2W4PA

Human common-type acylphosphatase variant, a99g
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
96
structure length
96
Chain Sequence
GNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ACYLPHOSPHATASE-1
publication title A Rigidifying Salt-Bridge Favors the Activity of Thermophilic Enzyme at High Temperatures at the Expense of Low-Temperature Activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 96
sequence length 96
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2008-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2w4pA00
5K9FA 2QYCA 3LGNA 2L3MA 4U9RA 2FTRA 1U7LA 2HIQA 1LQ9A 2K2PA 1URRA 1WD6A 2ASYA 2OD4A 2RILA 3F44A 1SB6A 1YJUA 1TL5A 2FB0A 1QUPA 2K1RA 3BDEA 2ZDPA 2ACYA 2HLTA 3HDSA 1FEEA 5B0FA 3HX9A 2K1RB 1CC7A 2AP6A 1AW0A 2LDIA 5B0GA 2QLXA 4HI2A 1P6TA 2KT3A 2AW0A 2KKHA 1K0VA 4OJ3A 4FNHA 3FGVA 3FRYA 1S6OA 1ULRA 1YJRA 2AJ1A 2OFGX 1FE0A 4QOTA 1KVIA 4YDXA 1JK9B 2HFNA 2GO8A 2GFFA 1OQ3A 3DXSX 2BUNA 4Y2KA 2IFXA 3BM7A 2KT2A 2ROEA 3BB5A 1GXTA 2HLUA 3HHLC 2IYGA 2VH7A 2XMWA 3KKFA 1APSA 1OSDA 2N4DA 1YJTA 2AJ0A 2BYCA 1FE4A 1X0PA 5IXUA 2KYZA 2XMUA 2W4CA 3K7RA 5T7LB 5B09A 1FESA 2HFOA 3KG1A 5B0BA 1N5SA 3QGPA 2N4CA 3CJKA 5B0CA 5B0EA 3HHLD 3CJKB 3IWXA 4A48A 2ROPA 1S6UA 2BJEA 4HH1A 1OPZA 2GGPB 1P8GA 3BGUA 2OP5A 4EFAC 3MZIA 2ZDOA 3DCAA 2LXFA 2W4DA 3LO3A 2N7YA 1XBWA 4NL5A 3HF5A 2OAUA 3TRGA 1Q8LA 3T9NA 1FVQA 1YJVA 2XMKA 3UDCA 5B0DA 1TL4A 5B08A 1TZ0A 2OFHX 2K7JA 1W2IA 3HHLA 1N5TA 1MWYA 2HQIA 3KNGA 4OJ1A 4A47A 1Y3JA 3KG0A 1CPZA 1OQ6A 2EW9A 3I9ZA 3HHLB 5T7LA 1KQKA 4A4JA 4DPOA 1Y3KA 3WDOA 1Y0HA 2CRLA 2VV5A 2LQBA 2W4PA 3TNVA 4F67A 1AFJA 1X8DA 1N5VA 5F0WA 2BJDA 4A46A 1MWZA 1TUVA 2ROGA 2RSQA 1SI9A 2GGPA 2K7KA 3BR8A 4Q2LA 4Q2MA 3VTIA 2XMTA 2PGCA 2BBEA 2G9OA 2OMOA 2FIUA 1YG0A 1Q8BA 2IYIA 5B0AA 2OKQA 2Q3PA 3BN7A 4OJGA 1IUJA 2GA7A 4OIXA 2GV1A 3TOQA 1AFIA 2QIFA 5A6PA 2OD6A 4Y2IA 1VQYA 1N5QA 2RU9A 2XMJA 3BF4A 3HFKA 1Y9OA 2QLWA 2GCFA 4OJHA 5A6WA 1FD8A 2XMMA 1FVSA 3GZ7A 4HI1A 4ZA1A 2LQ9A 1Q53A 5F0UA 4DL0C 5KAKA 4Y2MA 4DN9A 1JWWA 1KVJA 3LGMA 3MCSA 4HL9A 1X7VA 1GXUA 1VQSA 1YRXA 2PD1A 3IWLA 4FNIA 1V3ZA 4NPOA 2JDJA 4ZOSA 2XMVA 1RJJA 2RMLA 1TR0A 4HH0A 1SQEA 3QMQA 1Q4RA 3E8OA 3FMBA 1R6YA 4YEAA 1CC8A 2FHMA
chains in the Genus database with same CATH superfamily
5BYQA 2RS2A 1IJFB 1URRA 1YJNS 2VKZG 5HMXA 2HHSA 2P2CB 2HK2A 2HAFA 2B51A 1YGYA 2W9CB 2XB2D 2H1YA 4LQ3A 3D68A 1HNWJ 1IJEB 2Y1LB 2CIMA 3I31A 4DX5A 1UPMB 4ICLA 2BE2A 2O01C 4QIGA 3QRPA 1UVMA 1EKSA 1IKYA 3LO3A 1ZZNA 2CPIA 1BMQB 3HHLA 3T41A 2V68A 4DQIA 4RW7A 1KQKA 2J0QD 2AEMA 3DRRB 4C8ZA 3AQOA 2R2SA 3BN7A 3R5BA 2JRSA 4I2PA 1AT1B 3AOBA 5KG7A 3AB2B 2DT9A 2CNLB 2GMJA 2HRYA 5D77A 3R1HA 1S9GB 2E5IA 2UV8A 2NUHA 1TFWA 4K59A 3OXGA 4CLPA 2N3LA 4KV8B 1XMOJ 3TAMB 4NXMF 1LW2A 7AT1B 2BUNA 1ZM9A 3D66A 3J80U 2ZC4A 1V6HA 4ZVQB 2G13A 4X65J 3CMQA 2ZH6A 3UQSA 3CJKA 1NPPA 2CXEA 2WAQD 9ATCB 4EFAC 4F4KA 2YKMB 2W7OA 4ZDNA 2B43A 1DQAA 5KFGA 4ZP6A 3V6HA 2XMKA 4F3MA 2DRDA 1IKWA 2ILYA 2HQCA 2Q79A 5D3GB 1R8HA 5HMWA 2UXCJ 3NMAA 2BJDA 3BYPA 1FNOA 3CD7A 1QUVA 1GMWA 4LFAJ 3KHHA 2ZE2A 3MXHP 1N32J 1Y10A 1VR6A 4YB5A 2XCAA 1SC6A 3KUGA 5K5MA 3BO3A 2MJNA 2NPIA 2IRYA 3BO2A 1G6BA 3D6FB 5LMNF 1JLQB 4QR2A 2ZEJA 2UXBF 2UVVA 2AGQA 2FB0A 3T6JA 4ZN3A 3QIDA 4N76A 2LQ8A 1VQ5S 3R5AA 1DY3A 1Y5LB 1YJRA 3H4DA 4U7UK 3W60A 1TVRB 1U0HA 2YNGA 1F9EB 3BH7B 4IQMA 4NA3A 2YKNA 4MJKA 1LK5A 2Z56B 4N47A 4HTIA 3AD9C 4ETXA 1NXIA 4KHPF 2VODA 1S1UA 4NLWA 5D15A 4KH0B 2YWWA 3FCVA 1RTJB 4DUZF 3NAHA 2QLJB 1GH8A 2HBRB 2F9DA 1FXRA 4C8NA 4WTOB 3VCDA 3VF0B 2ASJA 3Q8QB 2GO9A 1QAYA 5EDWA 4FYYB 3B6BA 4DV0J 4X2BA 2R7SA 4NYZA 4DN9A 1X7VA 1RHKB 2J0XA 1WC0A 3W5YA 4LF7J 3CTRA 3TA1A 2W9BB 1JLCA 3V6DB 2VBWA 1GTEA 1FNXH 2ASYA 1FDAA 3F44A 1S59A 4IFYA 4DL6A 1MWQA 4J37A 4KSEB 5E41A 2NXEA 5F8LA 1LEOA 3KLEA 1SJ4P 3CCRS 4ECQA 3O3LA 2ZM6F 5IQQA 2KL8A 2FD2A 1RBAA 4DV7F 1CQMA 4CCHA 4JBCA 3M7VA 5D4NA 1YHQS 2Y9HA 8RUCA 3T19A 5CXTA 1BHNA 4QJVA 5C5JA 3N6MA 3PNIA 3GONA 1SBRA 4A4JA 4DDFA 2HNDB 2LQ5A 3I0SB 3V6JA 3DM2B 3BKUA 5JUMA 3FCHA 4E98A 2QLBB 3GLJA 5ETKA 2KXFA 1S57A 3Q8VA 4WIQA 1CULA 4FXVA 2OD6A 3W8GA 1XNRF 3OTEA 4FZVA 2GJFA 2HHVA 2ZH7A 5DG8A 2YNHA 4URQU 1ZA2B 5A0YB 4B9NA 1K0TA 2B6AB 4ERDA 3QGHA 5LMUJ 1JXEA 1WOOA 1IWGA 2DGWA 1KSPA 2AJQA 2E1CA 4DSFA 2J7KA 4ECYA 2R7WA 3C15B 3HHNB 1M5OC 2IYGA 1TTHB 1F5BA 1RWKB 2ZZMA 4IYQA 3QBCA 2HFOA 3V81B 5K8PA 4Y34A 2HQGA 3SCLE 2V8DA 2M8HA 3DHXA 4J9VA 5D4LA 3KUEA 5M2UA 2NREA 1S0OA 1HBNA 5ETTA 1R0CB 2O66A 3UN5A 4F2RA 3SMZA 2CRLA 2IA0A 3TVYA 1HLWA 5SUHA 2IVMA 4TU9A 4DQPA 2YQ0A 1Z2ZA 1PKUA 2XEXA 3PRVA 4OX6A 4I4BA 1NSKL 1MSWD 1YRTA 2MQ8A 4NA1A 3VVTA 1T05B 1YRXA 1VQSA 3IS9A 4NXNJ 4PPZA 1G4CA 1S0NA 3CIMA 4J91A 1HKAA 1SPBP 2BXJA 4U95A 5GADI 3I4PA 4RNOA 4R5PA 1UVLA 1ZETA 2NR0A 2ZJQQ 1C0UB 2VFSA 2BZ2A 3BN4A 3FBBA 1SJFA 1VQ9S 3KLFB 2YNFA 4GMKA 3NGTA 3GV5B 4LFCF 1CVJA 2VPWB 3I87A 2DXFA 5L46A 5BXIA 2HFNA 1WSRA 5IS2A 1PBUA 3OHBA 3SV3A 3ET6A 4C0OC 5B09A 5J2MA 1N4LA 2XBPA 3RG6A 2DHSA 3MURP 2ROPA 1T9TA 4FN5A 1ZA1B 2DHGA 2V8HA 3TWZA 3GV7B 3ZZ0A 2C2RA 2X7IA 3DOKA 1Y5NB 4HHJA 