2J0QD

The crystal structure of the exon junction complex at 3.2 a resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
89
structure length
89
Chain Sequence
PQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-DEPENDENT RNA HELICASE DDX48
publication title The Crystal Structure of the Exon Junction Complex Reveals How It Maintains a Stable Grip on Mrna.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 16
structure length 89
sequence length 89
chains with identical sequence G
ec nomenclature
pdb deposition date 2006-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2j0qD00
5LJ3Y 2V94A 2YH0A 1U1QA 2JVOA 4F25A 3ZZYA 2MSSA 2MQOA 2XS5A 3NNHA 1WG5A 3BEGB 2CQBA 2M4MA 2K3KA 3FEXB 2CQPA 3G4SS 2DNGA 3LPYA 5CXTA 2ADBA 3HHNB 1X5SA 2N7CA 1OIAA 1VQMS 3MOJB 4A8XA 2ADCA 3Q2TC 5DDPC 1VQ9S 3S7RA 2MGZA 1A7GE 5LXRA 5GAGU 2MMYA 2GO9A 2RVJA 2LA4A 4P6QA 2MZ1A 3CCVS 4ERDA 1VQ6S 1VQ5S 2D9PA 2MKHA 2DIVA 1M5VC 3BO4A 2RS8A 5LSLA 2AYMA 1JJHA 4IOAQ 4YOEA 2DHXA 5GAHU 5LXYA 1YJWS 3MXHP 2CJKA 2M8HA 3JB9k 2CQ3A 1WF1A 4QU6A 3J7ZT 3SMZA 2DHSA 4C0OC 1Q7YT 1B7FA 2NZ4A 2XNQA 2D9OA 2VOOA 2CQ1A 3NNAA 1VQLS 3CC7S 3G71S 1CVJA 4TU9A 1URNA 1X5TA 3MUVP 3DXBA 4CIOA 2QFJA 1PGZA 3TO8A 3UD3P 4C4WA 1H2UX 1QM9A 2DNKA 1OO0B 2M0GB 3R27A 1U1NA 2BZ2A 1P27B 2G4BA 2KM8C 1S72S 1KOHA 3ZZZA 1WG1A 4WFNQ 2K8GA 2DNOA 1D8ZA 2XS2A 2DNPA 2JVRA 2KYXA 2CPXA 2KFYA 3DLLQ 2KRBA 2N3LA 2KH9A 1SJQA 2HGMA 2I2YA 5DETA 2DB1A 5ITHA 2AYEA 1KOOA 1QVGR 2CPHA 1WWHA 2DNHA 2KU7A 2M52A 3MUMP 2DHGA 1U1OA 4Y0FA 2D3OR 2M9KA 2OTJS 1U1KA 3CULA 2MHNA 2QEXS 2ZJQQ 2MKJA 5GADU 2MKSA 3BO2A 2DNMA 2X1BA 2EK1A 3VAJA 1R8HA 3UCUP 3MUTP 4FXWA 3CC2S 1FNXH 1N52B 2MXYA 4OZ0A 2CPYA 2ZJPQ 2CQCA 4CH0S 2I38A 1N8RT 1Q81T 2QA4S 5JVHQ 4QPTA 1X4BA 3NMRA 1FXLA 2MQMA 3UE2A 4C7QA 1SJFA 1R8PA 3CD6S 4LJMA 3THPA 4QU7A 1UAWA 2DO0A 4F02A 1NU4A 4WCEQ 1DZ5A 2MZTA 2DNRA 2RQCA 2EK6A 1X0FA 3MD1A 4IUFA 2KRRA 4ED5A 1U2FA 4U67Q 1H2TZ 2JX2A 1P1TA 2CQ4A 5CYJA 3R1LA 2ERRA 1K73T 2DK2A 5IM0B 2DNQA 2FC9A 3CMES 3CCUS 2DO4A 2DISA 1X4FA 1ZH5A 2OIHA 3NNCA 2M7SA 1VQOS 3EGZA 2MSTA 3MD3A 1JJ2R 3NS5A 3B4MA 3CMAS 3U1LA 1A9NB 1RKJA 5DDOC 3UCZP 2U2FA 3VAMA 2UP1A 2J0QD 1XN9A 3P6YC 2DH8A 2LYVA 1WHVA 1JMTA 2HZCA 3CCES 3CCLS 3FEYB 1K9MT 1M5KC 2DGUA 3SDEB 2MZRA 2FPHX 2LEAA 2LXUA 2X1AA 2RS2A 4CQ1A 1RK8A 1M5OC 1VQ4S 1D9AA 3VALA 2MGZB 2L41A 3EX7B 3P5TL 5BJRA 1FT8A 3K0JA 3MDFA 2FHOB 1HL6A 2L08A 2O3DA 1WHXA 3ULHA 5H1SV 3G6ES 2KT5A 2E44A 2F9DA 3CCMS 5DM7Q 2CQIA 4IO9Q 1U1RA 1YI2S 2PE8A 4UY8T 2SXLA 1VQ8S 1HD1A 1K8AT 2BOPA 3CC4S 2EVZA 4YUDA 3CUNA 1UW4A 3G9CA 5DDQC 2G1DA 3CCSS 1WI8A 2FY1A 1HA1A 2XSFA 3N9UC 1VBZA 3I55S 2FC8A 2CQHA 2JRSA 2VOPA 3U1MA 1X4DA 1YJNS 1DBDA 2MY7A 2DGXA 1YIJS 1VC5A 1VQNS 1L3KA 2KG1A 3G8TA 2KXFA 1WHWA 3IWNC 1HD0A 1WF0A 4J5OA 3THTA 4WIIA 2KG0A 1G2EA 2M2BA 1YITS 2KXHA 4WFBQ 4UQTA 2X1FA 2DNNA 2LEBA 2JWNA 1N88A 2MKIA 2CPJA 2M70A 2XB2D 2RNEA 1X4HA 2DGOA 2J0SD 2J8AA 2LKZA 4IOCQ 3SXLA 4CH1A 1WEZA 2DIUA 1UP1A 2LQ5A 2DGWA 3S6EA 3P49B 2RU3A 1BY9A 1WELA 2CPZA 4RU2A 4WKRA 2MQPA 5D78A 4WF9Q 1UFWA 4W92B 2RUGA 1WHYA 2CPDA 2HGLA 1OWXA 2DNYA 3HI9A 3B4DA 3UCGA 3D2WA 3G8SA 2NLWA 4FXVA 1H6KX 2HVZA 1FO1A 2G0CA 2MZQA 3L3CA 3BO3A 3RW7A 2AYBA 2MKCA 1OPIA 3Q2SC 3H2VE 4F26A 3PIOQ 2MPUA 1VBYA 5CA5A 2AD9A 2CQGA 2MQLA 3J7YU 4W90B 2MYFA 4TLQA 2A3JA 3CTRA 4PKDB 2RRAA 2KM8B 2CPIA 5GMKa 3PIPQ 5IFMA 2KXNB 3H2UB 2KVIA 1NO8A 1SJ4P 2MQNA 4M5DB 1W2BR 1YWXA 1X5PA 2DNZA 1QVFR 2E5GA 1FHTA 5MLCV 2Q79A 1Q86T 1U6FA 1U6BA 3SDEA 4BS2A 2OSRA 1VC6A 1ZZFA 2KI2A 1DRZA 5JVGQ 3R1HA 5LJ5Y 2CPEA 3S01A 1AUDA 2L9WA 2DGSA 1X4EA 4TU8A 2VODA 4PRFA 1M5PC 2J76E 4LIRA 2CPFA 3V4MA 5GAEU 3NS6A 2M8DB 2F3JA 1FJEB 2AYGA 4PR6A 5GVQA 5D77A 2N3OA 1X4CA 2KN4A 2U1AA 3CXCR 2CQ2A 3CCRS 2LCWA 3BS9A 2N82B 1F9FA 2PEHA 2F9JA 1X4GA 2DITA 2XS7A 4LMZA 3P3DA 2OTLS 1SJRA 5FJ4A 3S8SA 1IQTA 2YWKA 3VAGA 5LSOA 2RQ4A 1KC8T 1Q82T 5EN1A 2DNLA 1SJ3P 4QQBA 4ZKAA 2MB0B 2HYIB 5HO4A 2MY8A 5DDRC 3LQVA 2RT3A 3CPWR 4OZ1A 2LXIA 3VF0B 2WBRA 2YTCA 2GHPA 1YTYA 1S79A 2KHCA 3TP2A 3UD4P 3IRWP 1M90T 3CCQS 3RW6A 2LECA 3G96A 1YHQS 4TU7A 1JJ4A 3MI7X 3VAFA 3VAIA 1PO6A 4Y00A 1ZZNA 5IQQA 1FJCA 2DH9A 2MJUA 2E5IA 2DHAA 2DH7A 3CCJS 2YKAA 4YB1P 1N54B 2HGNA 4EGLA 5DM6Q 1O0PA 1VQKS 3MURP 2M88A 2DGVA 1VC0A 2OJ3A 1FJ7A 1VQPS 1WG4A 5HL7Q 1M1KT 3OW2R 2X1GA 3I56S 2MQQA 2DGQA 1VQ7S 1KQSR 1X4AA 2MJNA 4V19X 2LA6A 1NJIT 1VBXA 2XNRA 3VAKA 2MZSA 1YJ9S 3US5A 5IM0A 2RRBA 1U1LA 1DHMA 3UWTA 1X5OA 2CQDA 2VONA 1WTBA 2MZJA 2YH1A 4Z2XA 3VAHA 3CF5Q 3EGNA 1U1PA 1U1MA 2MKKA 1WI6A 2ZJRQ 1WF2A 2DGTA 3TYTA 2LMIA 1WEXA 2OSQA 2E5HA 2B0GA 4WFAQ 1H2VZ 2E5JA 1SXLA 1WEYA 2CQ0A 1KD1T
chains in the Genus database with same CATH superfamily
