2SA 3GFHA 2ZH7A 2OTLS 4ID8A 2QG9B 2AYGA 2NREA 3UCGA 1SL0A 4JI6J 4DR7J 1R8CA 2LU1A 5AE2A 2EPIA 4F3OA 2DGOA 2ZH2A 1HI1A 1YX2A 5ETSA 2KVQE 2LA6A 4LF8F 4IFYA 3CT9A 2XS2A 3GJQB 4CH1A 4NCGA 4LJMA 3ITHA 4QJVA 1CQNA 2NZCA 3NP5A 1QAXA 4WP8A 4OMFG 3KLHA 4YR3A 3G82B 1HR0F 3WC2A 4DQPA 2Y0BB 3NL0A 3DI6B 4F02A 3IP0A 4KRWA 4Y2KA 1NJIT 4B9MA 2XY6A 1SV5B 5IV3A 1HYSB 4C9DA 3GJSB 1QM9A 2W8KA 4UY8T 1J5EJ 2E1AA 4IRKA 5D4PA 3BH6B 2K06A 3RBXA 1GAOA 4ZVRB 2VODA 3L7PA 2EFOA 3TNVA 1DY3A 2H5JB 3M2RA 4OI2A 4DJBA 3QRRA 5IT9U 5K8OA 5HJYA 2PE8A 3HCXA 2GIRA 2IVYA 5KG7A 2HHTA 2MKSA 1YGYA 1KLMA 1Y9OA 2RB7A 2L9NA 1B4SA 1I51B 1YBTA 4IO1A 5D0EA 4M5KA 4LFAJ 1T0TV 1YJVA 4Y6IA 1EZZB 1C0TB 2M0GB 3N6LA 3T5KA 4DF8A 2AJQA 4OHVA 2VQEJ 1FWPA 4FF2A 2ZNYA 2LA4A 5GAHI 1JLCA 1U2CA 2GS8A 4GVLA 5B0DA 3M8WA 4OYBA 4B9LA 1BQXA 3JSRA 2F4VF 1LWFB 5A8KB 5IOLA 2R8JA 1MU2A 2KJVA 2A1BA 3LALA 2DR5A 2HFOA 4NA2A 3Q0AA 4ZVPB 1X4CA 3HVWA 1GX6A 4UTGA 2XGPA 5H1SV 4QPXA 4ED8A 3H4DA 5DG8A 4NCGB 1WC1A 2AJ4A 2DGSA 2OEJA 4C98A 4X64J 3QJJA 3MOJB 4ID5A 3M2UB 3S6EA 5KG1A 1YHQS 4RUCA 3M05A 5D8HB 3AQOA 4E8UA 2XWXA 5J2QA 2DT9A 3N01A 4G1QB 5HVHA 3W3SA 2ZVSA 2DH9A 3H0PA 4Y00A 2RJZA 1BQMA 1CJTA 3MPYA 4LBHA 5AE3A 3MR3A 4B3OB 1YJRA 4RW9A 2OD4A 3C15B 2CPZA 3GIKA 4RNNA 2VV5A 1L3SA 4LF4F 4RNHA 3ILJA 2XHWA 1EP4A 4ZPAA 2XTJP 1MU2B 3IRXB 4NYZA 2DHGA 3AA8A 3GE9A 3OR1B 4FBUA 4O3NA 1UVMA 1VRUB 4YDDB 2MDAA 3M8PB 3Q8PB 2KFYA 3D2WA 4ZVFA 4YB1P 5HATA 4DFJA 1OPZA 1X4GA 1UJ5A 4H4KC 4X4VA 3MZIA 5KFJA 2UV8G 1EETB 1FJCA 3P96A 4OYXA 4X84A 3ZFVA 4LF9J 3ET6A 1RT6B 3U02A 3DLBA 4I68A 3M2RB 1R8HA 2CQHA 4M8LA 5DZ7A 3CULA 1XQIA 3SQOP 1P1TA 4EO6A 5DG7A 1WEYA 1WUUA 3B8HA 2EBEA 1RHUB 4G1PA 1C4CA 4ID5B 4RBVA 5T7LB 3F73A 3CD6S 2CZ9A 1FKOA 2V69A 4LRBA 1Z4UA 5GAHU 2PMZD 4CLUA 1MMDA 2PN6A 3NG8A 1S9FA 1U1RA 2VD3A 4KHMA 3BGOP 4NASA 4KSEB 2NPFA 4Z37A 4WFAQ 4B9TA 4NL5A 2AIRB 1XR6A 2YWHA 3IFEA 5K8MA 4X4UA 3DOKA 1OJ4A 2LXIA 3J7Z5 2HBYB 4QPTA 1SJRA 3H7HB 3MI7X 2J9DE 2CVIA 2WVBA 4EBEA 4B9UA 2KZMA 1EQ0A 4KYZA 2MJNA 4ELTA 3CPWR 1HQEB 4EBDA 1UEVA 3E3XA 1QTMA 4JI7J 1WC3A 2QA1A 1HHTP 2EG1A 5KFNA 4P72A 4DV5J 1VC5A 3CJ0A 4YY3F 3MXHP 3D9BA 1Z1ZA 4LFCJ 4FNIA 2E1CA 