1HARA

2.2 angstroms resolution structure of the amino-terminal half of hiv-1 reverse transcriptase (fingers and palm subdomains)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
216
structure length
196
Chain Sequence
PISPIETVPVKLKPGMDGPKVAQWPLTAAKIAALVAICTEMEKEGKISKIGPENPYNTPVFAIWAKLVDFRELNKRTQDFWEVKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILAPFKAANPDIVIYQYMDDLYVGSDLAIGAHRTKIEELRQHLLRWGLTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein, transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (FINGERS AND PALM SUBDOMAINS)
publication title 2.2 A resolution structure of the amino-terminal half of HIV-1 reverse transcriptase (fingers and palm subdomains).
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 54
structure length 196
sequence length 216
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1994-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1harA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1harA02
2V0NA 4HKQA 3ITHB 3QO9B 3DI6B 1RTIA 1XR7A 3D28A 1JLEA 2VG5A 3GV5B 2ASJA 4TQRA 4R5PA 2R8KA 4MFBA 1D0EA 2D41A 4NLPA 4URGA 3DYAA 4IDKB 4ZP9A 3DOKB 4MKAA 2V4QA 3KK3A 5KFKA 4X2BA 4RNMA 2JC1A 4IRCA 4KKOB 1SH2A 1RYRA 4DL5A 2FLLA 4NLYA 4PWDA 2E9RX 4ID5B 3V6DA 4IQXA 4FS2A 1XR5A 5K14B 5F8MA 5KFUA 3KMSA 3RB6A 3T19A 3DMJA 2I5JB 3D5MA 4MIAA 4TQSA 2OPSB 3TQ1A 1JLAA 2WOMB 3PW4A 3G6XA 3H98A 3I0SA 2YNHA 3DLKA 5KG6A 4O3QA 4URSA 2IAJB 1JLFA 1TQLA 2BRKA 4NLRA 1WNEA 1S10A 2EC0A 3CJ2A 1HPZA 4ED2A 5FDLB 5J2PA 2IM1A 4RW8A 1TKZB 3N6NA 1EP4B 4ED1A 5I3UA 1S0NA 3QIPA 4NCGB 3SFGA 2HWIA 3DLEA 4RNFA 4ICLB 4KO0B 4QWCA 3KLGA 2FJVA 3CDWA 3GV8B 2RDIA 3DOLA 1MMLA 2BRLA 4NLSA 2HNZB 1MU2B 4QWBA 4RUAA 1Z4UA 1XR6A 2W9CA 3BJYA 2C22A 3KHHA 1TKTB 2VG6B 4IFVB 3KHRA 3H4DA 3MEGA 2RF2B 1BQNB 1S1WA 2HNDB 5CYMA 1RTDB 3KJVB 3KK2A 4ZP8A 4HYKA 1CSJA 4WYWA 4EBDA 5KFFA 1J5OB 3KOAA 4EO8A 3CJ3A 3ICLA 3DRSB 4RW9B 4IFYA 5D3GB 3E01B 1T05B 4I2QA 1RTHA 4QPXA 4GC7A 3I0RA 3IGVA 4H54A 5KFMA 5EWGA 4QWDA 3FRZA 1LW2A 4ED0A 2E9ZA 3JSMA 5KFNA 4J9LA 4RW7B 4LSNA 3C6UB 4IG0B 1DTTB 2RKIB 3LP2A 1N6QB 4R8UB 2C2EA 3CJ0A 4NLXA 3BGRA 5J2NB 1BQMA 3IGNA 5KFTA 3OL6A 4K4XA 3RB3A 3IG1A 4KE5A 4DL2A 4TY8A 3T5HA 2YNGA 5DG8A 2IMWP 3DRRB 1VRTB 1C1BB 1S1TB 4YP3A 3M9NB 3OL8A 1HYSB 4MK7A 5KG0A 4KV8A 1S6QB 3DI6A 2ZD1B 1LWEA 1YVFA 2R8JA 4K50A 2IC3A 3NKYA 3HKWA 2R8HA 2W7PA 3MR5A 5KFLA 3KHGA 2ILYA 2C2DA 2V9WA 2UVWA 4PUOA 4IDKA 2IBKA 5F8NA 4MH8A 5HBMB 3V6HA 3NMAA 1FKPB 4Q45A 1IKYA 1TV6A 1TKXB 3H5SA 1JXLA 5KG1A 4IH6A 4K4SA 1RT3A 4ZPCA 5DG9A 5C25B 3NAIA 2OPQB 4WE1A 4K4UA 4ID5A 4J9OA 1HQEA 4DL4A 3DLGB 2YKMB 4JV1A 3Q8QB 5J2MA 5HLFB 1SH3A 3H59A 5KFIA 5KFDA 2V4RA 2ZKUA 2YKNB 3NBPA 2HMIB 4ECWA 1DTQA 1TL3B 1RA6A 2AGOA 2R2TA 3MR3A 3BSOA 1S48A 2HNYA 1REVA 4RW6B 5CYQA 3KLEB 1K1SA 4YMEA 1JLQA 3Q8PB 2FLNA 5KFSA 3KK1A 2J6SA 4RW4B 3FFIB 5L1LA 4FBUA 4Q0BA 3DDKA 2YNFA 4NLTA 1QAJA 3GIIA 3LALA 3MEDB 4NCGA 4YR2A 5DLGA 3SI8A 3V4IA 4ECQA 4H4OA 5EWFA 1C1CA 4ED3A 3OSPA 3PHEA 4O4GA 4LQ9A 5DLFA 2BR0A 3UDLA 4ZHRA 1VRUB 4O4RA 3T5LA 5J1EB 4NLVA 4DG1B 3N6LA 2C2RA 1S1VA 5I42A 4IR9A 1LW0B 1NHVA 1ZTTA 4JV0A 4ED7A 1FKOB 2VG6A 1RTJA 4IFVA 1T94A 1S9EA 3UR0A 2WCXA 2WRMA 2HAIA 4K4ZA 1D1UA 2XC9A 2RDJA 3ISNC 3LP0B 1TVRA 5DQIA 1N5YB 3M8QA 1J5OA 2GIQA 2IM0A 4TLRA 2E9TA 1SUQB 3MECB 1HNVB 1S1UB 3EPGA 3GIKA 1N48A 3Q8RB 1RT2A 1JKHB 1S6PB 5D3GA 3IS9A 1C0TA 2WONA 4NYZA 2B5JA 4ZP6A 4WXOA 4U6PA 4WYLA 3VQSA 4RZRA 1N4LA 3MF5A 4IRDA 4K4WA 4IG0A 4ZPBA 1DTTA 1N6QA 5KFOA 5DG7A 2ATLA 5C24A 1IKWB 4G1QA 4RNOA 2R2UA 5J2NA 1TP7A 3GIJA 3RAXA 1IKXB 1RT4A 5L9XA 2UVRA 4TYAA 3OHAA 2JLEA 2ILZA 2VA2A 4IRKA 1R0AB 1RDRA 2BE2B 1RT7A 5KFZA 1KLMB 5KT4A 3G6VA 3CJ5A 2JEIA 5KT3A 1DLOA 1SV5B 2WHOA 1HNIA 2OPPA 3HHKA 3RAQA 4MK9A 3KLIB 3V6KA 1LWFA 4EYIB 1RT6B 2ALZA 3EZUA 5EDWA 3FQKA 4Q43A 4IG3B 2BANA 2HWHA 3MEEA 1TL1A 4H4MA 2ZE2B 4J9SA 4IKAA 5HBMA 3JYTA 2B6AB 3V6JA 4RNNA 1LWCB 2OPRB 4K4TA 4DL6A 2ASDA 2AGPA 2J6TA 2XI3A 4ZP7A 5KG4A 1QE1B 5C42A 5KT5A 4PQUB 4YR0A 4R0EA 1FK9B 3MR6A 3DLGA 1JLBB 2W9BA 2YNIB 5HLFA 3G86A 4NLDA 4F50A 3IRXB 4JUZA 2I1RA 3OSNA 3PZPA 2ASLA 1S9GB 1EETA 1HARA 3QLHB 4NRTA 1HMVB 3UPFA 4ZMMA 1JLCA 3QGIA 5EWEA 4RW6A 4ECTA 1C0UA 5HROB 4O44A 5KFHA 1RTIB 2VG5B 4OL8A 4I7FA 4R5PB 4MFBB 2VG7A 4TXSA 5HP1A 2J6UA 4IH5A 1RT5A 4KFBA 4J9MA 3KK3B 3V81A 4ED6A 3E51A 4KB7A 1HQUB 1T03A 4ECXA 1S9FA 3C6TA 1T3NA 3SFUA 4EYHB 1RT1A 1JLGA 3M8PA 3KLHA 3DM2A 4PWDB 3V6DB 2FVRA 3ITHA 4LSLA 3QO9A 4G3IA 3TVKA 3T1AA 2XI2A 3DMJB 2GIRA 5F9LA 4RUCA 3DOKA 1JLAB 3BREA 4Y2CA 5KFBA 4QW8A 2O5DA 4NZ0A 2YNHB 2FJWA 3KNAA 1JLFB 4KKOA 5KFGA 1S97A 3RB4A 1HPZB 2IA6A 5J2PB 4RW8B 5K14A 1S4FA 4F4WA 3QIPB 4ECVA 3H4BA 2I5JA 1K1QA 1IM4A 2F8EX 2OPSA 5F8JA 3DLEB 5KFCA 3RBEA 4QW9A 5T14A 2WOMA 3BSAA 3GYNA 3GQCA 4ZVEA 4F4YA 1ZTWA 3KLGB 3GILA 3T5JA 3OL9A 2IAJA 4RNHA 3DOLB 5F8HA 5FDLA 4GC6A 1TKZA 2W9CB 1EP4A 4JV2A 5J2QB 2W7OA 3T5KA 3KLIA 3MEGB 5CYMB 5L1IA 3N6MA 3FQLA 3KK2B 2AQ4A 2FJXA 3I5CA 4ICLA 4KO0A 1NHUA 4KHRA 5DQGA 4ZVGA 5F8LA 3RBDA 1ZETA 2ZE2A 5KT7A 4NRUA 1C2PA 3H5XA 4IFYB 4ZVHA 1IKVB 4I2QB 1LWCA 1RTHB 2W8KA 2HNZA 1MU2A 3PW0A 3QGGA 4ED8A 5KFPA 2QV6A 