2MZJA

Nmr-structure of the nop6-rbd from s. cerevisiae
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
82
structure length
82
Chain Sequence
b'GNRFIVFVGSLPRDITAVELQNHFKNSSPDQIRLRADKGIAFLEFDADKDRTGIQRRMDIALLQHGTLLKEKKINVELTVGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleolar protein 6
publication title Not known yet
rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Rna binding protein
total genus 19
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2015-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mzjA00
2DGSA 2BZ2A 1VBYA 1X5OA 4TU7A 3UCUP 1W2BR 2X1GA 3CCLS 2CQDA 2N7CA 2ADBA 5DM6Q 2RRBA 3S7RA 2KM8B 1NO8A 2CQCA 3CULA 2DGXA 3P5TL 2MQNA 4TU9A 1VBXA 2MJNA 3ZZZA 2VONA 3CC4S 1U6FA 1U1KA 4PRFA 2CPXA 4YOEA 2VODA 5DM7Q 1VQ8S 1ZZFA 3NS5A 2KHCA 3LQVA 2SXLA 1U1OA 2ZJRQ 2M9KA 2CPEA 2E5HA 1WEXA 1HD1A 2MZRA 1JJHA 3VAIA 2LEBA 2MY8A 2LA6A 2G4BA 3Q2SC 3IWNC 4Y00A 5CA5A 2X1BA 3CF5Q 4BS2A 4V19X 2VOOA 3G9CA 3UWTA 3CCRS 1RKJA 2MYFA 1L3KA 2FY1A 3PIOQ 1FJ7A 3U1LA 2V94A 2DNNA 4TLQA 2I2YA 3BS9A 3MD1A 1M90T 3CC7S 2DNHA 1UP1A 3H2VE 1FXLA 2E5IA 1VQLS 1VQ6S 2MY7A 2NLWA 2CQ2A 5JVHQ 2RS8A 5BJRA 3RW6A 1U1PA 3MXHP 4CIOA 1N88A 1YWXA 2HGNA 1VQOS 1WHXA 1OWXA 2N3OA 3I56S 3US5A 4ZKAA 2CPIA 5GAEU 2MQQA 2DNQA 2MZ1A 2MZTA 3PIPQ 2DGVA 2JX2A 1X4EA 1U1MA 2DNMA 2HGMA 2DH8A 2MZQA 4OZ0A 5GVQA 2E5JA 1SXLA 3J7ZT 2KYXA 1SJQA 4UQTA 1U1NA 1A9NB 2KFYA 1X5TA 5CXTA 2DO4A 5GAGU 1NJIT 1WHVA 2I38A 4EGLA 2CQ3A 3BO3A 4ED5A 2G1DA 1HA1A 2CQPA 2XS5A 3EGZA 2LXUA 3P6YC 3DLLQ 2X1AA 3G6ES 1VC5A 2DHGA 2DGWA 3P3DA 2KXNB 1UFWA 2F3JA 2JWNA 2CPHA 2F9DA 2LCWA 1K9MT 2D9OA 2KXFA 4OZ1A 3CXCR 2OSQA 2E5GA 3CCUS 5DDQC 1S72S 3FEYB 1H6KX 3V4MA 2DHXA 2MB0B 5H1SV 5LJ3Y 2CQ4A 2YH0A 2HGLA 3K0JA 1AUDA 1BY9A 1DHMA 2YWKA 1NU4A 2DIUA 4RU2A 2DITA 2DHAA 1M5VC 1O0PA 2VOPA 3NNHA 2G0CA 2M4MA 1Q86T 1WTBA 1FHTA 3TP2A 2U2FA 3SDEA 2DHSA 3THTA 1X4FA 5LJ5Y 1YI2S 2CPYA 2FHOB 3UCGA 2YH1A 1Q7YT 1FJCA 2KRRA 3MI7X 2J8AA 2DGOA 1HD0A 2JVRA 2MQPA 2DO0A 4FXVA 3CUNA 4P6QA 1WI8A 1VQ9S 1SJFA 4U67Q 2LEAA 1X0FA 3NMRA 2LMIA 1Q82T 2L9WA 1M5OC 4F25A 2GO9A 2DGUA 2LKZA 3BO4A 1WI6A 2DNYA 2JRSA 2AYEA 4WCEQ 1CVJA 1D8ZA 1A7GE 2KN4A 3R27A 3ZZYA 3G71S 1YHQS 1OPIA 2KH9A 2DH9A 5GADU 3TYTA 2A3JA 1X4CA 3CD6S 1RK8A 3UD3P 2QEXS 2LQ5A 2CPFA 3MOJB 4W90B 2XB2D 2XSFA 1DBDA 2M88A 3P49B 2EK1A 5DDOC 2YKAA 4QU7A 1SJ4P 1VQNS 4J5OA 1KD1T 4LJMA 3BEGB 2KM8C 3SMZA 2MKJA 2ZJPQ 1HL6A 3MUTP 2DH7A 5HO4A 1KC8T 2LXIA 3R1LA 4QU6A 2HVZA 5GMKa 1PO6A 1VQKS 1JMTA 5JVGQ 1KQSR 1U6BA 2F9JA 2K8GA 1WHWA 4TU8A 5FJ4A 5DDPC 4C7QA 2M2BA 1VQ7S 1X5SA 2MQLA 2OIHA 1WG4A 4Z2XA 4PKDB 2J0SD 3U1MA 2KRBA 1SJRA 1P27B 4F02A 1H2UX 3OW2R 2RT3A 5D78A 1KOHA 1WF1A 2DNOA 2GHPA 2CPJA 4ERDA 3J7YU 2CQBA 3VAJA 3RW7A 1YIJS 3CPWR 2AYBA 3MUVP 4IOCQ 3TO8A 3HHNB 1VC0A 1X5PA 2DB1A 1UAWA 2KT5A 1WEYA 2MMYA 2Q79A 2RQ4A 3EGNA 2MGZB 3IRWP 1WWHA 4F26A 2U1AA 2DNKA 1QM9A 1IQTA 1VQ4S 3N9UC 2MKKA 1UW4A 2J0QD 5IFMA 3SDEB 4IUFA 2LYVA 2EVZA 3I55S 3SXLA 1X4DA 2RVJA 3LPYA 2KG0A 2RQCA 1JJ4A 4WFAQ 3NNAA 1H2VZ 2MGZA 3S01A 2DNGA 3DXBA 1U1QA 4LMZA 2RRAA 1WEZA 3S8SA 2DGQA 2ADCA 1DRZA 2FC8A 5LSOA 5ITHA 4W92B 2XS2A 3D2WA 2CQHA 1F9FA 1B7FA 3G8TA 2LECA 2DNLA 2BOPA 2KI2A 5GAHU 4WFNQ 2CJKA 1K8AT 2L08A 3JB9k 2MZSA 5MLCV 3H2UB 2M7SA 3CTRA 2M8DB 4FXWA 2CQGA 4UY8T 2M52A 5IM0A 3VAFA 3THPA 5D77A 1X4HA 4WIIA 4M5DB 3G4SS 1N8RT 3ULHA 1QVFR 2AYMA 2KVIA 2MKSA 4PR6A 1U1LA 1D9AA 4Y0FA 3VAKA 2DNRA 2OJ3A 4QPTA 3B4MA 1SJ3P 3UE2A 2FPHX 2ZJQQ 1WG1A 3EX7B 2N82B 4IO9Q 2B0GA 2ERRA 2D9PA 1X4AA 1M1KT 1X4GA 1VBZA 2WBRA 2QFJA 3Q2TC 4QQBA 3VAMA 2K3KA 2RS2A 3CC2S 3UD4P 1P1TA 2L41A 5LSLA 2DGTA 2LA4A 2RU3A 5LXRA 4CH1A 5IQQA 1WF2A 1ZH5A 3FEXB 2MXYA 2HYIB 1M5KC 3VF0B 1N54B 1R8PA 1VQPS 2XS7A 4WFBQ 1OO0B 1G2EA 3G96A 2M0GB 2PEHA 1XN9A 3VAHA 4LIRA 5CYJA 1YITS 1VQ5S 2MJUA 2PE8A 1X4BA 2AYGA 2MSTA 3S6EA 2OSRA 2RNEA 1WELA 2EK6A 4CH0S 4YUDA 2UP1A 4IOAQ 3VALA 2MKIA 3NS6A 2MQOA 3L3CA 2XNQA 1JJ2R 2AD9A 2QA4S 2NZ4A 1U1RA 2DISA 2KU7A 1R8HA 3MUMP 1U2FA 2M70A 1ZZNA 1VC6A 2JVOA 1WHYA 4CQ1A 2DNZA 2M8HA 2MSSA 2N3LA 1KOOA 5DDRC 3MDFA 1DZ5A 4A8XA 1URNA 3CMES 2J76E 3G8SA 1FJEB 2CQIA 1PGZA 1QVGR 5HL7Q 4WF9Q 1WG5A 2MHNA 2OTJS 2KXHA 3VAGA 3R1HA 2MKCA 2D3OR 5EN1A 5DETA 2MZJA 1S79A 3MD3A 3BO2A 2FC9A 2MPUA 2CPDA 1FO1A 3CCMS 2RUGA 2MQMA 2E44A 5LXYA 3CCSS 1VQMS 1YJ9S 2DIVA 2CQ1A 1WF0A 3CCQS 1FT8A 2YTCA 2DK2A 3HI9A 2KG1A 1N52B 2X1FA 1M5PC 1OIAA 3CCES 1YJWS 1YTYA 3UCZP 2DNPA 1Q81T 1H2TZ 3CMAS 4C0OC 4C4WA 1K73T 4WKRA 1FNXH 5IM0B 2CPZA 2O3DA 2HZCA 3MURP 2XNRA 2MKHA 4YB1P 2OTLS 3CCJS 2CQ0A 3B4DA 3NNCA 3CCVS 1YJNS
chains in the Genus database with same CATH superfamily
