2MZJA

Nmr-structure of the nop6-rbd from s. cerevisiae
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
82
structure length
82
Chain Sequence
GNRFIVFVGSLPRDITAVELQNHFKNSSPDQIRLRADKGIAFLEFDADKDRTGIQRRMDIALLQHGTLLKEKKINVELTVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Nucleolar protein 6
publication title Not known yet
rcsb
source organism Saccharomyces cerevisiae s288c
total genus 19
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2015-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mzjA00
2MY8A 2DGXA 3G8TA 1YHQS 1M1KT 3VALA 1N52B 1S72S 2J0SD 5CYJA 2JVOA 2KRRA 5FJ4A 2PE8A 5DDOC 1X4FA 2DH9A 5DM7Q 1M90T 1H2VZ 3IRWP 2DB1A 2MYFA 1VQLS 1KOHA 2M70A 5DM6Q 3RW7A 1JJHA 4V19X 1QVFR 3RW6A 2KG0A 5D78A 3TYTA 2M4MA 4TU9A 2RNEA 2DNPA 2LA4A 1M5OC 2MKSA 2E5JA 5JVGQ 2AD9A 1YITS 2MJNA 5CXTA 2X1BA 2DGSA 3G9CA 1U6FA 4ERDA 2DO0A 4OZ0A 4C0OC 1YWXA 4Z2XA 5CA5A 2N7CA 2RU3A 1NJIT 3MXHP 2CPZA 2OSRA 2N3LA 1U1NA 3CD6S 1RK8A 2KXNB 2LMIA 2VOOA 2MQLA 2N82B 2RRAA 1YJ9S 1KC8T 2FC9A 2D3OR 2LA6A 1VBXA 2KHCA 3SDEA 1WHVA 4WFNQ 1DRZA 1X4EA 2EK1A 3THPA 1HD1A 2CQ0A 2DNLA 2DHGA 2SXLA 2ADBA 1WG5A 2MZ1A 3FEYB 1U1OA 1D8ZA 3G96A 2LEBA 1VQ9S 2CQHA 2XS7A 2RQCA 1S79A 2HGMA 1FO1A 1YI2S 2U2FA 2I2YA 1P27B 1X4BA 2MQOA 2XS2A 1VC0A 1WF1A 1NO8A 1K9MT 2AYMA 3ULHA 3MI7X 3CC2S 5DDQC 1M5VC 2GHPA 1PGZA 2OJ3A 2ERRA 3CCRS 2VOPA 5IQQA 1VC5A 2MQQA 2UP1A 3EGZA 5EN1A 1SJRA 4ZKAA 1VBZA 3R1HA 1DHMA 4CH0S 2M7SA 4PR6A 1U1PA 4LMZA 2VODA 2MKHA 2M52A 2MSTA 1WF0A 3MURP 2MPUA 2KI2A 3HI9A 3U1MA 1DBDA 5H1SV 4YOEA 2QEXS 2E44A 3VAGA 2KXFA 3MD1A 2MSSA 2YH1A 4CIOA 2DGWA 4CQ1A 4TU7A 2HGLA 3BEGB 3R1LA 2CQIA 4LIRA 2FPHX 2RVJA 3LQVA 3G6ES 3JB9k 4QPTA 2NLWA 4Y00A 5LXYA 2JRSA 2F9DA 1VQKS 1Q86T 1K8AT 1Q82T 4RU2A 2MXYA 3B4MA 1CVJA 2KVIA 3P49B 1X5TA 2MZSA 1WTBA 2KM8B 3G4SS 5IM0A 2U1AA 3BO2A 1WELA 5IFMA 1U1KA 2CQ4A 2F9JA 4M5DB 5LSOA 3CCES 1FXLA 3CULA 3EX7B 4UY8T 3VF0B 2DK2A 2X1AA 4EGLA 4F26A 5LJ3Y 2CPHA 3UCGA 1SJ4P 2RUGA 4IOAQ 1HL6A 3CUNA 2OTJS 1HD0A 4WFAQ 1WG1A 2K3KA 2ADCA 1XN9A 3CPWR 1JJ4A 1YIJS 3UD4P 2G1DA 3CC4S 3MOJB 3CMAS 5GAEU 1OIAA 2DNZA 4FXWA 2LKZA 3CCMS 3D2WA 1IQTA 2LYVA 3CF5Q 1ZH5A 1WHWA 5GADU 4YUDA 1VQNS 1U1QA 4QU6A 4TLQA 3NS5A 3IWNC 5GAGU 2MKIA 3ZZZA 1VQ5S 3K0JA 2E5GA 3CTRA 1VQ8S 2OIHA 1WEZA 2KN4A 4UQTA 1W2BR 3CCVS 4OZ1A 5GVQA 1URNA 2CQPA 2DH8A 3UD3P 3R27A 1VQPS 2DNRA 1VQ4S 2X1GA 1UFWA 1M5KC 4ED5A 2MKJA 2MQPA 3J7ZT 1WF2A 1WEYA 1WEXA 2AYEA 2DGTA 2EVZA 3MUTP 3UCUP 3PIPQ 2XB2D 2CQ3A 2YH0A 3B4DA 3PIOQ 1VQ6S 1NU4A 2E5HA 3H2UB 1YJWS 3DXBA 5GMKa 2KM8C 2YTCA 1SXLA 1SJ3P 2M0GB 2MKKA 2FY1A 2MZQA 2KXHA 1FNXH 4P6QA 3US5A 1VBYA 2MMYA 1FJCA 2FHOB 2RT3A 1QVGR 4IUFA 1WWHA 1SJFA 5DDPC 4QU7A 3VAJA 2JX2A 5IM0B 2MQMA 1KD1T 2XNRA 2CPFA 4IO9Q 2FC8A 2GO9A 4QQBA 2LECA 1OPIA 4F25A 2LQ5A 2J8AA 4C7QA 2DNYA 3V4MA 2HYIB 1Q81T 2CQCA 2DITA 3P3DA 2CQ2A 2CPDA 1Q7YT 2HGNA 1AUDA 3EGNA 2MQNA 2BZ2A 3SMZA 2DO4A 3VAIA 1VQ7S 3VAMA 2DNNA 5BJRA 1WG4A 3CC7S 4J5OA 3Q2TC 5MLCV 3MUVP 2MKCA 2K8GA 3L3CA 2ZJRQ 1X4CA 2AYBA 2DNMA 2KG1A 1O0PA 5LSLA 2L41A 2JVRA 1YJNS 3P5TL 3NNCA 4WF9Q 2M8HA 3MUMP 2JWNA 2I38A 3J7YU 3LPYA 2G0CA 3N9UC 3CCSS 2CPYA 2J0QD 1X4GA 2OSQA 2KH9A 2N3OA 3VAHA 2RS2A 2MZRA 1G2EA 2KYXA 2A3JA 5ITHA 2XS5A 1VC6A 2HVZA 3S7RA 1X5SA 5LXRA 2DGUA 2OTLS 2QFJA 1K73T 2MZJA 3S6EA 2NZ4A 2VONA 5D77A 2WBRA 2KU7A 4IOCQ 2RS8A 5HO4A 4U67Q 3FEXB 3CCUS 1WI8A 3BO3A 5JVHQ 1JJ2R 2CPEA 3VAKA 1WHXA 2DIUA 5DETA 1L3KA 1FT8A 1B7FA 3MD3A 2CQGA 2BOPA 1HA1A 2YKAA 1U1LA 1X4AA 1U1MA 1H2UX 1U2FA 3CXCR 2LEAA 2M88A 1H6KX 3THTA 1WHYA 1A7GE 1FJEB 1KOOA 2DHAA 1OWXA 1H2TZ 2CJKA 2XSFA 4CH1A 4FXVA 2CQBA 2MGZB 1X4HA 1N88A 4F02A 3NMRA 3TO8A 1SJQA 2LXUA 1U6BA 5HL7Q 3UCZP 2YWKA 3VAFA 3DLLQ 2XNQA 2D9PA 2MB0B 1KQSR 3Q2SC 2CPJA 1WI6A 1ZZNA 1VQOS 1UW4A 2Q79A 3NS6A 2J76E 4WCEQ 4A8XA 1BY9A 3I56S 3P6YC 3I55S 2LCWA 4BS2A 3CMES 2CQDA 2M9KA 3HHNB 2DGQA 2DGOA 2KRBA 1UAWA 1X5PA 2ZJQQ 3NNHA 4C4WA 1F9FA 2PEHA 4WFBQ 5LJ5Y 2HZCA 3OW2R 1M5PC 2D9OA 5GAHU 4W90B 1RKJA 1N8RT 1X5OA 3NNAA 3S8SA 1P1TA 2DNQA 2E5IA 1PO6A 3MDFA 4WIIA 3UWTA 3CCJS 2KT5A 3H2VE 4YB1P 2DHSA 2EK6A 2L08A 3G8SA 3ZZYA 1VQMS 2MGZA 1DZ5A 2MHNA 3BS9A 1FJ7A 4LJMA 2DGVA 3UE2A 2CPXA 2X1FA 2MY7A 2DNOA 2MZTA 1R8PA 2O3DA 1QM9A 2DIVA 2DNGA 1X4DA 2V94A 3CCLS 2CPIA 1N54B 3CCQS 2L9WA 4PKDB 1X0FA 2M8DB 3BO4A 1ZZFA 1A9NB 4WKRA 2LXIA 1U1RA 2CQ1A 1UP1A 2AYGA 2G4BA 1JMTA 2M2BA 3S01A 3SXLA 4Y0FA 2F3JA 1YTYA 2QA4S 3G71S 3TP2A 2DNKA 2RRBA 2KFYA 2DH7A 2DISA 2RQ4A 3U1LA 1R8HA 4W92B 2MJUA 2ZJPQ 5DDRC 1FHTA 3SDEB 2B0GA 2DHXA 4TU8A 1OO0B 4PRFA 2DNHA 1D9AA
chains in the Genus database with same CATH superfamily
