5F0UA

Crystal structure of gold binding protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
65
structure length
65
Chain Sequence
GMQFHIDDMTCGGCASTVKKTILTLDANATVRTDPATRLVDVETSLSAEQIAAALQKAGFPPRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Putative copper chaperone
publication title Structure of tetrasilver bound to GolB at 1.70 Angstroms resolution
rcsb
source organism Salmonella enterica subsp. enterica serovar give str. s5-487
total genus 17
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2015-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5f0uA00
2AW0A 3KNGA 2W4PA 1CC7A 1P6TA 2K7KA 4U9RA 3HDSA 2CRLA 3TOQA 1APSA 2ROEA 4OIXA 3MCSA 1MWZA 3BDEA 2LDIA 1X0PA 1RJJA 2XMVA 3LO3A 2FIUA 2XMTA 3CJKB 3VTIA 4NPOA 3KKFA 3TRGA 2OD4A 1YJTA 1VQYA 2OP5A 1K0VA 2KT2A 2JDJA 2QLWA 4HI1A 2VH7A 5B0FA 2K2PA 2PGCA 4QOTA 4A48A 5B09A 1Q4RA 1YRXA 2AJ1A 3HHLA 2OFHX 2QIFA 2VV5A 3HHLB 1FVQA 3TNVA 2XMWA 3KG0A 4DN9A 3DCAA 1MWYA 4Y2KA 3WDOA 1V3ZA 3HHLC 2GCFA 2HFOA 2N4CA 1JK9B 4Q2MA 3FGVA 4Q2LA 1N5QA 1Y9OA 2ACYA 1FEEA 1CC8A 1TR0A 1IUJA 1N5TA 1TL5A 4OJ1A 2KKHA 2LQ9A 2RMLA 4Y2MA 3CJKA 4F67A 5IXUA 2ROGA 2HFNA 4HI2A 1OQ3A 3DXSX 1XBWA 1FVSA 2N7YA 3LGMA 1FE0A 5K9FA 1AFJA 1FD8A 3FMBA 2HLUA 3I9ZA 3T9NA 2QLXA 5F0WA 4Y2IA 3IWLA 2XMMA 1QUPA 1URRA 4HH1A 4YDXA 1Y3KA 3IWXA 1KQKA 2OKQA 1YG0A 2K7JA 2HLTA 2IFXA 2OFGX 3BN7A 2AP6A 4ZA1A 5T7LB 1SQEA 1OPZA 1OSDA 2OMOA 2ASYA 1S6UA 2XMJA 3KG1A 3BGUA 2GV1A 2RILA 5A6PA 2G9OA 3GZ7A 5A6WA 4DPOA 1WD6A 1X8DA 2LXFA 2K1RA 4ZOSA 2OAUA 3HFKA 1TUVA 5B0CA 4A4JA 2K1RB 1TL4A 2BYCA 2HIQA 5B0BA 1YJUA 2BUNA 5KAKA 1YJRA 2BJEA 3UDCA 4FNHA 2N4DA 2GGPA 3BR8A 1OQ6A 1X7VA 2Q3PA 4HH0A 2W4DA 4NL5A 2GGPB 1W2IA 2IYGA 2KYZA 2FB0A 3BM7A 4YEAA 4EFAC 2GO8A 2KT3A 1FESA 1P8GA 3QMQA 4HL9A 1TZ0A 2W4CA 3LGNA 1Y0HA 2L3MA 2RU9A 4OJHA 5B08A 5B0DA 3K7RA 3HHLD 1N5SA 1SI9A 1JWWA 2XMUA 5B0GA 5T7LA 1LQ9A 1KVIA 2XMKA 1R6YA 5B0EA 1ULRA 3HX9A 1Q53A 1GXUA 4OJGA 1FE4A 3QGPA 1Q8LA 2ROPA 2BBEA 2OD6A 1GXTA 2BJDA 2AJ0A 2PD1A 1YJVA 2FTRA 2ZDOA 1Q8BA 1Y3JA 2HQIA 5B0AA 2RSQA 4A46A 4A47A 1N5VA 3E8OA 3F44A 2ZDPA 3FRYA 2QYCA 3MZIA 2GFFA 1KVJA 2EW9A 1AFIA 1CPZA 2IYIA 4FNIA 3BB5A 4OJ3A 1U7LA 1S6OA 5F0UA 4DL0C 3HF5A 1SB6A 1AW0A 2GA7A 3BF4A 2LQBA 1VQSA 2FHMA
chains in the Genus database with same CATH superfamily
4Q43A 2IC3B 2FHOB 1OJ4A 3UR3C 2KXFA 2I5JB 5EWFA 2HWTA 3Q89A 4EWTA 3JSRA 1H6KX 1XIQA 5A8KA 3R1HA 1VRQC 4WFYA 2LU1A 3MUTP 4DV2J 3OJSA 3OL7A 1TQLA 1HWKA 4E2FB 1ZM3A 4CH0S 1KWMA 3NBPB 3CJ4A 2BDPA 2DNYA 4LIRA 1VMBA 3MM6B 1DFDA 2N4DA 2CQ4A 3BS9A 2MY7A 5A76A 3CMES 4LF4F 3P8BB 1LV5A 2FHJD 4A46A 3D1QA 4XO0A 1IBLJ 3QO9A 1BWVA 1YBTA 3NL0A 1RWUA 3BJYA 1RUSA 3CJKB 2DGTA 2OD4A 2ZH3A 4ECQA 4ID5A 5CYMA 4BLGA 3HO1A 1TK0A 3TNVA 4DR2J 4PEOA 1XNRF 5K20B 2BZ2A 1TK8A 1BXNA 4LF8J 3MDFA 5AE3A 3KHGA 5CZXA 3IN5A 4WIIA 4F3OA 3GFZA 3G82B 2ZH6A 3I9ZA 5C25B 3KG4A 2UXDF 3OR1B 4KY3A 2HS3A 3OLAA 5E2QA 4K0KJ 2HBYB 4CIOA 4RX6A 1J2VA 5J2NA 1HNXJ 2Y8YA 1WTBA 3V4IB 2K1RB 3MAAA 2ASDA 5KFUA 5EWEA 1NUEA 4NASA 2L9DA 2OPPB 2L3MA 1IXKA 2DR5A 3SYZA 2CJXB 4L72B 3KJFB 5J1NA 4A8XA 4RU9A 2VFTA 1WF0A 4JI8F 3GFXA 1HQUA 1S9GA 2DNNA 3MR2A 1LK5A 4J9MA 5CHCB 3LP0B 4UOCA 4DF8A 4WP3A 1J5EF 4R8UA 4DV1F 3OVAA 2A2DA 4C48A 2BJ7A 2JWNA 4WK3A 3H40A 2QTWA 3A12A 2JC0A 4Q5VA 5LMNF 2A0FB 1X31C 1S9EA 4CH1A 5F0WA 4EYIB 3DXBA 2COLA 1G1XA 3QLHA 2DGWA 4ZA1A 5I3UA 2RQKA 4USWA 2FHJA 2HIQA 1QAXA 2YVSA 2KYZA 2UUTA 2AJ4A 1TZ0A 3H25A 3BPDA 3ZTPA 1SI9A 2BJ1A 4NMXA 4DV0J 1S0MA 5IS2A 3AOAA 3SV4A 1NK6A 1WC0A 4B3TF 2LYVA 2F40A 4LR8A 1OYDA 1UFLA 4ELUA 1NXIA 1WOOA 4HTIA 1OPIA 1U47A 4QIEA 3EPGA 3IRXB 1FHTA 4EYHB 1YWXA 3ZZYA 2AD9A 1WELA 4USJC 4FYDA 2HGLA 2OPSA 1FDBA 4I1TA 2VDHA 2GNKA 5D78A 1IBKJ 1S1XA 2PI5A 4JI6J 2QIFA 4XPEA 4U8YA 3OTDA 3TR5A 3KJNB 3MMAB 2LEAA 3M8YA 3K5NA 3MEDA 1GFWB 4AFFA 1YHQS 3N28A 3PIOQ 3AHPA 3DXSX 1AFJA 1OY8A 1NPRA 3J7A1 1UVIA 5ADZA 1WOPA 1S77D 2H1YA 3OT9A 3FBBA 3HFKA 3PACA 2FZGB 3OFEA 4MYUA 4DXLA 1T02A 6FD1A 1H2TZ 3THPA 3TAMB 5F3ZA 1RTIA 1TKXA 4LSLA 4FS2A 1T9UA 3T41A 2HGNA 3TEHB 5B0AA 2QEXS 3PW0A 1UZHA 2GHPA 3MZIA 2CQGA 2AT1B 1JLBA 2QC3A 1MW7A 3S7RA 1MG7A 3BKFA 2DCLA 1I3OB 1G3OA 2PEBA 3ZNJ1 4FXWA 1S0VA 1ITPA 2V4QA 4R0EA 2A18A 1M90T 1ICEB 1IKWB 2O5DA 2PFFB 3DOKA 5L9XA 1ELOA 2I5JA 4P2XA 2E7XA 4B3MF 4JI4F 4TNOA 3PX4A 5KFFA 3ILIA 1DTQA 4NLWA 4PG6A 5H1SV 3UQSA 4OZ0A 4TN2A 3PJ9A 4Y2AA 4JI2J 4NZ7A 2HBQB 1VQ8S 3NBPA 4B02A 2MKIA 2V2KA 3N6NA 2KJWA 1RTHB 3MM6A 1K73T 1JJ4A 1RBLA 4OHZA 2XI2A 2DNRA 2KVIA 3QWUA 4OX8A 5FLXU 2K8GA 2I38A 3RW7A 1HI1A 3QIDA 4FF3A 4DL5A 1VQNS 3F41A 3RB4A 3A4TA 2RKIB 3PKYA 2KVQE 3D68A 2V63A 2AIRB 2J0WA 2OIHA 4JI3F 3UCUP 1ROFA 2I6WA 3RRHA 2B5JB 3CJQA 4RUBA 1HYSA 2XMWA 3QFWA 3M30A 2YKQA 2UP1A 2GCFA 2C1EB 3R8YA 3KMQA 3G82A 1WACA 5C25A 1HA1A 3OR1A 1V6HA 3BR9A 2XMMA 1KD1T 4DX6A 4NLSA 3V4IA 2K1RA 2W2MP 5KFSA 3EE3A 4ECTA 1RISA 1PC4A 4KHPF 4N7TA 3KDOA 3IA0A 1K9MT 2R4FA 4FF4A 1FE4A 2GIRA 3G8QA 2ZWPA 4L6V3 2VD3A 2XYPB 3R2DJ 4M1KA 1RABB 1K0TA 2CA9A 3CW2C 4BWJA 2I8EA 3HZEA 2QMUB 2V8DA 2WRMA 4ZIVA 2QLFB 5CAAA 3LP0A 3RTVA 3C3LA 2XMTA 3VTIA 