5AXLA 3KHLA 2V34A 5ETPA 3R3TA 2IC3B 1VR6A 3P5TL 1OSDA 4TU9A 1H73A 1U6FA 5A8WA 3U27A 3I0SA 3FQLA 5HVFA 2AV5A 4CRJA 2E5HA 4M1KA 3AA8A 3KTQA 3NWRA 2AU0A 2UUWA 4DX5A 1BUXA 3J7AN 2FVSA 2IVYA 3MD1A 3I6PA 3CC7S 1UP1A 3D0IE 3OR2A 3DLKA 4LSZB 2HGNA 3GIIA 1SUQB 3HHDA 3QJLA 4ZKAA 1B0VA 1S76D 1F60B 3N5BA 3Q23A 4QPXA 3MOZA 2DNMA 4OZ0A 1SC1B 1ZA1B 3AQPA 4YB6A 3KMSA 3DLLQ 3V5RA 3RBEA 4RBUA 2HK2A 2KXFA 4LFAJ 3O3LA 2YKOA 1BQNB 4Q8EA 3V2UC 3WZ0A 1NB7A 2UXCJ 5L38A 1AZSB 5C7PA 2F63A 4ZVFA 2RSQA 1RT2B 4KBIA 3R5AA 3CUNA 5KFRA 3PNIA 1RT1A 1MN7A 4TYBA 4F50A 2H4WB 2CAJA 2UVUA 1VCTA 1A7GE 1OPIA 2J9EA 3GCXP 4P74A 1S9FA 3CJ5A 2V2KA 2W2QP 4OYZA 2PEBA 1BWEA 4I0WA 1S97A 4XDCA 4DUZJ 2MLXA 2X3GA 2ZH9A 2J0XA 2JH3A 1R89A 3K5LA 1JMTA 2VG6B 3CB4A 3LALA 1RUSA 3AJDA 2BQRA 2VFRA 4YMEA 3CWJA 4ECUA 2AGQA 2IRXA 2BOAA 4C11B 3OW2R 2HIYA 5KFWA 4WZQA 3A12A 2PD1A 1UZDA 3SV3A 4K4XA 4OV6A 1YIJS 3BSOA 3C14B 1NK0A 3VQTA 4OHZA 4WWSA 4CLSA 3GFXA 2XGQA 1JLAA 5AJ3J 3JXOA 1C2PA 3IRWP 4F26A 3H8YA 2WVFA 5L1JA 2VUGA 5IFMA 1N34J 2LYVA 3CCWA 3V4IB 3R97A 1T3NA 1SB6A 3CO0P 3GFZA 4U95A 5EWEA 1U1QA 2OH2A 3M30A 5I42A 1RWPB 4ITSA 1YGYA 4WP8A 1VISA 3M4XA 1G3OA 1IQZA 1RP5A 3M6XA 5KTQA 1T0TV 1MMDA 4UY85 5GAHU 2HZVA 4RR5A 4NZ6A 5MLCV 4Z37A 2M7SA 2QV6A 5J2QA 2E9RX 2FIUA 1FK9B 4A4JA 5E3RA 2O66A 3VCDA 3VAFA 4RWWA 1KSPA 2HS0A 2AEJA 2ZBQA 1DLOB 4ILRA 3TZXA 2PA3A 2C2RA 2B6AB 2QLBB 2QN6B 4Y0FA 4OI2A 3VV2B 5L9XA 2ZOMA 1VRQC 4IFVA 3T9ZA 1RWUA 1T8EA 4ZVPB 3M7VA 4QQBA 1GXTA 1FJGJ 1YKWA 3CJ0A 1PC4A 2K2PA 2KJWA 1WF2A 3V6HA 4Q45A 4A48A 2HYIB 5BR8J 4WFBQ 3Q8QB 3JSMB 5LOQA 4LRCA 5KT5A 4N77A 2CJQA 3DOKA 4ALZA 1D0EA 1WKJA 3H0PA 4DL2A 1WELA 4Q5VA 1RBAA 4ZCIA 4WU3A 3T1YJ 3OLAA 1HNIB 2F8MA 2CJBA 1M0SA 4L73A 3GR1A 4RW6B 1UWAA 2IMOA 2CPDA 1EZZB 1XMOJ 2AQ4A 1TKXA 4ED3A 4DQRA 3WQPA 3KG4A 4LQ9A 4JI2J 1HQUB 2Y9HA 2LXFA 2RJZA 2BANA 1N32J 4CO2A 4HYKA 3D0GE 2NSCA 3TUZC 1IBCB 3D54A 3ITHB 3TUJC 1REVB 2BZ2A 1KP6A 3M8RA 4QWDA 2ABYA 1V5VA 3SYZA 5LSRA 2ZVSA 1HR0J 3MEEB 1WSRA 2VONA 4OZJA 4DV5F 2UV8A 2CPXA 2VODA 1KLNA 4GKJF 2V2VA 1UPPA 2SXLA 2B3TB 4B9MA 4LR8A 3OQ2A 3SBMA 4X62J 2GGPB 4FF1A 3CF5Q 3UWTA 4I6WA 2FZGB 1XNRF 1RAFB 4DOZA 2R7WA 3CE8A 2XC9A 3IM8A 4F4YA 4ECZA 4RNOA 2DNHA 3MWBA 4ES3A 3FBEA 4PCQA 1VQSA 5H9FK 3HD2A 1EB0A 5KFOA 3GYGA 3US5A 2KL8A 1S9EA 1HNXJ 4UOCA 1DFDA 1FKPB 3Q8SB 2XMAA 1YDLA 1C4AA 1HWJA 2ZVIA 4QW9A 2VL1A 3HVTB 2HQ3A 1I5OB 3EXYA 4GC6A 5J1EA 1YJ7A 2H4YB 2FUG9 2V8GA 2J5AA 3CT9A 5FIIA 3MHYA 2JHEA 4Z7CA 2ZD1A 2E7VA 2BM0A 2VDIA 3AJ2A 1JLGB 3N01A 3BSCA 3JYTA 2VQEF 1YI2S 4KB7A 3MZIA 3KKFA 2FLNA 1HD0A 2JVRA 3TQ1A 4ETXA 1SJFA 1P9QC 3NMRA 1HWUA 2A1BA 3QIPB 3GIMA 3I96A 4I68A 1X4CA 4FBUA 2VG7A 2QEXS 4CLTA 3D1OA 2D3UA 2EK1A 1W25A 2CG8A 2YKAA 2BJEA 4CDIA 2GS8A 1SVDA 3LWMA 4JI1F 3DLJA 3HXMA 4EO6A 3G82B 2R8GA 1F3FA 3OFGA 3SMZA 4KH0B 4YFUA 3SV4A 4IDKA 1JKHB 1JLBB 5LM7E 2FVCA 1DARA 5AT1B 1VQ7S 4F4XA 1RTDB 2UUAJ 3U1MA 2B5JA 2RT3A 3DHXA 5C42B 2CFXA 2HBRB 4J9UE 2AYBA 4URGA 3L7UA 1Q8BA 1K0VA 1QSLA 3W2VA 3JSRA 1T7PA 2IJFA 1WWHA 3N9UC 3U1NA 2J0QD 1WOSA 3OVAA 5M2UA 4EFAC 1X4DA 4F2SA 2JOQA 3NNAA 4JI8F 4QIWD 5G0RB 2HVIA 1RADB 1ZAVA 5KFYA 3S8SA 1SV5B 2R7TA 2DHHA 4H54A 2ZH6A 4LF7J 3QRRA 4DR1F 1YBUA 5EX0A 3EMTA 4WFNQ 1NDKA 2J0WA 1VRUB 4CCHA 2UUTA 2AX1A 1KQKA 3W60A 3Q8VA 3DGPB 3ILJA 2FLLA 3MPYA 4M5DB 4ECWA 4LF6F 4JV0A 4PXCA 4KHMA 1SJ3P 5EWGA 3V81B 4XK8C 2VPWB 1IM4A 2V8DA 4C8LA 2O01C 3ZZUA 4YDXA 3KJFB 4DPWA 5IQQA 4LFBJ 2XULA 1TVRA 5HJXA 1RGVA 2IM2A 3BM7A 4NLGA 3OR1A 4I2QB 2B4VA 5D4OA 2ZDOA 3GJRB 1GH8A 4OX6A 1U1RA 1TQLA 4JYAJ 2JVOA 4EYHB 3QATA 4CQ1A 4TKTA 2N3LA 4XPCA 1DZ5A 4F4KA 2AKWB 2CQIA 1NJXA 3R1HA 2MKCA 3LH2S 5C24A 4OX7A 3BO2A 1F5CA 5LXYA 4JI4F 3P5BP 3HX9A 3D6FB 5A8KA 2EBEA 4ZVRB 1T9VA 3U02A 4CLFA 2LVWA 5A0YA 4NXMJ 3DDKA 3VVTA 2BW7A 4DV6J 3MEGB 3CCJS 3R5CA 4DLGA 2RHSB 3UCUP 5E41A 3O44A 2CQDA 2NXEA 5LT5A 1G7CB 4C8KA 1SI9A 3S7RA 5HQ8A 2CJYB 3QFHA 3BDEA 4FS2A 2QMWA 2DJWA 3SSQA 4OL8A 3KLVA 4V19J 2MYFA 3U1LA 4JI0F 3BS9A 3BPDA 3TVKA 3VR1A 1N33F 1FWPA 4X4NA 4RW7A 4JI3F 4C2MA 4DR7J 2CQ2A 3ZO7A 3RW6A 1U1PA 3D1QA 4J9VA 2DBBA 5HSPA 3MPDA 4QYRA 2DGVA 2JX2A 2M5YA 2E5LJ 4ECRA 1SIWB 1EKSA 2D3ZA 4RLEA 4DR2F 1B70B 1NJIT 7FDRA 5J2MB 1NHVA 5KAKA 3MFHA 3H5YA 2KJVA 1HI1A 2POKA 2D1CA 2QO3A 1RAOA 3DGVA 3BGFA 2E5GA 3PV8A 4DR5F 3BKTA 4PZVA 1U7LA 5H1SV 3P45B 4H4KA 1NU4A 2DITA 4DQSA 2MEWA 4DN0A 5ETRA 2DHSA 1IBLJ 3N0VA 3OTEA 1UVJA 1UETA 4B3MF 2ZNYA 2YXLA 4FVCA 2YNHB 3KNAA 1HQEB 1R6VA 2PMWA 5E7OB 2LQBA 1S1TA 2GIRA 3HFZB 2DH9A 1FFSB 1C1BA 2R8HA 2VJUA 5IC6B 1Q78A 2BJDA 3M2UB 4DFMA 2M88A 4NCBA 1NSKL 1Y4ZB 3PR5B 4QU7A 1CJVA 2LEPA 3POTB 4NEZA 3GFYA 2RD5C 4H4MB 2ZM6J 1PJ6A 3UR0A 3KJNB 2IY5B 4FXDA 4I7FB 1LW0B 3WX4A 3V6JA 2MKYA 2VBXA 1TMMA 2V5HG 1IWAA 3ETMA 3O1LA 2E9ZA 1JB0C 1IKWA 1R7IA 4DN9A 1TKTB 5D78A 1F1BB 1XR6A 1WF1A 2CPJA 1KR4A 4M5IA 3R5JB 1RHKB 3CJKA 4K4ZA 2NYHA 2LQ9A 2OPQB 3TO8A 3OJUA 3EDQB 5KFEA 2YQ0A 1RDRA 2RIJA 3KHGA 1B99A 5MAOA 2DNKA 4HKQA 3I32A 1TL4A 4S0MA 2YX4A 3KLHB 3DRSA 4ID5A 1DTTA 2OMLA 3G87A 2AMCB 2J6SA 3S01A 3LP2B 5GADI 1MWZA 4CLLA 2BVZA 1VFJA 1V5IB 3AXMA 1O8BA 1CSJA 3NGDA 4YR0A 4ZLLA 1T02A 4UTGA 3KLFA 2W9BB 2QYGA 3TZWA 3K5MA 2HMIA 1U24A 4ZPDA 1W7WA 4K0KF 5DZ6A 3KK3B 2C42A 4USWA 5IV3A 3UI3A 8AT1B 1YSJA 2M52A 2AHOB 3KJQB 4WIIA 3N6MA 2KVIA 4DG1A 1KBRA 3FFIB 4N47A 2ZH2A 4QPTA 2GQ2A 1D3WA 2FPHX 1NXIA 3RTVA 2FJXA 2CNNB 2BJ1A 2YWHA 2UZAA 4BWMA 5RUBA 4DV3J 2GCFA 2H3EB 2OFHX 1XR5A 2RU3A 4K4VA 3CJ8A 4UOGA 1RTHB 2ASLA 1M5KC 1NSQA 3OL6A 4HDGA 1ROFA 1U09A 2DEJA 4B3OB 1VQ5S 2PE8A 4A8SA 2AYGA 2MSTA 4BDPA 3VZIA 