3NGRA 3G8TA 3M8QB 2JC0A 1RAEB 5DDOC 4FS1A 1TKDA 3GCWP 1WC0A 1RT6B 4O23A 3TQ1A 2NS1B 4OMFG 1UJ5A 3CDUA 7AT1B 2RU3A 3G87A 2B9WA 1VHIA 4X4TA 1ULRA 4J9LA 3H8YA 3CD6S 1NSPA 2KXNB 2XMUA 1JLAB 3BV8A 3QLHA 4QOTA 2YBVA 5HVHA 5IS2A 3A4TA 4NXNF 1XNQJ 2EK1A 4RWWA 1LEOA 4JV0A 3ZO7A 4UZCA 3DLJA 2MZ1A 1IM6A 1R89A 9RUBA 5F3ZA 1VQ9S 2LEBA 2QIFA 3Q89A 3Q22A 4CLYA 5A0YB 2IFXA 4JI6J 1X0PA 4GO5X 2C2DA 3EM1A 2VOPA 4KC5A 2MLYA 4EZ6A 4ZKAA 2MKHA 2MSTA 2PD1A 3LAMA 4NXMF 3V6JA 3PEHA 3FRYA 1NNDA 2UXBF 2HNYB 4G3IA 4RL1A 1NKBA 3PW4A 2BQ3A 1ZBTA 4FNIA 4CLWA 3MTKA 5KFXA 1S6PB 4L6V3 2GHVC 8ATCB 2BJ3A 1VQKS 3HHLA 4QIGA 3I9ZA 1WELA 3I0SA 1S6UA 3DRPA 4LFBF 2NUUG 4OYOA 3PX4A 4CNYA 3OL7A 2V4JA 3V6DA 2DKOB 3BSOA 3CPWR 1RTHA 3UD4P 2FVRA 2KFNA 2ASDA 4ZP7A 3UDVA 2ZH5A 2UXDJ 3D2WA 3K8WA 5E7OB 4UOFA 4WP9A 5M2UA 5D3GA 4OYBA 3V6KA 3UR3C 3DRRA 5A6WA 3Q8VA 1LNQA 2GHWA 1WF2A 1VJWA 1DLOB 1YJWS 3Q8UA 1HHQA 2CNLB 4ID5A 2JSXA 5K8NA 1QVGR 4QWEA 3DGPB 4UOCA 1WC6A 1I6JA 3V81A 2PO4A 3VQTA 3RRGA 4CTAA 5H9FK 3T5LA 3BZQA 4RX6A 3AXMA 4PXEA 5K8MA 1RBAA 5BJRA 3ISZA 4DSEA 3Q24A 1RJJA 2JVRA 3OXFA 1T3NA 2G0CA 3CCSS 3D6FB 4GKKF 3TANA 3H59A 3UN5A 5ITHA 4WE1A 4O4RA 4LFAJ 3S7RA 3QFHA 4RUAA 5H9EJ 2AJ4A 5KAKA 3ZXWA 5HO4A 1EHWA 3UNYA 4M95A 1EIYB 5JVHQ 4JI5F 4DV6J 1JLQB 1S76D 4FN5A 4RW8A 2AJ1A 2LEAA 2HIYA 1WHYA 1JB0C 3BQ2A 4MK9A 3KK2B 4CM2A 5CCMA 3HVTA 3DI6B 4V19J 1KFDA 4O3QA 1SQEA 3HKZD 1LXNA 2EFQA 3RB4A 1JNRB 1GXUA 1WDTA 3D5MA 2YKPA 2WVDA 2HFVA 2KKHA 1LK5A 4LR8A 2R9LA 1ZZNA 1AXQA 4A8XA 4RW4B 3CJQA 3NNHA 1FE4A 5CYQA 1GQEA 5JJBA 5J1PA 5J2NB 5A2QY 4ZVTB 1YJRA 3QO9B 1N5QA 3UNGC 2ATLA 4S0MA 2DHHA 2RU9A 3G8SA 3ENQA 4XK8C 3M2RA 3PVXA 4LF6F 3LANA 3CCLS 1X0FA 3ICLA 2L9NA 3LP0A 3G6VA 2E7XA 1RTJA 2XY5A 4A8MP 1UEUA 4QIFA 1BGXT 1DTQA 1NPRA 1TL3B 4J37A 3GJQB 4OHZA 3HT0A 4DV4F 1WTFA 1FK9A 3E2EA 2R2SA 4EK2A 1BC6A 5C2GA 2OUGA 4CO5A 2FJBB 3FVYA 2DR9A 1FCAA 4H4OB 2UXBJ 2VU5A 2QGFB 4RNHA 3E01A 2MJNA 2HMIB 4ZCKA 1H98A 3G9CA 2X51A 2N3LA 3UW1A 2B51A 2MQLA 2GV1A 2YX1A 4K5SA 2D3OR 4U7UD 1KWMA 3NGKA 4KKOA 4OQJA 4LFBJ 4TKTA 4O4GA 5B0AA 2DHGA 2AZ1A 2KVQE 1HNXF 1S77D 1KONA 5AXKA 4XIUA 1JLCB 2CQHA 1HI1A 1RT3A 1Y7PA 4ZVFA 1UVMA 4RW7B 3W66A 4OI6A 4KO0B 2J0WA 2BMBA 4DPUA 4O0NA 3TZYA 2IMOA 1FRXA 1IBKJ 1FNMA 5D4LA 2CA9A 3C6UA 2ZBQA 1R7IA 2ZD1B 4UTGA 2OLWA 5D0RA 1B99A 4K4YA 2VUGA 5F3TA 3UPFA 2QA1A 2OD6A 2VQFF 3MM8A 3TI0A 3LAKA 2ZE2B 4C8YA 1S0OA 1RDRA 2HLUA 2NSBA 2D74B 1IKVB 3GZ7A 1RHMB 2GVDA 3C16A 1HNIA 2ZHBA 2FLOA 1IWAA 2Y0SD 2D69A 1NHUA 3SQGA 1CC8A 2VIHA 3IR5B 3KLHB 3CF5Q 4QU6A 1S1XA 3FSIA 1S1UB 4B9VA 1VQ5S 1NJYA 1FEEA 2OIHA 3AOAA 1TUGB 2C3UA 5L1KA 4OYIA 1JXLA 3PYFA 1UFKA 3C6TB 4G1QB 2P6SA 3UVJA 1R3NA 1Z2LA 2CQ3A 3CJ8A 4N47A 2YTCA 3GP9A 2LVWA 4A47A 2FHOB 4MKVA 3FDSA 1T7PA 2P9GA 3NOGA 3MM5A 5IWAJ 2KYZA 4NA2A 4C7QA 4OZNA 4B3SJ 2PIIA 5DZ6A 3EZ5A 1RHUB 2BJ7A 3DMJA 2MDAA 3SMZA 2HFNA 5B7WA 4R0EA 4R5PA 4PG7A 2AX1A 3N5FA 2DNMA 1PJ6A 2JWNA 1N56A 2CPYA 2V9KA 4QR0A 5EUHA 3VAHA 1AYEA 1T8EA 2IA0A 1U0HB 2RMLA 1NCLA 2HVZA 2OPSA 1TUWA 2Z56B 5HLFA 4PXBA 1TL5A 2LLZA 5DLFA 1S9FA 3NY0A 2WHOA 1S7HA 3SCKE 4BCAA 4LF6J 4WK3A 2HRUA 2R8KA 4QW8A 1ZTTA 1YBUA 3QNWB 5KFVA 5I42A 4O44A 4HI1A 3ZNUA 5CHCB 3M8WA 4DQRA 3OVBA 3TAMA 4R25A 4C48A 4DR2F 1ZM4A 4LF9F 1LW2A 1N88A 4P71A 5IXUA 1CJTA 1V5IB 3D0GE 1ZAWA 3DLLQ 1Y0HA 1KQSR 4FKXA 3MFIA 4NRTA 4QWAA 2IPOB 2EI5A 3DYAA 3ISND 3EGWB 2QN6B 4CLPA 1NPKA 3H20A 2CNKB 2CQDA 1X5PA 1F9FA 1J5OB 5LJ5Y 2IJRA 5KFJA 2GO8A 2VJUA 3VV2B 3KDOA 3GV7B 2ZKUA 1SC4B 4MTPA 1R8BA 1NH8A 3PZPA 2HAFA 3D1HA 2IBKA 3QGPA 4OX6A 2OFHX 5AXLA 2RF2B 1CS4A 1J27A 2UZAA 3TEHB 4TYAA 3CCTA 1RXOB 2XQCA 2ALYB 3QFWA 1T02A 3C66A 3F41A 3D1QA 2DNHA 2ZH2A 2MY8A 1MLAA 4KPCA 2XMWA 2GA7A 2PE8A 4NL5A 1RU2A 2DH9A 3MPUB 1M90T 1FRLA 3GSDA 2YWEA 4IFVB 1MWQA 2CG4A 4TU9A 1LFWA 2MKSA 2GQQA 3HXMA 4MT1A 4IG3A 1YWXA 2VQFJ 3SV3A 4ILLA 1Q78A 4PQUB 2FVCA 4USMA 2C3YA 2N82B 3RAQA 3J7Z5 4USWA 3I5CA 3QRQA 3KK1A 2HNDA 4LF2A 4NYOA 4KJIA 1JK9B 4AE5A 2J8SA 3KJVB 1XMBA 5KT7A 1KVJA 3KLGB 5JUMA 4QIWD 1FO1A 2U2FA 2VPZB 1H72C 1H74A 3GU0A 3MEEA 2VQEJ 2ERRA 3V2UC 5IQQA 1VC5A 3HT3A 4LRFA 2PI4A 1KHWA 4ED4A 5M2PA 4E0DA 3QIPA 4RBTA 4PQAA 4IH6A 4NLDA 2QEXS 2UUBF 3MMAA 5HROB 1H7XA 4WFXA 2OEJA 5BYQA 1LWCB 3BYPA 4LSLA 1YGYA 4DPWA 2HQIA 2F9DA 3HX9A 1KFSA 2QC3A 3NGUA 1S97A 1R8AA 4ECRA 1HBNB 1UWBA 1S4FA 4M5DB 1FXLA 3VF0B 3UCGA 1SJ4P 4ED3A 1H3DA 3EVOA 2QO3A 3GTYX 3LOUA 2IY5B 1YIJS 4M94A 2G1DA 1HNWF 5E41A 4ED8A 2C2NA 2DNZA 3A12A 3KG1A 5B0CA 2LYVA 1I5OB 3NS5A 4JYAF 5AT1B 5HMWA 4DV2F 1MMLA 4O3OA 4Q44A 1SIWB 2KT3A 3Q8PB 4F67A 3LP2B 4GRSA 3TUJC 3UD3P 2MQPA 3J7ZT 1QAYA 1NLKL 4DWIA 3UCUP 1F1BB 4NLTA 2XB2D 2YH0A 4FNHA 1F3FA 1VQ6S 4ZPDA 4I7FB 4RBUA 3US5A 1IR2A 1SJFA 4ZA1A 1NJZA 5THWA 2ASLA 3MMCB 2QX0A 1KHVA 5KFFA 4DR2J 3A13A 4LF9J 3V4MA 3HSZA 1RAIB 1IKXA 2NPIA 3F0NA 1S9GB 4USKA 3PFEA 1N33J 3ZNJ1 5HAOA 4GVBA 2KG1A 2BOAA 4RNFA 2L9DA 1XR7A 1HARA 3IGNA 2I38A 2G2ZA 3N9UC 3FUYA 4XAKA 3LP1B 4ZPVR 4QW9A 3I5BA 5F8MA 2XS5A 2P5VA 1SL2A 4CLUA 3DRSA 4AQYF 4M5LA 3RUBL 3S6EA 4IRCA 3PX6A 5E33A 3CCUS 3WQPA 1Q8BA 1Q7LB 1S48A 4G6VB 3P4UB 3W2WA 1HA1A 1U1MA 2VA3A 2M88A 2X7IA 4EBDA 1PSDA 4HTIA 2C22A 4IKAA 1CJKB 3DDKA 2IYGA 3FFIB 4N41A 4F02A 1QLNA 1MWYA 2WAQD 1TVRB 2XNQA 4DHVA 1BUXA 1NEEA 2WVEA 3CJKA 2HIQA 2GJ2A 2IHR1 4WCEQ 1NJWA 2GQ2A 1YK9A 4MIWA 3VGUA 1LV5A 4C8ZA 4BS2A 2ZJQQ 2KRBA 2V8VA 3M6XA 4C4WA 3I82A 1R27B 1VRTB 3IBWA 3SZ2A 3ILJA 2CJQA 3I0RB 3KG4A 2GVZA 1R31A 3IRXA 4M5NA 2DGVA 2FB0A 4N7TA 1HQEA 1WKKA 3G6XA 3IS9A 2HKEA 4XDDA 4U9RA 2H5EA 2LXIA 2KJWA 3V4IA 2VH7A 3S01A 3LGNA 1YTYA 1HIYA 2G1HA 