2XBPA

A novel signal transduction protein pii variant from synechococcus elongatus pcc7942 indicates a two-step process for nagk pii complex formation
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
113
structure length
113
Chain Sequence
MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGSEYTVEFLQKLKLEIVVEDAQVDTVIDKIVAAARTGENGDGKIFVSPVDQTIRIRTGEKNADAIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Novel Signal Transduction Protein P(II) Variant from Synechococcus Elongatus Pcc 7942 Indicates a Two-Step Process for Nagk- P(II) Complex Formation.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Gene regulation
molecule keywords NITROGEN REGULATORY PROTEIN P-II
total genus 25
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2010-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xbpA00
1GNKA 5DS7A 3HLUA 3X3UA 2JJ4D 2NS1B 3NCQA 3BZQA 1V6HA 4C3MA 2XG8A 2NUHA 3AA8A 4USIA 1UMJA 1V3SA 1XK8A 1Q1KA 1KR4A 3M05A 1V3RA 1V9OA 3O5TB 2EG2A 2ZFHA 4CO4A 4CO0A 4OZNA 1PILA 4ZK7M 3AH6A 1HWUA 3OPKA 4CO2A 1UL3A 3L7PA 1VHFA 4E98A 2XBPA 4YB5A 4NYPA 4CNZA 3LF0A 2J9DE 2O67A 4R25A 3N5BA 4C3LA 4D3HA 4USJC 4D3GA 3MHYA 3NCRA 4USHA 4C3KA 2J9EA 4WK3A 4OZLA 3AHPA 5D4OA 3T9ZA 4CO1A 4YB7A 4CNYA 3O8WA 4RLEA 2GNKA 4RX6A 2DCLA 5L9NA 1OSCA 1NZAA 2NUUG 3GSDA 1O51A 1UFLA 4NYOA 2RD5C 3TA1A 2VD3A 2GX8A 2CZ4A 2PIIA 1J2VA 5D4LA 3TA2A 4YB6A 1H3DA 1NH7A 4AFFA 4RWXA 2GW8A 2ZOMA 5D4PA 3DFEA 2E66A 2O66A 2XZWA 3CE8A 2XULA 4WK1A 4CO5A 4Y65A 5D4NA 2J9CA 3TA0A 1O5JA 1QY7A 2EG1A 2J9DA 1NH8A 4Y6IA 1VFJA 5DRKA 1P1LA 1NAQA 1UKUA 4RWWA 4CO3A 4IYQA 3AA9A 4OZJA 2Z0GA 3NCPA 2V5HG
chains in the Genus database with same CATH superfamily
4WBFA 1KSPA 5FIIA 1CS4B 1BQMA 2CQ2A 4KB7A 5KG4A 4CQ1A 5HMWA 2G13A 3HLUA 5K20B 2QMWA 4WFYA 1R8CA 2V2KA 1YDLA 2XMUA 3L7UA 4K4UA 4FXDA 3M2UB 2HHQA 4JI3F 5F0UA 1WG5A 3M4XA 2QJ3A 1Q7YT 5KT6A 3T5KA 1WF2A 3ZZUA 1HQEB 2AV5A 3IAM9 3QT6A 1B99A 4UY8T 3W64A 1YBUA 4WKRA 1BWVA 4L3KA 4RL1A 1M5HA 4ZVSB 3LP1A 5KG3A 3C19A 1RTHB 2AU0A 1FXLA 2HNZA 3CJ2A 3HX9A 1M5KC 2FVPA 4DF4A 1S9FA 1XK8A 2NXJA 2RUGA 2MZJA 1Q53A 2V4JA 3DHWC 1H38A 2BQRA 1S6QB 3DRRA 2LA6A 2EFVA 1QAYA 2HGMA 2L3MA 4OQJA 3OL7A 1OYEA 4ICLB 2ZH5A 1ZA2B 1FVQA 4OJHA 3T19A 3PX4A 1CQNA 1R7IA 2IJFA 2LCWA 4P7VA 1P27B 2K8GA 4ZPAA 4N47A 4O4GB 1QLNA 2B3TB 3MMCB 3BM7A 1SB6A 1YJRA 5B0CA 1D3WA 2DXDA 1F1BB 1R8AA 1UL3A 2KXHA 5GADU 1N6QA 4NLGA 1UP1A 3D1QA 3GFHA 4LT6A 4EYHB 4IRCA 3GR1A 1SL1A 2CPEA 5ETRA 3DLJA 2HFVA 4NXMF 1VQKS 3O1LA 4TY8A 3SYZA 1SH3A 1F3FA 3PVXA 1AZSB 4QBUA 1CVJA 3H8YA 2HFUA 1B64A 5J1EA 5A0YA 1SKRA 2XLKA 1QAXA 4WK3A 1WHWA 3BJYA 3KLIA 3KLIB 1DLOA 2CPZA 4IFYB 1G4CA 3CDUA 4WU3A 4WKYA 2K1RA 2H1YA 4CRJA 2C22A 2ZZTA 1I51B 2XMAA 1LW2A 3W9IA 2I5JB 4ECSA 1N52B 1WKKA 1ZM3A 2VFRA 3VCDA 5L39A 3NMRA 4IQMA 3TAQA 2XNQA 5IT9U 1S49A 5C7PA 3I6PA 2LDIA 4DUZF 3SV4A 2FD2A 4H4OA 2LQ5A 4ZVEA 2CJBA 1TL7B 1VIOA 2GIQA 4FVMA 2F1FA 2OD4A 4LF8J 1T03A 1I94F 4FF4A 4NXNJ 3G86A 1Y5IB 2A6MA 1V5VA 4DX8H 2XCAA 4ECVA 3GPAA 2CZ4A 3AJDA 4K7QA 5L8RC 1KTVA 5JMNA 1H6KX 2CZVC 4JI6F 2AWZA 3A12A 1Y7PA 4BWMA 4DSFA 1J5EF 3IR6B 3GJSB 2R9LA 3M7VA 3QRPA 2UZAA 1EARA 1UEUA 4FKYA 4A48A 4W90B 3DI6A 3OTEA 4OI6A 1VMBA 4KGXB 2HFNA 4BCAA 4I6WA 2ROGA 3ZZRA 2ROPA 4L75A 4F0MA 1SL0A 2A0FB 1QSYA 5HQ8A 1FJCA 4Q43A 4NMXA 2XULA 3CXCR 1TV6B 2JEJA 5BR8F 2VFUA 2NYHA 3TVYA 1RACB 1ULRA 3PRBA 3ZC4A 3ZZPA 4FF2A 1MWQA 1RKJA 2Y0BB 1Z2LA 2ZKTA 3BSOA 2HHSA 1RAFB 3HZEA 4IFVA 1WWHA 2RT3A 4WFZA 4O3PA 1JMTA 3M6XA 8ATCB 2E9TA 1HQEA 2OI2A 1VFJA 2IJNA 3BF4A 2P6TA 1VQ7S 1IN0A 5DGBA 2LXUA 5AT1B 2YNHA 2IAJB 1FE0A 3PDNA 5LMUF 3C3LA 1JLAA 5KFWA 4JI8F 1U1NA 4F2SA 2C2MB 2VG6B 2Y1RI 2ZH3A 4KIAA 3DC2A 2D1CA 3DLEA 4K4YA 2R2UA 1VQ6S 3TVKA 2GV1A 2KTQA 2I5JA 4QYRA 1AXQA 5AE1A 3MM5B 2Z0GA 2JVRA 5KG0A 2HHWA 1S48A 3R2CJ 1D8YA 4RBUA 2IBOA 5G0RA 1B0VA 2GJIA 3KUGA 2QT7A 4FDFA 2B6AA 2WVEA 4JYAJ 4DV6F 2B6AB 4UZCA 3OL8A 1SQEA 2LXIA 3BYPA 4XAKA 3K5NA 4B9SA 2JVOA 3KLEB 3EGZA 1NJIT 3G6VA 3VAGA 3QQCD 4B9LA 2UVRA 5KFRA 4FBUA 1YJUA 3PHTA 2DHSA 2WSEC 4O3NA 4U7UK 4FYDA 3HSZA 1GMVA 5HMYA 5KFNA 4QWAA 1FK9A 3U1MA 3ZZTA 2E1AA 1Y5NB 1E6VB 4ZIWA 4Q45A 2J8SA 2VU5A 1YI2S 4I1TA 3RTVA 4ETXA 2Y1IA 3FEYB 3A8JA 5C25A 3JQMA 4JI8J 2W9AA 5C25B 4B9MA 3ONQA 4YDXA 2JOQA 2BE2B 2YKNA 3FJ2A 4AYBD 1WG4A 1LEOA 4ITSA 3OUYB 2QGFB 3OTOJ 3CC2S 5F8MA 1I6JA 1VJQA 2CQ4A 3M9MB 4DXLA 1R27B 1X0PA 2HZAA 4KGMA 4USUA 4X84A 2VG5A 2XSFA 1YBTA 1NDKA 2OLWA 3OPKA 1TKDA 1JXLA 3QRQA 1VHFA 3SCLE 4R5PB 3J81Y 1URNA 5KFGA 4OI2A 4DX6A 2FQQB 1N0UA 1ZZFA 2QMUB 3QLHA 4AXIA 1NM2A 2XMTA 4Y2KA 2UUBF 1GX5A 3G6YA 3QWUA 3EMTA 3GG0A 1JNZB 4Z37A 4IQXA 3MM6A 4PWDB 1U1OA 3GFZA 1DTQA 1PIEA 3C15A 4Y2IA 2KRRA 4NEYA 3DLEB 4PXCA 4PRFA 3I96A 2W2MP 1Q4RA 4MIAA 2ZBPA 1VDHA 1HNXF 2MGZB 2IM3A 1M1GA 3NOCA 5D4OA 4DV1F 2LFVA 2VBYA 2RIJA 3I87A 3HHLD 3T9ZA 5CHCB 3Q23A 3HJFA 2I1RA 2BYCA 3CJRA 4F67A 1N32F 1S5ZA 1S9EA 3DNCA 2VPWB 5E5NA 2I6WA 3LPYA 4ED1A 3UCZP 5AE2A 1VQPS 2HRTA 3PACA 4KV8A 1WC6A 2IHR1 5CCLA 3BBFA 3OSPA 2DR7A 5KFQA 1W25A 4RUCA 2VQEJ 3OJUA 2FJXA 2CG8A 4OX8A 3I0RB 1MG7A 1Q95G 4TY9A 4OYAA 2B5JA 4PWDA 2J7WA 5KOXA 