3EZUA 1WHYA 3CJSA 2A0FB 2M8HA 2PMHA 5EWFA 5HL7Q 1S1UA 4NE9C 2AGPA 4IRDA 1YQHA 1MROB 2IM0A 2O1PA 8RUCA 4Q0BA 3R9LA 1J2VA 3DDNA 3HJVA 3LGNA 4DV2J 2OLWA 3LP1B 3QO9B 5D15A 1H2TZ 1Y7PA 4IO1A 2W24A 1ELOA 1QAJA 2CG4A 2X1GA 4WXWA 3BSNA 2CUYA 3C16B 5IT0A 2MQNA 4U9RA 1HMVA 4LFAF 4YOEA 2Q6CA 2V4JA 5B0AA 3GV5B 2KHCA 2MLZA 2ZJRQ 2UXCF 4FPRA 1N5SA 2W9CA 1LWCB 1L3TA 1CBKA 2Z30B 3OTOJ 2F8HA 4KY3A 1GT8A 1YK9A 3E2EA 4OYBA 1F5BA 1M90T 2F4FA 2I5JA 2Q66A 4MK7A 4OYIA 2C2DA 3MR6A 5CYMA 1RTIB 1OWXA 2N3OA 4DPUA 1RYSA 2WSEC 1AUSL 2Y0SD 5KT4A 5DG8A 4J9SA 2KTQA 2E5JA 1U1NA 4QZVB 3KK1A 2CQ3A 1P9YA 4DUZF 5L39A 2FQQB 3GU0A 4ECXA 3PR4A 2R7SA 1HHQA 2OFGX 1OY9A 2VU5A 3CDAA 4CP5A 1RTZA 4FF2A 5BXIA 1CG2A 4IH5A 4DZ6A 1V3SA 2GW8A 4DSEA 3W5ZA 4F4WA 1S0OA 4U8YA 3TP2A 3QSIA 3THTA 2CPYA 2FHOB 1FJCA 5A8WB 3BQ0A 3MI7X 1DQAA 3I0SB 3M8ZA 5AJ3F 4P6QA 1VQ9S 3Q83A 3LAKA 4C0HA 1C4CA 4XTTA 1N34F 3DDIA 2AYEA 5ETMA 1AFJA 2DRAA 4M5GA 2A3JA 3HT3A 2CPFA 4NRUA 1K47A 5B0EA 4DCPB 2OELA 3OR2B 4OYXA 3MM5A 1TK5A 4NPOA 1VQNS 3DLKB 4USTA 5ETQA 3PX0A 1XC9A 2DR7A 1RHMB 1TKZA 4OHXA 2DH7A 2FGCA 5HO4A 4RNNA 2OHDA 4M5JA 3GJSB 5IS2A 4RW8A 4QIFA 1D1UA 3GILA 2BQUA 4JI6J 5HLFA 3MFIA 2OMOA 4NMXA 2ROGA 4A8YA 4IOCQ 1FJGF 3GYXB 2EC0A 4NLSA 1KEKA 3EGNA 3LA0A 2VPYB 3UN3A 1KFDA 5IZHA 6FD1A 4YS2A 2DRBA 5BR8F 4RJVA 4IUFA 4X66J 3I55S 4NEYA 3A4TA 2HAFA 3D6TB 2MGZA 4ZCKA 3V6DA 5H9EJ 4LMZA 2GQQA 3ETOA 1MU2A 3MAAB 3D1HA 3T1YF 5F8NA 3PO4A 1ZAXA 1Y5LB 1NH7A 5C5JA 3R7SB 2LECA 3D6HB 2KI2A 2VBYA 1Q5VA 1N6QA 4RNHA 3HSGA 4K5SA 3NCPA 3DRRA 3BV8A 4Y6IA 2OPPA 1TK0A 3H4BA 1XMOF 5CZVA 4HACA 4DR3J 1KVJA 4TYAA 3MCSA 2I9SA 4DJBA 2YKNA 2K3IA 2IYIA 4JI2F 2ZJQQ 5F3TA 2YNFB 2HSEB 1N32F 5LL6d 2H5IB 3CDUA 3O8WA 3ZTRA 3Q2TC 2MTLA 1PILA 4ZPAA 3QJPA 3UD4P 4NA2A 3KUHA 3OVBA 5LSLA 2LA4A 4EZ6A 1VYAA 2KFZA 2GMHA 1ZM3A 2FDNA 5HQMA 1HR0F 1UJ4A 1JX4A 4DCJB 3EDRB 1NK5A 2PDAA 4HHJA 4DV0J 4YUDA 5D4PA 3VALA 1GXLA 4U6PA 2QA4S 2QLJB 4X62F 2V9KA 1ZZNA 3IA0A 1GFWB 4B9VA 4EWTA 2XGPA 1NEEA 4G65A 4L6V3 5CH7B 2DT9A 2DIVA 4TN2A 1WC3A 3AXKA 4A8OA 4YP3A 2DNPA 1HNXF 4WKRA 4WKYA 1FNXH 2YKMB 2G0JA 3MTJA 2MKHA 1G1XA 2GZOA 1H0HB 2YPYA 4RU9A 5L1KA 4TU7A 1EIYB 3EE3A 4NOHA 4FYYB 1UA1A 3T6BA 4IFVB 4LF2A 3PHEA 3ZZZA 3VHQA 3C2PA 1RT7B 2X7IA 3FZBA 1XIQA 3DKDA 3HSDA 3SCKE 1S99A 3DOKB 1KRPA 2CIMA 2IFXA 1N5YA 2HHQA 3GSIA 1DTQA 4M5HA 3JAMU 2DCLA 1N88A 1YWXA 2CPIA 2J6UA 2DXDA 2ZHAA 2IIHA 3OLBA 2HQGA 1WDTA 3NGUA 1U0HB 1IXKA 2B9YA 5KFPA 1TKXB 3MR2A 4LBPA 3HZGA 4NWBA 4O4RA 1JLCA 3RRHA 4LUBA 3DLBA 5HJYA 1R31A 3OXFA 3W5YA 5HVHA 2V50A 4AUKA 1U02A 4CLYA 2CPHA 2BANB 2IHR1 3GTYX 2XMUA 3GQCA 2UUAF 3PO5A 1JLEA 4CNZA 4RU2A 2DIUA 4DS5A 4L75A 1Z2ZA 2VOPA 4USMA 3ILOA 2WVEA 3TEGA 1Q86T 3EPGA 1DURA 3CDBA 1RBOB 4AL6A 2BUNA 3UVJA 3I9ZA 5KFBA 3QT7A 4KGZB 5DQIA 1OYDA 2DGUA 1FRKA 2DNYA 3UQSA 4X4RA 1CVJA 1D8ZA 2C3OA 1D9DA 2GVZA 4X2BA 1PIEA 3TYTA 2VC0A 4HT5A 4QOTA 1O51A 1H98A 2XSFA 3DM2B 4LF7F 1CJUA 4CO5A 2KKHA 3OTCA 4NLWA 3BEGB 2CZ4A 2OP5A 2ZC3A 1YJVA 3DI6A 1S9EB 1RA7A 4DFJA 4RZRA 1QTMA 3L7OA 3JQJA 4K4TA 4YEAA 1MWYA 2F9JA 5A6WA 4C7QA 2M2BA 3FBCA 2K1RA 4HH1A 2HHSA 4EEYA 3K2YA 1HNZJ 3J7YU 3AT1B 3QLHB 2ZDPA 2ZD1B 1K0TA 4L74A 1RAGB 4FPIA 1FKOA 2ZEJA 1VRTB 2ZH4A 3IG1A 3AD7C 1AFIA 3T5HA 4IR9A 4LFBF 3MM6B 2MKKA 5B0FA 2KG0A 4C97A 2DNGA 4NCGA 5CAAA 1AYEA 4OI4A 2BJ7A 1Y10A 4UW2A 1DRZA 2DRDA 3I31A 9ATCB 4AFFA 1N5TA 5EDWA 3FRZA 1F2GA 1Q4RA 4JYAF 2CQHA 3M6UA 2Y0BB 5DLFA 1T05A 1KDNA 3K5PA 2J9DA 4PQUA 3TZYA 2L08A 1E6VB 2J6TA 2WB1D 3CCZA 3DOLA 3LWLA 4WZMA 1C1CB 4FXWA 4DEZA 2HBYB 4XIUA 3G4SS 1VJQA 1IWGA 4IFYA 4LSNA 2IA6A 2PN6A 3C8YA 4LF5J 2HNZA 3B4MA 4IDKB 5CCMA 2RDIA 2OPSA 4IO9Q 2B0GA 4NXMF 2D9PA 4NLPA 4MYTA 2F8EX 4DV6F 3FVYA 3BGRB 4AXJA 4DWIA 2B5JB 1UKUA 2DGTA 4K4WA 5LXRA 1H3DA 4RW4A 1KQGB 1ZH5A 2RKIB 4BWJA 3BGLA 4PEOA 3J7A1 2RQMA 2XS7A 4ZIVA 1H7XA 1BC6A 2PEHA 3EICA 2WW4A 3W2VB 2XHWA 3RRGA 3HJFA 1FXRA 4AL5A 1FTCA 3MEDB 4ZVTB 2IPOB 4HDHA 4NLOA 3TR5A 1U2FA 4PXEA 1W26A 3SZ2A 2FZCB 1UFLA 3HHLD 2D3OR 2NXJA 3J81j 1TP7A 4DR7F 2L9DA 3CNQP 2DK2A 3TX8A 5BYSA 4J9MA 2CRLA 4X65J 2WVBA 3I0RB 3HZEA 3CCES 3RGIA 1VI7A 2FJAB 2O5DA 4C4WA 2E5LF 4HEA9 4EK2A 3BH7B 2RMLA 3LOUA 4IH7A 2FJBB 4EO8A 5IC4B 1RU1A 4CYUA 1HBMA 4M63A 2AIRB 1IKYA 1IR0A 4QWBA 3UFCX 2MQ8A 3CULA 2CQCA 2B8PA 5T7LA 3KDOA 4KJIA 4Y2MA 4KC5A 4C3KA 1PBUA 4AXIA 5D8HB 1CC8A 1ZM2A 1ZZFA 3PW0A 2IAJA 2M9KA 1HI8A 4TXSA 1S0MA 3VAIA 2Y1RI 1UVIA 2G4BA 4U7CA 4N5SA 1TVRB 5EX3A 5A76A 1GQEA 2BJ3A 1IBLF 4O0IA 2R7RA 1WC4A 1S6PB 3OR1B 1RABB 4FP9A 1L3KA 4DDFA 3WC0A 2HNYA 3NGRA 1NK4A 3PXGa 1HPZA 2ZH5A 2AP6A 3PDNA 4MKAA 1RB0A 2CVEA 3HF5A 4PXDA 2ZOGA 2HNDB 3T9NA 3PIPQ 4P71A 4F2RA 2A6OA 3UN2A 4PPDA 2KFYA 4K2XA 1GTEA 2OD4A 3DYAB 5A8KB 1R8AA 1LWEA 2ZM6F 1HA1A 5ADZA 3M6WA 1PBAA 4KTQA 3UPFA 4MKVA 1UFWA 2G0IA 1SJ1A 5K8NA 2NZCA 1TR0A 2CVIA 1CJTA 2D9OA 4OZ5A 2ILZA 1KFSA 3C6TA 3K7RA 3BKFA 2JL9A 3PFEA 1M5VC 3KOAA 1QSYA 2C3PA 1EARA 4CH7A 3T5KA 5LJ5Y 2YH1A 2H1YA 1VIOA 3L7PA 1LFWA 1OSCA 1IBMJ 3JTNA 5KG4A 3ET6B 5G4DA 1WI8A 2C28A 4USHA 3BH6B 3MMBB 1M5HA 3FDSA 5C25A 3MR5A 2GHVC 2VFUA 2JRSA 2LDYA 2Y1LB 4OI0A 4K4YA 2FZKB 2ZWPA 