4P72A 4ALZA 3FEZA 1DAXA 1EP4A 4B3OB 5AJ3F 2PDAA 1QTMA 1I51B 1B64A 3PW0A 1TUVA 4DSEA 4LJMA 5LXRA 1UEVA 2G1DA 5EWGA 1S9EA 1R31A 2FJEB 3NOGA 4PG6A 5AXKA 2OPSB 3FSIA 3PO4A 2E5LF 3GG0A 2B4PA 3MEDA 4YB1P 3ELHA 4FVCA 3CDBA 1N8RT 4CLUA 3P49B 2VL1A 1SV5A 4K8RA 3GMGA 2Y8WA 2NQPA 4ZS6A 2HNYB 4OI1A 1HR0J 4KBIA 5IT9U 3J7YI 4DSIA 3O6QA 4NYOA 1H0HB 4DUYJ 4KAIA 2AZ3A 2HGLA 2DH7A 5B0BA 4P2MA 1JLFA 2QL7B 2KVIA 1NPKA 3PZPA 3FCWA 4L3NA 3CJRA 1T03A 3J81U 2B7CB 1HHSA 2MGZB 1IR1A 1WDTA 3JSYA 2KTQA 3MPDA 4PPDA 3NXZA 2G9OA 4MTPA 4ZJQA 4JI2F 2HVEA 5DLFA 2QSWA 2XMMA 4HI1A 4LSLA 1C4CA 2GHVC 2HK3A 2MYFA 5L1LA 5I3UB 2RD5C 3SI8A 4ZVUB 4WE1B 4OI3A 1UZDA 5F9NA 5AE2A 2GIQA 1AXQA 5KFVA 2PMWA 4KV8A 1E6YB 2EC2A 3Q23A 3TAMA 1LXJA 1T9XA 2KKHA 2H3EB 1U09A 1TL7A 1VC0A 1MN7A 1EHWA 1GXTA 3KKFA 3K58A 4B3MJ 5L8RC 1VBYA 4USWA 3M8SA 3US5A 4CIOA 1Y5IB 3CO9A 3W5ZA 3KLHA 3MMAA 1SXLA 4KPYA 4WF9Q 5IQ6A 1PC4A 3CPWR 2F4VF 1SUQB 3CNQP 4QIWD 2KHCA 2XCPA 1VBXA 5D3GA 4A8KA 3MAHA 4CO1A 4CO2A 4ZCMA 1O0PA 2M5YA 1PAUB 1RP5A 3OFEA 2ZUGA 5KG6A 4PYAA 3M9NB 3CMES 2MLXA 3HSGA 4M5GA 4Y28C 1F9HA 4NLPA 3I82A 4DN0A 1I5OB 3OV7A 2R7OA 1H74A 3H5XA 1KQGB 4DBQA 2BQUA 1X60A 4DU7A 3MM8B 1NK8A 1C4AA 2P9GA 3CD5A 1OPIA 2MKJA 3BKFA 1NK7A 4OYZA 1JLQA 1RYRA 4LBIA 3TVZA 5GAGU 1N34J 3SV4A 4Y2CA 3W61A 4TQSA 1DZ5A 2XM3A 3BGOP 4L72B 3G82B 2AP6A 1S48A 1PBAA 2RQ4A 2G0CA 3OBIA 4QZVB 2HVZA 1LWEB 1TVRA 2QA4G 1RWPB 3BM7A 2OTLS 2WZ1A 4B3RJ 3AODA 3OW2R 4PEOA 3EZ5A 2DNOA 4YFUA 1JIHA 1M5KC 3VALA 2Q6BA 2ZDOA 4OX8A 4FBTA 3UVJB 1F60B 2WVFA 4U8YA 1YJ7A 1XR5A 2OFHX 3MD1A 4WP9A 2VG5B 2CPXA 1RTJA 4MT1A 3D1HA 4A8QA 4GVLA 4TU7A 1HQEA 2IAJB 3ZC4A 4AQYF 3HLUA 1K9MT 2MKCA 2DNPA 4GKJF 3W2WA 5H9EK 2KZMA 2D7SA 1H72C 1HBOB 1FWLA 3IC1A 4ER8A 2UZAA 4YQWA 3AOAA 4DQSA 4DR1F 3OJUA 3L95X 2VQFJ 3CWJA 3ILOA 2ZITA 3UNYA 3ETMA 1LKZA 1JNRB 2AGPA 5K8OA 3MM7B 2DGSA 1RLCL 3NBPB 4OYWA 3T5KA 4JI7F 2KT3A 4OHWA 2E1RA 5U47A 4K0KJ 2H5JB 1X9SA 4RJVA 3DI6B 2ZWOA 1JKHB 1QAJA 1UW4A 2ZOGA 1A6LA 3NG8A 1A9NB 2XULA 5HMZA 4ELVA 5DS7A 4K2XA 4OZNA 2GQ2A 4F8RA 3MECB 4YB6A 1Y0HA 3G6ES 2HNDA 1XMBA 3THPA 3E2EA 1BQMA 3DM2A 5E3PA 2D69A 2H9ZA 3GIIA 2GGPA 2C3UA 5LJ3Y 2EFVA 1WJ9A 1P1TA 3KJFB 5C42B 3FQLA 1J5OA 8AT1B 2YKOA 3I32A 2R7QA 4DR5J 1NM2A 4NASA 1GEHA 4USKA 1ZZFA 1RHJB 1UVKA 3O1LA 1R43A 4LF4F 2RAQA 2VONA 1TL3B 2YH1A 4ZKAA 1EIYB 3FFIB 5B0GA 4XIUA 3TZXA 2C3OA 3BS9A 3C15A 3IO1A 3CCUS 2H5IB 3C19A 4B3TJ 3Q8RB 1U48A 3PEHA 3V81A 3CJ5A 3MHYA 5B0EA 1DURA 1X5OA 3EVWA 3PJXA 3TRGA 1ZAWA 5B0DA 4F4ZA 4UF4A 2KXHA 1HWKA 2UXDF 2LMIA 5AXLA 2DXDA 2Z2YB 2QT7A 3EICA 5JJBA 2J9DA 1FJCA 5GAGI 3T1YJ 2FVCA 2YNIB 5A6PA 1WC5A 1DBDA 3OR2B 1T05A 3GZ7A 3R7NB 2AYGA 1FDNA 1IXKA 3WZ0A 2JLFA 5CYJA 3WC2A 3BYRA 4K4UA 2NPFA 3VGTA 4GKKJ 2K06A 3QFWA 2UVWA 3KLFA 1CC7A 3JSMA 1HIYA 4OJ3A 5AXNA 3RB0A 3E01B 1FJGJ 1JJCB 1NSAA 2OTJS 4G1QB 1S6PA 1RAHB 1NJXA 1RWUA 1DLOB 2IMWP 2AYBA 3HT3A 2FHKA 1TP7A 2R8KA 4WXOA 3CSKA 4Y3CA 3KDOA 3VAIA 1MU2A 2C2DA 1Q16B 1UVNA 4B3OA 2HQIA 2YPYA 3ZZTA 4O0IA 4LF6F 3Q2SC 2B3TB 3DYAB 1DTTB 2AQ4A 3FBEA 4MFBB 2HZVA 2OH2A 1NU4A 4BBYA 3AJ1A 4KJIA 1FKOB 2XZTB 4W92B 4OQJA 1VQ7S 4PXCA 1WEZA 5KTQA 5K8NA 1UPPA 4RLEA 4NLYA 2OGUA 2ADCA 3Q86A 3BH6B 5K9FA 2RKIA 2HNYA 2LLZA 2W7PA 2FC9A 1MG7A 5I42B 5HMYA 2JX2A 4G1IA 2R2TA 4BDPA 4BWMA 4K2JA 2F9JA 4IOAQ 1M5HA 3W9JA 2OMLA 3LW5C 3MR3A 1MROB 4F04B 2RHSB 2JEFA 1FERA 2EKNA 1G1XA 2BDPA 2MGZA 1R0AB 1YKWA 5D0EA 2I2YA 5IFMA 2CQ2A 1GAOA 4I2QB 2ZHBA 3VTIA 3CCJS 2FZCB 2DIUA 2QZ8A 2GW8A 2CFXA 4ZPCA 2DISA 2Y1RI 3EE3A 2OPQB 5IM0B 2FY1A 5LM7E 4OX9F 3PW2A 3G8QA 5I3UA 5A8WB 4FVMA 2CJXB 4WE1A 1HW8A 1OO0B 1RI7A 4IOCQ 3DLKB 2HW3A 3A8JA 3HSZA 1KN6A 1WC6A 4A8SA 3HSDA 3TAPA 4KQZA 3G2XA 1MMNA 3L7UA 2RF2B 3FC9A 4XPEA 3H0PA 3JTOA 3M8ZA 2D3OR 3ZZZA 2VOPA 1LFWA 3MEGB 2LQJA 2UP1A 4CLSA 5AT1B 4YR0A 2BYCA 4USTA 1IQZA 1HPZA 3TUPA 1S1WB 3CC2S 3IRXA 4X4TA 4CLKA 1SUQA 1Q8LA 2AEJA 4LF5F 1R6VA 4AFFA 4C97A 3I9V9 3CJ3A 1YIJS 3MI7X 3MTJA 2HMIB 3BDPA 1GQEA 1XQIA 3I9ZA 1ELOA 4ES1A 2QMWA 5KFUA 2ASDA 5F9LA 5ETNA 1U49A 2FLNA 4ZVEA 4RUBA 4Q2LA 2ATCB 4Q2MA 2PGCA 5I3PA 4KO0A 2KM8B 4IH7A 2GA7A 1FRJA 3CJTA 4DFPA 1SC3B 3WIVA 2MSSA 4ZA1A 3DN9A 4IH5A 1H2UX 3H2UB 3PW5A 2XYPB 2E9ZA 3ICLA 1TL1B 4OZ0A 2DNGA 4DU8A 2APOA 5E2QA 2VHGA 1DARA 1BWEA 2OO4A 2ZD1B 3LANA 3I0RB 1U1RA 1FFWB 3G82A 4C11A 2K3IA 3DMJB 1N88A 2QYGA 4CLWA 1R0BG 4DZDA 1LWEA 1WHYA 2B9XA 2ZH4A 3NWGA 1AA1B 3K89A 1IBCB 4L6V3 4RZRA 1FDDA 5BJRA 3MFIA 2OSQA 3UVJA 1V3SA 4F4WA 4MH8A 1HD1A 4K5SA 3QRQA 1AUSL 3T1HF 4NRUA 3PRDA 4F3QA 3LQVA 2A2DA 2IAJA 1UKUA 4X4PA 5KT4A 2DGXA 1PC5A 3MM6B 5C2GA 5LT5A 3LPYA 1FVSA 2YX1A 3BSAA 4DF4A 5D0GA 1RJJA 2MEWA 3PFOA 5F8NA 5A2QY 4UW2A 1VI7A 4JP8A 2QYCA 2FLLA 3VGVA 3HKZD 2K2PA 2AHOB 2ZH1A 1ROFA 3VZHA 2ZKUA 4QPXA 2YBVA 1K0VA 3FGVA 2CKWA 2GHPA 3EXYA 4YDXA 2GFFA 2QGFB 4ZCKA 2ACMA 1WF0A 2XMUA 4LF2A 1E6VB 3TZWA 3QGPA 4N5SA 2YY3A 3N0VA 5CZXA 5J2QB 2YWHA 2Z30B 3GIRA 3V4IB 3CJ8A 3FZBA 3MECA 3OD2A 3K5OA 4OV6A 4LRCA 3CDAA 3UPFA 2MZQA 2DO0A 3UD4P 3OL9A 2COLA 5C42A 4XO0A 1LXNA 1V5VA 2XY7A 3PIPQ 4RW6B 1N5QA 3ZZRA 1SJ1A 1YDLA 2OPPB 4HHUA 2WBRA 1M90T 3N4WA 3IWLA 