1HARA

2.2 angstroms resolution structure of the amino-terminal half of hiv-1 reverse transcriptase (fingers and palm subdomains)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
216
structure length
196
Chain Sequence
PISPIETVPVKLKPGMDGPKVAQWPLTAAKIAALVAICTEMEKEGKISKIGPENPYNTPVFAIWAKLVDFRELNKRTQDFWEVKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILAPFKAANPDIVIYQYMDDLYVGSDLAIGAHRTKIEELRQHLLRWGLTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (FINGERS AND PALM SUBDOMAINS)
publication title 2.2 A resolution structure of the amino-terminal half of HIV-1 reverse transcriptase (fingers and palm subdomains).
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein, transferase
total genus 54
structure length 196
sequence length 216
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1994-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1harA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1harA02
4ED0A 5D3GA 1JIHA 4QPXA 4IG0B 1C1BA 4IG3A 4KV8A 2VG7B 1JLEB 3UQSA 3GIJA 3H5UA 5J2MA 3MFHA 5DG9A 3KLFA 4EBCA 4Q0BA 2OPPB 5C5JA 1RYRA 1RT4A 1IKVA 4I2PB 5T14A 1RYSA 5HLFA 1T03A 5KT3A 4R0EA 2XCAA 3LP0B 4F4ZA 4K4ZA 5EWGA 4Q8EA 4ECTA 4LSNB 3OL7A 3T19A 3LP1B 5J2QA 1RT1B 1QAJA 2CJQA 4H4MB 4NLQA 3TVKA 4GC7A 5C42A 5F9NA 4EYHB 1JXLA 4IFYA 3HVAA 3I0SB 5HROA 4NLXA 1S1UB 3DMJB 3IG1A 5JUMA 3QZ8A 2V4RA 2UVVA 2BQRA 3MF5A 1UWBB 3KHRA 1RTHB 4QW9A 4O4GB 5FDLA 3T5JA 4NLUA 3H40A 5KFNA 1C0UA 2YNGB 2IM0A 3NKYA 1FKPB 3IRXA 5KFRA 1TKZA 3QLHB 2OH2A 1HNIA 2C2RA 3FFIB 1SV5A 3T5KA 4RW9B 2VA3A 3MEDB 1S1VA 4TN2A 5DG8A 3DRSA 4ZHRA 3FRZA 1D1UA 3H5SA 1OS5A 4Q45A 3DI6A 4U6PA 2ATLA 2BE2B 1RT3A 1JKHA 3ISNC 2VG6B 2JEFA 2FLNA 2HMIA 4KFBB 3E01A 2V4QA 3CDUA 5KT6A 3UPFA 5KG4A 1MU2B 1RT5A 2WONB 1S9EB 4B3OA 4NZ0A 4TYAA 3DM2B 3MEGA 4ECRA 2OPRB 1J5OA 3MR5A 4ECZA 4ZVGA 2WB4A 3PW5A 2IC3A 1N48A 3SFGA 4WZQA 1RAJA 1LWCB 2OPQB 4KKOB 4JUZA 3UR0A 5CYMA 1RT2A 2W9BA 1T05A 3KHGA 4MH8A 4LQ3A 4IFVB 4PQUA 1IKWB 5F9LA 4JV2A 3KLIA 5KT5A 1TV6B 4ZPAA 3IS9A 4WFXA 3QIDA 5KFUA 1KLMB 4ED2A 3LAKA 4RW8A 4IQXA 4O44A 4ZP7A 3DOLA 4YQWA 3MEEA 1HNVA 4J9MA 4K4UA 5KG7A 2RF2A 2YKNB 2RKIB 3C6UB 4ZP6A 2JC1A 1KHWA 2OPSA 2WTFA 3QGHA 2I5JA 1S6PA 5J2PA 4NLVA 4URSA 3KK2B 2BRKA 2CKWA 3NGDA 1IKXB 1IKYA 4IR9A 3KK3B 1S1XB 3D28A 4ZMMA 4F4YA 5KFZA 1S1WA 3OLAA 4IH7A 1JLQB 5KFHA 1REVA 1K1QA 3DDKA 2AU0A 3NMAA 3Q8PB 2BANB 3M9OB 1RTJB 4ID5B 4M95A 1SH0A 5JXSA 1S97A 5KT7A 2VG7A 4QW8A 4RNFA 1JLEA 4IR1A 2OPPA 5CYQB 5F8HA 4WFYA 5KFBA 3GIIA 1I6JA 2R2SA 4H54A 4I2PA 1ZETA 2FJVA 3ITHB 3LP0A 4WE1B 5L1IA 3Q8SB 4LSNA 1SH3A 5HP1B 2XI2A 3OLBA 3QIPB 3BGRB 4NCGB 2J6TA 3RB0A 3LP1A 5KG6A 2IBKA 4KAIA 5I42B 2GC8A 1DTQB 1YVFA 1FK9B 3KLHB 4QWDA 4EBDA 3I0SA 2ZD1B 4IRCA 1S1UA 3DMJA 3LALA 1UWBA 4WYLA 2JEIA 3PHEA 2GIQA 4YMEA 2IAJB 1RTHA 5KFQA 3JSMB 3TAMB 3H5YA 3DRRB 4ICLB 3GIMA 2YNGA 1MMLA 2XWYA 1FKPA 4KB7A 5I3UB 3QLHA 3KMQA 2IM2A 2C28A 4F4WA 4YR2A 3FFIA 1LWEB 5KFIA 4RW9A 4RW7A 3MEDA 3KJVB 2YNHB 5KFEA 2DPJA 4KO0B 5KFXA 2BE2A 5K14B 1S0MA 3C6TB 1LWFB 2VG6A 3G6XA 4ED3A 4KFBA 5KFDA 4NLOA 1N5YB 1TQLA 4NYZA 4PWDB 2B5JB 1MU2A 2QE5A 2WONA 1S9EA 3CIZA 4LQ9A 2AX0A 4ZP8A 3DM2A 4K4WA 1S0NA 3KOAA 2OPRA 4QWAA 1VRUB 4I7FB 4RZRA 4Y34A 3CJ4A 4NLWA 3GV5B 2UVUA 3OHAA 4MKBA 5L1KA 4DL3A 1LWCA 3M8PB 4DG1B 2FLPA 4ZVFA 3LAMA 3PW0A 3MR6A 5DQGA 4RNMA 3DRPB 1IKWA 4K4XA 4O3OA 5KFTA 5KFCA 1QE1B 2BRLA 1SUQB 2IJFA 3RBDA 1KLMA 2XI3A 1EETB 3GV8B 4K4YA 5C24B 1C2PA 5EWEA 2RKIA 2R8JA 5KG2A 1HARA 3KLGA 1TVRB 1BQNB 3KK2A 5KFYA 1IKXA 2HNDB 3RAQA 3CO9A 1S1XA 3LANA 3EPGA 1JLAA 1S9GB 4RNHA 4I2QB 3UDLA 4MK7A 4R5PB 4ECSA 1JLQA 4XPCA 2FVRA 4YR0A 2BANA 3RB4A 1RTJA 4ID5A 4HYKA 2ASJA 2XGPA 2IM3A 4IDKB 2BQUA 1XR5A 4EYIB 3TQ1A 1R0AB 3LP2B 3KK1B 4RW6B 5KFOA 4MFBA 3ITHA 3EZUA 2HWIA 1HPZB 4WE1A 4JV0A 2YKMB 4R8UB 3QGIA 5HP1A 3QIPA 3BGRA 4NCGA 3HVWA 1JLBB 5L9XA 5KG3A 3JYTA 1RT7B 5I42A 5F8JA 3FSIA 1DTQA 2VG5B 2WRMA 1FK9A 3KLHA 4FBTA 2ZD1A 2GIRA 4IRKA 4RNOA 2D3ZA 2IAJA 3ICLA 1RT6B 4OL8A 3DYAB 3TAMA 3JSMA 3DRRA 4FS1A 2UVRA 3ISND 1C1CB 5I3UA 1NHUA 1D0EA 3BQ1A 1LWEA 4M94A 1RTDB 1HQUB 3KJVA 2IM1A 4TLRA 4WXOA 2YNHA 5DGBA 1DTTB 4TY8B 2E9ZA 4KO0A 1RA6A 5K14A 4NLPA 3C6TA 1LWFA 3E51A 1S0OA 4ECXA 2B6AB 3DOKA 4PWDA 2B5JA 4O4RA 2FJXA 4FBUA 3KLEB 5J2NB 3I5BA 4JV1A 1HMVB 1VRUA 4I7FA 5HBMB 1S6QB 4K4VA 3H59A 2FVSA 3KK3A 4J9RA 4NRUA 3Q8RB 2AQ4A 2ILYA 4KSEB 2IJNA 4IG0A 3BSNA 4TYBA 5J2MB 3DRPA 1TKTB 1BQMB 1TP7A 2UUWA 3GILA 4Y3CA 4NLTA 3NAIA 1QE1A 3DLGB 4EEYA 3BJYA 1NNDA 4J9OA 1SUQA 3V6JA 1N4LA 3BR9A 2HNYB 1EETA 3KMSA 3BSOA 5EUHA 5KG1A 4F4XA 3NBPB 4ECQA 2FVPA 3SI8A 2AGOA 5C24A 2HNZB 1LW2B 4Y2CA 2ZE2B 1Z4UA 2W9AA 3RBEA 1RT1A 2C2DA 5C42B 1BQNA 4H4MA 5KFGA 4QWCA 4YP3A 4IFYB 5KFVA 4TXSA 5HROB 2HNDA 3IG1B 2W8KA 4ED7A 3DLKB 4H4OB 1S4FA 1S9GA 4I2QA 4G3IA 2AGQA 3BSCA 1U09A 2FVQA 1QAIA 4O4GA 4NRTA 4IDKA 3OL6A 1HQEB 1TKZB 5DG7A 2R8KA 3V6HA 5F8IA 2YNFB 1R0AA 4J9QA 3VQSA 3LP2A 3KK1A 3V4IB 3IN5A 1SH2A 5KFKA 1JLCB 3V6KA 1HPZA 2YKMA 2B43A 2XGQA 5F8MA 1JKHB 3QZ7A 3T5LA 4ECVA 1JLBA 3N6NA 4K4TA 5F8NA 1EP4B 3MTKA 1JLFB 1RT7A 1S1TB 3HKWA 3RAXA 2VG5A 2JLEA 1S48A 3G6VA 2ASDA 3QYYA 1C0TB 