3JSMB 3FSIA 4LSNB 1TKTA 2FVSA 3LP2B 2IJFA 2RF2A 1BQNA 3BGRB 2HNDA 4XPEA 1RTDA 3KJVA 4NLOA 4KBIA 3G6YA 2DPJA 2XCPA 3IG1B 3CVKA 2OH2A 3LAKA 4RU9A 3H5UA 3CIZA 2BQ3A 2VA3A 2XGPA 3HVWA 4NLUA 3MR2A 2WK4A 4TY8B 3EPIA 3DRSA 1S9GA 4RW9A 3KLFB 3E01A 3QLHA 3DRPB 1T05A 1UWBB 4ECRA 3H5YA 3NL0A 2XCAA 4RW7A 3MFIA 3C6UA 4KV8B 2RKIA 1KHVA 4R8UA 5HROA 4NLQA 1S49A 2D3UA 4ECSA 1LWEB 4K4YA 5KFWA 4DL7A 2IC3B 3QZ7A 2QE5A 4IOBA 4PUOB 4J9QA 3Q8SB 3KHLA 3LP1B 5KFRA 2DPIA 1IKYB 1TV6B 1HQUA 3DRRA 4TYBA 3M9OB 2W8LA 2W9AA 1VRTA 1C1BA 1S1TA 4I2PB 2BQRA 5F8GA 1RT3B 4IR1A 4URQU 1HYSA 4ZVFA 4B3OB 4WE1B 1S6QA 5C5JA 4FS1A 4ZPAA 4F4XA 1HQEB 2UUWA 2ZD1A 2IM2A 3BSCA 2CKWA 4EO6A 3FDSA 4TY9A 5J2MB 2AGQA 4ECUA 2C28A 2IM3A 3NBPB 4M94A 1SH0A 1DTQB 1FKPA 3QIDA 5F8IA 4EEYA 2D3ZA 4LQ3A 3TAMB 3H40A 1TKXA 5KT6A 4WZMA 4Q8FA 2WB4A 4Y34A 3HVTB 2HNYB 5DGAA 1REVB 5CYQB 5C25A 5KFQA 1JLQB 2UUTA 3KK1B 2AX1A 2OPQA 4Q0BB 4O3OA 4O3NA 2YNFB 2YKMA 2B43A 4Q44A 4KSEB 2JEFA 2XWYA 1S1XB 4F4ZA 2R8GA 3V4IB 5JUMA 4H4OB 2YKNA 1C1CB 2HMIA 1TL3A 4O4GB 4Y3CA 3H2LA 4MIBA 1S0MA 4ZHRB 4LSLB 3KLEA 2WTFA 2R2SA 1S1VB 5I42B 4RW4A 3FFIA 3QYYA 1JLEB 4NLGA 3BR9A 3KLVA 5J2QA 1RTJB 3BQ1A 1S9EB 3DYAB 3MEDA 3BQ0A 3QGHA 4O3RA 3BSNA 1TVRB 3PW5A 1QUVA 3HVAA 3PW7A 3M8QB 4ECYA 2JEJA 2IJNA 3CDUA 4O3SA 5KFYA 3BQ2A 4ECZA 3GIMA 1VRUA 5JXSA 1RT2B 4IH7A 1IKVA 3IS9B 5J1EA 2FVCA 1C0TB 4DG1A 2WONB 2B5JB 1LW0A 3NGDA 3GV7B 4M95A 1N56A 3I5BA 1FKOA 4XPCA 2FVQA 1S0OA 5C24B 4G1QB 5KG2A 1JIHA 3PJWA 1RT4B 3LP0A 4NLWA 3I0SB 3DLKB 1W25A 3KMQA 1N5YA 5KFJA 1RT7B 1RAJA 1SUQA 4KHMA 3MECA 3IN5A 3PW2A 1HNVA 1S1UA 5L1JA 3KLFA 1RA7A 2BQUA 1S6PA 1JKHA 3DRPA 2JEGA 1UWBA 5KG7A 3CWJA 3PVXA 1DLOB 5KFXA 5I3UB 4YQWA 1HNIB 2OPPB 1GX6A 3PR4A 1JX4A 4KAIA 3LANA 4QWAA 4TN2A 1LWFB 1NNDA 3CO9A 1IKWA 3MTKA 5KG3A 4J9KA 4Q8EA 4O3PA 1IKXA 5KFAA 1KHWA 2CJQA 2BANB 1OS5A 3MEEB 1TL1B 1R0AA 4H4MB 3NAHA 5KFVA 2BE2A 5KG5A 3JYTB 4U7CA 3MFHA 4J9PA 1KLMA 4MK8A 3LP1A 1I6JA 2FVPA 5EUHA 4EBEA 1QAIA 3QZ8A 1RYSA 4I2PA 3PJXA 1SV5A 3PR5B 3UQSA 2D7SA 5C42B 4B3OA 4WXWA 4XO0A 5DQHA 2XGQA 4DL3A 3RB0A 1S1WB 2AX0A 1RT6A 3CDEA 2AU0A 5L1KA 4IG3A 5DGBA 2W9BB 4QWEA 2JC0A 2UVUA 4FBTA 2UVVA 1EETB 2B6AA 3I5AA 4WFYA 1U09A 3OLBA 2OPRA 3I0RB 3TAMA 4K4VA 1JLCB 1LW2B 4WFXA 3HVTA 3CJ4A 4YR3A 1QE1A 1C0UB 1GX5A 4PQUA 4O44B 2GC8A 1BQMB 2AWZA 4Y2AA 1FK9A 4I7FB 5F9NA 2VG7B 3OL7A 4J9NA 1JLBA 3OHBA 2FLPA 5HP1B 1S1XA 2YNIA 5KFEA 3M9MB 3IRXA 1RT5B 2YNGB 4KFBB 2R2RA 3V81B 4WFZA 4ZPDA 5KT2A 3ISND 1T03B 3OLAA 4MKBA 4J9RA 4WZQA 4EBCA 4DEZA 1HMVA 2R8IA 3C6TB 1RT1B 1JLGB 3M8PB 3KLHB 3DM2B 3LAMA
chains in the Genus database with same CATH superfamily
4CTAA 2R8KA 4KC5A 4X2BA 5HMYA 4RNMA 5HQLA 4KKOB 2VL1A 3CMQA 2FLLA 2L48A 3HLUA 2OPSB 1P1TA 1CJUA 2FGCA 3DDIA 3P49B 1VK3A 3ENQA 3IRWP 1YGYA 4P10A 2ZH3A 3R7BB 3JSRA 2VHGA 1WC1A 3F73A 4FVCA 1FERA 1Y7PA 2RDIA 4AD6A 3KHHA 1RCOB 2IFXA 2HNDB 2J5AA 2VB6A 3DFEA 4WYWA 2GGPB 2BE9B 5FLXY 5A8RB 4IFYA 1RTHA 4NZ6A 2DGVA 2CNKB 4ZLPA 2VPWB 1VQOS 5RUBA 1VHFA 4CH7A 3IG1A 2FY8A 3HFKA 4DSIA 1Q95G 1A6LA 4UZBA 2HBZB 2OFGX 4QU7A 4LFAF 2IC3A 2IBKA 2RE1A 1DAXA 3DN9A 4DPWA 3NCQA 3HFZB 1N5SA 2ZH2A 8ATCB 1WJ9A 2ZHAA 1EQMA 4CLLA 4ECWA 3G4SS 2LXUA 4N8OA 2R2TA 4WU2A 4LF8J 1WSVA 1WF0A 2IDLA 2CQ4A 4ECQA 2XSFA 1YBUA 1ZOTA 1F1BB 2WRMA 1MW7A 1O5JA 2DR8A 5JVHQ 1N48A 5E3PA 4J9UE 4OV6A 1DTTA 1AZSA 4USTA 1E6YB 3B6BA 1UCNA 3OHAA 1QVGR 4OZ3A 1NKBA 3ZZOA 2GVDB 1T9WA 4C11A 1WHWA 4RNNA 4PG7A 2Z57B 2MKHA 5KT5A 1TELA 2EW9A 1PBAA 4DPYA 2ADCA 4DLGA 3PZPA 4F50A 3G6ES 2HIQA 1YRXA 4ECTA 4O44A 3G87A 2VG7A 1CJKB 2LEBA 1UPMB 4YB7A 1W26A 1X0PA 3TVKA 3TWZA 2H51B 4FXDA 4Y2CA 2X7IA 4NASA 3VAGA 2N7CA 5GADU 2N4CA 4DR4J 1B0PA 1SJ4P 1CS4B 2VFTA 3T9NA 4NE9C 2CJKA 5T14A 2FJAB 3NMRA 3QQCD 2V68A 1TKZA 4A46A 5FLXU 3TO8A 3K89A 4KHRA 3W5YA 4MIWA 4U8VA 5MAOA 4OJ1A 2COLA 2PDAA 4BCAA 1TKTA 1FE0A 4XTTA 3NWRA 1RK8A 4DQRA 2VA3A 1H6KX 2WK4A 3VALA 3I32A 5A6PA 4MYTA 4XK8C 2AP6A 4KV8B 4HEA9 3SSRA 1R0CB 2VUGA 3QZ7A 4CO4A 3CMAS 2HW3A 1NK8A 4Q7AA 3R5AA 1RT3B 5HJXA 3CD7A 3CCLS 4FPIA 3BSCA 1T11A 2AGQA 4IOAQ 2ZDOA 4M94A 3CCTA 1WC5A 4CO1A 1UL3A 4WPAA 5DGAA 3NLCA 3FEXB 4U96A 2YKMA 1RAIB 4F26A 2FC9A 4H4OB 2HMIA 1MSWD 3BBCA 1S0MA 4ZHRB 2IRUA 2B9YA 5A0YA 2ZZNA 2OJ3A 3GONA 1IR1A 4ZPWR 2IJNA 5D4LA 4DV1F 3RW6A 4HVZA 3HZEA 3FSXA 1UJ6A 2KVIA 1AB8A 3K5OA 1ROFA 2CPHA 1IKXA 4F02A 3MEEB 1AXQA 2ZWOA 2CQ3A 3GYXB 4EBEA 3LP1A 4RPFA 5B0FA 1E6VA 2UXCJ 4XO0A 2ERRA 3QJLA 4NPOA 2K7JA 2HFOA 3TAMA 3BPDA 1ELOA 3IWLA 4WFBQ 2EFPA 4FPRA 3M9MB 1S1XA 5KFEA 4DF8A 2HBRB 2E5HA 2CPIA 5LMNJ 3QFWA 4DEZA 3CO0P 2DITA 4ZP9A 4LSLA 2QRRA 2V0NA 3W3SA 2G2YA 1TK0A 1OSDA 4MKAA 2BOAA 2VC0A 4RBUA 3KK3A 5K8OA 4DV2F 3VAHA 3R3TA 5DDQC 2A1BA 2RAQA 4DL5A 4WP9A 3RW7A 5IT4A 2C2OB 5F3TA 4UZCA 2Y1JA 4QR0A 2MMYA 4L3NA 3CJ2A 1TU0B 4I69A 3TQEA 2CQBA 4A8MP 3PM9A 2W9CA 1RTDB 2BW7A 2DXDA 2YWKA 1Y3JA 3M1VA 3MI7X 3HDSA 2MJUA 3QSYB 4F2SA 2NXNA 3PRBA 4KE5A 3FRYA 4P75A 2R7XA 2YNGA 1FT8A 3DRRB 1QLNA 1CC7A 2DBBA 5KG0A 5L8RC 1VQMS 2L08A 3R2DJ 3CTRA 4CLPA 1TKXB 4NX9A 5BYQA 1RJJA 2MZRA 3S8SA 3H59A 1KP6A 4OX8A 1RA6A 3MR3A 4RW6B 4CH1A 4OIXA 2A6MA 4NLTA 3W60A 1IBLF 3ET6B 1RP5A 1JXEA 1RKJA 