1YHQS 3OBIA 2YWEA 2AZ1A 4PWUA 1J27A 3UD3P 1VK3A 3TAMA 3B54A 2LP4A 1IKVA 1Q95G 4L76A 4I4BA 3HT0A 3A3OB 4AD6A 3EVMA 4NYOA 1PO6A 2NQPA 2FVQA 3MMAA 5FJ4A 5IWAJ 3MM8A 5ETSA 1EP4B 1IR1A 4Q44A 5D4NA 4YY3J 1WJ9A 3PG9A 1S1WA 3RW7A 3BGUA 3MUVP 2FVRA 4DV3F 4KH1B 4ZCLA 4DV4J 2OEJA 3GMGA 4DFPA 2EFQA 4O3SA 1BMQB 3OXLA 1BGXT 3FUYA 1N5QA 3VQSA 2EC2A 5ETOA 3DXBA 3M2VB 4EU0A 1SKWA 2YKPA 3JAMY 5LSOA 2I8EA 1YX2A 1S10A 4NASA 3N6LA 4R0EA 1NZ8A 1S1TB 3BPSP 1KHVA 3UD5A 4WE1A 2MZSA 1KKHA 1C1BB 2AJQA 3LAMA 3GV7B 2HFZA 1CJVB 5IM0A 3K17A 3N4WA 4DV2F 2DXEA 4PR6A 5H9EK 2H5EA 2XI2A 1S6UA 1QSSA 3QGGA 2WBRA 2EFPA 1UTAA 1IKWB 4IQXA 4BHQA 4R0JA 4J9QA 4KE5A 2UXBJ 2ZE2A 3GV8B 3CJKB 1WKKA 1VQPS 3BYRA 2HHXA 1XN9A 1R8CA 1Q8KA 1FTRA 3IM9A 2ROEA 4JOUA 2JSXA 4LSLA 2XZWA 3JSBA 4ZJQA 1NH8A 3DRSB 3FKBA 2FVPA 3MUMP 1WDDA 3KLGA 2G9OA 1DTTB 1RCOB 2J7WA 1I94J 2J76E 3OTOF 5I3UA 3LPEA 5E2QA 2HG4A 2VD3A 2ZZMA 3SQGA 1F9EB 4F0HA 1NZAA 3CCMS 1RLCL 3KLFB 4C0BA 4JUZA 1R0CB 1KLMB 3EGWB 4KFBA 3KHRA 4LF4J 2WCXA 3KLEA 1YTYA 1HWLA 3OL7A 3DHWC 1IN0A 4C0OC 3MCOA 4H4OA 2YNIA 2P9EA 2GMJA 3H5SA 3HVRA 1D9FA 2I1RA 1H38A 1WC6A 2RRBA 5L1IA 2YX7A 4ID8A 2B4UA 2RAQA 1VQ8S 2IC3A 4ZVSB 1L3VA 3Q2SC 1BHNA 3IWNC 4F67A 1SL0A 4V19X 2IM1A 2B56A 3A13A 3GZ7A 5CYQB 2HQCA 2UVRA 3H2VE 1VQLS 5ETLA 5SUHA 2MY7A 2NLWA 2BDPA 2B9WA 3GONA 4IG0A 4OYAA 1S1UB 2C1EB 3ENAA 5GAEU 1C0TA 4RUBA 1K44A 5F3ZA 2P8IA 1HWIA 2R7VA 1SXLA 1X8DA 1SJQA 1UVNA 2DY9A 4Q0BB 5HANA 3BQ2A 2QLFB 5DO2A 2XS5A 3G6ES 4RW9A 2DHGA 3NAHA 4ECQA 3I5AA 3M8WA 1ZBTA 5I3QA 2HHHJ 5HI7A 3CCUS 3OD2A 4DSFA 1H6KX 4DV7J 2BKOA 4G6VB 4OZ2A 4HHUA 4L72B 3NNHA 1T03A 3FSYA 2NYIA 2G0CA 2ZHOA 2A10A 3W8GA 3D3BJ 1BQNA 1HMVB 2M3DA 2XEXA 2N7YA 4CO0A 3C3LA 4FXVA 1AZSA 3AY0A 1NPPA 1LWXA 4X4SA 1GTHA 5U47A 2W9CB 3H40A 2L9WA 3JTOA 4X66F 3N6NA 3SQOP 3H98A 1MLAA 1UEVA 2KN4A 1RT3B 3KNGA 4LR7A 1APSA 4UOFA 3QIDA 2QSFA 4NA1A 4NX9A 2I5JB 4KV8A 2QIFA 3DRXA 5HK4A 5CYMB 3CSKA 3QT8A 4Y2AA 4DR6J 1EX8A 4OFZA 2QSWA 2KM8C 3GFHA 5D3GA 1XJWB 4KKOB 1YZ7A 4YDDB 1XQIA 4TNOA 2HVZA 1U6BA 2G2ZA 3VGVA 1WHWA 3D0HE 3KK1B 4DR3F 2XWXA 2WONB 3PW5A 2CWXA 2R2SA 1KWMA 1YLXA 2DVIA 1Z4UA 1MN9A 3QGPA 4QYZJ 4C11A 1TL7A 2GVDA 2HHUA 2Q79A 4EBCA 2UVWA 3LW5C 3T1HJ 3T41A 2C22A 4WFZA 2FLOA 1IQTA 3N5FA 2XBPA 1PC5A 4UF4A 1TL3A 2EVZA 5KFIA 1YJUA 3AD9C 3RZAA 4DX6A 2D3O1 2RRAA 1JLFB 4DV0F 3TAQA 3HULA 2JLEA 4WK3A 3SIPB 3CGIA 5ETVA 3M2RA 4K4SA 4PG8A 1JXVA 2YWFA 1VLYA 5D0HA 3H2UB 3CJTA 3HHLC 2GAGC 1SKSA 3MM5B 4QWEA 1QAIA 4UY8T 4ELVA 4D3GA 1X4HA 5HQLA 2ROPA 3GE9A 3TA2A 3HKZD 1Q7LB 2BABA 5IQ6A 2E7WA 1GX5A 2GHWA 1TKZB 2VFTA 1CJKA 3ZZPA 3MM9B 4UUXA 4B9SA 1DLOA 4K5RA 1KNZA 2B6AA 4RW8B 4ED1A 3FMBA 2C2NA 4LIWA 1UVKA 5HLFB 4O3NA 3AOCA 5I3PA 2MXYA 1RT4B 1FF2A 3HP6A 2WZ1A 3QNWB 1PYSB 3KYLA 3JSMA 1N56A 4X4OA 2B8QA 4A8XA 2AJ2A 1URNA 4CWBA 1MU2B 4E98A 2R2TA 2QYCA 3VAGA 1QJHA 1HNIA 3OTBA 1CEZA 1RHJB 1ZETA 2ACYA 2I6WA 5LMUJ 2OKQA 4O4GA 5AE3A 3PTWA 4RBTA 2MQMA 1QE1A 2YTCA 5GMDA 1N6QB 1TELA 5KFZA 4NI2A 1M5PC 4LF8J 5DRKA 1CS4A 3W66A 1VLOA 4G1QA 2XYGB 2HZCA 4HACB 2FJDB 5HMYA 3HHLA 4ZVQB 2UUCJ 1R27B 2YKNB 2ADBA 5HMZA 2BX6A 3QQCD 1NLKL 2W2MP 1JJCB 3ITHA 1QY7A 3FBBA 5FDLB 1SC6A 2HVDA 2Y8WA 2L48A 1S57A 5E3PA 1IKXB 2A2DA 3AQOA 1BXNA 3JQMA 4OYWA 2W2NP 2DR5A 4WJBA 3TVYA 1FJ7A 3PRVA 1FNMA 4OLOA 4O3RA 4L3NA 1NDLA 1LW2A 2RH3A 3QFWA 1U2CA 3QT5A 3OHAA 1VQ6S 3R2CJ 2J9CA 1T9UA 3BSAA 2V0NA 1WHXA 2ZKTA 3IMQJ 5KT3A 2R7OA 2CDQA 1YBTA 5HROB 3O5TB 1SC3B 2HGMA 4KGXB 2MZQA 4ZPWR 4PUOA 5GAGU 1PYTA 5B0CA 2LXUA 2X1AA 4ZVUB 3Q8RB 1FKPA 2XY7A 2DGWA 1HBNB 1H74A 2NXNA 1K9MT 4B3SJ 3HVTA 4DSKA 5DZ7A 1N48A 4DL7A 5LJ3Y 4OJGA 3AHPA 2HKEA 1BY9A 1DJ0A 1ZAWA 1HNZF 1S48A 4U8VA 2HQIA 3N79A 4AQYJ 1B0PA 2U2FA 1RWNB 4GVBA 2V63A 3K89A 3MECA 5KG7A 3UCGA 1JLGA 4NZ7A 5FD1A 3RB0A 2Z2LA 1U0SA 1RU2A 4GMKA 2W9AA 4BBYA 1LNQA 5KFJA 3ZNUA 4DL3A 2F5GA 4F3MA 2PO4A 3H5UA 3GJQB 4DUYJ 3NCRA 3C15A 2D69A 3GG0A 1RISA 2V2ZA 5GADU 4R8UA 3EXCX 3CIMA 4DHVA 1N5YB 5DDOC 2V8VA 4LFCJ 2XYPB 1NDCA 4WTOB 4FVMA 3TJ8A 5F8MA 2Z56B 4J9RA 3MUTP 3DN9A 1KC8T 2WBMA 5JVGQ 5F8HA 1S5ZA 4BC9A 1JLCB 5E0OA 4Q7AA 4PKDB 4LF5F 2B7CB 4F02A 4QIVA 1FD2A 1JLBA 2JLGA 3Q22A 3TARA 1H72C 2IDLA 2CQBA 2XWYA 2CNOB 1RTDA 3LP0A 4X4PA 1TV6A 1L3SA 2F4VJ 2WVCA 2W4DA 1JLEB 2MMYA 5C42A 5KG2A 4KGKA 5THWA 5D6GA 1VQ4S 5KG5A 3TEHB 5K8OA 2Y3YA 3R7BB 1S4EA 1XK8A 3NBPB 4V1Ak 4JP8A 3UVJB 1JJ4A 4I2PB 4WFYA 2GIQA 1LWFA 4A47A 3W63A 1JNRB 4KGMA 1FDAA 3A8KA 5KFFA 1AB8A 2BQ3A 3O2IA 1VHFA 2JZ5A 2MHEA 4J37A 1SV5A 5B0BA 2ZUAA 2QLXA 2GVZB 1FRHA 5KG6A 2XHCA 3DCAA 4ANCA 3CTRA 2M8DB 2RF2A 1ICEB 5F41A 1CJUB 2W8LA 5DGAA 1RI7A 4USVA 4X65F 3DGPA 3PKYA 3DI6B 1UVMA 2EG1A 2OJ3A 4M5DA 1WG1A 4NYPA 4ZP7A 1T95A 3WHIA 3AA9A 3TA1A 4E2FB 3J81U 5IT4A 2K1RB 1N5VA 3ZZRA 1GK8A 3KHHA 1PAUB 1R8BA 3FEXB 1OO0B 4EYIB 3PYDA 1FKOB 5KFXA 3IG1B 2IRYA 1NKCA 3PW2A 2KU7A 2PI4A 3IC1A 4MIWA 4I2QA 2BR0A 1PCAA 2MHNA 2I0XA 2OTJS 1R43A 2P9CA 1NUEA 1ZM9A 2FC9A 2QL9B 4DV1J 1OJ4A 2RUGA 1T05B 3DLEA 4KPYA 2HHVA 2OPRA 4PQUB 3ZZOA 3QSYB 2ZBRA 3F41A 3BB5A 3B6BA 4R5PB 2BKPA 5EGYA 2PI5A 3W9IA 3QPIA 2DPIA 1WORA 1DQ8A 1JWWA 4YB1P 2CQ0A 