3LGHA 4F8RA 2RRBA 5J1EA 5AE2A 4TY8A 1HFEL 3GILA 1T9YA 4P9SA 2DRDA 1FHTA 2YNFA 5CYMB 2WOMA 2QYCA 4NOHA 3VALA 1RYRA 2H48B 2J0SD 2BA9A 3TJ8A 2OPRA 2R7VA 2HK2A 2M70A 3WDOA 2E5LF 1UFLA 1CEZA 3TZZA 4L76A 5LMNF 3H98A 1YITS 1TL1B 3HHLD 1HNVB 1U6FA 3QJPA 2W2OP 2HQGA 2LFVA 3A8KA 4UUWA 1E6YA 4KPYA 4WFNQ 3H42A 5B0BA 5KOXA 4OX9F 1HWIA 2DR7A 3TUIC 5D8HB 2IM1A 2B6AB 3UI3A 1TL7A 3T1AA 2WONB 1S79A 2ZBIA 5ADZA 1HNWJ 1SJ1A 3DHXA 3ENWA 4ZHRA 1NSKL 4WXOA 4NMXA 1SJRA 3W9HA 1TV6B 4YHHF 1DQ9A 4PYDA 4H4MB 3R5BA 1S10A 4F04B 2AJFE 4O3NA 4HT5A 4F2SA 3EZOA 4Y2KA 2DGWA 1L3VA 4DCPB 1HBMB 1S1TB 4IDKA 2FPHX 5IQ6A 2VFTA 3A3NB 2NLWA 2AV5A 2W2QP 3G82B 2DD8S 4ELTA 3PM9A 4WYLA 3WHIA 1BMQB 2R7TA 2EFNA 3BPSP 4FPRA 3BO2A 3DOKA 2F9JA 1RT4B 3CCES 1B4SA 3R6LB 2VC0A 5A76A 3CUNA 2AKWB 1XC9A 4ECXA 3B78A 3KHRA 4K7QA 2LXFA 2BV3A 2YKMB 2R7QA 3CD7A 3BGUA 2HZAA 1Q4RA 3HP6A 1VRUB 3D7SB 1T03B 2QL9B 3CCMS 3KLIA 5F9LA 3C15B 5IT0A 4CYUA 2V6AA 3UN3A 5GAGU 3D66A 2VC1A 4ES1A 1IJFB 2CWKA 2G0JA 3RB0A 4CRJA 4OZ1A 1URNA 3BPDA 1S4EA 1CJVA 2HHSA 5HJYA 2HS4A 1NU4A 3G8QA 1C1CB 5EDWA 1U0SA 3W2VB 1SUQA 1RYSA 3QQCD 2OP5A 4J9KA 1WSRA 3TWZA 2EG2A 2JX2A 5J2QA 2Y1IA 4ES3A 2XNRA 1HHTP 3M30A 1Q7YT 2YNIB 4FDFA 1C4AA 3GIJA 3OJSA 2ZH9A 2ZJRQ 5LM7E 1QSYA 3OHAA 1O0PA 3NNCA 4MMOA 1I1GA 1N5YB 1TKZB 4Q8EA 1WC4A 1X5SA 4DPYA 3UN2A 4MIAA 3TA1A 2BBEA 5HQLA 4PABA 4QPXA 3WIVA 4CH7A 3MGJA 2FJXA 2HHWA 2W2PP 1EKRA 1KLNA 5ETPA 5FIIA 3D6TB 1NB2A 1JLGB 1SVDA 1GMUA 3X3UA 3V6HA 1TKTB 2B43A 2LDYA 4DMZA 2VBZA 3NKYA 3H90A 1OWXA 4PG6A 4DL3A 2DPIA 2XSFA 4JI1J 3ZC4A 3EJMA 1SJQA 3QGHA 4JBCA 1U49A 4QYZK 2RQKA 5ETLA 2ZBPA 3I56S 2OHDA 1QE1A 2WVFA 2G9OA 2X3DA 4ZP8A 5LMNJ 4CO1A 1MN9A 2BR0A 1BXNA 4HI2A 4WIIA 1RISA 3QJJA 3BGFA 4WU3A 2EK6A 3O8WA 3EDRB 1RLCL 2DNOA 2DNGA 1X4DA 4LT6A 1FERA 1V5VA 1DQAA 4WKRA 1FXDA 2Q1LA 3MEDB 1U1RA 2AYGA 2BW7A 1XMOF 3GG1A 3A8EA 2XEXA 3ZZ0A 2O67A 5C42B 1JLFB 2DISA 2RQ4A 4C97A 3PX0A 1C0UA 1R43A 4M5KA 4WYWA 2NXEA 4NYZA 2QSFA 3IA0A 2YWGA 4YHHJ 3SV4A 3T3FA 4L72B 1MU2A 5D0GA 3HJVA 3M6WA 3EZUA 3J81j 1SKUB 4DOZA 2EKYA 4EO8A 3M2VA 2DB1A 2VA2A 2K1RB 1RABB 3NLCA 3M9NB 5HMYA 2QG9B 5IC4B 3PV8A 1ACMB 4NCGB 4ERDA 3LWMA 2UUCF 2DO0A 4C0OC 2RB7A 4ITSA 4FXDA 3ZZOA 2YVSA 3M8QA 5BR8F 2RHSB 2COLA 2FD2A 3H5SA 4ZPCA 4DV0F 2Y8YA 3QSIA 3HFVA 4B3TF 2Z58B 3SQOP 2RQCA 1RT6A 2HGMA 3I31A 5DGBA 3HHDA 3VVUA 4ZCLA 3R5AA 2W7AA 5F41A 4Q43A 3MR5A 4DV5F 2QT7A 4RW9B 1NDPA 1EX8A 2PC6A 3AJ2A 3EGZA 1H7WA 4ZVPB 3AQPA 4B9UA 3BGOP 1TR0A 2J9DA 2M7SA 3QGIA 2M52A 4NI2A 4MK7A 5F0UA 2MPUA 4UOHA 1HMVB 1HYSB 2AGQA 4A8KA 2RH3A 1OPZA 4KFBB 2MSSA 4Y2MA 4CIOA 1VS3A 1A6LA 4CO3A 1LXJA 4DQIA 2VB6A 2AU0A 1PAUB 3CJSA 2HQDA 2B7CB 2MXYA 1UVJA 1HR0F 3LGMA 2W9AA 2G13A 6AT1B 4DL2A 4ZIVA 3H5YA 2YQ3A 2ADCA 4FYVB 3OLAA 2F5GA 1TU0B 1BQNA 2FHJD 5CAAA 2NSCA 4FYYB 1EARA 1UL3A 2GCFA 3OBIA 1ZH5A 4FYXB 3CJ2A 1S6PA 3ISNC 3QT7A 1S9EB 2KDOA 4USHA 3DGVA 2O1PA 3Q86A 2BVZA 2QZ8A 4QBUA 4RNMA 3KNGA 2AJQA 1SH0A 2H51B 4RUHA 3SCIE 5G0RA 2NPFA 3OVSA 2FYXA 2C1EB 1JX4A 1IBLF 4MJKA 4ZCMA 1NKCA 3MCMA 3E8OA 4WPAA 4BHQA 3FKBA 2EBEA 4PUOA 1RTDB 2J9DE 2KXHA 1Q95G 2D7SA 1GXLA 3EGVA 5CCLA 3T5KA 1N0UA 4QR1A 2HFSA 2HYIB 3C14A 4F36A 4NLPA 1AUDA 1ZM3A 4KHPF 2KHDA 3ETMA 2P8IA 3FJ2A 2C3OA 3L7PA 4X66F 3I96A 1CC7A 4NX9A 4PXDA 1DLOA 4EBCA 4K2XA 4LF4F 1BQMB 4HACB 3JSBA 2NXUA 3PW2A 4LF7F 4G1IA 1EZZB 2MZRA 2VG6B 4YEAA 1JKHA 1WNEA 3AXKA 4WK1A 1QY7A 3FRZA 3GIIA 2RS8A 3R97A 3KK3A 3FZBA 1GX6A 1B7FA 5C2CA 4F3OA 2R2TA 3CO9A 1XMOJ 5KFNA 1KS2A 2IYIA 2OAUA 4ZP9A 4WIQA 4FPIA 4DSKA 2GJFA 2FJVA 1JIHA 2ZZMA 2DJWA 1RTIB 2BE2B 3K17A 4FXVA 4DUYF 3BQ0A 2WCXA 2FGOA 3UD5A 2W9CB 1CSJA 4E98A 2IM3A 2EXUA 2UUWA 5EX0A 4LRAA 3MR6A 5IT4A 4KBIA 2CPJA 3JXOA 1KLMA 1KTQA 2J76E 5ETRA 1UTAA 3I55S 1Z1ZA 1HLWA 1S99A 2KZMA 3M8SA 1CJUB 3OW2R 3GR0A 5GAHU 1XQIA 4P2SA 1PO6A 1YZ6A 3DI6A 2V8GA 2M3DA 3BS9A 2D3ZA 2IIHA 4DV1F 1S6QB 4MH8A 2DXEA 3CCQS 5AXMA 4DV0J 4LFCF 1RBLA 5RUBA 2HHVA 3RZAA 3KKFA 4YS2A 2PMZD 4F4XA 1RWWB 4RW4A 2HURA 3TVKA 2IDEA 3PKYA 2IVMA 3DXSX 1D3WA 2YKQA 1RWKB 1N52B 2AX0A 3QO9A 4ED7A 1ZETA 1F9HA 2YPZA 3VHQA 3IRWP 4TVAB 2QLXA 4CNZA 3IFEA 4YB6A 3FK4A 5HBMB 5CD4H 3FBFA 1BE4A 1AA1B 2N7CA 3CD5A 1TL3A 2R8HA 1KC8T 1HR0J 2LA6A 5SUHA 1SIZA 5IZHA 5HP1A 3MAQA 2JNJA 4CWBA 3THPA 2ASJA 3CIZA 1OY8A 2FJAB 4X84A 1W2IA 3IG1B 4C0HA 4F4ZA 4H4OA 4ZPBA 2F40A 3CJ4A 2XS7A 2HVDA 3GJTB 1YI2S 4DPOA 4X4SA 2XS2A 2HMIA 2OGUA 3M05A 4C0BA 1PGZA 2IVFB 2UP1A 5EN1A 4LBPA 3R1HA 1DHMA 5KT2A 1NXIA 2XSJB 1U1PA 3PXGa 4LRBA 4K4ZA 3HVRA 2KI2A 4ID8A 1YQHA 3D3BJ 1IBLJ 2KXFA 4KRWA 1GFWB 2CZ9A 4BLGA 1FNOA 2VICA 2NYHA 1JLCA 5AJ3F 1VJQA 3QLHB 3MM9B 5J2PB 5J2MB 1N48A 4QWDA 4X4QA 3VCDA 2BM0A 1Q53A 2MZSA 2XGQA 4KO0A 2KM8B 4X4UA 2OPPB 2V69A 3EX7B 1Z2ZA 4KHPJ 3DU5A 3JS9A 3RB6A 1FJGF 2QTWA 4RZRA 1HD0A 1MNEA 1LWEA 2ZD1A 4X66J 4F3MA 2DR5A 1JJ4A 4MK8A 3R5DA 2EW9A 2YNHA 4PEOA 1XEZA 4LF4J 3K57A 2F8HA 4G65A 4LF7J 3CE8A 1E6VA 5EHHA 2BABA 1VQNS 4U96A 3WC0A 2FUG9 1UEVA 4IG0B 1RWMB 2ZE2A 1NRKA 1NSQA 2H9ZA 2CQPA 4USUA 1IKVA 1M5KC 1RQ0A 2BANB 2DGTA 4FBTA 3OUYB 4CT9A 4ZJLA 2KM8C 5GADI 2MMYA 3HHLB 1UVKA 1WWHA 5DDPC 1P1LA 