2C2KB

Crystal structures of caspase-3 in complex with aza-peptide michael acceptor inhibitors.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
103
structure length
103
Chain Sequence
ASGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CASPASE-3 SUBUNIT P17
publication title Design, Synthesis, and Evaluation of Aza-Peptide Michael Acceptors as Selective and Potent Inhibitors of Caspases-2, -3, -6, -7, -8, -9, and - 10.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 103
sequence length 103
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2005-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2c2kB00
2HBYB 2QL7B 1QTNB 2Y0BB 3D6HB 2Y1LB 1RWWB 1ICEB 3GJRB 1NMEB 5K20B 2P2CB 4DCOB 4ZVUB 2CJYB 5IC4B 2CJXB 3EDQB 1RHQB 1RWKB 2QL9B 1PYOB 1SC4B 2CNKB 3SIPB 2FQQB 4ZVQB 1RWPB 5IC6B 3IBCB 3KJFB 3P4UB 2DKOB 2H51B 4ZVPB 3R7SB 2QLBB 2H48B 3GJTB 1RWOB 4DCPB 3EDRB 2CDRB 1RWVB 4DCJB 2C2OB 2QL5B 1F9EB 1RHUB 2XZTB 1RHKB 3R6GB 4LSZB 2H54B 2C2KB 2H65B 1GFWB 1SC3B 2XZDB 3KJNB 3RJMB 3IBFB 1RHMB 3GJQB 2HBRB 3D6FB 2QLJB 1RWXB 1RWNB 1SC1B 1RHRB 2H5JB 2XYPB 1I51B 2C1EB 3P45B 3R6LB 4ZVRB 1I3OB 3NS7B 3R5JB 3QNWB 1BMQB 2H5IB 2QLFB 1QDUB 4ZVSB 2H4YB 2H4WB 3D6MB 1RWMB 3R7NB 2CNNB 4JB8B 3KJQB 2CNOB 2XYHB 1RE1B 4ZVTB 2C2MB 2C2ZB 4ZVOB 1PAUB 2XYGB 2HBQB 2CNLB 1RHJB 3GJSB 2HBZB 1IBCB 3R7BB
chains in the Genus database with same CATH superfamily
5HROA 4XK8C 4IRDA 4IFVA 2EK1A 2Q3PA 3KLIA 2P9EA 1PO6A 2QL9B 2Z8QA 1WACA 5H1SV 2BM1A 1GXLA 4DQSA 4P7TA 5HVGA 3NCPA 3VQSA 2JDJA 4K7QA 3FNNA 3R7SB 2AJ2A 4EZ6A 5K5MA 1DTQB 3D5MA 5CZVA 1HNZF 4FZVA 4RX6A 2XMUA 4ZPBA 2A6MA 4F3OA 4DJBA 4QW8A 3BGRB 2C3PA 2HURA 2RAQA 1KEKA 4NYPA 3O6QA 5D4PA 4E0DA 1RAGB 4X65J 3HDSA 5BXIA 3MEDB 1MWQA 4FS2A 3IGVA 4PABA 3ZNUA 1FJGJ 1VK8A 3JSMA 4DSJA 2PI5A 2E1AA 1N5SA 1HMVB 3ZZTA 4MYUA 3CCSS 3ZTRA 1JLFB 3SSQA 4ECYA 1R6VA 1E6YA 3TZXA 3G8TA 2FJWA 4FBTA 3DRPB 2IJRA 4ZLPA 1SXLA 2P2CB 2XMJA 2Y1RI 2YPYA 1S59A 4IRCA 2Y8WA 2UVVA 3EGZA 4DN0A 1VBKA 2RRBA 2BKPA 2V50A 3TA0A 3CD7A 2O01C 2ILZA 1YSJA 3BKFA 3TAQA 4ICLB 1CJVA 1X5SA 4Y3CA 3IG1A 5LL6d 3OJUA 4WK3A 2O1PA 1JWWA 2UP1A 1XMQJ 4K8RA 1VS3A 3PTWA 4Q43A 3J7ZT 4O3RA 4IQXA 5A76A 1S1VB 3EGVA 4NRTA 2VICA 2CQBA 4DFJA 5I3QA 4R5PA 4DR1F 2DYAA 4CO5A 2HFVA 5DDQC 3MPUB 4KFBB 3C6TA 2H9ZA 5G0RB 4FXDA 3N9UC 2PA3A 2JRSA 4ZP8A 2XMWA 2EI5A 3O5TB 5I3UB 4JP8A 4ZPCA 2XGPA 1I94J 2BJEA 4YN3B 2QZ8A 5A8RA 5K8PA 2VD3A 1Q1KA 2R7XA 4DZ6A 4DV4F 2NXJA 3C15A 1NUEA 4LF8J 4LF1A 1BHNA 4TXSA 1M1HA 1FO1A 1QAXA 2YNIB 5A0YB 5GAGI 1SV5A 3NWRA 1GX5A 4K5SA 1RACB 4EWTA 3JS9A 1CJTB 3HHEA 3L7OA 4GVBA 4PG6A 4JI0F 2K7JA 4QYZK 1BE4A 5F9LA 3TW0A 1RXOB 2DR7A 4PKDB 5DDRC 2Y0SD 3ET6B 4G65A 5E3RA 4J9NA 5E3CA 3ZZRA 3DXBA 1KBRA 1YQHA 2OP5A 3DRRB 4O3PA 1NZ8A 4OJ3A 2NPIA 4EFAC 4F2RA 1JLAB 1CBKA 4OHYA 5KFNA 1FWPA 2EC2A 2ROPA 1TFWA 5D78A 2QA1A 2YWGA 4ZCKA 2ZH1A 2FC9A 5F9NA 2MZSA 4KHPF 4DQQA 1TL3B 1O0PA 2EPIA 4WKRA 2LXIA 5DZ7A 3FBBA 3T1AA 1VOMA 2CRLA 1JLEA 4HHJA 3KLEA 5HJXA 2OPRA 3BQ1A 1AB8A 2XI2A 4CTAB 3W61A 1U6ZA 4X4OA 4DR3F 1CVJA 5C7PA 1XNRF 5K8MA 2A10A 1FX2A 1PSDA 3T5KA 2DR8A 4M5GA 3VGSA 1UWBB 4I7FA 3MEGA 3LWLA 2E1RA 1LWCB 5DQGA 2RRAA 5BJRA 4V19X 3T5HA 4DF4A 3SV3A 5ETPA 3D28A 2OAUA 2XC9A 1FRIA 2ZZTA 3HO1A 4QIWD 4ECVA 4OLOA 1F5AA 1RK8A 3H90A 3Q0AA 3ENQA 1VQ8S 4LQ3A 3NNCA 1H38A 4ED5A 1FXDA 3DLJA 4RW6B 3HVRA 2FVSA 2BR0A 7FDRA 3MM6B 2XYGB 1M5HA 3UVJA 1Y9OA 4TU8A 2OUGA 2UVWA 2HNDB 2C2EA 1LQ9A 5JUMA 4ZVFA 1SH0A 2CG4A 4KJIA 3UN5A 2QX0A 2CZ9A 1HBMA 3CIZA 2XQCA 2YNHB 1UZHA 3QBCA 1RT1B 2GAGC 2CIMA 2JEGA 1VQKS 5J2PA 2IRUA 2NQPA 1ZBTA 1UW4A 2U2FA 2BRLA 4DL4A 4ANCA 3KLFB 3DYAB 2YQ1A 2EBGA 1NJXA 4MFBA 4DLEA 4DSKA 3KG1A 4LMZA 2KVIA 4U67Q 3HKWA 2LECA 4MH8A 2IVFB 3CSKA 3LP2B 1RAIB 1R31A 5IFMA 2Z2MA 1WDTA 1H3DA 5J2QA 2H4YB 3PXGa 1UVLA 1TL7B 2QEXS 3K5LA 1KFSA 4WP3A 1NRKA 1Q4RA 2HPUA 2JC0A 1S1XA 2BQ3A 2L9NA 2OJ3A 3A3PB 3T5LA 3D9BA 4YR3A 3UO0A 4QZVB 1RT4A 3HHLB 4KKOA 3V6JA 2LA6A 3VZHA 2KL8A 2LP4A 4K59A 1DARA 2B9YA 3QGPA 3SV4A 4X4RA 5ETKA 1DFDA 4LRFA 4AL6A 3HD1A 2H51B 4W92B 1WOSA 1FKOA 2W4DA 4X4TA 4ZIWA 1AFJA 2R2TA 2N7YA 1RCOB 3CWJA 1RB0A 3M8SA 1HLWA 4RW8A 3AT1B 4DR2F 2D3O1 2DH8A 5A8KA 3CVKA 4KB7A 4EEYA 4FN5A 6AT1B 2YBVA 1CEZA 2QE5A 4RBVA 4BWMA 4DSIA 4X62J 3RG6A 3OVSA 2LMIA 2K8GA 2KYZA 1JLBB 1QAIA 3EM1A 2VONA 1SKSA 3NGSA 1F0XA 2H4WB 1U25A 4KHRA 3DOMA 4DV0F 1SQGA 3WIVA 2XYHB 3M2VA 1BD6A 1NHVA 4OHVA 1WHXA 1S6PB 4MJKA 1AZSA 2RSQA 2NZ4A 1IBCB 3R7BB 5DS7A 1WI6A 2HK3A 3CCMS 3OFFA 5CYQA 4ZA1A 3EX7B 3H42A 1EKRA 4LFCJ 1NSPA 3MWBA 2CQ0A 4A48A 1RWKB 2HHVA 4LT6A 2W01A 1TUGB 3HLUA 4QYZJ 3DGPB 3B54A 1Y00A 4DL3A 2MXYA 2CQHA 1HQEA 4H4OB 1UPMB 4F4KA 1YIJS 1KWMA 3AQOA 1IQZA 1H2TZ 3M6XA 3CDUA 4B02A 1DZ5A 3I31A 4X4UA 1DLOA 1TKXA 1EJ7L 5IZHA 2D3ZA 1MSWD 1UTAA 1WHVA 5DGBA 2W9CA 4FVCA 1U6FA 4K2JA 3H5SA 4FP9A 2B0GA 3QNWB 3VTIA 3KJVA 3TA2A 2VB6A 4IR9A 3SMZA 4Q8FA 3NGKA 2Z57B 2VV5A 1GMVA 5M2PA 4DSEA 1U26A 1DQ9A 2HEKA 2FPHX 3QIPB 1NK9A 1N56A 3EJMA 2HBYB 4UTGA 1UAWA 3QSIA 2WVEA 3PKMA 4R0EA 4G1IA 1Y7PA 1S1UA 3N5BA 3TA1A 1HKAA 1U1QA 3OUYA 3TWZA 2IFXA 1HBUA 1HR0J 1NO8A 4CLFA 4O4GA 1PJ7A 2HW3A 4C97A 4IKAA 2ZHAA 3L7UA 4O23A 3TR5A 1K0VA 4LFBJ 3OTOJ 3IAS9 5F8GA 1FK9A 3PYFA 2XY7A 3DNCA 2O3DA 3ZXWA 3WX4A 1F9HA 3KHGA 2B4PA 4DU7A 3IN5A 3CULA 4PQUB 2F9DA 2CVEA 1I51B 4PXBA 1VJQA 1MWZA 1RYSA 4JI3J 1U1LA 4J9RA 2GW8A 3M8PA 2OHDA 1DURA 3PV8A 3C46A 3OV7A 5CH7B 4DUZJ 1U49A 1QSLA 1HQUA 2ZVSA 1QE1B 1AROP 5KT3A 2WOMB 2UUCF 2RQ4A 4ITSA 1FJEB 1W7WA 2BOPA 1X9WA 3M2UB 4MK9A 4CO0A 4O0NA 4QW9A 3KLVA 1XJWB 2BACA 4EMDA 3P5TL 5GMKa 3PYDA 4EUVA 2HNYB 2RMLA 1FDDA 5L39A 3HD2A 5HN0A 1TKTA 2CQ2A 4M5LA 2CDRB 1RWVB 1M5SA 2I6WA 4CRJA 3F0NA 1VRUA 2HGNA 3EYZA 4GC6A 5HP1B 2XM3A 2IRXA 4WWSA 2CPYA 4X4QA 2ZDOA 2LVWA 3K59A 4HT5A 1G4CA 2OEMA 3D0HE 3EVOA 4PQAA 2I1RA 2EEYA 3DFEA 3ULHA 4USMA 3ADAC 2AEJA 2QG9B 3PHEA 4DPXA 4KHMA 1EQMA 2CWKA 4ED6A 3BO4A 2V2ZA 2FHJD 1T7PA 2YQ0A 3GFZA 4C98A 1XBWA 2W7OA 1NXIA 2L9WA 5AE1A 2DVIA 3RZAA 4JI4J 3J7Z5 4NLQA 1F1BB 5C25B 1MWYA 1YJNS 2EBEA 3H98A 1T02A 3D66A 4I4BA 2H5EA 1WEYA 3DOLA 2XLIA 2GVDB 3KFWX 5K8OA 3IBCB 1AXQA 4DQPA 1ULRA 1KHVA 3TEHB 1NBEB 2RB7A 3FBFA 2H48B 3EDRB 4TQSA 1PJ6A 5A6PA 4IOBA 3MEEB 3FFIA 2UUBJ 2BJ1A 3RB3A 4Q5VA 1N48A 1T03B 1Q8IA 3R2DJ 5HI7A 1NDCA 1QLNA 2BKOA 2OSQA 4YOEA 2E9RX 2PA8D 2PFFB 1PIEA 1MMDA 3D68A 3CJSA 4E98A 2C2MB 2K06A 4PCQA 4E2FB 4QWEA 3HVWA 1FF2A 2FVRA 1TL1A 2YKQA 4QU7A 2GIFA 5MLCV 4J9VA 1D9FA 3GR1A 3FVYA 4NMLA 3NKYA 2X1FA 4F36A 3DLHA 3F56A 1XWLA 4EBDA 4BWJA 2AGPA 4DG1A 1NPRA 2PEHA 1WF0A 1UJ5A 1S76D 4GKJJ 4RR5A 4P9SA 2HAFA 3VAJA 2V2QA 2ZJPQ 1VHFA 1IKVB 3LUYA 2JEFA 4OFZA 5E41A 3MPWA 4FF3A 1U1NA 2GJFA 1CULB 1WOPA 4DBQA 3IAM9 3HVTB 4C11A 2OPQA 3KLHA 5KFYA 1PC5A 3AJ2A 1OSCA 2IMWP 4ZKAA 4PZVA 2V6AA 1EB0A 2V8GA 3TUIC 4J9LA 1HNVB 2H5IB 2JZ5A 3OSNA 3D6MB 1C1CA 4JB8B 4F0KA 3T9ZA 1IR0A 1D3WA 4CWBA 1NCLA 1VGYA 4ZVOB 3M30A 4TKTA 3BREA 4UUXA 2DNHA 4OI2A 3ILLA 1DRZA 3UN3A 3M2RB 2BE2B 2Z30B 5KOWA 1I94F 4QR0A 2PEBA 3PR5B 4L75A 4DCOB 1GMWD 1E6VB 3M9MB 3CD6S 4WIIA 4WF9Q 1XC9A 4LF8F 3DOKB 4K4SA 1RWPB 1T3OA 3C6UB 2YKMA 2B8QA 2B6AB 1YX2A 2DGSA 2YTCA 2XHWA 3IM8A 4B9VA 1UVKA 3GG1A 3JAMU 2W2PP 1WJ9A 2FLNA 1Y0HA 1FCAA 3TNVA 2AW0A 2ZFHA 5IWAJ 1SPBP 2HHHJ 4QIFA 4F02A 3LPEA 2E7VA 2K1RA 2HQIA 1YJWS 4MAKA 5HO4A 4M63A 1N8RT 1P9QC 3M4XA 3OD2A 2CNOB 2G13A 4EO6A 2ZBCA 2DNYA 3FRZA 5DQHA 3OTDA 2B4OA 3K5MA 2HWIA 5DLGA 3MURP 4H4MB 1TU0B 1U1MA 3QFWA 3BH6B 5D3GA 4KGMA 4TLQA 3CE8A 4CM0A 1MU2A 3FQKA 3VCDA 3QWPA 3I4HX 2UVRA 3QPIA 3R1HA 4QWBA 2ABYA 3KJFB 2WAQD 2GVZA 2R8GA 3KHRA 5HBMB 2FLPA 4J9PA 2AV5A 1J5OB 3NP5A 3VGTA 1LW0A 1HHTP 1RISA 2ALYB 1IXKA 3J80U 1HIYA 4LSZB 1GK8A 2ZBQA 4F67A 3LAKA 3M1VA 3B8HA 3V4IB 4A47A 5KFMA 2VJUA 3CC7S 4USUA 2L3MA 3ISND 2DITA 2OTJS 2BQRA 1S1WB 1R8AA 1WSRA 3K58A 4RW9A 1FX4A 2GS8A 3Q2SC 4KGZB 2VG6B 2MMYA 4UZCA 1HWIA 3E2EA 4A8SA 4HHHA 1SI9A 4JI6F 3K5PA 7FD1A 2RRNA 2XHCA 1WG5A 2DRAA 4YY3J 1CJKA 4NLUA 5ETLA 1MNEA 2MDAA 4OJHA 2ZH8A 1M1GA 1MG7A 1RBOB 2CVIA 4IFYA 2AGQA 2EC0A 4DL6A 2W25A 1DY3A 1YWXA 2FHJA 2FVCA 3CJKA 4C8MA 5I42B 1NDLA 4G6VB 2UVUA 3E01A 1SL0A 2E29A 2AJFE 3RW6A 2BZ2A 3R6GB 2HS4A 2I5JB 4U7UD 3Q2TC 4C6AA 2W2QP 1KLNA 1RHRB 2J9DE 2X51A 4UQGA 1XR5A 3LQVA 1FNOA 1EX8A 2M52A 2E5IA 4HACB 4DS4A 2RJZA 1N34J 3VAMA 4G3IA 4NCGA 2ZOGA 3LP0A 2V34A 4JV5J 3AA8A 3GG0A 1LXJA 1T0TV 2BRKA 2HRTA 4LFAJ 4EI2A 4J9SA 2W2OP 1R0AA 3GJRB 1IBMF 4X4PA 1F5CA 1BQNA 2YPZA 1VC0A 2UUAJ 2I8EA 3FRYA 2Z0GA 4ECRA 4PG8A 2C3YA 1X5OA 1FDNA 1UA1A 1YVFA 3MECB 2DKOB 1MN9A 4ZPVR 1DTTB 3NOCA 4J5OA 4QIEA 4LJMA 2ATLA 3EPIA 4W90B 4USTA 3PEJA 4R8UA 1LEOA 3KUHA 2LQ5A 1RT2A 2AYMA 1C4AA 2CDQA 5CCLA 1CJUB 2YKNB 2ZEJA 2Z2YB 2B4VA 3DLEA 4DL0C 3D1HA 1NHUA 2FZKB 2K2PA 2HZVA 5LMNF 4DFMA 2P8IA 3W8PA 5LM7E 2MTLA 4AL7A 1PYTA 1WNEA 1LWFB 4NRUA 2ZH9A 5E33A 1GEHA 5EGYA 4PUOA 3BYRA 3I56S 1N36J 3HZGA 1PCAA 3OJSA 2DNPA 4RBTA 4LSLA 2WK4A 2CQ3A 4BDPA 2HQ3A 4LFCF 2ZH7A 3P4UB 1JX4A 5EWGA 3GLJA 2A6OA 1Y4ZB 3I6PA 3W1YC 4KGXB 1YJ9S 3SBMA 1IQTA 4DPUA 3B78A 1NKBA 4C8OA 4FYWB 6FDRA 3KLGA 2EKYA 5CHCB 4N77A 3VZIA 3MTJA 1K8AT 1FTRA 2W4CA 4B3TJ 2NSBA 2HLUA 1T95A 3I9V9 5KFOA 1FJ7A 1V6HA 2WW4A 1YJ7A 2BQUA 4IH6A 4P52A 3EWGA 4X4NA 1NSAA 3BV8A 1FFWB 2OTLS 4MIAA 2V68A 1T9UA 1NJWA 4HH1A 4FXWA 2RF2B 2CQPA 3C66A 4OZ1A 2V0NA 1VRTB 1KHWA 4IH5A 3AXMA 1EKSA 1UKUA 1T05B 2QO3A 3K8WA 3M8QA 4LF5F 5L1LA 4UY8T 5F3ZA 1XN9A 1VQLS 4JI7J 1LK5A 1S9EB 3C14B 3GV5B 5CYMA 1RAFB 2FQQB 4RNFA 4ZCIA 5J1EA 3C2PA 3S7RA 1REGX 2GC8A 2ZE2A 4AQYJ 1HR0F 4USVA 1U45A 3PDNA 3JB9k 2V63A 5F8MA 1LWEA 5KT4A 4LFBF 3D6FB 5DM6Q 2BJ8A 4MMOA 1ACMB 5A8WB 4DR4J 4ZOSA 1U0SA 4ZVSB 4LVOP 2ZUGA 5L9NA 3MM9B 4DQRA 1RYRA 5CAAA 2LU1A 2X1GA 4NYZA 1X7VA 4PEOA 4DUZF 1IBLF 4DR7J 2NCKL 3AJDA 3LP1A 2QFIA 4WP8A 4QIGA 2K3IA 4RL1A 1UCNA 4DZDA 3IO1A 3IRWP 2BJ3A 4OI0A 3GIIA 2OPPA 3DCAA 1XNQJ 4GKKJ 2BMBA 2WONA 5D0HA 5HJYA 4S0MA 4Q0BA 1RT3A 1S6UA 3ZNJ1 5CCMA 1SKUB 1JXVA 2IY5B 1NJIT 1JLQB 1UVIA 4DEZA 1K47A 4KV8B 1YJRA 3L4BC 1DQAA 5IT0A 4QOTA 2FB0A 1JIHA 2WBMA 3FK4A 2XS7A 2V8HA 3IP0A 3P6YC 2MQMA 2FGCA 1QDUB 4DLGA 4GRSA 1X4CA 4IG3B 1FT8A 4Y00A 2MQOA 4XPEA 2E7XA 2DNGA 1IN0A 5SUHA 1LXNA 3NMAA 2N82B 3TZYA 5HMYA 1HNZJ 1QTNB 1UL3A 2V69A 2VFTA 3M7VA 2KFNA 2R3VA 4JI4F 2HS0A 4XAKA 5HROB 1KP6A 2NSCA 3RR8A 1V3SA 2R7UA 3BKUA 3HJFA 2B43A 4J91A 2JL9A 5HL7Q 2DNNA 2W7AA 1RKJA 4L76A 3HT0A 3D2WA 2C42A 2Q1LA 2KM8C 2C2RA 