1HNIB 4YP3A 3NOCA 5B0FA 2YH0A 3V6HA 3BGOP 1BQXA 4ZCMA 3J80U 2XY7A 4ED8A 1S12A 5CXTA 3G71S 4NEZA 1RE1B 4HI2A 2FVPA 4PYDA 3LF0A 4JB8B 3H2LA 3IWLA 3CO9A 4RUHA 1U25A 4QIVA 3IFEA 1G6BA 2ZH2A 3P4UB 3RAQA 3TA1A 3DYAB 2JRSA 1YRUA 4DPYA 2X51A 2UU9F 1QDUB 3DRRB 3MXHP 4ZVQB 4OI4A 3BREA 3TARA 3NXZA 2VB6A 4MK7A 2A10A 4BS2A 1HNZF 1NSKL 5KFAA 5L1KA 2J9CA 4C3LA 1L3SA 2RU3A 3W2WB 2YNGA 3ELHA 2KM8B 2HHWA 1S97A 3KLGB 1RXOB 1URNA 3ENWA 4I6WA 1UTAA 4DQQA 1G4CA 3HJFA 1KSPA 3QGGA 3CVKA 3MMAA 1CEZA 1HI0P 1AB8A 4Y2CA 1FA0A 2E5LJ 2IAJB 3GJRB 3TQEA 3LPEA 3H42A 1QUPA 1XMQJ 4KTQA 2OPRB 1NNDA 2IJNA 3R27A 4JI0J 3FSXA 3PW4A 2AU0A 1B0PA 2LXFA 4DQPA 3HSZA 1EKRA 3M2RB 2H5EA 3K7RA 3TAMA 1JWWA 4X4QA 2RIJA 2J7KA 3MTJA 1WWHA 3TJAA 5HJXA 3ENVA 4DU7A 4DPXA 5EHHA 2E1CA 4MFBA 3T19A 3CJ5A 2DBBA 2D69A 3PRBA 4YB6A 5ETTA 2ABYA 2KT5A 2DPIA 4WFBQ 2DNOA 3IM9A 2F4VF 2HHTA 2UUBF 4M5JA 3V6DB 1T94A 2IJFA 4IG0B 1KTVA 2WB4A 4CH7A 4J7CA 3U7JA 2G0CA 4CCHA 4DJBA 5E41A 4LR9A 5KT7A 4URQU 1RTHA 1KN6A 4ERDA 4I2QA 5ETVA 2H5JB 2W4CA 4V1Ak 3QGHA 1VFJA 1M0SA 3C15B 1P1LA 1N0VC 4NWBA 2X3GA 4ETZA 2XM3A 1FK9A 1V5VA 3T1HJ 2YWEA 4CLZA 3W63A 1HHQA 3DCAA 3ENQA 1YITS 1EX8A 1N54B 2M7SA 1JXLA 3M8QB 4RL1A 2RKIA 1EZZB 1KHVA 4CYUB 3CDEA 3AB4B 4IRDA 2B5JA 1KLNA 4KH0B 2YXLA 3BBBA 2XMAA 2N4CA 1N56A 2Z2ZA 4DV4J 1ZBTA 1GNKA 1XEZA 2MYFA 3NGRA 2J9DE 3FQKA 5LMUJ 2HZCA 4DX7A 3VF0B 3B4DA 5A6PA 3K59A 3O44A 5F3TA 1EJ7L 5FDLB 4B9VA 4D3HA 1YJRA 2QLJB 3MR5A 1TV6B 1WC3A 2EG2A 5BYQA 4B9MA 3SDEB 1YJWS 4OJHA 2QRRA 1LQ9A 4QR0A 1ULRA 1SV5B 1T9VA 2XGPA 4USHA 1S49A 4Q45A 2VJVA 1N32F 2IDEA 5AJ3F 5IQ6A 2YPYA 3DLBA 2XY6A 3R5GA 2RS8A 2IA6A 1HNIA 2VL1A 3M1VB 3SSSA 1BWEA 1TUWA 1GT8A 1TP7A 3UCGA 1MNEA 1UVKA 3FQLA 1UVMA 2QX0A 4AL5A 2OFHX 1FRJA 2BANB 1CLFA 1MWYA 4OLOA 3GQCA 1K47A 2RE1A 2IBOA 2MQMA 2HVZA 2QN6B 4LRAA 2KB2A 2Y1RI 2OUGA 5ETLA 2KFNA 1KQKA 3MR3A 4FXDA 1UPPA 3D67A 5B0CA 1RLCL 1ZPWX 4PXCA 3R7BB 3DYAA 2BYCA 1SKUB 3C66A 4O4RA 2MXYA 2V2QA 1WSRA 3C2PA 2RQMA 5MAOA 1FDDA 1HWJA 3LGNA 2UV8A 4Y34A 2MQQA 2A2CA 3DRRA 5D4OA 4U7CA 1GXUA 2OD6A 4L74A 3KK1A 4FNIA 4RKUC 3HK2A 3M2UB 2AGPA 4LF5J 1T9WA 4MK9A 3BF4A 2W9AA 1PJ6A 2DNHA 3CD0A 3TYTA 3PX0A 1BC6A 3M9OB 3TRGA 2YNHB 3FBEA 4TVAB 4PWUA 2Q66A 2VV5A 2XWYA 1D9DA 4G1IA 5FLXY 4K2JA 1IUJA 1FRMA 1UW4A 2IAJA 3RGIA 1IJFB 1C4AA 1CG2A 1JLQB 1WKLA 3FEZA 2ZZMA 2OPRA 3FEYB 3PDNA 3UD5A 3CDBA 3PZPA 3WC2A 3AA9A 2KTQA 4NXMF 4ZITA 4IH7A 2HQGA 5KAKA 3J7ZT 2ZE2B 4X64F 2Y8WA 1NJYA 3M2RA 2R7UA 4EZ9A 7FDRA 3JQJA 4F50A 1X5OA 1RI7A 2DK2A 2NR0A 3MOJB 1BGXT 1XMBA 2F7VA 3KNGA 1IKVB 1N34J 2MLXA 2OGUA 4L76A 5AE2A 2XS2A 5EX3A 1N36F 4QWAA 3VAHA 2JDJA 1N52B 1ZOTA 2E66A 4NXNF 4X62J 4XPCA 1HLWA 4ECSA 4ZHRB 2AYGA 1R0CB 3PYEA 2ZWOA 1ZAWA 3LW5C 5L1JA 4OI3A 4WXWA 4GO7X 2CJBA 2JC1A 4UZCA 1UVLA 1MN9A 5CH7B 1SUQB 4IYQA 4YHHJ 3PYGA 3ZXWA 5SZTA 3SCLE 1RTJB 2L08A 2BQ3A 3ISNC 2P9CA 3D2WA 1NO8A 3DDKA 2MSTA 3HT3A 1NH7A 2FYXA 5J2MB 3MECB 1U6FA 2AJFE 5CYJA 2HGMA 3HHEA 3C15A 3J80Y 1WDDA 3QBCA 2FJDB 4F3MA 1YBAA 4FDFA 2LP4A 1IQZA 2LXUA 3M4XA 1NKCA 1I6JA 1AFIA 2L9WA 1F1BB 2O01C 1DQ9A 2YX7A 3M7VA 3W5ZA 3W9IA 2W1BA 4K4UA 1MSWD 2DNMA 4F36A 2UVUA 1RZMA 5KFKA 4ENOA 4CLFA 4CYUA 3G6ES 4ZN1A 1S7HA 1BQMB 4O0IA 2OP5A 3K8WA 1MLAA 2EC0A 2LQJA 3I0SB 2CKWA 2EVZA 4LF7J 5AT1B 2VG6B 1EIYB 4F0KA 1FXLA 5KFQA 1S48A 3FMBA 1AUDA 1U1RA 2D74B 4ICLB 1RT7B 1WKJA 3QPIA 1WEYA 5GAHI 1FKPA 2GQCA 6FDRA 4N8NA 4P2FA 3WIUA 2YNFB 5DETA 2ZC4A 2H9ZA 1IKXB 1ZAVA 1TV6A 4QBUA 2VJUA 1UA1A 2GGPB 3ZZTA 4LFBJ 1WTFA 4HL9A 2Y1JA 2XO7A 2VZ9A 2DCUB 2B7CB 5HQ8A 1SV5A 4QWEA 1SQGA 3KJVB 1YJNS 1T7PA 4KV8B 4FKXA 5DGBA 3L7PA 4DUYF 2H48B 3M05A 3N0VA 3VAIA 2C42A 4X4PA 3DOLB 4AQYF 1U2FA 4LRDA 2ATLA 1GTHA 1N0UA 3ISND 3M1VA 5HL7Q 3BKTA 2XY5A 2M2BA 3KLIB 2WTFA 4A8SA 3F73A 4RBVA 1DTTB 4FBUA 1LXNA 4DR2F 4HACB 3QZ7A 3SQGB 3I5AA 5D6GA 4J9KA 2F9JA 5IT0A 3PY8A 4ITSA 2YWGA 2KRRA 3NS5A 4BCAA 2EG1A 3D3CJ 3S1TA 1AA1B 4K0KF 1S79A 2EC2A 2R8JA 4LF4J 2D1CA 3W9HA 3D0HE 4LFCF 3DU6A 4X4SA 2QYGA 1NH8A 5D0RA 2RHQB 2LA6A 1VJQA 4WFNQ 5AXMA 4K4VA 3M6VA 3CCZA 3M9MB 4KGMA 3FZBA 4O3OA 3NGDA 3GJTB 3RAXA 3O2IA 4ZP6A 1N88A 4LFAF 2BJ8A 3M2UA 2YKNB 3OXLA 1XNRJ 3LANA 2M8HA 3NCQA 2HQDA 3KLFB 1QLNA 3B82A 5AE1A 2C2ZB 2LDIA 3HKZD 4CDIA 1WF1A 1U1NA 2UXDJ 4K5SA 3MM8B 4A8FA 3MURP 3K17A 3GU0A 2D3ZA 5KT2A 1RT3B 5KFWA 2PT0A 2FD2A 1WORA 2LA4A 2JZ5A 1KNZA 4I2PB 4BDPA 4JP8A 1FFSB 2CJQA 2KKHA 3TUJC 4IOCQ 1Y00A 3IBWA 2ROGA 2RUGA 4ECUA 3CWJA 1JLQA 3N4WA 2ZBRA 3UN5A 4P2MA 5H9FK 1OSDA 4C4WA 3QAEA 2HNZA 4Z7CA 3VHQA 3M8RA 2ZE2A 4JI8J 1NU4A 2RJZA 1G2EA 3IP0A 1UWBB 2LFVA 2CQ0A 1NB2A 3NLCA 4KYZA 3VV2B 3DHWC 2VIHA 1U0HA 4EZ6A 4F4AA 2ZDOA 2ZFHA 2VBXA 3R9LA 1WEXA 1J5EJ 4DCJB 4NOHA 3RW6A 4DV1J 3ZTOA 2MGZB 4A8WA 2K3IA 2Q1LA 2FLOA 4W90B 5BXIA 3OTOF 4FPRA 1IKVA 5LMNJ 3HXMA 2YQ1A 4C8LA 4MKBA 2MSSA 4DL2A 2VBZA 1NK0A 2KT2A 4I6YA 2OSRA 3DHXA 5ETQA 2RT3A 3IG1A 3NKYA 3MM9A 2MMYA 4NE9C 2HAIA 5GAHU 3C16B 2PDAA 4OYBA 4M5DB 4UOFA 1YJ9S 2A1BA 1S6PB 1SUQA 4HH1A 4TU7A 1RTJA 2CUYA 4J9QA 4B3TJ 3CNQP 2G2ZA 5CABA 4FNHA 4OV1A 4C8NA 3OR2B 5J2MA 4F2SA 3PO4A 2MHEA 3MECA 3DMJB 5F8MA 2CPYA 2F4FA 3EGWB 2XMKA 