2XBPA

A novel signal transduction protein pii variant from synechococcus elongatus pcc7942 indicates a two-step process for nagk pii complex formation
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
113
structure length
113
Chain Sequence
MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGSEYTVEFLQKLKLEIVVEDAQVDTVIDKIVAAARTGENGDGKIFVSPVDQTIRIRTGEKNADAIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords NITROGEN REGULATORY PROTEIN P-II
publication title A Novel Signal Transduction Protein P(II) Variant from Synechococcus Elongatus Pcc 7942 Indicates a Two-Step Process for Nagk- P(II) Complex Formation.
pubmed doi rcsb
source organism Synechococcus elongatus
total genus 25
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2010-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xbpA00
2V5HG 2EG1A 2XBPA 1UFLA 4OZNA 4RLEA 2ZFHA 1V9OA 1NH8A 5DS7A 3TA2A 3M05A 2J9DA 3O8WA 1UL3A 1KR4A 4USJC 1O5JA 2J9EA 4RWXA 4YB7A 3OPKA 3L7PA 1UKUA 2E66A 2JJ4D 1PILA 2GW8A 2PIIA 3MHYA 2J9DE 1VHFA 4ZK7M 1NH7A 2XG8A 1Q1KA 4RX6A 3NCQA 4OZJA 2DCLA 3GSDA 4R25A 2XULA 1V3RA 1NAQA 1XK8A 3AA9A 1V6HA 4USIA 2GNKA 3CE8A 2Z0GA 4Y6IA 3T9ZA 1H3DA 2RD5C 3AA8A 3O5TB 1UMJA 2NUUG 1O51A 4NYPA 3NCRA 4WK3A 4IYQA 5D4PA 4D3GA 3AHPA 3X3UA 2XZWA 4AFFA 5DRKA 2NS1B 1HWUA 4C3LA 3AH6A 5D4OA 4RWWA 4CO1A 1V3SA 4CO3A 3HLUA 4USHA 3TA1A 2NUHA 3LF0A 4E98A 4CO2A 1P1LA 4YB5A 4CO5A 1J2VA 5D4LA 1OSCA 3DFEA 1VFJA 1QY7A 4OZLA 4CNZA 3BZQA 4D3HA 1NZAA 4CO4A 4WK1A 4C3MA 5L9NA 2O66A 2J9CA 5D4NA 2CZ4A 3N5BA 2EG2A 4YB6A 1GNKA 2O67A 4C3KA 2ZOMA 4Y65A 4NYOA 2GX8A 2VD3A 4CO0A 3NCPA 4CNYA 3TA0A
chains in the Genus database with same CATH superfamily
3H5YA 2KDOA 3I0SB 3OJUA 4FS1A 1WF2A 2D3ZA 1U8WA 4MKBA 1JLAB 3CT9A 4IFYA 3PXGa 4TYAA 2ZOFA 1TK0A 5I3QA 3BM7A 5KAKA 1OPZA 1N33J 1FVSA 1BGXT 3SFGA 4DUYF 1KQFB 3CIMA 1WG4A 3AODA 2HHHF 2HVIA 4LIRA 4HVZA 2E1RA 1IJFB 3NXZA 1PO6A 1UJ4A 2RQKA 1H73A 2XS2A 2FY1A 3H7HB 3Q89A 5D4PA 3EYZA 1GXUA 4MT1A 3PIPQ 1N32J 1JXLA 1HIYA 2DIVA 4C3LA 3DRRB 2CZ9A 3LTOA 3RAQA 3UE2A 3W9IA 4B9UA 8RUCA 1IWAA 3GCWP 3I4HX 2JFKA 3DRYA 2LA6A 1HQEA 2HVHA 1YZ7A 4ZJQA 3RBZA 1YJVA 2FY8A 2RKIB 2M0GB 2HHXA 5ETRA 5EGYA 2OEKA 4W92B 4MAKA 3C3LA 2UXBJ 4OZ0A 2QRRA 2D41A 4LF8F 4F04B 3IBFB 1UWBA 3HHDA 4F8RA 4W4MA 3W2WB 3KLIA 4LF5J 2ZM6F 5FJ4A 5DZ6A 1RHUB 1TZ0A 2RD5C 4P2FA 3TRGA 4M5DB 1O8BA 4FKYA 1DHMA 2IVFB 2BV3A 1FX2A 1RGVA 3H2LA 4OJHA 3MEDA 3MOZA 2IM0A 4BLGA 2U1AA 1F1BB 2V2QA 1HPZB 4OHZA 3POTA 2UU9J 3R6GB 1YX2A 4X64F 1N5SA 1IR1A 4QU6A 3QIPA 4RPFA 4F50A 1U47A 2DNKA 2HGNA 3NMAA 4ED1A 2IBOA 4WFXA 2CPFA 1SVDA 4UQTA 3W8PA 3QAEA 1VQNS 2XMJA 1H72C 3VZIA 3V4MA 3PW5A 3HSZA 3E01B 4QYZK 4I56A 2MGZA 1HI8A 3SCLE 1HNXJ 2A3JA 4RW7B 5LL6d 5KFOA 4B08A 2ZH4A 2GC8A 1FRHA 1SKSA 2MLXA 3T1AA 1IWGA 2J6UA 4ZHRB 2CNNB 2XEXA 2D69A 2DGTA 1Y5NB 2FZCB 1VBKA 2DIUA 1IJEB 1HFEL 1Y3JA 2HVZA 1XMOF 1L3VA 4UY8T 2VG7B 1HWUA 1SV5A 2MKCA 3LQVA 3ZTOA 2K8GA 4X4UA 1I5OB 1Q78A 4MFBB 4HACB 3IWNC 2F1FA 4I67A 3MCMA 1U1MA 2HQIA 5D4NA 1LXJA 2ZOMA 4MIAA 4JI2F 4JI3J 5B0EA 1F2GA 5B0DA 1N6QB 4DX6A 2YNGB 2QN6B 1B0TA 3GPAA 4PXDA 4L72B 2FZGB 2DY1A 4KO0A 2IA0A 3M2UA 4TKTA 2ZEJA 2XZTB 5CYMA 5E41A 2HHSA 3FEYB 4OZJA 3CC7S 3ETOA 3KDOA 2UVVA 1HQUA 3CCJS 4GVBB 4RR5A 5GVQA 1S1XB 4DL5A 3NY0A 2I1RA 2P9GA 1FESA 1KHVA 3HFZB 3ZFVA 3W9JA 5KFNA 1F5CA 4OYPA 2YKQA 5THWA 3VGSA 4K59A 2YVSA 3AHPA 4PABA 5KG5A 3EDQB 5L9XA 3DDIA 2MSSA 5LOQA 2W4DA 1YITS 4OZ2A 4DR5J 1HNWJ 4PAAA 3KLEA 3WC2A 1QE1A 4A8QA 4X4NA 2DK2A 2W01A 2ZVIA 1PJ6A 3FC9A 3GG1A 1DAXA 4K5SA 1KQKA 3P49B 1Q5VA 5F8MA 4NZ7A 3QWPA 6FDRA 4OLPA 4DV7F 3GZ7A 2C2EA 2KXFA 1Q7YT 2CXEA 3CC4S 3HJFA 3FBFA 1HMVB 4ED0A 1RK8A 1GMWD 1CJVB 5J2PA 2DCLA 2YWHA 1FD8A 1WI6A 1TKZB 3IRXA 2WZ1A 3OL7A 4FYDA 2JEFA 4QIGA 1KRPA 3AA8A 4HT5A 1U2FA 2GQCA 4WCEQ 1RTHA 4DV5F 2RIJA 4U7UD 2CPJA 5B0FA 5ETLA 3PV8A 4M94A 2CADA 5JJBA 3OUYA 1GQEA 2RF2A 3NOGA 3S7RA 2R8HA 2DXDA 5AT1B 1LW2B 4OYOA 4U8YA 2BKNA 1IQZA 3EPGA 3FUYA 2DGOA 1W26A 3J80Y 2HRTA 3KK1A 4KB7A 2R7SA 5K8OA 4WE1B 3D2WA 1I51B 2FJDB 4I2QA 2I6WA 2LXUA 1RT4B 2ZC4A 2PFDA 1PC4A 1NSAA 2V2KA 4Q0BA 3L3CA 4CP5A 3KMSA 2ZBRA 2WOMA 3NP5A 4PWWA 5LMUF 1CEZA 4O44B 4OI4A 4BHQA 1VK3A 2ABYA 3EGWB 3MPWA 3AD9C 3IS9A 5E3QA 1RSCA 3RB4A 1RDRA 2GVDA 1NJZA 3MM8A 1HNZF 2GFFA 2FJXA 3T9ZA 3I5BA 4LT6A 2IMWP 1URNA 1FNMA 3O44A 1C1CA 3N6LA 1YKWA 4A8WA 3SYZA 1TL3A 2YNFA 4FF2A 4FXVA 1IN0A 1YWXA 4TU9A 3S8SA 4C0BA 3J7AN 5K5MA 2GHPA 1SKWA 2W4CA 4DSLA 3G6YA 3BDPA 5A6WA 3F0NA 1SB6A 4KGXB 3Q83A 4LFBF 5D4LA 1Q16B 3DFEA 2V67A 3W62A 3I82A 1FEEA 2VPZB 4CO4A 4WXWA 5DG9A 4YDXA 4JV5J 3BGRA 4WTOB 1SJRA 4Y65A 3D3CJ 1RTDA 4OJ1A 1H2UX 1S0VA 3J7ZT 5KFTA 3M2RB 4NLPA 2OPRB 4G65A 3BPSP 3SSSA 2CJ9A 4YB7A 3MDFA 1Z2ZA 3RU0A 3Q22A 1RYRA 3DLEB 1HNVB 1E6VA 4DV6F 1T9YA 3RG6A 1WC5A 2VPXB 2CQ4A 1QSYA 1AROP 3T6BA 1N34F 2KL8A 5DDPC 2B4OA 3IWLA 2DHAA 4WTYA 2B7CB 3FEZA 1RT7B 2DNHA 4DF4A 3C66A 3MR2A 3UFCX 3J80U 2CJBA 1RT6A 2C1EB 3AH6A 3AB2B 3T5KA 4C8KA 3MUMP 1UVNA 1S1TB 2H54B 5C42B 1N5YB 3VTIA 4EI2A 2BABA 3JS9A 4P74A 1Q8LA 3IRWP 1U1OA 1NK4A 1EJ7L 4XDCA 4RLEA 5DS7A 3C14A 5AXNA 4QW9A 4LFCJ 4KGKA 