5H1SV 1VRUB 1SL2A 4NLVA 4IR9A 5I42A 3AXKA 4C2MA 1J5OA 4TLRA 2CQDA 1X8DA 4DU8A 2ZJPQ 3IS9A 3C8YA 5LL6d 4ZPBA 7AT1B 1CULB 4RNOA 2E5LF 2BE2B 4C97A 4LBIA 5KT3A 1IR0A 2BJ1A 5I3QA 1SV5B 1GXLA 2OPPA 3KLIB 3VGVA 4FP9A 3GG1A 1LXJA 1FJ7A 4IKAA 2B6AB 4F3OA 5T7LB 1KQSR 3D3BJ 4UT4A 3C16A 2Q66A 3UPFA 3QGIA 2P8IA 1WG5A 1U0HA 4JI8J 4JYAJ 4MFBB 5HP1A 3G96A 1RT5A 1M5HA 1H7WA 1U2CA 1F5BA 3C6TA 1VMBA 2AT1B 3M6VA 4B17A 4N7TA 3M32A 4ZVRB 4NZ0A 2DHSA 1AFIA 1FX4A 4ZIWA 3K57A 4YOEA 1VC5A 4RW8B 1AT1B 3MMAA 4K2JA 5IC6B 4DR6F 2V67A 2QLXA 1GT8A 3GYNA 4ETXA 4NCAA 4ILRA 2VICA 4ID8A 3I82A 5ETVA 1XMOJ 1W2BR 5CYMB 3IC1A 4ZVGA 4YHHF 1J5EJ 3FSIA 4P71A 4LSNB 3LP2B 1D3WA 3KJVA 3H2UB 1PBUA 3DRSA 1S9GA 3KLFB 3DXSX 2XCAA 4X65F 1LWEB 5ETPA 1A0OB 4AE5A 5LJ3Y 4WCEQ 5A8KB 4IR1A 3B4MA 4OHWA 4LFBF 3UD4P 1NLKL 3EJMA 3MM8B 4AYBD 3Q2TC 1HWJA 2U2FA 2KM8B 1VLOA 4EFAC 4DU7A 4Y34A 2KO1A 3CCWA 1LNQA 2RJZA 5ETQA 4Q44A 2CPXA 1Y9OA 1MN7A 1C1CB 1RI7A 4WWSA 1Z1ZA 2VQEF 1FEHA 2HHHJ 2HGNA 2HURA 2Q43A 3EXCX 3N9UC 5LT5A 3CDUA 4ECZA 4U95A 4OJGA 2FJBB 3IWNC 5I4MA 2XS5A 2H1YA 1W25A 5SZTA 3D7SB 4ZVPB 1HHTP 3DRPA 1TL4A 4B08A 4TN2A 4O3PA 1OS5A 4J9PA 1I6JA 5MLCV 1R8AA 2CPEA 3PJXA 2PT0A 2JHEA 3D1HA 5DQHA 2BJ9A 4RR5A 4UOGA 1U1OA 4FBTA 5IV4A 1RAFB 3I0RB 1LFWA 3GCWP 1UVNA 4FZVA 2ACYA 1JLBA 2M7SA 2ZNYA 1CEZA 4EUVA 2R8IA 2FIUA 5EX3A 3CW2C 4F3MA 2DXEA 4PXDA 2QIFA 4B3TF 2P6TA 3D6HB 3GSDA 4IQXA 4ZDNA 2OFHX 1N32J 1IBKJ 1SXLA 4URSA 1JLFA 4HTIA 4WK3A 2D69A 3CCQS 1U7LA 4KO0B 4QWCA 4P2MA 3CDWA 3R6GB 3AA8A 3A3PB 2QL7B 4CZCA 1RAEB 3ICLA 2KVQE 4RW9B 4RW7B 2C2EA 1WOSA 3POTB 3OL6A 1BQMA 3IGNA 4LRAA 5B0CA 2DH8A 2BJEA 1S1TB 3P5BP 2KYZA 3HHLA 4MK7A 4K50A 2V9WA 5KFLA 5HBMB 5D4OA 2WB1D 5E7OB 2LLZA 2OPQB 3LOUA 4J9OA 4IO9Q 4DUYF 1Y5LB 2A10A 2BZ2A 3UDCA 3RRKA 1L3TA 4YMEA 1QM9A 2H5JB 3FFIB 1CJTB 2E29A 1TK5A 1KQKA 3IR7B 1CG2A 4WFAQ 3T5LA 3N0VA 3N6LA 1NHVA 1T9VA 2M9KA 1TVRA 2E9TA 4Z37A 4V19X 1AA1B 1IWGA 2AJ1A 1XWLA 4TYAA 2V2VA 4OYPA 3L7UA 4ANEA 2KG0A 3HSGA 3HM9A 3PRVA 3FQKA 4LT6A 4HH1A 3CD0A 3JYTA 2E1RA 3IFEA 4YEAA 4N76A 2BACA 2ABYA 2CZ9A 4R0EA 1PG5B 1L3KA 4X4QA 1X31C 3G86A 2GS8A 3PRDA 4Q5VA 4CDIA 1YJTA 2MQOA 5KFHA 1RTIB 2N4DA 3ZZ0A 1DARA 3W5ZA 1UP1A 2DR5A 4LF4J 1IUJA 4LJMA 4NEYA 3DM2A 3MPYA 2WVEA 3QO9A 3FBBA 2ROEA 6FDRA 1FDDA 1NAQA 3BV8A 1EJ7L 1YJNS 2R42A 2YWWA 1HPZB 2W2NP 1HWIA 3QIPB 2DH7A 2P6SA 3GQCA 1FO1A 3MMBA 5AJ3F 4FVMA 4DLEA 1KRPA 3NCPA 3N6MA 4DV6F 4CNZA 4DMZA 2V34A 5C2GA 1U1NA 2HNZA 3MWBA 3B54A 5KFPA 1TUWA 4NLOA 5AE3A 3CVKA 3HI9A 4DUZF 1I1GA 5K8NA 4ECRA 3DU6A 2B4PA 2DGOA 3JTNA 4U67Q 3FCHA 4USKA 1RU2A 3CJQA 1VI7A 2QL9B 3HSZA 2W9AA 2DHAA 3US5A 1JB0C 2UUWA 1QDUB 4GMKA 2IM3A 3QIDA 3IAS9 3HVTB 2YKQA 4CYUB 4X84A 4ZCLA 5IT9Y 2V50A 2EG2A 4C3LA 1RWVB 2RU3A 4HL9A 3ZZTA 3ILOA 5BR8F 5H9EK 2HZAA 1S59A 2GW8A 2CNNB 3HSJA 2LU1A 1HFEL 3NRBA 2B8QA 4A48A 1LW0A 3I5BA 1VK8A 3LGNA 2HK2A 1MMNA 1SUQA 3MECA 1I5OB 1SIZA 3EZOA 2Y3YA 5I3UB 1JX4A 4C6AA 4KH0B 2GFFA 3W8PA 2Y0BB 2IVFB 1OO0B 4OZJA 4ZJQA 2ZOMA 1GXUA 1S7HA 2EXUA 1N88A 2AX0A 2GMJA 4QWEA 3MGJA 2AW0A 2XMVA 1MWZA 2HQDA 1Q5VA 2AWZA 5GAHU 2F4FA 3PEJA 2IPOB 4J9RA 4NZ7A 1FESA 1JLGB 1FEEA 4NI2A 2DR6A 3TARA 4JI7F 3PG9A 4R5PA 2D41A 4NLPA 1I3OB 1OMSA 4G65A 4WIIA 3SCKE 2A3JA 3GB0A 3HT0A 4ZKAA 4LF7J 3T19A 3MCSA 4KGVB 4MIAA 4TQSA 3DHWC 1KVJA 2H54B 4ER8A 2LDYA 1P9YA 2RDDA 1MN9A 1OJ4A 3K7RA 2IM1A 1RUSA 2HS0A 4NMXA 1LK5A 1K0VA 2VONA 3D6MB 4M5MA 1XR6A 2QTWA 2LMIA 2YX7A 2WAQD 4MT1A 5KFNA 2AYEA 5J2NB 4LF1A 2JOQA 1PYTA 3CB4A 3D9BA 1UZDA 4LBHA 4N47A 1HYSB 1Q81T 2G0IA 5IS2A 4C8OA 3KHGA 4HHJA 1IKYA 5IT9U 2DHGA 4I56A 1TR0A 5D8HB 2R7WA 3GTYX 1KDNA 3NS5A 2I38A 1CQNA 3HO1A 2XO6A 2Z30B 4OFZA 3DDKA 2ZWPA 4JI5F 4YR2A 1V3SA 3PHEA 4Y28C 1N5QA 4CT8A 3HT3A 1SKSA 1FXLA 4K4ZA 1QSYA 3CULA 1RHRB 3FKBA 3OR2B 1HNVB 1DURA 3H90A 1ZZNA 4L74A 3UI3A 2PSZA 4RZRA 2QX0A 4CWBA 3ZZZA 3OW2R 3TI0A 2M0GB 2WHOA 1HNIA 2ALZA 4IG3B 1M1GA 1RADB 1LWCB 1TK8A 2XI3A 1M0SA 4P7TA 3H0PA 3D1OA 2DR7A 3OSNA 1FJEB 2HGLA 3UDEA 1VQPS 3MCNA 4RW6A 5CCLA 4FYDA 3IAM9 3IBCB 3NS7B 3V81A 4B9LA 3E8OA 2A18A 2N3LA 1T3NA 2BUNA 3SFUA 2ZH8A 3NXZA 4ZS6A 1SIWB 3V6DB 5F0WA 5M2RA 2YXLA 1XC9A 1Q78A 1X4HA 4Y2MA 4DJBA 3OL9A 4DX5A 3CCVS 2AEMA 3KJNB 5HATA 1OYDA 3KLIA 2RQKA 3W5XA 4OI4A 1SCJB 3OTDA 4ICLA 4BBYA 1ZETA 1IKVB 3ETMA 1M5SA 2DNLA 3E2EA 1HBNA 5LJ5Y 2UZAA 2RF2A 3H5UA 4ES1A 3FJ2A 3EPIA 4DPUA 1I51B 3OXFA 1ZYQA 3T1YF 2B9XA 4NLQA 4OZ0A 3HD1A 3WDOA 3LF0A 4YY3F 5KFRA 3M9OB 4DSFA 1C1BA 4B3OB 4ZPAA 3I31A 1UW4A 5HI7A 3NBPB 5F8IA 1SH0A 1DTQB 1FKPA 2W2MP 4CI0B 2QC3A 4DR3F 1XQIA 1JLQB 2JZ5A 1FDAA 5HL7Q 2YNFB 2YKNA 3HXMA 4C3MA 3EZ5A 4P2FA 4MIBA 2G9OA 1VS3A 3KLEA 4DUTA 3SMZA 4DPXA 3MTJA 3PW5A 1H2VZ 5HQ8A 2FLOA 3GIMA 3AD7C 4Q2LA 4TKTA 1URRA 2BJDA 1UJ5A 4OJ3A 4ALZA 4AL6A 2L41A 2OTLS 3KLFA 1IN0A 1BY9A 5ETKA 3MTKA 4X66F 2J8SA 3DLHA 2HLUA 5LSOA 2A6OA 4CO3A 2DY1A 1VBZA 3H7HB 2QMUB 1S1WB 1CPZA 1DJ0A 3CDEA 2D1CA 2Z58B 3T1HJ 2MZTA 3OLBA 1EQ0A 1LW2B 1PYOB 2LA6A 5F3ZA 1O6XA 1U2RA 4PQUA 1KEKA 1ZM3A 3OXLA 4I7FB 1RWOB 1HNWF 1T3OA 1U45A 2HFSA 1UFKA 3GFZA 4E98A 1KBRA 5D0EA 4A8FA 2FHJD 4IDKB 2AJQA 1B99A 2IJRA 2OKQA 4IRCA 3PNIA 4ID5B 2NXEA 2BBEA 3CD5A 2I5JB 