1HARA

2.2 angstroms resolution structure of the amino-terminal half of hiv-1 reverse transcriptase (fingers and palm subdomains)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
216
structure length
196
Chain Sequence
PISPIETVPVKLKPGMDGPKVAQWPLTAAKIAALVAICTEMEKEGKISKIGPENPYNTPVFAIWAKLVDFRELNKRTQDFWEVKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILAPFKAANPDIVIYQYMDDLYVGSDLAIGAHRTKIEELRQHLLRWGLTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.2 A resolution structure of the amino-terminal half of HIV-1 reverse transcriptase (fingers and palm subdomains).
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein, transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (FINGERS AND PALM SUBDOMAINS)
total genus 54
structure length 196
sequence length 216
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1994-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1harA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1harA02
3KLGB 5KFFA 4O3RA 3FRZA 3CJ3A 1IKWB 1S0NA 1EETA 3MEEA 4O4RA 3SFUA 2YKMA 2YNGB 1C1CB 4F4YA 1S97A 4JV2A 1MMLA 1HNVB 1S9GB 5KFOA 3OSPA 3E01B 3MR2A 4ECXA 3DRRA 2B6AA 2JC1A 4NRUA 3KK1A 1TQLA 4KBIA 1TL1B 5DG8A 1T3NA 4NLDA 3C6UB 2W7OA 1S1UB 1TP7A 5KFKA 2W9BB 3DLKA 2RKIB 4PUOB 3QZ8A 3T5HA 4KO0B 5F8HA 2VG5B 1GX5A 2WHOA 3ITHB 1HYSB 5KFRA 2XGQA 2IBKA 3KJVA 1IKXB 1HQEA 1LWFA 3JSMB 4KE5A 3E51A 1TL3A 4TQSA 2AU0A 5DQIA 4IR1A 2J6UA 1N48A 4J9OA 4H4OB 4XPEA 4WFZA 3MTKA 2RDJA 3RB6A 5KFMA 4NLVA 1JLGB 2C28A 5KT7A 2ASLA 1IKYA 3RBDA 3DLGA 5I42A 4TYAA 3DOLB 5C24B 3DLKB 3V6DB 3BQ2A 1N4LA 4ECWA 1FKPA 3MEDB 5KFYA 4R5PA 3Q8QB 1RT7A 2AQ4A 3LP0A 4TY8A 2OPRA 4OL8A 1K1QA 4EBEA 3LAKA 2BE2B 4XO0A 2HNDA 4G1QB 1S10A 3G86A 4ID5A 4MK9A 2JEFA 4X2BA 1LWCB 1TKZB 1C0UA 3QO9B 1NHVA 5KT5A 3OL7A 3EPIA 4J9NA 4O3SA 1S0OA 1S1TA 2C2RA 3DLGB 5I42B 3IGVA 4IG0A 1JLQB 3DDKA 4ZPDA 2BQRA 1N56A 4IQXA 4KFBA 5KFUA 1SH3A 3D28A 3BQ1A 3KLIA 1LW0B 2JEGA 1IKVB 1LWEA 1S6QB 1RDRA 3I0SB 2RF2B 2HAIA 4K4TA 5DG7A 4IDKB 5KFIA 1TL1A 3PW7A 2I5JA 4DEZA 3MFIA 3T5JA 4RNHA 3OHBA 2FVRA 3CJ4A 4ED2A 4IOBA 4JV0A 4KB7A 3PR5B 4ZVHA 3RB0A 4Q0BA 3DLEB 3KK3A 3DRSB 3MEGB 5HROB 4IG0B 5FDLB 2D3ZA 3PR4A 3Q8SB 3MR5A 1S9EB 4ZHRA 4RNNA 4NYZA 3KLHB 3GYNA 1IKWA 4Y2AA 2VG6A 1YVFA 3OL8A 2IAJA 2W8LA 4IRCA 3N6LA 2WB4A 1C1CA 1IKYB 4O3PA 2FJXA 2IMWP 3KHGA 4O4GB 1T03A 1XR7A 3IS9B 2R2UA 3H5XA 3NGDA 4KAIA 3C6TA 5KFQA 4R8UB 4RW8A 2HNZA 2YKNA 5F8GA 3RAXA 3T1AA 2E9TA 3KLHA 2BE2A 3I0RA 1KHWA 1RA7A 3KLFA 3BSCA 2ATLA 2D7SA 1REVB 2YNIA 3N6NA 3CJ0A 1NNDA 3GV7B 4NLGA 4J9LA 2FLLA 3TAMB 3KHRA 1RT6A 1VRUB 5KG1A 2BRLA 4URGA 1MU2A 2ZD1B 4IFVA 3KLEB 3OLAA 4IRDA 1HQEB 5HLFB 2JLEA 2B5JA 4URSA 1RT4A 2VA3A 2HMIB 3QGGA 1RT2A 1IKVA 1TV6B 3PW2A 2RKIA 4ZP8A 4H4OA 4RU9A 2R8KA 3NBPA 5KT2A 2R2SA 3DMJA 3KJVB 4PQUA 5KFSA 5KT4A 1LWFB 2YNIB 4ED6A 5D3GA 3IG1A 3DYAA 3QLHB 4LSLB 5CYQA 3NKYA 5KT6A 2R8HA 3TAMA 4O44A 4RUCA 1FKOB 2W9CA 3M8PB 3H4BA 2OPQB 4F4WA 2UVVA 3DRPA 4MFBB 1KHVA 4IR9A 3EPGA 4RW6A 3Q8RB 4H4MB 5K14A 1SV5B 2AGOA 1R0AA 2VA2A 2BQUA 4M95A 4Q43A 5F8MA 4GC6A 3QYYA 2WOMA 3MF5A 3H40A 3BGRA 2OPRB 3DYAB 3QLHA 3IS9A 4KSEB 4NLPA 5KFAA 3M9OB 4HYKA 3HVAA 4MK7A 2ASDA 2HNDB 1OS5A 3QIDA 5CYMA 3HKWA 2FLNA 3OHAA 4MFBA 5EWFA 2DPIA 4MKAA 1T05A 5DLGA 3NAIA 3H4DA 4FBUA 1S4FA 2O5DA 3D5MA 3LP2A 3HVWA 1SV5A 5KFBA 2ALZA 1FK9B 1SUQB 4EO6A 4KV8B 3V4IA 5J2PB 5JUMA 4ZP9A 4WYLA 1BQMB 4QW8A 5DGAA 3KLIB 5C5JA 3KK3B 1S9FA 5HROA 5KG2A 4ICLB 1LW2B 1BQNA 1JLBB 4ZMMA 4ECRA 4TLRA 4IH6A 5CYMB 3CDEA 3FFIA 1D0EA 1TV6A 3Q8PB 2UUTA 1C1BB 5T14A 1JLFA 4LQ9A 4B3OB 3MFHA 3MECA 5KG4A 3GIJA 1TVRA 1HARA 2GIRA 1RT5A 4WXOA 5L1KA 1DTQA 3CJ2A 2WONA 2BANA 2B6AB 3PW4A 1JLAA 4QW9A 3KMQA 4ED8A 3OSNA 4I7FA 4RW8B 3M9NB 2XWYA 2R8IA 3OL6A 1RT3A 2R2TA 3KLGA 5K14B 4R0EA 5KFJA 4O4GA 1T03B 4DL5A 1R0AB 4K50A 5F8NA 5KFDA 3LAMA 5C42A 3MR6A 2UVRA 4NLUA 1C0TA 1RT1B 4JUZA 4EYHB 4EBDA 1TVRB 2YKNB 3DOLA 5C24A 5J2NB 1JLEB 1TL3B 4EYIB 3H59A 1RTJB 3OL9A 4PWDB 2OPSA 3IN5A 4NLRA 5C25B 3TQ1A 5KFCA 3ISND 1ZTWA 1S1VB 4ZPBA 4O3QA 2UVWA 3DOKA 3LP0B 3PZPA 1IM4A 4F4XA 4XPCA 3GQCA 4WFXA 1T05B 2CKWA 4IFYB 3QGHA 3BSOA 3PW5A 2HWHA 4MIAA 1HQUA 3DMJB 4RZRA 2JEJA 2YNFB 2ZE2A 4WE1A 5HLFA 4QWDA 4KV8A 4TY9A 3H2LA 2IJFA 1RYSA 2ZKUA 2IC3A 4QWCA 2J6SA 5JXSA 3LP1B 3BR9A 1HPZB 4DL4A 2IM1A 5J2NA 2R8JA 2ILZA 3IRXB 5I3UB 2R2RA 4ED7A 2JEIA 3H5UA 4WFYA 2OPSB 3PW0A 5L1IA 4KFBB 1S1UA 1LWCA 1TKZA 1QUVA 5L9XA 4YMEA 4K4SA 1S1VA 1LW0A 1DLOA 1RTIB 5L1LA 4J9QA 2VG7A 1S1TB 3H5SA 4DG1A 3DM2B 2VG5A 1C2PA 1NHUA 2WRMA 4IRKA 4IG3B 4QWEA 1JLQA 3UR0A 3BGRB 2XI2A 2F8EX 2WK4A 4DL6A 3T19A 2AWZA 5KFZA 5KG5A 5KFHA 3G6YA 4FBTA 5KG7A 2B43A 4FS2A 3ICLA 5KG0A 2W8KA 3RB4A 2WOMB 2DPJA 3OLBA 1RTHB 3ISNC 4ID5B 2VG6B 3V6DA 2VG7B 2IAJB 3LANA 4YR0A 3MEDA 4DG1B 4KHRA 3MEGA 1JX4A 4Y34A 1RT7B 1S9EA 1J5OB 3GIKA 1DTTB 3FSIA 3V6KA 4ECSA 3KK2B 1BQNB 1JLBA 4I2PA 5HP1B 4M94A 3PJWA 4ZPCA 4NLXA 1FK9A 3DOKB 5J2PA 1KLMB 1C1BA 3CJ5A 1LWEB 1S6QA 1BQMA 4RW4B 4B3OA 4ZVGA 4NRTA 2I5JB 1VRTA 4KKOB 1N5YB 1RTHA 2FVQA 2YNFA 2IM2A 4ECUA 3FDSA 2C2DA 2XCAA 3N6MA 3KOAA 1XR6A 3M8QA 1HPZA 2YNHA 3CDUA 4NLTA 1DTTA 3G6XA 1I6JA 4IFVB 