1FRIA 4BDPA 3P4UB 3JXOA 4O0IA 3L3CA 3HO1A 3FC9A 3AQOA 3J7AN 1FFGB 1N0VC 5IM0B 1S1VB 1RB0A 1RWNB 2YY3A 3OUYA 2BACA 1WEXA 4OLPA 2H51B 1S0VA 2B7BB 4YUDA 1RT6B 2HK3A 4X62J 1LV5A 2WVDA 1L3UA 3NWRA 2LLZA 3PV8A 2PE8A 2ZDPA 1OO0B 3SFGA 4KJIA 4RBVA 2VHGA 5BYSA 5DG7A 3ADAC 3EDRB 5CABA 2CJAA 2KM8C 1S10A 3OXGA 5E3PA 2FY1A 4USKA 3KLFA 4WK1A 4Q5VA 1JQGA 2MQNA 4C0OC 1TTHB 1C2PA 4LFCJ 2XHCA 4MKBA 4MKYA 2WB1D 3AXKA 1CSJA 1B0PA 2A3JA 4QPTA 3NKYA 2G1DA 1M1HA 1DHMA 4Y6IA 1X31C 4ZVTB 1S9GA 3BSCA 2QLXA 3EZUA 4G6VB 2KO1A 3IM9A 2MZ1A 1WG1A 3M8QA 3CMAS 3DLBA 1VRUB 3JQKA 3UN2A 2YKAA 2V9WA 1WF1A 3RU0A 3BGRB 5L1JA 2ALZA 4ZDNA 2GO9A 2HVEA 2QA4G 3IR5B 4KH1B 2V6AA 2R2TA 2V63A 1TMJA 3HULA 1PKUA 4LSNA 2E7XA 2V2VA 2VBXA 3UQSA 3FRZA 3MEEB 1FKPB 2KHCA 1RK8A 3ETOA 3Q2SC 4JB8B 3NGUA 4IG0B 1JK9B 5KFBA 3PRDA 2HLUA 3MR7A 2B9WA 5GMEA 3W2WB 1WKJA 2E1CA 5KFJA 1UEVA 3AA8A 5GAHI 2GMJA 4J90A 2R2SA 4F02A 4MYUA 5B0DA 5D78A 1R0AA 2VBZA 1BLUA 2ZDOA 5I42A 4DL3A 4HI1A 3D68A 1PJ7A 3T6JA 3DRRB 3UD5A 2OSQA 3DOKB 4M5DB 2DVIA 2CYYA 1EB0A 3MGJA 2DEIA 2HHHF 2LP4A 3US5A 3JTNA 1MN7A 4OYWA 4K59A 4ZLJA 3TUPA 2MZQA 2PFDA 1EZZB 3G96A 3TJAA 1QTMA 3PW0A 3V4MA 3L7PA 2DPJA 2BDPA 2BQUA 3M8SA 3THVA 3CWJA 3H42A 1FO1A 3HVTA 2DR5A 3RGIA 2RDIA 4YB5A 3CCJS 3PG9A 3SDEA 2FLLA 2WONB 4CLLA 2O67A 4ES2A 4FYVB 5MAOA 1CJUB 2ZH6A 1OQ3A 2JFKA 4D3HA 5DDPC 2WTFA 1L3TA 1EKRA 1ZH5A 3D67A 3FSXA 1WACA 3P5BP 1JKHA 3PYDA 4QQBA 1FF2A 2MZSA 3KNGA 1JLEA 4ZN1A 2XCPA 4TN2A 2BJ7A 1VISA 3AHPA 1NJYA 4NLQA 4OZ1A 3KFWX 1SUQB 4OZ5A 4DJBA 3K0JA 1RWWB 3IG1A 3N6NA 4HHJA 4YDDB 3JSYA 2GNKA 4PG4A 2VFSA 3WC2A 4X4QA 5D3GB 2DJWA 3JAMY 1RBAA 3W61A 4PKDB 2NUUG 1HFEL 2FPHX 5KFAA 2B4VA 1LFWA 4LF2A 5GADI 4M5KA 2G0CA 2BANB 1O51A 1RLDA 3AXMA 4ILMA 2AZ1A 2DRBA 2HQFA 5LMNF 3ZNJ1 4UOGA 3N6MA 4AL7A 2NXCA 3RRGA 4A4JA 5IT0A 3R2DJ 2ZE2A 1Y00A 3B6BA 1VBXA 1RT1A 1Q82T 4JI5J 2PFFB 1XERA 3DRPB 1T3NA 3BS9A 5E41A 3K89A 2H5IB 3RB0A 1KQGB 1RSCA 1WOOA 5KFPA 3L09A 3UW1A 1HBUA 1U1PA 2MQQA 2ACMA 4CM2A 1PBAA 1X4BA 3IR7B 2MLXA 2QO3A 1UA0A 2HPUA 1FJGF 1CLFA 4BBYA 1SJ4P 1HWIA 1X60A 1IJFB 3CO9A 1NDLA 5BYRA 2P9CA 3KDNA 4CLTA 3CGIA 3L9ZA 3TQEA 3SZ2A 4KBIA 4L72B 3RUBL 2AMCB 1FRMA 3DKDA 1AW0A 2HW3A 1T05B 1MWYA 2E1MC 1NH8A 5MLCV 2VONA 3EUNA 4DL2A 2KB2A 2DY9A 2MY8A 3R7SB 3R3TA 1VHIA 2LQBA 2Y1LB 2VPZB 4LBPA 5BR8J 3KHRA 1K9MT 2AYEA 2EFQA 4ES3A 4M5MA 1YJWS 1NK9A 1N88A 1U8WA 2ZWPA 1JWWA 4X64J 1RBLA 2CIMA 2CPIA 2OMLA 4F26A 1G1XA 1VYAA 2G0JA 5DQHA 2BOPA 2CJYB 5A2QU 1NZ8A 2VDHA 4IOBA 2Y9HA 3QRRA 1VBYA 3NCQA 3RAXA 1RHMB 2GHPA 2E5JA 1S6PB 4RNMA 2FJAB 2YWGA 3NS5A 3VR1A 4DEZA 5F41A 2R8GA 1V6HA 5C2GA 1KRPA 2R8JA 4HACA 2RDJA 3T1HJ 4LF8F 4FN5A 2E5IA 1C4CA 2NXEA 1FK9B 5B0BA 5KOWA 2IFXA 1BUXA 1Q7LB 2VODA 1ZAXA 1V3SA 1UTAA 3PKYA 1QM9A 1Q1KA 3OD2A 1N56A 3OLAA 1FFWB 2M2BA 1TKZB 3A13A 3CUNA 3DOMB 1JLQB 2LU1A 2CA9A 3MOZA 3DOMA 1E6YB 1RCXB 4KGKA 3V6KA 2UV8A 3QO9B 4DV7F 1IKVB 4ECWA 4E2FB 1X4CA 4OHXA 1X4GA 3HSGA 3M30B 5KG7A 1X9WA 1S0NA 3TJ8A 1KN6A 3C2PA 3FSIA 3K5PA 2H5EA 2RUSA 5D3GA 2EW9A 2VQEF 3M8RA 1Q0NA 2XYGB 1O8BA 2EPIA 2VUGA 4ECZA 3FMWA 3KJFB 3FSYA 5ETKA 4Q2LA 1S6OA 3RYLA 5HROB 2MQOA 2GS8A 2W4PA 3GIKA 2R7WA 3W66A 2HGLA 1TL7A 4TU8A 5I3UA 1X8DA 1JB0C 2OSRA 4NX9A 3VVTA 3M2VB 2GIRA 4KE5A 2XMWA 2YNFA 2FTRA 3QGPA 4FZVA 4J7CA 2UXCF 2W9BB 3MEGA 2DD8S 2ZUAA 1N4LA 1SXLA 4TQRA 2DTJA 4K2XA 2XS5A 1L3SA 4Q44A 1KWMA 4RUBA 4KHMA 4GVLA 2OEJA 1TKTA 3HT0A 3CCRS 4PWWA 2Z2MA 3ETMA 1MU2B 3CC7S 2ZHOA 3C6UA 1UZHA 3ULHA 2CNOB 5ETLA 3AD9C 2FVCA 2OPRA 2F3JA 1K8AT 2OPRB 4EMDA 3D1HA 4HHHA 4BS2A 4FXVA 2X3DA 4O44A 1KLMB 1S1WB 3OFFA 3PRVA 2LQ9A 2B7CB 1JLCA 2LYVA 1JLGB 2Z8QA 1M90T 3D2WA 3KUEA 1TL1B 5EDWA 2FLNA 3KOAA 4EO6A 3OTBA 3BDPA 4JI5F 3BGUA 4DI6A 3RB4A 2UXBF 2YBVA 4JOUA 2UUAJ 1SC4B 1IQTA 4I56A 1J2VA 3V2UC 2VPXB 4OYBA 3LWMA 1RT5B 4QWCA 5LMNJ 2BEFA 2A2CA 3A3OB 1RT5A 2CQ0A 4IDKA 3V5RA 1HNWJ 5E3AA 2K1RB 5E7OB 4OV1A 1YVFA 3M8YA 2VB6A 2O3DA 3VTIA 5IWAJ 4X65F 1RAHB 4KO0B 4B17A 1SIZA 1QDUB 5HL7Q 2EFGA 3M8WA 2E66A 1ZTWA 1VQYA 1XIQA 4OYZA 1X4EA 2UXBJ 3TEHB 3TANA 2V94A 3HSDA 4Y2MA 3W9HA 1IKWB 2H4YB 4DDFA 3RB3A 2B8PA 5FJ4A 1XNRF 2O01C 2ZZMA 3PYFA 3V4IB 1HBMB 1KQFB 5EWGA 3CD6S 1TP7A 1KD1T 3DLKB 4PQUA 4C7QA 4Q0BB 2VPYB 4NA3A 4AQYF 4QR0A 2HG4A 5LM7E 3IWNC 1J5OA 1S1UA 2IMWP 1XR7A 5SZTA 4DUYF 3POTB 1VBZA 1FRLA 3P49B 3LAMA 3CD5A 4GO5X 1YZ7A 1UVJA 3PW7A 3B82A 2DYAA 2CNLB 2JZ5A 3PW4A 2CAJA 1SJFA 4U8VA 4LR8A 1YG0A 3OL6A 3HHLC 3IS9A 4Q7AA 3TUIC 4DFMA 4LR7A 4M5LA 2RHQB 5J2MB 2XO6A 2QZ8A 5F8JA 1XMOF 2P9GA 2UUWA 3BKFA 4KV8B 1VQ5S 3CNQP 3ZZYA 1VQ9S 3P96A 1VC6A 2J6SA 3SSRA 3R6GB 4F4ZA 1W2BR 7AT1B 1NHVA 1HD0A 3SCJE 2CQPA 3B4DA 3QO9A 3TVZA 3KK1B 2UUCF 1RYSA 4IH6A 3PXGa 2MXYA 4IR1A 2W7OA 1KOOA 2FUG9 1MMNA 1SQFA 3EGWB 2CQ3A 3VAHA 1WHYA 3W1YC 1B3TA 3QAEA 1J5EJ 4KC5A 5HO4A 3AJ1A 2NUHA 4JBCA 1SJ1A 4HDHA 3LWLA 2MKJA 2R7QA 5I3UB 4J91A 3UD3P 4ED3A 3UR3C 2M3DA 3I9ZA 1TAQA 4DR2J 2KL8A 3CCLS 3NRBA 5ETSA 1RWXB 3N9UC 2AIRB 1F9HA 4LSLA 3G82B 2B9YA 1WHVA 4LVNP 2B51A 3MXHP 2FLOA 3H4BA 2OEKA 1YJTA 5KFCA 2HNYB 1HWUA 1WORA 3BR8A 1O6XA 4UW2A 5B0FA 5I3PA 3D0GE 5CZVA 4CO2A 4DZDA 3PIPQ 1N6QB 4L73A 3G8SA 4AE5A 1Y4ZB 