1J5OB 3HVTB 3CJ3A 1CSJA 3OSPA 3IGNA 3DLEB 3SFUA 1RT6A 5F8GA 5DQIA 4RW4B 4IH5A 4DL2A 1RT2B 2OPQA 4KKOA 1T05B 2W9CB 1S9FA 1C1CA 2D41A 2BQ3A 3CJ0A 3I5CA 4X2BA 3M8QB 1JLGB 4IFVA 4HKQA 3CDWA 3M9MB 2W8LA 4DL7A 4O3SA 2C22A 1FKOB 1S49A 1TV6A 1RTDA 1HQUA 4O44B 1DTTA 4TY8A 5KFLA 1HNVB 5KFMA 2W7PA 4URGA 2JC0A 3H5XA 2YKNA 2FLLA 3C6UA 3PW2A 3CWJA 4NLYA 2VA2A 2B6AA 2R8GA 4LSLB 3CJ5A 4K4SA 3KLEA 5J2NA 2AWZA 4ECYA 2ZKUA 1HMVA 4MK8A 5HBMA 3QO9B 1S6QA 3T1AA 3G86A 3BREA 4KHMA 1DLOB 5KFJA 3PR5B 5J1EB 2EC0A 1T3NA 1TKTA 1BQMA 4KHRA 1HYSB 4WXWA 2IA6A 3DLGA 1JX4A 1TL3B 4Q44A 3H4BA 5CYQA 4MIAA 2XCPA 2FVCA 2HNYA 1KHVA 1K1SA 4Y2AA 5DLGA 3NBPA 4DL6A 2HNZA 1LW2A 4NLSA 2ZE2A 3V81B 2C2EA 5C25B 4G1QB 4YR3A 4J9KA 1T94A 4WFZA 5KFFA 2HWHA 4MKAA 3KHHA 4ECUA 4ECWA 1XR6A 2ASLA 2JEGA 3DLKA 4H4OA 1N6QB 3NAHA 3BQ0A 5L1JA 3N6MA 3H2LA 4ZPDA 5KG5A 1RTIB 3T5HA 3GYNA 2WOMB 4FS2A 1VRTB 1HQEA 3PZPA 4ICLA 4PUOB 4EO6A 4ZVHA 3H98A 2YNFA 3OL8A 3HHKA 4ZP9A 4IRDA 1LW0B 4RW7B 3V4IA 3N6LA 4EBEA 3MECB 4MK9A 3GIKA 1JLCA 1IM4A 2F8EX 2R2TA 2E9TA 2RDJA 1GX6A 5DGAA 3V6DB 4WYWA 4RNNA 3GV7B 1EP4A 1JLFA 1S1TA 1N5YA 5EWFA 4U7CA 4J9SA 2AX1A 4Q8FA 3MR2A 4DL5A 1C0TA 1TL1B 2HAIA 2YNIB 1TKXB 3HVTA 4GC6A 3DLEA 2QV6A 2R8HA 3I0RB 4RW4A 2JEJA 5D3GB 4URQU 4DG1A 3M8PA 1C1BB 4IG3B 3M9NB 3GQCA 2W9CA 4KV8B 3BQ2A 3M8QA 3CJ2A 4TQRA 1JLGA 2J6UA 3KLFB 3D5MA 4Q0BB 2WCXA 4RUAA 4RU9A 4J9PA 1FKOA 4XO0A 1ZTWA 4QWEA 4J9NA 1WNEA 1RT4B 1IKVB 3QGGA 2W7OA 5HLFB 1T03B 4J9LA 3PW4A 4O3NA 1ZTTA 4NLRA 3KLGB 4DL4A 5J2QB 3I5AA 5KT2A 1RA7A 2ILZA 2V0NA 4NLGA 4LSLA 1TVRA 2RDIA 1JLAB 3KHLA 3OHBA 3OL9A 2D3UA 5KFWA 4DEZA 3QO9A 2WHOA 4NLDA 4R5PA 2XC9A 3CDEA 5DLFA 5L1LA 2FJWA 5FDLB 1RDRA 4ZPCA 4O3PA 1DLOA 4IKAA 3PR4A 5J1EA 3MR3A 1C0UB 3IRXB 2R8IA 4O3RA 1HNIB 1HYSA 3RB6A 4MIBA 4TQSA 1TL3A 1SV5B 4IH6A 4WZMA 4MFBB 3CVKA 4RW6A 2D7SA 3KLVA 1S10A 1S1VB 3DRSB 4ZHRB 3KNAA 4R8UA 3FDSA 3DI6B 4KBIA 3V81A 2DPIA 1RT3B 5C25A 4G1QA 3JYTB 2R2UA 2R2RA 2HMIB 3E01B 2ALZA 1GX5A 3RB3A 3EPIA 2J6SA 1RT5B 3H4DA 2UVWA 3PW7A 4B3OB 1N6QA 3MEGB 1N56A 4XPEA 4ZVEA 2IMWP 4RUCA 3PVXA 1RTIA 2IC3B 1XR7A 3DYAA 2WOMA 1VRTA 5CYMB 4PUOA 2W9BB 1NHVA 2O5DA 4TY9A 5KFSA 4ED6A 4PQUB 3BSAA 2AGPA 3FQKA 4K50A 1LW0A 3KLIB 4Q43A 5KG0A 3IGVA 3IS9B 3MECA 2V9WA 4ZPBA 4RW8B 5KFPA 3PJWA 3DOLB 3MEEB 4O3QA 1W25A 3NL0A 4ED8A 3V6DA 2RF2B 2WK4A 4KE5A 3PJXA 2OPSB 3DOKB 5KT4A 3FQLA 2I5JB 1S6PB 5J2PB 1QUVA 5F8LA 3MFIA 5KFAA 3Q8QB 1IKYB 1TL1A 2I1RA 2UUTA 5DQHA 4F50A 2YNIA 1TKXA 3OSNA 4EO8A 2BR0A 5EDWA 4ED1A 1S1WB 3G6YA 4IOBA 4QWBA 1REVB 2E9RX 3I0RA
chains in the Genus database with same CATH superfamily
1C1BA 3MFHA 1AZSB 1FVSA 1HBNB 1RLDA 4TU7A 1IKVA 5KT3A 4PABA 3TQEA 1YZ6A 4DU7A 1WELA 4F4KA 3LP1B 5B0EA 1Y4ZB 3MM9A 4PYAA 1S1UB 2CQCA 3WBZA 3FJ2A 4HTJA 5H1SV 2LMIA 2QRRA 3HHLA 1YRXA 2D69A 5KFNA 3WC2A 2GJFA 2EI5A 2UXBF 5HMWA 5DG8A 3FZBA 2PFFB 2XMKA 1PJ6A 1RT3A 4CP5A 3D68A 2XWXA 4L73A 2Y1JA 4EMDA 5C2CA 3MR5A 4RLEA 2PC6A 5DDRC 4DSEA 2B4UA 1T0TV 5SZTA 3FCVA 3HHEA 4WFXA 4F02A 1NAQA 1MWYA 2KU7A 2E5HA 3SSSA 1YRTA 4QIWD 2ZBQA 4LFAF 1KKHA 1X0FA 2NR0A 3KK2B 4F4YA 1JLQB 2CJYB 3NMAA 2MKCA 3SYZA 3KG0A 4HT7A 2EFVA 2O01C 1S77D 1ZETA 1NPPA 2VC1A 2XI2A 4XDDA 3K58A 4LBIA 1UJ4A 3CCUS 1SL1A 3DRRB 1VLYA 1QTMA 2XYHB 3KMQA 1YX2A 3DU5A 1HIYA 1URRA 4NLOA 2B4PA 1XMQF 3A3NB 1HBOA 4I7FB 3GWCA 4QU6A 2ZVIA 2Q6CA 5KFTA 4CLFA 1Y10A 3GV8B 1KFDA 2GX8A 2B7BB 3UD5A 2FDNA 4C8MA 3DHWC 4HYKA 3ETOA 3L7OA 1SL2A 3TQ1A 3CULA 3PACA 3LP2B 2FTRA 3CJRA 2OFGX 2AF6A 3NGTA 3VZIA 5B0AA 2FB0A 2HRTA 4GKKJ 1LXNA 5IC4B 4FBTA 1YKWA 1W2BR 5IC6B 3ICLA 2IAJA 5I3UA 2DHXA 2JNJA 1YIJS 4TY8B 2CPHA 4ILMA 4M5MA 2HBYB 1PKUA 3A8IA 2B5JA 1Q79A 1UPPA 4I6YA 2FJDB 1FJEB 3OR2A 1RJJA 4J9RA 5IM0B 2AQ4A 4KSEB 2HQ3A 4Y3CA 4NLTA 4HACB 4FXDA 1K0VA 4DPWA 1RT1A 5KFGA 5H9FJ 5BYSA 2CA9A 3BH6B 1SJ1A 3A12A 3GJSB 1HBMB 4G3IA 4N8OA 2WZ1A 2ZEJA 2DIVA 3V4IB 5GAHU 3KG1A 5KFKA 3L09A 4OZ2A 1ELOA 1EP4B 2DK2A 1KTQA 1CSJA 4DV4F 1X9SA 1Q81T 3W63A 5H9FK 1H74A 5DQIA 1FNXH 2UV8G 4DL2A 2NREA 4ZOSA 4WFAQ 4QU7A 4HKQA 2W8LA 1WUUA 5KFLA 2B9WA 3EICA 1FESA 3OTCA 3CWJA 4LSLB 2YPYA 2HFOA 4NXNJ 2I9SA 2RMLA 1RHQB 2BE7D 4X4OA 3O5TB 3DDIA 4QYZK 2Z0GA 2MQPA 3PYDA 3T1HJ 4NXMJ 1KR4A 5L39A 4WFNQ 1DJ0A 2RH3A 3NRBA 3TJAA 4PUOB 3R2CJ 2ZWPA 2DR7A 2VF3A 4OZ0A 4X4NA 2R2TA 4F2RA 4PXDA 4PXBA 4DJBA 1U1KA 2FUG9 3HFZB 2FZCB 1N33J 4DG1A 3M8PA 4LF5J 4J9NA 1FKOA 4OYOA 5D4OA 4H4KA 3Q8YA 2VFTA 3DOMB 4DHVA 4DPXA 2ZM6J 2RDDA 1TVRA 1KC8T 2D3UA 3RGIA 5A8KA 1NU4A 2WVCA 4RJVA 3CJQA 3LUYA 2DPIA 4G1QA 3GIRA 3BGUA 1QJHA 2UVWA 4NMXA 1PIEA 1FNMA 4DQQA 2ZHAA 1VRTA 5CYMB 2O5DA 3HSDA 1RU2A 1M5VC 5FD1A 4M5NA 4ZN3A 4ED8A 3UI3A 3R5GA 1RLCL 2QL9B 5F8LA 2I1RA 4M5KA 1GAOA 2ZNYA 3M7VA 2F65A 4NYOA 2EFGA 4PRFA 3MMAA 1FFSB 4OV6A 3QWUA 5J2QA 2R4FA 1B4SA 2VOPA 2VD3A 1WTBA 1BWVA 3S1TA 3KHRA 1QVFR 1MROB 2CVIA 3Q2SC 2RT3A 1NSQA 3NKYA 4LVOP 2CQGA 4ZITA 2FZKB 3VZHA 2QX0A 2HQGA 5HVGA 4U6PA 2BE2B 3ISNC 2HMIA 3MM6B 2VPYB 4DV2F 2OPRB 1E6YA 1M1GA 5CD4A 3IBFB 3PFOA 1U8SA 5LSLA 2DNGA 1R0BG 5D78A 4J9MA 5DZ7A 5GAGU 1S7IA 2JC1A 4QZVB 3NOGA 5AE3A 3N79A 3OBIA 4DX5A 2IDLA 1SH0A 3F0NA 4QJVA 5F8HA 2KZZA 3MPUB 1X8DA 4IOCQ 5CCMA 