1HNIB 4IDKA 3I0RB 3H98A 5KG3A 2IA6A 3KLFB 4IKAA 2V9WA 1EETB 3MEEB 3DRRB 5J2QA 2AX1A 1RAJA 4YR2A 5EUHA 2ILYA 1HMVB 2XGPA 3M9MB 4WYWA 4K4WA 2YNGA 1RYRA 3NL0A 5C42B 4WZMA 1GX6A 4RW9B 1HNVA 1TKTA 5FDLA 4MIBA 1QE1A 2IM0A 3RBEA 4NZ0A 2EC0A 1RTJA 3GILA 3DI6A 4O44B 3HVTA 2AGPA 2R8GA 3T5LA 3G6VA 2GC8A 2V0NA 4ECQA 3C6TB 4ZP7A 2XCPA 4DL3A 2E9RX 1HNIA 3CO9A 1C0TB 1RT1A 4PQUB 5KFTA 4DL7A 5D3GB 4H4MA 1HQUB 1HMVA 4KHMA 3SFGA 5F8LA 2ZE2B 4WE1B 1JLCB 1FKOA 2W9CB 4JV1A 1JKHA 3JYTB 5KFWA 3ITHA 1HYSA 2IC3B 1IKXA 3LP1A 1J5OA 3JSMA 2UUWA 3QZ7A 3UDLA 4YR3A 5I3UA 4QWAA 3KLEA 4ED1A 5KFEA 1SH2A 4DL2A 2B5JB 1QAIA 5DLFA 4NLOA 5KFLA 4U7CA 4YP3A 2W7PA 1RT2B 2WCXA 3VQSA 3MR3A 3KK1B 2FLPA 1VRTB 1N5YA 1MU2B 3C6UA 4F50A 1SUQA 5J2MB 3BJYA 1RT4B 1JKHB 2OH2A 2W9BA 5DGBA 1W25A 4Q8FA 4PUOA 4LSNA 5EWEA 3BSAA 3DM2A 4G1QA 4I2QA 4RW7A 3QGIA 4TYBA 4ZPAA 2AX0A 4RW6B 4ECZA 3I5AA 4QPXA 2V4RA 3H5YA 4EEYA 2CJQA 2OPQA 1JLGA 5HBMB 5KFPA 4Y2CA 5F9LA 1U09A 3UQSA 5J2MA 3I5BA 1QAJA 4MKBA 3PVXA 4K4ZA 3FFIB 4G3IA 3V6HA 4ECYA 4ZP6A 1FKPB 1D1UA 2W9AA 5DQGA 2JC0A 2XC9A 2BRKA 3MECB 4F4ZA 2HWIA 3BQ0A 4IH5A 4U6PA 4ED0A 4ZHRB 1RT5B 4TXSA 4NLSA 5KFVA 1JIHA 2HNYA 3FQKA 1EP4B 3V81B 4KKOA 1S1XB 2FVPA 2BANB 4TN2A 1UWBA 4Q0BB 5DG9A 1N6QA 3RB3A 3PHEA 3CDWA 3I5CA 3V6JA 3NMAA 5F8JA 4NLQA 2I1RA 4RNOA 1LW2A 4PWDA 1CSJA 2FJWA 3LP2B 1ZTTA 3QO9A 4EO8A 2HNZB 3V4IB 4Q45A 3KHHA 3GV5B 4ED3A 2RF2A 4YQWA 5DQHA 5J1EB 3SI8A 1JXLA 5EWGA 4RW9A 2QV6A 3EZUA 1TKTB 4ZVFA 5F9NA 4NCGA 2OPPB 2IJNA 3GV8B 2WONB 4R8UA 4Y3CA 3HVTB 4LSNB 1RTDA 2FVSA 3CWJA 4J9KA 4I7FB 3CIZA 1S9GA 4I2QB 4RW7B 2E9ZA 4HKQA 1RT3B 5KFGA 4J9MA 2UVUA 1DTQB 4K4XA 1QE1B 2QE5A 1SH0A 2YKMB 1JLAB 1S48A 4MH8A 4MK8A 3NBPB 3DRSA 3IRXA 5KFXA 5F8IA 2V4QA 4RUAA 1WNEA 4K4VA 4LSLA 4NLYA 4FS1A 3GIMA 1DLOB 1ZETA 3M8PA 5C25A 3PJXA 4O3NA 3NAHA 4RNMA 5EDWA 4TQRA 4J9RA 4O3OA 4GC7A 4IFYA 1EP4A 3V81A 2C22A 4IH7A 5KT3A 1UWBB 1REVA 4NLWA 4ECTA 4KO0A 3KNAA 1S6PB 2IM3A 2AGQA 2BQ3A 1RT6B 1VRUA 5KFNA 3QIPA 2ZD1A 4I2PB 5HP1A 1K1SA 4K4YA 3IGNA 3CVKA 2HMIA 3UPFA 1S1WA 3LALA 3KMSA 4J9PA 3TVKA 5J1EA 2GIQA 2C2EA 3KLVA 5HBMA 3RAQA 4H54A 1C0UB 4NCGB 3E01A 4Q44A 1S6PA 5CYQB 4R5PB 1RTDB 3M8QB 1RTIA 4TY8B 3QIPB 2XI3A 4ZVEA 3DRPB 1RA6A 3KHLA 4EBCA 5L1JA 4WXWA 4IG3A 3BREA 1S1WB 3IG1B 3T5KA 2FVCA 2D41A 2WTFA 3FQLA 2YNHB 1S0MA 4ICLA 1TKXA 4J9SA 1Z4UA 4K4UA 5KG6A 4LQ3A 5J2QB 2HNYB 1S1XA 3DLEA 1JLFB 3I0SA 4QWBA 3BSNA 2BR0A 1N6QB 1T94A 1XR5A 4ECVA 4Q8EA 4RW4A 2RDIA 2FJVA 3KK2A 3DI6B 1JLCA 3HHKA 2J6TA 3JYTA 4WZQA 2OPPA 2ASJA 1TKXB 1S49A 2D3UA 1KLMA 4URQU 4RNFA 3GIIA 1JLEA
chains in the Genus database with same CATH superfamily
2R3VA 1U6ZA 2GMLA 2K1RA 2YKAA 3FRZA 3BBFA 4JI3J 2HRYA 1DAXA 1EETA 2MZTA 2OEKA 2RU9A 3SFUA 1LXJA 4GKJJ 1OWXA 3QNWB 1SL1A 4DPWA 4A8SA 2MZ1A 4XAKA 1S97A 1NXIA 1SB6A 3QFHA 1S9GB 3BM7A 3OSPA 3E01B 5BYRA 3BGLA 4QYZK 2B4VA 4AL7A 1NK8A 4ECXA 2EFQA 4CH7A 2B6AA 2JC1A 4NRUA 3VGSA 2C2ZB 1U2CA 3NGRA 4L76A 1BY9A 3DDIA 4RX6A 1FESA 1T3NA 4NLDA 2W7OA 4ZJLA 1F6TA 2UZAA 3QT8A 5A8KB 2PSZA 1Q78A 3ZO7A 1RSCA 1VQMS 4KO0B 3DU6A 2VG5B 1X5SA 2DCLA 2PEHA 3CJTA 1NSAA 5AXMA 3GZ7A 1IKXB 2IYGA 4WK1A 2JLFA 4BS2A 4MKVA 1TL3A 1X4FA 3BH7B 4QBUA 5DQIA 5FIIA 1N48A 4H4OB 4WFZA 2AJ2A 5CHCB 2RRNA 4NLVA 3K17A 1UETA 3ENAA 1VDHA 2CPHA 5E3RA 3MCMA 3QT5A 1UJ4A 4I64A 2C42A 3CCVS 1GMUA 2YQ3A 2CVEA 1F3VA 3BQ2A 2GFFA 2M4MA 1KFDA 3MEDB 1U26A 2DNLA 1YJTA 2FPHX 5A76A 2COLA 2VF3A 1N34J 1RAFB 4I1TA 2G1DA 1RT7A 4DFMA 4ZVTB 4TY8A 3R3TA 4QIGA 4CO2A 1HNWF 2JRSA 2BE2B 4G1QB 1N33J 2EC2A 2HBRB 3L95X 2EFNA 4C4WA 4J9NA 3T6JA 2CAJA 5KT5A 3T6BA 2F4VF 3MGJA 1GMWA 4CLFA 2HHTA 1S1TA 4OYWA 2CQ1A 3D6FB 2WBMA 5IQQA 3DHWC 2WB1D 1MROA 3MDFA 1HNZJ 3KLIA 4DV3F 4F04B 3R1HA 1D9DA 1RDRA 1UP1A 3I0SB 2RF2B 1VJQA 2APOA 2HFZA 4IDKB 2EFGA 3MOZA 4J7CA 4DEZA 4GVLA 3T5KA 3JSRA 4RNHA 2RS8A 5E3AA 2NREA 1LQ9A 4B02A 5KOXA 4M5DB 2BJEA 2XTJP 3RB0A 4Q0BA 2BABA 2R9LA 5CH7B 4DV5J 3MEGB 5HROB 2ABYA 4IG0B 1NPPA 3EDQB 4OZNA 2VV5A 1WC3A 1TUVA 2KB2A 4O23A 2CQ2A 2GIFA 5IV3A 3PR4A 1AXQA 4NYZA 2DH9A 3KLHB 3CC4S 1QVFR 1YQHA 2X1BA 3BYPA 1YVFA 4IRCA 2IAJA 2W8LA 3N6LA 3W5XA 4X64J 1EIYB 3LO3A 2BJ3A 3KHGA 1XR7A 3IS9B 3BB5A 5AE2A 3Q22A 1YTYA 3M1VB 4Y0FA 3NGDA 3C6TA 2B0GA 1WSVA 2MKSA 4R0JA 5KFQA 2HNZA 1KVKA 2W2MP 2K8GA 4UQTA 3T1AA 3VAMA 4LIRA 1QD1A 4DV6F 2R7VA 1IN0A 1KHWA 3BSCA 3OTOJ 1HBMB 3MMAB 1NM2A 2YNIA 2KRRA 2RRBA 3UNGC 2F7VA 2ZM6J 2FIUA 2VPZB 4KYZA 4NLGA 4J9VA 4B3TJ 2VPWB 2MQMA 2LQ5A 2Z2LA 1XERA 2ZBQA 3ENQA 4DR5F 1R6VA 2Q1LA 3KLEB 2GO8A 3MMCA 3R1LA 2B5JA 2FQQB 3HSDA 5A2QU 2KZZA 3BO4A 3QGGA 2V8PA 1RT2A 4MYUA 5LL6d 2QMXA 1IKVA 4DF8A 2CJYB 4X64F 3M2UA 4E2FB 2RQKA 4RU9A 3NBPA 1SC3B 2VB6A 4PQUA 3M2VB 5LJ3Y 1RCOB 5DS7A 5KT4A 1Q81T 4LF4F 1CVJA 5D3GA 1M5HA 3QLHB 3MM5B 5KT6A 3KUGA 4P74A 4PXDA 2R8HA 1HR0J 4DR6J 4HL9A 1R43A 3M8PB 4WKYA 5DDPC 4A8QA 3H4BA 3H42A 3MMJA 2HHQA 3HZGA 2FC9A 1FTRA 4FKXA 2MHEA 3H2VE 5LMNF 4IR9A 2NUHA 1XWLA 4HT5A 2XMWA 4RW6A 1YSJA 1R0AA 2BQUA 2XMUA 2W2PP 5DJBA 2CQIA 4CLSA 1PO6A 3MMBB 3IBCB 2HK2A 3HKZD 4KGKA 1HR0F 3BGRA 4DSIA 4KSEB 3OV7A 2J0WA 3KJQB 3GR0A 1HWKA 5CYMA 1OPZA 3FEYB 3NXZA 3C16B 5LMNJ 1NU4A 1M5OC 3OTCA 2NXNA 4MKAA 