2XBPA

A novel signal transduction protein pii variant from synechococcus elongatus pcc7942 indicates a two-step process for nagk pii complex formation
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
113
structure length
113
Chain Sequence
MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGSEYTVEFLQKLKLEIVVEDAQVDTVIDKIVAAARTGENGDGKIFVSPVDQTIRIRTGEKNADAIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITROGEN REGULATORY PROTEIN P-II
publication title A Novel Signal Transduction Protein P(II) Variant from Synechococcus Elongatus Pcc 7942 Indicates a Two-Step Process for Nagk- P(II) Complex Formation.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Gene regulation
total genus 25
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2010-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xbpA00
4YB7A 2J9CA 1UMJA 4C3LA 2CZ4A 2E66A 4OZLA 4C3KA 2O67A 4AFFA 1H3DA 3O8WA 1UKUA 2NS1B 1UL3A 2PIIA 3AH6A 3M05A 4CO3A 5L9NA 1KR4A 5D4NA 2XZWA 4USJC 1Q1KA 4CO0A 3OPKA 2J9EA 4WK1A 1NH8A 1O5JA 2ZOMA 3AA8A 2XULA 1VHFA 3TA0A 2NUHA 3L7PA 3NCPA 1NH7A 3MHYA 4YB6A 4OZJA 5D4LA 3O5TB 4E98A 3GSDA 3N5BA 3CE8A 4D3GA 5DS7A 5DRKA 1PILA 1GNKA 3TA1A 2XBPA 1V3RA 4D3HA 2EG1A 3TA2A 3AA9A 1V6HA 2GX8A 1NAQA 2DCLA 1V9OA 4YB5A 1V3SA 2GW8A 4CO5A 4Y6IA 2GNKA 2NUUG 4CNZA 4IYQA 4USHA 2J9DA 4Y65A 1HWUA 2EG2A 2J9DE 4CNYA 2RD5C 1O51A 2O66A 5D4OA 1OSCA 4ZK7M 1NZAA 4NYOA 4CO4A 3T9ZA 1VFJA 4USIA 3BZQA 4CO1A 1XK8A 2Z0GA 2XG8A 3AHPA 1QY7A 2VD3A 3NCQA 1J2VA 4R25A 4RX6A 1UFLA 4C3MA 2V5HG 3X3UA 3HLUA 1P1LA 4CO2A 2JJ4D 5D4PA 4OZNA 3LF0A 3NCRA 2ZFHA 4RWXA 4NYPA 3DFEA 4WK3A 4RLEA 4RWWA
chains in the Genus database with same CATH superfamily
4OYXA 1YBUA 2ROGA 2QIFA 4DPYA 3I6PA 1XMOJ 4ZOSA 1Q8LA 3MAQA 3T19A 1CJKA 2WAQD 5KFOA 2OP5A 2XZWA 5ETVA 4ZVEA 1RAOA 2NSCA 5HO4A 3W2VA 5D0EA 3C16A 2F8HA 3CW2C 3HXMA 5L1LA 1NH7A 1U24A 4RW9A 1ZPVA 2UV8A 2AU0A 1M90T 3TA1A 2IM1A 5I4MA 4NMXA 1H6KX 1QAYA 4PXEA 3HK2A 2J7KA 3FGVA 5I3PA 2L9NA 1KONA 4CO5A 3HHEA 2GO8A 2NUUG 2OGUA 2H48B 4C0BA 1RTIB 2QFIA 5KG7A 4YQWA 1ZYQA 2N7CA 1HBNB 1K73T 3I9ZA 2VG5B 4WP3A 4ECZA 1BWEA 3UDCA 1XMOF 1JJHA 3I4HX 4OV1A 2FJDB 1YLXA 3TQ1A 2JL9A 2XMAA 3KHHA 2R2SA 1LOUA 3MMAB 4B9MA 4NXNJ 2NS1B 4ED1A 4DL7A 4FYXB 3CCVS 3GONA 4EBCA 2V8PA 3PIPQ 1YBTA 1LFPA 3O6QA 4A8QA 3EGVA 1SH0A 4R8UB 3PXGa 1N56A 4TQRA 4FYWB 3SDEB 3TA2A 2ZH3A 2H5JB 2RILA 1N33J 1HI1A 3C6TB 2R8HA 4N77A 1LWFB 2RQ4A 4O0NA 3CJ8A 1NHKL 4DR2J 2GNKA 1DTTA 3R97A 3OXLA 4B08A 1N34J 1FESA 4DBQA 1FJ7A 1HNVB 3EVWA 4ICLB 5HJXA 5J2PA 4XPCA 5KT6A 1FRJA 3IBCB 2ZKUA 2HKEA 4DG1B 1JLEA 5ETRA 1S4FA 2PFDA 4X4RA 2EFVA 1T9YA 2Q6CA 1AFIA 2RQKA 1TK8A 1E6YB 4J9NA 1D8ZA 1QUPA 2BANB 2I9SA 2F9JA 3X1LB 1RAAB 1WC3A 2H3EB 2MEWA 2QLJB 4RUCA 3BO3A 2DHSA 4LT6A 1RHUB 2GJ2A 2FJAB 1FDDA 1T9XA 1JB0C 4ZCMA 2IBOA 4TY8B 1F0XA 3AD7C 1RTDB 3I0RA 1JLBB 3FCWA 4DR2F 3N01A 3JTNA 5B0FA 1HQEB 1KFDA 1K0VA 1ZM3A 3TJAA 3R6LB 2GZOA 3V6KA 3KJNB 4WTOB 3H40A 2AX0A 4IO1A 2W2QP 3LA0A 3UO0A 4PYDA 1S9GB 4X4VA 3TP2A 3RB4A 1IWGA 2O66A 2YKNA 4Q7AA 1U45A 1WC4A 2OEMA 1RT7A 2Z0GA 1ZAVA 1CS4B 3AJDA 4DWIA 4C9DA 1U49A 2WB4A 3KMSA 4H4KC 1FERA 2EFNA 2YWFA 2DPIA 3GTYX 1MROB 4F67A 1TL1A 1R0CB 2ALZA 1X0PA 4HACA 3WC0A 4WFYA 2HYIB 2Y1LB 2ZEJA 2CQ0A 3K8VA 7FDRA 2KL8A 5GAHI 2HNDB 3H90A 4KR0B 3HFKA 1D09B 1OSDA 1CJTB 4YN3B 2XI3A 3KDNA 2GFFA 1XQIA 2DK2A 2WRMA 3DDIA 4DU7A 2E5LF 1RYSA 1M0SA 1TKTB 3W8GA 3SIPB 4M8LA 5K5MA 3W9HA 2RMLA 3TNVA 4Q8FA 3TX0A 1TL7A 3Q8YA 1JWWA 1S1VB 4OYWA 3MI7X 4U7CA 3NWGA 4Q44A 2CFXA 3UE2A 2A2DA 1RWKB 3PYEA 1Q86T 2ALYB 3H59A 4OHVA 5C2CA 3A3NB 4WYWA 2FLLA 2VBZA 1RI7A 2CKWA 4C3KA 5F8JA 3M9MB 3C15A 3WBZA 2QLBB 1X4HA 2KRRA 2VDHA 3QZ7A 3W7BA 1OS5A 4LSZB 2MQQA 1O8BA 4K4TA 1RCOB 2I0XA 4U96A 2CPJA 4P9SA 2OMLA 3DOKB 5FDLB 2HHWA 2J0QD 1TVRB 2LP4A 3PRBA 1RCXB 2XBPA 2LEBA 4F4KA 2HNZB 2UUCJ 2PEHA 3FBFA 3Q24A 3LQVA 3N79A 4MT1A 4HL9A 1FFGB 1Q81T 4Y65A 4ED8A 2MZRA 4O0IA 2AJ4A 4OZ1A 2O5DA 1NJWA 4MKAA 4NLPA 4H4OA 3OUYB 4LF7J 2VG7A 1YJ9S 3LH2S 1KVIA 2DNHA 3O44A 1OWXA 4LF6J 4WXWA 1NDCA 3NOGA 2W2NP 3HSJA 3SSQA 4I69A 4FXWA 4FKXA 2FJXA 2DEIA 1KQFB 2ZNZA 1KWMA 3SZ2A 1PGZA 1BUXA 3TVZA 2V6AA 1UMJA 1B99A 3ZO7A 4QIGA 4KHPJ 1R8AA 3UI3A 1XR6A 2IIHA 3TAMA 4AUKA 2W2MP 4F7VA 4FDFA 2FD2A 4ANCA 2HFOA 1R8BA 3TZWA 1R0BG 2ADBA 2AT1B 2K7KA 1LWCA 1K44A 4L3KA 1IJFB 2RKIB 1WEXA 1AUDA 4MK9A 1Q79A 1N5TA 2DXDA 3MCSA 5ETKA 1S4EA 5B08A 4I6YA 1Y4ZB 1S0NA 4M5DA 1NK4A 2YKAA 3LP2A 3HVWA 1BQNB 4O3SA 2B6AA 2MZQA 4PYAA 2MTLA 1RT4A 3FNNA 4L76A 3PJWA 3I0SA 4DF8A 1QE1A 1ZM4A 3MFHA 2RVJA 1QSYA 3R7NB 2IJRA 2GHVC 5HVGA 3QNWB 5ETSA 3UN2A 4QPTA 2YKOA 3MAAA 4JI8F 5HAOA 3W64A 2L41A 2RF2A 1JXLA 1N6QB 3JQMA 3J7Z5 1X9SA 2R7QA 3DKDA 3SEOA 2HHTA 2XULA 2QX0A 3NL0A 3HVTB 1NKBA 4LFCF 2PMZD 4M95A 3SV4A 1HWLA 2QJ3A 5H9EJ 3D0GE 1Q5VA 4TY9A 1T3OA 3R9LA 3V4IA 2C42A 3KUGA 3GFZA 3EDQB 1UA1A 4TLRA 2R7RA 1LEOA 3GR1A 2YPZA 3QAUA 1B4SA 4W98A 2V50A 2AHOB 1IBLJ 1RE1B 2DR9A 5DQHA 3BGRA 5KT2A 1Q8BA 1GFWB 3BBFA 2B5JA 5L1JA 4IDKB 3KUEA 3J81Y 2GGPB 2IVYA 5SZTA 4DFKA 5LMUJ 4U67Q 1DQ9A 4OZNA 1LWXA 4EU0A 2RRNA 4ANEA 3D67A 4PWUA 2NYIA 5L9XA 3DRSA 3IRXB 