5AE2A 1WC6A 3KJQB 1HR0F 2ZUAA 1FF2A 2DNRA 2KN4A 2IRYA 2KXHA 2R3VA 3PYFA 3GYGA 3M30B 2E5JA 2YY3A 2KG1A 1XNQJ 1Q86T 3OR1B 4LFCJ 5HMZA 4BC7A 3MURP 3A8KA 4HYKA 4ZP8A 4F4KA 3J81j 1X5PA 3I0RA 3A1YG 3JSMA 3SQGB 3KG0A 1X4BA 3UN2A 3RB3A 3J7A1 2PN6A 3PO5A 1FJCA 1RWXB 2QT7A 3CDBA 4JI2J 3A12A 3LA0A 2W7PA 4P72A 2IY5B 5F8NA 3NMAA 3H5SA 1NK9A 1NO8A 4UQTA 4LRDA 2BXJA 1KD1T 1ZBTA 3MM7A 3DLGB 5E5NA 3G8SA 2QFIA 1QAYA 3Q89A 1S99A 4YDDB 5CYQA 3W2VA 1P27B 4RW4B 4Q0BA 1U1KA 2HVDA 1YHQS 4O4RA 1U48A 2DKOB 3MPVA 4QU6A 1FKOB 1KR4A 4C0HA 2RDJA 4DPTA 2IM0A 5ETLA 3Q8RB 5CQGA 2U1AA 5KFOA 4J5OA 3C15A 1HIYA 1LXNA 3POTA 5DDRC 4GKJF 5L9XA 1RHKB 2HEKA 1RT7A 3W2WA 1KTVA 3M6UA 1DLOA 3R2CJ 4ANDA 3Q0AA 1L5UA 3AOCA 3EZUA 3TEGA 4KJIA 3J7YU 4KGXB 2Q1LA 4FNIA 5HBMA 5H9EJ 1WTFA 1PILA 2J6TA 5KG4A 3K58A 2SXLA 2GO8A 4BHQA 1GMWA 1JJCB 1HQ2A 1YZ7A 1HMVB 2ZH1A 2YH0A 4OX9J 2CPJA 4OV1A 1U1QA 4MYUA 4ITSA 4LIRA 1UZHA 2EG1A 3FCWA 4M5LA 1T02A 3FEZA 4R0JA 4J9MA 1REGX 2XMWA 1WOPA 3A13A 2AHOB 1VIOA 3SEOA 1FRXA 3TANA 1FTRA 3AD9C 2PIIA 2MHNA 2HK3A 3DOKA 5KFBA 1CJUB 5GMKa 5D0HA 2OD6A 2CJYB 2CQ0A 5K14A 1IJFB 2CJXB 2EEYA 2E1MC 3NCRA 5F8HA 1B0VA 1X4AA 1U6FA 1T7PA 5J2QB 1URNA 2PE8A 4LIWA 4IFYB 3ONQA 4ZVHA 1RTHB 3PW0A 2NUHA 2HRYA 2DPJA 3IG1B 4A8QA 4ZCIA 3EVOA 1FX2A 1DBDA 2E44A 5E41A 2BKNA 2RKIA 2AIRB 1WC4A 5KFWA 4OQJA 2IC3B 4F0MA 1T0TV 2AJ4A 3ILLA 2XSJA 2V6AA 1YTYA 4FNHA 1S6QA 1KQFB 3UD3P 1T9UA 2VPZB 2KI2A 2XYPB 4F4AA 3QRPA 4O3OA 5L46A 4C3KA 2XWYA 1FKAF 4FF3A 2MYFA 3M2UA 2XQCA 3X1LB 3Q8UA 3MEDA 1TAUA 2PI5A 2JEJA 1KOHA 5GAGI 5KFYA 1UA1A 1ZH5A 3QAUA 3VQTA 3CCZA 1AZSB 5KG2A 3FBFA 4WKRA 3KMQA 1H2UX 1VJQA 1S1UA 1JK9B 1JKHA 1X9MA 2RUSA 5F41A 1NNDA 1KHWA 2NXJA 5LXYA 4C11B 3MFHA 2ZKTA 4LVNP 5D4PA 4H4KA 4RUHA 4RLEA 1C4CA 1FRJA 2HSEB 1V5IB 5IQQA 4I4BA 2W4PA 3HVTA 4FF2A 2X1GA 1GX5A 4O44B 1FK9A 2HAFA 2VG7B 2ZM6F 2GMLA 2XMAA 4EBCA 1WSRA 3MOJB 1Q16B 4OHXA 2G1HA 2XZDB 3TUPA 1XR7A 3MM6A 1V6HA 3IBWA 5KFKA 2GNKA 2QSFA 4OYMA 4RBTA 1RGVA 3K59A 3DMJA 4EZ9A 1S72S 1IXKA 1UW9A 1JLAA 1LFPA 2ZJQQ 3LUYA 2NYHA 4IOCQ 5J2PA 3N6NA 1TKZB 5I3UA 7FDRA 1PGZA 1RSCA 3DRYA 1L3UA 3W66A 4DX8H 2VPXB 1VR6A 1CC8A 4NLSA 2PMHA 3Q23A 1TKTB 5HQMA 3WC2A 3MM5A 3UCZP 1WACA 2IHR1 2POKA 2ATCB 4AQYJ 3FRZA 4L6V3 3ZNJ1 4TU7A 3RAMA 1N6QB 1HI8A 3BGRA 1N34F 4K4XA 1WKJA 2DGWA 3QPIA 3K5PA 4OX7A 2PA8D 2CDRB 3K5NA 1NSKL 2RQMA 1HD0A 3N5FA 3EGZA 1OYEA 3G82B 3JXOA 2YKMB 3SQOP 2HMIB 1ZAVA 5THWA 3H20A 4DCJB 3BSOA 4OHYA 4GKKF 3SV3A 4I68A 2FLNA 2J6SA 5A0YB 4FDFA 2PEBA 1KQGB 1UAWA 1MWQA 4LQ9A 2UU9F 1WTBA 2B7CB 1S0VA 1B0TA 2RHQB 2CQ1A 1RTJA 5D0RA 2VU5A 1D1UA 4ZK7M 5HVGA 2J9DA 1YSJA 3M8QA 2R4FA 1RT2A 4JI0F 4OYXA 3AOBA 2O1PA 3MF5A 4LF9J 1LQ9A 3V2UC 2ATLA 4G1QA 2MKJA 5J2NA 3EX7B 1IKXB 2XHCA 3EE3A 2MZJA 3NOGA 2EBEA 4A8YA 1E6VB 3GU0A 4MK9A 1NK7A 1LWFA 2KXFA 1UA0A 4W90B 2MPUA 3PACA 1SKWA 3ENAA 4ZP7A 1Q82T 4A47A 1L3VA 4DR1J 3GIRA 4M1KA 3QLHB 2UXDJ 1V9OA 1JLCA 5EWEA 4OL8A 4RWXA 3SSSA 2F5GA 2J6UA 1W2IA 1RWNB 3KK3B 3QWUA 4KGKA 1UVLA 3HP6A 2O5DA 2CQIA 5A6WA 4CM2A 4B3RJ 5G0RA 4CO0A 1KWMA 2W4CA 1NSQA 3SXLA 1K1QA 1TFYA 4M5KA 4A8KA 3BSAA 3MR7A 2JVOA 2XMUA 1U1PA 4DV0F 5FDLA 2LECA 2W9CB 2KFZA 4MJKA 4WIQA 1UVKA 4HH0A 3I5CA 3DGVA 3AB2B 3M1VB 1LWCA 1WI8A 5CCMA 1TMMA 5B0AA 2ZHBA 3HJFA 4AT1B 3CIZA 2BQ3A 2JDJA 2IVYA 4RO0A 3E01A 1T05A 4ZVSB 2RRBA 3C6UA 3GG0A 3R5JB 2ZH7A 3RGIA 3RJMB 4TYBA 2AV5A 2KRBA 1X5TA 1YWXA 2RB7A 3CPWR 2IM2A 1SJFA 5KT6A 3G9CA 1U24A 3CXCR 4P9SA 3PY8A 2RUGA 2QLWA 1M90T 2UUAJ 3AQOA 2QJ3A 4ETZA 2HVEA 4JI1F 2NQPA 2R2SA 5I42B 3KLVA 4AXJA 1NK0A 3PDNA 3R27A 2DCLA 2L9NA 1VGYA 1IKVA 3IS9B 2JFKA 1I94J 1VQ7S 2FVQA 3Q8YA 2V8VA 3ZTRA 3DLKB 4I6WA 4KHMA 3VGUA 4IQMA 3D0HE 3PW2A 2L3MA 3B78A 1U4BA 3PR4A 2OPPB 1GX6A 3MMCA 2NPFA 2LCWA 1XMQJ 1BLUA 5DJBA 5KFVA 5KG5A 1WG1A 3UWTA 4NXMF 3NNHA 4B3OA 3KJFB 4WXWA 4PAAA 4PZVA 2QA4S 3C16B 5L1KA 1UVIA 3CC4S 1X60A 2UVVA 2QA2A 3LWLA 3PXGa 4YR3A 1U0HB 1UFLA 1NK5A 3OTOF 4FYXB 5HP1B 2OEMA 3IRXA 4CQ1A 1RT5B 3BPSP 3L7PA 3C6TB 4UUWA 3LAMA 2CVEA 3DOMA 3D28A 2ASJA 3EGVA 1FHTA 3BB5A 3M32B 3F56A 2P9GA 2C2MB 4JI6F 1GTHA 1S5ZA 4JI3J 3SCIE 3OJSA 4PG6A 2FPHX 4P6QA 4OYWA 1M5VC 1N54B 2Q79A 3ETOA 3UVJA 1S7IA 1HNZF 4LR8A 4ED1A 1ZM4A 3H2VE 4NCGB 4EK2A 3MM9A 1VQYA 1ZA1B 2FJVA 1PC4A 4DR2J 2A0FB 1PO6A 2VG6B 3JTOA 3MEGA 1S1WA 3KJVB 2AEJA 2LQBA 2OEJA 3M7VA 1FXDA 4C7QA 2BOPA 2H3EB 3DRSB 5LMUJ 1LW2A 2IRXA 4W4MA 5KFTA 3TA2A 2IBOA 4P7VA 1U47A 3DU5A 2VH7A 2LQ5A 2BJ8A 2K7KA 3NY0A 4F67A 4M5HA 4LUBA 4DQIA 2A2CA 2M8HA 1SQFA 2ILYA 2X51A 4J7CA 4IDKA 3JQJA 1HBOB 1SQEA 2OLWA 2QLFB 4ID5A 3K2YA 2FHMA 2C3YA 2NZCA 4FKYA 5I3PA 1NK6A 5L1LA 2BM1A 3FCVA 4YB5A 2BE7D 2QGFB 4N56A 1SPBP 5EWFA 1S12A 1NDLA 3KUGA 2FDNA 3FVYA 3UDLA 2KT3A 3GJRB 3C19A 2QFJA 4ZCMA 2XBPA 4X4SA 2HAIA 3FK4A 1F2GA 2GIQA 4UW2A 2MEWA 4U7UK 2P2CB 4X64J 5DG7A 5C24A 3SQGA 2D9PA 2MGZA 5AXMA 4OI6A 4Q43A 1RHMB 1DQAA 2Y1LB 5A8WA 1FNXH 1RB0A 2ASDA 3HFVA 3DLGA 1JLBB 3D0IE 3G8QA 3U1LA 2QYGA 4I1TA 4BC9A 1OSCA 3AB4B 1VBYA 4UTGA 4FF4A 2XYGB 2MY7A 4IH5A 4X4VA 3ITHA 3W9JA 4B3MJ 2HKEA 3U27A 2N7YA 2ZOFA 4DQPA 4C8MA 1JLFB 1N0UA 1S97A 3P4UB 1OY9A 2HWTA 2HHVA 2WSFC 1D09B 2VDHA 4WJBA 2IAJA 4RNHA 3GZ7A 2UUCF 