4NE9C 1U8SA 2J6SA 3V4MA 3WHIA 2YWKA 2HNZB 1CS4A 5KG6A 2LU2A 3RBDA 4FNIA 5FD1A 1Q16B 1FE4A 2UUBF 3PW2A 2D3OR 3TQEA 3NGTA 1RT5B 3PRBA 4OI1A 3VWSA 1FNXH 3ZO7A 1Q8KA 3G2XA 2MPUA 3PJXA 2HSEB 1VC6A 3OL9A 4OZ0A 5KT7A 3F41A 4UOGA 2V2VA 3A8EA 1MMNA 3KK1A 3HSGA 4DL2A 2KU7A 1QSSA 4YB5A 1SUQA 5KAKA 4ZVGA 2R8JA 1XMOJ 1B0TA 1M0SA 4OJGA 3VGUA 2UUWA 1MROA 3FCWA 3DLKB 3IWXA 4EYIB 2RHQB 1Y3JA 2AEMA 3JTOA 5D4NA 2MKJA 2M8DB 1U2RA 2NS1B 4K4ZA 3EXCX 5IC6B 1CC8A 2LDIA 4KBIA 1U2FA 3CD0A 4GKJF 2WSEC 2Z2ZA 1SJ4P 2O5DA 3OXGA 4UF4A 4D3HA 2MY7A 2RS2A 5F41A 1MLAA 3IG1B 4ZIVA 4USWA 1DTQA 2E5LF 5HMXA 5B0BA 4JI1F 5DG8A 4AE5A 3DU5A 2W4PA 3BGRA 3C16B 2VODA 4NLTA 5L9XA 3BSAA 3I4PA 2NLWA 5KFQA 2DBBA 4K4WA 1ZM2A 4R5PB 3HHLD 4NLWA 2YNGA 1KKHA 5F8IA 3HFZB 2MQQA 3R5BA 1ZETA 3MEDA 1TP7A 2E5HA 1NJZA 4JI0J 4OI4A 2QL7B 3FCHA 3SDEA 2MQ8A 4FF2A 1HMVA 5E0OA 3Q22A 3BKTA 1B7FA 1JLFA 4XDCA 2MKCA 3UDVA 3C15B 3EE3A 4P71A 3DDNA 3DRPA 1M5PC 2UXCF 3AA9A 3GYGA 4CLTA 5D0GA 3MR3A 2CJBA 2ZJRQ 3WQPA 2HZCA 3R1LA 5KFLA 4WBFA 4GVBB 4DU8A 4K0KF 2M5YA 2RH3A 1W25A 4J7CA 4M5JA 1T94A 4ICLA 1VHIA 3KNGA 2CPEA 2RU9A 3PY8A 2XULA 1BC6A 1WDDA 2QTWA 4UW2A 5H9EK 2B51A 2FLOA 2EFNA 3RRHA 1SJ3P 4TNOA 2V4QA 7AT1B 1RLDA 1YZ7A 3Q8PB 5DQIA 4U96A 3QFHA 2BANA 2B4UA 2JC1A 4KGKA 5G0RA 1KRPA 4LF7J 2RDJA 4M95A 4KIAA 1T9WA 2FUG9 4HEA9 2OO4A 4USJC 5EWFA 4CT9A 4EO8A 2L08A 2OFHX 2BABA 3EGWB 3C3LA 5KT2A 2ZH6A 3HJVA 1H0HB 3NWGA 4NPOA 4W4MA 2VG5B 2YNIA 3MR2A 2J7WA 4KH0B 5A0YA 4ZP9A 2CADA 2NZCA 2IYGA 3L09A 1CJTA 2HVEA 4BCAA 3V2UC 5E2QA 4TYBA 2VKZG 1VQMS 2F8EX 2R7WA 3ET6A 5KFAA 4WZQA 2ZBPA 1D1UA 4PAAA 2KI2A 3R7NB 4YB6A 2F65A 2ZZNA 3MXHP 1UEVA 1SB6A 1JLAA 3UWTA 2M9KA 2QFJA 1NLKL 2QA2A 2KFYA 3FKBA 3AHPA 3SFUA 3RAXA 1NKCA 2RQMA 3UDCA 2B9WA 1RUSA 4C3MA 3OFEA 2GQ2A 2FTRA 3UW1A 4I67A 3MM7B 1OMSA 3GZ7A 5KOXA 4YY3F 3HHDA 1RCXB 1TTHB 2HVHA 1ZA1B 3MCSA 4IO1A 1NK5A 3I0RB 3M32B 4RUBA 4GO5X 1VQSA 1UA0A 3QZ8A 4P75A 1CC7A 1WHYA 4CTAA 3B4DA 3H2UB 1C0TA 2HFZA 3JSYA 4YEAA 2IVYA 1GFWB 2H3EB 3CT9A 3G6ES 4KTQA 2YXLA 1HBOB 4ILRA 5HQMA 1UWBA 3TAMB 1RLCL 1LWCA 1Q81T 4ZN1A 3US5A 3S1TA 4WIQA 3CCLS 2R7QA 3W3SA 3CCES 4LRCA 4C3LA 2WB4A 3UE2A 2XMKA 5L1JA 1N32F 1X4GA 3AOAA 2ACYA 5J2QB 4NZ7A 3I5AA 4ECSA 4R0JA 1X4DA 4TU7A 1N34F 4RW6A 4JV5F 2IVMA 2DXEA 3MM6A 4DR2J 4L72B 5B7WA 4LFAF 2HRUA 2PFDA 1L3SA 1R8CA 2HNDA 4ZMMA 3MMCB 2UUAF 4O3OA 3VHQA 1CQMA 2G2OA 2VHGA 2HWHA 2IM0A 2XMTA 1FE0A 4DV0J 5B08A 3EXYA 2YNHA 2UU9F 3I96A 2E1PA 1RT1A 3MAAA 4UY85 2CJAA 1P1TA 2XLKA 5T14A 3HSDA 4OV1A 2DNLA 1R89A 1X0PA 1VBYA 1BWEA 1SIWB 5ETTA 4DL7A 4ZPDA 2DR5A 4D3GA 1NM2A 3THVA 1NAQA 2ZKUA 5AE3A 3KLFA 3DYAA 1NPPA 2VOOA 2PE8A 3MUTP 1KR4A 1BGXT 1NEEA 5IV4A 2CQIA 2FJXA 3LP2A 2VBWA 1WOOA 3CO0P 2DB1A 4NYOA 1G1XA 1TL7A 4TVAB 2N4CA 2FJDB 3RGIA 2C22A 4I2QB 5ETOA 1IR2A 4B08A 2XWYA 4HL9A 2C3UA 1S4FA 2G0CA 2ZZMA 1UW9A 4TY8A 4FKXA 5CYQB 3PO4A 4CO3A 4I6YA 3HHLA 3PIOQ 1UVNA 2HQCA 2DRDA 5J2MB 4NMXA 4ZHRA 3UR3C 5KFUA 4DUYF 4L74A 3BB5A 4Y6IA 2EXUA 2ROGA 2FDNA 2M2BA 4WU3A 1JLCB 3W64A 4ILMA 3TOQA 1TKDA 3VVTA 4KO0B 3BM7A 1DLOB 3OFGA 5H9EJ 1FKPA 4NLVA 2C28A 4WJBA 2Z58B 1R8PA 4P73A 2FJVA 1VIOA 3CTRA 1VQ4S 3VR1A 4EYHB 3E8OA 1ZPWX 4WK1A 1K1QA 1XR6A 2AHOB 2N3OA 4PPDA 2BYCA 5J2NB 3NGUA 2UV8A 2BBEA 1SBRA 1JJ2R 4ED4A 4B3SJ 2E9TA 3GIRA 1PILA 5HAOA 4RNHA 1BQXA 3MUMP 2IM3A 1S6PA 1S0VA 5FIIA 1WTFA 3AOCA 2HGLA 4JI7F 3LA0A 2CAJA 1DJ0A 2ZKTA 3QWUA 3OHBA 1OWXA 3H5UA 3DGPA 3Q83A 2JSXA 3PKYA 4ED1A 4H4OA 2VFUA 3BDPA 2JVRA 2HBRB 2FVQA 2OEJA 2DK2A 1SJFA 2NYIA 5KFDA 2XNQA 3MOJB 4NZ0A 2R7SA 2HQDA 4YB7A 3EVWA 2UUCJ 3DLBA 5DRKA 1XIQA 1RDRA 3W7BA 3AJ1A 3RB6A 1S1TB 3D54A 5BYSA 3M8PB 5F0UA 2EVZA 2HLTA 3A4TA 4CNZA 3DDKA 3V6KA 4QU6A 1Y5NB 1BQMA 1HQUB 1UMJA 4O3NA 4PXDA 5KFIA 2DXDA 4AXIA 4Y2MA 2DHHA 3MR6A 3VAIA 3BH7B 2GGPA 3QIPA 4RBUA 2CQCA 3RRKA 2IM2A 4C8LA 4DR7F 1QM9A 2XGQA 4QWCA 3QT7A 1IWGA 1F9FA 3VALA 4WFYA 4PYAA 2N3LA 1V3ZA 3KWMA 1TZ0A 2YQ3A 3D6TB 1D8ZA 2AT1B 4WKYA 2DH7A 2BKNA 4NI2B 2AZ3A 3THPA 1VRUB 4Q45A 3KUEA 3OXLA 1CSJA 2DISA 2HVIA 5GAEU 5LOQA 3P45B 3A8JA 4N8OA 1P6TA 4Q2LA 2DH9A 4ANEA 4PQUA 1JJ4A 4UOFA 2CUYA 6FD1A 1HQ2A 3CF5Q 2W2NP 1HW8A 3MCNA 1ZTWA 4ZPTR 3Q89A 5IXUA 2RNEA 2IIHA 4CLLA 2FY1A 2V4JA 1REVB 1QE1A 3MF5A 4DOZA 2ATCB 1R7IA 2LQ8A 2MY8A 4F4XA 2WOMA 4C9DA 1RT7A 3WIUA 3ITHB 3DDIA 5KFWA 2FYXA 4I56A 3CMAS 1B70B 2ALZA 1WF2A 3M2UA 1QJHA 3M8RA 2VDHA 4ECUA 3BO2A 1S4EA 3CCZA 4HI1A 2J8SA 3M8YA 3H20A 1Y5IB 2VFVA 2BDPA 4DV2F 3TZWA 3K89A 4CLSA 4NLPA 1S6QA 2V5HG 1OIAA 3CW2C 3R6LB 3J80Y 5E3AA 4JI8J 3ZZPA 3I32A 2DY9A 4Z7YA 8RUCA 1WC5A 1TMJA 1S77D 2QT7A 4M5DB 4PRFA 1T9XA 1U09A 3Q8YA 3ILOA 3DLLQ 2XY6A 4JI5F 2COLA 2FLLA 4Y2AA 3S6EA 2VA3A 2QLXA 3DI6B 2DPIA 2VASA 2DNQA 3U27A 3QRRA 1TL4A 5IT4A 4FYXB 3CDAA 1YJUA 2GIRA 2YKOA 4OZJA 4MT1A 1XMOF 3TJ9A 1NJYA 5C25A 3TANA 2AJ1A 8ATCB 2KFZA 5L1KA 2C2OB 2BOAA 2XB2D 5GAHU 2GVDA 4CO1A 2B56A 4TQRA 4OZ3A 1XMBA 1YBUA 3W5XA 2G0IA 3IBFB 4OV6A 4WFZA 1H6KX 3AD8C 1J5EF 1VQNS 4I64A 3KKFA 4CLUA 1WTBA 4CH1A 4DV5F 3DM2B 4K50A 3MEEA 3MMAA 2CPHA 1IKYA 3FEZA 2BJ7A 2JH3A 5CXTA 4X64F 1T03A 3Q8UA 3R5CA 2VF3A 4LR8A 3CJRA 4ZN3A 2R7VA 3MCMA 5KG5A 3PO5A 3GFYA 3NLCA 2NXCA 3F73A 2KT3A 2MLZA 2ZJQQ 3EUNA 3ETOA 3CDWA 3GV8B 3K2YA 5IT9U 1RU1A 3JYTB 3TJAA 2O66A 1S0NA 2IC3B 4A8MP 1R8HA 5AE2A 1UFLA 1VI7A 2GHPA 3ISNC 4RUCA 4RW7B 2YKMB 3HMJG 3KHLA 2RKIB 2AGOA 2RUSA 2M8HA 4HHUA 4OI6A 2JNJA 2C2KB 3GYNA 4DXLA 1IKVA 4ES1A 2UXBJ 3UCUP 3SEOA 3OFHA 1H72C 4A8QA 4QWAA 3NGRA 2FGOA 3JTPA 1HD1A 3HVTA 4L6V3 4OI3A 2XSJA 3GU0A 3WBZA 2OKQA 1Q7LB 4IG0A 3TUPA 4YDDB 2D69A 1HNVA 3AH6A 3FSIA 2BXJA 4ETZA 3VAHA 1UJ6A 1OJ4A 3A1YG 1M5KC 1VBXA 5B0AA 1U1OA 3KK2A 3NCRA 3LANA 4P2MA 2GMLA 2LDYA 2CJYB 4LF7F 4OLPA 3KTQA 5L8RC 1FD8A 3CDBA 5EX3A 2RS8A 1MU2B 1IWAA 2F1FA 2W9AA 2HHWA 1EHWA 3DU6A 3GB0A 4J9UE 1FRMA 3M6UA 4JI6J 2RILA 3DOKA 3J81j 2CJQA 4LIWA 3C6UA 5GAHI 2B6AA 2VJVA 2XS5A 2RD5C 4IQMA 1RTHB 2YY3A 2F40A 1T9YA 3M6WA 1T3NA 2DJWA 3M6VA 5KFVA 1NPKA 3FDSA 1TR0A 3PEHA 4WCEQ 1RWMB 4OYBA 3RTVA 4NEYA 3FQLA 4OX9F 3PR4A 3HSJA 3T1HF 5FDLB 2J7KA 3TX0A 3U7JA 1KONA 1QUPA 1V5VA 1FRKA 1HI0P 5F8HA 2DEIA 2WRMA 1CJKB 1KLMB 4DV1F 4RUHA 2WSCC 3QIDA 1HYSB 3GR0A 3WZ0A 1S5ZA 3SCKE 2MQPA 4IR1A 4H4MA 3TZZA 2LEPA 3CJKB 3N28A 3JQJA 3DMJB 1HL6A 3M8ZA 2R2SA 3FEXB 4DR5F 4O44B 2V4RA 3KJNB 3DRSB 1B64A 3FZ2A 1J5OA 1C0UA 3SXLA 2I38A 1VDHA 1UWAA 2N7CA 2G1HA 4DX8H 5KG4A 4ZVRB 3LGNA 1R0CB 4NA1A 3V4IA 4KT0C 1IBMJ 4TYAA 1T11A 3TQ1A 2DHSA 4I69A 3BBBA 2E5JA 4MKAA 2MSSA 3HCXA 3N6LA 3G6XA 2IRYA 2G4BA 2VG6A 1X9SA 1WC4A 3OPKA 5DG7A 4IH7A 1G6BA 2YVSA 3LP0B 3NRBA 1ZH5A 1JB0C 1FRLA 4EZ9A 2DHGA 3BN7A 3LGMA 3CC4S 2DY1A 1WEZA 1YJVA 5L46A 1N0VC 1GT8A 2PMWA 2AKWB 1FDAA 3BDEA 1KSPA 5LXRA 1LW2B 4N47A 3G86A 2F4VF 4OZLA 2ZM6F 2ZNZA 3W66A 3H40A 3U1LA 5LJ5Y 5I42A 2J9EA 5LMNJ 3AD7C 1LK7A 1HHQA 3I0SB 4ALZA 2DIVA 1I5OB 3IR5B 1RT2B 3OR1B 2B8PA 3MMJA 5KFBA 2I5JA 3POTB 4ID5B 4F7VA 1TQLA 1TAUA 4E8UA 4YHHF 3QJPA 2GA7A 4CZCA 3UI3A 3IC1A 3HM9A 1J27A 1Q8BA 4HACA 1WELA 5KFJA 1EQ0A 2ZVIA 2GFFA 3UCZP 3CXCR 5JJBA 4F50A 3QATA 1CQNA 5KFEA 2SXLA 3GE9A 1HNIA 4LBHA 1GX6A 3BSNA 4KGVB 2ZD1A 2XI3A 3R3TA 1RQ0A 1G7CB 2XLJA 4WE1B 4LVNP 4DPTA 4NXMF 3KK3A 4H54A 3MECA 4DV3F 3G71S 1BWVA 1DTTA 3QAUA 3FUYA 1LWXA 4C3KA 2MKIA 2J76E 2H5JB 3I87A 1V9OA 1IVZA 3G9CA 4LF5J 4ETXA 4PWUA 1IM6A 1HA1A 3SI8A 3I5CA 4MIWA 2YKNA 4PWDB 4QPTA 3UPFA 2MJUA 5KFSA 2M3DA 3TEGA 2GJ2A 4DPWA 3D3CJ 3TUJC 2KJWA 5AJ3J 1TELA 2FY8A 3U1MA 1RE1B 4I6WA 5AXNA 3G8QA 3MGJA 2AEFA 2PT0A 4LRBA 1HWKA 2WVFA 2A2CA 2B3TB 2FJBB 4DMZA 5LXYA 3M9NB 3AXKA 4A46A 1PBAA 4HYKA 2KO1A 5DM7Q 2PI4A 1GAOA 3H2LA 3H5XA 3QZ7A 4B3SF 4AT1B 3LW5C 2G2YA 2ZOFA 2ZH2A 2AX1A 1Q8LA 3MR7A 3D67A 4HI2A 2GX8A 4DHVA 4C8KA 4URSA 1NH7A 3A3NB 5GADU 2HK2A 5J1EB 1FTCA 2MSTA 1JNZB 1EIYB 3PNIA 2HHTA 5CZXA 4NWBA 2KRBA 4CO4A 2W1BA 4HR2A 2XZDB 3LGHA 4XO0A 4A8YA 2J0WA 3R27A 3O2IA 2XBPA 1FRHA 4RU9A 2FVPA 4QYRA 2GO9A 2XYPB 1IBLJ 1RKIA 3NS7B 1G2EA 4ZJOA 4K4TA 2KZMA 1P1LA 1WHWA 2JVOA 2X1BA 4CLPA 3QQCD 3CCRS 4OYPA 2WTFA 2JWNA 5D0EA 3CO9A 4WZMA 4DFKA 2OI2A 1VRTA 1OY8A 3PG9A 1IJFB 3H25A 1OY6A 2LKZA 2BEFA 2CJXB 3W5ZA 4OMFG 3CCVS 4PG4A 2QGFB 3V81B 3BPDA 1WD6A 2EFGA 5C24A 4BC9A 1S9EA 3C14A 5F0WA 3CJ4A 1EAYC 3GONA 4MK7A 5LSOA 2V2KA 2UV8G 1AYEA 4RW4B 2XEXA 4ZJQA 2V67A 3HHKA 1RWNB 3MHYA 5RUBA 1TV6B 2W24A 3X3UA 2VBXA 4YQWA 1PJ5A 4JBCA 1VQOS 2FC8A 2WSFC 1JLGB 1X5TA 5A8WA 3FBCA 5M2UA 3TAPA 3BEGB 3CIMA 4ZVEA 1N5YA 1U48A 4KE5A 2YX7A 1L3KA 3DLGB 1JKHB 2QC3A 2DO0A 3MM9A 1U8WA 3SQGB 3FSXA 3CC2S 2RDIA 3PZPA 4U7UK 1WORA 5KFCA 2MHEA 4B3RJ 2KKHA 3PW5A 1R0BG 2VPZB 4NEZA 4OYZA 5IC4B 1YG0A 4WU2A 1DHMA 2CQDA 4KPYA 4EBEA 4YUDA 1HNWF 1U02A 2CJ9A 2KB2A 1FERA 3WX8A 4MKYA 4DN9A 3LH2S 1ZM4A 2IM1A 4I1TA 5KT5A 2R9LA 3KNAA 4DX6A 2V9WA 5B0DA 4YR2A 2AX0A 5GADI 1NZAA 1RHUB 3MCOA 1C1BB 1W2BR 4RWXA 4HVZA 1K1SA 5G4DA 1FWLA 4U8VA 5KFRA 4ED0A 4FDFA 1OYDA 1ROFA 1O51A 2KJVA 3HHLC 1JLQA 1I1GA 2BV3A 2XO7A 2KYXA 3CB4A 4LBIA 5D4OA 2Y1JA 4NZ6A 3Q86A 4KV8A 2OELA 2KZZA 2YWHA 4Q7AA 2IMOA 2PIIA 2FZCB 2LQBA 4JI8F 2FHKA 4DF8A 5C5JA 3ZZ0A 4IG3A 2NXEA 2QSFA 3W63A 4NXNJ 3BBFA 1Y5LB 3OVBA 5FJ4A 4B9TA 2E5LJ 2JFKA 1NSQA 4C2MA 2B5JB 1KOHA 1R8BA 1NKEA 2MYFA 4RO0A 4LQ9A 4JI1J 3DC2A 4LR7A 1U6BA 4KRWA 4B3MF 1FESA 1X5PA 3G82A 1K44A 2WB1D 4YMEA 4DCJB 3H0PA 5C2CA 3G6VA 2ZUAA 2FJAB 1RHKB 2H54B 3RB0A 5GAGU 4CP5A 1IKXB 4M8LA 1HD0A 1RTDA 4AYBD 1Q5VA 2E7WA 1VC5A 2GZOA 1TK0A 3GWCA 4ANDA 3D7SB 2KXFA 4UOCA 2HNZA 3MD1A 2AJ4A 3BYPA 4CH7A 1U0HB 5IM0B 3SFGA 2K3KA 2RU3A 3G87A 1RT5A 1FNMA 2UXCJ 3WC2A 4DS5A 2A18A 3CCWA 2B7BB 3KXDA 4HTJA 2YNGB 4UZBA 4X2BA 1VQ7S 2QN6B 5BYRA 1QY7A 4LRDA 3QGGA 4K0KJ 2GCFA 2DPJA 2PMHA 2EWHA 1GTEA 3SDEB 4FF4A 3J7A1 1S72S 3HK2A 1SL1A 3HFKA 3UR0A 1APSA 2IA0A 4J37A 2G9OA 3QMQA 5AXLA 5C42B 2RQCA 4N56A 3DLKA 3RUBL 3UNYA 1HNXF 4M94A 5IS2A 1X4BA 3O8WA 3OL7A 1KS2A 3GQCA 3MDFA 3IRXB 1R6YA 2W9BB 2HVZA 1FRXA 3GP9A 5CYJA 4AUKA 3QO9A 4QIVA 4LSNA 4WTOB 1RWXB 3NNHA 1OQ3A 4BC7A 2C1EB 2BJ9A 2Q43A 2GMJA 3AODA 2M70A 2UXBF 1S57A 5LJ3Y 2MZQA 3QLHA 5D77A 1XERA 2IAJB 3G8SA 5GVQA 3ILJA 4C7QA 3BSOA 3C16A 1YHQS 1GXUA 2I2YA 2JLGA 1VYAA 2BANB 1VQ9S 2WVCA 4A8KA 1NNDA 2DR6A 3CNQP 4P74A 3JSBA 1RU2A 4F3MA 1GTHA 1JJHA 2HVDA 4EU0A 4ED3A 4MYTA 4M5MA 1O5JA 1HFEL 5BYQA 4B3OB 2A2DA 3JXOA 2HHSA 3TO8A 4N76A 3P49B 1HBNB 4WXOA 5DLFA 2B9XA 5D4LA 1U1RA 1IUJA 1RAEB 2L48A 4ES2A 4GVLA 3FSYA 1SKWA 1ZYQA 1U1KA 3CJTA 4B9NA 3I55S 1HWLA 4QR1A 3FMWA 