2XBPA

A novel signal transduction protein pii variant from synechococcus elongatus pcc7942 indicates a two-step process for nagk pii complex formation
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
113
structure length
113
Chain Sequence
MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGSEYTVEFLQKLKLEIVVEDAQVDTVIDKIVAAARTGENGDGKIFVSPVDQTIRIRTGEKNADAIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITROGEN REGULATORY PROTEIN P-II
publication title A Novel Signal Transduction Protein P(II) Variant from Synechococcus Elongatus Pcc 7942 Indicates a Two-Step Process for Nagk- P(II) Complex Formation.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Gene regulation
total genus 25
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2010-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xbpA00
5D4LA 4YB6A 2RD5C 2ZOMA 2XULA 4CO0A 1V3SA 4IYQA 4OZLA 2NUUG 1O51A 4OZJA 1V6HA 4RWWA 1HWUA 1KR4A 3GSDA 2PIIA 1J2VA 5DS7A 4YB7A 1OSCA 3NCQA 3MHYA 3DFEA 4NYPA 2ZFHA 3HLUA 1NZAA 1V9OA 4AFFA 3O5TB 2JJ4D 3AA8A 4OZNA 4Y6IA 1VHFA 4RX6A 3NCRA 2GX8A 3BZQA 4USIA 2GW8A 4CO1A 2DCLA 3M05A 2J9CA 3LF0A 4NYOA 4D3GA 2O66A 4CO5A 2CZ4A 2J9DA 2NS1B 1QY7A 4RLEA 3L7PA 2XZWA 3N5BA 3NCPA 1NH8A 1XK8A 3T9ZA 3X3UA 4WK3A 2EG1A 4D3HA 1UFLA 3OPKA 1GNKA 2J9DE 2XG8A 5DRKA 1Q1KA 1UKUA 1PILA 2XBPA 4CO4A 1NAQA 5D4PA 1UL3A 2GNKA 4C3MA 4R25A 4USHA 4CNYA 3TA1A 1NH7A 1VFJA 1V3RA 3AH6A 4E98A 1P1LA 2NUHA 2O67A 4CO2A 4CNZA 2VD3A 5D4NA 4ZK7M 2J9EA 2V5HG 1H3DA 4WK1A 5L9NA 2EG2A 4USJC 4C3LA 4Y65A 1O5JA 4YB5A 1UMJA 3CE8A 3AHPA 4CO3A 4RWXA 5D4OA 2E66A 3TA2A 3AA9A 4C3KA 3TA0A 3O8WA 2Z0GA
chains in the Genus database with same CATH superfamily
2YQ0A 3NS7B 4C2MA 2KB2A 1KFSA 4M5DA 2DGQA 3TEHB 2PMWA 2E5HA 2IM2A 4NXNF 2IFXA 4IOAQ 3DCAA 2J0SD 4Y0FA 1ACMB 4Z37A 3NCRA 4F3OA 1LW2B 3CGIA 1VQ5S 4C7QA 3OD2A 3OJSA 2GQQA 2K1RB 5IM0B 3D1OA 1IBLF 1VQ7S 1JJHA 5KFAA 4EK2A 1S1TB 5KFPA 2W4PA 1YHQS 4U7CA 4ZP7A 4QWBA 5I3UB 3R5DA 1JJCB 1NK8A 4JI1J 1JKHA 1N33J 3FKBA 2F3JA 3NS5A 1Q79A 2ZH1A 2DJWA 4B02A 1K1SA 2HAIA 2G2YA 2R2UA 4WFXA 3F73A 4OHZA 3M7VA 3RW7A 3GB0A 2PO4A 4OX9F 4V19X 1FJCA 4C11B 2AEJA 5A8KA 3OLAA 4X2BA 4LJMA 4O3RA 1T05B 4JI6F 1HQ2A 4ZVFA 4X62F 2FVRA 2C3MA 7FDRA 4LF6J 2CA9A 1JIHA 3TP2A 5KT2A 3PACA 4DWIA 3OXLA 1FRXA 1Z2ZA 5D77A 4B9NA 1XQIA 3EGWB 1U26A 3IA0A 2GIFA 2PFFB 3CT9A 3T1HJ 4B3OB 3SFGA 3OV7A 1QSSA 3BBCA 3H40A 1GNKA 4M5MA 3HZGA 2C3UA 4NASA 1VQLS 1WACA 1S1WB 1F9EB 1QE1B 4YN3B 5FLXY 3TVZA 2ZZNA 3MEEB 4DSIA 3T5JA 1S49A 4LF4F 4C9DA 2MKYA 1TR0A 3JTOA 1NSPA 3E01A 2FJXA 1SC1B 1S6QA 2BJDA 3W5ZA 1CVJA 2HQ3A 4OHXA 3W2WB 3SXLA 4WIQA 2XWXA 2GA7A 4ZJOA 1HWIA 2CQDA 2HHHF 5C24B 3HZEA 4OZJA 5D15A 4JV2A 3ENQA 1VQKS 2FZKB 3VQTA 3JXOA 1UWBB 2UUTA 2Z2MA 1GMUA 3BGRB 2D9OA 3R6LB 2I5JA 2B7CB 2I38A 4I6WA 2ATLA 3KYLA 5D0GA 1FFGB 3LGMA 3TUIC 4NE9C 2XNRA 4DR2J 2E1AA 4J91A 3EGVA 2HNDB 5KTQA 4JP8A 1X60A 1TUWA 5HMWA 1SUQB 3NY0A 1YG0A 4ZCKA 4B3MJ 3QSYB 5AXNA 2VFRA 4DCPB 5C7PA 1JXVA 2HFOA 1MWQA 3U1NA 4GVLA 4IRCA 4KB7A 3N0VA 2CDQA 1HIYA 5LJ5Y 1TKTA 1T11A 1RDRA 3QT7A 2IJFA 2GMJA 5ETPA 2ATCB 2NYIA 4PG4A 2HBQB 4UUXA 1MWZA 3AXMA 5HVGA 2DKOB 3KHRA 1VHFA 1T03B 4JI4F 3OHAA 3Q8YA 5D0RA 4C8YA 4USIA 3U7JA 2EI5A 2HQFA 2QFIA 2FHKA 1S6PB 4CO5A 2PN6A 3MEDA 4LUBA 1Q86T 2DCUB 4TNOA 3MM6A 1NPKA 2XZTB 2ZC4A 5GAEI 4KIAA 2RE1A 4YP3A 1M5HA 1R0BG 2CQ0A 2GVDA 2WZ1A 1U2FA 4HVZA 1QAIA 3TI0A 3MMAB 1P8GA 4GKJJ 5F8JA 2Y1LB 1X8DA 4PXEA 4QWAA 1T9TA 2P6TA 4F26A 2DR8A 3M8QB 2VFUA 3V4MA 2O67A 2E1CA 3MEGB 4DPOA 1ZH5A 1X4GA 3HX9A 2F8MA 1Z2LA 5SUHA 1IBKF 2FC8A 1S1VA 4ED5A 1J5OA 4P10A 5B08A 4O44A 2ZDPA 1X9WA 1NJZA 4N8OA 3I5AA 2KRRA 2F1FA 1RAFB 3LH2S 4ZCMA 1EETB 2V4JA 3BGOP 2OPQA 4F7VA 1V6HA 3D66A 3PFOA 3QGPA 2DT9A 2OMOA 4ED3A 4I2QB 3EX7B 3QRRA 5K14B 2C28A 1BD6A 4ZMMA 5BYRA 4WXWA 2QX0A 3DRXA 2PI5A 5DRKA 1RT5B 5CZVA 2ZJQQ 1RTJA 4K0KJ 1TQLA 1QAYA 4CYUB 2WOMB 1GT8A 1HPZB 2N82B 3ZNJ1 4CLKA 3IO1A 1FRKA 4ETXA 2R7SA 4IRKA 2LKZA 2Z8QA 4RL1A 5G0RA 1VRTA 3IR6B 1B99A 3OVAA 3L9ZA 1UMJA 3KJVB 2IJNA 1JXEA 1RACB 2XLJA 1VYAA 3CCZA 1MU2A 2DH8A 2VOOA 5KT4A 1T9UA 2ZD1B 1ZM2A 3LW5C 4I7FA 1HLWA 4ZVEA 1VC5A 5HL7Q 3JSRA 2YKOA 1JLEB 2D3UA 3LF0A 3GJTB 1E6YA 3ULHA 1M0SA 2YKMA 4DL0C 3A12A 2HW3A 3CCQS 3GWCA 3Q8PB 4JI8F 2VBYA 2ZBCA 4FPRA 4DL6A 2ZUAA 1OYDA 4DUTA 1WELA 1U6BA 1OSDA 5L9XA 1RWUA 3QFWA 4KYZA 1ZTTA 4ZDNA 4LF8J 3C14A 1WOOA 4USJC 1AT1B 4UW2A 4QCLA 4K4XA 1QVGR 3DHXA 2Z2YB 2MJUA 2WW8A 3R5AA 4CLWA 3K57A 5AE2A 3PYFA 3H5XA 4Z2XA 3DXSX 3PZPA 2HG4A 5KG6A 3FFIA 4Q0BB 5HBMB 1REGX 2ZNYA 4ZVHA 1IKXA 1R0AB 3DLGB 1P9QC 3D68A 3I0SB 2MY8A 2IAJA 1QJHA 2UXDJ 3TX0A 2PC6A 2DR9A 3DLEA 3DDIA 1EHWA 4RW9A 3T9ZA 2AP6A 4OQJA 2DPIA 5D3GB 2DBBA 5ETOA 1UKUA 2KYXA 4ECTA 1VGYA 4EYIB 1RCXB 3GIIA 4ED0A 1VDHA 5KFHA 2Z58B 3MM5B 3HVTB 1PJ7A 2DNOA 5KG1A 5H9FJ 5C2CA 4KC5A 4CT8A 3D5MA 1UJ6A 2E7WA 5LOQA 3WC0A 1TKXA 2G1DA 2QA4G 3MR7A 2AF6A 3OFGA 4URGA 3FCVA 2CJQA 2V0NA 2QFJA 5IOLA 2ZITA 5F8MA 1QSLA 2BKNA 2UV8A 4B9TA 3B4DA 3E51A 4KH0B 5H9EK 3FCWA 3M2VB 4EZ6A 3VTIA 3E8OA 1LW0A 3LTOA 3KHHA 2X1AA 1N5YA 1ZAVA 1FWKA 1SQEA 5E3QA 3RR8A 5THWA 3PM9A 3MCNA 2XCPA 