4Q8FA 2MMYA 4A8YA 4DR7F 2WVCA 3MMJA 3LF0A 4UOHA 1U25A 2IIHA 1C1CA 1X4FA 1BHNA 5LXRA 2VH7A 2CUYA 2MHNA 3H40A 2VC0A 3NCRA 3MEKA 2QLWA 3N79A 2VZ9A 5A0YB 2XEXA 1U09A 5CYMB 2F65A 1S1VA 1YX2A 4NLYA 3TX8A 4JP8A 5DETA 1X9SA 3P3DA 5LL6d 2UV8G 3T5HA 3WIUA 1HPZB 3AB2B 5HSPA 1RHKB 3GCWP 2X1FA 3SCKE 1IR1A 5GVQA 3H5UA 2MQPA 4H4MA 4ECRA 1A9NB 5F8GA 3IGNA 1ELOA 2NPIA 1WTBA 4JI7F 4ZPVR 1RHUB 4WIQA 2QG9B 4WCEQ 4DG1A 2VJUA 2ADBA 1VOMA 3BSAA 2AT1B 5CH7B 2K06A 4ED6A 5CZXA 5T14A 1MW7A 1P8GA 2GVDB 2BKNA 2WB4A 3QT7A 2ILZA 4GVBB 4HEA9 4PZVA 4ZP6A 3VF0B 5L38A 1QAJA 3PO5A 4UY85 1RT1B 1FKAF 3BR9A 1U1LA 3BO3A 1U0HB 3CCZA 4BC7A 3MDFA 4LSLB 4F25A 1HHQA 4ES1A 3H5YA 3EGNA 2XO7A 2A18A 3QAUA 4ID5A 4LF7F 4LFBJ 1P1TA 3PFEA 4ID5B 4DPUA 3OR1A 4M5NA 3TYTA 2CDRB 1TL3A 1GFWB 3OFGA 1NPRA 5FD1A 4DR2F 3OVAA 3DFEA 3GMGA 4G1IA 5JXSA 3S6EA 1FESA 2F9JA 3HSJA 4NZ0A 3AODA 4M95A 1XJWB 3R27A 3W3SA 1VC0A 1PAEX 2HIQA 2NR0A 1Y0HA 5KAKA 3NMAA 1EQ0A 4LIRA 2DR6A 4X64F 2J7KA 1LOUA 3H20A 1O0PA 3P8BB 3V6DA 1IWAA 1OY8A 1TL4A 4IFVB 3RBXA 3GZ7A 3KLGA 4IOCQ 1JKHB 1KBRA 4WJBA 1VGYA 2RE1A 5HJXA 3P5TL 3FBFA 4K8RA 4KPYA 2E5GA 2WAQD 3UE2A 4C8LA 4J9LA 1RTJB 3SXLA 3M6UA 2ZM6J 3F0NA 1SUQA 2OELA 4DN9A 4LMZA 1EP4B 3EICA 4N8OA 2R7SA 3OL9A 2M5YA 3F73A 2UU9F 2FHJA 3IBWA 1S72S 4ZP7A 3QZ8A 2OPSA 3HHLB 4RNOA 3MUMP 4H4MB 3CJ4A 2HSEB 2BVZA 2XLJA 3MTKA 2E1PA 5ETOA 2OH2A 3CT9A 1U1MA 1RABB 4MFBA 4ZPTR 1T9VA 2V2ZA 3FGVA 2SXLA 3WDOA 1SC6A 5CD4H 3OSNA 4HTIA 4EUVA 1SC1B 1N33F 3M6VA 2EK6A 4A8OA 4RU9A 2GQQA 3GWCA 1WOSA 3HFKA 2F9DA 2JWNA 3KJQB 5KFXA 2RF2A 1NDPA 1WEZA 2ZH2A 2XGQA 2OFHX 5THWA 4ZJLA 3TEGA 3TR5A 4FYWB 3DRPA 2PSZA 3PFOA 1W26A 1B7YB 1S4EA 3FNNA 3LP2B 3LW5C 4ALZA 4DOZA 4RNFA 4M8LA 1KR4A 4H54A 3S1TA 5IXUA 1CC7A 2MKCA 1V9OA 1HBUB 5FDLB 5J1EB 3HVRA 5FDLA 1ZOTA 1YJ9S 1M5VC 4ZCMA 2M52A 1LKZA 4YR2A 1K44A 1YLXA 2OPQA 3I9V9 2KZZA 2DT9A 1R6YA 2Y1JA 1NK8A 3OR2A 3MEEA 4ZVHA 1WC5A 2DNHA 2CQDA 4RNHA 4E98A 2PGCA 1IKXB 2JRSA 3CD7A 1UVKA 1WKLA 1NPKA 5K5MA 1N36J 3QJPA 4NYPA 2V34A 1UVMA 1RAOA 3Q8YA 1TZ0A 1FCAA 3JQJA 4F0KA 1XMOJ 2W9BA 1Q8KA 4NYZA 1GMWD 3OV7A 1T03B 2GC8A 2RRNA 3C8YA 4URQU 1Y3JA 1QVGR 2RRBA 3R1HA 1U24A 2NXUA 3D3CJ 2L9WA 1EJ7L 1F5BA 4ZPWR 3TX0A 5ITHA 1RISA 3MD3A 5L1IA 3WX8A 4URGA 2XY7A 1YHQS 2UU9J 3QYYA 2ZKUA 3EE3A 3EDQB 3O8WA 2ZM6F 3N01A 1CBKA 5U47A 2UXCJ 4X4PA 3BO4A 2HQDA 5ETTA 4ANDA 3KHHA 1XNRJ 4DMZA 1UVIA 4DR1J 3H2UB 3TJ9A 4NYOA 2ATCB 2QA2A 5D8HB 2ZD1A 3QIPA 5KT2A 5L1KA 4A8QA 1NKEA 4EGLA 3CDAA 3NBPA 2U2FA 1T9WA 2E1RA 2JSXA 2CRLA 2KN4A 2OFGX 1VCTA 3A1YG 3QPIA 2DNGA 1VK8A 1C0TA 3I31A 2VA3A 3OLBA 4NWBA 2PO4A 3HMJG 1YSJA 1E6YA 2V9KA 4P7TA 2JX2A 4ZHRB 4N7TA 4M94A 1GXTA 2OPQB 4CLWA 4ERDA 1IJEB 2CPYA 2DKOB 4DV0J 5IV4A 2X3GA 1LWEA 3K17A 1NK5A 2YNIA 2ZOMA 3HKWA 1PYTA 1XTZA 2YX4A 1ZAWA 4PABA 1G7CB 1DQ8A 1UWBA 2W2NP 2C3PA 3MAAA 2DCUB 3NLCA 1QD1A 1WC3A 3MMAA 3CE8A 4R0EA 1RTIB 1KC8T 2C3UA 2YPYA 2VDIA 2YX1A 1XMQF 2V8GA 3HPOA 1HR0J 3VQSA 4A8SA 2OAUA 5D4NA 1RHRB 3AD7C 2XI2A 1FRXA 3TA0A 4QIFA 4DX7A 2K7KA 3BBBA 1MMDA 4XPCA 1SBRA 2Q6CA 1N5VA 1FEEA 4ZVGA 3U1NA 4Q0BA 2IC3B 3M8PA 1PYSB 4F3QA 5D6GA 3FCVA 1R8BA 3IXQA 4G3IA 1NAQA 2C3YA 2FHJD 2ZC4A 3EVMA 3EYZA 1FHTA 2R3VA 4IYQA 2ZH4A 4LBHA 2H3EB 1YQHA 1NHUA 1RT2B 3GV7B 2YKOA 4NA1A 3AA9A 4UOFA 3D3BJ 4DV1J 4ZPDA 2E44A 5CXTA 2EVZA 3KXDA 4QOTA 2XNRA 3PEJA 4TLRA 1SKSA 4KRWA 4CM0A 3DU5A 4M1KA 2Z57B 2YKQA 1LW0A 3KK1A 3MMBA 3DYAA 2J0WA 1UPPA 5DS7A 1JX4A 2UXDJ 2HQ3A 4J9OA 3JSRA 3MPDA 4ZVOB 3MUTP 2W8KA 4N76A 3GILA 4MJKA 2DNPA 2CJXB 1HARA 4DR7J 1F9FA 2LQJA 3CIMA 4CLFA 3CDBA 4R5PA 4PEOA 4HR2A 3BZQA 4DR3J 3LGMA 2C42A 2GGPB 1SV5A 1D1UA 1Q5YA 2AHOB 4CTAA 1D0EA 2UVVA 5T7LB 4E0DA 1BQXA 4QIEA 1Q16B 5T7LA 4C8MA 3B54A 2AJ1A 2KRBA 2N4CA 4YMEA 2ADCA 3QIDA 3DMJA 5D0RA 1V3RA 4RUHA 3CULA 2YWEA 3DRYA 4I0WA 4ICLA 1Y10A 1YJVA 3BH6B 1KP6A 1YK9A 1EETB 4DV7J 4NLPA 3CC4S 4DR6J 1NSQA 2YKMB 4CO4A 1S4FA 2JL9A 4G1QB 4WP8A 5KFLA 4WFBQ 2MTLA 2BABA 4USTA 5F8IA 5HN0A 2MJUA 2YWHA 3I0SB 4RKUC 1KKHA 2KG0A 4CWBA 5LJ3Y 5I4MA 2W9CA 3QJJA 1OY6A 5A8WB 3GU0A 1F3VA 2DNNA 2DNQA 3GFYA 4WYLA 2R8IA 3IBCB 2ZJRQ 4PPZA 2DEJA 1U1RA 3IFEA 4Y00A 3ZXWA 4PG8A 4RZRA 4N56A 4NE9C 1FD8A 2BJ1A 2ZD1B 3QIPB 4B3SJ 1VQNS 4USHA 1AUDA 5BJRA 3VALA 1C0UA 2HS4A 2AKWB 2KU7A 3OQ2A 4A8WA 4JI7J 4P2SA 4QCLA 4TU9A 2B4PA 3TUJC 4B3OB 1H2VZ 1NBEB 3UCUP 2E7WA 2DHAA 2RVJA 3PR5B 3CPWR 1VQMS 4RLEA 3BREA 1Z4UA 2H65B 3H7HB 1VC5A 2JC0A 4FXWA 2DCLA 3PJXA 5EX3A 1X5TA 5KT7A 2QC3A 3GSDA 1I5OB 1OY9A 5L9XA 1U48A 1DJ0A 3AAWB 1DZ5A 2RRAA 3UNGC 2ASDA 4DFJA 5KFHA 2BE9B 4NI2B 1HL6A 2BA9A 1REVB 2VL1A 2CVEA 2WHOA 4HT5A 1HNVB 4WXOA 2EXUA 3G8QA 4ZCIA 3U27A 3VAMA 3PW5A 2FJVA 4DV2F 3GR0A 4ZOSA 3TRGA 2OP5A 1YRTA 1QUVA 1HMVA 2F8MA 3LANA 3JYTA 1S9GB 2DNLA 2K7JA 3OTCA 2DO4A 3HF5A 1FTRA 5F8LA 2VQFF 2FVQA 4IOAQ 4ECQA 2VFTA 4QIGA 5D0GA 3GIJA 3AD8C 2C1EB 3HT3A 2K2PA 2YPZA 3D6FB 3GV5B 2ZBIA 4MK9A 4NCGA 4F50A 1M5PC 3P45B 4CO5A 3CCQS 4C9DA 4Y65A 4B3MJ 5KFSA 3PO4A 2DIVA 2J9CA 4FYYB 2X7IA 5KFTA 4CYUA 5JUMA 1LXNA 2HGNA 4KAIA 1TL1A 2PI5A 1BXNA 2EG1A 4NCBA 1T95A 3OXFA 1FE4A 2PMWA 4R8UA 2KXNB 2FC8A 2B8QA 4JI0F 3MI7X 3CTRA 3K8WA 5B0EA 2IAJA 2VQFJ 1GMWA 