3QZ7A 4OHXA 1OYDA 1DY3A 3I0SB 1SV5B 3R5JB 2FC8A 3KLHA 1FFWB 2HK3A 2BUNA 4DUYJ 3E51A 4ZVEA 2ZHAA 3TR5A 2DO4A 3VAMA 2D3UA 3ZTSA 2DNNA 2ZZTA 3C6TA 3AHPA 2GMJA 2N4CA 2IJFA 1UETA 3J7A1 3EMTA 3T5JA 2XYGB 3I6PA 3J7YU 5FDLB 1C1BB 4XPEA 2C42A 3HK2A 5F8GA 3T9NA 1L5UA 1S0VA 3JSYA 3D54A 3MEGB 1REVA 4B08A 1FVSA 2RSQA 3HHLC 2RHQB 3R5CA 2ZM6F 3UFCX 2CJ9A 5D77A 3L09A 4DV1J 1KQKA 2CADA 2VDHA 3QWUA 1C0TA 4LQ3A 4LFCJ 3CJ3A 1RE1B 3MD3A 4YDDB 4LRDA 3R7NB 1IKYB 2YKAA 1B0PA 4CTAB 1H2UX 2K06A 2FHKA 4JI2F 1H6KX 2BKPA 4ECUA 3NWRA 2QSWA 1KOOA 3AB4B 3OFFA 4X64F 4K5RA 1U0HA 4L3KA 3LTOA 5F8LA 1CQNA 4NZ0A 1NK6A 3NMRA 1U6BA 1VQSA 3NCRA 3VAFA 2MB0B 4NRUA 5BYSA 1N32F 4YQWA 2LCWA 4WE1B 2YX4A 1J2VA 3CMES 2DGOA 1NUEA 2YNGA 4NA3A 4WFBQ 2V8DA 1EJ7L 4W90B 2HHTA 1N8RT 1X5OA 3NNAA 4I67A 4NLYA 4ED0A 3UWTA 4Q7AA 3C19A 4EYHB 4CT8A 2R2UA 4P2XA 4D3HA 2O3DA 4RW8B 2DIVA 4PG5A 4DX8H 5A6PA 4RUCA 2J7KA 3WX8A 4NLGA 2G4BA 4DDFA 1QAXA 3HVTB 2F3JA 1MG7A 3QT8A 2DNKA 2VPYB 1FFGB 2B56A 2R42A 3MFHA 2XC9A 2UV8A 5A8KB 1OO0B 4OZ3A 1ZOTA 1M1KT 1D09B 4QIEA 3GIMA 4I6AA 4ZPTR 3QBCA 2UVUA 1VIOA 5HVFA 1NK4A 2ZHOA 2DGSA 3OV7A 5AJ3J 2J0XA 4H54A 5G4DA 1TAQA 1RK8A 3TA2A 4ZLPA 2I8EA 1DRZA 4DF8A 3C2PA 1IR1A 4TLRA 2ADBA 1FRJA 1S6OA 1EB0A 2AF6A 4ZDNA 1FD2A 4WZMA 1P27B 4I2PB 2DYAA 3AA9A 1URRA 1FK9B 3DLKA 5D4PA 4C8NA 1EETB 1WDDA 1V3RA 3IGVA 1S0MA 1NM2A 3E01B 1DBDA 3IXQA 4DX7A 3KJVA 1KBRA 3G2XA 3AOCA 3KLGA 4IR1A 3W63A 3R2DJ 1NB7A 5E2QA 3B54A 2J7UA 2KVIA 2QL5B 2BJ1A 2W2NP 2FLPA 2R4FA 3FQKA 2Z2ZA 4EGLA 2CZVC 1HQ2A 2WW4A 4X65F 3DCAA 3FGVA 1RT3B 2OTJS 2ZUAA 2EC0A 1XN9A 4ICLB 1HPZB 3OL8A 3PYDA 3HM9A 3CMAS 3O1LA 5KFLA 4HDHA 3RGIA 3V5RA 5KG3A 2ROPA 2XMJA 2FJEB 5CZVA 4KT0C 4LVOP 4ZK7M 2JEIA 3C6UB 2HSEB 1U24A 1W2BR 1Q8IA 4M1KA 1HBNA 2ZM6J 3GYNA 2DH8A 4M5DA 4D3GA 3UO0A 2CIMA 1NK7A 1O6XA 4CZCA 5J1NA 1T9TA 5KFWA 3JSMA 2GS8A 1IM4A 1OQ6A 2MKKA 4IH5A 4P6QA 2Y0BB 3PYEA 2RT3A 2XBPA 3PCOB 3KLEA 3SSSA 2MQMA 3PRVA 4KGVB 4X64J 2CG8A 4B17A 1RKIA 2J8AA 5HN0A 1HI0P 3AD8C 3C16B 2DXDA 2VHGA 1HNIB 3U27A 2CPDA 4IQMA 3EGNA 2HHHJ 1M5HA 1HQUA 3TA0A 2YQ1A 1KRPA 3LP2A 1HNZF 2YY3A 4DU8A 2MKCA 3C3LA 3SQGB 2VG7B 2YKNA 4WBFA 2CNNB 5L1IA 2WZ1A 1N32J 4OV1A 4LRCA 3NCQA 3POTA 3P5TL 2M8HA 5LMUF 4B3MF 3ILIA 4I7FA 3MUMP 1RUSA 2VFSA 3T6BA 2A3JA 1TK8A 3MMCA 1X9MA 1U2RA 2DGUA 5BYRA 2QFJA 1Y11A 1BD6A 4DL6A 4J9QA 2VONA 4I2QA 4RWXA 1JLEB 1RWNB 1U2CA 1UKUA 1N5SA 2XYPB 4CLFA 2PMHA 4ZLJA 3I4HX 3BGLA 4YR2A 1YVFA 2ZVIA 4JI0J 3MM5B 3W64A 1X4AA 2UVWA 3GB0A 1N34F 3M6UA 1RWPB 2I9SA 3PACA 2CJKA 2OMLA 3RR7A 3TQEA 3QT6A 3KWMA 4MKYA 1UW4A 3NS6A 4WU2A 3GSIA 3MOZA 4BWMA 4C3LA 2M9KA 2AZ3A 2JLFA 1UAWA 1GMWA 3RRKA 2DEIA 1C2PA 4RJVA 4I1TA 4FF2A 4HT7A 4C8MA 1P1TA 1X8DA 2DNQA 3CDEA 5D0EA 1P8GA 1CJKA 4YB1P 4CLTA 3FFIA 5KFIA 2ZNYA 4KH1B 3ZTOA 2X1FA 5HK4A 3PR4A 5I42B 4O44B 1U8SA 1QM9A 3IR6B 4DSFA 2L9WA 3IC1A 3BO4A 1A9NB 3TAMB 3N4WA 4ETXA 3M9MB 1SB6A 4RR5A 5B0GA 3FQLA 4RNNA 2R2RA 4DQSA 4JI7F 4KGMA 4JB8B 4CDIA 1F3VA 2NCKL 4F7VA 1CJTB 1KDNA 1VRTA 4P73A 2DGXA 2RDDA 3LH2S 3UR0A 1Y10A 2RAQA 2VZ9A 3I0RA 3DYAB 3RTVA 4USJC 3PJWA 2X3GA 3QJLA 2ILYA 2HS3A 3G86A 1DARA 2B3TB 2E66A 4Q8FA 3CJ5A 4IO1A 2DEJA 4DR3F 2N7YA 4JI3F 3MXHP 4CLLA 3ZTRA 1U02A 3OXLA 3DOLB 3BDPA 4Z7YA 2WW8A 2VASA 1DQ8A 5CYMA 1FVQA 5B0EA 4K50A 4DEZA 2DCUB 3HLUA 4X65J 3PHEA 4JUZA 4PWDA 2CYYA 2HFOA 2V8PA 1SH2A 2E9ZA 3I4PA 2QV6A 4Y3CA 3G96A 4NCAA 3VWSA 2ZFHA 4IFYB 2W01A 1WSVA 4EO6A 4LF5F 1HNVA 4OIXA 3SCLE 4FF1A 2RE1A 2BXJA 2B4PA 1HWLA 3NRBA 2MQQA 4YR0A 1NMEB 5CD4A 3VR1A 3PFOA 4JI8J 3LO3A 3W60A 2OMOA 3N6NA 1T11A 3T6JA 3CIMA 3IO1A 3QATA 3DDNA 3ENVA 2WONA 3OR2A 1S12A 3MPDA 4PYAA 2CJBA 1UVLA 2HHUA 3BH7B 4P2MA 4I6YA 2CJXB 5IM0A 1U1KA 5CQGA 3L95X 2HVEA 1SQGA 3D6HB 3KNAA 2VL1A 1HNZJ 5ETVA 2GQCA 4ANDA 4DFMA 4L73A 1LFPA 5LMUJ 1ZPVA 3GFYA 1Y5IB 2BYCA 3OLBA 4OV6A 1HBMA 1S1TA 4DX5A 3IWNC 3G82A 3S1TA 3K0JA 3QIPB 1VR6A 3X1LB 5E3PA 4YN3B 1QDUB 3MMAB 5GVQA 1RT4A 5GAEI 2FGCA 2VFRA 3AFGA 3PIPQ 2I5JB 3B4DA 2QLFB 2YKMA 2YPYA 1FNXH 4IUFA 2OEKA 1Q79A 1N34J 5T7LB 2XTJP 5ETSA 3W65A 1UWBB 1FKOA 1T03A 4K2JA 2CVIA 3EUNA 3C15A 2I6WA 2MTLA 1S59A 3MWBA 2V50A 2E29A 2BZ2A 3M32B 3SYZA 3MM7B 2V9WA 1WG4A 4NXNJ 4EZ9A 3MUVP 4B02A 4BC7A 1HBUB 3EVWA 1ZAXA 4WF9Q 1AZSB 3HVWA 3W2VA 2OSQA 4X2BA 5A8WB 1RT5B 1G2EA 4KHMA 4LBHA 3DM2A 3AODA 1U47A 4CLKA 1OY6A 3CCZA 4J7CA 2QA2A 1S1VB 1R6VA 4FYWB 5E3CA 1CBKA 5L39A 2YNIA 2GZOA 3FEXB 3M8YA 1DTTB 1TL4A 4NXMJ 4Q0BB 1O5JA 1HWKA 1QD1A 3RYLA 1UZDA 1NBEB 5KFEA 2F63A 4UT4A 2DR8A 4TY9A 3J81U 4Q45A 1TKZA 3HO1A 4HTJA 3OFHA 2LXUA 5AE3A 3FBCA 3HMJG 2DR6A 4DS5A 4ANEA 2W8KA 2KFZA 3SCJE 1B70B 4KAIA 4V1Ak 1T9WA 4FZVA 3VTIA 4C2MA 1NHVA 1TTHB 3O5TB 4ALZA 3GE9A 4ANCA 3W9JA 3PO4A 1ICEB 2GAHC 1TKTA 4KV8B 4JI3J 3DRSB 3KYLA 2HZCA 4J9SA 2XG8A 2CAJA 3OVAA 3A3PB 1A0OB 1OS5A 5D4OA 5T14A 2L08A 3TX0A 2UV8G 5E3QA 3W2WB 2ZKTA 2XI2A 2XLKA 1ZZFA 2CRLA 2CQ1A 5LSRA 4DR5F 4LF5J 2HWHA 1LK7A 4OZLA 3GIKA 2AMCB 2R8JA 1MROB 1U48A 1VMBA 3BKTA 3J7AN 1S72S 3W5XA 2IRUA 4N8NA 2J9EA 2QYGA 1R6YA 2DNPA 2XCPA 2AD9A 5JVGQ 3Q8YA 5EWGA 4Z2XA 2W25A 4ECTA 3DLEB 2GVZB 3ZTPA 1GTEA 1TFYA 3IRXB 5C42A 