2MZJA

Nmr-structure of the nop6-rbd from s. cerevisiae
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
82
structure length
82
Chain Sequence
GNRFIVFVGSLPRDITAVELQNHFKNSSPDQIRLRADKGIAFLEFDADKDRTGIQRRMDIALLQHGTLLKEKKINVELTVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleolar protein 6
publication title Not known yet
rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Rna binding protein
total genus 19
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2015-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mzjA00
4QU7A 3UWTA 3CMAS 3P49B 3G9CA 1WEZA 2RS8A 3CC7S 2PEHA 3H2VE 1WF1A 2YWKA 5IM0A 2RT3A 1N52B 1X5TA 1N8RT 4WCEQ 1F9FA 5D78A 2KXNB 3SDEB 2DO4A 3NNHA 3NS5A 1VQ4S 1H2VZ 2DGUA 3US5A 1KQSR 3CCES 5LSLA 3D2WA 3S01A 2DGOA 3J7ZT 2KG1A 1WF2A 2DIVA 2KFYA 1OIAA 1X4AA 1Q81T 2KH9A 3MD3A 1DZ5A 4IOCQ 4BS2A 3Q2TC 2HGMA 2L08A 3G6ES 1KOHA 1QVFR 2LA4A 1VQ9S 4OZ0A 1O0PA 2DISA 1JMTA 1U1QA 2XS5A 4WFAQ 2RQCA 5GVQA 4CQ1A 1SJ3P 1W2BR 1N54B 2PE8A 2YKAA 2MGZA 2KM8C 2CQ4A 1WF0A 2CQBA 1JJ2R 4IO9Q 1VQ6S 2K8GA 3VAJA 2LXUA 2B0GA 1AUDA 4LMZA 2X1GA 2DGVA 2AYGA 2JRSA 2YH1A 5DDOC 3ZZYA 5D77A 3CXCR 2OTLS 1RK8A 2LXIA 2MSTA 3VAGA 1WTBA 2DGSA 1X5OA 1VC5A 2J0QD 2KG0A 3MUVP 2AD9A 3BO4A 2MJUA 1WI8A 3VAHA 2JVOA 4C7QA 1SJRA 2CJKA 2XSFA 2LA6A 3HHNB 1PO6A 2CPDA 2MYFA 2OTJS 2XNRA 4WIIA 1VQMS 2D3OR 1X5SA 2KVIA 1U1OA 4WKRA 3R1HA 2KU7A 4IUFA 2KM8B 2M70A 4Z2XA 2GO9A 2LCWA 2FC8A 1SJ4P 5CA5A 1U1LA 1D8ZA 1WEXA 1WWHA 2DNQA 3TP2A 2DNRA 3CCUS 2DNNA 2DGWA 3UCUP 2N3OA 2G4BA 3OW2R 3K0JA 1SXLA 2MQMA 1VQOS 3BO2A 3G96A 1H2TZ 1HD0A 2N3LA 2CQDA 2E5GA 2DHGA 5CXTA 5IFMA 2CPYA 2QEXS 1NJIT 3LQVA 1VQPS 3J7YU 2DNHA 3CF5Q 4CH1A 4TU9A 1H2UX 2CPIA 2MKJA 4J5OA 3S7RA 3SDEA 1VBXA 3SXLA 4UQTA 2LEBA 2HZCA 3BO3A 1CVJA 3G8SA 3P5TL 4ZKAA 3MUTP 2MJNA 2EK1A 1U6FA 1HL6A 1ZH5A 1XN9A 1YHQS 2VOOA 3MDFA 1U6BA 4RU2A 2MKHA 3B4MA 1N88A 3N9UC 5LXYA 1YWXA 5GADU 4WFBQ 3P3DA 1DRZA 2N82B 3ULHA 2MXYA 5GAGU 2QA4S 1U1NA 1G2EA 1L3KA 2KRBA 3UCGA 1WHWA 5DM7Q 2FY1A 2RVJA 5LJ5Y 1FJ7A 1M5PC 2MHNA 3MI7X 3L3CA 1WHYA 2OSQA 2DGTA 4QPTA 2NLWA 1SJQA 3ZZZA 2XS2A 1YIJS 5BJRA 3FEXB 1A9NB 2CPZA 2I38A 3CPWR 5JVGQ 2MZJA 1QM9A 3NMRA 3MOJB 1FJCA 2AYMA 2E5IA 2LECA 2K3KA 2MQOA 1URNA 3CD6S 3UE2A 2HYIB 4TU7A 1HD1A 2RRAA 3VF0B 2U1AA 5EN1A 1FXLA 2X1AA 2D9OA 3V4MA 4TLQA 2O3DA 3NNAA 2KT5A 1U1MA 2CQ0A 2UP1A 2RRBA 2SXLA 2DITA 2RQ4A 3I55S 3VAIA 1UW4A 1U1KA 3G4SS 3TYTA 3I56S 2XNQA 5IM0B 4QQBA 2CQGA 1VQ8S 2KHCA 2RNEA 3CCQS 1VC0A 2YH0A 5DM6Q 2DNMA 2MY8A 3MURP 4FXWA 3DLLQ 3CCRS 2DIUA 1YJ9S 1PGZA 1BY9A 5ITHA 1S79A 2M88A 3Q2SC 2JX2A 2LQ5A 2L9WA 3THTA 1U1RA 4W92B 2M2BA 1M5KC 1K73T 1VBYA 1K8AT 2M8DB 2DHAA 3NS6A 1K9MT 5FJ4A 2F3JA 1X4EA 3CCJS 2A3JA 5MLCV 2ZJRQ 1H6KX 2MZSA 2WBRA 2DNKA 1VQ7S 3BS9A 1YTYA 2ERRA 1M1KT 3HI9A 5GMKa 2EVZA 2DH7A 2MKIA 4WF9Q 2FHOB 5IQQA 3UCZP 2HGNA 3G71S 2F9DA 2XS7A 4FXVA 2LEAA 2OIHA 1KOOA 3EX7B 5HL7Q 4QU6A 2CQCA 2ZJPQ 3R27A 2I2YA 1VQKS 3RW6A 2M4MA 2YTCA 2MKCA 2DNGA 2DNLA 5CYJA 1Q86T 4ERDA 4W90B 2MB0B 5LJ3Y 2DNPA 1FHTA 2HVZA 2MZQA 4WFNQ 2AYEA 2CQ2A 2D9PA 2XB2D 1HA1A 3CMES 2DNYA 2DB1A 1NO8A 2VODA 2DH8A 5GAHU 1JJHA 2CQIA 2BOPA 2DO0A 2DGXA 1FJEB 2MSSA 2OSRA 1U1PA 4LJMA 2X1BA 1VQLS 5LSOA 3VAFA 1KC8T 3MUMP 4YOEA 2MQQA 1WHVA 2J76E 3U1LA 2G0CA 1R8HA 3U1MA 1OWXA 2DK2A 1B7FA 5DDQC 1M90T 1DHMA 2X1FA 1S72S 2ZJQQ 2DGQA 1UAWA 2MZTA 1SJFA 2JVRA 2Q79A 4LIRA 3CULA 4F25A 2M9KA 5LXRA 2HGLA 2CQ1A 2DHSA 2F9JA 1YITS 2KRRA 4ED5A 3CCSS 2MY7A 1U2FA 2M8HA 4Y00A 2MMYA 5DETA 1WELA 3H2UB 1UFWA 2MQLA 3CCMS 2U2FA 4CH0S 2MZ1A 4CIOA 2KXHA 2DH9A 4PKDB 2E5HA 1VQ5S 2CPXA 3VAKA 2LMIA 1WG1A 2CQPA 3S6EA 1KD1T 4PRFA 2G1DA 1M5VC 3VALA 2RS2A 1DBDA 2DHXA 1FNXH 4UY8T 3EGZA 3IWNC 3P6YC 4F02A 1X5PA 2BZ2A 1X4FA 2CPHA 2FPHX 2MZRA 2MKKA 3IRWP 3PIPQ 2AYBA 2ADCA 1WHXA 1M5OC 3RW7A 2LYVA 1NU4A 1R8PA 3S8SA 1YI2S 1WEYA 1IQTA 1X0FA 4M5DB 2FC9A 1ZZFA 4F26A 4YUDA 2VONA 3FEYB 3G8TA 2GHPA 2E5JA 1X4GA 1Q7YT 3CC2S 1OO0B 2VOPA 2J8AA 2QFJA 1WG4A 1JJ4A 3BEGB 2KN4A 2N7CA 5DDRC 3CC4S 1YJWS 2MKSA 3DXBA 4U67Q 1D9AA 2CPFA 1X4BA 2E44A 4C4WA 2MGZB 3VAMA 2JWNA 3CUNA 2MPUA 3R1LA 4YB1P 2KYXA 1VBZA 3EGNA 3UD4P 3CTRA 2M7SA 4A8XA 2RU3A 3LPYA 4IOAQ 5H1SV 1X4DA 4Y0FA 5HO4A 1RKJA 1VC6A 2M0GB 3SMZA 5JVHQ 4V19X 4TU8A 2KXFA 3TO8A 2CPEA 4PR6A 1VQNS 1P1TA 2L41A 1X4HA 4P6QA 2NZ4A 2RUGA 3PIOQ 2J0SD 1OPIA 3CCVS 3THPA 1QVGR 1WI6A 2EK6A 1FO1A 1WG5A 3UD3P 2CQHA 3MD1A 2V94A 3JB9k 1YJNS 3B4DA 2DNOA 3CCLS 1Q82T 3MXHP 1P27B 2KI2A 2OJ3A 1A7GE 4C0OC 5GAEU 2M52A 1X4CA 2DNZA 2LKZA 4OZ1A 2CQ3A 4EGLA 1ZZNA 5DDPC 3NNCA 1FT8A 2ADBA 2MQNA 2MQPA 2CPJA 1UP1A
chains in the Genus database with same CATH superfamily