4ED2A 2QYGA 3N6LA 4PG7A 1PYOB 1UFKA 1UPMB 3EXYA 2AJQA 5B09A 1NB7A 1RXOB 2ZWOA 2NZ4A 2DNMA 5GAGI 2RB7A 4X4NA 2LKZA 4WWSA 3PIOQ 4USVA 3RW7A 1KVIA 2XTJP 4OJGA 2ZOFA 4TNOA 1LWXA 1SL2A 2FHKA 3ICLA 2DBBA 4I7FA 3NS6A 4QWBA 3U02A 3MMCA 4B9VA 5KFFA 1RTDA 2LVWA 1SVDA 2DHXA 4LBIA 3DXBA 3R5BA 1DURA 1A0OB 3MR5A 3R97A 3BGOP 4ZVRB 2ZEJA 2J5AA 3OJSA 1PJ6A 1RDRA 4K4ZA 2QLFB 1S1TB 3GP9A 4O44B 9ATCB 4USWA 3LP2A 3D7SB 4LF5J 2J8AA 2Z56B 1RZMA 4WP3A 5HMZA 2CJKA 2RSQA 3IRXA 1IBLJ 3GJTB 1QTNB 2FJDB 2E5HA 1S99A 4OI1A 1S59A 2Y8YA 1GTHA 2FHMA 3D6HB 2IDLA 4LF7J 2I38A 2CZ9A 9RUBA 1SIWB 3OR2B 4DV3F 1CS4A 2KFZA 4ZK7M 2VOPA 3AH6A 2DGWA 1KQKA 2GFFA 2MLYA 4J9KA 1N5TA 4DLGA 2F7VA 4HI2A 4LF9J 1AYEA 2L08A 4PQAA 3IWLA 4OV6A 3SQOP 4DPYA 1ZPWX 3J7YU 2ZOGA 2FLPA 4QU6A 3V6HA 3EPGA 2QLJB 1R0AB 2O5DA 2XZDB 2J9DE 2GAHC 2HWIA 3N5BA 4YS2A 2HNZB 1GK8A 2W2OP 2RU3A 4NI2A 2W8LA 4O0NA 1FI4A 4MT1A 1GMUA 3QT5A 3J81j 4TU7A 3GJQB 2MGZA 4JI1J 2XMVA 1IWGA 1SQGA 1HHSA 1ZETA 1T7PA 4OX9J 4QR2A 4C8YA 3DN9A 3FFIB 1NUEA 3R5GA 4U7UD 1S9EB 4NLTA 4ID8A 3OR1B 1XNQJ 4DQPA 3NS7B 5BYQA 5C24A 1GXUA 1TKTB 1XR5A 4C97A 4DL0C 5IT4A 2R7TA 4CP5A 1NZAA 1T9YA 3M32B 4J9VA 4O4RA 5LT5A 1PGZA 3NNHA 3L7OA 3OFEA 3BGFA 1UETA 2HRYA 4K4WA 1S77D 4CI0B 1HNIA 1RI7A 3TAPA 2V4QA 3HD1A 3FCHA 4NL5A 3KJVA 1C1CB 2HK2A 1YIJS 1Q86T 1JLFB 1RAJA 3MPWA 1XC9A 1DARA 2FJBB 1F2HA 2RQKA 2JFDA 4GO7X 4OX9F 5HBMB 3MF5A 3RZAA 2HIYA 1K1QA 2YNHB 1ZA1B 1RTJA 5JVHQ 4F2RA 1D8ZA 1LWFA 4DR5J 2RH3A 4J5OA 1HBNA 3SFUA 4EWTA 1ITPA 3C14B 3NP5A 2QYCA 2ZNZA 3ZTOA 3DOLA 4KHPF 2GW8A 1VIXA 3MAAB 5E3CA 4IUFA 4ANEA 3FKBA 3MD1A 5C42B 1S12A 3G82A 1HWLA 5C42A 1NMEB 4QIWD 1S97A 4DV3J 3MFIA 5E3RA 2WW4A 4MFBB 3QLHB 1D9AA 2YH1A 5HJYA 2ZC3A 4HH0A 2XS7A 3SSSA 3PM9A 3FK4A 3S8SA 2ZZNA 3TO8A 3VGUA 3G9CA 1FT8A 2LA4A 1ZPVA 2ZE2B 2WSCC 5D0HA 3KMSA 1DAXA 2VKRA 4ZIVA 4YOEA 1MSWD 4Q2MA 4B3TJ 1VQSA 2ACYA 4QIVA 2ASLA 4HACB 4BLGA 5DLGA 2HYIB 1GX6A 1B0TA 3K57A 3WC0A 1ZTTA 3FFIA 3NAIA 5IC6B 2H9ZA 6AT1B 3A3PB 3MPYA 5G4DA 1DFDA 2YKNB 4V19X 2BE2A 3GYNA 3R5CA 2FDNA 1ZYQA 2C2OB 3Q8RB 1MLAA 1HPZA 4A8MP 5AXLA 2UUTA 4ED0A 2BQ3A 5K14B 5M2RA 1NCLA 1LFPA 4NEZA 1H7XA 1JJHA 2JJ4D 3MM8B 5DM6Q 4RW6B 4XPEA 5KFDA 4OI0A 1F2GA 3H2VE 2AQ4A 1QVFR 4OL8A 3N5FA 4WPAA 5DQGA 1N5QA 1RAAB 1UJ6A 4MK7A 4NRUA 5HMXA 1CG2A 1S6UA 3RB6A 2QSFA 4OYXA 3A8KA 4LSZB 4DPWA 3ZNUA 3FRYA 3NEKA 4RUAA 1SJ3P 2IM2A 2OHDA 4DN0A 2MJNA 5FLXU 3SI8A 1RWVB 2VG6A 1WJ9A 2M7SA 3QGGA 3DOKA 4M5DA 3RAMA 2YX7A 5JVGQ 3D54A 1RE1B 2X1BA 4LFAF 1N8RT 3EXCX 5ETVA 2LQ8A 1GAOA 1JLBB 1U26A 2PEBA 1GT8A 4NLDA 3RJMB 3SSQA 4Z2XA 2HQCA 1R8PA 2U1AA 1FX4A 4TYBA 3BQ2A 4QPXA 3BQ1A 3C66A 4OYIA 5F9NA 3PNIA 5HP1A 4C4WA 5HP1B 3HVTB 4X65J 2BJ9A 3T5JA 5J2PA 1YGYA 1AB8A 2Y8WA 2KXFA 4DL7A 3I4HX 1WSRA 1X5PA 3MM7B 3LPEA 2XBPA 2GMLA 2JLEA 3E8OA 2HVIA 2XC9A 1PJ5A 5K9FA 2VA2A 4GKJJ 4F0HA 3NBPB 2PT0A 3CF5Q 2ZJQQ 3IM8A 3VV2B 4CCHA 2EFPA 4DSJA 2IYGA 1S7IA 5CYQA 2J9EA 4K4VA 4OX6A 3G6ES 2Y3YA 2QX0A 3GONA 2JEGA 1IM4A 3CCUS 1UZDA 3CCWA 4DV2J 3QFWA 3CSKA 5HI7A 2RNEA 2QA4S 4ZA1A 4IDKB 1F5AA 1RAEB 2YKPA 2OPSB 3GTYX 3HHLA 2OIHA 4I67A 3LAKA 2Z58B 4ER8A 3B8HA 3CJSA 4QZVB 4RW6A 5L9NA 1U7LA 1CJTB 3MECA 4DPTA 3MMAB 4NMLA 2UP1A 5LSRA 2RAQA 5K8PA 3MCMA 3LH2S 3N0VA 5GAGU 5C5JA 3F44A 3LA0A 3KLFB 1V5IB 3EVWA 1TKXA 2DB1A 3M2VA 4B08A 3H25A 1H73A 1K47A 3L95X 3UDEA 2HBQB 3MAQA 1FNOA 2B4OA 5I42B 1L3KA 3DDKA 2GVZB 1H2UX 3THTA 2GX8A 2VFVA 3J80U 1S1UB 3CJKA 3IRWP 1Y9OA 1T94A 1RTZA 4XTTA 3TA2A 2Z2ZA 5CD4A 1MMLA 2F5GA 3TI0A 4DF8A 4X62F 4Q8EA 2YVSA 5E3QA 4ECXA 2I9SA 2N7YA 1HD1A 2KVQE 2HHTA 4C11A 3DM2A 5EGYA 3DGPB 2C3OA 3ET6B 4DV5J 2H54B 4NLUA 1T3OA 5D4PA 2DNYA 2HHHJ 1TFWA 5IWAF 2DGOA 2CQCA 2RDDA 3G8TA 1S57A 2AP6A 2WOMB 2G2YA 3UVJA 4ZN3A 1UWAA 3H0PA 4P10A 3R5DA 4DUZJ 2C28A 4OYMA 2AJFE 1VI7A 4ETZA 2XSJA 5L46A 4JI6J 3EJMA 3T9NA 2RKIA 4U95A 3TW0A 2I8EA 1N5YA 1V3ZA 1JLGA 4DR6F 3M2UA 3M8ZA 4H4KA 3OT9A 2R8KA 3Q83A 2ASYA 4AUKA 5KG2A 2DGXA 2OEMA 4ZVQB 3E51A 3G2XA 4CLYA 5GMKa 1WC4A 1C0UB 4ELVA 3RBEA 4K5RA 1CJKA 1VQ8S 2K3KA 4V19J 2M88A 3WIVA 4DWIA 1P1LA 3QSIA 4WE1A 3JTOA 4I2QB 3T1HF 2AGQA 4B3OA 4KR0B 1FDNA 1W7WA 1SKUB 4X4RA 2KZMA 1DQ9A 1OWXA 4J9RA 1IKYB 2DGTA 1RT6A 1K1SA 2KJWA 3C16B 2GZOA 2MY7A 4ZCLA 2R7OA 3M1VA 3TAMA 4ECTA 1U6BA 1WHXA 1TUVA 3GSIA 4IG3A 2FVRA 4NXMJ 4ILRA 4PYAA 3W8GA 3ZZZA 3GV8B 1WDDA 3RR7A 3TZWA 2HBZB 4NLRA 4LJMA 2W4DA 3R7BB 3UWTA 4C0BA 3T1YJ 3KTQA 1R0CB 4KTQA 1VRTB 4MKVA 2C2EA 4ZP8A 2KT2A 5J2NB 2QMXA 2N3OA 2MZTA 5ETPA 5M2PA 2XG8A 1HQ2A 4HYKA 3NY0A 2MEWA 1ZM4A 3W2VA 3G6XA 2GO8A 3MWBA 2YWKA 2R7RA 2ZH9A 1RWKB 2P2CB 3ZTSA 1NDCA 4KQZA 3M05A 4O3QA 1RT3A 2DISA 3D0IE 1Q81T 3DLLQ 2POKA 4XO0A 3KLHB 1XBWA 2IVMA 5LOQA 1PSDA 2EG2A 2FYXA 2P9EA 2CJQA 1DBDA 2CNNB 1IKVA 2D3OR 5H9EK 4RW7B 5K8NA 5F8NA 2NCKL 3D4JA 2FZGB 3AQPA 2RKIB 2D74B 1UAWA 2V50A 4DL6A 2FGOA 1H98A 4B9UA 3MM9B 3ZTQA 4DUTA 2D7SA 1M0SA 2FY8A 3MM9A 4ZJQA 4A8FA 3OTDA 5DLFA 1X5SA 5A2QY 3PKMA 2ZITA 1T05A 4WZQA 4EZ9A 2C2RA 1AFJA 5ETMA 5J1PA 3OW2R 2EKYA 4OYPA 1U45A 2G9OA 4FF3A 1CJVA 4J9MA 2V8PA 1AT1B 1CJVB 1D09B 1HW9A 1WF0A 1VRQC 3JSBA 3MEGB 2GMHA 3PJ9A 4K2JA 3DMJB 3W9JA 4ZKAA 5CCMA 3LP0A 4Z7YA 