1AB8A 2H5IB 2PEHA 3PEHA 1FA0A 2CVIA 1KVKA 2AYMA 2VODA 1FD2A 5C2GA 3BEGB 2ZH6A 3T6JA 1FEEA 2OELA 2R2SA 1JLBA 4NMLA 5EDWA 1YJUA 4CLUA 1XMQF 3Q8VA 1HMVA 1GQEA 2CADA 1OWXA 5AT1B 5A8WA 1VMBA 4X4VA 1W25A 1KHVA 3UN2A 1NDLA 5GADI 1X4DA 1IJEB 1CEZA 1CJTA 1RHMB 1ZETA 1S57A 4KFBB 1VI7A 1V5VA 4ELTA 1H38A 3WDOA 3GIRA 1JLFA 4W4MA 1FVQA 1S1XA 1PBAA 1FJEB 3JB9k 4I67A 2FLOA 3HT0A 3QZ8A 5CXTA 2M9KA 2D3ZA 3T19A 4DN9A 2RQMA 3SV4A 1SQFA 2GFFA 4DUYJ 2F8HA 4MFBB 3OR1B 5A0YA 3DXBA 3DLBA 3P5BP 4C8NA 2YKNB 4AE5A 4JV5J 5D0EA 1RKIA 4ZHRA 4R5PB 3PW7A 3GYXB 2ZOGA 3M8RA 2ZE2B 3FK4A 1AA1B 1SJRA 3FVYA 1REVB 4ZJLA 2CIMA 3R7SB 5BR8F 1FJ7A 3KWMA 1N4LA 4EEYA 2HWTA 4RU9A 4HHUA 3VGUA 3PJ9A 1N0VC 2CPXA 2FB0A 2H51B 2J6SA 1ZA1B 1C0TA 4H4MB 3DRPB 2Y3YA 2AJ0A 3HHDA 3HFZB 5KFSA 4JI7J 1BQNA 2R8KA 3BR8A 4X4QA 2FYXA 2CPIA 3TJ8A 4LT6A 1NJWA 1BMQB 1HBOA 2A3JA 1YI2S 5IT0A 1N36F 4RW7A 1B0VA 5D8HB 3SQOP 4DPUA 3C6TA 1WOSA 4NLTA 2OFGX 5KG0A 4WKYA 2BQ3A 1E6VA 2MKKA 4ZCLA 3NWRA 1RYRA 2YNFA 4PWWA 3ZZOA 4UOGA 2RRNA 2DHHA 4DZ6A 3T5LA 5D6GA 2V8DA 5CQGA 4QR2A 2W9CB 1SV5B 4RBUA 5KFNA 2E7VA 4OX7A 3QWUA 1SL0A 2P6SA 4JOUA 3MI7X 2DEIA 4H4OA 3MMCA 1URNA 3T5HA 3J7ZT 4TU8A 1BUXA 1VQYA 3G86A 2RKIA 4HYKA 2BABA 4LFBJ 3SSSA 4CNZA 4DR4J 2G0IA 3D67A 4JI1F 1N33F 4F4AA 4DPWA 2LXFA 1T7PA 2WVCA 2C42A 1UEUA 2WTFA 3CULA 4EO6A 4O0NA 4OLOA 1MROB 2GQCA 2M70A 3UD4P 2MY7A 2HHQA 2XWYA 2LQJA 2HQCA 1X0PA 2AEMA 2JC1A 2JEIA 3E3XA 5E33A 2YNGA 1S9EA 3JS9A 3M32A 1NK5A 5KFGA 4R8UA 3FBBA 2NPIA 1RBLA 4DL7A 3KNAA 3LP2A 4D3GA 1CBKA 4DR3J 2WONB 1RWNB 4N76A 3DOMB 3T1HF 3EVOA 3R5BA 2Z57B 4KSEB 1CJKA 1IR0A 1RLDA 2QN6B 3EM1A 1XJWB 2JDJA 5EX3A 2AMCB 3O1LA 1SQGA 4F3QA 4ECUA 1FK9B 4E2FB 2W2QP 1YGYA 2MZTA 3MFIA 1HNXJ 4FVMA 3OL9A 2ZHOA 3KK1A 3VVUA 1FRIA 3HHLC 1ICEB 3PTWA 2B9WA 5E5NA 2MKHA 3UCZP 3M9NB 2J8SA 3FMWA 1WEXA 1YKWA 3CO0P 3RBZA 3ISND 2IM1A 4EYHB 1Q5VA 1Q7LB 3DM2B 2XGPA 4MK7A 3MF5A 2FGCA 4UY8T 1NKEA 4RW6A 1NLKL 2HEKA 2V8GA 4QWDA 1KEKA 1AROP 1HARA 3THTA 3EXYA 2L9DA 9RUBA 1N54B 2CDRB 2ZKUA 4X4UA 1B3TA 4DV2J 3GG0A 2XY7A 1KHWA 1NDKA 3DRRA 3TJAA 1CG2A 2R7VA 1LFWA 3EYZA 4ZPVR 2VH7A 4ANEA 3RGIA 3PO5A 3QIPB 3D4JA 4HACA 5JVHQ 3RTVA 2DK2A 3DU6A 2OTJS 3NWGA 5JXSA 4X4PA 3QZ7A 3GFHA 1XTZA 3PIPQ 4DR2F 1IKWB 1SCJB 3HMJG 3GZ7A 4DHVA 5C25A 3FBCA 5EWEA 2G0JA 1NO8A 1DY3A 4B3MF 1NK6A 2CJAA 2ROPA 2MYFA 5K8PA 3MCMA 3MM7B 2UUAJ 3D6FB 4L73A 4O3OA 1UVLA 3JYTB 2BYCA 2XQCA 3FUYA 3ILOA 1CJUB 1YTYA 2QO3A 4BC9A 1BQXA 3RG6A 1HBMA 1RE1B 7AT1B 2HHPA 4NYPA 2F9DA 5KG4A 3DLHA 3H2LA 4N77A 5DG9A 2XTJP 1WOPA 3DOLA 3T5KA 2OJ3A 1M5VC 5I42B 1GXTA 2HIQA 3CDEA 3MGJA 1V5IB 1T3NA 1HFEL 4OZ5A 3HK2A 1QVFR 4RNMA 4RO0A 1Z1ZA 4F3MA 5CYQA 3IXQA 1K73T 2CQCA 4GKJF 1RT1B 1YSJA 4E98A 2ASJA 4MAKA 1S6OA 1BQMA 3HHKA 2Y0BB 2IBKA 4W90B 1RBOB 3AJDA 4ZVSB 4U95A 1M5SA 3HHLB 1FWLA 3W61A 2G2OA 2OMLA 1NBEB 3N6LA 4ZN1A 3T41A 1OQ6A 2MJNA 1UW9A 3FMBA 4P52A 3MECB 4X84A 4V1Ak 5B0FA 3F41A 1S12A 4UY85 3NMRA 2BZ2A 3CXCR 2IIHA 3SEOA 3B54A 2WSCC 4CLYA 3W2VB 2GAGC 1HL6A 4F4WA 1Q8KA 4G6VB 1XNQJ 2AGQA 2W4CA 5JVGQ 3O44A 2GW8A 5IT9U 2QEXS 1P9YA 3K8WA 3WHIA 1H98A 1W26A 1NH8A 3H4BA 3LWMA 4QIWD 3CNQP 3C2PA 2EK1A 4B9VA 4KGXB 4ECZA 4UF4A 4DN0A 1F3FA 1DQ9A 4KV8B 4K0KF 2W7PA 1KLNA 4X4SA 5BYQA 1DRZA 4WFAQ 3VAJA 3ZZRA 4J5OA 1D09B 1RWWB 3BQ1A 4ZOSA 3SCKE 2OPRB 3I9ZA 1TMJA 3Q8SB 2W25A 1HD0A 3CD0A 4LRBA 5KT3A 3ETOA 3PEJA 2CNNB 2ZBPA 3I56S 2MLYA 2W9BB 5HP1A 1RT6B 4OYOA 2NUUG 3CD7A 2NXUA 2DR5A 4DX6A 1LWEB 3DGPA 1OSCA 5HN0A 2RDDA 5EHHA 1DQAA 2DXDA 2VJVA 3EVWA 5F3TA 1U1QA 4M5GA 4J9NA 4OV1A 4ZS6A 2HHVA 3W9IA 4YOEA 1PYTA 2A18A 3KK3A 3RZAA 1IM4A 5B0GA 3TJ9A 2J7UA 3PW2A 4FF2A 4QYZJ 3RRKA 2OI2A 3R6GB 2R42A 4NI2B 3Q8UA 1AW0A 2O3DA 1TL7A 3F44A 4J7CA 5GMDA 2DGXA 4ECYA 4WP9A 3PW0A 1VBXA 2XSJA 4IR1A 2YNIA 5DQIA 4J9PA 1U0HB 3IBCB 2EG2A 1G4CA 2QLWA 1RHJB 2HFSA 4O4GA 1YRUA 4LF8F 4PQUB 2UUCJ 4FBUA 1KQKA 1T9VA 4F4YA 3EZUA 2K06A 2V34A 2BMBA 2ZOMA 3HT3A 3BSCA 3DYAA 4A8KA 4L72B 4HHJA 4RWWA 1LK5A 4EZ9A 1WI6A 1NZAA 3QMQA 2DGOA 3NOCA 2V68A 5KFEA 3OSNA 1CULB 2QA4S 4TU7A 4NL5A 3PO4A 1IKYB 2UXDF 2AEFA 4PXCA 2G2ZA 2RQKA 3D6TB 3LP1A 1H2VZ 4PG7A 1SJ3P 4Y2CA 4NCGA 5D4PA 4ZP9A 4DL3A 2QLBB 1VISA 2MKIA 3EICA 2V50A 4Q8EA 2BE2B 5ETLA 2OPPA 4E0DA 2MGZA 3W7BA 3IR7B 3KLVA 2XY6A 1VBYA 3Q23A 2MQNA 2FC9A 3TAMB 2QIFA 1LWCB 4FN5A 3UCUP 3PDNA 5L46A 1SJFA 4ED6A 3AA9A 2Z0GA 1R8AA 1RADB 2WVFA 2YPYA 2XB2D 2FY8A 2Y1RI 1SL1A 5B0BA 2IMWP 3PX4A 3MMBA 3CMES 2NYHA 3QRPA 4J9LA 1YJNS 3IP0A 4HEA9 1LWXA 1FKOB 4J9RA 3WBZA 2M0GB 2XMTA 4U6PA 2JLGA 4RJVA 4B3TJ 4IDKA 4CT9A 3US5A 4RKUC 2AJ2A 4PKDB 3JTNA 3MOZA 4PG6A 2IYGA 5E0OA 1KLMB 3GFYA 5CABA 3DRSB 2L41A 1IKVB 1ZM4A 1ROFA 2V2ZA 3M6WA 2RU9A 2DNGA 2LLZA 3MM8B 1WC6A 1GXLA 3KXDA 5GAGI 3MR5A 2MB0B 3OXFA 4DV4J 3V4IA 3ILLA 1ZPWX 4CM2A 3NNAA 2WB4A 2FVQA 1TL3B 2D69A 3TQEA 4J9KA 1U6FA 1TV6B 2XI2A 2ZBQA 9ATCB 3M2UA 4RUAA 2H48B 4DJBA 4M5NA 1URRA 1HW8A 4FNIA 2V4QA 3DDKA 4QIEA 2V2VA 3UNGC 3BKFA 1RTHB 1U1NA 3MAHA 2EFPA 2PI4A 4DUYF 1F60B 2K3KA 1JJ4A 1KVIA 1TL4A 2BJ3A 1G1XA 2K2PA 3C46A 1TZ0A 3PFEA 3MEKA 4JV5F 1C1BA 1Q16B 1B0PA 3QATA 1JLGB 4ILLA 1ULRA 3J7YI 3N5BA 5A2QU 2XEXA 1F1BB 5T7LB 2EG1A 