3M8ZA 4LRCA 2J6UA 5AXMA 3FEXB 1RABB 3LPYA 3ADAC 1HQUA 4F3OA 3T1HJ 2MMYA 2GGPB 4PYAA 2D9PA 3LANA 2E9RX 2DIVA 4AFFA 4NLWA 3QGGA 2W4PA 2E7XA 2C28A 1HR0J 4RW4A 2ZD1A 5F3TA 4AL5A 3MXHP 3J7ZT 1VBKA 4BWMA 3W62A 3CE8A 3PACA 4NLGA 1T03A 4RL1A 3NXZA 2YVSA 2XM3A 3V2UC 3LP1B 4ZVPB 4DFPA 3KHGA 5KG5A 1AT1B 4DV2F 4NX9A 1TK8A 2GQQA 2H48B 4F8RA 3EZOA 2X3DA 4GVBB 5DETA 2IYGA 2R4FA 3HLUA 1RWNB 2V0NA 1KN6A 3EWGA 2EFPA 3B8HA 3GMGA 1FKOA 3KJVA 3LH2S 3QGHA 1FDNA 2IM2A 4CRJA 2DPIA 4RUHA 3K5MA 1B7YB 4JB8B 1S1UB 2ZJPQ 1TAUA 2CQCA 4CH0S 4O3QA 3W66A 1UVLA 4ENOA 2YNGB 1CJUB 3J7Z5 3PV8A 4QW9A 1R8PA 2RDIA 4QU7A 3IAS9 5KFNA 3A3OB 4X4PA 2RQCA 4C8YA 3L95X 3UW1A 1K73T 4UY85 5FLXY 1T3NA 5KFOA 3AD8C 5A2QY 4FKXA 3U1NA 1X4FA 3CDBA 2V5HG 4OZJA 2VQEJ 3DRPB 3R8YA 1EJ7L 3TW0A 4N5SA 1FDDA 1JNRB 2VDHA 3PYDA 5HQ8A 2VPXB 1ITPA 2CIMA 3FEYB 3F73A 1VMBA 2R2UA 4PXEA 1NK4A 1XNQF 3D1HA 3QAUA 5FIIA 4JI3J 2E1CA 4C0BA 1JLAB 3ZO7A 4DU8A 2Y9HA 1HL6A 4O4GA 1PC5A 4FS1A 3AQPA 2BQUA 3CEDA 3MTKA 3RU0A 5IWAJ 1FEEA 4O44B 2FY8A 3N9UC 2UV8G 3ETMA 3Q89A 3KLIB 5L38A 3QWUA 1MMNA 3UFCX 1ZAXA 4LSNB 1NPPA 3SSRA 4EK2A 1YX2A 2ZC4A 3Q22A 1G2EA 3AY0A 1PJ7A 4UQTA 3KLEA 1M5SA 2EBEA 2K7JA 2J8AA 1W2IA 5DQIA 5HLFB 2DGWA 3VQTA 3IWLA 1F3FA 1Y5LB 4Y28C 4FVMA 2P9CA 5E3RA 1NK8A 5IXUA 1IBLF 5FDLA 3D0HE 3DRSB 4E98A 2IM0A 1M1GA 3SFUA 1VBYA 4NEZA 4LRBA 3PFOA 1WNEA 1MMDA 3WZ0A 2XYPB 1MWQA 4USIA 4HL9A 3R5BA 1FRXA 1FKPA 3ILJA 2VU5A 4L6V3 3BKUA 3FFIA 3TJAA 1I51B 2DYAA 5D77A 5F9NA 2LCWA 2VZ9A 1RA6A 2EKNA 2BM0A 2VFVA 3FMWA 4I68A 5HMYA 2Q43A 1KC8T 4LF7J 2XY5A 3CWJA 1R0BG 2NUUG 4G6VB 3GP9A 3NGUA 3CIZA 3NKYA 7FD1A 1HPZA 1U45A 1VHIA 3CCQS 3DRYA 1TK0A 4B9VA 4DR1J 1JLEB 4C8LA 1JJCB 1NB7A 1X0PA 1IKXA 4X62J 1RAOA 2VG6A 5AJ3F 2YKAA 1SL2A 4NLVA 3KLGB 1O0PA 1VQKS 4DN0A 1RTJA 2CAJA 4MKAA 1WG4A 4LF6F 4HYKA 1TL3A 2M3DA 1YLXA 3V6JA 4MYUA 5A76A 4JV1A 2NCKL 3AOCA 2B9EA 1FJGF 1FFWB 4P75A 2MZJA 3QIPA 2BJ3A 3SCIE 4WFZA 1AXQA 3PDNA 4HEA9 1WEYA 1UFKA 2V68A 1H0HB 1LV5A 1WG5A 3H40A 1RWOB 4O0IA 2Y0BB 2AGOA 3HCXA 3O5TB 3GILA 4AD6A 4N7TA 4P73A 3C16B 2NXNA 1FWPA 1M5HA 1VQ6S 1KLNA 2AYMA 4IOAQ 5I3PA 2PN6A 1CG2A 3TQEA 2OGUA 2V2VA 3DOLB 4YP3A 4B3MF 1MN7A 2DHHA 4IFVA 5CABA 4RO0A 4DV3J 4NCGB 1Q79A 5F8NA 3PO5A 3TX8A 1RE1B 3VCDA 2QMWA 1WG1A 3H0PA 4I69A 3ZTPA 2C3UA 2PA3A 2VJVA 2CNOB 2N3LA 2B7BB 4EFAC 5F3ZA 3QYYA 2OPPA 3D54A 1T9WA 2CPHA 2W25A 4ELUA 4PWDB 4M1KA 5IZHA 2HIYA 3BO2A 3VAJA 1ROFA 4TVAB 5J1EB 5HATA 5E5NA 3ZZTA 4J9UE 2B5JB 3UDVA 3OSPA 1UJ5A 1OQ3A 3H2LA 3SCJE 2PMHA 4WKYA 5J2NB 3DU6A 1DZ5A 3N5BA 2UUTA 1JLFB 5BR8J 5J2PA 4FKYA 2JX2A 2IVYA 3BB5A 2RD5C 1HQEA 1T8EA 7FDRA 4K5SA 2DISA 2M7SA 5ETNA 4DZDA 2BJDA 1A9NB 4DV5F 5KFFA 1WOPA 3H90A 1FX4A 3CD5A 3MEGB 1YGYA 3CCLS 4Q44A 1YJ7A 3M1VB 3SDEB 3TR5A 2FPHX 1ZYQA 3LAKA 2L41A 3K0JA 2RDJA 1NXIA 5H1SV 4KT0C 1WC3A 3WC2A 3FCVA 3D6TB 3G6VA 2YKPA 1HBNA 5DDQC 2XSJB 2HVDA 1X4DA 1U47A 1UJ6A 2AKWB 5BYQA 4C8NA 5K9FA 4PUOA 5B0BA 5B0FA 3THTA 4L76A 5C25B 4NLSA 2DPJA 2DNNA 4GVLA 3GYXB 3M9OB 1B4SA 3T6JA 3LP2B 1RT7A 2DY1A 2VKZG 4P9SA 2NXCA 4OI3A 4WKRA 3WDOA 5DLFA 4OYZA 1KNZA 1P1LA 2IRXA 4KV8A 2JFDA 3QAEA 4WJBA 2CPDA 1UMJA 3K5LA 5HMWA 4KQZA 2RE1A 2GVDB 4Y2KA 3N6LA 2RHQB 1VIOA 3DRRB 4F0KA 4X64J 2W9CB 4NPOA 3OVSA 4WK1A 4H4OA 3H2UB 2BA9A 3ICLA 2VV5A 3JSYA 1RT3B 1U2CA 1Q8BA 1Q86T 3HP6A 1EP4A 1ZZFA 3GPAA 1NKEA 5DLGA 3QRPA 3R1HA 1S1VB 5EHHA 5KOXA 2YNHB 4NLTA 1LKZA 1EQMA 1B3TA 5AT1B 1X4EA 5GADI 3V4MA 4FP9A 3HVTA 2C2ZB 3BSOA 1X4CA 2CQ2A 2B4PA 2DEJA 2YNIB 2FVQA 2NS1B 5GMEA 4U8YA 5EN1A 2YWHA 2Z2MA 2VG7B 1NK7A 1A6LA 2NUHA 1NHKL 2LXIA 4LR8A 1Y5IB 4OYOA 1YRTA 4ZVHA 2O5DA 3EVMA 4N8OA 2Y1RI 1RWMB 1YHQS 3BREA 4ID8A 3A4TA 4OMFG 4JI0F 3RZAA 1N6QA 5L1KA 2J9DE 1U7LA 4WYLA 3PM9A 5AE1A 3H8YA 3PW4A 5F8MA 5GAHI 2ZBQA 3MMJA 3O8WA 2UU9F 3E01A 2LFVA 1WSVA 2FYXA 2HHVA 3PYGA 3EGNA 1QE1A 3O44A 2VF3A 5D0GA 3DFEA 2GIQA 3M32A 1R0AB 5LJ3Y 2G13A 3TVZA 2MSSA 1E6YB 4ZJQA 1TVRB 2WVEA 1WTFA 3TEHB 4JI7F 3JQKA 1QSSA 3O3LA 2R8KA 4DR2F 3GYGA 2UXBJ 2ILZA 1PAUB 4F4KA 2GJ2A 1QAYA 1S1TB 2RVJA 3CCVS 4OZNA 4B9TA 1N5SA 4IH7A 1GFWB 1LWFB 5GAHU 1V3RA 4GKJF 2H5IB 2ATLA 1F0XA 3K5NA 1B7FA 2R7VA 3DKDA 1T9YA 2HFSA 3DXBA 2IFXA 4NWBA 1HKAA 4MK8A 1SV5B 4U8VA 2HBQB 4NRUA 4M5NA 2AQ4A 2A10A 4OYBA 4DPWA 3FQLA 1RT2A 1DQAA 2DNHA 1Y3JA 3PW7A 2ZJQQ 1CS4B 2Z4PA 5K14A 3UCUP 1Q0NA 2C2EA 4JP8A 5I3QA 2LDIA 1RJJA 5DGAA 1Q81T 4KHPF 5ETRA 4N76A 4ED5A 1U2FA 2JJ4D 4DMZA 1W26A 1WKLA 1VS3A 2FC9A 2GHWA 1N34F 2KL8A 3PNIA 2OIHA 3NNCA 1VQOS 3EGZA 2BKPA 3NS5A 4E0DA 4ETXA 2J0QD 4IH6A 2P6SA 4RBVA 4Z37A 1CQNA 1LOUA 2QIFA 3B54A 5L1JA 1DQ8A 1RTHB 2LEAA 1LWCB 3MEDA 1PJ5A 1MW7A 4FPIA 3CDAA 3QNWB 2HLUA 2LEPA 4L72B 3JSRA 3CCMS 3TVKA 3W8PA 3LF0A 3H42A 1TL1A 4WFXA 1MROB 1CC8A 3G9CA 2WSEC 1NLKL 4OI0A 3PJWA 4MMOA 1IM4A 1LK7A 2VOPA 1LWXA 2AGQA 5EUHA 1WHWA 3DYAA 1XMOF 4OJ3A 2Z8QA 4K0KJ 3W5XA 1QAJA 3SQGA 6FDRA 4C0HA 1XNRF 2LQ5A 5GAGI 2DCLA 2ZKUA 5KFWA 4WF9Q 2ZH1A 3EZ5A 4O3SA 2DNYA 1JLGA 3SIPB 4KE5A 1HHQA 2WONB 2I5JA 1UEVA 1FDBA 4WP8A 3Q2SC 1SIZA 4ELVA 1K44A 2W9BA 2DBBA 1OQ6A 2A3JA 1IR0A 4WZMA 5B08A 3RTVA 1GX6A 3MM7B 2DNZA 2E5GA 1S49A 5HQLA 2AEFA 4IH5A 2DR6A 3PXGa 3QIDA 1Q1KA 5CD4A 1C1BA 5A0YA 3W7BA 3W61A 2IJRA 4RW4B 1EHWA 1V5IB 2F8MA 4NASA 4DQSA 2F9JA 1EETA 2DITA 2GX8A 3P8BB 3GIJA 1HBUB 4EUVA 4AXIA 2XGPA 3SI8A 3LQVA 4DCJB 3VF0B 2YTCA 4C8ZA 4U95A 4NYPA 5D0HA 4RW8B 2XMVA 3BH7B 2YKNB 2B9YA 3QZ8A 3BV8A 4USHA 4NI2B 2P2CB 4DF4A 2EFOA 3E2EA 3L09A 4QWBA 2M88A 4ZA1A 5CYMA 2MQQA 4K2XA 4USKA 3DLEB 1TKXA 2JL9A 5IM0A 4Z2XA 2XWXA 