2FIUA 3RUBL 3BSNA 3FMWA 3OR1B 4OYIA 3M1VA 4GVBA 3LUYA 4ZVUB 4MKVA 1KQKA 2BUNA 1OIAA 5CYMB 2AT1B 4RWXA 2JEFA 3PYFA 3LALA 4DV4J 4OZ0A 4DU8A 3R2CJ 5GVQA 1VRQC 1RT1B 3W9JA 1SJ3P 2MGZA 2EBEA 2XMAA 2YKQA 1EAYC 3MMCA 4AT1B 1OPZA 1VQ6S 4ZVRB 5E5NA 4DV4F 4ECRA 3HHEA 4J9KA 3SSRA 5A8WA 2MSTA 1KEKA 1VHIA 4CP5A 2ZOMA 3VWSA 1RT4A 1T05A 4RNOA 4KE5A 1T9XA 2ZWPA 1NXIA 4DCOB 2OPRA 2EKYA 4MIBA 3DLEB 3LGNA 3KLEB 2ZHAA 2V2ZA 2OI2A 2N3OA 2FLLA 3KK3B 3FDSA 4USJC 2NPIA 4P10A 4K4UA 5E3CA 1E6VA 4ANEA 2VPYB 2AF6A 3GJRB 3MAAB 3S7RA 4WU2A 3W65A 3C66A 2OUGA 4B9TA 1T9VA 4DX6A 2WCXA 1RWOB 3CJKB 2VPZB 5EX0A 4P72A 1N5TA 1FDBA 1FJGJ 1FJ7A 3OQ2A 5T14A 5B0CA 5CYQA 2G13A 1KNZA 3H4BA 3RG6A 1RT2A 1SJQA 1OS5A 1TTHB 1W26A 5JVGQ 2VASA 3O44A 2NQPA 1YLXA 2E5IA 4DCJB 2E7VA 5IQ6A 4DQIA 2QMXA 2U1AA 1U48A 1FVQA 3WC2A 2WSFC 3F73A 2Y1IA 2KT5A 4WTYA 3L09A 1MSWD 4ECYA 4JYAF 1RT5A 2MDAA 2XY7A 2R7QA 4NCAA 2RKIB 2BJ7A 4HHUA 2CZVC 4WXOA 3WBZA 4I7FA 3HHKA 5IS2A 1APSA 1JNRB 2V2VA 4K4XA 5GMEA 1LWFB 3VZIA 4ATNA 5C42A 1ZTWA 2IDEA 1X0PA 2EFGA 3KLHB 2EFNA 1Y11A 4ECTA 2JLEA 4NLYA 1Q16B 2XCAA 1H6KX 2B9YA 1YTYA 2HGNA 5I42A 1JLQA 1VQKS 2W2QP 2QLXA 4DR6J 2YKMA 2CQ2A 2V5HG 3PNIA 2OLWA 2K06A 3T1YJ 2ILZA 2PO4A 2R7TA 1RYSA 4DFJA 1FJEB 2AJ4A 2WSCC 4ZPVR 4AYBD 4DR6F 3KLGB 5HVFA 4X4PA 2HZAA 1VRUB 3T1YF 1B7FA 4ETZA 3TUIC 1UJ5A 2MZTA 1MMNA 2QA2A 3DM2B 5FLXU 4RW8B 3M2VA 4BC9A 3B8HA 4DV7J 4U8VA 4JI2F 1HKAA 4W4MA 4DV3F 4IOBA 4KGVB 4XTTA 3GSIA 1QJHA 2RS2A 2FPHX 1X4FA 1WHXA 2QMUB 3KG1A 1JLFB 2QTWA 2GV1A 4UT4A 3OXGA 1TV6A 2Z2ZA 4B3SJ 1CSJA 1ZM4A 2PD1A 4OZNA 3RB6A 4GKKJ 2K1RB 3SQGB 1ZA2B 3GIMA 2YPZA 3D7SB 1QTMA 1SV5B 3HHLC 4TLRA 4IFVA 5MAOA 1S9GB 1PAUB 4F0KA 4B3SF 3ENAA 1CS4A 3R5AA 2H9ZA 3UD4P 4CO0A 4A8XA 3MOZA 4CM2A 2RU3A 4DV0J 1N5VA 3DOLB 2IVMA 1RKJA 2ZFHA 3DI6A 2FJEB 1GX6A 1GXTA 3NG8A 4YB7A 1OPIA 1QVGR 1HBOB 5KFMA 4AD6A 2JC1A 1RUSA 3ELHA 2V94A 2LLZA 1B7YB 3CJRA 5DQHA 1CC7A 4X64F 1U2RA 3SBMA 2M52A 4N7TA 1REVB 4EGLA 5M2UA 4JI4J 3KK2A 1VJWA 2MQPA 4DV6J 1KVIA 4FS1A 2LVWA 3MM7B 2XI2A 3UWTA 2C42A 4PQUA 3CO0P 1F9FA 1TELA 1N5QA 1HPZA 3US5A 5U47A 1U25A 3N6LA 2R7WA 2YKNB 4DV6F 4WFYA 3MPUB 4KTQA 3Q24A 2XMWA 3MD3A 1HBMA 4QYZJ 1F2GA 3O2IA 4YB5A 1PYSB 2DISA 4ZITA 5BXIA 4FF2A 1T7PA 4DL6A 1UVMA 1CJKA 1FVSA 3ETMA 3QT6A 2HWIA 4U7UD 3J81j 3UNGC 3AJDA 4XO0A 4O3NA 2GGPA 3P5BP 2C28A 2RHSB 3PX4A 1L3SA 3C15A 5DO2A 2E66A 4C8NA 4WKRA 1D09B 1G6BA 4DPOA 2YWHA 2QLBB 2FVQA 3UCUP 2DGWA 3NXZA 1FDNA 2EBGA 1CBKA 1YJ7A 2FLPA 2WRMA 3CVKA 1KHVA 3JSRA 3GTYX 4HVZA 5IFMA 2F1FA 1GMVA 3GFZA 4H54A 4HDGA 3PTWA 5E0OA 1S0OA 3GSDA 1K1QA 3EZUA 4J9PA 1X9MA 3WDOA 4HR2A 3GV5B 3W63A 4QR0A 2BQUA 4QIEA 1RT3A 2XLJA 3IR7B 4ZP8A 2PI5A 1M5PC 3MI7X 5HMYA 2AJ0A 4I56A 4LFAF 5THWA 1HNIB 1TL3B 3CIZA 1A9NB 2CPZA 2OP5A 1QM9A 3NMRA 3OTOF 4WFZA 1U2CA 3NGDA 4LSZB 3L95X 3MM8A 3HT3A 3NBPA 4EK2A 2X1AA 2BOAA 3V4MA 3J7YI 2H1YA 1DQ8A 3HT0A 2L9DA 1SPBP 3FEZA 3POTB 4F4AA 3H20A 1CQNA 2ZD1A 4P74A 3I0RA 3IBCB 1RAHB 1S1TA 4F0HA 4ED8A 1BY9A 5ITHA 4JI7J 3EVWA 4TYBA 2OPSA 4ZS6A 4PZVA 3AODA 1KS2A 4FDFA 3QIDA 4JV2A 4LSNB 4ES2A 2ALYB 3BGOP 2DNKA 2Q66A 3A8IA 2CJQA 5HK4A 4ZN1A 3OHBA 1RT6B 3R6LB 5KFUA 3UPFA 2HW3A 3UCZP 2ZJPQ 1NZAA 3HSDA 2R7UA 4M5MA 3W9HA 2MB0B 2MZQA 2Z0GA 3KG0A 5IC4B 2HWHA 3MHYA 4B3OB 1HA1A 3KLIA 1HQUA 3B6BA 2CQIA 2MSSA 1U1PA 3QT5A 1VQLS 2E1PA 3U27A 3HX9A 4URSA 5D4PA 2IJNA 3UR3C 4OYWA 2G0CA 4NZ0A 1OWXA 3QRRA 2ZUAA 2CDQA 2ZH4A 3X3UA 3R6GB 4K0KF 2YWGA 1FESA 2Q79A 1KONA 5LSRA 4C8OA 2FGOA 4NLPA 2WVEA 2BANA 4R8UB 4OHYA 2PT0A 4DF8A 3HXMA 3QMQA 3PFEA 4KPCA 1G1XA 2FJAB 4KHPJ 4HTIA 4NXMJ 1JWWA 1RAFB 1K47A 3PIPQ 1M5OC 2CNNB 3PX6A 2O5DA 3ZNUA 1IM4A 1W7WA 3OL9A 2PA3A 3N0VA 3ZZOA 1D9FA 3H5YA 1SL1A 2MLXA 2HIYA 4Q0BA 3M6UA 3JAMY 3TJ8A 4DR4J 2VG5B 3GLJA 4C11B 1EP4B 2W2NP 2W25A 2M5YA 3GFHA 1NCLA 2OFHX 3TQ1A 3GG1A 3SCLE 2OD4A 3QO9A 1YSJA 2CPFA 2DRBA 4AQYJ 2ZNYA 4CCHA 2H5EA 2GX8A 5KFVA 4YB1P 4ZPAA 3PJWA 1S7HA 1L3VA 2ZH8A 3DRSA 4LREA 5F8JA 1RHMB 3KFWX 4LBHA 4V19X 2KXFA 4DR7J 3HD2A 4AQYF 4K2JA 1UEUA 1X4HA 4P6QA 2V69A 4NLTA 2JEJA 4MK7A 1LW0A 4DR5F 4ZVSB 4ZVOB 5BYSA 2UXCJ 2WK4A 2RSQA 4DR7F 2UXBJ 2CYYA 1UA0A 3RBXA 3QGIA 4Y2CA 5L1JA 3HDSA 2EFOA 3TQEA 2FGCA 2KZZA 3UD5A 4GC7A 4R5PA 4ZCLA 1HNWF 1SQEA 1CC8A 4ELVA 3MCOA 3G87A 4U7UK 2BM0A 2G2ZA 2XSJA 3D68A 5AT1B 1SL0A 3BYRA 1N32F 4WCEQ 1LWCA 1B0VA 4DUYF 3GYGA 2DIVA 3AHPA 3BH7B 3I82A 3DLGA 3JYTA 4BS2A 2RQKA 2AZ1A 4XIUA 2VJVA 3G6ES 1VHFA 4PXDA 4RW6B 1MNEA 2GW8A 5HLFB 2BVZA 5F8IA 4WFAQ 5KFPA 1F60B 5DQIA 1KFDA 1S6PA 3IS9A 3OSNA 4M94A 1S4FA 5GAEI 2WB1D 1HR0J 3MTJA 4NWBA 2JRSA 3CXCR 2FVSA 4NLRA 2B8PA 3OLAA 3KJVA 1VC5A 2DR8A 2AD9A 2MJUA 1RXOB 4C7QA 2F4VF 4W98A 4EUVA 3OFEA 1HR0F 3GONA 4ED0A 4O3PA 1AT1B 1U1OA 1NK8A 1XQIA 3NGKA 2KU7A 2KM8B 3TUZC 3GYNA 3QSYB 1TUWA 2BE9B 3D1HA 4E0DA 4ANDA 1T11A 3E8OA 3RAXA 4P9SA 5LT5A 4LF5J 2N3LA 2HFNA 1FXDA 3HSGA 1RA7A 3G86A 3J7YU 2PC6A 5B0BA 4GO7X 1UVKA 2CZ4A 5JXSA 4LF5F 1N4LA 2HHPA 3D4JA 1S1UA 3I5AA 2A18A 1TQLA 1N88A 2MKHA 4GMKA 3RTVA 1XR6A 2KYZA 4WXWA 3UCGA 4DPUA 5LJ5Y 3FBBA 1JLCA 1TL1B 5HBMA 3M8QB 2JEGA 5A8KB 1U02A 2O1PA 4A48A 3J7A1 2D9OA 3QAEA 3GR1A 2QO3A 1VQSA 3W61A 2QYCA 4CTAA 3M05A 2UUBF 1UVNA 3VVTA 5IWAJ 4HHJA 3QWUA 4N5SA 1WTFA 4X66F 2MY8A 4I1TA 5GAGI 3HHLA 4C97A 4FN5A 2NR0A 1U24A 4C8YA 1U1RA 2B8QA 3PKYA 1XMQJ 1HFEL 2IA6A 3V4IB 4WWSA 2WOMA 2G1HA 2V8GA 2CIMA 3MF5A 4F0MA 3LP0B 3O6QA 4C8ZA 4YDXA 3T41A 4IFYB 1SKWA 4KFBA 5FDLB 3OTBA 2HVZA 3D1OA 2JDJA 2POKA 3MMAB 2XB2D 2EI5A 3C16A 3QAUA 2NXCA 1RA6A 3VAFA 1KC8T 2E9TA 4N76A 4YOEA 5KFDA 1YJUA 4Q5VA 1B3TA 1VR6A 3VQTA 3IGVA 3EICA 