1U1KA 2QZ8A 1NPPA 3Q0AA 3U1MA 1VRUA 3HDSA 3B78A 2RU3A 2BQ3A 1TU0B 4C7QA 4A8SA 1WOSA 5A2QU 3MWBA 4N76A 2R3VA 3MEKA 1UVMA 5B7WA 5J1NA 3M30A 4I7FB 3RG6A 2VC0A 2VA3A 1SKUB 2YWGA 3BR8A 1C0UB 1LW0B 2V9KA 2VIHA 1QUVA 2E1AA 4KV8A 2ZBRA 5AJ3J 1H7XA 3OJUA 4MFBB 5FJ4A 3T1HJ 1S0OA 4KTQA 2GVDA 1KQGB 2VASA 4DV6J 5EN1A 1WKLA 3PYFA 2EVZA 2FC8A 3C14B 5C42B 1SC1B 1N5SA 5D0RA 1HNIB 4ZHRA 2B8PA 4F25A 3M2RA 2MLYA 3CGIA 2D9OA 3QT8A 5KOXA 3ENWA 2BR0A 1FRMA 1EX8A 3KLFB 2V5HG 4USUA 4DR7J 1ZS6A 3DLKB 3GYNA 3WIUA 1RT3A 4NWBA 2MQLA 2MKIA 2WVDA 1RBLA 1OQ6A 4U6PA 2LCWA 4DR6F 1GMUA 4QIVA 2XEXA 2W4DA 2OPQB 3KG0A 4CO3A 3VWSA 4NZ7A 1SL0A 1KSPA 3DC2A 4P75A 4KO0B 2UU9F 2C1EB 1QTNB 4NLXA 4QWCA 3L7PA 4J9SA 4PG6A 4EZ6A 2HBZB 3TOQA 3MD3A 4ZLJA 1L3TA 4KBIA 2J5AA 1NJXA 1J27A 2ZE2B 2IRXA 2DR7A 4WP8A 4FYDA 1S6QB 4DQRA 4Y2IA 5C5JA 3T3FA 3JTOA 3ZZOA 3CMES 2DGXA 1RTJB 1Y3JA 2RU9A 3CCUS 4DZ6A 4OYOA 5JXSA 3UDLA 1FVQA 2EKNA 3W5ZA 5BYSA 3W2VB 2ADCA 2B8QA 2BVZA 1N5VA 2B9EA 4U7UD 3QWUA 1A7GE 1F6TA 4C8ZA 2ZWPA 2J6TA 4CH7A 4TYAA 4C8OA 3RR7A 4YOEA 1WJ9A 1RUSA 2DRAA 4DX5A 3MPDA 3BYPA 4W92B 3CJSA 3PFEA 4ECVA 2HFSA 3Q8UA 1KP6A 2DHXA 1X4FA 2B9YA 2KT2A 1U47A 2HFZA 3DYAB 1JLFA 5D8HB 1K0TA 2AGOA 2IM0A 2IYIA 3RRGA 2Y8WA 1URRA 3EPGA 1F5BA 4IUFA 1FRXA 4EUVA 1R6VA 2CPHA 3GJRB 1YJRA 3ETMA 1S6PB 3M8QB 1VOMA 2HHHJ 3W61A 3LGHA 1AW0A 3Q8PB 3LP0A 2M88A 4YHHJ 4IQMA 1F9FA 5H9FK 4QWDA 1VFJA 4ZVPB 3CD7A 3FVYA 4DV3J 2VD3A 4I2QA 1YX2A 5J1PA 3LANA 1RT1A 2CQBA 3ZNJ1 3BQ0A 4GC6A 2OIHA 4OQJA 1UVIA 4RWWA 5KFQA 1A9NB 5DO2A 4JI3J 3QGIA 2ZJQQ 2UXCJ 4PPDA 3PW4A 5J2PB 3CJRA 1IR2A 4USJC 4DUYF 3DLJA 2HFUA 2CPDA 3R2DJ 5K8PA 1ZA2B 5F41A 3TZZA 1HR0J 3NNHA 4YHHF 4ZP6A 3ZTQA 1IVZA 1QLNA 4AXIA 1WHXA 3JQJA 4ZPAA 4M5LA 2LMIA 4UOGA 5FIIA 4R5PB 2VH7A 2Z2YB 5J1EB 3EGNA 4MKVA 3K5PA 3GCXP 3HSZA 1B70B 3S8SA 4USWA 2HFNA 4JV2A 2IRUA 2W9BA 2BW7A 3BB5A 2I5JB 3MCNA 4OFZA 1SH3A 2DCUB 2BE2A 3CJ0A 1WHYA 4RJVA 2LU2A 2W7PA 3DDNA 4DUZJ 4NEYA 4ZP7A 5A8RA 4FVCA 4B9TA 2VQEJ 1X9MA 2KG0A 1X5PA 2V2KA 4WE1A 2DR8A 2CVIA 2RH3A 3H4BA 2YKNB 3AD9C 2ROPA 5I3UB 3D7SB 1HR0F 4RUHA 3W65A 5LJ5Y 5DQGA 4A46A 3RBZA 5L1IA 1C2PA 4H4MA 2D7SA 1WSRA 2VQFJ 3QLHB 2LXUA 1FJEB 4YY3J 1HQUA 2DNMA 2XI2A 3NOCA 2JC1A 1TL1B 2G0JA 3IWNC 3TJ9A 2WSFC 2J9DE 4ID5A 1TELA 4QIEA 1RB0A 1Z2ZA 1M5KC 1C4CA 2MJUA 1T9WA 1VLOA 1VBXA 4QYZJ 2QA2A 2AD9A 3LP1A 1NBEB 3I55S 2CAJA 3GWCA 1RKJA 1U1MA 2GO9A 3RB3A 1T03B 3EYZA 2HHXA 1O0PA 3KK3B 3TR5A 1T05B 2IA6A 2BABA 1XBWA 1GX5A 2B0GA 4I67A 4NLQA 3POTA 1TL3A 3E01B 2R2TA 1D1UA 4K0KF 1KN6A 1URNA 4YY3F 1XERA 3NS5A 3WQPA 2DHHA 3FEZA 3DU6A 4JI0J 1IKYB 5KFEA 5IV3A 1V5IB 1KTQA 4KFBB 4CLUA 4X2BA 1NM2A 1WDTA 3JSYA 1U48A 4X65F 2WOMA 3IAM9 2VKRA 1YZ6A 2PC6A 2MZ1A 2D3OR 2HHVA 4LQ9A 5KFYA 2HHUA 4RUAA 2ZWOA 1Y0HA 5E5NA 4HYKA 5KFLA 3CJ2A 4KT0C 3AOCA 3W8PA 2YNHB 4XPEA 1JLQA 5G4DA 1UEVA 4ZP9A 1IWAA 4U7UK 2Q3PA 1NPKA 3DM2A 2WVCA 4HEA9 1CVJA 1FRLA 3M1VA 2EXUA 3PX4A 2BE9B 5ITHA 5J2QB 1TK0A 4GMKA 2MGZB 4RNOA 4H4OB 3CUNA 4I0WA 5I3QA 2J8SA 3CCWA 3MR2A 5F0UA 4A8WA 4A8MP 1VIXA 3LPYA 3OPKA 5AXKA 5LSOA 2ZOMA 4KH1B 3DNCA 3JSMA 1VRQC 4HT7A 1CQNA 3I31A 1S9EA 2D3ZA 5L38A 1PILA 3LWLA 2HURA 1M1HA 3CCES 1Y5LB 2CYYA 3LO3A 2RJZA 2H54B 2YXLA 3B82A 4DPUA 2E1CA 2GA7A 2RD5C 5DM6Q 5BR8F 1N36J 3JAMY 4ZKAA 2AMCB 2ZZNA 2YKMB 1SBRA 4JI2F 3AODA 3VCDA 3UWTA 2ZHAA 1F3FA 4ZVOB 2R7VA 2GVZA 1X4EA 4X4UA 5K20B 3BGLA 1LWCB 1RWMB 4B3MF 1H73A 3DLBA 2JJ4D 4DQSA 3BBCA 3TUIC 3M2VB 1U1RA 2C3PA 4UQGA 3AD8C 1HWIA 1K1SA 3KHGA 1VBYA 4G1QB 1IBMJ 2DGTA 3CO9A 2AGPA 4EBDA 4M5DB 3M7VA 3OL9A 4X66J 3K59A 3LP2B 3RAQA 2HWIA 1M5VC 2QFJA 3RUBL 4WKRA 2R4FA 2ACYA 2B6AB 4WJBA 1YI2S 2LVWA 2VPXB 2ZM6F 5D0GA 3I0SB 1NJZA 1WD6A 1GNKA 2DNOA 1QE1B 1N52B 4AYBD 2ZKTA 3M2UB 4P10A 1UTAA 3HVAA 5HQ8A 2X1AA 3TQEA 1B0PA 4ECWA 2PT0A 4FPRA 1WUUA 4CDIA 3HHDA 4Z2XA 5EUHA 1VQKS 1OY6A 3CCLS 2JEJA 2QYCA 3U27A 1C1CB 5IQ6A 4ED4A 1H2UX 2M9KA 3ZZ0A 4DLEA 1WC6A 1DLOA 2F8EX 4UOCA 2E5HA 3EMTA 4DZDA 3V4IB 4X66F 4GO7X 4F2RA 4ZN1A 1VMBA 4AFFA 3ILLA 2IPOB 4CTAA 3IWLA 3BS9A 4FF1A 3DI6A 4X4OA 1VQOS 3I4PA 2CWKA 2B5JB 3S01A 4OI0A 3QZ8A 1HW8A 4DX7A 3KJVA 2UVUA 2AWZA 3RGIA 2FJWA 1TKZA 3CE8A 4DV1J 4LFBJ 3HPOA 4ZMMA 2HHPA 1RWOB 2DR6A 5HMYA 1H38A 2ZOGA 3HM9A 4CLFA 1Q7LB 1PSDA 8ATCB 4J9MA 3NMAA 4OL8A 3M30B 2F40A 4ZPBA 2G1DA 1WF0A 4NYZA 3WC2A 3D3CJ 3T5HA 2V4QA 2W25A 1SC4B 3QQCD 3UW1A 4MIAA 3W3SA 1QY7A 4E8UA 2DO4A 1Q78A 5CD4H 2HQGA 5KFHA 2K1RA 4CIOA 4P7VA 4EYHB 3BSOA 2QL5B 3JYTA 2CA9A 4QQBA 3MTJA 4ZCLA 2XM3A 3KLIB 4I1TA 1CJUA 1P27B 3O8WA 3L7OA 2XS7A 4M5MA 3G96A 4NL5A 5J2NB 4DV4F 3M2RB 3T41A 4NA3A 4PQUA 2JX2A 1X4DA 3MR3A 4K4UA 3O1LA 2KYXA 5F8GA 5B0GA 1S0MA 5LXYA 1KQSR 4G1IA 1P9YA 4FNIA 2B9XA 4OI6A 4QW9A 1RT6B 2L9DA 1B3TA 4ZIVA 3EZ5A 4DL4A 1XNQF 2C3YA 1WHVA 2VPZB 2P8IA 3GR0A 4ZVHA 1YSJA 4ANDA 2DGVA 3DRRA 3KNGA 4DN0A 4ZVQB 1OPIA 1YBAA 2AQ4A 2BDPA 4RR5A 4ED7A 5E33A 3I82A 1CLFA 2MLZA 2KH9A 4FF4A 4BDPA 3OSNA 3R6GB 3AOAA 1DZ5A 3MUVP 2M8DB 2AV5A 3CVKA 5JVHQ 2GV1A 4DR1J 3MM9B 4C0HA 1X5SA 3CEDA 1IBKJ 3PFOA 1YJUA 4IH5A 1GQEA 1UEUA 3HULA 3TUZC 2LQJA 4X4PA 1NSPA 4PG4A 3ET6A 2HS3A 1WACA 1WDDA 3QFWA 2LKZA 1H7WA 5SUHA 3I5BA 1EQ0A 