1T05A 3QRQA 3NAIA 1ICEB 2HZCA 1S12A 3CC2S 4LFBF 2ZHAA 1SV5A 1HD1A 1FK9B 3A4TA 3CCZA 4KV8B 1OSCA 3D0HE 5J2PB 2N3LA 2YXLA 3MTJA 4RBUA 4WYLA 5JUMA 5GAGI 4TU7A 4UY85 1FX2A 2B8PA 5C5JA 1DRZA 4P52A 1LW2B 1BQNA 4HHHA 4LF9J 2HLUA 4KGVB 1ZZFA 3CDEA 2DK2A 3A3NB 3JQKA 1PAUB 3K8WA 4DV4J 2PI4A 2DGSA 2UUTA 2WBRA 3A1YG 3WDOA 1JLFA 2DO4A 4LQ9A 4F3MA 4MKYA 2HW3A 3MECA 4LFBJ 2AIRB 2FTRA 4HDHA 5L9NA 2YWEA 3GJSB 1XNRJ 5HI7A 2N82B 4IUFA 3D68A 1Y00A 3D66A 4RR5A 1QM9A 3GFHA 5B0DA 4RLEA 1YI2S 1JLAA 3CPWR 2UXDJ 1YZ7A 1K73T 2OUGA 2ROPA 4RW8B 1X5TA 1HQ2A 1X4HA 1HL6A 2CYYA 2UUBJ 4RJVA 1BC6A 1QVGR 2VONA 3Q2TC 1WEXA 2PMWA 4K7QA 4R0EA 3MCSA 1T03B 3F56A 1NSQA 3K57A 1SJ3P 7AT1B 4FF2A 4DN0A 1EJ7L 2KJVA 1C0TA 2HQ3A 4RO0A 4JUZA 3U1LA 3PEJA 2LEBA 1M1GA 4ZKAA 4IOAQ 3R8YA 2B9WA 4WTYA 1JLEB 1ACMB 3H59A 4PWDB 3D54A 2OPSA 1S7HA 4QR2A 5C25B 1KTVA 5KFCA 1FX4A 2FYXA 1QLNA 3DOKA 3R27A 4CM0A 2MKHA 2VBYA 3H25A 4IFYB 1WG1A 2DNPA 2GJFA 2MQLA 3MWBA 1IUJA 1SJFA 2B9YA 3DMJB 4RZRA 2ZVSA 4JI4F 5HLFA 1AROP 3H2LA 4CCHA 1WJ9A 2IJFA 1RYSA 5GAHI 4QWCA 3LP1B 5F3ZA 4DL4A 2IM1A 5J2NA 1UJ6A 4LBPA 3W66A 5I3UB 1V5VA 4DR5J 4ED7A 2JEIA 2NXEA 2HGMA 4WFYA 1XC9A 5L1IA 4F7VA 1LWCA 1FFSB 1KQFB 1FWLA 2PMZD 1S1VA 2ADCA 1L3SA 1MSWD 3GR1A 3EE3A 4LRDA 1FNOA 1MN9A 5SZTA 4IRKA 1RGVA 1C2PA 2WRMA 2V34A 2ZBRA 2X3DA 1JLQA 1V6HA 1KR4A 2OFHX 2X1GA 3B4MA 3DRXA 2WAQD 4LVOP 4OJHA 3L4BC 1LFWA 1V3RA 3NGKA 2IVYA 4ZA1A 2CJXB 4ZVOB 4CO5A 4DL6A 1WOSA 5KG5A 4FYDA 5KG7A 3J80Y 3THPA 3ZZRA 5CCLA 2KFNA 1URNA 4HR2A 1SBRA 4U8YA 1FRJA 3JAMY 1N8RT 3U27A 2WOMB 5CQGA 2ZNZA 3I4PA 4L72B 3OLBA 3ISNC 2F40A 4RU2A 1F9HA 2H48B 2PDAA 5E2QA 1WWHA 3NMRA 1K0TA 3W60A 2IAJB 2E7VA 3ZNJ1 4NCBA 4Y34A 2XZWA 2E1AA 4DCJB 2DY1A 1GMWD 3FSIA 4AXIA 3OQ2A 2V94A 2LA4A 2G0CA 3PO5A 3CJKA 4DPXA 5G0RA 1C1BA 4RW4B 1HBOA 2AEJA 2FJBB 2WSFC 4PWWA 2WVCA 2XMMA 5HMYA 4UZBA 1CPZA 1SPBP 3PTWA 2CJKA 1RTHA 1R8AA 2YNFA 2KFYA 3OFFA 1HWJA 1VLOA 3J7A1 3PDNA 2CQ0A 2GJIA 3AJDA 2O01C 3ENWA 1N36F 1HPZA 2CDRB 3CDUA 2QA2A 1ZM4A 3K5MA 3MMCB 4DUYJ 3CD6S 3G96A 1NPRA 3SYZA 4P9SA 3J81U 2FLLA 2VBZA 3GIIA 1CJTB 1RAJA 3M9MB 4NXNJ 3Q24A 3TANA 3MOJB 5E5NA 4ER8A 3HJVA 3KXDA 2VQFJ 1SI9A 2P9EA 2UUAF 4RW9B 1PYOB 4UUXA 5FDLA 2OP5A 4FNHA 2HHSA 1QE1A 1N0VC 1KS2A 1XMBA 4CLUA 3DI6A 3GILA 3T1YJ 1RQ0A 2HHHJ 2R8GA 3M1VA 3C6TB 4FKYA 2E5JA 1E6YA 1HNIA 1HBNB 1X8DA 4F2RA 3N4WA 1B64A 2OMLA 5KFTA 1LK5A 2BJDA 1RP5A 3A13A 2B8QA 1W26A 2AYEA 4KGXB 2KH9A 4B3MF 1HQUB 1HMVA 2ZE2B 2C3YA 2LLZA 3LUYA 1JKHA 1FO1A 2VFTA 1HBUA 4M63A 3TW0A 1FDDA 3HI9A 1EKRA 2BJ8A 3JSMA 1YK9A 1DJ0A 3QZ7A 2BW2A 3HSZA 2JVOA 2VODA 3KLEA 3PYEA 2QG9B 1SH2A 2V4JA 2VPYB 2B5JB 3HSJA 3OUYA 3ZZUA 4NI2A 4U7CA 1PBUA 1K8AT 1RT2B 5CXTA 2LCWA 4YB5A 4DX5A 3D1QA 1U0HA 2C2NA 4WU3A 4OQJA 3NNAA 2NZ4A 1O51A 5D4OA 2GVZB 5LSLA 2YX7A 1R3NA 3BJYA 2RILA 1RT4B 5B0CA 1WC0A 1WELA 2IFXA 4MMOA 2W9BA 4DUZJ 2E5LF 4Q8FA 3ZNUA 2DRDA 2UP1A 2B9XA 2DNMA 2HBYB 1VMBA 4C0HA 2AEFA 3DM2A 4DPTA 1U25A 4TYBA 1VC0A 4JI5J 4RW6B 4ECZA 3ULHA 4QPXA 5CZVA 1FRHA 2W01A 3CDAA 3D6HB 2Y3YA 3VV2B 2DGOA 4EEYA 1LEOA 2C3UA 4P71A 3G82B 4HDGA 3NGTA 1JLGA 2MQOA 1SKWA 2LMIA 2ALYB 3P5BP 4JI7F 2W2NP 1Y5NB 3OXLA 4ZP6A 4DMZA 1NK4A 3W5ZA 4IQMA 2W9AA 2HVEA 2JC0A 5B08A 2MGZB 1B7FA 4ZHRB 2VC1A 2H5JB 3R7SB 3EX7B 1EP4B 4QYZJ 1P9QC 1RJJA 4A47A 5BYSA 1G6BA 2AZ3A 4MYTA 3PHEA 3M7VA 3CDWA 5DM7Q 3MURP 1RHMB 3HXMA 1F5BA 2UV8G 2PFDA 1WF2A 1RHQB 1EHWA 3EICA 4C6AA 3IR5B 1Q0NA 3EGVA 1LW2A 4PWDA 3RW7A 4Q2MA 2QIFA 1KVJA 4EO8A 3BGUA 3V4IB 4Q45A 4YN3B 3KHHA 4DLGA 4NA2A 1JJCB 1JXLA 1BWVA 2AJFE 5EWGA 2QV6A 3MXHP 2W2OP 1RWVB 3GFXA 2KN4A 4ZVFA 4NCGA 2OPPB 1R8BA 1ZS6A 3Q86A 4WWSA 3SSSA 4Y3CA 1RABB 2WVFA 2BJ1A 4ZVQB 2UV8A 1VS3A 2HYIB 2AJ1A 2PA8D 4USJC 2EFPA 1VBYA 2K1RB 5HN0A 4HKQA 1BUXA 1J27A 1FJCA 1DTQB 2J9CA 2JHEA 2AT1B 4U8VA 4OZ2A 1P9YA 3EZ5A 5EGYA 2QN6B 2QSFA 3IRXA 3UVJB 5F8IA 1HNZF 2RE1A 3O1LA 4HI2A 4Y6IA 1WNEA 4X62J 3R2DJ 4JB8B 4FVMA 1OQ3A 1AT1B 1DLOB 1H2VZ 1PJ7A 2DJWA 4CYUB 5C25A 1NJWA 1GH8A 9RUBA 1TL7B 2DEJA 4RNMA 5EDWA 4B9SA 1UA0A 2XB2D 2MYFA 3IWXA 2F8MA 3R5BA 2I6WA 1HW9A 7FDRA 2MMYA 3M32A 4IFYA 2DEIA 1LV5A 3PX4A 4CLPA 2N4DA 2NQPA 2CADA 1UWBB 3H0PA 4NLWA 4C48A 4KO0A 2B56A 5K8NA 5KT3A 3J7AN 1KVIA 2AHOB 2RS2A 1YBUA 4QIVA 4X62F 3C14A 2BQ3A 1VRUA 3G2XA 2KO1A 5E3CA 4DQSA 2XY7A 2G4BA 1OYEA 3IGNA 2YPYA 1X0PA 2HMIA 3UPFA 4U9RA 3VAGA 3MM8B 4HACA 3CMES 2HQIA 1RBLA 4X4UA 4N47A 5H9EK 3ILLA 1S99A 2Z56B 4N7TA 2CIMA 2VBWA 4HHUA 3K5OA 4J37A 4YB6A 4CLTA 3RAQA 3GB0A 3NP5A 5HVGA 4OLPA 2RRAA 2DR7A 3E01A 4Q44A 2KL8A 2IPOB 4JI4J 2V5HG 2E5LJ 3S1TA 3VAFA 1TAQA 1RHRB 4AFFA 1RTIA 2HLTA 2ZH8A 4EZ9A 2KZMA 4TY8B 5LXRA 5CCMA 3Q23A 4IG3A 2LXFA 4USHA 1MWZA 2F3JA 1CJTA 1Q8IA 3IG1B 4USTA 4ZITA 3FQLA 2YNHB 2KXNB 3NOGA 2HS0A 1X9WA 3JQMA 1Z4UA 2Y8WA 1XBWA 4DR3J 2VOOA 2OD6A 2E5HA 2Y8YA 4K4UA 4BDPA 2HNYB 3UCGA 2C3PA 4DV3J 4NXMJ 5F0WA 1S1XA 3DLEA 2MQQA 3AD9C 3I0SA 1OY9A 3BSNA 3LPEA 2BR0A 4N8NA 1XR5A 4C8NA 2UUCF 4Q8EA 4RW4A 1HBOB 4V19J 2ZHOA 5BJRA 3TA1A 4C8KA 4F02A 2FJVA 3KK2A 4LR9A 4M5DA 3HMJG 4DSKA 2BM1A 1FWKA 2ZOFA 3NCPA 2ASJA 4NE9C 4WIQA 4WKRA 2W1BA 4URQU 3CCSS 3VAKA 2KXFA 3I6PA 1ZOTA 3BYRA 1TU0B 2E44A 2XO7A 1NK9A 