5ETSA 1HWUA 3NAIA 2VG7B 3UNGC 4ECWA 3RBEA 4XTTA 1U47A 2J5AA 1NDPA 5GMEA 2AD9A 4B9LA 2EFVA 1UP1A 4P6QA 4OYMA 2ZBIA 3MPVA 4A8WA 4N5SA 1DQ8A 2LXUA 3JQMA 4F25A 2ZHOA 2YNFB 1GNKA 4Q44A 1O6XA 3QT8A 1N54B 2VH7A 1X4EA 1KN6A 1RT6B 1RHQB 4ECQA 4CI0B 2MKHA 3OXFA 4QQBA 2OD6A 2WHOA 2KVQE 1Z1ZA 5HATA 5EDWA 1S9GA 2DHXA 3ZZZA 1N32J 4F4YA 2XNRA 5HMWA 1M5VC 1R27B 2A0FB 4ED7A 1ZAVA 1C0TB 1OYEA 1RTIB 1AUSL 1DBDA 3MM8B 4AD6A 5ETRA 2VG5A 4YS2A 4O3QA 3J81U 1D8YA 3AB2B 1UZDA 3NL0A 5KG7A 2MB0B 4WYLA 2IDLA 3MMBB 1XR7A 3OL8A 4ZPAA 5D6GA 2VBYA 4U95A 1V3RA 4F26A 2ZC3A 2QA4G 3ZZOA 4P72A 2DTJA 2HGMA 5KFHA 2F8HA 3W9IA 2AU0A 1VBZA 5ADZA 2EFPA 3GYXB 1NB2A 4OL8A 4RJVA 2JJ4D 1NK6A 3E51A 4G1QB 2UU9J 1PG5B 1NK4A 1HARA 1ZZNA 2ZWOA 1TVRB 2OMOA 2X3GA 5D15A 3QRPA 1MW7A 4K4XA 2F9JA 3W2WB 2DGWA 4PG7A 4NLDA 3M05A 1S79A 2MGZB 2OPSA 1H98A 3MM7A 4CQ1A 3NBPA 1K9MT 2QMXA 3QRQA 1U1PA 1SQFA 2ZH4A 1RTJB 3HI9A 3I0RA 3ISZA 3M32A 2MEWA 4C0HA 4JV2A 3MD3A 2OH2A 2YKPA 1HI1A 5KTQA 3AQPA 3MAAB 4DV7J 4J9OA 2P5VA 2QYGA 2V9KA 2Y3YA 1H7WA 2NPFA 1HBOA 4F4AA 4Y2IA 4CH0S 3KMSA 2XCPA 3KOAA 3TAMA 1KTQA 3K17A 1TFYA 1FXRA 4DPOA 2VQEJ 4DUYJ 4ECZA 4IDKB 2AMCB 1JJCB 1EP4B 5T7LA 4CT8A 2HBZB 3UD3P 1HPZB 1ZAWA 4WP9A 2AZ1A 3N79A 4OX6A 2MJNA 1FXLA 1IKWB 2LCWA 1N5QA 2GQQA 1F2GA 1TKZB 2JHEA 2EFOA 2VL1A 4M5IA 5HANA 2VIHA 3CJ5A 4F2SA 4CYUA 4TY8B 1PYOB 1GMWA 3GPAA 4NCAA 4BS2A 4NA2A 2P6SA 3LTOA 3ONQA 3BZQA 4ZHRB 2GV1A 1KDNA 4FYDA 2DCLA 1FEHA 4MKVA 2AP6A 1VR6A 3MMCA 4H4KC 3GILA 3BBCA 5EN1A 5K14B 1XQIA 4WFXA 2Y8YA 1VLYA 3VV2B 4ELUA 3N0VA 3CJ3A 4RPFA 5DG9A 4I2PB 3M9OB 1FKPB 1WKLA 1OPIA 5LMUF 4ATNA 1NK8A 1RAJA 2QA4S 1T9TA 4HLBA 1UFKA 3W2VA 3DXSX 2W7PA 2CPJA 2Q6BA 2D7SA 3OTBA 4ZCLA 4JYAJ 3OR2A 1PGZA 4DSLA 5AJ3F 3VQTA 2PSZA 3W65A 5ETQA 3RW7A 3MR5A 1RGVA 1Y11A 5HLFB 1L3UA 2R7OA 4I2QA 3NEKA 3SSSA 1HW9A 3T19A 3GCWP 2W2MP 1WG4A 3TARA 2OMLA 1VMBA 4P2SA 1FVSA 1ZZFA 3CEDA 1RZMA 1JQGA 4I6AA 2VKRA 5J2MA 2Z4PA 2B9EA 3DHWC 2VQFF 5D8HB 3H8YA 2HIQA 2E66A 4A4JA 3C8YA 4DL5A 4USHA 4XIUA 1JLCA 2AJQA 1CPZA 4YP3A 3RYLA 2OFGX 4KO0A 1S48A 4ED2A 3QJJA 3HKZD 3MI7X 1TMMA 2J6TA 5E3PA 1SVDA 2X3DA 4DQIA 4Y0FA 4AFFA 3M8WA 2O67A 2G0JA 4K4UA 1NK7A 1LFWA 4GMKA 4ELTA 2F3JA 3U02A 3N6NA 4JV0A 3X1LB 2VDIA 3HT3A 1FEEA 4Z37A 4DX7A 5BR8J 5J2NA 1PC4A 5B0EA 4ZLNA 5SZTA 1BQMB 3V5RA 3K7RA 1S10A 3V6DB 3IS9A 3W5YA 3D0IE 1A0OB 2GGPB 3SIPB 3LO3A 4F3QA 4URGA 1F6TA 2CFXA 3KDOA 5IT9Y 3PW4A 2WZ1A 1S99A 3H7HB 2MQNA 3GV7B 3N01A 4YDXA 2KH9A 3MM5B 3GIKA 1SC1B 1UJ4A 1EETB 5F8LA 2F4FA 2Z56B 5I4MA 1N6QA 2J9CA 3VF0B 2DIUA 2VU5A 3ZTSA 2QRRA 4M5HA 1BXNA 5DJBA 3D4JA 3TRGA 1JNRB 1N33J 2DNRA 2KRRA 2CPZA 2QSWA 4IFVB 2KG1A 4PPZA 3KLIB 2ASJA 4DPYA 1S1TA 3EZ5A 5B0GA 4DV2J 2C2NA 1VRQC 2YH1A 1YLXA 4CNYA 2ZWPA 5HQLA 3PJ9A 2IJFA 2DCUB 5MAOA 2V4JB 4TY9A 3N6MA 2BA9A 2VC1A 2BX6A 4B3RF 4FVMA 1RT7B 1GXTA 3THTA 3FCVA 4ZVPB 4ELVA 4PXEA 4LBPA 3Q8VA 2XWXA 3D1OA 1WC0A 2WBRA 4FF1A 1D9AA 4TN2A 4DV6F 3G6YA 4ZP7A 4LF4J 3TVZA 1IBKJ 4JI5J 2HFOA 4DR6J 1YZ6A 3H5YA 3JSMB 3AOBA 2G2ZA 2HMIA 1S6QB 4NI2A 3R5JB 4KYZA 4B9MA 2FHOB 4FXVA 2YWWA 4ZP6A 1E6YB 2MKSA 2L9DA 1R3NA 5HMZA 4TLRA 2EG1A 4Y65A 3PVXA 3K0JA 3K5NA 1N52B 3PFOA 3UFCX 1VFJA 1YRTA 5B0CA 4MKBA 5F8JA 2Y1LB 2MZRA 1S0OA 1J5EJ 1X4HA 3R97A 4XPCA 3IFEA 4NXNF 4CLWA 3R2CJ 2DGOA 1D9DA 4DV5J 3DN9A 4AXJA 3JQKA 2HRYA 1CJVB 3WDOA 1LOUA 3TJ8A 3PW0A 2QYCA 1REVA 2XSFA 3MFHA 3RBXA 5HQ8A 4X64J 5A6WA 4N41A 3VAKA 3HF5A 2J0SD 4O0IA 1TK5A 3ITHA 3EGNA 5DDOC 3SCJE 1M90T 4RZRA 2QMWA 4M1KA 1RHMB 1AT1B 1FFSB 1OO0B 2C3OA 3A3OB 5EHHA 4OYWA 1Q82T 4GC7A 2VA2A 3C6TB 1KQFB 2DT9A 5F3TA 3EZOA 4L3KA 1RA6A 2QJ3A 2CPFA 3MMAB 2Z2LA 1IKYB 3G96A 4JI2J 3PW7A 2LA4A 4KPCA 4C0OC 4F0MA 4U9RA 4BLGA 1PYSB 5A8RB 3LAMA 1LFPA 4M5DA 4LRAA 5CD4H 5EX0A 3IMQJ 2CJKA 1FFGB 2J7UA 5AXMA 2PD1A 4X65F 1SV5B 1FD2A 4Y2KA 5HVFA 1HWJA 1VQ5S 1T8EA 3L7PA 3DI6A 1FJGF 3HVAA 2CNKB 2KTQA 2M88A 4QWDA 1NSKL 1UPPA 1B4SA 2QLBB 2PN6A 2ASLA 4A8XA 5FLXU 2W8LA 4OQJA 1PAEX 2AYBA 4J90A 1S1VA 3IBWA 3UDEA 3OHAA 4X66J 3P3DA 1DAXA 3OL6A 3ZC4A 4KFBA 2F5GA 1BMQB 2M0GB 1QD1A 1X4AA 4NA3A 4RLEA 2XSJB 2OLWA 3DM2A 2DHAA 4J9QA 5I3UA 4IYQA 1JLEB 3R8YA 3P96A 4ES3A 3KLEB 4IG0B 4NLYA 4EGLA 4IO9Q 2D1CA 1XMQF 2CZVC 2OPRB 2XZWA 3PHTA 4ZLLA 1T9VA 2PC6A 1KQGB 4K4VA 2ASYA 1H7XA 2HIYA 3PM9A 3KK2B 1YKWA 3AY0A 4I7FB 3MEGB 1RWUA 5A2QU 2RDDA 2VFSA 2FIUA 3A13A 2MZTA 3EMTA 1IR1A 3MOZA 2DGVA 1FKAF 4P2XA 4OHWA 3JYTA 2IC3A 1XK8A 5AXKA 1EARA 5KFFA 3VAGA 3NMRA 4OX9J 1MN7A 3T1HJ 3H4DA 1AFIA 1WC1A 3DRRA 4RW7A 4ID8A 1WG1A 3EZUA 4DWIA 2RKIA 3OQ2A 1X60A 2N4DA 4DV1J 4A8FA 5AT1B 1OS5A 2J8AA 1I3OB 3SCIE 3ZTOA 1FHTA 3GCXP 4ZLJA 4N8NA 3R5DA 3HXMA 2QV6A 3UVJB 3T5JA 3CJ2A 4RNOA 4DI6A 4CCHA 1TL3A 3L9ZA 2DGTA 1VQ6S 4LF2A 4OHXA 2HFNA 2ADCA 4FNHA 4DR5J 1HBMB 5DO2A 3KMQA 1EZZB 3P5BP 4UQTA 4QPXA 3UD5A 2YX4A 4UT4A 2JLEA 5J2PB 3ZFVA 5J1NA 2LQ9A 1WC3A 3NY0A 4CO2A 4OX8A 3CJ0A 3IWLA 2WVBA 2EFQA 4MFBB 4FYVB 1N5VA 5U47A 3ILIA 1F9EB 2RHSB 4FYYB 2M7SA 2IBKA 1S6OA 2BJDA 2UXDJ 4C0BA 3I5BA 3TVYA 2DRBA 3OLAA 3PJWA 1C0UB 2ZH3A 3NNAA 2DXFA 1S1XB 1RTHA 2HZAA 3IWNC 2XTJP 4KR0B 4RU2A 1VLOA 1RT4B 2R7RA 3GFXA 9RUBA 4KKOB 2AWZA 3HPOA 2DNKA 2V94A 2YWEA 1VJWA 3CGIA 2F4VJ 2KXHA 2ZM6J 3GJSB 2KG0A 1LV5A 3RR7A 1ICEB 5FDLA 3DRYA 3IA0A 4CLYA 1ZAXA 4K4YA 4OYXA 2BUNA 1FDBA 5KG2A 3S01A 1FKOB 1FVQA 5KFPA 1KLMA 3L3CA 3C19A 1SC4B 4NLOA 3D1QA 1HYSA 3BPSP 4QR2A 4RW8B 3VAFA 4YHHJ 3AAWB 1ZM9A 5A8KB 4F0HA 3SZ2A 2LYVA 2UUTA 2AF6A 2H65B 1SQEA 4AL5A 5HVHA 2ZC4A 2P6TA 3DRXA 4USIA 2A1BA 1GH8A 3DMJA 4QJVA 3O44A 2EW9A 4WFNQ 1UFWA 3DOMB 4O44A 3DRSA 3BGLA 3M2VB 3PRDA 4DV7F 4NLGA 3LALA 4TU9A 4DFPA 2F7VA 4KQZA 1AZSB 1Z2LA 1VK3A 2DEJA 2KM8B 3NXZA 1Z2ZA 1XEZA 3PFEA 4Q2MA 2XMAA 3W8GA 4OYAA 2DGUA 3MUVP 2ACMA 4NXMJ 2VQEF 4U7CA 4EBCA 4ZPWR 2R4FA 4P10A 4DV3J 4ZVHA 1Y3KA 1CLFA 2KHCA 1HQEB 4O3SA 4KC5A 2VBZA 4QCLA 1HNIB 4EK2A 1Q86T 4I68A 2NXNA 1X9MA 3BQ0A 2VPYB 2R42A 2ZD1B 2F63A 1N0UA 1TKXB 2LLZA 2RIJA 1RWOB 4HTIA 2AQ4A 2ERRA 2HFSA 4WFBQ 2W9CB 3QYYA 2DD8S 2CXEA 5F8NA 2R7TA 2CKWA 4USKA 1LW2A 1L3VA 1NHKL 1U2CA 3KK3B 3MTKA 1P8GA 2NR0A 4X4VA 5E3QA 2QLJB 1JLBA 3KJVB 4U8YA 3Q8SB 3GMGA 3EPGA 1BY9A 3BGUA 1S12A 5HSPA 4NL5A 3EVMA 1JXEA 1BUXA 3HULA 3JSRA 3I0SA 4MTPA 1XTZA 3OR1A 2CNNB 3RAMA 3PCOB 2VOPA 3T1YJ 3POTA 4ID5A 3OSPA 1FRJA 1O8BA 4G1PA 1KVKA 1S1UB 5L38A 1ZPVA 4C8NA 3OUYB 1HBUB 4X62F 4J9MA 4O4GB 1NMEB 4JYAF 1YRUA 1X0FA 4B17A 5CABA 2FJEB 3IR7B 1WWHA 1X4FA 1FA0A 1P9YA 2KHDA 2DNOA 3QJLA 2BE9B 1FK9B 3CMQA 2E1MC 3U1NA 3SCLE 1Y10A 5KFGA 1WC6A 5LSRA 2CQ1A 1SH3A 4WPAA 2LEBA 4Z7CA 4NOHA 2NUUG 3PIPQ 4WE1A 2KXNB 1YBAA 1Q53A 3CPWR 2BM0A 4V1Ak 5KFXA 4C8YA 1NH8A 4PYDA 5KFTA 1F3VA 2HQFA 4HDHA 3HP6A 2VFRA 2XY5A 3P8BB 3NOGA 1D09B 2GJIA 5CD4A 3ENAA 4FS1A 4URQU 2CQGA 3KJQB 1N88A 3AB4B 4L3NA 1S49A 2IHR1 3W62A 1QSYA 3QT5A 2IPOB 4PWDA 1KOOA 3CUNA 2ZBRA 2EG2A 2XG8A 4NASA 2JOQA 4N7TA 1Q78A 1R43A 4CM2A 1TUVA 3LOUA 3OTCA 1F5BA 2IYIA 1F2HA 5BR8F 1TKTB 4LR9A 5CA5A 2B7CB 2QIFA 1V5IB 4LF6J 4LF9J 1QVGR 1B0VA 2CA9A 4XDDA 1UETA 4F4ZA 1N5TA 3LPYA 1FI4A 3GJTB 1YRXA 5C24B 1ZTTA 5H9FK 4BBYA 2HQGA 2ILYA 2KT5A 2JLFA 3Q8QB 4UOHA 2APOA 1SL2A 4DDFA 3K8VA 3W9JA 4FPIA 5HK4A 4OZNA 3QGHA 1UEKA 2WVDA 3ETMA 4K2XA 1KVIA 5IQ6A 3QAEA 1RAHB 3OTOF 4A8OA 1Q95G 3D3BJ 1HNWJ 5B0FA 3DKDA 4NLRA 1N5YB 2R8KA 2JFDA 1N33F 1NB7A 2R8HA 1ZS6A 2HS3A 2HHXA 3DOLB 3S8SA 4I0WA 2Y1IA 2MQLA 5THWA 4ZITA 5LSLA 1UEUA 4JI3F 1S97A 3W60A 3ZTPA 3CCTA 2YH0A 2HNYA 5ITHA 3FFIB 3MAQA 3QSYB 2VUGA 1B0PA 1HI8A 5HP1A 3V81A 2V8PA 5KFZA 2AIRB 2CQ4A 1SC3B 3CCUS 2HG4A 3GJQB 4ZJLA 5JXSA 3RRGA 3ZZUA 3LF0A 5EUHA 4O4RA 4LF4F 4RW4A 2RVJA 1IBKF 3MPYA 4DR6F 1YDLA 4DSFA 3H4BA 3BJYA 5KT6A 1TV6A 1TL1B 2LXFA 1JXLA 4DX5A 5ETMA 4B3MJ 1M1KT 2HWTA 1JLGA 2BVZA 4Q8EA 1ITPA 4M5KA 2CNLB 5KG0A 4DG1B 4PWWA 2BW2A 2HFUA 1SJ1A 2P9CA 3PACA 3DLGA 2D9OA 1JKHA 2HYIB 2JEIA 2RT3A 3SQGA 4IOAQ 3H2VE 4C11B 3BR9A 2V8DA 1VQYA 2OPQB 2MLYA 2X7IA 3KLHB 1D0EA 1Z4UA 1RA7A 3IGNA 1OPZA 1AW0A 2DO4A 5GAEI 2MZ1A 3G82B 2ZITA 2EK6A 2RE1A 2E9ZA 2DGXA 5I3PA 1N4LA 2CYYA 4ECXA 1C1CB 2QLWA 1RTDB 1C1BA 1F60B 1UVJA 3L95X 2KDOA 1SC6A 3BSCA 4RKUC 3BGOP 3Q23A 4RNNA 5K8NA 3M30B 3PYEA 2R2RA 3J81Y 5DETA 1S0MA 1BLUA 4CLKA 2HKEA 3KYLA 4JI2F 1GQEA 1HNXJ 3IR6B 4LUBA 4C4WA 5KFKA 4J9KA 4NX9A 2XCAA 1S7IA 4ILLA 1OY9A 3J7YU 3MZIA 5GMDA 5J1PA 2XS2A 2J0QD 1ZM3A 3W9HA 3RBZA 5LT5A 1CULA 1VISA 2B5JA 3OTEA 2GNKA 1SKRA 1B99A 4Z2XA 1URNA 1QUVA 2CG8A 1RSCA 1RTZA 1RABB 1IJEB 2P9GA 3GSIA 2I9SA 3I82A 3KG4A 1C2PA 2CZ4A 2K1RB 4WTYA 4DR1J 2E1CA 3QO9B 4LSNB 1IKXA 1PBUA 5IV3A 5DZ6A 1WKKA 5CQGA 2ASDA 1RBAA 4NCBA 4X66F 3R5GA 4H4KA 2CPIA 5T41A 3QLHB 2UZAA 3LWMA 3KG0A 2ZHBA 2OGUA 1M5OC 2VPXB 3BGFA 1U4BA 4DV4J 4ED8A 5D3GB 2HBQB 1U0HA 3D0GE 5IM0A 4NLSA 3M2RA 2BE2A 2ZH5A 4KAIA 3EICA 3HFVA 5K9FA 1Q79A 3ICLA 3PX4A 4OX7A 1E6VA 4P2FA 1AUDA 1KTVA 2ZDPA 2GVZB 2DR9A 3OVAA 1YGYA 1LW0B 3EDQB 2J9DA 4IUFA 5IQQA 5H9FJ 3A8IA 3NG8A 3T9NA 2XO6A 2HHUA 3M1VB 4HKQA 3J7AN 2LQJA 3PX6A 1GMUA 3VGVA 5DDPC 4YR0A 3CCQS 4IOCQ 2QL5B 5D0RA 1KQKA 3UDLA 3GFHA 5C42A 4CIOA 1TK8A 1WKJA 4RW9B 1URRA 3TI0A 3BF4A 2LEAA 3IRXA 2W9BA 3FGVA 3FJ2A 5C2GA 1SJQA 3IXQA 2BE7D 4F04B 2GAHC 2MLXA 4HDGA 4KHPJ 2RQKA 1YK9A 1Q5YA 1VIXA 4L73A 1KQSR 2IAJA 5IWAF 4IFYB 2OIHA 5E7OB 2HHHF 1S7HA 1YBTA 4DR3J 1XNRJ 1H2VZ 4X4SA 1I6JA 4U6PA 1X8DA 5B09A 3E3XA 5ETVA 3NAHA 3E01B 5HBMA 3RU0A 2L41A 3J7YI 5JVGQ 2CPDA 1WEXA 4HT7A 1SH2A 4F4WA 3HX9A 3RAQA 2ZNYA 1S9GB 2IDEA 1ZOTA 4B3OA 1Q7YT 2J0XA 3HZEA 2YX1A 1HBNA 3NGDA 1S1WA 2DNMA 3O1LA 1K73T 3T3FA 2UXDF 3T41A 3BN4A 2E5GA 3CMES 2Q79A 4NCGB 3ELHA 2PDAA 4PG5A 2IJNA 3OT9A 2Q6CA 4QBUA 4KY3A 3SSRA 2VG7A 4C8ZA 2EKNA 3DGVA 1KFDA 4F8RA 3I9ZA 1TUWA 2Q66A 1R0AB 2C2ZB 1PAUB 1BQNB 4V19J 2D74B 1YI2S 1S9FA 3MAHA 2K7KA 2XMMA 2MKYA 4JV1A 4Y28C 2GO8A 4YB1P 4OIXA 4ECTA 2OEKA 1TL5A 3O3LA 2YNFA 3HHNB 3FBEA 3H59A 3B6BA 4FKYA 3ZTQA 2Y9HA 2NUHA 3NS5A 4R8UB 2LFVA 1FJCA 2OPSB 2WW8A 2PGCA 3NBPB 1KVJA 1YTYA 3CJQA 3B82A 2VC0A 3GTYX 4DCPB 1RT6A 3R5AA 3JTNA 3ZZYA 3DLEB 3B4MA 2ZOMA 3TX8A 1JMTA 2QMUB 2KN4A 3OLBA 1P27B 1NDKA 4HH0A 1QVFR 4CDIA 4CLZA 3QT6A 4ZDNA 1WSVA 2HHQA 1RTIA 4B9UA 4OJ1A 3BS9A 3MM8A 3GIJA 4FBUA 2WCXA 2ROEA 1WF1A 2IA6A 3K5OA 2E44A 1PKUA 3MMBA 2GQCA 3TYTA 4ENOA 3BR8A 2JX2A 3MEKA 4ERDA 4PUOB 1B7YB 4WFAQ 1U7LA 3K57A 1F3FA 3RB4A 2GIQA 5T7LB 1RWWB 4LSLB 3PRVA 4OHZA 2HHPA 3ENWA 2VPWB 1RI7A 4FPRA 4ZVUB 4G1QA 1W26A 2MKKA 3TUZC 1SIZA 1TVRA 4MIBA 3W2WA 3KLGB 2NXUA 4CYUB 1SJRA 