2W4PA

Human common-type acylphosphatase variant, a99g
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
96
structure length
96
Chain Sequence
GNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYLPHOSPHATASE-1
publication title A Rigidifying Salt-Bridge Favors the Activity of Thermophilic Enzyme at High Temperatures at the Expense of Low-Temperature Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 23
structure length 96
sequence length 96
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2008-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2w4pA00
5B08A 2RMLA 1URRA 3BN7A 3BR8A 3KG1A 1Q8BA 1JK9B 3IWLA 4ZOSA 1V3ZA 2XMVA 2AJ1A 3KG0A 2HLUA 1AW0A 3BDEA 5K9FA 3MCSA 1OQ6A 1Y0HA 2QLWA 5B0CA 2EW9A 2XMUA 3LO3A 4OIXA 2FHMA 4YDXA 4DN9A 2GFFA 2KT3A 2ASYA 2AJ0A 2GCFA 1AFIA 1KVIA 1GXTA 2AP6A 1TL4A 2OAUA 3FRYA 4HH0A 3QMQA 1TUVA 2N4CA 2IYGA 2W4CA 1Q4RA 2AW0A 2N7YA 2BJEA 2LQ9A 2XMJA 3E8OA 1GXUA 1IUJA 1U7LA 2ROEA 2GGPA 1S6OA 3FGVA 2QLXA 3BF4A 4DPOA 2IYIA 1FESA 2GA7A 3TNVA 1XBWA 4HI1A 3GZ7A 5F0WA 3FMBA 2GV1A 2GGPB 1N5VA 2XMMA 3HHLC 1FE0A 3HFKA 1CPZA 1YJVA 5B0GA 4QOTA 4Y2KA 2K7KA 3BM7A 4DL0C 3MZIA 1Y9OA 4Q2LA 2W4PA 4Y2MA 1S6UA 3K7RA 3I9ZA 5T7LA 1OPZA 1JWWA 2ACYA 4Y2IA 3HHLD 2ZDPA 4HI2A 1WD6A 2BYCA 2ZDOA 3DXSX 5F0UA 4A48A 1VQSA 3BB5A 1FEEA 4NL5A 2VV5A 4A47A 4F67A 2ROPA 2XMKA 1TZ0A 5T7LB 1X7VA 1SQEA 1TL5A 5B09A 3IWXA 4OJ3A 2FTRA 1ULRA 1VQYA 2FB0A 3TOQA 1AFJA 4ZA1A 1QUPA 2HIQA 1Q8LA 1YJTA 1P8GA 4NPOA 2LQBA 1YRXA 5B0FA 1Y3KA 2N4DA 2KYZA 4OJ1A 1N5SA 2OKQA 2RU9A 1Y3JA 2K2PA 3TRGA 2FIUA 4EFAC 2PD1A 1KVJA 2BUNA 1FVQA 3F44A 1K0VA 2KKHA 1YG0A 2BJDA 2IFXA 3HDSA 3CJKA 4OJHA 3LGMA 2CRLA 2HLTA 2OP5A 2KT2A 4OJGA 1MWZA 5A6WA 1FD8A 1N5QA 1TR0A 2BBEA 2HFOA 2OD4A 3WDOA 3CJKB 3BGUA 3UDCA 2L3MA 2Q3PA 1FVSA 2K7JA 4YEAA 3KKFA 5B0EA 3T9NA 5IXUA 3HHLA 4FNHA 4A46A 4HL9A 1LQ9A 3HF5A 5B0AA 3LGNA 1R6YA 1MWYA 3KNGA 4FNIA 1YJUA 2QIFA 3VTIA 1P6TA 2OFHX 1OQ3A 1KQKA 2ROGA 1W2IA 2VH7A 2OFGX 1APSA 1Q53A 1FE4A 3HHLB 2RILA 5KAKA 3QGPA 4U9RA 2OD6A 2OMOA 1SI9A 2QYCA 5B0DA 1X8DA 2K1RA 2LXFA 1X0PA 2PGCA 1N5TA 2G9OA 4A4JA 2XMTA 1YJRA 4HH1A 2W4DA 2HQIA 3DCAA 1CC7A 1RJJA 2HFNA 2GO8A 1CC8A 4Q2MA 2LDIA 5A6PA 2JDJA 2RSQA 2K1RB 3HX9A 1OSDA 5B0BA 2XMWA 1SB6A
chains in the Genus database with same CATH superfamily
1M5HA 1L5UA 1RT5A 4B17A 1WKLA 2IDLA 2V6AA 4L73A 1SUQB 4DR7F 2XM3A 4URQU 2MMYA 1TK0A 4LF5J 2QRRA 2LEAA 4LR7A 2B3TB 1WEYA 3HSZA 3UD4P 2HFSA 3CDAA 5KFPA 3Q2TC 4DL2A 2ZWPA 4F50A 2OSQA 3BEGB 4ECTA 3DDIA 4WZQA 1FEEA 4TLRA 4AXIA 3VQSA 1IR0A 3P96A 2HWHA 3BZQA 3W8PA 2W9AA 1S99A 4ILLA 5HMXA 1NHUA 1VFJA 4IR9A 1U0HA 1R0AA 4NZ6A 3JS9A 2UXDJ 2CZ9A 3FK4A 2NREA 2G2OA 1HW9A 1U24A 4DR4J 1IKYB 3T9NA 4BS2A 4DPUA 3LP0A 4U67Q 3R6LB 1RCXB 3N79A 1RT1B 3I32A 3RTVA 2J5AA 4N7TA 3KOAA 4A8SA 4RUBA 1IWAA 4AUKA 5KFDA 1BQXA 1FRKA 2AJFE 4A8FA 4DR1J 1VS3A 2ATCB 3A8IA 1GXTA 3HLUA 1WDTA 1SJ4P 1WG1A 1RTJB 1RUSA 4JUZA 4N5SA 2ZJRQ 5KFRA 5C25A 2RB7A 3DRSB 3LAKA 2MQQA 2H3EB 1YJ9S 4ID5A 3UNYA 4NEYA 5IZHA 5K14A 4CT8A 2FTRA 1ULRA 2Y0SD 2CNKB 3IRXB 2CIMA 3KLGB 1ZAWA 2BVZA 2IJFA 1S1TB 3TZYA 3EM1A 2OPRB 2O1PA 1LEOA 4C8KA 3MWBA 4HL9A 1JLCB 3IA0A 3MM6B 3CMES 1NH8A 3PR5B 1VRQC 2VPXB 4DR5J 3QFWA 4Y0FA 1W7WA 5KFLA 2G4BA 1VHFA 5EX3A 4B08A 2OEKA 4CNZA 3C8YA 2KB2A 1MG7A 3M8ZA 3JQJA 4KGKA 2EXUA 4KFBA 4TVAB 3LH2S 4ANDA 2WVEA 2GFFA 1MU2B 1IN0A 2AP6A 2HGLA 4E8UA 3UQSA 1U0SA 1RWUA 3KMSA 2DEJA 2NSBA 2LMIA 2O67A 2R8HA 4EBDA 4KE5A 4B9LA 2H4YB 2M2BA 1OO0B 4WJBA 5IT4A 2UXCF 2ERRA 3FJ2A 2PI4A 4ETXA 4DX5A 3R1LA 3AOCA 1R3NA 4WU2A 2ZWOA 4LQ9A 3CJKA 4RWWA 4X4VA 2D41A 2OEMA 3P49B 1FRIA 3RAMA 4DCPB 4N77A 2N3LA 1K0TA 4YEAA 1H2TZ 4IH6A 4DV7F 1GT8A 3PY8A 4BC7A 4RNFA 2OD6A 1D9FA 2D1CA 2OMOA 2XCAA 1JKHA 5E3QA 2W2PP 2RD5C 1TP7A 4DV5J 2EK1A 4J9UE 2BE2A 5F3TA 1VQ4S 3N6NA 4AQYJ 4WP9A 1AW0A 2AT1B 4E2FB 4C0HA 5BR8F 2HHHJ 1XJWB 1HI8A 4OI2A 3NOGA 3NGDA 3LF0A 5L38A 3PJ9A 1C0TA 4J9SA 4JI0J 3MR3A 1JXLA 3MCMA 3R5DA 2J8SA 3GZ7A 2ZUGA 5A8WB 1V6HA 2ZOMA 1IJFB 3BKTA 2JLFA 3I9ZA 5DQIA 2Y3YA 4A48A 3NNAA 5F41A 4LF8J 1BGXT 4F67A 1QE1B 4NYZA 3IC1A 4OX9J 3HVAA 2VPYB 2IMWP 3HPOA 2M4MA 2G1DA 3VAHA 4PWWA 2QN6B 5C7PA 2BQ3A 2FLNA 4NCBA 3ONQA 4MH8A 1I5OB 2EPIA 1JLEB 1MN9A 3ICLA 1RTDB 2COLA 2FVCA 4EUVA 2LXFA 2NSCA 1X0PA 3H98A 3ZZ0A 1QY7A 3EVWA 5KFXA 1SPBP 5IT0A 2YWEA 2OSRA 4O3PA 1CQMA 2IRXA 5ITHA 1HI0P 1S7HA 4KHPJ 3EUNA 1OJ4A 1KLMA 3GE9A 3QMQA 2OLWA 2QLFB 4TU7A 4DUZJ 2DGSA 1VQ9S 4NLSA 1UZDA 4RW7A 1VC5A 5E41A 3EXCX 1VBKA 4OHVA 3VF0B 4F3OA 4K4TA 2DNOA 4KYZA 3QYYA 2JEIA 3G86A 4DZ6A 5BYRA 5F8LA 1OPIA 2JEGA 3DLEA 1U48A 3KLFA 4GKJF 3OR1B 4XIUA 4NX9A 1S0MA 4ZCKA 1RWXB 2DKOB 4F2SA 3PCOB 5HQ8A 1S0OA 3KNGA 4FNIA 4NA2A 3PW5A 2OFHX 1HR0F 3RJMB 1BLUA 5KT4A 1KONA 4WFXA 2A2CA 2DK2A 2EWHA 4HHJA 3FRZA 1RTHB 4CH0S 1RJJA 2W7AA 4CNYA 2J0XA 1BE4A 2FHJD 4IDKB 3QRPA 1W26A 3CJ4A 1PYSB 5D15A 4LIRA 1CBKA 4DOZA 2O3DA 3D6TB 4MFBA 3TX8A 4CO5A 1UA0A 5I42B 1PJ5A 3AJ1A 3Q89A 5CAAA 5BXIA 1JLAA 5KG1A 3CE8A 1JJCB 2Q79A 4C0BA 2GV1A 5E33A 1DQAA 2RUSA 2HHUA 2MQNA 2MLYA 2X1BA 1F3VA 3M1VB 2C22A 2M3DA 5GVQA 3VZIA 1FDAA 2K06A 