1IR2A 2DY1A 2H65B 4C8MA 3RGIA 4I2PB 3SDEA 4WIIA 4C0HA 2LECA 2J0SD 2D69A 5ETOA 2ASLA 2LQJA 3EM1A 5LM7E 5F8JA 4ZHRA 4JYAF 2AJ2A 3RU0A 3VGUA 4NXNJ 2XCAA 1MNEA 1FT8A 1OMSA 1N5QA 1WC0A 2MMYA 4NA3A 2EWHA 3EZ5A 1NK5A 3DCAA 1QSLA 1VLYA 4P73A 5IV4A 4J9QA 4TLRA 3W63A 5BYSA 1PC4A 1PC5A 1HBNA 2BE7D 2CADA 2ZWPA 4ENOA 4RNMA 2YKPA 4LSLB 1HBNB 4PPZA 3BEGB 1JLGA 3QMQA 2YWFA 3W62A 1WNEA 2ZKTA 4K7QA 1M5HA 1CC8A 3P8BB 4LRAA 3G71S 1UP1A 1JXEA 1WD6A 2H1YA 4Q8FA 3OTBA 2CQPA 4USMA 4TU7A 3KLFA 1SI9A 2FJDB 4ZIVA 1UL3A 2VQEF 4LMZA 4CLPA 2WVEA 1IKYB 4X4PA 3BREA 2YNHA 5I3PA 2DXDA 3KHRA 1DBDA 1FX2A 1U6BA 2WONB 3FQKA 4NX9A 3M32A 2ZUAA 3GV8B 2RMLA 4OYPA 4WE1A 1REVA 4OX8A 1N34J 2MKHA 3M32B 3TA2A 3TVYA 4RU2A 2BRKA 2L41A 1RU1A 4O3SA 1HLWA 4MFBB 3W2WB 5C7PA 1HNWJ 4C0BA 3CJ3A 2Y1IA 4U7UK 1VFJA 2QSWA 2DNOA 4CIOA 4HVZA 4NLTA 4DUZF 1CLFA 1XMOF 1NEEA 4K2JA 3T1HF 1KTQA 4K4YA 5J2QB 2BJ7A 1AROP 4LT6A 4AYBD 3X1LB 2HBQB 2I9SA 4WZMA 1CSJA 1DRZA 2J9DA 1S4EA 3CJRA 1MG7A 3NCRA 3PYGA 2J0XA 3ILOA 2HHPA 4DV3F 1NAQA 3E8OA 4A8FA 2MZJA 2CQ4A 2CJQA 2ZH8A 4A48A 4RW7A 5HQLA 5I3QA 3CVKA 3DOMB 4QIFA 1DFDA 3G82A 2HIQA 3V2UC 4USHA 3KLHB 4ER8A 4ILLA 4CLFA 3CCJS 2IAJB 2GHWA 3G96A 2DO0A 4ZJOA 2HHUA 1VOMA 2QIFA 3OLAA 4IFYB 5L9NA 3CD5A 5KFXA 3RTVA 4J9LA 3TVKA 1DARA 1MWQA 2JLFA 1FTCA 4P7TA 3HP6A 3TZYA 2PIIA 3GYNA 3Q8QB 3OUYB 3HT3A 1EETA 1RWVB 1X8DA 2BV3A 2DHHA 3DLKA 3T6BA 3SSQA 4IH5A 2HGMA 4DR4F 4DV7J 1P6TA 2XYPB 3CIMA 3UN5A 4JI1F 3HPOA 1N5YB 5IWAJ 1RISA 3B82A 4HHUA 2K3KA 1VHIA 1U0HA 1U02A 1ELOA 2RDJA 3PW4A 5LJ5Y 2XZWA 5EWEA 2ROPA 3HZEA 3ISND 1VQ6S 4WKRA 3N6NA 4J9OA 4ZIWA 1WTBA 1WG1A 4PAAA 2C22A 1KOOA 1FERA 1U8SA 1WDDA 1VHFA 3VAJA 3NOGA 2WBRA 4UUXA 3CJKB 3TX8A 3W60A 1UA1A 3KMQA 1V9OA 1JLEB 3ZZ0A 4F4YA 3DRXA 1I1GA 3BDEA 1M1KT 1SH3A 1VQSA 4DV4F 2G2YA 3K57A 4K4TA 4RW6B 1CJVA 3NGSA 4JV5F 3KLGB 1WKLA 2NUUG 3MM6B 2A6OA 4P2SA 4F0MA 4CP5A 4ZCKA 1T95A 3FFIA 3JAMY 2W2OP 6FDRA 1WF1A 3K5OA 9RUBA 1GX5A 1KFSA 1UFKA 3NWGA 1Q8BA 4GKKF 1CJKB 2WW4A 3JTOA 3OR2B 2XS7A 4OZLA 1IM4A 3VZHA 2R2UA 1UA0A 1NNDA 3BV8A 1R0CB 5C25A 3M8QA 1VRUA 1G1XA 2BRLA 5AJ3F 4DX7A 3A12A 3I0SA 4KO0A 4NLWA 1JLAB 3NKYA 1RABB 4HACA 2ZH4A 2VBYA 3DLJA 