3U7JA 3KDNA 4YY3F 4NA1A 1FX4A 2GC8A 1DTQB 4FP9A 4B3RJ 4WYLA 4C11B 5KFQA 3MDFA 4C98A 3CC7S 1FKPA 2ZH6A 3FFIA 1YJ9S 3A8JA 2YNHB 2RD5C 2DPJA 4KTQA 4I68A 2RIJA 2UUCJ 1UA0A 3EGZA 4NWBA 2V6AA 2AX0A 2UP1A 2BJEA 4RZRA 3CJ4A 3GV5B 4DV0J 5MAOA 1KVJA 1RAEB 2LQBA 3LGMA 4FN5A 3KUGA 4UUWA 1U6ZA 3IFEA 3PJ9A 1HBUA 2RKIA 4P6QA 2VZ9A 4J91A 2J9DA 3RAQA 1IKXA 3TI0A 3QPIA 5GVQA 3NP5A 2RHQB 1S72S 2XS2A 3VGUA 4DUZJ 3AQOA 4OZ1A 4B9MA 1X4CA 3UO0A 5LOQA 4KYZA 1FO1A 4DR3J 4YB6A 5HVFA 4M5JA 1VHFA 1ZM2A 2KRBA 1R3NA 1ZOTA 2GVZB 2MJNA 2HQFA 4NLPA 3C6TA 2MKYA 2OHDA 3ULHA 3V4MA 4GKJJ 2YXLA 2LXFA 2H4WB 4LVNP 1EAYC 2LQ5A 4LSZB 2GJIA 2HNZB 1HLWA 1TUVA 2ZE2B 4ZLJA 4USKA 2C2DA 4TXSA 1RWKB 3UN5A 1KEKA 3BSCA 4JI3F 4RU2A 2D1CA 4DLEA 4NRTA 3OTOJ 5F8IA 1D8YA 1JLCB 4ZK7M 2BJ7A 1G3OA 3CC4S 3QZ7A 1TL7B 4FYWB 2JDJA 3I9ZA 3O3LA 1WKJA 2QA4S 3S6EA 1RT6A 5LMNJ 2FLOA 2BQ3A 4E0DA 3CJ0A 3JXOA 3LOUA 4X62J 4O3SA 2QZ8A 2PSZA 4ZPTR 2FLLA 3MM5B 2FIUA 4AL7A 2EFNA 2IVYA 1KONA 3LWMA 2L41A 3OVAA 2FZGB 5KFJA 4PPDA 4WXWA 3OFGA 3H4BA 1SIWB 2HNYA 3FRYA 1LW2A 3J7YI 2HQDA 3CD5A 4WFZA 1NO8A 4MKAA 5D6GA 3TZXA 3EVOA 2HFNA 3H2LA 4A4JA 1L5UA 1M5OC 4CLUA 5J1NA 4WU2A 4MK9A 2GNKA 2RQCA 4ZLNA 3D6MB 1N5YA 1FDAA 4Q8FA 4Y2IA 2QSFA 4DOZA 1TZ0A 5CCLA 3FGVA 1XWLA 4TQRA 3D5MA 2WCXA 1LFPA 1WEZA 3AD8C 4NLRA 2MLYA 2ILZA 2ZOGA 6FDRA 2CJXB 2W2QP 3HHLC 2V2ZA 2F63A 5E3QA 1KQFB 1KQGB 2EFOA 3T1YJ 3BPSP 3LO3A 4OX7A 4K7QA 1S10A 1WDTA 3DI6B 4KBIA 1HI1A 3EPIA 1T3OA 3H4DA 3KJFB 2DIUA 3QT6A 4XPEA 2MKJA 3I32A 4R25A 4C8YA 5HN0A 4A8QA 3PX0A 1YWXA 3TZYA 1H38A 1NHVA 2CPFA 5HK4A 2LQJA 3IS9B 1HW8A 4LF6J 2F5GA 3AD9C 3J81Y 3WX8A 2CWXA 2LEBA 2DNLA 5KFAA 1IKYB 2UUTA 1PGZA 2B4OA 4EO8A 1X5SA 4ED1A 1U2CA 3JTPA 3GIJA 4NOHA 1KTVA 2IA0A 3QT8A 4I2PB 2V68A 2E5GA 3ET6A 3EWGA 1UWBB 3UCZP 4GKKF 3ENAA 1NPKA 3OJSA 2CNLB 2YY3A 3CDUA 5KT6A 4WIQA 4OJGA 5IFMA 4ECZA 4ZVGA 3R7NB 2QA4G 1FWLA 2H3EB 3GONA 1TV6B 4KY3A 5KFUA 2CNNB 2GMJA 4K4UA 2RF2A 3CTRA 1S99A 3D28A 2ZBRA 4RBVA 4CH7A 4NA3A 2ZUGA 5KT7A 2VG7A 2M3DA 1NJWA 2CQ0A 2DH8A 3CIMA 4WE1B 3CJKA 3BGRB 1RABB 1A7GE 2N7YA 3DMJA 3PHEA 1T9UA 3GIMA 1CC8A 3P3DA 1Y7PA 1GMWD 3NNAA 3O1LA 3LF0A 2X3DA 1S12A 4G65A 5E41A 1M5KC 1Q1KA 4MKBA 1X5TA 1DBDA 4F0KA 3RBDA 4NXNF 5B0CA 3KLGA 1VIOA 1JLAA 5A2QU 4ECSA 3T1HF 3VAKA 4YR0A 3PO4A 2QA1A 1U48A 2QA2A 1VISA 3CCRS 3AOBA 4ED4A 4K0KJ 3HVWA 5IT4A 4ELUA 2BUNA 5A0YA 4CLSA 2WRMA 2PFDA 1NJZA 2ZD1A 4DMZA 3GR1A 4ZLLA 2UVRA 1NK0A 5B0FA 4PKDB 3BQ1A 1LXJA 5DGBA 1N33F 1YRUA 1G6BA 1YJTA 1RA6A 2J9CA 4LF5F 2B6AB 3DOKA 4PWDA 4W98A 2FJXA 4DSKA 5H9EJ 4WK3A 3H90A 3PYEA 1REGX 4E2FB 2MZRA 1RI7A 2XQCA 3K0JA 5EN1A 2ZM6F 2UUWA 5ETNA 3JTOA 4BBYA 1OSCA 4F4XA 3W7BA 2XY6A 3NBPB 2QLFB 4Y2CA 2PMWA 2W9AA 3MHYA 2HHVA 3MZIA 5HROB 2ZITA 1KVKA 3DLKB 4YN3B 4QPTA 5E3CA 2R8KA 3DLHA 2PA8D 1TKZB 1P27B 4K2XA 1H98A 5IZHA 2JWNA 3CW2C 2HW3A 5A8RB 3V6KA 1WC0A 1KN6A 2DB1A 1S1TB 2ASDA 3C16A 4B3SJ 3CJ3A 2G0IA 1LK7A 4X4UA 3EYZA 3I5CA 3GB0A 3CDWA 4H4KC 3RU0A 2C22A 1FJCA 3ISZA 2MGZB 1DTTA 2W7PA 2XBPA 4TLQA 1PC5A 4DWIA 4DV1F 2YVSA 1AT1B 2LEPA 3HJFA 2AWZA 2ZKUA 5ETSA 4DL0C 3SSQA 3FEXB 1U26A 3I56S 3K5LA 1YITS 4ZLPA 4ID8A 5C7PA 3F73A 1V5IB 2EW9A 1XR6A 4CT8A 4UOGA 3N6MA 3OR1B 1NB7A 3I55S 3GIKA 3QWPA 2VFVA 4B02A 1U47A 4HVZA 4B3TJ 4HDGA 4WPAA 3JQKA 3ZZZA 1EARA 3FEZA 2XMWA 4PWUA 2W7OA 1KOOA 1CC7A 3C14A 3HFVA 1RSCA 4DS5A 3VGTA 4DEZA 3QO9A 2M4MA 4N77A 2ZH7A 1WOOA 1HYSA 1SV5B 3HHLD 4MFBB 5ETVA 4OI1A 4B3RF 2I8EA 1HR0J 1VOMA 1RGVA 3E01B 1T02A 4NZ6A 5E3AA 3RB3A 1CJTB 1U1PA 4QCLA 2Z2ZA 2VL1A 3I4PA 4P10A 2VONA 2WVEA 4MKYA 2CQIA 2UUCF 1FRMA 3G2XA 1RB0A 2G0JA 1C4CA 4RW8B 3SZ2A 2DRBA 3NL0A 4DV0F 3L3CA 2B0GA 3N0VA 2A3JA 1CVJA 5DQHA 4Y0FA 1U0SA 2DCUB 2BV3A 3TVZA 3ZZYA 3I0RA 5IM0A 3KLFA 4Q0BA 1U1LA 1RAOA 4F4ZA 1RU1A 4A8FA 3P6YC 2LKZA 3T19A 5A8WB 4DUZF 1NJXA 3HVAA 2UVVA 2PD1A 2BVZA 5IS2A 1IBCB 4DR4J 1NJIT 1VMBA 4JYAJ 4DR3F 2X7IA 3M2UB 2R9LA 2ATLA 1XMBA 3FC9A 5B08A 2H4YB 3CO0P 3O44A 3DM2B 3MCMA 3HD1A 4USIA 5K9FA 4I1TA 1CS4B 5B7WA 2NXCA 3DOLA 4O0IA 2R7RA 3AT1B 1HWUA 1S97A 1N34J 3ZZRA 3HJVA 3UDVA 2ZDPA 3Q89A 3OLBA 1Q8LA 3EZOA 5D77A 2KT5A 3OTOF 4B9UA 3MM7A 4BS2A 4M5HA 2GIQA 2RAQA 2YNGA 4NI2B 5LT5A 3VAHA 2O3DA 1F2HA 1X4AA 4N56A 5K14B 2IJRA 5K8OA 3WZ0A 2NSBA 4CNZA 1NKBA 3U1MA 4DPOA 3FKBA 2DNOA 4ZP8A 1R8CA 4MT1A 3GSDA 1WACA 3SIPB 2R7TA 2XMTA 4JI0F 1MMDA 2KO1A 4U67Q 2E1CA 4OYBA 3FEYB 5ITHA 3PM9A 3NS7B 4OJHA 3Q8VA 4FPRA 3K5PA 3PKYA 8RUCA 3PKMA 4ZCIA 2CIMA 1U8WA 1RTJA 2Y1IA 1QLNA 4UY85 3FUYA 4WK1A 5KFOA 3OUYB 2YQ3A 3VAFA 3FSIA 2GIRA 2A6OA 2EXUA 3JSMA 3AFGA 3BKTA 1C1CB 1R6YA 5ETPA 2KG0A 4HL9A 4DPTA 4WKYA 4DU8A 1D09B 3TZZA 2OIHA 1HNZJ 4OJ3A 3J7ZT 2OLWA 4ANEA 5HBMB 3X3UA 1R8PA 4PG6A 3MM8A 1QSSA 4DPYA 1V3ZA 4QIVA 3CCZA 4EEYA 1YBAA 3BSOA 1DQ9A 1UVLA 2IFXA 1WF0A 3DGVA 1HNWF 1S0VA 4TU9A 3T1YF 3CMAS 1TAUA 3K7RA 3GFHA 1T9YA 1YQHA 1HQEB 2YNFB 2DITA 4DR2J 1U0HB 4OI4A 1VLOA 3NG8A 4YEAA 1VQYA 2JVRA 3U1NA 4FKXA 1PAUB 2HURA 2ADBA 4LF6F 4KT0C 2XSFA 4RW4B 2WSFC 2RRAA 1U1OA 1U2FA 3TUIC 3J81U 1GH8A 1HQUA 3QATA 1M5PC 2DNHA 2N3LA 3LH2S 1NDCA 2HPUA 2CUYA 4OMFG 4FF4A 3ZZOA 2YWHA 1APSA 2AEFA 3WC0A 2RU9A 1T3NA 3IBCB 2G2OA 2HIYA 1LNQA 4Y2AA 