4FNIA 1UCNA 3OFGA 2ALYB 4DL4A 2UXBJ 5JVHQ 1IBMF 1TL3A 2HIQA 3UO0A 1TL5A 4J9SA 2CJYB 2R7UA 1RA6A 3JB9k 2M4MA 3OL8A 4ZLNA 5KFQA 1WWHA 2ROEA 5DG9A 3KHLA 3C14A 3W63A 3W66A 1H6KX 3BPDA 1H38A 4KHPJ 1KD1T 2F4FA 2ABYA 2VICA 3E3XA 1D9FA 5D8HB 3EDRB 3IBFB 4Q0BB 2P9CA 4R8UB 4H4KC 2CWKA 4CDIA 3R2CJ 1MWZA 1BD6A 3BZQA 4LSZB 3BQ2A 4TN2A 1OYEA 2QA1A 2XY5A 1U1QA 4OIXA 1RBLA 3OR2A 3N5FA 2I6WA 3DLGA 3HFKA 2GCFA 3NGSA 1BXNA 4NCGB 5C7PA 1AROP 1N6QB 4LUBA 3RB4A 4F0KA 3KJNB 2HQ3A 1QSLA 2P9EA 2K1RB 1S4EA 3VHQA 1T3OA 5CCMA 3E01A 1H2VZ 2M0GB 2W9AA 5EN1A 4F4AA 1TKZB 4G1QA 3K5LA 4DV7J 5ADZA 2VKRA 3A8EA 4EZ9A 3TP2A 4M5KA 2IBOA 1PJ5A 3ETOA 1LNQA 3JXOA 1J5EF 2IM1A 2ZHOA 4OJ1A 4DR4F 4JI5F 3OR1B 4WFAQ 4ES2A 5KFMA 3KLGB 3LA0A 3GQCA 4EI2A 3DDKA 2E5GA 2CQIA 4CRJA 3TI0A 2DNHA 1WF2A 2AX0A 3MCNA 1XNRJ 1S97A 2LA6A 3CJ4A 2HIYA 3QT6A 4ZVFA 1JMTA 3K0JA 4A8OA 2HFVA 2GC8A 4Y2MA 2DCUB 3AXMA 4J7CA 3AJDA 3NGUA 4NLUA 2XO7A 2FVRA 3D5MA 4JI8F 3CD6S 2DNMA 2QTWA 3FMBA 2CUYA 1UETA 4UQGA 2L3MA 4Q7AA 4HDHA 3DLJA 1UVIA 1VBKA 2Z57B 4CLFA 3HXMA 4ZJOA 4QWAA 3OL7A 5G4DA 4CLYA 1FTCA 3GSIA 5F8JA 2IBKA 4KGKA 1MROA 4QU6A 2V69A 2V2QA 2BVZA 3DGPA 5IC4B 4DG1A 3ZZPA 2QX0A 4FF3A 2DITA 3LP0B 4AL6A 1UJ5A 4I2QA 1RT5B 2R42A 5DQHA 2MY8A 1L5UA 4WTYA 4OI0A 2OMOA 4UTGA 4PKDB 2JH3A 5MAOA 5AE3A 5ETQA 2KRRA 3MGJA 3PYEA 2DHXA 2V94A 4JI4F 2YWGA 5E3QA 5IV3A 4IUFA 2YTCA 1T02A 1YSJA 5A8WA 2FDNA 2EBGA 1QJHA 4IO9Q 3H5UA 2FJBB 1HWLA 1RT2B 3DLKA 5HBMA 2WB1D 4UY8T 4KGVB 5CA5A 4B3SF 4ZPTR 1BQNA 4LFCJ 2HS3A 4JI1F 3KLVA 4KHMA 2NXUA 1X0FA 2XSJA 4YUDA 1T94A 3JQJA 1RTHB 2XYHB 3Q89A 3MEGA 3NS5A 1F3FA 1MN9A 3HVTA 2G1HA 4IG0B 3OFHA 5JVGQ 1SJ3P 5T14A 3CJ0A 2DTJA 4DV3F 1VQNS 4DX8H 3PFEA 2FLOA 4RBTA 2M88A 4MIAA 4OFZA 1FVQA 5AJ3J 1KQFB 3EGVA 2WONB 4X62F 1NPRA 1LWCA 1RTZA 4ED2A 1RK8A 4KT0C 6FD1A 4M5JA 2BOPA 3RBEA 1KLMB 5C2CA 2KDOA 3IP0A 1XK8A 3WX8A 1XMQF 4ZPAA 2RDJA 2GQQA 2P6SA 2E5LJ 4Y2IA 4YMEA 1HL6A 4MIWA 2QLWA 4ID5A 2OSRA 4GVBB 2X51A 1JLBB 2PSZA 4A8XA 3GCWP 4EO6A 3MPWA 2ERRA 3UDEA 3KMSA 2WVCA 3IAS9 4ZMMA 3BO4A 2VV5A 2KH9A 2ZD1A 1DQ9A 2DR8A 1FKPB 4OYXA 3I0RA 4CYUA 4DQQA 2ZC3A 1QUPA 3DMJA 1L3UA 3QO9A 2LDIA 2HVIA 4EMDA 2I5JB 2JLGA 5JMNA 3CEDA 4IDKB 2G2OA 3U7JA 5CD4H 1B0VA 2KHDA 5K8MA 1NJIT 4EEYA 4U7UD 1D8ZA 2WW8A 2A10A 5L1IA 4EO8A 1S10A 1Y11A 2XYGB 1TK0A 4YHHF 4ZP7A 2GIRA 2QMUB 3NGKA 1U1LA 3R6LB 1VK3A 1FRHA 1YBAA 3CUNA 4QWCA 2XI2A 3KHGA 1N5VA 1B99A 4ZIWA 1NK9A 1A0OB 1S1TB 4JI2J 3MM6A 1TUWA 4IH6A 1FRIA 2B56A 3JSBA 1Q1KA 5LOQA 2QL5B 5DDPC 1FRKA 1B3TA 4DCPB 5DQIA 2RRBA 3D0IE 2RH3A 3RAQA 3M6VA 2VF3A 3W8PA 4PG8A 4WU3A 1UFKA 1ZPWX 4WKRA 3H8YA 3TZZA 3B4MA 4F3OA 4ICLB 2QLXA 1P6TA 2G2ZA 1IKYB 3QFHA 4ANCA 1Q7YT 3N79A 3MM5B 4DEZA 1E6VA 4RW7B 3X1LB 3SSSA 2ZZTA 3W65A 2AYEA 2F4VJ 1OY8A 2HHWA 3ZXWA 3HFVA 2B7BB 2B5JA 4FYVB 4KTQA 3T9NA 2IM0A 2HGNA 4I2PB 2M7SA 1T9UA 1RU2A 1EX8A 3H7HB 2FJVA 1A7GE 5DZ7A 2GS8A 5DM7Q 2W8LA 2DNRA 1TKXB 1N5YB 2OPPA 2CQ0A 3PEJA 4NEYA 2J9DE 3MEKA 4N56A 3MAAA 3PACA 4MK8A 1EARA 4XDCA 1LW2B 2ZFHA 2M52A 3HK2A 1G2EA 1WI6A 4NI2B 3PHEA 4K4TA 4HKQA 4RNNA 3ILLA 3RBXA 4OYMA 2XTJP 3AT1B 2MHEA 4DV6F 3L7OA 4V19X 2UUAF 4FNHA 4QR1A 1N33F 3A13A 2XI3A 3ISZA 2VFVA 1IKWB 2M70A 1NNDA 1R7IA 5F8MA 4ES3A 5IWAF 4KIAA 4PQUA 3QSYB 3UE2A 2CDQA 3KG0A 4AQYJ 1Y3KA 4R8UA 3ONQA 3GFYA 4GKJJ 3MTKA 5L9NA 5DM6Q 1S76D 2W2QP 3T5JA 1X4EA 2V4JA 4UOHA 3DLHA 1QM9A 3FNNA 2EWHA 4RX6A 4U96A 4L73A 3ISNC 1D3WA 1Q5VA 4HLBA 5H1SV 5KT7A 3HULA 4DR1J 2F8MA 3D6HB 2VFTA 4B9UA 2Z2ZA 3EYZA 4NCGA 4L75A 3W5XA 2EEYA 2VBZA 2N3OA 1N6QA 3ENAA 1TR0A 3QMQA 2GMHA 5GAEI 5HLFA 1RDRA 2FYXA 2GNKA 3KMQA 4RNHA 2AZ1A 2YNGB 4OYIA 1WD6A 4JI7J 3H98A 2K1RA 2FVSA 3OT9A 3V2UC 3QRRA 4FYDA 3P8BB 1RAEB 1NHVA 1TKZA 4P7VA 5KFSA 3EWGA 3T9ZA 2DH8A 1REGX 2MZTA 1URNA 4CTAB 4L74A 3G8SA 1TAQA 3CXCR 1FJ7A 4Y00A 3R5GA 2J8SA 1UWBB 1WTBA 3BGRA 1I94F 3OR1A 2GAHC 1VQLS 3KLGA 2DGOA 4IR1A 4ZCLA 4O3QA 4DV2J 1M5PC 2FGOA 2ADBA 1M1HA 1SH0A 4OJGA 1F5AA 4FP9A 2OI2A 5IV4A 4L3KA 1JLCB 2V67A 2UVRA 4F25A 3LGHA 2DGTA 2JVOA 4NOHA 2CQDA 4A8FA 4QWDA 2MJUA 3KLEB 2C28A 4LF4J 2CQ3A 3C16A 1VRTA 3PXGa 4USHA 4OI4A 2KG1A 2BKNA 3O8WA 5D4PA 3VAMA 4JYAF 3RR8A 1OMSA 2A6OA 3GJSB 2L9WA 1ZAVA 5THWA 2C2NA 4RUHA 2AMCB 4C8OA 1V9OA 4LVNP 1D9DA 4DPXA 2W4CA 2J9EA 4OZ3A 1N36F 4N41A 3M8RA 1WKLA 3BSCA 3ZFVA 2R3VA 5CYQA 5KFZA 2CPFA 2YH0A 2RE1A 2UXDJ 4LT6A 4ZLPA 3M9MB 4KR0B 2UVUA 3GTYX 1IBKF 2H51B 4I7FA 3CC7S 1U1OA 1RT5A 1R89A 5E5NA 4OYPA 2YNHB 1X4HA 2DD8S 4YDDB 1T95A 2C2KB 4DPYA 3NNHA 1BWVA 1NSQA 4IRCA 3GIKA 1QE1A 3GB0A 2IA6A 2R7XA 3QLHA 4E2FB 4WP3A 1CJUB 2EK6A 2DR5A 4LFAF 1S79A 2Y0SD 2KB2A 3NNAA 1RSCA 5HK4A 2PEBA 4Y6IA 5CAAA 1RTHA 1AZSB 1P1LA 3P6YC 3DOLB 3H59A 3PTWA 3IMQJ 4IG0A 3CCWA 2ZJRQ 2GMLA 1HBNB 3KUHA 2NXNA 2RNEA 4QR0A 3FEXB 1FT8A 5ITHA 2QEXS 4DL7A 1WOSA 1KHWA 3PVXA 4WWSA 2F8EX 2F8HA 2WONA 3E51A 3C2PA 4USIA 1TL4A 3I56S 1RAJA 2DK2A 2IVFB 4M8LA 4LF6J 5KG1A 2P5VA 3BGLA 3JAMU 3PCOB 2Y3YA 4UUXA 3PV8A 3CD0A 4O3NA 4K4ZA 5CABA 3N6NA 3M8WA 2AYMA 4LBHA 4R5PB 4J9LA 2GVZB 1HI8A 2JZ5A 2CG4A 3NAIA 1RWVB 1KBRA 4PABA 4LSNB 2YNFB 3N6LA 1YX2A 2VUGA 1KFDA 2AU0A 3HVAA 4U6PA 