2B7BB 4Y2IA 4G1QA 4NYZA 2GCFA 2BA9A 2WSEC 4K50A 1GX5A 3R2DJ 1SH3A 3WIUA 3TA1A 3UVJA 3HSZA 3UR0A 2RNEA 1FX2A 5LXRA 4YDDB 1IN0A 4WK1A 1WHYA 2MMYA 3M8YA 3ZTQA 2GO9A 1FDBA 4P7VA 4K4SA 2CPHA 2ZEJA 3THVA 3KMQA 3CC4S 3FNNA 3T1YJ 4M5JA 2E66A 5B09A 4LBPA 4JI7F 3TWZA 3SBMA 3MAAB 1RAEB 2PT0A 4OJ1A 1SB6A 3SDEA 2X3GA 2K1RA 5IM0A 3M8ZA 2PMZD 1VR6A 2GIQA 2YKAA 1TUGB 4M5HA 2VFTA 3CJ3A 1WEZA 4OJ3A 4AUKA 2XI3A 3CUNA 5I3UA 3GIKA 1AUDA 3I5CA 1FESA 1FNXH 3IWLA 4NEYA 1FDNA 3MCOA 4D3HA 4CLTA 4LBHA 5HLFA 4K4VA 2ASDA 3SCJE 2C3PA 3R27A 3DI6B 3MPUB 1DLOA 3C15A 1YLXA 2Q6CA 1WDDA 2R7RA 4C11A 1KQGB 3J7AN 8AT1B 4LFBF 1QUPA 2L08A 4QPTA 1L3SA 1HNWJ 4DR4F 3I9V9 4OYWA 2DIUA 4RBTA 3GJQB 1PIEA 1MW7A 3NNCA 1Y10A 3FBFA 2OH2A 3FEYB 3FJ2A 3DLKB 5DETA 1W7WA 4P2FA 2EC0A 1KOHA 3M9MB 5H9FK 4YS2A 1U24A 1U1MA 1A0OB 2BANA 1ZPVA 3ZNUA 3GU0A 1RT7B 4RZRA 2E9RX 4LSLA 3K2YA 3IM9A 1Y4ZB 3EZ5A 3KLHA 5HROB 5EWGA 2YTCA 1RHKB 1Y5IB 2BJ9A 1ELOA 2V94A 1ZA2B 4DR3F 3MPVA 2QYGA 2MZ1A 4CH0S 4NZ0A 2LVWA 2M5YA 1WC3A 3FBEA 4IOBA 4YDXA 1FRHA 1UZDA 1TMMA 2XMUA 1FRMA 4M5DB 3P4UB 5FD1A 1FERA 1LK7A 2NXEA 2ROEA 2HWHA 3LPEA 3QIDA 3ZC4A 4M5IA 1HNXF 3P96A 2UXBJ 4MKVA 4HH1A 4URSA 1F5AA 4BLGA 4F36A 1ZM9A 2F4FA 1P6TA 4RWXA 4LSZB 1H74A 2VICA 3TA2A 4MIBA 2HNZA 1W2BR 1UWBA 4BBYA 4I64A 2R4FA 3OHBA 5F8GA 3D1HA 4IFYA 1NUEA 1YJRA 2CQ2A 3K7RA 4BWJA 4NOHA 1JKHB 4C97A 2LYVA 1OPZA 2BM0A 5EGYA 4XAKA 3VAKA 3OVSA 3L7PA 1NJIT 1SUQA 1OQ3A 4WYWA 1PCAA 1SXLA 2HFUA 4OI2A 3CDUA 3SV3A 2PGCA 5IFMA 4DV2F 3KLGA 3CC2S 5A8KB 2QLJB 4USHA 2RIJA 5GADU 1CLFA 1QDUB 3M8PA 5F8HA 2HVHA 4CP5A 4LSNA 4TYAA 2HGNA 1NNDA 1H7WA 1T03A 4NLGA 2J8AA 1WF1A 4ELVA 1NZ8A 3RUBL 2FJWA 4WFBQ 5ETMA 3H2VE 1S6PA 4C8ZA 2UUAF 2PDAA 1TFYA 3JAMU 3HULA 2VBZA 2FY1A 4NEZA 3QGIA 4PXDA 4LVOP 3O5TB 3MM9A 4Q5VA 1UVNA 4NCBA 4F4KA 3E01B 1APSA 1NXIA 1PYOB 1S6QB 4G1IA 2HZCA 3Q24A 1JNZB 3B8HA 1D0EA 2M88A 4Q2MA 3A3OB 1YITS 2KRBA 3TVKA 1Q1KA 4N47A 4PWDB 4NLPA 1M1GA 4C3MA 3S6EA 2YY3A 4ZVTB 2MQOA 1SKWA 3T1AA 4DPYA 2W9AA 3R7NB 5J2QA 4ZPAA 1P1LA 2PEBA 1U09A 5IQQA 3GYNA 4ECWA 5HSPA 1XMBA 3VALA 1NKCA 3GCWP 4TVAB 1SIWB 2WK4A 1N48A 2H5EA 3DOKB 5J1EA 4PXBA 4NZ7A 4B9SA 1PJ5A 4DOZA 2W1BA 2F40A 2CUYA 5K8OA 4I2QA 1G3OA 4DZDA 1FCAA 1RJJA 2I5JB 1HW9A 1X4FA 3QSIA 1JJ2R 2VG7A 2VOPA 2Z56B 3BYPA 1VRUB 3TARA 2RMLA 3VGSA 2IY5B 2I0XA 4Q44A 5IWAJ 3M1VA 1XNQF 1HPZA 5L1JA 1QUVA 5KFWA 1Y0HA 3OL8A 5BXIA 3BPSP 3BQ0A 4TYBA 1XK8A 3SCIE 2KT5A 1XR6A 4ENOA 1BLUA 4CO4A 1TKTB 3OUYA 2WRMA 3RAQA 4U96A 1S0VA 3K0JA 2OAUA 3W1YC 1WDTA 1TL1A 1S76D 1GAOA 1WI8A 4DFPA 2EEYA 1VS3A 4ZK7M 2NR0A 2DGTA 3H5SA 2BQRA 1M1KT 1R8CA 3PXGa 2MQMA 3ZZZA 2QG9B 4A47A 3SIPB 2ZJRQ 1BWEA 2J6TA 4KHPJ 3GILA 3MEDB 4FYYB 2BQUA 3V6JA 4N7TA 2E5IA 4N56A 3UQSA 1YZ7A 3MM6B 2F8EX 4TU9A 1CC7A 5G4DA 1C1CA 5ETRA 1RQ0A 3TA0A 2IYIA 2HNYA 5A6WA 2GVDB 1DTQB 3I4HX 2D9PA 4OV6A 4RR5A 3P49B 5KT5A 2H4WB 3AJ2A 3NP5A 3GJRB 3W62A 1UA0A 3H20A 1Q78A 2YNHB 1Q7YT 3MPDA 2CQ3A 5DGAA 3HXMA 1HKAA 2FQQB 2R8GA 2QV6A 1S1VB 5DG7A 1J5OB 5J2PA 3CCJS 1X4CA 4ZVOB 2CNKB 4ZLPA 1F0XA 2A2DA 2VPZB 4WFNQ 2V4JB 3CCSS 1ZTWA 3KUGA 2OPQB 4HR2A 3Q22A 2G0CA 3B82A 4CM0A 1VJQA 1YBAA 4IG0A 1K47A 5KG7A 3VAMA 1WKKA 4Y65A 3AQPA 5KFXA 2XMKA 4LMZA 1DTTA 2J5AA 3EPIA 2ACYA 2JH3A 2JLEA 1F5CA 4KGKA 2YX7A 3I4PA 5EN1A 3LPYA 5KFUA 2KHCA 2UUCF 2ILYA 2Y1IA 4IH6A 1RTJB 1HR0J 3ENVA 3UPFA 1T9XA 2YWFA 3AQOA 2JFKA 2JJ4D 4BS2A 5DLGA 3EPGA 4TN2A 4YR0A 2O01C 4I2PA 3HVTA 1NSQA 1VRTB 1UEKA 2XGQA 1FNMA 3W65A 2Q43A 3NRBA 2JEGA 3L7UA 2VUGA 3AOCA 2B8QA 1VHIA 1J5EJ 2D3OR 2VC1A 1GXUA 4DSKA 4OYAA 1MU2B 2FJBB 5E41A 1HBNA 3H4DA 3HP6A 3OSPA 2DRBA 3W63A 1UJ5A 4RNNA 1C4CA 1HD1A 1BWVA 4I7FB 2OP5A 2J0XA 4DU7A 3X1LB 5FJ4A 5L39A 4LR8A 4BHQA 1KRPA 4ALZA 2ZH3A 2OLWA 3J80Y 1E6YB 1RTZA 2YKMB 4YMEA 1N5QA 4CLLA 3IBFB 5KFDA 2JOQA 2ZKTA 3AXKA 2AZ3A 4FF1A 4ZPTR 3V6DA 2PA8D 2XS2A 1SI9A 3GSDA 1RU2A 4XDCA 2FJVA 3PR5B 5M2UA 5DM6Q 1NSAA 3CJRA 3H7HB 2GMHA 5HI7A 3KJNB 1RA6A 2HBRB 2D41A 2V2KA 3C14B 2DGSA 2BR0A 4I68A 1P27B 4B3TF 3KMSA 2C2MB 2NXCA 2W01A 2Q66A 2DHXA 1YIJS 5J2NA 1WC4A 1X4AA 1KVJA 3ICLA 2DTJA 2CJXB 1FKPA 2HVDA 1S1UA 4OZ3A 1FDAA 3FFIB 3PRBA 2HRYA 1IKXB 3HJVA 4DV6J 2YKPA 2IAJB 4OYMA 1OYEA 2VFVA 4DV4F 1RA7A 1CQNA 2N7CA 3CJTA 1KFDA 4FP9A 4OYBA 3DDNA 2CQIA 4RW9B 1R6VA 1N88A 2NXNA 4R5PA 5DDQC 1VBKA 4ZIVA 5IQ6A 5LMUJ 2KFNA 3W5YA 3BN4A 3ZTRA 1U1PA 1WG1A 1RWPB 5LL6d 3QJLA 4DV5J 4ZJQA 1L3TA 3U27A 4ES2A 4OZ0A 3BGUA 1RYSA 3FSYA 2IDEA 1TKXB 4DS5A 3J7A1 1QY7A 1QTNB 4OI6A 1U2CA 3CJ8A 4G1PA 4K7QA 2KDOA 2RT3A 2MQ8A 1UA1A 2LP4A 4DX8H 2FJDB 1N5SA 4ZITA 5A8RB 3CVKA 1NHKL 1QAJA 4F0HA 1LW0B 3GE9A 2ASYA 2A10A 1N5YB 4RU2A 1X4EA 4NXMJ 2HVIA 4GC6A 4X65J 2Q79A 4CRJA 3RR7A 4QYZK 1NSKL 2DISA 4LF1A 3MAQA 2QZ8A 4G3IA 3TO8A 3SYZA 3GV8B 2DH9A 4CCHA 5DG8A 5B0AA 2EKYA 3MXHP 4RBVA 4KPYA 4EBDA 1JLBB 4RNFA 1UEVA 1IUJA 5FDLA 2Y8WA 2MHEA 4B17A 4OI4A 3T1YF 3ILJA 1HMVB 3THPA 4DG1A 2Y1JA 2OO4A 1N34J 2EFOA 4GO7X 2JHEA 4EUVA 5A8WB 4O23A 3WX4A 1WJ9A 4L6V3 4LF9J 1ZAXA 3G9CA 5HVFA 2NCKL 2MLZA 1CJTB 3HKZD 1X7VA 1T9YA 3R5GA 1RT3A 2GVZA 2W8KA 3K5LA 4C8KA 1ZAWA 5CYMA 2CQGA 3HVRA 1HBUA 4FXVA 1L3KA 1JLFB 3DMJA 3N9UC 2E1RA 3V6KA 1S1XB 