4IFYB 4LSNB 1U49A 1VBYA 3NL0A 3CCLS 1DQ9A 2V9WA 4C6AA 2OPSB 4DI6A 3MEGA 1HBUA 1NO8A 4TY8A 4A8KA 4EI2A 3P96A 1WOOA 1B4SA 1X31C 2JFDA 4YN3B 2XMJA 3OT9A 2DTJA 4ZPCA 1TMJA 4OJ1A 1HYSB 1KVIA 3DLHA 2X1BA 2VKRA 3RB6A 2J8SA 3TWZA 1IBMF 3I4PA 3HHKA 4TLQA 3M9OB 3FNNA 3NRBA 5JVHQ 5BJRA 4D3HA 2Z0GA 3BDPA 1VJWA 1N0UA 4IQMA 1FX4A 4K7QA 4BLGA 5HVGA 5IOLA 3IN5A 2ALZA 4UQTA 4ZVGA 3W3SA 1KVKA 5J1NA 4OI1A 2BYCA 1SCJB 1WC0A 3TANA 1SQEA 3HDSA 1YVFA 4C3MA 5IWAF 2ZBIA 4OZ1A 3BBBA 4MKBA 5JXSA 3UDLA 4CYUB 2ATCB 2YWKA 2VICA 1VK8A 3PRDA 4ZIWA 4YY3F 2HFSA 2J7UA 3M8SA 5KFKA 1B7YB 1FHTA 3ISNC 3SDEA 1X4FA 4UOHA 3SSSA 3QBCA 2HWTA 4K50A 4DV4F 1RKIA 3DXSX 2WSCC 2IJRA 2LQJA 1NKBA 1WD6A 1Y3JA 5H9FJ 2DEIA 5CABA 4F36A 3EZ5A 4DQIA 1XNQJ 1EJ7L 2XMMA 3M1VA 2HNYB 3L4BC 2LQ5A 2W7AA 4OQJA 2QTWA 3AAWB 3V6KA 4ZPBA 3AODA 1MMNA 2CDRB 2HVEA 2JDJA 3QT6A 3IBFB 1X9SA 3C66A 1HL6A 1JQGA 1SKUB 5KFDA 2CKWA 4QU6A 3POTA 5GMKa 1VQKS 2JEJA 5HP1A 4F3QA 1FRIA 1X9MA 3NP5A 4FBTA 4I6YA 2KRBA 3PKMA 1LW0A 1NDPA 5HN0A 2WK4A 3BJYA 2JNJA 3IRXB 3KLIA 3L95X 3C6TB 3HHNB 2JC0A 1GX6A 1UAWA 1SH3A 3I5CA 4LRBA 1QUPA 2UXBF 2OPQA 5K5MA 3RR8A 2BA9A 2UUBJ 2XLJA 2V69A 3PEHA 3PW4A 2DGQA 2RB7A 3KLHA 3TI0A 4W92B 2H48B 2XMVA 3D2WA 4ES2A 4H4KC 2DNLA 2CNKB 1I94F 1NJYA 3LANA 4O3OA 1NPKA 5KFTA 4MFBA 2EFNA 3UNGC 2W9BA 3TAMB 1KQFB 4FF4A 5KFVA 2FY8A 3RU0A 1N8RT 2BMBA 3KK3A 4GVLA 4LF4F 5E5NA 3D3CJ 3UE2A 3EX7B 4PG7A 2ZUGA 1KHWA 3MMAB 2V4QA 2ERRA 5C2GA 1B3TA 2VBZA 1HARA 5KT2A 3QZ8A 2PIIA 4KGVB 2QFJA 2RS2A 2F1FA 1S77D 3ZTQA 2R42A 3TUIC 1TU0B 1S12A 1P8GA 4C8MA 4QWCA 1S1WB 2KO1A 1NB2A 2HHTA 5AE1A 2ASDA 1HW8A 1HI0P 4FYVB 1RHQB 4PXBA 1GAOA 1JIHA 2OSRA 2XY5A 2B7BB 2MKIA 3NS6A 1UFKA 4QJVA 1VC6A 3OXGA 4PG4A 2MSSA 3WDOA 1KOOA 2KZZA 2XSJB 1HBOA 3G8SA 1FJEB 3IP0A 3M8PA 4NLXA 1VIXA 3FGVA 3EJMA 1T94A 4Z7YA 3MD3A 3D4JA 5F8LA 2E44A 3OUYA 1AT1B 2CQ1A 1WF0A 3CCQS 4PYDA 4LR9A 4WE1B 4ES1A 2BE2A 4P75A 1AROP 5EHHA 4TVAB 1WSVA 1S0VA 1UCNA 1RT5A 5IM0B 2HAIA 1NHUA 2W8KA 3CCVS 1VBZA 3LP1A 3FZ2A 2DGSA 2V8PA 5K20B 4CO3A 4ZK7M 3NOGA 3HLUA 4OI6A 1U2RA 1P1LA 1FNOA 3HCXA 4K4UA 2HHHF 5KFUA 1U25A 1U4BA 1VBXA 2FJVA 5E33A 1UEUA 4DV7F 1JLQA 1UWBA 2E7XA 3C16A 1S6QA 4MKYA 4CLUA 4Y28C 3Q0AA 3X1LB 4NL5A 4B3RJ 4Y00A 1IJEB 4NLUA 2GNKA 2ZKUA 4BS2A 4DUTA 1TZ0A 2FY1A 4OX9J 3PIOQ 2BE7D 4GKKJ 1LWCA 3WIUA 3KG0A 5AXMA 1TL1A 4LF9J 3KLGB 3K57A 2VG5A 1RAIB 2V68A 2VJVA 2J7KA 3EUNA 3TAPA 4O23A 3KDNA 2A18A 2MQQA 2MZ1A 3SQGB 1X4EA 5T41A 1RACB 1FRJA 3J7ZT 2DCUB 4NA3A 4WFXA 4DR6F 2ZH7A 4KFBB 4WP9A 2DR6A 2V4RA 2WTFA 3KLEB 4DSLA 2UVVA 4IYQA 2NXUA 2KXNB 5KOXA 3J81Y 2F3JA 1JK9B 2F9DA 1YJTA 2C2EA 2CQ4A 3K0JA 1LKZA 1DHMA 1RWVB 2DHAA 3OV7A 2OAUA 2DGOA 2JC1A 3T1HF 4P72A 5K14B 2WSFC 3GYNA 1Q82T 4B9NA 1C0UB 2GO9A 2LKZA 5F8JA 3G6YA 3R27A 3FK4A 2BACA 4HVZA 5HMXA 3VGTA 1RK8A 4ELUA 4W90B 1SIZA 4A8FA 1YG0A 1UEKA 1GNKA 3K5OA 3EGVA 4IG0B 5AXNA 5B09A 3IXQA 3NGTA 2Y1JA 4ZS6A 3FCVA 1SQFA 2EBGA 1FE0A 3NWGA 1C0TB 4KRWA 1KONA 2WB4A 4P2SA 1XMQJ 3A3PB 1HNVB 1S7HA 1FD8A 4DLEA 1SJRA 5IT9U 1BE4A 4RW9B 4ERDA 4DX8H 1XR7A 2NSBA 3PYEA 1J5OB 2CXEA 1BLUA 4CO4A 4ANDA 1VC0A 2XM3A 3PY8A 3A8EA 3ZZTA 2ZFHA 2U1AA 3HVAA 1T03B 5KFSA 4DQQA 2RQKA 3SXLA 4P10A 1MSWD 2BJ8A 1WOPA 3C6UA 4NLDA 2EI5A 4RPFA 1TUVA 2C2KB 3ONQA 2A6MA 2CZVC 5JUMA 3RB3A 4ZHRB 3IS9B 3H4DA 4NLQA 3MAAA 1TUWA 4WIQA 2J9DE 2FB0A 4PG6A 2VHGA 4KV8B 5LMUF 1XMBA 2UU9J 2CQGA 3IGNA 3PFOA 4M8LA 3EPIA 5D3GB 2FHMA 2ZC4A 4F3OA 5T14A 4LF8F 2E1AA 3IAS9 3F56A 2GX8A 4DF8A 4J90A 4YB7A 2E1MC 2N82B 4J9KA 1ITPA 1X4AA 2V2QA 3NEKA 1LV5A 2KFNA 3CC2S 3H7HB 1JNZB 2UUCF 1LFPA 2YNFA 2HK3A 5K8PA 3KJVB 1RAJA 3KUEA 1KS2A 4Y34A 2VQFJ 3KUGA 3GB0A 3UDCA 1TL7B 4LIRA 2E1CA 2GVDB 1FXDA 4N7TA 7AT1B 2EXUA 4RUAA 3H20A 2AD9A 3C46A 3MGJA 2HFUA 1TL3B 2HLTA 3WC2A 4UZBA 5KG1A 2IBKA 1YRTA 4USUA 1D09B 4WF9Q 4ED4A 1F3VA 2AJ1A 2HRUA 2DD8S 1ZM4A 3M2RB 1JXLA 4M5MA 1YJ9S 2R9LA 1IBKJ 1QLNA 5A8RA 1S1VB 1YJWS 2HQFA 5CHCB 3R8YA 3CMAS 4FYWB 1TKDA 1U8WA 1Y5IB 4ZITA 2HRTA 1XTZA 4DL5A 4PG5A 1CJKB 2YKMA 2BEFA 2KM8B 4B3SF 2DGXA 2GJ2A 4A8MP 4CM0A 2BXJA 2NCKL 2HZAA 4PRFA 1RZMA 2C2ZB 1HD1A 1JJHA 3ZTPA 5DGBA 4WK1A 4AQYF 1S7IA 2QL7B 2ZOFA 5CA5A 2FJEB 1RT7A 4JI5J 3G9CA 3PX6A 2V94A 1HLWA 4MT1A 4ZPTR 3T1AA 3W64A 3M9NB 4N8OA 4KQZA 1NNDA 4DUYF 1RQ0A 3MXHP 1TFWA 2Q6BA 3FRYA 1R0AA 5DG7A 1B64A 3H59A 4O4GB 2DH8A 2AZ3A 4LFCF 1RJJA 2VPXB 5DLGA 1HFEL 1X5TA 1QE1B 4OYPA 3CCTA 1WHVA 4ZCMA 2G1DA 2CQPA 4NI2B 2R8JA 1U0HA 1CS4B 2W7OA 2KHDA 3P3DA 1ZTWA 4RBVA 2XZDB 4G1QB 4USJC 2OEMA 5KFQA 2XY6A 2Z2MA 2GA7A 2DKOB 3HHLB 1Q79A 3R5BA 2DHXA 2MB0B 3JTPA 2QMXA 5IXUA 3AD8C 1O0PA 5D0GA 3PJWA 4AT1B 2M4MA 1RT1B 4OIXA 4B02A 4MIBA 3NY0A 3CJ3A 2F4VF 3DU5A 2UXDJ 3JSYA 2YKQA 2MQPA 5DQHA 4NLRA 1QD1A 4NMLA 4ZOSA 1OS5A 1HKAA 5CQGA 5J2NA 4WCEQ 5CD4H 1GXUA 4P7VA 3LF0A 3W65A 3NMAA 4KAIA 3DLGA 1LW2B 1SJ4P 4J5OA 3H2LA 2ZWOA 4QW8A 3CMQA 3D9BA 2LLZA 1PYOB 2XZTB 1L5UA 3RG6A 3E01A 3HFKA 4B3TJ 3DM2A 2LXIA 3E3XA 4EBDA 4U96A 2JFKA 3OVSA 4ILLA 4PUOB 2HS3A 3HVWA 3MTKA 4RWXA 1KOHA 2DNOA 4RO0A 1JLAB 2CZ9A 4DS4A 3VAJA 4C48A 1YZ6A 2NR0A 3MPVA 2PMZD 2D7SA 4PYAA 2DB1A 4ICLA 3QWPA 3PW7A 1RLDA 3NLCA 