4U7UD 1HBNB 5T41A 3TZWA 2BBEA 2KYXA 2FGOA 4L3NA 1FNMA 2XULA 1HIYA 3N9UC 3CC2S 4C0OC 4DSIA 3RBZA 2BABA 3M8WA 4GC6A 4IG3B 5DDRC 1KQFB 1U45A 4LBPA 1BQMA 3TWZA 1K0VA 1FD2A 1YRTA 2MTLA 1E6VB 3SFUA 3I0SA 2QT7A 1FVQA 3RRKA 5RUBA 4NLGA 4KJIA 1QVFR 2Z2YB 3CB4A 2VG6A 2GIQA 5I42B 4PG4A 3RZAA 4ICLA 3MCNA 4WWSA 1RT7A 1MMDA 4F26A 2IM0A 2ZH7A 6AT1B 2NREA 4IQXA 1JKHB 1A0OB 4KPYA 4PUOB 8RUCA 4LF6F 2OAUA 4WKYA 2R8IA 1IKXA 2GGPA 4PAAA 1SCJB 2GQQA 2V8VA 1VK8A 4KHRA 3ILJA 3NS7B 3KJVA 4KV8A 4V19J 1BY9A 4WFZA 3Q8SB 5GAEI 5F8LA 4RW6B 1SIWB 2YKPA 4B3MJ 4OYIA 4A8KA 3DM2B 3ZZRA 3DOLA 3HF5A 1U1PA 3CT9A 2MKSA 4TXSA 3GV5B 3EYZA 1S76D 1F60B 1MWZA 1H2VZ 4GVBA 4LVOP 3KLIA 4YR3A 2HHQA 5A2QU 1SH3A 2GHWA 3GIIA 3CDUA 2DEJA 3W61A 3GP9A 2Y1IA 2Q79A 4HACA 3SQGA 3HSJA 1TAQA 4AT1B 3EWGA 4DR3J 4BC7A 4IO1A 3U1MA 4C8YA 2AEMA 4LIWA 1QY7A 3OV7A 4F4XA 1WJ9A 1V9OA 1F9HA 4A4JA 2ZC3A 4KT0C 4LUBA 2EPIA 4XIUA 1FF2A 2MEWA 1MMNA 2UVWA 2HVIA 3M6XA 2CZ4A 3OVBA 5F8HA 1TU0B 4C8MA 3W66A 2YKNA 4JI3J 1MU2B 4NLRA 5IT4A 2H4YB 4O44B 4KIAA 3UE2A 4ILLA 4PABA 1HMVA 5D4PA 3HD2A 4UOGA 3CCJS 4DPWA 5JXSA 3NRBA 4NPOA 3MM8A 4ZP9A 3KLEB 4PWDB 4P75A 1DAXA 2W9BB 1RT3A 4IR1A 2R8KA 4ED5A 4ZPAA 4I2PA 5GVQA 2MB0B 3CIMA 1SIZA 4DS5A 2FHKA 4O3QA 2HHPA 3H7HB 1E6YB 3I4HX 1IM4A 3LAKA 5EWGA 2HVDA 3CTRA 1TKDA 2N7CA 1GQEA 4KHPJ 1HQ2A 2KO1A 4W4MA 2CXEA 2FVSA 4RNNA 4EO6A 1Q95G 2IFXA 1KVKA 2X1BA 3E2EA 4QU6A 3WQPA 4ATNA 2V68A 2IRYA 3AD9C 3QIPA 5DDPC 4IO9Q 5A8RB 2HIYA 1W2IA 3DKDA 2KZMA 2DJWA 1T8EA 3QGIA 3R5DA 1ZA1B 4WFAQ 1NK4A 4TY9A 2O1PA 2ASJA 2P8IA 5HMZA 4ZPWR 1GH8A 2MGZA 4DOZA 2V50A 3CJ0A 2WVDA 2EFPA 5HP1B 2DIVA 3CJSA 2IY5B 4M94A 3SBMA 2YY3A 5LSRA 1Q78A 3R5AA 2VA3A 2HVEA 2XQCA 4CLUA 2ZITA 3CC4S 3OFFA 1KHWA 1OS5A 2HYIB 1VI7A 1RAEB 3ET6A 3C16A 1Y5LB 2J76E 4AXIA 3GR0A 2HHSA 2WVEA 4O23A 2VICA 3LWLA 1R27B 2GAHC 1S6PA 3GCWP 5KFZA 2UU9J 3EZUA 3EXYA 2IMOA 1NLKL 3A8EA 5A6WA 5KFHA 3FZ2A 4GKKF 3MFHA 1FJGF 5DGAA 5BYSA 3OR2A 3PFEA 2Z56B 3FCVA 4HH0A 3TJ8A 4UUXA 2AV5A 3DMJA 3FNNA 3MM5B 3CCQS 1V3RA 4UUWA 2IIHA 2W8KA 1HBNA 3HX9A 1REGX 3CJTA 3KJQB 3OXGA 5KT4A 3D28A 4OX6A 3DGVA 5HMXA 2IM1A 3ILOA 3IBFB 3AQPA 2KG1A 2UZAA 3D66A 1O0PA 1S1TB 1Q1KA 4LR7A 3WZ0A 1VRTB 1UVNA 1U6BA 3EVMA 2YKMB 4YY3F 2CVEA 3SSRA 1C1BA 4I67A 1U48A 2IVMA 4FPIA 2UUWA 5GMKa 3R5BA 4AUKA 3MUVP 2DHXA 5I42A 1U8SA 5IXUA 1HR0F 3N5BA 2KXNB 1C1CB 3W65A 3TZYA 1FD8A 5IM0B 3NGTA 2W8LA 3IWXA 5LL6d 4KGXB 2B6AB 2ASYA 1JKHA 4PUOA 2F63A 1I51B 2KHDA 4R25A 4DL6A 4OZ1A 1HQEB 2NUUG 1B7YB 2R7QA 1NDKA 2ZUGA 3I5BA 2N3OA 5HROA 4PQAA 4WKRA 2VFVA 3MPVA 1FRKA 1NDLA 3ZC4A 1D0EA 1QJHA 3CUNA 3DM2A 3VZHA 2F4VJ 4JV5F 2UUBJ 3C6TB 1LXJA 3PO5A 1U1LA 2ALZA 3LP2B 3KK2B 1KQGB 1FNOA 2E7WA 1S9FA 2JJ4D 3GFHA 3GG1A 1MWQA 3KHRA 2G2OA 2LXIA 3B78A 1Q7LB 1R7IA 2Z2MA 3FRZA 5DZ6A 2ZM6F 4UW2A 5KFDA 1YLXA 3HHLC 2R2SA 1SJ3P 1RHJB 2HS4A 4CO2A 3CCUS 2B9EA 4G65A 2GC8A 2MKCA 3MAQA 2JLEA 3HSDA 2LECA 3MPWA 3NNHA 1U1OA 4IRCA 1H98A 4JYAF 1WOSA 3MMBA 2JHEA 3W5XA 1QM9A 1XMOF 1V3SA 2FJEB 3BBFA 4JI7F 5LJ3Y 3B54A 2MJNA 5AXNA 5G0RB 1REVB 2NYIA 4TQSA 4TU9A 4DCOB 4CO3A 2QZ8A 2W7OA 1UL3A 1RYSA 4O44A 2D9OA 5I4MA 2ALYB 2DHAA 5MLCV 3VGTA 3FCHA 3CO0P 1WG5A 1A7GE 2ZZNA 3CSKA 1TL3A 1B7FA 2LEPA 1HBUA 3E51A 3GCXP 3KLEA 2W9BA 2QA4S 1VCTA 1RB0A 3BGLA 4I69A 1LEOA 1WC5A 2RD5C 1FEEA 1E6YA 2EWHA 2OEMA 2F8HA 1GX6A 3MR6A 2HLUA 2ILZA 4I7FB 1JXVA 3C19A 2WZ1A 4LT6A 1SQEA 2WBRA 3VVTA 4AYBD 1EKSA 1N32J 1XN9A 5A8RA 5E3QA 5KFBA 4ZVSB 1TUGB 1RLDA 2WAQD 1FDAA 2FJBB 3VALA 4M63A 3HHLD 3R3TA 4CNZA 4LRBA 2DNZA 2VQEF 4MIAA 3GR1A 4NI2B 2XC9A 2L9NA 1PG5B 5HP1A 1KR4A 2BVZA 2ERRA 4XK8C 1UWAA 1Q82T 2XEXA 3PR4A 3BDEA 1RA7A 1CBKA 3V5RA 4DG1B 3HMJG 3V6KA 4USKA 2HNDB 4KO0A 1IWAA 2NUHA 4F25A 4IH6A 3MPYA 2RAQA 4QYRA 5GMDA 1RCXB 3HVRA 2DRAA 3M9NB 2CQPA 2GV1A 3GZ7A 4C7QA 1TUVA 2VBWA 4CI0B 2QA2A 2G1HA 2J9DA 3GJSB 1AZSB 5A2QY 2BW7A 3HJVA 3AD8C 2MQLA 3JXOA 3EPIA 3EM1A 1HQUB 4PXEA 1WUUA 3B4MA 3THVA 2FQQB 2C2EA 1X4EA 3R1LA 1ZA2B 2PD1A 3JQMA 3MOZA 3PW2A 4RO0A 1HWUA 3AY0A 3FRYA 4ZVOB 1G7CB 3DNCA 1ZPVA 3MCOA 1FT8A 1EETB 1AXQA 4RWXA 5IQQA 2IM2A 4DV7F 1S1TA 3UD3P 1F5CA 4YB7A 1RAFB 2ZNYA 1NSQA 1TL7B 3HT0A 4M5GA 2YKMA 2PE8A 4KHMA 1HHTP 4FS1A 3QLHB 3CE8A 1CJUB 2AZ3A 5I3UB 4NXMJ 4EBEA 9ATCB 4X64J 3S6EA 2QV6A 2XWXA 3I6PA 1H73A 4M5HA 3I4PA 3LGMA 1XJWB 5IM0A 2PFDA 2FVCA 2H54B 4Y2IA 1HPZB 3H90A 2R7TA 2B6AA 2AYBA 4Y28C 4RNOA 2HRUA 2ZBIA 4URGA 1ZM9A 1Q8KA 8AT1B 4NA2A 4QJVA 4A8MP 2L48A 3MF5A 5K8OA 4LSNB 4IDKB 1M5SA 1YQHA 1CULB 2FJAB 1RBAA 1LWCB 1N36J 1UJ5A 1FJEB 2AX1A 4QIGA 4ZMMA 1S72S 1N5VA 4HKQA 2GFFA 4NXNJ 3C6TA 5HMWA 1B0VA 1F9EB 4QCLA 2B9XA 2GA7A 2RQCA 2DH7A 2C2NA 1PKUA 1WF2A 4UOHA 4QWCA 1Q86T 1X4BA 4K8RA 4BWMA 2WHOA 5EGYA 1IBMF 4IOAQ 2P6SA 5KG4A 4WZQA 3H98A 1VGYA 2G2YA 2CADA 3OXFA 2V8PA 2HK2A 3HULA 4NZ0A 3Q8VA 2E1RA 3ISZA 3A3NB 1Y7PA 1TK5A 2V67A 3RU0A 2XMJA 3CDAA 1L3VA 3P5TL 5C5JA 2QA1A 1XR5A 4HT7A 4O4GB 3BSNA 4CLYA 4LFBF 4QPTA 1YDLA 3MGJA 1Q53A 4L3KA 4OLPA 4RW9B 5G0RA 1U09A 1REVA 3QNWB 2APOA 3DOKB 2XI3A 4WF9Q 5LJ5Y 2WOMA 2EFNA 1JLFB 4DFKA 5CD4H 1WNEA 3BEGB 3RRGA 1RJJA 5JVGQ 1UEUA 1DTQB 2YWFA 4X4RA 2E5JA 