1XMOJ 3QNWB 1H2TZ 1Q81T 4ES3A 5A2QY 3R9LA 3C6UA 4KO0A 4XK8C 1WNEA 5A0YB 4AXIA 4MKAA 2J9EA 5C42A 4B3RJ 3BSOA 4ZVRB 2ZM6J 1YBUA 1RWVB 3A3NB 3G6YA 3GR0A 2BEFA 1XBWA 3AD9C 2ALYB 4DI6A 4ZHRB 1O5JA 2RB7A 2RHQB 4YB5A 4PUOA 1HNWF 3POTA 1M5KC 2VZ9A 2YQ3A 4ZPCA 5EUHA 5M2RA 4QU7A 4X64J 5KFCA 3ZO7A 4FF4A 1X5SA 4I69A 4DX7A 3Q2TC 4P9SA 2XZDB 1J2VA 3VGTA 2I1RA 3HM9A 3OTBA 4JI5J 3QLHA 2BRKA 2AV5A 2Q6BA 4C48A 5GMEA 5EWFA 4C8MA 1KNZA 2W7OA 1YRTA 4JYAJ 3I32A 4PWUA 2ZH5A 1XNRJ 1U8WA 3OTOJ 3RW6A 1TVRA 2AYGA 5M2PA 1BQNB 1RAAB 4WXOA 1FK9A 2POKA 3CJ0A 4Y3CA 4CI0B 2HS0A 1HBOB 4K5RA 1RAOA 1VQOS 4PAAA 4RW7B 2XMAA 5E7OB 3C6TB 3DHWC 2BJ7A 3QRQA 5JUMA 1E6VB 2D74B 2YNFB 4TKTA 1B64A 1SC6A 2A1BA 3QFHA 4QOTA 1MLAA 4I6YA 3Q2SC 1FO1A 2CKWA 4OYPA 2XHWA 3GP9A 2UXBF 3DLLQ 5F0WA 4H4OB 3LAMA 3MMCB 4IYQA 4O4RA 1FF2A 1VIOA 3IRXA 2WBRA 3A1YG 3RB6A 2RKIB 3NCQA 2BRLA 3BKTA 4GO5X 1UFKA 4AL5A 2RJZA 1T95A 3NAIA 4HLBA 1K44A 3KLEA 1FRLA 4KJIA 4WZQA 2CFXA 1D3WA 2RUSA 3BDEA 1R0CB 2BXJA 2OIHA 4HI2A 2CJ9A 3GCXP 2KG1A 3AJ1A 3W66A 5GAGU 2YNGB 1RLCL 2FVCA 1S9EB 5J1NA 3M32B 2KFZA 2A2CA 4DL4A 4R8UB 2M7SA 1AFIA 1GTHA 5KFKA 3ZZYA 2OPSA 4KHRA 2GO8A 1CQMA 1RAGB 4KR0B 2RD5C 3OR2A 1SPBP 4Y2KA 3TR5A 3FSXA 4ILRA 1CJKB 2CQ4A 1JB0C 3KHLA 4YB7A 2ROGA 2H5JB 3SQGA 2LQ8A 3TAQA 3BV8A 4DQPA 1MG7A 2H3EB 1N56A 3KK1B 3CJSA 3KLIA 1YZ6A 4P2XA 4QZVB 3VWSA 2A6OA 1IJFB 3QT5A 2YQ1A 2XS7A 1F6TA 4QW8A 3OTEA 1QLNA 3H5UA 2KKHA 4UT4A 5B7WA 3U02A 3OJUA 2XMMA 2NREA 3SSQA 2DEJA 3N28A 2HWIA 4DU8A 1QM9A 4I6AA 1HQEA 2V9KA 5HK4A 3R3TA 4RW6B 3BN7A 1ZS6A 3TZXA 1RHRB 1IVZA 2DVIA 3M8WA 4YQWA 1HNVB 4HHHA 5LJ3Y 4CO3A 5F0UA 2DPJA 3MD1A 1H2UX 4AL7A 3DRRB 3MD3A 1LXJA 1FNOA 3FRYA 3BF4A 2E9TA 2IA6A 3BO2A 3B78A 4HACB 2FUG9 1OIAA 4A8OA 1WF2A 3ZZPA 2QMXA 2YKQA 1R6YA 3MR3A 4DF8A 1TU0B 2LXIA 4DL2A 3W60A 2GS8A 3ENWA 3JAMY 2KTQA 1H0HB 5C25B 3IBWA 2AYEA 3LP0A 2GV1A 2YX4A 3HVAA 4EFAC 5F8IA 5IWAF 2MZJA 3H5YA 3X3UA 4IKAA 3K58A 3QJPA 1VK3A 4FDFA 1MMLA 3W8PA 5ADZA 3FZBA 3M6UA 2LA6A 2EK6A 2OPRA 4ID8A 1HBMB 2HBYB 1JX4A 2G13A 3DOLB 1VQ9S 4LF2A 2M8DB 1FT8A 1FWPA 3RRHA 3PX0A 1YRXA 1M1HA 1TELA 3UDEA 3UFCX 2QLXA 2XS5A 4KHPF 4YEAA 2MSSA 1F2HA 2KXNB 3PHEA 2AW0A 1FE0A 2BW2A 4UUWA 5IC6B 1KC8T 2DHGA 1OS5A 1NU4A 1XWLA 3I31A 1HWLA 4A4JA 2FVSA 1V9OA 1BQMB 1XN9A 1S99A 4OYIA 4X66J 1LNQA 2RH3A 4A8MP 3A8IA 1Y5NB 2VF3A 2QL9B 4C0HA 3M4XA 5CD4H 4UZBA 3PKMA 3HD2A 1LWFA 4KGZB 4N41A 1U0HA 1PJ6A 4L76A 1LXNA 3R5CA 3LANA 4PYDA 3CCUS 2C3OA 3QT6A 5HATA 4ES1A 4CH7A 4O3NA 3CCES 4C3LA 1LOUA 1NDPA 1C0UA 4LF7J 2W2OP 4RPFA 1N32J 2QA2A 3T9NA 3B6BA 2LU2A 2W8LA 3BYRA 3D1QA 3CD5A 4WE1A 3N01A 3UWTA 5K9FA 5B0CA 2HFNA 3KK2A 3UDLA 2HFVA 1S6UA 1HR0F 1S9GA 2WAQD 4YR3A 2CNLB 4DR7J 3BBBA 1L3UA 1IWGA 4KTQA 2KG0A 3VR1A 2CZ9A 1T94A 2LEPA 4P71A 3T3FA 5KFBA 3LUYA 2DNZA 2LQ9A 1TKZA 4Y28C 2RSQA 1LQ9A 1UJ4A 2RRBA 1AZSA 1LKZA 4X4OA 4Y34A 2ZH2A 2B4VA 1HWJA 5IT4A 1PAUB 3IC1A 3QYYA 2X51A 5HP1B 5K5MA 1V3RA 3IS9B 5IZHA 3CWJA 2HHTA 1HYSA 1J5EF 3N79A 3DGPB 2HSEB 4ZA1A 3OFEA 2SXLA 3CW2C 2CQBA 2GHWA 2B4PA 2YWKA 3KK3B 3MUMP 1JLQA 1R43A 2UVWA 4ED7A 4OHYA 1FXLA 4MMOA 2FZCB 5D4OA 3TUZC 1XR7A 2H4YB 4HH0A 3NBPA 4HKQA 5K8NA 1DQ8A 1KR4A 1TL7B 3C8YA 4RUCA 3EE3A 1WD6A 3D0GE 3FQLA 3VZIA 4DV0J 2BBEA 3HI9A 4Y2MA 2XSJB 2RF2B 2ZHAA 2V6AA 1SJQA 3OXGA 4WP8A 4W92B 1FJGJ 4IH7A 5HJYA 5GMKa 4O4GB 1WSRA 3IG1A 4P2SA 3MR6A 4P75A 3OT9A 5D78A 1EARA 1T3OA 4O3SA 4IO1A 1UVJA 4OYXA 1S59A 3M30A 3H59A 3BO3A 2J7KA 1KN6A 1OMSA 1SKRA 3MCSA 3DYAB 1VFJA 1QD1A 2HMIA 4FKXA 4PRFA 3PVXA 5DDPC 2U2FA 4AD6A 2CAJA 3ISZA 5DGBA 2X1GA 3IAS9 2DO4A 2RQ4A 1YJWS 1BY9A 2YWWA 3SZ2A 3ISNC 4DV6F 3TQ1A 5ETVA 3G2XA 2KVIA 2JEFA 1RAIB 3SCLE 3Q8QB 3LP1B 4K4WA 2YX1A 4YB6A 2DIVA 2BACA 4NCGB 3KFWX 3BGLA 1KDNA 4DEZA 1C2PA 3TUJC 3CDWA 2G9OA 1WWHA 1ZZNA 1WG4A 2ILZA 5LMUF 4QIGA 2OPPB 2MGZB 4CO1A 3TZWA 3UO0A 4DV5F 3GIJA 3FCHA 3BSNA 1S7HA 2AWZA 3MFHA 3UE2A 1U25A 1NAQA 2JC0A 3I6PA 3TX8A 2CWKA 3D0HE 2R7TA 3TANA 5DJBA 5F8LA 4OI3A 3K8VA 1QAXA 2OD4A 1K0TA 3G6VA 2VD3A 4H4KC 4DR6J 3R2CJ 3CJ4A 4EBCA 1RUSA 4NXMF 4RW8A 3MOJB 1EQMA 4X65F 4IDKB 3FC9A 3ET6A 2DGUA 3FZ2A 4NLXA 1Y7PA 2MZQA 3HSGA 4U8VA 5KFQA 1SJ1A 2JL9A 5BJRA 1R7IA 1EJ7L 3J81Y 4A8FA 3MHYA 3OL7A 2V8VA 1N34F 5LSLA 2KJVA 2VV5A 1OPIA 4TY8A 4R0EA 4QPXA 5F9NA 3V4IB 1IBCB 2A0FB 4LF9F 2VG6A 3G82A 3O6QA 4EO8A 3GFXA 1NK9A 4LVNP 2CJKA 1VLOA 2E5LJ 2O1PA 1MNEA 2HK2A 2N3LA 2IBOA 1UFLA 2M4MA 3OVBA 3M2UB 1V3ZA 3N4WA 3CCLS 1S4FA 4QBUA 1XMOF 4K5SA 1T02A 3VGVA 1S9FA 3DLKA 2GC8A 3D54A 1U1RA 4Y00A 2R2TA 1VQMS 4WFZA 4DLGA 4M5KA 5HQ8A 4B3RF 3C16A 1AUSL 2ZM6F 2AJ1A 4C4WA 2V2QA 3EWGA 1C1BB 1ZOTA 4TQRA 2HS4A 3V81A 3R1LA 4ECRA 2E7XA 1GTEA 4DUZJ 4L74A 1D9AA 5CYJA 1WG5A 4X64F 4DCJB 4OLPA 3RJMB 4IH5A 1F9FA 4P7TA 3UVJB 1CPZA 3OW2R 4WU2A 4IFVB 1EAYC 2B9EA 4NA3A 5I3PA 5AE1A 2ZUGA 1I3OB 3VCDA 4GKKJ 4JI5F 2XC9A 1XEZA 1FI4A 4GC7A 2QC3A 1HI0P 3G4SS 4JYAF 5HMXA 4DV7J 1RI7A 5F3ZA 1WC5A 1XNRF 3OTOF 3HSDA 4QYRA 2XM3A 4ER8A 5GAHI 4FPIA 2DD8S 3D3BJ 3SDEB 2DXEA 4QW9A 4N8NA 4CLPA 2NUHA 3JTPA 5ETSA 4E8UA 2BVZA 4HL9A 1TUVA 2AJ4A 2B56A 4OZ2A 3HF5A 1U47A 3KTQA 4LRCA 4ED2A 2V4RA 3PJXA 5J2MA 1X5PA 1R31A 2YXLA 2DNQA 3Q83A 