5HK4A 2PD1A 3C16A 3I5AA 4OZLA 2YH0A 1TUGB 3LGHA 3W8PA 3EX7B 4FS1A 3HFZB 3GYGA 3ZZOA 4DPOA 2H48B 3HHKA 3NGKA 4LIWA 5KT4A 1P9QC 1MROB 2BRKA 3QGIA 4W92B 4FYXB 5AE3A 4EBCA 2B4UA 1KONA 1WD6A 3CJTA 4WTOB 3I56S 3AB4B 1VRTA 3NNAA 4L74A 3BPSP 1S7HA 2CPFA 3D66A 4P52A 1LW0B 4PXDA 1TK5A 1SH2A 4C8ZA 3DYAB 4B3TF 3RRHA 2XSJB 2VF3A 4B9TA 3KJVB 1N5YB 3QJLA 4GMKA 2BJDA 2AX0A 5KFZA 2GAGC 1FXRA 1MN9A 3H90A 4QYZK 5AJ3J 2HMIA 1RQ0A 2CXEA 1OJ4A 3DU6A 1RWMB 4CIOA 3Q8VA 3NGTA 2A10A 3R1LA 3HDSA 1HWKA 1ICEB 2CNKB 4DV4F 5J2QA 2HWHA 4S0MA 3THPA 1H3DA 1T8EA 4ZHRA 1S0OA 4AD6A 4WE1B 2G4BA 2Q3PA 4AFFA 4ZCKA 4FBTA 1T9XA 4N5SA 1YRXA 3NGSA 3OTOF 2GQ2A 2ALYB 2YQ0A 4TXSA 1KTQA 3TOQA 3PR4A 3Q8PB 4K4XA 1UWBB 4MKAA 1TFYA 2Z2LA 4I7FB 3HP6A 3MPUB 4KFBA 2P6SA 3UNYA 2W2QP 4M5HA 1RTIA 4H4OB 1DQAA 2KG1A 1VLOA 3RR8A 3MR2A 1YJNS 1O5JA 4GKKF 1WTFA 4ECYA 1X7VA 2J9DA 1LWCB 1SC3B 5KFEA 1HI0P 3ZZ0A 3VVUA 3LOUA 3WQPA 4DZ6A 4DLEA 2RF2B 3LP0B 3TZZA 3AOCA 3QWPA 5H1SV 4TLQA 1HMVB 3MCSA 3UO0A 4B9NA 1HNWF 2HHXA 4CO3A 1NSKL 4DFKA 2IRYA 2ZUGA 1R43A 3V81B 3I55S 2W1BA 4V1Ak 4JYAF 1K73T 2PMZD 3CDWA 3DI6B 5HQLA 4YB1P 2XQCA 1MU2A 2KVIA 3QFHA 2M9KA 4DFPA 2IA6A 2PMHA 3H5SA 1DLOB 4IFYA 4Y2AA 2V5HG 2J0SD 2A6OA 1NLKL 3UD4P 2QL9B 3MM8A 2VG5B 2PDAA 4CLSA 1N33J 1NEEA 1S1XA 3ITHB 1RWPB 2MKKA 5HVGA 2JEFA 2MB0B 2ABYA 4LFCF 4L76A 4YQWA 2VV5A 4U7CA 3UI3A 1IR0A 4O23A 1RWOB 3VGVA 1D9DA 4JI4F 4DL4A 2HNDB 4ZLPA 4HH1A 2IVFB 3VWSA 4JI2F 4LQ9A 4ZLLA 2D9OA 3DLGA 5KT3A 3Q22A 3MPVA 1BMQB 2IYIA 2FHOB 2PC6A 3MFHA 3JYTB 2WW8A 2ZVIA 3O5TB 4YFUA 4KGZB 2ZFHA 4DR4J 3T3FA 3TUZC 2UVWA 3DXSX 3SV3A 1FD2A 3E3XA 2JEIA 3FEZA 4I2PB 1N5SA 3V4IA 3C6UB 4F4AA 4LF4F 1HBMA 5LXYA 1PC4A 1HLWA 2YNGB 3J7ZT 4OZ3A 1N34J 1FXDA 2FB0A 1LWCA 2E9RX 4WFAQ 1IR2A 4QU7A 1RUSA 1HW8A 1JJCB 3NAHA 2XZTB 1URRA 2GQCA 1RYRA 3Q8SB 4KHPJ 4USJC 1U0SA 1NJZA 1AZSA 2C2NA 2QEXS 4U9RA 1U2RA 1AFIA 2RQ4A 3AOBA 3T6BA 5HBMA 2B0GA 2KM8B 3HJVA 2W25A 4ZP9A 2CKWA 2CQ1A 3I5CA 4N77A 1YITS 3X1LB 4Y3CA 4X4OA 3TQ1A 3B78A 3EWGA 4CNYA 4F4YA 2HFZA 2RS8A 4YR0A 1AA1B 4ZPCA 2QV6A 2DHGA 3CJ5A 3M9NB 1NU4A 1ZM9A 5EN1A 3GE9A 1KNZA 3NOGA 3UCGA 2ZVSA 2MQ8A 4OJ1A 2BKPA 2DK2A 3Q86A 2IRXA 2APOA 3BEGB 4FVCA 4EK2A 2WRMA 3BYRA 1DTQB 3MM6B 4YHHJ 1W2IA 1CULB 1RADB 1XQIA 3D0HE 3TA1A 2UUCJ 3K59A 3DLGB 4FPIA 2CPHA 2HFOA 1UCNA 3SQGA 2QTWA 3UFCX 3PJWA 3M8QB 2XMMA 2ZBCA 5D4LA 3VQTA 5JJBA 2DRAA 2UUBJ 4CDIA 1Q8IA 3E01B 4UOCA 2W01A 4DPXA 2NYIA 1S0MA 4PUOB 2AYBA 2CWXA 1KS2A 4OHWA 5E0OA 1HA1A 4AT1B 2DGUA 4E8UA 2ILYA 3IO1A 4TKTA 2O66A 4P2XA 5KG6A 3IC1A 2M70A 3IWXA 1HR0F 4DL5A 3RW6A 5A8RB 1HNIB 3O6QA 3BPDA 4L3NA 2EEYA 3KG1A 5EX0A 4ATNA 4DV0F 2AGOA 1T9TA 1DRZA 2J6UA 4O3OA 4P6QA 1IXKA 1JLFA 4WYWA 1RHQB 5E2QA 2YQ3A 1A6LA 1T02A 2BUNA 1NPPA 2EBEA 2MKHA 4DQSA 4JV5F 1FDDA 3LQVA 4USMA 2EC2A 3H59A 5F0WA 2MKIA 4KKOB 1LWFB 5DDOC 4BWJA 3CVKA 1NRKA 1U2FA 2KH9A 1RT4B 3RRKA 1X4AA 2PA8D 3PX0A 2N4DA 3PCOB 3DOLB 2D3O1 1NHKL 3KMQA 2IM1A 1HBOA 2EFNA 3FBEA 5KFYA 3GLJA 3TZXA 4HKQA 4DU7A 3CCVS 4UT4A 2IM0A 2UUAF 3GB0A 2GHVC 1GNKA 1WDTA 2MZRA 4K5SA 4K0KJ 1Y11A 2X1AA 1S79A 2NS1B 3GCXP 4DR1F 1NK7A 3TWZA 5DDQC 2N7CA 3JSMA 1J27A 1RTDB 2I2YA 2O1PA 3M32A 2GVDA 5EHHA 1FJ7A 4EFAC 5A8WA 4G1PA 4RPFA 2IMOA 1SI9A 1FJEB 4NPOA 3BDEA 4F36A 2AEFA 3K5OA 1EQMA 4P75A 4XDCA 3M9OB 2QL7B 1U6ZA 4LRFA 3IRXB 2ZH8A 5LJ5Y 3A8IA 1WC1A 2DNKA 2MLZA 4J9SA 2XS2A 3C6TA 4PG6A 1YTYA 4W4MA 2WOMA 5ETQA 4RW7A 1I3OB 3OVSA 1QAIA 2JC1A 3MR3A 1PILA 4WFXA 4QWDA 4B3SF 2I0XA 3EZ5A 1MWZA 1JJ4A 2UXDF 2BJEA 3MZIA 4MMOA 3FQLA 1TMMA 3TP2A 4DSLA 1HYSB 4HL9A 2KYZA 4EZ6A 5FLXY 2GHWA 1QE1A 1WC0A 3CW2C 2G1HA 1ZS6A 3OVBA 2DITA 4WIIA 1PO6A 1ZBTA 4I2QA 4KKOA 5A6PA 2AJ2A 3G71S 4B3MF 1EAYC 2V2QA 3D28A 3HVWA 3W5YA 2WVFA 4I4BA 4CH1A 2DH8A 3CCES 1REGX 4YEAA 2AF6A 1HBOB 1OPIA 3M1VB 2G2OA 4RW4B 3SQGB 3TAMB 4M5IA 3DCAA 2VKZG 4X66F 3DHXA 3DM2B 4BC9A 3KJNB 1XN9A 3CJ0A 1KQSR 2CPXA 4QW9A 3ELHA 3UVJB 3KNAA 3J7YI 1OSCA 2YXLA 5DQIA 4ELUA 3ILLA 4EO8A 2MPUA 2RQCA 5LMUJ 2XWYA 4JV2A 2BZ2A 1G3OA 1FWKA 1ZM2A 2EBGA 3CDEA 2DH7A 2FZCB 3PX6A 2LEPA 1OS5A 3ISND 4CYUB 1OYDA 2J0XA 2VD3A 4OZ0A 2F4FA 4RO0A 4JV0A 2IDEA 1KFSA 1IBKF 1TVRB 1X5OA 2R7XA 3BH7B 5KFIA 4QW8A 1XNQF 2LDYA 4KT0C 2OTJS 2JDJA 1AUSL 2M4MA 2XYHB 2HKEA 2N82B 3CEDA 3CJ3A 4RWXA 2HQGA 2EC0A 3Q2TC 2HHUA 3BBCA 2BV3A 1VK3A 3R9LA 1NB2A 1CJTA 3FMBA 4AL6A 2QE5A 3R8YA 2Z4PA 5LSLA 2BM0A 3A4TA 3CJ8A 2FVSA 5AXKA 1SPBP 2FJEB 3B4MA 4JUZA 3NNCA 1TKXB 1RT7A 5F8HA 1REVA 1YKWA 1EKSA 1QJHA 1HNVA 1RT7B 2CPDA 2HWTA 2V67A 1M1KT 1VQ4S 3MM7A 2XMKA 1VS3A 2GVZA 5IT9Y 3VZHA 1LK7A 3HD2A 1UKUA 3IBFB 2J0QD 3O2IA 3FDSA 1PG5B 4HLBA 5DO2A 1FFSB 1UW4A 2BW2A 3NG8A 1Y5LB 4OMFG 2EI5A 1BQNB 1UVLA 3VHQA 1K0TA 3CIZA 5IQ6A 2RMLA 4NCGB 2Q1LA 2XHWA 1VJWA 2XB2D 3KYLA 1Y3KA 4FS2A 2OD6A 2ROEA 1XR6A 2ZJPQ 4K4SA 3M30A 4ZPBA 1S1XB 3ITHA 2ATLA 1NJWA 1PCAA 1FKPA 4CLUA 1N32J 3MECB 4HT7A 4ZLNA 3ZFVA 3GIMA 3K5LA 4LF4J 1L3VA 4U67Q 4FF1A 1HHTP 1EHWA 1FDAA 2XI3A 2BBEA 1IKXA 1IM6A 4C3MA 2IJRA 5D0EA 5DM7Q 5HATA 2AJ4A 1B7FA 4LF5F 5J2QB 4BHQA 3G4SS 2N3LA 2J76E 3QATA 4KHRA 2Q79A 4CT9A 4AL5A 2W9CB 5RUBA 1EP4A 4LRCA 2QFJA 4U6PA 4C8KA 3IA0A 2FGCA 2KFYA 1C1BB 1KEKA 2W7AA 