2ACMA 2HURA 2YX4A 4RBTA 5J1EA 4KGKA 3HVAA 1V3ZA 3SZ2A 4HHHA 2AWZA 1UAWA 2ZVSA 4HT5A 5G4DA 3PCOB 2H5IB 4NCAA 2M0GB 4I7FA 2CQHA 1XR7A 4NCGA 3CJRA 3DN9A 1RWXB 3C8YA 4DUYJ 1AUSL 2IMWP 2OTJS 3Q23A 1B3TA 5M2RA 1YKWA 5HANA 5B0BA 4CO5A 4AQYJ 5F8JA 2A3JA 4FN5A 4J9PA 3RG6A 2KI2A 2OEKA 3CCSS 4DMZA 4B9UA 2CPHA 3VGSA 4WP8A 3D5MA 3CJ8A 2E9TA 2VQFF 1U7LA 4NI2A 4OQJA 3LPYA 3IGVA 1HYSB 5ETNA 3M30B 2HEKA 3I96A 1DLOA 2M70A 4K59A 4USTA 5M2PA 3KKFA 3DLJA 4DG1A 2J8AA 1VQ6S 2HNDA 4IFYA 2DGUA 4LFCJ 2HHUA 1Y9OA 2RMLA 1KC8T 4DR4F 2X7IA 2DVIA 4LQ9A 1IJEB 3NEKA 4DQSA 1KP6A 3TAQA 4RLEA 2CVIA 4DUZF 1DZ5A 4PCQA 2F65A 1JNZB 2RDIA 4LFAJ 4YFUA 5IOLA 2XGQA 3K0JA 3PYDA 1AZSA 2FJVA 3G6VA 2IBKA 1IBCB 3FSYA 4YS2A 2HZVA 2XSFA 1Y0HA 1VR6A 2RNEA 2XNRA 4OYWA 3OD2A 1YJVA 4PPDA 1BLUA 3EGNA 3WBZA 3UNYA 3T1AA 2VHGA 1EETA 3GMGA 3KFWX 3G9CA 3DLLQ 1RWOB 1M5OC 3RAMA 2P2CB 2YQ0A 3BPSP 4M8LA 3JSMB 1C2PA 1CC7A 2W24A 1XWLA 2WW4A 2BRKA 2ZD1B 4QPXA 4OIXA 4OHVA 3MMCA 2V6AA 1TL7A 3MTKA 3Q22A 4K4WA 3CMQA 2FY1A 3OL6A 4QW8A 1CJUA 1TELA 3MAHA 1WG4A 3K58A 2JL9A 3GB0A 4PPZA 2CFXA 2X1FA 2X1AA 2N7YA 2XCPA 1H7WA 4GMKA 2YX1A 1HPZA 5DG9A 1HHSA 2C3MA 1GEHA 3PRDA 1M5PC 4HHUA 4NLXA 5E7OB 3N6MA 2WBMA 1LFWA 2KN4A 3OTOJ 4LSNA 4IDKA 1SL1A 1CULA 1LWCA 3BGRB 1PYTA 2ZJPQ 5T7LA 3TA2A 4OYXA 2YNGB 4F4WA 3IAM9 3PJWA 1X9WA 1Q79A 3OTBA 1P9QC 1K1QA 2QLBB 1AW0A 4CLPA 1VLYA 2R7SA 1VQMS 4MYTA 1W7WA 2W4PA 2K7KA 1SL0A 1T9YA 2DHHA 1VC6A 2CJAA 3UD4P 1KFDA 2VU5A 5DM7Q 3CIZA 1Q16B 4B3RF 3Q24A 4ZS6A 2CYYA 2J0SD 4U95A 2DGVA 2KFYA 3W1YC 1VRUB 2UVVA 2DGSA 4DR6F 3J7YI 4C0BA 2QMXA 3NGSA 1N6QB 3DLEA 4OZLA 2QL7B 2MJUA 4GC7A 5A0YB 1OPZA 3GV7B 3L7OA 2AX0A 2F9DA 5HMYA 2BA9A 2HPUA 5DS7A 4O4GA 2EK6A 5HSPA 4TLQA 3EMTA 2VONA 1WDTA 4MFBB 3MM7B 2RU9A 4LJMA 1KVIA 4ED4A 1QAJA 5KG3A 4RW9A 3QGPA 3PXGa 4YR0A 1JIHA 1QTMA 1J27A 1UFKA 4ZVEA 3CJ2A 1GXLA 1JQGA 2MLZA 3IC1A 1JLFA 2ILYA 3AJ2A 5DRKA 4M5IA 2HHHF 4X66F 4OHXA 2HFSA 1S1WA 4CTAB 2ADBA 4OYZA 2P6TA 1S6QB 4LF6J 2KG0A 2HBRB 3BDPA 4EO8A 1B64A 4I2QB 4WXOA 4DR1F 1NHUA 1KOHA 3AJDA 4DR3F 2HG4A 3W8PA 2JFKA 2P9GA 1IR1A 4YDXA 4RBUA 2O67A 4DEZA 3TUZC 2FLNA 2ZHAA 2RHSB 2EXUA 3UDEA 3Q8PB 3OFHA 1Q8IA 3K57A 1FK9B 3TQ1A 4JV1A 3J7AN 4CNYA 5KG1A 2DGOA 2VBYA 1XC9A 5F9NA 5D15A 2J6TA 2DXEA 3EUNA 4USMA 2AJ0A 1EARA 2IYIA 1LW0B 2MQOA 5HVGA 1YVFA 2CZVC 1S5ZA 1P6TA 3TP2A 4LBIA 3UN3A 3UI3A 1YX2A 2KHCA 2YKAA 4DZ6A 1ZM4A 2HFVA 2YH1A 2R42A 3CCMS 1ACMB 1Y5IB 3D6MB 3NCPA 4UT4A 4H4MB 1FERA 2ZKTA 3SMZA 4JOUA 1TMMA 3H59A 5GAGI 5DDOC 2E1PA 4PR6A 1WC4A 4PG5A 1X4GA 4OI0A 3H8YA 3QJLA 2PIIA 4J5OA 5IWAF 3FUYA 1S6UA 2G9OA 1OIAA 1FWKA 2NPFA 4KH1B 1NSAA 4ECZA 3M8ZA 3O3LA 1FESA 1IQTA 4K4TA 4I6AA 3OBIA 4R0JA 1JLAB 5LXYA 2NXJA 3JTNA 1RACB 2IM3A 2R8GA 2QA4G 1FCAA 1Y3JA 5L1LA 1UPMB 1MN7A 2BE2B 3UDLA 3JSMA 1RHUB 1T05B 2ZD1A 1APSA 1UKUA 1NRKA 3AOCA 3OVSA 4IRKA 3EZOA 3THTA 1AT1B 4PXBA 3KLVA 1XQIA 2RDJA 3QT5A 3A3OB 2PEHA 2HFOA 3M32A 3WHIA 2V2ZA 2LLZA 3O8WA 3LH2S 4K2XA 1P9YA 5ETOA 1XBWA 1FKAF 2JFDA 3QYYA 3HVTA 4C3KA 3RYLA 3VAFA 3H4DA 1AYEA 2NZ4A 3ZZ0A 2LEBA 3Q83A 3CCWA 4YN3B 1ZTTA 3TA0A 4C3MA 1EP4B 3KK1B 4DR5F 3Q8QB 2GVZB 3DFEA 2KH9A 2WSEC 4I68A 1TVRB 2DTJA 2YWKA 3G96A 3G87A 4JUZA 4OI1A 2V69A 3BGRA 2AZ1A 1ZZFA 2RQ4A 2E29A 2VFSA 1OO0B 5C2GA 2V94A 1SC3B 1RT5B 1X4HA 1Y5NB 2GQ2A 2AKWB 2G4BA 3B8HA 3HP6A 1SH0A 1SKRA 3BYRA 3F56A 2ROEA 1WG1A 3W62A 1JLCA 2NPIA 3BSAA 1ZZNA 4ZLJA 3NAIA 3T5LA 3VVUA 1S10A 2A6MA 4WU2A 4ZJOA 2UVRA 3Q2TC 3OHAA 1NAQA 3W64A 4GKKJ 1FJGJ 5E33A 3DOMB 1VRUA 2OLWA 3UR0A 4YUDA 3T6JA 2B4VA 1HW9A 2I2YA 1N6QA 2QLXA 3D1OA 2GJFA 4ED2A 2QL5B 4KFBB 1HNVB 2QSFA 2OH2A 3T5JA 4Q8FA 5A0YA 2AP6A 4TY8B 4MIWA 1RHMB 1BD6A 4EUVA 1BMQB 3AODA 3ITHB 1X7VA 4OZNA 3MM7A 2QJ3A 1U8WA 4DUTA 2D9PA 4JI5F 1HNWF 3TZXA 3GONA 1S1VA 1F9FA 3BSOA 4YY3J 3FDSA 1VHFA 1HWLA 2H51B 3D9BA 4XDDA 4ID8A 5SUHA 4ZPVR 1HR0J 2HRTA 5D0EA 5IV4A 2DO0A 4CTAA 4CT8A 1KBRA 1QUVA 2AJ1A 1S6QA 3OFGA 1H7XA 5GAGU 3G2XA 3L9ZA 1R0BG 1NEEA 3D6FB 2E5HA 2V4RA 2UXBF 2KRBA 2W01A 4ZKAA 3ETMA 4CRJA 5F8GA 1FRLA 2B51A 5C7PA 4JV5J 5HJYA 5DDQC 4H54A 3W60A 2ZH5A 2NCKL 2VPYB 4QU7A 3PTWA 4FYYB 1VQ4S 1X4CA 2XB2D 4ZLNA 3C6UB 3SEOA 2VODA 2QSWA 4Y00A 4Y0FA 4DX5A 1EAYC 4L75A 1LW0A 1PC5A 2ZM6J 5H9FJ 1FJCA 4MKYA 3BO2A 3A8KA 3MEKA 2OMLA 1F5AA 2AYEA 1BHNA 3J7Z5 5E0OA 1C0TB 2KZZA 2MQNA 3CMAS 3SIPB 1YIJS 1P27B 3PW5A 4H4MA 1FKPB 4JYAJ 3VAGA 2KJVA 4I56A 4ECYA 1FNXH 5IZHA 4URSA 1N8RT 1XMOJ 3IMQJ 1LWXA 4JI7J 1FXDA 1RAAB 1S99A 1UEVA 1NDCA 2CNNB 1YBUA 3KK3A 2RRBA 5L9NA 2XS7A 4CLTA 4WFXA 1SC1B 5BYRA 3AQOA 2AGOA 3A1YG 3TW0A 4EU0A 4YEAA 3QRRA 3K5OA 3D6TB 1F5BA 3AH6A 1JLAA 1F2GA 1NPKA 3P96A 1HBOB 3BH6B 4PRFA 4YMEA 4B3OB 2NYHA 2CNOB 4OV6A 2CQ1A 3NG8A 2BE2A 1WKKA 4DDFA 4EEYA 1HWIA 1T05A 4LRCA 4MH8A 4BBYA 1WI6A 1QD1A 5KG2A 1VIOA 3MCMA 2J6UA 1YZ6A 3BQ1A 3I5CA 3I9V9 2PSZA 4WJBA 3MI7X 4OFZA 3BKUA 1U26A 4FYWB 2JVRA 1TMJA 4M95A 2DNQA 2EK1A 4Q0BB 1XR6A 2M52A 1PCAA 2DHGA 4U96A 4MJKA 1Y3KA 2VKRA 3HFVA 2GW8A 4HYKA 3UNGC 4CLSA 1EP4A 2J0XA 2VQEJ 2GVZA 3I82A 4PQUB 2BE9B 1TVRA 3MEGA 1OQ6A 4ANCA 1X5SA 2JEJA 3T5KA 3EGVA 3Q8YA 3FKBA 3V4MA 1RT5A 4ER8A 4K5RA 1QSLA 5CA5A 