2OEJA 1QSYA 2GJ2A 4YDXA 2ZFHA 3EMTA 2VFSA 2GMHA 1OYEA 2N3OA 5KG5A 3O2IA 4DZDA 1FD8A 3ETMA 4KIAA 5EX3A 1IXKA 3M6WA 2RJZA 2RDJA 1O0PA 2V67A 3MR2A 3O8WA 3G8TA 3AB4B 2FY8A 2MZTA 1IQTA 3C8YA 2ZH1A 4F0HA 3CD6S 1A0OB 5AE1A 2U1AA 5IWAJ 7AT1B 2E29A 2XB2D 2FJWA 2NLWA 2Y3YA 5LXYA 1VFJA 3NGRA 3VQTA 4OHWA 3T41A 3CCQS 2R2UA 1GX5A 2RILA 2KVQE 3MEGB 4RUBA 3CT9A 4BC7A 4TY9A 1VQLS 1RWVB 1S6OA 3IGVA 2DNQA 3MEEB 3UDCA 2AD9A 1W25A 3JAMY 2WW4A 4GVBA 3AJDA 1FRXA 1TKXA 3P8BB 3BO3A 1RXOB 3ZZ0A 4IG3A 1JLEB 1W26A 4HHUA 5T14A 1XNQF 5K8NA 2ZJRQ 4Q8EA 4ECTA 3RG6A 1QAJA 2I6WA 5JUMA 1EJ7L 4K0KF 3QZ8A 4MJKA 2V8GA 3IR5B 2F7VA 1VCTA 5D0EA 2DEJA 2W2OP 3MEDB 3KYLA 3KJNB 2Z2LA 1EQMA 2OMOA 3UCUP 1PBAA 2G4BA 2IC3A 1RAJA 4B9TA 1XEZA 1YJ7A 4JV2A 3KLIA 1GTHA 1FTRA 2DR5A 3BN4A 3C6UB 2RE1A 3RRHA 3QRQA 4LF7J 2ADCA 5ETRA 1FDBA 5KFHA 4LF4J 4Y2MA 4ILLA 3L4BC 1SXLA 2BXJA 1I6JA 2NXJA 2VJVA 2YKQA 3TR5A 3QRPA 5HP1B 3W5ZA 1JJ4A 4KAIA 3HKZD 2A10A 4OZLA 3QJPA 2QT7A 3EJMA 2JH3A 2VJUA 1YJWS 4F4WA 2YQ0A 2GAGC 5HL7Q 2C3MA 3M05A 4B3SF 4OYWA 3DGPA 2RVJA 1S0MA 1LWFB 3EVWA 4Y65A 3BGLA 2WONA 1LWCA 1R8BA 4WKRA 4F7VA 1IKWA 1KLMA 2HFUA 3SSRA 3AJ1A 2R8JA 4DI6A 5KG2A 1F9EB 1P1LA 1BQNB 4QIEA 4CYUA 1R27B 2JHEA 4XPCA 4AFFA 4ID5A 3M8ZA 4A47A 2BZ2A 2OMLA 3BDEA 2ZOMA 3ITHA 1R7IA 4JV0A 4R8UB 3H8YA 2VG5B 2UU9F 4RNOA 5BJRA 3TAMA 1W2IA 2W1BA 4K5SA 2PN6A 2FY1A 2PI4A 1NRKA 1VGYA 4RUHA 4TLRA 2VU5A 1L3TA 2HFSA 5AXLA 4ECXA 3WQPA 1HMVB 1F1BB 3A3PB 2FVSA 2NQPA 2MDAA 5J2MB 5L46A 3QJJA 4EZ6A 3TYTA 1EETA 4ZPWR 3RBEA 1VQPS 4LF9F 1S4FA 3ZTPA 4I2QA 2FHKA 4ZCMA 2FC8A 2VBWA 1KQSR 1Y3JA 1R0AA 3AOAA 2K7KA 3MMCB 1F2GA 2CQBA 3DKDA 3GG1A 1JLFB 3R2DJ 1VQ5S 1C0TB 3HVTB 3IGNA 3SFUA 1VK8A 5F8GA 2APOA 1T05B 1CJKB 4N5SA 3D2WA 1TV6A 2PMZD 1ULRA 1FF2A 1SBRA 1QD1A 5HQLA 3NS6A 2R8GA 2N82B 2POKA 2IPOB 1SJ3P 3HF5A 4MIAA 2AYMA 5HQMA 1SC1B 1FVQA 5C25B 1RK8A 3MOJB 3V5RA 2ROEA 1U1NA 2V2VA 2GMLA 4JYAF 1RTIB 3GYNA 1N54B 2GFFA 4X65J 3H20A 4FNIA 3UR3C 4RW7B 4EBEA 3RBXA 5D0RA 2BACA 2A1BA 3EDQB 3CCSS 3LW5C 5DS7A 3HK2A 4BLGA 4FYVB 1UZDA 4WU3A 2W9CA 1ZTWA 1NCLA 4M5DB 4RPFA 2FJAB 2ZH8A 3P5BP 1VK3A 3M8RA 2B9EA 2RDIA 2DXEA 1N34F 1NMEB 4NLDA 1WOSA 4DFJA 2LQ8A 4JI1J 5J1EA 1C0UB 3SMZA 1CLFA 1TL3A 2VFRA 3E8OA 2XULA 1X9WA 3R5DA 3JYTB 1ZH5A 5THWA 4CO4A 4RUCA 2ZC3A 4DR5J 1RCOB 5HJXA 3GG0A 2W9BB 4BCAA 3TEHB 3QSIA 4K50A 3M6VA 3FVYA 3G8SA 2DHAA 4JI8J 2HFZA 1RBAA 5HMXA 2J0WA 4A8XA 3FQLA 1WHVA 5CA5A 3AQPA 4IOBA 2C2ZB 1K0TA 1TELA 3J80Y 2VUGA 4EBCA 3IXQA 1CEZA 5HLFA 1T03A 3GLJA 5EWGA 4U8YA 3M32B 1M1KT 4FKYA 5HROA 1H2VZ 3CD0A 3SCJE 5I3QA 1TKZA 3QLHB 1CJVA 2LQ9A 1QSLA 4W92B 2HKEA 1O51A 1R0CB 2BA9A 1P6TA 1UVNA 1VBKA 1RT5A 2QLWA 2IYIA 2ZH5A 3PXGa 3W64A 1NUEA 5KG7A 2WTFA 5J2PA 4NLVA 1HQ2A 2CKWA 2H54B 3BS9A 3OLAA 3JSYA 4LFAJ 2V4JA 2R7XA 4PEOA 2DISA 1PYTA 2R2SA 3LP0A 5IQQA 1SH3A 1OQ6A 2AMCB 1VC6A 5I42B 4F26A 3ILLA 4QWDA 2BW7A 3LWLA 3LALA 1SB6A 5K8MA 3NGUA 3NNCA 3M8WA 1JNRB 2XWYA 3P49B 2E66A 3W2VB 1O5JA 2OUGA 3ELHA 2R3VA 2LEAA 3IRWP 4CLPA 4RX6A 2L3MA 2E1PA 1WORA 4A8KA 4K4WA 4LQ9A 2KXNB 2ZJPQ 2UVUA 3IP0A 4O3OA 2DRAA 1SUQB 3BBBA 1Q0NA 1M1HA 5C24B 4F4AA 2RQMA 2F4VF 2FVRA 3G6ES 2BANA 2XGPA 2IM3A 1WOPA 1N5TA 4RW6B 4MFBA 3NNHA 3QIPA 4ZPVR 2HHTA 1EZZB 3C2PA 1TUGB 2ACYA 1RWMB 2HHUA 9ATCB 2GQCA 2GAHC 4OHXA 4ATNA 3E51A 2W2MP 5DETA 2MTLA 3H59A 3CCLS 3PEJA 2QLBB 1VQ6S 3GILA 4X4VA 4WTOB 3DLGB 4MKVA 3BJYA 5IWAF 4YFUA 2DNRA 5LM7E 5C42B 3P96A 3KUEA 4YP3A 4IFYB 4I69A 2AJFE 4DCJB 2AGQA 3VF0B 4AE5A 3M6XA 3RW6A 2B43A 2KL8A 5F8MA 2GCFA 4AD6A 1HI0P 2V2KA 5F8NA 1RWUA 2XM3A 3G6VA 4F8RA 4PCQA 3DLEB 2AP6A 3LTOA 2D41A 2P6SA 3M9MB 4DV4J 3JAMU 4ZCKA 1UP1A 1VQ9S 2D3OR 1RTDA 2KRRA 1LQ9A 3FK4A 4NLYA 2HVDA 3KLEA 4DN0A 2DGWA 4MK8A 1S6QA 3JQMA 2JJ4D 4AL5A 1BQMA 3EUNA 2CJAA 2XCPA 2CNKB 2MQ8A 3W9JA 4B3MJ 1T94A 3D6TB 4XDCA 4DR6F 1R31A 3TUPA 1ACMB 2BMBA 4ZPDA 7FD1A 4C0OC 4J5OA 3DLBA 3K59A 4J9SA 2HGLA 4URQU 3PIPQ 2G1DA 3RJMB 2R7QA 1SJRA 4LF7F 5HI7A 2J5AA 1WI6A 4BWMA 2ZC4A 3AOCA 3NXZA 1SPBP 3WIUA 3OHBA 1LEOA 5HQ8A 2MLZA 5FLXU 2GA7A 4DV6J 5L1LA 2E7XA 5FDLB 3PR4A 2K8GA 3MPYA 3IRXB 1HNIB 4DSIA 4MIBA 3MAAB 2CQPA 3DRSB 4ZHRB 1VQSA 2C2OB 3HSZA 5F0WA 1X9MA 3FSXA 4DR7J 3D4JA 4B3OB 3G71S 1RWOB 3POTA 4F3OA 4KJIA 5C2GA 4C8OA 2EBGA 3FQKA 3BKUA 4Q43A 3SDEA 3OT9A 4ZPBA 2FGOA 4O3QA 4JI6F 5D4LA 2YKPA 1S6PB 1TL1A 3EXCX 2QMUB 3X1LB 1S1WB 2MKIA 2W7AA 3KK3B 5D3GA 4KV8A 3VHQA 1DQAA 5GADI 3UQSA 3H5UA 1RACB 2OPPB 3JQJA 4NZ7A 1Z2ZA 4K4ZA 5G0RA 2BKNA 3A1YG 3AY0A 2DHSA 3MF5A 3OFHA 3D66A 2KH9A 4QR2A 5KFRA 1G1XA 3HLUA 2QYGA 3FCWA 1NEEA 3R7SB 3VGVA 2EG1A 3VALA 4Q45A 2GIFA 5KG4A 2WSCC 2JFDA 5HAOA 3CNQP 3F56A 1Q8IA 2VIHA 2C2NA 1BY9A 2M8DB 1KLNA 2CNOB 4OYAA 2E5JA 2HVHA 1ICEB 3MUMP 1LWXA 2P2CB 3OV7A 4IR9A 4RR5A 4I67A 1REVA 2ZZMA 1MLAA 2R7VA 2HHHJ 4YHHJ 5B0GA 3RUBL 4ZIVA 1UJ5A 3D1QA 3W60A 4LSNA 1YHQS 2FPHX 4AT1B 1B64A 3ZNJ1 3R6LB 2VASA 1YVFA 2YWFA 3K8WA 1N52B 1JB0C 3H5YA 4CNYA 1KOHA 4O0NA 3I4HX 4ZVPB 3GFYA 3KJVB 2IDEA 1KDNA 5EX0A 1VRQC 5D4NA 4ED3A 3RR7A 1S9EA 4UZCA 3KOAA 3GYXB 4QWAA 2QEXS 3LAMA 4RNMA 2AZ3A 3DRPB 4K4XA 1RHUB 1VBZA 5L38A 2BOAA 1TMJA 1S1XA 1S9GB 3UDLA 1MMNA 2G13A 4LRAA 1SC4B 2DGSA 1NM2A 