2LMIA 3GCXP 4QIVA 1JLFA 4GKKJ 3MR3A 2IDLA 1UPMB 1UVIA 3KJQB 1KEKA 1TQLA 2UXCF 3JQKA 2CQ0A 1CULA 1K1QA 5KT6A 1QUPA 1G3OA 1AW0A 4KY3A 4K0KF 2RKIB 1VK3A 5J1EB 2K1RA 3TARA 4ZITA 3PW0A 3EICA 4JI5J 5F8NA 2Z30B 1X4BA 2HBQB 4NCGA 3ONQA 2AYMA 1T9UA 2VDIA 4ZPAA 4HEA9 2EG1A 1WORA 1OJ4A 4CH0S 2YQ0A 4LSNA 4P74A 4ZMMA 3TW0A 2D3O1 1YZ7A 3KXDA 5B09A 4BBYA 4WFYA 3DOMA 2Y9HA 2E44A 3MPWA 1TKXA 1F9EB 1SQFA 4UZBA 1ZM9A 2FIUA 2HGLA 4LIRA 2FHMA 1Q16B 1ZA2B 3R2CJ 1PG5B 2CQ4A 2BACA 4ELUA 4F0KA 3BREA 3IM8A 3CGIA 1VK8A 1HMVA 1R0AA 1HYSA 2K3KA 4ZHRB 5H9FJ 4KFBA 2QMXA 1AUSL 1IQTA 5GADU 4B3RF 1T94A 1GAOA 2ILZA 1FF2A 4DQPA 2ROEA 5A8RA 4AUKA 2RDIA 3GG0A 1TK5A 2WSFC 3PDNA 4B9NA 3CDAA 4DV4J 1VQPS 1DURA 2X1GA 4W98A 2EVZA 5GMEA 4NE9C 2H5JB 4DU7A 5C24B 1L3TA 3DNCA 4WWSA 2IVYA 4MFBB 1V3SA 4NLWA 1Z4UA 3MAAB 2IAJB 5DG9A 2XMKA 2LQ5A 2J6UA 3MM6A 3EYZA 3QGGA 4P7VA 2PFFB 1OMSA 4GMKA 1Q81T 2DITA 1UJ4A 3R8YA 2FJDB 2EFGA 4NA1A 2UU9F 2FQQB 4ILRA 3UDCA 1EQ0A 5KFDA 2H4WB 3HSDA 3KMQA 3CVKA 2AYBA 5LSLA 1HNXJ 4KE5A 2JFKA 4DPXA 3TVZA 1RTDA 2E1RA 4A8WA 2KH9A 3VVTA 1RT7B 3R7BB 4MIBA 5I3QA 3TUPA 3GYGA 3GFHA 4ZJQA 3D1OA 4IOCQ 3ET6B 1NAQA 3R5GA 3BO3A 2XHWA 1YJUA 2HEKA 4JI6F 2AGOA 1BQMA 4HACA 3BGRB 3PTWA 4E2FB 2W4CA 5KFBA 2DHAA 3L7UA 1K44A 1IVZA 2A6MA 1SPBP 2VG6A 5C25B 1HW9A 5C5JA 5HL7Q 5KT3A 2NZCA 3D3CJ 3A3OB 4PCQA 4ZOSA 4Q2LA 3OTDA 4EFAC 3NP5A 2Q6BA 5L8RC 5ETKA 2V0NA 4I4BA 3KHLA 1M1HA 1NDLA 5H9EK 4IQXA 2HWIA 5B08A 2JLGA 1H38A 3A8IA 1RTIA 2BE2A 1EAYC 4DR1F 2IRXA 3BYRA 2UXCJ 1D1UA 2W9CA 1JLBA 2V94A 3CCWA 2EFVA 3JSRA 4K0KJ 2EWHA 3MF5A 2ZDPA 1UP1A 4HVZA 3SXLA 4CO2A 4DV7F 5AE1A 1JNZB 1CJUA 4UY85 2I0XA 2R7RA 4I69A 3CB4A 4PXCA 1BWVA 5FJ4A 1UCNA 4NEZA 3GPAA 4YB7A 4B9SA 1VQLS 1S6QA 2OPQB 3F73A 5D78A 4OFZA 3EWGA 2DY9A 5CA5A 1NJIT 2B5JB 2CPZA 3HHEA 1FE0A 2WVBA 7FDRA 2GJIA 2GX8A 1G6BA 4J9VA 2E7WA 4DL4A 1T9VA 4CLZA 2DRBA 4HHUA 1YKWA 3NBPB 4KH0B 1D8ZA 2VD3A 4JI4F 4ZVSB 3MCNA 1C0UB 3HULA 3L9ZA 2YKOA 1BWEA 3GYXB 3CCRS 3BM7A 2QLWA 4HH0A 4A8YA 2CDRB 3OFEA 5KFMA 1VLYA 1OQ3A 5KFUA 3M2VB 2V34A 2IJNA 1FRHA 1FDNA 4DV6F 3PRBA 4RPFA 4E8UA 4DCOB 1W7WA 2HRYA 3IG1A 3MD1A 3N28A 2ASYA 2JOQA 1APSA 3BKFA 4OYWA 1NK5A 1FDDA 3D6MB 3UQSA 3H40A 2RVJA 3G6ES 4TYBA 1Q82T 3B4MA 3OL6A 1RT2A 3GJRB 3VGTA 5IFMA 1RWOB 5EX3A 1H73A 4UY8T 1LWXA 3UDEA 2UU9J 2B4OA 4XO0A 2XSJA 4N76A 5KFCA 4L74A 2WRMA 3BBBA 3H2LA 2I1RA 1QAIA 3JYTB 2BE9B 4BWJA 3HDSA 1KR4A 5DG8A 5K8PA 1VRQC 1EP4B 4DSJA 5DQHA 1NH7A 3MM9A 5J2PA 2JLEA 3ITHB 5J2MA 3MECA 1B7YB 3QAEA 4NI2B 4OYXA 5L38A 2C2EA 1KNZA 2BJEA 2OPPA 4WTOB 4NLXA 2DNRA 3TZWA 2V2VA 2AYEA 2G0IA 3PIOQ 3N6MA 1VQYA 5GMKa 1SJ3P 1FTCA 1IN0A 4DX6A 4K4XA 2H54B 4AL5A 2Y1LB 2A2DA 4QQBA 1T05B 4LR7A 2N4DA 2DNYA 2ZBCA 2PA3A 1ITPA 3KFWX 4IG0A 4HHHA 1AFIA 2JJ4D 3IN5A 1BQNB 2DXFA 2Z0GA 2BANA 4F3QA 1GMWD 3HD2A 3OUYA 3VZHA 3PR5B 3ZZTA 1YRUA 1X4GA 3ZZUA 2RS2A 3LA0A 3Q8SB 3TJAA 5G0RB 3W7BA 1SV5A 1RBOB 1WOPA 4DR1J 4AL6A 2LU1A 1XJWB 3TEGA 4PUOB 5CABA 3CDWA 2CPEA 4N77A 2K3IA 1FT8A 4DJBA 1G1XA 3W5YA 3FCHA 3DRYA 2UUBJ 1TELA 5F9NA 3IMQJ 1Y4ZB 4DV7J 2FVPA 2V5HG 1A7GE 3C14B 1RT1B 5FDLA 1IBKF 4NASA 3EPIA 1C1BA 3KUGA 4ZJOA 3EXCX 4UQGA 4N8OA 4FF4A 1NKEA 4CH1A 5LL6d 3A8JA 3JTOA 3MEGA 2MGZB 2KTQA 4ED6A 3RJMB 1HWUA 3OTEA 1TFWA 1N6QB 4RBVA 4CCHA 4A8FA 5GAGI 4X4OA 1UEKA 1LW0A 2R7OA 4OZJA 2BEFA 3BN4A 1JKHB 1MMNA 1IKYA 5D6GA 1RKJA 3S8SA 3KHGA 1K0TA 3R3TA 4XPCA 4JYAJ 3D0HE 3KK3B 4DV2J 1DZ5A 2LQBA 1RCOB 4P52A 2MY7A 4ATNA 1QAJA 1Y00A 1Y3KA 4KGXB 4JI4J 1TZ0A 2QA4S 1IKWA 4RO0A 1IJEB 4DPTA 2W1BA 3U1LA 1YSJA 3SDEB 4Y6IA 4ETZA 4GVLA 5A2QU 5CYJA 4HKQA 1F0XA 1KLMB 3ZZPA 3OTCA 1UPPA 3TJ9A 4NWBA 2XWXA 2KG0A 3GWCA 2RNEA 1M5OC 5F8IA 5DO2A 3M8PB 5IWAF 5KFAA 4B3SF 1ZTWA 3JAMY 3DC2A 2D41A 5A8KA 1HD1A 4AQYJ 2W9BA 3Q83A 4OHWA 2SXLA 1WG5A 3DRXA 4ZIWA 1YJTA 3D9BA 2ROGA 1HW8A 3MMBB 3FC9A 3NGTA 2R7WA 3CJTA 5KFKA 1U6ZA 2CJAA 2VFVA 2A1BA 2PI5A 4WZQA 1NO8A 5HQ8A 4ZCIA 5DDQC 3PW5A 1ZS6A 1RZMA 2RUSA 3D4JA 4ZPWR 3KLVA 3ILLA 3BR9A 4UOGA 2LQ8A 4DR4F 2MHEA 5HJXA 3MR7A 2LQJA 4CQ1A 3TOQA 2KT2A 1NHKL 2CQIA 3LQVA 1X9SA 4I2PA 5HP1B 4RU2A 2VG5A 1CVJA 2QRRA 4RU9A 4J9MA 1XMQF 1WTBA 2V2KA 3CNQP 1EETA 3FEZA 1T9XA 4ECZA 3WZ0A 1SL1A 2CPHA 2UUAF 2WVCA 3ZTQA 4DFKA 2P9EA 3WX4A 4ELVA 1WG1A 1SKSA 1TUVA 2IM0A 4U7UK 2OD4A 4O0IA 1ELOA 3MOJB 2A2CA 3OSPA 5GAEU 4CO0A 1OIAA 2HRTA 3F44A 1PCAA 1LWFB 4TLQA 1Y9OA 2GGPA 2RDJA 2K7KA 2KN4A 1F2HA 2DBBA 1RB0A 3H2UB 3RB3A 3SEOA 4H4KA 2B7BB 4C11B 1FJCA 4ICLA 1HPZA 2E5LJ 4MKBA 3K2YA 1JJCB 2OELA 4PPZA 1HBOB 1WC5A 3NWGA 4IO9Q 1YJVA 1SC1B 3NG8A 2CQ2A 2HGNA 1LWEB 1JWWA 1KQGB 2AP6A 1VQ7S 2YNHB 4OX9J 1FXRA 3N5BA 1TK0A 3L3CA 4PG4A 4DZDA 4ZVOB 4HR2A 1E6VB 2ZWPA 3BJYA 6FDRA 2L41A 1MW7A 2M5YA 1LOUA 1SC6A 2H5IB 5K14B 4N5SA 1AROP 1PYOB 2C3PA 2BW2A 2EKNA 3DLGA 1M1GA 3DHWC 4U8VA 2H65B 2AHOB 2ZOFA 5FD1A 3L7OA 3K59A 4KIAA 1XNRF 3VAKA 2DIUA 3M1VB 1B64A 2VG7A 2VQEF 2IC3A 3OR1A 1HWJA 3CXCR 3MZIA 1FWPA 4ZP6A 3THTA 3BF4A 4RNOA 2B8QA 3M2UB 4YB5A 2IMWP 2EFPA 1D8YA 2MKYA 3MTJA 3CDBA 3FSXA 3PEJA 3N0VA 4ZVHA 3IWXA 4ECSA 1D9FA 5LOQA 1JLEA 4WKYA 3Q23A 2QJ3A 4EEYA 2EPIA 4J9NA 2HQFA 5T41A 1N0VC 1D9DA 