2OD4A 3CF5Q 1ZM4A 1S6QB 3C14A 2LQJA 5J2MB 2KJWA 4DUZJ 5A8KA 2OSQA 1YJUA 4WFAQ 2E5JA 4PZVA 2QO3A 2VIHA 4ZVOB 3JSBA 3W9JA 1HNVB 3NNHA 1U09A 2HHXA 4DV0J 2HFOA 2W1BA 2EKYA 2H5EA 3MOJB 5DDPC 4RZRA 2QSFA 3PR4A 2ZEJA 2UXCF 3BSAA 3RJMB 3OLAA 3D28A 5LXYA 5ETVA 3CJKA 4PQUA 4LBHA 4ECTA 2DHSA 2DR9A 5LT5A 5C5JA 4ZPAA 2OMOA 4TY8A 4TU9A 2PT0A 1UL3A 1FNOA 2XULA 4CZCA 5L46A 1U1NA 4GKKJ 3ZZZA 4CLYA 2G2OA 1LXNA 3M8SA 4C48A 2JVRA 1H73A 2IA6A 2IIHA 2KH9A 2HGMA 2I2YA 2FTRA 3V6HA 2ZZNA 1FI4A 5B09A 4NYOA 1N33J 3DC2A 3DLBA 3R5JB 2X1BA 2EK1A 3HKZD 4FVCA 3DHWC 1J5OB 4LFAF 3OTOF 1NDLA 2VA3A 3ZTQA 1V9OA 1BWVA 1LW2A 4LJMA 3THPA 4F02A 4CLKA 3MMAA 2BE2B 2BJ1A 4A8YA 2CQ4A 3CMES 2LQBA 4RWXA 4CDIA 1RI7A 3DLKA 4M5DA 4FZVA 5L9XA 2EXUA 2GJFA 4DN9A 4A47A 1F1BB 1N5VA 2JOQA 1CJVB 4LF1A 2VPZB 3M30B 2BJEA 2XO7A 2E7VA 4CCHA 2R7QA 3TA2A 2AP6A 2K1RB 1VQ4S 1XMBA 2VFTA 5G0RB 1VRUB 3FFIB 1HIYA 3FDSA 4CT8A 2KT5A 1HW8A 4C6AA 1XJWB 1A0OB 2SXLA 2Z56B 4XDCA 2FLLA 4LF4F 5KTQA 1IKYA 2W4CA 3JYTB 2B56A 5LSRA 4LFCF 2NXEA 1DJ0A 3X1LB 2XTJP 2AX0A 1EQ0A 1HNZJ 3C6UA 3L7OA 1ICEB 1SUQB 1N88A 2C2DA 1J5EF 4IOCQ 1JLCA 1S1XA 3KK1A 1PIEA 2MTLA 4KH0B 2F7VA 3G87A 2RU3A 2NSCA 4NXNF 5A8RB 3H59A 5GAEI 3AAWB 3T5KA 2XMTA 2HQDA 2VFSA 3DOMA 3MECB 1RWXB 2ZVSA 1CULA 1IJFB 4Y2MA 3C6TA 5LMNJ 2LXFA 3C2PA 2CWXA 4HACA 3C46A 1NSQA 4ZPVR 1UZDA 2RRAA 2KM8B 2AF6A 3ZXWA 4KO0B 4W98A 2CG8A 2J8SA 1DRZA 1RCXB 1TK5A 4CLLA 2UV8A 1E6VA 5GAEU 3NS6A 2QLBB 4PR6A 5F9LA 2N3OA 1WD6A 1GMUA 3NWRA 1HBOA 5G4DA 2HNDA 2RUSA 3I6PA 3DLGA 1Q53A 1R89A 1VRTB 3TP2A 3WBZA 1IBMJ 2QLWA 4FYDA 2CKWA 2E1MC 3RAQA 3KLHA 2OPPB 2CZVC 4Y00A 4IOBA 5ETKA 3K5OA 2Z2ZA 1SH0A 3AFGA 3GV8B 2RHSB 1EX8A 1VR6A 4JV5F 2A1BA 4XO0A 4ZPCA 3LO3A 4CT9A 3CB4A 2X1GA 5D0RA 1VLYA 3G8QA 1S1WB 4HT7A 4WU3A 5HAOA 1U0HB 5B0EA 2XWYA 1X5OA 2A0FB 3VGUA 4CLFA 3BGOP 3QJLA 3RB0A 3CO0P 3ZNJ1 1FEHA 2B0GA 1O51A 2CQ0A 1U1QA 2CA9A 2PFDA 4YY3J 5ETSA 2XC9A 4ELTA 3GG0A 1R0CB 2L3MA 4J90A 1IKVA 4HTJA 3Q8RB 5KOWA 4OLOA 4C8MA 4G1QA 4KR0B 2XI3A 3OHAA 2DTJA 2HHPA 4KC5A 5HROA 3HHEA 2Q6CA 5LSLA 1NJZA 3TZZA 1DURA 1R8BA 3CCTA 2C3OA 3IM9A 4PXDA 2HHHF 1HWKA 2GO8A 2VOOA 1H38A 2ZFHA 5K8NA 8ATCB 1C2PA 3W2WB 2ZZMA 1S72S 1KOHA 3LP0A 2L48A 1L3SA 2HQ3A 2VD3A 1TV6B 3DLLQ 9RUBA 1ZS6A 4LF8J 4OI1A 2QLJB 5T41A 3W8GA 2AYEA 1RHKB 2BDPA 1FXDA 5F0UA 2ZOGA 4MFBB 3GSDA 1U1OA 4EZ6A 4NZ7A 3ENVA 2XZWA 2XGQA 2D69A 5DQGA 2WAQD 2JEGA 3CC2S 3D3CJ 1PKUA 2W7AA 4O3OA 2HBRB 5KFRA 2ZH8A 2QA4S 3HD2A 2QRRA 1FXLA 3LTOA 4QBUA 3RRKA 5ADZA 2C2NA 1U02A 2H4YB 1PYOB 2XCPA 4H54A 1TL7A 2K06A 3NAIA 4J9MA 1S97A 3PX6A 2MSTA 2HS3A 2HIQA 3B4MA 3CMAS 3KYLA 4B17A 3P6YC 1C0UB 2EG1A 5D3GA 4OI6A 5KG1A 2MZRA 2MGZB 5C42A 4M5KA 2CADA 2FHOB 2VG5B 2ZNYA 4WFYA 1GH8A 2ZVIA 2F9DA 2ZM6F 3HSDA 3NL0A 3UO0A 2XMMA 3MMBB 4Q7AA 2IBKA 3CNQP 2YBVA 1C1CA 4IFYA 2OO4A 1F5BA 2AEJA 4QOTA 5D15A 3BN7A 1VRQC 3FGVA 1HNXJ 4U7CA 1ZETA 2PA8D 1U6ZA 2QL5B 5DRKA 1KHVA 1WF0A 3T41A 4ED2A 1I1GA 1CSJA 2OPRB 2QV6A 3M2VA 4ZIWA 3QO9A 2RNEA 3KUGA 4OYIA 4CH1A 3VGVA 1UP1A 1Y7PA 2NXUA 3QRRA 2ROEA 4CLPA 3BGRB 3IS9B 3R97A 1BD6A 4NA3A 1S9GA 3RR8A 3M2RA 1D8YA 3HI9A 2B8PA 3DI6B 4DSLA 3E01B 5KT6A 4FXVA 1FO1A 3BO3A 1XWLA 2B6AA 2O1PA 3PCOB 1UCNA 5F8HA 1KWMA 2E66A 4K4TA 1EARA 3GR1A 1YRUA 4M5HA 3PY8A 3M32B 4RNOA 4KHRA 4FPRA 1AYEA 4CO4A 4RW9A 2KXNB 3G6XA 3OXFA 3UDLA 2MLXA 2Q79A 1U6FA 1S9EA 4LF5J 2D3UA 4URGA 5KAKA 1AUDA 4ILLA 4MTPA 2HRUA 3R6GB 1C0TB 1FNMA 2WVFA 4ID5B 5E0OA 4TU8A 1PBUA 2J76E 2CPFA 4LIRA 4BCAA 4KKOB 2AMCB 4F67A 1X4GA 2BKOA 1R27B 4L3KA 1MN9A 3OUYB 1ZA1B 3VZHA 2EEYA 2FJAB 1YJVA 2HYIB 5HO4A 5DDRC 3DGPB 2QX0A 3VWSA 3CPWR 2WBRA 1YTYA 1X7VA 4RUAA 2VKRA 1I94J 2WBMA 2R2TA 2EWHA 3SV3A 4UQGA 1H98A 1TQLA 2V4JA 5JXSA 3CCJS 3ITHB 4UOCA 5DM6Q 2FQQB 5K14B 2R2SA 3J7AN 1M1KT 5C24A 4C98A 3OR1A 1JK9B 2CRLA 3LAMA 1AZSA 2V8HA 2F4FA 1WTBA 4PG6A 2PMZD 3JSMA 3ONQA 1U1PA 2MKKA 1DTTA 1NSKL 4I6YA 4UTGA 3KUHA 1KD1T 3QFHA 4C97A 3WIVA 2XS5A 2CXEA 4WE1A 2K3KA 4IDKB 5F8IA 2CQPA 4A8QA 2DNGA 3BR8A 3K7RA 3SSQA 3VGTA 5E41A 1OIAA 2VBWA 4P52A 1HARA 3MM9B 4PG4A 2CDRB 4J9PA 3SEOA 5K8PA 2XY6A 3QT8A 2H51B 4CWBA 4MH8A 4AXJA 1JLBB 3L7UA 1HNWF 3H20A 4C0OC 1RWPB 3A12A 4D3HA 2DR8A 2BM1A 2J9DA 2X3GA 2QFJA 3UD3P 1QM9A 3D6FB 5ETMA 2GW8A 1GQEA 3SFGA 3DM2B 2PDAA 3F44A 4QCLA 4WTYA 1GNKA 3N6MA 1SB6A 1RWVB 2O66A 5KG2A 2GQ2A 1NH8A 1RAHB 2WHOA 2UUWA 3QBCA 3MOZA 1OSDA 3IGNA 5E2QA 2F65A 2XZDB 2MXYA 2R8GA 1R31A 2DRDA 5K5MA 3CJ8A 3FSYA 5KG7A 1FK9A 2QA2A 1WC0A 1HWJA 2DO0A 1Y3KA 3UN2A 2C3YA 2OFGX 3EGVA 3QJJA 1VK3A 2ERRA 3I0SB 3OXLA 2ZHAA 3W65A 2OAUA 3IR5B 4NOHA 3NGSA 3GWCA 4OJGA 2D74B 4ZP7A 4KGXB 1D9FA 2Y1IA 1RB0A 2Y1LB 2R7XA 2LYVA 3LGMA 2FZGB 4RUBA 4J91A 2CDQA 1UZHA 1U8SA 1Y4ZB 2DGUA 2VC1A 4DPYA 5BJRA 1RTIA 4QR1A 4XDDA 1T9TA 2DJWA 2E44A 2HHSA 3PTWA 4I64A 4WIQA 2HFVA 2ZH4A 4ECUA 1KKHA 4U9RA 3IRXA 3CCSS 1S6PA 4UF4A 3IC1A 4ES2A 4IR9A 1YJNS 1MNEA 1NK9A 3POTA 1ZOTA 4WWSA 4I7FA 2KXHA 4USJC 2UUBJ 2UVUA 4ZVSB 4G1PA 1RT6B 3PEHA 1S48A 4JI5F 4P7TA 4U7UK 2OUGA 4DR7F 1JKHB 1MWYA 2PSZA 1QJHA 2UXDJ 4C3LA 4NZ6A 1SCJB 2N4CA 1SQGA 4RPFA 1N5TA 2BACA 4EEYA 3B4DA 4JI8F 4LF9F 3M8PB 3RYLA 