1FNMA 4PPDA 4Y34A 3FEXB 3KLVA 4RW4A 2AJ0A 4O4GA 4QJVA 4A8XA 1UFWA 2MDAA 3NWGA 1GEHA 2KJVA 1JLBA 3H98A 3IMQJ 3FVYA 1FRJA 4ENOA 1QSLA 1FEHA 4WXWA 1FX2A 3W7BA 2BE7D 3ZTPA 2F8EX 3M2RA 3P6YC 3S01A 1SH0A 1NK0A 3OHBA 2DH9A 4ED4A 1C4AA 2B43A 2D9PA 3A8EA 4FP9A 3GIIA 3HHNB 2WBMA 4RW9A 1M5SA 2W24A 3MR6A 4K0KF 3V81A 4UUXA 5D15A 4I68A 4CLZA 1U6FA 2B5JB 4RR5A 4C3KA 5HLFB 5HLFA 3IN5A 1JLQA 4LF9F 4FKXA 4DCOB 3K8VA 1TKZA 2YWFA 3R5JB 4PXBA 4P9SA 4J37A 3MCOA 2CPJA 3U7JA 2Q6BA 4P71A 3R7NB 2JLGA 4DQIA 2COLA 3K7RA 1TELA 2A1BA 2JH3A 1LNQA 1HBNB 3N4WA 4GKJF 3TARA 3AJ2A 3C14A 1CPZA 1KVJA 3MTJA 2FIUA 5AXNA 1FRHA 1IBLF 3PEHA 4U8YA 1P6TA 3BSNA 1ZZNA 2DNZA 4MIWA 3F56A 4PCQA 4WU2A 4DCPB 1RAGB 5HROA 2GGPA 1KHVA 1RLCL 2M8HA 4QWEA 2RD5C 4DS4A 4M5GA 1KFDA 1SKWA 3VAJA 1FKOA 1WI8A 3C15B 2DIUA 2J7UA 4IKAA 4OX7A 5ETNA 4C8NA 5J2NA 2R42A 2OO4A 2GJ2A 3LUYA 4DSEA 2W7PA 1UVNA 3DLHA 4UZBA 1NJXA 1KHWA 3W2VB 5HAOA 4EEYA 1AROP 1EETA 3E01A 2BJ3A 1NSAA 2W4CA 1M5OC 1SJQA 2D3UA 3Q89A 2OTLS 4MK8A 4FNHA 2YWWA 3DGPA 2LEBA 1RT2A 3NXZA 2DNRA 2AZ3A 1X4HA 1HI1A 2QL5B 4K50A 1HWJA 3ILOA 1TV6A 4KH0B 1WUUA 4F3OA 3DDIA 5IS2A 2F40A 3D6MB 4Y28C 5KT5A 4LREA 3KHGA 4C8OA 5KTQA 4LR9A 2GIFA 4ZVPB 5KG1A 1F0XA 3D6TB 3RBZA 4AXJA 4Y2CA 4XIUA 1RCOB 2B56A 2VIHA 2ASJA 5F3TA 2XMJA 5B0AA 4GKKJ 3O3LA 7FDRA 3J7A1 3MCNA 4CT8A 4QYZJ 2E7VA 5CQGA 3GQCA 1CJKB 2JHEA 3EGVA 4J9NA 3KK2A 1GXLA 4MH8A 3D1OA 5CA5A 2MSTA 3PZPA 5L1LA 3A3NB 1FTCA 5A8KA 3BKTA 2DPIA 4A47A 4OHYA 4LFBF 1LW2B 2RHSB 2NREA 2XY6A 1JXEA 2HHVA 1GH8A 2MQLA 2LEAA 2FJWA 2AEMA 1FRKA 3NCPA 4CH0S 4ED5A 5G0RB 3OHAA 1X0FA 2WZ1A 4IG3B 2RILA 3L4BC 5AXMA 3LALA 4I2PA 5BXIA 2CADA 3I0SA 1RWUA 3KK3B 3X3UA 3KK3A 2HHPA 4WZMA 1LQ9A 3T41A 2DGQA 2AD9A 2YNGA 2VOOA 1T9UA 1CULA 3DRSB 5CYJA 3HCXA 1FA0A 1BY9A 3POTA 2CQHA 3M2RB 4X4VA 1J5OB 1WEYA 3UPFA 4YY3F 2KYXA 1NSPA 4TY8B 2BRLA 3RBDA 2D41A 1X4DA 2HAIA 3KWMA 4PR6A 5B7WA 3AY0A 1L5UA 2OKQA 2BOAA 1UMJA 5DJBA 1PAUB 2WBRA 3SIPB 5CAAA 4DR5F 1GTEA 3IS9B 8AT1B 4YHHF 7FD1A 5LSOA 4RNNA 2F63A 3WZ0A 3VAKA 4DR4F 2HLTA 3ENWA 1XMBA 3W62A 1F60B 2PN6A 4ILLA 5GAHU 1BD6A 3ENAA 5GAEU 2IVYA 1HNXJ 1KOHA 3EVOA 1APSA 3BB5A 1R31A 4ZVFA 4JI2J 3D9BA 3MMBB 2X1GA 3ILJA 1JXVA 2KT5A 3W5ZA 3W2WA 1RHJB 4YY3J 3NGDA 3J80Y 1BC6A 1FDBA 1HQUA 4NZ6A 2BANA 2IBKA 1HQUB 5SUHA 1RU1A 2YQ1A 4PQUB 2Y0SD 3DLKA 3KKFA 4C3LA 2AGPA 4D3GA 1JLAB 1FWPA 4HDGA 3QZ7A 5IFMA 2L48A 5IQQA 4KGVB 4NZ7A 2BKOA 2YNFB 3ILIA 4FNIA 5GMDA 5K8MA 4J9PA 4QR1A 1U0HA 3HK2A 4F4WA 4P72A 3CJKB 2HVDA 2OUGA 3SBMA 4CO1A 1HNZJ 3CO0P 5DG8A 4NRTA 2VG7A 3PW2A 4TVAB 5C2CA 1XEZA 2VG7B 1RA6A 2IRUA 1CEZA 4M63A 1T11A 3DRSA 5M2UA 6FDRA 2EK1A 1BQMB 1DY3A 3SDEB 5KFMA 1TR0A 2WONA 4G65A 3GJRB 4LRAA 3R6LB 3CMES 3AT1B 3HKZD 3HXMA 1JLCB 2ZNYA 1NNDA 4KYZA 3V6DB 4PG5A 2BJ8A 2BX6A 4UQGA 4R8UB 3BO2A 4DV5F 1P9YA 1NK4A 4IRDA 2MKSA 2G2ZA 2HMIB 3K2YA 5D77A 4C6AA 3LP1B 2H5JB 1RTHA 2OMOA 3C6TB 4OIXA 3I5BA 4ZMMA 1NH7A 2VICA 3RAQA 4IR9A 4X2BA 2V4JB 1FERA 1WI6A 2QFIA 2YTCA 1IBMF 4ECUA 2AYGA 5HANA 3CMQA 2A2DA 2HBRB 2DNOA 2L41A 1SJRA 1ROFA 1VQLS 3Q24A 5T41A 2DHHA 3VAFA 1HYSA 5ADZA 3H4DA 4KFBB 3I82A 1FVSA 2HNYA 2P8IA 4DG1B 1HIYA 5F3ZA 3Q0AA 5A76A 1QE1B 4P2FA 4ED7A 1NKCA 2WVBA 2VASA 1SCJB 3CCTA 4LQ3A 5IZHA 4N41A 2MQMA 2Q43A 3F41A 5F9LA 2PA3A 4NLOA 2V4RA 1YZ6A 2JLFA 2MSSA 4GRSA 3W60A 3AFGA 2ZHBA 1U47A 1OQ6A 3PYEA 1NKBA 4CZCA 2PI4A 3BV8A 1WNEA 3BN4A 4B3RF 4JI0J 5KG5A 4RBTA 3H2LA 1E6VA 4KY3A 2AYMA 1QUPA 3BGRA 3BQ0A 4MIBA 3U1LA 3QSYB 1MNEA 2LU2A 5CYMA 4C0HA 1TL3B 4RJVA 1Q78A 3BN7A 4OI3A 4LUBA 4WTYA 5IC4B 4X66J 1U02A 3GFXA 3MEDB 4KPCA 4PXEA 4ZS6A 3UR0A 1EIYB 3KHLA 2FZKB 2HS0A 1R3NA 2HRUA 4NXNF 1F5CA 3PTWA 4DV6J 1R89A 3DDNA 1R0BG 4F4XA 3ISNC 1CC8A 4J9UE 1RA7A 4DSKA 4R0JA 2BM1A 4EI2A 1U8SA 3QBCA 4MAKA 3GIRA 4ANCA 1XWLA 2BMBA 1IQZA 4C2MA 4B3RJ 3VZIA 4U96A 5AJ3F 1Z2ZA 2GCFA 3FZ2A 4GVBA 3W65A 3K58A 2CJ9A 1PC5A 1RGVA 2EKNA 1F9EB 4DV4J 1C1BA 4HTJA 1UEKA 3I32A 2L9NA 2EFOA 2UVUA 4J9QA 5DDRC 1H72C 1WOPA 5HQMA 3VGTA 4IH5A 2BXJA 3HI9A 5EWEA 3NGRA 3N28A 4FPRA 3HHEA 4OZNA 2IY5B 1IVZA 2DRDA 1D9FA 2NQPA 2J6TA 4NLWA 5C24B 4I69A 4OI4A 2Z30B 4Y0FA 2XY5A 3BGLA 3KLEA 5HVHA 2V8HA 2MYFA 4UUWA 4OYOA 1S76D 3DGVA 2QN6B 3QMQA 1FNXH 3T1AA 1NXIA 1WSVA 2HS3A 5IV3A 3FZBA 2ZH7A 2VC1A 4AQYJ 4JV1A 5E33A 3MHYA 2OPPA 1RT3B 1TL5A 2OPPB 4HVZA 3WX4A 1YWXA 2G0IA 1TVRA 3VAIA 2LECA 1RU2A 1BQNA 4DHVA 1N48A 1I94J 3NL0A 1TK8A 1VLYA 3MOJB 3IAS9 2D69A 1B4SA 4OFZA 3ENVA 1Q8LA 2DR9A 4YB7A 3IG1B 1RT4A 2HZCA 1LWEB 2GJFA 2QRRA 2AEJA 2B9EA 3AOAA 3OBIA 3WBZA 6FD1A 3UDLA 3I4PA 4A8KA 3MAHA 3CB4A 4P73A 4UQTA 1OSDA 3MM5A 3UDCA 4I64A 2HEKA 4A46A 2LMIA 2JNJA 2WSFC 1VQOS 2B9XA 3DRXA 4OHZA 4EBEA 3IP0A 1UFLA 3JTPA 2HVZA 1IKWA 4EU0A 1HNZF 1VBKA 3KDOA 2KFNA 1RP5A 4PAAA 2BW7A 2V8DA 1TQLA 4PWUA 4DQRA 1DTTA 2NLWA 5KFUA 2CQGA 2CWKA 2H4WB 3TNVA 4DS5A 2IPOB 3WHIA 4X4UA 5H9FK 2PIIA 4NLVA 8RUCA 3CCSS 5KFOA 2WCXA 3QNWB 2E9ZA 3QT8A 2V8VA 4NA2A 4YB6A 4ZITA 1U1KA 4PYDA 3GYXB 3W5XA 4PUOA 1N54B 4DU8A 1OMSA 1GQEA 5J2MA 5DZ7A 4DCJB 4O3SA 1H74A 4DR3F 4LRBA 2AX1A 5IOLA 1IBKJ 2RJZA 5J2PB 1RJJA 2XZWA 3CJQA 4LSNB 4N8NA 4MTPA 4JI4J 1KLMA 1S1WA 1LK5A 2BR0A 3T1YF 1JNRB 