1SH2A 1FKPA 2WOMA 1IVZA 3D9BA 1U7LA 3AJ2A 1NH8A 2MQNA 3FJ2A 2ZOMA 1ZM2A 4AYBD 3M8QB 4C9DA 2EBEA 1U6FA 1NSPA 3PYGA 4IDKA 1T0TV 3C6TB 4CZCA 2UU9F 2Z0GA 1NBEB 4U8VA 5CYMB 2Y1IA 4CT8A 1FFSB 3OVSA 2CQ4A 4G1PA 2KU7A 1S9EB 2WSFC 4FPRA 4ED5A 2XLKA 1X5SA 3DLBA 4YN3B 3QATA 5DLGA 2E1MC 4XK8C 1HQ2A 2K7KA 4LFBF 2LEPA 4HEA9 1SV5B 4DV1F 2DEIA 2HVDA 2RT3A 2MKIA 2DIVA 3SSQA 4OX9J 1IR2A 2HYIB 2E5HA 3DOMA 1V3RA 1FXLA 4FXDA 1NKEA 2H4YB 1IQTA 1FD2A 2E44A 2GJIA 4H4MB 2EI5A 3LP1B 3SBMA 3JAMY 1JLFB 3M8YA 3MM5A 2GJ2A 3D0GE 1XR6A 4UOCA 3CJ2A 2PT0A 2DB1A 1T03B 4JI0F 3CC4S 2VH7A 1D1UA 2A6MA 2POKA 4DPWA 5B0CA 3NEKA 3R5DA 1FFGB 3EZOA 4ILRA 1B4SA 4LF5J 4ELUA 2CYYA 1HNXF 4FS2A 2UUCF 2HHQA 3KNGA 2HFUA 1R8CA 3A3PB 2C2OB 3SQGA 1MMDA 4LSLB 1IKXA 5JXSA 5KFRA 1U2CA 1GFWB 4ZPBA 1TKXA 1N5YA 4RW4B 2LQ9A 3M6WA 3NKYA 2V63A 3ADAC 2E1PA 3S6EA 3PKMA 4NYPA 2RIJA 1TL7B 4NI2A 4URGA 2FHMA 1RXOB 2YKQA 1VQPS 3PJWA 4PUOA 3HD1A 3EDQB 2QN6B 5B0FA 3KLHB 2BE7D 3MMAB 1WKKA 2Q43A 4DPTA 1ULRA 5KFIA 3VAGA 1T9WA 3HHLC 3M05A 5A76A 2QFJA 5IXUA 4JV1A 4B08A 5A8RB 1R8AA 4CO0A 3DDIA 4CM0A 2EVZA 3T1HJ 2ZKTA 2KG0A 3JS9A 5GAHI 3S7RA 1NCLA 3WIUA 2MLYA 3QIPA 5T7LA 3HMJG 2BQ3A 1VMBA 1OS5A 1PGZA 4ANEA 5KOWA 5D6GA 1D0EA 3ITHA 4ZVTB 3V6KA 4IFVB 3BJYA 1RAAB 2BBEA 2EFOA 3KJVB 6AT1B 4DCOB 4IQXA 1HFEL 2YXLA 1UJ4A 2LEAA 2L08A 3GYXB 1UWAA 5BYSA 4ECUA 4WK3A 3Q8PB 1WTFA 1ZH5A 3KG4A 3QT8A 3NWRA 5GADU 3H90A 1M0SA 1HNIB 4S0MA 3NCQA 2ACYA 4NLTA 1WF1A 3OTCA 2E29A 2JJ4D 2LKZA 2O67A 1JK9B 4YR2A 4M5HA 5DQGA 1FCAA 4CTAA 3PYDA 3DC2A 1HQEB 1NDPA 4LVOP 3IXQA 1UWBA 4FYXB 2BABA 3W2WB 3B82A 2GX8A 2WHOA 2HWTA 4O3PA 3I6PA 1HNVB 1V5IB 3KLIA 2CVIA 1NJZA 4C98A 4DXLA 3AFGA 4C6AA 3DKDA 3IN5A 2GV1A 1KNZA 2KXNB 1VQYA 4LF9F 2I38A 4A8WA 2GAGC 1DFDA 5KAKA 2W01A 2RRNA 1B0PA 2QRRA 1IBMJ 1VK8A 2B9WA 1PYOB 1F1BB 3C46A 3QJPA 1S1VA 3ZTSA 1SKRA 4YR3A 2MZSA 4D3HA 4FBUA 2F40A 3MFHA 2BJ3A 1VLOA 1HD0A 3ZZYA 1R3NA 3HZGA 3RB3A 1NJWA 1NDLA 4P9SA 3IG1B 2HLUA 4KRWA 4RO0A 2A18A 1YI2S 4FYWB 3D6MB 4HT5A 3J7YU 1JXLA 1RE1B 4RUCA 4G6VB 3T5LA 3CCMS 5KT3A 1BQMB 4UT4A 3MMCA 4JV0A 5HJXA 2GGPB 2ZBIA 3IBCB 5HP1B 1RHQB 3N28A 1TZ0A 1CBKA 1J5OB 2CPZA 3O2IA 3VAFA 4FDFA 1RA7A 2I9SA 3QWPA 1YBTA 4RWWA 3CCLS 2XMTA 2RDIA 3CVKA 1Q79A 2ZBQA 3MM9A 4Q44A 1VHFA 3HFZB 2G0IA 4DX6A 2FJAB 3OSNA 2X1BA 3G86A 1X9WA 2DNLA 1UVJA 3P3DA 3S01A 4FS1A 3LALA 1YBUA 1CJUA 1VOMA 4KGZB 4CH7A 1SB6A 4LIRA 4ECTA 1AW0A 1AZSA 1KKHA 3Q22A 3DOLA 4YB7A 1G7CB 3TW0A 2DXEA 4I6AA 3R7SB 5FIIA 1OYDA 2ILZA 1PSDA 3AQPA 1U1KA 3KXDA 4Q5VA 2ZH2A 1J5EJ 2XS2A 3VGSA 3DRXA 3AH6A 2JC0A 2XSFA 1XEZA 3K5NA 4JI5J 3FVYA 2DKOB 1RT6A 1VDHA 1BGXT 1P27B 2LQBA 1NMEB 2YVSA 3D1OA 2NXCA 4C8MA 2ZNZA 3C8YA 4Q8FA 1FF2A 4AE5A 3QAUA 2EKYA 2GVZA 2RVJA 1KRPA 1WORA 5L1JA 1MLAA 4LSNA 2YWKA 4JI8J 2IRUA 4MYUA 1N56A 1SQFA 2L9NA 5KT6A 2JEGA 3JSMB 4P2SA 5FJ4A 1T9YA 1EZZB 4XTTA 1HYSA 2DNYA 1S6PB 5CZVA 4F36A 1YJWS 1T3NA 3M8QA 1XERA 1SJQA 1N0VC 3RBDA 3C6TA 1MU2B 1VC5A 1WG4A 4AXIA 4ZPDA 2VJVA 1QDUB 4DFMA 5CYMA 3F73A 2J7UA 2NSBA 1UFWA 3SYZA 2BJ7A 1KQSR 4HACB 4DI6A 3U1MA 3ENVA 5AE1A 3LH2S 3BPSP 1CPZA 4MK7A 2VFUA 1CJTA 1WELA 2LDYA 3GWCA 5E3RA 1ITPA 1ZAXA 1F2HA 3KYLA 3QPIA 3GIMA 1VQKS 2QIFA 4C3LA 4WKYA 2RKIB 3TEHB 2CPDA 2MSTA 2YKPA 2CWXA 2IJFA 1RBOB 3NMRA 4ATNA 3A3NB 2UUTA 4B3SJ 3L9ZA 2MKSA 3KK1B 4JI1J 3ENQA 4DQRA 3KJQB 4H4MA 1S1XA 2J5AA 3BKTA 3R5CA 3LP1A 4MYTA 1O5JA 4F2SA 2J7WA 3RR7A 2YWFA 4DR5F 1N48A 4EBEA 2RJZA 4Y2KA 3TVKA 3LP2B 2ZH9A 1QD1A 1QLNA 5ETPA 3PW4A 2RU3A 3ZZUA 2IDEA 3CCVS 4LIWA 2AWZA 3PRBA 3LAKA 3NL0A 4X62J 4K4YA 4D3GA 2FHJD 2Y8YA 3DGVA 2J9CA 1N5TA 4LREA 3MOZA 1U1MA 5EWEA 1XNQF 1IKVB 2VASA 2W4PA 3H25A 3HSJA 4KFBA 2GZOA 4O4GA 4OI2A 3H5SA 4A46A 1XMQJ 1RHRB 6FDRA 1KWMA 2BJ9A 3KHRA 3ZZOA 2V8GA 4RW4A 4TY8B 4LRAA 4DL2A 2BKOA 3R6GB 1X4AA 3GSDA 2HZCA 4YY3F 1K1SA 3IR5B 3QT5A 1QVFR 1QY7A 1VQ8S 3TEGA 1RWMB 2D41A 4DS4A 1XJWB 1RTDA 3J7A1 2X3DA 3T1YF 1QTNB 2FJDB 3IFEA 2OD4A 1BY9A 1HPZB 3OXFA 3TQEA 3NNCA 4TQRA 2ZBRA 1GK8A 2QLFB 2KT5A 3IRXB 1S72S 4HR2A 3V5RA 1B7YB 2ZVIA 4DV5F 3RRGA 3ZNUA 2R4FA 1RT7A 1NB2A 5A8RA 3ILIA 4P2FA 4E0DA 1I1GA 4I6YA 4YHHJ 2CA9A 1S6UA 1OPZA 4MMOA 4O3OA 4K7QA 2VFRA 4NCAA 2JEJA 4NL5A 2BM0A 4AD6A 1CJKB 4KO0B 5HVHA 2J76E 1IM4A 2LU1A 2EW9A 1C1CA 4KYZA 3LTOA 3I5CA 2LECA 4IFVA 3FQKA 2A0FB 1VJWA 1LW0A 1ZOTA 2F63A 3KJVA 2XWYA 2VQEF 3GYNA 3PG9A 2BW2A 4KE5A 3EGNA 3CB4A 3VVUA 3QQCD 4ECZA 4FXWA 4DF8A 5KFTA 4C11B 1U2RA 2AGOA 2JVRA 2GIFA 5BYRA 2XMVA 3WQPA 2XS5A 3Q83A 1WNEA 4ECRA 1UA0A 3M9OB 4M95A 4O4RA 3I4HX 2KO1A 3CDWA 5HAOA 4EBDA 5DDOC 2CAJA 2W2NP 1HHQA 1HNIA 2CJKA 3NLCA 4DCJB 4P71A 2V34A 3R5JB 4QBUA 1RYSA 3LUYA 2HFSA 3BV8A 4JI6F 2PA8D 3RZAA 5ETVA 1DQ8A 3MUVP 4C3MA 2CJQA 1APSA 4ZVPB 4I56A 1DTQB 1S77D 2MKKA 4LR8A 2ZH5A 4ED1A 5HQLA 3V4MA 1U1NA 2R2RA 1UA1A 1YJ9S 3RAXA 1HNVA 1KHVA 5L1KA 1JJHA 4UUWA 4C0HA 3G71S 2KJVA 4PCQA 4I69A 2HHTA 4CP5A 8ATCB 3POTB 3KWMA 3UNGC 4GO7X 4DOZA 4QYRA 5LXYA 2R8JA 3NGDA 3DU6A 2IIHA 4CLZA 4NPOA 1PO6A 1RABB 4B17A 1RU1A 1RT4A 4GO5X 3B78A 4M63A 1HI0P 4DV6J 2FTRA 5E3CA 1SVDA 4OLOA 2FGCA 3M30B 2HQFA 2UUAJ 2JHEA 4K4VA 3IAM9 4W98A 4QQBA 2FPHX 