3KUHA 3HXMA 4USJC 2YKMB 2EKYA 2B9XA 1JLBB 1RT7B 4X65F 3L95X 3KLHA 3R5BA 2YX7A 4C3KA 1UL3A 1QDUB 2OFHX 1FE4A 1FWPA 2R7OA 4C8NA 2OSRA 3PX4A 1BMQB 1WC1A 3UW1A 1NB2A 4KO0A 4WBFA 1WC6A 2OI2A 1JJHA 1L3VA 4LRFA 3J81j 5J2NB 1VRUA 4ZDNA 4PZVA 2UV8A 2K1RA 3NAIA 5JVGQ 1SVDA 5EUHA 1VQMS 3D6HB 3EGWB 2MQQA 2HNDA 3DN9A 1U2RA 1U09A 3DU6A 1D9DA 3KK1A 3MI7X 1X4DA 1HPZA 1JKHB 2I38A 1FE0A 3T6JA 3MTKA 3RAXA 1SKWA 3UVJA 3W2WA 1AROP 1GEHA 4JI8F 5GAHI 2VDIA 2FGCA 2M70A 3M8QB 1TFYA 1T9TA 3HP6A 1WEXA 2JC0A 4YUDA 3C6UA 5MLCV 4C7QA 3J80U 5JMNA 3ZZUA 4LR7A 2H5EA 2V9KA 4QOTA 3M2RA 1K44A 5IOLA 4V19J 4I64A 1B7FA 1UMJA 1TKTA 4KHRA 3VAJA 3R1LA 4ZKAA 5B0BA 3MMBB 2HRYA 2KM8C 1CBKA 3FBCA 3SQGA 5KAKA 4ECUA 4U9RA 3K57A 4H4OA 2RS2A 2BBEA 3TJ8A 1TK0A 2CZ9A 1LW0B 1CULA 4A48A 3DXSX 1VIXA 4E8UA 3M8YA 2MJUA 2XSJA 3AXMA 4X4PA 5IT9U 4U7CA 5IQ6A 1ZAXA 4DV5F 2C42A 4DL5A 4WJBA 2YNIB 1LKZA 4UOCA 3W65A 2WVDA 4LBHA 2JEJA 1C1BB 3GQCA 2CFXA 2DEIA 4YS2A 1UVIA 1IKVB 2DR6A 1F5AA 4O3NA 3I5AA 3C19A 2V0NA 2VBXA 3N01A 3MM9B 3D3CJ 2XC9A 3HHLB 2R8IA 2DGXA 3THTA 3OJUA 3TAQA 3KLVA 1X5OA 4R8UA 3FDSA 4OYXA 2Z8QA 2NCKL 1RT3B 2XZWA 1J5EJ 2DY1A 3HD2A 1WWHA 2KFZA 4X84A 1Q82T 4DX8H 4Z7CA 4DQIA 4DX7A 2RB7A 2AJ1A 3NCRA 4XIUA 3MECA 2DVIA 1WG1A 1WG5A 3TP2A 3V6DA 2WK4A 2VB6A 2M8HA 5J2MA 1RT4A 2AV5A 1KSPA 1YZ7A 4N8NA 1N88A 3AD7C 3ZFVA 1OSDA 1FRHA 1JXLA 4X4SA 1RWWB 3QT5A 1X31C 2BQRA 1UCNA 3C46A 4JI2F 1S1VA 4BWJA 3Q8UA 2KXFA 3H5SA 1OS5A 5LJ5Y 5F0UA 1X4GA 4ZVRB 1HBOB 3BN7A 3AXKA 3PW5A 3SFGA 2OPQB 1T05A 3KHGA 2AJQA 4PQUA 1RISA 2YWWA 2RS8A 3MTJA 2IIHA 1RQ0A 1ZAWA 3EGVA 4HT5A 1JQGA 5ETQA 1IBKJ 4ZP6A 2OPSA 2BE9B 3G82A 4URSA 2M0GB 4ZMMA 3BH7B 1NSAA 4ZVSB 3MPWA 2ZOFA 4LREA 3A8EA 4YDDB 2VQEJ 2VBYA 5KFBA 2ZNZA 2B8QA 3OFEA 2E1AA 2Z2YB 4J90A 4NL5A 2NYIA 3D54A 1UAWA 1IUJA 1VQKS 2IAJB 1RTHA 2XHWA 2AYBA 4G1PA 2DGVA 3T9ZA 5I3UB 2GO9A 2QGFB 1TL4A 4RW7A 2XZDB 1VQ4S 5KFEA 2VG6A 2B5JB 4QYZJ 3GMGA 4Y34A 1Q8KA 3OR2B 4WP8A 4M1KA 3FCHA 2RQ4A 2XI3A 1ZBTA 1C2PA 4LF1A 2AYEA 1UFKA 2V2QA 4FF3A 4MK7A 4R5PB 5RUBA 6FD1A 4B3MF 1UWAA 5A2QY 2MB0B 4LR9A 3P45B 4OYIA 4DCOB 1UEUA 3VGSA 1EKRA 3EZUA 2MSSA 3C3LA 3QGIA 4OIXA 4MYTA 4NCGA 5KG3A 3JYTA 2F4FA 2DR9A 4P52A 1PJ7A 2HS4A 3D0IE 1NHUA 4NYPA 3LPYA 2PO4A 2F9DA 4HHHA 4FXWA 4U95A 3HZEA 3HT3A 1RBLA 1GT8A 3EX7B 4Z2XA 4G6VB 1QE1A 1NNDA 4A8SA 3BR9A 2CG8A 4ECQA 5T7LA 3BKFA 3MCSA 4DV6F 1Z4UA 3UD3P 3RBZA 1HD0A 4UQGA 4PG7A 1NK6A 4QWCA 2IBOA 3R5CA 4Q7AA 3IWXA 4N76A 4IDKA 4YB1P 1AB8A 3TUZC 1URNA 4GRSA 4DR7F 4EK2A 5AT1B 4DQRA 3N6NA 4LFBF 1OJ4A 2JLEA 3QYYA 2CZVC 3AA8A 1U02A 1FKOB 4C0BA 1HNVB 3TOQA 1AYEA 4N47A 2GV1A 4IO1A 1S5ZA 4K4SA 1CJUA 1L3UA 3LA0A 2HHWA 4WTYA 3M1VA 4NASA 4DV1J 4CRJA 3PR5B 3HM9A 2E7WA 1MWZA 4JI5J 1F5CA 4ZIWA 2CQDA 4PYDA 4NA2A 2WSEC 4NLSA 4G1QB 2EPIA 4WP9A 3KKFA 2BW2A 3EDRB 2MKHA 3BZQA 8AT1B 3RZAA 1NBEB 3ZTQA 1VRTB 1BWEA 2DNPA 2F1FA 2F8EX 3UNGC 5D4PA 5EWFA 3KDOA 2U2FA 3TW0A 2HG4A 1MN7A 4ES2A 2MLXA 3BQ2A 1JLGA 4KHPJ 1WNEA 2C3YA 3MMAB 3PW4A 2JOQA 1FFWB 1Z2LA 5J2QB 2XTJP 2ZH3A 4ALZA 2QLJB 2HHHF 2GGPA 4YHHF 1M0SA 4KGXB 2XY5A 1A6LA 1UW9A 3MR3A 4O3RA 4OI0A 1RWXB 2K06A 4RW6A 3KNAA 3GFZA 4DFMA 2HMIB 2ALZA 4XK8C 2J6SA 1N6QA 1E6YB 2CQHA 1ZS6A 1XR7A 4DSFA 4MYUA 2WOMA 1F6TA 4JOUA 2MMYA 1ZA2B 5DM6Q 1IWAA 1Y5NB 3VVTA 4K59A 4RBTA 1DAXA 2XLJA 1YBTA 3ILOA 3U27A 2C2MB 1FA0A 1NZ8A 4LUBA 2MPUA 1FJGJ 5C42A 3VAGA 4IFYA 1TR0A 2QFIA 2AEMA 2AIRB 1HNXJ 3PIOQ 1FKPB 3TVYA 3FFIB 2ZUAA 2Y0BB 5E33A 4OFZA 1VYAA 4NZ0A 3N5FA 4WZQA 4KKOB 3UNYA 3UR0A 1KRPA 6AT1B 2H5JB 1BLUA 5KT5A 3C15A 2E1RA 2V50A 3OXLA 3LAKA 2KN4A 2RKIB 3DRYA 2I5JA 1IKXB 3RW7A 1YTYA 2Y1LB 2J9DE 1MWQA 2B8PA 2A6MA 3M8SA 2UXDJ 5CYQB 3OXGA 1YGYA 4DF8A 4ES3A 3RB0A 3GZ7A 1E6VA 4EGLA 2IBKA 3I0SA 2SXLA 3IMQJ 5L9NA 2DY9A 1VDHA 5F41A 2A2DA 2E5IA 5LL6d 4QR0A 3ENVA 2KG1A 4YR2A 1DRZA 4RW9A 3NS5A 2P6TA 4P2XA 4ES1A 3C6TB 4KFBA 3PO5A 1UPMB 1MU2A 2QE5A 1N5VA 2BM1A 2BDPA 1UZHA 3D1OA 3PW0A 4ER8A 3Q0AA 2HZAA 2BX6A 2XLKA 2PIIA 2XNQA 4CDIA 4K4YA 2XYGB 5EWEA 4WF9Q 1F5BA 4JI0J 2MZQA 4KGMA 1HARA 1O8BA 4Q5VA 1CQNA 3LANA 4DV3J 1DFDA 1X60A 4OHZA 1XR5A 4ZVOB 4NCAA 2XS5A 4OX8A 3QT7A 4AYBD 2HK3A 4ED5A 1FK9A 3PV8A 3W9HA 1RT6B 4FS1A 1YJRA 1H2TZ 1LWEA 2M88A 4WXOA 2V34A 2ATCB 1RHJB 2FHOB 4OYPA 1IVZA 2UUAJ 2CDQA 3KK3A 4U7UD 4NEYA 3V6JA 2HNYB 1LW2B 2Q3PA 3UFCX 2MYFA 2KZMA 4OI6A 2G1HA 2NXEA 5KFVA 2EFQA 5HJYA 4FDFA 1HNWJ 1J5EF 4J9QA 3VQSA 1TTHB 2OAUA 4C8ZA 3KFWX 1SH2A 3UCGA 2DHHA 4ECVA 1Q4RA 1FXRA 1FEHA 2OP5A 3KWMA 1S48A 2B9YA 2MY7A 3HO1A 3SV3A 3NCPA 3C66A 4J37A 1WTFA 4URGA 2VQFJ 4AUKA 4FYYB 2FHJA 4DLGA 2CQ1A 3BREA 4Q44A 1D3WA 3D6FB 2FVCA 5DLGA 4ZVUB 4WFBQ 2JLGA 1ROFA 3SCIE 4J9KA 2JEGA 3VWSA 5L1JA 4Z7YA 3HZGA 1SIZA 1NHKL 4ZVHA 4ZP9A 1AXQA 3N6LA 2EG2A 4NPOA 3D0HE 1PBUA 4LBPA 1SI9A 2FHMA 4KH1B 1TUWA 2DNNA 4OLPA 1TKDA 2BKPA 2QIFA 3PYFA 3GE9A 3K17A 2ZHBA 1IBKF 2Y8WA 4CO0A 4J7CA 3THVA 1WF2A 5D8HB 4J9LA 5JVHQ 2QO3A 1F0XA 2VQEF 1N0VC 4UOFA 1UEKA 3MAQA 2AJ4A 4ZPCA 1DLOA 2XMJA 2BABA 4XTTA 3CVKA 1BHNA 3R9LA 3V81A 3SQOP 4OZNA 1B0TA 3PVXA 1CPZA 2DH9A 3K5NA 1JXEA 5CYJA 3KXDA 4DV7J 4ZA1A 3TWZA 1P8GA 4FNHA 2RF2B 3PJXA 3MFIA 3DHXA 3OSNA 3J7Z5 1GFWB 1T9VA 4F3MA 2VG7B 