4USIA 2VA2A 2HSEB 4MK8A 5KFNA 2J6SA 1RWKB 1IVZA 3NWRA 3TX8A 4ZCLA 4ZJLA 3KMSA 3RB3A 3IAS9 2CIMA 3PR5B 3IWNC 4TU8A 4C0HA 1H2UX 3AAWB 5K8NA 3LQVA 4AL7A 1RWMB 2CDRB 2IDLA 4LMZA 1RQ0A 4JV2A 4ES2A 5JMNA 3KHHA 3DOMA 1YGYA 2OSQA 4RNMA 2HNZB 4B9NA 1SC6A 3H4BA 2CJKA 2LKZA 1NHVA 1RBOB 2J5AA 5HK4A 4KFBA 1HNVA 2I9SA 4Y3CA 3DRYA 2LU2A 5J2QB 4TY8A 3DDNA 3OTEA 2UXCJ 1U0HB 3ITHA 4WPAA 1LK7A 3DGPB 3RBXA 2FVRA 1S0OA 3POTA 1N5YA 2KFZA 4QR2A 4DV7J 1X4AA 2BJ3A 1RHRB 1IR0A 3FFIA 1N5SA 5E3AA 2EI5A 3A8IA 3W7BA 1VBKA 5C42B 1X9SA 1F3VA 1CSJA 3EXCX 3OJUA 4F7VA 2LQBA 2ZH8A 2W7PA 1T9XA 3IG1B 3MM9B 4DV6F 3R6LB 5L1IA 4OX9F 4HR2A 2Y0BB 3KYLA 5CCMA 2FJWA 3H20A 3US5A 1RT2B 4FF2A 1PBAA 4Q2MA 4B3SF 3PG9A 3QFHA 4ZN3A 4QZVB 2GIFA 5DJBA 2HK3A 1B70B 4U67Q 4G6VB 3ZTQA 2V2VA 3H2VE 1RKJA 2HRYA 2VPXB 3AD7C 4JI1F 3CXCR 2HBZB 4I4BA 3M8PA 1SL2A 5H9EJ 2BW2A 4WCEQ 4HDGA 1CJKB 1VQOS 1TAUA 4RR5A 2PMZD 3MMJA 4KRWA 5J1PA 3ZFVA 2HZAA 1Q5VA 3AFGA 1OY9A 3SI8A 3C6UA 3UDVA 1R6YA 3GG0A 4PG7A 1VIXA 3SCKE 4ZVFA 1PGZA 1RHKB 4OMFG 1IBMJ 4FBTA 4A47A 2KDOA 3GSDA 1JLGB 3TVYA 1VQ7S 3BN4A 2J9EA 1YJ7A 2AHOB 3TZZA 2QO3A 1RKIA 5F8NA 2DEIA 4Y6IA 3CCLS 4E8UA 1C0TA 3JTOA 4O3SA 3OHBA 3QJPA 4M5KA 3T1YF 1XTZA 5T14A 4J9LA 3DRXA 4MKAA 3ZTSA 1TR0A 1TL5A 2RUSA 3GWCA 4GVLA 4X65F 1WSVA 5I3QA 2F5GA 1FX4A 4WYWA 2K7JA 3L7UA 1AROP 2CNLB 4F0HA 1WD6A 1TL1B 3TUPA 1CS4B 3G8SA 1TFWA 1DJ0A 1JB0C 4ZOSA 4EFAC 1LW2B 4ZVPB 2E5GA 1QE1B 2ADCA 2WSCC 1WC6A 1HBOA 4RNHA 3HPOA 3D0GE 3QJJA 4N5SA 1X5PA 4B3OA 2W9CA 4GVBB 5IT9U 3HFZB 5KG0A 2W25A 2GMLA 1RGVA 3SFGA 4TQRA 4ALZA 2B43A 2J7UA 2AW0A 4DI6A 1RK8A 1BUXA 1T0TV 2FDNA 5HLFB 4GKJJ 3V81B 1FDNA 2O66A 1OY6A 3RUBL 2AEJA 3GLJA 4EK2A 2QE5A 4C11A 4NA3A 2E1MC 4WBFA 3GJQB 2P5VA 2KL8A 4DZDA 4X4TA 1BQNB 4DN9A 4DX8H 3DRPB 2IC3A 4ELTA 3T5HA 4J90A 4MTPA 1PBUA 2WVBA 4Y2MA 2HFNA 4Q0BA 5K5MA 5FD1A 2HQ3A 3MR7A 2V0NA 1W2BR 3MPDA 3P49B 2NZCA 4XDCA 3R5JB 4HTJA 5DG7A 5CCLA 3KWMA 1X8DA 2MY8A 3CCES 4PQUA 2VQFJ 4CLKA 5FJ4A 1GMVA 4ZJQA 1GX5A 1ZETA 5CYQB 5EN1A 3GILA 3FBCA 2MKYA 5I3PA 1HMVB 5BR8F 2E1AA 2HHXA 2DYAA 4K4SA 5ETSA 4NLDA 4RPFA 4OJ3A 4WP9A 1YK9A 5K8MA 5LM7E 4F8RA 3SSQA 4DR4J 2XBPA 2Z4PA 2O3DA 2JEFA 2M5YA 4CM2A 1S57A 1U2CA 2FUG9 3HI9A 1T3NA 4DUZJ 3K89A 1T03B 4LF2A 1HBMB 3DLGB 4I0WA 4KGZB 3N6LA 3ZO7A 1M1GA 2HS0A 3QIPB 3CJKA 1N4LA 3C14B 2DNLA 2LDYA 1FI4A 3W8GA 2ZH9A 1UVJA 3FJ2A 4OZ2A 5J2QA 2I1RA 2Z2LA 4FZVA 3GSIA 1M5VC 1RWWB 3DGPA 3MD1A 2M4MA 4DHVA 4TKTA 2GO8A 1QAIA 1NCLA 3IBCB 5DG8A 3NMAA 2UUCF 1DQ8A 4OJGA 3PHTA 5C42A 3V6JA 3KHLA 2HWIA 2ZHOA 5ETRA 1GMWD 2F8EX 1DRZA 4C6AA 4WE1B 1R8HA 1J5OB 2L41A 2VC1A 2OPPA 2NXUA 2Y1LB 1R8PA 4P6QA 4NX9A 3ET6B 5E3RA 1NJZA 1HI8A 1YJTA 3DRSB 1H0HB 1RT2A 4DV3F 1RT1B 3KOAA 2LQ8A 2RRNA 5HQMA 4OJ1A 1NHKL 4F67A 1R8AA 1HARA 1DHMA 2B4UA 2E9RX 2WW8A 1QVGR 4L73A 2XCAA 1WEZA 1VBZA 3L3CA 2ZJQQ 2ZNZA 4P2SA 3I32A 1CJKA 5KFXA 2CPJA 3SQOP 4M5MA 5KFMA 3BM7A 5KG6A 4UF4A 2D3O1 4X2BA 1P8GA 3HKWA 3D3BJ 3L4BC 5J2PB 2DPJA 5K14B 1BE4A 4ZIWA 2DY1A 2HVHA 5B0GA 1DBDA 2Q43A 2C2MB 1U4BA 3LTOA 3UPFA 1T3OA 4ES3A 1NZAA 4F3QA 1WHWA 4B3RJ 2FLLA 2CWXA 2HQIA 1JLGA 4ILMA 5F0UA 5JUMA 3QSIA 1C1BB 4X4UA 4DU8A 3GIRA 1PO6A 5KFIA 3FC9A 4DR6J 4IOBA 1RU2A 4ETXA 3EGZA 4K7QA 3PJXA 2PI4A 1RAJA 4KAIA 1WHYA 4G3IA 5HATA 2B4PA 2VF3A 2V4JB 3TANA 3IRXA 3A3PB 2XLIA 2DH9A 1CC8A 4DF4A 2H4WB 2ZBPA 3IR7B 2LQ9A 3NS6A 4FF1A 2CQCA 2VASA 1O51A 5K9FA 4KC5A 1IR2A 2CJ9A 2MKKA 3W5YA 5HROB 1KS2A 4RJVA 1ZM2A 2Y9HA 5KOWA 4RUAA 1TL1A 1XNQF 4DCPB 1CS4A 2CJYB 1GMWA 4Z2XA 2PO4A 1RCOB 1LW2A 4NL5A 4TYBA 4J9VA 1QE1A 3FSIA 2HHHJ 1RAOA 4X66J 4UY85 4HEA9 2RSQA 2FY8A 4DS4A 3CJ3A 3GIKA 2JLGA 5JJBA 3EICA 5B7WA 5HAOA 3RBEA 1KKHA 3RR8A 4DL7A 3SCIE 5HLFA 3V81A 4CZCA 1U6ZA 3PW7A 1SKSA 1X0PA 3D1HA 4DR1J 1R31A 4LVNP 1A6LA 2KM8C 3I0RB 3EX7B 4HI1A 2VH7A 2HFUA 4QOTA 1BQNA 2OTLS 1RP5A 1YTYA 3DRPA 2DR6A 4HHJA 1FXRA 3IR5B 1VQLS 1NJIT 1IKWA 3N5FA 2LVWA 2E9ZA 2EFGA 3MMBB 3Q8RB 2DO4A 5HO4A 2DRBA 1D9AA 1VK3A 4C98A 2RILA 2WSFC 2CPEA 2ZBQA 5KFRA 1U0SA 4HVZA 4ZVRB 1VBXA 3CD7A 4USVA 1RT6B 4YDDB 1JJHA 5CYQA 1SBRA 2D3UA 1R6VA 4NYOA 4DPTA 3JTPA 2WVCA 5C24B 4X4VA 1Q5YA 2JVOA 2FJXA 1Q0NA 3FEXB 4LRFA 1TL3B 2IHR1 4C9DA 1NKEA 1Q8BA 3GE9A 5H9EK 5E3PA 1HBUB 2UUAF 1RT4B 1PILA 4YB1P 5C2CA 3VAJA 2NSCA 2ZVIA 3MEEB 3IRWP 3TX0A 3M2VB 1FX2A 3TI0A 4DSLA 1Z4UA 1T03A 3QATA 4OYOA 3R2CJ 1YRXA 1HBMA 1PYSB 4NLPA 5IWAJ 3DLGA 2AQ4A 2BE7D 3K5PA 2CPDA 3EDQB 2IVYA 2N3LA 1C0UB 4YOEA 2MZRA 3C14A 2HMIB 1R8BA 1OQ3A 4B9LA 1FE0A 2OPQB 4TLRA 4UZBA 4ZP7A 4B17A 4E0DA 1RTZA 3GIJA 4ES1A 3C46A 3P3DA 4GRSA 4F04B 7AT1B 4DPOA 2B7BB 3WX4A 2NSBA 1SVDA 1K8AT 3ILLA 3P6YC 2BV3A 3IGNA 3AA8A 3KUHA 3A13A 1LWFB 1FO1A 4M5NA 3LUYA 1FTCA 4DR7F 3UVJB 2AGQA 1FRHA 5FIIA 2RB7A 1M1HA 1LWEB 2HWHA 2J8SA 1P1TA 4ECVA 2QYCA 2WB1D 4WE1A 2MPUA 1J5OA 4CP5A 3FMWA 4J9UE 1TFYA 3VGUA 1PIEA 1NKBA 1I5OB 4YB5A 3O5TB 5L38A 2MZJA 4UY8T 2QFIA 4KO0B 4RW4B 1UW9A 1ZAXA 1JJCB 3GIMA 3FCWA 1I94F 4LF9F 2PC6A 3DRSA 2MKJA 2X1GA 1RT1A 4F4YA 4RU2A 3M6WA 2EBEA 1IWGA 4A8QA 3VAMA 4DR5J 2Z58B 5IT9Y 4IQMA 2XZTB 4U7UK 4Q8EA 5GAEU 2BACA 1FJ7A 4NLVA 3U02A 1T95A 1U1QA 1UETA 1PAEX 