3O3LA 3HK2A 4QYZJ 2K7KA 2FHJD 1XR6A 2KN4A 2EW9A 1RWVB 4NEYA 4KV8A 3M32B 1NJXA 2RS8A 5CCLA 3UR0A 4YHHJ 1C0UA 2DJWA 2WVBA 1G7CB 1P1TA 3GV7B 4NLOA 2FDNA 1VRTB 5LSOA 1ZPVA 3F44A 2HK3A 4M5KA 2ALYB 4PG7A 2XHWA 3MECA 4NPOA 1B0VA 4CO1A 1JB0C 3TA1A 1XTZA 4F3OA 3TQ1A 2XYPB 4XIUA 4Q44A 3KK3A 1R8CA 4KFBB 2GVZA 2GMHA 4DFKA 2W25A 4WZMA 1F0XA 5J1EA 2O66A 5KT7A 2AEMA 2EG2A 1AB8A 5MLCV 4GC7A 4DFPA 4ES2A 1FRXA 1RTIB 2BE7D 4B02A 2YKMB 4A8SA 4TXSA 2HHPA 3RRGA 2HMIB 1QDUB 3OTOF 3BO3A 1UJ6A 1TUVA 1B70B 1KOHA 2QSWA 3SDEB 1JLQA 4JB8B 3IP0A 2RE1A 4I69A 3MR6A 3TUZC 3B6BA 4F4WA 1A9NB 2WVDA 4H4MB 3G6XA 4WBFA 3E2EA 3GFZA 3IAS9 1IKVA 3QO9B 2O3DA 3LGNA 4UT4A 1FE4A 5IQQA 1K9MT 3I9V9 1OQ3A 1S7HA 3BYPA 3G2XA 1SCJB 4IG3A 3JYTA 1V3ZA 3MAHA 2IHR1 3MM5B 5BYSA 2DNPA 2NCKL 5HQLA 2E5IA 1S0OA 3H20A 4ED4A 1SJ4P 3DOLA 4J9RA 2PA3A 1KP6A 3T1HJ 2GHVC 3EUNA 2DGSA 2Y0BB 3BEGB 2P6TA 2X7IA 5DLGA 4KE5A 1CPZA 4NCBA 2MZRA 5D0GA 4OYBA 3VAFA 3D3BJ 4X4QA 1S76D 1H7XA 3OL9A 3GMGA 3C2PA 2VBXA 2FLPA 4B9NA 4DR1F 4LR7A 1FNXH 1XEZA 3QMQA 4PWDB 2M8HA 3B78A 4K4WA 3Q8RB 3PHTA 4GVLA 5E3CA 3T5LA 4F4YA 2OEMA 4ELTA 5CYQB 4FYWB 4P10A 5EWEA 3EE3A 3OQ2A 4YY3F 2MQLA 4CLKA 4X84A 3H40A 3GLJA 4TY9A 4RBUA 1HBNB 2CJXB 2O01C 3VVUA 4HI1A 5DDRC 2QFJA 2GGPB 2A6OA 2HQCA 2BJDA 3I56S 3OR2B 3I9ZA 2OTLS 4FF3A 3KJFB 4DR2J 1NBEB 2PMHA 4UY85 5D77A 3HXMA 3FK4A 1Z2LA 1LWFA 3IR5B 4E98A 3KJVB 2R2TA 3OFFA 2JC0A 1U1PA 1Y10A 2WVCA 2VASA 2I2YA 1JLEB 2KM8C 2HYIB 3FQKA 3SCKE 4J9NA 3BDEA 1P6TA 2DD8S 4CNYA 1KONA 1WOPA 3D6FB 4JUZA 2MEWA 3CCLS 2VG6A 4ECSA 3GFXA 2UXCF 2H5IB 5AJ3F 3UDCA 4W98A 3PRDA 3FFIB 1X5OA 3NS5A 3UDVA 3MR5A 4F3MA 3PKMA 3DOMB 4KYZA 1X4GA 1RYSA 3M8QA 5K8NA 2ASJA 1TUGB 4A8FA 2FIUA 1Q1KA 4KGVB 5L38A 1WC6A 5HBMA 1FE0A 3R8YA 1F60B 1BQNB 2DBBA 3C6TA 1NK0A 4A48A 3GIMA 4C8OA 5HVFA 5IXUA 4WZQA 3K7RA 2HWHA 3FDSA 3HM9A 5K14B 5GAGU 1OYEA 3NGTA 2E5GA 1RWKB 3MAQA 2ZWOA 3CCTA 2A1BA 1R0CB 3PJWA 2W7AA 2LEBA 2IAJA 1J5OA 2WVEA 3CCZA 4YS2A 3H2UB 4ZPVR 1AXQA 1BMQB 1TVRA 1VFJA 1NUEA 1K0VA 2D9OA 1NZAA 3R27A 2YNHB 4A8OA 4NLRA 3Q8PB 3QRPA 1QAJA 5J2NA 1OY6A 3NBPA 4LQ3A 4MIWA 5C25A 4I1TA 2OPPB 3QFHA 1X31C 1OJ4A 1RI7A 4QWBA 2J7UA 1X4DA 1MN7A 1D8YA 3NAIA 1AT1B 2HBRB 2K06A 2W2PP 5D6GA 3OVAA 1VHFA 4DCJB 2RHQB 2HPUA 1D09B 1FCAA 3R97A 1S1WB 4CYUA 1VHIA 2FHOB 1N8RT 3OLAA 2UUCF 2XY6A 2ZH7A 1XNRF 1N5VA 2MY7A 2AQ4A 1SL2A 5IV3A 4C9DA 4B9LA 1Q8BA 2E7VA 5HLFB 1VBYA 5F0UA 3BGLA 2AJFE 4PG6A 3VAHA 4JI0F 3PVXA 1UVJA 3V81B 2V8VA 3C46A 1SJFA 3V2UC 3EWGA 1Y00A 2H1YA 5GMDA 3FSYA 3KLFA 1UTAA 1S59A 2XSJA 2KH9A 3MR7A 3IC1A 3ZC4A 3R5CA 1MMLA 2QLBB 3FCWA 1W2IA 2P5VA 4E2FB 1TL1B 3BYRA 2ATLA 1NJWA 4NCGA 5G0RB 3N6NA 3BQ1A 3D0IE 4HDHA 4FXWA 2CQ3A 4YR0A 2MQMA 5T14A 4JI6J 2Z57B 1XMQF 2UUBJ 1PAUB 2W24A 4OYAA 1PCAA 2GIRA 1JLBB 5BR8J 3CCRS 2Z2YB 1K1QA 1RWOB 4DSFA 3D66A 1EP4B 1B99A 1JK9B 2HZVA 3ZTQA 4DUZF 3KLVA 2IIHA 4NZ0A 5D15A 3M1VB 1S7IA 1M1KT 2EPIA 3SIPB 2JVOA 3I31A 5C2GA 2Q6BA 4KGZB 2R8JA 1UZDA 3TAQA 1Q8IA 2CJQA 2EC0A 3HD2A 3CDWA 3ZZOA 3WX4A 4IDKA 2N82B 4IQMA 2BE2B 3B54A 2HWIA 3CJ5A 1GFWB 4OFZA 4ILLA 1KD1T 4NLWA 2I38A 1L3KA 3KLGA 1S6OA 2W4PA 3FSIA 2KYZA 4USWA 1P9QC 4YOEA 2KHCA 3J7Z5 2G2ZA 3N28A 5KFBA 1JKHB 4YR2A 3IG1A 1BE4A 2GO8A 2NREA 1R0BG 3KLHA 1ZTTA 1HR0J 5KFAA 1GMWA 3IM9A 4EBDA 1Y5LB 1WOSA 4B3OA 2NR0A 4J9UE 1VQ7S 2J9DE 3HCXA 4RL1A 2Y1LB 3MTJA 3B4DA 2FQQB 2ZBQA 4B3RF 2ZD1B 2HRUA 1RAEB 3ILOA 3OTDA 4ZN3A 4ZITA 2V63A 3R1LA 1SC4B 4O0IA 2R2UA 4CH1A 3HULA 1NXIA 4P6QA 3F73A 2EC2A 1YQHA 2IRYA 3M8SA 2GIQA 3G8SA 2KZZA 3TW0A 1X4BA 4H4KA 1UW9A 1Q8KA 3VAIA 2Z2LA 3DLKA 2YH1A 4JI4J 5KG3A 3JTPA 3R9LA 3H4BA 2WCXA 4I4BA 3HVTB 3NGSA 2W9AA 3DU6A 2MYFA 1H2TZ 2DR6A 5AE1A 4ZA1A 2Y1JA 1NZ8A 1SQFA 1U6ZA 4M5HA 3CUNA 1HQEB 2Q66A 2VFUA 3Q8VA 1XNQF 3MM6A 3GG0A 2XLIA 2V4QA 1UFLA 4PRFA 3F56A 4IO9Q 1G1XA 2XQCA 2R7XA 3DCAA 1QAXA 1CG2A 4K50A 2CQ0A 4NL5A 2IVMA 1LWEA 1HLWA 2BRLA 8ATCB 1YBUA 1ZZNA 1U49A 4O3NA 4KIAA 3LAMA 5I42B 1EZZB 1KVIA 2CDRB 4RBTA 5KFSA 4IRKA 3MPVA 2KB2A 3CJ4A 4FVCA 4UZCA 5KT4A 1VLOA 2XHCA 4OX9J 5H9FK 2SXLA 5ETKA 1RWPB 2KT2A 4EBEA 3GYGA 3VGVA 2FYXA 5GAEI 2DHGA 4LRFA 3AY0A 4PQAA 2MJUA 4NMLA 5U47A 4ECXA 4JBCA 3WX8A 1TK8A 1KVJA 2LU2A 4OZLA 3I32A 3HHKA 4I6YA 1F5AA 4NE9C 4RZRA 4JP8A 4Y00A 2YQ3A 2A2CA 2YWKA 4U67Q 4M95A 1YJ9S 2CNKB 2C22A 4ZDNA 3ZNJ1 5F41A 5KFIA 3QAUA 5J1PA 3OBIA 1KN6A 4OHVA 1YZ6A 2VKZG 4G3IA 2QYGA 2ZH5A 4FP9A 1VBXA 1T11A 3CJ2A 4WWSA 2KO1A 1FRKA 1T9UA 4DUTA 4M8LA 1NDPA 2XS7A 2MQQA 2MY8A 2OMLA 4QWEA 5KFJA 1IKWA 2QL5B 1WNEA 1UVKA 2L08A 3HSDA 1FJ7A 5EWFA 1UPPA 3PFEA 3D4JA 4Y2IA 3N79A 2VQEF 4LSZB 3VF0B 4TY8A 3RBDA 4X4TA 3W61A 5KFLA 1RT3A 3HSJA 4DV3J 5HK4A 2DNZA 3VAMA 1W7WA 4X66F 1RBAA 2XTJP 5CD4H 3TJ8A 2RRAA 5KFVA 3H90A 4PQUB 2Z2MA 5C24B 4MKVA 4EGLA 4PR6A 4P2XA 5DQGA 1DQ8A 4KY3A 1JXVA 4CLZA 3HVWA 2OEJA 2LVWA 2E5HA 2FHJA 2XWXA 2DITA 3CMAS 2IC3B 1PSDA 1WTFA 4IG0A 2QA4S 4DQRA 2DEIA 1DTQB 4ICLA 5HSPA 1YK9A 3H42A 1UWAA 4Y0FA 3ZO7A 2APOA 1JWWA 4ZK7M 2NXEA 5A8RB 1HQUB 2WRMA 3ZZUA 2DT9A 5HATA 4UF4A 3M9OB 2UP1A 1FWLA 1KS2A 1U25A 2JFDA 2X1BA 4EK2A 3A3OB 3KG4A 1TUWA 5DGBA 3TP2A 4HT7A 3MMAB 3LP0A 1JQGA 4B9MA 4DV0F 5JMNA 1HBUA 2FVCA 