1UVKA 3LGMA 4DL2A 3D4JA 1CSJA 2W9CA 2GIQA 2EWHA 2UUAF 1MMLA 5KG6A 2BJ3A 1HWUA 5KFSA 4EBEA 3ZZZA 1HA1A 2QL7B 4DQIA 4F4AA 1JLFB 3P96A 3TUPA 2HQ3A 1WORA 2OLWA 1SH2A 4F4XA 4IO9Q 4Z7CA 4UUWA 1J2VA 3ZTOA 5LOQA 3AT1B 1H72C 3TO8A 2UZAA 4O23A 3Q23A 4OJGA 1NDLA 3TANA 2CZ9A 4LF8J 5A8WB 1NLKL 1RABB 1W2IA 2A6MA 5KT7A 3QSYB 2AYGA 1F2HA 1Y7PA 3PR5B 1HPZB 1ZOTA 3GV8B 4O3RA 4NZ6A 3R7SB 5B0DA 4RW8B 1U7LA 4OYPA 5CZVA 2P9EA 1HHSA 3UD3P 2FHKA 4N41A 1TMJA 1SC6A 3GSIA 5K8MA 4HHHA 2V4JA 2XHWA 2ROEA 1TV6B 3A3OB 3DDKA 1CJVA 2EFOA 2MKYA 1KVJA 3EUNA 4KRWA 2E9RX 5BYQA 4UZCA 2F65A 4CNYA 2YNFA 2XMUA 5A0YA 1Z4UA 1R8PA 1LWEA 1U2CA 2F9DA 4G1PA 1JK9B 3OXFA 1WNEA 1MU2A 3RYLA 2ATCB 2D3O1 2IJNA 4UY8T 3GV7B 1X5TA 4UZBA 4NLTA 5HQLA 8AT1B 3QT6A 4JYAJ 2KM8B 4NI2B 2D69A 4RZRA 1YJNS 3TEGA 5D3GA 3MF5A 2OPSB 2HW3A 3V6JA 4NLSA 1CPZA 2UP1A 4DV0J 4Y00A 4OYMA 2CVEA 3MEGA 2RQMA 3CDUA 3A8JA 4L74A 1S1TA 4YDDB 3GIJA 3MZIA 3G87A 4M5NA 5KT5A 1X7VA 5DETA 4K8RA 4J9QA 2JFKA 1S1UA 2BJ1A 1FXRA 2R8GA 4OLPA 4CT9A 2M0GB 3DGPA 3V5RA 3R8YA 2CPIA 2W01A 1C0TA 2OD6A 4IOAQ 3S1TA 4KE5A 4WE1B 3IWXA 5CCLA 3I96A 2HVEA 3R5JB 1XNRF 1WELA 4UY85 1DQAA 4WU3A 3VGTA 2AZ1A 3BN4A 2HNYB 1SQGA 3D6MB 1HARA 4RBVA 2FJEB 2LU1A 3IG1A 3D5MA 2XG8A 4DSKA 4ZVGA 2OPRB 2HVHA 1YJWS 1IKVB 1AZSA 1TR0A 2QLXA 3BGOP 1PC4A 4MH8A 3K89A 2IJFA 2FHOB 4J9OA 1RXOB 3KLEA 4DFPA 2R2RA 4FF2A 4RW4A 4LREA 2PE8A 2YBVA 1Q53A 1ZAWA 4A8XA 4K50A 1AB8A 2NCKL 4HDHA 1M1GA 1RK8A 1RLDA 3R5DA 5CAAA 2FTRA 5EDWA 2E7XA 3LP1B 4MK8A 2HS0A 3OFGA 1DHMA 3RBEA 1FE4A 2HS4A 2GHWA 3QO9B 2E29A 5KFXA 5KFPA 4FP9A 2XS2A 2AJ2A 1L5UA 2LEPA 2VL1A 4C8LA 1R6YA 4J9PA 3GFYA 5DM7Q 4CWBA 5HANA 1WHWA 3UVJB 4IH7A 4CRJA 2NXUA 2F3JA 4P2FA 1D9AA 1YQHA 4DL3A 2PD1A 4OI2A 1H0HB 4HLBA 1VQ6S 4K7QA 1RAIB 3VTIA 1S48A 1FEHA 3VHQA 5D6GA 2W24A 4U8YA 2LDYA 2C3OA 4RKUC 4RW7A 4CCHA 4A47A 3DOLA 3N0VA 4H4KA 3VZHA 3CF5Q 3QJPA 2CJ9A 1T95A 1W2BR 4IRCA 4LF2A 1IKXB 5B0BA 3NS7B 1IXKA 3B6BA 4OZ5A 3EWGA 5KFUA 2ZC4A 1JLQB 3A3PB 4USVA 5J2MA 1OIAA 2EK6A 2XSFA 2YNIB 4OYBA 3RBDA 3GJTB 1FK9A 2XMVA 2MKSA 2UXDJ 1D9FA 3SFGA 2DJWA 4ZVSB 3BBBA 3JTPA 3LUYA 1DBDA 2VPWB 3DMJA 4ZIWA 2BOPA 2NXNA 4DR3F 3MDFA 1VBKA 4M94A 3MCOA 1RGVA 4IG0B 3BKTA 3ZZUA 4X4SA 5JJBA 1BMQB 3V81B 1NK9A 1KC8T 2UVRA 5K8OA 1N4LA 4PG7A 2OUGA 4OV6A 3TWZA 1XN9A 3NNCA 1UWBA 3HVRA 4K4VA 3TVKA 3BKFA 4NX9A 4OI4A 3BEGB 4EO6A 2GVZB 1HBUB 5T7LA 1HW9A 1S49A 1MMDA 5G0RA 1KRPA 1K47A 1GH8A 1OY9A 1S99A 2HQFA 2X3GA 1JJCB 2IY5B 2UUBJ 3GYGA 1EP4B 2HGLA 3R2CJ 2W4CA 4X84A 4RNNA 1JXEA 3GU0A 1W7WA 3W1YC 4A8FA 1YHQS 3BPSP 4DF4A 5D4OA 1I5OB 2FLNA 1GMWD 4B3TJ 5E3CA 3QFHA 3D28A 2EFGA 5KFCA 4R0JA 4QCLA 4NLYA 1GTEA 3VAHA 3PG9A 3C6UA 2JOQA 3QGHA 1BLUA 1RU2A 2HVDA 2M8HA 4EK2A 2RDJA 3KLGA 3HD2A 1NPRA 2IDEA 3FZBA 2HSEB 1HNWJ 4C8KA 1JLCA 1SV5A 2J7UA 3KJQB 4ZVTB 2XWYA 1AA1B 2ZBQA 3GIKA 3NGRA 2OD4A 4URSA 2VG6B 7AT1B 2V8GA 3A1YG 2Z58B 1HI0P 3LGNA 4CP5A 3LW5C 4ECSA 5A6PA 3ITHA 4ED2A 1YTYA 4B3TF 4CTAB 1FEEA 1JLAA 4RNMA 3HZEA 4B3SJ 4ALZA 4G6VB 2CNLB 2CQ1A 1RYRA 2NLWA 4CLPA 2NREA 1ZM9A 3MUTP 3OR1A 4BBYA 1TKZB 1UCNA 1VCTA 5B0EA 2QLWA 3VGVA 4JI1F 2R7OA 4BWMA 3ZC4A 4LSNA 3HHLB 1YZ7A 3MUMP 3ELHA 1ULRA 4LRBA 2GJFA 1VQMS 1NRKA 1JXVA 3ZXWA 4N8OA 1WG4A 1U6ZA 3G9CA 1PBAA 2KXNB 3VAGA 5AXMA 5CH7B 1BXNA 2VV5A 3J7AN 4K5SA 3F0NA 1FJCA 3G82B 1Q1KA 1WC0A 2A0FB 3PW0A 4GVBA 4AT1B 3Q8SB 3DLLQ 3KMQA 3TYTA 4TVAB 3ZTPA 5KFTA 5IT9U 3GFHA 3DRPB 1T9UA 1J5EF 4P74A 2HAFA 3KYLA 4ELUA 3K5LA 3UFCX 1IN0A 3KG4A 3BYRA 1V5VA 3I9V9 2OEKA 4FXDA 5IV4A 3MMBB 4PQUB 3L95X 4S0MA 3DU5A 4XAKA 4JI7J 4DOZA 2K3IA 1OY8A 1TP7A 3NXZA 2P9CA 4GKKJ 3R5BA 4WIQA 1MWYA 1S1XB 2YNGA 2YKQA 1U2RA 1XMQF 3UD4P 2QC3A 4HTIA 1TK5A 1TFWA 2J0WA 1FNMA 1TQLA 2XMKA 3T1YF 2AX1A 4Q8EA 2DISA 3PJXA 3CXCR 5DJBA 2OSRA 2XTJP 2VUGA 5CZXA 4WK1A 2V4RA 4F02A 2VHGA 1VHIA 2XY7A 3JS9A 3DRRB 4TYBA 4JI5J 3ISZA 2JRSA 2CPXA 2OSQA 1H2VZ 1FNXH 3CDAA 4X64J 2VODA 4V1Ak 1HBOA 2YPYA 2WTFA 2J6UA 4QWBA 4ILLA 3CSKA 1FDNA 4DHVA 5KFIA 4USIA 3SSRA 3ET6B 3MEDB 2Z2LA 1U1PA 3FKBA 4KQZA 1BWVA 2M3DA 3VAIA 1WTBA 4OHXA 3MM8A 2BOAA 1S7HA 3H0PA 4MYTA 3H2UB 3ZTSA 2EPIA 1S10A 4Y0FA 4IG3A 2KO1A 1N0VC 3D66A 1R3NA 3D0IE 3U1NA 4TKTA 5B09A 4I2PB 3KK2A 1LXNA 1SUQB 3PCOB 2GS8A 3C19A 4ECQA 1RZMA 4HI1A 3VZIA 1S77D 1UFKA 3PW5A 1YRTA 2VFVA 3PTWA 3BH6B 4LSLA 3THTA 3PW7A 1SXLA 1KNZA 4ETXA 3FQKA 3FUYA 3Q89A 1R7IA 1RHMB 4GVLA 3FFIA 4N7TA 3CIMA 2FQQB 1QVGR 5C2GA 3GV5B 1SKWA 2E9ZA 1ZBTA 4ES2A 2RUSA 4QU7A 2KHDA 2DNLA 1S79A 4NLGA 2V4JB 1REVA 3NCQA 2LXIA 3UN3A 4BCAA 3ISND 2XZDB 4CYUB 1S6OA 1CJVB 5D4PA 1EARA 2B4UA 3OHAA 5E2QA 3H7HB 4F4YA 1HMVA 2KU7A 4JV5F 3N4WA 4A48A 2DY9A 2JNJA 1HNXF 3FEYB 1L3KA 2C2RA 1RTZA 4DL0C 1UPMB 3BN7A 3EZUA 3VGUA 4M63A 3KK1B 3D9BA 3TA0A 3V6DB 1D0EA 2AJQA 4NCGA 1FD8A 3TRGA 1JJ4A 2KRBA 1E6VB 4IQXA 3M9NB 5LMNF 1J5OA 2Y1IA 4LBPA 4LVNP 2LLZA 2GHPA 2RB7A 3GE9A 3PHEA 2BW2A 2J9DA 3MEGB 4RW6B 2DH8A 3BO2A 1S1TB 1YVFA 2V68A 3C8YA 3A4TA 4ERDA 3TARA 2P6TA 3OTOF 1G2EA 2N3LA 3HT3A 5A2QY 5JVGQ 2R8KA 1IM6A 4WK3A 2HEKA 4ZJLA 3JB9k 4ZP8A 2BKPA 2HVZA 1ZAXA 2CJBA 3P8BB 2MHNA 4ED3A 3GIMA 3VGSA 4C11A 3HT0A 2FGOA 4ED6A 2F1FA 2PA3A 3CC4S 3QGPA 4ILRA 2CQCA 