1TKTA 4Y2IA 2E29A 1WJ9A 3H5XA 1OSCA 4ATNA 4TQSA 3L4BC 3UR0A 2VUGA 4OZLA 3KHRA 3GIMA 4W90B 3AOAA 2GAHC 1FHTA 2PI4A 3JQMA 2KI2A 3A3NB 3U02A 3EMTA 5HMZA 3DDIA 3GR0A 4PXBA 2L9DA 1O8BA 1FJEB 2QC3A 2BQRA 2MLYA 1FDAA 4ZHRB 4JI2F 3CJKB 2XS7A 4KH1B 4KGMA 1CBKA 4B9MA 2C2MB 1S99A 4HR2A 3M6XA 4ZKAA 5IT9Y 1UA1A 4KAIA 3Q8SB 4GO5X 1N36F 2OPQB 2CG4A 4TYAA 1QD1A 3OQ2A 3MFHA 4YHHJ 4PEOA 5CH7B 5H9EK 2QTWA 3DOKA 4QWDA 1IBKJ 2OMLA 1HI1A 3MR5A 3L7PA 3C15B 4Q43A 4W4MA 3A1YG 4Q2LA 4ICLA 2IVMA 2HNZB 1NDPA 1T9VA 3O2IA 1NJIT 2FUG9 1LW2B 1MLAA 4ES1A 1NNDA 3DMJB 3UNGC 4USVA 1WI6A 3KLFB 3F0NA 4ILRA 3TYTA 1H2VZ 4Q0BB 1N5YA 1NBEB 4KFBB 2FDNA 3MPVA 3NEKA 2WVCA 5JUMA 3P5BP 1QAXA 4B3TJ 5LMUJ 4A8XA 4Y2AA 3MEEB 1S0VA 3AA8A 2XLIA 5CYQA 4IRKA 1ULRA 4P6QA 3HXMA 1IJEB 3M9NB 2MKHA 2R7WA 1M5VC 4IG3A 4YR0A 2RQMA 4OHWA 2VC0A 3O1LA 1RXOB 1LW0B 3MAHA 4DL3A 2F40A 2BJ8A 4DPUA 2VQFJ 3ENAA 3TAMA 1H7XA 1URNA 3UD5A 4CIOA 4C4WA 3MAAB 5HP1A 4A8KA 2ZOMA 2FGOA 4LVOP 2D1CA 3MR2A 3EDQB 3R7SB 2FGCA 4B3OB 2M52A 2DHGA 4UOHA 3AD7C 2FD2A 4CYUB 1S6OA 3C6UB 2BRLA 1RAFB 3FCWA 2ILYA 2KZZA 4IYQA 4ZP9A 1P8GA 2I38A 4EO6A 4JI1F 2Y8WA 3AQOA 1S9FA 3CJ2A 1VHFA 1SH2A 4X4RA 4DS4A 2J5AA 3NCRA 5KT5A 2GVZB 3K2YA 3E3XA 1IR1A 2OEJA 4DUYF 1DLOA 4HH1A 4I67A 1RKJA 4Z7CA 4G3IA 2WZ1A 3UCZP 3HHLB 3OR2B 1N0UA 3NY0A 2BABA 4Q8FA 1X8DA 1XMQJ 2YKMB 5HJYA 2H1YA 2ZHBA 1K9MT 2FVPA 3EXCX 4DG1B 2WK4A 2HSEB 2IRUA 1P9QC 3HVWA 3DLHA 4FBUA 2DKOB 4K2JA 1I3OB 2O3DA 2HAFA 3LGHA 1RAJA 3PJ9A 4OHZA 3H4DA 4DR3J 3W5YA 3DGVA 4U6PA 3J81U 3VR1A 1L3KA 2ZE2A 1U2RA 5DG8A 1JB0C 2WRMA 1NEEA 1HHSA 2M2BA 5AXKA 2XY7A 1YITS 2RU9A 2Q66A 2AIRB 2HWHA 4ZMMA 1Q8IA 1HWIA 3HJFA 3GJTB 3S6EA 2OEMA 3VVUA 3IMQJ 2C2KB 3R7BB 1T05B 4A8FA 4DLGA 2C2RA 4Y6IA 2NQPA 1NPRA 4HDHA 3D2WA 3G8SA 2NLWA 3KLVA 2CJ9A 1R8CA 3EZUA 3TUPA 2AYBA 1ACMB 1FERA 1R6YA 5M2RA 3EPIA 4PABA 4DR4J 4DZ6A 4TLQA 2FJBB 2UUCF 2XMKA 3PFEA 2VFUA 1RTDB 5MLCV 4JI6J 5LJ5Y 2HVHA 1PSDA 2QMXA 4DS5A 4OI2A 2DGSA 4JBCA 3K8WA 4AT1B 4KPCA 3CJ5A 3OTCA 4OX9F 3LP1A 4HDGA 1RP5A 2WOMB 1ZM3A 4FYVB 4QJVA 2Q1LA 3GQCA 5FJ4A 3ET6A 3ZFVA 2HVEA 2B4UA 1B0PA 2HMIB 3CDWA 2AZ1A 1JXLA 2MY8A 1RWWB 4GVBA 5LL6d 3Q0AA 4PAAA 4FDFA 2GHPA 4Q2MA 2OPSB 3R5GA 1RHRB 1ZPVA 2LECA 3NWGA 3LW5C 1RLCL 4M95A 3MI7X 3VAFA 4NL5A 1IWGA 4HTIA 4NXMF 1UPMB 1S1UA 1NJYA 3MM6B 2NSBA 4M63A 4RLEA 4P10A 2AJ1A 2YNGA 1CJUA 3DRXA 4UUXA 1FJ7A 1WACA 4DV6J 5HSPA 2JLGA 3T1YJ 3MFIA 2COLA 3M7VA 2D7SA 4QYRA 2FJVA 4MYTA 2XNRA 3VAKA 2GZOA 4ES3A 4R5PB 2ZHOA 1Q7LB 2HG4A 3S1TA 2DGTA 2LMIA 3FQKA 2E5HA 3DRPA 2VICA 4AQYJ 3W63A 4JV2A 5C2CA 2HZVA 1T3OA 3HKWA 5E33A 4DV4J 4PPDA 2DR5A 4IQMA 1FFGB 3OHBA 1DARA 2KTQA 3HHNB 1UWBB 4K5RA 5IQ6A 4CLWA 3PR5B 4LVNP 4WXWA 1T9XA 3IG1B 1JLAA 1VK8A 1CPZA 3R5DA 4C3MA 4ZN3A 2BANB 3SSSA 3BQ2A 2BE9B 4KPYA 3EM1A 1YJWS 2UUAF 1WF1A 3SMZA 4ZPDA 1Q95G 2XLJA 4O44A 1BQMB 1S4EA 2XNQA 2XMUA 3GJQB 3ISZA 3KLIA 1VQLS 4ZLLA 4KIAA 1PGZA 4DV1F 2G4BA 1P27B 2YPZA 4LSNA 5H9EJ 4PQAA 3D0IE 4B02A 4EWTA 1KQGB 2DY9A 4WFNQ 4DX5A 3OPKA 4OX6A 2KYXA 2KFYA 1UWAA 4IFYB 3BGUA 4DF8A 1KRPA 1KOOA 1IBCB 2K3IA 4B3RF 3CULA 3OVBA 2NPFA 1AUSL 1KP6A 2MKSA 5KFDA 1RBOB 2GFFA 4FF3A 1IXKA 3OTDA 2PD1A 1Q4RA 2J9CA 4EZ9A 3N01A 3AJ2A 1N4LA 1KVIA 4WXOA 2QA1A 1X4BA 4CO3A 5KFTA 3UE2A 4C7QA 4JYAJ 1NU4A 3DRSA 5ETQA 4EYHB 1VDHA 4J9KA 2HEKA 4DXLA 4QIEA 3TOQA 2R9LA 4M5GA 4I2QB 2XHCA 2F4VJ 3RAXA 1S6UA 1ELOA 4ZVQB 1RUSA 5DDOC 4WBFA 2HHUA 3U27A 1FRMA 1RKIA 1UETA 2HZCA 1UVNA 2EC2A 1S9EB 4J9OA 3J80U 3W2VB 4CQ1A 3UVJB 5KG6A 3EX7B 1FE4A 2KHDA 3FRZA 4PG7A 2DXFA 2QFIA 3ULHA 4OYMA 4X65F 5DM7Q 1YI2S 1YBTA 4JI4J 4DR5F 4HHHA 4P71A 5EDWA 3PKYA 3OL7A 1VBZA 5EWFA 2DR7A 1JLEA 2CQHA 4O4RA 4BC9A 8RUCA 3ZNUA 2MY7A 3PO4A 4U7UD 1L3UA 1LXJA 1HD0A 2QA4G 2V4QA 3KWMA 4QR2A 2RKIB 2JWNA 2M70A 3RBDA 1HBMB 2JC0A 4X66F 2AW0A 4DV7F 4ZCIA 4NE9C 4ZPTR 1WDTA 4PCQA 5KT4A 4J9NA 4R8UA 4CM0A 4CLZA 3OR1B 1OWXA 2OD6A 1HQ2A 1NMEB 2HVZA 1UA0A 3JSMB 3MEKA 1UVKA 3PIOQ 3JXOA 2P6TA 5J2QB 2MYFA 3C16A 1Z4UA 3B78A 1JIHA 3U7JA 1YDLA 3A8EA 3OV7A 4P74A 3I0RB 1N32J 4BS2A 3KG1A 2VJUA 3DOLA 2L9WA 3UDCA 4DQIA 3MF5A 1BWEA 2F3JA 5IOLA 2U1AA 5D4OA 2P9EA 3TUJC 4NCGA 1K0VA 3S8SA 1BQNB 3VAGA 2YQ1A 3QSYB 1S59A 2ZH9A 1SC1B 2MB0B 1KQFB 2KYZA 2DCUB 5HK4A 4UZBA 3PW5A 4ZITA 4PWDA 3TANA 2RDDA 3RW6A 4B3SJ 4MT1A 4K4VA 1MU2B 5J1EA 2RMLA 1VGYA 5IC6B 4V1Ak 2ZH7A 1W25A 2B5JA 4LFBF 3LUYA 5KFHA 1B70B 1N54B 1TKZA 2HGNA 5AE2A 4Y34A 1REVB 3MURP 2BRKA 5J2NA 2GNKA 2ASDA 1FRLA 1JLFA 2WSFC 2LA6A 2Q3PA 2YNFB 4DR6F 3V6DB 3VTIA 2E5LF 2ZJRQ 1FFSB 1T94A 5MAOA 3BZQA 1SXLA 3HF5A 3B6BA 4ED1A 3GU0A 3AB2B 3BEGB 4WP3A 3MEGA 5T7LA 1YBAA 3M1VA 4CI0B 3KJQB 3AXKA 1VQ9S 3T1HF 3J81Y 2GO9A 4OL8A 2ASYA 2EG2A 2RS8A 3HMJG 4WYWA 5FLXU 1HR0F 1HYSB 4KSEB 3WX8A 5CD4H 2Y1JA 3UI3A 2IAJB 2PC6A 5BXIA 5JMNA 1D1UA 1J27A 2XSJA 3K89A 3HULA 2A6OA 2RAQA 3MUVP 4DV2J 3R27A 3NBPB 3JS9A 3GSIA 3NOCA 2BQ3A 1SVDA 2DNOA 1QSLA 1D8ZA 4K4WA 5CZXA 3KHLA 1VCTA 5C25A 2G9OA 4N56A 3LOUA 5EWEA 5I3UB 3LP2A 1CJKB 5HANA 4DL6A 1GAOA 3FRYA 2MKJA 4ECZA 3ILIA 1S0NA 4YB6A 3TEGA 1N0VC 4I6WA 3MPWA 2GJIA 1OJ4A 1BC6A 2YKQA 4QPTA 2LQ9A 2GVDA 1CJTB 4FYYB 3HVRA 