2HZVA 1UFWA 1FNOA 2YTCA 3CJKB 2CJQA 3TVKA 4NLQA 1U24A 1XNQJ 4XAKA 4NLXA 3DMJB 2OSQA 4JV5J 2OELA 2DBBA 2B3TB 4PPZA 5SUHA 4PG4A 4DPUA 3EZ5A 3OPKA 4Q2MA 1U25A 1BQXA 1JKHA 1Z1ZA 1YG0A 2FLNA 2COLA 1FT8A 1GXUA 1ZM3A 3B82A 1OO0B 1UJ6A 2AYGA 4EWTA 3PG9A 1IJEB 1A9NB 4PAAA 4A8YA 2YH0A 1MG7A 5JXSA 1AZSA 1HBNA 5KOXA 4H54A 4IQMA 1YJVA 3W8GA 3LP1A 4EBDA 2ZD1B 1S1UA 1R8AA 4B9SA 4YMEA 4ICLB 3CPWR 2C28A 2CQ2A 3S7RA 1RE1B 5E5NA 3CEDA 2ZH9A 2PE8A 2PMHA 4YB7A 4PWDB 4PWWA 1D9FA 3CIZA 2BYCA 1MN9A 1J2VA 1SKUB 1I51B 4OV1A 3TAPA 5L1KA 4ZVFA 3CCVS 2M52A 3SEOA 1H7XA 2XLIA 2NPIA 3AODA 2F9JA 3U1LA 2HHQA 1G4CA 3KK2A 4JI5F 1JLQA 4O23A 3RB4A 2CPYA 5FJ4A 1OPIA 3VCDA 2H1YA 3FNNA 4DQPA 1WKLA 3C16B 4AL6A 2DO0A 3DYAB 3DRRA 4W4MA 3GCXP 1JJCB 2UU9J 1ZA1B 4S0MA 1U1RA 1DTTB 2E9ZA 2HWTA 1S0OA 1PYSB 4O4RA 2ZH4A 1XN9A 2EWHA 4KHPF 4MAKA 4I7FA 1CQMA 5HO4A 3Q8RB 2ILYA 3BSNA 4KPCA 1SQFA 2R7SA 2LLZA 2RNEA 1QAYA 3I9V9 3MCOA 2HVZA 5J1PA 3MUVP 3Q83A 3OL6A 1HI8A 1G7CB 5CHCB 4LF9J 2Y1RI 3LP2A 4CI0B 2VH7A 1IBMJ 3R8YA 4J9UE 2X1AA 2ZBPA 1XERA 4IH5A 2OPQA 4AXIA 4DX6A 2QSWA 4ZS6A 2HBRB 2HYIB 4TY8A 1M90T 3C14B 3PW2A 2XEXA 2VA2A 3R5JB 5GAEU 3PDNA 2H65B 1HD1A 3QO9B 2X3GA 1I94J 1HYSB 2IA6A 4HACA 1FJGF 1K1SA 3IO1A 1NK5A 4C4WA 1OPZA 1HNXF 1WKKA 4YR3A 2QL7B 1HBMA 3EE3A 4EO6A 4IRDA 3V4IA 2DTJA 8ATCB 1EP4A 1NH7A 1R43A 4P75A 1BD6A 4QIGA 3I0RB 2G2YA 3S8SA 1HHQA 1B0PA 3NWRA 3CJ2A 2A18A 3KLFB 4Q0BB 3GP9A 1FRLA 4ZJQA 4LRBA 3ILJA 4DL4A 1FHTA 5KT2A 2UXDF 4LSLA 2FD2A 3OL9A 2WB1D 4R5PA 5DLFA 2I0XA 4L3NA 2DJWA 4OHVA 2YX4A 1EQ0A 4KRWA 3R3TA 4LRDA 1GMVA 2R2RA 2WVBA 2GVDB 3B4MA 1FCAA 2EK1A 3D7SB 3ZTOA 1WD6A 2QN6B 4PUOA 5KFSA 2KDOA 3B78A 2CJKA 1V6HA 3T9NA 4USWA 1EB0A 2CQ3A 3DOLB 2DXDA 2BEFA 5KT4A 4F50A 2EC2A 2J7UA 2YWEA 2CXEA 4DF4A 4IG0B 1Q7LB 4F67A 1RYRA 1NSPA 3D9BA 4DV3F 3PFEA 3DOMA 4V1Ak 3CCMS 4ETZA 2MHEA 4M63A 4LT6A 5E0OA 3F41A 3R6GB 3MM7B 3IR7B 5AE2A 3N9UC 1VR6A 4DZ6A 1PG5B 2YNGB 2IM0A 3QNWB 2C2RA 2ZWOA 4I56A 3T5KA 1YLXA 1OMSA 5ADZA 5CXTA 2JEFA 3UPFA 1SC6A 3GJQB 5CYMA 3BF4A 1F3VA 4OJ1A 3PY8A 2UUAF 2J9EA 3Q24A 1HNVA 2YKNB 2DCLA 3QGHA 4I6WA 1BXNA 4X4TA 4B9NA 3GPAA 3DDKA 3HMJG 2AU0A 5CZXA 1RTJB 3L7PA 3CD7A 2RRNA 2YBVA 3GIIA 2J8AA 3Q8SB 3KNGA 2MHNA 1U1QA 2LA6A 1NK9A 1HWKA 2HVIA 1Y11A 4LFCF 3JSMB 1MROA 2LDIA 1LFWA 1NSKL 2OD6A 1F3FA 5KFIA 2MSTA 2ZJQQ 4LF2A 2BE2A 5DO2A 3G6XA 3MM6A 2OPRA 1PILA 4NEZA 3ZC4A 3MM8B 2VQFF 4I6AA 3FSYA 3GTYX 5A76A 4KR0B 2YKAA 1Y00A 3OTDA 1D8ZA 2ASJA 1WC3A 5LJ3Y 1YJNS 5BR8J 2F4VJ 1H2UX 2ZBCA 1S6UA 3CDAA 2YX1A 2NUUG 2KHCA 4P9SA 1QM9A 2M2BA 2CZ4A 1DTQA 1Y5LB 3SCKE 4C11A 3BB5A 1V3SA 1NK4A 1JJ2R 1HQUB 3H2UB 2YNHA 4U96A 1UTAA 4OI2A 3ZNUA 2NZ4A 1NDPA 3Q2TC 3JTNA 2VODA 1Y9OA 1TP7A 2V8PA 2QC3A 5KG1A 2XYPB 4RWXA 2ZZNA 2MZ1A 2W8KA 2AEJA 1NK7A 4USVA 2HEKA 1KS2A 2O1PA 4BHQA 5I3PA 2QLXA 3S01A 2XGQA 3ENQA 1AFIA 2CPDA 3OFFA 5K5MA 1RCXB 4DV7F 1TK8A 3NY0A 3P5TL 1S79A 2IY5B 4KKOA 3CJSA 2VPWB 4GVLA 1BGXT 3RTVA 2GVZA 3TNVA 3ZZTA 3G87A 2HK2A 2RRBA 4Y2KA 3MUTP 3G86A 1RAIB 2CPZA 4QQBA 3US5A 1JX4A 5CYQA 4IOAQ 2HNZA 2ZE2A 4JV5F 3A13A 4JI7J 1FJ7A 5KFFA 3BR8A 1T7PA 4NCBA 2M9KA 4FS2A 3H98A 4ETXA 2P9GA 4DR6J 4JP8A 1JLCA 2DT9A 2J76E 1TL7A 4ITSA 4WYWA 1RKJA 1VJQA 4GVBB 4G1IA 1TKXB 1SQGA 3AHPA 4IG3B 4RU9A 4JI4J 4J9PA 1F60B 4XO0A 1NK8A 1EX8A 3FMWA 3MM5A 4OHYA 1RA7A 2G0CA 2XO6A 2MEWA 3GR0A 2CAJA 4C3MA 4CTAB 3P4UB 2IVMA 1RDRA 1FFGB 5FLXY 3BM7A 3TARA 3NEKA 4IH6A 2NZCA 1R6VA 4B17A 2HHPA 1OWXA 3BO2A 2P8IA 3PHTA 3GU0A 4CO5A 4DSLA 1B0VA 2IMWP 4M5IA 4X4QA 2IC3B 5CQGA 3NOCA 2KXHA 3PEHA 2CQ4A 3KLIB 5KG0A 1XNRJ 4L76A 2HS3A 4TKTA 5B0DA 4OX9J 3KTQA 1DZ5A 4JI6J 2IJFA 2E9RX 4PG8A 1GTEA 4OYZA 3IC1A 2J7WA 2ZZTA 4L6V3 2QYCA 3OD2A 1YBUA 5F9NA 5D0GA 4EYHB 3ZTSA 4P72A 1SL0A 3SV4A 2Z4PA 1WDDA 5KOWA 4OZJA 3DGPB 1M5HA 4N41A 3DI6A 1FRJA 2WONB 3TJ9A 4CH1A 1WHXA 3N5BA 1LWCB 2QFJA 3H2VE 2MQNA 1VQ8S 3JS9A 4KGVB 1XBWA 1IKWB 2HGMA 2UZAA 3HI9A 4OI3A 3GFXA 3IS9A 1KLMB 4IQXA 3TANA 4YB5A 3R7BB 2KI2A 1IKYA 4CYUB 5KFZA 1U49A 1K1QA 4ID5B 4ILRA 4QW8A 4IR1A 1IM6A 1U7LA 4L72B 4I2PA 3ITHB 3UN3A 5L1IA 2NUHA 2KFYA 1C4AA 1P9YA 2X51A 5D15A 4HI2A 1H72C 2XMUA 1UWBA 1IBMF 3TAMB 1H7WA 1K47A 2D9PA 4WP3A 2Z30B 4LF8J 3EM1A 5KFXA 1UFLA 4GO5X 5E3RA 1XC9A 4NYZA 5ETTA 1W7WA 2FJBB 4A8WA 4NLWA 1GK8A 3A8KA 4DDFA 9RUBA 3OHAA 3RR8A 4DL3A 3MR6A 5K20B 5IT0A 2AZ1A 2CADA 2IMOA 3H25A 1EETB 2P5VA 2V94A 1Q95G 4IYQA 3OVBA 1I94F 2CPJA 4I2QB 1SJFA 1FEEA 2G2ZA 4EYIB 1R0AB 3IWLA 1WJ9A 4WE1A 3BGRA 4BC9A 2BJ9A 4RWWA 1QY7A 3CCES 5IV4A 4BDPA 5HANA 3A4TA 3ISND 1B99A 4L3KA 4M94A 3BV8A 3K5MA 1H3DA 3BYRA 3CE8A 2GHVC 2AW0A 2HLUA 2Z58B 3HSJA 2YWGA 1XTZA 4NRUA 3JB9k 2FHJD 2R7UA 2CRLA 1RHKB 1GQEA 1N4LA 1L3KA 2OGUA 2FVPA 1Q86T 1N5QA 3PRVA 4ED7A 3BPDA 1HFEL 4NE9C 4GMKA 2FJEB 2DR8A 1SQEA 1KQKA 2DNMA 2V8DA 3MR7A 1TAQA 1GXTA 4UOHA 2ZH2A 2GHPA 3QFHA 1J5OB 1DY3A 5CD4H 3CUNA 3M2VB 1I5OB 4ANCA 1RT2B 4EU0A 2W9CB 2D3O1 1IR2A 1ZM9A 4O44B 2V8VA 2UXCJ 2B6AA 3SCLE 3JSRA 1RZMA 3J7YU 2N7CA 4NXMF 3ENWA 5J1EB 2EBEA 1GXLA 4ZCLA 5DDQC 1TL3B 2LXUA 3NBPA 2KYZA 2C3UA 3VR1A 1N5SA 2Q6BA 3TO8A 3ADAC 1B7YB 2Z57B 5DM7Q 1NXIA 2PGCA 2KM8B 3DLKA 2K3KA 2VC0A 3T5HA 5CAAA 4ICLA 2YPZA 3THPA 