1NKCA 4ELVA 2GAHC 1KLMA 3SI8A 2O1PA 3QAEA 3HMJG 2FVPA 1AZSB 3Q86A 1LKZA 1OYEA 2MKCA 2MKJA 2Z4PA 3AQPA 2OTJS 1TUGB 2KFNA 3GG0A 4Y2KA 2N4DA 1N8RT 5DLFA 2V67A 4LBHA 2JLEA 1FDAA 1NJYA 2VDIA 4RW4B 5H9EK 1S72S 1JMTA 5LL6d 2MXYA 3T9ZA 5C24A 3FDSA 5MLCV 3AB2B 4K2XA 4P73A 2M4MA 2ZH4A 4GC7A 2HWHA 3NBPA 2H5IB 4DR4J 1UFLA 2V34A 5IXUA 1VIOA 3FRZA 4YR2A 4PUOA 2RT3A 3IM9A 4KGKA 3CCRS 4J9RA 4OZLA 3NS6A 4DV7F 1NXIA 2K7JA 2QLFB 2E5GA 4P7TA 4PABA 4QWAA 4YR0A 4ZJOA 2AIRB 4NCAA 2YX7A 1MN9A 4XTTA 2FLOA 3UCUP 1NK0A 3I32A 2ZH2A 1GMVA 1VGYA 1QAJA 2VOPA 3NMRA 5DS7A 2UXBJ 1Y3KA 2E5LJ 3GPAA 3D1OA 1U6FA 5GMKa 1RTIA 2FZKB 4RW7B 3DOLB 1HBNA 2HRTA 4O3QA 1OJ4A 2AJ0A 4OX7A 2KM8C 3IR5B 2BJDA 3RU0A 4DR4F 3DHXA 3ISNC 2B7CB 3AB4B 3C3LA 1HBMA 5I42B 2HQIA 1FWPA 5J2MB 2O3DA 2VICA 3M8PA 3FSIA 5HLFB 1RU1A 4QOTA 1F5CA 2Y1RI 4TN2A 2JDJA 2HVIA 2BRLA 2E66A 2LFVA 1XC9A 1AFJA 2MHEA 3FCHA 4R8UA 5HMWA 3FRYA 2H51B 5F8HA 3SMZA 2UXBF 3G6ES 2FIUA 3RB6A 1NO8A 3SDEA 4LR7A 3C6TA 5E3RA 1LWFA 2DIUA 4UOHA 3L3CA 3N5BA 1U6BA 1RP5A 4OX6A 1HNVA 2LDIA 4Q0BB 1AYEA 1U26A 2BM1A 4DG1A 4MJKA 1RADB 2OKQA 1UWBB 2X3DA 1N5YA 2NXEA 2AYMA 2DNPA 4ZVFA 4LFAF 3FZ2A 2KVQE 1E6YA 3W62A 3BJYA 5G0RB 1IKWB 3HHKA 2J8AA 3AHPA 4R25A 4RX6A 2MSSA 1U8WA 3GMGA 4FPIA 3OLBA 3T5LA 1YGYA 1OMSA 1FDBA 5IWAF 1HLWA 4DX6A 1VQSA 1DY3A 4TY8A 1VI7A 3R27A 1RTDA 3W66A 4OZ2A 2V9WA 2KZMA 3OR2B 3HHNB 2CQ4A 4IH6A 2LA4A 4TQSA 3W9IA 3IO1A 2ZUAA 4ETZA 1T0TV 2DGQA 5KT4A 1OPZA 3DXSX 2FVCA 1FJGF 4HTJA 4JUZA 1D3WA 3AQOA 1WEZA 2IMOA 3C6UB 3BSAA 1S9GA 3K5NA 3MR7A 4Z7YA 1FD2A 5KFFA 5HP1A 1N5QA 4X4TA 1L3UA 3KLGB 2C2ZB 2W9AA 5HMZA 4JI4F 2IM3A 4MMOA 5F8IA 1Y11A 1Z1ZA 3CD0A 3M6UA 2VFUA 5KOWA 3CJKA 3GJSB 1VQLS 4EZ9A 2DGUA 3HHLD 4NXMJ 3AFGA 5DZ6A 1HD0A 4B3RF 1MMNA 4ZVUB 4NRUA 1MROA 5DG9A 4L73A 3RW7A 4IR9A 3T6BA 1P1LA 4CO2A 4UUXA 1QAIA 3KDOA 4O44B 1A0OB 3BPDA 4RPFA 3ITHB 5KFBA 3UNYA 2MQPA 4JI8J 5DG7A 2HWTA 2YH0A 4ILMA 1FE0A 3SV3A 1JLAB 2HNDA 2C22A 5E0OA 3CCSS 1UL3A 1C1BA 3HSDA 5D4NA 1TL5A 4J90A 4V19J 1CJTA 3PDNA 3OR1B 4LFCJ 4J9VA 4G3IA 4QIWD 3JQKA 1MSWD 3DXBA 4DCOB 4RU9A 5IFMA 2F4VF 3D2WA 4OI3A 3N5FA 2R42A 7FD1A 2OAUA 2AEFA 3CMQA 1N32F 3LPEA 1HNZJ 3KHLA 2CPZA 4NXMF 1S1VA 3OD2A 3QPIA 2ZUGA 4NLVA 3MM6B 4NA1A 4H54A 5CXTA 2NZ4A 4GO5X 5KG3A 1GXLA 4F26A 4CO1A 4JP8A 4FBTA 4ZPTR 3MM7B 1FFWB 2V8HA 2ZVIA 3BR9A 5F9NA 4ELTA 6AT1B 3NKYA 4LRCA 5IZHA 2DY1A 2MQMA 2XHCA 1XTZA 3DOKA 5FDLA 5L39A 1TVRA 2HBQB 3H5UA 4ER8A 3UCZP 3SCLE 1PO6A 1S5ZA 3PYGA 1RHQB 3K5OA 1HNZF 1I51B 4Y2AA 5KFGA 2AGQA 2EW9A 3RAXA 4YFUA 4C2MA 1UETA 3MXHP 2D41A 3R7BB 1X8DA 1UZHA 1EETA 1TUWA 1PAEX 3M9OB 3OUYA 4AXJA 1TFYA 4EO8A 3IS9B 3EE3A 2B56A 1VK3A 4KGVB 4DPXA 2CJAA 3R5CA 2R8JA 1WC5A 2NXCA 3ILOA 4CLLA 4FN5A 4Z37A 2B51A 4PCQA 5T41A 2K3KA 2QG9B 4C8NA 2KDOA 3T1AA 4ED5A 4C6AA 2MY8A 3PVXA 2FHJD 2CQIA 3CCMS 4DR6J 2AP6A 3NCRA 1GTHA 4QYZK 2M70A 5D15A 4ZDNA 4WIIA 1S1WB 4YB7A 4ZJQA 1HBOB 1LW2A 4DDFA 3NGKA 1GK8A 4DV2F 1VRTB 2DGOA 3KLHB 2UU9J 1U1OA 2RKIA 1JLGB 2IYGA 4DSEA 2CJXB 5HMXA 2E5JA 4QPXA 3RW6A 4LR9A 3P45B 1WKJA 5KAKA 3G8TA 4KYZA 1SI9A 5CYMB 1KHVA 2HRUA 2FDNA 2RIJA 3VVTA 1I3OB 3MOZA 3HHLC 3M6XA 1FWLA 4DXLA 1Y5NB 3UPFA 2MPUA 2FVSA 3IGVA 2N82B 1YG0A 3KK2B 2WSCC 1I94F 4QYRA 5DDRC 3PX6A 1N48A 3AAWB 4YP3A 5RUBA 4WFZA 2IRYA 1CC8A 4C3MA 3OL8A 2ZITA 3RR8A 3QIDA 4N8NA 4QBUA 4CH1A 2ZBCA 5CABA 4KJIA 3I56S 2HG4A 2CIMA 4LSLB 3N6LA 3NGDA 1N6QA 4R0EA 5HVHA 4ID8A 4DLGA 3R1LA 2LQ5A 5CCMA 3J81j 2ZD1B 3HVTA 2GMLA 5D77A 4YMEA 4PWDB 2HGMA 4LF9F 1LQ9A 4E0DA 1S57A 2HMIA 2AYBA 3HI9A 2BQUA 3D6TB 1SCJB 3DGVA 1YJVA 3GB0A 1CJKB 2YX1A 5BYRA 4M5IA 3CJQA 4DEZA 4W4MA 3PM9A 3C16B 3VV2B 1BQMA 4RW9B 4IDKA 4MTPA 4PR6A 1JNZB 3ENVA 1VQ5S 2YKPA 3OQ2A 1WI8A 1QM9A 1RAFB 4N56A 1MNEA 4DJBA 1DFDA 3IRXA 2KT3A 4UT4A 1O6XA 4ZPCA 2ATLA 4DUTA 1Y10A 2C2NA 3BQ2A 1J5OB 1R27B 1TUVA 2A2CA 3LF0A 4LRAA 1Q7YT 4F4ZA 1T3NA 4O4GA 2QMUB 2ZZTA 2QMWA 2EC2A 3CB4A 4X4NA 4I7FA 4OHYA 4URGA 4MK7A 5GAGI 5A6WA 1LW0A 1S59A 4DSIA 4DUYJ 1F2GA 3M05A 4ED0A 1OYDA 1QSSA 5EX0A 2F4FA 4C8YA 1HHTP 2BZ2A 3AA8A 1TAQA 3CJ4A 1PIEA 2F8MA 4LJMA 2QTWA 1X60A 1X31C 2VJUA 3QRRA 3C14A 5C42A 3MECA 1VQ9S 2ACMA 1HNIA 1LK7A 2BKOA 3CPWR 4AQYJ 4QJVA 1HYSA 4C11B 1APSA 2HLTA 4N47A 1IR0A 1BY9A 3PRDA 3AXKA 2OFGX 3DLKA 1Q0NA 5KTQA 5L46A 4GKJF 1DTTB 1UFWA 2J6SA 4LF5F 3E8OA 2V8VA 1FRIA 2DNGA 1KOHA 2HHSA 3A8EA 2W8KA 3DLGA 1KEKA 2OPPA 4DV5J 3P6YC 1VQPS 1JLEB 1UZDA 1FKPA 1VC5A 5KFNA 4CQ1A 4ZPWR 1XJWB 2QA4S 4I4BA 2UV8G 3M8YA 4ZA1A 2CDRB 4KO0A 1R43A 1H74A 1ZETA 2VA2A 3LWMA 3HJFA 1JNRB 2A18A 4RBUA 3TVYA 1FHTA 1X9WA 3ENQA 5MAOA 2VFSA 1TTHB 3NBPB 3FSXA 2UVVA 2WW4A 2C2MB 3EPIA 4AQYF 1S6QA 4DCPB 1P9QC 1RWPB 2XQCA 1JKHA 1HWKA 1RTJA 2RSQA 4PUOB 2G4BA 2WCXA 5CD4A 3HF5A 3WZ0A 3GYXB 1P8GA 4HH1A 1V3RA 3OW2R 5EWGA 3TAPA 2KFZA 1YRXA 3I0RB 1NU4A 1YITS 3CTRA 3FSYA 3IM8A 2LEAA 2BYCA 4K4ZA 3FBCA 1T94A 2QE5A 2Z30B 1B0TA 2QA1A 2Z2ZA 5F3TA 4WXOA 4DV5F 3R1HA 3GJQB 1TL4A 3QIPA 3GP9A 3OV7A 1TKDA 3RTVA 2C3UA 3PO5A 2QT7A 2DBBA 4RO0A 1JIHA 1RT7B 1BGXT 3DYAA 4LIRA 3A13A 4F0KA 4WKYA 1AROP 4K0KJ 2VBYA 1FTRA 1JJ2R 3HCXA 9RUBA 1HBMB 1NUEA 2K8GA 1NK7A 2ZDPA 1S6PA 3M8QA 3F56A 3H25A 4HACB 