4B3MJ 3Q0AA 1SIWB 3BKUA 2ZH6A 5DRKA 4ANCA 4Y28C 1RU1A 1X31C 4ED5A 4CT9A 3T6BA 1YJVA 4CT8A 4USIA 2MQLA 5AE3A 4B3MF 1QUVA 1UVLA 2C3MA 3LGMA 4CO1A 1TL5A 3VR1A 2GVZA 3VHQA 2VG6A 5GAHI 2MZRA 4IRDA 1GH8A 3SCJE 4M5DB 4YUDA 3DRPB 3W5YA 4WFXA 4WP8A 1DFDA 4A8YA 2JH3A 2Q6BA 2HHVA 4ID5A 3O5TB 4I6AA 1JXVA 2E44A 4IQMA 2YNGB 1CPZA 3GMGA 3VAMA 4KB7A 1TKTB 3M2UB 3CUNA 1T9TA 1EJ7L 4C6AA 1PILA 3DU6A 1DTTA 1AB8A 2AGOA 1IR0A 3FFIB 5JVHQ 4KAIA 1FEHA 3M2RA 3H4DA 4ZCIA 3HO1A 1RTIB 2QZ8A 2YNHB 4NA3A 3N6MA 4FNHA 5GAEU 2AX0A 1SC4B 1FERA 2CVEA 3OJUA 2CPJA 3F0NA 2C2OB 4KR0B 3DCAA 4TY8B 3P49B 4ES3A 3G9CA 3C46A 1WEZA 3CC7S 4ZVHA 3CJ4A 3NGRA 3IG1B 4NCGB 5AE2A 2V50A 4CI0B 2VPWB 3EYZA 3FGVA 3BBFA 1AXQA 2KL8A 3D28A 2VB6A 2L08A 4LSLB 3KUGA 3O8WA 4CQ1A 4C48A 1JX4A 2W2MP 2CQBA 4NOHA 2A2CA 2J7UA 3C2PA 1FE0A 3JAMU 5F0UA 3VGTA 1HWIA 2JVOA 2CJKA 3PW5A 1D8YA 4CO5A 2HRUA 3OJSA 3ZZPA 2LQBA 4PG7A 1HW8A 4PXEA 1V9OA 3I0SB 2DNRA 1N34F 1J5OA 3FVYA 3DMJA 4WYLA 2BX6A 3IRXB 5A6WA 3A3NB 3J7Z5 1PCAA 3G82B 3GJTB 3TANA 2J0WA 2Z2LA 4UQTA 3GB0A 2EG1A 2HZCA 4KSEB 4ZDNA 3G8SA 3EGVA 2NXJA 2VQFJ 2VOOA 4QOTA 4I6YA 2VFVA 5GADU 4M5KA 4ZPDA 5GAGU 2GVDB 5DM7Q 5J2PB 2HVHA 1HWLA 3MM9B 1SUQB 3L3CA 1WHYA 2OSQA 1PJ5A 3MEGB 2AV5A 3H2LA 1YIJS 2IMOA 3TNVA 1RT7B 2MLZA 1VYAA 4KHRA 2HYIB 4TU7A 5LOQA 2QX0A 2Y8YA 1EB0A 3GILA 1N5YB 4XPEA 5J2QB 1IWAA 3I55S 2HQCA 4HLBA 4PWUA 4P73A 3DLEA 1LQ9A 2CQGA 5LL6d 1PYTA 4ELUA 3CCQS 3V6JA 3KK3A 1R8BA 3W62A 2D3O1 1HARA 2YX7A 5CCMA 4DL3A 3RB0A 5F8HA 2DD8S 4UW2A 5K8PA 3MAAA 5SUHA 2X3DA 1SC1B 3MMCB 2Z30B 3CJKA 3R5DA 2MKCA 2DNLA 3E01B 4K4TA 2GS8A 1R31A 2GHWA 3MEEB 5A8WB 3CD5A 2G2OA 3PRBA 2LDIA 4O44B 3OHAA 5GAHU 2AGPA 3TR5A 3GV7B 3C6TA 5KFOA 5J1EB 1RT4B 2OSRA 4X2BA 1H74A 2ZEJA 5I3PA 1BXNA 3CWJA 2CJAA 1S6QB 2R2UA 4RLEA 1RHUB 3ZTRA 1RJJA 5SZTA 2BE2A 4K59A 3U7JA 3QRQA 4N77A 1LOUA 2VIHA 3BGUA 3CULA 2QSFA 1NMEB 2HGLA 2CQ1A 3R7BB 1YX2A 1YITS 2QJ3A 3T5JA 3ZC4A 4PYAA 8RUCA 3OV7A 2HFSA 2KT3A 2RKIA 4J9UE 2U2FA 2I1RA 1NK0A 2VJUA 4JV0A 1LWFA 2VQEJ 1I1GA 3IWNC 3MM5A 4DV5F 4JP8A 2GHVC 4NLSA 4ZIWA 2W4CA 1DARA 4L3NA 1UJ4A 1RT2B 3ZZRA 2VQEF 2C2MB 1K0VA 2WSEC 4Z7YA 3T3FA 4RW4A 3CC2S 2HQIA 1B0TA 3CC4S 1F3VA 2BDPA 1TVRB 2QMWA 2GQCA 2A2DA 2XI3A 3MZIA 3OL7A 2KYXA 3CD7A 4IYQA 1VBZA 3CTRA 4NZ6A 4AXIA 3LPYA 5K14B 2LU2A 1LEOA 1SH3A 3MR5A 4DSKA 4NRUA 2HS4A 4O0IA 3GCXP 5EWGA 4I7FB 4JB8B 3K17A 3QYYA 1H7WA 3BR9A 1WI6A 1M0SA 3EM1A 4LF6F 1BQNA 1UCNA 3TX0A 4Y3CA 3CDWA 3CCLS 3EZOA 1N33J 2QT7A 1S7IA 1A7GE 4IKAA 1Q0NA 4USWA 4Q2LA 3A8KA 4L75A 1JLQB 2MQNA 2PSZA 4OYAA 3A3OB 2YKMB 1NDLA 5IM0A 2W9BB 1WORA 2EFVA 2YBVA 3WQPA 2XYGB 4ZK7M 1M1HA 2HG4A 3SQGA 2KH9A 3DHWC 1KOHA 1BQXA 3OLBA 1HHQA 4DSEA 1S9GA 4Q45A 4UOGA 3PG9A 4NYZA 1JKHB 4ELTA 1AUDA 4X4QA 4LMZA 3DOLA 3KLFB 4UZBA 1WTBA 4LRDA 1X5OA 4OV6A 3EXCX 3VAHA 1SJRA 1F6TA 2XZTB 2R42A 2DVIA 1GT8A 3D0HE 1TKZB 3Q23A 3HHNB 1HBOA 2GA7A 2MYFA 1WD6A 1FWPA 3ZNJ1 3DLKA 4LR8A 3HVAA 1WKKA 2HVDA 4OL8A 3DOMB 5KT4A 1TV6B 1G4CA 2AX1A 4Z37A 4DV1F 2H5IB 2VBZA 3MM7A 4AL6A 3CCTA 5H9FJ 3M8WA 4RU9A 3PO4A 3EDQB 2B5JA 3TARA 3PR4A 4TU9A 1CJVA 1IBKJ 3AAWB 1HBUB 2YKNA 2BRLA 4RBUA 1NK6A 5CZVA 1U1NA 2CVIA 5IV4A 4USUA 2E9RX 2VV5A 4QPTA 2XS2A 3MTKA 2I9SA 1S10A 3CPWR 3ZTSA 4RUAA 3MAHA 3TJAA 5F3ZA 4OYPA 1R0CB 3R7SB 4LRAA 2KDOA 3EJMA 5E3PA 2YKOA 4B3RJ 5F8MA 5KG6A 1WOPA 3KOAA 3QFWA 2XNQA 1N0UA 2XO6A 1GNKA 1Q5YA 2BJ1A 3CCRS 1FTRA 2J8SA 5C2CA 5DZ6A 5KOWA 1XMBA 2LU1A 2W8LA 4PEOA 1U6ZA 5J2MA 4DS4A 4PG4A 1A0OB 1KN6A 1X4EA 4F3MA 3R5GA 3M9MB 1U8WA 5ETNA 1FF2A 3GZ7A 1UETA 1TKXB 2QGFB 2DNPA 2GGPB 3QRPA 4LR7A 4KYZA 1RLDA 4K4YA 2DH8A 4OMFG 3ISND 3Q8SB 2P9CA 4PWDA 1TL3A 5LSOA 5DGBA 3ISZA 4DPWA 2COLA 5D0HA 2MQQA 4FP9A 2CWXA 1R8HA 2NSBA 1SI9A 2UU9J 5KFEA 2V2KA 3BBBA 3G6XA 2YKPA 2M9KA 4OYXA 2YWEA 3F56A 1CJUB 2FLNA 3POTA 2VICA 3RB3A 3K5NA 2UU9F 2HQGA 2CQPA 1KFSA 2Z4PA 4OX7A 1FNMA 1DQ9A 3D6HB 1M5VC 3OVAA 1KBRA 3FBFA 1RKIA 3I4HX 2LFVA 4LSNA 2HLTA 2HFUA 3MR2A 1IQTA 2EKNA 1RT6A 2AKWB 3BQ2A 3TZZA 1Q7YT 1FKOA 2LQJA 1HYSB 5KG3A 5E3RA 1U8SA 4DFKA 3BEGB 2HNDA 2KN4A 4PXCA 3NBPB 1YJWS 4OHZA 1D9AA 4A8MP 3DC2A 3SCKE 1HMVB 5HROB 1F5AA 3K57A 1NPPA 4OJHA 1RAOA 3EPIA 2HHHJ 5H1SV 5HQMA 3TO8A 4LF8F 2J0XA 4TY9A 1S1TB 2K7KA 4J9LA 4NLUA 1NK9A 2M3DA 1IBMJ 3PIOQ 4J9OA 2R8KA 3FCWA 4UF4A 4B9VA 2OPSB 1F0XA 1YJNS 2VG7B 2DNOA 2B7BB 4R8UA 2XZDB 4Z7CA 4AE5A 1IBMF 1R0AB 1RWMB 4OYOA 4K4ZA 1TU0B 2V6AA 1RAIB 1BUXA 4GVLA 2P5VA 3IO1A 2EG2A 4ZLJA 5AE1A 4X4VA 2KTQA 8AT1B 5A2QY 3KLIB 4NLOA 3NS5A 4O0NA 3SV3A 4ZJQA 3J7ZT 4B9UA 2KJWA 3VGVA 1X4AA 1DZ5A 1NSQA 4IOCQ 1GXUA 2AJQA 1EP4A 5LM7E 2XCPA 3WX4A 2RQCA 4YR2A 3K5PA 3BGLA 5L39A 4IO9Q 5KG7A 1NPRA 2GC8A 3OFFA 5B0FA 4MT1A 5CZXA 3R5JB 2BJDA 4LVOP 4ZLNA 3W8PA 2IPOB 3VGSA 3FNNA 1VQMS 4EBCA 2CWKA 2IMWP 2V4JA 2R9LA 4M5HA 2ZH1A 1EQMA 3CCUS 4G3IA 1WDTA 3G8QA 3HD1A 1R8CA 3EVOA 3K0JA 1LW2A 1H3DA 2OPPA 1TUGB 3TVYA 1H2TZ 1HD0A 5LMNJ 2CKWA 2VH7A 1MWYA 3DHXA 3T1HF 1RAJA 3ZZTA 3GV8B 1V5IB 2WTFA 2Z8QA 3QO9B 1TKDA 2OEJA 1Q79A 2C2EA 1VLYA 4MIWA 3TUJC 2V4QA 5LMNF 2MJNA 3CMQA 4M5IA 2HRTA 3MFIA 3ULHA 2DT9A 4LF1A 4OFZA 5L1KA 5IT4A 2FY1A 2UUCJ 5I3UA 