1N5TA 2C3PA 4JV2A 4V19J 3RBDA 4AL5A 2RS8A 1PC5A 3EYZA 2N82B 1VQ8S 2KKHA 3HK2A 3BH6B 3SDEA 2B56A 2ZITA 1ZS6A 1N36F 3R5BA 2Z2ZA 3W63A 4QIGA 3HHLB 5DZ7A 3MFIA 4ELUA 3WX8A 1CVJA 3L95X 3PIOQ 3EVWA 3KHLA 1B64A 3M2VA 3ZZUA 1V3RA 3LO3A 2VD3A 3NWGA 4F4XA 1QSLA 3FDSA 2NZ4A 4RWWA 2WVCA 2QMXA 1WD6A 1WHYA 4LMZA 4X4PA 3U1NA 4F0HA 3MEKA 2KZMA 1NSAA 3PIPQ 2Y0SD 2M3DA 3TA0A 2ALYB 2JJ4D 5J2QA 5ETOA 3DYAB 4PPDA 1TVRB 1Q8LA 3M05A 1GNKA 2OHDA 1GEHA 3IXQA 4NXNF 2J9CA 2AF6A 2BYCA 1S0OA 2GHWA 2QMWA 1CLFA 4KHPJ 2CFXA 3CE8A 4C0OC 2H5EA 2XMMA 3EDQB 4J9KA 3DC2A 2CJQA 1TTHB 3JYTB 3P6YC 2FVPA 3HX9A 4BWMA 2MSTA 2HQ3A 1A7GE 2UVUA 3D6TB 3I5AA 2ZZMA 1U09A 3TX8A 5EX0A 3CC7S 3OL7A 4GO7X 2FLPA 3EICA 4JP8A 4MKBA 4CM0A 3DM2B 3QO9B 2PO4A 2LYVA 2QLBB 3P96A 2YQ3A 3K17A 2FUG9 1RYRA 1JNRB 2V2KA 1IJEB 4DHVA 5B09A 4ES3A 2XTJP 5D77A 1VHIA 3QJJA 3BKFA 3N5BA 4J90A 1S10A 2EI5A 2XMJA 4ED2A 3MMBB 3RUBL 2OEKA 4MKYA 4QPTA 4QYRA 1A9NB 1W7WA 1B7YB 2JFDA 4ED4A 2F9JA 1FFSB 3GFHA 3DOLA 3W9HA 2HNZB 1YRUA 2ZBCA 2M5YA 2I0XA 3KHRA 4B3SJ 3SYZA 3G2XA 4U9RA 2DD8S 3DGPA 3IGVA 3BR8A 4IG0B 4XDCA 2WW4A 2RMLA 2NSBA 5HJYA 4CLUA 1N33J 1YBAA 3T6JA 1WELA 3UO0A 4C4WA 2GZOA 1FJGJ 1RLDA 2VIHA 1KVIA 1WDTA 3V5RA 3OFHA 2NREA 2VJVA 3FBCA 2V4RA 3WIUA 1FA0A 4PCQA 5ETTA 1VQNS 1H73A 1RE1B 1JJ4A 2CWXA 4CLFA 3LALA 1YITS 3D4JA 3V4IA 2EFOA 3OSPA 4Y2KA 1PJ5A 2DNKA 1WEYA 1LW0B 1U2FA 3MCMA 2V8HA 3MAAA 2BMBA 3T3FA 1SUQB 3MECB 1C0TA 3OBIA 5E3AA 4ZLJA 1N6QA 4USJC 5HANA 1WDDA 3CF5Q 2QA1A 4QIFA 4LREA 1HNXF 4DFKA 4B9MA 3SSQA 2J7KA 2J76E 2F4VF 2WBRA 1X4GA 1MROA 4W92B 5ITHA 2DNGA 2XLJA 4GVLA 3U7JA 3G82A 2JNJA 3UFCX 1BQXA 1EKRA 5E3CA 1EETA 1U49A 2MY8A 5A2QU 3N01A 4LF6F 2EFVA 1SJ1A 2KXNB 3FZ2A 4NI2B 2XY5A 1MG7A 4R5PB 2PFDA 4ZVQB 1AW0A 3QMQA 4ED6A 1T03A 4JI4F 3KLHA 5DETA 4G3IA 1UEVA 2GIRA 4DSJA 2V8PA 3BREA 2ZH9A 4DR5F 2MKSA 4DS5A 1S4FA 2LFVA 4ECVA 4DR7F 2IYGA 5CZVA 2F7VA 5IM0A 2KFNA 4QW9A 3TRGA 4LFAJ 4UQGA 1ZTWA 1RWPB 3VVUA 1EP4A 2OD4A 3AT1B 4OZLA 1FRHA 3FQLA 4DDFA 2DH9A 3EGWB 3UCGA 4DV5J 3H5XA 4QR1A 3PX0A 3KG1A 1TL7A 1VCTA 2MZSA 4NLUA 3MR2A 4UF4A 3QLHA 1AYEA 3G71S 3NL0A 4R8UA 3IM9A 4AL7A 3HZGA 2IIHA 2QE5A 1H3DA 1SI9A 1IKYB 5GVQA 1Q5YA 1VRTA 1U8WA 3KTQA 5IWAF 4DF4A 2E5IA 4X62F 2CKWA 4EO6A 3EDRB 4TY9A 2CAJA 2GVZA 4DV3F 3C3LA 1SL0A 4OX6A 4WZMA 2D3ZA 4Q8FA 4W98A 1LOUA 3NGRA 2LA4A 3HHLD 3MDFA 4OZ1A 1TL3A 2E7WA 4Y3CA 5CH7B 1SQGA 2DEJA 1Y10A 2O3DA 5M2UA 2NCKL 2KT2A 4M63A 3GLJA 1YRTA 3EVMA 5J1EA 5CAAA 3UCUP 3NGDA 2CPZA 4M95A 2KJVA 3M8WA 1XNRF 2XWXA 2LXIA 1KN6A 8RUCA 4J91A 5B0BA 3L3CA 1RAJA 4Y6IA 3IN5A 1R8CA 2WBMA 5H9FK 1HNIB 2DXFA 3PTWA 5KG3A 1IKWA 4G6VB 1VBXA 4NYPA 2W01A 3TZZA 2DR9A 1QAIA 3R5DA 4DL3A 3KYLA 4DL0C 1EB0A 2V9KA 5DGBA 5BYRA 1NUEA 1O8BA 2K2PA 2MDAA 4F2RA 2LQJA 1IBMF 5EGYA 1GH8A 2PC6A 3NNAA 2KZZA 2YNIA 5KT2A 4JI3F 3V81B 1F6TA 1JMTA 5L38A 2EK1A 4DS4A 2DGQA 1GXTA 2VQFF 2W7AA 2E9RX 1Y00A 2HHWA 4K0KF 3I9ZA 3TQ1A 1U8SA 2HIYA 3H98A 4M5NA 2YNHA 3DLKA 4ILMA 2BRKA 2LEPA 3OTCA 2CA9A 1WC3A 2HYIB 3W9IA 1UTAA 4ICLB 3QSIA 3GJSB 2HVHA 4CT9A 1RCXB 2V63A 4QIVA 1HBNB 4M5GA 2RF2B 1SJRA 2UV8G 3KOAA 2PEHA 4EO8A 2YX1A 3PYDA 4I2QA 4ED0A 2ZVSA 2DISA 4NLXA 1Z2LA 3RYLA 3T5HA 1C1BB 2EPIA 3OL8A 5GAHI 1YVFA 4DV1J 1SC6A 5CZXA 2UVWA 2JX2A 1FKPB 2UUBF 2CPDA 1YKWA 1RISA 4QOTA 2Y8WA 3OFGA 2UXBF 1HQEA 2LEAA 5HLFB 5D15A 2YKNB 3R9LA 2JL9A 2C2NA 3KLEB 5KFSA 6FD1A 3GIIA 4NCGA 3SI8A 4ED3A 4O4GA 4JV5F 1R8HA 2YH1A 1X0FA 4DFJA 2C2RA 2VG6A 1HBUB 2DRAA 1EIYB 1GQEA 5AXKA 2BDPA 4DV7J 2DNPA 3IO1A 2J9EA 4IRDA 3R7NB 3HPOA 1LKZA 1TP7A 3GIJA 1RT4A 3AA9A 4IRKA 2GX8A 4O0NA 3GMGA 4DV2J 3MXHP 3FUYA 2XB2D 1AROP 4EYIB 4DFMA 1TL1A 4H4MA 4HT7A 4K4TA 2AEFA 5IV3A 4FF1A 1HBOA 1WEXA 5C42A 1R8BA 4PQUB 4KTQA 4L76A 2W9BA 5LSRA 4TLQA 3BBFA 2CPYA 1FDBA 2D9OA 2P9EA 3ILIA 2DIVA 2Z2MA 3RU0A 3TAQA 2QLJB 4KB7A 1X4DA 3MCOA 3LWMA 4CIOA 1IR2A 3DDNA 3HKZD 3AY0A 2MLXA 4QW8A 2HLTA 2CZ4A 1NU4A 3J7ZT 5F8JA 4CH0S 2F8MA 3M8YA 4DV4F 3NNCA 3BBBA 3THVA 3A8JA 1TUVA 3OPKA 3NGSA 2PMWA 3OQ2A 2D3O1 4NRUA 1MU2A 4K7QA 5B0DA 3JSMB 2FVSA 1OPIA 4CO5A 1IBLJ 2LP4A 2DTJA 1H72C 2OMOA 2QEXS 1VQ5S 3D6FB 4ZVTB 3PKMA 5KOWA 2AJFE 2FQQB 4C8KA 3U1MA 1FNOA 2F1FA 3MM7B 1NPPA 2E1PA 2E5LJ 3IBFB 4EEYA 1J2VA 2I9SA 5HMWA 3R8YA 5CYQB 3W2VB 5C25A 5KFQA 3O1LA 4Q0BB 2B43A 2R8GA 4RL1A 1RAAB 2HQCA 2B51A 1XEZA 3P3DA 3BR9A 5A76A 5CHCB 3BKTA 3HVAA 3PW7A 1APSA 4O3SA 3ZTOA 3BQ2A 1X5OA 5SUHA 4DG1A 2BM0A 1YX2A 3J81Y 3C15B 3CMES 4N77A 2IDEA 3LP0A 1BWVA 1VQKS 2GCFA 1RT7B 4PKDB 3W2WB 2BJ7A 1DLOB 2P9CA 2Z4PA 1T95A 4OHVA 3P5TL 4PEOA 5K8MA 3NAHA 2DGXA 4LF8F 1Y11A 4F7VA 8AT1B 1B3TA 2H65B 4DR6J 3R97A 4XDDA 1YJ7A 4TU9A 3TZWA 1TMJA 2OPRA 3BH7B 3M6XA 2XEXA 1QE1A 1PAEX 4Y2AA 1FRMA 4DQQA 4LRBA 4J9NA 4CLSA 1HA1A 3J7Z5 4AFFA 4ZPDA 2H4YB 3ILJA 3GCXP 2NSCA 4YHHJ 4HKQA 2B4VA 3GV5B 2OTJS 3DYAA 1NPRA 3DOKB 3BO2A 1H74A 4PWDA 2V2ZA 2QZ8A 5K14B 2HHXA 1ZPWX 4FYYB 2LVWA 3KNGA 3VZHA 4X65J 2YWEA 1QSSA 3PW4A 5D78A 2EC0A 4Z7YA 1MNEA 3UN3A 4LFBJ 2PA3A 2HWIA 3DLEA 3SCJE 2CQCA 3QT6A 2GQCA 1FVSA 1FD2A 2DB1A 2FZCB 4QWBA 4KRWA 1ULRA 4WFNQ 2DNNA 3KK2A 4EBDA 2BV3A 3ZXWA 2DNMA 5D3GB 2R7OA 4CNYA 5IZHA 4GC7A 2VZ9A 2VQEJ 2XLKA 3C66A 2RKIB 4KH1B 3W64A 