2CQ2A 4DSEA 4CI0B 4Z7CA 1VK8A 3HHLB 3P3DA 4N47A 1QE1B 1IKYA 4CNZA 1XNQJ 1UZHA 2NZ4A 4ZVFA 2MHNA 5I3PA 3ILJA 1CS4B 4FYYB 3BB5A 4FZVA 1TMMA 2EFQA 4DL3A 2PEBA 1OSDA 4EO6A 4DS4A 3RW6A 3LANA 1QM9A 1NH8A 4P2MA 3JSRA 1ZETA 3SXLA 3FRYA 2HVEA 4X4SA 4OJ3A 4DV4J 2LMIA 3JXOA 3OFHA 4DR7F 3BJYA 1A6LA 4RW8A 4B3SF 3I96A 2OO4A 3WIUA 4PG4A 1EETB 1FVQA 2VPYB 3UVJA 3GR1A 1F3FA 4PUOA 4X4OA 1G4CA 1KLMB 3CDBA 1NPPA 2YPZA 5CAAA 3SZ2A 1FKPA 4QR0A 5LXRA 3QGPA 3ITHB 1VQYA 3DDKA 1HD1A 4IOAQ 3CW2C 3ONQA 3CJTA 3KK1B 2QA2A 2LFVA 2X3DA 4C2MA 5IZHA 1KHWA 5HJYA 1GX6A 3TYTA 2P6SA 5KG2A 1BQMB 2IDLA 3DXBA 4RNOA 2RRBA 4O3PA 3RW7A 2ASLA 3CDEA 4C8NA 4DMZA 2P8IA 2CJKA 1TL7B 2CFXA 4HH1A 1UVLA 4C8ZA 3IS9B 2BJ1A 3MPUB 1S77D 4NMXA 2RU3A 1KWMA 4JI8F 2YQ1A 4ZCIA 3V6JA 3LUYA 3U7JA 3GYXB 4ECRA 3DC2A 3NOCA 5RUBA 1VLYA 1ZOTA 1C1CB 2OLWA 3FQLA 2Q43A 3DDNA 2CNOB 4NYPA 1TL3B 2YNFB 3KUGA 4L75A 1SC1B 1VRUA 2E1MC 2M5YA 1OO0B 4ZOSA 4M5NA 2D74B 1TKTA 2VQFF 2JDJA 1FEHA 3HI9A 4NX9A 1TMJA 1PBAA 1TFWA 2W7PA 4C7QA 3T9NA 3I0RB 1HD0A 1CULA 3KMQA 2QJ3A 2MKKA 3TEHB 4OL8A 3SMZA 2EWHA 5A8KA 2ZFHA 3Q8YA 4UOGA 4KSEB 2QLFB 4LR9A 1DLOA 4OI0A 3O8WA 2CPZA 2NZCA 4LF1A 1MWYA 5G4DA 1BHNA 4GKKJ 2OD6A 4IR9A 2B8PA 2E1CA 1RHKB 4YP3A 1DQ9A 3D9BA 3TARA 3RR7A 3VAJA 3LP2A 3ZZPA 4R25A 2DGWA 5KFYA 2NPFA 1E6YA 3C15B 1RWWB 5LMNF 2C2RA 4Y34A 3LPEA 2F8MA 3AD7C 4D3GA 2XGPA 4NXNF 1RT6B 1SH3A 1U1KA 3PM9A 3M30B 2CG8A 4PXBA 4GMKA 5HQMA 2AGOA 1AW0A 3W9HA 2HNZA 1SL1A 2B9WA 1HYSB 4OX7A 4FPIA 1YRUA 3K59A 1EKSA 2MKSA 3PCOB 1IBCB 5B0BA 2OP5A 5ETTA 4DV1F 1KLNA 3K5PA 2P2CB 3DYAB 2P9CA 4B3TJ 4XDDA 3OV7A 5BYRA 2VB6A 3EGVA 1NK7A 2W1BA 1DTTB 3EZUA 2BEFA 3DGVA 2V8GA 4DPYA 1XMBA 4MIBA 1X4EA 3FNNA 2ROEA 3MEKA 2EFNA 2MKHA 1C0TB 4AE5A 3DM2A 1WF0A 1R3NA 1ZPWX 3T19A 5B0AA 2DNMA 1EQ0A 1VQLS 1GH8A 4CLWA 3MECB 3HZGA 3THPA 3S01A 3D28A 5D4OA 2KT5A 2FGCA 2MQOA 2Z8QA 2YQ0A 4BBYA 2C2OB 1FERA 3FKBA 5DGAA 3W3SA 3RBEA 3HSGA 3HP6A 4M5JA 1OY8A 1S6PA 5DQHA 1YBTA 2LLZA 1ZA1B 1TTHB 4JYAF 2QO3A 3QNWB 2XZDB 2WAQD 1HNIA 5LSRA 2D9PA 4RW6B 1YG0A 3ELHA 1X5TA 2DKOB 3NWRA 3MM9A 1HWLA 1RE1B 2DISA 2E66A 4ZVHA 4HHJA 3ZZRA 1HHQA 1T8EA 1OY9A 3AXKA 3BO2A 1S97A 1R7IA 4WKYA 4FKXA 4WP3A 2CQHA 4M5LA 5F8JA 1SUQA 4J91A 3B8HA 3JYTB 3G86A 4O4GA 2XM3A 1SIWB 4NLQA 4CLUA 1SBRA 2WW4A 2UVWA 2NYIA 2I0XA 2NXNA 2K1RB 1C2PA 4WFYA 4JI7F 1YI2S 2VQFJ 2BW7A 2VDIA 1FXRA 2L9WA 4QZVB 2XC9A 1FI4A 2G4BA 4DN0A 1FFSB 1ZA2B 3H98A 1RA6A 2CPDA 4RJVA 3MWBA 3DN9A 3ADAC 2MQNA 4QIEA 3E8OA 5H1SV 3VCDA 2QL9B 1WTBA 3ENQA 1JIHA 1SI9A 1V5VA 3D1HA 4ZLJA 3P8BB 4LFAJ 2J9EA 2MKJA 3RBXA 4PEOA 3TVKA 4DBQA 5JVGQ 4KJIA 5DM6Q 1VQ6S 3D7SB 4U7UK 3AJ2A 2XSFA 1S72S 1SQEA 1ZBTA 3MF5A 1UFWA 3ZTSA 1FJEB 3BBCA 3CCSS 3L4BC 1GMVA 1H3DA 2UZAA 1UEVA 2V69A 2MJNA 3DHWC 1XC9A 1REVA 2QTWA 5L1IA 2RMLA 4DR4F 2L3MA 2HZCA 2BJ9A 3GJTB 3R7NB 4JI5F 2UXDJ 4OI3A 4KRWA 1FK9A 1Z1ZA 3AAWB 1D0EA 5KT2A 4UTGA 2CPYA 4KTQA 4C0HA 4ZLLA 3NGRA 2OPSB 5SZTA 3T1YJ 1GNKA 3OVSA 5FLXY 4UOFA 3NNHA 2V4JA 5J1NA 3QIDA 3GSIA 1RA7A 4I64A 2FTRA 3BGFA 2J8SA 3R5BA 1X9WA 1S9GA 4O4RA 3DLBA 1NPKA 2PMZD 2BOAA 3RTVA 2IM3A 4NI2B 2PIIA 5D3GB 3GSDA 1REGX 2BYCA 3DMJB 1J5EJ 2EBEA 3DGPA 2WONA 4BCAA 4QIVA 1PG5B 3AQOA 2KHDA 4G1PA 3QT7A 4I2PB 2OKQA 2GQQA 3L7OA 4M5MA 2W9BB 1PBUA 4RW9A 3J81j 1MNEA 2VFSA 4DF8A 1GXLA 4LF9J 4ZJLA 1FJGJ 2N4DA 4CO3A 4DQIA 1J5OB 3R3TA 2QG9B 4FNHA 2IYGA 1AA1B 1IKXB 3O1LA 4DCOB 1WORA 1FKOB 3J7YI 2H51B 3FMWA 3UD4P 2CNLB 4WYLA 4XO0A 5A6PA 1HARA 2OAUA 3ZZ0A 3NBPB 1OS5A 5C25B 3SV3A 2MSTA 4TQSA 3IO1A 1B7FA 4YDDB 1I1GA 1N36F 1APSA 2FHKA 1C1BA 1TQLA 2YTCA 3V6DA 1PIEA 3MPYA 3MCOA 1NDKA 1R27B 3I0SA 5KG7A 2XMMA 2B7BB 2DNQA 4CYUB 4ZIWA 1JLAA 1ICEB 3BPDA 3AOBA 3O5TB 1Y3KA 5BJRA 2BRKA 2OGUA 4CM0A 2ZJPQ 3OTEA 5IWAJ 3NEKA 3U02A 4G1QB 1IBLF 2F4VJ 3TAPA 3G82B 1G3OA 2HFZA 2AU0A 2HKEA 3MI7X 3DHXA 2WBMA 1FRJA 5A0YA 1YTYA 3TNVA 1MMDA 3SSRA 3CCQS 2NXJA 2XSJB 3S1TA 5FLXU 3A8JA 1NCLA 3D0GE 2XYHB 3BREA 3CCVS 2HNDA 2AJ2A 4RW4A 4I7FA 2GS8A 1LWCB 3DRRA 2CDQA 2K3KA 3CF5Q 4OZNA 1JLFB 4IFVB 1VQ9S 2AJ4A 1XQIA 1QSSA 4KKOB 4URGA 4U96A 3FBCA 4K4XA 1TELA 1DJ0A 5KT6A 5AXLA 1I6JA 2B4UA 4WFNQ 2RKIA 1CQMA 3O2IA 4I0WA 2NXCA 4UUWA 4ZN1A 3NGKA 1JLCA 1U1LA 3RAXA 2ALZA 4QW8A 2XI3A 4MJKA 3BN4A 4LJMA 1U24A 3VQTA 1K73T 4CQ1A 3QQCD 1B64A 3W2WA 2AW0A 5F3ZA 4OZ1A 3CJ8A 1JJ2R 1HWJA 2BJ8A 2XZWA 2VJVA 4DX5A 2VOPA 1Z4UA 1R0AA 1MU2B 4RNFA 4B3MJ 5GMEA 2KU7A 5JXSA 1YJWS 1QAYA 5KFXA 1F9EB 2DH9A 1RBLA 2ZC3A 5B0CA 4I6WA 1T95A 1HPZA 2YNIB 3A13A 2N7CA 5KOXA 2XNRA 4B3OB 1SC3B 4J9KA 2OHDA 2AYMA 3C19A 1IQTA 3OLBA 1ZM9A 3CD5A 3EGZA 1DARA 2KT3A 2HGLA 3DI6B 3E01A 3GR0A 4RW7A 1MWQA 3PO4A 1R43A 2ADCA 3DLKB 5J2MA 4CCHA 2PDAA 1N5QA 2VF3A 2UUAJ 1IM4A 2F8EX 2W7OA 4LRBA 4IOCQ 4PKDB 2CPHA 1YRTA 1P1LA 4ZHRA 3BSOA 2R8IA 1JMTA 4DV2F 2DB1A 3LGHA 4HHUA 5K20B 4NLSA 4OV6A 2JWNA 4DQPA 4P7VA 2UV8G 2MZJA 3CMES 1ELOA 1YHQS 4MFBA 1I94F 4AXIA 4H4KC 4QIWD 4HACA 1LWEB 1TKXA 3ILIA 5CZVA 3NGDA 1RKIA 2DGVA 3ICLA 1NMEB 4F25A 4DR3F 2FC9A 1N6QA 5L1JA 2R42A 2BVZA 2ACYA 1NK8A 3GCXP 1RZMA 5GADU 1M0SA 3WQPA 1AZSA 1NJIT 4DPOA 4K0KJ 4DSJA 3B4MA 3KTQA 5C2CA 2RVJA 4ELUA 2CQIA 4ED6A 1T94A 1ZM3A 2WVFA 