3QLHA 1QM9A 4MK8A 2G1HA 3M30B 4U7UD 1FCAA 5I42B 4GVBB 3MECB 3BBFA 2FYXA 1VRTA 4LBIA 4TQRA 2QA4G 1Q8IA 3MM6A 4A8QA 5ITHA 4IG3A 4DF4A 1BWVA 4K59A 2IYGA 5J2QB 2YWWA 1B7FA 3G8TA 2H51B 3VGSA 1S6OA 3C15B 2K7KA 3MMCA 4R8UB 4NRTA 5K9FA 3GJTB 3D6MB 4YHHJ 1B0TA 3G6XA 4DV1F 4LBHA 2RRNA 1V3ZA 1A0OB 1E6VA 4KYZA 5GAEI 4FKXA 4FN5A 3D5MA 4IRKA 1C1CA 1ZTTA 4CLZA 2P6SA 2P6TA 2JEFA 1HNWJ 1MWQA 3MCMA 3BBCA 1YBAA 3M32A 3R6LB 1QAXA 4N76A 1CQNA 2F7VA 2HIQA 1NK9A 3LP0B 3BGRA 4O44A 1TV6B 2LU1A 3BYPA 1V9OA 2VPZB 1X4BA 4QR0A 1GEHA 3S6EA 1QAYA 2B9XA 2EK6A 4CH0S 2RKIA 3DRPA 1WUUA 2DISA 2ZH1A 2XLIA 2M70A 3FSIA 1CPZA 3EVWA 3H90A 2AT1B 3GWCA 1PKUA 1LWFB 3MEDA 3ENWA 1WG5A 3IWLA 3SCIE 2ACMA 1QUVA 5EN1A 3KK2A 2W01A 2MPUA 3GIKA 2GFFA 5KFCA 1VQMS 1LQ9A 4IOBA 3HD1A 3IO1A 4N41A 1FESA 3K8WA 1MNEA 1IM6A 2IM3A 2RF2B 2JEIA 2GIFA 3PYGA 1K73T 3DFEA 3K58A 2OI2A 1NKEA 5IT9Y 1EETA 3I0RA 2ALYB 3RR7A 1M1GA 4ED6A 1NK6A 4Y2IA 1X5OA 3IWXA 6AT1B 2LDIA 5A6PA 3R2DJ 1OY8A 1REGX 4C8YA 3HMJG 3RBZA 4B9LA 3BN4A 3CC4S 3IR6B 4I64A 3NS5A 4HTJA 3FCHA 1WEXA 4OV1A 2EG2A 2XTJP 5KG0A 2HLUA 1M1HA 3QZ7A 1RKJA 1AA1B 4HLBA 4KT0C 1TK8A 1FXLA 1S6PA 4QR1A 1XNQF 2HURA 5B0DA 3I56S 2NUUG 3RBDA 5E3QA 3CIZA 3RUBL 2NS1B 3CJ4A 3QGHA 2MZTA 4O3QA 5J1EB 3DLEB 2K7JA 2HNDA 1A9NB 4DFKA 2IA0A 1O6XA 2I38A 2OPRB 3SFGA 4RNFA 3BO3A 4EUVA 1FFWB 3BGOP 4Q8FA 1N4LA 2QL5B 2WOMA 3AOBA 4ZLJA 1RWWB 2QFIA 1J5EJ 2JWNA 3CD5A 3DYAA 7FD1A 2H9ZA 1S72S 3D67A 3PRBA 2E9TA 3JYTB 1PJ7A 2IBOA 2C3UA 5DJBA 4URSA 1FEEA 3PYFA 1HBUB 2HBZB 4LRFA 1Q5YA 4TY8B 4W4MA 2GJIA 3ZTSA 4FF3A 4F8RA 2KRRA 2FHJD 1K1SA 3I9V9 3BZQA 4HR2A 4U67Q 2LEAA 3KXDA 4C3LA 2VG7B 4F25A 4LVOP 4OI3A 1G6BA 3ET6A 2APOA 4G1PA 2UUBF 5A2QU 3W9HA 2X51A 3MMJA 3W2WA 3CD6S 1FEHA 3MMBA 3AB4B 4O3PA 2ZH3A 3P49B 3P4UB 4RL1A 3T5LA 5B7WA 1R3NA 2N4DA 3UDVA 3M8QA 1RCXB 4XPEA 3I5BA 3OSPA 3CD7A 4HI2A 4CLPA 5CZXA 2QRRA 2EPIA 4ED8A 4TU8A 3MF5A 2AGOA 3WBZA 1QDUB 1RWKB 2MQLA 2W4CA 1EKRA 4Z2XA 1S1XA 4B08A 3MM7A 1P27B 4PAAA 1YRUA 4FDFA 3UDEA 3M9MB 2VASA 1TUGB 3TJAA 2N4CA 1FX2A 1EP4A 3MPWA 3CPWR 3DU6A 1Y3KA 1AW0A 4K8RA 4DBQA 1WEYA 4XDDA 2QG9B 2GQCA 2RQ4A 1S9GA 3RJMB 2PFFB 4MMOA 4Q43A 5KT7A 3L9ZA 3SDEB 4QCLA 3LUYA 1GMUA 2ADCA 1S59A 2FC8A 2YBVA 2HQDA 3M2VA 3M1VB 2YWGA 3Q8YA 1K8AT 3PHTA 2DR8A 3OHBA 3NKYA 5LMNJ 2ZHBA 3CDEA 3JS9A 4P2MA 3ZNJ1 2Z57B 1Y00A 1U1LA 5B0GA 2W25A 2DNRA 5F0WA 2XMTA 5GAGI 5KFGA 1T9YA 5HP1B 2P5VA 5HBMA 2K3KA 5ETNA 3S1TA 2QGFB 4IR1A 2HWHA 4DPOA 4I67A 1CULA 4N8NA 3VWSA 3SCJE 1N54B 1DAXA 1WACA 3KLIB 3PJ9A 1HHTP 1WNEA 2MJUA 4OZ3A 3B82A 4OYMA 1TAUA 3TQEA 3L3CA 2XNQA 4B3RF 5C24B 1VBKA 5GAHI 4OX9F 5L46A 4NXNJ 4GKKF 4CLWA 3TZZA 2DR9A 3BN7A 2MZJA 4KO0A 4LF9F 3CCSS 2RILA 1BQMA 2LQ8A 3WX8A 1XEZA 5A0YB 1LXNA 1MMLA 3FMWA 4MFBB 2FD2A 2QA1A 4UT4A 3UCZP 1ULRA 1H7WA 4GO5X 2V8HA 1KLMA 1NSAA 3B4DA 3FBFA 3NNCA 1IUJA 2G2YA 4P9SA 1W2BR 1SBRA 4DU8A 4O0NA 5DM6Q 1F0XA 2KB2A 3W61A 3PCOB 4CTAA 2HEKA 2HWIA 2QC3A 2KT2A 1YRXA 4F7VA 4PWDA 2ZH8A 3LQVA 1EAYC 1UJ6A 4DQPA 4FYDA 5AXKA 1NK8A 2LEBA 2COLA 4L3KA 4DSJA 4RW7B 4ED0A 3CCRS 1N0VC 1DY3A 2UV8G 1G4CA 1PSDA 1FRMA 4F4AA 1YJRA 4M5NA 3IR5B 1SPBP 2HS4A 3DNCA 2PGCA 1HBOB 5CYQA 3KFWX 3MAHA 5HATA 1FKAF 3M8PB 2GC8A 2DNQA 3KMQA 4JI7J 5GVQA 2KYXA 3OUYB 4HTIA 4LVNP 1RT6A 2HBQB 2BE2B 1RBLA 3P6YC 1ZPWX 4JV5J 2WAQD 4TQSA 1XMQF 2GMLA 1K1QA 1RT5B 4NLYA 2YNGA 4JBCA 2E1PA 4YQWA 3T5JA 2ZBCA 2OSQA 5DDQC 2ZZNA 2XMKA 1SH2A 4A46A 2YQ1A 3R5GA 5B08A 4QBUA 5CD4A 5DQGA 3TOQA 1Q7YT 2B9EA 1JLQB 1UWBB 4OZLA 2DO0A 3DOMA 2BE9B 1S6QB 1Y0HA 1IR2A 4Y3CA 4ECYA 1FWKA 3ZZYA 3T6JA 2FTRA 1DBDA 1TTHB 8ATCB 1TL1B 3SI8A 4HH0A 1RT3A 2VG5B 3DMJA 1OQ6A 4EBEA 4X64J 4R25A 3R1LA 1O5JA 2UU9F 3J7Z5 2LU2A 2FHKA 4I69A 4TY9A 4KKOA 1RTJA 3QRPA 1H2UX 3Q86A 1HWKA 2C3MA 3GIJA 1X7VA 1PAEX 3WIVA 2EFVA 4NYZA 4KHPJ 2DY1A 3TRGA 2WONA 4ID5B 2KT5A 4LT6A 2R7XA 2ASYA 5KG3A 3B8HA 1E6YA 1FERA 2D74B 1UW4A 1NK7A 1MW7A 2VQFF 2ZZTA 2RQCA 3I4HX 2KYZA 3FSXA 4Y2CA 1UW9A 3W62A 4X4VA 3U7JA 4IRCA 2HMIB 4KSEB 3SCLE 3GP9A 5J2PA 1F9FA 4DCOB 2WHOA 5HMWA 4MK9A 1S0NA 2Y8YA 1JLFA 1RA6A 3EM1A 2CJKA 4HHHA 4DR4J 4DG1B 2P9GA 2PC6A 3IAM9 1IBKF 2NUHA 3PACA 1I3OB 2W2PP 4B17A 2MKSA 1U48A 1NPRA 3D28A 2IJNA 2C2OB 4I6AA 4RNMA 3DRYA 5KT6A 4DU7A 1OQ3A 1M1KT 4WTYA 5KFNA 3UR3C 3VAMA 3MM9A 4QWAA 2L41A 4CH1A 2XO6A 4FZVA 1GMWD 1G2EA 3CJ2A 3OL9A 2R2UA 2R2RA 3ENQA 1V6HA 2AEFA 3DC2A 4CI0B 3RAQA 4FS1A 2YQ3A 3KG1A 2L3MA 4Y2KA 4I56A 1RT4A 3THVA 5A2QY 1VMBA 2XO7A 3SFUA 3EYZA 4ZN1A 2DPJA 4I1TA 4CT9A 2DNZA 3MDFA 4JI5F 1PJ5A 1TFYA 1ZYQA 3C6UB 1QVGR 1SUQA 3PEJA 2GV1A 4ZP6A 2XLKA 1FDDA 3W8PA 3PM9A 1SC4B 2Q43A 4ED7A 2KVQE 3W5XA 4MAKA 4LF1A 1FT8A 3BREA 4YR3A 2MLYA 2KG1A 1OIAA 4MH8A 4URQU 4Y65A 4ECVA 2HFNA 2AJ0A 2VZ9A 4JI6F 5GMEA 2BV3A 1FDNA 3NG8A 2KT3A 3ADAC 6FDRA 3EWGA 2F40A 2V4JB 4BCAA 3RAXA 2QE5A 3AFGA 2MJNA 1RT2A 2ZNZA 4G1IA 2XCAA 2HHWA 1IVZA 4P2XA 1S4FA 3ZXWA 2B4OA 4ZPVR 3QRQA 2CPEA 1N36J 4WYLA 2MY8A 4X4TA 5FDLA 1UJ5A 1SQGA 3KWMA 1RE1B 2UXDF 2ILYA 1VS3A 3C19A 1IKXA 2V67A 2E5IA 2O67A 1Q0NA 2VKZG 5EUHA 2YY3A 2OO4A 4OZNA 2QT7A 2W2OP 1FVSA 3K5NA 1RAEB 1U1MA 2VG6A 1UZHA 1NSPA 3W9JA 5CXTA 4OJHA 