1DFDA 3DRRA 1YVFA 2DNRA 3F56A 3GG1A 3MD1A 3GB0A 3KK2B 1F2HA 1TKTB 2W9CA 3HZEA 5K20B 3OTBA 3CCUS 2ZH2A 2JEFA 3KXDA 2VQEF 1RT3A 4OZ2A 4P2FA 4USTA 4B9LA 4C11B 2VHGA 1S1VA 2B8QA 2DH8A 4OZ5A 2YNHA 5A8WB 4ECVA 1SBRA 4C2MA 4TXSA 5E3PA 3FZ2A 3GFHA 2D3O1 3BN4A 3M8RA 4LSLA 3MCSA 3DHXA 1G4CA 2ASJA 1XNQJ 2RS2A 1M5OC 4LBIA 1RT1B 1TTHB 2IC3B 4JI3F 2V69A 3G6ES 3KNGA 2V4RA 3SQOP 1HMVB 2CQIA 3HZGA 1Y10A 4LRAA 1K8AT 2BOPA 3RR7A 4YUDA 5IWAF 5KFUA 2G1DA 3NG8A 5IV4A 1Y00A 3CJSA 4ZJLA 2YQ3A 1NKBA 1YZ7A 1AA1B 1TZ0A 3IWNC 3H98A 4F4ZA 2HWTA 3T19A 4L3NA 1RYSA 3KG0A 2XB2D 4QIWD 1YZ6A 3V5RA 1X9WA 2W7PA 3P45B 4UZCA 4DCOB 3HJVA 4ZJOA 1YBUA 4BWJA 3W9HA 4QWEA 4OHYA 3FMBA 2NZCA 4ICLB 4MJKA 1IBLJ 5E3CA 1Q8KA 4ZP6A 4DL2A 2BJ7A 4RW6B 1R0AA 4RKUC 1U4BA 4TLRA 2J0XA 3MM5B 1HNIB 2MZQA 1E6YA 3CGIA 3FKBA 4CM2A 1NKCA 1OPIA 3BBFA 3H2VE 3EICA 3M8WA 4RW7A 2CQGA 1NRKA 1GTEA 2DEIA 2BV3A 3CTRA 1S1TA 2CPIA 1WORA 1PBAA 2MQNA 2HNYB 2VBZA 1S10A 2DD8S 1QVFR 4USMA 1XQIA 2W2QP 1VC6A 1VFJA 4I0WA 1LNQA 3T5HA 3BDPA 4GC6A 4PRFA 1BGXT 5D0EA 3V81B 3BS9A 2YQ0A 4ANDA 4ZK7M 2N82B 2VPYB 3CIMA 3FJ2A 3D6MB 4NLRA 4H4MB 3HPOA 3NGDA 1SV5A 1SJRA 5B7WA 3P4UB 1RT4B 4QQBA 4LF7F 5BYSA 4GRSA 2UZAA 2RT3A 3OVAA 4OZ1A 2KHCA 2NYIA 3UD4P 2JSXA 1MSWD 2HK2A 1CS4A 1FRIA 2GMLA 4DR1F 1C4CA 1RT5B 2EFGA 4ZLNA 2OELA 4I2PA 5HBMB 5AJ3J 2HRTA 4X62F 2RILA 3PRBA 4LF6J 1N56A 1S4FA 1PG5B 2I8EA 2V34A 3HD1A 4NRTA 1FTCA 3R6LB 1FJGJ 4V19X 1R3NA 4CTAB 2K7KA 2MZSA 3US5A 3J80Y 3P96A 1DHMA 2OHDA 4GMKA 2CJAA 5AXLA 4KRWA 4TNOA 4F04B 4KBIA 3IP0A 5I42B 3G4SS 3TWZA 1RWUA 4GC7A 2R7SA 2J7UA 1RTHA 3KK3B 1LWCA 3OFFA 3FSXA 4J9SA 2HHQA 3FBCA 4ERDA 3AB4B 4OYXA 1JJHA 1WOOA 4YOEA 2N7YA 4DSEA 5KFZA 2B4OA 4K4XA 2A2CA 4F2SA 4B3MJ 1MROA 4BLGA 4LSZB 2GV1A 4RNFA 1CVJA 2ASLA 2FHKA 1B99A 3GIKA 2BVZA 4DV3F 4P72A 2GS8A 3M6VA 4USWA 4A46A 1JLQB 1QVGR 1WWHA 5U47A 3HT3A 4J37A 2OTJS 3GCXP 1RU2A 1NHUA 5GMDA 4TN2A 4DPXA 5DJBA 5KFLA 2HRYA 2C1EB 1ZM9A 1TR0A 3JTNA 3TA1A 3B82A 2WONA 2MQMA 1TUWA 1JWWA 4WZQA 3EE3A 2DVIA 2DXEA 5BR8F 3QLHB 1H2TZ 4RJVA 4D3GA 1GXLA 1T9UA 1XR6A 1MWZA 3Q8UA 3MM7A 3G82B 1JJ2R 4DV5J 4OYAA 3PW0A 2PFFB 1X60A 2KKHA 3DNCA 3R3TA 1XN9A 2BR0A 3I32A 1WHVA 1CLFA 1JMTA 1XK8A 2VBYA 1S57A 1HQUB 5K8OA 3Q8YA 1PYSB 2XI2A 2YWWA 3P5TL 1HBUA 3TRGA 4X4SA 3RB6A 1PYTA 3CCWA 2NPIA 3IA0A 4ZOSA 2ZC3A 3GZ7A 2ZD1B 3BR9A 3JTOA 4UY8T 2CUYA 3ZTRA 3ET6B 2HFUA 4HH0A 1WI8A 4RW8A 1JNZB 4NCBA 4TY9A 1T03B 3GE9A 2D41A 1KVKA 4S0MA 2C3MA 4CLSA 1DBDA 1TFWA 1VC5A 2YKNA 3QSIA 2B9WA 6FD1A 4OHVA 2KG1A 4AE5A 2Q6BA 4NI2A 4HKQA 3TJ9A 2VFRA 1QAIA 1WKJA 3M9MB 2LEBA 1LQ9A 2Y3YA 1B64A 2AWZA 4ECXA 3X3UA 3DU5A 3SXLA 4ZVEA 2G2ZA 3DLEA 1FKOB 4Z7YA 2N4DA 3KJVB 4MKBA 4DL5A 4RU2A 5A6WA 1ZM2A 2ZZTA 1UKUA 4DX7A 1S6QA 4DQQA 5J2MA 2HGLA 3TZYA 3CJRA 1QUVA 3M8YA 2HS4A 4X4TA 1HNVA 2G0CA 4HHJA 4QPXA 2MKCA 4F26A 4ZCKA 2IMOA 4X64F 3MR7A 4HLBA 1FD2A 3BPDA 4PKDB 4IG0A 5GMKa 3QZ7A 1NO8A 1RBAA 3ENQA 4FNIA 1FRHA 4ED8A 1DTQA 2CPEA 1LWEA 1SQEA 2RRNA 3IR6B 2BYCA 3SCKE 1M5PC 4A48A 4AL6A 3LA0A 4QR0A 1TL4A 4OV1A 2PEHA 1Y5NB 4LMZA 3BF4A 3BBBA 2RQ4A 3IWXA 4O4GB 3FBEA 2YWGA 4ETZA 1DAXA 1FKAF 4ITSA 3OFEA 1RACB 1IN0A 2HAIA 1Q78A 4LBPA 1RSCA 3FEZA 3IRWP 1UVJA 2XBPA 1Q16B 1R6VA 3SBMA 4JI0J 1KR4A 2HKEA 2NYHA 1J5OA 2DH9A 3UN3A 2I0XA 2E5IA 2DHAA 2WVBA 2XYHB 4NLQA 1JXVA 4YDDB 5J1NA 3KLEB 3D68A 1BMQB 3OW2R 2BE2A 3I56S 5KFQA 1NPKA 1KQSR 2UU9J 1NSPA 1GMWA 2AZ3A 1VBXA 4XPEA 3NMAA 4EYIB 2E1AA 3FK4A 5EGYA 1VISA 4CLTA 3KJNB 2YH0A 5FDLB 1CJVA 2O01C 3ELHA 2H54B 4JI7J 2RSQA 3M30A 3MPUB 2XLKA 2NR0A 1VQMS 4DR2J 3TVYA 1VJWA 2K1RA 5DZ6A 5G0RA 2PGCA 1VRUA 5KG0A 2UXBF 4DBQA 3V6KA 2RIJA 1VQ5S 4LRDA 1RHJB 1VLOA 3OFHA 4F3MA 3SV4A 2FJXA 1RLDA 1OS5A 2FIUA 4GKJJ 3KDOA 4F50A 3IN5A 4QU6A 1FKPB 2ALYB 3ETOA 4JOUA 2QE5A 5KFGA 3NNAA 4A8SA 2EI5A 3EXYA 1FCAA 3JYTA 4GO7X 2KM8C 4NLDA 4DUTA 3G6YA 4KHMA 2YY3A 4R25A 4LR9A 5IC4B 1YKWA 5SZTA 3BSNA 4I1TA 1SUQA 1RZMA 5ITHA 3BJYA 2ROGA 2MHEA 4Y0FA 1F3VA 1HPZB 1Q8LA 1TKDA 3QT5A 2B9XA 5A8RA 1N52B 3N6NA 5KFAA 3BPSP 2FJDB 4OZ0A 4K7QA 1IKXB 3PEJA 2VG6B 5L1LA 1H7WA 3MECA 2Z58B 4NLUA 1ZBTA 4KHPJ 1RTJB 3PRVA 1TL3B 1QLNA 4R8UB 4OJ1A 4CO0A 1X0FA 4UOFA 2IM3A 2LVWA 3FBBA 1RTZA 4O3NA 1N34J 2VDIA 4ILMA 3HSJA 3QIPB 3I82A 3MD3A 2A2DA 4KO0A 2AT1B 1VIXA 4FYXB 1HLWA 2IDLA 3M4XA 1M0SA 1UFLA 1KHWA 2HURA 4P2MA 2ZKTA 4WTOB 2E7WA 4ANEA 4C8OA 3OL8A 5EWGA 1UVMA 4ZCMA 2ZUGA 3QGPA 1Y11A 4ED7A 4K4SA 1W7WA 3N0VA 1YSJA 3BGFA 4ZP8A 1VRTA 4YFUA 1KTVA 2R42A 2CVEA 2FB0A 4IFVB 2V2QA 4LR7A 1BLUA 2AX1A 2JDJA 2V9WA 1FE0A 4M5JA 1S0MA 2QJ3A 1AFIA 1VQNS 2VB6A 3I87A 3DDKA 3LWMA 1FESA 1XMOJ 3I4PA 4TYBA 4WPAA 4KTQA 3KDNA 3KNAA 4K0KF 2MKIA 4X4VA 5CCLA 2KZMA 5FD1A 1XNRJ 2MQ8A 1OYDA 1WEZA 2DIUA 1S1WA 1U0HA 1TKZB 3P49B 1BY9A 1WELA 1JQGA 1GMVA 5E3AA 4CNZA 5D78A 4N41A 3Q86A 1IR2A 1VOMA 4FYWB 2RUGA 4QWCA 3NCQA 4BBYA 3R7NB 1H6KX 2J9EA 1U49A 3R5CA 3EPGA 4L73A 1TAQA 4DPOA 1H74A 5J2PB 2KT3A 3HHKA 3MGJA 2E9ZA 2YPYA 2QLFB 2W2NP 1HQEB 2DRBA 5AE3A 3AH6A 2UVRA 5T7LB 3RBXA 1NB2A 4NEYA 3CSKA 3C3LA 3CT9A 1CEZA 1D0EA 2O67A 4UUWA 2H3EB 2HW3A 2HK3A 5EX0A 1NK0A 4HI2A 5K8MA 1S12A 2F1FA 3AT1B 4DSFA 