4C2MA 4IUFA 2B8QA 2NXEA 3BQ0A 1Q81T 5J2PA 2G1DA 5K14A 3JAMU 4D3GA 1F2HA 3HZGA 1KEKA 3O1LA 3X1LB 2XTJP 3CC7S 5AXLA 2MHNA 2ASLA 4ECWA 1S6OA 1GTEA 4DSEA 3D54A 2RS2A 2IVFB 1UZDA 2HQFA 3GYGA 3PIPQ 1GK8A 3D4JA 1ZH5A 3VZIA 4A48A 3MWBA 3DLKB 5LT5A 4MIBA 3HHLB 2V4JA 4ZPBA 3W2WA 4P52A 1VBYA 3NGKA 3Q86A 3KLGA 3S01A 4JI5J 2EFVA 2GZOA 1HNWJ 3UO0A 4ZVUB 3BN7A 2CZ9A 5DM6Q 4CO4A 2VUGA 3KG1A 4ZP8A 3CD5A 4DN0A 3L95X 2GAGC 4M5LA 2Q3PA 2BX6A 3HHKA 5D3GB 2E7VA 1HKAA 2UV8G 1UP1A 2AJ2A 5B0EA 1SJRA 3PV8A 4BC9A 2ROPA 4IR9A 1NPPA 4N56A 1GXTA 2C2DA 5D4LA 4DL3A 4MKVA 4E98A 4X84A 4OI2A 5HVFA 3V2UC 3QT6A 2FPHX 3IM8A 3TVKA 3I31A 1Y4ZB 1RSCA 3QRQA 1V5IB 3D6HB 4Q44A 4KE5A 1CQNA 2UXBJ 2K06A 2BRLA 2VFUA 3I0RA 2C28A 3BZQA 2HFZA 2R7VA 1FFGB 2DRDA 2VPZB 2XO6A 2XLKA 1B4SA 3U1NA 2ACYA 3PEJA 3HHNB 2GJIA 3FBFA 2GX8A 5L8RC 1TKZB 3R5CA 1X60A 4EI2A 4DV5F 2B56A 4ED3A 4N8OA 3NAHA 4KBIA 3QT7A 1URRA 3R97A 2MZ1A 1R3NA 5GADI 3W3SA 1NK7A 2C2OB 3UW1A 3V6DA 5D0GA 4CT9A 2W7AA 2BKPA 1DARA 1U1KA 4LF1A 4IG0A 2D41A 1SJQA 3UDCA 4RZRA 2W4DA 1RT6A 5IC6B 1HL6A 4G1QB 2WOMB 2PA8D 4QW9A 3E3XA 1HD1A 5C24A 1D1UA 2CNKB 1Y11A 1I1GA 4WK1A 2DITA 2BEFA 2F1FA 3NNAA 1RT4A 3CD6S 4P10A 4CM0A 2XYHB 5KT5A 2BMBA 3MEEA 5J1EB 5F41A 3H0PA 3ULHA 2C3YA 1UFWA 3JQKA 4H4OB 5CD4A 1O8BA 2FLPA 1L5UA 4ZPDA 4EBCA 3U27A 2KXHA 3M2VA 5AXKA 2XMVA 1N33F 1RWNB 2ZKUA 2NLWA 2CQ2A 2BOPA 4ZK7M 4K4ZA 4ZPCA 2PGCA 3PNIA 1IKYB 4NCGB 5ETMA 3BYPA 4WYLA 2BM0A 2BR0A 2EBGA 3M8QA 2IPOB 2VKZG 3OUYB 1C0UA 2HMIA 3IXQA 3KNAA 1U1MA 2Z57B 1MROB 1KRPA 2OPQA 3VQSA 4PG8A 1FTRA 2V34A 4HLBA 3AXMA 4MMOA 2BOAA 2XNQA 1M1KT 2OFGX 4NRUA 2D7SA 2NXCA 4A8YA 1NM2A 2JEIA 2R2RA 1K1SA 1OSCA 4ED7A 2IJRA 5BJRA 2CQDA 3DLHA 2G0IA 1NK5A 3QT8A 3T9ZA 2KT3A 1S0NA 2DIUA 4DV2F 2MDAA 1LWFA 4EGLA 1S7IA 4QR1A 2LQ5A 2DR9A 1DLOB 3UVJA 1Q8LA 5FDLA 1LWEA 4WTOB 1SKWA 2CQBA 2VFRA 3LAMA 1OMSA 1CJVB 2XZWA 1R43A 3SDEA 4IFYB 2M9KA 1B99A 4RW4A 5LOQA 4KPCA 4XAKA 4OYAA 2J7WA 4DFMA 2QMWA 5LSOA 3ZZZA 1IBLF 3N79A 1EQMA 2HAFA 2DNKA 1PYOB 4U6PA 3R6GB 4IFVB 4CLWA 1T9TA 2C2KB 4LREA 1KOOA 3CULA 3K5MA 3LGHA 3T9NA 4O3RA 1HFEL 3VGVA 2BANA 3TJ9A 2HLTA 3K8VA 1CJTB 3S8SA 1IM6A 5F9LA 2EEYA 2UXCF 2JX2A 4DSJA 4LF8F 2BJEA 1UEKA 2RVJA 3TVZA 1CVJA 1RHQB 1R0AB 5KFLA 2EKNA 3MMCB 1JX4A 3KLHB 2A6OA 4QQBA 1YSJA 1C4CA 2LMIA 3NP5A 1HNXF 3DDIA 4DL0C 4KR0B 1O6XA 2Q6BA 3WC0A 4C8ZA 4NMLA 3CGIA 4IKAA 3LO3A 2CDQA 2ZOGA 2W2PP 1WHXA 4P7TA 1Z1ZA 5ITHA 8ATCB 3G8TA 2XSJB 3W2VB 5DO2A 3DLKA 3HHLA 4W92B 3G6XA 3KUGA 3WDOA 1RU1A 4KB7A 3FGVA 5GADU 1SQFA 2EFQA 1FWLA 3LA0A 4RUCA 3HLUA 3PM9A 3BSCA 2YNHA 5KT6A 2CG8A 1S59A 3Q8UA 2K3KA 1KONA 5T7LB 3AXKA 2N82B 1NJXA 4EBDA 1NB7A 5D3GA 4KKOB 2IYGA 1Z2ZA 5KG7A 5D0HA 2CG4A 4C8OA 3RB6A 4DV6J 2W2NP 1L3UA 1U49A 5M2UA 3RJMB 1VQ5S 1Z2LA 3KXDA 4OX9J 5E5NA 5CZVA 1RTDB 2ZDPA 4NRTA 4DLGA 1TKTB 4F02A 1U2RA 2SXLA 3MFIA 1VS3A 2ZH4A 4B3SJ 4Z37A 3PX6A 3MCSA 5THWA 2VDIA 4NLYA 4DV0F 4NYPA 4JI1J 4ED1A 2H65B 1WC1A 7FD1A 3DLEB 2F8MA 5HBMB 4DLEA 3TUIC 4FYXB 1NSPA 1N5QA 4ZCIA 4AD6A 1TKZA 4NA1A 2R3VA 3TO8A 4ED6A 5U47A 3J81U 3I87A 1IBKF 2GMHA 1YG0A 4ZHRA 4JI6F 3G6YA 1X5TA 3JSYA 2BQRA 3UCZP 4B9SA 3MPUB 4G1QA 3H5YA 1X0FA 3QMQA 2MZQA 3MHYA 2DNPA 2WONB 3L09A 5KOXA 3X3UA 1SPBP 3EVWA 2B9WA 4NEYA 3PRVA 9RUBA 4UTGA 3T1YJ 2EW9A 4NYZA 1R89A 1S1WB 2GMJA 2QL9B 3J81j 3K5LA 1NMEB 2FC8A 4H4OA 3CCVS 5A8WB 3BO3A 2ZOFA 4X65J 4GKJF 1JXEA 2NQPA 1IN0A 4DSKA 1IKYA 4A8OA 3JAMY 2PN6A 1ZS6A 3ONQA 4DPUA 5DQGA 3OW2R 3UN2A 1JNRB 1KLMB 4R5PB 3OUYA 2DXFA 1MROA 1VYAA 2JSXA 3P5BP 2DT9A 2DGXA 2VC0A 2E44A 4P72A 4RW7B 1LNQA 2ZH1A 1LKZA 5KFTA 3ADAC 4KSEB 3LWMA 2Y0SD 1RYRA 5DLGA 5B08A 2XMUA 1DURA 1H74A 1KDNA 2B8PA 4JI2F 3FVYA 5ETPA 2YNFA 4NLQA 1VQKS 2DNGA 1CPZA 2CPZA 1CJVA 4USUA 2IRUA 2QG9B 3PYFA 1FRXA 1H38A 3EDRB 1RWPB 2BXJA 2CRLA 4OZJA 2QGFB 2QFJA 2C3PA 2HHVA 3LP1B 4FXVA 3PKMA 5K8PA 4JI4J 3OL8A 3BV8A 4ZLPA 3RR7A 3OSPA 4ZPTR 4IFVA 3ZTRA 3HVWA 4ZLLA 2Z8QA 2C22A 2DR7A 4RNFA 3B6BA 3H2UB 1D9FA 5BR8J 1CJTA 1FWPA 1DTTA 3JB9k 1S1UB 2H3EB 3OL9A 1W25A 3QWPA 4JBCA 2FB0A 4I64A 4RWWA 2AMCB 1D3WA 2RDDA 4N76A 1R0AA 5KFOA 3A8JA 3MUMP 1VC5A 3R7SB 1JMTA 4ZDNA 3KLHA 4OZ3A 4QIFA 4CLLA 2VPWB 3AB2B 3NGUA 1NJWA 3M32B 5KFPA 1NDPA 1WI8A 2M8DB 3Q0AA 3NOGA 2B0GA 2XSJA 3W2VA 4DL4A 1VOMA 2VG5B 4OYPA 3HVTB 1W26A 4KGVB 3KUEA 4Y2KA 1F0XA 4PYAA 2CPIA 1JK9B 2G13A 3KLFA 4QYZJ 2R2UA 2G0JA 3NMRA 3E01B 2XG8A 2DY9A 4ZVGA 1WHVA 2UUCJ 3BH7B 1B0TA 1VQPS 2OMOA 1HW8A 2XS5A 1RADB 3ZZOA 3W9JA 1FEHA 2MQPA 3VCDA 4KKOA 3TEGA 2FGCA 2FZKB 2R2TA 3PFOA 3KTQA 4ZCKA 3PVXA 1D09B 1XK8A 4CO1A 2BQUA 5EUHA 4OHWA 2FVQA 4K4YA 3JS9A 4QWBA 4DQRA 1JLCB 3ZNUA 1RTDA 3E8OA 1TKTA 1VC0A 4Z7YA 1LFPA 3TAPA 4DV3J 1UWBA 2MZTA 1SB6A 4DBQA 4MT1A 1VQSA 4V19X 2JOQA 3BBCA 2R9LA 1QSSA 4U9RA 4Y65A 4X4NA 3H5XA 2V9WA 2DKOB 1QSYA 5EDWA 5IV3A 5KFJA 4IH5A 3VAKA 4WTYA 2PMHA 3BO4A 2K2PA 4F0MA 3D7SB 1FKOB 5HBMA 4DQIA 4FKYA 2BM1A 2BKOA 3NY0A 3LOUA 2R7RA 1FVSA 2ZZTA 2JLFA 2VG7B 3UWTA 4Q7AA 1VISA 2HNYB 1TTHB 3SCJE 3Q2SC 1OWXA 1S1VB 4BHQA 2V8GA 1TL4A 2WVFA 3F0NA 2MKHA 2OI2A 4M5DA 2E5LF 3H5SA 2WONA 3PEHA 4NLUA 5B0DA 2ZBCA 1UA0A 1JLEB 1XMQF 3KDNA 4JI0F 1KFSA 