1WUUA 5LMUJ 2RUGA 2MGZA 5JMNA 4LIRA 3AD9C 1CJUA 2GHWA 5ETNA 1CG2A 1RADB 4JUZA 3RJMB 4PR6A 1B3TA 1RTJA 2FD2A 3AFGA 2YKAA 3WC0A 1RAAB 1NK0A 2PMZD 3F44A 2GMHA 2ADBA 4ZS6A 4BHQA 3NS6A 2MZJA 3M8QB 3A8KA 1AA1B 2NYHA 3QGIA 3UN2A 2X1AA 3W2VB 3SYZA 4KH1B 1SCJB 1LWFA 2IBOA 3T1YF 1J2VA 4P7VA 2W8KA 1Q0NA 2VQFJ 1H2UX 5CYMB 3BO3A 3OR2B 4IDKA 1VQPS 5K20B 1EP4A 1QAJA 2ZE2B 4YFUA 1C4CA 3T6JA 1JK9B 1HPZA 4PXCA 4ZK7M 3MFIA 2OD4A 3V6HA 4ZVQB 1X31C 3A12A 1IKWA 4ZCMA 5E5NA 1LWEB 1TKZA 3G4SS 3PX0A 4UUWA 2FHMA 2D9PA 1FWKA 4RNMA 1HHSA 4OYOA 4LREA 5JVHQ 1OQ6A 2M4MA 3N4WA 3PYGA 1IM4A 1TAQA 4RUAA 1N36F 3KUGA 1RAOA 2J6UA 1QTMA 5K14A 3ENVA 1H73A 2JEJA 2DNZA 3FZBA 2RF2A 1L3TA 3MPDA 4I2PA 2AYGA 1U24A 4RWWA 1T05A 2GHVC 4GO7X 2BW7A 3N5FA 1QAYA 1RHJB 3LP1B 1RBLA 1ZA2B 3UQSA 4B3TF 3OW2R 1LKZA 2Y0BB 3D6HB 1RJJA 3TP2A 3KHHA 2OPPB 2HAIA 5L1IA 2WONB 2DGQA 1RP5A 5KG3A 4Q0BB 1RT3B 3VVUA 4OYIA 3GIMA 3KDNA 3IS9B 3GSDA 2D3UA 4R25A 5HLFA 4K5RA 1UVMA 2VZ9A 1WI8A 4WXWA 2AJ0A 3DHXA 1L5UA 1W2IA 4LF6F 4LF9F 2C3MA 2POKA 4X84A 1G3OA 2KT2A 1YJTA 5IOLA 1A9NB 1YITS 2FZGB 5FLXY 3FEYB 4OZ2A 5M2RA 2V8VA 1KNZA 2NREA 2C2DA 1ELOA 4AQYF 2I0XA 1N6QB 3TVKA 8AT1B 4NLXA 1KD1T 4JOUA 3T6BA 2U1AA 3SQOP 4ZVTB 3CD5A 3BQ2A 5EWEA 4Y2CA 1H74A 4W98A 2A3JA 2CPXA 9ATCB 4DV6J 2D41A 4DR4F 3FMBA 2R2UA 4B9SA 3OBIA 2AYEA 2MHNA 4MK8A 3CCJS 3CDEA 4OZ5A 2R8IA 1NU4A 3CJ8A 4Y34A 3FC9A 4ER8A 3V6DA 2PO4A 1CS4B 4IRKA 1A7GE 5DGAA 3Q8RB 2XZTB 1KC8T 4WYWA 5A2QY 3NCQA 2H1YA 3IM9A 2CWXA 1A6LA 1OSDA 5KG1A 3Q24A 3UD4P 1MMLA 3MM5A 1XNQF 4GKKF 3KK1B 4M5NA 2QLFB 2OSRA 4KSEB 2HMIB 3R9LA 3UCGA 1K0TA 3HSZA 1EETA 1VCTA 1SUQB 1LNQA 2G1DA 3JAMY 2XMVA 2YWFA 4DUTA 1MROB 2F8MA 4C48A
chains in the Genus database with same CATH topology
2HBYB 2QL7B 1QTNB 2Y0BB 3D6HB 2Y1LB 1RWWB 1ICEB 3GJRB 1NMEB 5K20B 2P2CB 4DCOB 4ZVUB 2CJYB 5IC4B 2CJXB 3EDQB 1RHQB 1RWKB 2QL9B 1PYOB 1SC4B 2CNKB 3SIPB 2FQQB 4ZVQB 1RWPB 5IC6B 3IBCB 3KJFB 3P4UB 2DKOB 2H51B 4ZVPB 3R7SB 2QLBB 2H48B 3GJTB 1RWOB 4DCPB 3EDRB 2CDRB 1RWVB 4DCJB 2C2OB 2QL5B 1F9EB 1RHUB 2XZTB 1RHKB 3R6GB 4LSZB 2H54B 2C2KB 2H65B 1GFWB 1SC3B 2XZDB 3KJNB 3RJMB 3IBFB 1RHMB 3GJQB 2HBRB 3D6FB 2QLJB 1RWXB 1RWNB 1SC1B 1RHRB 2H5JB 2XYPB 1I51B 2C1EB 3P45B 3R6LB 4ZVRB 1I3OB 3NS7B 3R5JB 3QNWB 1BMQB 2H5IB 2QLFB 1QDUB 4ZVSB 2H4YB 2H4WB 3D6MB 1RWMB 3R7NB 2CNNB 4JB8B 3KJQB 2CNOB 2XYHB 1RE1B 4ZVTB 2C2MB 2C2ZB 4ZVOB 1PAUB 2XYGB 2HBQB 2CNLB 1RHJB 3GJSB 2HBZB 1IBCB 3R7BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HBY B;  2QL7 B;  1QTN B;  2Y0B B;  3D6H B;  2Y1L B;  1RWW B;  1ICE B;  3GJR B;  1NME B;  5K20 B;  2P2C B;  4DCO B;  4ZVU B;  2CJY B;  5IC4 B;  2CJX B;  3EDQ B;  1RHQ B;  1RWK B;  2QL9 B;  1PYO B;  1SC4 B;  2CNK B;  3SIP B;  2FQQ B;  4ZVQ B;  1RWP B;  5IC6 B;  3IBC B;  3KJF B;  3P4U B;  2DKO B;  2H51 B;  4ZVP B;  3R7S B;  2QLB B;  2H48 B;  3GJT B;  1RWO B;  4DCP B;  3EDR B;  2CDR B;  1RWV B;  4DCJ B;  2C2O B;  2QL5 B;  1F9E B;  1RHU B;  2XZT B;  1RHK B;  3R6G B;  4LSZ B;  2H54 B;  2C2K B;  2H65 B;  1GFW B;  1SC3 B;  2XZD B;  3KJN B;  3RJM B;  3IBF B;  1RHM B;  3GJQ B;  2HBR B;  3D6F B;  2QLJ B;  1RWX B;  1RWN B;  1SC1 B;  1RHR B;  2H5J B;  2XYP B;  1I51 B;  2C1E B;  3P45 B;  3R6L B;  4ZVR B;  1I3O B;  3NS7 B;  3R5J B;  3QNW B;  1BMQ B;  2H5I B;  2QLF B;  1QDU B;  4ZVS B;  2H4Y B;  2H4W B;  3D6M B;  1RWM B;  3R7N B;  2CNN B;  4JB8 B;  3KJQ B;  2CNO B;  2XYH B;  1RE1 B;  4ZVT B;  2C2M B;  2C2Z B;  4ZVO B;  1PAU B;  2XYG B;  2HBQ B;  2CNL B;  1RHJ B;  3GJS B;  2HBZ B;  1IBC B;  3R7B B; 
#chains in the Genus database with same CATH topology
 5HRO A;  4XK8 C;  4IRD A;  4IFV A;  2EK1 A;  2Q3P A;  3KLI A;  2P9E A;  1PO6 A;  2QL9 B;  2Z8Q A;  1WAC A;  5H1S V;  2BM1 A;  1GXL A;  4DQS A;  4P7T A;  5HVG A;  3NCP A;  3VQS A;  2JDJ A;  4K7Q A;  3FNN A;  3R7S B;  2AJ2 A;  4EZ6 A;  5K5M A;  1DTQ B;  3D5M A;  5CZV A;  1HNZ F;  4FZV A;  4RX6 A;  2XMU A;  4ZPB A;  2A6M A;  4F3O A;  4DJB A;  4QW8 A;  3BGR B;  2C3P A;  2HUR A;  2RAQ A;  1KEK A;  4NYP A;  3O6Q A;  5D4P A;  4E0D A;  1RAG B;  4X65 J;  3HDS A;  5BXI A;  3MED B;  1MWQ A;  4FS2 A;  3IGV A;  4PAB A;  3ZNU A;  1FJG J;  1VK8 A;  3JSM A;  4DSJ A;  2PI5 A;  2E1A A;  1N5S A;  1HMV B;  3ZZT A;  4MYU A;  3CCS S;  3ZTR A;  1JLF B;  3SSQ A;  4ECY A;  1R6V A;  1E6Y A;  3TZX A;  3G8T A;  2FJW A;  4FBT A;  3DRP B;  2IJR A;  4ZLP A;  1SXL A;  2P2C B;  2XMJ A;  2Y1R I;  2YPY A;  1S59 A;  4IRC A;  2Y8W A;  2UVV A;  3EGZ A;  4DN0 A;  1VBK A;  2RRB A;  2BKP A;  2V50 A;  3TA0 A;  3CD7 A;  2O01 C;  2ILZ A;  1YSJ A;  3BKF A;  3TAQ A;  4ICL B;  1CJV A;  1X5S A;  4Y3C A;  3IG1 A;  5LL6 d;  3OJU A;  4WK3 A;  2O1P A;  1JWW A;  2UP1 A;  1XMQ J;  4K8R A;  1VS3 A;  3PTW A;  4Q43 A;  3J7Z T;  4O3R A;  4IQX A;  5A76 A;  1S1V B;  3EGV A;  4NRT A;  2VIC A;  2CQB A;  4DFJ A;  5I3Q A;  4R5P A;  4DR1 F;  2DYA A;  4CO5 A;  2HFV A;  5DDQ C;  3MPU B;  4KFB B;  3C6T A;  2H9Z A;  5G0R B;  4FXD A;  3N9U C;  2PA3 A;  2JRS A;  4ZP8 A;  2XMW A;  2EI5 A;  3O5T B;  5I3U B;  4JP8 A;  4ZPC A;  2XGP A;  1I94 J;  2BJE A;  4YN3 B;  2QZ8 A;  5A8R A;  5K8P A;  2VD3 A;  1Q1K A;  2R7X A;  4DZ6 A;  4DV4 F;  2NXJ A;  3C15 A;  1NUE A;  4LF8 J;  4LF1 A;  1BHN A;  4TXS A;  1M1H A;  1FO1 A;  1QAX A;  2YNI B;  5A0Y B;  5GAG I;  1SV5 A;  3NWR A;  1GX5 A;  4K5S A;  1RAC B;  4EWT A;  3JS9 A;  1CJT B;  3HHE A;  3L7O A;  4GVB A;  4PG6 A;  4JI0 F;  2K7J A;  4QYZ K;  1BE4 A;  5F9L A;  3TW0 A;  1RXO B;  2DR7 A;  4PKD B;  5DDR C;  2Y0S D;  3ET6 B;  4G65 A;  5E3R A;  4J9N A;  5E3C A;  3ZZR A;  3DXB A;  1KBR A;  1YQH A;  2OP5 A;  3DRR B;  4O3P A;  1NZ8 A;  4OJ3 A;  2NPI A;  4EFA C;  4F2R A;  1JLA B;  1CBK A;  4OHY A;  5KFN A;  1FWP A;  2EC2 A;  2ROP A;  1TFW A;  5D78 A;  2QA1 A;  2YWG A;  4ZCK A;  2ZH1 A;  2FC9 A;  5F9N A;  2MZS A;  4KHP F;  4DQQ A;  1TL3 B;  1O0P A;  2EPI A;  4WKR A;  2LXI A;  5DZ7 A;  3FBB A;  3T1A A;  1VOM A;  2CRL A;  1JLE A;  4HHJ A;  3KLE A;  5HJX A;  2OPR A;  3BQ1 A;  1AB8 A;  2XI2 A;  4CTA B;  3W61 A;  1U6Z A;  4X4O A;  4DR3 F;  1CVJ A;  5C7P A;  1XNR F;  5K8M A;  2A10 A;  1FX2 A;  1PSD A;  3T5K A;  2DR8 A;  4M5G A;  3VGS A;  1UWB B;  4I7F A;  3MEG A;  3LWL A;  2E1R A;  1LWC B;  5DQG A;  2RRA A;  5BJR A;  4V19 X;  3T5H A;  4DF4 A;  3SV3 A;  5ETP A;  3D28 A;  2OAU A;  2XC9 A;  1FRI A;  2ZZT A;  3HO1 A;  4QIW D;  4ECV A;  4OLO A;  1F5A A;  1RK8 A;  3H90 A;  3Q0A A;  3ENQ A;  1VQ8 S;  4LQ3 A;  3NNC A;  1H38 A;  4ED5 A;  1FXD A;  3DLJ A;  4RW6 B;  3HVR A;  2FVS A;  2BR0 A;  7FDR A;  3MM6 B;  2XYG B;  1M5H A;  3UVJ A;  1Y9O A;  4TU8 A;  2OUG A;  2UVW A;  2HND B;  2C2E A;  1LQ9 A;  5JUM A;  4ZVF A;  1SH0 A;  2CG4 A;  4KJI A;  3UN5 A;  2QX0 A;  2CZ9 A;  1HBM A;  3CIZ A;  2XQC A;  2YNH B;  1UZH A;  3QBC A;  1RT1 B;  2GAG C;  2CIM A;  2JEG A;  1VQK S;  5J2P A;  2IRU A;  2NQP A;  1ZBT A;  1UW4 A;  2U2F A;  2BRL A;  4DL4 A;  4ANC A;  3KLF B;  3DYA B;  2YQ1 A;  2EBG A;  1NJX A;  4MFB A;  4DLE A;  4DSK A;  3KG1 A;  4LMZ A;  2KVI A;  4U67 Q;  3HKW A;  2LEC A;  4MH8 A;  2IVF B;  3CSK A;  3LP2 B;  1RAI B;  1R31 A;  5IFM A;  2Z2M A;  1WDT A;  1H3D A;  5J2Q A;  2H4Y B;  3PXG a;  1UVL A;  1TL7 B;  2QEX S;  3K5L A;  1KFS A;  4WP3 A;  1NRK A;  1Q4R A;  2HPU A;  2JC0 A;  1S1X A;  2BQ3 A;  2L9N A;  2OJ3 A;  3A3P B;  3T5L A;  3D9B A;  4YR3 A;  3UO0 A;  4QZV B;  1RT4 A;  3HHL B;  4KKO A;  3V6J A;  2LA6 A;  3VZH A;  2KL8 A;  2LP4 A;  4K59 A;  1DAR A;  2B9Y A;  3QGP A;  3SV4 A;  4X4R A;  5ETK A;  1DFD A;  4LRF A;  4AL6 A;  3HD1 A;  2H51 B;  4W92 B;  1WOS A;  1FKO A;  2W4D A;  4X4T A;  4ZIW A;  1AFJ A;  2R2T A;  2N7Y A;  1RCO B;  3CWJ A;  1RB0 A;  3M8S A;  1HLW A;  4RW8 A;  3AT1 B;  4DR2 F;  2D3O 1;  2DH8 A;  5A8K A;  3CVK A;  4KB7 A;  4EEY A;  4FN5 A;  6AT1 B;  2YBV A;  1CEZ A;  2QE5 A;  4RBV A;  4BWM A;  4DSI A;  4X62 J;  3RG6 A;  3OVS A;  2LMI A;  2K8G A;  2KYZ A;  1JLB B;  1QAI A;  3EM1 A;  2VON A;  1SKS A;  3NGS A;  1F0X A;  2H4W B;  1U25 A;  4KHR A;  3DOM A;  4DV0 F;  1SQG A;  3WIV A;  2XYH B;  3M2V A;  1BD6 A;  1NHV A;  4OHV A;  1WHX A;  1S6P B;  4MJK A;  1AZS A;  2RSQ A;  2NZ4 A;  1IBC B;  3R7B B;  5DS7 A;  1WI6 A;  2HK3 A;  3CCM S;  3OFF A;  5CYQ A;  4ZA1 A;  3EX7 B;  3H42 A;  1EKR A;  4LFC J;  1NSP A;  3MWB A;  2CQ0 A;  4A48 A;  1RWK B;  2HHV A;  4LT6 A;  2W01 A;  1TUG B;  3HLU A;  4QYZ J;  3DGP B;  3B54 A;  1Y00 A;  4DL3 A;  2MXY A;  2CQH A;  1HQE A;  4H4O B;  1UPM B;  4F4K A;  1YIJ S;  1KWM A;  3AQO A;  1IQZ A;  1H2T Z;  3M6X A;  3CDU A;  4B02 A;  1DZ5 A;  3I31 A;  4X4U A;  1DLO A;  1TKX A;  1EJ7 L;  5IZH A;  2D3Z A;  1MSW D;  1UTA A;  1WHV A;  5DGB A;  2W9C A;  4FVC A;  1U6F A;  4K2J A;  3H5S A;  4FP9 A;  2B0G A;  3QNW B;  3VTI A;  3KJV A;  3TA2 A;  2VB6 A;  4IR9 A;  3SMZ A;  4Q8F A;  3NGK A;  2Z57 B;  2VV5 A;  1GMV A;  5M2P A;  4DSE A;  1U26 A;  1DQ9 A;  2HEK A;  2FPH X;  3QIP B;  1NK9 A;  1N56 A;  3EJM A;  2HBY B;  4UTG A;  1UAW A;  3QSI A;  2WVE A;  3PKM A;  4R0E A;  4G1I A;  1Y7P A;  1S1U A;  3N5B A;  3TA1 A;  1HKA A;  1U1Q A;  3OUY A;  3TWZ A;  2IFX A;  1HBU A;  1HR0 J;  1NO8 A;  4CLF A;  4O4G A;  1PJ7 A;  2HW3 A;  4C97 A;  4IKA A;  2ZHA A;  3L7U A;  4O23 A;  3TR5 A;  1K0V A;  4LFB J;  3OTO J;  3IAS 9;  5F8G A;  1FK9 A;  3PYF A;  2XY7 A;  3DNC A;  2O3D A;  3ZXW A;  3WX4 A;  1F9H A;  3KHG A;  2B4P A;  4DU7 A;  3IN5 A;  3CUL A;  4PQU B;  2F9D A;  2CVE A;  1I51 B;  4PXB A;  1VJQ A;  1MWZ A;  1RYS A;  4JI3 J;  1U1L A;  4J9R A;  2GW8 A;  3M8P A;  2OHD A;  1DUR A;  3PV8 A;  3C46 A;  3OV7 A;  5CH7 B;  4DUZ J;  1U49 A;  1QSL A;  1HQU A;  2ZVS A;  1QE1 B;  1ARO P;  5KT3 A;  2WOM B;  2UUC F;  2RQ4 A;  4ITS A;  1FJE B;  1W7W A;  2BOP A;  1X9W A;  3M2U B;  4MK9 A;  4CO0 A;  4O0N A;  4QW9 A;  3KLV A;  1XJW B;  2BAC A;  4EMD A;  3P5T L;  5GMK a;  3PYD A;  4EUV A;  2HNY B;  2RML A;  1FDD A;  5L39 A;  3HD2 A;  5HN0 A;  1TKT A;  2CQ2 A;  4M5L A;  2CDR B;  1RWV B;  1M5S A;  2I6W A;  4CRJ A;  3F0N A;  1VRU A;  2HGN A;  3EYZ A;  4GC6 A;  5HP1 B;  2XM3 A;  2IRX A;  4WWS A;  2CPY A;  4X4Q A;  2ZDO A;  2LVW A;  3K59 A;  4HT5 A;  1G4C A;  2OEM A;  3D0H E;  3EVO A;  4PQA A;  2I1R A;  2EEY A;  3DFE A;  3ULH A;  4USM A;  3ADA C;  2AEJ A;  2QG9 B;  3PHE A;  4DPX A;  4KHM A;  1EQM A;  2CWK A;  4ED6 A;  3BO4 A;  2V2Z A;  2FHJ D;  1T7P A;  2YQ0 A;  