1N33J 4DZ6A 3SFGA 4RNFA 2KFZA 3IG1A 3U1LA 4ENOA 2GO8A 2VA3A 3BB5A 4CNZA 2J6UA 5E3AA 1VIOA 7FDRA 1IBLJ 1OSCA 4DHVA 2ZH8A 5IWAJ 3Q8YA 4QIVA 4ZPWR 3G6VA 3SZ2A 5HP1A 2WCXA 2C2EA 1U45A 1CLFA 3BBCA 1HBUB 5D0HA 4HTJA 4WBFA 4WFZA 2EG2A 2E66A 1RWOB 1TELA 3MPUB 3SCKE 2DNKA 2WB4A 4MKBA 3FKBA 1XIQA 2D3ZA 2PEHA 3ISND 2QMXA 1WEYA 1V3ZA 1ZM4A 3F41A 5J2NA 2GVDA 4NMXA 4J9KA 4OHVA 1KVKA 1NB7A 2IM3A 2OPRA 3TJAA 2Y0BB 3WC0A 2HVHA 3ZTOA 1AUDA 2QA4S 2Z2LA 3Q2TC 3C14B 4W90B 5HVFA 2P8IA 2E9TA 4QW8A 4B02A 2XHCA 2D74B 4GC7A 3CCTA 2C22A 2QV6A 3F0NA 2F3JA 3ILJA 3IWXA 2QO3A 2M8DB 3DRSB 5KFWA 1I94J 2C1EB 2QFIA 1ZBTA 5HANA 4C8YA 1SJRA 3PX4A 1W2IA 3ZTQA 3DLGB 3MR7A 3TNVA 2AJ4A 1J2VA 2ROGA 5A8KA 1UEKA 4RNMA 4R25A 3MPVA 1L3VA 3K8VA 1IUJA 2V4QA 2RRAA 1JLGB 1TFYA 2OUGA 1WUUA 3TX0A 1O51A 4ZHRB 2ZH3A 5F0UA 1RCXB 1LV5A 3TZYA 1PJ7A 1CJVA 3DDNA 2LP4A 4B9TA 5E0OA 1K1QA 1C0TB 4JYAJ 1KOHA 3OUYB 2NXJA 5DJBA 4NLRA 2C2ZB 1VHIA 1YVFA 4J9NA 4X66J 3GJQB 2BKPA 1N36J 5EX0A 4CO5A 3D4JA 2QA2A 1CS4B 2E7WA 4HACA 2DBBA 1XBWA 4CM2A 2IHR1 1IBKJ 5KG3A 4M5NA 4X4VA 3HHDA 4QIEA 3PHTA 4X4UA 2XZWA 1U4BA 4WCEQ 3DU5A 3ENWA 3DHWC 3OTDA 3QAEA 2RUSA 4PG7A 3MEEB 5C24B 1RQ0A 2IDLA 1T7PA 1W7WA 2LYVA 1FWKA 3QGGA 2ALZA 3KK1A 4A8MP 1WHXA 4ZPVR 3HKWA 4R0EA 2ZHAA 4DV4J 2VC1A 2FHOB 4BS2A 2HLTA 3HI9A 2HRUA 3CULA 2W2PP 3TJ8A 1S6QA 3DGPB 3LF0A 3LP2A 3UDVA 4DG1B 4GRSA 2F5GA 1WI8A 1BC6A 2Z58B 4QYZJ 4O3RA 2BE9B 2WW4A 3W3SA 1LK7A 4OYBA 3CO0P 3O5TB 5G0RA 1IN0A 4HVZA 2V8PA 2HHHF 5BR8F 1IKVA 1NKCA 1F3VA 2BANA 1D09B 2PA3A 3CCES 4HHHA 4O3SA 3DLLQ 4QIFA 2W25A 4JOUA 1FXDA 4IO1A 5DETA 1UP1A 4NLOA 2R8IA 5HBMB 4TY8A 1CQNA 1P9YA 2VG7B 2XZDB 1BQNB 4RPFA 1UW9A 4TXSA 3HCXA 1UL3A 4LMZA 3P96A 2XSJB 2HPUA 4MKVA 2IMOA 4N7TA 4ZOSA 2W2MP 3RBZA 1Q4RA 1PG5B 2JLEA 5LSRA 1RT1B 4I67A 2NSCA 1KP6A 1RACB 3DRPA 4OHXA 3HVTB 4ILMA 3J80Y 3CE8A 2KFNA 2UUBF 2DRBA 3HX9A 3OTOF 1S7HA 2MMYA 5A2QU 2UU9J 3BSOA 4K4XA 3PX0A 1WEXA 2IFXA 3R1LA 1X0PA 4ZVSB 5KFAA 1LWCB 2N4CA 1KTQA 2QJ3A 5K14B 3RRKA 1CJKA 3MCOA 1Y00A 1NH7A 3W1YC 3OVBA 4NMLA 3CCZA 2O3DA 4LFBJ 4TVAB 2V2ZA 4ID5B 2V6AA 1O6XA 4OX7A 3PW7A 1HNZF 4DV1J 4DLEA 2B8PA 4J9QA 1S49A 1FRXA 2E1AA 4ZLJA 4M5DB 3I55S 2CZVC 5H9FJ 2EFNA 1S0VA 4CYUB 4IR9A 3IGVA 1T9VA 2RUGA 1TKTB 1Q53A 1XN9A 3QO9B 4ECXA 1KTVA 2VPXB 4TYBA 1GMVA 1SL2A 2YX4A 4P6QA 3J7Z5 3W64A 4OZJA 4CO3A 4QU7A 2YQ3A 2L48A 2V5HG 3I96A 4X4NA 3M32A 4JI0J 2Z2MA 2DRAA 2KT2A 5HATA 1Q8KA 2Q1LA 4QPTA 1DTQA 2DNNA 4F4XA 1FESA 4CT9A 4KGMA 3THTA 3VAHA 1HNXJ 3CDUA 1VC6A 2UUCJ 2HWHA 1BLUA 3RU0A 4DFKA 2V8VA 1C1BB 3TUJC 4P52A 2CNKB 2QL9B 3G6YA 1PJ6A 1FK9A 4KC5A 2MKYA 3POTA 1ZYQA 2BOAA 2BRKA 2DGUA 4WYWA 1S0MA 2J6TA 4EK2A 1KFSA 2XMJA 3DLEB 1RAGB 4NXMJ 4OJHA 1JLAB 4CH0S 3MF5A 3UCUP 2V0NA 3UN2A 2KRBA 4RW8B 3H40A 2Q6CA 3FSXA 3DNCA 3U1NA 4EBCA 4NE9C 4M94A 4ECWA 2HAIA 5KG5A 5D0RA 3M30A 3Q8UA 2HSEB 4I1TA 4WFNQ 2VZ9A 3OLBA 2FJXA 2AF6A 3QT7A 3CGIA 3HDSA 2ZZNA 2N7CA 1NRKA 1S12A 1H7WA 1IR0A 2B5JB 3GILA 4HT7A 2BX6A 2AJ0A 4UZBA 5SZTA 3HHLD 2BJEA 2BRLA 3OVAA 2LA4A 2D9OA 5LL6d 1HBUA 4X4OA 3RW7A 2CDRB 2DR9A 4FKXA 2D9PA 3NGRA 5KFBA 2J0SD 5KFKA 4RW9A 4LRBA 1AFJA 3MAAB 4CLLA 3OFFA 5LMNJ 2DEJA 4ED0A 4WPAA 2HFZA 2P6TA 3TOQA 2XNQA 1FRLA 1KLNA 5I3QA 3D67A 4P2XA 2E7XA 3MCMA 2IM2A 3BQ1A 2RMLA 2VG6A 4P74A 5IC6B 3VWSA 2PMHA 1FKAF 1HMVA 1RADB 2HZAA 3B4DA 3W2VA 4DWIA 4WYLA 3P4UB 3EGWB 4FKYA 1FO1A 1NZAA 3AXKA 3G8TA 4LQ9A 4DSLA 3AOCA 4OZLA 4JV5F 4PQUB 4DUZJ 3N01A 2YKAA 4OV1A 1OSDA 2N4DA 1Q81T 4QW9A 1JJ4A 1S9FA 3IR7B 5HROB 3DRSA 2MQPA 3U27A 3BGUA 3DCAA 2W9CA 1Q78A 2V4JB 3RW6A 4FPIA 3AY0A 4PRFA 1GMWD 4PAAA 4V1Ak 3BEGB 1K8AT 3WDOA 3RJMB 5LSOA 2EG1A 2A1BA 5DZ6A 3EXCX 4OZ5A 3SQOP 1WC1A 4LF9J 5HLFB 1JLGA 2FZKB 1S7IA 2CJAA 4ZHRA 1Y9OA 4O44B 2DGVA 3DRRA 3D1QA 5M2RA 1IM6A 1NUEA 2ZM6J 1UFLA 2JDJA 4NRTA 1C0TA 1D9AA 1R6YA 3QJJA 2FJWA 3OUYA 1JQGA 2VDHA 2V9KA 2RQCA 3VZIA 3M2VB 2ZBPA 1FX2A 3BQ0A 1S9GA 1N54B 4QOTA 1WKJA 1NLKL 1OQ3A 4K50A 1TK8A 2DGQA 3BGRB 2VJUA 1RAFB 2CG8A 4PG4A 1NK0A 5GVQA 3QWUA 3P5TL 1CS4A 5T41A 3K5PA 1YQHA 4NLXA 5KFNA 2NCKL 4J9MA 1VRQC 4DR3F 4MAKA 3THVA 3BBBA 4XDDA 2HGMA 3UDCA 3TANA 2QE5A 2XLIA 4DPOA 5F3TA 4WZQA 4WJBA 3ZTRA 1FJEB 5KFDA 2OLWA 2YKMA 2W8KA 1I3OB 1Q8BA 5F8GA 4Z7CA 3W62A 3C16B 2DNQA 2FUG9 2IC3B 3SEOA 3MEEA 1VRTB 4FF2A 3AA9A 5C24A 2R7VA 2VPZB 3LGMA 4WIIA 1X5TA 3UD5A 3BGFA 5IT9Y 1U26A 4ED7A 1CG2A 4A8YA 4ZN1A 3SIPB 2EXUA 1F0XA 1YWXA 3S8SA 1H98A 2VDIA 3NOCA 4X4RA 1VGYA 5HQMA 2X1AA 3CDEA 5CYQB 4ZLLA 2HBZB 5D4OA 1UEUA 4NA2A 3J81Y 4IKAA 2HWIA 4I7FB 2B9EA 5KT2A 3NCPA 2WK4A 2CQGA 1S4FA 5DDRC 1KEKA 4TY9A 3FEYB 1T8EA 2PI5A 3H2LA 1Y3JA 1OQ6A 1YTYA 3GR1A 4DR6F 3H2VE 1GX5A 5DO2A 4P73A 5F0WA 1QE1B 3BR8A 2EFPA 3HVWA 4AL5A 3QLHB 3MWBA 2CQPA 2FIUA 1YG0A 4C4WA 2VG7A 4J9UE 5GMDA 1SQGA 3I5AA 2MKHA 2KJWA 4Q45A 3HM9A 1X4DA 3KTQA 1RT1A 1UJ6A 4DR7F 2OEKA 1H7XA 4F7VA 3JYTB 4M5IA 2DYAA 3G9CA 4AT1B 1VQMS 4WU2A 2CPEA 2D3UA 4X64F 4DSKA 1TQLA 4K4SA 4GC6A 2EFGA 2W9BA 2AIRB 4C8LA 2VBYA 3V6DA 4M1KA 3PR4A 2UV8G 4ECSA 5K14A 3BREA 4ZK7M 3PIOQ 3QZ7A 2DR7A 3VQTA 3C66A 2W1BA 3HF5A 5DDQC 1QAIA 4TLRA 1UAWA 1MWYA 3EPIA 2HURA 3DXBA 