2F9DA 2ZJRQ 1HW9A 4DR4F 4DL2A 2BW2A 2XSJB 5DG8A 2IMWP 3CJKA 5ADZA 2RD5C 1S6QB 3KXDA 2QSWA 2YPZA 4C8YA 3MR5A 2C2DA 4PUOA 2NLWA 4K5SA 1VRQC 5D4NA 1TV6A 4K4SA 4IH6A 2Y8YA 1RWWB 3BS9A 4U7UD 3I55S 4WBFA 3OJUA 4A8WA 5J2MA 4DPOA 2ZBQA 2KHCA 3M2UB 2HNYA 1NMEB 2P5VA 4USWA 1V3ZA 3HD2A 3Q24A 4DQSA 1QAJA 3MEDB 4B02A 4MKVA 3J81U 3W61A 4FXWA 4I6AA 1S9EA 1LEOA 1YJWS 2XC9A 4WP8A 3WZ0A 5DQIA 1GK8A 2ZHOA 1S1UB 1JKHB 1RHUB 3WQPA 3MUMP 4K4WA 4IG0A 4NA2A 2DHXA 2YQ0A 4ANCA 3ZTSA 1VYAA 3HMJG 2KDOA 3GR1A 2M88A 2GAHC 1F5AA 2F8HA 2LU2A 3J7AN 3NEKA 2MQQA 4B9VA 4B3TJ 1DQ8A 3IM8A 3V6KA 3EM1A 5EDWA 1VJWA 3CCMS 3B8HA 1BGXT 5HK4A 3MHYA 1BD6A 2RRAA 4YR0A 1FK9B 2RVJA 5GAEU 3OVBA 1XK8A 4Q2MA 4ZMMA 4PR6A 2V4JA 1C0UA 4RBVA 3S7RA 3PCOB 3BO4A 3MM6B 3CUNA 3ZTQA 1F9EB 4KPCA 5H9FJ 2JH3A 1FWPA 2XI2A 3DMJB 3HHEA 4LF5J 1CJVB 1JLAB 1Z2ZA 1M5OC 1YIJS 1ZAXA 2UXCF 5B0EA 5J2PB 1NJIT 1O0PA 3H4BA 4DV5F 1IM4A 3TJAA 2F8EX 5KFCA 2V2QA 4L3KA 2WOMA 4M5DA 2XZWA 4GVBB 4F4YA 3GILA 2DGSA 2W1BA 2EFNA 4GC6A 3MM5B 4E0DA 3DCAA 5L1IA 4DUYJ 5LMNF 2YBVA 2WZ1A 2E5GA 5KT7A 1C2PA 4WP3A 4ZPVR 4R25A 1PIEA 1JJHA 2VFSA 2DEIA 3RB6A 3BGRB 5FIIA 3EUNA 3J7YI 3FMWA 2MZQA 2GHPA 2C2ZB 1S49A 2D3UA 2AD9A 3HVRA 4DWIA 3N79A 5F8GA 3PYEA 3KG4A 1GFWB 4O3NA 3OTEA 5JUMA 4C8NA 3ZZPA 2MQMA 3W65A 1RTJB 4PQAA 5DS7A 3ELHA 3M8QB 3IR5B 1VQ9S 4X4UA 1RT2B 4IH7A 1PJ7A 2XLIA 2DO0A 4G1QB 1JIHA 5KFJA 5L1JA 1S6PA 2JEGA 3PVXA 3TJ9A 5KFXA 4XIUA 4EZ6A 3LANA 1LWFB 5HSPA 4IYQA 1R0AA 2WVDA 2XY6A 1VBKA 2HFUA 1KC8T 1KLMA 1BXNA 3ZFVA 3TAPA 1RT6A 2J0XA 1IWAA 2KL8A 2W2PP 1M1KT 2BJ3A 2F63A 4ZPTR 3M8RA 1JLCB 2HQIA 5AJ3J 4DV6J 1U6BA 2XYHB 3RRGA 2ZC4A 5J1PA 4MTPA 5DLFA 3DI6B 2VG5A 1VC6A 1D9AA 3PX6A 3DXBA 3UD5A 4DUZJ 1FDNA 1GMWD 2AKWB 4NLYA 5G0RB 1GMVA 4PWUA 3TR5A 4OYZA 2RQCA 2Z2YB 1TQLA 2K3KA 5FDLB 5U47A 2GO9A 1S76D 5KTQA 2MKCA 3T6BA 4DX7A 1UEKA 4RNFA 1NDCA 3KLGA 2MXYA 4JI8F 4JYAF 1Z4UA 4LR9A 1R89A 4IFVB 2ZZTA 4X4NA 5KFFA 2HFVA 4MAKA 2YX4A 3E01B 1T05B 1XBWA 1X9SA 5EWGA 4CCHA 2J0QD 4ZOSA 3C6UB 3TJ8A 2CUYA 3IR6B 3CJ0A 5BR8J 2G13A 4JB8B 2IMOA 5J1NA 4PYAA 4DX6A 2LDIA 2G1DA 2GJIA 2VKZG 4KYZA 4QIEA 1XERA 3VGSA 3HKWA 1NKEA 3GE9A 1NJWA 2YKAA 5KG1A 1XMOF 1TAQA 3CT9A 3TVYA 1S4EA 2YWGA 5KFIA 2AGOA 2AYGA 4B9UA 1XJWB 1J5EF 2R7VA 3BDEA 1REVA 1WHVA 2VFVA 4DV7F 5DDOC 3NP5A 1FI4A 2K1RB 1ZTTA 4CLWA 3M8ZA 3NOCA 3BGOP 4HLBA 4DN9A 2FY1A 1G7CB 2F65A 2X1AA 3T9ZA 4FN5A 2B5JA 4WXOA 1ZM9A 3MMCB 3IA0A 1QJHA 1HLWA 4JI7J 2JLEA 1YJRA 5AT1B 2MB0B 5KFZA 5K9FA 4OZ5A 1KVKA 1VQSA 1ZPVA 4NWBA 3AXMA 2LQ9A 4J9SA 2HHHF 5ETMA 5G4DA 1R6YA 2DRDA 3R5CA 3MR6A 3WIVA 5HLFA 3IRXB 4JUZA 1QY7A 4PPZA 2G0CA 3C14B 3I96A 5HROB 3DOMB 3LH2S 1LWXA 4KFBA 4WTYA 5E2QA 1RT1A 3M8PA 2RNEA 3HHNB 3WX4A 4DSEA 3T1AA 3OVSA 4RUCA 5F9LA 1HBUA 2FTRA 2RRNA 3QNWB 1YDLA 5CD4A 3UVJB 3RB4A 3UN5A 2FJDB 3W8GA 3A3NB 4P2XA 2ZDPA 1FXRA 2RQ4A 3MM9B 2FZKB 5DO2A 4ZVEA 4USMA 3CC2S 3RTVA 3AJ1A 2C3UA 1RHQB 3MEGB 1RZMA 2FJXA 5DQGA 4GRSA 2XS2A 3QGGA 1X7VA 1RQ0A 1BQNA 4KBIA 1R3NA 4ZJLA 4JI5J 2XGPA 3BYPA 1M1HA 5LOQA 2Q6BA 1S6OA 1Y3KA 1SC1B 4LR7A 1N32F 4IOBA 1IBKF 3Q8SB 3D66A 2W8LA 1YJUA 1SKRA 2PD1A 2L9WA 5DDPC 2MKIA 2ZD1A 3H40A 1UJ4A 4I6YA 1S6UA 2E66A 4USVA 3WC0A 3I56S 2V69A 4ZN3A 2Y1IA 1FFGB 1EX8A 2K06A 1T8EA 1RWKB 5L39A 3TYTA 3NGKA 2C3OA 3BQ1A 3QGHA 2VBWA 2O01C 3BSNA 3HULA 3E3XA 1MWYA 2KRRA 5E3QA 5C24B 4NLWA 3I0SB 1N5YA 2MGZB 1BE4A 4OYAA 3GSIA 3EXYA 3BO3A 3OTBA 2NUUG 3PX4A 4QWAA 1Q1KA 3AHPA 5A8WB 1HD1A 3TW0A 3QZ8A 2CIMA 3RB0A 5AE1A 2XNQA 2JC0A 4WFYA 2JRSA 4WFXA 3THPA 1RAHB 1X5SA 3CCES 4RJVA 2H4WB 1SVDA 3EWGA 2BKOA 4HTJA 2R2RA 3F41A 1WG4A 2QL5B 2DCUB 1YG0A 3ITHB 3NGTA 2HGMA 3OT9A 3FGVA 5LSLA 3GWCA 1UFWA 4PXBA 1IBCB 4X4RA 1VISA 1HBMB 2HQGA 5CABA 4FS2A 2MKYA 5KFUA 3T1YJ 3KMSA 2CJAA 1H7XA 1UVMA 1QVFR 1G6BA 2IAJB 4NLRA 4Y00A 4YY3J 3LPYA 4OZNA 2FGOA 2ZH6A 3D54A 1Q8BA 3BZQA 2CRLA 3BYRA 3BGFA 3SDEB 4DR3J 4DFPA 2C22A 2KYXA 3H4DA 3GR0A 3HHLC 2VC1A 3D68A 1CSJA 4LF4F 2G2ZA 1HKAA 2QO3A 1PYSB 1EKSA 2B0GA 4N5SA 1M5KC 2B7BB 4TY8A 5ETSA 3M2VB 2D3OR 2E1CA 2R8JA 2R8HA 1NHKL 2EK6A 4Q45A 1JXLA 4BWJA 4B9SA 4ZPCA 3B82A 4K8RA 4WE1A 1NCLA 3LQVA 3QWPA 4DL4A 2NYIA 2ZBPA 4DZDA 4X66J 2X3GA 2FD2A 2RS2A 3KK1A 1X9WA 1VDHA 2FYXA 3TX0A 2BR0A 2K3IA 1S1VA 1S57A 1OIAA 2NR0A 4K2XA 3BGUA 3K5MA 1HNWJ 4LSZB 1VLYA 3VHQA 3GIKA 2BABA 5D3GA 1IQZA 4RUBA 2WONA 4U6PA 4ZP6A 2MQ8A 4UUXA 1N4LA 3MPWA 3RG6A 3RAXA 4HDGA 2VA2A 4NA1A 3CJ5A 4K59A 3TZYA 1G4CA 1NKCA 2BANA 1U6ZA 5HVHA 3H42A 2ZE2B 3OVAA 3AFGA 4DL6A 2MHEA 2FC8A 1HR0J 3PFOA 2C1EB 3TOQA 5DM7Q 3FBEA 3KDNA 4ZA1A 3ZNUA 1YI2S 1WEZA 1FWLA 4CRJA 4LF5F 4EGLA 4Y0FA 1PKUA 3VAFA 2HHTA 2WVFA 1HQUB 5HAOA 2CNOB 3M2RA 5CXTA 1KNZA 4KR0B 3VAJA 1YJ9S 3TUJC 3ADAC 2GHVC 1FE4A 4NOHA 1XN9A 1FD8A 4KKOA 3BGLA 5FD1A 2IYIA 3ULHA 2OPSA 3DOLB 2OAUA 2AYMA 2MTLA 2VF3A 3NS6A 3T5KA 3CCUS 3NGUA 1O51A 3DGPB 3DLJA 3EGNA 2IJFA 2HNDA 2R7RA 1HWLA 4J37A 4ILLA 4I67A 2OH2A 3LAKA 2GGPA 4RU9A 1DFDA 1R0BG 3HVWA 2Z56B 1NBEB 5E33A 5A8RA 4OI0A 3NG8A 3ENWA 4LF7F 3DHXA 4K4YA 2Z0GA 2VASA 4J9QA 3VAIA 4PG4A 2DPIA 3UW1A 1K0TA 2VJUA 4U8YA 3THTA 1F3FA 5BJRA 4GKJJ 2C28A 1CJVA 1AFJA 1HWUA 3CJTA 2ZFHA 3PV8A 5JJBA 2M8DB 1OQ3A 2DNOA 5ETNA 4EWTA 