1K1SA 2IJFA 4GVBA 3EJMA 1GAOA 4NWBA 1CJKA 3P5TL 2KKHA 1S1XA 4BS2A 2N4CA 3RB6A 2DGXA 4N8OA 4QPXA 1H2VZ 1S1UB 3UI3A 1HHSA 3DLLQ 4YB6A 2BQ3A 3GP9A 4OZ5A 1FTCA 4QIFA 1Y7PA 3I5CA 4ZMMA 1RHMB 3QYYA 1FRIA 3TVZA 5GMKa 1BY9A 3DRPB 3P5BP 1RHRB 4OX8A 3EDRB 4ECTA 1U0HA 2OH2A 3MGJA 2ZE2B 2K7JA 3JQMA 2E5LJ 4WYWA 3CJKB 2YWEA 2MZ1A 5A8WB 4QU7A 3SSQA 1NHVA 4ZCLA 1HMVA 5M2RA 1XJWB 3M6WA 3D6HB 1CBKA 2DRAA 1TKZA 4X62F 2ILYA 4KHRA 1WF1A 4OZ3A 1ITPA 1TU0B 5CYJA 1VCTA 3HF5A 3VALA 1RAJA 4OYZA 4Z7YA 5BXIA 2WB1D 4P75A 4OMFG 3PJXA 1WDDA 4NXMJ 1D9FA 1UAWA 4LSLB 4K5RA 1R8PA 3OSPA 3GYNA 1LW2A 1B7YB 3B82A 3CJRA 3WC0A 5HN0A 1L3UA 4NLDA 4OQJA 3BKUA 3L7UA 3KK2A 2YKOA 3K57A 2ROPA 3NRBA 1MWZA 4FYXB 1RT4A 2F40A 2ZJRQ 4CLLA 2WHOA 1BQXA 3QPIA 1H74A 2EXUA 3IR7B 2B51A 2FUG9 4KGMA 2DY9A 2VG5B 1DQAA 4AQYJ 4KBIA 4LF7F 5A76A 3AB4B 4O44A 1FDAA 4J37A 3LP0B 4KH0B 3M8ZA 2IBKA 4DR6F 1HBUB 3PEHA 3QFWA 4F3QA 3TX8A 1WEXA 4LBHA 3WIVA 2Y3YA 4F36A 4LF4F 4OLOA 4F0KA 2DHHA 3BN7A 1IR2A 2LQ8A 1F5BA 1VYAA 4OHXA 5L9NA 2BANA 4DUYJ 1TK5A 1NKEA 6AT1B 3N6MA 2HHHJ 4P71A 3EXCX 2DXEA 2VBZA 2BX6A 2ZH1A 1R31A 3FBEA 4QWCA 3DRXA 2V8PA 2F7VA 2AX0A 4QWDA 2QMWA 4NCAA 1EIYB 2CWXA 3QBCA 4MK9A 3ILLA 2X1GA 1LWXA 1RT5A 5IM0A 3M2RA 2BKPA 1KTQA 4LUBA 3UCZP 1XK8A 2LXFA 3M6UA 4RU9A 2F3JA 2KFNA 3DLEA 1HNVA 2E5JA 4F02A 4JI1F 1WSRA 2BJ3A 4GKJF 1YDLA 4KHPF 4B9SA 1FKPB 2XWYA 4ZPBA 1RCXB 2CJYB 4IO1A 3Q2SC 5LM7E 2RNEA 3BSNA 5HP1A 1X9SA 2V94A 4LF8J 2IYIA 2M70A 1RT7A 2CQCA 4O3OA 4ID5B 1PJ7A 2AEJA 4CM2A 3C16B 4WFZA 3QLHB 2ZM6J 4HTJA 4KPYA 1RTJA 4JV0A 1S1TA 5ADZA 1KDNA 5C42A 4RO0A 3R7BB 5ETNA 2M52A 5HAOA 3G96A 4K4ZA 4YN3B 2HHQA 1MW7A 3G4SS 3MMBA 3THVA 3KOAA 3D5MA 3PW0A 4U7CA 2M7SA 5I3UB 2AZ1A 3ENAA 4RNMA 3QZ8A 4X64J 5E3AA 2J0WA 2I5JB 1S4EA 3KUEA 4FVMA 3DNCA 2LQ9A 3OT9A 1WACA 3M32A 1RAHB 3Q8UA 1L3SA 1T9XA 3UCGA 4KC5A 4DZ6A 3U27A 2CVEA 3K5LA 2H5JB 2HRYA 1HQ2A 1VRTA 2CQ1A 2R4FA 1CULB 4USKA 3K5MA 4KR0B 1IBMF 4LR8A 2EFOA 2E7WA 4USVA 3TJAA 4F4KA 1ZZFA 2IM2A 3R5JB 5IC6B 5A8KB 3NS6A 3LPYA 3KHRA 4GC6A 2W2QP 4PPDA 2M88A 3MUVP 4RWXA 2VPWB 2V50A 2DTJA 1R8BA 2CRLA 3HHLD 2C3PA 4NEZA 5HMXA 1RBOB 5LXYA 1QD1A 3SCIE 3MHYA 1XMOJ 1D3WA 3LP2B 1RTIA 2FJAB 1LOUA 2JVRA 2JH3A 5C5JA 2YKMA 2CKWA 1IBKF 3M8WA 4NRTA 1WC3A 2ADBA 4ECUA 3JTOA 2M3DA 3N5FA 4LF7J 1G6BA 4R5PA 4TNOA 1TAUA 2W2MP 3UWTA 2XLKA 1WDTA 4JI2J 3NLCA 3QO9A 4ZKAA 5ETMA 2FHMA 2RU9A 4RWWA 4K2XA 2HNZB 2JL9A 1TV6A 3PW7A 3ZZZA 2VONA 2ZBIA 3MM5A 3K89A 5K9FA 4B9VA 3SFUA 4F4AA 2KJVA 4QR2A 3WHIA 1RT2A 1GEHA 4Y2AA 3MZIA 2HG4A 4ITSA 2J8AA 1EHWA 3LWMA 1Q4RA 2FZKB 2BMBA 2DHXA 3MR3A 3SQGA 4Y3CA 1MROA 3M7VA 4DG1B 1U1QA 2VA2A 3MEGB 2C42A 2B0GA 4DL7A 1M5KC 3RB3A 2GQ2A 5CYQA 2EK1A 1LKZA 2AJ1A 1HBNA 3HLUA 2N3OA 4ED3A 3PR4A 3H0PA 3BQ2A 4DV7J 2OMOA 2GGPA 3K17A 3OR2A 2BUNA 1VI7A 2HIQA 1N48A 1VDHA 2XO7A 4NLTA 3QZ7A 1NB2A 1S6PB 2MZSA 2IA6A 3PIOQ 2LCWA 3HHEA 2E29A 4MMOA 1ZAVA 1CJUA 1HNIB 1HI1A 1S6QB 4RBVA 2ZH8A 2GIFA 3BQ0A 3KJVA 2VA3A 3CD7A 2B6AA 3PZPA 4DV5J 3QJJA 5DDQC 2HFUA 3TUJC 3KJQB 4DPWA 3MPDA 4BC7A 4CWBA 4OYWA 5HL7Q 1SUQB 1V6HA 2Z30B 2HW3A 1EB0A 4ZP8A 1NSQA 3V4IB 3DOMA 4O4GB 2R2SA 3BSCA 4R8UB 4HLBA 1RAOA 1HBOB 5B08A 1N33F 3WDOA 3IR6B 2HHWA 1VOMA 2WBRA 4DU8A 4K2JA 1KOOA 4DOZA 3OXGA 2YKPA 1FX4A 4DWIA 3GFHA 1RAGB 5LMUJ 2OSQA 5K14A 1LW0A 3W63A 4LMZA 4V1Ak 2A18A 3PR5B 5IT4A 4WIQA 2CQPA 1UEKA 1H0HB 3NCPA 1QVGR 3AXMA 2M9KA 1F9HA 2GAHC 3OVBA 1RXOB 5F8HA 3MM7A 3DOKB 2OD4A 4ZPDA 1HNZJ 3X1LB 4A47A 5KFQA 2H48B 2DRBA 3SI8A 2R7VA 2M2BA 4C4WA 4OIXA 2ACMA 4C0OC 2COLA 4IKAA 4USUA 2DVIA 3KFWX 1QAIA 1PILA 1T9WA 1R6YA 1XWLA 2HS3A 1YIJS 4ED5A 4UZBA 2VV5A 2F9DA 3HHNB 3M6VA 3GU0A 1N52B 2LU1A 2OPPA 4LFBJ 1VISA 1OPIA 3HVRA 2HLTA 2UXBF 1U02A 2CVIA 3ZZTA 2VBWA 3FBBA 1Y11A 8AT1B 2X1AA 4PG8A 4DL2A 3G6ES 1BWVA 1SC6A 2XMUA 1S1WA 1BXNA 3G87A 3MEEA 4LF5F 4AFFA 3AOCA 3A3PB 2AD9A 5M2UA 2DPJA 2GJFA 2Z56B 4TU7A 3GTYX 3PYFA 2HAIA 4UW2A 1BC6A 2JNJA 5GAGI 3FZ2A 4DV6J 1VQ5S 4AL5A 2O67A 2EBGA 3VAKA 2GZOA 5EUHA 5KFHA 2V4JB 4NLYA 1N34J 3DKDA 3V81A 2R8KA 4USMA 2ZNYA 1B3TA 3AFGA 4H4OA 3GIRA 2UU9F 1WD6A 4XAKA 2C3UA 3Q86A 2KXNB 1NSPA 1T0TV 2JJ4D 3JSBA 4U9RA 1TFYA 4F7VA 2J6SA 5G0RA 2YBVA 3R6LB 1UEUA 1VQ8S 5A2QY 1HWKA 2WONB 3LP1A 4RKUC 4ETZA 4ER8A 3TAMA 2B5JA 2YWGA 4MKYA 4G6VB 4X65F 4WF9Q 1WSVA 2EK6A 3IXQA 1HNXF 5IV4A 2WSCC 1EAYC 2OUGA 1JLBA 2HSEB 2HIYA 5HJXA 3NG8A 2RDDA 2KRBA 4TLQA 2C28A 1XIQA 2OPQA 1R89A 3PYEA 4WP9A 3K58A 1NM2A 2Y1RI 5IC4B 2KG0A 1KVKA 4QYRA 1TL5A 2FLLA 4N7TA 3R5DA 3Q2TC 3CJQA 1HA1A 5K8MA 2FVRA 4ZVUB 3A8KA 2RQ4A 2V8HA 1UPMB 2BE2A 4ZVTB 1KNZA 2J9DA 2XB2D 4C48A 2EVZA 3I55S 1SJ1A 5LJ3Y 2V4RA 3A3NB 4PCQA 3O6QA 4F4XA 4Y2KA 1RWXB 4WKRA 4Q7AA 1X7VA 3NNAA 2BACA 1D9AA 4DLEA 4JI3F 2YKNB 1JKHA 3EVMA 4NA2A 1FKAF 4L3KA 3PO5A 3FCHA 3TR5A 3NCRA 2EEYA 3OHAA 1FTRA 5L1KA 3G8QA 4GRSA 3DXSX 2ZD1A 2YX4A 1M1HA 3PFOA 5A0YB 1AYEA 3OTBA 5CA5A 2GJIA 3OTOJ 5F0WA 3NKYA 1BLUA 4CO5A 3CJ3A 2IRXA 2AJQA 2HNDB 4RW4B 3GQCA 2CZ4A 4I7FB 5FDLA 3BKFA 4CO0A 1YBAA 5AE3A 2LP4A 1MLAA 5HI7A 2BQRA 5ETSA 3HVTA 3KJNB 4AXJA 3V6KA 1HNWF 4DR5F 1WC1A 4A8XA 5M2PA 3HT3A 4P52A 5HROA 5A2QU 1X0PA 1O6XA 3CWJA 1RAFB 1Y5IB 2ZBPA 1JLCB 