2RNEA 2UXCF 5KFFA 3EWGA 1P8GA 1S0NA 1VQSA 2DB1A 2EPIA 4O4RA 3W2WA 3QWUA 2UXDF 1BMQB 1JQGA 4DR1F 4F4YA 4JV2A 1MWQA 3CCJS 3GJQB 2QL5B 1T3OA 2MZJA 4M5MA 2XMVA 3QBCA 3CCQS 3L9ZA 5A8WB 1UEVA 5ADZA 3I4HX 2V9KA 4UQGA 3KK1A 1WKJA 3TX0A 2JLGA 1B99A 2HVHA 2EI5A 2Y0SD 3DGPB 1NJXA 3HD2A 2NPFA 3C6UB 3VGVA 1S1UB 1IBMJ 1R6YA 2L48A 3KTQA 3K5LA 4F3OA 3T5HA 5K8OA 2GVDA 2ATCB 2WHOA 2XGQA 3HULA 3TARA 3IM8A 3KJVA 4BHQA 3JSMB 1RAAB 1KWMA 3GCXP 3W62A 1X4BA 1A6LA 1IR2A 3E51A 3MM7A 2AU0A 3TRGA 1OSDA 4IR1A 4K5SA 2K06A 2PT0A 4OI1A 2J6UA 4FXDA 3R5AA 2MGZA 2RDJA 3RB6A 1JJHA 2KYXA 3EVMA 5KFMA 1SL2A 1CC7A 4ZLNA 3CUNA 4USUA 4DR6F 2ZH6A 4LF4J 5I42A 1HWUA 5C24B 3VCDA 3DLKB 5HMZA 3HF5A 3V6DB 4ECWA 1N4LA 3MPYA 4P10A 4A8FA 4C2MA 4R5PA 2O1PA 3O3LA 3UDCA 3UN5A 3J7YI 5ETPA 3VAJA 2AQ4A 2H4YB 3HHDA 1FKAF 2OPRA 3J81Y 3W2VB 4OL8A 1K1QA 4X4PA 4OYPA 3BO3A 2BXJA 2ZUAA 2HNDA 4QOTA 1UWAA 3G86A 4RBTA 2CZ4A 1S10A 2JEFA 1N33F 1NHVA 1UEUA 2RT3A 3EPIA 2OJ3A 3OL7A 2R7TA 4MAKA 2MEWA 2XNRA 1MLAA 2DNOA 2W2QP 1FRMA 2I9SA 4DBQA 4OYIA 1SL0A 2Y1LB 3T9ZA 3DLGB 3ZTQA 4GKJF 4K0KJ 1P1TA 6FDRA 1NDKA 2GAGC 2HQDA 3E8OA 4WFBQ 1N56A 2EVZA 3KDNA 4KFBA 1FE4A 5KFUA 4L3NA 3D28A 2J5AA 2W4DA 4FXVA 1IKVB 1LWEA 3HHEA 3R7NB 4GKKF 4KC5A 2R7QA 1U45A 3SBMA 1OY6A 1GT8A 3T5JA 2FVRA 3OR2B 2IDEA 4IOBA 2Y0BB 1TKDA 2V67A 3PR5B 3TVYA 4M5JA 5L38A 5IT9U 4WZQA 3VGUA 4DV5F 2AYBA 2JEGA 2FHJA 2OIHA 4RBVA 3MR5A 5AXKA 5CD4H 5DG7A 4U7UD 2HK3A 4RNNA 4QU7A 3OXGA 2DIUA 3PCOB 1Q82T 2OEMA 3U1NA 3ZZZA 3GYNA 1FI4A 3ILIA 4DV1J 2Z8QA 1IKWA 4Y2AA 4DV2F 1S76D 1Q16B 2I2YA 2WSCC 2WB4A 2YWFA 1C1CA 1IKYB 4KTQA 1RKJA 2ZJQQ 4OV1A 1X4DA 4OYXA 2WVDA 5LMUJ 2NR0A 2LKZA 1RWNB 3GSIA 4ILMA 4KAIA 1WHXA 4X65F 4ZK7M 3SZ2A 1T9YA 4RW8A 2XEXA 4ZCMA 1NH8A 3P5TL 3K5PA 2MLZA 3I0RA 4CLYA 2BYCA 3GIRA 2ATLA 3KLFA 1UPPA 1HW8A 2D7SA 2NUUG 4KIAA 4UF4A 1UAWA 1NNDA 3MCOA 4Q7AA 5HQ8A 4RPFA 3ZFVA 4TU9A 4J9LA 3B6BA 2DR6A 2V68A 1O5JA 3FGVA 4BLGA 3I55S 4DR4J 1EQ0A 1MU2A 2ZD1B 2JDJA 4IRDA 3PACA 2DITA 2VA3A 1ZM3A 4OI3A 4DLEA 4EMDA 1VFJA 2H4WB 4W98A 4YHHJ 3PW2A 2KT3A 2MSSA 8RUCA 3FK4A 2ZEJA 1EARA 2AYGA 4CP5A 1U0SA 1FT8A 1A0OB 3DMJA 1AZSB 4CQ1A 3DOMA 4KR0B 4WTOB 4ED6A 3I9V9 3IG1A 4LSLB 5CYQA 1H74A 2ACYA 3TAMA 5D0HA 1FKOB 2W9CA 4ZDNA 1HHQA 1UZHA 3QATA 1ZM9A 2HVZA 1DHMA 1NBEB 4MFBB 1N88A 3WIUA 3AOBA 2B51A 5L39A 3CC7S 2PD1A 1I1GA 1ZM2A 5C2GA 4A4JA 4N5SA 5IWAJ 2VQFF 2IY5B 4PG8A 3Q8RB 1L3UA 4H4MB 4LRCA 2L3MA 4DX8H 4K2XA 1UPMB 1YLXA 2QYGA 2W25A 3JQJA 5D6GA 4AT1B 5F8MA 3MPUB 5M2RA 4Q43A 2UU9J 4GC6A 3QYYA 3PKMA 2MKKA 3MF5A 4YFUA 4JI6F 3MAHA 3M9OB 3DYAB 3H40A 2HAFA 2QSWA 2BVZA 2OTLS 3N5FA 1CQNA 4ITSA 3FBFA 2OD4A 1TELA 3HKWA 2C3MA 1HWLA 3AD7C 2CWKA 3KNGA 3Q89A 2DPIA 1CULB 4OJGA 3BPSP 1WHWA 3RYLA 1RE1B 4WP9A 4J9UE 5DLGA 4DN9A 2Q66A 2DBBA 3W8PA 5KFBA 2F4FA 4OJ3A 3IXQA 1SUQB 4OX7A 2XYHB 1H73A 1BQXA 2R7RA 1NK6A 1MG7A 4AYBD 3KLIB 1ZZNA 3KK3B 1WF0A 1D8YA 1U1NA 2CA9A 3TVZA 2ZC4A 2JSXA 3TJ9A 4USIA 2VOPA 3AQPA 1TV6A 1UVKA 2BM0A 1C1BB 2DNQA 3M6UA 5T14A 2M0GB 2YQ1A 3HD1A 3IR6B 4LUBA 5D4LA 5J1NA 1Q5YA 1PJ5A 4OIXA 4OHVA 3W61A 1NSKL 1RT5A 3GE9A 3FSXA 3UN2A 2J0XA 4ES1A 2ZJRQ 2VJUA 2N7YA 2XBPA 3ILJA 2XS7A 4QW9A 1U1QA 2DR5A 2ERRA 3UN3A 4ED8A 3KJNB 2XWYA 3LQVA 3NWGA 4ZCKA 1VBZA 1VYAA 1YX2A 2EK6A 2FZCB 4N8OA 2XHWA 4BC7A 3AB4B 1IM6A 1FCAA 4EGLA 3AHPA 5KFJA 2HFNA 3NS5A 2CPIA 3RBXA 5KFDA 1Y7PA 1XEZA 2GX8A 3CEDA 1VK8A 3H90A 4KQZA 1RT1B 3GG1A 3W2WB 3UD4P 1TVRB 3CMAS 4EZ6A 2Y9HA 1T9TA 3KDOA 2CQ3A 3SQGB 5C24A 2B4OA 2HVIA 2VDIA 3VALA 2LFVA 4FXWA 2JJ4D 2LU1A 3RGIA 3D0GE 3CCWA 2RH3A 2UVWA 4LF5F 2PGCA 1WEYA 3THVA 1IM4A 1HHSA 5GMEA 4XPCA 1RBAA 1XJWB 4WFXA 2FJAB 3PW5A 4TNOA 4OZLA 3BSOA 1X31C 1OO0B 1XK8A 1HQUA 2NSCA 2O67A 3H2UB 4MIAA 2YNFB 2ZE2A 1FXDA 4G65A 3R9LA 5DO2A 2ZKTA 3DXBA 5HJXA 2DXFA 1K9MT 1ZA1B 5JXSA 1HPZB 2X7IA 1VQPS 2DYAA 3OBIA 1NB7A 4EK2A 3VF0B 4DFKA 5HAOA 4ZS6A 4KFBB 1I5OB 1TKZA 1QUVA 1R7IA 2VH7A 5L9XA 1M0SA 2ZH3A 3B54A 5L1LA 4J9QA 1JB0C 2ZZMA 1S79A 2DT9A 1BD6A 2GA7A 2J76E 2VG7A 2QLWA 3C19A 1Y3JA 2EK1A 4DG1A 1NHUA 3SCIE 5IM0A 2J7KA 1SQEA 1WDDA 1VQ8S 3UR3C 4DV1F 2NPIA 3W5YA 2XI2A 1KQKA 4B3MJ 2WK4A 5KFZA 2AWZA 3G6YA 3OR1A 2M8DB 1EKSA 3CGIA 1ELOA 1SXLA 3UW1A 2B7CB 1RACB 3W2VA 4KH0B 4ZN3A 3L7OA 3RB4A 2ADBA 2DPJA 2XYGB 4ELTA 3DDNA 1RU1A 4N77A 4ZPWR 4DS4A 3AOAA 3LANA 3CNQP 3MM9B 4YR0A 2DR9A 3MM6B 2HWTA 4M5HA 4Z7YA 2A0FB 1FVQA 1B0TA 1PBAA 1S9EA 4WP8A 3MUVP 2PMHA 2LYVA 3O2IA 4JI3F 2HZAA 1JLBA 4L75A 4I2PA 5HP1B 2FZKB 3S8SA 1D9FA 2VICA 4O0IA 2A2CA 4WP3A 1CJUA 1XMOJ 1IBKF 2VPXB 1FK9A 3BDEA 4PRFA 4ETZA 5J2PA 1LWEB 1M1KT 4B3OA 1JK9B 1S4EA 2C2OB 5A6WA 2IM2A 5LSRA 2J8AA 3BPDA 4ECUA 2ZDPA 4AQYF 5F0UA 2RUSA 3DRYA 3R7BB 4D3GA 5A8RB 3HPOA 3F41A 1J5EF 3GCWP 2UXBJ 2HHPA 2V8DA 3HDSA 4NLTA 1DTTA 2Q6CA 4DPOA 3LF0A 3M2RB 4YY3F 3H98A 3PYGA 4M5IA 4AL6A 2G2YA 2NXJA 3QQCD 5HL7Q 2ZH9A 2IA6A 1NO8A 1KRPA 1WEZA 2AKWB 4IKAA 5J2QA 3NMAA 4UOHA 2XGPA 2KU7A 3TQEA 4PKDB 4WYWA 3T1HJ 4ANEA 5C42B 1PILA 1SJ4P 4WZMA 2V2KA 1XN9A 2F9DA 3L09A 3N5BA 4LIWA 2H54B 1HNVA 3SCLE 3U1MA 5GAHU 4MIBA 1GEHA 2KI2A 4I4BA 2IM0A 2MQNA 2EC0A 1RTJA 1KN6A 4I6WA 3TO8A 1HD0A 3A3PB 3QPIA 4ILLA 4UW2A 2E9RX 5HMXA 1RWMB 1IJFB 3CO9A 