3W1YC 3I5AA 1REVB 2ZITA 2GW8A 2PEHA 4F4KA 2EEYA 1S1WB 1NK9A 4JOUA 4AYBD 1U8WA 2E5IA 2F65A 2XGPA 3LWLA 3NL0A 2EFOA 3T1HF 4ZVGA 1RAFB 4AXIA 3H2VE 3UDLA 1VQMS 3CW2C 2J6SA 4P2FA 1OY9A 1C0TB 5B0DA 4K4TA 1JLAA 2C2ZB 4R0JA 1Q1KA 3T5HA 2YXLA 3UE2A 1R8PA 2ZBRA 4X4NA 2HHPA 3J80Y 5IV4A 2ZWOA 1HI8A 4YP3A 3KUEA 1UMJA 1MN7A 2FHJA 4U7CA 4DR7F 4LVNP 4CP5A 1O51A 1R8CA 2AT1B 4W92B 2PA8D 5DDRC 2ZOMA 4ENOA 1D9AA 5A0YA 1NJXA 4URQU 3M8RA 4LF8F 4I6WA 5M2RA 5I3UB 3PJXA 4RW6B 4QWBA 2V68A 3RW7A 4DR4J 2YNGB 1QVFR 1F5CA 3LW5C 5KG4A 5CXTA 2WSCC 3GR1A 4EBEA 3MHYA 5IC6B 2HNYA 2POKA 4OLOA 3WBZA 2VKZG 4A8SA 2ZNZA 2VOOA 1UA1A 2PMWA 1XMQJ 1VBXA 1N33F 2ZH3A 2UUAJ 3QRRA 2WSEC 3KDNA 1KQFB 1U1OA 5HANA 3TRGA 2A18A 3CD0A 4ZVUB 3MCOA 4BC9A 4JV2A 2GHPA 2OJ3A 3OD2A 3GMGA 2WBMA 3K5LA 2E9TA 3DOLA 4GKJF 4X4VA 3FMBA 4M5GA 1WF0A 3O44A 3OTBA 4ECYA 2NQPA 1NZ8A 1KVIA 3GQCA 3U1MA 5L9XA 5GAHI 5KG0A 2YH1A 1Y5LB 4FP9A 1IUJA 4IFYA 2XWYA 3JB9k 1RLDA 2WK4A 1RAHB 4M5JA 1Q86T 1SKWA 1S57A 1ZAVA 3DGPA 8RUCA 2HHQA 1RADB 4KSEB 4F0MA 2HWTA 5JXSA 1FESA 2PFDA 2OO4A 4WP3A 4DG1B 3HJFA 3CULA 2X1AA 1GNKA 4F26A 5KFGA 5U47A 3W8PA 4IOAQ 1HL6A 4DSLA 4WFAQ 4M5IA 1AT1B 1T0TV 2RD5C 3CC4S 3IBCB 4YFUA 4B3OB 1UZHA 2RJZA 2C2OB 3DLKB 3FCVA 2XO7A 4FXWA 4J9RA 5DZ7A 4LBIA 4A8QA 2HNZB 1VQ8S 3RG6A 1QSLA 3CSKA 5E0OA 2VPXB 3DLHA 1WEXA 4J9UE 4F50A 1XNRJ 3KLFB 1SXLA 2FY1A 1FKPB 1JXVA 4DV3F 2ALZA 4A4JA 1VLOA 3RBZA 3VAJA 4NLQA 1Q8KA 1JLQA 2BJ9A 3RAMA 2UUCJ 2GO9A 4F25A 4UF4A 2ACMA 2ZOGA 1W26A 1J5EF 3NXZA 3P3DA 2F4VF 3CT9A 1U25A 3KK2A 2ZC3A 4NLUA 2AEFA 5BR8J 3LF0A 2I5JA 4DLEA 3CJ0A 4K4VA 4B3TJ 4QYZJ 3LPYA 4ED1A 2N3OA 5T7LA 4BDPA 4ZN1A 4DV5J 2GMHA 3T1HJ 3LUYA 5J2NA 3JSMB 3BDEA 3H4DA 2WBRA 4C3KA 3M32A 1L3SA 1ZM2A 4U95A 3QRPA 1WI8A 3ILOA 3MM7A 2PGCA 5IOLA 2ZEJA 1L3KA 3KLEB 3M8ZA 4DI6A 3PO5A 5ETMA 1HBUA 5L9NA 2FLNA 4DR7J 1AZSA 3P5BP 2CWXA 1U2FA 1V6HA 4OX8A 5A8WA 1HQUB 1RT5A 4J9PA 4EMDA 3ZFVA 3JTPA 2BM1A 1UW9A 1WKLA 3TO8A 4LF8J 1S1VA 2YKNB 1WOSA 1TMJA 2CUYA 3POTB 3Q2SC 2C28A 4USTA 4R8UB 1RHJB 4IRDA 1DTTA 3P6YC 4Q0BA 4JP8A 2J5AA 2C2MB 2L48A 5BXIA 4HL9A 2FJWA 4I2QB 4KB7A 3PY8A 3H4BA 1L3UA 3K7RA 1YLXA 1FRMA 1FEHA 3OQ2A 2W7OA 4A8OA 3AH6A 2H3EB 2BKNA 4J91A 1RTZA 2BJDA 1N54B 2M8DB 1UA0A 4Y2CA 2HBYB 1QSSA 1JMTA 2QL7B 2M2BA 2UVRA 1KVKA 3KG0A 4Y0FA 4NLVA 2XYHB 4AT1B 4PWUA 3Q0AA 2GIRA 1T95A 4KV8A 1BLUA 1XWLA 1YRTA 4RW7A 4PRFA 1SBRA 1S5ZA 5L46A 2HAIA 5LT5A 2Q43A 4GKJJ 2JVOA 3J7YI 3DN9A 4WTYA 2A6OA 3DFEA 2XM3A 4K4SA 3WC2A 2LA4A 2X1BA 4OZ0A 2OSRA 2DCLA 2B9YA 4PG8A 1G4CA 4DUTA 2EC2A 4NZ7A 3RU0A 1MROA 4ECVA 1YDLA 4Y2AA 1Q5YA 3TAQA 4EYIB 3RBDA 2Y8WA 1Y5NB 3SSRA 3T1YF 2JEGA 1F5BA 4WP8A 5E3RA 1VOMA 1ZPWX 2EBGA 5HATA 4IH7A 5C7PA 2CXEA 1IQZA 2MQ8A 1SI9A 2MQOA 4IR9A 2G2YA 3RRHA 2AJ0A 1WF1A 2FDNA 4F4WA 1WJ9A 3DLEA 4FVMA 1K47A 1RP5A 3DRPB 4ZLNA 3OXGA 2NYIA 3O3LA 1I3OB 1S1UA 2J7WA 2V4JB 3V6DB 4USVA 3HI9A 4YOEA 1RTHB 3JQMA 1RA6A 3GFXA 3HSJA 4G1QA 3BSNA 1GK8A 2RKIA 4DV3J 3R1LA 4YY3F 1QTMA 2R7XA 3AB2B 4QPTA 1F6TA 4ECWA 4JI1F 2JRSA 4UUXA 3SFGA 5KFTA 3PG9A 5D3GB 1J5EJ 3DRRB 4PWDB 1I51B 2P2CB 2F4VJ 2DK2A 5LJ3Y 2QLJB 3TNVA 3HPOA 2RUGA 4TQSA 3DDIA 4ID5B 1IBMF 3Q8QB 4DF4A 4AXJA 3V81B 4N56A 4AL7A 3QSYB 1MMDA 3DU6A 2NUHA 3NOCA 3MCSA 2JDJA 4UQTA 1UVNA 1NSAA 2ZH1A 2ZH7A 1VQ4S 4M5MA 4DN0A 3MUTP 1PBAA 2VF3A 3FBBA 5HI7A 3OR2B 2Z8QA 4TXSA 3H25A 3CMQA 1WKJA 5EWEA 5ETNA 2ZZNA 1UWAA 3FNNA 5IM0B 2H4YB 4M63A 4OJ1A 2CPFA 2QMUB 2LECA 1OPIA 3JAMU 3OFGA 2CQCA 1XERA 2OKQA 3NAIA 4OLPA 5DQIA 2V67A 4A48A 3CC7S 2GIFA 4J5OA 3Q2TC 5F0WA 1RAAB 2VBXA 1FKAF 2Q66A 1PC5A 1YJNS 5C24A 3GFZA 3HVAA 2HFZA 3GLJA 4MFBA 2H1YA 3EXYA 4OYAA 3MAAA 2IAJA 3K5MA 3BN7A 3U1NA 1JQGA 1J5OA 1F60B 1GEHA 1K73T 4XTTA 2MZJA 2DVIA 5D4NA 2KU7A 2K2PA 5D0HA 3F56A 3LPEA 3SBMA 1NK0A 2XLIA 2F1FA 3K8VA 2XCAA 3W3SA 3PJ9A 3FSYA 1FKOB 6FD1A 3CWJA 5DG7A 2CQGA 5CYQB 5KTQA 5K5MA 4DS4A 2C2KB 3TX8A 4QZVB 1PILA 4L3NA 2RF2A 2XHCA 1GXTA 3BBCA 4RLEA 1WC1A 1RT7A 2BQRA 5KFOA 2BKOA 5HMXA 2W7PA 3UCZP 2YWKA 3NGDA 4X4RA 3M2RB 1D0EA 3ET6A 3O2IA 4KQZA 1YBTA 1N5VA 1FJGJ 3LP0B 3IAS9 3W61A 1KTVA 4MAKA 4Y34A 1RTJB 4IFVA 3DM2B 1B3TA 3HHNB 1PKUA 1DTQB 3BGRA 2OFGX 1M5PC 4F0HA 1SKRA 4LF1A 2KT5A 4CLSA 4OJ3A 2XZWA 2PEBA 5C25A 3ZZYA 3ADAC 3RBXA 2MEWA 1KSPA 4PQUA 4QCLA 2HHXA 4ZVQB 2CPXA 2FVSA 1DJ0A 1REGX 2ACYA 1SC3B 3T1YJ 2PDAA 2AW0A 2PT0A 4FBUA 3OL9A 2E7VA 1RU1A 2HBRB 4ES2A 2BX6A 3SFUA 2KFYA 3CJRA 3G6YA 2MJUA 1LKZA 2DHXA 3K5NA 2ATCB 4KKOB 4C8KA 4O4GB 2V63A 4J9OA 4B9MA 1VFJA 3GV5B 1H2VZ 2AJ2A 2MYFA 1YX2A 2JC1A 3HHKA 4V19X 2CJYB 1S49A 3EDQB 2E5JA 5KG5A 5L1JA 5HROA 4YY3J 4UW2A 5HSPA 1U1NA 4C98A 1LWCA 2RRAA 5E5NA 1WHVA 1X4EA 2PN6A 4LIWA 2FY8A 4USIA 2DNLA 4TN2A 2FZKB 1NDKA 5D15A 4LUBA 3FEYB 2GC8A 1U7LA 1IBMJ 5JMNA 4DFPA 2OPQA 1QUVA 4URGA 4DXLA 3H7HB 2I2YA 3MM8B 4ILMA 2B8PA 4M8LA 1PC4A 1FFSB 1M5VC 2B5JA 1PJ7A 1RHQB 3TZXA 4JI2J 1VBZA 3E3XA 3QIDA 3QAUA 2GVDB 3MURP 3PYGA 4OHYA 2ABYA 3MPYA 3GIRA 3M4XA 1TAUA 1NDCA 4K8RA 4O3PA 2ZDOA 3IAM9 3NBPA 4OJGA 2IM2A 4TU7A 4DR6F 3K58A 1FTRA 1GT8A 3HKWA 2JZ5A 2B4UA 1S1XB 1FDAA 1X60A 4Y00A 5LXYA 4X4PA 5IV3A 2HG4A 2VV5A 2Z2MA 5EGYA 2E1CA 