3GFZ A;  4C98 A;  1XBW A;  2W7O A;  1NXI A;  2L9W A;  5AE1 A;  2DVI A;  3RZA A;  4JI4 J;  3J7Z 5;  4NLQ A;  1F1B B;  5C25 B;  1MWY A;  1YJN S;  2EBE A;  3H98 A;  1T02 A;  3D66 A;  4I4B A;  2H5E A;  1WEY A;  3DOL A;  2XLI A;  2GVD B;  3KFW X;  5K8O A;  3IBC B;  1AXQ A;  4DQP A;  1ULR A;  1KHV A;  3TEH B;  1NBE B;  2RB7 A;  3FBF A;  2H48 B;  3EDR B;  4TQS A;  1PJ6 A;  5A6P A;  4IOB A;  3MEE B;  3FFI A;  2UUB J;  2BJ1 A;  3RB3 A;  4Q5V A;  1N48 A;  1T03 B;  1Q8I A;  3R2D J;  5HI7 A;  1NDC A;  1QLN A;  2BKO A;  2OSQ A;  4YOE A;  2E9R X;  2PA8 D;  2PFF B;  1PIE A;  1MMD A;  3D68 A;  3CJS A;  4E98 A;  2C2M B;  2K06 A;  4PCQ A;  4E2F B;  4QWE A;  3HVW A;  1FF2 A;  2FVR A;  1TL1 A;  2YKQ A;  4QU7 A;  2GIF A;  5MLC V;  4J9V A;  1D9F A;  3GR1 A;  3FVY A;  4NML A;  3NKY A;  2X1F A;  4F36 A;  3DLH A;  3F56 A;  1XWL A;  4EBD A;  4BWJ A;  2AGP A;  4DG1 A;  1NPR A;  2PEH A;  1WF0 A;  1UJ5 A;  1S76 D;  4GKJ J;  4RR5 A;  4P9S A;  2HAF A;  3VAJ A;  2V2Q A;  2ZJP Q;  1VHF A;  1IKV B;  3LUY A;  2JEF A;  4OFZ A;  5E41 A;  3MPW A;  4FF3 A;  1U1N A;  2GJF A;  1CUL B;  1WOP A;  4DBQ A;  3IAM 9;  3HVT B;  4C11 A;  2OPQ A;  3KLH A;  5KFY A;  1PC5 A;  3AJ2 A;  1OSC A;  2IMW P;  4ZKA A;  4PZV A;  2V6A A;  1EB0 A;  2V8G A;  3TUI C;  4J9L A;  1HNV B;  2H5I B;  2JZ5 A;  3OSN A;  3D6M B;  1C1C A;  4JB8 B;  4F0K A;  3T9Z A;  1IR0 A;  1D3W A;  4CWB A;  1NCL A;  1VGY A;  4ZVO B;  3M30 A;  4TKT A;  3BRE A;  4UUX A;  2DNH A;  4OI2 A;  3ILL A;  1DRZ A;  3UN3 A;  3M2R B;  2BE2 B;  2Z30 B;  5KOW A;  1I94 F;  4QR0 A;  2PEB A;  3PR5 B;  4L75 A;  4DCO B;  1GMW D;  1E6V B;  3M9M B;  3CD6 S;  4WII A;  4WF9 Q;  1XC9 A;  4LF8 F;  3DOK B;  4K4S A;  1RWP B;  1T3O A;  3C6U B;  2YKM A;  2B8Q A;  2B6A B;  1YX2 A;  2DGS A;  2YTC A;  2XHW A;  3IM8 A;  4B9V A;  1UVK A;  3GG1 A;  3JAM U;  2W2P P;  1WJ9 A;  2FLN A;  1Y0H A;  1FCA A;  3TNV A;  2AW0 A;  2ZFH A;  5IWA J;  1SPB P;  2HHH J;  4QIF A;  4F02 A;  3LPE A;  2E7V A;  2K1R A;  2HQI A;  1YJW S;  4MAK A;  5HO4 A;  4M63 A;  1N8R T;  1P9Q C;  3M4X A;  3OD2 A;  2CNO B;  2G13 A;  4EO6 A;  2ZBC A;  2DNY A;  3FRZ A;  5DQH A;  3OTD A;  2B4O A;  3K5M A;  2HWI A;  5DLG A;  3MUR P;  4H4M B;  1TU0 B;  1U1M A;  3QFW A;  3BH6 B;  5D3G A;  4KGM A;  4TLQ A;  3CE8 A;  4CM0 A;  1MU2 A;  3FQK A;  3VCD A;  3QWP A;  3I4H X;  2UVR A;  3QPI A;  3R1H A;  4QWB A;  2ABY A;  3KJF B;  2WAQ D;  2GVZ A;  2R8G A;  3KHR A;  5HBM B;  2FLP A;  4J9P A;  2AV5 A;  1J5O B;  3NP5 A;  3VGT A;  1LW0 A;  1HHT P;  1RIS A;  2ALY B;  1IXK A;  3J80 U;  1HIY A;  4LSZ B;  1GK8 A;  2ZBQ A;  4F67 A;  3LAK A;  3M1V A;  3B8H A;  3V4I B;  4A47 A;  5KFM A;  2VJU A;  3CC7 S;  4USU A;  2L3M A;  3ISN D;  2DIT A;  2OTJ S;  2BQR A;  1S1W B;  1R8A A;  1WSR A;  3K58 A;  4RW9 A;  1FX4 A;  2GS8 A;  3Q2S C;  4KGZ B;  2VG6 B;  2MMY A;  4UZC A;  1HWI A;  3E2E A;  4A8S A;  4HHH A;  1SI9 A;  4JI6 F;  3K5P A;  7FD1 A;  2RRN A;  2XHC A;  1WG5 A;  2DRA A;  4YY3 J;  1CJK A;  4NLU A;  5ETL A;  1MNE A;  2MDA A;  4OJH A;  2ZH8 A;  1M1G A;  1MG7 A;  1RBO B;  2CVI A;  4IFY A;  2AGQ A;  2EC0 A;  4DL6 A;  2W25 A;  1DY3 A;  1YWX A;  2FHJ A;  2FVC A;  3CJK A;  4C8M A;  5I42 B;  1NDL A;  4G6V B;  2UVU A;  3E01 A;  1SL0 A;  2E29 A;  2AJF E;  3RW6 A;  2BZ2 A;  3R6G B;  2HS4 A;  2I5J B;  4U7U D;  3Q2T C;  4C6A A;  2W2Q P;  1KLN A;  1RHR B;  2J9D E;  2X51 A;  4UQG A;  1XR5 A;  3LQV A;  1FNO A;  1EX8 A;  2M52 A;  2E5I A;  4HAC B;  4DS4 A;  2RJZ A;  1N34 J;  3VAM A;  4G3I A;  4NCG A;  2ZOG A;  3LP0 A;  2V34 A;  4JV5 J;  3AA8 A;  3GG0 A;  1LXJ A;  1T0T V;  2BRK A;  2HRT A;  4LFA J;  4EI2 A;  4J9S A;  2W2O P;  1R0A A;  3GJR B;  1IBM F;  4X4P A;  1F5C A;  1BQN A;  2YPZ A;  1VC0 A;  2UUA J;  2I8E A;  3FRY A;  2Z0G A;  4ECR A;  4PG8 A;  2C3Y A;  1X5O A;  1FDN A;  1UA1 A;  1YVF A;  3MEC B;  2DKO B;  1MN9 A;  4ZPV R;  1DTT B;  3NOC A;  4J5O A;  4QIE A;  4LJM A;  2ATL A;  3EPI A;  4W90 B;  4UST A;  3PEJ A;  4R8U A;  1LEO A;  3KUH A;  2LQ5 A;  1RT2 A;  2AYM A;  1C4A A;  2CDQ A;  5CCL A;  1CJU B;  2YKN B;  2ZEJ A;  2Z2Y B;  2B4V A;  3DLE A;  4DL0 C;  3D1H A;  1NHU A;  2FZK B;  2K2P A;  2HZV A;  5LMN F;  4DFM A;  2P8I A;  3W8P A;  5LM7 E;  2MTL A;  4AL7 A;  1PYT A;  1WNE A;  1LWF B;  4NRU A;  2ZH9 A;  5E33 A;  1GEH A;  5EGY A;  4PUO A;  3BYR A;  3I56 S;  1N36 J;  3HZG A;  1PCA A;  3OJS A;  2DNP A;  4RBT A;  4LSL A;  2WK4 A;  2CQ3 A;  4BDP A;  2HQ3 A;  4LFC F;  2ZH7 A;  3P4U B;  1JX4 A;  5EWG A;  3GLJ A;  2A6O A;  1Y4Z B;  3I6P A;  3W1Y C;  4KGX B;  1YJ9 S;  3SBM A;  1IQT A;  4DPU A;  3B78 A;  1NKB A;  4C8O A;  4FYW B;  6FDR A;  3KLG A;  2EKY A;  5CHC B;  4N77 A;  3VZI A;  3MTJ A;  1K8A T;  1FTR A;  2W4C A;  4B3T J;  2NSB A;  2HLU A;  1T95 A;  3I9V 9;  5KFO A;  1FJ7 A;  1V6H A;  2WW4 A;  1YJ7 A;  2BQU A;  4IH6 A;  4P52 A;  3EWG A;  4X4N A;  1NSA A;  3BV8 A;  1FFW B;  2OTL S;  4MIA A;  2V68 A;  1T9U A;  1NJW A;  4HH1 A;  4FXW A;  2RF2 B;  2CQP A;  3C66 A;  4OZ1 A;  2V0N A;  1VRT B;  1KHW A;  4IH5 A;  3AXM A;  1EKS A;  1UKU A;  1T05 B;  2QO3 A;  3K8W A;  3M8Q A;  4LF5 F;  5L1L A;  4UY8 T;  5F3Z A;  1XN9 A;  1VQL S;  4JI7 J;  1LK5 A;  1S9E B;  3C14 B;  3GV5 B;  5CYM A;  1RAF B;  2FQQ B;  4RNF A;  4ZCI A;  5J1E A;  3C2P A;  3S7R A;  1REG X;  2GC8 A;  2ZE2 A;  4AQY J;  1HR0 F;  4USV A;  1U45 A;  3PDN A;  3JB9 k;  2V63 A;  5F8M A;  1LWE A;  5KT4 A;  4LFB F;  3D6F B;  5DM6 Q;  2BJ8 A;  4MMO A;  1ACM B;  5A8W B;  4DR4 J;  4ZOS A;  1U0S A;  4ZVS B;  4LVO P;  2ZUG A;  5L9N A;  3MM9 B;  4DQR A;  1RYR A;  5CAA A;  2LU1 A;  2X1G A;  4NYZ A;  1X7V A;  4PEO A;  4DUZ F;  1IBL F;  4DR7 J;  2NCK L;  3AJD A;  3LP1 A;  2QFI A;  4WP8 A;  4QIG A;  2K3I A;  4RL1 A;  1UCN A;  4DZD A;  3IO1 A;  3IRW P;  2BJ3 A;  4OI0 A;  3GII A;  2OPP A;  3DCA A;  1XNQ J;  4GKK J;  2BMB A;  2WON A;  5D0H A;  5HJY A;  4S0M A;  4Q0B A;  1RT3 A;  1S6U A;  3ZNJ 1;  5CCM A;  1SKU B;  1JXV A;  2IY5 B;  1NJI T;  1JLQ B;  1UVI A;  4DEZ A;  1K47 A;  4KV8 B;  1YJR A;  3L4B C;  1DQA A;  5IT0 A;  4QOT A;  2FB0 A;  1JIH A;  2WBM A;  3FK4 A;  2XS7 A;  2V8H A;  3IP0 A;  3P6Y C;  2MQM A;  2FGC A;  1QDU B;  4DLG A;  4GRS A;  1X4C A;  4IG3 B;  1FT8 A;  4Y00 A;  2MQO A;  4XPE A;  2E7X A;  2DNG A;  1IN0 A;  5SUH A;  1LXN A;  3NMA A;  2N82 B;  3TZY A;  5HMY A;  1HNZ J;  1QTN B;  1UL3 A;  2V69 A;  2VFT A;  3M7V A;  2KFN A;  2R3V A;  4JI4 F;  2HS0 A;  4XAK A;  5HRO B;  1KP6 A;  2NSC A;  3RR8 A;  1V3S A;  2R7U A;  3BKU A;  3HJF A;  2B43 A;  4J91 A;  2JL9 A;  5HL7 Q;  2DNN A;  2W7A A;  1RKJ A;  4L76 A;  3HT0 A;  3D2W A;  2C42 A;  2Q1L A;  2KM8 C;  2C2R A;  4NE9 C;  1U8S A;  2J6S A;  3V4M A;  3WHI A;  2YWK A;  2HNZ B;  1CS4 A;  5KG6 A;  2LU2 A;  3RBD A;  4FNI A;  5FD1 A;  1Q16 B;  1FE4 A;  2UUB F;  3PW2 A;  2D3O R;  3TQE A;  3NGT A;  1RT5 B;  3PRB A;  4OI1 A;  3VWS A;  1FNX H;  3ZO7 A;  1Q8K A;  3G2X A;  2MPU A;  3PJX A;  2HSE B;  1VC6 A;  3OL9 A;  4OZ0 A;  5KT7 A;  3F41 A;  4UOG A;  2V2V A;  3A8E A;  1MMN A;  3KK1 A;  3HSG A;  4DL2 A;  2KU7 A;  1QSS A;  4YB5 A;  1SUQ A;  5KAK A;  4ZVG A;  2R8J A;  1XMO J;  1B0T A;  1M0S A;  4OJG A;  3VGU A;  2UUW A;  1MRO A;  3FCW A;  3DLK B;  3IWX A;  4EYI B;  2RHQ B;  1Y3J A;  2AEM A;  3JTO A;  5D4N A;  2MKJ A;  2M8D B;  1U2R A;  2NS1 B;  4K4Z A;  3EXC X;  5IC6 B;  1CC8 A;  2LDI A;  4KBI A;  1U2F A;  3CD0 A;  4GKJ F;  2WSE C;  2Z2Z A;  1SJ4 P;  2O5D A;  3OXG A;  4UF4 A;  4D3H A;  2MY7 A;  2RS2 A;  5F41 A;  1MLA A;  3IG1 B;  4ZIV A;  4USW A;  1DTQ A;  2E5L F;  5HMX A;  5B0B A;  4JI1 F;  5DG8 A;  4AE5 A;  3DU5 A;  2W4P A;  3BGR A;  3C16 B;  2VOD A;  4NLT A;  5L9X A;  3BSA A;  3I4P A;  2NLW A;  5KFQ A;  2DBB A;  4K4W A;  1ZM2 A;  4R5P B;  3HHL D;  4NLW A;  2YNG A;  1KKH A;  5F8I A;  3HFZ B;  2MQQ A;  3R5B A;  1ZET A;  3MED A;  1TP7 A;  2E5H A;  1NJZ A;  4JI0 J;  4OI4 A;  2QL7 B;  3FCH A;  3SDE A;  2MQ8 A;  4FF2 A;  1HMV A;  5E0O A;  3Q22 A;  3BKT A;  1B7F A;  1JLF A;  4XDC A;  2MKC A;  3UDV A;  3C15 B;  3EE3 A;  4P71 A;  3DDN A;  3DRP A;  1M5P C;  2UXC F;  3AA9 A;  3GYG A;  4CLT A;  5D0G A;  3MR3 A;  2CJB A;  2ZJR Q;  3WQP A;  2HZC A;  3R1L A;  5KFL A;  4WBF A;  4GVB B;  4DU8 A;  4K0K F;  2M5Y A;  2RH3 A;  1W25 A;  4J7C A;  4M5J A;  1T94 A;  4ICL A;  1VHI A;  3KNG A;  2CPE A;  2RU9 A;  3PY8 A;  2XUL A;  1BC6 A;  1WDD A;  2QTW A;  4UW2 A;  5H9E K;  2B51 A;  2FLO A;  2EFN A;  3RRH A;  1SJ3 P;  4TNO A;  2V4Q A;  7AT1 B;  1RLD A;  1YZ7 A;  3Q8P B;  5DQI A;  4U96 A;  3QFH A;  2BAN A;  2B4U A;  2JC1 A;  4KGK A;  5G0R A;  1KRP A;  4LF7 J;  2RDJ A;  4M95 A;  4KIA A;  1T9W A;  2FUG 9;  4HEA 9;  2OO4 A;  4USJ C;  5EWF A;  4CT9 A;  4EO8 A;  2L08 A;  2OFH X;  2BAB A;  3EGW B;  3C3L A;  5KT2 A;  2ZH6 A;  3HJV A;  1H0H B;  3NWG A;  4NPO A;  4W4M A;  2VG5 B;  2YNI A;  3MR2 A;  2J7W A;  4KH0 B;  5A0Y A;  4ZP9 A;  2CAD A;  2NZC A;  2IYG A;  3L09 A;  1CJT A;  2HVE A;  4BCA A;  3V2U C;  5E2Q A;  4TYB A;  2VKZ G;  1VQM S;  2F8E X;  2R7W A;  3ET6 A;  5KFA A;  4WZQ A;  2ZBP A;  1D1U A;  4PAA A;  2KI2 A;  3R7N B;  4YB6 A;  2F65 A;  2ZZN A;  3MXH P;  1UEV A;  1SB6 A;  1JLA A;  3UWT A;  2M9K A;  2QFJ A;  1NLK L;  2QA2 A;  2KFY A;  3FKB A;  3AHP A;  3SFU A;  3RAX A;  1NKC A;  2RQM A;  3UDC A;  2B9W A;  1RUS A;  4C3M A;  3OFE A;  2GQ2 A;  2FTR A;  3UW1 A;  4I67 A;  3MM7 B;  1OMS A;  3GZ7 A;  5KOX A;  4YY3 F;  3HHD A;  1RCX B;  1TTH B;  2HVH A;  1ZA1 B;  3MCS A;  4IO1 A;  1NK5 A;  3I0R B;  3M32 B;  4RUB A;  4GO5 X;  1VQS A;  1UA0 A;  3QZ8 A;  4P75 A;  1CC7 A;  1WHY A;  4CTA A;  3B4D A;  3H2U B;  1C0T A;  2HFZ A;  3JSY A;  4YEA A;  2IVY A;  1GFW B;  2H3E B;  3CT9 A;  3G6E S;  4KTQ A;  2YXL A;  1HBO B;  4ILR A;  5HQM A;  1UWB A;  3TAM B;  1RLC L;  1LWC A;  1Q81 T;  4ZN1 A;  3US5 A;  3S1T A;  4WIQ A;  3CCL S;  2R7Q A;  3W3S A;  3CCE S;  4LRC A;  4C3L A;  2WB4 A;  3UE2 A;  2XMK A;  5L1J A;  1N32 F;  1X4G A;  3AOA A;  2ACY A;  5J2Q B;  4NZ7 A;  3I5A A;  4ECS A;  4R0J A;  1X4D A;  4TU7 A;  1N34 F;  4RW6 A;  4JV5 F;  2IVM A;  2DXE A;  3MM6 A;  4DR2 J;  4L72 B;  5B7W A;  4LFA F;  2HRU A;  2PFD A;  1L3S A;  1R8C A;  2HND A;  4ZMM A;  3MMC B;  2UUA F;  4O3O A;  3VHQ A;  1CQM A;  2G2O A;  2VHG A;  2HWH A;  2IM0 A;  2XMT A;  1FE0 A;  4DV0 J;  5B08 A;  3EXY A;  2YNH A;  2UU9 F;  3I96 A;  2E1P A;  1RT1 