4F4AA 4CLZA 1VQMS 2FJEB 1MN7A 4OI6A 4OYZA 4NYPA 1PKUA 5IQQA 3MM7B 1U45A 1F2GA 1TR0A 2MQMA 3DOLA 1ELOA 5DLFA 1MMDA 1O6XA 4QYZK 1CJVA 3AODA 3W64A 3K8VA 4DUYJ 1DTTA 1KWMA 2C2EA 3EWGA 1HFEL 1HBMB 3UCGA 1D8ZA 5BYSA 2JDJA 3H7HB 2NS1B 1OSDA 4NRUA 4ZITA 2XMWA 4QPXA 3KK2B 3DRRB 4ECXA 2NYIA 3I0SB 2XY7A 1C1BB 4RW6A 2LKZA 3MUTP 1UTAA 1G3OA 1XR6A 3BS9A 3DRYA 1CJKA 2HRTA 1RAJA 2Q43A 3H5SA 4KY3A 1Y11A 4K2XA 3ULHA 2CNLB 2RDIA 3SCJE 2W9BA 1PILA 3C16A 3DFEA 3PW4A 4ECWA 4MK8A 4P9SA 3A8EA 4M5LA 3BKUA 3I56S 3OXLA 3KJVB 2HFUA 2OH2A 1KHWA 2EEYA 4EYHB 1RWVB 4JI4F 2ZFHA 4A8YA 4QZVB 2FB0A 2HBRB 2YNHA 3MMCA 3TAMB 4NCGB 3M7VA 4FVMA 1GTHA 4IFVA 1H3DA 3DOMA 1RISA 3BV8A 4DDFA 2ZE2B 4LSNA 4B9NA 2Y1JA 1KQKA 1EQMA 3HZGA 2AF6A 3DLJA 3DLKA 2D69A 4Q45A 5B0DA 1UA1A 3DMJA 2LDYA 3K8WA 2DB1A 1SQFA 1IBLF 4DR3F 2V9KA 1NK4A 1UWBB 1UVLA 2E1MC 4NE9C 4FKYA 1KVIA 3UVJB 2WCXA 2M9KA 3MMBB 4QBUA 2FZKB 3CXCR 4NOHA 1CS4A 2DHHA 2NCKL 2OELA 2XYHB 3CCQS 1P9YA 4YHHJ 2LXIA 3HSJA 2HEKA 3BM7A 3AHPA 4LF4J 2FDNA 1GMVA 4MIAA 4C3KA 1X7VA 2FGOA 2D74B 4J90A 3W5ZA 1FDNA 4OMFG 1U1QA 2OO4A 2GHPA 3MMAB 3OTOJ 8RUCA 4DV4J 1HNIA 1U49A 2IVFB 4J9KA 4OI0A 3M2VA 3M2UB 2DPJA 2DJWA 4WE1A 2DNHA 2B9YA 4PG4A 4LR9A 3R9LA 1SC3B 1HBNB 3KLHA 2QYCA 3KJFB 3D1OA 2R7OA 2XSFA 2WOMA 3C19A 3PHEA 4A4JA 1IWGA 3RAQA 2HWIA 3W65A 3H5YA 5LSLA 3KK1B 4NA1A 2IM3A 4DQQA 4YR2A 4CCHA 1JJHA 3BBBA 4LSLA 1YBUA 1RT3A 1SJRA 4Q0BB 1DQ8A 3D66A 1T3NA 1RAEB 5K5MA 2AJQA 5KFOA 1ZM3A 1RLDA 3DNCA 2QMWA 1AYEA 1HA1A 1MSWD 4DQRA 1WI6A 5AXKA 2HBZB 1XR5A 4A8MP 3RBEA 4OJ1A 3QGGA 3OLAA 3PVXA 1XMOF 2D7SA 1SV5B 2KT2A 3W61A 2GHVC 4NA3A 1EP4B 4DV2J 1RYRA 3IO1A 4K4YA 1HARA 5AXLA 1UL3A 4PG7A 3DI6A 1WSRA 1Q53A 4LF6J 4RUCA 3GG0A 4C98A 3Q8QB 4MIWA 1DTQB 4Z7CA 5LM7E 2YKNA 1SH2A 1YRUA 4DSKA 1LWEB 2CJQA 1IVZA 2FJBB 4OZ0A 4PZVA 3S01A 5D4NA 4YMEA 2OI2A 4QJVA 2ZD1A 4MYTA 1ACMB 3MR2A 1NK0A 2JEFA 1PJ6A 2P9GA 1TL1A 4X62J 2HRYA 4YN3B 2ACMA 2MZTA 3VWSA 2EVZA 2RDJA 3TUJC 5D3GB 1QSLA 2DR7A 1S6UA 3SQGB 1PGZA 3BB5A 1SL1A 1BQNB 2HNYA 1N36J 2ZVSA 5B09A 3GB0A 4ITSA 2JSXA 4NLYA 4WP8A 2N4DA 4TY9A 2PO4A 3DRXA 3PKMA 1DURA 2IFXA 2H48B 1N52B 4OV1A 3LWLA 3ENAA 1HD1A 2A0FB 3WZ0A 2DHGA 3QIPB 2MKKA 4HHHA 3WIVA 3U1LA 4RUHA 2CJBA 2JX2A 3QJLA 1RT2B 1TFYA 2KM8C 2D9OA 3CJSA 2XGQA 4B3OB 3L7UA 5KFTA 1RHUB 5ETMA 2QGFB 3G6YA 2APOA 2HMIB 1QSSA 1R8PA 1ZH5A 2X1FA 3W9IA 5DQHA 4CLKA 2IY5B 4ZVFA 5KFEA 2DXDA 1Y0HA 1U02A 2ILZA 3GPAA 3M32B 4UW2A 5GMDA 3RB6A 4J9MA 3CB4A 4WU3A 2GGPA 2OMLA 1BHNA 4ZIWA 3VGTA 2DGVA 3G8QA 1KRPA 3KLIB 3BSOA 5DQGA 1FD2A 1GXLA 3THVA 1TL7A 5A8KB 1YWXA 3W2VB 4JI7F 3N01A 1X4CA 2BANB 4H4KC 5FJ4A 4DJBA 1M1GA 5DETA 1VQYA 3ENQA 4ZA1A 3I87A 4N76A 4C8ZA 2MGZA 1J5EJ 3LGMA 2FVRA 1KR4A 1Q95G 1VBYA 3M8YA 4NXNJ 3RGIA 4ZPWR 4ZP8A 5LSOA 2CJXB 1S1TA 3HXMA 3O6QA 2BRLA 3LALA 3VTIA 1DY3A 3RZAA 3CSKA 3HSGA 2WK4A 5AT1B 3V4IB 4LRBA 2VG6B 3UI3A 4EGLA 1S48A 3IMQJ 3JAMY 3L9ZA 4DEZA 5AE3A 2QLWA 3JAMU 4K4ZA 3T5LA 1VC0A 1CVJA 4WK1A 4UF4A 4P72A 5IT9U 4LBHA 2AV5A 2VBXA 4CI0B 1N5VA 3KDNA 3V81A 4DF4A 5F8IA 2CAJA 3CIZA 2KFNA 2JC1A 4OZ1A 3M05A 3Q24A 5KFFA 3CJ0A 4NPOA 2J0WA 1DLOA 4LFCJ 1GFWB 3BGLA 1JLQB 1VRTB 3MEDA 3G82A 1YSJA 2ZKTA 4ZVSB 1RT7B 4ZJQA 3V6DA 1X4GA 4ZPTR 2MLZA 4H54A 1J27A 3B82A 1V9OA 4O3RA 2E7VA 3DLGA 4AD6A 4IH5A 4CRJA 3AD9C 1KQGB 2V8PA 1T02A 3B4DA 1RGVA 5KT6A 4C8MA 2H5IB 1FXRA 1YJRA 2MZSA 4I6AA 5HLFB 4U7UD 4ERDA 2NXNA 2D3OR 2F8EX 4OZLA 3T1AA 3ZZZA 3HVWA 3DRPB 2IM2A 5CD4H 1AUSL 5CYQA 1M1HA 3SI8A 4C8OA 5L39A 2WRMA 1Q1KA 4XAKA 3C15B 4CM0A 2YNFB 2UXBJ 5ETRA 4QCLA 1KFDA 3UCZP 1C0UA 1FXLA 2HIYA 2CPIA 2KG1A 2DNKA 3WC0A 4QWAA 5AXNA 3PO4A 3IRWP 5F9NA 3QGHA 4P74A 3K5NA 3KK3A 3DGPA 3B54A 4PYDA 4Q8EA 1SCJB 2WVDA 1KS2A 2N82B 3IS9A 5K8PA 4CO3A 4OHYA 3GR0A 1QDUB 1N56A 1S9GB 3NCRA 3QGIA 2NXUA 2WB1D 1F1BB 1VR6A 4KTQA 3NKYA 2IIHA 3NLCA 3SYZA 3HJVA 4LRDA 1Q8BA 2VJUA 1K73T 3PW7A 2VFSA 3C6TA 2AZ1A 1Y5NB 1TL4A 3VGVA 1JLBA 4TU8A 2V50A 4ICLA 4ZP6A 2KRBA 4PQUB 2VDHA 2ASDA 1D0EA 3KUEA 2LCWA 1M5PC 1OYEA 1VCTA 1NRKA 4ZK7M 3HI9A 4HR2A 4CTAB 2DR8A 2R9LA 1SH3A 3POTA 4PG8A 2MQLA 2FJWA 1S49A 4OYPA 4IG0A 1FKPA 3DHWC 2B7BB 5HK4A 3TA2A 3KHRA 2RU9A 3DC2A 2PSZA 2PD1A 2YVSA 3K5MA 3GV5B 4ZVPB 4PWDB 1YGYA 4DQPA 4RZRA 3UN5A 3NP5A 4JV5F 1MROA 3MCNA 4C3MA 1A7GE 4C3LA 3QT6A 2HAFA 1ZPWX 2XS7A 4O3OA 3OVAA 1SI9A 1N6QB 1Z2LA 4H4KA 2BJ8A 2YY3A 2BACA 4DQIA 3TP2A 3ZZTA 2F4FA 5CZXA 3BN7A 4KHRA 2MTLA 3IR6B 1L3TA 3QO9A 3FSXA 1IKWB 1LWFA 1K44A 2MLXA 2HHXA 5FD1A 2A6MA 1TKZB 2XHWA 3KMQA 3EX7B 4PWUA 3TQ1A 2GNKA 4FF3A 5LMUF 2JNJA 3TAQA 3PRBA 1CPZA 1PSDA 3WQPA 3VAJA 4U7UK 1OPZA 2H5JB 4ZVQB 1NPPA 3PZPA 1Q8LA 2E66A 2OKQA 5HMYA 2MZ1A 1KTQA 4ECSA 4FDFA 1I6JA 2XYPB 2R42A 2ZH8A 4DR7J 5J2QA 5HBMA 3CNQP 3OHAA 2R7XA 1UVNA 2XZTB 5B0EA 3HK2A 4ZCIA 5LMNF 1UW9A 3DDKA 4LVOP 4DR6F 3KJQB 2E1RA 3QGPA 4KAIA 4JI1F 1XMBA 2J9DA 1M1KT 3M6XA 5IC6B 2B8QA 4U7CA 2IRYA 4QIEA 4FKXA 5DDPC 2CPJA 3EGVA 4MTPA 4BLGA 2AKWB 1YZ6A 2QSWA 3MAAA 3QPIA 4PCQA 1NSQA 1FWPA 4DHVA 4KH1B 4ZVEA 2UU9F 1FRJA 1GXUA 1RACB 2ZH1A 2MQ8A 2IBKA 4DSJA 1OYDA 2MZQA 1S5ZA 1YIJS 5C42B 5C5JA 5FDLA 1JJ2R 1SC4B 3FBBA 2DO4A 2VG7A 2QL9B 