1CULB 1OYEA 3LALA 3UVJB 5IT9Y 4DFJA 4F2RA 2J6TA 1RHKB 3HSGA 2P9CA 1H0HB 1S9GA 3MMJA 3J80U 1PJ5A 2R7UA 2V2ZA 2XULA 4TQRA 1EKSA 2YX7A 2VBYA 4HDGA 5KFHA 3I87A 1U1QA 4LSNB 2AQ4A 2E1AA 4Y2IA 3DMJB 4EUVA 3LP1A 3AD9C 5FLXY 2E1PA 3DOMB 5KT4A 1BHNA 1TKXB 3ETOA 4ED5A 2MKJA 4R5PB 2GIQA 2AEJA 3U7JA 3NCPA 2YWHA 4LSZB 4FYDA 1VBYA 4DN9A 3JYTA 4RUBA 1GX5A 2HPUA 2A0FB 1EP4A 4AFFA 2OPSB 1KD1T 2RILA 1LQ9A 5HLFB 3CEDA 1M5SA 3BSCA 3ITHA 2ZH4A 4YDXA 1R0AB 4JV1A 4YR3A 2CKWA 3GONA 4L75A 1U45A 1TVRA 2WB1D 4ZS6A 4DL7A 5A8RB 4NLRA 3K89A 2J0QD 4I0WA 1SL0A 2BE7D 1TMMA 1LW2B 2FZGB 4EWTA 5LXRA 3QYYA 2Q6CA 1RAGB 1T05A 2MLZA 1ZA1B 3PRDA 1PYSB 5KFSA 4DCJB 2NXJA 3SSQA 2GFFA 1PYTA 2WTFA 4NLOA 1G7CB 2E1MC 2IBOA 1V3ZA 1JJ2R 2BJ8A 1WHXA 4U6PA 1AB8A 4OI1A 9ATCB 2XMAA 3MM6B 2AWZA 2HQ3A 2BDPA 1RHRB 5HMZA 4P75A 3KHHA 1M0SA 4LQ9A 1X4HA 1F2GA 4OYZA 4DQQA 3QT5A 2Q3PA 2HW3A 2Y1JA 1CS4B 4MKAA 3AY0A 3GV8B 2V4QA 4X62F 5K9FA 2V4RA 5KG2A 3N01A 5DQGA 2DGQA 2LDIA 2ZVSA 1X9WA 3FZ2A 4XDCA 3CO0P 3T9ZA 2D9OA 3NS7B 1TL1A 1RT1A 3IR7B 1CLFA 1VISA 2B4VA 1K1SA 2MGZA 2MHNA 4ER8A 1FJ7A 3QMQA 4LJMA 2ZH8A 1N6QA 2JH3A 1MSWD 4OHVA 3FCWA 4IG3B 4I64A 1U4BA 4K4UA 2WB4A 1YRXA 3TP2A 2B6AA 1NK8A 1TP7A 4A46A 1OSCA 2DH7A 1NPPA 1X31C 2UUTA 4P7TA 2B0GA 2W4PA 3HZEA 4NMLA 4CM0A 3KK1B 2HNDB 4DZ6A 4OL8A 1X7VA 2FLLA 3EVMA 1XTZA 4J90A 2KRRA 3M7VA 2JL9A 1TV6A 1MWZA 2HQCA 3HFKA 3FBEA 4P72A 1KOHA 5DM6Q 1JJHA 3RW6A 3W5ZA 4H4MA 2M4MA 1U26A 4DR6J 3KJNB 3MEEB 2BRKA 5KFQA 2LEPA 4B3MJ 4DUZF 4OI3A 2QLBB 3HCXA 2F8EX 1YJ9S 4HH1A 2AEMA 3SDEA 1R0BG 1JLBB 4NCBA 5ETOA 3B8HA 3D0IE 2NXNA 3RBEA 2O66A 4Q5VA 3D67A 2R7SA 3NMAA 4LSLB 4M5HA 2L3MA 2HBZB 1VC0A 4DLGA 1K9MT 4OZ2A 3MI7X 3M8PA 1VRUA 2JFDA 2ZH6A 3PNIA 4QJVA 2RRNA 2J9CA 2R8IA 2GAGC 1N36F 4PR6A 4K4WA 2VODA 1P6TA 3W8GA 5H1SV 4PAAA 3VAGA 1JXEA 2BQUA 2F4FA 4O3SA 2OH2A 4OI2A 4RKUC 2CZ4A 3ZZRA 4FF3A 3MMBA 4NLSA 3QWPA 1C1CA 3VGVA 2Z4PA 1K8AT 3P49B 1X5TA 3KUHA 4O3RA 1IR0A 2VKRA 1CPZA 2B9XA 3G4SS 2VJVA 2LU2A 3BBFA 3ELHA 4EI2A 5B0FA 3VQSA 5KFZA 1F5AA 2YWWA 3OJUA 3U02A 1I94F 4DSIA 2O01C 1WACA 3PKMA 1FWLA 1DAXA 1WHWA 4YUDA 2UVVA 3DKDA 2RIJA 4NZ6A 4JI7J 2MKIA 3ZZZA 2E5GA 3N79A 1IKXB 1N5YA 2HZVA 1P9QC 1UFWA 3M6VA 2P6TA 3AJDA 3M9OB 4GVBB 2QE5A 2MZQA 4F4AA 5ETTA 4G1PA 2KB2A 3GJSB 4QWCA 1RT2B 4QYRA 5F8JA 1JLGA 2QMWA 1HKAA 8AT1B 4DR3J 1LWFA 2XMVA 3BB5A 3MR2A 4QR2A 1PAEX 3THVA 2E9RX 2MQNA 3ENAA 4KHRA 2NR0A 2IRYA 2W8LA 3VAIA 1S7IA 3JTNA 4I56A 4OI0A 1RWXB 1VGYA 5MLCV 2XY7A 1X4CA 4F4YA 4OYPA 4X62J 4ZVRB 2OI2A 3BSAA 3MECB 3TUZC 4C11A 4C8LA 3J81Y 1VI7A 2QA4G 1PIEA 3I32A 3N6LA 1VC6A 4GO7X 1HBOA 4HYKA 2OTLS 5KG6A 2HFUA 2VFUA 1DFDA 3FMWA 3AOBA 3WIUA 5MAOA 5K8OA 3CJKB 2DT9A 4OZ5A 4JV5F 1RGVA 4GC6A 2LQ9A 5DETA 3IBFB 1R0CB 1FA0A 2Z2YB 4KYZA 1VYAA 4OJHA 1U1LA 5DLGA 5K14A 3MEDA 1T3OA 1FJEB 2W24A 3VGSA 1H2TZ 2APOA 4MYTA 3NEKA 2QFIA 2D9PA 1HQEB 3IS9B 4B9TA 2Z2LA 1WI6A 5CZXA 1O8BA 3V4IB 5CH7B 3BH6B 2BRLA 1YG0A 3O6QA 3M1VA 2W2MP 4DBQA 1WC3A 1GTHA 2DY1A 5L1LA 4W4MA 4TY8B 4CO4A 1VCTA 4PPDA 4DUZJ 2GNKA 2YNFB 4WXWA 2WOMB 1SCJB 3M2UA 3MDFA 3CCJS 2PSZA 2DPJA 3OTOF 1SH3A 2F8MA 2YWFA 2OPRB 2XMTA 5I3PA 4PKDB 3TVYA 4ZLLA 5KFPA 3KMSA 3HF5A 2CFXA 3A1YG 1IWGA 3G71S 1QJHA 2KJVA 1E6YB 1R8HA 1Q0NA 1Q5VA 1S1WA 3DLBA 2C2RA 1OSDA 4ECQA 1YHQS 2OEMA 1N36J 1BQXA 4RW9A 1W25A 4Y28C 1FX2A 1LW0B 2GMLA 1B0TA 1X4FA 2Z57B 5DM7Q 2RQMA 5KG7A 1TL7B 3IM9A 2KL8A 2K7JA 2JEJA 1U09A 4B9LA 3T19A 4URSA 3TYTA 1N5TA 3IP0A 1XBWA 2KZZA 3C46A 3IWLA 5E3AA 1UJ6A 2HHHF 1AFJA 3BR8A 2FC9A 1VBKA 2KHCA 3P45B 1FDBA 7FD1A 3I9V9 3MAHA 5I3UA 2AIRB 3R9LA 2AGPA 4KGKA 1IXKA 2R8GA 1IKWB 4RW6A 3SI8A 1I94J 4OI4A 4GC7A 4IDKB 2HLTA 2VPWB 3HFZB 3ULHA 3CC2S 2KO1A 1EQMA 1FWKA 1N4LA 3DOKB 1FI4A 2Y1RI 4YMEA 5AXNA 1FRKA 4KR0B 4LMZA 1S9EA 4HHJA 1RSCA 3OPKA 3KTQA 3PHTA 3AJ1A 2XLJA 2HVIA 1RAJA 3KOAA 4JI0F 2DTJA 3P96A 1QTNB 3BEGB 3KLIB 2W4DA 5HQMA 4C6AA 4CYUB 2ZUGA 3OT9A 3JQJA 2JEFA 1Q8LA 1XK8A 3L4BC 2U1AA 4NYPA 5I4MA 2XZDB 2W9BB 4WJBA 5LSOA 2FZCB 1XNQF 2ZC4A 1CJVB 3QPIA 3AAWB 2MLXA 5KOWA 5KFYA 2CDQA 4Q2MA 3QZ8A 1SUQB 2LP4A 2XY6A 4PZVA 2XZTB 5DRKA 3H5UA 2V8HA 1ZYQA 4FKYA 5J2QB 2A10A 4I68A 5KG1A 5KFRA 2LKZA 3M30B 4C8OA 5ETQA 4Z37A 2D1CA 3C8YA 2NXCA 5DS7A 4DR5J 1KN6A 3RAXA 1PBUA 2C3MA 3CTRA 4PWWA 1RWUA 1WEZA 5SZTA 3CCVS 2FTRA 4TNOA 1VHFA 3H0PA 3R27A 4DG1A 1S0NA 3K5PA 1WEYA 4P10A 1VIXA 4LREA 3KJFB 4JV5J 2E5HA 1WUUA 3DXBA 2M0GB 2FVQA 5F8HA 1YBAA 3NAHA 4NPOA 2VG5B 1B0VA 2HS0A 2Y3YA 4KGZB 4QU7A 4B3OA 5GMDA 1KP6A 2CNOB 4K59A 4Y65A 3B82A 1RA7A 1FD8A 1C4CA 2HNZA 3TAPA 4NEYA 3P8BB 4U8YA 3AT1B 3EPGA 1IBCB 4OYMA 4C3MA 2XO6A 1Y3JA 2K8GA 1XR5A 1RACB 2R3VA 2B9EA 4AD6A 2CVEA 3KLFA 1GH8A 1FKPA 2GGPB 3AA8A 2XMMA 2UXDF 5KT5A 2V2QA 3W62A 3RR8A 4HLBA 2KYXA 3NGSA 3H5XA 5K20B 3AQOA 3R7SB 3OTOJ 4EU0A 1WOOA 3EE3A 2NZ4A 2HVHA 4U67Q 3Q8RB 3R6GB 1QE1B 3MPVA 3PW7A 3OSNA 3AD7C 1XIQA 2BOPA 5EWFA 4IRKA 1RWVB 1YJ7A 2O5DA 1RCXB 1RI7A 4DL5A 3D28A 4JI8F 4FVCA 2CQBA 2F7VA 3SIPB 3OHBA 2JHEA 4KTQA 1RAOA 4Z7CA 5IT9U 3W9IA 3BKUA 1NZAA 1CQMA 1VQOS 2Q79A 1HHSA 1BY9A 3VZIA 5HVGA 1V9OA 4WFZA 4LR9A 4IOBA 3DLGB 4H4KC 4MYUA 3K5OA 4OX7A 1KKHA 3HZGA 3MEKA 4CI0B 4ZN3A 2VBWA 4LFAF 5HBMA 4C9DA 2G2OA 4IYQA 1FX4A 2XI3A 4B3RJ 2NREA 1K0VA 1XR6A 5FLXU 1MU2B 2DHSA 5DJBA 3B6BA 1WD6A 4DL0C 2MZTA 3D68A 1GMVA 2IA6A 2IC3B 2CPIA 3OR1B 4ED2A 5DGAA 4R8UA 1P9YA 3BQ1A 2DRAA 1VDHA 1FRIA 3HD1A 1ROFA 3T41A 1CG2A 2ZJPQ 4FS2A 4TU8A