A;  3MAA A;  4UY8 5;  2CJA A;  1P1T A;  2XLK A;  5T14 A;  3HSD A;  4OV1 A;  2DNL A;  1R89 A;  1X0P A;  1VBY A;  1BWE A;  1SIW B;  5ETT A;  4DL7 A;  4ZPD A;  2DR5 A;  4D3G A;  1NM2 A;  3THV A;  1NAQ A;  2ZKU A;  5AE3 A;  3KLF A;  3DYA A;  1NPP A;  2VOO A;  2PE8 A;  3MUT P;  1KR4 A;  1BGX T;  1NEE A;  5IV4 A;  2CQI A;  2FJX A;  3LP2 A;  2VBW A;  1WOO A;  3CO0 P;  2DB1 A;  4NYO A;  1G1X A;  1TL7 A;  4TVA B;  2N4C A;  2FJD B;  3RGI A;  2C22 A;  4I2Q B;  5ETO A;  1IR2 A;  4B08 A;  2XWY A;  4HL9 A;  2C3U A;  1S4F A;  2G0C A;  2ZZM A;  1UW9 A;  4TY8 A;  4FKX A;  5CYQ B;  3PO4 A;  4CO3 A;  4I6Y A;  3HHL A;  3PIO Q;  1UVN A;  2HQC A;  2DRD A;  5J2M B;  4NMX A;  4ZHR A;  3UR3 C;  5KFU A;  4DUY F;  4L74 A;  3BB5 A;  4Y6I A;  2EXU A;  2ROG A;  2FDN A;  2M2B A;  4WU3 A;  1JLC B;  3W64 A;  4ILM A;  3TOQ A;  1TKD A;  3VVT A;  4KO0 B;  3BM7 A;  1DLO B;  3OFG A;  5H9E J;  1FKP A;  4NLV A;  2C28 A;  4WJB A;  2Z58 B;  1R8P A;  4P73 A;  2FJV A;  1VIO A;  3CTR A;  1VQ4 S;  3VR1 A;  4EYH B;  3E8O A;  1ZPW X;  4WK1 A;  1K1Q A;  1XR6 A;  2AHO B;  2N3O A;  4PPD A;  2BYC A;  5J2N B;  3NGU A;  2UV8 A;  2BBE A;  1SBR A;  1JJ2 R;  4ED4 A;  4B3S J;  2E9T A;  3GIR A;  1PIL A;  5HAO A;  4RNH A;  1BQX A;  3MUM P;  2IM3 A;  1S6P A;  1S0V A;  5FII A;  1WTF A;  3AOC A;  2HGL A;  4JI7 F;  3LA0 A;  2CAJ A;  1DJ0 A;  2ZKT A;  3QWU A;  3OHB A;  1OWX A;  3H5U A;  3DGP A;  3Q83 A;  2JSX A;  3PKY A;  4ED1 A;  4H4O A;  2VFU A;  3BDP A;  2JVR A;  2HBR B;  2FVQ A;  2OEJ A;  2DK2 A;  1SJF A;  2NYI A;  5KFD A;  2XNQ A;  3MOJ B;  4NZ0 A;  2R7S A;  2HQD A;  4YB7 A;  3EVW A;  2UUC J;  3DLB A;  5DRK A;  1XIQ A;  1RDR A;  3W7B A;  3AJ1 A;  3RB6 A;  1S1T B;  3D54 A;  5BYS A;  3M8P B;  5F0U A;  2EVZ A;  2HLT A;  3A4T A;  4CNZ A;  3DDK A;  3V6K A;  4QU6 A;  1Y5N B;  1BQM A;  1HQU B;  1UMJ A;  4O3N A;  4PXD A;  5KFI A;  2DXD A;  4AXI A;  4Y2M A;  2DHH A;  3MR6 A;  3VAI A;  3BH7 B;  2GGP A;  3QIP A;  4RBU A;  2CQC A;  3RRK A;  2IM2 A;  4C8L A;  4DR7 F;  1QM9 A;  2XGQ A;  4QWC A;  3QT7 A;  1IWG A;  1F9F A;  3VAL A;  4WFY A;  4PYA A;  2N3L A;  1V3Z A;  3KWM A;  1TZ0 A;  2YQ3 A;  3D6T B;  1D8Z A;  2AT1 B;  4WKY A;  2DH7 A;  2BKN A;  4NI2 B;  2AZ3 A;  3THP A;  1VRU B;  4Q45 A;  3KUE A;  3OXL A;  1CSJ A;  2DIS A;  2HVI A;  5GAE U;  5LOQ A;  3P45 B;  3A8J A;  4N8O A;  1P6T A;  4Q2L A;  2DH9 A;  4ANE A;  4PQU A;  1JJ4 A;  4UOF A;  2CUY A;  6FD1 A;  1HQ2 A;  3CF5 Q;  2W2N P;  1HW8 A;  3MCN A;  1ZTW A;  4ZPT R;  3Q89 A;  5IXU A;  2RNE A;  2IIH A;  4CLL A;  2FY1 A;  2V4J A;  1REV B;  1QE1 A;  3MF5 A;  4DOZ A;  2ATC B;  1R7I A;  2LQ8 A;  2MY8 A;  4F4X A;  2WOM A;  4C9D A;  1RT7 A;  3WIU A;  3ITH B;  3DDI A;  5KFW A;  2FYX A;  4I56 A;  3CMA S;  1B70 B;  2ALZ A;  1WF2 A;  3M2U A;  1QJH A;  3M8R A;  2VDH A;  4ECU A;  3BO2 A;  1S4E A;  3CCZ A;  4HI1 A;  2J8S A;  3M8Y A;  3H20 A;  1Y5I B;  2VFV A;  2BDP A;  4DV2 F;  3TZW A;  3K89 A;  4CLS A;  4NLP A;  1S6Q A;  2V5H G;  1OIA A;  3CW2 C;  3R6L B;  3J80 Y;  5E3A A;  4JI8 J;  3ZZP A;  3I32 A;  2DY9 A;  4Z7Y A;  8RUC A;  1WC5 A;  1TMJ A;  1S77 D;  2QT7 A;  4M5D B;  4PRF A;  1T9X A;  1U09 A;  3Q8Y A;  3ILO A;  3DLL Q;  2XY6 A;  4JI5 F;  2COL A;  2FLL A;  4Y2A A;  3S6E A;  2VA3 A;  2QLX A;  3DI6 B;  2DPI A;  2VAS A;  2DNQ A;  3U27 A;  3QRR A;  1TL4 A;  5IT4 A;  4FYX B;  3CDA A;  1YJU A;  2GIR A;  2YKO A;  4OZJ A;  4MT1 A;  1XMO F;  3TJ9 A;  1NJY A;  5C25 A;  3TAN A;  2AJ1 A;  8ATC B;  2KFZ A;  5L1K A;  2C2O B;  2BOA A;  2XB2 D;  5GAH U;  2GVD A;  4CO1 A;  2B56 A;  4TQR A;  4OZ3 A;  1XMB A;  1YBU A;  3W5X A;  2G0I A;  3IBF B;  4OV6 A;  4WFZ A;  1H6K X;  3AD8 C;  1J5E F;  1VQN S;  4I64 A;  3KKF A;  4CLU A;  1WTB A;  4CH1 A;  4DV5 F;  3DM2 B;  4K50 A;  3MEE A;  3MMA A;  2CPH A;  1IKY A;  3FEZ A;  2BJ7 A;  2JH3 A;  5CXT A;  4X64 F;  1T03 A;  3Q8U A;  3R5C A;  2VF3 A;  4LR8 A;  3CJR A;  4ZN3 A;  2R7V A;  3MCM A;  5KG5 A;  3PO5 A;  3GFY A;  3NLC A;  2NXC A;  3F73 A;  2KT3 A;  2MLZ A;  2ZJQ Q;  3EUN A;  3ETO A;  3CDW A;  3GV8 B;  3K2Y A;  5IT9 U;  1RU1 A;  3JYT B;  3TJA A;  2O66 A;  1S0N A;  2IC3 B;  4A8M P;  1R8H A;  5AE2 A;  1UFL A;  1VI7 A;  2GHP A;  3ISN C;  4RUC A;  4RW7 B;  2YKM B;  3HMJ G;  3KHL A;  2RKI B;  2AGO A;  2RUS A;  2M8H A;  4HHU A;  4OI6 A;  2JNJ A;  2C2K B;  3GYN A;  4DXL A;  1IKV A;  4ES1 A;  2UXB J;  3UCU P;  3SEO A;  3OFH A;  1H72 C;  4A8Q A;  4QWA A;  3NGR A;  2FGO A;  3JTP A;  1HD1 A;  3HVT A;  4L6V 3;  4OI3 A;  2XSJ A;  3GU0 A;  3WBZ A;  2OKQ A;  1Q7L B;  4IG0 A;  3TUP A;  4YDD B;  2D69 A;  1HNV A;  3AH6 A;  3FSI A;  2BXJ A;  4ETZ A;  3VAH A;  1UJ6 A;  1OJ4 A;  3A1Y G;  1M5K C;  1VBX A;  5B0A A;  1U1O A;  3KK2 A;  3NCR A;  3LAN A;  4P2M A;  2GML A;  2LDY A;  2CJY B;  4LF7 F;  4OLP A;  3KTQ A;  5L8R C;  1FD8 A;  3CDB A;  5EX3 A;  2RS8 A;  1MU2 B;  1IWA A;  2F1F A;  2W9A A;  2HHW A;  1EHW A;  3DU6 A;  3GB0 A;  4J9U E;  1FRM A;  3M6U A;  4JI6 J;  2RIL A;  3DOK A;  3J81 j;  2CJQ A;  4LIW A;  3C6U A;  5GAH I;  2B6A A;  2VJV A;  2XS5 A;  2RD5 C;  4IQM A;  1RTH B;  2YY3 A;  2F40 A;  1T9Y A;  3M6W A;  1T3N A;  2DJW A;  3M6V A;  5KFV A;  1NPK A;  3FDS A;  1TR0 A;  3PEH A;  4WCE Q;  1RWM B;  4OYB A;  3RTV A;  4NEY A;  3FQL A;  4OX9 F;  3PR4 A;  3HSJ A;  3T1H F;  5FDL B;  2J7K A;  3TX0 A;  3U7J A;  1KON A;  1QUP A;  1V5V A;  1FRK A;  1HI0 P;  5F8H A;  2DEI A;  2WRM A;  1CJK B;  1KLM B;  4DV1 F;  4RUH A;  2WSC C;  3QID A;  1HYS B;  3GR0 A;  3WZ0 A;  1S5Z A;  3SCK E;  2MQP A;  4IR1 A;  4H4M A;  3TZZ A;  2LEP A;  3CJK B;  3N28 A;  3JQJ A;  3DMJ B;  1HL6 A;  3M8Z A;  2R2S A;  3FEX B;  4DR5 F;  4O44 B;  2V4R A;  3KJN B;  3DRS B;  1B64 A;  3FZ2 A;  1J5O A;  1C0U A;  3SXL A;  2I38 A;  1VDH A;  1UWA A;  2N7C A;  2G1H A;  4DX8 H;  5KG4 A;  4ZVR B;  3LGN A;  1R0C B;  4NA1 A;  3V4I A;  4KT0 C;  1IBM J;  4TYA A;  1T11 A;  3TQ1 A;  2DHS A;  4I69 A;  3BBB A;  2E5J A;  4MKA A;  2MSS A;  3HCX A;  3N6L A;  3G6X A;  2IRY A;  2G4B A;  2VG6 A;  1X9S A;  1WC4 A;  3OPK A;  5DG7 A;  4IH7 A;  1G6B A;  2YVS A;  3LP0 B;  3NRB A;  1ZH5 A;  1JB0 C;  1FRL A;  4EZ9 A;  2DHG A;  3BN7 A;  3LGM A;  3CC4 S;  2DY1 A;  1WEZ A;  1YJV A;  5L46 A;  1N0V C;  1GT8 A;  2PMW A;  2AKW B;  1FDA A;  3BDE A;  1KSP A;  5LXR A;  1LW2 B;  4N47 A;  3G86 A;  2F4V F;  4OZL A;  2ZM6 F;  2ZNZ A;  3W66 A;  3H40 A;  3U1L A;  5LJ5 Y;  5I42 A;  2J9E A;  5LMN J;  3AD7 C;  1LK7 A;  1HHQ A;  3I0S B;  4ALZ A;  2DIV A;  1I5O B;  3IR5 B;  1RT2 B;  3OR1 B;  2B8P A;  3MMJ A;  5KFB A;  2I5J A;  3POT B;  4ID5 B;  4F7V A;  1TQL A;  1TAU A;  4E8U A;  4YHH F;  3QJP A;  2GA7 A;  4CZC A;  3UI3 A;  3IC1 A;  3HM9 A;  1J27 A;  1Q8B A;  4HAC A;  1WEL A;  5KFJ A;  1EQ0 A;  2ZVI A;  2GFF A;  3UCZ P;  3CXC R;  5JJB A;  4F50 A;  3QAT A;  1CQN A;  5KFE A;  2SXL A;  3GE9 A;  1HNI A;  4LBH A;  1GX6 A;  3BSN A;  4KGV B;  2ZD1 A;  2XI3 A;  3R3T A;  1RQ0 A;  1G7C B;  2XLJ A;  4WE1 B;  4LVN P;  4DPT A;  4NXM F;  3KK3 A;  4H54 A;  3MEC A;  4DV3 F;  3G71 S;  1BWV A;  1DTT A;  3QAU A;  3FUY A;  1LWX A;  4C3K A;  2MKI A;  2J76 E;  2H5J B;  3I87 A;  1V9O A;  1IVZ A;  3G9C A;  4LF5 J;  4ETX A;  4PWU A;  1IM6 A;  1HA1 A;  3SI8 A;  3I5C A;  4MIW A;  2YKN A;  4PWD B;  4QPT A;  3UPF A;  2MJU A;  5KFS A;  2M3D A;  3TEG A;  2GJ2 A;  4DPW A;  3D3C J;  3TUJ C;  2KJW A;  5AJ3 J;  1TEL A;  2FY8 A;  3U1M A;  1RE1 B;  4I6W A;  5AXN A;  3G8Q A;  3MGJ A;  2AEF A;  2PT0 A;  4LRB A;  1HWK A;  2WVF A;  2A2C A;  2B3T B;  2FJB B;  4DMZ A;  5LXY A;  3M9N B;  3AXK A;  4A46 A;  1PBA A;  4HYK A;  2KO1 A;  5DM7 Q;  2PI4 A;  1GAO A;  3H2L A;  3H5X A;  3QZ7 A;  4B3S F;  4AT1 B;  3LW5 C;  2G2Y A;  2ZOF A;  2ZH2 A;  2AX1 A;  1Q8L A;  3MR7 A;  3D67 A;  4HI2 A;  2GX8 A;  4DHV A;  4C8K A;  4URS A;  1NH7 A;  3A3N B;  5GAD U;  2HK2 A;  5J1E B;  1FTC A;  2MST A;  1JNZ B;  1EIY B;  3PNI A;  2HHT A;  5CZX A;  4NWB A;  2KRB A;  4CO4 A;  2W1B A;  4HR2 A;  2XZD B;  3LGH A;  4XO0 A;  4A8Y A;  2J0W A;  3R27 A;  3O2I A;  2XBP A;  1FRH A;  4RU9 A;  2FVP A;  4QYR A;  2GO9 A;  2XYP B;  1IBL J;  1RKI A;  3NS7 B;  1G2E A;  4ZJO A;  4K4T A;  2KZM A;  1P1L A;  1WHW A;  2JVO A;  2X1B A;  4CLP A;  3QQC D;  3CCR S;  4OYP A;  2WTF A;  2JWN A;  5D0E A;  3CO9 A;  4WZM A;  4DFK A;  2OI2 A;  1VRT A;  1OY8 A;  3PG9 A;  1IJF B;  3H25 A;  1OY6 A;  2LKZ A;  2BEF A;  2CJX B;  3W5Z A;  4OMF G;  3CCV S;  4PG4 A;  2QGF B;  3V81 B;  3BPD A;  1WD6 A;  2EFG A;  5C24 A;  4BC9 A;  1S9E A;  3C14 A;  5F0W A;  3CJ4 A;  1EAY C;  3GON A;  4MK7 A;  5LSO A;  2V2K A;  2UV8 G;  1AYE A;  4RW4 B;  2XEX A;  4ZJQ A;  2V67 A;  3HHK A;  1RWN B;  3MHY A;  5RUB A;  1TV6 B;  2W24 A;  3X3U A;  2VBX A;  4YQW A;  1PJ5 A;  4JBC A;  1VQO S;  2FC8 A;  2WSF C;  1JLG B;  1X5T A;  5A8W A;  3FBC A;  5M2U A;  3TAP A;  3BEG B;  3CIM A;  4ZVE A;  1N5Y A;  1U48 A;  4KE5 A;  2YX7 A;  1L3K A;  3DLG B;  1JKH B;  2QC3 A;  2DO0 A;  3MM9 A;  1U8W A;  3SQG B;  3FSX A;  3CC2 S;  2RDI A;  3PZP A;  4U7U K;  1WOR A;  5KFC A;  2MHE A;  4B3R J;  2KKH A;  3PW5 A;  1R0B G;  2VPZ B;  4NEZ A;  4OYZ A;  5IC4 B;  1YG0 A;  4WU2 A;  1DHM A;  2CQD A;  4KPY A;  4EBE A;  4YUD A;  1HNW F;  1U02 A;  2CJ9 A;  2KB2 A;  1FER A;  3WX8 A;  4MKY A;  4DN9 A;  3LH2 S;  1ZM4 A;  2IM1 A;  4I1T A;  5KT5 A;  2R9L A;  3KNA A;  4DX6 A;  2V9W A;  5B0D A;  4YR2 A;  2AX0 A;  5GAD I;  1NZA A;  1RHU B;  3MCO A;  1C1B B;  1W2B R;  4RWX A;  4HVZ A;  1K1S A;  5G4D A;  1FWL A;  4U8V A;  5KFR A;  4ED0 A;  4FDF A;  1OYD A;  1ROF A;  1O51 A;  2KJV A;  3HHL C;  1JLQ A;  1I1G A;  2BV3 A;  2XO7 A;  2KYX A;  3CB4 A;  4LBI A;  5D4O A;  2Y1J A;  4NZ6 A;  3Q86 A;  4KV8 A;  2OEL A;  2KZZ A;  2YWH A;  4Q7A A;  2IMO A;  2PII A;  2FZC B;  2LQB A;  4JI8 F;  2FHK A;  4DF8 A;  5C5J A;  3ZZ0 A;  4IG3 A;  2NXE A;  2QSF A;  3W63 A;  4NXN J;  3BBF A;  1Y5L B;  3OVB A;  5FJ4 A;  4B9T A;  2E5L J;  2JFK A;  1NSQ A;  4C2M A;  2B5J B;  1KOH A;  1R8B A;  1NKE A;  2MYF A;  4RO0 A;  4LQ9 A;  4JI1 J;  3DC2 A;  4LR7 A;  1U6B A;  4KRW A;  4B3M F;  1FES A;  1X5P A;  3G82 A;  1K44 A;  2WB1 D;  4YME A;  4DCJ B;  3H0P A;  5C2C A;  3G6V A;  2ZUA A;  2FJA B;  1RHK B;  2H54 B;  3RB0 A;  5GAG U;  4CP5 A;  1IKX B;  4M8L A;  1HD0 A;  1RTD A;  4AYB D;  1Q5V A;  2E7W A;  1VC5 A;  2GZO A;  1TK0 A;  3GWC A;  4AND A;  3D7S B;  2KXF A;  4UOC