4RJVA 3Q2TC 3KUHA 3MM8A 3LWLA 2HPUA 4AL5A 3V6DB 2GAGC 2G0IA 1H98A 2E44A 3HM9A 3CB4A 3BN4A 3SCLE 3OV7A 4ILMA 3EJMA 3IAS9 2ZM6F 1U0SA 2FLOA 2VG5B 3M1VB 4A46A 3RBEA 2AYBA 1HQEA 1CQMA 1OQ3A 3FVYA 3HF5A 1TAQA 4DHVA 1HIYA 3ILIA 2KJWA 4ECXA 4DZ6A 1HMVA 1S1VA 5ETQA 1GT8A 4F3MA 4DL0C 2CA9A 4RR5A 2AX1A 3UD5A 1HL6A 4HHJA 4UT4A 3MPWA 1H73A 2FVRA 3P5TL 3IS9A 3J80U 3EXCX 3T5JA 3JSYA 1Q8LA 2YY3A 1NXIA 2KHDA 3DDNA 4H4KA 4U96A 2ACMA 4DUYF 3KLIB 1W7WA 1Z2ZA 4DX6A 1C2PA 4ZPBA 3MAQA 1OSDA 2V50A 4CLZA 3VZIA 5LXRA 3CCTA 1LWFA 5A8KA 3DLLQ 5KFFA 4HLBA 4C4WA 3I0RB 2J5AA 2AW0A 2C2EA 1WOOA 2C2ZB 3TUPA 1R7IA 5J2MB 2MQOA 1OO0B 5HBMA 4NYPA 2YKQA 3VAIA 2XMMA 1NDCA 2ZHOA 5F8MA 2DPJA 4O3OA 2J7UA 3MPUB 4NZ7A 2DCLA 3J80Y 2XNRA 1FESA 3BR8A 3IR5B 5HQ8A 1JLFA 3FNNA 4YB6A 2ILZA 3MEKA 2V9KA 3MF5A 3TX0A 2RE1A 1N6QB 2VUGA 1F3VA 1GMWD 5HVFA 5IC6B 3THTA 2W1BA 3ULHA 1FEHA 1N0VC 4RW4A 4V19X 1X5SA 2YH1A 2M2BA 1HYSA 3OVSA 3O2IA 1LW0A 2BANA 3CCZA 4I2QA 4MTPA 4WP9A 4TLQA 1PYTA 1X4DA 3D6TB 3M8ZA 2M5YA 3PNIA 4QIVA 4JUZA 3G6YA 3MEGB 4JI8F 3R2DJ 2HFVA 4GVBB 3MECB 3BQ2A 3W1YC 4UUWA 2WSCC 2ZH9A 2KFZA 2OPPB 2AGOA 2HVZA 1G4CA 4DFMA 2CFXA 3L3CA 1JJHA 2VG6B 1DTQA 5DDQC 2VKRA 3MM9A 2AZ3A 1AXQA 4J5OA 4RL1A 2X1GA 2IFXA 4F7VA 1VGYA 3HSZA 4LVNP 4WIQA 2KN4A 1X60A 2C2NA 2OPRA 2MQPA 3TANA 1R43A 2W7AA 4UF4A 4OI6A 1KD1T 1NSAA 5HBMB 4LRFA 2DPIA 4N77A 1U26A 2IM0A 2LQ5A 3NS5A 5F3TA 2QL9B 2Z2YB 4MYTA 2UXBF 4TKTA 2M7SA 1PBUA 2DK2A 1RAAB 1RT5A 2F9DA 2ZEJA 4ZOSA 2VG7B 3ZZPA 4ECYA 2V68A 2ZJPQ 1WJ9A 2V8VA 4IH6A 2E5LF 1DZ5A 1TKDA 3HHLB 4NCAA 5F9NA 3LOUA 1VK8A 4AL7A 4C0OC 7FDRA 2FJAB 2RILA 1VQPS 4WF9Q 1KEKA 2R2TA 3DU5A 3OT9A 3C16A 1WKJA 3AD9C 1HI0P 1SJFA 2XMKA 2HVDA 1KBRA 3Q8RB 1M5VC 2XYHB 3HHNB 1RK8A 4ED4A 4F4WA 3N5BA 3UPFA 4N5SA 3BM7A 1K44A 3M9OB 2JDJA 1JLAA 4URQU 3RB0A 1S6PA 3OR1A 3EUNA 4JBCA 1X4AA 2UUBJ 1SJQA 3TZWA 5C24A 4MMOA 1KOHA 5E33A 5DM7Q 2BR0A 1L3UA 2QL7B 3AH6A 3IA0A 4KHPJ 4FYVB 3H5XA 3ZXWA 2KDOA 1N33J 4DPUA 4UY85 4K4ZA 2R7UA 5F8HA 3G6XA 1AZSA 3NY0A 2UVVA 4PYAA 1UJ6A 4JI8J 3R1LA 4DSJA 4FF4A 1MSWD 3FFIB 4X4SA 4USKA 3IGVA 1KR4A 1Y5LB 3BKUA 2MY8A 4EU0A 5GAGU 4ZVOB 4EO8A 4ZMMA 2AD9A 4M1KA 1SKRA 1CJUA 4P2FA 