4TQRA 4DQSA 2DGTA 1IKYA 2V9KA 3J80Y 2AYMA 1KKHA 1T3NA 2Z58B 1XBWA 2UUCF 3M8RA 4DR1J 4DDFA 3I6PA 4DG1B 1U1MA 1Q1KA 2DXEA 2HSEB 4LIWA 2EFQA 1S1XA 2DR6A 2XSJB 3EE3A 4JV1A 4DR1F 2V63A 3NOCA 1LWCB 3H42A 2WVCA 3GJQB 5L46A 1S79A 4DR3F 2L9WA 2RH3A 1XNRJ 3JYTB 3DLGB 2Z2YB 3MR6A 1K9MT 4ZMMA 2AU0A 4JI0J 2JOQA 1VCTA 5C24A 5B0AA 4ECZA 1S6PB 3IS9B 3CEDA 2XS7A 4WKYA 2OIHA 1XNRF 3QJPA 3NLCA 2I2YA 2O67A 4DPXA 3OVSA 5CYJA 5LJ3Y 1VK3A 1FDDA 3IWLA 3AOCA 5KFTA 1S1VB 4DCPB 4QCLA 2VODA 5DG8A 1JJHA 3M8QA 4C0HA 5A8KA 3CSKA 2DGXA 1NLKL 2X1BA 2XMUA 2J7KA 1RI7A 3DNCA 1QSLA 2NUUG 2IC3B 4OHXA 3U1LA 5KOXA 3J7AN 3MCNA 2C2ZB 2ZJQQ 1UAWA 2IRUA 3NWGA 5DLGA 1MROB 3HJFA 4FYYB 4PG5A 1RHRB 1QUPA 4X4RA 2HMIA 2VPXB 1YKWA 4DZDA 1FI4A 2ZBRA 2BV3A 1VQ5S 5BYQA 4DJBA 1NKBA 3ZXWA 2UUAF 1FRHA 3OXLA 5F0WA 2Q3PA 4MYUA 1NBEB 1IJFB 4PRFA 2VBXA 1DBDA 1S1UB 3DLJA 1FNXH 3IM9A 2FTRA 3IBWA 4N41A 3AT1B 4OYBA 3H0PA 2E1CA 2RIJA 3V4IA 1CQMA 2PA8D 4ZPCA 1JLCB 5HBMB 4EU0A 2KJVA 2FC9A 2YX1A 3EZ5A 4NA2A 2GHPA 2K2PA 1RHJB 2XGPA 3R8YA 3HVTB 4IFYA 3HFKA 2Y0SD 2X7IA 3MMAA 2W1BA 1OYDA 1XIQA 1J5EF 2G0JA 1ICEB 1XEZA 3HKZD 2IHR1 1RP5A 2AHOB 3MMJA 3N4WA 1RAEB 1JLGB 4CTAB 4LF4F 2BR0A 1VC6A 1O6XA 2CPEA 2RB7A 4KPYA 4KC5A 4KT0C 2DHHA 5CH7B 4M5JA 3HHLB 4ZLPA 2BKOA 1NB2A 2GMJA 2IRXA 3DFEA 3GJSB 3QWPA 4L6V3 4DL4A 4DWIA 4CLFA 2WOMB 1FEEA 4NYOA 5J1NA 1H98A 3R2DJ 3I4PA 1WOSA 1KVJA 1FTCA 3Q8VA 1K44A 2PFDA 2DR9A 2RT3A 2YWFA 1RTDA 5D78A 3SDEB 1UPPA 4JI1F 2UUTA 2ZBPA 1SL2A 3DRPA 3S01A 2BEFA 1XK8A 4DF4A 2VF3A 3QSIA 4L3KA 2VU5A 2HGMA 3PXGa 4NLGA 1QVFR 1O0PA 4FVCA 2VC1A 2H65B 4K8RA 1IUJA 2YKAA 4M5GA 2YNGA 1U45A 1TKTA 2ZZMA 2B0GA 2E1RA 1Q4RA 2HRYA 1C4CA 4RWWA 4DL7A 3PY8A 4LF9J 3ZZYA 5D77A 3BN7A 3R7NB 4I6WA 1ZOTA 5HP1A 1WI8A 2FUG9 2QG9B 1KSPA 3A1YG 2XNRA 3PR5B 2KVIA 2HFVA 1EKRA 4KBIA 4DQQA 3KMQA 3HP6A 2YNHA 1WOOA 4EWTA 2ZNZA 4I2QB 2CAJA 4DBQA 1IM6A 4ED7A 3JQMA 2UXDJ 3SYZA 3G96A 5B0EA 3TWZA 1ZPVA 4O3RA 2PI4A 2FQQB 1VQPS 2HEKA 4ID5B 2RE1A 3IG1A 4NCGA 3W66A 1F2HA 4ED2A 4YY3J 3MUTP 4RW9B 3DGPB 3DOKA 5D8HB 4CO2A 1S97A 4RU2A 4LSLA 1DLOA 1YWXA 2MXYA 3I5CA 2RVJA 1GXLA 2F5GA 4KH0B 5A2QU 4S0MA 3BM7A 3W3SA 3IMQJ 3IBFB 5D0EA 2GMHA 4X65F 2K3KA 1V3RA 2RHQB 1S0MA 3GIKA 4FNIA 3Q8QB 4M63A 3RR7A 2GIRA 3LAKA 2KVQE 5C25A 4FXWA 1YRTA 3C3LA 2KT2A 1DTQA 5CHCB 2XO7A 4OI2A 4CNZA 2A6MA 3G82A 3IC1A 2CXEA 2DPJA 2ZVSA 2XMTA 4OI6A 2DXDA 2F3JA 2DEIA 3K7RA 2A3JA 4BWJA 2XGQA 2ERRA 2J9DA 4B02A 1IBCB 3HVRA 3KTQA 3W2VB 3EX7B 5HL7Q 1FKAF 3K5MA 2YTCA 2DNGA 1S9FA 2RDDA 2IBKA 4OI0A 1BLUA 1HI8A 1GTHA 2B3TB 5J2PA 3BQ1A 1SUQA 1A6LA 3MEGA 5D4NA 3OFHA 1TL4A 1RT7A 4XAKA 2J76E 2E5LJ 5EWFA 2ZKUA 5J2QA 5AXMA 2NYHA 3MR7A 2D74B 5E3QA 2F9JA 1MW7A 3J80U 3CCMS 3IWXA 1KDNA 2E5HA 3VAKA 5L38A 4O4RA 5KT5A 3HPOA 3AD8C 2XLKA 4RBTA 3ZTQA 4J90A 3MPVA 2MKKA 1YRXA 1XC9A 1I94J 4MK9A 2W8KA 3JSMA 3Q89A 3ONQA 3RRHA 2CNOB 1ZZFA 1OY9A 3BH6B 1FX4A 1P1LA 4RZRA 4LFBJ 1SC6A 3H98A 3E01A 2CZ9A 3MEEA 1I94F 1R6YA 3A8EA 1OQ3A 1FKPA 5HVGA 1SKUB 2ZBCA 5ETSA 1SJ1A 2NZCA 4O44A 2H3EB 1X4BA 3TJ9A 2CNLB 3T5KA 5J1EA 4C8KA 4FZVA 4LFBF 1S6QA 4FXDA 4HACA 3ILIA 5KFCA 1VQNS 1JQGA 1CULA 3M8YA 5F3TA 3UD3P 1ZM9A 3MD1A 1C2PA 4WBFA 3JB9k 3GE9A 2ZH3A 2J9DE 3ICLA 2G9OA 3MCMA 2CRLA 2IJRA 1QAYA 3IM8A 3M6WA 3H5UA 1WSRA 5ETQA 3BBCA 2V67A 3HLUA 4FVMA 2UUWA 2X3GA 9ATCB 2XTJP 2Y1RI 3HM9A 3RRKA 4DFPA 1N52B 3TZWA 2KXNB 1HHSA 4K50A 3C6TB 1W25A 5EX3A 2W4PA 4NEZA 1Q81T 4L72B 4WP3A 1FJGF 1BGXT 3MFHA 4K4VA 2BE2B 3MEDB 1TVRA 4FPRA 2F40A 3SIPB 2FYXA 4OLPA 3P96A 1C0TA 1SQGA 5K14A 4U9RA 3FJ2A 1IJEB 3KHLA 2LXIA 1R0BG 2KG0A 3WZ0A 2J7WA 2Y0BB 3MM5B 2F63A 3AB4B 3KWMA 2GO9A 4YFUA 4OX9J 2DNNA 4KV8B 3CGIA 5BR8J 1SXLA 5F8GA 4DSIA 3HF5A 4MYTA 1RWPB 4RW4B 3EVMA 4WU3A 2QEXS 2R8HA 2RRNA 4MH8A 3CF5Q 5BR8F 2YY3A 4E8UA 3ZFVA 5ADZA 8ATCB 4CH1A 2W9BA 4K5RA 4DSFA 2UVVA 2GCFA 5HQLA 5ETMA 4Y34A 2WBMA 3UDVA 1NH8A 1AZSA 1H72C 4C0BA 1Y3JA 3UQSA 2RDJA 4C3LA 4IR1A 1VRTB 2H54B 4B9SA 1LK5A 3BQ0A 1JKHA 1BQNB 1FRIA 3S1TA 3BB5A 3MOJB 3KLFA 4YP3A 1YVFA 4OI3A 3FZ2A 5KT6A 1Y9OA 3NOGA 4TLQA 5EUHA 1TKZA 1L5UA 4DV7F 4PAAA 4KGXB 1GAOA 3BREA 1Q95G 1F1BB 3ET6A 4RNNA 2Q6CA 3TA1A 5IM0B 4Q8FA 1VC0A 3OVBA 3MURP 3DOMA 2DIUA 4RJVA 3ADAC 4F7VA 1YJTA 3Q2SC 2QLFB 5HJYA 1K73T 2FDNA 4ZVGA 4ZOSA 4ZJOA 9RUBA 5GMKa 2MKIA 1HBUA 1IR2A 4GKJJ 2FHOB 1V6HA 4GKKF 2Y1LB 2M4MA 1IKWA 2HIQA 2ZHBA 2HWTA 2DBBA 1HQEB 3CCWA 4UOCA 2DRAA 3CMES 2DNYA 2DB1A 4GKJF 3M32A 3M8PA 1RADB 3BYPA 4DV0F 3N6NA 3NGUA 1WHVA 3BKTA 3DLKB 6FDRA 5KT3A 1F9EB 1SIZA 2ZM6J 5CD4A 2B7CB 1WKLA 4ZPWR 2VDHA 4MJKA 3RR8A 3U02A 3AA9A 1AYEA 3ISNC 2DXFA 1NHUA 1T9YA 4LBIA 2B5JB 2JC0A 4CH0S 1RWWB 1VLOA 2D1CA 4NMLA 1CJVB 3KYLA 1WG1A 2EEYA 4JI4F 4NXNJ 4EI2A 3MECB 4RNMA 2ROGA 4MKYA 3CT9A 2XQCA 2RD5C 2AYBA 3RW7A 1M1GA 4LT6A 3FRYA 4YMEA 4KO0A 2HHWA 1FXRA 1TKXA 3EWGA 3FCVA 4Q7AA 5EGYA 3OD2A 2KFNA 5DJBA 4C9DA 4C4WA 2FB0A 4CLYA 5ETRA 2AJFE 3K8WA 3CJQA 3CE8A 2UV8G 1ZM3A 1K0TA 4WPAA 4TU8A 1VISA 3E3XA 2CA9A 3AJ2A 4DR2J 1Z2ZA 5D0RA 1VMBA 2V9WA 4ZVQB 4TN2A 3I5BA 5J2MB 2I5JB 1CJUA 4B9NA 3BN4A 1G7CB 4LF7J 2W9CA 1S12A 2KI2A 5JMNA 4DR2F 1TP7A 1NEEA 3OR2B 5F9NA 1X4CA 