5KG5A 1AYEA 2B8PA 4EBEA 3I82A 1EIYB 5HLFB 4W98A 2CG8A 4FYVB 4JUZA 1UAWA 1RT2A 5RUBA 2IC3A 1DLOB 3C15B 1NHUA 3MDFA 2Q1LA 1WEYA 8RUCA 3J7Z5 5CD4A 1PGZA 2Z2ZA 1NK0A 4NLQA 1K1QA 2PFDA 5J1PA 2F7VA 2AHOB 2WCXA 2QRRA 2XYPB 3MMJA 1ZYQA 5U47A 4PPDA 3A8KA 1PSDA 4F50A 2RAQA 4FXWA 2JFDA 4LFCJ 3CCWA 4ANCA 4LQ3A 2VPYB 2VFSA 4R0JA 4A8SA 3UD5A 1UWAA 5KOXA 2BANB 1RABB 1VOMA 5KFVA 3CCTA 2VDHA 4A8QA 1WC0A 4AQYJ 5E3CA 2ZHBA 4IRDA 4LSLB 4ICLA 2OEJA 5KFJA 2J7WA 3DC2A 4M63A 4NWBA 3KLHB 4UQTA 1HQUB 1UPMB 1GFWB 3NGRA 2FHOB 5A76A 2OGUA 3TW0A 1GEHA 2XY5A 3VQSA 1UFWA 2MEWA 3BR9A 4OFZA 5KFMA 2HRTA 1OO0B 4PWDA 3CPWR 2AIRB 2PE8A 2KZMA 2LCWA 2VASA 3WX8A 2V8HA 1IBMJ 5DZ6A 2B5JB 5L8RC 4Q2LA 1RTDA 4F4XA 3QJJA 3GFZA 4X4TA 3CB4A 2HNZB 3DOKA 4NLUA 1RTIA 3BKUA 3IM8A 2C2ZB 4IFYB 5L1KA 2LEBA 1F2GA 3VHQA 2BOPA 1JLCA 2DHAA 1WHXA 1TK8A 2VG5A 4WCEQ 1VRUA 4IR9A 4J9MA 4DL5A 3EUNA 5DQGA 5K20B 1NB7A 2MLXA 4OZLA 2HHXA 4N5SA 3KLGB 1Y3KA 4HI1A 3ILIA 2CZVC 4JI3J 4UZCA 4AFFA 3JQJA 3M8PB 5L1LA 2UXCJ 4OYZA 2JRSA 4IG3A 2DNNA 2AGOA 1LV5A 2JEJA 3CDBA 3LQVA 3PRDA 4LSNB 4QR1A 3TUPA 3N6MA 1C4AA 3TEGA 3M2RA 4DSJA 3MPWA 2H9ZA 4LF5J 2AX1A 4ZLJA 2V69A 3SMZA 4DFMA 4FVCA 2AZ1A 3FEXB 4WYLA 2N4DA 1FDDA 4NLOA 4BC7A 3K89A 3GYGA 3VVTA 1N6QA 1O8BA 1DTQA 3MM9B 1YK9A 2KT3A 1JMTA 5MAOA 4I56A 2G1HA 1I5OB 3S8SA 2CPYA 1X9SA 2VQFJ 4B3SJ 3BB5A 1MWYA 4U67Q 2GGPA 2YNHA 4QIVA 2XMVA 2H65B 1MMNA 1J27A 1NK4A 3PYEA 4RW4A 3AT1B 4WTYA 2FLLA 5J2QB 2QTWA 3D6MB 3HHNB 4LQ9A 3BZQA 4L3KA 3PR4A 1PBUA 5KFZA 1X0FA 3TZYA 1U45A 5J1EB 4X66F 5F8NA 3D7SB 1Q8BA 5KAKA 3H98A 2EFVA 2R8JA 5KFRA 1DZ5A 3JQKA 1I6JA 4GVBA 2B4UA 4CWBA 2R7WA 3GQCA 4KGVB 3RBDA 2KHDA 2AYBA 2VG7B 4DSLA 1Y9OA 1AXQA 1XERA 2EPIA 3GG1A 2VBXA 3M1VB 1EX8A 4M8LA 2OKQA 3ZZ0A 1UVKA 2MXYA 1JLAA 3V5RA 5HJXA 3G6ES 1CJVA 3RYLA 4LF7F 1N32F 2JWNA 3IRWP 3OUYB 3CTRA 4PR6A 2NZCA 3QBCA 5T41A 4K59A 4PG5A 4HDGA 5AE3A 1TL1B 3MUVP 4CH1A 1RBAA 4LR7A 1DARA 1YJ7A 3FEZA 3MURP 2P2CB 4DR7F 2J9DA 1D8YA 3I0RA 2XYHB 2W2NP 2AKWB 4TLQA 2NPFA 1EP4A 2DNHA 5LM7E 4CTAA 3A8EA 1C1CB 3QAUA 4KHMA 2FPHX 2HNYB 2YVSA 3CJKA 1L5UA 2Y0SD 2I9SA 2AU0A 4HTJA 4CO2A 2ADCA 3H25A 3ZZTA 3EJMA 1DHMA 3Q0AA 4DV1J 4A8YA 1VC6A 2BE9B 3H90A 2R9LA 1RT4A 1YDLA 4I1TA 2WVEA 3GMGA 3KUHA 2APOA 2BOAA 5J2PB 2XCAA 4Y2AA 2OSRA 1CS4B 5GAEU 3QT8A 2HZAA 5CA5A 3L95X 4S0MA 2KYZA 3MWBA 8ATCB 2YWHA 4J9SA 1RHQB 2MZRA 2AT1B 4IG0B 4WTOB 1O0PA 4DV0F 4OMFG 4HDHA 1DTTB 3DRYA 4ECVA 4DR1J 1N5VA 2OEMA 3GLJA 1FJGF 5E3RA 1PYSB 2HVEA 2CWXA 4NLWA 4WF9Q 3W9JA 2C3YA 3H2UB 1EZZB 5GVQA 2LEAA 4KKOA 2J76E 1I94J 2BX6A 4KPCA 2IM3A 1YQHA 5CAAA 4L75A 3AOAA 3O3LA 2FVPA 3RAXA 1WSVA 2MZSA 2ZZMA 2J0WA 4CDIA 3OBIA 1EQ0A 3NNHA 2PSZA 2QLFB 4I2PB 4F67A 2B6AA 3ZFVA 4P74A 3NKYA 1YWXA 3RBXA 4ID5A 3O8WA 4DCOB 1YVFA 1PG5B 4C0BA 3AAWB 5HMYA 2HHWA 4CIOA 4LFAJ 2XMWA 3QO9A 2DNMA 2VPXB 1TKDA 3DFEA 2DGVA 3ITHA 1HBNB 3BH7B 3W8GA 1SJ4P 4RX6A 2ZH8A 4J9VA 4F25A 5A8RA 4DX5A 2VJUA 1SH0A 3C19A 3M8SA 4QJVA 3ZZUA 1HNIA 2WHOA 1RU1A 3UDVA 2UUBJ 3KLFA 3S1TA 2ZVIA 1U1KA 3JSMB 1BHNA 2XG8A 1RISA 4A46A 2VC0A 2VONA 2AD9A 1NEEA 2DY1A 4LIWA 2CJBA 5LMNJ 3MPYA 5JJBA 3V6DB 3IGNA 1TAUA 2X1FA 2LDYA 2P9GA 1KOOA 4OIXA 4ERDA 4RNOA 1LW2A 4J9QA 5HAOA 1FEHA 2EXUA 4Q43A 5AXKA 3GJSB 1RP5A 4DR6F 3NOGA 2ABYA 4M5LA 3UDCA 3G96A 3AFGA 4O3QA 2IVFB 2CVEA 3EZOA 1OJ4A 1S1TA 3HCXA 3QGHA 2VQEJ 4OX8A 1CSJA 5J2NB 2UVVA 1FKPB 2GQ2A 2RILA 2C22A 1S1UB 3WC2A 3F0NA 2XMJA 3RAMA 4NPOA 2UVRA 1B0TA 4DDFA 1X5OA 2I8EA 3C3LA 1HWKA 2UU9J 1GMVA 4XDDA 1VQ4S 1N8RT 2ZWOA 3PIOQ 3EDRB 2LA4A 4ECQA 3BPDA 3EDQB 1SC4B 3GIMA 1T05A 2E5LF 3EMTA 2Z4PA 3P5TL 4ZIWA 2IVMA 4X4NA 2NSCA 4OI0A 1OY8A 3ZTSA 5KG3A 3QAEA 1SKSA 7FD1A 2XYGB 2WW4A 2R7OA 3RB4A 1U1OA 4B3OA 2FHJD 2WVBA 1RWXB 2VB6A 3BDPA 4K2JA 3K5MA 2OD6A 1NPRA 1S1WA 4C3KA 1IQZA 1QE1A 3N6NA 2IJRA 3L3CA 2FGOA 4P72A 4DUZF 3UN5A 2HLTA 2VDIA 4WJBA 4MYTA 2LDIA 3MEEA 3KUEA 2VHGA 5AXLA 1DBDA 3BS9A 2DHSA 3L7OA 4DQSA 2IRUA 1RB0A 3P45B 4HTIA 1JXLA 3A3PB 3SI8A 1OY9A 4DLEA 1U6ZA 4ZPDA 3W2WA 4WKRA 1GX6A 4GKKF 5A6PA 4MIWA 1UVIA 2Y8YA 2NSBA 1H7XA 1VIXA 5C24A 1UL3A 5FDLB 2RDJA 1TK0A 4JI0J 4DV7F 1U7LA 1UZHA 3HPOA 4WPAA 4DG1B 5KFOA 3GV7B 1H73A 3T6BA 2QL5B 1O6XA 2HRUA 4OJGA 1ITPA 3BGRA 5AJ3J 3AD7C 3DU5A 1RT3B 1HHTP 2GVZB 2ZNZA 3LGNA 2FJEB 1YJ9S 5CYMB 2HPUA 4CQ1A 1HBUB 1S97A 2ZZTA 3DMJB 4USUA 1KTQA 2OTLS 4USMA 1V3SA 2FLPA 1RWKB 2R7XA 3E2EA 2HNDA 3C6UB 5DS7A 1VRQC 4KO0B 5L1IA 3OLBA 2W7AA 2X7IA 5C42B 2GHPA 2FHMA 2O66A 1JNRB 3NGUA 2YH0A 2E5JA 2MQLA 3BQ2A 1TK5A 4ED1A 1N0UA 2ZVSA 4YY3J 1PO6A 2O5DA 4WK3A 4PUOB 3POTB 2MHNA 3M9OB 3D2WA 4LF6F 2DR6A 3I55S 1MN7A 3WIVA 2VPWB 2VU5A 4KY3A 4LFCF 4QWEA 4F04B 5DM7Q 4NLRA 4NRUA 1IWAA 3QLHB 5L9NA 4ZP6A 4AQYF 2NQPA 2R2RA 3RB3A 4NMXA 1KSPA 3GV5B 1AFJA 2GJIA 2ZC3A 1FXRA 1TVRB 2FD2A 1NB2A 3MMAA 2C2DA 4LR9A 2HAFA 4DV3J 1X4HA 3G87A 1RZMA 3M8QA 1ZZFA 3MEGA 1WTFA 4FYWB 4Y6IA 1M90T 6FDRA 1SC3B 2GMLA 2X1BA 4TLRA 2RS2A 3GTYX 2RQCA 2VKRA 1U49A 1IBMF 3P8BB 5DDRC 1G7CB 2L3MA 1EETA 2AGPA 1HNVA 1RCOB 4ECXA 4L3NA 3IRXB 2CPZA 1WHWA 3AH6A 2MKSA 2BJEA 1HI8A 5K14A 2HQDA 2WSFC 2DRDA 2VL1A 2Z2LA 4NRTA 4MT1A 2AQ4A 2KXHA 4MJKA 3TRGA 1U02A 2NLWA 2BJ8A 3KLEB 