2VBYA 5J2QA 1JLGA 5GAHI 3HT0A 5KFKA 2OIHA 2NPIA 2FD2A 1KSPA 3NMRA 2G0JA 2POKA 4MTPA 2MZTA 4IYQA 3CB4A 1SJ3P 5I42A 2N3LA 4DR1J 3X3UA 2HBYB 2V2VA 1R0AB 2BQUA 3LOUA 2XS5A 2YY3A 2KG1A 3FEXB 5KG0A 3EVOA 5DZ7A 1L3TA 4Q8EA 2V9WA 3W2VA 3CCES 4ANCA 1T05A 1WHXA 1S99A 4YY3J 5ETOA 1GTHA 4PXCA 3N01A 5DETA 1WHVA 4LBIA 4FF1A 2F65A 2XMTA 2PSZA 2VJUA 3PJ9A 1CJTB 1T9VA 1RLCL 1TP7A 1YRXA 3QGHA 4YUDA 4ZLNA 3THTA 4M1KA 1S10A 2AWZA 4Q5VA 1Q86T 2ZKUA 3KHHA 1C4AA 3BKTA 2DEJA 1WELA 5T7LA 2DH8A 1MN9A 1TAQA 1T9TA 4X65J 1VQPS 3NAHA 4OYIA 3EMTA 1KC8T 1T03A 2W9CB 2ERRA 1GK8A 1NJYA 4OYXA 5IS2A 3M8PB 5J2MB 2GJ2A 3EGNA 2KXHA 2QLJB 4LVNP 2UXCJ 5AJ3J 1GT8A 3IBCB 4MK8A 4HEA9 4EZ6A 2EI5A 4YMEA 4IFYB 4MK7A 3MXHP 1Q79A 5GAHU 3KDNA 3HKZD 2N7YA 3ISND 1RKJA 4C3KA 2UUWA 3PNIA 2GX8A 5KFWA 4KH1B 4FS2A 2BR0A 3N0VA 1ZAXA 5D8HB 4YQWA 2RDJA 1FJCA 1TKXB 2VFVA 4PQUA 5KFRA 4S0MA 1U1RA 5C24A 4NA3A 4ED8A 2D3OR 4ED2A 1ZM4A 3IM8A 2R9LA 4NOHA 1N56A 2ZUGA 2GW8A 4JV5F 2IC3A 4FBTA 5LSLA 3I4PA 5CZXA 7FDRA 2PO4A 2HBQB 4Y6IA 1AZSB 4ZVSB 4CDIA 2VOOA 3PX0A 3A1YG 1DTQA 4ECYA 2ATCB 3VQSA 4RUHA 2ZH9A 2QMUB 5A8RA 4Q45A 3H8YA 4BC9A 3MMCA 3AT1B 1HW8A 3RB0A 3FSXA 1WEZA 1CJKB 2V68A 2RDIA 2DR7A 1S79A 4DL6A 3CEDA 3SQOP 2NUHA 2GCFA 1B0PA 1J2VA 3PTWA 3EPIA 3OJSA 3ZTRA 1VQSA 4WIIA 5DQIA 3MMAA 3QT8A 3MOJB 1UWBB 1FF2A 3TA0A 2CPXA 3KLIB 2RAQA 2ZVSA 2UUCJ 3HHLA 5FIIA 1OYDA 1XNRJ 4C8MA 1ZAWA 2IMOA 3MTKA 4P7TA 4TLRA 1CS4A 4V19X 1BWEA 3BGOP 3D54A 2LDYA 1PYOB 5E0OA 2L41A 3MEDB 4NYZA 1U8SA 4HTIA 2MDAA 1U0HB 1FHTA 5KG6A 4JI0J 3ZTPA 4LFCF 3POTB 4X2BA 3QT5A 3D67A 3JSYA 5KTQA 2ZZTA 1FD2A 3QRRA 3QIPB 4H54A 2HWTA 2NXUA 4N76A 3GJQB 2LXIA 2HFOA 4DX7A 1WKLA 1Y0HA 4YHHF 2AYGA 1EETA 3MUTP 2RS2A 4G1IA 1XMQJ 1HBMA 2WTFA 5IT9Y 2MGZB 1KLMA 4CLTA 1KFDA 3VWSA 1EQMA 5KT3A 3D1OA 4O0NA 1U2RA 3ITHA 4C8LA 1MMNA 3M2VA 4DUZJ 4O3RA 2JZ5A 2BM0A 1RT1A 1RHJB 2ZHAA 4Q2MA 1NDLA 1X60A 5L46A 1JNRB 4LIWA 2MQPA 3KK2B 3L7PA 1S9EA 2HURA 2R8GA 2QSFA 1R6VA 3JAMY 3OXFA 4RUAA 2MMYA 5F3TA 1KQSR 2J7KA 1WEYA 2XG8A 1BQMA 3FMBA 2JX2A 1FRMA 2I9SA 1SV5B 3EICA 3PEJA 1F2HA 2E7XA 4EYHB 4KQZA 3WBZA 3OR1A 3I87A 1TL7A 2HFSA 1F3VA 5E5NA 1KTVA 1NNDA 3SCJE 2ZH3A 2VICA 4OHWA 1KBRA 4ZIVA 1V5IB 2R2RA 5JVHQ 3R2CJ 4IRDA 4D3HA 2HNYA 2BANB 4KO0B 5K8PA 3MD3A 1P27B 2J9CA 3M2UB 2J5AA 5CYMB 2AX1A 5B7WA 3L09A 1HL6A 4WU3A 1LK7A 4B3RJ 3T1HF 3AQPA 3HVAA 3G9CA 3CVKA 3PX4A 4B17A 3J7A1 3I0RA 2KVQE 1NB7A 2G2OA 5DLFA 1RT5B 5IM0B 2JEGA 2W8KA 1DBDA 2XYGB 2ZHOA 4K8RA 2R7TA 2MTLA 4CZCA 2DHSA 2LA4A 1X4AA 2HZAA 3KLEB 1GTEA 2DGUA 4DHVA 1U45A 3UW1A 5CHCB 1FXLA 1L5UA 2CQBA 2A2DA 4IR1A 3ENWA 4WPAA 5IT9U 2KYXA 1UETA 5HP1B 1RISA 2ZZNA 2HLUA 3KXDA 3Q0AA 2Q3PA 2R7UA 3C15A 4DQQA 1XR7A 2Q79A 2XMKA 2DCUB 3GB0A 2V0NA 2KFYA 2A6MA 2RUGA 3JSMA 3E51A 2JSXA 4DR2F 4L74A 3M30A 3GFYA 2LDIA 5J2PB 1RTJB 3LO3A 1RHQB 3IRXB 3JAMU 3BH7B 1HYSA 2OI2A 1SH0A 1A7GE 1HWIA 1Q95G 2AV5A 2JEIA 1RTHB 2E44A 3QWUA 5CXTA 1H7WA 2HBZB 4DQSA 3MMBB 3DYAA 4CTAA 3QRQA 3CO9A 2ZWPA 2FB0A 3R7SB 3OUYB 3CE8A 1U48A 2RF2B 2Z0GA 3D6MB 1DTTA 1Y9OA 3BBFA 1RJJA 2MHEA 2R7QA 2H9ZA 1X4CA 3T6JA 4HDGA 1HKAA 3KG1A 1VJQA 1AFIA 4DZDA 5IQ6A 4P73A 4ES1A 1H38A 4I2QB 1C0TA 5HVGA 3H5UA 2NS1B 1WI8A 1RABB 1D8ZA 4F67A 1GXTA 2RQCA 4Q0BB 4AL6A 3VGUA 2WOMB 2W2NP 4LSNA 4J9OA 3BBBA 1CQNA 4BWMA 3NL0A 2QYCA 1FDDA 2V5HG 3EZ5A 3GONA 3PHEA 3M05A 4F2RA 2GVDB 3MM8B 3PKYA 2O1PA 2RSQA 4MYTA 3AOAA 2GV1A 4PWUA 4Z2XA 2VQEJ 5EDWA 4ZLPA 1CLFA 1UKUA 4OI1A 1HW9A 4U6PA 1CC7A 2HAFA 1M90T 4ETXA 4Y2MA 3AJDA 2FGOA 3WZ0A 3QATA 3T5HA 1P8GA 4X66J 1VQKS 2IRUA 4RW6A 1GMUA 4R5PB 1JNZB 2Z58B 3DLGA 5HMYA 2PMWA 4C11A 1H6KX 1PC5A 2FJVA 4ELVA 2IM1A 4I68A 3H59A 3BGRB 4EWTA 2YH0A 2BW2A 1RTDB 2ZNZA 3N9UC 3UDEA 3N4WA 5D0HA 2XMAA 2QT7A 3L95X 4LF2A 1TV6B 4DXLA 2HVDA 4ZPAA 1WC0A 4QPTA 3PACA 3C6UA 2OSRA 3E3XA 2JLGA 2K1RA 2DH7A 1E6VB 3GIIA 5EHHA 4I6AA 3KNAA 1AUDA 1RT2B 2B4PA 2MXYA 3TA2A 5KT5A 2KFZA 1JJ4A 2G1DA 1RTZA 3D1QA 4ANDA 2B43A 1QUVA 3A12A 3P45B 1W2BR 1LEOA 2YX7A 2U2FA 4NLUA 3SQGB 2AF6A 4DV0J 2W8LA 1MROB 3AJ1A 5AE2A 3ET6A 3ZZYA 1V3RA 3PYGA 2EKYA 3KNGA 2IY5B 2JEJA 2H4YB 5CQGA 3Q8SB 4JI6F 4XTTA 2UUBF 4WK3A 2VKRA 4N56A 1FDNA 3KUHA 1OWXA 1NHUA 2VIHA 5KG4A 1X4HA 4GO7X 2ZJQQ 4NLVA 1NEEA 5BR8F 3UO0A 3GJSB 3R2DJ 4CT8A 3C14B 4F0MA 4USTA 2F8HA 2PT0A 3PDNA 1SPBP 3BZQA 3CGIA 2MB0B 4C3MA 1CSJA 2OELA 3BF4A 4K4YA 1CJUB 4DR7J 1MG7A 4QCLA 4KV8B 2CQDA 2AYEA 4B3SJ 4N8NA 2DPIA 4DLGA 2Z2ZA 3SEOA 4DFMA 4IOBA 5KFGA 1C0UB 2B6AB 2PI5A 2WSEC 3UN3A 3UN5A 1FFGB 2OPSA 3Q23A 1QTMA 4ZVEA 4L6V3 4W90B 2B8QA 2DGQA 3IMQJ 2KRRA 3NNCA 2J0SD 1RU2A 2M8DB 3H5XA 3CMQA 4F0HA 1S49A 3P6YC 3TOQA 4HH0A 1IR0A 4ZCKA 2H4WB 2UUTA 3RGIA 1HR0F 3VZHA 3KK3B 4X4RA 2GVZB 4TQRA 4U8VA 4NI2A 2IJRA 3LH2S 5FD1A 1BD6A 2F63A 2J0XA 5J1EB 1XBWA 4XPEA 5D3GA 1WOOA 3MAAA 3NS7B 3DMJA 3CJ0A 5E2QA 1NDCA 4NZ6A 5KG1A 1Y4ZB 4XK8C 3H25A 3CSKA 4I2PA 1LW0B 1JLQB 3GIKA 2I8EA 2QFIA 3CTRA 2W9BA 1Q82T 1S48A 3UDLA 1Q7LB 3RZAA 2MQ8A 1U0SA 3MM7B 4WU2A 2OFGX 1N54B 1IKVB 5D78A 4JI4F 4JI8J 1IKXA 4A8YA 2CZVC 1FKOA 2VC1A 3DRSA 1I3OB 2DNYA 2G9OA 4RUCA 3LGMA 4IG3B 3G6VA 4X4VA 3HPOA 3W66A 4DX8H 2HS4A 3DOLB 4JV1A 3EX7B 3PG9A 4Q43A 1VS3A 