chains in the Genus database with same CATH topology
4WYWA 1SBRA 3G8TA 4NYZA 2HAIA 2QSFA 5LT5A 3IA0A 1S72S 2YWGA 2Q43A 3M8QB 3SV4A 3T3FA 2JVOA 3J7YI 2JC0A 4L72B 1MU2A 5DDOC 4FS1A 1TKDA 3M6WA 3EZUA 3DN9A 2IRUA 4DOZA 2EKYA 4WTYA 4EO8A 1U1QA 3M2VA 2DB1A 4N8NA 2VA2A 2K1RB 1RT6B 3DFEA 3NLCA 4K4SA 3M9NB 4O23A 2J9EA 5HMYA 3WC2A 3TQ1A 1R6YA 2DNPA 2LA4A 2XCPA 2NS1B 5JVGQ 2AD9A 4OMFG 2X1BA 3PV8A 1UJ5A 3CDUA 4NCGB 5EWGA 3LWMA 2UUCF 2DO0A 4OZ0A 4C0OC 4Z2XA 2RU3A 2RB7A 2W25A 4ERDA 4ECTA 2B9WA 2OSRA 3DLEB 4X4TA 2DCLA 2B9YA 1ULRA 4J9LA 3H8YA 3CD6S 1GTEA 4PG8A 1TFYA 4ITSA 3IRXB 2KXNB 5C42A 2LMIA 2XMUA 4QIVA 1JLAB 1JLFA 3QLHA 4QOTA 3MR3A 4FXDA 4NZ7A 3RU0A 1MROA 4ECVA 1UVIA 3ZZOA 4Y2AA 1KEKA 5IS2A 4NXNF 3TAQA 1TQLA 2UXCF 2YVSA 2EK1A 4RWWA 2CQ0A 4EYIB 3RBDA 3M8QA 5BR8F 1Y5NB 2COLA 4JV0A 1K1QA 3DLJA 3SSRA 5KT6A 3T1YF 1QUPA 2FD2A 2JEGA 1F5BA 1G3OA 1AW0A 2MZ1A 3H5SA 4ZPCA 1R89A 4DV0F 4K0KF 5E3RA 1VOMA 2RKIB 1ZPWX 2EBGA 1VK3A 5F3ZA 5J1EB 2LEBA 2K1RA 1VQ9S 4B3TF 2QIFA 4IH7A 2RQCA 1RT6A 2HGMA 3TARA 1IQZA 3PW0A 3I31A 5DGBA 3HHDA 5F8NA 4ZCLA 3R5AA 1SI9A 3Q22A 1X4BA 2MQOA 2W7AA 5A0YB 4IR9A 5F41A 4Q43A 2AJ0A 1WF1A 3MR5A 2IFXA 3RRHA 4NCGA 3ONQA 4DV5F 2AYMA 2QT7A 4RW9B 2FDNA 1X0PA 4GO5X 4ZPAA 4HEA9 4F4WA 2EG1A 2C2DA 2VOPA 3DLEA 4KC5A 4EZ6A 4FVMA 2PC6A 3AJ2A 3EGZA 1H7WA 4ZKAA 3AQPA 4B9UA 4CH0S 1RP5A 3DRPB 1TR0A 2J9DA 2M7SA 4LSNA 3QGIA 3OXGA 2NYIA 2MKHA 3O3LA 2J7WA 1S1UA 2M52A 2MSTA 2PD1A 3TW0A 4ZMMA 2V4JB 4MK7A 3LAMA 3V6DB 5F0UA 2MPUA 4NXMF 3V6JA 1HMVB 5B09A 1HYSB 4BBYA 4WFYA 3HI9A 2AGQA 4YOEA 1RTHB 4A8KA 3DOMA 3FRYA 1NNDA 2RH3A 1OPZA 2E44A 1RA6A 3GFXA 3PEHA 4KFBB 3MPWA 2MSSA 1TKXA 4Y2MA 4G1QA 4CIOA 3BSNA 2HNYB 4G3IA 1ZM9A 1VS3A 1A6LA 1NKBA 2FIUA 2RKIA 3PW4A 2HGLA 4CO3A 2BQ3A 1LXJA 1ZBTA 4FNIA 3R1LA 4DQIA 2VB6A 4YY3F 3MTKA 5KFXA 4LIRA 1S6PB 1QTMA 2AU0A 2R7XA 3AB2B 4L6V3 4QPTA 4ECWA 2GHVC 4JI1F 2JRSA 4UUXA 3SFGA 1VQKS 2B7CB 5KFTA 3HHLA 2MXYA 2FHMA 1UVJA 1Q16B 5D3GB 4QIGA 1HR0F 3DRRB 4PWDB 3I9ZA 3LGMA 2W9AA 1WELA 2CQ4A 3I0SA 1S6UA 2BACA 4ELUA 3DRPA 2DK2A 4LFBF 2NUUG 3BREA 5LJ3Y 2G13A 3PX4A 4DL2A 4CNYA 3TNVA 3HPOA 2RUGA 4TQSA 3OL7A 2V4JA 3CGIA 3V6DA 1VK8A 3H5YA 1HMVA 2YQ3A 1R0AA 3BSOA 1HYSA 2K3KA 2ADCA 4ZHRB 3OLAA 3CPWR 1RTHA 4ID5B 1IBMF 3UD4P 5H9FJ 4KFBA 3Q8QB 4DF4A 1BQNA 2FVRA 2QMXA 2KFNA 2FHJD 2NSCA 2ASDA 4ZP7A 4AXJA 1UL3A 3V81B 4N56A 2ZH5A 3D2WA 1IQTA 2GCFA 3OBIA 3K8WA 4AL7A 5E7OB 1ZH5A 5GADU 3CJ2A 1S6PA 4B3RF 1T94A 1GAOA 2ILZA 1FF2A 3ISNC 1MMDA 4DQPA 2ROEA 1S9EB 5A8RA 4AUKA 3DU6A 2KDOA 4USHA 2NUHA 5M2UA 2O1PA 2RDIA 3GG0A 2BVZA 3MCSA 1TK5A 2JDJA 2QZ8A 4UQTA 5D3GA 2WSFC 3PDNA 3V6KA 4QBUA 4RNMA 1UVNA 3KNGA 4B9NA 2AJQA 3UR3C 1SH0A 3DRRA 5A6WA 4RUHA 3CDAA 3SCIE 5G0RA 2ZH1A 2NPFA 3OVSA 1VQPS 2ZH7A 1VQ4S 1DURA 2X1GA 2GHWA 1WF2A 4DN0A 1VJWA 2EVZA 3MUTP 1JX4A 1IBLF 4MJKA 5HI7A 4ZCMA 1DLOB 1NKCA 3E8OA 3OR2B 2Z8QA 1YJWS 4TXSA 3H25A 5C24B 4BHQA 3DNCA 5F9NA 2EBEA 1L3TA 4PUOA 1RTDB 2J9DE 2KXHA 2D7SA 4ID5A 2IVYA 4MFBB 2JSXA 1GXLA 1V3SA 5K8NA 1QVGR 4QWEA 5EWEA 2ZZNA 5CCLA 4NLWA 4UOCA 1Z4UA 3FNNA 3T5KA 1I6JA 3V81A 5IM0B 2IAJB 4M63A 4OJ1A 2PO4A 5DG9A 2CPFA 1N0UA 2XMKA 3VQTA 3RRGA 4QR1A 1OPIA 2LECA 2LQ5A 2J6UA 3MM6A 3EYZA 3QGGA 4CTAA 4P7VA 2PFFB 4GMKA 3OFGA 2HYIB 1Q81T 2CQCA 2DITA 1UJ4A 1XERA 2OKQA 3NAIA 4NLPA 2FJDB 1AUDA 2EFGA 4NA1A 2UU9F 3T5LA 3BZQA 4OLPA 4RX6A 1ZM3A 4KHPF 4ILRA 4PXEA 3UDCA 5K8MA 5DQIA 2KHDA 5KFDA 4A48A 5BJRA 3CC7S 3ISZA 3FJ2A 4J5OA 3Q2TC 2C3OA 5F0WA 3L7PA 4DSEA 4X66F 3KMQA 2VBXA 3I96A 1FKAF 3CVKA 1CC7A 4NX9A 2Q66A 4PXDA 1DLOA 2AYBA 4EBCA 1PC5A 3Q24A 5LSLA 1RJJA 2JVRA 4K2XA 4KE5A 2JFKA 3GFZA 3HVAA 3OXFA 5C24A 1YJNS 1BQMB 1T3NA 4LF4F 3TVZA 1RTDA 2HFZA 3JSBA 2E1RA 2NXUA 3PW2A 4LF7F 2G0CA 3CCSS 4MFBA 4A8WA 4G1IA 2KH9A 4GKKF 3EXYA 3TANA 2MZRA 3H59A 1RT7B 4MIBA 5ITHA 5I3QA 2VG6B 4YEAA 4WE1A 4O4RA 2IAJA 3S7RA 3K5MA 3BN7A 1JKHA 3U1NA 4RUAA 1WNEA 1J5OA 1F60B 4WK1A 5H9EJ 3GFHA 1K73T 2AJ4A 1QY7A 2MZJA 2DVIA 3FRZA 3GIIA 3D1OA 5D4NA 5KAKA 2KU7A 4IOCQ 2K2PA 2RS8A 5HO4A 1NAQA 3F56A 4M95A 1NK0A 2XLIA 3BO3A 3KK3A 5JVHQ 2F1FA 3FZBA 2XHWA 3K8VA 2XCAA 3W3SA 4JI5F 1GX6A 1YJUA 1JLQB 1B7FA 3FSYA 1FKOB 6FD1A 1S76D 3CWJA 4F3OA 2R2TA 3CO9A 5DG7A 4FN5A 5KFNA 2CQGA 4RW8A 1KS2A 5CYQB 1U48A 2AJ1A 5KTQA 4JI6F 5K5MA 2AGOA 2IYIA 2OAUA 4ZP9A 4DS4A 1BQMA 2LEAA 3BGRB 4QZVB 3TX8A 1PILA 4L3NA 2RF2A 4DSKA 1WHYA 2W4CA 1JB0C 1GXTA 2FJVA 3BQ2A 5KFBA 2DHAA 1JIHA 2ZZMA 2DJWA 4MK9A 1RTIB 4RLEA 3KK2B 5CCMA 2BE2B 3DI6B 3HVTA 4V19J 1RT7A 4FXVA 2VG6A 4DUYF 1KFDA 5C25B 4O3QA 3BQ0A 1HW9A 5KFOA 2BQRA 2WCXA 2FGOA 1SQEA 5HMXA 3HKZD 5C5JA 1LXNA 2W9CB 2W7PA 2EFQA 3RB4A 5HL7Q 1CSJA 4E98A 3UCZP 2YWKA 5KT3A 1JNRB 2IM3A 1GXUA 4X4RA 3M2RB 3NGDA 2UUWA 5EX0A 4PCQA 3D5MA 2YKPA 4ZOSA 3MR6A 2KKHA 4Q2LA 1D0EA 3OTDA 1LK5A 5IT4A 4KBIA 2CPJA 2R9LA 1ZZNA 3O2IA 4KQZA 4EFAC