4N8NA 4M5MA 3M8QA 3MECA 5M2RA 3HT3A 2LQ8A 2BJDA 2DVIA 2C1EB 2VQFF 1Q0NA 2VBZA 3ENWA 3GJRB 2WONB 1NSAA 2Y8YA 4K59A 2IA0A 4G1PA 4QWDA 3PX4A 1RT4B 3TANA 3EPGA 1P6TA 2J9DE 4U6PA 1ZM4A 1V3RA 2RKIB 3EVOA 2W24A 1EKSA 1FK9B 2HFNA 1D09B 4J9OA 3JSMA 3ET6B 3D1HA 3QLHB 2RMLA 3QZ7A 4USMA 1S6QB 2ZHBA 1U1OA 1TAQA 1YLXA 3Q2SC 4K0KF 1RU1A 5DDOC 2QFIA 4B02A 5SUHA 1ICEB 1Y5IB 3LGHA 3NXZA 3OFHA 4OZNA 3IBCB 4XTTA 3IP0A 1U09A 2MB0B 4CLUA 4J37A 3NGSA 2JC0A 5A8RA 2AJ4A 1I1GA 4P52A 4KR0B 4HTJA 3M6WA 2UUWA 1S4EA 1V5IB 5F8JA 1Q7YT 1AXQA 4KBIA 2AHOB 3RU0A 1R0BG 4LR8A 1WELA 1WORA 1ZYQA 3D6FB 2VFVA 4GVBB 2B4UA 3GJSB 5H9FJ 2RQMA 4B9SA 4LF2A 5KOXA 3DCAA 3D3CJ 3M30A 2FD2A 1VISA 3HULA 4QYRA 1FI4A 1UFWA 4ZN3A 2UXCJ 1SJQA 1NK9A 2CPYA 5DGAA 2HZCA 4HKQA 5A0YA 3AAWB 3GQCA 4I7FB 1XTZA 4D3HA 1EX8A 1HNWF 1NNDA 3BBCA 1ZM2A 1FKOB 4DV7J 2XMMA 4L75A 3ZO7A 4CYUA 2GMLA 4ELVA 2XZWA 2W2NP 2MSTA 2DXEA 1Q8KA 1XMQJ 3MFHA 2W2OP 3HHKA 3P45B 1TUWA 2JL9A 2HNZB 3CC4S 2V34A 2GHWA 2X51A 3BJYA 3BQ2A 2RRNA 5BR8J 3W3SA 4CLFA 4B3MF 2QA2A 2I9SA 4MT1A 4IO1A 4ED7A 4C7QA 3QRQA 1UVJA 3HHLB 5I3UB 3LQVA 1HNXF 4V19J 4FS2A 2HRUA 3HJFA 1HHSA 2HNDB 3D1QA 3GFYA 4HVZA 2WB4A 2XS2A 1HBUA 2GW8A 2BDPA 2PE8A 1WG5A 3CGIA 3MEGA 2ADBA 1QVFR 1WEXA 4LQ3A 5JMNA 2V2KA 2ZZMA 1TL3B 4KRWA 4GC6A 4O0NA 2PFFB 4RW4B 1XNRF 4I4BA 4RUAA 5HAOA 1NKCA 3SSSA 2IBOA 2P9CA 3IBFB 4Q2LA 4DSFA 1R8BA 2GAHC 4IO9Q 4TU9A 3GFHA 2JWNA 1SQEA 1WJ9A 1GMUA 2LA4A 4KPCA 4O44A 3FEZA 1QUVA 1T8EA 1XC9A 4I56A 3SQGA 2HK3A 3R7NB 2MYFA 3PYDA 4MK9A 3KLEB 3G4SS 4XK8C 4DQSA 2BE7D 4ZPDA 2G0CA 2CPZA 2NUUG 3OL7A 4FNHA 4A46A 4Q8FA 1S6PB 1TAUA 1EETB 3VALA 3A12A 3FCWA 1D9AA 5EN1A 5KG6A 5KOWA 2GQQA 4LF9F 4C6AA 3BR8A 1TV6A 4DBQA 4IG3A 4IFYB 2XMAA 3H2LA 4ZVHA 1FHTA 2EC2A 1C4AA 4GKJJ 2RS2A 2XLKA 5IV4A 3G96A 3B6BA 2X1AA 3SMZA 5D6GA 2W8LA 4FP9A 2V4JA 4L6V3 4WTYA 4RW9B 3JTNA 2UVUA 2BX6A 4Z7YA 5J2PB 1WD6A 5LOQA 4PUOA 4ED2A 1HNVB 3E51A 3BGRA 5HROB 2ZNYA 4KO0A 4DSLA 3OUYB 2BQRA 2LEBA 1KDNA 3V4MA 2FIUA 2JFDA 5C2CA 2CPFA 3CCWA 2OTJS 4MKYA 1FJ7A 3CMAS 3SFUA 3TZZA 2F7VA 5HMZA 3UDCA 3AFGA 3IBWA 3RB4A 4ED4A 1S4FA 3LOUA 2R4FA 3N5BA 2VPZB 5HP1A 4F0KA 4R5PB 4PKDB 1HYSA 4K2JA 2EFGA 1RT6B 4DFJA 1LW2B 2FYXA 2W2QP 2HBQB 4HH1A 1KP6A 2VBYA 3JXOA 1JLGB 3FEXB 4CLTA 1U1NA 2OEJA 3E01A 5B0BA 2PIIA 4DV0F 5KG5A 3L7OA 2VPWB 1URRA 1TKTB 2HLUA 4TQSA 3J7AN 4XO0A 1XNQF 5IWAF 3G2XA 2HVEA 4OLPA 1TMJA 1GQEA 3QWUA 5D4OA 2QT7A 3DYAB 2FVSA 2A3JA 3FFIB 2HYIB 3T1HF 1HBOA 4ECYA 3G87A 5T7LB 3W60A 2C3YA 4G65A 2HBYB 2DR9A 3KLVA 4RW8A 4RNMA 3I6PA 3GJQB 2JOQA 1N34F 3Q8SB 1U47A 3DOKB 2E5LF 4ZPCA 5HVFA 3RRKA 2Z2MA 1UPMB 4N56A 3RYLA 2GVDB 2VH7A 4P6QA 3HO1A 4AFFA 2JRSA 1MWQA 5KAKA 3I82A 1HIYA 4M5JA 5L1IA 1VRUB 1WC6A 2ZH9A 3W9HA 1S76D 4ER8A 4PXCA 2OPPB 1FTCA 2BE9B 4JI4J 3MCSA 2NXEA 2AIRB 2ZBRA 1G2EA 3ZNUA 2RH3A 3BH6B 4C8NA 3JSRA 2RRBA 3ZZOA 2IC3A 3MTJA 4DFPA 1FJCA 3TNVA 3TI0A 3P8BB 3LAMA 4W90B 1BWEA 3OD2A 4F4ZA 5J2MA 3R2CJ 1KTVA 5AE1A 1LXNA 2CG8A 2J7UA 3PRDA 1IBLJ 4DR3J 5IM0A 3AJDA 5B0FA 2K2PA 3H40A 1B64A 3LPYA 3DM2A 3R5JB 2VONA 1SIWB 2BBEA 4ZPVR 4DFKA 5HVGA 4OYOA 2GJ2A 3T1YF 2GX8A 3GIRA 2IAJA 4LRFA 2HZVA 2LP4A 3RBDA 1C1CA 4EYIB 5J1EB 4ZCLA 3H4DA 4OI1A 2AJ1A 2KTQA 1RWMB 2UUAF 5IFMA 1S1VB 3OR2B 1PCAA 3OTEA 1BC6A 3FBFA 1Q4RA 2ZH6A 2XNRA 2J9EA 1EJ7L 4RX6A 2YNIA 5GAHI 3M6UA 3RB3A 1SH0A 2LA6A 3ZZUA 4MAKA 2HVIA 4ID8A 1RZMA 3NBPB 2K7KA 5A76A 1D3WA 4NLOA 1RA7A 2XTJP 2DGWA 4YS2A 1GMWA 1Q5YA 5M2UA 4WXOA 4LRCA 4M94A 5ETQA 3OV7A 4H4OA 5LL6d 4ES2A 4FN5A 4QW8A 2VUGA 3NMRA 1QAYA 3UD3P 1T03B 2MKIA 8ATCB 3VCDA 3L7PA 1CC7A 2ZC4A 4G6VB 3M2RA 2B5JB 4LREA 3N6LA 3IWLA 1S1UB 7FD1A 3TVZA 1ZTWA 1S1WB 2RS8A 1QLNA 4NLRA 1QTMA 1T7PA 1XMOJ 2VOOA 4KH0B 2CQ4A 2J9CA 2W4CA 5KFGA 1YJWS 3W2WA 3TA1A 2DO0A 2R8GA 1ZTTA 3P4UB 3MM8B 2YPZA 5J2NB 3BO2A 4CO1A 2DRBA 3H42A 4RR5A 4NZ7A 3EDRB 3NL0A 1NSPA 4DR4F 1R0CB 4ZPBA 2KXHA 4XPCA 4NI2B 3TZWA 2PI5A 1YBAA 1M90T 1CEZA 2E9RX 4HACB 2FLOA 4P71A 3J80U 1X9SA 4OYAA 2BW7A 2QFJA 3TO8A 5HSPA 2RF2B 4ED1A 3V6JA 1TKDA 4ECRA 2NUHA 3AA9A 5MLCV 2G9OA 1RWOB 1M0SA 1CULA 2MKYA 1FX2A 1T3OA 4USTA 2H9ZA 3LTOA 4OL8A 5KFVA 1LWCA 4JI3F 3FZBA 3HVTB 5HQMA 2VQEJ 4HT5A 2V4QA 5KFNA 2DR5A 3DLHA 4K4UA 2AW0A 2BJEA 5KT7A 4U96A 2U2FA 1ZAXA 3D6HB 2XLIA 4ZLLA 2XSJB 3GCWP 4TYBA 2HHSA 4OV6A 3I0RB 4JI6F 3U27A 3CJ3A 3ZC4A 2QA4S 2BEFA 1FJGF 3KFWX 4ED6A 5DRKA 1EZZB 3CTRA 3K58A 1IKVB 2DTJA 9RUBA 1AZSB 2OPSA 1CJUB 4RNHA 1VOMA 1PIEA 1R6VA 2UV8A 1ZETA 2DHAA 1VQ7S 5KFMA 1N5QA 4ZHRB 2IM0A 3A3PB 4EZ9A 4HDGA 1WHXA 2H4WB 2X7IA 3DLBA 3G6ES 4DS4A 1UJ4A 4OX6A 4ANEA 4ED5A 2BM0A 4RLEA 4QU6A 1CC8A 4LBPA 2LDIA 4RO0A 1B7FA 4JI7J 2OPQB 3T5HA 1VC6A 2C3UA 2F63A 3MUVP 1JXEA 4B3TF 4CP5A 2PC6A 2Q6CA 2YNGA 3FKBA 2H54B 3FRYA 3PFOA 3A4TA 1BQMA 5I4MA 1HWKA 4ECZA 3OSPA 1WC1A 3TEGA 1S6OA 4DPOA 1F6TA 3ITHA 2ZOGA 3GWCA 3ILJA 4X64F 1HMVB 1A9NB 3MZIA 1SKWA 2X3DA 3ZZYA 4PQAA 1UW4A 5F0UA 2L9DA 3H0PA 3S7RA 1BMQB 4ZVTB 4FYVB 1X4BA 2O66A 4ZJOA 3GCXP 1GTEA 1REVB 4DV3F 4BCAA 1KVJA 2V69A 2PA8D 2NXCA 4FXVA 5M2PA 2NPIA 2Q3PA 3BSCA 1G6BA 4K8RA 4AQYF 4MIBA 1WKJA 1CSJA 1HWLA 3CD6S 4F26A 1TTHB 3CO9A 1P27B 