3P3DA 3W2WA 2CFXA 3GFYA 2ALZA 2V8DA 1RGVA 1SJ1A 1TV6A 1X31C 5KFKA 5E7OB 4QIFA 1SKUB 4MFBA 1EKRA 1HBNB 1S77D 4OHXA 4DOZA 3PVXA 1M90T 4JV0A 3D9BA 2MDAA 3GYNA 3M6WA 2X51A 1IQZA 4J9LA 4PUOB 1RDRA 2MJUA 2VPWB 4G1IA 3T6BA 2LDYA 2OI2A 2AGPA 1WKKA 4ECRA 3LWLA 1SKWA 4LUBA 5CQGA 2DGQA 1RT7B 3RRGA 4NMXA 2HQCA 4LQ9A 2BW2A 2RRBA 3UWTA 2CQDA 2VONA 4PPZA 2YH1A 2B3TB 4ECWA 4KV8B 1ZAWA 1Y9OA 4DUZF 2RQKA 4UT4A 2EW9A 1C0UA 1HI8A 3TI0A 4URQU 2IVFB 4F25A 3JTPA 4DV0F 3K58A 2ZBIA 2WB1D 2N7CA 2H65B 5HMXA 3RAMA 2MGZA 2JZ5A 2M5YA 4OLPA 4H4OB 1V3SA 5SUHA 2V67A 2UXCJ 4YR3A 4ZLJA 3ZZPA 2VG5A 3Q23A 2FHJA 1AB8A 4LSLB 3BO4A 3OD2A 2W2PP 1NCLA 1EP4B 3UN5A 3MMBA 4DX6A 2DXDA 3I96A 2BX6A 5ETPA 3IBCB 4ECSA 3HVTB 2D9OA 4OI4A 4P2XA 3MZIA 5T14A 1L5UA 3CVKA 3W5ZA 2DNKA 1Y0HA 1EIYB 2EFNA 2XZTB 3MM8A 1KBRA 4GKKF 2K8GA 2HZAA 3RBEA 2J7WA 2OPRA 2F5GA 2CPXA 1I6JA 4DQPA 4ZLPA 5B0CA 1NK5A 1OY6A 3ZZUA 3MUMP 2ZWPA 2KDOA 1TUGB 2D3OR 2M9KA 2I9SA 2R7RA 6AT1B 2QEXS 1HI0P 5GADU 1N33F 1TP7A 2FLPA 4K59A 3VVTA 3BGRA 1VJQA 3BSCA 3IS9A 4LFAJ 3OTOJ 2VL1A 3RG6A 2CYYA 2BUNA 1N6QB 1N8RT 4NA2A 4ECYA 2E1PA 3DI6A 1ZTTA 3TA0A 3GJSB 3ZZOA 4DFMA 4WCEQ 2BEFA 5HVFA 5IS2A 2BMBA 4F4WA 2DK2A 4BHQA 3TUZC 2JEJA 1QE1B 3GTYX 1U25A 2PMWA 3QT7A 3TAPA 4RW7B 3T9ZA 1TMMA 4AL7A 1C0TA 4ID5A 3H4BA 3W3SA 4RR5A 3BQ1A 2LP4A 4M5LA 1PJ6A 1F9HA 4KKOA 2OP5A 1D9AA 3OUYA 3EYZA 2J7KA 3PX0A 1UEKA 3DGPA 3TJ8A 2FZCB 2MEWA 3TNVA 1VQ8S 3CC4S 4B9SA 4LF4J 2W2MP 2ATCB 3UQSA 1KTQA 5KFYA 1I5OB 4LFCJ 3G8TA 3ENWA 3ITHA 2KG0A 2QYGA 1HNZF 2X1FA 4F4XA 1RT2B 5DZ7A 1OMSA 2YKOA 1WC1A 1J5EJ 1SC4B 3MCOA 4P7VA 5RUBA 2J0SD 1RQ0A 4I2PB 4CP5A 4NXNJ 1REGX 5KT2A 2MQPA 2JHEA 1GTHA 1NAQA 4W92B 4EMDA 3UCGA 2J0WA 1CC7A 3D66A 2W2OP 4A8MP 4OIXA 2EBGA 4IDKA 5D4LA 3RW7A 2G1HA 3OJUA 4M94A 5LMNF 4EI2A 1ZA2B 4ALZA 2J6SA 2XHWA 3MM9A 3JAMU 1ZTWA 4J9VA 3PIPQ 4WU2A 2A6MA 3MMCA 2E1RA 3RUBL 3AA9A 3IGVA 2OSRA 1VI7A 3MPDA 1H3DA 1JLBA 5DG7A 1FA0A 2VASA 2QL9B 4Q45A 1SH3A 3PX4A 3HVAA 4YS2A 3BKFA 1F2GA 4BC7A 3D1OA 1K1SA 2VA2A 1Q5VA 3MEDB 5ETLA 2P5VA 3GIIA 3DM2A 2ZH5A 1SJ3P 3T9NA 1F9EB 3IXQA 1TL1B 2XMAA 3KUEA 2BJ9A 4CO1A 1IBMF 5B0GA 1JXEA 4TU7A 3G2XA 2CNLB 3WHIA 5F41A 5DO2A 1PO6A 3WX4A 4XIUA 5IQQA 2HBZB 1S0OA 3KJFB 2CNKB 4JV5J 4EGLA 3DYAB 4K4YA 3CJ4A 1U0SA 2WCXA 2X7IA 1LEOA 3SQGB 3QPIA 2K2PA 4DSKA 2FJWA 4XK8C 2AJFE 2B51A 3I0SA 1K0TA 2VH7A 3BKTA 2R2RA 1FWLA 4HI1A 3GJRB 3K59A 1U1MA 4ZDNA 4ZVRB 2FLOA 2IRYA 1JLGB 1YK9A 3ILLA 3VQSA 2I5JB 2A18A 2JVOA 3CDUA 3ZZYA 3R2CJ 3HSGA 3W9IA 3QFWA 4YY3F 3OBIA 1V3ZA 5HJXA 4YB7A 2W9BB 3Q2TC 1F6TA 1S76D 3QGIA 3E51A 4RWWA 5GAGU 3TZXA 4MK7A 9ATCB 1FXRA 3UDEA 4E8UA 3N4WA 2M8HA 2CQ3A 4K8RA 3HFKA 4LRFA 2HHHJ 4CNYA 1C1BB 1RCOB 2GMHA 5A0YB 2BE7D 2OKQA 5DGBA 4XAKA 1FVQA 3TO8A 1H2UX 1EETB 4F36A 2M0GB 3J7A1 3HFVA 2HFNA 1UW9A 1URRA 4EBDA 1L3TA 2XS2A 3GLJA 2AJ2A 4LF8F 1R7IA 4TQRA 5KFEA 4PG8A 1TFYA 1EAYC 4MK9A 4C9DA 4ZPBA 1R43A 1RT6A 3NGKA 4FF2A 1R8HA 3MUTP 1JKHA 4C8KA 4OQJA 4L74A 3ISNC 1XR5A 3NCPA 1SI9A 3HM9A 3M8PA 4DQRA 4C3KA 2GC8A 2ZH6A 3AOBA 3IO1A 4NLXA 5CYMB 2KRRA 3MHYA 4U67Q 1TKXB 1KLMA 1LFPA 2V9KA 5IM0B 2BKNA 4DL0C 2DNQA 4NA1A 1HWUA 3M05A 4F4YA 2Y8YA 4F3QA 3CJ0A 3C14B 2YX4A 3U1LA 5A8KB 5IT0A 2V8PA 5E3QA 3IFEA 4ZVUB 4IG0B 1SL0A 2IA0A 5L8RC 1RAAB 2V6AA 4ED6A 4KGKA 4CH7A 1YG0A 1GMWD 3QWPA 3FCHA 1DTQB 4F0HA 4ZHRA 1LWEB 4DEZA 2W8LA 5KT3A 4KJIA 2R7UA 5DG9A 1JX4A 2L08A 1WHXA 4MIAA 2ZM6J 1U1RA 2AU0A 1C4AA 1L3VA 4WP9A 5D8HB 4PQUB 4M8LA 3PHEA 1QSYA 1KDNA 2EVZA 1RADB 2V63A 2Z2LA 2OPQA 3I55S 1NZ8A 3T5LA 8AT1B 5F8LA 4TY8B 3U1MA 3BM7A 4N77A 2DGXA 1HNXF 2IYIA 4WIIA 4F7VA 2HVIA 3UNYA 1IKWA 3H25A 4V19J 3C15A 3OL6A 5HQMA 2OLWA 1U48A 1NJXA 5LOQA 1AFJA 2DGOA 2HNZA 3T3FA 2LU2A 3RGIA 5H9FK 4FNHA 1FX2A 5A6PA 3UPFA 4A4JA 3CW2C 1FRKA 2B7CB 1QUPA 3SZ2A 1Q5YA 1D09B 2PEBA 2W4DA 3DMJA 3HX9A 3KLFA 1WHYA 1QDUB 4DFKA 1Z2LA 3RB3A 4Q0BA 4KFBA 1DQ9A 3Q83A 5F0WA 2EFVA 2W7OA 1CQMA 1WDDA 4JUZA 3PRDA 2HHTA 3D7SB 2FHMA 3MMAB 2IJFA 4RNMA 2AD9A 1YQHA 3MEEA 4MIWA 3O6QA 5KFVA 1TMJA 2IDEA 2KVIA 3DLKB 4M5DB 1W2BR 1YWXA 1K47A 3K8VA 1FF2A 3IBFB 2F8EX 1RA7A 1N5QA 4DLEA 4XTTA 1LW0A 3OT9A 4LF5F 4EO8A 3S01A 1NH7A 1KONA 4QWAA 2M8DB 2AYGA 5GVQA 3CCRS 2V50A 3PG9A 1F9FA 2XMWA 2C22A 3MAAA 4IO1A 2YWKA 7AT1B 5L39A 1V5VA 3NGRA 4A8WA 3N79A 2AJ0A 4B3OA 3HHLC 4AYBD 2JLEA 3PHTA 2QYCA 1XEZA 2OH2A 4CYUA 2RF2A 3M2UA 1I94F 1IKYB 4ZVGA 5ETTA 1UJ4A 4H4KC 3BQ0A 2XMJA 3TUIC 3AJDA 3MR6A 1NDCA 4MKYA 1ZZNA 3D67A 1HFEL 2DRAA 4CLUA 2DH7A 4NMLA 1YRXA 1RHQB 4I56A 1G3OA 1VC0A 1X9MA 4IR1A 2CJQA 3WQPA 1JLCB 1S1XB 2GVZA 3KK1B 4KGZB 2ZUAA 3EUNA 1FVSA 5BYRA 2UVVA 2FZKB 4M5MA 4Y65A 1AROP 2FVCA 4N8NA 1WF2A 1G6BA 1ZPWX 3DDNA 3DOMB 4USUA 1MMLA 5F8GA 3HHLA 3N5FA 3OR2A 4NZ0A 2V94A 2MQOA 1CULB 2FVRA 2YKMA 3C6TB 2P8IA 4DJBA 2LQ8A 5CXTA 1V6HA 4HACB 4DG1A 4YDXA 4H4KA 4YQWA 5KFPA 3S7RA 1SKSA 2Z0GA 4PWUA 3OL9A 1G1XA 3OXGA 4RBUA 3JB9k 3V4IA 1HNWJ 1VYAA 3WC0A 4KYZA 2QMUB 5F8JA 3H5YA 1Q7YT 1HW9A 1E6VB 3I9ZA 2ZOFA 2IY5B 5KFXA 1RHMB 3EVWA 3FC9A 2CJYB 1KFSA 4YR2A 4M5IA 2BZ2A 3GCWP 1PAEX 2QL7B 1ZAVA 1HBOB 2HNDB 3FBFA 3TZWA 2DB1A 2GCFA 2W01A 3R5AA 1J2VA 3DLGB 1BUXA 