1AUSL 3AA9A 2MKYA 4RNHA 4Z37A 4QOTA 3VV2B 3UD3P 2F9JA 1YLXA 3QJLA 2IFXA 1S1VA 3MEEB 3EM1A 2FVSA 5E3PA 4J90A 1QJHA 1JJCB 2B9EA 4K7QA 5F8NA 2C2DA 2KI2A 1IM6A 1GX5A 2W2OP 1VC0A 3CULA 4G1QA 4OX9F 3UPFA 1NK6A 3G82A 3MCSA 2E1PA 4H4OB 1FT8A 3CPWR 1M5SA 3M8YA 1VBZA 3BR9A 4RU2A 3MMJA 3LALA 2WW8A 1S12A 3OFGA 3JQKA 5LMNJ 3BS9A 3KKFA 1CVJA 2RJZA 2ASDA 5C7PA 1OQ6A 2J0QD 2VUGA 2H65B 1LWCA 2DR8A 2AYBA 1K47A 4NXNJ 1NH7A 1DRZA 3UNYA 6FD1A 4RX6A 1JLFA 2DXFA 2XULA 3LP1B 4IFVA 1TKDA 2D3UA 1WG5A 3TAMB 2B5JB 3DU5A 1LWFB 2R7RA 4KKOA 4FYVB 5HVHA 4A4JA 4P72A 1RB0A 4DV1J 1YJ7A 1FWPA 5F8GA 2PA8D 2XNQA 3BGUA 5DRKA 2RH3A 3M9MB 2DNNA 2OPQB 2VG6B 2QA1A 3TZZA 4DPUA 3QJPA 4CO2A 2HFVA 1KKHA 2YWWA 1X8DA 5E7OB 3M6XA 2HHUA 5D0RA 4YB1P 3M8QB 3HX9A 1O0PA 1UCNA 5DDOC 2BDPA 4DV3F 2ZZMA 1MU2A 3W5XA 1WKJA 3CCWA 3IFEA 5HBMB 1SIZA 3QSYB 2FPHX 1S9FA 3C6TB 4ZPTR 3VVTA 2V9KA 4OJGA 7AT1B 1ZS6A 1VQMS 2EKNA 4DU7A 2CPEA 2K2PA 3W8GA 3OW2R 3A8IA 5ETPA 3SBMA 3UN2A 2V34A 4ZVPB 2YNIA 4CRJA 3T3FA 2BA9A 3TWZA 2KJWA 1ZH5A 1UJ5A 2O5DA 2IAJB 3HKWA 4LF6F 3ULHA 2XY7A 3GILA 1TVRB 3I5AA 4HHHA 4AL7A 2JRSA 4M63A 2QZ8A 2YX1A 1RLDA 4DI6A 3Q24A 4JYAJ 5J2NB 3DI6A 3K0JA 4UUXA 1VMBA 1SJQA 1VQOS 1X0FA 2MLYA 1N0VC 3L9ZA 5EN1A 5FDLB 4QBUA 4X4PA 4EFAC 1N5TA 1UVMA 1R8HA 3ZNUA 1U6FA 2PI4A 1M5OC 3RYLA 2GHWA 3MFIA 5F9NA 4C97A 1TR0A 4ANEA 1TL4A 1VIOA 4E0DA 2V8DA 2AGPA 1NSKL 3TQEA 5HROB 2YKAA 1JJHA 2ZHBA 3CD6S 2C3MA 2VODA 1M5HA 2RHSB 1NKBA 4PYDA 4JI7J 2JHEA 2Q6CA 5J2QB 1JLGB 1F9FA 3TVYA 3PY8A 3LA0A 1U1NA 3TO8A 1KEKA 5KOWA 5DM7Q 2DR9A 3UR3C 5JUMA 3DLJA 3KLFB 2QLXA 5T41A 3PRBA 4DV4F 1RAIB 4YEAA 4V19J 3TEGA 4DPTA 1K44A 2OJ3A 4WJBA 4NCGB 3U1NA 3W2VB 1T05B 1UW4A 2RUSA 4DL0C 3M8RA 3R5AA 3PX6A 2B56A 4ZP6A 4TYBA 4JV2A 1NPRA 4EMDA 1WUUA 5LJ5Y 5EWGA 1YVFA 3HMJG 1WC4A 4UQGA 4ED7A 3CNQP 4ZPCA 1S1UA 1OIAA 3OL8A 4DR4J 2HS0A 5D0EA 3IAM9 4JI5J 4BDPA 4AD6A 5T7LB 2RILA 3ETMA 2HFNA 4WXOA 4USIA 4F4ZA 4IDKB 4FN5A 4A8KA 2LEPA 5AXKA 3CXCR 5DG7A 4DS5A 1T03B 4M5DA 1NLKL 1FO1A 3DRPA 5BYQA 4PXEA 3KLGB 2ZE2A 2QLWA 5GADI 3CJKA 2V6AA 3IWXA 2L9DA 3IG1B 3RRKA 5A8WA 1RU1A 1RWNB 3KLHB 4WFBQ 3S6EA 4K4SA 2AZ3A 1ROFA 4WK1A 3N5BA 2L9NA 2FJWA 4GO5X 3HD1A 4OX6A 3OSNA 3FJ2A 3VGTA 4ZP7A 3H5SA 1RCOB 1OMSA 4N77A 1WG1A 5B09A 2IDEA 1SKUB 3P4UB 4NRUA 4M5IA 1S57A 1YGYA 2ZDOA 4LSLA 3GE9A 2MZQA 3K2YA 4URSA 4LF6J 5GAEU 1SKRA 4CT9A 2HQGA 5L1LA 2QIFA 2HQDA 4O3SA 1O51A 4GKKF 5H9EK 1HHTP 1QSLA 1S6UA 4LRAA 5DJBA 3MMCB 2Y9HA 2OTJS 4ILRA 3MM6B 1VJWA 3LWLA 2VG7A 2EFPA 3GJRB 1P9YA 2E1AA 3A4TA 1N36J 1LFPA 5HMZA 2VG5A 2PFFB 4EU0A 1NRKA 4DCPB 3OHBA 1T02A 1VQ4S 1WWHA 3FZBA 4ECVA 1FFWB 1NU4A 3ENVA 1Q5YA 4UOHA 2E9RX 2QMXA 2EG1A 4J9SA 1SQGA 3BO4A 4ECZA 3PW2A 2YNGA 2PN6A 2PC6A 1KR4A 2LQJA 2VC0A 4K4UA 1QUPA 2KVIA 5HANA 2QL7B 2AT1B 1RAAB 2AMCB 1IBLJ 2RQMA 9ATCB 4PZVA 3KHGA 4NASA 2G1HA 4QWAA 4B3TF 4IQXA 3H4DA 2UV8A 4Q8FA 5CCMA 2LKZA 1UFKA 3HFKA 4ALZA 3HHLC 5DO2A 3NGUA 4IH6A 3BR8A 3P96A 1EARA 2CYYA 4AUKA 4ZS6A 1M1GA 1HBMB 4ZP9A 4CLPA 3D6TB 2JC1A 4KPCA 4ZVRB 3IBWA 3M2VB 1X5PA 4YR3A 1LXNA 4TU8A 1IKWB 1RT1B 4UOCA 2Y8WA 2G2YA 4ZVQB 4NLGA 3TJ9A 1S9EB 3HO1A 3HFVA 4DSIA 5SUHA 5KFDA 4TVAB 4ID5A 4TY8B 1U6BA 1RT3B 1IVZA 3C16A 3QLHA 1MSWD 1ULRA 4J9VA 2ASYA 1CJVA 4C98A 4N41A 4L76A 2GNKA 4J9LA 3C8YA 4EZ9A 4O3QA 3OR1B 2EFGA 4DN9A 4ERDA 1WHYA 1YSJA 3K8VA 2CWKA 1Q0NA 2WK4A 3CD0A 4IRCA 2B4VA 3W60A 2ZUAA 2BM1A 5I3UA 3CDAA 1LQ9A 4IG0B 3EVWA 1U2CA 2I5JA 2HNYB 4DEZA 4ATNA 3U1MA 3CCMS 3ZXWA 9RUBA 5IT0A 4ICLB 4WE1A 2G13A 3TZXA 4ZJOA 4A46A 1XR5A 4P2SA 1FDBA 4ILMA 1ZTWA 1M5VC 1UVIA 3CC2S 4F26A 4LBPA 3F41A 2C2MB 3MD1A 1PGZA 4QR1A 2NSCA 3UQSA 2R7OA 2D3O1 1NK9A 5EX3A 2CUYA 3MFHA 2NLWA 3GV8B 4AT1B 4PYAA 1UA1A 5KFEA 4RNNA 2CA9A 4FDFA 3G71S 4LFAF 1DURA 4DV2J 1RADB 1IKYB 1VC6A 1PYSB 3D0HE 4KAIA 5KFFA 1M5PC 2H5EA 1DZ5A 3TZYA 1I94J 4PG5A 4P9SA 5H9FJ 4JOUA 3H2VE 5L39A 3QGGA 4NA1A 2ROGA 4ZVOB 3JSMB 4DR3J 5I4MA 4FBUA 4NYOA 1S0NA 1N0UA 3HZEA 4CIOA 3RUBL 4BWJA 3OL6A 4RW8B 4NLXA 1JXEA 1NHKL 2UXDF 4CLYA 2CJAA 3LAKA 2OPRA 4USJC 1O5JA 4DSKA 3QT6A 3UVJB 4PUOB 3GWCA 2FJBB 4IUFA 1IUJA 4ENOA 4CTAB 3T1YF 2CAJA 1Q81T 4Y28C 2RT3A 1NAQA 3EXYA 2VFRA 3K5OA 1RP5A 4CH7A 4ZVGA 2DNGA 4R0EA 1PKUA 1R8AA 2EFVA 2XO6A 4HKQA 4J9PA 5KFPA 2DNRA 5CH7B 2P9EA 2D7SA 5HMWA 4J9MA 4DG1A 1SH2A 2J7WA 1J5EF 1YJNS 2FVQA 3MEGA 2JLFA 4CLFA 2PGCA 4EO8A 3AD8C 4LSNB 1FA0A 1CC8A 1KFSA 3VAGA 2R7WA 2HHTA 1N5YA 4ES3A 1D9DA 2VD3A 2A0FB 2D1CA 1JX4A 4HR2A 3VR1A 4LF9F 2WSFC 1FJGF 2DNLA 2QE5A 3J81Y 3FCVA 3CIZA 1EX8A 3U1LA 1YJRA 1RQ0A 2A10A 3PRVA 4OYMA 2F5GA 2JOQA 1VRUB 4AYBD 4X62J 3W1YC 1S6QA 2Q1LA 3DLGB 1VGYA 1TKTB 1PJ5A 2GO9A 2C3OA 1ACMB 4C11B 5H9EJ 4CH0S 2DO4A 1D1UA 2KTQA 3W5ZA 1KQGB 3NWGA 1QVFR 4ZCMA 3FRZA 2AKWB 2GMJA 4DL4A 2VU5A 5L8RC 1LNQA 4USHA 2BJEA 1UA0A 3V4IA 4OI2A 1U7LA 4Y2CA 1DLOB 2LECA 3C6UB 4YB5A 4R8UA 1OSCA 4U95A 1HBOA 4KFBA 2BOPA 2HGMA 5IWAF 3KYLA 2BBEA 3RR8A 2YPYA 1Q53A 2F4VF 3HJVA 1HI0P 2HHVA 2BJ7A 2BKOA 1FNOA 2K3IA 4L73A 2FC8A 1DY3A 2HMIA 4R0JA 3SDEA 1E6YB 2C2ZB 1U4BA 2DR5A 1F6TA 4DDFA 2PE8A 2FLOA 2CPIA 4DR6J 2HQ3A 2ZDPA 2XMVA 5KFCA 4H4MA 3ET6B 3DOKA 3FGVA 5DG8A 2Y8YA 2GA7A 2QEXS 2UVRA 3BV8A 