3LQVA 3CSKA 5A8RA 5T41A 4QIFA 4RNNA 3MPVA 1S1TA 3T3FA 2AX1A 3ZXWA 3TRGA 4JBCA 2IVFB 5IT9Y 2R8HA 2PEBA 4PXCA 4DV5J 3PX6A 1I1GA 3H7HB 2MGZA 5HLFB 1T03B 2NXNA 3WHIA 1T11A 2LYVA 4KGZB 7FDRA 3O6QA 1XIQA 5KFWA 4UZBA 1CJVB 1JXVA 2BJ1A 5H9EK 3FBFA 2OJ3A 4WZMA 2H48B 2HSEB 3N4WA 2JVOA 1RT5B 4ELTA 4WCEQ 4LIRA 3OR1A 1F9FA 1WHYA 3DYAA 1RUSA 2VOOA 1RWPB 1R8HA 1Q7YT 3BGOP 2V9WA 3KJQB 2PDAA 2W4PA 4OZ3A 3UD4P 3HHDA 5J2PB 2OO4A 3JSBA 2BR0A 4UF4A 2V4JB 2Z2MA 2LFVA 1JIHA 1P9QC 4KH0B 2ZDOA 2HQIA 1RYSA 4AXJA 2XCAA 3LP0B 1FDNA 3FZ2A 3GJTB 4H4MB 5M2RA 5HMZA 5BR8F 2LXIA 4PG5A 4UT4A 2CDRB 1X4FA 3G96A 1X4BA 4HLBA 1SV5A 2AT1B 1D1UA 3ZZPA 4JI2J 2J0SD 2OTLS 4C9DA 3E01A 4AQYJ 1CJTA 4ANDA 1AUDA 1N48A 3MCNA 1UKUA 5GMKa 4MH8A 4LQ3A 3G4SS 4RW8A 1DHMA 1X7VA 4Y6IA 1KHWA 2WAQD 2L9NA 4WWSA 3NGDA 1RHMB 2BANB 4RNFA 4FPIA 5LMUJ 3DNCA 3QRRA 1ITPA 3QIPB 1BC6A 2J6TA 5A8WA 2JSXA 3NCQA 4ZVTB 4IRCA 3NWGA 2JFKA 1WC4A 4CIOA 3H42A 3M2UA 4I4BA 3QMQA 3DM2A 1ZPVA 5A6PA 2FLPA 1CS4A 3W9IA 2F8MA 3HPOA 4P73A 1ZZFA 5K8PA 1FWKA 4FF1A 1XJWB 1PSDA 3BYPA 1EIYB 5CH7B 5KFYA 3CO9A 1FDDA 1QTNB 1EHWA 2BQUA 1PCAA 2E7VA 4JI7F 2DH7A 5CZVA 3M6UA 2OTJS 5L9XA 2GVDA 2K7JA 4TVAB 2C3OA 4OX6A 4NI2A 2V5HG 1RTDB 2IM1A 1K73T 1X0PA 4C48A 5K14A 3VV2B 5LSRA 4KPYA 4GKJF 3AA9A 4FBUA 3KLEB 4JI4F 4U7UK 2AKWB 2DHGA 3DLJA 1S6QB 2NXUA 2XMVA 1NZAA 1DARA 4IG0A 1B70B 1NJYA 4TYBA 1QUPA 1UA1A 1BQMB 2W01A 2JLFA 3K5OA 4J9OA 3W5YA 2YKOA 5G4DA 3D67A 2QMWA 3IG1B 1FERA 1OY8A 4CH0S 5BYRA 2FVQA 5DG7A 2A2CA 3OUYA 3IA0A 4DR1J 3A3OB 2K2PA 5AXKA 5LMNF 2MZJA 3W1YC 2LP4A 1XNRF 4X62F 4RKUC 4LFBJ 3QGPA 4DQSA 4CT9A 4HH1A 1C1CA 1PAEX 2H5IB 1HHTP 4OX9F 3RRGA 1S4EA 4QBUA 3DLLQ 3H5XA 2YKNA 4NX9A 2UUBJ 5HBMA 3T1AA 1U4BA 4X66J 1MW7A 2KJWA 4DL6A 2ASLA 3POTB 3TA2A 2CVEA 1NDLA 4EI2A 3MOZA 1DQ8A 1HQEA 2YNFA 3OL8A 1U0HA 4TNOA 3SDEB 4USTA 4P7TA 1IM4A 4DSJA 2PEHA 1GX6A 3W61A 3GV7B 3MXHP 4DN9A 1TL1B 2QV6A 4RW4A 5D3GB 4Y28C 3M30B 4KV8B 1Q5YA 4CLLA 1O6XA 4CCHA 3DRXA 1HWIA 3QGGA 1TMMA 5G0RB 1N36J 4DUYJ 1XMOJ 3KHLA 1KNZA 3CDEA 1NKCA 4IKAA 2R7WA 2BJDA 4X4RA 1FXLA 1AW0A 2F3JA 1PJ5A 2VHGA 4UW2A 2VKZG 2MQLA 2FC9A 2XO7A 2BJ3A 5BXIA 1N56A 4ZVEA 3VAIA 2HVEA 4LF8F 1VI7A 3I82A 3BBFA 2DNKA 1RAAB 5KFPA 3PJWA 2IRXA 3EXYA 1RP5A 1K9MT 4KE5A 4C8KA 5EDWA 1K8AT 4QWBA 1REVB 1S76D 1HKAA 4QPXA 4F25A 3CJTA 2JL9A 2MXYA 1JNZB 3CGIA 1PYOB 4R0EA 2IRUA 4LSNB 3SXLA 1H6KX 3SBMA 2V4RA 3OTEA 1RTZA 4O4GB 1UVJA 3D1HA 3R5AA 2EEYA 2VA3A 2Q43A 4TN2A 2DNYA 2F40A 2QL5B 2MZSA 3I96A 2L9DA 1S9EB 4TYAA 3MEGA 5E3PA 4B9VA 5M2UA 4JUZA 4IFVB 1XK8A 5F9LA 3PNIA 5KTQA 3QIDA 4CQ1A 4LR8A 3MEEA 3MURP 1X4HA 3GYGA 4RO0A 1S1XB 1BE4A 1FXDA 4LMZA 1RAGB 4E98A 2J7KA 3Q8PB 3W66A 4M5GA 2B51A 1JLEA 4WFYA 4USUA 2FJVA 2EFPA 5KG6A 3W8PA 3KLHB 5M2PA 2JEIA 2HHXA 3FMBA 2CWKA 2H9ZA 2RU3A 3CCJS 2D9OA 4IUFA 5I4MA 3MEDA 4KO0B 2RHSB 4EZ9A 2RUSA 3GJRB 1SKRA 3E3XA 1VJWA 1VRUB 1T9XA 5DZ6A 5AXNA 2ROGA 2W4CA 5DQGA 2UXCF 4LRCA 2K1RB 2BRLA 3CCWA 4P7VA 2HHSA 1VBXA 2HNDB 3M4XA 4D3HA 3MAHA 2PT0A 4MTPA 3CC2S 2HIQA 3W5XA 4CTAA 1VC5A 2XZTB 3KK1B 2E5LJ 2VDHA 2Q1LA 1HPZB 2HBQB 5HP1A 2KFNA 4UTGA 3T6BA 3UVJB 2X1BA 1B3TA 3W2WB 3BBCA 1SCJB 2LU1A 2DNZA 3CMQA 2KHDA 2IHR1 5ETKA 3TA0A 2RQKA 3QJLA 1AFJA 2ROPA 4OZ5A 1LWFA 4CLYA 4F3QA 1TFWA 2C3PA 4JV1A 2IRYA 3M2RB 4K4VA 2G9OA 1TKTB 2GW8A 1HWJA 2MKSA 3QBCA 4P74A 4ZJLA 5D0HA 4HHJA 2GQQA 3R1HA 5DDPC 3SQGB 3ONQA 1BQNA 4DL7A 4X64J 4H4OB 2J0QD 3K89A 2L08A 1UVMA 1QAIA 4A46A 1EKSA 4M5LA 2J0XA 5E2QA 2EK6A 1CULB 3IN5A 4UUXA 5ETMA 1T95A 1FRIA 2XSJB 5HVHA 4LIWA 3CDBA 2VG5A 2DGUA 2VBZA 2Y0SD 2HGNA 2ZVSA 4CO3A 2F8HA 3RYLA 4DXLA 2DD8S 4P2FA 4DBQA 3WDOA 3HX9A 3CJ5A 3D0GE 1HMVA 1U6FA 2DGTA 3MPDA 2X1FA 3BEGB 2A0FB 2C2EA 3FBBA 2EKNA 3KHHA 4ECWA 4MIWA 1ZYQA 2B4VA 4ZVQB 3QAEA 1UEVA 3OQ2A 3BQ0A 4HH0A 2RUGA 3IR6B 4CLZA 1RHRB 5L8RC 1IN0A 2LU2A 5DRKA 1XQIA 4AQYF 3B4DA 2P9EA 3MECB 2BM0A 4DFKA 4B3TF 2E9TA 1ZZNA 3MMCA 1J27A 5DGAA 3V6DB 1AA1B 2W24A 1JLFA 1T8EA 5ETOA 4PR6A 4F2SA 1C0TA 4RBUA 3HVTA 2WW8A 4GC6A 5AJ3J 4OQJA 4HDHA 5HATA 2CJ9A 3M9NB 1CJKA 2KT2A 1HA1A 2J6UA 4DCPB 4C2MA 1RT4B 4KQZA 1ZTTA 2BJ8A 4OLOA 4P71A 3N28A 3PRDA 4L74A 4UY8T 2WHOA 5LMUF 4PXEA 5GAGI 1HR0F 3OVSA 1IBLJ 1S1VB 4C0HA 4CO2A 4F04B 1U1MA 5C25A 4IO9Q 3MD1A 2VPZB 4HI1A 3PW7A 1RTIA 4M8LA 4ED6A 4PQUB 1TU0B 1OY6A 4FYXB 1TL5A 1HHSA 4CM2A 5EGYA 2OPSB 4Y00A 1WEYA 3G82B 3Q8QB 1X5PA 5DG9A 2MQMA 2DGOA 4M5DA 1NDKA 4FXVA 3NMRA 1MSWD 3KG4A 1GMUA 1RT1B 1UW4A 4GC7A 3IM8A 2AJ0A 3B6BA 4DR4F 3L9ZA 1RTHB 1NKEA 4NLUA 3H40A 1C0UA 3K2YA 4GO7X 3DFEA 2VKRA 3I6PA 2VG6B 3BO4A 2V4QA 1IWGA 2QJ3A 4ECRA 1J5OA 1ZAVA 1U45A 2WB4A 1NPRA 3M2VA 3VTIA 2ERRA 1ZPWX 3R97A 2NSCA 1RT2A 2W9BA 5F3ZA 2KTQA 4ZPAA 1OQ3A 4ED2A 2OD4A 1T9WA 4O44A 4ZP7A 4USMA 4YQWA 1H0HB 2QG9B 4P2SA 1UETA 3QAUA 2YH1A 2HLTA 5FIIA 2BRKA 4A8MP 2PI5A 1NH8A 3CCTA 3I31A 3M9OB 3HFKA 1OIAA 4M95A 3PTWA 4F36A 2IYGA 3UWTA 3M32A 4NCGB 3GSIA 2GO8A 2B56A 2C2KB 2ZHOA 4DR1F 1RBOB 4KGKA 4KB7A 3QLHA 2DO4A 2IM2A 3NGSA 1SJ4P 4I0WA 1SKSA 1VQOS 5KFDA 2JZ5A 4EUVA 1TQLA 5F3TA 4USHA 2QMXA 4JB8B 1S0NA 2BOPA 4DG1B 3M8PB 2GHWA 2UUBF 1QE1B 1YDLA 2W4DA 5T7LB 1N32J 4MMOA 2DYAA 3HCXA 1Q5VA 1UVKA 3VAMA 1TVRB 4FVCA 4X66F 