2EC0A 2KU7A 5C2GA 1U1KA 2MHNA 3JAMY 3KLHB 2YX7A 1T05A 3IR7B 5B0DA 1HHTP 4ZVFA 3M8QA 1YJTA 2KVQE 4NCAA 1H72C 3NMRA 2QT7A 3ZTSA 3CD6S 4N47A 1IWAA 2I6WA 4PYDA 2V8VA 2XYGB 3MTJA 1O5JA 2BBEA 2LLZA 1WC5A 4FF1A 3NLCA 4O3PA 3CJTA 2C42A 1WSRA 1RTDA 4ER8A 2GGPA 1XIQA 2MLZA 1Z2ZA 1TL5A 1IKVB 5CAAA 3LALA 2WOMA 4RNNA 1RK8A 5HVHA 3D5MA 4LT6A 4G1QB 2CVIA 3MDFA 2BW7A 2HMIA 5HROB 1T02A 2OPSA 2AEMA 2XQCA 2ZITA 2FC8A 3AJ1A 2RJZA 2H5JB 4ANCA 1IVZA 5J1PA 3HT0A 3LP0B 1Z1ZA 2FHJD 3MM6A 1GXTA 5KFMA 4I6AA 4WFBQ 2HQFA 5IV3A 1LK5A 3NRBA 2ZBRA 5D4NA 4E2FB 2UUBF 2CPJA 3PYFA 2FLNA 3RBZA 2LKZA 4JI5J 3ZC4A 2ZDPA 5IT9U 1EZZB 2NXJA 2R3VA 2KO1A 4DR7J 1KEKA 1P6TA 5B0AA 4R5PA 3D6HB 2HFZA 1UFWA 2GA7A 2GMJA 2UXDF 4JI8J 3Q8PB 4LF9J 3H5UA 4ED0A 4F2RA 4B9UA 2GHVC 1GK8A 3SYZA 3FSIA 1UWBA 1NM2A 3A8JA 1QY7A 1TL7B 2ZNZA 3HHDA 1G7CB 4OX8A 3IG1A 3BYPA 2G0IA 1SJ4P 2CNNB 1X5PA 2CZ9A 1U24A 2BANA 4LREA 1U6BA 3J81j 3DXSX 1NSAA 5JVGQ 3BH6B 2Z30B 2V8GA 1GT8A 3MWBA 1BQMA 3HDSA 2VODA 4DPTA 5M2UA 2WTFA 2KN4A 5D3GB 4PG5A 4JI2J 3C66A 3KKFA 5CCMA 2B43A 5C42B 5HI7A 5L1IA 2WB4A 3KMSA 2UVWA 3TX0A 4DI6A 2XCAA 5H9FJ 4NLPA 3TARA 1NDKA 1N36J 3MM8B 4MAKA 4CO2A 3NP5A 3W1YC 1C1CB 1JJ4A 1SQFA 4U96A 4R0JA 4IQXA 1MG7A 1FJCA 2ACYA 3GV7B 1RU1A 4YB1P 4YHHF 5HLFA 1NK6A 3AXMA 1IBKF 2R7OA 2GQCA 3M2VB 2G2YA 3QO9B 2HWIA 1NJWA 3GFZA 2W8KA 2EFQA 4I2QA 1YJ9S 2PO4A 2HLTA 4FN5A 1T0TV 3OFGA 4KB7A 4J9QA 3C8YA 1S9GB 4QIVA 3PW2A 1RAEB 3M2RB 5KFBA 3LGNA 4FF4A 1WEXA 4J7CA 3VHQA 4ZS6A 2CQBA 3OJSA 2B6AB 4TKTA 2W24A 3M6UA 4QW8A 2AJQA 3PKMA 1APSA 4B3TF 1XR7A 5LMUF 2ADCA 4QYZK 4UW2A 3W2VA 1A7GE 3UVJA 2HS0A 5LXRA 2LA4A 4EBCA 4RW9B 2MZ1A 3CMQA 1NUEA 3T1AA 2ZH3A 2YX1A 3MPYA 3I31A 2WSCC 2XEXA 5DQHA 1UTAA 1BHNA 3LPEA 2ABYA 2VQFF 2CQ1A 4DCPB 1BQXA 4DDFA 3G71S 4RUCA 1X5TA 3SCLE 3MAQA 4PXCA 4DL4A 4DU7A 2KJVA 4G65A 2DNPA 2KRBA 3OLBA 2RKIA 2LU1A 3NS7B 1M1HA 3Q8VA 3UR3C 4DX8H 4F0MA 3KFWX 1HBMA 2QLXA 3KLGA 3BYRA 4UOGA 4Y2CA 1OY8A 2IHR1 2IJNA 3K57A 2CPYA 2Y0SD 1SL1A 3AD9C 4ZIVA 4JI1J 2V4JB 5D4PA 4LF2A 2HBYB 2JLFA 4X4UA 2AHOB 4HT5A 3GV5B 5C24B 2Z2YB 4HVZA 3JQJA 1RWKB 1AZSB 5J2QA 3R1LA 1OPZA 2KB2A 3H7HB 4LQ3A 2DO4A 4DUYJ 4X4NA 3RRHA 4DSIA 1AW0A 3I0RA 2JFKA 1DTTB 2U2FA 3QQCD 5CZVA 3F41A 4WE1B 3KTQA 1PC4A 1XMQF 3VZIA 2ZDOA 3MMCB 4FXDA 2AJ4A 2Z57B 2X1AA 1BE4A 3IM8A 3BDEA 4OV6A 1BQNA 2KFZA 4RX6A 3KOAA 1IUJA 1KFDA 1GXUA 2JC1A 4IO9Q 4YMEA 1HD1A 5ETOA 4OFZA 4LIWA 1UW4A 2FVSA 4IRCA 2FY1A 4DR3F 3ZZ0A 5CHCB 1MU2A 1P9YA 2CZ4A 2JRSA 3H5SA 2B4VA 1YIJS 2IM1A 1T11A 2DT9A 4K4UA 4DHVA 3I5AA 2F8HA 1REVA 3R9LA 5KFIA 3EJMA 1K1QA 3DCAA 3PYEA 1X4HA 2POKA 2HHWA 4X4QA 4P2SA 4ZN1A 4OX7A 2CPZA 2W9AA 1U26A 2YNFA 4YEAA 2WW4A 3MR3A 3R2DJ 2KT2A 3V6DA 1FTRA 3AODA 2C3PA 2V2ZA 1NZAA 4FS2A 2IBOA 1FK9B 3D3BJ 3L3CA 1OY9A 2OFHX 3L9ZA 4L75A 2MPUA 5CA5A 3CJQA 4QIGA 2XO6A 2MQLA 2MKYA 2YXLA 4DR4F 1D3WA 5IFMA 2UUCJ 3OTEA 3SDEA 4XPCA 1HYSA 3BBCA 4JI6F 3VGSA 1NHVA 3I4HX 4OYWA 2IAJA 1KQKA 4OX9J 3K5PA 1QTNB 3CXCR 1EB0A 5HN0A 2QG9B 4ZVTB 1LFWA 3TAQA 3A8KA 5A2QU 2XG8A 3NBPA 2OTLS 1IQTA 5LSOA 1RTIB 1Q82T 2DNLA 3K17A 4B08A 4K4ZA 1UEUA 1D9DA 5I3UA 4RBTA 4FBTA 5AXNA 1CJKA 1S79A 4DL7A 4DWIA 1HWLA 2APOA 3IRXB 3WIUA 3OSNA 3KMQA 1S6PB 5IT4A 1TU0B 2HQIA 1DY3A 1TELA 3D4JA 4NXMJ 3VAIA 3ISND 2ZBPA 1RYRA 3ZZRA 4NLOA 3POTB 4RNHA 4O23A 4ED4A 1X9SA 4I7FB 1RISA 4MKVA 4OJHA 1T7PA 3EVOA 1CJTA 3HK2A 2OJ3A 1VQPS 2WW8A 1XERA 4DV6F 2WVDA 3T1YF 3MCNA 2MJNA 4DSJA 2V2KA 3KK2A 2OEKA 3QRQA 2FJEB 4OYPA 1XTZA 1U1LA 2RH3A 3RB4A 3VAHA 5M2PA 2L9NA 4NYZA 3W60A 4C11A 1KLMB 4AQYF 4RU9A 2GIRA 4I4BA 5A8WA 2QGFB 1F5AA 4DV4F 2M4MA 1EKSA 3IBWA 2ADBA 1X5SA 1RT1A 3GIRA 5KG4A 4ED3A 2IC3A 4WK3A 3GONA 5DS7A 2DHXA 3BGLA 1HMVA 3GFXA 2IMWP 2UUAJ 2YNIA 2CJKA 2HPUA 5THWA 3FZBA 1IM6A 3ZTOA 2NZ4A 1PCAA 1QTMA 2VG7A 1S7IA 4A8OA 2CJXB 3CC7S 4DV1J 1OO0B 2R8HA 1UVIA 4IKAA 2C2OB 2JEIA 4QZVB 3CCZA 1S5ZA 4F4AA 1SKRA 1SJQA 1T95A 2AV5A 3CDEA 5KFJA 4B3RJ 5EX3A 2GIFA 3I9V9 2DNMA 1KSPA 1IKWB 4DFJA 3CO9A 4FXWA 1FNXH 3MCMA 4K50A 2ROPA 4IRDA 1VQSA 5JVHQ 4YB5A 1R8AA 4RW6A 3EDRB 3DOKB 3MM5A 1HNIA 2I1RA 1SJFA 1UAWA 4JYAF 3Q24A 2MZTA 4QYZJ 3CD7A 1GX5A 2EK6A 4IUFA 3HFZB 1P1TA 5CYJA 3D0GE 1B0TA 3KG4A 4J9RA 1ZH5A 2F4VF 1TVRA 2HNYA 3CD0A 2CWKA 5C7PA 1XBWA 2ACMA 2BOAA 3I5CA 3VAMA 2UP1A 1N5YB 3FNNA 1BXNA 1FWKA 1F5CA 1VQYA 1RHUB 3NAHA 3CCES 4ZPWR 3V81A 1M5KC 1TUVA 1LWFA 2YWEA 2LXUA 5CYQB 3VALA 4H4MA 3QATA 2NREA 3THVA 1FT8A 4B9NA 3A8IA 1RT4A 2IPOB 4X65J 4IG3B 3HHLD 2HQGA 5KFCA 1SC6A 2PE8A 3I5BA 4DR5J 4Q8EA 4JI4F 2JH3A 1GEHA 1SC3B 3CUNA 1KS2A 2EPIA 3QT6A 5HVGA 1HA1A 2XSFA 3TAMB 4R0EA 4YN3B 5D6GA 2BXJA 1RT5A 4URSA 5HP1B 4PWWA 5HBMA 1F60B 2KXFA 3J7YI 2RF2B 3ILOA 3M2UB 1WC6A 4J5OA 2E9TA 2ZBCA 3HSZA 1XC9A 1OYEA 3T5JA 3Q8QB 4X66J 3PZPA 4DV7J 2J6TA 4CTAA 3A3PB 1WUUA 4HHUA 1RAIB 1WC4A 1FRJA 1SPBP 3TQ1A 3DN9A 2PI5A 2KFNA 3FVYA 4ZCLA 5LM7E 2F63A 3CJ3A 3E8OA 1FD8A 5I42A 3W64A 1U8WA 4O3RA 5JJBA 3NOGA 3KK3A 1S7HA 5L9NA 3J7YU 3VV2B 2H4WB 5KFSA 1DLOB 2VBXA 1KVJA 3AHPA 2YWFA 2PIIA 2QSWA 1B0VA 1N32F 2D3ZA 3NGTA 2QN6B 5I4MA 4O0NA 1RAGB 3QMQA 1YJRA 1N48A 1PILA 4OZ3A 3V4IB 2ZWOA 3QJPA 4Q5VA 4MIBA 4CO5A 2P9GA 3N28A 4EU0A 3G86A 4KY3A 4Y3CA 3EGWB 1JLQA 2R8IA 4BDPA 3PJXA 4X4OA 2CJBA 4X84A 1SIWB 2JNJA 3G96A 5KT7A 1WOSA 4B3SF 2RB7A 1O6XA 4LFBJ 2R8JA 3A13A 2QZ8A 2H9ZA 3KHHA 2ZE2B 4X2BA 4NLYA 3DLJA 2G0JA 2DGVA 2R7TA 1UPPA 5HL7Q 3FUYA 2GAGC 4AUKA 3M8QB 3IAM9 4ECQA 1VQ7S 1X4AA 3QLHA 4DR6J 5KG3A 4EBEA 2E5LJ 3G82A 1RBLA 3D1QA 4KGVB 3HO1A 3C19A