2MQPA 1ZZFA 3V4IB 2HZVA 4GVBA 3H2LA 3CCJS 4ATNA 3F44A 3WBZA 2WTFA 3RR7A 1JLEB 3MAAB 3T41A 4FYWB 4ZJOA 1C0TB 4RU2A 2V8GA 3A8IA 3G8TA 2ZUGA 1RA7A 3GJQB 3LGHA 3CWJA 4Y65A 4YQWA 2XG8A 2GAGC 1MROB 1E6YA 4Q8EA 3SZ2A 5KFAA 2ZVIA 4U7CA 4MK8A 5EUHA 1XMBA 2GA7A 3UQSA 2XGQA 3O44A 2WSEC 2GVDA 4HI1A 2XMTA 2CADA 2HHQA 1NJYA 1EETB 2W25A 4J9VA 2FB0A 4K4VA 3CNQP 3CJ4A 1T9XA 3FNNA 3JQMA 1VOMA 1VIXA 4CO2A 3ISND 1T03B 1FVQA 3KLHB 3DLBA 2CG8A 1CJKA 4L73A 2KJWA 3UDVA 2D74B 2CVIA 4DBQA 2G2OA 5F8MA 3W62A 2VV5A 5IOLA 1SL1A 3D5MA 5IM0B 3G6XA 3L4BC 4O3QA 1TKDA 1CS4A 1EP4B 4Z7CA 3I9V9 2GJ2A 2EC2A 3JTPA 3JS9A 3IWXA 4RUAA 5HO4A 2R7SA 2FJEB 3A4TA 1UWAA 1TL7B 4OI1A 2DYAA 3R7SB 4ZIVA 2R7TA 4QPXA 3HF5A 4H54A 1WKLA 1QAXA 4PWWA 3O6QA 4R8UB 4RKUC 3Q83A 4L72B 4K5RA 3QT5A 4OI2A 1CBKA 2HFNA 2CPFA 1VRTB 4KV8A 1TZ0A 2E1AA 3DI6A 1ITPA 2GVZB 3NKYA 2MLZA 2B9EA 3Q22A 4B9TA 2GMHA 2PI4A 1G3OA 1RT3A 3GPAA 4QYZK 3AJDA 2J8AA 5EN1A 1Q4RA 3FC9A 2DVIA 3X3UA 1TL3B 3QJPA 2HQFA 4H4OA 3LTOA 1JWWA 4ZHRA 5J1EB 4AXIA 1P9QC 1R6VA 4IFVA 3AH6A 4YFUA 2PMZD 3PFEA 5B0GA 2FHKA 2ZM6J 2ZH4A 4HACB 9ATCB 3VZIA 1Y0HA 4NYZA 4WYLA 3SBMA 1IKWB 1RXOB 3KUEA 2R2UA 4JOUA 3R5GA 3ZC4A 3JAMY 1KSPA 4A4JA 3QAEA 4LRCA 3TUIC 2VFRA 1KONA 2HBYB 3MEEA 4E2FB 4I64A 2OI2A 3OXGA 1RHJB 1NJZA 4M5IA 2XNRA 2H9ZA 5CD4H 2NS1B 3BN7A 2QA4G 4KT0C 1RWUA 1JJ2R 1RABB 1Y5IB 3HCXA 2YNIB 4C9DA 5K5MA 1CQMA 3GP9A 2FZGB 4O0IA 4ZITA 1XTZA 2MJNA 2ZNZA 3LGMA 4ECXA 2HS3A 3B4DA 1TL5A 2K1RA 1N34J 3JSYA 2YNHB 3DKDA 1RBLA 2J0SD 4PG5A 3T1HF 2W4DA 2BEFA 2XZTB 3T5JA 4KGMA 4OYOA 1KFDA 3PHTA 2M52A 1SB6A 2AQ4A 2B9WA 2C2KB 2XULA 1NDKA 2HVIA 3MPUB 4I2QB 1K44A 4GKKJ 1RTDA 3KWMA 1MMDA 2J7WA 1UWBB 4HI2A 2UU9J 3H5YA 3C14A 5IXUA 2XHWA 5HN0A 5HROA 3QT7A 4ECSA 3CJRA 1HHQA 2KH9A 4WTOB 3F0NA 4V1Ak 2DNHA 2W2OP 3DRRA 1HWKA 3U02A 3N28A 4JI0J 5C5JA 1HQEB 1TUGB 1AUDA 4ECUA 4DZ6A 2R9LA 1LV5A 4LQ3A 1XNQF 1TKXA 4LFCF 1SC3B 2AX1A 4P73A 2NPIA 2JSXA 4TNOA 2JEFA 4F4ZA 2HPUA 1ICEB 4O4GB 2ACMA 4Z2XA 2J9DE 3QYYA 3PEHA 3L9ZA 4ED5A 2ZC3A 1IQTA 1GTEA 1QUVA 5CA5A 3ET6A 4ECYA 2KFYA 1M5PC 1VQ6S 1RTZA 2DHHA 1VRUA 2HRTA 4JI2F 3I87A 3JAMU 4WK1A 3MOZA 3MUVP 1H0HB 1QTMA 1RT4B 3C2PA 1V5VA 2BQUA 2DNYA 5FJ4A 2KM8C 5KG7A 3KKFA 3TZXA 2YWHA 1CULA 1NSPA 5EHHA 1TL1B 4H4MB 2BE2A 1DY3A 1EARA 3ISZA 1R27B 2EVZA 3ZZYA 1SV5A 5C42B 4C98A 3VV2B 2W9BB 2DIUA 2JWNA 2HBQB 3O3LA 2WW8A 2B6AA 3K0JA 5T7LA 3L09A 4I0WA 4NA3A 1F0XA 1YQHA 4DV0J 3QRQA 4F04B 2OSQA 1HL6A 2KHDA 4PXCA 3RBZA 3OFEA 1F2HA 1YBTA 4MFBA 1D0EA 1HI1A 3R1HA 4URGA 2V4QA 4PRFA 1SH2A 1Q0NA 5F0UA 2FHOB 3FSYA 2IVMA 2HZCA 3I0SA 1WNEA 3S01A 4RW8A 4QZVB 2BA9A 4OX9F 1MMLA 2BRLA 1MU2B 5CYMA 1RKIA 4OJHA 4QWDA 3OUYB 2B8PA 4J9LA 4LSNA 4JI1J 3LP2A 2BVZA 2RILA 4YP3A 4YN3B 3K8VA 2DGUA 1LWEA 1RAGB 1N52B 2I8EA 4A8XA 3V6HA 1NDPA 3MAHA 5A8KA 4LBPA 4HT5A 5C25B 2DT9A 1HBMA 3MM8A 2YKOA 3OFFA 1SH3A 1BHNA 3P45B 1D8ZA 1S48A 4OYBA 1NRKA 3WHIA 4FBUA 4NXMJ 2ROPA 1C1CA 3DLLQ 2RSQA 1OY8A 4CP5A 4P74A 4DG1B 5LXRA 4F36A 1P1LA 3UR0A 4P2SA 4GO5X 2QYCA 3LP0B 3RBXA 3OTOJ 4NYOA 4OI3A 1NH8A 2W2QP 4JV1A 2JVRA 3AQPA 2EKNA 1FWKA 2G4BA 2UVRA 1Q8KA 1RDRA 3TA1A 3K5LA 4JI6J 2OUGA 2EFQA 3UR3C 1KLNA 3RAQA 1P8GA 2HWHA 2KT5A 4ZCKA 2OPRB 1QE1B 4YUDA 1HNZJ 2OP5A 4A8SA 2CQPA 1ZAWA 1HARA 2DNQA 4HDHA 2GQQA 2VOPA 4TXSA 4YB1P 1S9FA 1KFSA 3R6LB 3RR8A 4PWDB 2Q6CA 4IUFA 1NK4A 1P6TA 2CQ2A 3QFHA 4ERDA 3FEYB 4X4TA 3AAWB 1U1MA 3KNAA 4KPYA 2VFUA 1NB2A 2CQGA 1Q8IA 2VDIA 4D3GA 2HHSA 3DLEB 4UOCA 1RBOB 4ELVA 4ELTA 2CQHA 3JSBA 1UVJA 2HHPA 3KK2B 1PSDA 1WHXA 4KO0A 4MMOA 2ZE2A 2PGCA 4QCLA 1X4EA 4ED8A 4KIAA 3W1YC 4OZ2A 3G6YA 2X3DA 2Z8QA 1PCAA 2IA0A 3VF0B 1NZ8A 4RW9A 3CJKB 1FRIA 4WU3A 2XS7A 4RW7A 5BXIA 3BN4A 4F0KA 1YJVA 1G2EA 3I4HX 5A2QY 1X4FA 1F5CA 2E7VA 4PUOB 1NEEA 1D8YA 3MD1A 1TV6B 1HQUA 4C48A 1S1TA 4I2PB 4URQU 2XO7A 1N8RT 5J2MB 1L3SA 3AODA 3P8BB 3CIMA 1OWXA 2HNYB 5B7WA 3AOAA 1FFWB 1UETA 3KUHA 2OPQA 4YDXA 1U0SA 3UNGC 3GJTB 4AQYF 4FKXA 4CTAB 3FFIA 4NLGA 1CJTA 3ENVA 1WF1A 1S9EB 3FMBA 2DO4A 2GQ2A 4X4OA 4EU0A 3J80Y 1N56A 2ASYA 4CLZA 2ZEJA 4H4KC 4E8UA 4QYZJ 2CXEA 1YLXA 1EZZB 2MQLA 2HVZA 2DGTA 1Y5NB 2EWHA 5DM6Q 3BM7A 5T41A 2VBYA 2G0JA 3MPDA 5IT0A 1JQGA 2LXFA 2I2YA 2ZOGA 2V4JB 1C0UB 2W24A 2UUCJ 5F9NA 2HG4A 4WFZA 1FRLA 1JNZB 4LF9F 1QD1A 3AD8C 1RTIA 3QGPA 1JLEA 4TQRA 3KDOA 2Y9HA 2LQ8A 2MSSA 2Z2LA 3BF4A 4CLTA 1N36J 2HRUA 5HVFA 3HJVA 1XR5A 4DCPB 2WOMB 3GFXA 4M5DB 3M8SA 3TNVA 3UNYA 4NL5A 2ROGA 1HPZA 3Q86A 1NPKA 1S0NA 3QIPA 4DR1F 3SFGA 2JLFA 3L7OA 7FD1A 2M4MA 3JB9k 2UXDF 3TEHB 3GV8B 2QN6B 2B4OA 2UV8A 5D0GA 1NJXA 2ADBA 3BJYA 3N4WA 5IQ6A 3PKYA 2E7XA 1FNMA 3CJ3A 2E9ZA 1X4CA 1UKUA 2VBXA 4YB6A 1DTTB 4FYVB 6AT1B 1VQLS 2BKPA 3O8WA 1PJ6A 1R8PA 4B3RF 4RX6A 3OD2A 1UPPA 1U25A 1RACB 5K20B 1T9YA 4NXNJ 4AUKA 1SKUB 4PXEA 3VVTA 4XAKA 2GJFA 3NAIA 4K4UA 4ZLNA 3AJ2A 1U26A 2ZKUA 2DY9A 2OELA 4M8LA 4CYUA 2N3OA 4NEZA 3J80U 5DRKA 3S1TA 5ETRA 3VR1A 3BKUA 4CLKA 4ZN1A 4BLGA 2CJ9A 4JV0A 4ED7A 2Q3PA 2WCXA 1S79A 1R7IA 2ZH5A 1YZ6A 4A8OA 3EPGA 4WF9Q 1S6PB 4LVOP 3VQSA 5AXNA 2HFZA 1T9TA 4C0BA 2WSCC 2ILZA 1R0AB 3D2WA 1QTNB 1KLMB 4F25A 3G6VA 2JEIA 4ZLLA 3SIPB 4ES2A 3HHKA 2H48B 1RT6B 2UUAF 1WF2A 2FHJA 1WC0A 2VKRA 2ZBRA 4DSLA 