1C0TB 4NZ6A 2IDLA 4FF3A 2LEAA 1Y11A 3CE8A 1LOUA 2IBOA 2L9NA 2QL7B 2DD8S 2D69A 3JTOA 3GP9A 3POTA 4H4MA 5J1PA 1M5VC 3B78A 2RJZA 3TEHB 3SFGA 2HZVA 3TZYA 4A8WA 1JLCB 2WW4A 3TZZA 3DXSX 2YH1A 2IC3B 3ADAC 2RQCA 1VQ7S 1VQ4S 2DHAA 2FHJD 2H1YA 2UUWA 3M8WA 5AT1B 2GHPA 3H7HB 4D3HA 1PAEX 4ALZA 1EQMA 4S0MA 1HLWA 2K3IA 4Z2XA 2MXYA 3TJ8A 2R7WA 1RAEB 2HQGA 3RR8A 5DLFA 5KFLA 4KHPJ 2W7PA 2WCXA 1L3KA 2OFGX 1R0BG 3MR3A 1VQ9S 4Y00A 1VRTB 2RHQB 3OJSA 3EYZA 4P75A 1RI7A 2DNNA 1XMQF 2G9OA 1SUQA 2OH2A 2YQ0A 6FD1A 4W92B 4CO1A 6AT1B 1F3FA 4NEYA 4FS2A 2ZZTA 3FRYA 2AJ4A 3SIPB 3C3LA 3R2CJ 5EWEA 3W3SA 2R7OA 5DETA 4CWBA 3BSAA 3NRBA 2QL9B 3M30B 4KH1B 5E0OA 4HHJA 1JJ2R 2FHKA 3GJTB 4DFPA 1FERA 4V19X 1GXLA 4OX9J 2OPQA 2BE9B 1YJWS 1X5OA 2L9WA 3QT7A 2MLYA 5J2MA 3WIVA 1QAJA 4K4ZA 4ZCIA 3FFIB 4WK3A 2QA1A 3V6HA 2HEKA 3PHTA 1L3TA 2XC9A 3W63A 4EO6A 1U48A 1M90T 2QA4G 1CS4A 1YJVA 3LA0A 4ED0A 4TXSA 5ETLA 1LNQA 1JIHA 2R7UA 1AFJA 3SCJE 4KKOA 4JI8F 2BANB 3FZBA 2B9EA 2ZHBA 5H9FK 1UWBA 2IIHA 5DG9A 1N6QA 1P1LA 4TU8A 1M5PC 1A9NB 4QQBA 4FYWB 4K59A 3SQGA 5F8JA 1R8CA 1VGYA 2I1RA 3I32A 2PFFB 5FLXY 5KOWA 2MQ8A 3MR7A 1CSJA 1F2HA 2FJWA 2LQBA 2JOQA 2OGUA 3LP2B 1Y0HA 4L6V3 3SXLA 2BQRA 2ZUGA 1ZTTA 2HNZB 1FF2A 2HGLA 2GNKA 4ZIVA 2XS2A 2RF2A 1AYEA 4YQWA 5JVGQ 5DQHA 2CPDA 2ZOMA 4YB7A 2XSFA 4CT9A 4YS2A 4C11A 3BS9A 2KXHA 2Z58B 2CFXA 4HTJA 4P72A 3CTRA 4RUHA 5F9NA 4P2SA 1TK0A 4R8UA 3HVTB 4LSNB 2FVSA 1F60B 2QLXA 5H9FJ 5M2UA 3GWCA 3CJ8A 4J9KA 1VQOS 1T0TV 1KKHA 3CIZA 5D0RA 3ZZ0A 5KFGA 1QTNB 1X4AA 1QE1B 1R0CB 4EI2A 2M5YA 5GADI 1MW7A 1AUSL 3M2UB 4MK8A 4TKTA 3NBPB 4FNIA 4DSFA 3DRSA 1PYTA 5AE3A 4F0HA 5KFXA 5DDQC 2VIHA 5L46A 2U2FA 1IWAA 2V4QA 5ETOA 4K4VA 3PRBA 4FS1A 4EUVA 3SSRA 4MT1A 2FGCA 4H4KC 3M8PA 4KPCA 3R5DA 1L5UA 3PYFA 4C3LA 4F8RA 3NCQA 2CXEA 1Q86T 1NZAA 5GMKa 2VQEF 3MUTP 4KPYA 4GC7A 3V81A 1NDCA 3AFGA 4Y28C 3HVRA 3WZ0A 2Y1RI 3GG0A 4ZVUB 2XLJA 1HBMA 1X4CA 3TOQA 4ECTA 1NJZA 2CPFA 3CDBA 1S6PB 2FHMA 1NZ8A 3BKFA 1U8SA 2AGQA 4OHXA 3ETOA 1XQIA 3UDEA 3SDEB 2YTCA 3QIPA 1ZAVA 4XIUA 2WZ1A 2UVRA 4I2PB 5HP1A 8ATCB 2DNRA 4Y2IA 1KEKA 4LJMA 3GU0A 1L3VA 2ZBIA 5F41A 3BH6B 4I56A 3C16A 1S1WA 5A0YA 3TNVA 4PYAA 1N5SA 4J9PA 1XMOF 3KFWX 3TVKA 3I82A 4FDFA 2MZQA 3LPYA 2PA3A 2C2EA 1VR6A 5HBMA 3FKBA 3UI3A 4KT0C 4AD6A 1HFEL 3PIPQ 1C0UB 1SKRA 2NCKL 3ENVA 4CI0B 1URRA 4R5PB 2I0XA 3ET6B 3VTIA 1U2FA 2XI3A 2MKIA 1IBLJ 1RA6A 4ZN1A 3VHQA 1EAYC 4CO3A 4ES2A 5L1JA 5ETQA 4LMZA 2DH7A 3IFEA 5IXUA 3SCKE 1PKUA 5K5MA 4HTIA 1C4CA 4NYPA 1B4SA 2D9OA 4CTAA 1XNQF 1NCLA 2KVQE 2GVDB 2K3KA 4C7QA 9ATCB 2QFJA 2RUGA 4OZ5A 4J9SA 1S0MA 2IVMA 3AJ1A 3I96A 4ETXA 5B0FA 4LQ3A 1UVJA 2M9KA 3LWMA 1Q95G 1YRUA 1O6XA 4Q2LA 3UFCX 2DKOB 3F0NA 4P73A 4QWBA 1RB0A 4DX7A 3CCMS 4ECVA 5H9EJ 2RB7A 2ZZNA 3DGVA 4ZPTR 2RDIA 2LP4A 2YPZA 4OX9F 1QJHA 1JLCA 2E1CA 5E41A 4A46A 1FEHA 1TKXB 2W24A 2D3UA 2JFDA 1KLMA 3Q8UA 2CPYA 4FZVA 4RUBA 1JLEA 3CCRS 1NJIT 4DUZF 4UT4A 1H2TZ 2AYMA 2KYZA 1F1BB 4DQIA 3CJ3A 1IKWB 3X3UA 2N3OA 3EDRB 1C1CB 4ZLPA 2LECA 1DFDA 1RAIB 3PYDA 4I69A 3ZZOA 1RU2A 2VC0A 1HNVB 5HANA 3MR2A 1GXUA 2VBXA 3VZHA 2CQGA 3DRRA 1VBXA 4P7TA 2XULA 3CXCR 1TQLA 2G0IA 2V8GA 3WC2A 4QCLA 4DCOB 2GV1A 2CRLA 3W9JA 5IS2A 2X3GA 1TP7A 1VQNS 4HT7A 4P7VA 5ITHA 2RKIB 2ZNYA 4PUOB 2G0JA 2CNKB 4X4RA 5IQ6A 3QZ8A 4DSEA 1KD1T 3CB4A 2J0QD 1N5QA 2Q3PA 4C8ZA 5KFRA 4ERDA 1TL7A 1APSA 3RU0A 1LWFA 3H20A 4F0MA 5C7PA 1VQ6S 4KE5A 1NK0A 2F65A 4C98A 4TQSA 3M32B 5HK4A 1V5IB 4ELUA 2Z2ZA 4XPEA 3MD1A 3MCNA 3W9IA 3LTOA 2NLWA 4ZVRB 3W1YC 2C28A 2ASLA 1IKYA 2DISA 1X9MA 1UFKA 3DOLB 2NYHA 1F2GA 3F44A 1S0VA 1T02A 2ZOGA 5E3QA 1FKPA 3AOCA 4OX6A 3G87A 5KFYA 1FDAA 1PGZA 3Q8QB 1U1MA 3LP0A 1GNKA 2RIJA 3DHXA 3HX9A 3MD3A 2VHGA 2PI5A 1NDPA 4EBEA 5GAEU 1RISA 3Q8YA 5HJYA 4ID5A 4MK9A 1LWCB 1NK7A 3HZEA 3J80U 2UU9F 1VIOA 2JZ5A 1S0OA 1WI6A 2EG2A 4NA1A 1KQSR 2C2RA 3C15A 4IG0A 1JLQB 1G4CA 2HFSA 3EM1A 3SEOA 4IQXA 1UVLA 2KT5A 5MLCV 1Q1KA 4JYAF 1SH3A 5KTQA 2GGPB 1KOOA 4BWMA 3BQ1A 4DV4F 1LW0B 1DARA 2D74B 1S6QB 2P8IA 2B7BB 2HAIA 2EW9A 2HPUA 4PG6A 4PWUA 4BWJA 4EU0A 1TL1A 3Q0AA 2I5JA 4UY8T 3FUYA 4F4AA 4PPZA 2GHVC 3DLHA 3CSKA 3DOMB 3M8RA 4JV5J 3VAHA 1U24A 4V1Ak 4ZVHA 2V2ZA 1GFWB 4B08A 4JI2J 1VK3A 1VLYA 3DLEB 3KK3A 3DRSB 2FJDB 2QGFB 4B17A 3J7ZT 4LF6F 5FDLB 2D3ZA 2P5VA 4ANCA 5FLXU 2FLNA 4DS5A 2RD5C 4CH0S 2DR8A 1Q7LB 3A3OB 3GPAA 4QR1A 3W65A 1FDNA 2NS1B 4CT8A 4Q5VA 3MZIA 1ULRA 4LF2A 3LWLA 1E6YB 1HBNA 3OL8A 2EKYA 1JXEA 1ROFA 1I51B 3MPVA 2ZVIA 1RAGB 3D6MB 3UD3P 3B82A 3QAEA 4O4GB 2VFUA 5F3TA 1W7WA 2R2UA 8AT1B 1YDLA 2X1FA 2OSQA 1H0HB 4R8UB 2R7SA 2YKNA 4J5OA 2EBGA 1SIWB 3OTEA 3C2PA 3KLHA 3D1OA 2H51B 3ZTRA 4A8YA 1RA7A 4LBIA 4CIOA 1REVB 2JFKA 5LXYA 3N6NA 3CJ0A 3GV7B 5AJ3J 1UVMA 3NGSA 3U02A 1T9UA 3KHRA 1RT6A 4PXEA 5KG1A 4XDDA 2BRLA 3US5A 5IOLA 3PRDA 1N32J 3CULA 1HQEB 1T9VA 3CT9A 4URSA 3IBWA 1RT4A 1Z2LA 2E1MC 3O6QA 1JJ4A 1SJ1A 5K9FA 3PJ9A 1N34F 4ED5A 2ZH7A 2FB0A 1TV6B 1LXNA 2XYPB 3OFGA 1VOMA 4X4QA 2R8KA 1O8BA 4WPAA 4C3KA 1IR1A 5D4PA 3TUJC 3KJVB 5KT2A 5KFSA 2HG4A 2NYIA 2HHHF 1YKWA 2YNIB 1YJ7A 2A6OA 2XMAA 2B4UA 1S77D 2KDOA 1N32F 2YKPA 5CAAA 2DGTA 4USKA 1HBUB 4F4WA 5U47A 4C3MA 3DRPA 2DGWA 5IT4A 4X66F 2UVVA 2DHGA 4F3QA 3BDPA 1ITPA 