2HURA 2L9DA 2NSCA 4IG0A 2KT3A 4CH7A 5DGAA 4RU2A 1CJUA 5EUHA 4XDDA 3J7Z5 2XLIA 3W63A 2DXEA 1ZAVA 1C0TB 4XK8C 4TYAA 1R8HA 5KFVA 3TZYA 2FC9A 4KSEB 5DRKA 4DQQA 2HZVA 4ELTA 1UW9A 3HM9A 1FJGJ 2R7UA 5IM0A 5KFKA 4RWWA 1Z1ZA 3O44A 1X9MA 5A8KB 5B0GA 1IKYA 3BKUA 2R7VA 4KO0A 2CQIA 4DBQA 4JI3J 1RKIA 4W98A 1I1GA 5J1NA 4OZJA 1BWEA 2DY1A 3SEOA 1EX8A 3CCMS 4F4KA 2R2RA 4LF6F 4DX5A 3KUHA 2HVHA 1TUWA 1KLNA 2C2ZB 4ZVUB 3T5LA 3HHDA 1IUJA 4C48A 2XGPA 3EM1A 4GC6A 1Q79A 1LXJA 2KKHA 2VBWA 3S7RA 1OIAA 5HVFA 1U2CA 3M6WA 2NXNA 4WF9Q 1U1QA 2DXFA 2V68A 3HFVA 4USIA 2CQBA 2X51A 4UF4A 1HI8A 2OGUA 4X4SA 4LF1A 4M5JA 1H0HB 1UJ4A 1VRUA 2D3ZA 2R4FA 1H7WA 4DSIA 3OXLA 1CQMA 4C11B 4K4TA 3R5AA 4I6AA 2DO0A 3ET6A 5CYQB 2M0GB 4OZ2A 2XWXA 4IH7A 4LFAJ 4H4KC 1OPZA 4C98A 5H9EJ 3CD0A 1WELA 3ENQA 4YR3A 2W2PP 2NSBA 4CO0A 3MUVP 4TQSA 1G2EA 2C3MA 1TU0B 4IO1A 1Q8BA 3FBCA 5K14A 2NPFA 4F04B 2E5LF 2ZH1A 2ZBQA 4ZJOA 5GAEI 4DUYJ 4JI1F 5B08A 4WP9A 1KDNA 2HBYB 1N34F 2CVIA 5EWFA 2KHDA 3Q8QB 1QSSA 4CNZA 4CTAB 2HNDA 2K3IA 1FKOB 4R25A 2IA0A 4YP3A 2OJ3A 2Q66A 4UTGA 3KK2B 1NK6A 3ZO7A 2CFXA 4P2MA 2XYPB 2RU9A 4Z7CA 1R6VA 2DGSA 1DTTB 1S6QA 3D5MA 3OFHA 4L6V3 4WFNQ 2E5LJ 1T0TV 1NO8A 3LTOA 4RW8B 3ISZA 1YJ7A 1H2TZ 3H5XA 1N36F 3FBBA 1TK0A 3HVAA 4OLOA 3JAMU 2YKMA 2V69A 2RQMA 1MROA 1U49A 1JIHA 2Z2YB 2F4VJ 4F8RA 2KDOA 2PEHA 1G6BA 2M8DB 3HZGA 4RX6A 2QIFA 4OJ3A 3G87A 4ED8A 4IO9Q 1RAIB 4NCAA 3Q8UA 2GA7A 2HAFA 4JV5J 3SMZA 1UJ5A 3FQKA 3K5MA 1K0VA 3EZOA 4NLXA 4EBDA 1A7GE 3FCWA 4X4TA 3JS9A 5A8RA 3VGSA 1HKAA 2ZHAA 4I6YA 2C2KB 3I0RA 2QSWA 4NOHA 4NASA 4OHVA 5A6WA 1U4BA 2F4VF 1BE4A 3UDVA 1PBUA 1ACMB 2EWHA 2C2DA 3PY8A 1BGXT 3KLGB 1XMQJ 1SV5B 4LF6J 3RG6A 1JJ2R 3KLHA 2XM3A 3PYGA 1Q5VA 1F6TA 3E2EA 2CG4A 3LO3A 2F8HA 2AW0A 3KG4A 2WK4A 2NZCA 1B70B 4F3MA 3JB9k 1YBAA 3UN5A 2YNIB 4P74A 3V6JA 3J81U 2E29A 4HHUA 1UA1A 2MKYA 3C46A 4G1QA 4MYTA 3SCIE 4LVOP 2RS2A 1IBCB 1YRUA 3PHEA 4F7VA 3ZTRA 2CDQA 2MHEA 2V0NA 2DGVA 4IRKA 2R8HA 3UN3A 1IBMJ 1S6PA 4LRDA 4EYIB 3KG0A 1QY7A 3JSMB 2DR8A 3EPIA 1TAUA 4O3RA 4URSA 5K8OA 1S1TA 1FWLA 4RW8A 5DZ6A 4GC7A 2IC3A 3IGVA 3M8PB 1KVKA 4RW9B 5I3QA 4CLKA 3LGNA 4B02A 2HQIA 2HFSA 5H9FJ 2ZBRA 3MURP 4NLSA 2ERRA 4YN3B 1JLEB 2QLBB 3FUYA 3GG1A 2P5VA 2QA1A 5DG9A 3QGHA 2LXFA 4CLPA 1VR6A 3MEDA 1RBOB 2VJVA 2KI2A
chains in the Genus database with same CATH topology
1KSPA 5FIIA 1BQMA 2CQ2A 4KB7A 5KG4A 4CQ1A 5HMWA 2G13A 3HLUA 3R1LA 2QMWA 4WFYA 1R8CA 2V2KA 4FXDA 2XMUA 2HHQA 3M2UB 4JI3F 5F0UA 1WG5A 3M4XA 1Q7YT 5KT6A 3T5KA 1WF2A 3ZZUA 1HQEB 2AV5A 3IAM9 4UY8T 4WKRA 5KG3A 1M5HA 3LP1A 1RTHB 2AU0A 1FXLA 2HNZA 3CJ2A 3HX9A 1M5KC 2FVPA 4DF4A 1S9FA 1XK8A 2RUGA 2MZJA 1Q53A 2V4JA 3DHWC 1H38A 2BQRA 1S6QB 3DRRA 2LA6A 2EFVA 1QAYA 2HGMA 2L3MA 4OQJA 3OL7A 4ICLB 2ZH5A 2KZMA 1FVQA 4OJHA 3T19A 3PX4A 1CQNA 1R7IA 2IJFA 2LCWA 4P7VA 1P27B 2K8GA 4ZPAA 4N47A 4O4GB 1QLNA 2B3TB 3MMCB 3BM7A 1SB6A 1YJRA 5B0CA 1D3WA 1R8AA 1UL3A 2KXHA 1N6QA 5GADU 4NLGA 1UP1A 3D1QA 3GFHA 4LT6A 4EYHB 4IRCA 3GR1A 1SL1A 2CPEA 3DLJA 4NXMF 1VQKS 3O1LA 4TY8A 3SYZA 1SH3A 3PVXA 4QBUA 1CVJA 3H8YA 1B64A 5J1EA 5A0YA 1SKRA 2XLKA 1QAXA 4WK3A 1WHWA 3BJYA 3KLIA 3KLIB 1DLOA 2CPZA 4IFYB 4WU3A 3CDUA 4WKYA 2K1RA 2C22A 1LW2A 2I5JB 4ECSA 1N52B 1ZM3A 2VFRA 3VCDA 5L39A 3NMRA 4IQMA 3TAQA 2XNQA 1S49A 3I6PA 2LDIA 4DUZF 3SV4A 2FD2A 4H4OA 2LQ5A 4ZVEA 2CJBA 1VIOA 2GIQA 4FVMA 2F1FA 2OD4A 4FF4A 1T03A 1I94F 3G86A 1Y5IB 4DX8H 2XCAA 4ECVA 2CZ4A 5L8RC 1KTVA 1H6KX 2CZVC 4JI6F 2AWZA 4BWMA 1Y7PA 4DSFA 1J5EF 2FLLA 3IR6B 2R9LA 2UZAA 1UEUA 4A48A 4W90B 3DI6A 3OTEA 4OI6A 1VMBA 2HFNA 4BCAA 4I6WA 2ROGA 3ZZRA 2ROPA 1SL0A 1QSYA 1FJCA 5HQ8A 4Q43A 3CXCR 2XULA 2JEJA 1TV6B 5BR8F 2VFUA 3TVYA 3ZC4A 1ULRA 3PRBA 3ZZPA 4FF2A 2HHSA 1RKJA 1Z2LA 2ZKTA 3BSOA 3HZEA 4IFVA 4WFZA 1WWHA 2RT3A 4O3PA 1JMTA 3M6XA 2E9TA 1HQEA 3BF4A 1VFJA 2IJNA 2P6TA 1VQ7S 1IN0A 5DGBA 2LXUA 2YNHA 2IAJB 1FE0A 3PDNA 5LMUF 3C3LA 1JLAA 5KFWA 4JI8F 1U1NA 4F2SA 2VG6B 2Y1RI 2ZH3A 4KIAA 3DC2A 2D1CA 3DLEA 4K4YA 2R2UA 3TVKA 2GV1A 2KTQA 2I5JA 4QYRA 1AXQA 5AE1A 3MM5B 2Z0GA 2JVRA 5KG0A 2HHWA 1S48A 1D8YA 4RBUA 2IBOA 5G0RA 1B0VA 2GJIA 2QT7A 2B6AA 4DV6F 2B6AB 3OL8A 1SQEA 2LXIA 4XAKA 3K5NA 4B9SA 2JVOA 3KLEB 3EGZA 1NJIT 3G6VA 3VAGA 4B9LA 2UVRA 5KFRA 4FBUA 1YJUA 2DHSA 2WSEC 4O3NA 4U7UK 4FYDA 5HMYA 5KFNA 4QWAA 1FK9A 3U1MA 3ZZTA 2E1AA 1Y5NB 1E6VB 4Q45A 1YI2S 2PI4A 4I1TA 3RTVA 4ETXA 2Y1IA 3FEYB 5C25A 2W9AA 5C25B 4B9MA 3ONQA 4YDXA 2JOQA 2BE2B 2YKNA 3FJ2A 4AYBD 1WG4A 4ITSA 3OUYB 3CC2S 5F8MA 1I6JA 2CQ4A 3M9MB 1R27B 1X0PA 4KGMA 4X84A 2VG5A 2XSFA 3OPKA 2OLWA 1TKDA 1JXLA 1VHFA 3SCLE 4R5PB 3J81Y 1URNA 5KFGA 4OI2A 1N0UA 1ZZFA 3QLHA 4AXIA 2XMTA 4Y2KA 2UUBF 1GX5A 3G6YA 3QWUA 3GG0A 4Z37A 1JNZB 4IQXA 3MM6A 1U1OA 3GFZA 1DTQA 4Y2IA 2KRRA 3DLEB 4PXCA 4PRFA 3I96A 4MIAA 1Q4RA 1HNXF 2MGZB 2IM3A 5D4OA 4DV1F 4ECWA 2VBYA 3I87A 2RIJA 3T9ZA 3HHLD 3Q23A 5CHCB 3HJFA 2I1RA 2BYCA 1N32F 4F67A 1S9EA 3DNCA 2VPWB 5E5NA 4ED1A 3LPYA 3UCZP 5AE2A 1VQPS 4KV8A 3PACA 2IHR1 5CCLA 3OSPA 2DR7A 5KFQA 1W25A 4RUCA 3OJUA 2FJXA 4OX8A 3I0RB 4TY9A 2B5JA 4PWDA 2J7WA 5KOXA 1FRIA 4BDPA 4O0IA 3L3CA 3HO1A 3AQOA 1N0VC 5IM0B 1S1VB 2YY3A 3OUYA 2BACA 1WEXA 4OLPA 2B7BB 4YUDA 