4LF4J 3T5JA 5E33A 1URRA 2LQ5A 2MLZA 4HYKA 2J76E 1T7PA 3PYDA 2VL1A 4FF4A 4FXDA 3Q8QB 4HL9A 3CDUA 3TI0A 5MAOA 3V5RA 1S5ZA 4K4VA 2AIRB 5KFMA 2AHOB 4KHMA 3LF0A 4C8YA 2DYAA 1QY7A 2CG4A 3V6HA 3HDSA 2E9ZA 4LRCA 5IOLA 4YFUA 1A0OB 3CJSA 2PEHA 1VC5A 3J81U 1WHWA 4LQ9A 4HI2A 2X1FA 1XN9A 2L48A 4DJBA 3RAMA 1U09A 2XMWA 2OFHX 2BE9B 4PWDA 3DM2B 1UL3A 2NQPA 2AJ0A 4B3MF 2ZOGA 4URQU 5KFZA 3CO0P 5IFMA 1QLNA 4JI1J 2PD1A 4FPRA 2VFTA 4GKJJ 2V2ZA 4XPCA 4ECWA 4KHPJ 3BSAA 1T3OA 1T3NA 2XLJA 1RUSA 2ZBCA 2MKIA 2ZKTA 1YJTA 4QJVA 2YXLA 5EX0A 1UMJA 4E8UA 2BZ2A 2B3TB 3MAAB 4EEYA 2G0CA 1EKRA 2RB7A 4J5OA 2XI2A 1BUXA 1UP1A 2QGFB 3GV5B 2DNOA 2YWFA 1NO8A 4OV1A 4DFJA 3K5NA 3MM9B 3DLHA 2FVPA 5F8LA 3R1HA 5F8IA 3JTNA 2WB4A 2XY5A 1JLEA 5ITHA 2C3YA 2XBPA 1B4SA 1YJUA 2UUAF 2B9YA 5B0GA 3T41A 3UD5A 2QC3A 3W5YA 1X4FA 2DRDA 5CABA 3DRSB 1W25A 2HQFA 3FFIA 2QX0A 2Z4PA 1DFDA 4FNIA 1RWMB 3SV4A 5HO4A 3K8WA 4EYIB 1S0MA 3QGIA 2F4FA 3UCUP 3NCQA 3PW4A 1XERA 2AP6A 4TN2A 1FXDA 1LV5A 1U26A 4LRDA 1NK5A 1BQNA 5KFUA 1ZM2A 3G8TA 3IA0A 2DO0A 2X3GA 1IBMJ 1S1VB 4MKAA 2E9TA 1C4CA 2XCAA 1N4LA 2YKNA 2VZ9A 5E3RA 2GAGC 3OTCA 1RACB 2C2KB 3TUIC 4MYUA 1V3SA 1N32F 7FD1A 1N88A 3MURP 3FVYA 2XCPA 4WP8A 2BXJA 3CCUS 4K0KF 2KZMA 4QQBA 2H3EB 3TX0A 4PPZA 2Y0SD 4OI6A 2VDHA 2LQBA 1AFJA 2LYVA 2YNHA 1IBKJ 2IJNA 3RJMB 3TUPA 5LT5A 4EBCA 3M9NB 3KHLA 2RRNA 4N5SA 3OPKA 3EZOA 5ETQA 3I6PA 3IN5A 1PYTA 4ECQA 1NKCA 4RUBA 2IPOB 1REVB 3ISNC 3UNGC 4L3NA 3IGVA 2UVUA 2HEKA 2R3VA 3A8EA 2QV6A 1FK9B 1K0TA 3KG0A 4F2SA 2NUUG 3BH6B 3J7YU 2CQGA 3W7BA 1J27A 1RWUA 3R5GA 3US5A 1WJ9A 4J7CA 4KT0C 4M5GA 3TZWA 1VIXA 3QSIA 4EUVA 5HLFA 1LK5A 4J9QA 2J6TA 4MH8A 2M4MA 4K4TA 1VRQC 1SXLA 2E5LF 1PAEX 3GIJA 3RRHA 2KM8B 1S9GB 4Q2LA 1WKKA 2ZH2A 2ZITA 5HQ8A 4ZPWR 1TL1A 2XGQA 1V9OA 4C6AA 3OD2A 4IH5A 3TANA 3DGPB 3W64A 2QA4G 3VHQA 4LREA 2X51A 2Y1IA 1K8AT 3KWMA 4IH7A 4DPXA 2FJEB 3JQJA 2ILZA 1G2EA 4WFAQ 1FWKA 2MPUA 4NXMF 3ISZA 4RW9B 1VR6A 2AEFA 5AXMA 2FLNA 1LFWA 4A8MP 1CJTA 1EP4A 2AGQA 2JLEA 2CIMA 3M1VA 2ZH6A 3OFEA 2HK2A 3MCNA 1SL0A 2VHGA 4CLSA 2IVYA 5F9LA 2B9XA 2VH7A 4B9TA 3IGNA 1X5SA 2C2NA 2G0IA 4LVOP 1FRLA 2GMLA 5CD4A 1S4FA 2NSBA 2NYHA 1H98A 4OHYA 2LEAA 3JB9k 1IXKA 2W9CA 4AQYF 3D68A 1C1BB 1ZYQA 4O23A 3LW5C 3V6DB 3M8PA 5ETVA 1QTNB 3OXLA 1X9MA 3W65A 3M4XA 4ID8A
chains in the Genus database with same CATH topology
3MM7B 4WU2A 5A8KB 2OFGX 1N54B 2LVWA 3NS6A 3LPYA 2E5HA 3H5YA 3KHRA 2FHJA 2KDOA 3I0SB 3OJUA 4GC6A 1IKVB 2DITA 2XWXA 3CMAS 1WF2A 4PPDA 4FS1A 2D3ZA 2IC3B 5D78A 4JI4F 1PSDA 1IKXA 4A8YA 1WTFA 4MKBA 2CZVC 1JLAB 3CT9A 4IG0A 1FKOA 2VC1A 2M88A 4IFYA 4RWXA 3MUVP 2QA4S 3DRSA 2DNYA 2G9OA 3PXGa 4TYAA 4DQRA 1DTQB 2VPWB 4RUCA 2DTJA 4ICLA 1R8BA 2ZOFA 3LGMA 3BM7A 2CRLA 4IG3B 5I3QA 5KAKA 3HHLD 2C3PA 1OPZA 3G6VA 4X4VA 4Y0FA 3HPOA 5HMXA 1FVSA 5LXYA 1BGXT 2APOA 3SCIE 3SFGA 4DX8H 1JWWA 2HS4A 4DUYF 3MHYA 1KQFB 3CIMA 1D3WA 1WG4A 3LP2B 4ZK7M 3DOLB 1RTIA 2FJAB 1LOUA 2JVRA 2JH3A 5A8RB 1HQUB 5C5JA 2HHHF 2YKMA 4JV1A 3EX7B 2WRMA 2CKWA 3ZZUA 4Q43A 1IBKF 4NRTA 1VS3A 2DT9A 2ADBA 3M9OB 3AA9A 4ECUA 3JTOA 2HVIA 2UP1A 2M3DA 3N5FA 1G6BA 4LIRA 4HVZA 1KS2A 4RNHA 1U25A 4Z37A 4QOTA 4TNOA 4R5PA 1TAUA 2JFDA 2E1RA 1IJFB 2X1BA 3UWTA 1PO6A 2XLKA 1UJ4A 3UD3P 3KG4A 2RQKA 2F9JA 3QJLA 2IFXA 5DGBA 3TP2A 4HT7A 2FY1A 2XS2A 1S1VA 3MMAB 5D4PA 3EYZA 1GXUA 3LP0A 3PIPQ 3NLCA 4B9MA 4DV0F 1HBUA 2FVCA 3QO9A 3MEEB 4ZKAA 2CQ2A 1JXLA 2DIVA 2FHMA 2RU9A 4C3LA 3DRRB 2FVSA 4RWWA 5E3PA 4K2XA 4DSEA 4CI0B 3RAQA 1QJHA 2HNZB 2JL9A 5F8NA 1TV6A 1VK8A 3HHLB 3PW7A 2C2DA 3UE2A 3P3DA 2KI2A 4N47A 1QE1B 3ZZZA 4B9UA 2VONA 1IKYA 2ZBIA 4CNZA 3MM5A 5K9FA 4B9VA 1GX5A 3CULA 1VC0A 4G1QA 3I4HX 2JFKA 3DRYA 2NZ4A 4OX9F 4ZVFA 2LA6A 2MHNA 3SFUA 1HQEA 2HVHA 5I3PA 3UPFA 3BB5A 4FZVA 1NK6A 1YJVA 2RKIB 2EFQA 4DL3A 2M0GB 3MCSA 2HHXA 2KJVA 1OSDA 5EGYA 4QR2A 4EO6A 4DS4A 3RW6A 3LANA 1QM9A 1NH8A 4H4OB 1FT8A 1RT2A 3JSRA 4MAKA 4W92B 4Y2AA 3CPWR 1ZETA 1M5SA 3C3LA 3MZIA 3BR9A 1VBZA 4RU2A 4OZ0A 2QRRA 3MMJA 3LALA 2HG4A 2WW8A 4ITSA 2D41A 3OFGA 4LF8F 3SXLA 3FRYA 3BS9A 2J8AA 3KKFA 3LWMA 1Q4RA 1CVJA 2RJZA 2ASDA 4X4SA 2DHXA 1OQ6A 1UWBA 4OJ3A 2J0QD 2LMIA 2VUGA 2DR8A 1LWCA 3MR3A 2AYBA 3OFHA 3HHDA 4F8RA 1NH7A 4DR7F 1DRZA 3SQGA 3BJYA 1A6LA 4RW8A 4Y3CA 4RX6A 3W2WB 3KLIA 6FD1A 1JLFA 1MROA 2XULA 3LP1B 4IFVA 4DG1B 4B3SF 3I96A 2ZM6F 5FJ4A 2OO4A 1U1QA 4PG4A 1TKDA 2D3UA 1WG5A 1TZ0A 3TAMB 1EETB 1FVQA 2RD5C 2B5JB 2VPYB 3DU5A 1LWFB 3MEGB 2VA2A 2R7RA 2C42A 3GR1A 4KKOA 4M5DB 3TRGA 2B0GA 4DL7A 4PUOA 1M5KC 3RB3A 1O8BA 1DHMA 2IVFB 4X4OA 2BV3A 2GQ2A 5CYQA 1RGVA 3H2LA 2EK1A 4A4JA 4OJHA 3MEDA 3MOZA 1KLMB 3CDBA 2IM0A 3SZ2A 5F8GA 1FKPA 2PA8D 4QR0A 2XNQA 1LKZA 5LXRA 3BGUA 3QGPA 5DRKA 2RH3A 2AJ1A 3M9MB 2DNNA 2U1AA 3ITHB 1HBNA 1VQYA 2OPQB 3DDKA 2VG6B 3HLUA 2QA1A 1HD1A 4IOAQ 1HPZB 4OHZA 2N3OA 4ED3A 3PR4A 3POTA 3BQ2A 3QJPA 4CO2A 2OMOA 3ONQA 2GGPA 3KK1B 1X8DA 2QA2A 3OR2A 2BUNA 1VI7A 2HIQA 5E7OB 1N5SA 3M6XA 4C2MA 1KHWA 5IZHA 4X64F 2HHUA 1N48A 1GX6A 2XO7A 3QIPA 4NLTA 3QZ7A 4QU6A 4F50A 1U47A 4YB1P 2DNKA 2HGNA 3NMAA 3TYTA 3M8QB 3HX9A 4ED1A 2P6SA 1O0PA 1S6PB 2MZSA 2IA6A 3PIOQ 2IBOA 4WFXA 2LCWA 5KG2A 5DDOC 3HHEA 2E29A 4MMOA 2BDPA 2CPFA 1ZAVA 