4BC7A 5EWFA 4LF8F 1FNMA 2K8GA 3NS7B 3G87A 4M5DA 1U25A 3IA0A 2WOMB 1TKTA 3UR3C 4WXWA 1OY9A 2DNZA 3I0SA 2IRXA 1XWLA 2ZUAA 2RQKA 4DLGA 4HH0A 4Q43A 4USUA 1RWNB 4DV2F 2N82B 4Z37A 4U9RA 1KR4A 5GAEU 1VBZA 1YJUA 3CJQA 4YS2A 4F02A 1UZHA 2W2OP 3A4TA 4X4SA 5A0YA 4ZVHA 4X84A 3HJVA 2B6AA 1EB0A 2WVEA 5F41A 2FLPA 2R8HA 1QAXA 1Q82T 1M1GA 1X4BA 2C2MB 4CI0B 2KM8C 2LXFA 2XWXA 1F6TA 1XNQJ 5LJ5Y 1C1BA 3J81j 2BR0A 3AHPA 2VB6A 1U24A 5KFYA 3DOMB 3SCIE 2YX7A 5B0AA 2W7AA 4J90A 2XLJA 3DLEA 2DJWA 2ZVSA 2RU9A 3EVMA 1JLAA 3BF4A 4YY3J 4DFJA 4JI3F 2UUWA 2G4BA 1SC1B 4RW8A 2XG8A 3FUYA 4DL0C 4BCAA 2ZOFA 3KK2B 2XQCA 1BQXA 2RS8A 1L3KA 2X3GA 1OIAA 1S5ZA 3NS6A 5KFCA 3BDEA 2OJ3A 3EPGA 3KDNA 4G65A 5CD4A 1U8WA 4DV5J 1EKRA 3A3OB 1C0UA 2HG4A 3HP6A 4M5MA 3MMBB 1TMMA 4LF1A 3GFZA 5CHCB 3SQGB 3IWNC 4I0WA 4O0NA 1IKXB 2IJRA 1FHTA 3TARA 1RHMB 1HBMB 2PE8A 2V9WA 5J1PA 4NLSA 3W9IA 2XGQA 4B9MA 1WC3A 2NZ4A 2HS4A 1X5PA 1U1PA 2VQEJ 2DHAA 2ASLA 2CPJA 4DL3A 3EZUA 3KK3B 1RTIB 3OL6A 4PWDB 4J9OA 1HI1A 1VRUB 3WHIA 3L09A 3M1VB 1ZM3A 2KYXA 4PUOB 1VQOS 2U1AA 3MCSA 5F8HA 4MIBA 4RU9A 3R2DJ 2VIHA 3WX4A 1SKSA 2OPSA 4JI6J 1KDNA 4O23A 5KG2A 2KFYA 2G2YA 5ETMA 3UW1A 4B9SA 4I68A 2WVBA 3TA2A 3QIPB 5T7LB 2H65B 2WSCC 4MKYA 5HROA 4BHQA 4RBUA 3ITHB 1U0SA 2V4RA 9RUBA 5MLCV 2X1GA 2R7RA 4EZ6A 4KKOB 1OWXA 4FF1A 4A47A 4F0MA 5IOLA 2JNJA 5AXMA 1Y7PA 2CJ9A 4OHZA 4U67Q 3T1AA 2NS1B 2V2KA 5CQGA 3H5YA 2OEMA 4RR5A 1JLEB 2OKQA 2BJ1A 3CMAS 4DR2F 4O44A 2EFQA 4NX9A 4H4OB 5HO4A 3LWMA 4QWEA 1HHTP 3MUMP 4R0JA 2MXYA 1NHKL 1VYAA 4F4YA 4P10A 5J1NA 2FY8A 3M6UA 4AUKA 3M2VA 5J1EB 5HJYA 2PO4A 1LFPA 1SH3A 1KS2A 2NZCA 3NP5A 2YWEA 2WRMA 3UN3A 1FEHA 3AA8A 3RYLA 1E6YA 2LXIA 1HNWF 3GIJA 3KLIB 4CH1A 5KFLA 1F9FA 3P5BP 3IM9A 3MPYA 2M2BA 1WC4A 2HS0A 2LEBA 1WDDA 3GJTB 1PYTA 3UCZP 4Q8EA 5FDLB 2I8EA 2RSQA 2CQCA 3D6TB 3MAQA 4CO4A 4CQ1A 2NYIA 3D54A 4G3IA 5HN0A 2IC3A 4KHRA 4NWBA 3QYYA 4P7TA 5RUBA 3R97A 2R8GA 2GHWA 2MZ1A 1S1VB 1MMLA 4NEZA 1NK6A 1JWWA 1QSYA 2PD1A 5H9EJ 1SL0A 2Q66A 1VISA 1X4CA 1SQEA 4B9VA 3GG1A 1K47A 4Z7YA 1PAEX 1CC8A 5I4MA 2EC0A 3SXLA 4LBPA 3CF5Q 1PYSB 3HHKA 1LQ9A 3UFCX 2RILA 2BQRA 5KFJA 1JB0C 3MM8A 3UI3A 2ZJPQ 2J0WA 4HI2A 3MMCB 2H5EA 4LR9A 3PR5B 1XMOF 3QNWB 4EUVA 2XMWA 5CH7B 5EUHA 2D3O1 1KONA 1TV6B 2B4VA 1UTAA 3W9HA 3PM9A 4X65F 4RL1A 2CJBA 4KY3A 3TA0A 3K5MA 1Q5YA 4B9LA 5IT4A 2CQ1A 1ACMB 2JEIA 1Q7LB 1RZMA 3MM9B 1H73A 5EGYA 4EWTA 3T3FA 2VU5A 1GNKA 3CCSS 3SSRA 3FBFA 2UXCF 1PIEA 2VG5A 1NHUA 3UDLA 4PZVA 4QCLA 3WBZA 3PX6A 1N32F 5DRKA 4C3KA 1AYEA 4TNOA 1DJ0A 1FWPA 3E8OA 1LWXA 2BEFA 1HBOA 3JYTA 1Z4UA 2VD3A 2CPYA 2GQCA 3ZNJ1 1S6OA 1JX4A 1FE0A 2CQBA 4RU2A 2IY5B 1RT6B 3MM7A 5FD1A 3HO1A 1TUGB 3NBPA 3TR5A 1YZ7A 3EJMA 3TQ1A 4HH1A 1UMJA 1RWWB 4C7QA 1B70B 2MQOA 3DI6A 5GAHU 1JKHA 2J8AA 2NUUG 1VQ4S 5HQ8A 1M1KT 3QSIA 2LU2A 5ETRA 1GMUA 1NEEA 3MUTP 5ETLA 1HYSB 3R7BB 4OYAA 3GE9A 2MLZA 2B4UA 4DV0F 4H4KA 2LVWA 4XPCA 3M2UB 2VPYB 3OQ2A 2A3JA 2KI2A 5KFEA 3JTPA 4LF7F 3Q24A 2M9KA 2JFKA 3AD7C 2Y1JA 2CPHA 4M5LA 5ETSA 5HL7Q 2XGPA 2F1FA 5KG4A 3EMTA 4BWJA 4PXDA 3F56A 1HW9A 3K7RA 4TLQA 1N5SA 4URSA 4DS5A 3FFIA 1CJTB 4ED8A 1RCOB 4PWWA 4A48A 3JQMA 2EPIA 2R7TA 2HHHJ 2B0GA 3S1TA 2HQDA 5BR8J 4WFBQ 1S99A 1B0TA 2B9YA 5C25B 4UOGA 2RHQB 5M2PA 1K73T 4IG3B 2KVQE 4ZVGA 1OJ4A 1WG1A 1RUSA 3X3UA 3G4SS 2RDDA 4F26A 4LRDA 1S1XB 1X31C 4JUZA 4J5OA 2CZ9A 3KK2A 4HL9A 1WHWA 2YNIA 1F2GA 4LRFA 4Z2XA 1SC4B 5E7OB 2HHXA 2UUBJ 3TJ9A 3OTBA 3OTOJ 3SFUA 2OIHA 1WG5A 2DY9A 4ZITA 5LMUF 5EHHA 3GCXP 3W7BA 3A8IA 2DCLA 4ECVA 1WOPA 3T5HA 3LPEA 3GJRB 4NZ6A 1N0UA 3MMBA 1TKDA 2BW7A 4L76A 1AB8A 4KFBB 5HI7A 4O4GB 2CVEA 2OP5A 4IRKA 3MZIA 1L3TA 2W4DA 1SIWB 2OAUA 1HBMA 2RQMA 4MK9A 1ZTTA 3FBCA 3C6UB 2HBQB 5DGBA 4HYKA 3JQKA 1DLOA 4UOFA 3MR6A 1HNZJ 3R8YA 3K2YA 3KK3A 1RTIA 4ANDA 3MMJA 2BJ8A 3A12A 4WFYA 2WSEC 4PWDA 2BMBA 3VQSA 1ICEB 1RTDB 1VRUA 3N5BA 3L4BC 4OYOA 3M1VA 3VV2B 4V19J 2QG9B 5KG0A 3D7SB 3SDEB 4ZVOB 4C48A 3O44A 3AD8C 1TAUA 4ETZA 4KB7A 3DYAA 4DX7A 2HHPA 1DTTA 4WP8A 4MFBA 4NXNF 1Q8IA 1FKOA 5J2PB 2AT1B 1RT7B 3PYFA 3OLAA 3RTVA 2YPZA 3PKYA 3VGUA 1OY6A 1PCAA 2CQHA 2DPJA 3TX8A 3Q0AA 4OL8A 1EETB 1U02A 1H2TZ 4H54A 1YJTA 2AD9A 1G3OA 4NLVA 4YOEA 3FK4A 5I42A 1C1CB 3LOUA 4ZP8A 3TUIC 4OMFG 1LW0B 4KKOA 3BSNA 2H48B 4KPCA 3H4BA 3CW2C 2DY1A 2ZBCA 1ZTWA 2HRTA 4C2MA 4PXEA 1NAQA 5K20B 3R3TA 1FRMA 3OSPA 5IZHA 4F67A 2FHJA 4F50A 2V50A 2I0XA 1JLEA 2CADA 2Q3PA 1R0AA 5IT0A 4H4OA 3D28A 4OI6A 3MD3A 1BUXA 1HQUB 1FD8A 2F7VA 1RT3B 3UR0A 3IM8A 4DSJA 1XC9A 2XC9A 4UQTA 1X9MA 5KFXA 3H20A 1DRZA 3GFXA 2KZZA 4PXBA 4EGLA 1TU0B 1YRUA 5KFPA 2OPQA 2H4WB 5IM0A 5J1EA 2VC0A 1BE4A 3DFEA 3PO5A 1R8BA 1HR0F 3K57A 5FLXU 3N9UC 2OFGX 4TYAA 4PG5A 1W26A 2AX1A 3GFHA 1F5CA 3TYTA 1CEZA 4DUYF 2BA9A 2SXLA 1REVB 2RF2A 2D1CA 4X4QA 3M8PB 2H54B 2CNOB 3AB4B 4NCBA 1U8SA 2Z8QA 2YQ1A 5LSLA 3RB6A 1Z2LA 2HEKA 4U7CA 1S1WA 2AJ2A 5FDLA 4ELTA 1GTHA 4MKAA 4RKUC 4QWBA 2MHNA 1M5SA 4EYHB 1RT4B 3D2WA 2JC1A 2HMIA 2VOOA 3RRHA 1LOUA 3EUNA 1W25A 5L38A 4RUAA 1RKJA 2G0JA 3Q8SB 4YP3A 5CCLA 2PFDA 2IVYA 3T6BA 2M3DA 3FZ2A 1M5VC 1TL1A 1U2FA 1R27B 4LR7A 1PILA 3GR0A 3RGIA 3IGNA 1WSVA 4JV5J 1VQ6S 3AAWB 4Y2AA 5GMEA 