3M8PB 3J80U 1VQ4S 1KKHA 4P2XA 2OJ3A 1LK5A 9ATCB 2EBEA 4X65J 4TLQA 4DPTA 3CD5A 3HKZD 1U2FA 4AL5A 4L3NA 1KLNA 3NP5A 2B4OA 1ZM2A 3CJ5A 5E41A 4USHA 2FJBB 2DT9A 1K9MT 2EG2A 5E7OB 2FLPA 3G86A 1PYOB 4C4WA 3UR3C 2YY3A 4ZLPA 4OYZA 2GMJA 3VF0B 2VC1A 1TL7B 2CJKA 1H98A 5KG4A 2CPFA 1ROFA 3ZZPA 4HKQA 4AL7A 1WOOA 2LQ9A 1I6JA 3CNQP 2CG8A 1QAXA 5DDOC 1X4CA 2YQ0A 4KGZB 3PRVA 2HBYB 2CNKB 3OHBA 4WFNQ 1N5YB 2BRKA 1T9TA 1UAWA 4NXNF 5HROA 5T14A 1DRZA 3Q22A 3P3DA 1PAUB 1QDUB 5FLXU 5EWEA 3MEEA 2E44A 2L3MA 4XK8C 3BDPA 2DNKA 4OI1A 3C15B 2JVRA 1Q82T 3M4XA 2BV3A 2BM0A 4M5KA 2IM2A 4UTGA 4R5PA 3ZZRA 4CLWA 3KHRA 5J1EA 3H5XA 3MAHA 2DCLA 1N33F 2JEGA 2I5JA 5BR8J 4MKBA 2NQPA 4LR8A 3CT9A 4JI2J 1M5OC 1HHQA 3L09A 1N34F 3M8ZA 2U2FA 1CEZA 5KG2A 3W2WA 1HI8A 3Q8RB 3T9NA 1UVLA 5HBMA 4B3MJ 2CDQA 3CJ3A 4B9SA 4RL1A 5HP1B 2VG7B 3HD1A 3G6YA 2L08A 5I3UA 1RAGB 2EBGA 5IM0A 2MMYA 2LYVA 4XIUA 3PEJA 3PKMA 3D54A 4RUBA 4DMZA 5EHHA 3VAJA 2DNQA 3OL6A 1NSAA 4HVZA 2M5YA 2QYGA 3CJKB 3BQ1A 4G65A 2KZZA 3QLHA 2KXHA 4WZQA 4CO0A 2ZM6J 3G8SA 2EEYA 2OI2A 3Q8VA 3TAMB 1M1KT 4ECXA 3TZYA 1NK5A 3D3BJ 5HQMA 2FY1A 1AXQA 5GAGU 3S7RA 3CWJA 2RUGA 1MWQA 3HJVA 2O01C 1RA6A 1C1BB 1F1BB 2A10A 3MTKA 3TX8A 1R0AA 3KNAA 4DFJA 2QSWA 2DHGA 1M5PC 2AEMA 4OJ1A 5HSPA 4URQU 1RLCL 4Q45A 1TAUA 1T03A 3KK3A 1T05A 2N3OA 3DRXA 4CM2A 3D6FB 3C46A 3TI0A 2XCPA 4KKOA 3ILJA 3SXLA 3E01A 3PV8A 3I5CA 3QT7A 2APOA 1FKOA 5CQGA 2PMHA 4DX8H 2M7SA 1RT4B 2I1RA 1IUJA 1RAJA 4FNHA 1UKUA 1IKYA 2XNQA 1RT5A 3QBCA 4EEYA 3HX9A 1FVSA 3H2VE 4KFBA 2Z56B 5GVQA 1R8HA 2BJ9A 3MAAB 5C7PA 2RF2B 4MIBA 3B4MA 2DGWA 3QSIA 4K59A 4ES3A 3DHWC 3H8YA 2GW8A 2VJVA 4OYAA 1P1TA 3U02A 2YNHA 3EDRB 3NGSA 4KB7A 2RDDA 2G1HA 4ZK7M 2G13A 1NZAA 4NYOA 3N6MA 5GADI 3OFEA 2G2YA 3ZNUA 4CLTA 4NEZA 2XMJA 4WBFA 2RAQA 5J2QA 1N88A 1EETB 3BGRB 4A8YA 2CPEA 2MGZA 3K8WA 4RNFA 4MAKA 4AE5A 2PDAA 2YTCA 3EVMA 3M8RA 3L4BC 2XMWA 4DV4J 1NK8A 3AH6A 2DIVA 1PJ5A 3UNGC 3DRSB 4JV1A 3SBMA 1RQ0A 2RDIA 3TUJC 3VAFA 4F3OA 1VRUB 4TNOA 2YWHA 4NLWA 4PQAA 2CUYA 3PZPA 4E98A 4C97A 4X62J 5DRKA 1T7PA 4Y3CA 4ATNA 1UJ4A 2COLA 5JMNA 1LW2B 2YKMA 4P6QA 5D78A 2UUCF 1B7YB 4KV8B 4WYLA 1XNQJ 1WEYA 2R7UA 3J7ZT 2MDAA 1JQGA 5HN0A 1DTQA 1YK9A 1VYAA 2GVDB 2PMWA 3K2YA 2W7OA 4CO4A 3DN9A 3PY8A 3M2VA 5IT0A 2EFQA 1FCAA 2K2PA 4LF7F 4KGMA 2IMWP 2E9TA 2ZBIA 4LF6F 2KYZA 1X4BA 4G1QA 4ZHRB 4EI2A 1QTMA 4LQ3A 4J5OA 3PIOQ 4ITSA 3WX8A 4RLEA 5LJ3Y 4Q43A 3J7A1 2KJVA 1FI4A 3IBWA 2FYXA 4BLGA 4DU8A 3Q83A 2DITA 1IJEB 4KHPF 1RT3B 3MMCA 4X62F 2HQDA 2GQ2A 2MZJA 4LMZA 3BH7B 3M2UA 2Y1JA 1FKAF 4F04B 2R7SA 2XYGB 4M1KA 3G6XA 2M2BA 4I68A 2B4PA 2FC9A 5LSLA 2UUAJ 4F36A 2F7VA 1VR6A 5K9FA 2LA6A 1U0SA 3MM5A 2OFHX 4FBUA 4F50A 3P4UB 1GXTA 1KHWA 4B9LA 1C1CA 3OL7A 2HMIB 1S0VA 1VS3A 4EFAC 5DGBA 4DFMA 1GMWA 4AD6A 3UDEA 4P72A 2EI5A 4FS1A 1AT1B 4QR0A 5K8NA 3OFHA 4XDCA 4WFBQ 2XO6A 2PA8D 3X3UA 3MR6A 1KQKA 1PJ6A 1UVNA 4DPWA 1L3SA 3G71S 1NDPA 2CXEA 1BQMB 4YB6A 3T5KA 2BE7D 2BJEA 1PKUA 1F9EB 2NZCA 3UCGA 2OO4A 1NJIT 5E3AA 3N28A 3KJFB 2FVRA 2CG4A 3NLCA 1RKIA 2NXJA 4K4WA 2FZCB 2Q66A 1WOPA 1D9DA 2RHQB 5HATA 4ZS6A 3JSBA 5HK4A 2XYPB 4QR2A 4O4GB 4RU2A 4C0OC 3MURP 4OX9J 4W90B 2YX4A 3VVUA 4LIWA 1GAOA 2NSBA 2CADA 2M52A 3M32A 2ZNYA 5B0CA 1G4CA 3OFFA 4KHMA 2FUG9 2GIRA 3VQTA 3VAKA 2IC3A 2DXFA 2WZ1A 4WFXA 3KLVA 3S6EA 2JZ5A 5IOLA 1IBLF 3RJMB 3G2XA 3LP0B 4P71A 1RAEB 1EKSA 3EVOA 1Y9OA 3QGGA 3B4DA 3KLIA 3PX0A 3MECB 1PYSB 2VBWA 1YKWA 2PI5A 5LMUF 4WCEQ 5GAHU 2D74B 4WPAA 5J2NA 4DSJA 2JH3A 2XYHB 4I2QB 1HYSB 2DHAA 4ZPDA 1ITPA 2B3TB 1RT1B 5IT9Y 2E1MC 2ASYA 2VU5A 3GZ7A 5BJRA 3QJLA 1A6LA 4OX9F 2FGCA 3FK4A 1PG5B 1RT6A 3CDWA 3DLGB 3EZOA 2OPPB 4LRFA 2GQCA 2JVOA 1FKPB 3OBIA 4M5GA 2ZH5A 3TEHB 5AJ3F 1SVDA 3ICLA 3T1HF 3MD1A 3GLJA 2AJFE 2E5IA 2IA0A 1XNRJ 5IQQA 4DV6F 2H4YB 3CMAS 4Y2CA 3D68A 3ADAC 3LOUA 3BREA 2JWNA 3CDBA 2H5EA 3DRYA 2DVIA 1SQFA 1ZH5A 1W26A 3BSCA 1JKHB 3IR7B 2QA4G 5KFRA 3A8IA 3NG8A 3IC1A 2DO0A 3H2LA 2W9BB 4DR7F 3MM9A 3CCQS 3A8KA 1IR1A 3HO1A 2BE2B 4NOHA 1XWLA 2OELA 3THPA 5A8RB 4O4RA 5GADU 1FNOA 4HHJA 5ETPA 3QIPB 4CH0S 1X4GA 1RT2A 1SKSA 5AXLA 4D3GA 3T5JA 4XO0A 5GMEA 2HK3A 5CA5A 1G6BA 2EG1A 2Q6BA 2BX6A 2G0IA 1FRKA 4F3MA 5KFKA 1U1NA 1Y5IB 2V8DA 2VKZG 4H4MB 1Q95G 4XDDA 3US5A 3M6VA 3RBXA 1REGX 1HQUB 4OLOA 4NLUA 2CQGA 2WK4A 4FF3A 1U4BA 4HI2A 2J0SD 4OJ3A 2SXLA 1YRUA 5HVFA 3M6WA 3MOJB 1UPPA 5C25A 3GIRA 2G9OA 4ID5B 4PG5A 1RBOB 2HZCA 5A8WA 2DKOB 2Q1LA 1NSKL 2ZDOA 1M5HA 2C28A 1RHKB 3DFEA 4A8KA 1M5SA 1HPZA 5FD1A 4UW2A 3BDEA 2CZ4A 2WVEA 3K58A 1NNDA 2XMMA 4RW8A 2ZH7A 3NEKA 3BF4A 1X5OA 2A6OA 1R8CA 4CLSA 2UUTA 2B7BB 2VFTA 2VF3A 2WONA 4K2JA 1T8EA 4J9KA 1ELOA 2PSZA 1TV6A 2LQBA 2VONA 3G6VA 1NH8A 1CC7A 3POTB 1TL3B 3O5TB 3A12A 3SQGA 5LM7E 3WX4A 2RHSB 2KXFA 2GX8A 1D8YA 4B9UA 4YB5A 1YWXA 3PW2A 3EXCX 2HHHF 3KXDA 3PKYA 1F3VA 3IBFB 3F44A 2NYHA 5HROB 2B4VA 3FC9A 4O3PA 2WOMB 2XCAA 4RBTA 4DR3J 3MEEB 2ZH9A 2FHMA 4NI2A 2U1AA 2XY5A 3WDOA 2OPSA 5AXNA 2R8IA 4DV3F 3PNIA 4YS2A 3Q2SC 3EGWB 4L75A 3LTOA 4QWEA 2DYAA 2QO3A 2KFYA 1R89A 4B9NA 4Y28C 3LAMA 4KC5A 5IT4A 2ZJPQ 2JC0A 4JI3F 3DM2B 2F63A 3IA0A 2UXCF 3CIZA 1RSCA 4WF9Q 4MKYA 3W2WB 3M1VB 3SSSA 3PJ9A 5HBMB 1VHFA 3THVA 5IC6B 4OZ0A 