3GFYA 1DHMA 1NB7A 2XY7A 2R7UA 3O5TB 1I94F 4NRTA 3TVZA 4UOFA 4OMFG 1U1RA 3PO4A 2VG5B 2V5HG 4YS2A 4N41A 2OO4A 4DN0A 3VCDA 3VTIA 1JLGA 3ZZRA 2FVRA 3CJSA 1UMJA 1XMQF 1S77D 1NZAA 1ZM2A 3R1LA 3H25A 2FJWA 1BWEA 2RIJA 1SJQA 5KFGA 4HACA 4TVAB 2IA6A 2MKKA 4PG8A 4USIA 2RU9A 3RBEA 3S6EA 3PYGA 1VFJA 3KLGB 3D67A 1QUPA 1RU1A 3OV7A 3ZO7A 2OIHA 1G1XA 2V94A 1IM6A 2WVBA 1HI0P 1K47A 3QBCA 5E0OA 2W8KA 2YKPA 3TP2A 1WOOA 4C8LA 3O2IA 5KAKA 4XPEA 2XCPA 2YWFA 1Q7YT 4F8RA 3ZTPA 1U02A 1KTQA 4L75A 2AMCB 3Q2SC 1EAYC 5GAEI 3MUTP 3LP1B 2DJWA 3QT8A 1HYSA 4ZVFA 4FS1A 1U1LA 1F3VA 3A8EA 2VOOA 4S0MA 2NXCA 2R7QA 2L9DA 3TAMB 1N0VC 1HNXJ 4DR2F 1K8AT 1XIQA 1REVB 2OMLA 5DZ6A 2X1FA 2UUTA 3H8YA 2OSRA 3MMJA 2F4VJ 4KSEB 1S1XB 1NH7A 4BS2A 2UP1A 1KKHA 5LMUF 4LSLB 2KTQA 1RWMB 4EI2A 1SBRA 1VC0A 4QR2A 3BQ0A 1WI6A 1PAUB 1SJ3P 2MLYA 1KOOA 2A2DA 4QIWD 2F40A 3CD6S 2B5JB 4LF6J 3GV7B 1WORA 4LF2A 1DZ5A 3PJWA 2BX6A 2DRBA 2CJBA 3UE2A 3OR2A 1HNVA 2YQ1A 2APOA 1UWBA 2AZ1A 4JI4J 3A3OB 4KAIA 2VPYB 3CO9A 5L9NA 2MQNA 4DOZA 1KS2A 4DR5J 3FZBA 3V4MA 2D7SA 2OGUA 3SCLE 1WKKA 5CYJA 2HS4A 4DXLA 4IG3A 4DR7J 1H38A 1K73T 1OY6A 2V8DA 2GC8A 2O66A 3OHBA 4KFBB 2YNGB 5C7PA 4WZQA 3OLAA 2CYYA 4KQZA 1RT1B 3M8PB 4QBUA 4X64F 5LM7E 2GIFA 4Y2IA 2JLGA 1HHSA 3TUZC 4N8NA 2J0WA 4ENOA 4OLOA 4OYIA 2JC1A 1NXIA 3CSKA 3V6DA 4USHA 2H5IB 1Q7LB 2DNZA 4BDPA 5HMXA 1Y4ZB 3BEGB 3RRHA 3QATA 5KG6A 3W7BA 4PYDA 2AJ0A 5K8PA 5IWAJ 3RZAA 3M6WA 2C42A 4X62J 4G1IA 3LW5C 5GADI 4DV3J 5D6GA 1DRZA 3HHDA 1ACMB 1OQ6A 4HHHA 2LKZA 1OPZA 1FRKA 2XM3A 2X1BA 1BQNB 4DI6A 1J5OB 3CEDA 1RLCL 2PFFB 5KFMA 4B3MF 4LRFA 2C3MA 1FCAA 1D9DA 1GMUA 3QRRA 2M70A 3IMQJ 1B7FA 3M9NB 2GV1A 2F3JA 2ZD1B 1DQ9A 4B9NA 1XNRJ 4MH8A 3CCRS 4JBCA 5DG9A 2K8GA 2AJ2A 5M2PA 3Q8QB 1Q53A 5KFDA 3NBPA 1DTQA 3MD3A 5IFMA 2CDQA 1K1SA 3Q8PB 1JLQA 1YK9A 2RHSB 2YNFA 3I6PA 1UEUA 2VBZA 5DLGA 2MZ1A 4HHUA 1B4SA 4DCOB 4UOHA 3CGIA 4P52A 2EKYA 1IBMJ 4CLYA 3C46A 1T94A 5IC4B 5JVGQ 3ISNC 1WUUA 3JQKA 1N5YB 2J7UA 4C8ZA 3D3CJ 3MAQA 3OUYA 3MMAB 4NCBA 1JXVA 2EFGA 3CJ8A 3VAKA 1Q79A 4DSKA 4D3HA 2RT3A 5KT4A 3Q8VA 2VQFJ 4OHZA 3VGTA 1BMQB 4K0KJ 9RUBA 1F9FA 5GMEA 3V6JA 4QQBA 3I4PA 1IVZA 2AGPA 4NMLA 1GAOA 4NLDA 4WKYA 2ASLA 4UY8T 2I1RA 1S9GB 1EHWA 2CG4A 3VAMA 2KB2A 5JMNA 2EBGA 4KHPF 3VWSA 1TFWA 1R43A 4I7FA 4ZVUB 4USUA 4KGZB 4QJVA 1F9HA 1NM2A 3E51A 4EYHB 5AXLA 1LK7A 1D9FA 2CWKA 4ZVOB 4F3QA 4F4WA 2I5JA 2NXUA 3SV4A 5GAGU 4O23A 3LPEA 2UUBJ 2W7OA 5B08A 2Y1RI 2UXBJ 3D1QA 3M30A 1NHUA 1HW8A 1MLAA 5F8LA 1AUSL 2QV6A 3OR1A 2YVSA 3EMTA 3HSDA 3DNCA 2XMKA 2YPYA 2RH3A 4TY8B 1K9MT 3DRPB 4JV5J 1KHVA 2M2BA 4DL7A 4HR2A 2KU7A 2BQRA 4IO1A 3IP0A 4WE1B 1FTCA 3K8WA 1SC4B 2CNLB 2HHUA 1BC6A 2O67A 2WB4A 3KFWX 1B70B 3KK1B 2B3TB 3CCSS 4B3SF 1H2TZ 3D0GE 1R31A 2I6WA 4G1PA 1F60B 1N5VA 4OLPA 1S1VB 4RW4A 5GMDA 1N33F 4O3RA 4EMDA 5JXSA 2FVCA 2WONB 1FJGF 2AZ3A 1FKOA 4XPCA 3BDPA 2AYBA 1J27A 5BYSA 4UY85 1ZA2B 2QG9B 3CDAA 2YTCA 3DRXA 2CZVC 4PABA 1RBAA 2BANB 5E3RA 2B4UA 4KY3A 1RYSA 4I2PA 1C4AA 3PR5B 5C2CA 2AU0A 4FXVA 1VQ4S 4TU8A 2DK2A 5KOXA 3PJ9A 1RAOA 4DV4J 1BQMB 3M4XA 1BUXA 4M5JA 2VODA 1H98A 3MZIA 1HMVA 1WWHA 2ZBIA 3M2RB
chains in the Genus database with same CATH topology
5L38A 4CTAA 2EK1A 4A8FA 3DLBA 2R8KA 2FHJD 4DS4A 2DGQA 4KC5A 4IDKB 2AJQA 2KJWA 4X2BA 2OKQA 5HMYA 4RNMA 4IRCA 1GXTA 2VQFF 4KKOB 2W7AA 2VL1A 3PNIA 2D74B 2CVIA 2FLLA 2E9RX 4DBQA 1Y00A 4ID5B 2HHWA 5F8MA 2VV5A 4K0KF 2BBEA 3CD5A 1SL1A 2I5JB 2L48A 3D5MA 3HLUA 5AE2A 2OPSB 3I9ZA 3TQ1A 1U8SA 5IM0B 1P1TA 3G6XA 3H98A 2YNHA 3DLKA 4ILMA 4O3QA 2BRKA 2FGCA 1TKDA 1HR0F 2LEPA 3OTCA 3P49B 1VK3A 3ENQA 3IRWP 1EP4B 2HYIB 1YGYA 3I9V9 1FF2A 2DNRA 2GJ2A 2KN4A 2IRYA 2KXHA 2ZH3A 3JSRA 3M30B 2E5JA 4ICLB 2HVHA 3JTPA 3F73A 2YY3A 4FVCA 2KG1A 1FERA 1Y7PA 4CT9A 2RDIA 1Q86T 3IWXA 4RUAA 5HO4A 3OR1B 2FJEB 2R7SA 4QIVA 4BC7A 5HMZA 3KHHA 3MURP 1HBNB 2IFXA 2RF2B 4HYKA 4ZP8A 2HNDB 4F4KA 2J5AA 4OI1A 2VB6A 3DFEA 1SJRA 4WYWA 2UV8G 2GGPB 3KOAA 2PEHA 4EO8A 2YX1A 5FLXY 5A8RB 4IFYA 2R7TA 4I2QA 1RTHA 1X5PA 4NZ6A 3I0RA 2DGVA 3A1YG 3HF5A 4H54A 4ZLPA 4QPXA 4ED0A 2VPWB 1VQOS 3JSMA 1QAXA 2ZVSA 3O6QA 4R8UB 2DISA 4NLXA 3SQGB 1VHFA 1Z2LA 4RKUC 3KG0A 4CH7A 4L72B 1X4BA 3RYLA 3RB3A 3IG1A 3J7A1 2PN6A 4K5RA 4OI2A 3PO5A 1FJCA 3HFKA 2HFNA 3T5HA 4DSIA 2CPFA 1A6LA 1VRTB 1C1BB 2EPIA 2QT7A 3CDBA 3OL8A 2OFGX 4KV8A 1TZ0A 2E1AA 3DI6A 4QU7A 5GAHI 1YVFA 1SC6A 4LFAF 2IC3A 3NKYA 2W7PA 5CZXA 2UVWA 5F8NA 2IBKA 2JX2A 2RE1A 3NMAA 1DAXA 1FKPB 2UUBF 2CPDA 1RISA 3H5SA 3Q22A 3DN9A 1NK9A 4B9TA 1NO8A 2GMHA 2PI4A 1G3OA 3NCQA 4QOTA 1RT3A 4UQTA 1N5SA 2ZH2A 2BXJA 3OFGA 1KD1T 2UXBF 1HQEA 1ZBTA 2J8AA 3MM7A 2ZHAA 2LEAA 3DLGB 5EN1A 1Q4RA 2DVIA 5HLFB 3X3UA 5E5NA 4ECWA 3G8SA 2YKNB 3G4SS 1TL3B 2JL9A 2LXUA 4N8OA 2R2TA 1QAYA 1S99A 4WU2A 4YDDB 5CYQA 3W2VA 3KLEB 1P27B 5KFSA 4RW4B 4Q0BA 1WF0A 6FD1A 3GIIA 4NCGA 2CQ4A 3SI8A 1U1KA 3QJPA 4ECQA 4H4OA 4ED3A 4O4GA 4JV5F 1R8HA 2XSFA 2YH1A 1JWWA 4ZHRA 1X0FA 1YHQS 4O4RA 4DFJA 5J1EB 2C2RA 1U48A 4AXIA 3MPVA 1P9QC 4QU6A 1FKOB 2VG6A 4IFVA 1HBUB 1KR4A 1ZOTA 4C0HA 2DRAA 3AH6A 2WRMA 4YFUA 2PMZD 1MW7A 2RDJA 1GQEA 1O5JA 3PFEA 5B0GA 5AXKA 2BDPA 2FHKA 2DNPA 2ZH4A 2IM0A 2DR8A 3IO1A 5JVHQ 3VZIA 2J9EA 1Y0HA 5E3PA 3Q8RB