4DV3F 2ZZMA 4UQTA 1BQMB 3QAEA 1VQNS 3DXBA 2XMJA 1MU2A 2RRBA 4RNOA 1HNIB 1HI1A 4O3PA 3CCWA 1S6QB 4RBVA 3V4MA 3VZIA 2ZH8A 3IFEA 3RW7A 5HBMB 3BQ0A 1SIZA 3PW5A 2ASLA 3KJVA 3CDEA 2VA3A 3CD7A 2B6AA 3PZPA 2FPHX 1S9FA 3E01B 3C6TB 4I56A 4C8NA 4DMZA 4ZPTR 3QJJA 2V9KA 4OJGA 2MGZA 1HI8A 2CJKA 3SCLE 5DDQC 1VQMS 2A3JA 2CPEA 2K2PA 3TUJC 4RW7B 3OW2R 2CFXA 4HH1A 1UVLA 4C8ZA 3IS9B 5LL6d 4BC7A 5KFOA 4B08A 1S77D 2ZH4A 2YNIA 3T3FA 2GC8A 1FRHA 2RU3A 1SKSA 2BA9A 5HL7Q 2KJWA 1SUQB 1ZH5A 1V6HA 2HW3A 4JI8F 1UJ5A 3HVWA 4ZCIA 3V6JA 3LUYA 3U7JA 4ZP8A 3GYXB 4ECRA 3DC2A 2O5DA 2IAJB 3HKWA 4LF6F 3V4IB 1VLYA 1ZOTA 3DOMA 4O4GB 3ULHA 3T1AA 2J6UA 4ZHRB 2R2SA 1C1CB 2OLWA 3BSCA 3FQLA 4R8UB 2XY7A 3GILA 2Q43A 2XEXA 4HLBA 3DDNA 2DGTA 1TVRB 1Y5NB 4NYPA 1TL3B 2YNFB 1HBOB 5B08A 3I5AA 2DIUA 1N33F 4AL7A 1IJEB 1HFEL 1Y3JA 3WDOA 1VRUA 3IR6B 2E1MC 2JRSA 2M5YA 2HHWA 2HVZA 1XMOF 4M63A 1L3VA 1VOMA 4UY8T 1OO0B 2QZ8A 2WBRA 2VG7B 2YX1A 4ZOSA 3Q24A 2D74B 1HWUA 1TKTA 1SV5A 2MKCA 3LQVA 5J2NB 2K8GA 2VQFF 2JDJA 1FEHA 3HI9A 3DI6A 4NX9A 4UUXA 3K0JA 1KOOA 1VMBA 4X4UA 1Q78A 1SJQA 4DOZA 1TFWA 1VQOS 4MFBB 2W7PA 3OXGA 1X0FA 2YKPA 4DWIA 4C7QA 3GFHA 3T9NA 1N0VC 3IWNC 2F1FA 4I67A 2OSQA 5K14A 5EN1A 3I0RB 1U1MA 1HD0A 1LW0A 2HQIA 4LMZA 5D4NA 3KMQA 2A18A 5FDLB 1LXJA 3PR5B 2ZOMA 4MIAA 5IT4A 2CQPA 4JI2F 1H0HB 3NCPA 1TK0A 5B0EA 4QBUA 4X4PA 1QVGR 1F2GA 4EFAC 1N5TA 5B0DA 2M9KA 1UVMA 2MKKA 1N6QB 1R8HA 3OVBA 5F8HA 3MM7A 3DOKB 2OD4A 3SMZA 4OL8A 2EWHA 5A8KA 1U6FA 2YNGB 2ZFHA 4ZPDA 2PI4A 1M5OC 4KSEB 3RYLA 2GHWA 3MFIA 1DLOA 5F9NA 1B0TA 3X1LB 4A47A 1TR0A 4PXDA 1TL4A 1VIOA 3O8WA 4L72B 2CPZA 4C97A 2V8DA 5KFQA 3SI8A 2DRBA 2M2BA 4E0DA 2R7VA 2AGPA 4C4WA 4OIXA 5HROB 1MWYA 5G4DA 4C0OC 2YKAA 4KO0A 1JJHA 2IA0A 2OD6A 2ZHBA 2COLA 3M2UA 4IKAA 3CD6S 2DVIA 2C3MA 4TKTA 4IR9A 2VODA 3KFWX 1QAIA 1PILA 1M5HA 5CYMA 1NKBA 2E1CA 1R6YA 5E41A 1XWLA 2HHSA 4YP3A 1DQ9A 3TARA 2HS3A 3FEYB 3VAJA 2JHEA 2Q6CA 1YIJS 4OZJA 5J2QB 3LP2A 2VV5A 3CC7S 3ZZPA 1JLGB 2F9DA 3ETOA 3HHNB 3M6VA 2UVVA 1HQUA 4R25A 1N52B 1F9FA 3CCJS 3TVYA 3PY8A 2LU1A 2DGWA 2OPPA 1U1NA 5GVQA 5KFYA 3TO8A 1KEKA 1OPIA 3HVRA 5KOWA 2HLTA 1S1XB 2NPFA 4DL5A 2UXBF 2CVIA 2I1RA 1E6YA 2P9GA 1FESA 3ZZTA 2VBWA 1KHVA 5DM7Q 2X1AA 4PG8A 5LMNF 3UR3C 3ZFVA 3DLJA 4Y34A 5JUMA 3G6ES 4DL2A 5KFNA 1F5CA 2C2RA 3KLFB 2YKQA 2QLXA 5THWA 1SC6A 3PRBA 5T41A 2F8MA 4DV4F 4K59A 4YEAA 4D3GA 2YVSA 3AHPA 4V19J 2XGPA 2XMUA 4NXNF 1RT6B 1SH3A 1S1WA 5KG5A 1U1KA 3PM9A 3M30B 3MEEA 4LF5F 4AFFA 5L9XA 4PXBA 4GMKA 2OJ3A 4WJBA 2MSSA 4NCGB 2W4DA 2AD9A 5M2UA 1YITS 2DPJA 2AGOA 3U1NA 1AW0A 4TU7A 2HNZA 2HAIA 1SL1A 2B9WA 3KLEA 1HYSB 3WC2A 3W2VB 1QE1A 4OX7A 4UW2A 4A8QA 1T05B 1BC6A 1UW4A 1YRUA 4X4NA 3K59A 2MKSA 2DK2A 3FZ2A 5GAGI 1VQ5S 4DL0C 3M8RA 4AL5A 2O67A 2EBGA 3VAKA 3R5AA 5B0BA 3PX6A 2OP5A 4DV1F 1KLNA 2B56A 3GG1A 3K5PA 4ZP6A 1DAXA 4K5SA 4TYBA 5EUHA 1KQKA 3P49B 5KFHA 4JV2A 2V4JB 3DYAB 2P9CA 4XDDA 3OV7A 4NLYA 5BYRA 5LJ5Y 5EWGA 2R8KA 2VB6A 3V81A 1YVFA 2ZNYA 5F8MA 4NZ7A 3QWPA 3HMJG 4H4OA 6FDRA 4OLPA 1NK7A 4OI0A 4UQGA 4DV7F 2UU9F 1DTTB 3EZUA 4ED7A 3GZ7A 1WD6A 2C2EA 4ZPCA 4XAKA 1S1UA 2KXFA 1Q7YT 1OIAA 2C3UA 2KXNB 3OL8A 2V8GA 3CC4S 2JJ4D 3JSBA 3HJFA 2HS0A 1HMVB 4U9RA 1TFYA 3IAM9 4ED0A 1RK8A 4BDPA 1XMBA 5T7LB 2J6SA 4MIBA 1X4EA 3FNNA 5J2PA 2DCLA 5G0RA 2ROEA 2YWHA 1FD8A 1WI6A 2RILA 3MEKA 1TKZB 2EFNA 2MKHA 3IRXA 1C0TB 1VQ8S 1UEUA 4AE5A 5A2QY 1HWKA 2HFNA 2WONB 3DM2A 4WXOA 3OL7A 4FYDA 4USIA 3LP1A 4RKUC 4ETZA 1WF0A 4IDKB 4F4ZA 4FN5A 2JEFA 1R3NA 4QIGA 1KRPA 3AA8A 4HT5A 3TAMA 1U2FA 4A8KA 2LEPA 2B5JA 1ZPWX 2YWGA 2GQCA 5AXKA 3CXCR 4WCEQ 4DS5A 5DG7A 3T19A 1RTHA 4M5DA 4DV5F 1T03B 4G6VB 2RIJA 5B0AA 2DNMA 4X65F 4WF9Q 1FO1A 2CPJA 3DRPA 5B0FA 2EK6A 5BYQA 3IXQA 1HNXF 1VQLS 2WSCC 1GH8A 1JLBA 4PXEA 3KLGB 3MECB 3NG8A 3PV8A 3HZGA 3THPA 4M94A 2KRBA 5JJBA 3OUYA 3S01A 3D28A 4TLQA 2ZE2A 5D4OA 1GQEA 2RF2A 2KT5A 2FGCA 3S7RA 2R8HA 2QLWA 1LW2B 2MQOA 2OPQA 5GADI 2C28A 1R89A 3CJKA 3K58A 2Z8QA 2Y1RI 1IQZA 3IWXA 2L9DA 4BBYA 3IG1B 2KG0A 3EPGA 2DGOA 3RRKA 5A8WA 3J80Y 4QYRA 1TL5A 3KLHB 2FLLA 3KK1A 4WFBQ 4KB7A 3S6EA 2R7SA 5K8OA 4K4SA 4WE1B 1FERA 1ROFA 5DGAA 3R5DA 4WK1A 3D2WA 3Q2TC 3W3SA 3RBEA 2FJDB 3N5BA 3HP6A 2L9NA 1HA1A 2FJWA 4I2QA 4GO5X 1S6PA 4OX6A 5K8MA 5DQHA 2LXUA 1RT4B 2LLZA 3OSNA 2FVRA 2ZC4A 3FJ2A 2RQ4A 2V8HA 4JYAF 1PC4A 2QO3A 2BE2A 4ZP7A 1KNZA 2J9DA 2WAQD 1HNIA 3H5SA 2V2KA 2XB2D 5LSRA 2D9PA 4RW6B 1YG0A 4Q0BA 2EVZA 3L3CA 3I55S 1X5TA 1SJ1A 5LJ3Y 3MM9A 3KMSA 2V4RA 1HWLA 4N77A 1WG1A 2WOMA 3NP5A 5B09A 2DISA 4PCQA 3O6QA 5LMUF 2E66A 4F4XA 1CEZA 4ZVHA 4O44B 4Y2KA 4HHJA 3ZZRA 4WKRA 4OI4A 4Q7AA 4BHQA 1T8EA 4NRUA 1VK3A 1YGYA 2ABYA 2ZDOA 3EGWB 3MPWA 1X7VA 4LSLA 3BO2A 3NNAA 2BACA 1S97A 3IS9A 3GE9A 1D9AA 1R7IA 4DLEA 4JI3F 2MZQA 5E3QA 3K2YA 2YKNB 4URSA 4WKYA 1JKHA 5GAEU 1SKRA 4CT9A 3RB4A 1RDRA 5L1LA 1NJZA 3MM8A 5F8JA 2CQHA 2QIFA 4NA2A 1HNZF 2GFFA 1SUQA 2FJXA 3T9ZA 3B8HA 1FKAF 3I5BA 4LT6A 2IMWP 3PO5A 3JYTB 3FCHA 3G86A 1URNA 4O3SA 1FNMA 4O4GA 3TR5A 1SIWB 4NLQA 1O51A 4GKKF 3O44A 1SBRA 1C1CA 1HHTP 3NCRA 1S6UA 1QSLA 3N6LA 5DJBA 2NYIA 2UVWA 4A8WA 3SYZA 1TL3A 2YNFA 3OHAA 1FTRA 2I0XA 4FF2A 2K1RB 4FXVA 1C2PA 1IN0A 5L1KA 4WFYA 1YWXA