A;  2HNZ A;  3MD1 A;  2AJ4 A;  3BYP A;  4CH7 A;  1U0H B;  5IM0 B;  3SFG A;  2K3K A;  2RU3 A;  3G87 A;  1RT5 A;  1FNM A;  2UXC J;  3WC2 A;  4DS5 A;  2A18 A;  3CCW A;  2B7B B;  3KXD A;  4HTJ A;  2YNG B;  4UZB A;  4X2B A;  1VQ7 S;  2QN6 B;  5BYR A;  1QY7 A;  4LRD A;  3QGG A;  4K0K J;  2GCF A;  2DPJ A;  2PMH A;  2EWH A;  1GTE A;  3SDE B;  4FF4 A;  3J7A 1;  1S72 S;  3HK2 A;  1SL1 A;  3HFK A;  3UR0 A;  1APS A;  2IA0 A;  4J37 A;  2G9O A;  3QMQ A;  5AXL A;  5C42 B;  2RQC A;  4N56 A;  3DLK A;  3RUB L;  3UNY A;  1HNX F;  4M94 A;  5IS2 A;  1X4B A;  3O8W A;  3OL7 A;  1KS2 A;  3GQC A;  3MDF A;  3IRX B;  1R6Y A;  2W9B B;  2HVZ A;  1FRX A;  3GP9 A;  5CYJ A;  4AUK A;  3QO9 A;  4QIV A;  4LSN A;  4WTO B;  1RWX B;  3NNH A;  1OQ3 A;  4BC7 A;  2C1E B;  2BJ9 A;  2Q43 A;  2GMJ A;  3AOD A;  2M70 A;  2UXB F;  1S57 A;  5LJ3 Y;  2MZQ A;  3QLH A;  5D77 A;  1XER A;  2IAJ B;  3G8S A;  5GVQ A;  3ILJ A;  4C7Q A;  3BSO A;  3C16 A;  1YHQ S;  1GXU A;  2I2Y A;  2JLG A;  1VYA A;  2BAN B;  1VQ9 S;  2WVC A;  4A8K A;  1NND A;  2DR6 A;  3CNQ P;  4P74 A;  3JSB A;  1RU2 A;  4F3M A;  1GTH A;  1JJH A;  2HVD A;  4EU0 A;  4ED3 A;  4MYT A;  4M5M A;  1O5J A;  1HFE L;  5BYQ A;  4B3O B;  2A2D A;  3JXO A;  2HHS A;  3TO8 A;  4N76 A;  3P49 B;  1HBN B;  4WXO A;  5DLF A;  2B9X A;  5D4L A;  1U1R A;  1IUJ A;  1RAE B;  2L48 A;  4ES2 A;  4GVL A;  3FSY A;  1SKW A;  1ZYQ A;  1U1K A;  3CJT A;  4B9N A;  3I55 S;  1HWL A;  4QR1 A;  3FMW A;  5ETS A;  1HWU A;  3NAI A;  2VG7 B;  3UNG C;  4ECW A;  3RBE A;  4XTT A;  1U47 A;  2J5A A;  1NDP A;  5GME A;  2AD9 A;  4B9L A;  2EFV A;  1UP1 A;  4P6Q A;  4OYM A;  2ZBI A;  3MPV A;  4A8W A;  4N5S A;  1DQ8 A;  2LXU A;  3JQM A;  4F25 A;  2ZHO A;  2YNF B;  1GNK A;  4Q44 A;  1O6X A;  3QT8 A;  1N54 B;  2VH7 A;  1X4E A;  1KN6 A;  1RT6 B;  1RHQ B;  4ECQ A;  4CI0 B;  2MKH A;  3OXF A;  4QQB A;  2OD6 A;  2WHO A;  2KVQ E;  1Z1Z A;  5HAT A;  5EDW A;  1S9G A;  2DHX A;  3ZZZ A;  1N32 J;  4F4Y A;  2XNR A;  5HMW A;  1M5V C;  1R27 B;  2A0F B;  4ED7 A;  1ZAV A;  1C0T B;  1OYE A;  1RTI B;  1AUS L;  1DBD A;  3MM8 B;  4AD6 A;  5ETR A;  2VG5 A;  4YS2 A;  4O3Q A;  3J81 U;  1D8Y A;  3AB2 B;  1UZD A;  3NL0 A;  5KG7 A;  2MB0 B;  4WYL A;  2IDL A;  3MMB B;  1XR7 A;  3OL8 A;  4ZPA A;  5D6G A;  2VBY A;  4U95 A;  1V3R A;  4F26 A;  2ZC3 A;  2QA4 G;  3ZZO A;  4P72 A;  2DTJ A;  2HGM A;  5KFH A;  2F8H A;  3W9I A;  2AU0 A;  1VBZ A;  5ADZ A;  2EFP A;  3GYX B;  1NB2 A;  4OL8 A;  4RJV A;  2JJ4 D;  1NK6 A;  3E51 A;  4G1Q B;  2UU9 J;  1PG5 B;  1NK4 A;  1HAR A;  1ZZN A;  2ZWO A;  1TVR B;  2OMO A;  2X3G A;  5D15 A;  3QRP A;  1MW7 A;  4K4X A;  2F9J A;  3W2W B;  2DGW A;  4PG7 A;  4NLD A;  3M05 A;  1S79 A;  2MGZ B;  2OPS A;  1H98 A;  3MM7 A;  4CQ1 A;  3NBP A;  1K9M T;  2QMX A;  3QRQ A;  1U1P A;  1SQF A;  2ZH4 A;  1RTJ B;  3HI9 A;  3I0R A;  3ISZ A;  3M32 A;  2MEW A;  4C0H A;  4JV2 A;  3MD3 A;  2OH2 A;  2YKP A;  1HI1 A;  5KTQ A;  3AQP A;  3MAA B;  4DV7 J;  4J9O A;  2P5V A;  2QYG A;  2V9K A;  2Y3Y A;  1H7W A;  2NPF A;  1HBO A;  4F4A A;  4Y2I A;  4CH0 S;  3KMS A;  2XCP A;  3KOA A;  3TAM A;  1KTQ A;  3K17 A;  1TFY A;  1FXR A;  4DPO A;  2VQE J;  4DUY J;  4ECZ A;  4IDK B;  2AMC B;  1JJC B;  1EP4 B;  5T7L A;  4CT8 A;  2HBZ B;  3UD3 P;  1HPZ B;  1ZAW A;  4WP9 A;  2AZ1 A;  3N79 A;  4OX6 A;  2MJN A;  1FXL A;  1IKW B;  2LCW A;  1N5Q A;  2GQQ A;  1F2G A;  1TKZ B;  2JHE A;  2EFO A;  2VL1 A;  4M5I A;  5HAN A;  2VIH A;  3CJ5 A;  4F2S A;  4CYU A;  4TY8 B;  1PYO B;  1GMW A;  3GPA A;  4NCA A;  4BS2 A;  4NA2 A;  2P6S A;  3LTO A;  3ONQ A;  3BZQ A;  4ZHR B;  2GV1 A;  1KDN A;  4FYD A;  2DCL A;  1FEH A;  4MKV A;  2AP6 A;  1VR6 A;  3MMC A;  4H4K C;  3GIL A;  3BBC A;  5EN1 A;  5K14 B;  1XQI A;  4WFX A;  2Y8Y A;  1VLY A;  3VV2 B;  4ELU A;  3N0V A;  3CJ3 A;  4RPF A;  5DG9 A;  4I2P B;  3M9O B;  1FKP B;  1WKL A;  1OPI A;  5LMU F;  4ATN A;  1NK8 A;  1RAJ A;  2QA4 S;  1T9T A;  4HLB A;  1UFK A;  3W2V A;  3DXS X;  2W7P A;  2CPJ A;  2Q6B A;  2D7S A;  3OTB A;  4ZCL A;  4JYA J;  3OR2 A;  1PGZ A;  4DSL A;  5AJ3 F;  3VQT A;  2PSZ A;  3W65 A;  5ETQ A;  3RW7 A;  3MR5 A;  1RGV A;  1Y11 A;  5HLF B;  1L3U A;  2R7O A;  4I2Q A;  3NEK A;  3SSS A;  1HW9 A;  3T19 A;  3GCW P;  2W2M P;  1WG4 A;  3TAR A;  2OML A;  1VMB A;  4P2S A;  1FVS A;  1ZZF A;  3CED A;  1RZM A;  1JQG A;  4I6A A;  2VKR A;  5J2M A;  2Z4P A;  2B9E A;  3DHW C;  2VQF F;  5D8H B;  3H8Y A;  2HIQ A;  2E66 A;  4A4J A;  3C8Y A;  4DL5 A;  4USH A;  4XIU A;  1JLC A;  2AJQ A;  1CPZ A;  4YP3 A;  3RYL A;  2OFG X;  4KO0 A;  1S48 A;  4ED2 A;  3QJJ A;  3HKZ D;  3MI7 X;  1TMM A;  2J6T A;  5E3P A;  1SVD A;  2X3D A;  4DQI A;  4Y0F A;  4AFF A;  3M8W A;  2O67 A;  2G0J A;  4K4U A;  1NK7 A;  1LFW A;  4GMK A;  4ELT A;  2F3J A;  3U02 A;  3N6N A;  4JV0 A;  3X1L B;  2VDI A;  3HT3 A;  1FEE A;  4Z37 A;  4DX7 A;  5BR8 J;  5J2N A;  1PC4 A;  5B0E A;  4ZLN A;  5SZT A;  1BQM B;  3V5R A;  3K7R A;  1S10 A;  3V6D B;  3IS9 A;  3W5Y A;  3D0I E;  1A0O B;  2GGP B;  3SIP B;  3LO3 A;  4F3Q A;  4URG A;  1F6T A;  2CFX A;  3KDO A;  5IT9 Y;  3PW4 A;  2WZ1 A;  1S99 A;  3H7H B;  2MQN A;  3GV7 B;  3N01 A;  4YDX A;  2KH9 A;  3MM5 B;  3GIK A;  1SC1 B;  1UJ4 A;  1EET B;  5F8L A;  2F4F A;  2Z56 B;  5I4M A;  1N6Q A;  2J9C A;  3VF0 B;  2DIU A;  2VU5 A;  3ZTS A;  2QRR A;  4M5H A;  1BXN A;  5DJB A;  3D4J A;  3TRG A;  1JNR B;  1N33 J;  2DNR A;  2KRR A;  2CPZ A;  2QSW A;  4IFV B;  2KG1 A;  4PPZ A;  3KLI B;  2ASJ A;  4DPY A;  1S1T A;  3EZ5 A;  5B0G A;  4DV2 J;  2C2N A;  1VRQ C;  2YH1 A;  1YLX A;  4CNY A;  2ZWP A;  5HQL A;  3PJ9 A;  2IJF A;  2DCU B;  5MAO A;  2V4J B;  4TY9 A;  3N6M A;  2BA9 A;  2VC1 A;  2BX6 A;  4B3R F;  4FVM A;  1RT7 B;  1GXT A;  3THT A;  3FCV A;  4ZVP B;  4ELV A;  4PXE A;  4LBP A;  3Q8V A;  2XWX A;  3D1O A;  1WC0 A;  2WBR A;  4FF1 A;  1D9A A;  4TN2 A;  4DV6 F;  3G6Y A;  4ZP7 A;  4LF4 J;  3TVZ A;  1IBK J;  4JI5 J;  2HFO A;  4DR6 J;  1YZ6 A;  3H5Y A;  3JSM B;  3AOB A;  2G2Z A;  2HMI A;  1S6Q B;  4NI2 A;  3R5J B;  4KYZ A;  4B9M A;  2FHO B;  4FXV A;  2YWW A;  4ZP6 A;  1E6Y B;  2MKS A;  2L9D A;  1R3N A;  5HMZ A;  4TLR A;  2EG1 A;  4Y65 A;  3PVX A;  3K0J A;  3K5N A;  1N52 B;  3PFO A;  3UFC X;  1VFJ A;  1YRT A;  5B0C A;  4MKB A;  5F8J A;  2Y1L B;  2MZR A;  1S0O A;  1J5E J;  1X4H A;  3R97 A;  4XPC A;  3IFE A;  4NXN F;  4CLW A;  3R2C J;  2DGO A;  1D9D A;  4DV5 J;  3DN9 A;  4AXJ A;  3JQK A;  2HRY A;  1CJV B;  3WDO A;  1LOU A;  3TJ8 A;  3PW0 A;  2QYC A;  1REV A;  2XSF A;  3MFH A;  3RBX A;  5HQ8 A;  4X64 J;  5A6W A;  4N41 A;  3VAK A;  3HF5 A;  2J0S D;  4O0I A;  1TK5 A;  3ITH A;  3EGN A;  5DDO C;  3SCJ E;  1M90 T;  4RZR A;  2QMW A;  4M1K A;  1RHM B;  1AT1 B;  1FFS B;  1OO0 B;  2C3O A;  3A3O B;  5EHH A;  4OYW A;  1Q82 T;  4GC7 A;  2VA2 A;  3C6T B;  1KQF B;  2DT9 A;  5F3T A;  3EZO A;  4L3K A;  1RA6 A;  2QJ3 A;  2CPF A;  3MMA B;  2Z2L A;  1IKY B;  3G96 A;  4JI2 J;  3PW7 A;  2LA4 A;  4KPC A;  4C0O C;  4F0M A;  4U9R A;  4BLG A;  1PYS B;  5A8R B;  3LAM A;  1LFP A;  4M5D A;  4LRA A;  5CD4 H;  5EX0 A;  3IMQ J;  2CJK A;  1FFG B;  2J7U A;  5AXM A;  2PD1 A;  4X65 F;  1SV5 B;  1FD2 A;  4Y2K A;  5HVF A;  1HWJ A;  1VQ5 S;  1T8E A;  3L7P A;  3DI6 A;  1FJG F;  3HVA A;  2CNK B;  2KTQ A;  2M88 A;  4QWD A;  1NSK L;  1UPP A;  1B4S A;  2QLB B;  2PN6 A;  2ASL A;  4A8X A;  5FLX U;  2W8L A;  4OQJ A;  1PAE X;  2AYB A;  4J90 A;  1S1V A;  3IBW A;  3UDE A;  3OHA A;  4X66 J;  3P3D A;  1DAX A;  3OL6 A;  3ZC4 A;  4KFB A;  2F5G A;  1BMQ B;  2M0G B;  1QD1 A;  1X4A A;  4NA3 A;  4RLE A;  2XSJ B;  2OLW A;  3DM2 A;  2DHA A;  4J9Q A;  5I3U A;  4IYQ A;  1JLE B;  3R8Y A;  3P96 A;  4ES3 A;  3KLE B;  4IG0 B;  4NLY A;  4EGL A;  4IO9 Q;  2D1C A;  1XMQ F;  2CZV C;  2OPR B;  2XZW A;  3PHT A;  4ZLL A;  1T9V A;  2PC6 A;  1KQG B;  4K4V A;  2ASY A;  1H7X A;  2HIY A;  3PM9 A;  3KK2 B;  1YKW A;  3AY0 A;  4I7F B;  3MEG B;  1RWU A;  5A2Q U;  2RDD A;  2VFS A;  2FIU A;  3A13 A;  2MZT A;  3EMT A;  1IR1 A;  3MOZ A;  2DGV A;  1FKA F;  4P2X A;  4OHW A;  3JYT A;  2IC3 A;  1XK8 A;  5AXK A;  1EAR A;  5KFF A;  3VAG A;  3NMR A;  4OX9 J;  1MN7 A;  3T1H J;  3H4D A;  1AFI A;  1WC1 A;  3DRR A;  4RW7 A;  4ID8 A;  1WG1 A;  3EZU A;  4DWI A;  2RKI A;  3OQ2 A;  1X60 A;  2N4D A;  4DV1 J;  4A8F A;  5AT1 B;  1OS5 A;  2J8A A;  1I3O B;  3SCI E;  3ZTO A;  1FHT A;  3GCX P;  4ZLJ A;  4N8N A;  3R5D A;  3HXM A;  2QV6 A;  3UVJ B;  3T5J A;  3CJ2 A;  4RNO A;  4DI6 A;  4CCH A;  1TL3 A;  3L9Z A;  2DGT A;  1VQ6 S;  4LF2 A;  4OHX A;  2HFN A;  2ADC A;  4FNH A;  4DR5 J;  1HBM B;  5DO2 A;  3KMQ A;  1EZZ B;  3P5B P;  4UQT A;  4QPX A;  3UD5 A;  2YX4 A;  4UT4 A;  2JLE A;  5J2P B;  3ZFV A;  5J1N A;  2LQ9 A;  1WC3 A;  3NY0 A;  4CO2 A;  4OX8 A;  3CJ0 A;  3IWL A;  2WVB A;  2EFQ A;  4MFB B;  4FYV B;  1N5V A;  5U47 A;  3ILI A;  1F9E B;  2RHS B;  4FYY B;  2M7S A;  2IBK A;  1S6O A;  2BJD A;  2UXD J;  4C0B A;  3I5B A;  3TVY A;  2DRB A;  3OLA A;  3PJW A;  1C0U B;  2ZH3 A;  3NNA A;  2DXF A;  1S1X B;  1RTH A;  2HZA A;  3IWN C;  2XTJ P;  4KR0 B;  4RU2 A;  1VLO A;  1RT4 B;  2R7R A;  3GFX A;  9RUB A;  4KKO B;  2AWZ A;  3HPO A;  2DNK A;  2V94 A;  2YWE A;  1VJW A;  3CGI A;  2F4V J;  2KXH A;  2ZM6 J;  3GJS B;  2KG0 A;  1LV5 A;  3RR7 A;  1ICE B;  5FDL A;  3DRY A;  3IA0 A;  4CLY A;  1ZAX A;  4K4Y A;  4OYX A;  2BUN A;  1FDB A;  5KG2 A;  3S01 A;  1FKO B;  1FVQ A;  5KFP A;  1KLM A;  3L3C A;  3C19 A;  1SC4 B;  4NLO A;  3D1Q A;  1HYS A;  3BPS P;  4QR2 A;  4RW8 B;  3VAF A;  4YHH J;  3AAW B;  1ZM9 A;  5A8K B;  4F0H A;  3SZ2 A;  2LYV A;  2UUT A;  2AF6 A;  2H65 B;  1SQE A;  4AL5 A;  5HVH A;  2ZC4 A;  2P6T A;  3DRX A;  4USI A;  2A1B A;  1GH8 A;  3DMJ A;  4QJV A;  3O44 A;  2EW9 A;  4WFN Q;  1UFW A;  3DOM B;  4O44 A;  3DRS A;  3BGL A;  3M2V B;  3PRD A;  4DV7 F;  4NLG A;  3LAL A;  4TU9 A;  4DFP A;  2F7V A;  4KQZ A;  1AZS B;  1Z2L A;  1VK3 A;  2DEJ A;  2KM8 B;  3NXZ A;  1Z2Z A;  1XEZ A;  3PFE A;  4Q2M A;  2XMA A;  3W8G A;  4OYA A;  2DGU A;  3MUV P;  2ACM A;  4NXM J;  2VQE F;  4U7C A;  4EBC A;  4ZPW R;  2R4F A;  4P10 A;  4DV3 J;  4ZVH A;  1Y3K A;  1CLF A;  2KHC A;  1HQE B;  4O3S A;  4KC5 A;  2VBZ A;  4QCL A;  1HNI B;  4EK2 A;  1Q86 T;  4I68 A;  2NXN A;  1X9M A;  3BQ0 A;  2VPY B;  2R42 A;  2ZD1 B;  2F63 A;  1N0U A;  1TKX B;  2LLZ A;  2RIJ A;  1RWO B;  4HTI A;  2AQ4 A;  