2GQQA 5JVHQ 5IWAF 2J0SD 4F36A 1ZPVA 4OZJA 1SV5B 4H4KA 5HVHA 2ZC3A 4EWTA 2V63A 4K4TA 2HRTA 3IM9A 4OYAA 4MJKA 3RW6A 2FUG9 2OPRB 3QLHA 1EB0A 5ETNA 2GVZA 1RKIA 5JJBA 5K8PA 3PKYA 2VUGA 4MK7A 2QEXS 2HNDB 3KJFB 1ZYQA 3OTDA 1AB8A 3QIDA 4HLBA 1U7LA 5DZ6A 4LFCJ 3OHAA 2EKNA 5EWFA 1TTHB 3CCLS 4JI0J 1KONA 1RADB 4N56A 3H4DA 4FBUA 2O5DA 3D5MA 2DGXA 2IRYA 3FMBA 2EG1A 3HVWA 4NCAA 2XY5A 2ROGA 3V4IA 2AP6A 4CM2A 4L73A 4ZP9A 4QW8A 1BQMB 1U02A 1S9FA 2FY1A 3QJPA 3J7Z5 3G4SS 4QIWD 1JLBB 4CLKA 4DV0J 4TLRA 2V2QA 3A8EA 4P6QA 3OR2A 5CYMB 4K8RA 3G8QA 1Y3KA 3VQTA 4QZVB 3Q8PB 5C2CA 4LF8F 1MN7A 1MMNA 2CQBA 4B3OB 1MMDA 2DXEA 1SIZA 2M3DA 1KNZA 4PG5A 3E2EA 1M5SA 3GFYA 5HVFA 5KG4A 1FRKA 5ETKA 1HARA 2GIRA 5L1KA 3VAIA 3HK2A 1DTQA 2CQPA 2P9CA 3PEHA 4DR2J 5HMWA 1VQYA 2WONA 4HH1A 3ELHA 2B6AB 4YY3J 4M1KA 2PE8A 3CF5Q 2KG1A 3PW4A 3OR1B 2IMOA 2MSTA 2MPUA 3NGUA 4OJ1A 3KMQA 3C46A 4I68A 4QR0A 3FVYA 4U67Q 5E3PA 2R2TA 1SJQA 3JSYA 1N0UA 2XO6A 5THWA 1QAXA 5K14B 5F8NA 5BYQA 3R6LB 4LR8A 3P96A 4UUWA 1CQMA 1GTHA 2BMBA 5C42A 4ANDA 3VR1A 3MR6A 4ZJOA 1PJ6A 1T11A 1VC5A 1QAYA 1TUGB 4EYHB 1X5PA 4RWXA 4YEAA 4EBDA 3RBZA 7FD1A 5G4DA 1VIXA 2KFZA 1K0VA 3DOLA 5J2NB 2GMHA 4OYBA 1TL3B 2DNZA 5KAKA 1RZMA 1RTJB 1K44A 3QMQA 4EYIB 3PW7A 3IN5A 3OL9A 2HBZB 1WORA 1DY3A 3TQ1A 3AJ2A 3ISND 1ZTWA 1S1VB 1E6VB 1VHFA 2K7JA 3C14B 3LP0B 4O3QA 3CCUS 4F4XA 3R5CA 4F0KA 2VD3A 3PZPA 3GQCA 4JI8J 2DGUA 3QGHA 2CQDA 5IV4A 2JEJA 4Y65A 2IA0A 3OTOF 4QWDA 4TY9A 2ZKUA 2IC3A 1QDUB 2QJ3A 3D3BJ 2J6SA 2UUCJ 1LWXA 2LXUA 2RVJA 3C15B 3I9ZA 3IRXB 3UVJA 1YGYA 3CD5A 5B0BA 3H5UA 3DN9A 2H5IB 2OPSB 1SKUB 3PW0A 1SQFA 2IHR1 1F9FA 4YMEA 5A8KA 4K4SA 1N5TA 1LW0A 1DLOA 1RTIB 1TL4A 2ASYA 2CVIA 1FD2A 2YBVA 3IAM9 3JTPA 4DQRA 1U1PA 1S1TB 1P27B 1V3SA 1RCXB 1RWOB 2VG5A 1F5CA 2QLBB 2CQCA 1WI8A 4IG3B 1MWYA 2BA9A 4KRWA 4DV2J 3M4XA 5RUBA 1NK5A 3TUZC 3UR0A 2DGVA 2XSJB 3JB9k 3JTNA 2F8EX 2OHDA 4WFAQ 2AW0A 3T19A 4L74A 5KFHA 4K5RA 3HO1A 3FBBA 3T9NA 3M6WA 2B43A 2MKYA 4QJVA 3ICLA 4JP8A 5D78A 5GMDA 2BJ9A 4A8XA 3RRGA 1F9EB 4DL5A 2QC3A 4C0BA 1RTHB 1IR0A 4ID5B 3O44A 5EX3A 4JI2F 2BE7D 1RWWB 1W2IA 4YDDB 1Y5LB 3MEDA 4KHRA 2C3OA 3MEGA 4PR6A 1JX4A 4LF7J 4USMA 1V3ZA 3UD5A 1RT7B 3FC9A 2FDNA 3GIKA 3BO2A 3DKDA 3V6KA 4ECSA 3KK2B 3PO4A 3B8HA 3PJWA 4ZPCA 4ES3A 4X4TA 4NLXA 1YJRA 3CJ5A 1PC4A 4RKUC 2XZDB 1S6QA 3WX8A 5I4MA 4ZVGA 3TZXA 1NKCA 1FJGJ 2I5JB 4YHHF 1VRTA 4KKOB 2FVQA 4DJBA 1DZ5A 2V8HA 3PY8A 3FDSA 3GTYX 4ZVPB 3FBEA 4DPYA 1RWPB 3N6MA 5HATA 3T1YF 2CNOB 1XR6A 3M8QA 2YNHA 1NMEB 4C8MA 1WG5A 3F73A 1I6JA 1QSYA 3MPWA 1HNIB 2XLKA 4IDKA 3ZC4A 2Q43A 3EJMA 4B9TA 3MEEB 1RYRA 2F1FA 1HMVB 2ILYA 2YNGA 1B70B 1WKLA 2OSRA 5DDRC 2BKPA 2LXIA 2DNKA 2CZ9A 3LW5C 2PO4A 3ZTPA 5HQLA 4MIWA 1S59A 3H8YA 1RK8A 3M6VA 4C11B 4QIFA 1N5VA 4NZ0A 2RSQA 4ZCLA 1WC1A 3HVTA 2AGPA 4DSJA 3G6VA 2V0NA 3QWPA 2XCPA 1DQ9A 4ZP7A 3TJAA 1G1XA 3SV4A 1RT1A 4PQUB 3FCWA 5H1SV 3HHLD 3MI7X 3IRWP 4DL7A 1KTQA 2WW8A 2FZGB 5D3GB 3MM5A 3TEGA 1U1LA 2GO9A 2O66A 5F8LA 4LFCF 2YWWA 1NPKA 4WE1B 4TLQA 4F26A 1H3DA 4JV1A 5KFWA 3ITHA 1HYSA 4CH1A 3ZZPA 1NRKA 3CCES 1J5OA 2HIYA 2QT7A 5T41A 3UDLA 3K58A 3GYXB 1CJVA 2MDAA 2NSBA 5KFEA 3AH6A 2AZ1A 5D8HB 1X4GA 3EGZA 1PSDA 3OXFA 1RAOA 4NLOA 2P6TA 4YP3A 3KK1B 4FN5A 4JYAJ 2HHWA 1VRQC 2P9GA 2ZFHA 3Q83A 1N5YA 1UJ5A 2KJWA 3G82A 3N9UC 4PEOA 1RUSA 3C6UA 1YJNS 1Q8KA 1S57A 1SQGA 5DM6Q 1JKHB 2GS8A 5DGBA 5ETVA 3K5NA 1HKAA 1W25A 2HKEA 1FXRA 4LSNA 4A8MP 2V6AA 1R27B 1U2RA 1CJKB 4GO7X 3UE2A 3RZAA 4IOCQ 3QGIA 3N01A 1RAHB 2AX0A 3WQPA 4HEA9 2GHWA 3I5AA 4BC9A 2OKQA 3GLJA 4YDXA 4M5GA 5B0EA 3WHIA 1DQ8A 2E7WA 3QSIA 4OI6A 1RXOB 2CJQA 3H5YA 1IQZA 5HBMB 5KFPA 5F9LA 3UQSA 1SC1B 3PVXA 4MKBA 1HNXF 2P2CB 4W90B 3MEKA 1UW4A 4GVBA 3FZ2A 1D1UA 2GMJA 4PABA 1D8ZA 4UZCA 1RTZA 5DQGA 2YWHA 2BRKA 3MECB 3MAAA 4PG4A 2HSEB 1VI7A 2HWIA 3K7RA 4IH5A 4B3TF 4NLSA 2MTLA 5KFVA 2LEPA 1P6TA 3V81B 2FVPA 2EXUA 3IBFB 2FJEB 2OO4A 4M5LA 4CTAB 4X65J 1YIJS 4F4KA 1MNEA 3D2WA 3RB3A 3TUIC 2AD9A 2VL1A 2U1AA 3QGPA 5I3QA 5EHHA 2ZJPQ 2HS4A 3I5CA 4OLOA 1M1HA 2DHHA 4DCPB 2Z2YB 2GCFA 4NLQA 3BGFA 2MLXA 4WCEQ 1C4AA 2MZSA 2BUNA 3BR8A 2ZH2A 1EX8A 3QO9A 1PIEA 5A6PA 3GV5B 3WC0A 1CEZA 1WTBA 3T3FA 1NKEA 3AAWB 1TKTB 2VFRA 3THTA 4ID8A 3GV8B 2WONB 5D77A 3P8BB 3NOCA 1DBDA 3HFVA 4NASA 2OEJA 3KG4A 1ZH5A 3AODA 2PIIA 3CWJA 1UMJA 2E66A 2HFOA 2M70A 2XY6A 4LRAA 1S9GA 2DVIA 4I2QB 4RW7B 1CBKA 1UL3A 3PRVA 2E9ZA 3BKUA 4J9MA 4OI0A 2F9JA 2NZCA 4K4XA 3HT0A 2CWXA 2OELA 3NS6A 1GXTA 1SH0A 2QE5A 1T95A 1KSPA 3HJFA 1S6OA 2Q79A 4N41A 1JLAB 1S48A 4MH8A 1NKBA 4OHWA 5GVQA 3JS9A 1BE4A 1VISA 2VDHA 3DC2A 3VVTA 1TZ0A 4RUAA 2DHSA 3N79A 4LSLA 3VVUA 1YHQS 5GAGU 1S72S 3NNHA 5CZXA 4FF1A 4DR2F 3TX8A 3W7BA 1H72C 2DCUB 2YX4A 3EZOA 3NAHA 4O3NA 1UVIA 3KYLA 4KY3A 4TQRA 3OVBA 4J9RA 3K0JA 4O3OA 1WDTA 3RUBL 1GAOA 2LDYA 4LSZB 4KHPF 2DO0A 3IC1A 2QYCA 2C22A 2AEMA 2KHDA 3B4DA 4DV7F 1XIQA 2LU2A 2W4PA 3KG0A 3KNAA 4B3RF 4HI1A 2W7AA 1WHYA 1SKSA 4DL0C 1NDLA 1NEEA 5KFNA 3EVWA 2CNNB 1TAUA 1X4EA 2ZD1A 1KQGB 4K4YA 3HFKA 3L3CA 3M05A 1BXNA 2F8HA 3LALA 3KMSA 5LMUF 1HI1A 1NH7A 2KHCA 5J1EA 1Q5VA 3W9HA 1SCJB 2FGOA 1AUDA 4BBYA 4H54A 3M30A 4OI2A 2DY9A 1Q79A 1Q53A 2CQHA 5CYQB 2VFSA 1RTDB 2MB0B 3M8QB 