chains in the Genus database with same CATH topology
4ED1A 3VQSA 2I5JB 2J6UA 1U1QA 2A18A 2JVOA 3CDUA 3ZZYA 3AB2B 3BEGB 5AXMA 2XC9A 4ELTA 4YY3F 3FEXB 3OBIA 3MEGA 3GG0A 3LPYA 1V3ZA 5T7LA 1YBAA 2L3MA 1HQUA 3M1VA 1IKVA 4HTJA 4YB7A 3Q8RB 4CI0B 2W9BB 5KOWA 3Q2TC 4OLOA 4F3OA 1S76D 3QGIA 3E51A 4C8MA 1VQ9S 4RWWA 3T1HF 5GAGU 4G1QA 4KR0B 2MMYA 2XI3A 2DTJA 2GGPB 2GO9A 4MK7A 3J81Y 3OHAA 2HHPA 4OL8A 2D9PA 3LANA 4KC5A 2E9RX 1FXRA 2DIVA 4AFFA 5HROA 3HHEA 2Q6CA 4NLWA 2ASYA 2EG2A 2RS8A 3QGGA 5LSLA 1NJZA 2W4PA 2E7XA 3HMJG 2C28A 4WYWA 4RW4A 2ZD1A 5F3TA 4E8UA 4AL5A 1DURA 3N4WA 1HR0F 3MXHP 1R8BA 2M8HA 1HYSB 4KSEB 2CQ3A 3HFKA 5CD4H 3J7ZT 3CCTA 2C3OA 2Y1JA 4BWMA 4CNYA 3CE8A 4PXDA 3UI3A 2IAJB 1HWKA 2PC6A 2HHHF 1D1UA 1C1BB 3PACA 4NLGA 2GMHA 1T03A 2XSJA 5A0YB 2GO8A 2VOOA 2YVSA 3V2UC 1H38A 2OKQA 3LP1B 5DGBA 3MUVP 4XAKA 1FVQA 3TO8A 4DFPA 3KHGA 1H2UX 1EETB 2ZFHA 5K8NA 2M0GB 3R27A 1C2PA 3NBPB 5KG5A 3J7A1 3W2WB 2ZZMA 4DV2F 4NX9A 2HFNA 1S72S 1KOHA 3LP0A 2L48A 2BQ3A 1L3SA 1TK8A 2GQQA 2HQ3A 2DNOA 1URRA 2VD3A 4EBDA 1QSLA 1L3TA 1D8ZA 2XS2A 4K4WA 1TV6B 3DLLQ 5CZXA 4F8RA 3KHLA 5C25A 2G9OA 4N56A 5DETA 3LOUA 4OI1A 2IYGA 2R4FA 5T41A 5EWEA 5I3UB 2AYEA 3HLUA 2BDPA 4LF8F 1FXDA 5F0UA 2ZOGA 1R7IA 4MFBB 3GSDA 3LP2A 5KFEA 4TQRA 2V0NA 1KN6A 1U1OA 4EZ6A 4PG8A 4DL6A 1GAOA 1TFYA 2EFPA 3FRYA 4NZ7A 3ENVA 3B8HA 4MK9A 4C9DA 3GMGA 1R43A 1RT6A 4ZPBA 2MKJA 4ECZA 2XZWA 1FKOA 2XGQA 3NGKA 3KJVA 3LH2S 3QGHA 1FDNA 2IM2A 4FF2A 5DQGA 1R8HA 3MUTP 2WAQD 1JKHA 2JEGA 4C8KA 3CC2S 4YB6A 1S0NA 2DPIA 1N0VC 4RUHA 3K5MA 4I6WA 3MPWA 2W7AA 4OQJA 4O3OA 2GJIA 3ISNC 1XR5A 1S1UB 2ZJPQ 3NCPA 2CQCA 1TAUA 4CH0S 1SI9A 5KFRA 1BC6A 2YKQA 4O3QA 2ZH8A 2QA4S 1UVLA 3HM9A 4QPTA 3M8PA 4DQRA 2QRRA 2YNGB 4C3KA 2GC8A 3J7Z5 3PV8A 2LQ9A 4QW9A 1FXLA 1R8PA 2RDIA 4QBUA 4QU7A 3RRKA 5ADZA 3HVRA 3IAS9 1DFDA 5KFNA 2ZH6A 3DRRA 3IO1A 4X4PA 1YVFA 4NLXA 2DNRA 3F56A 3GG1A 5CYMB 2RQCA 3MD1A 4C8YA 2KRRA 3L95X 3MHYA 3GB0A 3UW1A 2XCPA 3KK2B 4U67Q 4H54A 1TKTB 2W9CA 3HZEA 1TKXB 1KLMA 1LFPA 1K73T 4UY85 5FLXY 2V9KA 1T3NA 5IM0B 5KFOA 3NAIA 4DL0C 2DNQA 3OTBA 5A2QY 3CCUS 4J9MA 2ZH2A 3U1NA 1S97A 1X4FA 3CDBA 2JEFA 4NA1A 2V5HG 1HWUA 4OZJA 3PX6A 2MSTA 3M05A 2HS3A 4F3QA 4F4YA 3CJ0A 2HIQA 3B4MA 1RT3A 3CMAS 2VQEF 2YX4A 3U1LA 4B9LA 5A8KB 5IT0A 3KYLA 4C11B 3DRPB 5E3QA 3TW0A 1S1VA 4B17A 4N5SA 3P6YC 1C0UB 3IFEA 2DH8A 4OZ5A 2YNHA 2EG1A 5A8WB 4ECVA 1FDDA 4IG0B 1SL0A 2IA0A 1SBRA 5L8RC 1JNRB 4C2MA 4TXSA 5HQ8A 2VPXB 5E3PA 3FZ2A 3GFHA 4ED6A 4KGKA 4CH7A 3BN4A 3M8RA 2CIMA 1YG0A 4LSLA 3FEYB 3MCSA 3F73A 1VMBA 3DHXA 3QWPA 2R2UA 5D3GA 4OI6A 3FCHA 5KG1A 1DTQB 2MZRA 4PXEA 1NK4A 2ASJA 2RS2A 1M5OC 4ZHRA 1XNQF 1LWEB 1RT1B 3D1HA 3QAUA 5FIIA 5C42A 4DEZA 2MGZB 5KT3A 2W8LA 4KJIA 2E1CA 2IC3B 4C0BA 4JI3F 1JLAB 2R7UA 2FHOB 2VG5B 5DG9A 1JX4A 1HL6A 2L08A 4O4GA 1WHXA 1PC5A 2ZNYA 4MIAA 4WFYA 4FS1A 3G6ES 1GH8A 2F9DA 3KNGA 2V4RA 2ZM6F 3AQPA 1HMVB 2CQIA 2BQUA 3CEDA 3HZGA 1U1RA 3NL0A 3MTKA 1C4AA 2AU0A 3RU0A 1L3VA 5D8HB 2XMMA 3MMBB 4M8LA 1K8AT 3PHEA 4PQUB 1QSYA 2BOPA 2EVZA 1FEEA 4Q7AA 4O44B 5KFUA 4YUDA 5IWAF 3RR7A 2IBKA 2G1DA 2Z2LA 2OPQA 1Y00A 3NG8A 3N9UC 2UV8G 3I55S 1C1CA 3T5LA 4IFYA 5F8LA 3KLIB 2YQ3A 2OO4A 1F5BA 4TY8B 1NKBA 5L38A 3U1MA 3QWUA 1MMNA 4QOTA 3UFCX 3BM7A 4N77A 2DGXA 3BN7A 3FGVA 1ZAXA 4LSNB 4U7CA 3SSRA 1ZETA 1HNXF 2PA8D 2IYIA 1TZ0A 1U6ZA 3IWNC 5DRKA 2ZC4A 1KHVA 1WF0A 3Q22A 4ED2A 1I1GA 1CSJA 2OPRB 3H98A 4WIIA 1G2EA 2HVIA 3AY0A 4F4ZA 1IKWA 3H25A 4UQTA 2HWTA 2QV6A 3M2VA 3KLEA 4V19J 3OL6A 3T19A 4L3NA 1RYSA 1M5SA 2EBEA 2OLWA 3QO9A 1U48A 3KG0A 2XB2D 2RNEA 1NJXA 4QIWD 2K7JA 1AFJA 2DGOA 2HNZA 2J8AA 1W2IA 3T3FA 2LU2A 5DQIA 4CH1A 1UP1A 3V5RA 4FNHA 1X9WA 5HLFB 2DGWA 1Y7PA 5A6PA 3UPFA 2NXUA 4A4JA 2W7PA 1FRKA 2B7CB 3VQTA 1QUPA 2ROEA 3IWLA 3SZ2A 4BWJA 1Y5LB 2W4DA 3DMJA 3BGRB 4Y28C 4QWEA 3IS9B 4OHYA 3HX9A 1BD6A 3FMBA 4ICLB 4NA3A 3KLFA 1S9GA 1WHYA 4FVMA 3RR8A 3M2RA 1D8YA 4MJKA 4DFKA 3HI9A 2P9CA 5E3RA 1Z2LA 3RB3A 4Q0BA 5E3CA 4ZP6A 4DL2A 4KFBA 1DQ9A 4RW6B 5F0WA 5IXUA 3DI6B 1R0AA 1NK8A 4RKUC 1U4BA 3E01B 4TLRA 2J0XA 5FDLA 2EFVA 3MM5B 4FXVA 1HNIB 5KT6A 2W7OA 1FO1A 1CQMA 2MZQA 4JUZA 3BO3A 1E6YA 1XWLA 2B6AA 2O1PA 3CGIA 3D0HE 3DRSB 3PRDA 1NKCA 2HHTA 3MMAB 2FHMA 1OPIA 2IJFA 3H2VE 4E98A 2IM0A 5F8HA 3SFUA 4RNMA 2E66A 1VBYA 4K4TA 2AD9A 1YQHA 3GR1A 1YRUA 3MEEA 4RW7A 2CQGA 1NRKA 3PY8A 3M32B 1GTEA 4MIWA 1WNEA 3PFOA 4RNOA 2BV3A 3O6QA 4FPRA 4KHRA 3CTRA 1S1TA 5KFVA 1MMDA 2CPIA 4CO4A 4RW9A 3WZ0A 2KXNB 2KVIA 3G6XA 2MQNA 3DLKB 4M5DB 3OXFA 1W2BR 1YWXA 2HNYB 3K8VA 3UDLA 2VBZA 1FF2A 1S10A 2DD8S 2F8EX 1QVFR 1RA7A 1N5QA 2Q79A 4USIA 1U6FA 1S9EA 2D3UA 4DLEA 1VC6A 1VFJA 4I0WA 4URGA 4HL9A 1LW0A 5KAKA 3R5BA 4LF5F 1FRXA 4EO8A 3S01A 1AUDA 4ILLA 1FKPA 4MTPA 2HRUA 1C0TB 1NH7A 1FNMA 4ID5B 5E0OA 3T5HA 1KONA 4L