2W2NP 2XB2D 2DISA 3QNWB 3DRPA 3ETOA 4HH1A 2QEXS 1WHYA 3IAM9 5KT5A 4O0IA 2OEMA 3VV2B 5KFVA 4QWAA 3MD3A 1BD6A 2HQIA 3HHEA 3CF5Q 4X4TA 1UWBA 3D1HA 2O66A 3HVTA 2DJWA 5U47A 4EK2A 1IQTA 5JXSA 3WDOA 1W2BR 1RP5A 2DTJA 3A4TA 3Q8VA 1LFPA 3MAAA 1KONA 1L5UA 1K1QA 3OVBA 3CCWA 4IG0A 3GQCA 4OYMA 3G6VA 1FXRA 2HK3A 5D0RA 2LYVA 4ECRA 1ZPVA 2IDEA 4ES1A 2UUAF 2YKMA 2E7VA 4O4GB 4CLSA 2W8LA 2B9XA 2R42A 1EARA 1UMJA 1SQFA 1UFLA 4TY8B 1CPZA 2G9OA 3OSNA 2CVEA 2HAIA 5FJ4A 2C28A 2GVZA 2AMCB 4YY3J 2PA8D 5HN0A 2OGUA 4OHWA 2LCWA 4X65J 1X0FA 2IA6A 2OH2A 1FXLA 1EX8A 1TFWA 2RUSA 3ZTSA 1AYEA 1OSCA 3BSNA 2VC0A 4FVMA 1XMQJ 4X66F 2QYCA 2MHNA 3PYDA 4ZP8A 4AT1B 2QMWA 4JI6F 1TL3B 2HEKA 1UKUA 4UQTA 5HMWA 4DR1F 1DTTA 2YKNA 3BO2A 2YX4A 3FMBA 1WHWA 4PKDB 1F3FA 5EDWA 2VF3A 2J76E 5C42B 4XK8C 3R5GA 1TU0B 4QU6A 3VVUA 1SJ3P 2A18A 2F40A 4M5DB 4CLTA 4J9PA 2OHDA 4K5SA 5GMEA 4DZDA 1ZYQA 4H54A 2AX0A 3K7RA 5D78A 4DR2F 3N9UC 4IRDA 5BYRA 1GNKA 2VU5A 2CJBA 3VAFA 4C8OA 4PZVA 5A8WB 3EPIA 2XZDB 2MZ1A 1S1WB 2MY7A 4RBUA 2FGOA 3H2VE 5AT1B 4QIEA 4KY3A 4FXWA 2V8DA 4QWEA 2MYFA 3TQ1A 4WE1B 2N3LA 3VWSA 4F2RA 1S48A 4IDKB 4QCLA 2HNDA 3HT0A 2HFSA 2F8HA 1RA7A 1VBKA 2KZZA 1GFWB 1U49A 3KK2B 3MHYA 1BWVA 2Z0GA 4QW9A 3NNAA 3GR0A 3Q8UA 2MKKA 4JI2J 3HSJA 4LBPA 2VJVA 4WBFA 5G0RA 3M9MB 5KFDA 5F0WA 4IOAQ 4CTAB 1NB7A 5AXLA 5EWFA 4ECVA 3T1HJ 4HT7A 2DGUA 4NEYA 2V94A 3UDEA 4QWDA 2SXLA 4IQXA 4KQZA 5KG3A 5HLFB 1YJ9S 3PO5A 4OJGA 1HNXF 5HLFA 2O1PA 1RSCA 2DR6A 2EC0A 2VDIA 4JB8B 2MKCA 1FRHA 3I31A 5IQQA 1TAUA 4P9SA 5KT3A 4DV2J 3PM9A 5HQMA 3V4IA 2HVIA 3ENQA 4NLYA 4J91A 3SQGA 5A0YB 1X9WA 4F4KA 1XMOJ 3IRWP 5RUBA 4NZ0A 1VCTA 3PW7A 1I94F 2R7XA 3V5RA 1NDKA 1LW0B 1RWKB 4KH0B 3DRYA 5L8RC 9ATCB 1LV5A 1RI7A 1ZTTA 1IM6A 4U6PA 2RU3A 3GP9A 1FEEA 2CDRB 1S9EA 3KFWX 3GIJA 2H4YB 3TVZA 2NXCA 5ETRA 2KXNB 2DHAA 5LMNJ 2DRDA 2C3MA 4B9SA 4OX6A 5ETLA 3C16B 4PG6A 3NGTA 2VHGA 4F4ZA 2WCXA 3ONQA 4G1IA 4MIAA 4PG4A 5E41A 2AHOB 2JHEA 2KI2A 3TQEA 7AT1B 4FXVA 1B3TA 3NGRA 1KNZA 2GV1A 4NLXA 3MCSA 4ZS6A 2E5HA 3QGGA 5DLFA 1IKVA 1QD1A 5IT0A 4L75A 3UNYA 3HULA 2F1FA 1TK8A 4O44B 3TOQA 1L3VA 3P45B 2PI4A 5EWGA 4WZQA 1AW0A 2BVZA 4L3NA 1KFDA 1W26A 1UAWA 1F9HA 4QZVB 1TKZB 