2DNZA 2LKZA 2ADBA 4DX5A 1PBUA 5AXNA 5LMUJ 1Z1ZA 3CMAS 2H48B 1FNOA 3J81U 1BE4A 1VI7A 2DO4A 5KFKA 2KG1A 4PWDB 2AJ1A 2DRDA 4DEZA 3C6UB 2G0IA 2E7XA 1HYSA 4X62J 4IQXA 1XMOJ 2GQ2A 1U1QA 3LGHA 2ASDA 4OQJA 1W2BR 3GFYA 1IBLJ 1HMVA 5HROA 1QAIA 3VAJA 2XHCA 1GMWD 2CJBA 4P2FA 3LO3A 4EYHB 3MAQA 1XMOF 2UV8A 4KIAA 4USTA 1RK8A 2DGSA 4ECVA 4JUZA 1IBLF 2XMVA 4PUOB 2IRYA 1RBLA 2QLWA 2HBZB 2E1MC 1S9EB 3R1HA 4AL5A 2M70A 2VG7A 3W9IA 2FC8A 4P7TA 2BMBA 1D8ZA 2B6AA 3RZAA 1ZAXA 1EETB 1IN0A 4A8QA 1R0AA 1S4EA 3LA0A 4PG6A 3H5XA 4JI7F 1Q78A 4IO1A 1J27A 4TQSA 3TZXA 3WX8A 3LH2S 1RSCA 4ZPTR 4NE9C 4LVNP 1FKOB 2DTJA 1T8EA 3TEHB 3THVA 5KFFA 2HNDB 3QATA 4J5OA 4UUXA 3M4XA 4UQGA 5BYRA 2JNJA 5DLFA 1JLEB 1S77D 1IKVB 2BJ8A 1HL6A 2OAUA 1YHQS 3D0GE 4OI1A 3A12A 3ENQA 1G2EA 1L3KA 1DJ0A 1EX8A 1EIYB 2R7OA 3FRZA 2P8IA 3UI3A 2ASYA 3HHDA 1B70B 3N01A 3HJVA 3H59A 1X9SA 3QT8A 5KFNA 1MU2B 2C3OA 2NREA 3QLHB 1YG0A 3DRYA 5KFYA 4FYXB 2CQ0A 5F8NA 2VDIA 4RNHA 1EARA 2DITA 4EBDA 2FHJD 1C1BA 4F36A 4KHPF 5DM6Q 2IAJA 4N8OA 4NXMF 2VFRA 1PGZA 2EWHA 3ITHA 4U8YA 4QYRA 3KHHA 2AMCB 1EKSA 4FXVA 3OFGA 4NLVA 1KOOA 1MWZA 4DR4F 3SQOP 3RW6A 3VCDA 4FF1A 4N8NA 1B99A 3FBCA 1AFJA 2ZH9A 4ECSA 5KG5A 4BWMA 4I4BA 1S1WB 2OO4A 3BR8A 3RBDA 2V4JB 3V2UC 2XG8A 4B9LA 1WSVA 1K1SA 4DG1A 1LW2B 2OPPB 1BC6A 2E9ZA 5J1PA 3AJ1A 2DHSA 2UXCF 1RWVB 2M8HA 2UXBF 1WELA 4IDKB 4FF3A 2DH9A 4ICLA 2ZKTA 2CPXA 4B3TJ 1VFJA 1UZDA 3S6EA 1FRMA 1B64A 4E98A 1UVJA 1Q8BA 4OX8A 2DHXA 5E33A 1U09A 4F02A 1UWBA 4DL5A 2F8HA 2HQFA 4FF4A 4YN3B 5A6PA 1HNXJ 3L9ZA 4B3TF 1R8PA 3GIRA 3S8SA 5I3UB 1N48A 3C8YA 3H40A 3OUYB 4Q44A 1IKYB 1TUVA 3FSYA 2QFJA 1HHTP 1YRUA 3JQKA 4Q2MA 2ZOGA 1HW9A 1S1VA 4CLLA 3W64A 2DJWA 2J9EA 2W2PP 4WTOB 3R1LA 1QLNA 1V3ZA 5JUMA 5ETKA 3EGNA 4BBYA 3DRXA 1S1XB 4ALZA 2IC3A 1TMMA 2WAQD 1UPMB 2P6TA 2AP6A 3W5ZA 1TR0A 3CJ8A 2HAIA 2L41A 1MROA 3Q22A 3WIUA 2JLFA 1TAQA 4WYWA 4O3OA 1P27B 2ZDOA 1W2IA 4C0OC 4OX6A 5C24B 4U96A 4QWDA 4DUTA 4C2MA 3R9LA 1FRKA 2R2RA 1Q8IA 1WC1A 3ZTPA 1SH0A 2DGUA 1P9QC 1WF2A 1NB7A 1BD6A 3B54A 1WNEA 3HVTA 3QBCA 2ABYA 2XWYA 1WC4A 3AY0A 4P2SA 4CLPA 1LWXA 4H4KC 1TFYA 3M9OB 4KH1B 5M2RA 1R8AA 2XY6A 1JLGA 2HQ3A 1RU2A 3PEJA 2HMIB 4CDIA 3I96A 4KQZA 2DKOB 3CJTA 2B9WA 1VJQA 5GADI 2HHXA 4TYAA 2A0FB 5IXUA 4JI8J 4CYUB 3UNYA 1QAXA 2BKPA 1RCXB 2D3OR 3BKFA 2PIIA 1XNQJ 5IWAF 2IYGA 1WKJA 4NMXA 5FIIA 4C8MA 3TEGA 2HNZA 1ZTTA 3OTDA 3HVWA 2D7SA 4PYDA 1UKUA 2XZWA 5I3QA 1XMQF 2CPYA 4WP9A 4QPXA 1NK5A 4PABA 4HEA9 3A13A 3SDEA 1BMQB 4YEAA 5KFJA 3V81A 4XK8C 5AXLA 2GAHC 1DRZA 2F8EX 1TL7A 4PPZA 2ZC3A 4EYIB 2BXJA 4OZJA 2YNFA 2OH2A 1AA1B 4A4JA 5BJRA 3FEXB 4OJGA 3CCZA 1RABB 4B9MA 3GIJA 4HI1A 4ZHRB 4M5LA 4OHVA 4XDCA 2RRAA 3VF0B 3PVXA 3PHTA 2C2RA 4NCBA 2O3DA 2Y9HA 2UVRA 2RRBA 3D67A 4B08A 2J6TA 1RE1B 2OFGX 3KHRA 4I2QA 3Q86A 1RTDB 5KFAA 2VKRA 2J6UA 4K5SA 1PSDA 2JX2A 1UJ6A 2FVCA 1M5KC 1OYEA 2BABA 2KKHA 5FJ4A 4J37A 5MLCV 3OTCA 2HURA 1VQ7S 3PW2A 1M1KT 2J5AA 4NI2B 5IQQA 2HPUA 4QU6A 4RW9A 3DGPA 4WJBA 4GC6A 4A46A 3BPDA 1F3FA 1OJ4A 2AQ4A 3CD0A 5T41A 2JJ4D 4HDHA 5HP1B 1NO8A 4LRCA 1BQMB 1S48A 4O4GA 4MKAA 4ED1A 1P8GA 4C8LA 3K2YA 2W7OA 2RF2A 1DQAA 3C14A 1XR7A 4HH1A 5DDQC 1DHMA 5I4MA 4Y6IA 1GTEA 3PW0A 2R7RA 3EDRB 2DPIA 4H4OB 4DLEA 5EHHA 2MY7A 4JYAJ 2QLJB 3UDCA 5DETA 4BHQA 1URRA 1WDDA 3E2EA 1KD1T 1AFIA 2C22A 2QC3A 2G1DA 4D3HA 2AEJA 3GIIA 3DOKB 3UN3A 2P9EA 2CPHA 2BQRA 4FBTA 1DLOB 3IRWP 1O8BA 3FBEA 3CDBA 5CD4H 1NU4A 1C1CA 2DY1A 2VA2A 2P2CB 2BYCA 1U7LA 2FJDB 3FEYB 3G8TA 3W2VA 3OPKA 1NKEA 1CEZA 3P45B 3JXOA 1X60A 4FYVB 5L1IA 1NJYA 1WC5A 3AQPA 4EEYA 1RCOB 1LFWA 1E6YA 2RQMA 2P9GA 4R25A 1XWLA 4A8SA 3CJ0A 4J9QA 3MWBA 3RB4A 2ASJA 4IRCA 2B4OA 3UVJA 1V5VA 1X4DA 3SEOA 1UEKA 4L73A 5KFRA 1Y10A 5C25B 3CB4A 2HK2A 5ETVA 2FLOA 1D9DA 2NZ4A 1DTQB 4X4NA 4PCQA 3CDUA 3W2WB 1QE1A 2ZDPA 4F4ZA 1RB0A 3UR0A 1YZ6A 4JI2J 2C1EB 3PX0A 3BZQA 4DV3J 2OJ3A 3JSBA 1N5SA 3B78A 1T3OA 3PRVA 3H7HB 1R3NA 1S76D 2BW2A 4NA1A 1X5TA 2IM0A 1VQ4S 1HNVA 5KG0A 1NRKA 4KKOB 2ZZNA 3BSOA 2IDLA 4DPYA 2KFYA 2VQFF 3NWRA 1JK9B 3PZPA 1GFWB 4A47A 3IR5B 4DUZJ 5ETTA 2DYAA 4FKYA 2R3VA 1UTAA 5IT0A 3RAQA 1S99A 2D3ZA 3W5XA 2V8VA 5KFQA 4YS2A 4DUZF 3HK2A 2R7VA 4QYZK 4MFBA 2DGVA 2XC9A 3LWLA 3VAGA 1NDKA 3MUVP 3QNWB 2W9AA 1H73A 1O51A 3H25A 1X5SA 2HS3A 4UOFA 1R7IA 4Z2XA 4ECQA 1ROFA 2L48A 2DNQA 2UVWA 3TP2A 3JSMB 1U4BA 3DLBA 3OW2R 1H7XA 4X64J 2WHOA 2B56A 2JFDA 3RBZA 1RHQB 2CQDA 1OSCA 1NK4A 2HLUA 1FKPB 2DNHA 3QT7A 2KHDA 3PYEA 4IRKA 3M7VA 1FRLA 3PW4A 1N56A 3Q8PB 4R0EA 3P5TL 5ETOA 4ZKAA 1U6FA 1ZH5A 1GEHA 2ZUGA 1ZPWX 3MDFA 1U6BA 2CADA 4JBCA 4HACB 2QA4S 1Y5LB 3MEDA 2MKYA 4IG0A 4RW7B 2MHNA 1CULB 3IAM9 3JQJA 1C4AA 4OYZA 4NASA 4P2MA 2NLWA 2MQOA 1URNA 2GNKA 1Y7PA 4F50A 1I6JA 2ATCB 5K5MA 1QDUB 2JSXA 4F2RA 2R2TA 2HHSA 1SB6A 2Z57B 2RQ4A 3M6XA 5K8OA 4RPFA 5E7OB 2HNYA 4UOHA 1IKXA 4KV8A 2YH0A 3I9ZA 5KFBA 2OMOA 5CABA 1LWEA 1JNZB 3THTA 1PC5A 3FQLA 3DU5A 3UO0A 4D3GA 1K8AT 1FK9B 2V2QA 1SCJB 2QYGA 4QR2A 4G1QB 3BS9A 3BPSP 3I32A 4A8OA 1C0TB 2AIRB 2HHQA 1FD8A 3M6VA 6FD1A 4YHHJ 1IWGA 1PJ7A 1VRTA 3TZYA 1U0HA 3BSAA 3QPIA 4ED6A 3NY0A 4LJMA 3HSZA 4LFAJ 3JSYA 4YHHF 1EZZB 2W7PA 4RUBA 3U1MA 3OTOJ 3A4TA 