3CEDA 1VJWA 4I4BA 3TAPA 3AHPA 4Z7CA 1RT5A 1R3NA 2UUWA 5ETKA 4Q8FA 2EFGA 2BKPA 1Y11A 3B4MA 4USWA 4NLYA 3LO3A 4CYUA 2HHUA 2WOMA 3CIMA 2HYIB 4U9RA 1TAQA 4DQQA 1I1GA 1G2EA 1S0NA 4JI3F 3UW1A 2FTRA 2C2KB 2J9CA 2EC2A 3BJYA 2UXCF 1SH2A 2CQPA 2XO7A 3KJVA 2OPSB 3NCPA 2R8HA 2M8HA 4KBIA 4UQGA 1SBRA 1Y5LB 1VK8A 4C8OA 3OR2B 4J37A 3QWPA 1YBTA 3BO4A 4LF5F 6FD1A 4Q7AA 4QU6A 2ZD1A 3SSRA 4MIAA 5KFYA 2UZAA 4PZVA 1D9FA 2IHR1 2LMIA 2P9EA 2QE5A 2KU7A 3SQGB 1B4SA 4F02A 1B7FA 2A6MA 1S79A 1JLEA 3OFFA 2ZBIA 2VIHA 3CCRS 1T8EA 3TVYA 4DFKA 2IRXA 5ITHA 2GJ2A 2MKCA 4XPEA 3KLIB 4ED4A 5HMZA 2N7YA 3G8SA 2K8GA 4ZPWR 2VQFF 4B3SF 3PHTA 3ZTOA 5AXMA 3F56A 4K4TA 2IDLA 2QL7B 3D6HB 4QIFA 4O44B 4ZVQB 3LGHA 4IO9Q 2QA1A 5IT9Y 4OZNA 5DZ7A 2F4VJ 1HQEB 1RSCA 1YX2A 1JWWA 3Q86A 5MLCV 2ZDOA 4MKYA 5E2QA 3GR1A 5KFIA 3H0PA 1FTCA 2I6WA 2DNRA 2XHCA 5GAHU 4G65A 4XTTA 2MSTA 4Q0BA 5HBMA 4OI1A 1R0AA 1OY6A 3AB2B 3DLGA 2P5VA 4NLSA 3H42A 3MUTP 3I0SA 3UD3P 3AD8C 3DKDA 4TY9A 3K59A 2N3OA 3DGVA 3OQ2A 2MQQA 3HSJA 3LP0B 3CSKA 4PEOA 4LRDA 4WU3A 4F2SA 2LFVA 3CE8A 1VCTA 4WP3A 5D3GA 2IPOB 4ZLNA 3IAM9 2B0GA 1R8HA 4UOHA 4DQRA 4RNHA 3HHLD 3BM7A 2B3TB 2B9YA 4CO0A 5HANA 5G0RB 2JSXA 4C98A 2K7KA 3MM5A 1X9MA 2L9NA 1Q5YA 3KG1A 2HURA 5B0EA 4EI2A 3VZHA 3R7BB 2FDNA 1GMWD 4OZ1A 3IMQJ 1NPPA 3IS9A 2JVRA 3PW5A 4WZMA 4OJHA 2LXUA 3W9HA 5KFTA 3I5BA 2J9DE 3AOBA 3M2VA 2YPZA 5EX0A 2WVDA 1S7IA 4OX6A 1RAHB 1S4EA 4Q45A 1GH8A 1I51B 3CF5Q 4NLVA 4URQU 1H3DA 4DSFA 4KAIA 1WORA 3K5PA 4OL8A 5CH7B 3J81j 4UOFA 5SZTA 1IQTA 1LFPA 2KH9A 4DV1F 1VQPS 4USTA 2D1CA 4PG8A 1WF0A 3LAKA 1LWFB 2RF2A 3J80U 5I3QA 4NCAA 2DO0A 3LALA 4F4ZA 2FHJA 1UW4A 4P73A 3FDSA 4X4RA 3IWNC 2GZOA 4K4YA 5LSOA 4DFJA 3ZTPA 4JV1A 4ATNA 1K9MT 2EWHA 4KFBA 3VAIA 2J0QD 1U48A 1FD8A 2GX8A 1UETA 2RVJA 3SFUA 3HVWA 5ETTA 2X3DA 1XR5A 2C2NA 2RDIA 1BE4A 1HNZJ 1C0UB 4TXSA 1H6KX 2OSQA 2H54B 1R27B 4R25A 4DR1F 4MFBA 4WE1B 4AT1B 3OR1A 1KWMA 1RXOB 4GRSA 3GPAA 4PABA 4ITSA 2RHSB 1UPPA 3KK2B 3DLEB 2R3VA 2BKOA 2YKNA 1ZBTA 5CCMA 1X4BA 1WC1A 1NJXA 4BDPA 4ANDA 1S9GB 2XLIA 1I94F 1WKLA 3S01A 2ADBA 2JNJA 5KG2A 2ZE2A 1DAXA 4XPCA 1REVA 4CLZA 1VC0A 4EGLA 3VV2B 1TKZB 5D4LA 1RWOB 1AZSB 4DF4A 4JI2J 4FS1A 4ZVGA 3W5XA 2CRLA 2OEKA 1MMDA 4H4MA 2FZGB 3DRPA 3IFEA 1HYSB 4LFAF 4O3PA 1IM6A 1B70B 2LQBA 4U8YA 1PKUA 1FHTA 4ZP8A 3I96A 1JLQB 3WZ0A 3NLCA 1BC6A 3R5JB 4ETZA 2UUBF 1RKJA 3M6XA 3P3DA 2DXFA 4ZPBA 3NBPB 1H72C 3HKWA 2XNQA 5LMNF 4F0MA 2WBMA 3Q8RB 2ZWPA 2W9CA 1NDCA 1SV5A 4KH1B 2DR7A 1JQGA 2BE7D 4DMZA 3IGVA 2BV3A 3IG1B 2BJ1A 3DN9A 3CJQA 1O51A 2XLKA 2XO6A 3M30B 2VQEF 5DO2A 1KD1T 1MN9A 1FVSA 3GONA 1F5BA 3IWXA 3HLUA 2HMIB 2C2EA 3TYTA 5KFFA 4PQAA 2H1YA 2QSFA 3RBEA 2R7QA 5ETNA 1NCLA 4ZKAA 1K0VA 1MROA 2UU9F 1X31C 3JQMA 3C66A 4TQSA 2EKNA 1NMEB 2DH7A 3PCOB 2VA3A 5CZXA 1FE4A 5KT7A 4DPTA 1XIQA 4JV0A 2GAHC 4KE5A 4YHHJ 4C8LA 1Q8LA 2ZH4A 1Q8IA 4DR5J 4FKYA 3HO1A 5D4NA 3PKYA 1FXDA 4FS2A 3FQKA 4A8XA 2ACMA 2KJWA 2B43A 3D28A 1KKHA 3D9BA 1U8SA 1UVMA 2WONA 2ZH9A 1IR2A 3BSAA 4FXDA 3DOMA 4IFVA 1C0TB 3NG8A 3K5OA 3NEKA 1DJ0A 4NXNJ 2RS8A 5KFLA 4IQXA 3G8TA 4LRAA 3BGFA 3PNIA 3ELHA 3HHEA 4LIRA 3G8QA 5HO4A 2KZZA 4OHWA 5LXYA 1IBLJ 2DY9A 4RW8B 2LQ5A 3NGTA 3QQCD 5FLXU 1UCNA 3K17A 4H4KA 1UP1A 3HDSA 3ET6B 2QMWA 1PILA 2DYAA 5BYSA 5DLFA 1P1TA 2KFYA 3DM2A 1FTRA 3LOUA 1TL5A 1S10A 2HK3A 4JI0F 3D0IE 3LA0A 1DURA 2PD1A 3EGZA 4UTGA 4CZCA 4TY8B 4KRWA 4OX9J 2FIUA 2GIRA 2VG6B 3G82B 1A9NB 2VA2A 4JI6J 4X62J 5AJ3F 4USKA 5ETQA 3QIPA 1XC9A 2C1EB 2CPJA 1HWUA 1IKWA 1FKAF 3AODA 4Z7YA 3EVMA 2PA3A 2D7SA 3ONQA 5T14A 1NM2A 4DPXA 1R89A 1SL2A 3KJQB 4YB1P 4FBTA 2M2BA 2NS1B 3C16B 3ADAC 1N52B 3MM7A 2RRAA 2MKJA 4MKBA 5E3PA 3KKFA 1A6LA 3JSBA 4B9MA 4XO0A 3V81B 2DITA 2RUGA 2CQHA 3JYTA 4YY3F 1CJUA 1U4BA 2QT7A 4LF4J 3KOAA 1HQUA 1KQFB 3LP2B 3CO9A 4JBCA 3VF0B 4MH8A 1NH7A 2LECA 2EBGA 2HHSA 3DNCA 5KOWA 1YJTA 2NXJA 2B51A 5I42A 1M5OC 3MTKA 3PYGA 1T9WA 1WHVA 1Q4RA 2IA0A 1G6BA 4M95A 1RAJA 2HHHJ 2VKZG 3IR5B 3VAHA 4U7UD 1VQNS 1NHVA 2AJFE 1BXNA 1IXKA 2V9WA 2L9WA 1ZM3A 2XULA 3J7YU 2PMHA 4MYUA 4NZ6A 4F8RA 2B5JA 1RT1A 2WB1D 4DV3F 1Q53A 3AY0A 1UTAA 4FYDA 4P6QA 3CCMS 2OHDA 4ZN3A 1FFSB 3HHLA 2E5GA 3PX6A 1NKBA 4RUHA 3M05A 2NZ4A 4YR2A 2EFQA 4K4UA 5IXUA 3MECA 3TNVA 2QMUB 1RHUB 3NXZA 2B4OA 5J2MB 2HIYA 2DNYA 2E1PA 1U1LA 4C0OC 1GMWA 2V63A 1S77D 1Q82T 4J9OA 4NX9A 4NA2A 1S48A 2E29A 3W2VA 5KT6A 1RT2B 3H8YA 3MTJA 2IC3B 3GSIA 2ZJPQ 3ETMA 2IVYA 5IS2A 3HD1A 1HA1A 1A7GE 2YWGA 1F9HA 2K3IA 3KG0A 3TZZA 4DQIA 3S7RA 3VAGA 1TFWA 1NRKA 4KV8A 2KXFA 4JI4J 2HKEA 4PCQA 3BREA 2QJ3A 5I4MA 1NJYA 4DBQA 1S5ZA 4USVA 5HVHA 2BUNA 1Q0NA 4ICLB 1NK7A 4PPZA 3R97A 3UNYA 4LBIA 1D8ZA 4DXLA 2AX0A 1Y00A 2DB1A 4QQBA 2Q3PA 2XSFA 2W9BA 1RT6A 4JB8B 2BM1A 4QWCA 2B9XA 2J6UA 3R8YA 3HFVA 2JZ5A 4B08A 1LWEA 1QTMA 3UCGA 2JLFA 3WQPA 3UN3A 2W4DA 5H9EJ 3TOQA 1IBKJ 2V5HG 3KG4A 2KL8A 3V6HA 2UV8G 1X5TA 1HHQA 2BW7A 2YH1A 5CYQB 2CYYA 2OFHX 4P2MA 2JVOA 3KDOA 3PRVA 2HGLA 5DDOC 1RTDB 3W64A 4XIUA 4NI2A 1MSWD 1PC4A 2MQPA 4BCAA 2F5GA 3PYDA 2L48A 2DRAA 1RTIB 3QGGA 4ILMA 3ZXWA 3U1MA 3CCVS 5C5JA 2CG4A 2E9ZA 1U0SA 1R8PA 4OHVA 2RU3A 4BWMA 1JLCB 2F4VF 4PQUA 1KS2A 3EGNA 2CQ1A 2VG5B 4M1KA 1WUUA 4FZVA 4HT7A 4K2XA 