5A8RB 2EFGA 1SKRA 4J9LA 5HROA 3PVXA 4B3TF 4UZCA 1BQXA 4M94A 1Z2LA 3HSJA 3ZFVA 1OPZA 3C14A 3IR7B 3OL8A 3V4MA 3ZZ0A 4U7UK 1EQMA 3F44A 1AUDA 1NHKL 1HBNA 4GRSA 4J91A 4F4ZA 1Y5NB 3CJRA 3G8QA 1LXJA 2R4FA 3J80U 3V4IA 4NLTA 2RDDA 1FA0A 1NJZA 2EKNA 1BD6A 2OGUA 1OY6A 1X0FA 5FLXU 4Q2MA 1NBEB 1P6TA 1M5OC 4XAKA 3BO4A 4E8UA 1XWLA 2VFSA 4YR2A 3G71S 1WKLA 2KH9A 1ACMB 4OMFG 2VDHA 1FK9A 2FHJA 3GG1A 5KFHA 3TVZA 2NPIA 1RAHB 4YHHF 2A2CA 1FFGB 1R0AB 3UW1A 3QWUA 2RHQB 3BKUA 4QIGA 2J0SD 1FVQA 3G6VA 3MR3A 3QAEA 2GHPA 5JMNA 2AWZA 2RDJA 3NCQA 1HNWF 1U26A 3I87A 4ZVHA 1X60A 4WP3A 2MGZB 3K8VA 4CLKA 3V6DB 4DL0C 2RVJA 2RU9A 4C8ZA 3CJQA 1RXOB 1OYEA 2BBEA 1CC7A 1CLFA 4RW6A 3CEDA 4HI1A 1EQ0A 1Q16B 1NRKA 3NBPA 3AB2B 2XS2A 3DRRB 4I2PA 3ZTOA 2OPPB 5J2NB 3W1YC 2H65B 3FEZA 4W98A 4WBFA 1MG7A 4ANEA 4JV1A 3GLJA 3JB9k 2CADA 2NREA 5F8IA 2B51A 3DLGB 4DPTA 1HQUA 5SZTA 2AW0A 2AJ4A 2QMUB 1SL2A 1Q53A 2FLPA 1REVA 1FRXA 3E01B 3VAKA 4F0MA 4X4UA 2VA2A 1UPMB 2IVFB 4ILMA 3X3UA 1X4GA 3A3NB 3MEKA 3T19A 3MEEA 2XG8A 3ZC4A 2E1RA 1P1TA 1Q1KA 3ELHA 1W2IA 3CD0A 2GGPA 5CYJA 4ICLB 5KFAA 2XMWA 3GR0A 2R3VA 3GCWP 2EKYA 4ZJOA 2NZ4A 4JB8B 4XO0A 2YPZA 3RRKA 3H25A 5C2CA 4NCAA 2EWHA 4OX8A 4AE5A 1F2HA 4M95A 4ZVOB 5D0EA 4IG3B 1FO1A 2L9NA 3FJ2A 3A1YG 4C98A 2CNLB 3D66A 3MMCB 3M8YA 1N52B 4X84A 1FRLA 1ZS6A 4ZMMA 5M2RA 1V3RA 5DG9A 2O3DA 1VGYA 1RSCA 2BJ9A 2OTLS 4ZLPA 2JJ4D 1L3UA 4OHWA 4EZ9A 4R5PA 1R0BG 1I6JA 3F73A 2B4PA 2N7CA 1J5EF 1U47A 4E0DA 2BRKA 4WU2A 4B9UA 4LRAA 2Z58B 3M32B 4ZA1A 5KOWA 2BW2A 2R8IA 2MZRA 2D41A 1U45A 1KN6A 4O44B 3QIPA 1D8YA 3HSZA 1DTQB 2QX0A 4P52A 1PG5B 2I2YA 3QAUA 1HYSA 3DRPB 1RYRA 1CQMA 3ILLA 3TUPA 1LK5A 2LFVA 3G82A 4UUWA 2XQCA 4CNYA 4FNHA 3KK2B 4RUCA 5E3AA 1JKHA 1QTNB 4LREA 1Z1ZA 2VBWA 2DO4A 3GPAA 4EGLA 4ED5A 3IBCB 3EGZA 1VC5A 3E51A 4PABA 2C2MB 4OHYA 1EETB 1RAAB 3CXCR 2OEKA 1RWMB 3AJ1A 4DV5J 3HM9A 4OJ3A 2CJAA 2YH0A 5KFMA 4GKJJ 2VA3A 2R7UA 1JXEA 3G2XA 1R6YA 1WTBA 2GJFA 2H54B 5G0RA 1XNRJ 5KFLA 4DMZA 5HAOA 4QR2A 3GSDA 1VRUA 2E66A 5L8RC 5D4LA 2PSZA 2XB2D 1Q8LA 4CZCA 2R7QA 4DPYA 4WPAA 2H5JB 2KZMA 4LJMA 9RUBA 4AYBD 5E3CA 1NMEB 3ILIA 2ZJPQ 2CYYA 1XERA 2JLFA 2EW9A 3UNYA 3HHEA 3VGUA 1X0PA 3V81A 1NAQA 5LMNF 4USIA 4F0KA 4GO7X 1X5SA 2K06A 2HRYA 3MR7A 3IBWA 3MPUB 2WOMB 1WC5A 3Q8UA 3Q24A 3I82A 3OTDA 2VQEJ 3QGIA 2NPFA 4F04B 3ICLA 2XYHB 3AH6A 4C8OA 2VFVA 4MTPA 4NCGB 2AF6A 3OFFA 3IRXA 2G13A 3JQKA 1VQYA 2AJFE 2CA9A 4ECSA 3BR9A 1LEOA 1WEZA 4LRDA 4B9TA 3T3FA 2IMWP 2ATLA 3DOLB 2ZITA 5ETTA 2GAHC 2Z2ZA 4JI1J 2BOPA 3AOAA 2ASJA 3SSRA 4DL4A 5I4MA 5M2PA 1U8SA 3W2WB 4NXNF 4PPZA 2C3YA 2HNZB 3THPA 5D77A 3G86A 3VZHA 3M8QB 1URRA 1WTFA 1QVFR 3VVUA 4G3IA 2V6AA 4JV2A 2PA8D 3CW2C 2NXCA 3NOCA 3NAIA 1F5AA 3OFHA 4KR0B 3VTIA 3LTOA 1LOUA 4RW4B 1HQ2A 1M5SA 1ZA2B 4FNIA 2RE1A 1S1XB 3MM7B 4ECTA 4RX6A 3UN5A 5JJBA 3J80Y 2HVHA 2OD6A 3BR8A 2BRLA 2QLWA 2M0GB 4DX7A 1KTVA 3OPKA 3VAHA 1UVLA 2DXFA 4JI8J 3N28A 5FLXY 1HW9A 2RNEA 1S9GB 3P8BB 1FI4A 4IOAQ 1RHUB 2EFOA 1JJ2R 4CM2A 1T3OA 1FE4A 1SH0A 1X9WA 4DR1J 2W1BA 3CMES 4IKAA 1GMWA 3MAQA 3ISZA 2W7PA 3CVKA 2FGOA 2XI3A 1S79A 2Z2YB 5AE2A 2HHPA 2XSJA 4P73A 5J2MA 4ATNA 4C9DA 4LF6J 1FWLA 2HW3A 3ENVA 3UO0A 3OFEA 2YX1A 3TX0A 1Q81T 1AXQA 4JI7F 2E29A 2PFDA 4ZLNA 1HBMB 3R7NB 2CPZA 1IKYB 3MURP 2XNRA 4AL7A 5D0RA 5T7LB 2ZBPA 3CDWA 3D7SB 4JV5F 3RYLA 3EVOA 2VV5A 4J7CA 3RAMA 2IAJB 4CO1A 3M05A 4KHRA 4HT7A 2Z8QA 1U1KA 5HBMB 4K2JA 2B43A 3NXZA 5DM7Q 4YB5A 5BYQA 1U1OA 2AEMA 1CULB 2YNHA 1HQEA 2LA6A 1UL3A 3HKWA 3QMQA 1HPZB 4UQGA 2VOOA 1KTQA 1VHIA 4ETZA 1S49A 2GO8A 2BKNA 2DNNA 3HO1A 2VC1A 3OJSA 1F6TA 3M2UA 4J9NA 3E8OA 3HPOA 3A8IA 3H42A 4JI4J 2RS8A 2DYAA 3Q8PB 1T9XA 4CIOA 1VOMA 1VQOS 4H4MA 5ETKA 1LWEB 3QYYA 3RBXA 2KDOA 2CJ9A 3LGMA 2IVMA 4I7FA 4KO0B 4LQ3A 4ELTA 1BQMB 1CJTB 4X64F 4IH6A 4GC7A 1TKTA 4TLRA 1U6ZA 2CJXB 3O6QA 2LCWA 4N56A 1NCLA 2HFOA 3FEYB 3IGVA 3M6VA 4USKA 4WYWA 3HFVA 2HGLA 3L09A 3D68A 3B78A 5F9NA 2QZ8A 2QA2A 4KHPF 4CTAB 4A8WA 1IJFB 5C25B 2J8AA 5L1LA 4PWDB 4QYZK 3LP2A 1RWOB 4JI0J 2LMIA 4CT8A 1N33J 2WW8A 1T9TA 5K8MA 4JI3J 1WI6A 1NJWA 2F65A 2VF3A 4J9OA 5BYRA 3OSNA 3NS7B 1XBWA 4RKUC 5K14A 1IKVB 2XCPA 2W4PA 1C0UA 3MOJB 3RB4A 4M5KA 4QIEA 2WVDA 1KD1T 4ZP8A 4DR2J 3FCWA 5CCLA 1RWXB 3MM8B 1GMVA 2MKJA 4DR4F 4M5LA 3FFIA 3LO3A 1ZPVA 1VDHA 1KQSR 2K8GA 1F9HA 3CO9A 5DDPC 1RT6B 2OIHA 4DR5J 1WG4A 2CWKA 1T9WA 2P2CB 1UA0A 3W7BA 1HNVA 4ZN3A 4MIAA 4P7TA 1RTHA 2YNGB 4MYUA 3TA0A 4RUHA 2QJ3A 4B3OA 1X5PA 4B3MJ 3GIRA 1J5OA 2IRUA 4ZVEA 3R5DA 2VH7A 5F8GA 2OUGA 2MDAA 3LPYA 4OYOA 4WFAQ 1HHSA 3BQ1A 1H2VZ 4OLPA 3DOMB 3PJXA 4DZDA 1RHRB 4ED2A 1ZOTA 1MROA 1LK7A 3A8JA 2AX0A 2R8KA 2FJWA 4DPXA 4P2FA 3QJJA 4ZDNA 1NM2A 4ZHRA 3HK2A 3IFEA 3IS9A 3QO9A 4ZJLA 2RUSA 3TW0A 2EEYA 5IV4A 1EHWA 5L9NA 3DMJB 3ULHA 2HPUA 2AYMA 1Y9OA 4NZ0A 3R6GB 1D9AA 4FYXB 4Q2LA 3FQKA 4FKYA 3PZPA 3J7YI 5DS7A 5F9LA 4KPCA 2ZE2B 1HIYA 4BC7A 1RTJB 1A6LA 2PT0A 1T11A 5J1PA 2Y1IA 2G2OA 4LSLB 4OHVA 5F0UA 3VF0B 1R8PA 3G96A 1WC1A 4J9PA 1YITS 4ENOA 4HL9A 3NGSA 4ER8A 4DXLA 2Z4PA 3FC9A 3KJVA 3PX4A 2JEGA 2VB6A 2UP1A 1TAQA 5I3UB 3EZOA 1E6YB 1UMJA 2YVSA 1N36F 3H5XA 3ISND 2MQOA 4NLVA 1R8HA 4X4QA 3SEOA 5DDRC 2X3DA 1RTIA 2Q1LA 4PWWA 3F0NA 2IDEA 3K59A 1SL1A 3BF4A 1PGZA 3NGKA 4K0KJ 1FDBA 2KXHA 2Q3PA 4DL6A 4KIAA 1I1GA 4EMDA 2BM1A 2WRMA 5DETA 4MJKA 5J2PB 1OMSA 3Q89A 3LGHA 4PQAA 4H4OB 4DSIA 2HFVA 3HI9A 2YNIB 3MCNA 4ZP9A 3TJ9A 2X1FA 1TL5A 2VIHA 1I51B 3TNVA 4WXOA 1S1VA 4C8NA 1Y11A 1YJNS