1R8BA 2VPZB 2ERRA 3AB4B 3JTPA 1S59A 3BSCA 2VBWA 2YPYA 3FSXA 4RNFA 2E7WA 2N4DA 4I56A 4NLDA 2YNFA 5IS2A 3W5XA 1X5TA 4H4OA 5H9FJ 1LWXA 1B70B 2ZBPA 4DR7F 2VG6A 1X4FA 1Q7LB 3MCNA 4B3SF 2F4VJ 4MJKA 3RR7A 5FLXU 1YDLA 3IWLA 3NOCA 2CNOB 1WOPA 1RUSA 3HSDA 6FD1A 1C1BA 3M2VA 3S7RA 4OLPA 4BCAA 1JQGA 1IBKF 1D9DA 1C1BB 3O5TB 5CYMB 1N56A 1J27A 1RTIB 4C2MA 1NLKL 2QV6A 5KT4A 3OFFA 4KH1B 4DV1J 1I6JA 2XSJA 4RW4B 3IMQJ 2O01C 2QGFB 3H98A 3LP2A 2RH3A 3O6QA 5AXKA 4WKYA 4ZN3A 2BE2A 1XTZA 4C11B 4LF5J 2CQ0A 3EPGA 3KNGA 5I42A 1I94J 4IQMA 3QSYB 5M2PA 1XERA 3K2YA 2BW2A 3TP2A 2QO3A 1SJ4P 1TELA 2JEIA 3CC2S 4IG3A 4JP8A 5DGBA 1T3NA 3QAEA 4WJBA 3TA1A 2JL9A 2R2SA 3W9JA 3IM8A 2UV8A 5M2RA 1X7VA 3BS9A 2CQIA 3PIOQ 4LF7J 1IR1A 1P9QC 4U7CA 4Q0BA 4ETXA 5A76A 2NUHA 2W01A 3BF4A 2POKA 1RWUA 3G6ES 3SCJE 1S0OA 1YBUA 4DPWA 1P27B 1TKTB 3BSAA 4I1TA 4LUBA 3GCXP 1C0TA 3MCOA 1GXTA 3EWGA 2VJUA 2DITA 3NS7B 2YWKA 1BGXT 1Q4RA 3O1LA 5A2QU 1M0SA 1FNOA 1NBEB 3D3BJ 4M5JA 4FYYB 2WAQD 2XULA 5KFHA 5H9EK 1UVNA 1Y10A 2KXFA 2YXLA 5I42B 1SQGA 1ICEB 1Y0HA 3KK3B 3KHLA 1J5OA 1ZM2A 2QLFB 2V2QA 4O3QA 3PX0A 2Y9HA 1K0VA 2HWTA 2YQ1A 5IM0A 1O6XA 1VQ7S 1JKHB 2E29A 4DL5A 2PFDA 3DU6A 2E9ZA 1OYEA 1SV5A 2AJFE 3CXCR 4OX7A 5KFEA 1YVFA 1HQUB 2FVCA 2RNEA 2W25A 3CJSA 1SPBP 3POTA 4QQBA 1WSVA 2KT3A 2C2OB 5K8NA 3V4IB 1QSSA 4DV1F 3L7OA 4ANEA 5KTQA 3GONA 3MM5A 4DR2J 4PRFA 3WIUA 5B0BA 3OXLA 4NMLA 2FTRA 2HKEA 2RS2A 1NKCA 2FB0A 5E7OB 3MEDA 5B0FA 1PYOB 3MMJA 3C66A 4K2XA 1R89A 3HVAA 1V5VA 4WCEQ 5LMNF 2B4PA 4CO5A 4C8NA 1V3ZA 2W2MP 2OPRB 4XAKA 2VQFJ 2BE9B 3B54A 1KSPA 2UVWA 2EFQA 1MWYA 1S5ZA 4DEZA 3TA0A 2VICA 1NU4A 1NHVA
chains in the Genus database with same CATH topology
3U1MA 1HBOB 1S6OA 2XMTA 4RUHA 4OQJA 1F5CA 1IR0A 2DRAA 2WRMA 5B0EA 1RTDA 1GXUA 2AQ4A 4CQ1A 2V5HG 1DQ9A 3KLIA 3MGJA 4ZPVR 3HKWA 1QUPA 4AXJA 3KJVA 4LSNB 3CMES 5DJBA 2ASJA 1TK5A 4DFPA 4IDKA 2OFHX 3CD0A 4NRTA 1REVB 4WK1A 2DNKA 4F50A 3BGRA 2F9JA 2HFZA 3PEHA 1HWKA 2KT2A 3SI8A 4DSEA 5LL6d 4A4JA 4WFNQ 5KG2A 1JLFB 2W4CA 2HVHA 5HMXA 4QIGA 5E0OA 3TW0A 2XWYA 4M5DA 5KFMA 4ECUA 1N48A 2BJDA 2G13A 2X1AA 2B43A 5KFBA 1JMTA 2B4VA 2X3GA 3PEJA 5J2NA 2JEFA 3RR8A 2HZCA 3HO1A 4PQUA 2UUCF 