1T9WA 1ZAWA 3TA2A 1HBNB 1TFWA 1SJFA 2FJWA 2B43A 3NCRA 3BSCA 2KRRA 3GFXA 5HMZA 1N33F 3UDEA 2KXHA 1Q5VA 1NDCA 4JV5J 4F8RA 3ZZUA 5DQGA 2IA0A 3FSIA 4H4KA 1AZSB 2QL7B 5DG7A 1Q7LB 3ZTOA 1QSSA 1RISA 1REGX 4WE1B 1T95A 3DYAB 4YB6A 4JV5F 2A6OA 2VONA 4IG3A 1UFKA 2CJ9A 1NH7A 1QSYA 4JI5J 4AUKA 1UMJA 2J8AA 3PKMA 1HQEA 5G0RB 3T6JA 1VOMA 2JZ5A 3CJ3A 2MKSA 3MR3A 3GYXB 2HBQB 2EC0A 4JI5F 3NEKA 5K20B 4IOAQ 1NUEA 3ET6B 3QIPB 1CLFA 3T9ZA 4PR6A 2BW7A 3L4BC 7FD1A 3L7PA 4P7VA 2J0SD 3CCVS 4K0KJ 2IVFB 2EK6A 2IBOA 3LWMA 3D6FB 4DHVA 1ELOA 1Q82T 1FFSB 4HL9A 3KK1B 4ZA1A 3PYDA 3MECA 3NNCA 2ZHOA 3SSSA 3G2XA 1S5ZA 4H4MB 1S6OA 2FVRA 1IKWB 1S0NA 3G6VA 1VK8A 2RS8A 2C3UA 3H2VE 1IBKF 1WC0A 4Q8EA 1MG7A 2CFXA 3H8YA 3M32B 3M8PB 5B7WA 1KQSR 3CCES 5D6GA 5T7LB 2LQ9A 3TAMA 1CJTB 4LF2A 3SCIE 2P6SA 2XWXA 5B08A 3Q2TC 4F2SA 1AROP 4OYMA 2HFOA 5A0YB 2EFPA 2GJ2A 4X4OA 1SQFA 4BCAA 3KLVA 2FJVA 1P9YA 4KJIA 2YPYA 5H9EK 4G1PA 2BRKA 2RMLA 1RWXB 1HNZJ 5DDOC 4K7QA 4ECUA 1KR4A 3BO4A 3BF4A 2NS1B 3UFCX 2QA1A 2OTJS 2BJ3A 3UN5A 4B3RF 4IUFA 2I5JA 1HNZF 3SFGA 4DR5J 4QWBA 1HQ2A 1WWHA 3CIMA 1IXKA 4CM0A 4KO0B 3O3LA 3OR2A 3KNAA 2WONB 4NLQA 1HNWJ 1NJIT 3MMBA 3QJLA 3F41A 4EZ9A 3SV4A 1H2UX 4F04B 1I51B 1N32J 5ETLA 4DUYJ 2XMKA 3JTNA 2EK1A 1IR1A 3C6UA 1NKCA 5KFZA 2NXUA 4CLTA 4Q43A 4WFBQ 2ROPA 1T9UA 2KRBA 3D1QA 3UN2A 2KFZA 1JLAA 1QTNB 5H9EJ 2VZ9A 1N6QA 2ZC4A 4ZJLA 1NSAA 1UVIA 2W9CB 2D41A 1HD1A 2CG4A 5EN1A 1FXLA 3MM6A 3ZZ0A 1PKUA 4EO6A 2XBPA 2R7XA 4PUOA 2F4VJ 3C19A 2SXLA 1S9EA 2I8EA 2X51A 2D3UA 5KFLA 1U1KA 4F3QA 3A3PB 4RKUC 1EETA 2RNEA 5HMXA 4I68A 2FY8A 1YJ9S 2BJ9A 4FYWB 2M88A 5HANA 2BBEA 4EFAC 2M2BA 4F4WA 1UFLA 3GCWP 4USHA 4AXJA 1VBYA 4DQPA 5B0GA 3CCJS 4OIXA 3VTIA 3KJNB 1WJ9A 3DDIA 2JLGA 5L9NA 2F7VA 3PFOA 2XM3A 1JLEA 1IKVA 1BHNA 2LEAA 1C0UB 2QL5B 4J9NA 3LP1A 2ILYA 4ED3A 1I5OB 3GPAA 5D3GB 1Q86T 2FZCB 1DAXA 2W24A 3MPYA 1X7VA 1NDPA 4ID8A 4DS5A 4NL5A 2BOPA 5HAOA 4PPDA 4F67A 3D6MB 3IFEA 2VBWA 4J9RA 4USVA 1YDLA 2HHHF 3V6DA 3EMTA 2B6AB 1D1UA 1MU2A 1JIHA 1RDRA 4QIGA 1U49A 3QLHA 1KLMA 2NSCA 4ES1A 2JVRA 4HI2A 5LXRA 3LW5C 2BACA 1AW0A 2NCKL 1RWKB 4CWBA 1RAAB 4Y00A 3CNQP 1TK5A 1ZM2A 1R89A 2UUBJ 1UFWA 4QIVA 2MZ1A 3NGSA 2OEMA 2IM3A 3IR6B 2LMIA 3LOUA 3PDNA 4X66J 4RUHA 3B82A 2O01C 3EGZA 2CUYA 2QL9B 4I2PA 5C5JA 1MLAA 2R4FA 2LYVA 4I69A 1NSKL 2BKNA 4NLDA 4OLOA 3BGRA 2IY5B 1BWEA 1DY3A 3N79A 1WG4A 4DL2A 1S1WA 4WK1A 5D0GA 5KT2A 1Q8LA 2HS0A 2M7SA 2G2YA 1Y3KA 3R5BA 1FRXA 2ALZA 3TW0A 4Y0FA 3OL8A 1C1BB 2VC0A 2VBYA 4BC7A 3PO5A 3GWCA 2IAJB 5K8NA 3NGTA 2QSWA 1X9WA 4ZPBA 2IYIA 1FO1A 3ITHB 4J7CA 2CQHA 4OZLA 2XYPB 4IDKA 2PMWA 1TZ0A 3PJXA 2RU9A 5DDPC 3QJJA 4ZLLA 5KFXA 3D3CJ 3LP2A 1UP1A 2PEHA 2YWKA 1YBAA 4YDDB 1N8RT 4I67A 2E29A 5LSLA 1VQYA 3OUYA 4J9MA 2LP4A 2HAFA 1OSDA 1T03B 5L9XA 4G1IA 4QZVB 4YR3A 4X4UA 2R7SA 1ITPA 4ETXA 2LA4A 4Y2KA 2HFZA 2DY9A 1MN9A 1Q8KA 4ENOA 2K3IA 4A8WA 4CRJA 4ECWA 1N54B 5FD1A 1NZ8A 1U47A 1WF0A 3HCXA 2JEIA 3AFGA 3DRRA 2W7AA 4IH6A 5C7PA 1JLBB 3MGJA 3W60A 4HYKA 3RYLA 1T02A 2OTLS 4ICLB 2JL9A 3FQKA 4I0WA 2XSFA 4TXSA 2B4VA 2LA6A 2YX4A 4WIIA 4O23A 1N36J 1UWBB 2LCWA 2H4WB 1RBOB 5CA5A 1U1LA 3KXDA 4XPCA 1NHKL 2QE5A 3AQOA 1YJRA 1J2VA 4LRBA 2K7JA 3P4UB 1VQOS 3FC9A 1N36F 1SVDA 2EW9A 5KG1A 2CNKB 1FD2A 2I6WA 4JI0F 2EPIA 4DU7A 2OHDA 2DR7A 3PM9A 1MMDA 2XMMA 4C3KA 1RTJB 3CDAA 5LXYA 1Z4UA 2RJZA 2APOA 1FA0A 3NS7B 4Y65A 4BLGA 1N0VC 2OD6A 2I38A 2OELA 1LNQA 3GP9A 1FJCA 4ITSA 3WC0A 4URQU 5EDWA 2V8DA 4QBUA 3AH6A 3MPDA 2RILA 4ECXA 2Y1JA 2AW0A 4ZVTB 4CYUA 2OPQB 2QN6B 2N4CA 4OI4A 4XDDA 3G4SS 3EUNA 3AXMA 1WACA 2VA3A 1VQ8S 3OSPA 1N34J 3T9NA 2YNIA 5IV3A 5D4OA 5A8RB 2W4DA 2ZWOA 5J2NB 4PXBA 3TRGA 2DHAA 1GK8A 4DSJA 1V3SA 2MZSA 3DDNA 3E51A 2YQ3A 2MEWA 1RTHB 2VL1A 2F9DA 2W01A 4NYPA 4EBEA 2AEFA 4RBVA 2V68A 3QZ8A 4ERDA 3OR1A 4WFNQ 5IT9Y 4K4WA 4DL0C 3OBIA 4A8FA 4BDPA 4X4SA 2DEJA 3QFHA 4DOZA 2A1BA 4P75A 5CYMA 4K4SA 2ZZTA 1KHWA 4N56A 4HTJA 4ZHRA 2ZE2B 4QIFA 1QAJA 3QQCD 2HNZB 4DV2J 1ZYQA 1RT1A 5IC6B 2VKZG 2WVFA 3D5MA 5DGAA 1MWQA 2F4FA 1HLWA 2MMYA 5L1LA 4P52A 3H5SA 7AT1B 4DV2F 4QW8A 2MHEA 4USKA 2Q43A 1KTQA 1HWUA 1I3OB 2FZGB 3KHGA 1AUSL 4LBPA 3V81B 4KGKA 2FZKB 2AJ2A 3M30B 2BZ2A 3KNGA 4OHWA 3M1VB 1TL7B 3KLEA 4GVBB 4DQRA 3EXYA 2ZITA 2UZAA 4NI2A 2YNFB 2DCLA 3TX8A 4U7CA 2D69A 2ZH2A 5DDRC 4ER8A 4TVAB 1BQMA 2MGZB 3L7OA 1GMWA 3K58A 2JWNA 1Y5IB 2LXFA 2Y8WA 1VS3A 2B9EA 4LF9F 3FSXA 3EPGA 3V6HA 2OKQA 3D66A 1T05B 3ILJA 4M5NA 4H4OA 2BA9A 4X84A 3ZO7A 2ZH7A 3NP5A 4UY85 2OPRB 4ZVEA 2HHTA 3MXHP 1SKRA 2HBRB 2UXDF 3PHEA 1FX2A 2WW4A 1FCAA 4QIWD 4OJ3A 4NPOA 4QU7A 1E6VB 2W2OP 4DV5J 3NAIA 2C2KB 4YY3F 3NNHA 2MQ8A 2AEMA 4O4GB 3I31A 1UW9A 1WC3A 3D2WA 3G6YA 3W7BA 2QIFA 4GO5X 2F65A 3P8BB 4LQ9A 3KLHA 3I87A 1L3TA 2RF2B 3C14B 2YWWA 3MCSA 2KO1A 2R8IA 3GG0A 2PE8A 4RUCA 5CYQB 2KM8C 3V6KA 3IXQA 1EHWA 2Z2MA 4GRSA 3LAMA 1ZA1B 2J9CA 2YH1A 4RNFA 4DX8H 3FUYA 1NK7A 6AT1B 1KRPA 2CJXB 1RLCL 3U1NA 2CPDA 4IH5A 3NL0A 2HKEA 4ZVFA 2FHJA 2V8PA 3W2WA 1RT5B 2Y3YA 1RAGB 4LR9A 4LF6J 1WC6A 3KLGA 1WEXA 1VRUA 2IFXA 1C1CB 1WUUA 2V8HA 1FDAA 1F5BA 3DM2A 4NRTA 4RW8A 3L7UA 1TAUA 5C42B 2DHGA 2E5GA 3NMAA 3RRGA 3DKDA 1E6YB 3PYGA 2A10A 