4M95A 1UETA 4KKOB 5DGBA 4YB7A 2RUGA 4ILMA 1U1LA 1IKXB 2F9JA 3DU5A 2BA9A 4ZOSA 2DCUB 2E5IA 1K47A 2IDEA 3X1LB 5HJYA 4K5RA 1M5SA 3ILLA 3T19A 4FPIA 3P6YC 1S9EB 1ZOTA 3HHDA 2OIHA 5T14A 3NMAA 3PFEA 4OX9F 2I5JB 2VFRA 2DNZA 3T5JA 4R8UB 1H73A 1YJNS 2KRRA 4CO2A 3PYFA 4I2PA 1LW0A 2UUCF 3IXQA 1TKXB 3L3CA 4Y34A 4YFUA 9ATCB 4UOGA 1AFJA 4ZJLA 4O3NA 3LP2A 3ZFVA 3D67A 1IJEB 2EFPA 3P5BP 2O5DA 3NEKA 3ELHA 1TVRB 2QMXA 2EBEA 2P5VA 2VG5A 1LNQA 3I4PA 2YBVA 1GNKA 4DX6A 1AB8A 4A8XA 1ZZFA 1Z2ZA 4USIA 4M8LA 4TLQA 4WIQA 3I4HX 2QLJB 3FUYA 1JNZB 4OZ5A 1I3OB 4J9PA 3LO3A 3OSNA 1H7XA 1OSCA 2KT3A 3M8PB 4YB1P 5KT3A 3UN2A 2CVIA 4KQZA 1NAQA 4X66F 1HWIA 1OS5A 3PM9A 2PFDA 2AX0A 5BYQA 3JTOA 4IQMA 4F7VA 4M5DA 1VQPS 1VQKS 4F25A 1NDLA 4I2QA 1IBKF 3UWTA 4F0HA 3TR5A 1X60A 5HI7A 1HPZA 4V1Ak 1RK8A 2YWFA 2WTFA 2D9PA 4OYXA 1RI7A 3UCUP 1R89A 2HIQA 1B3TA 3AB4B 4KV8A 1OY6A 1YG0A 2N3OA 4WFAQ 3C6UA 1RAOA 4N41A 3TW0A 2B4OA 2POKA 3H4BA 3P3DA 4BC9A 1Z4UA 3CDBA 2F4VF 1FE4A 4QIGA 2IVYA 1DRZA 2ASLA 4M5IA 4DLGA 1T9XA 3IR5B 1J5OB 3PX0A 2DYAA 1JIHA 1RTIA 4FXWA 2DGTA 4DL4A 1ZZNA 2I38A 2VDIA 4ZDNA 3N0VA 2FGCA 1RT5B 4C11A 2EW9A 3CWJA 2DEIA 1G7CB 1AFIA 1KD1T 3QIDA 1GAOA 3ZTSA 3T6JA 5HL7Q 4WWSA 2PEBA 1FWLA 4JV5J 1RWWB 3K2YA 3WIUA 2OTLS 2KXFA 3BREA 2V67A 4UUWA 3BYPA 4O4RA 4ENOA 3SQOP 3PV8A 5FLXY 4X84A 1N5SA 3NS5A 5IOLA 2CYYA 1WC0A 1X4EA 5FLXU 2HLTA 2GAGC 1QM9A 4MMOA 4EU0A 1U0HB 3MM5A 1R0AB 2L3MA 1SJFA 2DGQA 3NAHA 3NY0A 4OYWA 3Q8PB 4JB8B 5LMUJ 3MEEA 1KSPA 2GC8A 3LP0B 2BJ1A 2V9WA 1S77D 1PAEX 4DXLA 5LSRA 3OXGA 3R7SB 5CH7B 4PPDA 4JYAJ 2F1FA 3KDOA 2A6OA 4LMZA 1F5CA 3ISND 2C3MA 4X65F 5HO4A 5D0HA 4DL7A 5ETPA 2Z2LA 1GMWD 1GX5A 2EKNA 2R2SA 5GAEI 1WKKA 2HVHA 3DDNA 5LMNJ 2LQ5A 4OHXA 4QIFA 4WPAA 5E3AA 4JI1J 1RSCA 2FUG9 5AJ3J 5C25B 2Z56B 2JHEA 1Q5VA 1X5OA 4ID5B 5HATA 4DPTA 4AL5A 3DXBA 4AL6A 5K14B 4X2BA 4P7TA 3CJRA 3PIPQ 4OZJA 3O8WA 4USUA 3IFEA 3OW2R 3LUYA 3CC2S 1B0TA 2UU9J 3KWMA 3SCKE 1PO6A 3SDEA 5GADU 4CH7A 4PXEA 4IOAQ 4Y00A 2KZZA 4GRSA 1BXNA 4FBTA 2JZ5A 4ZVUB 1HQUA 5G0RA 4LSZB 3J81Y 6AT1B 3H8YA 1KOHA 4YHHF 3C14A 2VF3A 3J81U 1EB0A 2BKOA 1RBAA 4KFBB 2MKSA 1XK8A 3C66A 2XBPA 2VQFJ 3IG1A 1AROP 1R8AA 2M88A 2LLZA 3ILOA 4Q5VA 4HDHA 3W1YC 1FRMA 5EWFA 1KC8T 1F9EB 1U26A 4DG1A 2OHDA 3LP1A 3A1YG 2DNLA 4NL5A 3VHQA 1OY9A 2Z4PA 3SSQA 3VV2B 5HQLA 4WKYA 4J7CA 3NS7B 3M9NB 2BUNA 3ZTQA 4FBUA 3B8HA 1NHKL 3NCQA 4NMLA 3QSIA 3CJKB 4NLXA 5KG7A 3WX4A 5ETTA 3PW2A 3OLBA 5C24A 4OZ2A 4UUXA 3F0NA 4Y2AA 1RWPB 2MKHA 3PRVA 5CXTA 2BM1A 2K1RA 1X4FA 1Q16B 3TQEA 4K4VA 1NM2A 1JKHB 2W01A 5AE2A 2XY5A 4C8YA 3FQLA 2PN6A 1KNZA 2BE2B 3GR1A 2U1AA 4HLBA 1U2CA 2DITA 4ILRA 1IBMJ 4X4RA 1FDDA 1NBEB 1U8SA 3E8OA 2ILYA 3QAEA 3D5MA 1C0TB 4PXBA 1JNRB 4QOTA 3CCMS 2OUGA 3K89A 4TY8A 5GAHU 4UOCA 1YVFA 3BO3A 2QJ3A 4DV2F 3KNAA 2E44A 2IRUA 2IA6A 1RP5A 4RU2A 3MR6A 1WF2A 1H2UX 2P6SA 4DN0A 1UVIA 3CJ5A 2HW3A 3CCLS 1OWXA 4OJHA 1CLFA 2DNGA 3MM9A 4ZCMA 3RRHA 2YKPA 2QX0A 5HANA 3RUBL 4CH1A 3FQKA 4MKVA 2HGMA 3B78A 4O23A 2J8AA 1CJTA 4AE5A 1HNWJ 2G13A 1RAGB 2AMCB 4QR0A 3FDSA 4ZP9A 5CCMA 4W98A 2EBGA 3BGOP 2GMJA 3PTWA 1RLCL 3ILIA 3CUNA 3KG4A 1FT8A 2BJ3A 3CJ2A 2RQKA 3BDEA 1RBOB 4RL1A 5GMKa 2HQGA 3NGRA 3TAPA 4B3SF 7AT1B 1B70B 1KLMB 3BO4A 2XGPA 4H4MA 2IYIA 4B3MJ 4A8OA 4AT1B 1D8YA 1PC4A 3K7RA 1HNXJ 4RW7B 4IRKA 4ATNA 1VQOS 2F8HA 2DD8S 2FQQB 2GVZA 1VK3A 3JYTA 1S72S 3VGUA 3OT9A 1A0OB 2PT0A 3DLEB 2E9TA 3QNWB 3KLFB 5LXYA 1XNRJ 1R6YA 1WACA 2R7WA 2BV3A 2BJ9A 5JVGQ 3UFCX 1IM6A 2HVDA 4RBTA 4LVNP 3O1LA 2XI2A 1IBCB 2XI3A 1YJ7A 3AXMA 1RABB 5ETKA 4G1IA 5D77A 5KTQA 2B4VA 4JV1A 4NLVA 3KG0A 3GIMA 1N5YA 1VDHA 4UZCA 3U7JA 1Y5LB 2VFTA 2AZ3A 3C46A 2DY9A 2WZ1A 5FIIA 4MK7A 2GQ2A 3FGVA 2AEJA 4MFBB 3H59A 3DGVA 1JLAB 2M8HA 3MPUB 3CCZA 4NXNF 4NCAA 1VBXA 3HVRA 5K8MA 2QLBB 1S1XA 4DV6F 4LF9J 3GIIA 5F3ZA 4G3IA 3X3UA 2CQCA 2NYHA 1XWLA 1N8RT 1VK8A 2OP5A 3HFZB 1NB7A 2HS0A 4FF4A 1L3VA 2M70A 1FTRA 5B0AA 3DOLB 3O44A 1CJVB 1YTYA 4FXDA 2RHQB 3G71S 1DTTB 1Q79A 1JLFA 4NLUA 2C2DA 4DSIA 4NLQA 2HSEB 4PR6A 4L76A 4OYIA 3PIOQ 1WF0A 2BOAA 2E1AA 5DZ6A 3BQ0A 2CPDA 3RBXA 3MPDA 3KHHA 4JI8F 4Q7AA 2JLGA 2HVZA 1NDKA 3R1HA 4RW6B 3IN5A 3MOZA 3VAKA 1CJKB 1T95A 4CLYA 3FZ2A 4ZIVA 1E6VA 3FCVA 5K20B 3FCHA 1D1UA 2ZM6F 5CYMA 2RQ4A 2W9BB 3C16B 4QIVA 4DL3A 1TZ0A 2ZITA 3VVUA 1E6YA 1S79A 3V2UC 4DV0J 4BDPA 3R6GB 1N88A 4OYMA 3BYRA 2KKHA 3CCJS 2DCLA 2YNHB 1VQ6S 1RAHB 3MMCB 1EHWA 4G1QA 5H9EJ 2C2RA 2M0GB 5IWAJ 3VR1A 4YDDB 2WAQD 4IFVB 3DOMB 1I94F 3VAMA 2NQPA 1NJYA 4N47A 2DISA 4LSNB 1SL0A 4DR2F 1SKRA 1LOUA 3DLKB 2GS8A 3T1HJ 3HX9A 3HP6A 3DMJB 4JI5F 2YQ3A 1T05A 2J76E 2CPEA 3BGFA 4QWEA 3US5A 2YKMA 4YP3A 2XQCA 2HAIA 1TFWA 2V8DA 4KIAA 1N34J 4UQGA 2W9CA 3OQ2A 2E5LJ 1PAUB 2JJ4D 1HQEA 2CVEA 4LFBJ 5L1LA 5EWGA 2CQHA 2RVJA 4DL5A 3FSIA 1S9EA 2V8VA 1CS4B 2KZMA 2W4PA 4Y2MA 3K5LA 3ZNJ1 1T9YA 1RE1B 1FEHA 2OJ3A 4IYQA 3AD8C 4OJ3A 5SZTA 1X31C 3H90A 6FD1A 4GKKF 4ZP7A 1RKIA 1C2PA 4Q43A 5KFQA 4J9VA 4M1KA 1WSVA 3TARA 4FYDA 2FHJA 3GFZA 4F4WA 1N4LA 3JSBA 4O4GA 2HFOA 1EKRA 1HNIB 5ETNA 4BHQA 2C2MB 3PJWA 3W66A 3M2VB 4I69A 3F73A 4WE1B 2CDRB 3G6VA 4YY3F 3VAFA 1R31A 2MZRA 4XDCA 1APSA 1TUGB 4RJVA 3NS6A 