4DPOA 1Y7PA 1OQ6A 1SIZA 2BUNA 2AJ0A 3DRSB 1VQMS 2G1DA 1WELA 5CZVA 2D3OR 1K9MT 5C24B 3PRDA 5E3AA 2ZJRQ 3TUZC 1RT4B 3QPIA 3IS9B 2GQQA 1QVGR 2IRYA 2LLZA 3GR1A 3QGHA 4QR1A 3PV8A 1S0NA 3OFEA 2HG4A 4MIWA 5DQHA 4ICLB 1HPZB 5GAEI 2LQBA 5KFSA 1J2VA 5GAGI 4CT8A 1FD8A 4OHYA 4EEYA 3K0JA 2XSJB 5G4DA 4NLSA 2NPIA 4A8MP 1GQEA 1O51A 3DM2A 3GSDA 3M2VB 4A8KA 5B0GA 4CCHA 1U1LA 2JEJA 4QIWD 5EHHA 2MQNA 5JVHQ 1S10A 4YR0A 2CYYA 2EVZA 1SL1A 2YNGB 1TV6A 2DNLA 2HYIB 1HD0A 1K73T 2J7WA 2MZSA 4R25A 3QJPA 3MMBA 2R7TA 3QO9B 4M95A 1MMLA 3VTIA 1S1XB 2RRBA 2PMHA 4IKAA 2OSQA 3NLCA 2AV5A 4C8YA 5F8LA 3D1OA 4Y2CA 1TKZA 1FDDA 3MM5B 3VQTA 5F8GA 2W9CB 2VONA 3HK2A 2CJKA 2FC8A 3OBIA 3GMGA 3LAMA 3MEGA 5A6PA 1HQUA 2Q6CA 2XMUA 4ZHRB 5ADZA 5HROB 2YH0A 2J6UA 4DS5A 1TVRB 1M5KC 3NNHA 3HVTB 1V3SA 1SQEA 2FUG9 2CPEA 4BWMA 1N6QA 4WYWA 4CO0A 2GNKA 3THPA 2ADCA 4EWTA 1IN0A 3Q22A 1PILA 5KFIA 3J7ZT 5IQ6A 3QWPA 3R5AA 4YDXA 3SCIE 1ZOTA 5KG0A 2MZQA 2Y0SD 4ECZA 5KFOA 2U2FA 3E01A 5CH7B 4CH0S 2RS8A 2E5IA 3K59A 3E2EA 2LEBA 5J1NA 1S0VA 2R7SA 1FK9B 4IG3B 5L1IA 4WK3A 1IKXB 1FKPB 2K7KA 3I56S 1K0TA 2B7BB 2FC9A 5T7LA 2WK4A 2XC9A 1RT3B 2A2DA 2C3YA 2IVMA 4WFZA 1E6YB 1RDRA 3CJ2A 5A6WA 5KOWA 3H8YA 4LSLA 2JWNA 4U67Q 3QO9A 4OZ0A 2KXHA 4I6WA 1OS5A 3MM7A 3CDAA 2KH9A 1SUQB 1TV6B 3D1QA 2KYZA 2ZDOA 4R5PA 4ZP9A 2JLEA 2OIHA 2ZNZA 1SH2A 5IZHA 3SFGA 5DDRC 4WFYA 4NZ6A 2NLWA 4OI0A 2WBMA 4TU9A 2D74B 2VG7A 3N28A 1Y5NB 2AF6A 4X4RA 1WG4A 3JSBA 1FNMA 2JOQA 4XDDA 4IOCQ 4OFZA 3F56A 5J2PB 1UWBB 3U27A 2C3OA 2XMVA 2R8GA 1N0UA 4KFBA 2GGPA 3UI3A 2J6TA 3I5CA 2QA4S 5C5JA 1TQLA 2ZKUA 1QE1B 3JYTB 5T41A 1IBMF 1VS3A 3QAUA 3TAMB 3M30B 2ZE2B 1UVIA 3IXQA 3DOKB 2HW3A 1MROB 1WHVA 1D1UA 5D77A 1H38A 1NK7A 4KKOA 3W2VB 4OLOA 3FEXB 2G4BA 2VQFF 1HWUA 2WOMB 1SIWB 4G6VB 4Q2MA 3EGZA 4DL2A 3MURP 4F8RA 4YB5A 2DR7A 3I9V9 2WB4A 1N4LA 3MUTP 4KGMA 4N47A 2EKYA 1FO1A 5DQIA 2MB0B 4DBQA 2X1BA 2MZRA 4C3KA 3D0IE 3KKFA 2E5JA 2AYEA 5CA5A 3DLKB 3FQLA 5KFTA 4CTAA 2DIUA 2FHKA 3ZZTA 4K4XA 1UVLA 1MWZA 3NBPB 3OFHA 2R7OA 3ENWA 3X3UA 4I64A 1HNIA 4CZCA 2C2DA 4C8KA 5KT7A 4O4RA 2DGXA 4IFVA 4ZVGA 3LAKA 2J9CA 1S9GB 4ZPTR 4LVOP 2KM8B 3M8QB 2QRRA 3Q8SB 4QW8A 4RW7B 1YTYA 3KNAA 2ZBCA 