1BWVA 3BDPA 2CPIA 1VBXA 3FMBA 3VVUA 4MMOA 1SH2A 1H0HB 4KKOA 1CVJA 4M1KA 1S57A 5I42B 5H9FK 1XN9A 2Q1LA 3UVJB 4CH7A 4ILRA 1KWMA 3B4MA 3HZGA 2VD3A 1JLFA 1NNDA 2VFTA 4R0JA 2EXUA 3J81Y 1VGYA 4ED4A 1QE1B 2K1RA 2B4UA 2E5LF 2MZJA 2OEKA 2XHWA 3PJ9A 1SV5A 1YZ7A 3T5HA 3NKYA 3HZEA 3Q8UA 5KG4A 5DG9A 2ZH5A 3QGHA 4RX6A 1D3WA 2LEPA 3M2VB 4L74A 4NX9A 4ZN3A 3TYTA 1F5CA 2N7YA 3RU0A 2DNMA 3DLLQ 1HNVB 4OJ1A 3HKWA 3OT9A 2QA4G 4DV1J 3FKBA 3NS6A 5A76A 1RWUA 5DS7A 2ZJRQ 5D4LA 2IVYA 3HI9A 3JS9A 1RBAA 1REVA 1UZHA 4WK3A 3Q8RB 1OY6A 3G71S 5HSPA 1MN7A 2B9XA 4DFMA 4MFBB 3AOBA 1PBAA 4W90B 5CAAA 5KG2A 2AYEA 2D9PA 3QZ7A 1TK0A 4IFVB 4L76A 4RW7A 2PMHA 3PRDA 4V1Ak 4MK8A 1JJCB 2HQDA 4KGMA 3TAQA 1CS4B 2DO0A 4JOUA 4Y2IA 5IZHA 3KMSA 3BDEA 1SKSA 4QJVA 4TKTA 4M8LA 4LUBA 3DI6B 1ZAVA 1D0EA 1M90T 3D0IE 2X1FA 1VIOA 3VQSA 1DURA 4F25A 4LQ3A 2H4YB 3CCSS 1NSPA 2F8MA 3H2UB 2UVUA 4CIOA 4PKDB 2BM1A 3CW2C 3ILOA 4LFCJ 4J9SA 2HVEA 2LQ8A 3KK2B 3VALA 2WVBA 1M5SA 3IP0A 2Z56B 3H90A 4AL7A 1X5PA 3HHLD 4PQUB 1FK9A 4JI6J 1HIYA 4G1QA 3BJYA 4IG0B 4LFCF 4HKQA 3OL6A 2WZ1A 4CLWA 4DPTA 1RYRA 1HPZB 2XY5A 4F26A 5KT7A 3F44A 1LKZA 1X4GA 4JI6F 1HBMB 3K8VA 2VOPA 1OO0B 5CQGA 4WZQA 3O1LA 4ZIVA 5HN0A 2LDYA 1OMSA 4DN0A 3TVKA 1CJKB 1UA1A 5RUBA 3K5OA 1LFPA 3Q83A 4NZ7A 5DZ7A 2HNYB 1IKXB 3W1YC 4RR5A 1PJ6A 5IT9U 2OMLA 1HBNA 1R43A 1S59A 2GJFA 1LWEB 3C15B 1HWKA 1HNIA 2I0XA 1R27B 4J91A 4OX9F 1SBRA 5E41A 3A8JA 3SZ2A 1NAQA 2IJFA 4USMA 3T1AA 1ZETA 4QWEA 4OZ1A 1ZZNA 2CQ3A 3N5BA 4QWAA 1NJZA 2GFFA 1RTZA 2KB2A 1UL3A 3I9V9 2B51A 1KVKA 1YGYA 3MEKA 1WF1A 4OZ5A 2IM1A 4G6VB 4WE1A 3DYAA 2XMJA 5KFHA 1U0HB 1JXEA 1H2VZ 3M9NB 2H51B 4P71A 4I64A 2DR5A 3FCHA 3JTOA 2MLYA 3RGIA 2NXEA 1RT3B 5KFIA 3CJ5A 4E2FB 5G0RA 4ZCKA 3X1LB 2V0NA 2ROEA 2BQ3A 5F41A 2CQ4A 2V34A 3OXFA 5KFGA 1T94A 3TOQA 4HH0A 2K8GA 1GQEA 2LXUA 4P2XA 2X1GA 3QIPA 4TNOA 3TVZA 4B3OA 3MM8B 2ASLA 1TMJA 4LF8J 4CNYA 4F4XA 2WB4A 2GQQA 1S49A 4F3OA 3DGVA 1H38A 4J9VA 5HATA 4M95A 3QGPA 2MTLA 2ZD1B 1RQ0A 3I0RB 3T5LA 3KK1A 3UDLA 2G4BA 2GIQA 4AFFA 2MQMA 3JTPA 3NRBA 1PIEA 4IG3B 4H4MA 3PCOB 1QD1A 3TA0A 1S6UA 3CJSA 1G3OA 2AZ3A 2XEXA 2GAGC 1FFGB 1KLNA 2MKJA 1T0TV 5T7LA 1CJTA 3HULA 2C3PA 3IA0A 2FJBB 3ILLA 3R5CA 3P3DA 5A0YA 1KQFB 1WHWA 1KQGB 1LXJA 4CLKA 4UTGA 1HI1A 2WVDA 1HQUB 5HVHA 2HK3A 4HT7A 3DLHA 3TUPA 3ZZZA 2O66A 1UWAA 2VHGA 2VG5A 4C11A 2GO8A 2CJYB 2GJIA 4CO3A 4MIAA 2ZM6F 4YR0A 5KAKA 4QW9A 5HJXA 4LRFA 2YQ1A 3NNAA 2PEBA 4DSLA 1XERA 4F4KA 3KJQB 3R3TA 1VIXA 2BANB 4Y2MA 3I56S 4QQBA 4NXNF 3MPWA 2JHEA 3WIVA 3TAMB 5B0DA 1XTZA 3UW1A 2LQ5A 5KFSA 4W92B 3Q8YA 1U26A 2WONA 2EC2A 5B09A 1NPKA 5D15A 2J6SA 3T1HJ 2EVZA 1FE4A 3AD7C 3R27A 4EMDA 4Q0BB 3DN9A 3PW7A 1GMUA 2NPFA 3RBEA 3WHIA 1LK7A 2B4PA 3ENWA 2C2NA 3D9BA 4NLXA 5EWEA 4KRWA 5F8LA 3SSQA 3DRSB 4FS2A 2HZVA 3PEHA 1RHKB 4RW6A 5AJ3J 3KJFB 5HLFA 3NCPA 3HFVA 2CG8A 2QV6A 2XULA 2DGQA 4RO0A 1S0VA 3KG4A 1XJWB 4IH7A 1LW0B 4LF7F 2BE7D 5AJ3F 3MMBB 5IOLA 2WW8A 4PG8A 3LTOA 4KY3A 4O3QA 2HBYB 1YK9A 5E3AA 4RL1A 3GQCA 3EGWB 5LMUF 4R5PB 4UY8T 1U0SA 4DR3J 2L3MA 3P6YC 3DXSX 2NYIA 4DN9A 2GMLA 2ADCA 1NHVA 4MKBA 3SI8A 4V19J 5KTQA 1YI2S 5L8RC 1WEYA 1RGVA 3AD9C 2E5JA 3R97A 3IAS9 4MTPA 1JLAB 1C0UA 5M2PA 1N6QB 4X62F 5D3GA 3AXKA 4DX7A 3CDEA 3MM6B 1FFWB 1EQ0A 4URGA 3KDOA 2MPUA 4FYDA 1ACMB 3N28A 4OZ2A 4EZ6A 1YQHA 1SC3B 5HO4A 4FBUA 2CDRB 2NUHA 3SMZA 4DI6A 3KJVB 1P1TA 2R2SA 1TL1A 5CCLA 4N47A 1KTVA 2RUGA 4OV1A 3THPA 3VZHA 4O3SA 1YBTA 3PV8A 4F4YA 2GZOA 3LPEA 2ZBQA 3GR0A 2UUAJ 7FDRA 3FK4A 3LP1B 3K5LA 4KHMA 1RACB 4CO4A 3NAHA 1YBUA 4QWCA 2N4DA 2RDIA 4DZ6A 4CZCA 3NCQA 2L9NA 2DGOA 3D54A 3ENVA 3V6DB 4KGZB 5K8MA 1UEVA 2H5JB 2XLIA 1VQ9S 5KFWA 4PWWA 1JMTA 1P6TA 4DXLA 2XS5A 1KLMB 4ZP9A 1J5EJ 1JJ2R 1ZBTA 3LP0A 5AXKA 4U6PA 2PFFB 2AYGA 5FDLA 4LF4J 4MAKA 1KP6A 2FVPA 5K9FA 2R8GA 2J0QD 5ETPA 2E1AA 2PDAA 3TI0A 1PO6A 2V4RA 1MMLA 2ATLA 3DDKA 4ILLA 4I2PB 2HVIA 3K59A 5HMWA 1SJ4P 1FRJA 2JFKA 4C3MA 2C2DA 3AB2B 2ACMA 1NJXA 1PAEX 3K89A 3BO2A 4DLGA 2ACYA 3BGRB 5CXTA 4A8KA 2RAQA 3LQVA 3VGUA 3W8GA 1IVZA 3SXLA 2GIFA 2LEBA 1B0PA 1TK8A 4JI1J 3BO3A 3HSJA 2C3YA 1NM2A 1T03A 1R6VA 3OTEA 3M8ZA 1HWJA 4KFBB 3N9UC 4ZP6A 2N82B 4K2XA 3ETOA 1FWKA 2BJEA 4WZMA 5FLXY 3C16B 2NXNA 4M5DA 4CLUA 1RWNB 1JLBA 4C98A 3AOAA 2HHUA 2ZVIA 2LECA 3CD6S 3UE2A 2AWZA 2OGUA 1ULRA 1XR5A 1Y4ZB 1HI0P 1OY8A 4OZ3A 3M2UA 2UP1A 4HT5A 3VAIA 3LP2B 4ILMA 1UW4A 5G4DA 4EO8A 4FKXA 1Q53A 3FFIA 4WIQA 1X8DA 2FHMA 2KHCA 4JI3J 5C2GA 1IQZA 2YQ0A 2GVZB 4NLWA 2VG6B 3AA8A 1RTIA 3T19A 1HNXF 2M8DB 1O5JA 3D3BJ 4JI3F 3KDNA 2WBRA 3HMJG 2DH7A 2FD2A 4WF9Q 1L3UA 3DRRB 2CQCA 3SFUA 1RTJA 4TY8A 1FHTA 1ZS6A 3KUHA 2R8JA 2KZMA 1JXLA 1PC4A 3CJ2A 4CLSA 3RJMB 4YQWA 3MUMP 5GMDA 1DTTB 3KUEA 4CLZA 4X65J 2AGQA 2DK2A 1S72S 2VFSA 4UUWA 3FZBA 3M2RB 4HHHA 2OPQA 1Y5NB 3BV8A 4LIRA 3HFZB 4G65A 4ZCMA 3IGNA 1U2FA 4X4TA 5HQ8A 2ZOFA 3CO9A 1JB0C 1F9HA 2IIHA 2YVSA 1NJWA 1Z2LA 1CG2A 5F9LA 5A8RA 1GX5A 2ZBIA 4FPIA 2PMZD 5J2NA 4ZVPB 2FHKA 3M8SA 1QY7A 2RUSA 3IN5A 1Y00A 1OQ6A 3I0SA 3V5RA 4DMZA 4PQAA 1RTHA 1X0FA 2PN6A 1VBKA 3IRXA 3KKFA 3N5FA 2VUGA 1Y0HA 2PGCA 1JJ4A 2N7CA 1VDHA 3GU0A 3DXBA 4U67Q 3VV2B 1M5HA 3QGGA 2QFIA 3LANA 1FWLA 2XYHB 4U95A 3RAMA 4QR1A 1PYOB 4NEYA 4B17A 1B4SA 3LF0A 3PACA 2M0GB 2ZE2A 3TAPA 2GVDA 4JI8F 3D6TB 2YNIB 3MM9A 1LV5A 2YXLA 2VFUA 1XNQF 1WG5A 2QRRA 5JJBA 3BGFA 5HI7A 3B4DA 4IR9A 4UZCA 5E2QA 2DCUB 2E7WA 1J5OB 3DMJB 4ZP7A 1LXNA 4Y2AA 1N5YA 2IM2A 2FJXA 1FT8A 1PG5B 1RZMA 3M30A