1NLKL 2E5GA 1W2BR 1QSSA 1T9XA 4ZVEA 2CJAA 4E98A 4Z7CA 4PQAA 3SQOP 5JMNA 4EBCA 2ROEA 3E3XA 4M5KA 3P49B 1WF1A 1ZA2B 2HFVA 3RRKA 2ZWOA 3BREA 3P3DA 1S5ZA 3NLCA 5EX0A 2VZ9A 4HACB 3ZZYA 2FVCA 3C8YA 2BOAA 4PG7A 2HGNA 4LT6A 4TVAB 2D41A 5DDOC 1R89A 2K7KA 2WTFA 1YJ9S 4QPTA 4ICLA 1R31A 5B0AA 1CS4B 1FFGB 1Z2ZA 3D6TB 3FNNA 5KG6A 1U49A 3FCHA 4Z37A 1I94J 4JI7J 4ZLJA 2XLIA 4A8KA 4OI4A 1N6QB 1JXVA 4CO0A 4OHYA 1LKZA 2DRAA 3G9CA 3QT6A 3CJRA 2KVIA 3HSGA 1TFYA 3GFZA 4GMKA 3QRRA 4YB1P 3UO0A 4AE5A 3DI6B 3M8YA 2YWGA 5I3PA 2BBEA 2QLFB 4RNFA 4LFAJ 1JMTA 1WOOA 4CLLA 2OLWA 4WU2A 1UZDA 4LF7F 3X1LB 2YY3A 2HIQA 2POKA 3KLGB 4O3RA 1IWGA 3OPKA 4ED4A 3RTVA 3SV3A 3MEEA 1VBKA 2H5EA 3V2UC 2BACA 1U1RA 2DNGA 2IYIA 3HLUA 2QFIA 2YKMA 2YNGB 1FE0A 2Z0GA 4NOHA 3SSQA 2GZOA 5ETRA 4G6VB 1MMLA 2MQPA 1IXKA 2CG4A 5KFOA 3OUYB 4WFNQ 3D0IE 3EVOA 3HM9A 3P4UB 5E33A 4DPUA 4WIIA 5AE1A 4X4SA 1NAQA 2E29A 1TR0A 4KBIA 2VU5A 3ISZA 4DDFA 1JNZB 1TL1B 1AA1B 5DG8A 5AJ3F 2EEYA 3NG8A 3OJUA 3IAS9 2ZH4A 2QMWA 5KFKA 2VQEJ 1J5EJ 3CJQA 2QLJB 1UFWA 2W9BB 3DLKA 3CW2C 3DLLQ 3FJ2A 1KOHA 2E7XA 3KG1A 3OD2A 5F8HA 1WC6A 3NNCA 1GX5A 2IBKA 3ITHB 1HYSB 2JWNA 3EGNA 1ZAWA 1HQEA 4FVCA 4F67A 1RWKB 3A8IA 3J7YU 3I56S 5IT9Y 1GMVA 4K2JA 2OI2A 5EN1A 4GVBB 1N54B 4PCQA 5CA5A 3TZWA 1PG5B 4J9OA 4B3SJ 2ZH5A 4C0OC 3MAAB 3MTKA 4X4NA 3DGPA 4HVZA 2GAHC 1KLNA 2A3JA 1JLGB 5KT7A 1YITS 1T9WA 3RBDA 1GTEA 3DLGA 2CG8A 4TYAA 1NJYA 4AL5A 3CD0A 1FJGF 3L7PA 2RHSB 3R97A 2A18A 1CLFA 1FNMA 5CD4A 4JBCA 5A0YB 1JWWA 2EWHA 3TUPA 1AW0A 3KWMA 3LAKA 1CJKA 2E1RA 4XO0A 4X2BA 1FWPA 4J91A 1TKZB 3QO9B 1C0UA 3OW2R 4C8OA 3BV8A 5D15A 5D4NA 4O3SA 1D3WA 1BHNA 4NEZA 4PXCA 5LM7E 2KT2A 5I42B 2MHNA 2XNQA 3IGVA 5IM0B 1T8EA 4NXNF 4RL1A 3CIMA 1FA0A 3DDKA 2RAQA 3QAUA 4ZPDA 1OYDA 1TUWA 2SXLA 1FEEA 2HFUA 4E8UA 3TAPA 2R7XA 3G71S 3NEKA 3IO1A 2XMTA 2Y1JA 4B9UA 4LRBA 2KM8C 4LFAF 1Q8LA 2NXUA 1F0XA 3R5GA 2OTJS 3V5RA 4FYVB 5KFIA 5B7WA 3P45B 2CZVC 2RQ4A 5ETSA 3VGTA 3MFIA 3OHBA 3D67A 2G13A 3CJ4A 3G8SA 4U7UK 2BEFA 4ED2A 2HHXA 4JV0A 4KB7A 4NZ7A 1QSLA 3EUNA 3IA0A 4I67A 3Q8SB 1S9EB 4ZHRA 2V8VA 5LJ5Y 2R4FA 2HQCA 3O5TB 4PXBA 2VG6A 2CPXA 2N4CA 4IYQA 5D0EA 2EFOA 3TR5A 1QTMA 1HIYA 1S7IA 4O3PA 2ZBPA 2FJXA 2IMWP 3PG9A 2ACMA 1T03A 3G8TA 3GYGA 4UOGA 3H5XA 2J9DE 3M8ZA 2A6MA 2RQMA 1F5AA 4Y2KA 2CJBA 5B09A 4ELVA 2J7UA 5A8RA 2UUBF 4R25A 3BN4A 5F8GA 3RAXA 1NB2A 5LOQA 3DU5A 2E9TA 4DV6J 2BE2A 4I6YA 3LOUA 3BGOP 2M8HA 4P2MA 3M8SA 4CNZA 4OZ0A 3TI0A 4QYRA 3FCVA 2Z2MA 4ATNA 2LDIA 3QFWA 4X4OA 3K89A 1PC5A 1KP6A 3IP0A 1H38A 3TAMB 1VRUB 2D3O1 2O3DA 2AMCB 3ETMA 4URGA 2J7WA 1LFPA 4UOFA 4IFVA 3OLAA 2V2VA 5HLFB 2JLEA 4YUDA 2ZH1A 1IJEB 2HMIB 1FTCA 3TA2A 2QMUB 1SJRA 3RR7A 2RKIA 4ZP8A 4H4OA 4Y2MA 4LREA 4CZCA 3FSYA 1KC8T 2R2SA 1B7YB 5BR8J 1FD8A 3J81j 1LWFB 2YX1A 3N0VA 3NKYA 3DYAA 4JI6J 3BZQA 3TP2A 1YG0A 4M8LA 4O44A 2D9PA 1RHKB 2DIVA 5DRKA 4RUCA 1FNXH 4DR4F 2LVWA 2OPQB 3ILOA 1U1KA 5T7LA 3UNYA 4LF5J 1VQLS 1KHVA 4OYMA 1HHTP 2XZTB 2J6TA 2QX0A 2YH0A 2CDQA 3T41A 3EPGA 3HFZB 2CUYA 4GRSA 2R42A 5K14A 1IQTA 2DHXA 2AGOA 2Z30B 2MKCA 4LVNP 4NL5A 2VA2A 1QY7A 4M95A 5ETMA 5BXIA 2FD2A 4PZVA 2WOMA 1R8PA 2F4VJ 2GQCA 4HYKA 4NLPA 4B9MA 2ZBCA 3IS9A 1H6KX 2F5GA 3HCXA 5KFAA 3G6ES 1OY8A 3HVAA 2ASDA 1OS5A 1WC4A 3RAMA 2J9DA 1REGX 4DR1J 2L41A 1Q4RA 4MFBA 1SVDA 2YWKA 3MM8A 4WBFA 4ILRA 5GADU 2D3OR 3VWSA 3HHLC 3PXGa 1S4FA 3LP2A 2ALZA 2VFVA 5G0RB 5HQMA 2RU3A 4FF4A 3GSDA 3HT3A 1Y9OA 5DGAA 4JV5F 4P2FA 5M2PA 5HROA 2MY8A 4ICLB 3JSBA 3R6GB 5KG2A 4ZMMA 1UTAA 3AD8C 2G2OA 3NS7B 4ECRA 4DHVA 1Q7YT 4DWIA 3L7UA 4IH6A 3FFIA 1D0EA 3ZTSA 3JAMU 4LF8J 2H9ZA 4NA3A 1CULA 3MFHA 1YRXA 1OIAA 4X84A 1FHTA 4XK8C 3GIJA 1TVRA 1GK8A 2C2KB 4WXOA 4CDIA 1WHVA 5A8WA 3CJ2A 2CPEA 4QIEA 2BANA 3LGHA 4LR7A 4DUYF 2BKNA 3BKTA 4CRJA 1GQEA 2I8EA 2D1CA 3OSNA 4I7FA 2GJ2A 2DXDA 4OFZA 4CLWA 3M9NB 3OL6A 1O0PA 2R8IA 1RT3A 2YVSA 2VJVA 1WG4A 2HQFA 3AXKA 4B3RJ 2F63A 1AFIA 1UCNA 3KLGA 1YWXA 4O4GA 4F25A 1R0AB 1YRTA 4K50A 3LAMA 4NXMF 3BBCA 1A7GE 1ZPWX 3KKFA 4NLUA 4DZDA 2UXBF 2DRBA 2CPJA 1WSRA 2YKNB 4EFAC 1VCTA 2DTJA 3DLJA 3OVAA 4X4VA 1WACA 3MM7B 4I6AA 1VC6A 1T7PA 2ZWPA 2PC6A 3OT9A 4RWWA 1LK7A 1TMJA 1Y5IB 3D1HA 4NLRA 2IVFB 4DU7A 4ZPBA 3RRHA 1FXLA 1T05B 2CKWA 4CNYA 2HWHA 1HWIA 1WC5A 3DCAA 3M2VA 2K2PA 1XMQJ 4WE1A 3EGWB 2P6SA 4NI2B 4KV8A 1OJ4A 5K20B 2N7CA 2RMLA 2AV5A 3LGNA 1U0HB 3BR9A 3DNCA 3D7SB 2R8JA 3PX0A 2ILZA 2R2RA 4IO9Q 1M5KC 4L3KA 4K0KF 1JNRB 1TFWA 1S1UA 4U96A 3ET6A 2B4PA 2MKJA 3S7RA 1KFSA 4DV7J 3OTBA 2M52A 2JVRA 1I94F 3H5SA 3DM2B 1WUUA 4QWEA 2BZ2A 2XM3A 3HHNB 3W8GA 4MTPA 1U47A 2E1PA 2BOPA 3BGRB 4KGZB 4B9NA 2XWXA 1NHKL 2EFVA 2HVDA 2B3TB 3AA9A 4FBTA 3AY0A 4JOUA 4PAAA 3HP6A 5IC6B 2CNLB 1FRIA 2BJ7A 2HBQB 3TYTA 1TMMA 2IRUA 4NX9A 3SDEA 5KG0A 4DU8A 4DUTA 2A10A 1N52B 2W8KA 2AJQA 2VG6B 1RHJB 3V6DA 2VG7B 5IC4B 4AQYJ 4DG1B 4G1PA 1HNXJ 3GONA 4PPDA 1BLUA 1J5OB 3QJLA 1DTTB 2JNJA 2WVBA 1YZ6A 4UOCA 4M94A 1BQNB 1WOPA 2OMOA 4DX6A 4B9LA 4ZOSA 5FJ4A 3DLBA 3V4MA 4OX8A 2G1HA 3MUMP 1FRLA 3DOKB 3AQOA 1KLMB 4U95A 1BQMA 3QJJA 1PYSB 4NRTA 1IVZA 1WD6A 1N5YB 5HSPA 3R5JB 4I0WA 3GJRB 2C2DA 1YJUA 1Y4ZB 4OHZA 2XCAA 3D4JA 3O8WA 3KOAA 3NY0A 3G6XA 1H7WA 4IFVB 2VASA 4BCAA 1IBKJ 3I0RB 1RHUB 