2IHR1 2NPFA 2R7SA 4KSEB 3KLHB 2CQ0A 5CCLA 3D0IE 2WOMB 1EQ0A 1SUQA 1UVKA 3PEHA 4BWJA 2AJ0A 3EZOA 4HTIA 3D3BJ 4LSLB 5D0GA 4PG5A 1RT3B 4WFBQ 3T1YJ 3ZZPA 2QG9B 3OXFA 4NXMF 2PMWA 5KFBA 2BXJA 3CDUA 2ZDPA 3GP9A 4GO7X 1GEHA 2ABYA 2BQUA 4EO8A 2M52A 1P8GA 1NK6A 4R25A 3TRGA 2UUAJ 5A6WA 1IKYA 2JH3A 2HQFA 4I0WA 1RT1A 1DAXA 2CQPA 2KH9A 2D3ZA 4WFNQ 1MLAA 3CD7A 2DY1A 3DI6B 3OTBA 2QC3A 1NZAA 2KDOA 2RHSB 5KG2A 2YKNB 1YK9A 4I67A 4DCJB 5EHHA 3G8TA 3H5XA 3MR5A 1YKWA 2ZD1B 3NG8A 2CADA 2P2CB 1RTJA 3U1NA 3TJ9A 2ROEA 4ES1A 2PA3A 1UVMA 4LF1A 1TL1B 3DRSA 4V19X 2MKJA 3Q83A 3ZTRA 4TYAA 2DNPA 1RB0A 4Y2KA 2F3JA 3PHTA 1SIZA 1JJ4A 1ZBTA 1YHQS 3IRXA 3KLGA 2ROPA 2XMKA 5H9EK 4X4SA 2OPRA 2HNYB 3AT1B 3TJ8A 1FA0A 1RKJA 2V0NA 4CQ1A 1H38A 3OTDA 5LJ3Y 1JLCA 3MM6A 3EZUA 3MR7A 4WTOB 1NB2A 2YWHA 1NJXA 2OFGX 3T5KA 4F02A 4ZKAA 1RQ0A 1HLWA 2B7CB 2DGOA 4ES3A 2KFYA 1NPRA 1MU2A 3WC2A 3TX0A 3D6MB 1LWXA 4U8VA 2F8MA 4YDXA 1FDBA 4C48A 1VLOA 2ZOFA 2UZAA 3MD3A 2BABA 1BD6A 1VJQA 2VIHA 4MYUA 4M5HA 2GGPB 1M5VC 2VHGA 1N54B 5LT5A 5A2QY 5GAEU 5A2QU 2VV5A 1TL7B 2V94A 4CZCA 1FO1A 1TL5A 2XHCA 2HG4A 1FWKA 2HQDA 2LECA 3PW0A 4PG6A 4JI3J 1RTZA 4TNOA 3R97A 1NLKL 3O2IA 5CA5A 2MGZB 1Q81T 2ZH5A 2MZJA 4TKTA 1A6LA 3GFXA 3CO0P 3MUMP 1T9TA 2QZ8A 4YOEA 3OL9A 3BSNA 4UZBA 3EGNA 1V5VA 3R8YA 1QVGR 4JI6J 3HMJG 1U1PA 3E3XA 4GC7A 1FJGJ 2ZH3A 4L74A 1YBTA 1U1RA 2KJVA 1ZA1B 2AQ4A 2C2ZB 1MW7A 3AQPA 3EE3A 4HH0A 4FZVA 5A8WA 3N9UC 4AL7A 1F9HA 3GIKA 3JTPA 4UQTA 1S0VA 3D0GE 3K0JA 2B9XA 4DL0C 5T41A 1QE1A 3V81B 4RBUA 1RXOB 4CLWA 2FJAB 2MY8A 4KJIA 1DARA 5U47A 5DLGA 2B8PA 4B3TJ 3W9JA 4KGXB 1Y7PA 4BWMA 2BW2A 4USHA 1DLOB 2NZ4A 1JLEA 1N0UA 3EZ5A 1H6KX 3MEDB 3G82B 2XB2D 3CDWA 2ZBCA 1RTDA 3LANA 3V6DB 5DG8A 2C28A 3CJQA 4X64J 3HKZD 3DLGB 3JQKA 4GO5X 2WSFC 4ED8A 3AA8A 4EBEA 2Y9HA 2B6AB 1DZ5A 1J2VA 2IMOA 4YB6A 1K1QA 3OTCA 4DV3J 3DLLQ 1NH7A 4EBCA 4WK3A 3G6XA 2E1CA 2V2ZA 4QYZJ 1RAIB 3NRBA 1XMQF 2QLXA 5CYQB 3JQMA 3CULA 3T3FA 4LJMA 2DH8A 2LEPA 4J9NA 1JX4A 4C8LA 3IGVA 2BYCA 2DR6A 2AGPA 1C0UB 4L3NA 3GIJA 1U1MA 3IAM9 3OR1A 1FXDA 3I5AA 4X4QA 5IQ6A 1Q8IA 2L41A 3KK3B 3DGPB 2IPOB 2Y8WA 4P2FA 2OD4A 3IS9B 3BGUA 1TQLA 1FVSA 4ALZA 4J9QA 1FJEB 5DS7A 4ECVA 4KGMA 2D3O1 1RTHA 3T9ZA 2HHWA 3CCVS 3W62A 1VQNS 2VC1A 2YPYA 3AXKA 2UUCJ 4DU8A 2ZZTA 1RHJB 4IDKA 2KO1A 4RU9A 2XNQA 3IR7B 1K9MT 2V68A 3BR9A 5I42A 2ZVIA 1U2FA 3QJJA 3I5CA 3C6TB 3OL8A 1TUVA 1RAFB 2B0GA 2LQ9A 1JLBB 4ICLB 1RHKB 1WOSA 3D9BA 3HFVA 1S12A 2KM8B 4IUFA 4DFMA 2KXNB 3M1VA 3CD5A 2AGOA 2GJFA 1B4SA 3DN9A 1RA6A 2XULA 2H51B 3POTB 3IWXA 3OVBA 2FVPA 1F5BA 4IG0B 1FKPB 3MM7A 1VGYA 4B3RF 4JV0A 4YR0A 2QEXS 3MAHA 2CWXA 1GK8A 4X66J 4Y6IA 1MROB 2VBWA 1HBMA 1UZHA 3PNIA 5C2GA 4EK2A 2RNEA 2RILA 1SL2A 5AXMA 3PR4A 3GU0A 1TK5A 3M4XA 1DQ9A 4USKA 3THTA 1IBKJ 1N33F 1VHIA 3DHXA 2B56A 1SVDA 3KTQA 3KK2A 1YRTA 3DRRA 3I0SA 3V6HA 3CCTA 4WKRA 1C1BA 1XN9A 4OHWA 2LFVA 3FNNA 3MCOA 5K8OA 1NKBA 4Q44A 4FPRA 5D4PA 3QO9B 2GZOA 3RB0A 1LWFB 2XO6A 1WC3A 2H65B 2E5JA 3KJVA 3F56A 1Y00A 3N5FA 1UKUA 2F4VJ 1HHQA 3A3OB 3UO0A 4C9DA 4F3QA 4LF7F 5GMEA 2HS4A 3TAMA 4NCGA 1EAYC 2RAQA 3R2DJ 2Z57B 3QAUA 5L1JA 1N32F 4Y65A 1FNOA 3WX8A 2ZE2A 3OHBA 2ADCA 3MDFA 5I3QA 1FCAA 5J2QB 3A8JA 3I96A 5HBMB 2DIUA 1MWYA 2C2KB 1KFSA 3KYLA 4MKAA 3LA0A 3IAS9 4CO0A 4RWXA 2DRAA 1S10A 1UWBA 2HQ3A 4WXWA 3UVJA 4QPTA 4DUTA 1G4CA 3CC7S 1EARA 2C42A 4WFYA 3MMBA 2QO3A 3MAAB 3EPIA 1FX4A 2MJUA 3GONA 4CIOA 1SC6A 3IWNC 4WCEQ 5KFZA 4HT7A 2A18A 3ZTPA 2FLLA 5EDWA 2MHNA 2MQOA 1VYAA 2ZC3A 3MMAA 5FDLB 2YWGA 2VG7B 2KG0A 3M2UA 3M8QB 3A8KA 2XO7A 3MECB 3PXGa 2VA3A 5KT5A 3MPWA 4UOFA 4X65J 1Z1ZA 5CHCB 2RT3A 3CW2C 4CM2A 1HBNA 3PYEA 1U2RA 1NXIA 3I5BA 3CCUS 5E2QA 1NHVA 3ETOA 3CMQA 1NK7A 1P1LA 4ETZA 5HN0A 3RW6A 2MSSA 2GO8A 3KK1A 2EFVA 1FNMA 1KQSR 4PXDA 2CQ2A 3UN3A 4X4OA 3JSMB 3ENVA 3EMTA 5B0CA 5KFIA 2CQIA 4DMZA 4Q0BA 3FBCA 1FFSB 4KHMA 2AX1A 4U8YA 5CD4A 2DPIA 2YTCA 4USJC 2EKYA 4Y2CA 2YKOA 1YITS 3CPWR 1ITPA 1R27B 1Y4ZB 3R27A 1X9WA 2HHPA 1Y9OA 2E1PA 4ZMMA 2GO9A 3DXSX 3BDPA 2Y0BB 4U95A 2FC9A 2BMBA 1Q78A 4UTGA 1SV5A 4FF1A 4EO6A 4EFAC 1T9UA 5A8RB 3HDSA 4XDDA 3M8SA 4R0JA 1EP4A 1FRXA 1G1XA 2C2OB 1H0HB 1NCLA 4Z37A 3GSDA 1FFGB 1IQZA 2AWZA 3CJ8A 3KKFA 3PO5A 1WTBA 5HJXA 1DTQA 2B4PA 3EDQB 2ZH2A 2VFUA 1HWUA 1LWEA 2V8GA 2RIJA 1URNA 2VKZG 1L3SA 3GSIA 1H98A 3AH6A 4M5KA 5B7WA 4UOHA 3GILA 1Y10A 2WSEC 2RQCA 1W2BR 1TU0B 3M30B 2RJZA 3PG9A 3TUZC 4ZN1A 4OI4A 3S1TA 3CCES 1JXVA 3J7YI 3UD5A 3MAQA 1N0VC 5A0YB 4IH7A 3TEHB 2IJRA 3HD2A 1F3FA 5J1PA 4USWA 5D3GA 1RYSA 4NWBA 1QAJA 4DCOB 1PG5B 3EVMA 2C3OA 1VJWA 4LFAF 4IRDA 4K50A 5HVHA 1BQNA 1O0PA 5F8HA 2V4RA 2MPUA 4I6YA 4CYUB 4CO4A 2W2MP 4QWCA 3W8GA 4RPFA 3QIPA 2FZGB 4KPYA 4DV1F 1X5SA 1RT2A 2K7JA 3CVKA 3UDVA 4DPXA 1WDDA 4B3OA 1UCNA 2BRKA 1KLNA 4CLLA 4JP8A 2ROGA 2HMIA 2JVRA 3C3LA 3ISZA 1RHQB 2BOPA 2WBMA 4KGVB 2XMTA 4J9LA 2FPHX 4HI2A 2FC8A 2HKEA 5GAGI 3GYXB 2DHXA 3M32A 5F9LA 1VQ5S 1HR0J 1HBUB 4CWBA 3D54A 4F0MA 3MEGB 2XS5A 5HMWA 3QT8A 3BSAA 3QBCA 3E2EA 2EK6A 2UUBF 1X4AA 4KC5A 3KLIA 1KQFB 2LQJA 4B9VA 3R7BB 5A8KA 2W7OA 2YQ1A 3EXYA 3SFGA 1M5KC 3W2VA 2GJIA 4K7QA 5H9FK 4F4YA 2BANA 1B0VA 2MJNA 2N7CA 2B9EA 