5F41A 3NMAA 1DFDA 2MTLA 1T0TV 2VBWA 2W2PP 1D9DA 4I0WA 1HI1A 2F9JA 5H1SV 1FFWB 4KT0C 1CULA 1VBZA 4GMKA 4IG3B 2DNLA 1IKYA 2V67A 4LREA 4A8WA 2HZVA 2FLNA 3MR2A 3VAFA 1N5TA 4QR0A 2HLUA 2AJQA 2KO1A 3M2RB 5F9LA 3A4TA 3KDNA 1TTHB 6AT1B 3KNGA 4EWTA 1K8AT 3CMQA 5DQHA 2G4BA 1Y3JA 2BE2A 4WBFA 1SKUB 3AA8A 3K5NA 3V2UC 3U1LA 3AB4B 1N6QB 3JSYA 2W24A 2EVZA 3CMAS 3TAMA 4DS4A 1S0MA 1LWCA 2IMOA 4WWSA 4UOCA 1RK8A 1SVDA 4RLEA 1KBRA 4JI8J 3KHGA 3CJ2A 2GGPB 2ERRA 1F3VA 2KT2A 4WIIA 5CHCB 2R8IA 4CLFA 4H54A 2EFNA 4FNHA 4MK8A 5K8MA 4RW4B 4KGMA 1FKOA 2CPFA 2GJFA 2R7UA 4IOCQ 4ZLLA 2OUGA 5FIIA 4ZVPB 1Z4UA 2MPUA 4IUFA 3CC7S 2CPEA 3OFHA 4YFUA 4CLSA 2DNPA 1CS4A 3FRZA 2D3O1 1KLMA 3MZIA 2CJYB 3DRSA 1VLYA 1KP6A 4V19J 1IKVA 1SIZA 4K4ZA 3L4BC 2KVQE 2YNIB 3OL6A 3MM8A 1EB0A 2HGMA 2M3DA 4GVBB 3UI3A 4K8RA 4ED8A 5IV4A 2Y9HA 3PV8A 3OTCA 3G6XA 1HHSA 1TL3A 1IR1A 2DCLA 1TV6A 2CZ4A 2LU1A 2ZOFA 1VQ8S 2E1MC 3KJFB 2C2RA 3NAHA 2ASLA 3FSIA 2HBZB 1JLAB 2U1AA 1PC5A 2XBPA 1CJVB 4AYBD 4PYAA 1HNZF 3D3CJ 1RTHA 1BGXT 2K7JA 4CNYA 3P6YC 1KONA 1S0OA 2ALZA 1U2RA 3NS6A 1RWMB 3ENAA 2COLA 4WFYA 3NGKA 1EKRA 4FYXB 2KN4A 2HFZA 1S72S 1JLGA 3IN5A 2KM8C 4AL6A 3HFKA 4DSEA 2P8IA 4NA1A 2MDAA 3I0RB 5T7LA 3A13A 1EP4B 2HQGA 4EU0A 4CTAB 3RU0A 3UR3C 3CJ5A 3LWLA 1QSYA 2HVZA 2F63A 3CJKB 3QPIA 2CXEA 3L09A 4HT5A 4JI2F 5HQLA 3I87A 2ZFHA 3JSMA 4U7UK 1FX4A 1CC8A 3G71S 2KI2A 2V8PA 2FJAB 3MMBB 1VQSA 3W3SA 3CDAA 5L38A 2P9CA 2XZWA 1RT4B 2QYCA 1XMQJ 4NLDA 4AXJA 5IC4B 2ZBRA 5D0HA 3HJFA 3R1HA 2M52A 2JX2A 3MAAA 4IQMA 2YBVA 1KQSR 3NGDA 5CCLA 3EXCX 2E44A 3N5FA 1EKSA 4MK9A 4O0IA 2EW9A 3RB0A 1M5PC 2CNOB 2Z30B 2UP1A 3PW4A 3A8JA 3PJWA 2DGWA 2W2MP 3M6VA 3CD6S 1JK9B 2YWEA 2HQIA 3FGVA 4EMDA 2EBEA 2QGFB 4M94A 3Q89A 3NL0A 1R8BA 5LSRA 1TP7A 3O2IA 1WTBA 5E3AA 1Q95G 1PAEX 3DI6A 4ZVUB 2C2OB 2CPDA 2PIIA 1GK8A 4MTPA 4KKOB 4RUBA 3CIZA 2IM0A 1KTVA 3DLJA 1W2IA 3J81U 4A48A 1LEOA 4ZCIA 4KQZA 1WKJA 4NYOA 3BBFA 3NGSA 5BR8J 3PG9A 1D1UA 2IRYA 4B9LA 4F2RA 4LRFA 4C6AA 2DNKA 3PY8A 3OPKA 2B6AB 4ELUA 1B7YB 1RGVA 4ID5B 2GNKA 2QSWA 2HS3A 3OTDA 2GHVC 1RT7A 4F0KA 2I2YA 3QO9B 4YHHF 4J9UE 4YUDA 4J90A 5HQMA 3ITHB 1L3VA 2F65A 4G1QB 5HROA 2BDPA 4FF3A 4DR5F 4ECSA 2KM8B 5B0DA 1VQ6S 1FRJA 5JMNA 2N4CA 2ZH7A 3BH6B 4B9UA 1N36J 1HNIB 3RRGA 5IV3A 3KLFB 2UVUA 1YJVA 5LT5A
chains in the Genus database with same CATH topology
1R8AA 2KXNB 1X4HA 3PHEA 2AW0A 1FE0A 2BW2A 2KB2A 4C2MA 2XB2D 1KFSA 2Y1RI 4UUWA 1SL1A 4M5DA 5B0BA 2IMWP 3PX4A 3MMBA 3CMES 2DGQA 1KC8T 3M8QA 2DHGA 4J9LA 1ZZFA 1OS5A 2E5HA 1NU4A 1YJNS 1XWLA 2IM2A 3MEGA 3I31A 1WTFA 1HWLA 4HEA9 4NXNF 2IFXA 4A4JA 2FVSA 4IOAQ 1FKOB 4J9RA 1V9OA 3DCAA 2J0SD 1BQMB 4Y6IA 4Y0FA 3WBZA 2M0GB 4Z37A 1XN9A 3NCRA 1M90T 1S99A 2XMTA 4U6PA 2JLGA 6FDRA 4F3OA 1LW2B 2RH3A 4IDKA 3CGIA 4CT9A 4A8MP 2GMLA 1VQ5S 3US5A 2X1BA 1Y5NB 4C7QA 4RKUC 4PKDB 3JTNA 3MOZA 4PG6A 2IYGA 5E0OA 1KLMB 4TLRA 3OJSA 4C0HA 3GFYA 2RS2A 2GQQA 3M4XA 2RQCA 5CD4H 2VKRA 3DRSB 2K1RB 5IM0B 1U49A 3PKMA 1LWFA 1IBMF 3D1OA 1IBLF 2L41A 5DDRC 1VQ7S 4N41A 1JJHA 1IKVB 1G7CB 5KFAA 1ZM4A 1ROFA 1LXNA 2L3MA 1EETA 1S1TB 5KFPA 3M6WA 3R5CA 2RU9A 3LANA 2AGPA 2W4PA 1YHQS 2DNGA 1HNVA 4ZP7A 4U7CA 2LLZA 4QWBA 4ECXA 5I3UB 3R5DA 3CCUS 3MM8B 4L3NA 3IRXB 2CPZA 2C3OA 1NK8A 1WHWA 1JKHA 1GXLA 3AH6A 2MKSA 2F3JA 3NS5A 2BJEA 5GAGI 3MR5A 4ES1A 1HI8A 4CH7A 2MB0B 1Q79A 5K14A 3OXFA 4O3NA 2ZH1A 2DJWA 3V4IA 1ZPWX 2WSFC 4B02A 1K1SA 2VL1A 2WB4A 3NNAA 3CCES 2FVQA 2HAIA 2Z2LA 1TL3B 4C3LA 4NRTA 2AQ4A 2KXHA 2R2UA 4WFXA 3F73A 4MJKA 1LOUA 4OHZA 3TRGA 4J9KA 1U6FA 1TV6B 3RW7A 2NLWA 3GB0A 3KLEB 1C0UA 3CEDA 1VJWA 2XI2A 4I4BA 2PO4A 4OX9F 3TAPA 3AHPA 4V19X 1RT5A 2QA2A 3T9NA 1R3NA 2UUWA 3M2UA 4RUAA 1FJCA 4C11B 2LU2A 2W8LA 4DJBA 5A8KA 3OLAA 4Q8FA 4LJMA 3D1QA 1URRA 4O3RA 2EFGA 4X2BA 1T05B 1HW8A 4JI6F 3CD5A 4FNIA 3B4MA 3N01A 4WE1A 2V4QA 4NLYA 3LO3A 4ZVFA 3DDKA 2WOMA 3UWTA 4X62F 2FVRA 4QIEA 2HHUA 5K9FA 5B0CA 3UNGC 3CIMA 2C3MA 1RTHB 2HFNA 7FDRA 3KK2A 2HYIB 1JIHA 4U9RA 3UDLA 1U1NA 3MAHA 1TAQA 2EFPA 3TP2A 5KT2A 3PACA 4DWIA 4DQQA 1S6UA 1HR0F 2PI4A 1S9GA 4DUYF 1F60B 2K3KA 2WAQD 3OXLA 4YR3A 1FRXA 1Z2ZA 5D77A 1JJ4A 4B9NA 1I1GA 3EGWB 1U26A 1KVIA 1G2EA 1TL4A 3IA0A 1L3UA 4KTQA 1G1XA 2KG0A 1S0NA 2K2PA 4JI3F 3UW1A 3VR1A 2FTRA 3C46A 2PFFB 3CT9A 1T94A 2J9CA 2LEPA 1TZ0A 3PFEA 3MEKA 4B3OB 3BJYA 2UXCF 4JV5F 1SH2A 1C1BA 1Q16B 2CQPA 1B0PA 3SFGA 2XO7A 1JLGB 3T3FA 5KFBA 4ILLA 1ULRA 3LUYA 3J7YI 3N5BA 3OV7A 3KJVA 1QSSA 2OPSB 2DNZA 2XEXA 3NCPA 2R8HA 2LQ9A 2M8HA 4KBIA 1TKZA 4Y28C 5T7LB 2RSQA 2EG1A 3H40A 1LQ9A 1UJ4A 2B7BB 2RRBA 1GNKA 1LKZA 4UQGA 4Y2IA 3HZGA 4X4OA 2C3UA 4G1QA 4NYZA 4Y34A 2ZH2A 2GCFA 2B4VA 1HWJA 1SBRA 1WACA 1S1WB 2BA9A 5IT4A 1VQLS 3IC1A 1QE1B 5FLXY 1Y5LB 1VK8A 2WSEC 4C8OA 3OR2B 3QYYA 4K50A 1GX5A 3TVZA 4J37A 2X51A 3QWPA 5HP1B 3BO4A 4LF5F 1SH3A 6FD1A 4Q7AA 4QU6A 2ZD1A 3SSRA 3TA1A 5K5MA 1V3RA 3IS9B 2ZZNA 4MIAA 5KFYA 3MEEB 5IZHA 3CWJA 4DSIA 2HHTA 1HYSA 2UZAA 3N79A 1J5EF 1D9FA 3T5JA 2IHR1 3UR0A 2RNEA 1S49A 2LMIA 4LF4F 2P9EA 2QE5A 2KU7A 5LXRA 4C9DA 3SQGB 4ZA1A 4YDDB 4F02A 1IN0A 1B7FA 3JTOA 1TR0A 3OFEA 3E01A 4WK1A 1WHYA 2MMYA 1S79A 2FJXA 1JLEA 2SXLA 3OFFA 4DUZF 2ZBIA 1S6QA 3CCRS 2GO9A 1T8EA 