2XO7A 1NZ8A 3RRKA 3CDEA 4K5RA 4Q2LA 4KY3A 5HJYA 4EYIB 2ASDA 3D0HE 3UR0A 2BMBA 3JSMB 5IM0B 2R7XA 2V63A 2HNYA 2BUNA 3N9UC 1S9EB 4PRFA 5F3ZA 2BEFA 3W5XA 5U47A 1PJ7A 5E3PA 1XIQA 2X51A 3IGNA 2FZGB 1N54B 2OPRA 5ETTA 2KJWA 3KFWX 4CT8A 1IKVA 2RE1A 3BKUA 3KG1A 1DAXA 2HAIA 3ONQA 3KUHA 2BACA 5DLGA 4F4WA 4CLZA 1XR7A 2XLIA 3SQOP 1FXDA 3OVAA 1S97A 2V69A 3R3TA 1TMMA 3IMQJ 2XZTB 4K4SA 4DUZF 2VQEF 2CQPA 2YH1A 1KOOA 1R0AB 1G7CB 2W2OP 3W60A 4NZ0A 1PC5A 4LUBA 4A4JA 1Q8IA 5GAEI 5DG8A 4ZN3A 3QO9A 3I87A 1SIZA 2GC8A 4AL6A 5ETMA 3BO4A 1NHUA 4KKOB 2CQ2A 3ZZTA 2C2KB 2W8LA 5AE1A 3HSGA 2KVIA 2VQFF 1FKOB 1NAQA 1SIWB 2D3UA 3G8QA 2CZVC 3PYDA 5KFWA 1DARA 2HK2A 2MLXA 3UVJA 3SCKE 3HP6A 3CCJS 1XMBA 3J7YI 2C2EA 1RT5B 1T02A 3HKWA 1QSLA 3K57A 1RHJB 3DCAA 4L6V3 3Q8QB 4IKAA 3CULA 4JI1J 2H4WB 3HFZB 1RWUA 1MN7A 4N5SA 2BXJA 1VJWA 4QW8A 3OVBA 2ZZMA 3DLEA 5GMDA 3SYZA 3UDVA 3K7RA 3K17A 3QATA 3J81U 1PBUA 1IKXA 4PWWA 2MQ8A 4EMDA 1SJFA 1N0UA 5EGYA 5AE2A 2HFVA 3GFXA 1H3DA 1DLOB 2YQ3A 1MLAA 2YNIA 3NRBA 2FJVA 3K5MA 4OX8A 4IFYA 4NASA 1U0HA 3DI6B 2KG1A 2VB6A 1GEHA 1PYTA 1J5EJ 1GXUA 3G4SS 4DL6A 4JI0F 3DOMA 2RRBA 2FY8A 3BV8A 3OTEA 1C4AA 5L1KA 1DQ8A 4BWJA 1RWVB 4KGXB 3KJVB 1FX2A 3O3LA 2NPIA 2XC9A 1GX6A 4Y6IA 4YUDA 1HKAA 1HWJA 2KN4A 2WSEC 2MY7A 4IG0A 1PCAA 4LF1A 1FRHA 1WF2A 3NNAA 3EJMA 6FDRA 1BHNA 3V81A 2V0NA 3LALA 3N6NA 1XMQJ 3VAMA 1U1QA 3IP0A 3SCIE 2G0CA 2BJ8A 1RBAA 4RWXA 5DDPC 4NE9C 2KB2A 3T1YJ 3C66A 2WBMA 5A8KA 1HBUA 5EX3A 5LXRA 1KS2A 1DTQB 2GQQA 2BQRA 2K1RB 3B54A 1WI6A 2CJQA 3JYTB 3QMQA 2ZH8A 3MPVA 2R7TA 1EP4A 2DEJA 4NCBA 1CJUB 2AKWB 1ZTWA 1EKRA 3V2UC 5CYQA 5KT3A 2Y0SD 5DGAA 4KAIA 4J91A 2IDLA 2L9WA 1S12A 1MG7A 4LBIA 2ZC3A 3MPUB 4DSLA 2HIYA 2W2PP 4CNZA 5H9FJ 4ECYA 3CC7S 4JB8B 2W1BA 3VALA 3OVSA 1QVFR 3MMCB 2ZHBA 4U9RA 1NMEB 1N36F 5KFJA 4QZVB 4ZLNA 1UEKA 1RHRB 4I64A 2MKHA 1WC1A 2WHOA 5KG5A 2MZTA 4JI6J 2MYFA 3ZZYA 2AZ3A 4CI0B 2R2UA 4FYYB 4B3OA 4LF4J 2CWXA 3OTBA 4C3LA 3MM5B 3KOAA 3RB0A 4A8OA 3JSRA 2E1RA 3ULHA 1IBMF 2VG6A 2CQ3A 2PI4A 1Z2LA 1SL1A 1ZA1B 2VOOA 2J0XA 1T9VA 2POKA 5B0AA 2AF6A 2DNYA 3LAKA 5BXIA 2A1BA 4MYUA 3CO0P 1Q16B 2I6WA 3T6JA 4QU6A 2JEFA 3IFEA 2I38A 2QMXA 1UA0A 4HR2A 2XSJA 4DSFA 3HFVA 2WB1D 3H4DA 5CYJA 3QJJA 4YR3A 1O51A 2GJIA 2W9CB 4JI6F 5HI7A 2HZVA 3HHLA 2MJNA 8RUCA 3AOBA 4LF4F 3HZGA 3K0JA 2DH7A 2DD8S 2B43A 4NMLA 1RTHA 4EWTA 4C98A 2YWKA 4JV5J 4IOBA 3FQLA 2WW8A 5H1SV 1U25A 3G82A 4ZVRB 1DJ0A 1HNXJ 1ZTTA 2HHQA 2R9LA 3M32B 1JX4A 3FBBA 1EHWA 2IC3B 4O3OA 3RAMA 1VQ7S 4FYVB 2PIIA 2JEIA 4YB1P 2P5VA 2YQ1A 3DRPA 2V94A 4YDXA 3UN5A 5LMNJ 1HIYA 3E51A 4ES1A 2IAJA 4D3HA 4DV1F 3AA9A 4LFBF 1SL2A 1LFWA 1Q8KA 3MMBA 1V9OA 4KH0B 2XGQA 3MPYA 5LSRA 1TKXA 2AW0A 1S1XA 2V2VA 2IVFB 4KPYA 5GAEU 4OMFG 3OTOJ 1IQZA 1EB0A 4BHQA 4CM0A 2YNFB 4IFVA 1HFEL 3FCVA 1CULA 1VDHA 5A0YB 1SJ3P 2CPYA 1H2TZ 1LWEB 1VLYA 3EX7B 1MU2B 2A3JA 2RQCA 3J7YU 5DZ7A 5IS2A 5D3GB 1F60B 1SB6A 3PO4A 5K14A 2W7AA 4WWSA 2IFXA 1MW7A 4E2FB 3EXYA 2GIFA 4M5JA 2WVFA 1RISA 2HQCA 5ETNA 2JFDA 2KKHA 5D0HA 2FB0A 1S1UB 4P2SA 4BC9A 3MEDA 4NLRA 1NB2A 2EK1A 1B7FA 3DGPB 5M2PA 2UUWA 1C0TB 1CG2A 1OSCA 4TU8A 1X0FA 3IRWP 2BKNA 4PPZA 2K06A 2OHDA 2X7IA 1RT2B 1FFSB 3U1LA 2MZSA 2FHJA 2DNZA 1EQMA 1U09A 3H5YA 2AEJA 4DV7J 4Y2MA 1RWXB 3IG1B 2BBEA 4I2PA 2GAGC 1SUQA 3GILA 2DNRA 1FWKA 5ETLA 1SQEA 3H42A 3TAQA 5L8RC 4NRTA 2MKKA 3O2IA 2GMHA 2DGSA 1FO1A 4ZLLA 2B9WA 4DR1F 4WU2A 1O5JA 1RAHB 5C25B 3KLEB 3OTCA 1IBKF 4DR5J 1IBCB 1U02A 1KDNA 2RNEA 3QRPA 5LT5A 2FVQA 3V6HA 5ADZA 4M5HA 4JV0A 2PEBA 3FJ2A 1VISA 2D1CA 1UJ5A 2WONB 3PR4A 3BGUA 1UJ6A 2XNRA 2QV6A 4CYUA 3IAS9 1CQMA 1SJRA 2KI2A 2DH9A 3H20A 3OT9A 3SQGB 1K8AT 2LQ8A 2DRDA 3NGUA 3KWMA 3SFUA 4OHWA 2Y3YA 2OH2A 4JBCA 5A76A 3FBEA 4DL5A 4NYPA 3TZXA 1NB7A 1SKRA 5DDQC 1YJ7A 3TW0A 4Y34A 1ICEB 4DR5F 3KK1A 3V6DA 4LF8F 3MGJA 1ACMB 4HH0A 1E6VA 4WFAQ 1S6UA 2JSXA 2VFRA 2VG5A 5EWFA 4NLDA 4ECRA 5F0WA 3AY0A 4V19X 2JHEA 4RW6A 1FXLA 1AUSL 2ZH6A 2JLFA 2WBRA 2ASLA 2QSFA 3SCJE 1K1QA 2PFFB 2WVBA 1EAYC 3R5GA 4IYQA 4DPOA 3MMAA 2UVWA 1FK9B 1KBRA 4F0HA 5KFVA 4LFAJ 2X1FA 2E1PA 4Q2MA 2GCFA 4MIWA 3NWRA 3ETOA 3P49B 3JAMU 3QT5A 2P9GA 3KTQA 5IWAJ 1NEEA 3DMJB 4Q5VA 4FKYA 1RDRA 2J9CA 4JYAF 2NR0A 5F8LA 2EC0A 5KFMA 1RWWB 1UW9A 1VQYA 5E3QA 1FF2A 4DV0F 4K4XA 4ICLA 1WSVA 3CD6S 1FJGJ 3BSNA 1G1XA 2J76E 2DRBA 1KTVA 1LXJA 3NCPA 4PXDA 1HQ2A 4OZ3A 3CJTA 1FA0A 1R31A 3ENAA 1LNQA 5DQIA 3IXQA 1IM4A 4JI4J 2CJYB 1I1GA 5T7LB 4OYIA 1V3SA 1VQNS 2PGCA 4KSEB 1EIYB 5KG0A 3W9JA 2XMTA 2BANA 3MPWA 2AYEA 2E7WA 1MWZA 3JXOA 2ILZA 4QR1A 4B3RJ 4IRDA 1RWNB 2HLUA 2IBKA 1UWAA 1XK8A 4I56A 4F0MA 4USTA 2C3MA 4B02A 1JLBA 1TZ0A 2PO4A 3CCTA 3EICA 4K4YA 2YVSA 1HQEA 1WTFA 2F5GA 2FPHX 5KFAA 2G2OA 3NAHA 1WWHA 3NAIA 4F8RA 1KR4A 4RNHA 4KIAA 2F4VJ 2C2DA 3H98A 2XY6A 2MSTA 1RACB 4UOFA 3DLEB 1N32J 1CS4A 3OXGA 4L72B 1JLCB 1SV5B 1VC0A 2ZHOA 2YWWA 2HRYA 5I42A 1KVKA 3AJ2A 4CZCA 3RZAA 3PACA 3IR6B 2OMOA 1LV5A 4USKA 5HLFA 3QYYA 5KG1A 4U95A 5JUMA 3AXMA 3FMWA 3GG1A 2Q43A 4IFYB 5F9LA 1U0HB 2I8EA 4DQPA 3UD5A 2I2YA 3DOMB 3BM7A 6FD1A 2CQDA 1WF1A 1FX4A 5IC4B 3PHTA 4DCJB 1TKTA 2XLKA 4UQTA 4I6WA 2ZJRQ 5AT1B 2Y0BB 3H5SA 4LSNB 1B0VA 2L48A 3J80Y 1YIJS 2W4PA 5F8NA 4QIFA 