2B7CB 2YNHB 1N8RT 2CPJA 3Q24A 4YMEA 3CCES 4CI0B 1FKOB 1U09A 2PI5A 3G4SS 3K5NA 2YWGA 4PXBA 2IC3B 1KQKA 4B3TF 3DRPB 2HS3A 4OIXA 2O3DA 4C8LA 1VQNS 2Q3PA 1HWLA 3PXGa 2BBEA 2P9EA 3FSIA 2CIMA 3FGVA 5GVQA 4BHQA 5G0RB 1RT6A 4KFBB 2N7CA 5HMZA 4OJ1A 4ZP7A 5BJRA 2OPPA 1WG5A 2R2RA 3KK2A 3OTDA 1VBYA 4IUFA 3V6DA 2Z2LA 3FSYA 2IM3A 4ZK7M 2Q6BA 3LP0B 3PRBA 4ES3A 1FJ7A 3BB5A 5DGAA 2OAUA 1FDAA 4MK8A 3RB3A 1A9NB 1VQ5S 5B09A 2J7KA 2V4RA 3MR5A 3SDEB 4A8QA 3NNCA 4EYHB 4Q5VA 5MAOA 1R31A 4KB7A 2Z4PA 3NS6A 4R5PB 4H4OB 1Y00A 3CJ5A 1H7XA 2WTFA 1LWCA 2HRUA 3S1TA 2V8GA 2DNPA 5H9EJ 1N5SA 3KLGA 2RQMA 5L9XA 5KAKA 2W7OA 3H2LA 5KFCA 4HH0A 5K14A 1IJEB 2CQGA 3IG1B 4PUOB 5HO4A 4LQ9A 3GILA 3AY0A 3QIDA 2N82B 4DWIA 2K7JA 2CQDA 2Y1RI 2OPSA 1XR5A 2VOPA 2NXUA 3CDWA 2XEXA 2OPSB 4MAKA 2GHPA 3R5CA 4DV7F 4ED7A 1LQ9A 2KHCA 2UU9F 3CEDA 3KLVA 3IO1A 4M63A 2IVFB 2ZH3A 1N5YA 4Z2XA 3EXYA 2GGPB 2B4OA 2FHOB 3M1VA 3CJKA 1PSDA 3ISZA 1AFJA 1Z2LA 2D1CA 4KE5A 1W2IA 3LUYA 2HLUA 3QGIA 3PIPQ 4JI0F 5KFUA 2W7PA 2PGCA 1R8AA 1ZBTA 4Q44A 2AP6A 1H7WA 4Y2IA 4OHZA 4DQQA 2CJ9A 3RBDA 5B0AA 4CO4A 3BN7A 5JJBA 3AQPA 3FZBA 1B7FA 2BZ2A 1DHMA 2JJ4D 3LF0A 2RQKA 2C3PA 3S01A 4NLVA 3T5HA 1KQGB 5K8PA 3PX4A 3QIPB 3LO3A 5KFKA 3NCQA 3T6JA 4K59A 4P6QA 4WXWA 3V4MA 2XNQA 3JTNA 4A8XA 3SCKE 3GIMA 2J8AA 4XPEA 2GX8A 3O3LA 2FHJA 5J1EA 1VBXA 2FLNA 2HHXA 3QLHB 1FKPA 5CZXA 3DOMA 3DNCA 2OPQB 2ACYA 2F8EX 3DLGB 3TUJC 1NK8A 2FLPA 2DO4A 3H4BA 1WF0A 2DVIA 2JZ5A 2AJ1A 4IH7A 4WU2A 1HNVA 3AHPA 4CO2A 4ZDNA 5L1JA 2V2KA 3CC7S 4O3RA 5CYQA 4DLGA 1N5VA 2VC1A 2YQ3A 4HEA9 2DHSA 2KYXA 3OUYA 2ZDPA 3KTQA 2LXFA 3RAMA 1HBMA 2HS0A 2CQ3A 5DDOC 1SXLA 5LSLA 5D3GB 4C7QA 1TUVA 3OPKA 4KGKA 4MKBA 2CZVC 3DOLA 2CZ4A 5F3ZA 4DOZA 1RAJA 1SKWA 2BJEA 3KLEA 3JB9k 5AXMA 2E9TA 3NGKA 4BWJA 3B78A 2YWEA 4DV0F 4F4XA 3QLHA 3EYZA 2BOPA 1XN9A 4DV5F 1U1NA 5CCLA 3GYXB 3UCZP 2QLXA 4YP3A 1FRLA 2ZE2A 1H0HB 1Y3JA 3LWMA 1BWEA 1DLOA 3BR9A 2IBOA 2NS1B 3KG4A 1DLOB 4ZA1A 4WFBQ 1XNQF 3ZZUA 1XR7A 2OD6A 2VA2A 2D41A 2DNRA 2GIQA 2L08A 1FRKA 2RT3A 2R8IA 2P6SA 1Y5IB 1SBRA 2KVIA 4Y3CA 2ASDA 1D8YA 2J0WA 3CGIA 1VQYA 3K58A 3GZ7A 4L72B 2W9BA 1DQAA 2PDAA 2JVOA 4DG1A 4UOCA 3UR3C 4X65F 3I9ZA 2COLA 1LXNA 