2M5YA 3DDNA 4DUTA 2D74B 5A8KB 1CG2A 1HL6A 4IDKB 2E44A 4V19X 2E1MC 3IAM9 4PQAA 3IBWA 1AUSL 2CPEA 2KVIA 3OTBA 2HWIA 2W2PP 5I42A 5F8JA 2UXBJ 4DS4A 2GZOA 4IRKA 4EFAC 4OL8A 2VPXB 2DRDA 2OEMA 4P2MA 1D0EA 1HNZF 3W2VA 1IR1A 1QAXA 3TA1A 3ILIA 2KJVA 4FYDA 1VC0A 1V5VA 1S57A 1VQNS 2ACMA 1CJUB 3R27A 1FX2A 4WIIA 3CXCR 1H73A 3M1VB 1IR0A 1N36F 2HS0A 3HT0A 4FF2A 1SUQA 4K2JA 4DUYF 1XMOF 3SI8A 2AGOA 5C24A 3NGKA 4H4MA 4ENOA 1WG4A 4DR2F 3GCWP 5A6WA 3RRKA 2O67A 1L3SA 3V6HA 2JRSA 2CPIA 4Q2LA 2W2NP 3TZWA 4J9VA 3NLCA 1RWNB 1Y5IB 3H0PA 2ABYA 2HAFA 2VICA 2L9WA 5LXRA 1XMQJ 4X2BA 4ZJOA 5GMEA 1JLGB 3LGHA 2Y8YA 2Y9HA 2X1GA 3EGNA 3DC2A 4C8LA 1F9HA 2GGPB 1YSJA 1KP6A 4ECYA 3TEGA 1HW9A 1I3OB 2EC0A 3B54A 3DLGA 1RAHB 1KWMA 1RADB 1IJFB 4OYMA 2HWHA 2LVWA 3AH6A 1N6QB 3NAHA 3IWNC 2M7SA 3PRBA 2WOMB 3G8QA 1G2EA 4ELVA 3HHKA 1R89A 5HMYA 3F44A 2N4DA 1RKIA 1D9AA 3Q22A 4RL1A 3AJ2A 3UDEA 3DLEA 3RAMA 3EVMA 2XS7A 1YI2S 4YOEA 3BGFA 1HBUB 5ETLA 4U8VA 2HFVA 3AAWB 2WVFA 4LJMA 2CYYA 1WSVA 4CLKA 3BDPA 4O3PA 2XHCA 3L7UA 3RB6A 2P9CA 2Z56B 5HSPA 1WF1A 2KKHA 3MD3A 2DGQA 1X4EA 2BKOA 1P1TA 4W90B 2CG4A 3BSAA 3C15B 1OYDA 2VFUA 1KVIA 4C6AA 1JMTA 1JWWA 4ERDA 3CJ8A 2I5JB 1S59A 1Q78A 4CM0A 2Q79A 4ED0A 3I87A 5IXUA 2AJ2A 2LECA 5C5JA 1WC5A 3IAS9 3CMES 2VV5A 2PA3A 3OL7A 3CB4A 1E6VB 1PC4A 3I0SB 3IG1A 3UN2A 2E5LF 2EVZA 3U02A 4QW9A 5FDLA 2GS8A 3T5JA 5U47A 3IRXA 2GQ2A 1HNIA 2OH2A 3MAAA 2HQCA 4RW9B 2FYXA 3DRSA 4ZHRA 3FRZA 4K8RA 4KFBB 3D3BJ 2XMAA 4CLWA 1MU2B 1NLKL 4B3OA 3J7A1 4QR1A 2O66A 4A8OA 3UE2A 2CPXA 1MNEA 3HVRA 5E7OB 1OY9A 1YJUA 1KD1T 2J8SA 1FRKA 4LF4F 3ZTRA 1S6PA 3WX4A 1S1WA 3WIVA 4IH7A 3HULA 2C1EB 2OPPA 4X64F 2WBRA 1DURA 1Y3KA 2OKQA 3LGNA 1FK9B 2AHOB 2ASYA 2NPFA 2MY8A 1MMLA 1LWEB 3PYGA 3QQCD 4LFCJ 3PCOB 2MKKA 1N5YB 4B08A 4TU8A 3MWBA 4L75A 2XMMA 3IM9A 2NYHA 3M30A 3AB2B 5KFCA 3TX8A 3VVUA 2KT3A 1N8RT 1V9OA 3EPGA 4RNHA 1KBRA 1LV5A 4HEA9 1Q8BA 4FVMA 1VS3A 5CABA 2KYXA 5GMDA 3J7AN 3B8HA 5JJBA 2D3ZA 5DJBA 4CLTA 1LOUA 1GMWA 1M5SA 1SC3B 4DV2J 2CJBA 3KJVA 5AJ3F 2I2YA 4HR2A 4B9LA 3I5BA 3W3SA 2YWKA 2L48A 2OEKA 1S7HA 2IJNA 3QSYB 3DRPA 4CWBA 1FTCA 4FZVA 1PO6A 3TUJC 3KMSA 3E2EA 4R0JA 2DKOB 3ET6B 4KC5A 1KFSA 3TX0A 3HSGA 1HWLA 3HHNB 1S9GA 4CZCA 1IBLF 5EHHA 4YY3J 1V3RA 1BUXA 4O4GA 5DDOC 5B09A 3QFWA 5IV3A 1Q16B 3OXFA 4Z37A 2YKMA 4HTIA 3T5LA 1JLBA 4K4TA 1RT7A 3HKWA 2ZKTA 3CF5Q 1FI4A 3OSPA 2RSQA 2NS1B 1S9FA 2JX2A 1Y0HA 4IFVA 3LPEA 1S49A 5KFMA 2XG8A 3DXBA 2LDYA 4N7TA 1VHIA 5J2NA 2ALYB 2HBZB 3FBEA 4ZN1A 2Q66A 4KHMA 5BYQA 1DLOB 4NMLA 2K3IA 1N0UA 2V63A 3Q23A 2LA4A 1KHVA 5GAEI 3MMJA 3V81B 4DFPA 2QTWA 3OW2R 2V69A 1Q53A 3PZPA 2ZBIA 3HDSA 4UQTA 1SJQA 3MEKA 1GNKA 3G9CA 2XNRA 2HAIA 4CO1A 2KB2A 2HZCA 3DCAA 3K8VA 1WSRA 3M8QA 1VBYA 4RUAA 1QVGR 2XY7A 4QWEA 3V2UC 1LK5A 2B7CB 2LCWA 4JI1F 3KLGB 1TK5A 2YQ1A 4QYRA 4NLGA 1JLAB 1U6BA 1WHWA 4C97A 2FQQB 1ZM4A 1WI8A 2WBMA 4TQSA 1FKAF 2D7SA 4K5RA 4JI3J 2N4CA 2HRUA 3MMBA 5AXMA 1IQZA 5A0YB 4DR5F 2V8HA 2W25A 1JK9B 2MQOA 3Q86A 4D3GA 3W62A 5LSOA 4C3LA 1YK9A 3MGJA 2AGPA 1LW0A 4F0MA 5GADU 1RAFB 3DOKB 1QUVA 1VQ7S 2DXFA 2R42A 2YNIA 3G6YA 2H51B 3ZO7A 1FD2A 1N32F
chains in the Genus database with same CATH topology
1JIHA 3U27A 1C1BA 4IG3A 3ZZ0A 1JLEB 1P9QC 3MFHA 2ZDOA 2HQIA 1FA0A 1FVSA 1HBNB 5T14A 1IKVA 4TU7A 1XNQF 1RYSA 4AXJA 5K8NA 5KT3A 2XCAA 2ZJRQ 3LP0B 1FDNA 3FZ2A 4ECTA 4Q8EA 4LUBA 1WELA 4F4KA 3LP1B 1QAJA 2MPUA 5B0EA 4H4MB 1Y4ZB 5M2RA 3MM9A 5C42A 5HMZA 5BR8F 3VAGA 4IFYA 5JUMA 1TR0A 1S1UB 2LXIA 4PG5A 3QZ8A 4MJKA 2CQCA 2V8GA 4K0KF 3IR5B 3WBZA 3FJ2A 2F7VA 4HTJA 5H1SV 2LMIA 2QRRA 3HHLA 1X4FA 1YRXA 5KFNA 3PIOQ 3WC2A 3G96A 1FKPB 2EI5A 1X4BA 3TVYA 3FFIB 4HLBA 2UXBF 1SV5A 3MEDB 3KYLA 5HMWA 5E33A 5DG8A 1D1UA 3FZBA 3ZZPA 2J0SD 2XMKA 4OFZA 2PFFB 2Z2LA 2OTLS 1RT3A 4C9DA 3E01A 2XWXA 4NZ0A 2OMOA 2Y1JA 3MR5A 1AUDA 3N5FA 4RLEA 3UCUP 2G4BA 2IC3A 2PC6A 5DDRC 1N48A 1RAJA 4WZQA 4KKOB 3UR0A 4DSEA 4B9TA 2B4UA 1UKUA 5GMKa 4MH8A 1KRPA 1XEZA 4LQ3A 5SZTA 1BLUA 4JV2A 3KLIA 3G4SS 5KT5A 3HHEA 2E1RA 3OXLA 4WFXA 4F02A 1NAQA 3LAKA 4RW8A 1GTHA 1MWYA 1FTRA 2KU7A 1DHMA 1X7VA 2E5HA 3SSSA 1YRTA 4QIWD 4Y6IA 2DR5A 4LFAF 2KN4A 3BN4A 2RKIB 3C6UB 2RE1A 3RRHA 1KHWA 2WAQD 1X0FA 2NR0A 3DRYA 2I5JA 2L9NA 3KK2B 3NGDA 1IKXB 3RW7A 2ADCA 1YTYA 4F4YA 2J9DE 1JLQB 1FDBA 5KFHA 3NMAA 2BANB 2MKCA 4Y2MA 4ILLA 3M8SA 3SYZA 4RNFA 3KG0A 5CYQB 4HT7A 1SXLA 2BXJA 2EFVA 1I6JA 2O01C 3OXGA 1S77D 3DNCA 2VC1A 1ZETA 2YKQA 3TR5A 1YGYA 4DF8A 5HP1B 2XI2A 4XDDA 4ES3A 3QIPB 3K58A 1BC6A 1JJ4A 2J6TA 3RB0A 3GZ7A 5A8WA 1E6VA 2JSXA 3NCQA 4EGLA 2IBKA 4KAIA 3HKZD 2A10A 4OZLA 3QJPA 3I0SA 2SXLA 2QT7A 5L9NA 2JH3A 4IRCA 1UJ4A 3CCUS 3NWGA 1SL1A 3DRRB 2JFKA 1VLYA 1QTMA 5F41A 2A2DA 2E5IA 5LL6d 1YJWS 3KMQA 4QR0A 3ENVA 2KG1A 4F4WA 4YR2A 1DRZA 4RW9A 4CIOA 5HL7Q 2C3MA 3M05A 3NS5A 3DU5A 4B3SF 2P6TA 3DGPA 2RVJA 3M2UA 1S0MA 4ES1A 3C6TB 1LWFB 1URRA 4KFBA 4NLOA 3PO5A 4Y65A 2B4PA 4I4BA 1XMQF 3BGLA 1MU2A 2QE5A 2WONA 3QMQA 3DM2A 1ZPVA 5A6PA 1HBOA 4I7FB 3GWCA 1N5VA 4QU6A 2FLPA 1LWCA 2BM1A 2BDPA 3D1OA 3PW0A 1R8BA 4WKRA 1IKWA 2Q6CA 3Q0AA 5KFTA 2XLKA 2F8MA 1KLMA 2PIIA 3GV8B 1KFDA 3HPOA 2XNQA 2GX8A 2B7BB 1ZZFA 4K4YA 3SSRA 5K8PA 3AJ1A 5EWEA 2R8JA 4WF9Q 5KG2A