3SCJE 1JNZB 1RKIA 1TV6A 1VLYA 3HJFA 3M2RB 4B3MF 4UZCA 1IWAA 4DL5A 3PJ9A 1MW7A 3KOAA 2XHWA 5DG7A 3K17A 2JSXA 1DHMA 2K7JA 4DMZA 3MDFA 3U02A 1WACA 3D3BJ 3OXLA 2HBYB 3RUBL 1KOOA 3GYGA 1Z1ZA 3QGIA 5J2NB 2GVDB 2HNZB 4IRDA 3P45B 5FLXY 2JOQA 4CNYA 2OPRB 2AKWB 2DR6A 3EVOA 3IR6B 1WHVA 1P9QC 1ZPVA 1W2BR 1LWFB 3KFWX 2B8QA 3TO8A 2QSFA 1Q95G 4YEAA 3HD2A 2B4OA 1VS3A 4KH1B 1N34F 1FEEA 2NYHA 1TK5A 2XS7A 2AW0A 4ILLA 3C3LA 1SL1A 4DR4J 1KVIA 3VAKA 2BACA 4WK1A 1CSJA 2LCWA 4OHYA 4B3RF 3KG1A 2WTFA 2OEJA 4W4MA 4USVA 4DR3J 2BE2B 3D0HE 4ZIVA 5A8KB 1U6BA 1NK4A 2OELA 4ID8A 4DUTA 2BV3A 4OLPA 2MQLA 3GU0A 4N8NA 2XMAA 2CNNB 1K44A 2LFVA 5HVGA 3HHLB 3NRBA 1H3DA 2I1RA 4PYDA 3M4XA 4ZJLA 1CJVB 1O8BA 1ZS6A 4XAKA 2IYIA 5KFOA 4EYIB 5J2QA 3VR1A 3V4IA 2DO4A 2E9RX 5ETOA 5EX3A 2FZGB 5KOXA 1L3SA 3RAMA 3M2UA 3EGZA 5DGAA 3H42A 2VQFF 4RW6A 2FQQB 5E33A 3NY0A 4EU0A 4N77A 1R8PA 1NK5A 2IPOB 1Q0NA 1VIXA 5L9XA 4J9RA 3G6XA 3HVRA 3B54A 4NLGA 2MQQA 2Z4PA 4J9PA 4K0KF 4I64A 3FSYA 2MQMA 1U6ZA 1HARA 3CJKB 2C42A 7FD1A 5L39A 2F65A 3UWTA 2HKEA 4JI4J 5C25A 4DR6J 2NLWA 2C3MA 3VAJA 3OHAA 2PMZD 2PI4A 2A2CA 3G96A 4IG3A 4HDGA 1B7FA 3QZ8A 1QSSA 5HSPA 3M6XA 2O5DA 4PR6A 2ZE2B 1XR7A 1IBLF 1NDCA 3L7PA 4KGXB 4PQAA 2MZRA 3HZEA 3EM1A 1RGVA 4Q0BA 1RLDA 2PIIA 5KFFA 1SCJB 2FC8A 4DR7J 5KT5A 2HHUA 1S6QB 3MR2A 2J6SA 3PY8A 4X64J 2AJFE 3CIZA 4DV3J 2FVQA 1VJQA 4CLTA 4NZ7A 1GX6A 3PDNA 3HPOA 3K59A 2XY6A 4C8KA 2AJ1A 5G0RB 2DHHA 4FF4A 2DH9A 1HWIA 1U0HB 1HA1A 2MY7A 1FE4A 1FX4A 4B3TF 2BANB 4USJC 3GP9A 5GMKa 2YKNB 1RAOA 1NDKA 2O1PA 3JSRA 3CT9A 4WFXA 1JXVA 3LAMA 3D3CJ 3OPKA 1GT8A 1EQMA 4K5RA 1S1UB 4DPUA 4AXJA 3C6UA 4LF8J 1FI4A 3HT0A 1FDBA 1X8DA 2L9DA 4JB8B 4RBVA 3K8WA 4RWXA 1NJYA 2U2FA 5F3ZA 2E5JA 3ZTPA 1EQ0A 4N8OA 1MNEA 2E7VA 2K3KA 3GV8B 3DRPB 1KC8T 3SDEA 1X4FA 1YK9A 4NLDA 2ATLA 4USMA 1FTRA 1I6JA 2AEFA 5J2PA 2WVDA 2RB7A 4ED4A 1RB0A 4ZCIA 3TUZC 4AL7A 4ZP9A 4GKKF 4IFYB 1Y4ZB 4UY85 3FRYA 4QYZK 1EETA 2C3YA 2PN6A 1SIZA 4ED6A 2ZNYA 1N52B 1VFJA 1FJGF 4DJBA 2MTLA 2IJNA 4NLQA 3FRZA 2W24A 3DRYA 1NO8A 4I6WA 2N7YA 3A8KA 2XNRA 4F0HA 1J27A 4X66F 3LWLA 3BR9A 5KFHA 1QVGR 1HWJA 3L3CA 1SI9A 1NKBA 1JJ2R 2CZ4A 4TU8A 3ZO7A 4JI3J 2KN4A 2FVPA 3LP0A 1HWUA 1CULB 1HQUA 3BBFA 3CJSA 4CWBA 1RT3A 2L41A 1X4GA 3J7AN 1KVJA 2MDAA 3M32B 4JV2A 4BLGA 1RHUB 1SKUB 2VA2A 2JWNA 2JFDA 2ZDPA 4TKTA 4C0BA 4BC9A 3KNAA 1RT2A 3IBWA 1T11A 2OHDA 3DXSX 1YITS 3HHEA 3CCQS 3OJSA 1REVA 3NCRA 2PFFB 3M8PA 4DV4F 1FK9B 1P8GA 1RWXB 3IRWP 2V2VA 2PC6A 1YJVA 5B08A 2BM1A 3TAQA 2QC3A 3MR5A 3GPAA 5H9FK 1U47A 4Y0FA 3FMWA 2JL9A 1EAYC 3A1YG 2VBXA 1EJ7L 2MZJA 5A6WA 4ED3A 1NZ8A 5D78A 3J7ZT 1Q86T 1KLMA 2X1FA 4OZ2A 3R27A 4ZVRB 3I5BA 4K4WA 3IS9B 2C3PA 1VCTA 4NZ0A 1YZ6A 3LGNA 5B7WA 1TMJA 4GVBA 3UD3P 3B8HA 1JLBA 2R9LA 1RAIB 1GXLA 4IOBA 3JTNA 3ULHA 4ITSA 2KYZA 3M2RA 2R2UA 1C2PA 3ET6B 4RW9B 5J2MB 2DPIA 4PWUA 2MPUA 2XO6A 2WBMA 2I5JA 3EX7B 2DVIA 4P75A 2ZWPA 1YLXA 5F8IA 3MOJB 4E8UA 3DOKB 1EP4B 3UCGA 2HNZA 4DR2J 4OZ1A 2VG6B 4Y65A 1SKWA 1AFIA 1XTZA 2EK1A 1HMVB 3R9LA 3W2VB 3QJLA 1LWFA 2LXUA 3FDSA 1RISA 4WZMA 2AV5A 1GXUA 1FA0A 2MB0B 3MEDB 1S1TA 1D8YA
chains in the Genus database with same CATH topology
5JVHQ 1IBMF 1HYSA 5BYQA 2DNYA 1OIAA 2RS2A 1TL3A 2HIQA 1IJFB 1S6PB 5CZVA 1URRA 3NS6A 1YJWS 5KFCA 1T3NA 1TL5A 3BDEA 2OJ3A 3EPGA 1YJNS 2VKZG 5HMXA 3M8QA 4J9SA 2R7UA 1XERA 2HHSA 1RA6A 1SJQA 2B51A 3JB9k 2M4MA 3OL8A 1N0VC 1YGYA 3RBDA 2W9CB 2XB2D 3C6TA 5KFQA 1WWHA 1MU2B 2ROEA 1VC5A 4LQ3A 1WG4A 4AXIA 5DG9A 4ZPDA 1C0UA 1IJEB 2HG4A 3HP6A 3KHLA 3MMBB 4DFMA 2CIMA 3I31A 3GFZA 5CHCB 3SQGB 1H6KX 5CYMA 3F73A 2J7UA 4ICLA 2BE2A 2O01C 4QIGA 2NSBA 1H38A 3IWNC 4I0WA 1UFWA 1UVMA 1IKXB 1IKYA 1KD1T 3SYZA 3LO3A 1ZZNA 2ABYA 1FHTA 1KQSR 3TARA 3U1MA 3E3XA 3ENVA 1D9FA 1HBMB 2PE8A 2CPIA 5D8HB 5AE1A 3LH2S 2V9WA 5J1PA 3HHLA 4NLSA 4DQIA 1CPZA 2XGQA 4B9MA 2NZ4A 4RW7A 4MK7A 1KQKA 2VFUA 2J0QD 4Q0BB 2P9CA 2HS4A 1X5PA 3DRRB 4R8UB 1U1PA 4H4KC 2DHAA 4C8ZA 2ASLA 1MWZA 2CPJA 4DL3A 1BD6A 3BZQA 3AQOA 3EZUA 1WELA 3KK3B 2LDYA 3GWCA 5E3RA 2R2SA 1RTIB 3BQ2A 1ZAXA 4TN2A 2QA1A 2XY5A 1U1QA 3KYLA 3BN7A 3QPIA 3GIMA 4OIXA 3R5BA 3OL6A 4PWDB 1VQKS 2QIFA 2JRSA 4J9OA 4C3LA 4I2PA 4WKYA 1HI1A 1VRUB 2RKIB 3OR2A 3N5FA 2CPDA 3DLGA 3L09A 2MSTA 3M1VB 3HFKA 2YKPA 2GCFA 1ZM3A 2KYXA 2IJFA 4PUOB 1VQOS 5KG7A 3NMRA 2U1AA 3MCSA 4NCGB 5F8HA 3AB2B 2DT9A 4MIBA 4ATNA 2GMJA 2HRYA 2UUTA 5D77A 1AROP 4RU9A 3R1HA 1S9GB 4LUBA 1N6QB 2E5IA 2UV8A 2MKSA 3KK1B 2NUHA 1TFWA 3RB4A 3ENQA 3WX4A 4DQRA 2HQ3A 4H4MA 1SKSA 1S1XA 2J5AA 2OPSA 3R5CA 4K59A 3OXGA 3LP1A 1QSLA 4O23A 2N3LA 4KV8B 2P9EA 2K1RB 4MYTA 3TAMB 1O5JA 4F2SA 5KG2A 4NXMF 2J7WA 3RR7A 2YWFA 1T3OA 5CCMA 2KFYA 4DR5F 3E01A 1H2VZ 1N48A 1LW2A 4EBEA 2RJZA 2M0GB 2W9AA 5EN1A 4Y2KA 2BUNA 3TVKA 1ZM9A 3LP2B 2ZH9A 3UW1A 2ZC4A 1TKZB 4G1QA 4B9SA 4I68A 1V6HA 3K5LA 2G13A 5ADZA 1QLNA 2VKRA 3TA2A 2ZH6A 3PW4A 3A8EA 3QIPB 5T7LB 2RU3A 3UQSA 3ZZUA 4EZ9A 3CJKA 2WSCC 4MKYA 3TP2A 3CCVS 5HROA 2IBOA 4LIWA 4BHQA 4RBUA 2AWZA 3ITHB 2WAQD 3PRBA 3ETOA 2V4RA 4EFAC 5MLCV 2X1GA 2R7RA 4F4KA 3LAKA 2YKMB 3NL0A 1J5EF 2W7OA 4K4YA 4EZ6A 4D3GA 2IM1A 4ZDNA 2FHJD 2B43A 4KKOB 1DQAA 5KFGA 