1FDBA 4P7VA 4K4SA 2CQBA 2GHWA 2BJDA 3TVYA 2B4PA 2YWKA 4DFKA 2IRXA 5ITHA 3KK3B 2CPHA 3MUMP 1JLQA 2GJ2A 2HQ3A 3THVA 1CVJA 3KMQA 3CC4S 1R43A 2UVWA 4ED7A 2MKCA 4XPEA 4OHXA 3FNNA 3KLIB 3W2WB 4OHYA 3SXLA 1FXLA 4MMOA 5D4OA 2E66A 5HMZA 2N7YA 3G8SA 2XWXA 5B09A 2K8GA 3TUZC 4ZPWR 2GA7A 2VQFF 4B3SF 4JI7F 1XR7A 5AXMA 4HH0A 3F56A 2PT0A 1HWIA 2CQDA 2HHHF 4OJ1A 1SB6A 3NBPA 4K4TA 5C24B 3SDEA 4HKQA 3HZEA 2X3GA 5K8NA 4OZJA 1DQ8A 1KR4A 4QIFA 2K1RA 5IM0A 3C8YA 4O44B 4RUCA 2PMZD 4IO9Q 4JV2A 3ENQA 1VQKS 2GIQA 2YKAA 1WD6A 3D0GE 3FQLA 2QA1A 5IT9Y 2VFTA 4OZNA 3VQTA 3VZIA 1HQEB 3CJ3A 2BBEA 3HI9A 4Y2MA 1WEZA 2XSJB 2RF2B 4OJ3A 4AUKA 2ZHAA 1JWWA 2XI3A 3CUNA 1UWBB 1SJQA 3OXGA 5I3UA 5MLCV 4W92B 3GIKA 2UUTA 2Z2MA 2ZDOA 1AUDA 3I5CA 1FESA 4IH7A 1FNXH 3BGRB 5GMKa 3IWLA 4MKYA 4O4GB 3GR1A 5E2QA 5KFIA 2D9OA 3IG1A 1FTCA 2DNRA 2I5JA 1FDNA 4P2SA 5GAHU 2B7CB 4D3HA 3MR6A 5D78A 2I38A 4I6WA 1T3OA 5HLFA 2ATLA 3KYLA 4K4VA 4O3SA 2ASDA 4IO1A 1UVJA 3SCJE 2C3PA 3R27A 2MSTA 4Q0BA 3DI6B 3M30A 3LGMA 3H59A 3TUIC 3BO3A 2J7KA 5HBMA 4OI1A 2XNRA 1KN6A 1DLOA 1SKRA 3MCSA 2E1AA 3DYAB 1VFJA 1R0AA 3AB2B 2Q6CA 3DLGA 2P5VA 2HMIA 4NLSA 4PRFA 2HNDB 5KTQA 3MUTP 3I0SA 2R7RA 3UD3P 5HMWA 3PVXA 5DDPC 1SUQB 4TY9A 4C11A 1KQGB 3K59A 1YG0A 2U2FA 4ZCKA 4LFBF 1QUPA 2L08A 3ISZA 2N3OA 5DGBA 5AXNA 2X1GA 3IAS9 3OQ2A 4QPTA 1L3SA 4DR4F 2VFRA 2DO4A 2RQ4A 3I9V9 1BY9A 1YJWS 2MQQA 3SZ2A 3ISNC 2DIUA 2HFOA 3LP0B 4RBTA 3CSKA 4DV6F 3TQ1A 4WU3A 1MW7A 3NNCA 4F2SA 3U1NA 3CE8A 2OH2A 2KVIA 2JEFA 4IRCA 5D3GA 4KB7A 3N0VA 2CDQA 3SCLE 3FEYB 3IAM9 3Q8QB 3LP1B 2B0GA 5LJ5Y 1TKTA 1R8HA 3FJ2A 4K4WA 4DQRA 4RNHA 2YX1A 3DLKB 4YB6A 2DIVA 3HHLD 3BM7A 5DETA 2BACA 2B3TB 2EC0A 1KOHA 2B9YA 1RDRA 4NCGB 4CO0A 3KFWX 3BGLA 2IJFA 3M9MB 4DEZA 1C2PA 2GMJA 3TUJC 1U24A 2NYIA 5G0RB 2JSXA 3CDWA 4PG4A 1U1MA 4C98A 2K7KA 2BANA 3MM5A 1X9MA 1ZPVA 4UUXA 2L9NA 1MWZA 1RT7B 2G9OA 3KG1A 4RZRA 2E9RX 1WWHA 1ZZNA 1WG4A 3KHRA 5B0EA 1VHFA 1T03B 4JI4F 4LSLA 2ILZA 3VZHA 3OHAA 5LMUF 3K2YA 2FDNA 4QIGA 1Y4ZB 2OPPB 4USIA 4C8YA 3EZ5A 2MGZB 4CO1A 3KLHA 3U7JA 2EI5A 5HROB 5EWGA 4OZ1A 2FHKA 1S6PB 2YTCA 4CO5A 2PN6A 3IS9A 2JVRA 3MEDA 1Y5IB 3PW5A 4LUBA 1Q86T 4WZMA 4DV5F 2DCUB 4TNOA 3GIJA 1ELOA 3FCHA 3MM6A 3BSNA 1S7HA 2ZC4A 4OJHA 2LXUA 2V94A 5GAEI 2AWZA 4KIAA 5KFTA 4DR3F 2RE1A 3I5BA 3MPVA 4YP3A 1M5HA 2J9DE 3MFHA 2MZ1A 2CQ0A 1U2FA 4HVZA 3UE2A 1QAIA 3MMAB 4CH0S 4NZ0A 2LVWA 1U25A 1P8GA 2M5YA 1NAQA 3M2VA 3TI0A 4IOBA 5F8JA 2JC0A 1X8DA 4PXEA 3I6PA 3TX8A 4YDXA 3D0HE 5EX0A 4QWAA 1FRHA 2R7TA 2P6TA 3TANA 2XMUA 4F26A 1FRMA 4M5DB 5DJBA 4OX6A 2DR8A 5F8LA 3M8QB 4OI3A 2VFUA 3K8VA 3V4MA 4Q45A 1QAXA 2OD4A 5FD1A 1FERA 2O67A 2E1CA 1K0TA 3MEGB 1LK7A 4DPOA 3G6VA 1GH8A 2VD3A 1ZH5A 2ROEA 4H4KC 1X4GA 3HX9A 3CF5Q 3CJ4A 4NLVA 4URQU 4EBCA 1H3DA 2HWHA 4DSFA 2F8MA 4NXMF 4KAIA 1Z2LA 3QIDA 4RW8A 5SUHA 3K5PA 3MOJB 4X65F 4OL8A 3ZC4A 1IBKF 2FC8A 1S1VA 5CH7B 4IDKB 1J5OA 1HNXF 4ED5A 3P96A 5B08A 4O44A 5SZTA 4HH1A 2DGUA 1F5AA 1LFPA 2ZDPA 4URSA 2KH9A 1IQTA 3FZ2A 4DV1F 1ZM9A 1VQPS 1X9WA 4NLXA 1NJZA 1P6TA 1Y7PA 2D1CA 3I5AA 2MZQA 4N8OA 4RWXA 4PG8A 1WF0A 3LAKA 2KRRA 1LWFB 3TA2A 4MIBA 2RF2A 2F1FA 2HNZA 5I3QA 4NCAA 2DO0A 1W2BR 1UWBA 3LH2S 4ZCMA 3LALA 4BBYA 4F4ZA 5KFQA 4I64A 1EETB 2FHJA 2R4FA 2V4JA 1SJ1A 3OHBA 5F8GA 1UW4A 2JL9A 2OPQA 3D1HA 3FDSA 4IFYA 5BJRA 1R7IA 1V6HA 4X4RA 3IWNC 3PFOA 1YJRA 3QGPA 2CQ2A 2DT9A 2OMOA 3K7RA 3J81Y 4BWJA 4K4YA 4NOHA 5LSOA 1JKHB 4DFJA 4C97A 4A8FA 2LYVA 3MHYA 3OL7A 1OPZA 4ED3A 4I2QB 4JV1A 4ATNA 3EX7B 1K9MT 2EWHA 2V8VA 1N34F 2BM0A 4KFBA 5LSLA 3VAIA 2KJVA 2VV5A 2J0QD 1OPIA 5EGYA 4TY8A 1U48A 1FD8A 5K14B 2GX8A 4R0EA 4XAKA 4QPXA 1UETA 5F9NA 3V4IB 2RVJA 2C28A 3SFUA 4LF9F 3VAKA 2VG6A 3HVWA 3O6QA 4EO8A 3GFXA 3OVSA 3L7PA 1NK9A 1XR5A 2RDIA 4LVNP 1NJIT 2CJKA 1BD6A 2O1PA 4ZMMA 1MNEA 5BYRA 2N3LA 1SUQA 4WXWA 2IBOA 3DRXA 1C0UB 1OQ3A 4TXSA 4WYWA 2PI5A 1H6KX 1SXLA 1UFLA 2M4MA 4OI2A 5DRKA 2OSQA 3CDUA 3OVBA 1RT5B 3SV3A 2PGCA 5CZVA 3M2UB 2ZJQQ 1R27B 5IFMA 4DV2F 1RTJA 1V3ZA 3N4WA 3KLGA 3CC2S 4R25A 3CCLS 1S4FA 5A8KB 1TQLA 1QAYA 4DR1F 4MFBA 4USHA 4QBUA 2RIJA 4WE1B 3OR1A 2WOMB 1GT8A 5GADU 1HPZB 4ITSA 1XMOF 2N82B 1CLFA 4K5SA 3KK2B 1T02A 3DLEB 2YKNA 3M8PA 1ZBTA 5F8HA 1S9FA 5CCMA 1X4BA 3IO1A 1NJXA 4BDPA 3DLKA 2GC8A 1FRKA 1S9GB 2HVHA 4ETXA 2XLIA 2R7SA 3D54A 1I94F 1U1RA 3S01A 4IRKA 4LSNA 4Y00A 2LKZA 2Z8QA 2R2TA 1VQMS 2ADBA 5G0RA 4WFZA 5KG2A 4DLGA 4TYAA 2ZE2A 5HQ8A 4B3RF 1VRTA 3IR6B 2ZM6F 1DAXA 3OVAA 2AJ1A 4C4WA 4XPCA 2HGNA 1C1BB 1ZOTA 1REVA 1UMJA 4TQRA 2HS4A 3V81A 1NNDA 3R1LA 4ECRA 1VC0A 1H7WA 2E7XA 4EGLA 3KJVB 1GTEA 1T03A 4NLGA 2IJNA 1D9AA 1TKZB 2J8AA 1WF1A 1JXEA 5CYJA 4ELVA 5D4LA 2FJWA 4WFBQ 4DF4A 3H2VE 1S6PA 4FS1A 2XLJA 4ZVGA 1WG5A 4C8ZA 3CCZA 2UUAF 2PDAA 1MU2A 2CRLA 4X64F 1TFYA 2DH8A 4OLPA 1MMDA 2VBZA 2FY1A 2VOOA 5KT4A 3QGIA 4H4MA 4IH5A 2ZD1B 1F9FA 4P7TA 1CPZA 3DRPA 3IFEA 3OW2R 4PXDA 4WU2A 4LVOP 1HYSB 4IFVB 4NA3A 3O5TB 4LFAF 1ZM2A 5I3PA 3LW5C 4I7FA 5AE1A 4O3PA 3MM9A 2ZUGA 4Q5VA 2LQBA 4ZVEA 3VCDA 1UVNA 4NCBA 1VC5A 4F4KA 3E01B 5HL7Q 1APSA 3JSRA 4JI5F 2YKOA 1JLEB 2D3UA 3LF0A 1S6QB 4G1IA 2XC9A 1XEZA 1FHTA 2HZCA 4GC7A 4ZP8A 1JNZB 3I96A 3Q24A 3B8HA 1D0EA 2M88A 1E6YA 3ULHA 1JL