2ERR A;  2HFS A;  4WFB Q;  2W9C B;  3QYY A;  2DD8 S;  2CXE A;  5F8N A;  2R7T A;  2CKW A;  4USK A;  1LW2 A;  1L3V A;  1NHK L;  1U2C A;  3KK3 B;  3MTK A;  1P8G A;  2NR0 A;  4X4V A;  5E3Q A;  2QLJ B;  1JLB A;  3KJV B;  4U8Y A;  3Q8S B;  3GMG A;  3EPG A;  1BY9 A;  3BGU A;  1S12 A;  5HSP A;  4NL5 A;  3EVM A;  1JXE A;  1BUX A;  3HUL A;  3JSR A;  3I0S A;  4MTP A;  1XTZ A;  3OR1 A;  2CNN B;  3RAM A;  3PCO B;  2VOP A;  3T1Y J;  3POT A;  4ID5 A;  3OSP A;  1FRJ A;  1O8B A;  4G1P A;  1KVK A;  1S1U B;  5L38 A;  1ZPV A;  4C8N A;  3OUY B;  1HBU B;  4X62 F;  4J9M A;  4O4G B;  1NME B;  4JYA F;  1YRU A;  1X0F A;  4B17 A;  5CAB A;  2FJE B;  3IR7 B;  1WWH A;  1X4F A;  1FA0 A;  1P9Y A;  2KHD A;  2DNO A;  3QJL A;  2BE9 B;  1FK9 B;  3CMQ A;  2E1M C;  3U1N A;  3SCL E;  1Y10 A;  5KFG A;  1WC6 A;  5LSR A;  2CQ1 A;  1SH3 A;  4WPA A;  2LEB A;  4Z7C A;  4NOH A;  2NUU G;  3PIP Q;  4WE1 A;  2KXN B;  1YBA A;  1Q53 A;  3CPW R;  2BM0 A;  4V1A k;  5KFX A;  4C8Y A;  1NH8 A;  4PYD A;  5KFT A;  1F3V A;  2HQF A;  4HDH A;  3HP6 A;  2VFR A;  2XY5 A;  3P8B B;  3NOG A;  1D09 B;  2GJI A;  5CD4 A;  3ENA A;  4FS1 A;  4URQ U;  2CQG A;  3KJQ B;  1N88 A;  3AB4 B;  4L3N A;  1S49 A;  2IHR 1;  3W62 A;  1QSY A;  3QT5 A;  2IPO B;  4PWD A;  1KOO A;  3CUN A;  2ZBR A;  2EG2 A;  2XG8 A;  4NAS A;  2JOQ A;  4N7T A;  1Q78 A;  1R43 A;  4CM2 A;  1TUV A;  3LOU A;  3OTC A;  1F5B A;  2IYI A;  1F2H A;  5BR8 F;  1TKT B;  4LR9 A;  5CA5 A;  2B7C B;  2QIF A;  1V5I B;  4LF6 J;  4LF9 J;  1QVG R;  1B0V A;  2CA9 A;  4XDD A;  1UET A;  4F4Z A;  1N5T A;  3LPY A;  1FI4 A;  3GJT B;  1YRX A;  5C24 B;  1ZTT A;  5H9F K;  4BBY A;  2HQG A;  2ILY A;  2KT5 A;  2JLF A;  3Q8Q B;  4UOH A;  2APO A;  1SL2 A;  4DDF A;  3K8V A;  3W9J A;  4FPI A;  5HK4 A;  4OZN A;  3QGH A;  1UEK A;  2WVD A;  3ETM A;  4K2X A;  1KVI A;  5IQ6 A;  3QAE A;  1RAH B;  3OTO F;  4A8O A;  1Q95 G;  3D3B J;  1HNW J;  5B0F A;  3DKD A;  4NLR A;  1N5Y B;  2R8K A;  2JFD A;  1N33 F;  1NB7 A;  2R8H A;  1ZS6 A;  2HS3 A;  2HHX A;  3DOL B;  3S8S A;  4I0W A;  2Y1I A;  2MQL A;  5THW A;  4ZIT A;  5LSL A;  1UEU A;  4JI3 F;  1S97 A;  3W60 A;  3ZTP A;  3CCT A;  2YH0 A;  2HNY A;  5ITH A;  3FFI B;  3MAQ A;  3QSY B;  2VUG A;  1B0P A;  1HI8 A;  5HP1 A;  3V81 A;  2V8P A;  5KFZ A;  2AIR B;  2CQ4 A;  1SC3 B;  3CCU S;  2HG4 A;  3GJQ B;  4ZJL A;  5JXS A;  3RRG A;  3ZZU A;  3LF0 A;  5EUH A;  4O4R A;  4LF4 F;  4RW4 A;  2RVJ A;  1IBK F;  3MPY A;  4DR6 F;  1YDL A;  4DSF A;  3H4B A;  3BJY A;  5KT6 A;  1TV6 A;  1TL1 B;  2LXF A;  1JXL A;  4DX5 A;  5ETM A;  4B3M J;  1M1K T;  2HWT A;  1JLG A;  2BVZ A;  4Q8E A;  1ITP A;  4M5K A;  2CNL B;  5KG0 A;  4DG1 B;  4PWW A;  2BW2 A;  2HFU A;  1SJ1 A;  2P9C A;  3PAC A;  3DLG A;  2D9O A;  1JKH A;  2HYI B;  2JEI A;  2RT3 A;  3SQG A;  4IOA Q;  3H2V E;  4C11 B;  3BR9 A;  2V8D A;  1VQY A;  2OPQ B;  2MLY A;  2X7I A;  3KLH B;  1D0E A;  1Z4U A;  1RA7 A;  3IGN A;  1OPZ A;  1AW0 A;  2DO4 A;  5GAE I;  2MZ1 A;  3G82 B;  2ZIT A;  2EK6 A;  2RE1 A;  2E9Z A;  2DGX A;  5I3P A;  1N4L A;  2CYY A;  4ECX A;  1C1C B;  2QLW A;  1RTD B;  1C1B A;  1F60 B;  1UVJ A;  3L95 X;  2KDO A;  1SC6 A;  3BSC A;  4RKU C;  3BGO P;  3Q23 A;  4RNN A;  5K8N A;  3M30 B;  3PYE A;  2R2R A;  3J81 Y;  5DET A;  1S0M A;  1BLU A;  4CLK A;  2HKE A;  3KYL A;  4JI2 F;  1GQE A;  1HNX J;  3IR6 B;  4LUB A;  4C4W A;  5KFK A;  4J9K A;  4NX9 A;  2XCA A;  1S7I A;  4ILL A;  1OY9 A;  3J7Y U;  3MZI A;  5GMD A;  5J1P A;  2XS2 A;  2J0Q D;  1ZM3 A;  3W9H A;  3RBZ A;  5LT5 A;  1CUL A;  1VIS A;  2B5J A;  3OTE A;  2GNK A;  1SKR A;  1B99 A;  4Z2X A;  1URN A;  1QUV A;  2CG8 A;  1RSC A;  1RTZ A;  1RAB B;  1IJE B;  2P9G A;  3GSI A;  2I9S A;  3I82 A;  3KG4 A;  1C2P A;  2CZ4 A;  2K1R B;  4WTY A;  4DR1 J;  2E1C A;  3QO9 B;  4LSN B;  1IKX A;  1PBU A;  5IV3 A;  5DZ6 A;  1WKK A;  5CQG A;  2ASD A;  1RBA A;  4NCB A;  4X66 F;  3R5G A;  4H4K A;  2CPI A;  5T41 A;  3QLH B;  2UZA A;  3LWM A;  3KG0 A;  2ZHB A;  2OGU A;  1M5O C;  2VPX B;  3BGF A;  1U4B A;  4DV4 J;  4ED8 A;  5D3G B;  2HBQ B;  1U0H A;  3D0G E;  5IM0 A;  4NLS A;  3M2R A;  2BE2 A;  2ZH5 A;  4KAI A;  3EIC A;  3HFV A;  5K9F A;  1Q79 A;  3ICL A;  3PX4 A;  4OX7 A;  1E6V A;  4P2F A;  1AUD A;  1KTV A;  2ZDP A;  2GVZ B;  2DR9 A;  3OVA A;  1YGY A;  1LW0 B;  3EDQ B;  2J9D A;  4IUF A;  5IQQ A;  5H9F J;  3A8I A;  3NG8 A;  3T9N A;  2XO6 A;  2HHU A;  3M1V B;  4HKQ A;  3J7A N;  2LQJ A;  3PX6 A;  1GMU A;  3VGV A;  5DDP C;  4YR0 A;  3CCQ S;  4IOC Q;  2QL5 B;  5D0R A;  1KQK A;  3UDL A;  3GFH A;  5C42 A;  4CIO A;  1TK8 A;  1WKJ A;  4RW9 B;  1URR A;  3TI0 A;  3BF4 A;  2LEA A;  3IRX A;  2W9B A;  3FGV A;  3FJ2 A;  5C2G A;  1SJQ A;  3IXQ A;  2BE7 D;  4F04 B;  2GAH C;  2MLX A;  4HDG A;  4KHP J;  2RQK A;  1YK9 A;  1Q5Y A;  1VIX A;  4L73 A;  1KQS R;  2IAJ A;  5IWA F;  4IFY B;  2OIH A;  5E7O B;  2HHH F;  1S7H A;  1YBT A;  4DR3 J;  1XNR J;  1H2V Z;  4X4S A;  1I6J A;  4U6P A;  1X8D A;  5B09 A;  3E3X A;  5ETV A;  3NAH A;  3E01 B;  5HBM A;  3RU0 A;  2L41 A;  3J7Y I;  5JVG Q;  2CPD A;  1WEX A;  4HT7 A;  1SH2 A;  4F4W A;  3HX9 A;  3RAQ A;  2ZNY A;  1S9G B;  2IDE A;  1ZOT A;  4B3O A;  1Q7Y T;  2J0X A;  3HZE A;  2YX1 A;  1HBN A;  3NGD A;  1S1W A;  2DNM A;  3O1L A;  1K73 T;  3T3F A;  2UXD F;  3T41 A;  3BN4 A;  2E5G A;  3CME S;  2Q79 A;  4NCG B;  3ELH A;  2PDA A;  4PG5 A;  2IJN A;  3OT9 A;  2Q6C A;  4QBU A;  4KY3 A;  3SSR A;  2VG7 A;  4C8Z A;  2EKN A;  3DGV A;  1KFD A;  4F8R A;  3I9Z A;  1TUW A;  2Q66 A;  1R0A B;  2C2Z B;  1PAU B;  1BQN B;  4V19 J;  2D74 B;  1YI2 S;  1S9F A;  3MAH A;  2K7K A;  2XMM A;  2MKY A;  4JV1 A;  4Y28 C;  2GO8 A;  4YB1 P;  4OIX A;  4ECT A;  2OEK A;  1TL5 A;  3O3L A;  2YNF A;  3HHN B;  3FBE A;  3H59 A;  3B6B A;  4FKY A;  3ZTQ A;  2Y9H A;  2NUH A;  3NS5 A;  4R8U B;  2LFV A;  1FJC A;  2OPS B;  2WW8 A;  2PGC A;  3NBP B;  1KVJ A;  1YTY A;  3CJQ A;  3B82 A;  2VC0 A;  3GTY X;  4DCP B;  1RT6 A;  3R5A A;  3JTN A;  3ZZY A;  3DLE B;  3B4M A;  2ZOM A;  3TX8 A;  1JMT A;  2QMU B;  2KN4 A;  3OLB A;  1P27 B;  1NDK A;  4HH0 A;  1QVF R;  4CDI A;  4CLZ A;  3QT6 A;  4ZDN A;  1WSV A;  2HHQ A;  1RTI A;  4B9U A;  4OJ1 A;  3BS9 A;  3MM8 A;  3GIJ A;  4FBU A;  2WCX A;  2ROE A;  1WF1 A;  2IA6 A;  3K5O A;  2E44 A;  1PKU A;  3MMB A;  2GQC A;  3TYT A;  4ENO A;  3BR8 A;  2JX2 A;  3MEK A;  4ERD A;  4PUO B;  1B7Y B;  4WFA Q;  1U7L A;  3K57 A;  1F3F A;  3RB4 A;  2GIQ A;  5T7L B;  1RWW B;  4LSL B;  3PRV A;  4OHZ A;  2HHP A;  3ENW A;  2VPW B;  1RI7 A;  4FPR A;  4ZVU B;  4G1Q A;  1W26 A;  2MKK A;  3TUZ C;  1SIZ A;  1TVR A;  4MIB A;  3W2W A;  3KLG B;  2NXU A;  4CYU B;  1SJR A;  1WUU A;  5LMU J;  2RUG A;  2MGZ A;  5JMN A;  4LIR A;  3AD9 C;  1CJU A;  2GHW A;  5ETN A;  1CG2 A;  1RAD B;  4JUZ A;  3RJM B;  4PR6 A;  1B3T A;  1RTJ A;  2FD2 A;  3AFG A;  2YKA A;  3WC0 A;  1RAA B;  1NK0 A;  2PMZ D;  3F44 A;  2GMH A;  2ADB A;  4ZS6 A;  4BHQ A;  3NS6 A;  2MZJ A;  3M8Q B;  3A8K A;  1AA1 B;  2NYH A;  3QGI A;  3UN2 A;  2X1A A;  3W2V B;  3SYZ A;  4KH1 B;  1SCJ B;  1LWF A;  2IBO A;  3T1Y F;  1J2V A;  4P7V A;  2W8K A;  1Q0N A;  2VQF J;  1H2U X;  5CYM B;  3BO3 A;  3OR2 B;  4IDK A;  1VQP S;  5K20 B;  1EP4 A;  1QAJ A;  2ZE2 B;  4YFU A;  1C4C A;  3T6J A;  1JK9 B;  1HPZ A;  4PXC A;  4ZK7 M;  3MFI A;  2OD4 A;  3V6H A;  4ZVQ B;  1X31 C;  3A12 A;  1IKW A;  4ZCM A;  5E5N A;  1LWE B;  1TKZ A;  3G4S S;  3PX0 A;  4UUW A;  2FHM A;  2D9P A;  1FWK A;  4RNM A;  1HHS A;  4OYO A;  4LRE A;  5JVH Q;  1OQ6 A;  2M4M A;  3N4W A;  3PYG A;  1IM4 A;  1TAQ A;  4RUA A;  1N36 F;  3KUG A;  1RAO A;  2J6U A;  1QTM A;  5K14 A;  3ENV A;  1H73 A;  2JEJ A;  2DNZ A;  3FZB A;  2RF2 A;  1L3T A;  3MPD A;  4I2P A;  2AYG A;  1U24 A;  4RWW A;  1T05 A;  2GHV C;  4GO7 X;  2BW7 A;  3N5F A;  1QAY A;  1RHJ B;  3LP1 B;  1RBL A;  1ZA2 B;  3UQS A;  4B3T F;  3OW2 R;  1LKZ A;  2Y0B B;  3D6H B;  1RJJ A;  3TP2 A;  3KHH A;  2OPP B;  2HAI A;  5L1I A;  2WON B;  2DGQ A;  1RP5 A;  5KG3 A;  4Q0B B;  1RT3 B;  3VVU A;  4OYI A;  3GIM A;  3KDN A;  3IS9 B;  3GSD A;  2D3U A;  4R25 A;  5HLF A;  4K5R A;  1UVM A;  2VZ9 A;  1WI8 A;  4WXW A;  2AJ0 A;  3DHX A;  1L5U A;  1W2I A;  4LF6 F;  4LF9 F;  2C3M A;  2POK A;  4X84 A;  1G3O A;  2KT2 A;  1YJT A;  5IOL A;  1A9N B;  1YIT S;  2FZG B;  5FLX Y;  3FEY B;  4OZ2 A;  5M2R A;  2V8V A;  1KNZ A;  2NRE A;  2C2D A;  1ELO A;  4AQY F;  2I0X A;  1N6Q B;  3TVK A;  8AT1 B;  4NLX A;  1KD1 T;  4JOU A;  3T6B A;  2U1A A;  3SQO P;  4ZVT B;  3CD5 A;  3BQ2 A;  5EWE A;  4Y2C A;  1H74 A;  4W98 A;  2A3J A;  2CPX A;  9ATC B;  4DV6 J;  2D41 A;  4DR4 F;  3FMB A;  2R2U A;  4B9S A;  3OBI A;  2AYE A;  2MHN A;  4MK8 A;  3CCJ S;  3CDE A;  4OZ5 A;  2R8I A;  1NU4 A;  3CJ8 A;  4Y34 A;  3FC9 A;  4ER8 A;  3V6D A;  2PO4 A;  1CS4 B;  4IRK A;  1A7G E;  5DGA A;  3Q8R B;  2XZT B;  1KC8 T;  4WYW A;  5A2Q Y;  3NCQ A;  2H1Y A;  3IM9 A;  2CWX A;  1A6L A;  1OSD A;  5KG1 A;  3Q24 A;  3UD4 P;  1MML A;  3MM5 A;  1XNQ F;  4GKK F;  3KK1 B;  4M5N A;  2QLF B;  2OSR A;  4KSE B;  2HMI B;  3R9L A;  3UCG A;  1K0T A;  3HSZ A;  1EET A;  1VCT A;  1SUQ B;  1LNQ A;  2G1D A;  3JAM Y;  2XMV A;  2YWF A;  4DUT A;  1MRO B;  2F8M A;  4C48 A; 
#chains in the Genus database with same CATH homology
 2HBY B;  2QL7 B;  1QTN B;  2Y0B B;  3D6H B;  2Y1L B;  1RWW B;  1ICE B;  3GJR B;  1NME B;  5K20 B;  2P2C B;  4DCO B;  4ZVU B;  2CJY B;  5IC4 B;  2CJX B;  3EDQ B;  1RHQ B;  1RWK B;  2QL9 B;  1PYO B;  1SC4 B;  2CNK B;  3SIP B;  2FQQ B;  4ZVQ B;  1RWP B;  5IC6 B;  3IBC B;  3KJF B;  3P4U B;  2DKO B;  2H51 B;  4ZVP B;  3R7S B;  2QLB B;  2H48 B;  3GJT B;  1RWO B;  4DCP B;  3EDR B;  2CDR B;  1RWV B;  4DCJ B;  2C2O B;  2QL5 B;  1F9E B;  1RHU B;  2XZT B;  1RHK B;  3R6G B;  4LSZ B;  2H54 B;  2C2K B;  2H65 B;  1GFW B;  1SC3 B;  2XZD B;  3KJN B;  3RJM B;  3IBF B;  1RHM B;  3GJQ B;  2HBR B;  3D6F B;  2QLJ B;  1RWX B;  1RWN B;  1SC1 B;  1RHR B;  2H5J B;  2XYP B;  1I51 B;  2C1E B;  3P45 B;  3R6L B;  4ZVR B;  1I3O B;  3NS7 B;  3R5J B;  3QNW B;  1BMQ B;  2H5I B;  2QLF B;  1QDU B;  4ZVS B;  2H4Y B;  2H4W B;  3D6M B;  1RWM B;  3R7N B;  2CNN B;  4JB8 B;  3KJQ B;  2CNO B;  2XYH B;  1RE1 B;  4ZVT B;  2C2M B;  2C2Z B;  4ZVO B;  1PAU B;  2XYG B;  2HBQ B;  2CNL B;  1RHJ B;  3GJS B;  2HBZ B;  1IBC B;  3R7B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...