1NJZA 1LFWA 2DR9A 1RT2B 3DHWC 5F9LA 1SKSA 3DLGA 4C3LA 2OLWA 3SMZA 1IKYA 2VFUA 3B4MA 4NLRA 2UP1A 5DQGA 3MUMP 2Z8QA 1ZM4A 3J7YI 1FNXH 3MR2A 3CCQS 1LWEA 1XBWA 2HNYA 2R4FA 3MPVA 4DX8H 3I87A 3M6UA 1U1OA 4YEAA 3QZ7A 4YOEA 1T3OA 3PO4A 2ZUGA 5AE1A 3ZZZA 2NSCA 3CO9A 4MYUA 2PEHA 4FZVA 4N56A 1O8BA 1WWHA 3MEDB 3UWTA 5J2PA 1QAIA 4Q8EA 2W9AA 1FK9A 2BYCA 3OTOF 1FCAA 3VCDA 4ETZA 2XBPA 2KRRA 3CDBA 2UXCF 1H2UX 3IR6B 1TR0A 2DBBA 1CG2A 5K9FA 3LW5C 2DNGA 2IA0A 3HJFA 2Q66A 1CC7A 3CTRA 3QGPA 4RW8A 4TYAA 3H5UA 3SEOA 1M5PC 2CQCA 1LWCB 2LMIA 4WXOA 3DLHA 1XNRF 1SUQA 2OSRA 3MAHA 1S4FA 4MKAA 4EZ6A 2H9ZA 3T1AA 1FE0A 4RUAA 1U4BA 4FP9A 4J9NA 1T03A 4ES2A 1YRUA 2YKOA 3AA9A 4DL3A 3QWUA 2NZ4A 4DFKA 5EX3A 2FY1A 5GAEU 3CCMS 2NSBA 1ZAWA 2KG0A 2KFNA 3FRZA 3EZUA 3H25A 1E6VA 2ABYA 4J9MA 3UQSA 1D3WA 3B4DA 1BQMB 3M6XA 3TUIC 3AB2B 3O8WA 5A8RA 2OMOA 4Q43A 2DIVA 4LF9F 2GQ2A 1R3NA 1QY7A 4HT5A 5J1EB 4ED1A 2KKHA 4PUOA 5GADU 1QE1A 3JYTA 1RA6A 3I5AA 1LK5A 5L1KA 3CSKA 3BO3A 1S1UB 3GWCA 5GMKa 4GKJF 5IT9Y 2GO8A 2R8KA 2UUWA 5KFPA 2MXYA 2L9WA 5THWA 2FIUA 4ECTA 4A8YA 2IYGA 1OPIA 4DMZA 4K5RA 2GFFA 1VRTA 5KFAA 1HBUB 2P6TA 2BANB 2I1RA 4I2QB 1S76D 4JOUA 5E3RA 2OTJS 2C3UA 3LP1A 1IXKA 5KT6A 2K1RA 3WZ0A 2B6AB 2E1MC 4YFUA 3P6YC 2FVQA 2I8EA 1HI8A 2IJNA 2VKZG 5I3UB 3GFYA 5LMUF 1KVIA 4I4BA 3NMRA 4W90B 1RJJA 3CUNA 5KG6A 1S1UA 2O67A 4G1QA 1WTFA 2VL1A 1TZ0A 3FJ2A 3G8TA 1MMNA 1N52B 2ZJQQ 2VPXB 4HDHA 4CNYA 3D28A 5KFLA 3DOLB 2CPHA 4XIUA 2KT5A 2HHSA 1D9AA 4L6V3 2UVRA 3C2PA 1S9GA 4OHXA 4GMKA 3VALA 4J9SA 3HHLC 3MDFA 1LWEB 2CQ1A 1X5PA 4LF5F 2WHOA 4HDGA 4RZRA 2FVSA 4NXNF 2MGZB 3DRRA 4DS4A 2IJFA 3VR1A 2B9YA 4IR1A 2VFVA 2Q1LA 3FMWA 3ZZOA 1F60B 2BQ3A 2GMHA 1NK6A 4K50A 4URSA 2MSSA 2DD8S 1HNVB 4ED6A 2GJIA 3MM8B 3SYZA 1U47A 4KJIA 4ERDA 4OZ1A 1JNZB 5EN1A 4N76A 4DG1B 3HXMA 4NLUA 3IRXA 3HHDA 1FVQA 2WOMA 3NAIA 4DL7A 2W24A 3KG0A 1VRTB 1HNIB 2AYMA 1ZETA 2RF2A 3I96A 3SXLA 1DJ0A 3SSRA 1UVJA 1S6UA 4YUDA 3KG1A 1MW7A 2QA4G 2E1RA 3F44A 1URRA 3UCUP 1JJ4A 4KIAA 4PXCA 4ZCMA 3D0GE 5KG4A 1C0UB 2P9CA 3MM6A 3OFGA 4QOTA 5HP1A 4R8UB 3FCHA 2APOA 3UE2A 3M8SA 3MFHA 2WB1D 3I4PA 4ZKAA 1J5EF 3H20A 2VH7A 1O0PA 2OKQA 3R5BA 3WBZA 2HHQA 2HWIA 3GFZA