1VHIA 5KG3A 3MAQA 1U1OA 3KLFB 1CJUB 2V9WA 1EETB 2AX1A 3DRRB 4YR2A 5EUHA 1U8WA 3NWRA 4HH0A 4ZLLA 4K4WA 3NL0A 3S6EA 2YKQA 3PX6A 3A8KA 1GX6A 5D0GA 1G7CB 2DNHA 3Q2SC 3PIOQ 4NWBA 1TKTA 4B3SF 3RBEA 2AJ0A 2PEBA 4O44B 1ZBTA 1NUEA 4OZ1A 1G3OA 1RWUA 2VKRA 2GC8A 4J90A 2QTWA 4OYOA 5T7LB 4DXLA 4ECQA 3T5LA 3C66A 3M2RA 4DL3A 4DF4A 1AZSA 2GQ2A 4WJBA 2MY7A 1H7XA 1UFLA 2LQJA 4KGMA 4AXJA 5IT0A 1FVSA 2W4CA 3T1HF 1UW9A 2ZITA 4KHMA 1I3OB 1CC8A 3CJSA 3N28A 2BKOA 4ENOA 4DSLA 1FKOA 3PM9A 3OVSA 2MZRA 4XTTA 3JYTB 4A8OA 2W9CB 4DFJA 3WBZA 1TK5A 2BV3A 4GO5X 3IWNC 1IKXA 1E6VA 3LP1A 3MPDA 3HHLA 5LT5A 4FP9A 4YR3A 2XG8A 5I3UA 2HRUA 3AB2B 2KKHA 3EMTA 3FEXB 1YBAA 4QWAA 2M7SA 4ED1A 4DL2A 1QAIA 2G2ZA 2J8SA 3CJKB 3RG6A 3FEZA 4KJIA 1IBMF 3VQSA 1X7VA 2FLPA 2J9EA 1U6BA 5IZHA 3TA0A 3WX4A 4C8YA 1MU2B 4O0NA 4F50A 5J2MB 3BBBA 2KG0A 1UEKA 4USWA 4PUOA 4LRFA 3KUEA 2C1EB 4NYOA 2H65B 1K47A 1KBRA 1HI8A 4G1QA 4I2QA 4RW7A 2WSEC 4DR7J 2VKZG 4ZPAA 2XSJA 3W64A 1XNQJ 2PN6A 2V50A 1WKKA 2V4RA 4LF6J 2HHUA 4NPOA 4FYYB 5ETTA 2LQ9A 4Y2CA 1OMSA 1TK8A 1OQ6A 1U09A 3I5BA 3AXMA 4G3IA 4ECYA 1SC4B 1FKPB 1RWXB 1V9OA 2L08A 4AUKA 2HS3A 5AXNA 2Y1IA 3P6YC 1DQAA 3A8JA 3QRPA 4F4ZA 3PNIA 4LF9F 3OFEA 3BQ0A 5CYJA 4U6PA 2MJNA 3KUHA 1VQ5S 1RT5B 4DR7F 1G2EA 1FDBA 2HNYA 3FQKA 5CABA 4TN2A 1S1XB 2FHOB 4E0DA 1NSPA 4Q0BB 5FD1A 3OFHA 2LA6A 3V6JA 1TL5A 2HHVA 2CJ9A 3FBCA 4WF9Q 4RNOA 2JX2A 2ZDOA 2V4JB 3ONQA 4NMLA 2IJRA 3S01A 3PFEA 1FRXA 4CLZA 1N36J 3AT1B 1D9AA 1OPIA 2KRBA 2EBEA 3UCUP 2GGPA 1YBTA 2DNYA 4DZ6A 2XMJA 1X60A 2LQ8A 3LGMA 4X66J 2XQCA 4ED3A 3RJMB 3SI8A 5J1EB 4G1IA 2X1AA 4RW9A 3CCTA 1IBCB 1B0VA 3EZUA 4B9VA 1H98A 1MROB 3BEGB 2CPZA 3ZTOA 2IJNA 2XHCA 3D9BA 1Z1ZA 4JI0F 4C97A 5BR8F 1J2VA 5B0GA 2KM8B 1RTDA 2X51A 3BF4A 3PFOA 1DURA 4I7FB 3FMWA 2NXCA 3QSYB 2UXCJ 3ZXWA 1RT3B 1EZZB 3MMAA 2UVUA 3M6XA 3GMGA 2V69A 4DQQA 1HI0P 2YKMB 1RLCL 1U6FA 3IWLA 3UWTA 4NMXA 4FPRA 2RDDA 1ZAXA 2QZ8A 4OV6A 3VZIA 3MHYA 5HO4A 1U4BA 4NLYA 4ZJQA 3GIMA 1UA1A 1ZETA 5A2QY 4JI1F 3PJXA 5MAOA 1WTFA 3I31A 3K2YA 3UCZP 1XNRF 1H2UX 2Z4PA 4PYDA 4YOEA 1VQKS 3D3CJ 1EP4A 4LBHA 3A12A 4IH7A 1CJVB 4M5NA 5IFMA 1REVA 2XMKA 3NCRA 2E5IA 3Q8VA 4LF1A 2BW7A 2IM3A 1QUPA 1B3TA 1RT6B 4USVA 1BGXT 4UTGA 4JI1J 2XS5A 2JH3A 1HNWJ 1CG2A 3PV8A 1X9SA 1K1SA 2M88A 3ZZTA 4DI6A 2FLOA 2QO3A 4OZ3A 1UKUA 3CVKA 3SMZA 5SUHA 2OAUA 3K59A 3MM9A 2M2BA 4CO4A 3LH2S 4OMFG 3MM6A 5E7OB 3MMBA 3I87A 4XDCA 4JI5F 4P2XA 4DV0F 1R8HA 2BX6A 2GIQA 3KLVA 2A2DA 2CQ4A 1D09B 2FC8A 1FJEB 2L9DA 4NCGB 4OYZA 2IRXA 1S6PA 1BWEA 5L8RC 4ZPVR 5DZ7A 4N76A 2KTQA 3QIPB 3KHLA 3DRPB 1Y10A 4IO1A 1S6UA 1FJ7A 3JXOA 4WXWA 1X0FA 2C2MB 2YKOA 2DGQA 1KDNA 2A1BA 2Q6BA 2Z57B 1S1WB 2HURA 2H3EB 1FFWB 1SC6A 4QU6A 2I38A 3EXYA 1TKXA 3EXCX 4A48A 3IMQJ 3CMQA 4DR3F 3BN7A 3DFEA 5J2QB 3AA8A 1RBOB 2BDPA 2WVEA 4CYUA 4GKKJ 1VJWA 2ZM6F 1JLFB 4C8LA 3CD7A 5GAEI 1IBLF 3UDVA 4F2SA 1T94A 2MJUA 1XTZA 3TAQA 3U7JA 4C9DA 1HA1A 2QA4S 5LSOA 4FPIA 3HHKA 2FY8A 3TWZA 3IR7B 3K8VA 3JYTA 5AXLA 4ZIWA 2OPPA 2GW8A 1PCAA 3CO0P 4FYXB 4W4MA 4ZVSB 2DH8A 4DOZA 2UUAJ 1Q8BA 3HHLB 1S49A 4DQPA 1UVNA 1B0PA 2AF6A 2JL9A 3POTB 5K8MA 1RLDA 2QRRA
chains in the Genus database with same CATH topology
1U6ZA 2GMLA 2K1RA 2YKAA 3FRZA 2HRYA 1DAXA 1EETA 2MZTA 2RU9A 3SFUA 1LXJA 1OWXA 1SL1A 4A8SA 2MZ1A 4XAKA 1S97A 1SB6A 1S9GB 3BM7A 3OSPA 3E01B 5BYRA 3BGLA 2B4VA 4AL7A 1NK8A 4ECXA 2EFQA 4CH7A 2B6AA 2JC1A 4NRUA 1BY9A 4RX6A 1FESA 1T3NA 4NLDA 2W7OA 2UZAA 5A8KB 2PSZA 1Q78A 1VQMS 4KO0B 3DU6A 2VG5B 1X5SA 2DCLA 2PEHA 5AXMA 3GZ7A 1IKXB 2IYGA 4WK1A 2JLFA 4BS2A 1TL3A 1X4FA 4QBUA 5DQIA 5FIIA 1N48A 4H4OB 4WFZA 5CHCB 2RRNA 4NLVA 1UETA 5E3RA 2CPHA 4I64A 1UJ4A 2C42A 3CCVS 2YQ3A 2CVEA 3BQ2A 2GFFA 2M4MA 1KFDA 3MEDB 1U26A 2DNLA 1YJTA 2FPHX 2COLA 4I1TA 2G1DA 1RT7A 4DFMA 4TY8A 3R3TA 4QIGA 4CO2A 1HNWF 2JRSA 2BE2B 4G1QB 3L95X 2EFNA 4C4WA 4J9NA 3T6JA 5KT5A 2F4VF 3T6BA 3MGJA 2HHTA 1S1TA 2CQ1A 5IQQA 2WBMA 3DHWC 2WB1D 1MROA 3MDFA 3KLIA 4DV3F 3R1HA 1D9DA 1RDRA 1UP1A 3I0SB 2RF2B 2APOA 2HFZA 3WDOA 4IDKB 2EFGA 3MOZA 4DEZA 3JSRA 4RNHA 2RS8A 5E3AA 2NREA 1LQ9A 4B02A 5KOXA 4M5DB 2BJEA 3RB0A 4Q0BA 2BABA 2R9LA 5CH7B 3MEGB 5HROB 2ABYA 4IG0B 3SV4A 4OZNA 2VV5A 2KB2A 1TUVA 4O23A 3PR4A 2CQ2A 1AXQA 4NYZA 2DH9A 3KLHB 1QVFR 1YQHA 2X1BA 1YVFA 4IRCA 2IAJA 2W8LA 3N6LA 3LO3A 3KHGA 1XR7A 3IS9B 3BB5A 5AE2A 3Q22A 1YTYA 3M1VB 4Y0FA 3NGDA 3C6TA 2B0GA 2MKSA 5KFQA 4R0JA 2HNZA 4UQTA 2K8GA 3T1AA 3VAMA 4LIRA 4DV6F 2R7VA 1IN0A 1KHWA 3BSCA 1HBMB 3MMAB 3UNGC 2YNIA 2KRRA 2RRBA 2F7VA 2FIUA 2VPZB 4NLGA 2VPWB 2MQMA 2LQ5A 2Z2LA 1XERA 3ENQA 4DR5F 3R1LA 2Q1LA 3MMCA 3KLEB 2GO8A 2B5JA 2KZZA 3BO4A 3QGGA 1RT2A 4MYUA 5LL6d 2QMXA 1IKVA 4DF8A 4X64F 3M2UA 2RQKA 4RU9A 3NBPA 2VB6A 4PQUA 3M2VB 5LJ3Y 5DS7A 5KT4A 1Q81T 1CVJA 4LF4F 5D3GA 1M5HA 3QLHB 3MM5B 5KT6A 2R8HA 4PXDA 4HL9A 1R43A 3M8PB 4WKYA 5DDPC 4A8QA 3H4BA 3MMJA 2HHQA 3HZGA 2FC9A 1FTRA 5LMNF 2MHEA 3H2VE 4IR9A 2NUHA 1XWLA 4HT5A 2XMWA 4RW6A 1YSJA 1R0AA 2BQUA 2XMUA 5DJBA 2CQIA 1PO6A 3MMBB 3HKZD 4KGKA 1HR0F 3BGRA 4DSIA 4KSEB 3OV7A 2J0WA 3GR0A 1HWKA 5CYMA 1OPZA 3FEYB 1M5OC 1NU4A 3OTCA 4MKAA 1T05A 3NAIA 4LFBF 2HZCA 3CC2S 2ZHAA 1SV5A 1HD1A 1FK9B 3D0HE 3CCZA 4KV8B 1OSCA 3MTJA 5J2PB