4UT4A 2CZ4A 3KHGA 1VBZA 1FKAF 4O44B 1H7WA 4FVCA 3N6MA 3MI7X 5J1NA 2VODA 4OJGA 3I31A 1QSYA 2CQ1A 3UR0A 1XERA 4B3SJ 1SJ3P 1L3UA 5BJRA 2XWXA 1ZM9A 4OQJA 1KN6A 1WHVA 1PYOB 5H1SV 2E29A 1UEVA 3V4IA 2VQEF 2VG6A 4KB7A 3QJPA 1X4DA 4QR2A 5EUHA 4TN2A 4D3GA 2QA4G 4NMXA 4NZ0A 3UNGC 4IKAA 2XCPA 1TV6B 2ASYA 2W1BA 4IG3B 1SQGA 2FZCB 1X5TA 2N4CA 3GMGA 3M6VA 3V6KA 1U7LA 4YQWA 3THPA 4IOBA 3ETMA 2XY6A 5CABA 1NJZA 1B99A 3G9CA 2A10A 5DG9A 4DS5A 4PEOA 1IXKA 4RBVA 5KFAA 1JWWA 2V4JB 2CWKA 3CD0A 4NEZA 4C0OC 1CG2A 4PUOB 3PX6A 1JB0C 1JLQA 1VRTA 2F5GA 1RT7A 3BGRB 1Q82T 4KO0B 2SXLA 4IRCA 5JJBA 1T9VA 2R8IA 5KG3A 4CLPA 3GV8B 3R5AA 2WSCC 1NSKL 4DLEA 1W2IA 1UP1A 3MURP 4F4XA 5HLFA 5HP1B 5A6PA 4FYYB 3TZXA 1HYSB 2RSQA 4WF9Q 5MAOA 3KG1A 1NU4A 4DU7A 3DRPA 3E01B 2HQCA 4DV6J 2Z2YB 1MMNA 2GMHA 4DN9A 2YX1A 3TWZA 3HT0A 3C15A 5F8GA 2YNFA 2R2TA 2GA7A 3CIMA 2E7WA 2KHCA 1SKSA 2PEHA 2BR0A 1FE0A 5DJBA 3MPYA 1HNZF 1X5PA 2EFOA 5IT9Y 4A47A 1HBOB 1X0FA 4ZVOB 1XQIA 1YJTA 4J9RA 1GX6A 2MXYA 1XEZA 1FRHA 3VAGA 1U6FA 4JI8J 4P2MA 4RW8B 1T94A 1S9GA 3BPDA 2XZDB 2J6UA 4IR1A 3OJUA 4OYBA 1YJUA 4P2XA 2V5HG 4K5SA 4CT9A 4O3QA 1IR1A 1TMMA 2R7TA 2ZM6J 3SCLE 1MMLA 2VOPA 2LVWA 1NK8A 1BY9A 1U6BA 2J7WA 3QT5A 3EJMA 1UFLA 3QQCD 4PQUA 4MKBA 4JI2F 2B6AA 2CQ3A 2N7YA 3J7A1 4P73A 5KFYA 1FESA 3HM9A 1QJHA 4EEYA 1VIXA 4CTAA 4EMDA 2IC3B 1I94J 3MTKA 4NLDA 3S8SA 2ALYB 4CLSA 1WTFA 5KFHA 3Q0AA 4DR2J 5J2MB 1LXJA 3PDNA 1U6ZA 5ADZA 4JI5J 1QUPA 2DNMA 4PWDA 1FFWB 3PJXA 5IM0B 3C2PA 4LF5F 4M5GA 4RNOA 3CEDA 3DM2B 3N4WA 4L3KA 3CCSS 3PACA 5LXRA 2F65A 4YR3A 1LQ9A 2OGUA 1N6QA 2VL1A 3SIPB 1N5TA 4K4XA 2IAJB 4NLWA 3DU6A 2RU3A 4PAAA 4GMKA 1C1CB 4M5NA 2AYEA 1IKWA 2KN4A 2NLWA 2FJXA 2XEXA 1C4CA 2FY1A 4GKKJ 2UXDF 3P5TL 4ZLPA 1TKZA 2L08A 1YI2S 2DT9A 1XBWA 2CJAA 4A8WA 2V2VA 2AEMA 5ETLA 3HHLC 5KFKA 3MHYA 2YNIB 3MEKA 3AB2B 4YY3J 2FJVA 5B0GA 2DNYA 2ZBQA 2VA2A 2AJ2A 2C3PA 4JBCA 4IQXA 3HSDA 1N48A 4DR1F 3L4BC 3R5BA 4L72B 4X4TA 8AT1B 4ZS6A 1MNEA 5KT2A 2HPUA 2DRDA 1S59A 1SBRA 3K59A 3AD7C 2G0IA 4LRAA 4H4OB 3LGNA 1K1SA 4F3MA 2CQBA 2EC0A 3LPEA 3NWGA 2CJ9A 4NXMJ 1KBRA 4QWBA 4Q2MA 1WG4A 5E5NA 2I8EA 1M5OC 1T9WA 5RUBA 1F5AA 4B9TA 1HHTP 1UJ5A 3M2RB 2XMUA 1S7IA 2Z30B 3G8SA 1PBUA 3W7BA 1AA1B 1LFWA 4K4SA 4PYAA 1FF2A 3PYGA 5CYJA 2XMJA 4B9UA 2KJWA 1O5JA 1NDCA 4HI1A 4I6WA 2AD9A 5C42A 2VICA 1UJ6A 2KL8A 2K8GA 3W2WB 1T0TV 4DR5F 2NR0A 2ZBPA 4RKUC 7FDRA 2V2QA 5K8NA 2QSFA 4HYKA 4WIIA 2R2RA 1L3KA 3R3TA 1YX2A 5IS2A 4QR1A 2WONA 3NGTA 3PKYA 3V5RA 2K3IA 1RT4A 3IGNA 1F2HA 2MKCA 4ZPAA 4P10A 4JYAF 5L46A 2RKIA 3FC9A 2P8IA 3BH7B 3SSRA 1FK9A 3LW5C 2CA9A 2NZCA 5DO2A 3ET6A 3BPSP 3QLHA 2DNQA 3GJTB 3J7Z5 5DM6Q 1S6QA 2GIRA 1CULB 5K9FA 1I51B 1LWCB 4OFZA 4LT6A 4DZDA 5AJ3F 3M8WA 2AYGA 2ATLA 1KOOA 2ZJQQ 4NLTA 2HWTA 5D4LA 2HZAA 2ASJA 3D68A 4DSEA 4P7VA 4NLGA 4NRTA 4DV5F 5L9NA 2DXFA 2BKPA 4GVLA 3GYNA 1Y3KA 4TQRA 1Y3JA 2HHHF 3KUHA 2YKQA 2ZKUA 5L8RC 2Q66A 2Y1IA 2OPSB 2CUYA 4S0MA 3NWRA 2R8KA 3KUGA 4GVBA 1VMBA 1X9MA 3Q8YA 1CQNA 4JI0F 3UR3C 3CF5Q 5L1KA 4O0IA 3EGZA 3BN4A 3D28A 1BWVA 4HEA9 4DX8H 1OQ3A 1V3SA 2B43A 1LKZA 2IVMA 3RW7A 1DHMA 2JVOA 4LF8F 2W4DA 1PJ7A 4E98A 3SCIE 3TJAA 2P6TA 2WVFA 4YB5A 4I7FA 4DI6A 2O01C 2GCFA 3Q86A 2I2YA 3M9OB 2YNGB 1FKOA 1IUJA 5E3PA 1BQMB 4LIWA 1HQ2A 2MY7A 5LJ5Y 1X4HA 3ITHB 1NK5A 2EG1A 4Z2XA 2CKWA 3HKWA 2ZH7A 1F0XA 3Q23A 1YQHA 1KEKA 1RCOB 1ZA2B 2CPXA 1S57A 2HNZA 4KHPF 1B7YB 3TYTA 3NNHA 2YQ0A 2Z58B 3GG1A 2R8JA 1LV5A 2P9EA 3T6BA 4DUZF 3HHLA 5ETOA 5I3UA 4PRFA 1PC5A 2HNDA 3ADAC 3KXDA 4Y28C 1IBMF 4LBIA 2G2ZA 4EZ6A 2UUTA 2XWYA 1SB6A 2R7VA 1JK9B 1NPKA 3BKFA 3VZHA 1TL3A 4HHUA 2Z0GA 3U02A 2E5HA 4RW4A 2QV6A 4JOUA 2B9WA 3JSYA 4X4NA 2KT5A 1SJ1A 4PABA 5CQGA 2K3KA 3J7YU 5DZ7A 3QATA 3FMBA 3W63A 4F4KA 1ZPVA 2M7SA 2UVVA 5E3RA 3SZ2A 2PDAA 2UVWA 1NZ8A 4I2PB 1LW0B 1LFPA 3RAXA 3H5UA 2LQBA 3KLEA 3JB9k 2YWKA 1YZ7A 4UY85 3DKDA 4OX8A 4ED3A 3LP2B 1R8CA 2YKAA 4KT0C 1FERA 2M5YA 1XR7A 3N28A 1WWHA 1S6PA 5KFCA 1EETA 3TUPA 3UDLA 2QE5A 3OFEA 2VG5B 2A1BA 1W25A 2EG2A 5KFWA 4ED0A 4IFYA 2DGXA 2A2DA 3FBEA 2R2UA 3NAIA 1UMJA 1H72C 5GAGU 1U4BA 2OAUA 2IYGA 5EGYA 3UDEA 2HHQA 2J0QD 1OIAA 2DH9A 4DUYF 4KGZB 2VZ9A 3L09A 1HKAA 3SV3A 4RW9A 1QAIA 4I64A 3HFKA 5J2PA 3GTYX 1HNVA 3VVTA 1NUEA 4B9MA 2ACYA 1FRLA 4M5DB 2XC9A 5HROA 1REGX 4I2QB 2CG4A 3OUYA 2CNOB 1UAWA 3RBZA 2IJNA 4QQBA 1HPZB 2C2NA 3TOQA 3Q8UA 2YH0A 2BZ2A 4OI3A 1Q86T 3VQTA 1U8WA 4KV8B 1YDLA 3QWPA 3O5TB 3H25A 4ZLNA 3VAIA 3C6UB 2HFVA 2GQCA 2CNNB 2HGNA 2QA1A 4NYOA 3HHNB 1NO8A 5EX0A 4R5PA 1WHYA 3K5PA 1RT6A 1LW2A 1NMEB 2J0SD 4U9RA 1JLGA 1UEUA 2RE1A 1X8DA 4M63A 1QTNB 1TKTA 3TVKA 2XYGB 1EIYB 3GYGA 1V3ZA 1WC5A 2BKNA 1RTIB 2QYGA 4J5OA 4DR6J 3QFHA 3OFFA 2YWWA 2MDAA 4B3RJ 3W5YA 4C11B 5D8HB 3ISNC 3K17A 2WBRA 4O3SA 3DYAA 2HURA 3FFIA 4OHZA 3K57A 2WVBA 2I6WA 3MGJA 3NNCA 5T7LA 3MF5A 1JMTA 2ZDOA 3H2UB 3QT7A 1N33J 4J91A 1U1KA 1XIQA 2Y1RI 4QW9A 1RWKB 5D78A 2KYZA 1UFKA 1AUDA 3KJNB 3DOKA 2I1RA 3UPFA 1KHVA 1K8AT 4P2SA 2GVDA 3EYZA 1VRUA 3MM5B 5E3CA 2VKRA 4ELUA 4LF4F 3MPVA 1AT1B 4F8RA 4JV2A 2LYVA 1WHWA 2OPPA 3MEEB 4WFZA 1VI7A 3FSYA 2ZHOA 1S97A 4LF7J 4A8QA 4W92B 3OTOF 2F9DA 4DV4F 4WYWA 1WEZA 1WI8A 