4ZP6A 3V6HA 2XMKA 4F3MA 1IKWA 2ILYA 1OWXA 2J9CA 2ZHOA 4OJ1A 4FF1A 1N5TA 4JI5F 4DR4F 4A47A 2Q79A 3MOZA 3OR1B 5EWEA 4WFAQ 5D3GB 1U1MA 1XNQF 4ES2A 1IKVB 2VASA 1R8HA 5AXMA 1Y7PA 2W4PA 4KFBA 5HMWA 5KFMA 3KLGB 3H25A 3NMAA 3GQCA 2CJ9A 4O4GA 4OI2A 4OHZA 3H5SA 3DDKA 2BJDA 4A46A 4U67Q 1FNOA 3CD7A 3T1AA 6FDRA 1QUVA 2E5GA 2NS1B 2V2KA 2CQIA 5CQGA 3H5YA 3KHHA 3TI0A 2ZE2A 2DNHA 1WF2A 2AX0A 3MXHP 1JLEB 2OKQA 1S97A 2LA6A 3CJ4A 4ZVFA 3CMAS 3KHRA 3ZZOA 4DR2F 1JMTA 2V8GA 4O44A 4RW4A 4TY8B 2EFQA 4NX9A 4H4OB 3K0JA 4DL2A 4A8OA 5HO4A 2GC8A 1X4AA 3GSDA 2DCUB 4Y2MA 4QWEA 2HZCA 4YY3F 3LWMA 1HHTP 1K1SA 3IR5B 3MUMP 4R0JA 4YB5A 1QVFR 1QY7A 2XCAA 1SC6A 4NLUA 2MXYA 1VQ8S 2XO7A 2FVRA 5K5MA 3D5MA 4JI8F 3BO3A 2MJNA 3CD6S 2NPIA 2DNMA 2IRYA 2D41A 3FMBA 3BO2A 4F4YA 4DS4A 1RTDA 1G6BA 5J1NA 3J7A1 5LMNF 1JLQB 1UETA 3T1YF 3M6UA 4QR2A 4UQGA 2L3MA 2UXBF 4Q7AA 2FJDB 4HDHA 3DLJA 3IFEA 2OD4A 1BY9A 1HPZB 3OXFA 2UVVA 4AUKA 2AGQA 3NNCA 2FB0A 3M2VA 1UVIA 5J1EB 3T6JA 4TQRA 3QIDA 4N76A 2KT5A 3IRXB 1S72S 2PO4A 3HXMA 1VQ5S 4QWAA 3OL7A 1LFPA 3V5RA 3R5AA 1Y5LB 1YJRA 3H4DA 4U7UK 1SH3A 1KS2A 3NP5A 2YWEA 1TVRB 5G4DA 4DV5F 1FTCA 2YNGA 3RRGA 5F8JA 2WRMA 2IBKA 1FEHA 1RT7A 2R4FA 4IQMA 3AA8A 3RYLA 4NA3A 2YKNA 1E6YA 4MJKA 4KGKA 5A8RA 1LK5A 1MROA 2LXIA 1HNWF 4QU6A 4E0DA 3GIJA 4N47A 1I1GA 3KLIB 4I6YA 4CH1A 1S6UA 4HTIA 5KFLA 1F9FA 1OPZA 2BVZA 4MMOA 4O3OA 4ETXA 2VFRA 3DGPA 4NCAA 2JEJA 4NL5A 2BM0A 4KHPF 3MPYA 2M2BA 4DG1A 2VODA 1S1UA 4KO0B 3ZZPA 4NLWA 4FF3A 2J76E 2DITA 3LP0B 1IM4A 2HS0A 2LEBA 2LU1A 2EW9A 1C1CA 3UCZP 3I5CA 2LECA 1RTJB 1UJ5A 4AL6A 4DUZF 3NAHA 4I2QA 4Q8EA 1GH8A 5FDLB 1RT5B 2I8EA 4IFVA 3FQKA 2F9DA 5DQHA 2RSQA 1VJWA 2CQCA 2MY8A 1FXRA 1L5UA 1LW0A 1ZOTA 4WTYA 4OI0A 3KJVA 2XWYA 2OMOA 4PKDB 4C8NA 2VQEF 3MAQA 3VCDA 4CO4A 3VF0B 4CQ1A 2NYIA 3Q8QB 3GYNA 2ASJA 2BW2A 2GO9A 2JH3A 3D54A 4G3IA 1QAYA 4KE5A 5HN0A 5MAOA 5EDWA 2IC3A 4KHRA 4NWBA 3QYYA 3EGNA 5AE3A 3CB4A 4P7TA 2KRRA 3MGJA 2DHXA 4X2BA 2R8GA 2GHWA 4ECZA 2MZ1A 1S1VB 1MMLA 2V94A 4JI4F 4FXWA 2R7SA 4DF8A 2YWGA 4NYZA 5KFTA 1NK6A 5E3QA 4IUFA 1JWWA 2YTCA 4DN9A 1QSYA 1T02A 1YSJA 1X7VA 4C11B 1U2RA 2FDNA 2EBGA 2JVRA 1QJHA 2PD1A 5A8WA 4IO9Q 3H5UA 5H9EJ 1SL0A 2Q66A 5BYRA 2J0XA 1X4CA 2XMVA 2FJBB 2XS5A 3CTRA 1SQEA 1HWLA 1RT2B 3GG1A 3TA1A 4B9VA 1WNEA 3DLKA 4ECRA 5HBMA 2W9BB 2WB1D 3M9OB 1CC8A 5I4MA 1UA0A 4M95A 4UY8T 2EC0A 5CA5A 4O4RA 1JLCA 3SXLA 3I4HX 3V6DB 2KO1A 3CF5Q 3CDWA 2VBWA 1GTEA 5DDOC 4ZPTR 4EBDA 1FNXH 4B3SF 3HHKA 1HNIA 1LQ9A 3UFCX 2ASYA 1BQNA 2RILA 1FDAA 3F44A 5KFJA 2BQRA 2HS3A 2CJKA 4JI1F 3NLCA 4IFYA 4KHMA 3KLVA 4DL6A 1JB0C 3MM8A 3UI3A 2ZJPQ 2NXUA 4QBUA 1X0FA 1RYSA 2XSJA 3LUYA 4YUDA 1T94A 2J0WA 4HI2A 3MMCB 4J37A 4KSEB 5E41A 4JI6F 2H5EA 2PA8D 5F8LA 3PR5B 3RZAA 3KLEA 1SJ4P 1RTHB 1DQ8A 3CCRS 4ECQA 1XMOF 3MEGA 3MUVP 4C3MA 3O3LA 2CJQA 3NS5A 2ZM6F 4EUVA 5IQQA 1APSA 2XMWA 3HVTA 5CH7B 4IG0B 5EUHA 2FD2A 1KONA 1TV6B 4I56A 1DTQB 3OFHA 2B4VA 5JVGQ 1SJ3P 5T14A 3CJ0A 1S77D 4DV7F 3PM9A 4X65F 1CQMA 2MKKA 2CJBA 4CCHA 2ZH5A 3TA0A 3K5MA 4JBCA 5D4NA 4B9LA 1YHQS 2DTJA 4DV3F 1VQNS 5IT4A 4DX8H 3PFEA 4ED1A 2FLOA 4RBTA 3V4MA 2CQ1A 3T19A 5CXTA 2M88A 4MIAA 1U1NA 2JEIA 4OFZA 4QJVA 1FVQA 1Q7LB 5C5JA 1KQFB 2R2RA 1UA1A 3MM9B 1YJ9S 2WONB 5EGYA 4X62F 3RAXA 1HNVA 1KHVA 3N6MA 3PNIA 4EWTA 3T3FA 1SBRA 4A4JA 5L1KA 1LWCA 4ED2A 4DDFA 1JJHA 1RK8A 3CCSS 1GNKA 4KT0C 6FD1A 4UUWA 4C0HA 3G71S 3SSRA 2HNDB 2BOPA 2LQ5A 3I0SB 3V6JA 3DM2B 3RBEA 2KJVA 1KLMB 5JUMA 2UXCF 2KDOA 3FCHA 4E98A 1XK8A 4PCQA 1XMQF 2KXFA 4I69A 4ZPAA 2HHTA 3POTB 2RDJA 2GQQA 3KWMA 3UNGC 2P6SA 2OD6A 4FXVA 4GO7X 4DOZA 4Y2IA 4YMEA 1HL6A 2VG5A 1NHUA 3UDLA 4QYRA 4QCLA 3WBZA 1XNRF 3PX6A 5LXYA 2R8JA 4MIWA 3OTEA 4FZVA 5DRKA 2QLWA 3DU6A 3NGDA 1N32F 4C3KA 4ID5A 2OSRA 2HHVA 2X51A 1JLBB 2ZH7A 2PSZA 4A8XA 4EO6A 5DG8A 3MPWA 2YNHA 2ERRA 4URQU 4NPOA 1PO6A 3KMSA 4TNOA 4B17A 3IAS9 1RT4A 4GO5X 5A0YB 1DJ0A 4B9NA 3E8OA 1K0TA 4ZMMA 3BO4A 2VV5A 1HBOA 2B6AB 3B78A 4M63A 4ERDA 2KH9A 2ZD1A 1DQ9A 2DR8A 1FKPB 1HI0P 3JYTA 3I0RA 1Z4UA 3QGHA 2FTRA 5E3CA 4DQQA 4OLOA 2FGCA 3M30B 2JHEA 2ZC3A 1JXEA 4K4VA 2VD3A 1QUPA 3IAM9 2DGWA 3DMJA 1KSPA 1L3UA 2CPYA 3QO9A 2GQCA 2LDIA 4QQBA 2FPHX 2HVIA 2AJQA 3SFGA 1S6OA 1JX4A 4RNFA 2E1CA 2I5JB 2KFZA 3IG1A 1FE0A 2JLGA 4DSFA 3U1LA 2J7KA 2GO8A 2R7WA 4ECYA 2VA3A 2CQBA 3CEDA 4RU2A 3BB5A 4IDKB 1M5OC 3HHNB 1RT6B 2IYGA 3U7JA 3MM7A 4CNZA 5CD4H 5FD1A 2J6UA 1F5BA 2ZZMA 3HO1A 4IYQA 3NBPA 1B0VA 2KHDA 2HFOA 5E3AA 5K8MA 3V81B 3TR5A 4EEYA 1NJIT 5K8PA 3TQ1A 1D8ZA 4Y34A 2WW8A 2A10A 5L1IA 1VIOA 4EO8A 1S10A 7FDRA 4HH1A 3SCLE 1OSCA 4DHVA 2ZH8A 1UMJA 1TK0A 2V8DA 2M8HA 3DHXA 4QIVA 4ZPWR 3G6VA 3SZ2A 5HP1A 2WCXA 2C2EA 4YHHF 1U45A 1CLFA 4ZP7A 5D4LA 2GIRA 3NGKA 4C7QA 5M2UA 1U1LA 2NREA 1HBUB 1S0OA 1HBNA 2MQOA 1VK3A 4HTJA 1FRHA 1YBAA 2O66A 3DI6A 3CUNA 5GAHU 4F2RA 3SMZA 1JKHA 2CRLA 2IA0A 2J8AA 4WFZA 3TVYA 2NUUG 4QWCA 2XI2A 2EG2A 1VQ4S 3KHGA 5HQ8A 1N5VA 5SUHA 2E66A 2IVMA 4TU9A 1M1KT 4DQPA 2LU2A 1NK9A 1S1TB 3SCKE 2DNKA 3MM6A 1Z2ZA 4IH6A 2WB4A 1FRIA 1NEEA 2XEXA 4MKBA 3MUTP 4OX6A 4I4BA 2B56A 1HYSB 2D3ZA 3JSBA 1Q1KA 5DDPC 1MSWD 2PEHA 3GE9A 1FRKA 1YRTA 4NA1A 2B4UA 3ISND 1T05B