4ECUA 4FVMA 3P5BP 4Q0BA 4WZMA 1BD6A 1GT8A 2LECA 5D4LA 5F8MA 3GSDA 2KT5A 2ZBPA 1QJHA 4C48A 3P5TL 3GCWP 1WKKA 5A8KB 5KFDA 4GVBB 3D1QA 3QWPA 2VPYB 2KTQA 1IKWA 2UXDF 4WTYA 3WIVA 3WHIA 2DB1A 1ZZNA 4F2SA 3F73A 2ILYA 5CYQB 2P2CB 4ZCIA 3ILIA 3OR2A 3UQSA 1UW4A 3OSPA 2HPUA 2ZFHA 2HGNA 4BS2A 2XB2D 2HNZA 2VZ9A 3NY0A 4ECTA 5FLXY 2MQNA 2YNGB 4CLKA 4DV2J 2PN6A 4LRDA 1XR5A 1SJ4P 1XEZA 3L7UA 3L9ZA 1NHVA 3RRHA 4OJHA 3MCMA 2XGPA 3W63A 4UF4A 2Q79A 4NLOA 4KPCA 3V4MA 3MHYA 4J9UE 3U7JA 1RA7A 4TXSA 3KKFA 4IRKA 4B3OB 3D1HA 1V6HA 3OLAA 1VBZA 3C2PA 2UUBF 3OJSA 4DI6A 4DN9A 3D6HB 2P6SA 3Q2TC 2DTJA 2Z2MA 4NA2A 3E2EA 1I94J 3E3XA 2MQOA 1F9HA 4PG8A 1DURA 4O44A 4OIXA 2RS2A 1F5AA 1NDKA 2QRRA 5M2UA 3VR1A 1SJ1A 1V3ZA 2BJ7A 4P2MA 2HIQA 5CHCB 2H9ZA 1RJJA 2CRLA 1G3OA 3VQSA 1NSQA 4ZITA 5ETQA 4F3QA 2RS8A 2V2QA 2XSJB 2V2ZA 3PEHA 1S9FA 1P6TA 3IN5A 4LF9J 1WG5A 3MM8B 5M2RA 1YJTA 5L9NA 1NCLA 2ZOFA 4DQQA 1U1LA 2RRAA 5ETOA 4IG3B 1HNWF 2DNNA 1NKEA 2R7WA 2H65B 1BQNA 2NUHA 2C2OB 2EFPA 2BA9A 4HHUA 2D9PA 1UVJA 1RTHB 5HL7Q 3MM6A 3R5AA 4PXBA 4USMA 1SPBP 1KFSA 2N7YA 3MFIA 4NPOA 1VK8A 5KFZA 2QN6B 2IVMA 4YEAA 2ABYA 4B17A 3MM7A 4PEOA 4ZCKA 1Q4RA 1S7IA 2QEXS 1FTCA 4B3SF 4J9LA 1BE4A 4PZVA 4PXCA 4O3NA 2IHR1 1SC3B 2H1YA 3FFIB 4B9VA 3MR5A 4GRSA 3GQCA 2IAJB 1FT8A 3W5YA 3HLUA 2QGFB 2HBRB 4BC7A 2CNNB 2EKYA 4PAAA 1REVB 1L3VA 1ZPWX 1BQXA 2KHCA 3GIIA 1VQ8S 3DLHA 1TKXB 3ZFVA 4IOCQ 2E7VA 1Y00A 3EGZA 1NK6A 1HMVB 2X1BA 4P52A 1CBKA 4KHRA 2XWXA 2XLJA 4IFVB 2GGPA 4EGLA 4DS5A 1CULB 1SJQA 1VC6A 1VJQA 3I5AA 1X4AA 3IS9A 4U8VA 3M8SA 2CQHA 2LXFA 2VBXA 4NCGB 4HDGA 1BC6A 1HL6A 4C8MA 3B8HA 2YWEA 2Y9HA 3QRQA 4GKJJ 4FZVA 5K14B 1IQTA 1OO0B 4LF5J 1B64A 4TU7A 3ZTRA 1S1WA 4JI7F 5THWA 1C0UA 4OHZA 2OEJA 4ZPVR 1YDLA 4GKKF 4I6AA 4TU9A 2XS5A 2X1GA 1EZZB 4JOUA 4FXVA 4MFBA 1VRTA 2Z57B 3KLHA 3OTDA 2DR5A 5AE3A 1Q5YA 4IR1A 1JLGA 2O67A 1S76D 2ZH1A 4J37A 2DPJA 2MB0B 4CLYA 2J9EA 3CCZA 3FEXB 4ENOA 2HZAA 2CNOB 2ERRA 1KD1T 5CYMA 4OZJA 4DS4A 3BGFA 3KLFA 4JI5F 3F41A 3M8WA 3AJ1A 2AJ1A 3FMBA 4PKDB 4LVOP 1WG1A 2Y8YA 2JLGA 1ZZFA 2G2ZA 1KLMB 4X64F 4X4QA 1QD1A 1W25A 2OPQA 2ASJA 1HD1A 3EM1A 4HT5A 4J7CA 4FS2A 1OQ3A 2N4CA 1EJ7L 2ZVSA 3CC2S 2J7WA 2QL9B 2OTLS 2Z8QA 1U8SA 3BZQA 2DXEA 1UP1A 4WP9A 1T11A 2NPFA 2ZD1A 3TJ8A 4PWDA 3MMJA 3NGTA 5C24B 2ZE2A
chains in the Genus database with same CATH topology
4QWEA 2ROGA 4EYHB 3BSOA 3ITHB 5KFBA 2QIFA 2QO3A 2MQPA 2KFYA 1R89A 3JYTA 4B9NA 4Y28C 4QQBA 5DG7A 3I6PA 3MTJA 2HWTA 2YH0A 4ZCLA 4ILMA 1FE0A 3SV3A 3KLIB 4I1TA 1JLAB 3LAMA 4KC5A 5IT4A 1P27B 2HNDA 2C22A 5E0OA 2ZJPQ 3O8WA 3CCSS 2JC0A 4JI3F 1UL3A 3L7OA 4ZOSA 1Q8LA 3DM2B 3MAQA 3T19A 3IA0A 2UXCF 2XS7A 2WAQD 1C1BA 3CIZA 3G96A 5KFOA 2OP5A 5D4NA 2XZWA 1TL5A 4NL5A 4ZVEA 5J2NB 4DV4F 4V19J 3PDNA 2NSCA 3M2RB 5HO4A 4MKYA 3W2VA 4WF9Q 3W2WB 3M1VB 3SSSA 4NA3A 3OR1B 4PQUA 5HBMB 2JX2A 1VHFA 2F8HA 1X4DA 4G3IA 3THVA 3MR3A 3HXMA 4QIWD 5L1LA 1NH7A 1U24A 4K4UA 1MSWD 3DXBA 3O1LA 4RW9A 1ZPVA 4RU9A 5IFMA 2UV8A 2AU0A 4OZ0A 3D2WA 1M90T 4OI3A 2XO7A 2F4VF 3N5FA 3RRKA 3CDEA 2KYXA 3TA1A 5F8GA 7FD1A 2IM1A 2OAUA 4K5RA 5B0GA 4Q2LA 5I4MA 5LXYA 1S0MA 4EYIB 1H6KX 1KQSR 4G1IA 1QAYA 4FNIA 4PXEA 2ASDA 3HK2A 2J7KA 3FGVA 1N32F 5I3PA 2B9XA 3D0HE 4OI6A 3UR0A 4QW9A 2L9NA 5IM0B 3JSMB 2R7XA 1KONA 3KHLA 1RT6B 2CPZA 4CO5A 3HHEA 2L9DA 2GO8A 2HNYA 2BUNA 4NXMF 1S1VA 2NUUG 3N9UC 1S9EB 4NLVA 3QPIA 2ZUGA 4PRFA 5F3ZA 5U47A 5E3PA 3EZ5A 3MM6B 4DL4A 2X51A 3IGNA 1XNQF 1N54B 2OPRA 4C0BA 1RTIB 2C3YA 1WHVA 2KJWA 3KFWX 4CT8A 2VPZB 1IKVA 2RE1A 5KG7A 4NA1A 4H54A 5CXTA 4YQWA 3KG1A 1ZYQA 2NZ4A 2N7CA 1HBNB 1DAXA 2HAIA 3GR0A 4GO5X 5KG3A 1K73T 3ONQA 3I9ZA 4ZVHA 1GXLA 2BACA 2VG5B 5DLGA 4F26A 4F4WA 1YSJA 4CO1A 4FBTA 2DGVA 4ZPTR 1XR7A 3DRRA 3KNGA 4DN0A 3MM7B 4ECZA 1OPIA 1YBAA 2XLIA 2V8HA 2AQ4A 1BWEA 3UDCA 1XMOF 2BDPA 1JJHA 4ED7A 5E33A 3I82A 1FXDA 3OVAA 1S97A 3I4HX 3R3TA 3BR9A 5F9NA 1CLFA 4OV1A 2FJDB 4ELTA 2KH9A 4FF4A 3TQ1A 3NKYA 2JL9A 4K4SA 4DUZF 4BDPA 3OSNA 3KHHA 2R2SA 1LOUA 5IZHA 3MMAB 2VQEF 2CQPA 1DZ5A 2YH1A 4B9MA 3MUVP 2MQMA 1KOOA 2M8DB 2NS1B 2AV5A 1XTZA 3DOKA 3CVKA 5FDLA 1R0AB 4ED1A 4DL7A 5L39A 5JVHQ 2GV1A 1TVRA 3MM9B 4C0HA 1G7CB 1X5SA 3H5UA 3CEDA 3CCVS 4EBCA 3PFOA 1YJUA 4NZ0A 3UCZP 1PC5A 3SCLE 1PO6A 4IH5A 4LUBA 4A4JA 1GQEA 1Q8IA 5GAEI 5DG8A 3QO9A 1LFPA 3PIPQ 3I87A 1UEUA 3TUZC 1SIZA 3O6QA 2LQJA 2GC8A 4X4PA 4AL6A 3K5OA 3BO4A 4PG4A 1HNZF 2HS3A 4A8QA 1SH0A 1WACA 4R8UB 1NHUA 3PXGa 4Y2AA 5KFGA 2LKZA 1H7WA 2AGQA 5SUHA 3I5BA 1N56A 2EW9A 3RAXA 4YFUA 1UVKA 1UETA 4C2MA 4TQRA 4KKOB 2CQ2A 3ZZTA 3MXHP 2W8LA 2D41A 5AE1A 1X8DA 3LGMA 4DL2A 2KVIA 1EETA 1CSJA 3SDEB 3TA2A 2ZH3A 2VQFF 2W9CA 1FKOB 2RILA 1HI1A 1NAQA 3C6TB 2R8HA 4N77A 1SIWB 1LWFB 2GIQA 3M9OB 2RQ4A 3OUYA 2D3UA 3G8QA 2CZVC 2EWHA 4AXJA 1TFYA 2UUAF 1MMLA 4EO8A 5KG6A 3IS9B 2GNKA 5KFWA 2B56A 1DARA 1VK3A 1DTTA 3SCKE 1HWUA 3HP6A 5KFSA 3OXLA 3CCJS 1XMBA 3J7YI 3ZZZA 1HA1A 4B08A 4EBEA 1FESA 2CJAA 2C2EA 3R5CA 2R8JA 4DBQA 1RT5B 1FJ7A 1HNVB 4ICLB 5J2PA 4XPCA 1T02A 4DQIA 5KT6A 3HKWA 1FRJA 2ZKUA 1QSLA 3K57A 1JLFB 3P96A 4DG1B 1JLEA 3DCAA 2HQ3A 4L6V3 4FN5A 3Q8QB 4IKAA 2OLWA 1SH2A 4Z37A 2B51A 4F4XA 1S4FA 4IO9Q 4PCQA 3CULA 5T41A 2K3KA 4X4RA 