4H4KC 1DY3A 2MQ8A 1OYEA 3RB0A 1KVJA 5L46A 1HNZJ 2XHWA 2ATCB 2PA3A 1ZYQA 2I0XA 2XYGB 5A8WA 4PWWA 1F3FA 3TOQA 4ZVTB 1HD0A 2E5IA 3M6UA 4P73A 2FIUA 2U1AA 1VQYA 1U24A 3QRPA 1RAHB 4ILRA 1SC4B 4S0MA 4P71A 2DXDA 1KLMA 1XNQJ 4R5PA 4IG3A 3EVOA 4GO5X 4N41A 1VLOA 2CPXA 1M5KC 1E6VA 2YNIB 4RW7A 1PSDA 4O3NA 3CPWR 2ZEJA 1DQAA 5ETKA 3ZZPA 3T6BA 2WK4A 1YJUA 3SXLA 4AL6A 1QTNB 2XZDB 4ANEA 2NXNA 3GV8B 4J9OA 2C2RA 3GYNA 1FRIA 2V8HA 3AJ1A 2DHSA 2FZCB 1K44A 4RW8B 1PAUB 4KQZA 3OSNA 3FK4A 2FTRA 5KT3A 2JEGA 3LALA 2M88A 2CQ3A 2RH3A 4JV0A 2BJ9A 2MZSA 3JYTB 2XLJA 3LP1A 4RW6A 5DZ7A 3H5UA 3NCRA 5B09A 3NNCA 3T1HF 4B9TA 4J37A 1UJ6A 4OZ5A 1S4FA 3I55S 2ZOMA 3KK3B 2ZJRQ 3ENAA 5LXRA 1YZ7A 5DQHA 1N48A 2OHDA 1O5JA 2OO4A 3CDWA 1U02A 3HCXA 2GO9A 4C97A 2M3DA 4O3PA 5DLFA 1X4FA 1S1UA 2POKA 2DH8A 1UCNA 4YQWA 2DR8A 2UUAJ 3DU5A 2F3JA 1MMLA 2GVDB 4NLTA 4DV4F 1YI2S 5KG5A 3DI6B 2ZUAA 4ECRA 2RF2B 4OHYA 5LMUF 5D77A 1KQSR 4OL8A 2HW3A 4PXDA 1S4EA 4FP9A 5HVHA 3RBDA 4ANDA 4ED0A 5KFCA 5GMEA 3HM9A 2BJDA 2YTCA 4J9RA 1NK9A 3ZZUA 4DFJA 4LBHA 3U1LA 3F44A 5IC4B 2PMWA 3BB5A 3GFYA 3J81Y 3J7YU 4OI6A 3IS9B 3VWSA 5EX0A 2B4OA 1JJ2R 3UFCX 2V5HG 5KFYA 1MU2A 2CAJA 2VG5A 4DSFA 2YWWA 4U8VA 1Q4RA 2U2FA 1VJWA 1RAIB 3G4SS 1Q7YT 2YQ3A 1SXLA 3ICLA 1ZTWA 1H3DA 1XERA 3OPKA 5A8KB 1D8YA 3OLBA 3E01A 3CF5Q 4PWDA 2IA0A 2NS1B 3MEGB 2DISA 2Z0GA 4OX7A 1H72C 1RWVB 1Y10A 5KFGA 1EHWA 4DR7J 2AEFA 1VHIA 3BGFA 2VOPA 3EJMA 2BUNA 3JSBA 4NZ6A 4ECXA 4J9NA 2W2QP 3P45B 3GTYX 4CWBA 3AOBA 2IRXA 2CQIA 3IR6B 1QAYA 2R8HA 3PHEA 1I94J 2WCXA 2C3OA 4LF9J 5AJ3J 2YBVA 3QO9B 2GJ2A 4DWIA 2B9YA 3BQ2A 3O6QA 2FHMA 2YKOA 4H4KA 3NWGA 5L39A 4G1PA 4P74A 4ZVHA 1RA6A 2XHCA 4FVCA 3WX8A 1FKOA 2OEJA 4HDHA 4ID5B 5CYMB 4F4ZA 2EKYA 4LF5F 5KTQA 1PJ7A 4EMDA 1PJ5A 2AYMA 4WIQA 4J91A 2YWHA 3EZ5A 5HI7A 3ETOA 2VG7A 3POTB 1N5YB 3I56S 2OJ3A 1VDHA 2HNYA 2OKQA 1CQMA 3FFIB 2Y3YA 3CCRS 3T3FA 4O0NA 2KU7A 3WIVA 2ZHBA 5J2NB 5CQGA 3VR1A 3HD1A 3MAAB 3N01A 1VQ9S 3D0IE 4B08A 1JLEA 3QSYB 4P9SA 2DB1A 4N47A 4CQ1A 4J9SA 2R7OA 1X4DA 4DFPA 1R8CA 3OQ2A 4ELVA 4XTTA 2Z30B 3MM5A 2V9KA 2AJQA 1UMJA 4QIWD 1S9GB 2VOOA 4QWDA 2R7XA 4CO0A 4TYAA 5LSLA 1L3KA 4F2RA 1SJ1A 2C3UA 2BKNA 1M5HA 3IO1A 2QLWA 1RDRA 3VQTA 3CEDA 4R8UB 4NCBA 3M8PB 5F8IA 2R7WA 1GAOA 1N5TA 1VRTA 1N34F 2YPZA 3GPAA 1FFWB 1S9EB 2YNIA 1L3TA 4FYVB 4YR2A 2FC9A 4K50A 4X62F 4LSZB 4X4OA 1X9MA 4QYZK 5HQLA 3K2YA 4Q2LA 1C1CA 2CPFA 2P9EA 3QZ8A 2J0QD 2DGQA 2CWKA 4RW8A 2JNJA 4YHHF 1F6TA 4P7VA 4F4KA 2HQCA 2W2OP 1HQEA 1T11A 4K4XA 1EB0A 2AF6A 1LOUA 4FVMA 3QAUA 3G86A 1EQ0A 5IFMA 4UQGA 3HDSA 2HKEA 3MD3A 1GMUA 3JYTA 4DV5J 3QQCD 1NBEB 4WU3A 2OPSB 1SJFA 5KFEA 5KFVA 4AXJA 1RAGB 1S1XB 3M8SA 1SH2A 3KG0A 4C8KA 3LP2A 3KK2A 2OELA 5HN0A 3MEDB 5JVHQ 3SV3A 4WZMA 3R7NB 3HSGA 2MLYA 5E3CA 5D8HB 2JH3A 3GYXB 1KTQA 4NLOA 3DC2A 3BGUA 1NK8A 2EFOA 4PZVA 2RRAA 3AT1B 2W9CB 1NZ8A 2GVDA 4LF7F 1A9NB 4PKDB 2GS8A 3BR8A 3DI6A 4UQTA 3CCTA 1UJ4A 2X3DA 2LCWA 1SJ4P 2RF2A 2Q6CA 5DQIA 2D3OR 4N77A 1RTIB 1N33J 5D4NA 1TKXB 4LSLB 4AE5A 2GHVC 4OYMA 4LQ3A 3OTCA 4W98A 2DD8S 1D8ZA 4C11B 3IS9A 1JLBB 2B3TB 3HHDA 4MAKA
chains in the Genus database with same CATH topology
2CZVC 1IKVA 1P6TA 4Q43A 3TP2A 2IC3B 2RS2A 2FHOB 3HXMA 2IVFB 3UR3C 3UI3A 4C8LA 3PIPQ 4MKBA 2KHCA 2YKAA 2MSSA 4DL2A 2VBZA 2KXFA 1NK0A 2KT2A 1ZH5A 2I5JB 5EWFA 4I6YA 3VZIA 4A48A 3MWBA 2HWTA 2OSRA 3DHXA 3DLKB 4EWTA 1ZM4A 4MIBA 5LT5A 2YH1A 3HHLB 1H6KX 2V4JA 3JSRA 4ZPBA 3CCMS 1Y5IB 2RT3A 3NCPA 3IG1A 1FERA 3NKYA 4H4MB 3MM9A 3W2WA 2MMYA 2HAIA 2ZKTA 1VBYA 5GAHU 5A8KA 2PDAA 3R1HA 4WFYA 2LU1A 3SMZA 3NGKA 4JOUA 3KLGA 3MUTP 4M5DB 3OJSA 1YJ9S 2A1BA 3S01A 3H59A 3OL7A 5GAGI 1S6PB 1SUQA 1TQLA 4HH1A 5DDOC 4PR6A 1HWKA 4PG5A 2EFVA 1X4GA 4TU7A 1RTJA 1ZM3A 4OI0A 3BN7A 3H8YA 2PIIA 4J5OA 5IWAF 5DM6Q 3QJLA 4CO4A 1S6UA 2VUGA 4CH0S 3KG1A 4J9QA 4ZP8A 2G9OA 3CD5A 3NBPB 1OIAA 4DN0A 3CJ4A 2BDPA 3L95X 2DNYA 2NPFA 4LIRA 1VMBA 3MM6B 1DFDA 4FNHA 2N4DA 4OV1A 2Q3PA 4C8NA 3OR2B 3HHKA 5D3GB 5J2MA 4ECZA 4F2SA 3O3LA 1FESA 3PO4A 2UV8G 2MHEA 3MECA 4K4TA 1IQTA 2CQ4A 3DMJB 5F8MA 4I6AA 3BS9A 1UP1A 3OBIA 4R0JA 2MY7A 1JLAB 2CPYA 5LXYA 3EGWB 2XMKA 5B0EA 1HBNB 3JTNA 5T41A 1SJRA 3PV8A 4BC9A 2ROPA 4IR9A 2BBEA 4N56A 3CMES 4LF4F 1GXTA 2IM3A 2C2DA 5D4LA 2KYXA 2R8GA 1LV5A 2FGOA 2QA4G 1FCAA 1Y3JA 4L3NA 1FNMA 2FHJD 4DL3A 4A46A 3D1QA 5L1LA 4E98A 4XO0A 4X84A 3QO9A 4OI2A 2XULA 2BE2B 3N9UC 3V2UC 3NL0A 2FPHX 3CC2S 3UDLA 3TVKA 4C0OC 3JSMA 4DSIA 1RWUA 3I31A 3BJYA 1Y4ZB 2BABA 1T05B 2ZD1A 4GC6A 4Q44A 1APSA 4KE5A 4IG3B 1CQNA 1KQFB 5DDRC 1UKUA 1U45A 2BRLA 1NRKA 2VFUA 3OVSA 3CJKB 1BQMA 4IRKA 2DGTA 2OD4A 3I0RA 1K0VA 2C28A 3BZQA 2HFZA 2ZH3A 2R7VA 1FD2A 4ECQA 3THTA 4PXBA 4ID5A 3KLVA 1YRTA 5CYMA 1E6VB 2VPZB 3SFUA 3HO1A 3I0SA 2QT7A 2RDJA 1TK0A 1FVQA 3TNVA 3RRKA 1XNRF 4NLGA 2XLKA 2BZ2A 4KJIA 1QVFR 1TK8A 2PEHA 2HFOA 2VG6A 3CB4A 3M32A 3U1NA 2ACYA 3PEJA 3HHNB 3MDFA 5AE3A 2GJIA 2LLZA 3KHGA 3O8WA 5CZXA 2GIQA 2GX8A 3LH2S 4K2XA 5L8RC 5I42B 1TKZB 3R5CA 4WIIA 3IN5A 4F3OA 1XBWA 4PG4A 3GFZA 4DV5F 2B56A 2JFDA 1FKAF 4ED3A 2ZH6A 3QYYA 3RZAA 3I9ZA 4N8OA 3HVTA 5C25B 3KG4A 2UXDF 3NAHA 3OR1B 4ICLA 4KBIA 2HS3A 1RT7A 1URRA 3RYLA 