1RT6B 1LV5A 1L3UA 2LLZA 3PV8A 2PE8A 2ZDPA 1OO0B 3SFGA 4KJIA 4RBVA 5BYSA 5DG7A 2FLPA 2FY1A 2CJAA 2KM8C 1S10A 3OXGA 5E3PA 3KLFA 4WK1A 4Q5VA 2MQNA 4C0OC 1C2PA 4MKBA 4MKYA 2WB1D 1B0PA 1CSJA 2A3JA 4QPTA 3NKYA 2G1DA 1DHMA 4Y6IA 1S9GA 3BSCA 2QLXA 3EZUA 4G6VB 2KO1A 2MZ1A 1WG1A 3M8QA 3CMAS 3DLBA 1VRUB 2YKAA 2V9WA 1WF1A 3RU0A 3BGRB 5L1JA 2ALZA 4ZDNA 2GO9A 2QA4G 3IR5B 2R2TA 4LSNA 2E7XA 2VBXA 3UQSA 3FRZA 3MEEB 1FKPB 2KHCA 1RK8A 3ETOA 3Q2SC 4IG0B 1JK9B 5KFBA 3PRDA 2HLUA 2B9WA 3W2WB 2E1CA 5KFJA 1UEVA 3AA8A 5GAHI 2GMJA 2R2SA 4F02A 4MYUA 5B0DA 5D78A 1R0AA 2VBZA 1BLUA 2ZDOA 5I42A 4DL3A 4HI1A 3T6JA 3DRRB 2OSQA 3DOKB 4M5DB 2DVIA 2CYYA 3MGJA 2HHHF 3US5A 3JTNA 4K59A 2MZQA 3G96A 1QTMA 3PW0A 3V4MA 3L7PA 2DPJA 2BDPA 2BQUA 3M8SA 3THVA 3CWJA 1FO1A 3HVTA 2DR5A 2RDIA 4YB5A 3CCJS 3SDEA 2WONB 4ES2A 2O67A 5MAOA 2ZH6A 1OQ3A 2JFKA 4D3HA 5DDPC 2WTFA 1L3TA 1ZH5A 3FSXA 1WACA 4C8ZA 1JKHA 4QQBA 2XCPA 1FF2A 2MZSA 3KNGA 1JLEA 4TN2A 3AHPA 1NJYA 4NLQA 4OZ1A 3KFWX 1SUQB 4OZ5A 4DJBA 3K0JA 3IG1A 3N6NA 4HHJA 4YDDB 3JSYA 2GNKA 4PG4A 2VFSA 3WC2A 4X4QA 5D3GB 2DJWA 3JAMY 4PKDB 2NUUG 1HFEL 2FPHX 5KFAA 2B4VA 1LFWA 5GADI 2G0CA 2BANB 1O51A 4ILMA 2DRBA 5LMNF 3N6MA 4AL7A 3RRGA 4A4JA 5IT0A 2ZE2A 1Y00A 1VBXA 1RT1A 1Q82T 2PFFB 1XERA 3DRPB 1T3NA 3BS9A 5E41A 3RB0A 1KQGB 5KFPA 3L09A 3UW1A 1HBUA 1U1PA 2MQQA 1X4BA 3IR7B 2QO3A 1UA0A 2HPUA 1FJGF 1CLFA 4BBYA 1SJ4P 1HWIA 1IJFB 3CO9A 5BYRA 2P9CA 3CGIA 3SZ2A 4KBIA 4L72B 1FRMA 1AW0A 2HW3A 1T05B 1MWYA 2E1MC 1NH8A 5MLCV 2VONA 3EUNA 4DL2A 2KB2A 2MY8A 3R3TA 2LQBA 3KHRA 1K9MT 2VPZB 2AYEA 2EFQA 4ES3A 1YJWS 1NK9A 1N88A 1JWWA 2CPIA 2CIMA 2OMLA 4F26A 2BOPA 5DQHA 4IOBA 1VBYA 3NCQA 3RAXA 2GHPA 2E5JA 1S6PB 4RNMA 2FJAB 2YWGA 3NS5A 3VR1A 4DEZA 5F41A 2R8GA 1V6HA 1KRPA 2R8JA 2RDJA 4LF8F 4FN5A 2E5IA 1C4CA 5B0BA 1FK9B 5KOWA 2IFXA 1Q7LB 2VODA 1ZAXA 1V3SA 3PKYA 1N56A 1QM9A 1Q1KA 3OLAA 2M2BA 1TKZB 3CUNA 1JLQB 2LU1A 3MOZA 3DOMA 1E6YB 4KGKA 3V6KA 2UV8A 3QO9B 4DV7F 1IKVB 1X4CA 4OHXA 1X4GA 5KG7A 3M30B 1X9WA 1S0NA 1KN6A 3C2PA 3FSIA 3K5PA 2H5EA 5D3GA 2EW9A 2VQEF 3M8RA 1O8BA 2EPIA 2VUGA 4ECZA 3FMWA 3RYLA 3FSYA 2MQOA 4Q2LA 1S6OA 5HROB 3GIKA 2R7WA 2W4PA 2HGLA 4TU8A 5I3UA 1X8DA 1JB0C 2OSRA 4NX9A 4DQIA 3M2VB 2GIRA 4KE5A 2XMWA 2YNFA 2FTRA 3QGPA 4FZVA 2UXCF 2W9BB 3MEGA 2DD8S 1N4LA 1SXLA 4TQRA 2DTJA 4K2XA 2XS5A 1L3SA 4Q44A 4KHMA 1TKTA 3CCRS 2Z2MA 3CC7S 1MU2B 2ZHOA 3C6UA 3ULHA 2FVCA 2OPRA 2F3JA 1K8AT 2OPRB 3D1HA 4BS2A 4FXVA 4O44A 1KLMB 1S1WB 3OFFA 2LQ9A 2B7CB 1JLCA 2LYVA 1JLGB 2Z8QA 1M90T 3D2WA 5EDWA 1TL1B 3KOAA 2FLNA 4EO6A 3OTBA 3BDPA 4JI5F 3BGUA 3RB4A 2UXBF 4JOUA 1IQTA 4I56A 1J2VA 3V2UC 2VPXB 3LWMA 1RT5B 4QWCA 2A2CA 4IDKA 1RT5A 2CQ0A 3V5RA 5E3AA 2K1RB 5E7OB 4OV1A 1YVFA 3VTIA 2VB6A 2O3DA 4X65F 4K4TA 4KO0B 4B17A 1SIZA 5HL7Q 2EFGA 2E66A 1ZTWA 1VQYA 1X4EA 3TANA 2V94A 3RB3A 4Y2MA 4DDFA 1IKWB 5FJ4A 1XNRF 2O01C 2ZZMA 3V4IB 1HBMB 1KQFB 5EWGA 3CD6S 1TP7A 1KD1T 3DLKB 4PQUA 4C7QA 2VPYB 4NA3A 4AQYF 4QR0A 2HG4A 3IWNC 1J5OA 1S1UA 2IMWP 1XR7A 5SZTA 4DUYF 3POTB 3P49B 1FRLA 3LAMA 3CD5A 4GO5X 1UVJA 3PW7A 3B82A 2JZ5A 3PW4A 1SJFA 1YG0A 3OL6A 3HHLC 3IS9A 4Q7AA 3TUIC 4DFMA 5J2MB 2QZ8A 5F8JA 1XMOF 2P9GA 2UUWA 1VQ5S 4KV8B 1VQ9S 3ZZYA 2J6SA 3P96A 1VC6A 3SSRA 4F4ZA 1W2BR 1NHVA 1HD0A 3SCJE 2CQPA 3B4DA 3QO9A 3TVZA 3KK1B 2UUCF 1RYSA 4IH6A 3PXGa 2MXYA 4IR1A 2W7OA 1KOOA 2FUG9 1MMNA 3EGWB 2CQ3A 3VAHA 1WHYA 3QAEA 4KC5A 5HO4A 3AJ1A 2NUHA 4JBCA 1SJ1A 4HDHA 3LWLA 2MKJA 2R7QA 5I3UB 3UD3P 4ED3A 3UR3C 2M3DA 3I9ZA 1TAQA 3CCLS 3NRBA 3N9UC 4LSLA 2B9YA 1WHVA 4LVNP 2B51A 3MXHP 2FLOA 3H4BA 1YJTA 5KFCA 2HNYB 1HWUA 3BR8A 4UW2A 5B0FA 5I3PA 3PR5B 1VQ6S 3D0GE 5CZVA 4CO2A 3PIPQ 1N6QB 3G8SA 4AE5A 1Y4ZB 4Q8FA 2MMYA 4A8YA 4DR7F 3MMJA 3LF0A 1U25A 1C1CA 1X4FA 5LXRA 2VH7A 3H40A 2MHNA 2VC0A 3NCRA 3MEKA 2QLWA 3N79A 2VZ9A 5A0YB 2XEXA 1U09A 5CYMB 4NLYA 1S1VA 3TX8A 5DETA 1X9SA 3P3DA 5LL6d 2UV8G 3T5HA 1HPZB 3AB2B 2X1FA 3SCKE 5GVQA 3H5UA 2MQPA 4H4MA 4ECRA 1A9NB 5F8GA 3IGNA 1ELOA 2NPIA 1WTBA 4JI7F 4ZPVR 2ADBA 4WCEQ 4DG1A 1VOMA 3BSAA 5CH7B 4ED6A 5CZXA 5T14A 1MW7A 1P8GA 2WB4A 3OLBA 4HEA9 4ZP6A 2ILZA 3VF0B 5L38A 3PO5A 4UY85 2XS2A 1QAJA 1RT1B 1FKAF 3BR9A 1U1LA 3BO3A 3CCZA 4BC7A 3MDFA 4LSLB 4F25A 4ES1A 3H5YA 3EGNA 2XO7A 2A18A 3QAUA 4ID5A 4LF7F 1P1TA 3PFEA 4ID5B 3OR1A 3TYTA 3OFGA 1TL3A 5FD1A 4DR2F 3OVAA 3DFEA 3GMGA 4G1IA 5JXSA 3S6EA 1FESA 2F9JA 4NZ0A 4M95A 3R27A 3W3SA 1VC0A 2HIQA 2NR0A 3NMAA 1Y0HA 5KAKA 4LIRA 4X64F 2J7KA 1LOUA 3H20A 1O0PA 3V6DA 3KLGA 1TL4A 4IFVB 3GZ7A 4IOCQ 1JKHB 4WJBA 1VGYA 2RE1A 3P5TL 4KPYA 2E5GA 2WAQD 3UE2A 4C8LA 4J9LA 1RTJB 3SXLA 3M6UA 1SUQA 4DN9A 4LMZA 1EP4B 4N8OA 2R7SA 3OL9A 2M5YA 3F73A 2UU9F 2FHJA 3IBWA 1S72S 4ZP7A 3QZ8A 2OPSA 3HHLB 4RNOA 3MUMP 4H4MB 3CJ4A 2BVZA 2XLJA 3MTKA 2OH2A 3CT9A 1U1MA 4ZPTR 4MFBA 3WDOA 3FGVA 3OSNA 2SXLA 5CD4H 1SC6A 4HTIA 4EUVA 1N33F 3M6VA 2EK6A 4A8OA 4RU9A 2GQQA 3GWCA 5KFXA 3HFKA 2F9DA 2JWNA 2RF2A 1WEZA 2ZH2A 2XGQA 2OFHX 5THWA 3TR5A 3DRPA 2PSZA 3PFOA 3FNNA 3LP2B 4ALZA 3LW5C 4RNFA 4DOZA 4M8LA 1KR4A 4H54A 3S1TA 5IXUA 1CC7A 2MKCA 1V9OA 1HBUB 5FDLB 5J1EB 3HVRA 5FDLA 1ZOTA 1YJ9S 1M5VC 4ZCMA 2M52A 1LKZA 4YR2A 2OPQA 3I9V9 2KZZA 2DT9A 1R6YA 2Y1JA 1NK8A <