1TELA 3AOBA 3M8RA 5D0EA 3D7SB 3TVYA 2HFZA 2WW4A 1N32J 4I1TA 2W7PA 2DGUA 5E7OB 2PMHA 4F04B 2VD3A 2Q6BA 1OY8A 4C2MA 4Y2IA 3NGUA 2XG8A 3RR8A 3B4MA 2KU7A 4K0KJ 2H1YA 2KFZA 5E0OA 1T11A 3MD1A 1NEEA 2E5GA 1SC1B 1P9QC 1O51A 3RR7A 1IQTA 5CZVA 1FNXH 4F2RA 3R5GA 5KG0A 2L48A 3CCRS 3EGWB 3SDEB 3HD1A 5J1EA 3MOJB 1F60B 5GADI 3SV4A 1TK8A 5DM7Q 2CXEA 3L95X 4LFBF 1HL6A 5EWEA 2HHVA 3LWMA 1S1VA 3OR2A 2X3GA 5G0RB 1HQUB 5JXSA 3R5CA 4OIXA 2NXJA 2QL7B 3C14B 1WOOA 3UE2A 3SBMA 2CQDA 2FVQA 3NBPA 4LF6F 5F0WA 3IG1B 2GIFA 3D0HE 2GIQA 2G1HA 2MEWA 3WBZA 4ECUA 4DG1B 1Q7LB 3LP1B 5DDQC 4DX7A 2CFXA 3OFGA 2I0XA 3O3LA 1HWJA 4WBFA 5JVHQ 1FVQA 3OL6A 2KVQE 5KFJA 2ZNZA 4X62F 1GH8A 2LU2A 4TXSA 3WDOA 2AU0A 4PPZA 3A3NB 4OLOA 2RRAA 2H5EA 1T03A 3S6EA 2EI5A 5C24B 3TA0A 2HQIA 1N36F 2B5JA 3RG6A 2Z8QA 2K1RB 4EWTA 1S1UA 4E0DA 1WNEA 1S1WA 1VIOA 2PMZD 2XMVA 2FHKA 1R7IA 3QRRA 3HHEA 4URSA 3ZTOA 2J7KA 1KVKA 4OX7A 1QAXA 4ELTA 2DH7A 3ZZRA 3MM8A 1ZAVA 1HI1A 2CZVC 5J2NA 3CJTA 3H20A 1S0NA 4AYBD 1UEKA 1YJVA 4R0EA 2WW8A 3CT9A 4TY8B 4YUDA 2BJ7A 4NI2A 3GLJA 4IOCQ 4HACA 3GV7B 3HZEA 1DJ0A 3J81j 3F44A 3I55S 2R7QA 1D9DA 2VU5A 4C97A 5KFSA 5KFUA 2KVIA 2RF2A 3MM9B 1ZS6A 4DPWA 3FMWA 2G0JA 2M8DB 3WHIA 1CJTB 4LFAJ 3AJ2A 2PGCA 1RBLA 2UV8G 3NCPA 3MMJA 6FDRA 4P75A 3HVTA 1P1TA 1F9FA 2V63A 1OQ6A 1J5EF 4CDIA 4XPEA 1PYTA 2R7RA 4DV1J 2XSJA 2LU1A 1SKUB 4ANCA 3I0RA 4BBYA 2DNRA 2QTWA 2E9ZA 2YX7A 4H4MB 1IKVA 1R8HA 2AYBA 2ALZA 4N8OA 3HHLD 3U1MA 2HS3A 1AZSA 1CJUA 2DIVA 5KG4A 1VLYA 2ZJPQ 3M9MB 2GVZB 3D2WA 2G2YA 3JYTB 1QD1A 4ZHRA 2CRLA 5JUMA 3QZ8A 1LK5A 3BBFA 3IM9A 3NGKA 1FD8A 3J7ZT 2Q1LA 2UUBJ 2AEFA 1NJIT 3HF5A 2QIFA 2X1GA 3J80Y 2W25A 4AXJA 4QU7A 4FS1A 5F8NA 2OPQA 2AYMA 2Z2ZA 1LK7A 2CJYB 2UVRA 4LFCF 3H2VE 3F41A 2E7XA 3KHLA 3FVYA 2FJDB 4DL6A 2VB6A 2YX4A 1N5YB 1R43A 1IM4A 2V8HA 3OPKA 1HD0A 1HMVA 3BF4A 2ZBIA 1RU2A 2EFNA 2DBBA 5THWA 4ZLJA 1RWNB 1XNQJ 5D0RA 2ZZNA 1O8BA 1RADB 2AGQA 1REVA 1BUXA 1YRXA 1B0PA 1S1XB 5IV3A 3FEYB 2KI2A 2EFQA 2VASA 2YH1A 3SXLA 3QSYB 4OZ3A 2UXBF 4KKOA 1H74A 3K5OA 2CDQA 2D3UA 4I68A 5G4DA 3I9V9 3Q8RB 1IKXA 5DDRC 4ZVRB 3ZXWA 4URGA 2DNNA 4RNNA 1JLFB 1VQLS 1SXLA 5L9XA 2RDDA 1NJWA 3TUIC 2YXLA 2F40A 2CJKA 2FHMA 4W4MA 1UPPA 2CQGA 2I5JA 4WYLA 2XLJA 2UP1A 4FYWB 4R8UA 5F8MA 4USVA 1VQ8S 3OJSA 3IM8A 4ECQA 2R7UA 5DG7A 2ZUAA 3AOAA 2ZH4A 3RRGA 3HCXA 2FHOB 2QL5B 1TKXA 1RHMB 3AQOA 1E6VB 3MFIA 5CYMB 4ZVGA 2J6SA 1S9FA 1RHRB 2QMUB 3OBIA 2FLPA 4Y3CA 3BQ1A 2KYXA 2HK2A 1IR2A 4FYXB 3PEJA 1OMSA 1TVRA 1E6YB 2LXUA 2CPHA 1K0VA 1NKEA 2DHSA 1WF1A 2Y1LB 2ZEJA 4MJKA 3Q22A 1UWAA 5IXUA 4G1QB 2MHEA 1KKHA 1DBDA 1ROFA 5ETVA 2W8KA 1DFDA 3NOCA 4DWIA 3T41A 3A13A 1HNZJ 2JEJA 2VJVA 5B08A 1WOPA 3MXHP 3Q8VA 4DPYA 3W5XA 3M8PA 2IM1A 2WHOA 2L9WA 4X4PA 2HHTA 3D4JA 1T05B 4X4UA 4C4WA 2L9NA 3OVSA 3SEOA 2YKMB 1U25A 4NLPA 2WVCA 2J6TA 3CDEA 2VC0A 2W9CB 4UY8T 2JLEA 1HQEB 1VQSA 4EI2A 2MQPA 2KHDA 4WZMA 4DF8A 4FF2A 3AY0A 1RDRA 5I3PA 4QIWD 4F36A 2ZHAA 1JQGA 1WUUA 1MWZA 4JI2J 1PBAA 2JFKA 4NASA 4O4GB 4A8KA 2B51A 1WC4A 2R3VA 3VGSA 1H2VZ 5IC4B 4WP3A 5ETSA 1J5OA 1RAAB 1HW8A 4LUBA 1NDPA 3UW1A 3EICA 2FY8A 4K4WA
chains in the Genus database with same CATH topology
3D1HA 1M5HA 5MAOA 1L5UA 1RT5A 3QLHB 2RMLA 4B17A 3KG1A 3QZ7A 1NU4A 3CUNA 3KG4A 1FT8A 3CJ2A 3DRPA 2RQKA 3E01B 3BDEA 1S6QB 1MMNA 5GMKa 2GMHA 1SUQB 4DN9A 2ZHBA 4DR7F 3TAPA 2YX1A 1U1OA 4B3SF 4URQU 2MMYA 1TAQA 1TK0A 2QRRA 2LEAA 1KLMB 3Q2SC 3BO4A 5F8GA 4K0KF 2YNFA 2B3TB 2XGPA 4H4MA 1WEYA 2IYIA 2R2TA 2GA7A 3CIMA 5DDOC 3UD4P 2E7WA 2KHCA 1SKSA 2PEHA 4A8OA 2BR0A 1FE0A 3CDAA 4B02A 5KFPA 1D8YA 1PC4A 5SUHA 3Q2TC 4DL2A 1Y5IB 4F50A 5DJBA 3K7RA 3MPYA 2OSQA 3OFHA 4OZNA 3BEGB 4RW7B 4ECTA 1HNZF 1X5PA 2EFOA 4WZQA 1FEEA 4IRKA 1U09A 4A47A 2MB0B 5IT9Y 4TLRA 4ATNA 4J37A 1VQOS 4AXIA 2F8HA 2DD8S 2JC0A 1HBOB 1VK3A 3JYTA 1X0FA 3VQSA 1S72S 5A8RA 1IR0A 2AJ4A 3P96A 2HWHA 3BZQA 1YJTA 1I1GA 2W9AA 1S99A 4KR0B 4HTJA 4ILLA 5HMXA 4J9RA 1NHUA 1VFJA 1GX6A 3M6WA 4IR9A 2UUWA 2MXYA 1XEZA 1R0AA 1FRHA 5F8JA 2PT0A 3DLEB 3VAGA 4NZ6A 1AXQA 1Q7YT 1U6FA 4KBIA 2E9TA 3RU0A 4RW8B 3KLFB 1WELA 2NREA 1T94A 1S9GA 1HW9A 1ZYQA 1U24A 5LXYA 2J6UA 1IKYB 2VFVA 3T9NA 4BS2A 2B4UA 4IR1A 3OJUA 1R6YA 1WACA 2R7WA 1YJUA 2BV3A 2V5HG 4K5SA 3LP0A 4CT9A 4U67Q 3N79A 4O3QA 1RT1B 3I32A 3UFCX 5JVGQ 3RTVA 5H9FJ 2RQMA 4RBTA 5KOXA 4B9SA 2J5AA 4LVNP 2R7TA 3KOAA 3O1LA 4A8SA 3SCLE 2XI2A 4AUKA 3DCAA 2XI3A 3M30A 2FD2A 1MMLA 4G1IA 2VOPA 5D77A 2LVWA 5KTQA 1NK8A 1BY9A 4QYRA 1UFWA 2B4VA 1U6BA 2J7WA 1BQXA 5KFDA 1FRKA 1SJQA 4JV1A 4NLVA 2AJFE 3KG0A 1NK9A 3GIMA 4A8FA 1N5YA 1VS3A 2CPYA 3U7JA 5DGAA 1UFLA 2HZCA 4HKQA 1Y5LB 2VFTA 5A0YA 4MKBA 4PQUA 1GXTA 4JI2F 3C46A 2B6AA 3AAWB 3GQCA 3HLUA 4I7FB 1XTZA 2CQ3A 5FIIA 4MK7A 2N7YA 3J7A1 1SJ4P 4D3HA 5KFYA 2GQ2A 3FGVA 1WG1A 4MFBB 1RTJB 1HNWF 1FESA 3HM9A 1QJHA 4JUZA 4N5SA 4EEYA 1NNDA 1ZM2A 1VIXA 4CTAA 2ZJRQ 1FKOB 3H59A 5KFRA 2IC3B 2XMMA 1JLAB 3MTKA 4NLDA 5C25A 3S8SA 2M8HA 2RB7A 3DRSB 3LAKA 2MQQA 1WTFA 2GMLA 5KFHA 2XZWA 4ID5A 3CCZA 3Q0AA 1YJ9S 4ELVA 5J2MB 1LXJA 3PDNA 4NXNF 1U6ZA 2MSTA 5IZHA 4NCAA 5ADZA 5K14A 1VBXA 3HVRA 5K8MA 4CT8A 2FTRA 3MFHA 1ULRA 1S1XA 3HHKA 2Y0SD 3IRXB 