4C3KA 1MMDA 5E2QA 4F26A 3OLAA 3H4DA 2MZ1A 3VAFA 1R3NA 5GADI 2IM0A 3W3SA 1NK7A 2NZ4A 3ZZ0A 2LEBA 2ZH7A 3UW1A 4RX6A 4CIOA 3V6DA 3CCWA 4CT9A 2NREA 2W7AA 4IQXA 1JKHB 4KPYA 4PUOB 1J2VA 3TA0A 1ZTTA 5J2NA 1DARA 4LF6F 1U1KA 2OAUA 4C3MA 1EP4B 1WTBA 4WKYA 3KK1B 4DR5F 3Q8QB 1IKXA 2K1RB 2R8IA 3V4IB 4IG0A 3DFEA 2D41A 1SJQA 3UDCA 2KH9A 2WSEC 2ASDA 4I68A 2GGPA 5KFUA 4RZRA 1TVRB 2W4DA 1RT6A 2DTJA 5EWEA 2YWKA 3G96A 1HL6A 2GQQA 4G1QB 2V8VA 4JUZA 1VK8A 2WOMB 4OI1A 2L9DA 2OPPB 2PA8D 3BGRA 4KHRA 2L3MA 3E3XA 4QW9A 1IXKA 5C24A 1HD1A 2DR5A 1D1UA 3KJVA 1ZZFA 2RQ4A 2E29A 1I1GA 4WK1A 4KV8A 4V19J 2DITA 3SYZA 2VFSA 1OO0B 1BY9A 4WFZA 3Q8SB 4L72B 5GAEI 2V94A 4RW6B 5F8LA 1RT5B 1SIWB 2F1FA 2YKPA 3NNAA 5J1NA 1RT4A 4A8XA 3CD6S 1X4HA 1Y5NB 4RU9A 4A8KA 2VFTA 3DM2B 1WF0A 2GQ2A 3ZZRA 4JI8F 3DOLA 3HF5A 1U1PA 3GFXA 2G4BA 1HQUA 3B8HA 3CT9A 3MEEA 5J1EB 5F41A 5KT5A 3HP6A 1S9GA 3ULHA 1SH0A 1SKRA 2C3YA 2MKSA 1UFWA 2DNNA 4H4OB 3F56A 4TXSA 3GV5B 3EYZA 3MR2A 1O8BA 1WG1A 2ROEA 1F60B 4ZPDA 1JLCA 1MWZA 1L5UA 1LK5A 4EBCA 3U27A 2KXHA 2NPIA 3M2VA 1H2VZ 5AXKA 2XMVA 3BSAA 4J9MA 5CHCB 1ZZNA 3LP0B 1N33F 4UOCA 2ZKUA 3NAIA 4LVOP 2NLWA 4DF8A 2CQ2A 2BOPA 4ZK7M 3T5LA 3KLIA 4YR3A 4K4ZA 2HHQA 4ZPCA 1J5EF 2PGCA 1SH3A 1S10A 2GHWA 3PNIA 4R8UA 1IKYB 4NCGB 4DV1F 3GIIA 4WU2A 4WYLA 2UVRA 3CDUA 3OVAA 2BM0A 2A2DA 3Q2TC 2Y1IA 2BR0A 3OHAA 2EBGA 2Q79A 3M8QA 1NAQA 2JWNA 3SQGA 4WK3A 3H40A 2VKZG 5E33A 3OUYB 1VRUA 1C0UA 2OLWA 1TAQA 2JC0A 3UR0A 4YUDA 4Q5VA 2HMIA 3IXQA 3T6JA 5LMNF 3KNAA 1U1MA 1MROB 1KRPA 2B4VA 2OPQA 1S9EA 3VQSA 1HW9A 4BC7A 4PG8A 2I2YA 1FTRA 4CH1A 1N6QA 2QLXA 5F0WA 3DXBA 4EYIB 4HLBA 3D1OA 2COLA 4ED2A 3QLHA 4IO1A 4MMOA 4KFBB 1HNVB 1G1XA 2QSFA 3U1MA 2OH2A 4C8YA 2XNQA 3T5JA 1M1KT 4Q8FA 5A0YA 2DGWA 2OFGX 4LIWA 4NRUA 1QY7A 2AP6A 2D7SA 4ZA1A 5I3UA 4TY8B 3OV7A 4MIWA 4A8YA 4F4XA 2JEIA 1V9OA 2R2RA 1BD6A 1K1SA 4EUVA 1OSCA 4ED7A 2RQKA 4A4JA 2FHJA 3ITHB 5BJRA 2HIQA 1QAXA 2ZC3A 2CQDA 3DLHA 2YVSA 4KT0C 4LUBA 1X7VA 1NK5A 2KYZA 2UUTA 3T9ZA 2KT3A 4OZNA 1S0NA 2DIUA 2EPIA 4DV2F 2AJ4A 2MDAA 1TZ0A 3MM7A 4XIUA 3H25A 1LWFA 4EGLA 1FF2A 1MMNA 4QR1A 1SI9A 2UVWA 2LQ5A 2D9PA 2DR9A 2HVIA 4JI5F 3M6XA 2CZ4A 1HNWF 3OVBA 1DLOB 1Q8LA 5F8HA 1S1VA 1S0MA 5FDLA 1LWEA 5IS2A 1F9FA 3SV4A 1NK6A 3BSOA 4C8MA 1SKWA 2CQBA 2F40A 2LYVA 4B3TF 2YKNA 3FDSA 4ELUA 1MU2B 1UFLA 4NLRA 5IT4A 2VFRA 1VHFA 1HWLA 3LAMA 2XZWA 1R43A 4HTIA 4O44B 4KIAA 3UE2A 3SDEA 4XDDA 1OPIA 4ILLA 1U47A 4IFYB 4QIEA 3EPGA 4ID8A 2M9KA 3IRXB 1FHTA 1HMVA 5SUHA 4EYHB 5D4PA 4ZPVR 1YWXA 3ZZYA 2AD9A 4RW4A 3CCJS 5JXSA 1WELA 3NRBA 4USJC 4FYDA 4XAKA 2HGLA 3MM8A 4NPOA 2J7WA 2OPSA 4DFMA 1FDBA 4I1TA 4ZP9A 3KLEB 2QMWA 4PWDB 1DAXA 2GNKA 5D78A 2W9BB 2DO0A 5LSOA 1S1XA 4CTAA 3ZZZA 4CT8A 1IBLF 1RT3A 3N79A 4IR1A 1QUVA 2DNKA 2AJ1A 2R8KA 2PI5A 2QIFA 4U6PA 4XPEA 1S6QA 3OTDA 4ED5A 3TR5A 3OFGA 4ZPAA 4I2PA 5GVQA 1H7XA 5GAGU 2MB0B 3MMAB 2LEAA 3K5NA 3CIMA 1SIZA 4IFVB 4DS5A 2FHKA 1NEEA 4O3QA 3MEDA 2HHPA 1E6YB 3I4HX 2E5HA 2V4RA 1IM4A 3LAKA 3N28A 4AFFA 5EWGA 3CTRA 3PIOQ 1KOOA 2KRBA 1YHQS 3AHPA 3DXSX 1TKDA 3CULA 2N7CA 1GQEA 3K5MA 1AFJA 4ZKAA 2KO1A 3T9NA 4O3RA 1HFEL 3J7A1 2FVSA 1UVIA 5ADZA 4RNNA 2BANA 4EO6A 2HLTA 2IFXA 3K8VA 3S8SA 2X1BA 5F8GA 1S77D 3E2EA 4QU6A 1FRLA 5F9LA 2B51A 4ATNA 2IRYA 3HFKA 3QIPA 2UXCF 3PACA 2JX2A 5DDPC 4IO9Q 4DSJA 4LF8F 5DDQC 5A8RB 2BJEA 4H54A 2ZH5A 2RVJA 2VPYB 4QU7A 1W2IA 3TVZA 3G9CA 3OFEA 1CVJA 4MYUA 2KZMA 2DJWA 1T02A 1T8EA 6FD1A 1VQ4S 1H2TZ 1X4CA 2XB2D 3THPA 1R0AB 3QGIA 3R5DA 3TAMB 5F3ZA 1RTIA 5KFLA 3C6UB 1TKXA 4LSLA 3SEOA 4WFAQ 2QSWA 4FS2A 1NK4A 2VODA 2HGNA 3MMCB 4Y00A 4TY9A 4Y0FA 2O1PA 2ASJA 1JX4A 3KLHB 4QQBA 1YSJA 1C4CA 5B0AA 2QEXS 3PW0A 2LMIA 3NP5A 1HNXF 2GHPA 3MZIA 4ZPWR 2CQGA 5HMZA 1LW0A 1GH8A 2MGZA 4DOZA 1PC5A 1JLBA 5H9FJ 4DL0C 1MW7A 3S7RA 1FJCA 4MKYA 3CJ0A 4KR0B 2EFPA 2Q6BA 5HP1B 2DIVA 2DCLA 3WC0A 1G3OA 3BO2A 4M94A 4C8ZA 4FXWA 4NMLA 3CGIA 3MEKA 4IKAA 2OMLA 1S0VA 2YY3A 5LSRA 1F5AA 2V4QA 4R0EA 1Q78A 3R5AA 2VA3A 2AYEA 3LO3A 2A18A 1M90T 3J7Z5 2CDQA 2ZOGA 1IKWB 2O5DA 2PFFB 3DOKA 5L9XA 2ZITA 1ELOA 5E0OA 1C0TB 1WHXA 2I5JA 4P7TA 1Z1ZA 2MQNA 5ITHA 3CC4S 2KZZA 3G8TA 3OFFA 2XSJB 2E7XA 4B3MF 3W2VB 1KHWA 5DO2A 1OS5A 3DLKA 3CMAS 4JI4F 3HHLA 1YIJS 4TNOA 2HYIB 4W92B 1P27B 3PW5A 3G6XA 1VI7A 3PX4A 4H4MA 1FKPB 5KFFA 3WDOA 4KB7A 2KJVA 3FGVA 4I56A 3VAGA 4ECYA 5GADU 1FNXH 5IZHA 2EFQA 1Y5LB 2J76E 4AXIA 4URSA 4RUCA 1N8RT 1DTQA 4NLWA 3GR0A 3HLUA 2HHSA 3PM9A 3BSCA 4O23A 4PG6A 2YNHA 5H1SV 3UQSA 3LWLA 1R27B 4OZ0A 4TN2A 1S6PA 1FXDA 5KT6A 5KFZA 3EZUA 4Y2AA 3EXYA 2IMOA 1S99A 1UEVA 4NZ7A 2K3KA 1KONA 5T7LB 1VQ8S 3KK3A 2RRBA 5L9NA 3NBPA 2XS7A 3A8EA 5A6WA 4B02A 5KFHA 4WFXA 2MKIA 2V2KA 3N6NA 3FZ2A 2KJWA 4GKKF 1RTHB 3MM6A 3MFHA 2N82B 5BYRA 3AQOA 4EBDA 5BYSA 5DGAA 2AGOA 1NJXA 1NB7A 3A1YG 3OR2A 5D3GA 3PFEA 4KKOB 3TW0A 4HH0A 4EU0A 1K73T 4UUXA 2IYGA 4YEAA 1JJ4A 4OHZA 3K5OA 1Z2ZA 2AV5A 3DMJA 3FNNA 5KG7A 3MM5B 1F5BA 3CCQS 2CG4A 2XI2A 3AH6A 4C8OA 1V3RA 1JLAA 3RB6A 2DNRA 4UUWA 1F2GA 3P96A 1L3UA 1U49A 2W8KA 5M2UA 2KVIA 1HBNA 3QWUA 3HX9A 4OX8A 1VQ5S 1HBOB 1Z2LA 4PRFA 2K8GA 2I38A 3OXGA 5E5NA 4YMEA 5CZVA 4B3OB 3RW7A 5KT4A 1HI1A 1RTDB 3D28A