chains in the Genus database with same CATH topology
5AXNA 2PSZA 2FIUA 3BSNA 3FMWA 3OR1B 1Z1ZA 3CMAS 1FNOA 2PEHA 2YKMB 3M1VA 2YWKA 1YBAA 5IM0A 4YDDB 1VI7A 1N8RT 3LUYA 2DO4A 2W9BB 2EFVA 4I67A 2E29A 5KFKA 5LSLA 1VQYA 3OUYA 4ZK7M 2KG1A 4J9MA 1KQKA 4PWDB 2BUNA 2AJ1A 1OSDA 1T03B 4DEZA 1OIAA 2HG4A 5L9XA 3C6UB 4G1IA 4QZVB 4YR3A 5CYMB 3SQGA 4X4UA 2KH9A 2R7SA 2E7XA 4RWXA 1HYSA 2JEFA 3DHWC 1KOHA 4ETXA 3LALA 2LA4A 1BQXA 4OZ0A 4IQXA 4Y2KA 2HFZA 3OLBA 2GQ2A 2K3IA 4A8WA 1U1QA 4DSEA 5GVQA 2ASDA 4ECWA 1RT1B 1S9GA 4OQJA 4Q45A 1W2BR 1N54B 1SJ3P 3GFYA 5FD1A 2MGZA 2EBEA 1U47A 1WF0A 2YKQA 1HMVA 3MMCA 1OPZA 2JEIA 3DRRA 1VQ6S 5HROA 2W7AA 4NYZA 1JKHB 1QAIA 4IH6A 4ELTA 1JLBB 3MGJA 3VAJA 1AUDA 2CJBA 4X4QA 5E5NA 4DV4F 4LMZA 3LO3A 4EYHB 4ECRA 3MAQA 4HYKA 1XMOF 3DOLA 3KLFB 3HHEA 3RYLA 2UV8A 4KIAA 3SSRA 4J9KA 1T02A 5A8WA 2OTLS 1RK8A 2MSTA 1WTBA 2DGSA 1KEKA 4ECVA 1X5OA 4ICLB 4JUZA 1IBLF 3EXCX 2JL9A 2XMVA 3VAHA 1SJRA 3FQKA 4I0WA 2DVIA 2XSFA 4TXSA 2B4VA 1GT8A 3D0HE 2ZOMA 2LA6A 1TKZB 3Q23A 3HHNB 4PUOB 1HBOA 2GA7A 2IRYA 2QLWA 2MYFA 3VWSA 2YX4A 1RT4A 1T05A 4RNOA 4KE5A 4WIIA 4O23A 1WD6A 1S9EB 2E1MC 3R1HA 4AL5A 2M70A 1UWBB 2LCWA 2VG7A 2FC8A 2OPRA 2EKYA 4P7TA 5CA5A 3DLKA 4MIBA 3HVAA 1D8ZA 1U1LA 2B6AA 3DLEB 3LGNA 3KLEB 4XPCA 3RZAA 2QE5A 1ZAXA 2ZHAA 1EETB 1IN0A 2N3OA 3AQOA 1YJRA 4A8QA 1J2VA 1R0AA 4OL8A 2K7JA 4PG6A 3KK3B 3FDSA 2FLLA 3H5XA 5KT4A 1TV6B 1Q78A 1VQOS 4JI7F 4IO1A 4TQSA 4USJC 2AX1A 2NPIA 4Z37A 4DV1F 2VBZA 3LH2S 4ZPTR 1N36F 4K4UA 3MM7A 4AL6A 2EW9A 3CCTA 4LVNP 5E3CA 5H9FJ 1FKOB 2DTJA 5KG1A 1T8EA 4RU9A 3PO4A 1E6VA 1FD2A 3THVA 2B5JA 4JI0F 5KFFA 2EPIA 3TARA 2VPYB 2AF6A 2HNDB 3PR4A 4TU9A 4J5OA 3AAWB 3S7RA 4UUXA 3M4XA 4UQGA 4WU2A 2DR7A 3C66A 5BYRA 1HBUB 5DLFA 4B9TA 2YKNA 3PM9A 1JLEB 1S77D 2BRLA 1MMDA 1IKVB 4RBUA 1HL6A 2OAUA 2WCXA 3CJKB 1YHQS 2VPZB 2XMMA 4C3KA 1NK6A 1RTJB 3D0GE 4OI1A 3CDAA 5LXYA 5EX0A 1Z4UA 1N5TA 2RJZA 2APOA 1FDBA 1FA0A 2CVIA 3ENQA 5CZVA 1U1NA 1L3KA 1G2EA 4Y65A 1DJ0A 2E9RX 1FJ7A 3OQ2A 5T14A 5B0CA 2VV5A 2R7OA 3FRZA 5CYQA 2G13A 1KNZA 3UI3A 3H4BA 2ASYA 3HHDA 4QPTA 3N01A 1RT2A 1SJQA 1OS5A 2XS2A 3MTKA 1N0VC 2OD6A 2I9SA 3H59A 1X9SA 1S10A 2I38A 3CPWR 5JVGQ 2VASA 5KFNA 3O44A 4RUAA 2NQPA 1FJCA 3MAHA 5IQ6A 2E5IA 4ITSA 1MU2B 3WC0A 4URQU 2C3OA 2QMXA 5EDWA 2NREA 4DQIA 2V8DA 2U1AA 4QBUA 1U48A 1FVQA 3WC2A 3AH6A 5F3ZA 2RILA 2WSFC 3QLHB 3F73A 4ECXA 1YG0A 2Y1JA 3DRYA 5KFYA 2AW0A 2Y1IA 2KT5A 4WTYA 2CQ0A 2OPQB 3L09A 1MSWD 5F8NA 4RNHA 2DITA 2KDOA 4ECYA 5E3PA 2N4CA 2YKOA 4JYAF 1RT5A 4OI4A 2MDAA 4EBDA 4XDDA 5F8MA 2XY7A 2R7QA 5KG6A 4NCAA 3G4SS 3KOAA 2XNQA 3EUNA 2FHJD 2RKIB 1C1BA 1N0UA 1WACA 2VA3A 1VQ8S 2CZVC 1GNKA 4WXOA 3WBZA 4KHPF 4I7FA 3OSPA 5DM6Q 2IAJA 3HHKA 3T9NA 2YNIA 3CCRS 5IS2A 4N8OA 1APSA 4NXMF 1FTRA 1JNRB 2VFRA 1PGZA 4K4XA 5D4OA 5A8RB 5KOWA 2W4DA 1LWFB 3VZIA 4ATNA 1XMBA 5C42A 1ZTWA 2LU1A 2W8LA 5J2NB 1U6ZA 2EWHA 5J2MA 1X0PA 4PXBA 3ITHA 2EFGA 3KLHB 4DS4A 2EFNA 3TRGA 2JLEA 4ECTA 2DHAA 4PG4A 4DSJA 1KN6A 1V3SA 1X4EA 4NLYA 1Q16B 2XCAA 4QYRA 1H6KX 2MZSA 3DDNA 2B9YA 3KHHA 4F3MA 3E51A 2YQ3A 3M9MB 1YTYA 1RTHB 2VL1A 2HGNA 2F9DA 4NYPA 4FXVA 3OFGA 1FF2A 1JLQA 1KOOA 4NLVA 4EBEA 3GZ7A 1MWZA 5I42A 1UETA 4DR4F 3RW6A 1VQKS 1TKXB 4RBVA 3VCDA 3QZ8A 4FF1A 4ERDA 3OR1A 2QLXA 4N8NA 2DNPA 4WFNQ 2YKMA 2CQ2A 5IT9Y 2V5HG 4K4WA 4DL0C 3OBIA 2GGPB 3PNIA 4BDPA 2OLWA 4A8FA 1AFJA 2ZH9A 4ECSA 5KG5A 2ILZA 4BWMA 4K4YA 2PO4A 4I4BA 2DH8A 4X4SA 2R7TA 4OMFG 1RYSA 1S1WB 4DFJA 4DOZA 2A1BA 3ISND 3Q8SB 1FJEB 2P9CA 2AJ4A 2OO4A 4PWDA 3BR8A 1TL3A 5LSOA 5DGBA 2WSCC 3RBDA 3ISZA 2COLA 2V4JB 5CYMA 4ZPVR 4K4SA 3V2UC 4AYBD 2XG8A 4DR6F 2MQQA 4B9LA 4FP9A 3KLGB 1KHWA 4N56A 4HTJA 1R8HA 4ZHRA 4X4PA 2ZE2B 2NSBA 1VRUB 4QIFA 1QAJA 3T1YF 1K1SA 1B7FA 2HNZB 1SI9A 1ZYQA 4ETZA 1RT1A 3TUIC 4DG1A 1LW2B 1UJ5A 2MZTA 2OPPB 1BC6A 5KFEA 1MMNA 2QA2A 3DM2B 2V2KA 2VKZG 2E9ZA 3G6XA 3D5MA 4RW8B 2YKPA 5J1PA 2M9KA 3AJ1A 3M2VA 5DGAA 2YWEA 4BC9A 3B8HA 2DHSA 3F56A 2UXCF 4JI2F 2FLNA 3POTA 2M8HA 2MMYA 5L1LA 2UXBF 1WELA 4IDKB 3H5SA 4FF3A 4DV3F 2DH9A 4DV2F 3RB3A 3K5NA 4ICLA 4QW8A 2MHEA 2ZKTA 2UU9F 2CPXA 1VFJA 2CQPA 3S6EA 2Q43A 1KFSA 1FRMA 1B64A 1KTQA 1HWUA 2Z4PA 4IOBA 3KHGA 4E98A 3V81B 1UVJA 4OX7A 1FNMA 1DQ9A 1M5VC 3OVAA 1Q8BA 4OX8A 1QJHA 2RS2A 2DHXA 4KGKA 1RKIA 3M30B 5E33A 1U09A 3I4HX 4F02A 2BZ2A 2FPHX 1X4FA 1UWBA 4DL5A 2F8HA 3KNGA 4FF4A 1WHXA 4OHWA 5A6PA 3M1VB 4LSNA 3KLEA 2HLTA 3KG1A 4B3TF 4DQRA 1JLFB 3EXYA 1R8PA 2ZITA 3S8SA 5I3UB 3MR2A 1IQTA 2GV1A 2UZAA 3OXGA 1RT6A 3C8YA 1N48A 2YNFB 3H40A 1TV6A 3OUYB 3BQ2A 2DCLA 3TX8A 1CSJA 1ZM4A 2PD1A 4Q44A 1IKYB 1TUVA 4OZNA 3RB6A 1Q7YT 2K1RB 3SQGB 4U7CA 1FKOA 2LQJA 3GIMA 3FSYA 1HYSB 5KG3A 5E3RA 2QFJA 1HHTP 1YRUA 4Q2MA 1U8SA 2ZOGA 2ZH2A 1QTMA 1SV5B 4DFKA 1HW9A 3HHLC 3BEGB 1S1VA 2HNDA 2KN4A 4TLRA 4IFVA 5DDRC 5MAOA 4PXCA 3NBPB 1YJWS 4OHZA 1D9AA 1S9GB 4A8MP 1BQMA