2CIMA 3KLGB 4DV6F 1ZAWA 1QUPA 3GIIA 2DNMA 4PWDA 2BVZA 2IJFA 5F3ZA 1S1TB 2JL9A 3X3UA 2HNZB 4G3IA 2CQCA 1XWLA 3CC4S 1N8RT 2OPRB 3PJXA 5IM0B 1VK8A 2GHWA 2OP5A 2O1PA 2X51A 3C2PA 3BJYA 3BQ2A 4LF5F 2RRNA 4RNOA 1NB7A 2HS0A 3CEDA 4C8KA 4FF4A 1L3VA 3W3SA 3DM2B 3N4WA 4B3MF 2QA2A 2I9SA 2M70A 1FTRA 3PACA 5LXRA 3CCSS 3MWBA 4HL9A 4YR3A 1LQ9A 1JLCB 3IA0A 3MM6B 3CMES 4IO1A 5B0AA 3DOLB 4ED7A 1N6QA 1NH8A 3O44A 3PR5B 4C7QA 1UVJA 3HHLB 1YTYA 5I3UB 3LQVA 2VPXB 1HNXF 4FS2A 4V19J 4FXDA 2VL1A 2HRUA 3HJFA 1HHSA 1DTTB 3G71S 4Y0FA 2HNDB 1N5TA 3D1QA 3GFYA 1Q79A 4K4XA 1JLFA 4NLUA 2IAJB 2C2DA 4NLQA 5KFLA 4DSIA 4NLWA 4HVZA 3DU6A 4PR6A 2RU3A 2G4BA 1VHFA 5EX3A 2WB4A 4B08A 2XS2A 3PIOQ 1WF0A 4CNZA 3C8YA 4GMKA 1HBUA 2GW8A 1C1CB 2E1AA 2BDPA 2KB2A 2PE8A 2AYEA 4KGKA 1IKWA 1WG5A 2KN4A 2NLWA 3CGIA 3MEGA 3BQ0A 2ADBA 4KFBA 2CPDA 2FJXA 2XEXA 1QVFR 1C4CA 3LH2S 2FY1A 1WEXA 4LQ3A 3KHHA 2UXDF 2GFFA 4JI8F 1MU2B 3P5TL 1IN0A 2AP6A 2V2KA 4Q7AA 2HGLA 2ZZMA 4ZLPA 2JLGA 1TKZA 2HVZA 1TL3B 4KRWA 4GC6A 3R1HA 2L08A 4RW6B 4E8UA 2PFFB 1YI2S 4RW4B 1XNRF 4I4BA 3UQSA 4RUAA 2DT9A 3IN5A 1XBWA 3MOZA 3VAKA 2CJAA 1NKCA 4A8WA 1T95A 3SSSA 1RWUA 3FZ2A 3HHLC 2IBOA 3MHYA 2YNIB 3MEKA 3AB2B 5KFKA 1E6VA 3KMSA 2FJVA 2NSBA 5B0GA 2LMIA 2DNYA 2O67A 2R8HA 2P9CA 3FCHA 4EBDA 1D1UA 4KE5A 4Q2LA 2ZM6F 5CYMA 2VA2A 4B9LA 4DSFA 2RQ4A 1R8BA 2M2BA 2W9BB 4QIVA 1OO0B 2C3PA 4WJBA 4IO9Q 5IT4A 4TU9A 4DL3A 3GFHA 4JBCA 1TZ0A 4IQXA 2JWNA 1SQEA 2UXCF 2LA4A 2ZITA 1E6YA 1S79A 3V2UC 4O44A 1N48A 4DR1F 3FEZA 4BDPA 2ERRA 1QUVA 3FJ2A 2PI4A 4ETXA 1N88A 3R5BA 4L72B 3R1LA 1XC9A 1T8EA 4I56A 1R3NA 4X4TA 3SQGA 4ZS6A 4WU2A 4LQ9A 2KKHA 1MNEA 3CJKA 4RWWA 5KT2A 3CCJS 2DCLA 4X4VA 2D41A 2MYFA 2YNHB 3P49B 1VQ6S 2HPUA 3MMCB 4MK9A 3KLEB 3G4SS 1FRIA 3RAMA 1SBRA 4G1QA 4XK8C 4DQSA 5H9EJ 3K59A 4ZPDA 4N77A 2N3LA 2C2RA 2G0CA 1K0TA 2M0GB 4YEAA 1H2TZ 3VR1A 2CPZA 4YDDB 2NUUG 2WAQD 3OL7A 4IH6A 4FNHA 4IFVB 4A46A 1GT8A 4DV7F 4Q8FA 1I94F 4H4OB 3VAMA 3LGNA 2NQPA 3PY8A 1K1SA 4BC7A 1NJYA 1S6PB 1TAUA 1EETB 4N47A 2DISA 4F3MA 3VALA 4LSNB 4RNFA 2OD6A 2CQBA 2EC0A 1D9FA 2D1CA 2OMOA 1SL0A 2XCAA 1D9AA 2CJ9A 3NWGA 4DR2F 1SKRA 1JKHA 5EN1A 1LOUA 3DLKB 5E3QA 2RD5C 1TP7A 4QWBA 4Q2MA 2EK1A 1WG4A 5KG6A 5KOWA 3HX9A 3HP6A 2GQQA 3DMJB 5E5NA 4JI5F 2BE2A 2YQ3A 4LF9F 1T05A 5F3TA 2I8EA 2J76E 3BR8A 3N6NA 1M5OC 1VQ4S 1TV6A 4DBQA 4IG3A 1AW0A 1F5AA 4B9TA 1HHTP 4IFYB 1UJ5A 3M2RB 3H2LA 2XMUA 2CPEA 3BGFA 4ZVHA 3G8SA 1FHTA 4C0HA 1C4AA 3W7BA 5BR8F 4QWEA 3US5A 2YKMA 4YP3A 1HI8A 2HAIA 4OI2A 1LFWA 2RS2A 2XLKA 4K4SA 1FF2A 1TFWA 3G96A 2V8DA 5CYJA 3NGDA 2XMJA 3LF0A 4KIAA 5L38A 4B9UA 4UQGA 1C0TA 2W9CA 4J9SA 2KJWA 3OQ2A 3MR3A 1JXLA 1O5JA 4I6WA 4HI1A 2JJ4D 3R5DA 2AD9A 5C42A 1HQEA 2CVEA 3GZ7A 2X1AA 2ZUGA 3SMZA 5L1LA 5A8WB 1UJ6A 2CQHA 5D6GA 2RVJA 5EWGA 2W8LA 3FSIA 2K8GA 3W2WB 1V6HA 2ZOMA 1IJFB 4FP9A 4DL5A 1S9EA 2V8VA 2V4JA 4L6V3 4WTYA 4DR5F 2NR0A 4RW9B 2KZMA 3JTNA 2UVUA 2W4PA 4Y2MA 2JLFA 3K5LA 3I9ZA 4RKUC 5DQIA 5J2PB 7FDRA 1WD6A 4A48A 4PUOA 5K8NA 5F41A 4ED2A 3NNAA 1FEHA 2QSFA 1BGXT 4F67A 2OJ3A 4HYKA 1HNVB 3E51A 4IYQA 4WIIA 2R2RA 1L3KA 1QE1B 3BGRA 4NYZA 3IC1A 4OJ3A 3R3TA 5HROB 2ZNYA 3HVAA 4KO0A 5SZTA 4DSLA 3OUYB 2VPYB 6FD1A 2BQRA 2LEBA 5IS2A 4ZP7A 4GKKF 2IMWP 1RKIA 4QR1A 3V4MA 2FIUA 2JFDA 3HPOA 2M4MA 1C2PA 2G1DA 2WONA 4Q43A 5KFQA 2CPFA 3VAHA 4M1KA 3PKYA 3CCWA 3V5RA 3TARA 4FYDA 2OTJS 2K3IA 4MKYA 2FHJA 2BQ3A 1FJ7A 3GFZA 4F4WA 1N4LA 3JSBA 4O4GA 2HFOA 1HNIB 3SFUA 3CMAS 2FLNA 1RT4A 2F7VA 3IGNA 4BHQA 3ONQA 5HMZA 3UDCA 3PJWA 4NCBA 4C9DA 2MKCA 4MH8A 3M2VB 4I69A 4ZPAA 3F73A 2EPIA 1JLEB 4WE1B 4JYAF 3IBWA 3G6VA 4YY3F 3VAFA 2RKIA 1R31A 2MZRA 4XDCA 3RB4A 1APSA 1S4FA 3LOUA 2R4FA 3N5BA 2VPZB 3SSRA 5HP1A 1FK9A 2IHR1 3ICLA 3LW5C 3NS6A 2NPFA 1RTDB 4R5PB 2R7SA 5DO2A 4PKDB 2COLA 2FVCA 4KSEB 1HYSA 4EUVA 2EFGA 1RT6B 2LXFA 1LW2B 1X0PA 2NSCA 3H98A 3KLHB 3ZZ0A 4DFJA 1QY7A 5KFXA 4HH1A 2CQ0A 5IT0A 5CCLA 2VBYA 3QLHA 2YWEA 1JLGB 2OSRA 3FEXB 4O3PA 2DNQA 1CQMA 3J7Z5 1U1NA 3D0IE 5DM6Q 2IRXA 2WOMB 3E01A 5B0BA 2PIIA 4DV0F 1S6QA 5KG5A 5ITHA 2GIRA 2VPWB 3L7OA 1URRA 1HI0P 1TKTB 1SUQA 1UVKA 2HLUA 3PEHA 1S7HA 4TQSA 5K9FA 4XO0A 3EUNA 1LWCB 4OFZA 4BWJA 1KLMA 2AJ0A 4LT6A 1XNQF 3GE9A 5AJ3F 3QMQA 2OLWA 2AYGA 5IWAF 2ATLA 4HTIA 4TU7A 2DGSA 4LSLB 4PG5A 1KOOA 1VQ9S 4OLPA 2ZJQQ 1GQEA 1RT3B 4NLTA 4NLSA 2HWTA 4WFBQ 5D4LA 3ZZPA 3QWUA 2ASJA 4RW7A 1VC5A 3OXFA 5D4OA 4DSEA 2QT7A 5E41A 3EXCX 4NXMF 3DYAB 4P7VA 4NRTA 4OHVA 3VF0B 4F3OA 4K4TA 2FVSA 4NLGA 5KFBA 2BXJA 2A3JA 3CDUA 2DNOA 3FFIB 2HYIB 4DV5F 2ZDPA 1HBOA 3QYYA 4GO7X 5L9NA 3T1HF 2JEIA 3G86A 2ABYA 4ECYA 2BQUA 4EO8A 5BYRA 5F8LA 5T7LB 2M52A 2C3YA 1OPIA 2DR9A 2JEGA 1P8GA 3DLEA 1NK6A 3GYNA 4R25A 1Y3KA 4TQRA 3TRGA 3KLVA 1Y3JA 1U48A 4RW8A 3KLFA 2HHHF 4GKJF 2YKQA 2ZKUA 3I6PA 4RNMA 3OR1B 5L8RC 2Q66A 2Y1IA 2OPSB 4XIUA 2R8KA 2JOQA 5A6WA 1IKYA 4NX9A 2JH3A 1VMBA 1X9MA 1N34F 3Q8SB 1CQNA 4JI0F 3DOKB 1U47A 1S0MA 4ZCKA 3UR3C 2E5LF 3CF5Q 4ZPCA 5L1KA 3RRKA 2Z2MA 4I0WA 4O0IA 3EGZA 3BN4A 3D28A 4F2SA 1RT1A 5HQ8A 1DAXA 3KNGA 4FNIA 2CQPA 4NA2A 4N56A 3PW5A 1S0OA 4HEA9 3RYLA 4DX8H 2OFHX 1OQ3A 2KH9A 2VH7A 4P6QA 1HR0F 1V3SA 3HO1A 2D3ZA 4WFNQ 4AFFA