chains in the Genus database with same CATH topology
1U49A 5AXLA 4RU9A 1VBYA 5L1KA 4TU7A 1IUJA 3NL0A 1W2BR 1SBRA 3KHLA 3CCLS 3R3TA 1DQ9A 4NOHA 5DM6Q 2V9WA 2OPSB 1F0XA 2KB2A 1UA1A 3MEGA 1HBUA 2IC3B 1NO8A 4TY8A 3T6BA 4IFVB 3P5TL 4A8KA 1OSDA 4TU9A 3PHEA 3ZZZA 4CTAA 2HWIA 3P96A 1U6FA 5A8WA 3C2PA 2JFDA 2KT2A 1YRXA 3U27A 4PWDA 2ZH8A 3I0SA 2XMJA 1RT7B 3FQLA 3LQVA 1UJ6A 2AV5A 2DTJA 4DQPA 4ZPCA 3FZBA 2E5HA 4FYDA 4OJ1A 4M1KA 5AXKA 1NK8A 2LEBA 3AA8A 2COLA 3KTQA 1HYSB 1KVIA 4DSJA 3DLHA 2AU0A 2X1BA 2VKRA 2UUWA 3SCKE 3RB6A 1S99A 3DOKB 4RW7B 4ED0A 3CCRS 1N0VC 2UV8G 1IBMF 3I4PA 1PSDA 2FVSA 2IVYA 1KRPA 2CIMA 3HHKA 1FRMA 4TLQA 1YJRA 3MD1A 2IFXA 3I6PA 3CC7S 1N5YA 2HHQA 3IR5B 1UP1A 3D0IE 3OR2A 3M9OB 1DTQA 2HS4A 3FNNA 3NRBA 5JVHQ 5BJRA 3DLKA 4D3HA 2DCLA 3DNCA 2PGCA 1N88A 1YWXA 2HGNA 2Z0GA 3BDPA 1HBOB 1VJWA 5CYQA 3GIIA 1N0UA 3KFWX 4IQMA 3MAHA 1SUQB 3HHDA 3QJLA 4ZKAA 1FKAF 3M8PB 2CPIA 2J6UA 2GC8A 1B0VA 2DNQA 1S76D 2ZHAA 3KMQA 1F60B 3N5BA 3OLBA 4QPXA 3Q23A 3MOZA 3IN5A 2DNMA 4OZ0A 1IXKA 5GVQA 2B9YA 2KYXA 3OUYB 2ALZA 4UQTA 5KFPA 1TKXB 4HTIA 3MR2A 4NWBA 3HZGA 4LVNP 4O4RA 1JLCA 1RT6A 3RRHA 4ZVGA 3AQPA 2BE2B 4LUBA 3W3SA 3DLBA 5J1NA 4YB6A 4OI1A 1ZPWX 3KMSA 3DLLQ 3P6YC 1R31A 3OXFA 3V5RA 3RBEA 2BYCA 2WAQD 4TQSA 4AUKA 1XMQF 2GMLA 1K1QA 4RBUA 3TANA 1SQEA 3HDSA 1YVFA 1RT5B 4NLYA 2YNGA 2CPHA 4JBCA 4C3MA 2BANB 2IHR1 2KXFA 5IWAF 2ZBIA 4OZ1A 4YQWA 3T5JA 2ZBCA 2OSQA 2XMUA 5DDQC 3GQCA 2UUAF 2ZZNA 2XMKA 3PO5A 1SH2A 3O3LA 2YKOA 4MKBA 5JXSA 1BQNB 3UDLA 4A46A 1JLEA 4CNZA 2YWKA 2DIUA 5B08A 4DS5A 4RU2A 4QBUA 1VK8A 3PRDA 4YY3F 4Q8EA 3V2UC 3WZ0A 1Z2ZA 1NB7A 2J7UA 2VOPA 3M8SA 5L38A 1Q86T 5KFKA 3EPGA 1FHTA 3ISNC 5DQGA 3TOQA 1DURA 3CDBA 4ZVFA 3SDEA 1X4FA 2RSQA 1RT2B 3SSSA 4AL6A 1Q7YT 2BUNA 2HWTA 1JLQB 1UWBB 4K50A 3I9ZA 4KBIA 3R5AA 4DV4F 1RKIA 3DXSX 4OZLA 3CUNA 5KFRA 2DO0A 3DOMA 3PNIA 2WSCC 5KFBA 1RT1A 2LQJA 1S6QB 1NKBA 4TYBA 1WD6A 1Y0HA 1Y3JA 5H9FJ 4F50A 5DQIA 3EZ5A 4Y3CA 4DQIA 4ECYA 2DGUA 1FRKA 2DNYA 3UQSA 4X4RA 2UVUA 1CVJA 1D8ZA 1A7GE 2C3OA 2XMMA 3M1VA 3ZZYA 1OPIA 1D9DA 3T6JA 4X2BA 2J9EA 2HNYB 3TYTA 2VC0A 4HT5A 4QOTA 2FTRA 2LQ5A 2W7AA 4OQJA 1O51A 1S9FA 1H98A 2XSFA 1DBDA 3CJ5A 3AAWB 1TL1B 3V6KA 4ZPBA 2V2KA 3DM2B 3SI8A 4LF7F 4HH0A 1RT3A 2VG5B 1BWEA 4I0WA 3DMJA 1MMNA 1OQ6A 4CO5A 1S97A 2KKHA 3OTCA 4NLWA 3BEGB 4XDCA 2CZ4A 2JDJA 4EBEA 2OP5A 2ZC3A 1YJVA 2X3GA 1X9SA 3DI6A 3C66A 1HL6A 1S9EB 2ZH9A 1RA7A 2J0XA 4RZRA 2JH3A 3L7OA 4DFJA 1QTMA 4R25A 5KFDA 3R1LA 2CKWA 4K4TA 4QU6A 1R89A 3POTA 5GMKa 1O5JA 3K5LA 2UU9F 1VQKS 1JMTA 2VG6B 4YEAA 2JEJA 3CB4A 5HP1A 1MWYA 2F9JA 5A6WA 3LALA 4F3QA 3J7Z5 2BQRA 1FRIA 2LU2A 2FHKA 2M2BA 2VFRA 4I69A 4TY9A 4C7QA 3NP5A 1X9MA 4YMEA 3CWJA 4ECUA 2AGQA 4FBTA 4KKOA 4I6YA 2IRXA 1RTJA 2KRBA 2K1RA 3PKMA 4HH1A 2HHSA 1LW0A 4EEYA 4C11B 3K2YA 1H2UX 3OW2R 5HN0A 5KFWA 4WZQA 2PD1A 3J7YU 1HWKA 3SV3A 4K4XA 2WK4A 2C3MA 3GIJA 1X7VA 3QLHB 3BJYA 2EFVA 2ZDPA 1YIJS 4NYZA 3BSOA 3IRXB 3KLIA 1NK0A 3VQTA 2ZD1B 3L95X 4OHZA 3C6TB 3HHNB 1K0TA 3TRGA 2WONA 2JC0A 4ID5B 1GX6A 3GFXA 1UAWA 2KT5A 2XGQA 1FKOA 1SH3A 1JLAA 1VRTB 2ZH4A 3IG1A 4LT6A 2R7XA 1C2PA 3IRWP 2ASYA 4F26A 5KG3A 1AFIA 3H8YA 3I5CA 1QUPA 3B8HA 1E6YA 3T5HA 1FERA 2UXBF 5L1JA 4IR9A 2D74B 2OPQA 3MM6B 2MKKA 4LFBF 1UW4A 2VUGA 5K5MA 1NK7A 1MW7A 5IFMA 5B0FA 2VQFF 2LYVA 3CCWA 3RR8A 2KG0A 2RQCA 3I4HX 3V4IB 2KYZA 3FSXA 4Y2CA 1T3NA 1SB6A 4C97A 5EWEA 3GFZA 2BA9A 2DNGA 4NCGA 1U1QA 2OH2A 2XLJA 3M30A 3PEHA 4OI4A 3PW4A 2DGQA 4UW2A 4X4VA 3U7JA 5I42A 2RB7A 1DRZA 4ITSA 1YGYA 3KLHA 4IRCA 2HMIB 3I31A 4KSEB 3SCLE 4AFFA 1N5TA 5EDWA 3FRZA 3TI0A 4W92B 3M4XA 1F2GA 1Q4RA 2XMVA 4JYAF 3D2WA 5J2PA 2CQHA 1F9FA 1G3OA 3M6UA 4ES2A 2WHOA 5DLFA 1T05A 5HMWA 1IQZA 3K5PA 4MK9A 1RP5A 4H4KC 2DNLA 3M6XA 1JLFA 5KTQA 1MMDA 1RA6A 1S0NA 1I94F 1NJYA 4UY85 5GAHU 2J9DA 4PQUA 3LANA 4O3OA 2CJKA 2L08A 1E6VB 4NZ6A 2J6TA 5KFTA 4MFBA 5MLCV 2WB1D 3CCZA 3DOLA 4DG1B 3LWLA 4WZMA 4Z37A 2M7SA 2QV6A 5J2QA 2E9RX 2P9GA 2FIUA 2EFNA 1FK9B 1C1CB 4A4JA 4FXWA 5E3RA 3UNGC 2W9BA 4DEZA 3TAMB 2O66A 1KQFB 4FF4A 3VCDA 3VAFA 2PC6A 3IAM9 5KFVA 4RWWA 3RU0A 4XIUA 3G4SS 1KSPA 1IBKF 1N8RT 2HS0A 2NUHA 4IFYA 4LSNA 3PACA 1DLOB 4ILRA 2PA3A 2MKSA 4B17A 3KK3A 1U48A 2IA6A 3D28A 2C2RA 2B6AB 2PN6A 4LF4F 3C8YA 2IJNA 4I6AA 5E5NA 2HNZA 4Y0FA 4RNMA 4OI2A 3DRYA 3B4MA 4IDKB 5CCMA 3UE2A 5KT6A 5L9XA 2RDIA 2OPSA 3EX7B 1OQ3A 2ZOMA 4IO9Q 2B0GA 4PG7A 2ZUGA 1KHWA 2D9PA 3MMAB 2V4QA 4NLPA 4WTYA 4MYTA 5KFNA 1M1KT 2VBZA 2F8EX 1HARA 4IFVA 5KT2A 4DV6F 3FVYA 3T9ZA 3QZ8A 2PIIA 3UR3C 1RWUA 1T8EA 3BGRB 2QFJA 4QQBA 4AXJA 1GXTA 2B5JB 3MM9A 3VAMA 4QWAA 2RS2A 4DWIA 1UKUA 2F1FA 1S77D 2L41A 2DGTA 4K4WA 5LXRA 3CJ0A 3TUIC 4C8MA 1P8GA 1H3DA 4CH1A 4QWCA 1PC4A 2K2PA 4FZVA 4RW4A 1KQGB 2KJWA 1S1WB 1WF2A 1ZH5A 3V6HA 4Q45A 2RKIB 4BWJA 2KO1A 3BGLA 4A48A 2HYIB 2HHTA 3J7A1 2RQMA 2XS7A 4WFBQ 3Q8QB 1G2EA 3JSMB <