1RWUA 4C8NA 2KDOA 3T1AA 2EFVA 4N5SA 4UUWA 4ED5A 2BXJA 1J2VA 2MY8A 2Q6CA 3PVXA 1VJWA 2FHJD 4QW8A 3OVBA 2CQIA 1AFIA 3TO8A 2ZZMA 2UZAA 3DLEA 2RQKA 3CCMS 3SYZA 2AP6A 3NCRA 3K7RA 1TK8A 1GTHA 4O23A 3Q23A 2M70A 4ZDNA 4WIIA 1E6YB 4OJGA 4J9NA 1S1WB 1D8ZA 4YB7A 1QUPA 3TANA 1HBOB 1IKXA 1LW2A 2BANB 2I9SA 1SJFA 5A8WB 1N0UA 2F9JA 3X1LB 4DDFA 5EGYA 5AE2A 1W2IA 3GFXA 1H3DA 5KT7A 3NGKA 4RUCA 2AYGA 3BO3A 1DLOB 2DHSA 4LT6A 2GJ2A 1Y7PA 3PR5B 2FJAB 1FDDA 1VRTB 4DV2F 2YQ3A 1HPZB 1ZOTA 2DGOA 3KLHB 3GV8B 4O3RA 4NZ6A 1U1OA 1JB0C 4ZCMA 2YNIA 2RKIA 3NRBA 5B0DA 2FJVA 4RW8B 2IBOA 1U7LA 4TY8B 3K5MA 5CZVA 2P9EA 1HHSA 3UD3P 1F0XA 1JLGB 2FHKA 1RTDB 4N41A 4OX8A 4IFYA 2IYGA 1SC6A 5K8MA 4DSEA 3I0RA 1JLBB 2V4JA 3DI6B 4DR2F 2XHWA 2ROEA 2KG1A 2VB6A 3N01A 3JTNA 1GXUA 5HMXA 5B0FA 1HQEB 1KFDA 3G4SS 2E5JA 4DL6A 1K0VA 4JI0F 1ZM3A 3DOMA 1TV6B 2RRBA 3OTEA 3DDKA 4QPXA 3RW6A 1C4AA 5L1KA 5KAKA 2EFOA 1DQ8A 4BWJA 3G8TA 3V6KA 1KVJA 3EUNA 3KJVB 4KRWA 3O3LA 2NPIA 2E9RX 1SI9A 5CYMB 1KHVA 2XC9A 5BYQA 1GX6A 3H40A 2HRUA 4Y6IA 4YUDA 2FDNA 2RIJA 3MOZA 2AX0A 3HHLC 4IO1A 4CNYA 3M6XA 2YNFA 1S9GB 4X4VA 2XMUA 1Y5NB 1HWJA 3TP2A 2KN4A 2WSEC 2MY7A 3UPFA 5A0YA 1Z4UA 2MPUA 3RB4A 4IG0A 2FVSA 2O66A 3IGVA 1R8PA 2N82B 2YKNA 1LWEA 4Q7AA 1YG0A 1U45A 1FRHA 3KK2B 2WSCC 2F9DA 1WF2A 4G1PA 4QYRA 5DDRC 1I94F 1JK9B 3NNAA 3PX6A 3OXFA 6FDRA 1MU2A 1WNEA 3RYLA 1RT7A 3V81A 1N48A 2V0NA 2IJNA 4UY8T 3AAWB 4YP3A 3GV7B 2Z0GA 4WFZA 3LALA 2IRYA 1ZAVA 3N6NA 1X5TA 3VAMA 1U1QA 1CC8A 4C3MA 3OL8A 2ZITA 4NLTA 3SCIE 2G0CA 3RR8A 3QIDA 4N8NA 4QBUA 4CH1A 4DWIA 2ZBCA 4C9DA 4KJIA 2KM8B 1U49A 2WB4A 2HG4A 4RWXA 3I56S 3KMSA 4H4KC 1FERA 2CIMA 5DDPC 4LSLB 3N6LA 3NGDA 1N6QA 2EFNA 2KB2A 4RZRA 2YWFA 1YJNS 3C66A 5D3GA 2DPIA 4R0EA 3MF5A 2OPSB 2HW3A 1MROB 2WBMA 5A8KA 4ID8A 4NLSA 4DLGA 3V6JA 3R1LA 1CPZA 4F67A 2LQ5A 1TL1A 2UP1A 5CCMA 2ZD1B 2ALZA 4Y00A 3HVTA 1X0PA 2GMLA 1HBUA 5D77A 5EX3A 5LXRA 1KS2A 2CVEA 1DTQB 4YMEA 3MEGA 4PWDB 2GQQA 2RQMA 3WC0A 3CDUA 2BQRA 4WFYA 2K1RB 2HYIB 2HGMA 1S1TA 4LF9F 4YDDB 2CQ0A 1LQ9A 1WI6A 2CJQA 3K8VA 3GIJA 2HMIA 2AYBA 3MZIA 4E0DA 3HI9A 2BQUA 3JYTB 7FDRA 3QMQA 5KT5A 2ZH8A 5GAHI 3MPVA 2R7TA 1X7VA 1EP4A 5DETA 4NCBA 1YJVA 2HNDB 3GB0A 4KR0B 3HFKA 4J9QA 1ZTWA 3V2UC 2JFKA 1S1UA 1FXRA 5CYQA 5KT3A 2Y0SD 1OSDA 2YX1A 5DGAA 2R8GA 4OLPA 5BYRA 4CT9A 2XI3A 4KAIA 2GFFA 2DK2A 2WRMA 4DEZA 2M0GB 3DGPA 3V5RA 2L9WA 3PM9A 2E5LF 2CPIA 1RYSA 1M0SA 1TKTB 1C0TA 2OD6A 4M8LA 5K5MA 1BQMA 2ZC3A 4DSLA 4IOAQ 4RW9B 4IDKA 2RMLA 3S1TA 4CNZA 4KE5A 4WE1B 3IWXA 3TNVA 5H9FJ 4MTPA 5CCLA 4ECYA 4Q8FA 3CC7S 4PR6A 3I96A 3VALA 1JNZB 3ENVA 3OVSA 1VQ5S 1QVFR 3MMCB 1XNRF 2ZHBA 1WELA 4UY85 1DQAA 2YKPA 3OQ2A 1WI8A 4U9RA 1JWWA 1QM9A 4WU3A 1N36F 3BN4A 4N56A 5KFJA 2HNYB 1S1VB 4QZVB 1HARA 1MNEA 4DJBA 1DFDA 4I64A 4RBVA 2MKHA 2FJEB 3IRXA 2KT3A 2LU1A 3IG1A 3D5MA 3MI7X 3NWGA 4U7CA 4Q44A 2WHOA 2XG8A 4ZPCA 4ZVGA 4DSKA 2CFXA 3UE2A 2A2DA 2OPRB 2ATLA 5KG5A 2MZTA 3BQ2A 1J5OB 2MYFA 2HVHA 3ZZYA 1YJWS 1Q86T 1IKVB 1R27B 4CI0B 2R2UA 1TR0A 1TUVA 2A2CA 3LF0A 3H59A 4OHVA 1Q7YT 4F4ZA 1T3NA 2QLXA 4O4GA 2QMWA 4B3OA 4WYWA 3OTBA 1PC4A 4MH8A 3CB4A 4X4NA 4C3LA 4I7FA 2FLLA 4OHYA 2IJFA 2FHOB 3MM5B 4J9OA 2VBZA 3KOAA 3KLEA 4DFPA 3RB0A 1RI7A 2CKWA 4C3KA 4MK7A 4URGA 2R2RA 4A8OA 5GAGI 5F8JA 3JSRA 5A6WA 1LW0A 3M9MB 4FF2A 2E1RA 4DSIA 4RW4A 3WBZA 2PE8A 3ULHA 1F2GA 1X4HA 2KRRA 3M05A 1Q53A 1IBMF 1ZAWA 2VG6A 2CQ3A 3QZ7A 4A8XA 2PI4A 4K50A 1Z2LA 3W7BA 1SL1A 4ED0A 1OS5A 1QSSA 5EX0A 4HDHA 4C8YA 2MQQA 1HHTP 2VOOA 1RK8A 2J0XA 1O8BA 2POKA 4K4TA 2BZ2A 3AA8A 1TAQA 3R5DA 5B0AA 2I0XA 2AF6A 2DNYA 2FTRA 2CPJA 3LAKA 3CJ4A 2OMLA 5EDWA 2E7XA 2A1BA 2F8MA 3DOKB 4MYUA 4LJMA 5FDLB 2HHWA 3LP1B 1TVRB 4MK8A 3PRBA 2J0QD 2HS0A 1Q16B 3OFGA 1DHMA 3T6JA 3RBEA 1FE4A 4QU6A 2XBPA 2LEBA 2HS4A 5C42A 3MECA 1VQ9S 4F4KA 2GHWA 2HNZB 3QO9B 2JEFA 2E29A 3IFEA 2PEHA 1HNIA 2I38A 2QMXA 1LK7A 1UA0A 3Q24A 5KFXA 5KFPA 3LQVA 3N79A 3CPWR 4FP9A 2XS2A 4HL9A 2XSJA 4DSFA 1L5UA 2LEPA 1Q81T 2VL1A 4QJVA 4Y65A 4ED8A 2WB1D 1HYSA 3H4DA 4C11B 5CYJA 4C8LA 2MZRA 1R6YA 4O0IA 3QJJA 1APSA 2AJ4A 2HLTA 4OZ1A 4YR3A 4J9PA 2O5DA 4N47A 1NJWA 4MKAA 1O51A 2GJIA 3GFYA 4NLPA 1IR0A 2W9CB 5DM7Q 1BY9A 4H4OA 4JI6F 3PRDA 5HI7A 3OUYB 2OFGX 2VG7A 3DLKA 2MJNA 3HHLA 3LH2S 1YJ9S 5KTQA 1KVIA 4GKJF 2DNHA 3O44A 1OWXA 1WHWA 1DTTB 4WXWA 4LF4F 3HZGA 1UFWA 3K0JA 2J6SA 4LF5F 3E8OA 2V8VA 4IH7A 2DH7A 1FRIA 2DNGA 1KOHA 2DD8S 2NXUA 3SSQA 2B43A 2F3JA 4FXWA 3A8EA 4I69A 3DLGA 2W8KA 1KEKA 4NMLA 1D9AA 1YQHA 4DL3A 2FJXA 1RTHA 2OPPA 2PD1A 4OI2A 1KQFB 2ZNZA 4EWTA 1H0HB 4HLBA 4C98A 3SZ2A 1VQ6S 2YWKA 3P6YC 1VQPS 1PGZA 1JLEB 4IOBA 1FKPA 3VTIA 1S48A 3FQLA 1VC5A 3TVZA 1FEHA 2WW8A 5H1SV 1U25A 2W24A 5D6GA 5KFNA 4CQ1A 4ZPWR 2QA4S 2LDYA 4I4BA 2C3OA 1UMJA 1DJ0A 2UV8G 4RKUC 1ZTTA 2HHQA 2R9LA 4RW7A 4ZA1A 4CCHA 4A47A 4KO0A 3M32B 1JX4A 1R43A 3DOLA 4QIGA 1ZETA 3N0VA 2VA2A 1R8AA 2IC3B 3UI3A 3LWMA 4O3OA 3HJFA 4H4KA 3VZHA 3RAMA 1JNRB 3CF5Q 1VQ7S 2A18A 2PIIA 2CJ9A 4RBUA 3TVYA 3QJPA 2JEIA 1FHTA 1T95A 1W2BR 1XR6A 4IRCA 1X9WA 4YB1P 2P5VA 1IKXB 3DRPA 5B0BA 3TAMA 4AUKA 3ENQA 2V94A 5MAOA 1IXKA 2VFSA 4YDXA 4OZ5A 5KFUA 2ZC4A 1JLQB 3NBPB 2FD2A 3FSXA 2UVVA 5J2MA 2HFOA 1R8BA 3EPIA 4AQ