2J0QD

The crystal structure of the exon junction complex at 3.2 a resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
89
structure length
89
Chain Sequence
PQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-DEPENDENT RNA HELICASE DDX48
publication title The Crystal Structure of the Exon Junction Complex Reveals How It Maintains a Stable Grip on Mrna.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 16
structure length 89
sequence length 89
chains with identical sequence G
ec nomenclature
pdb deposition date 2006-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2j0qD00
1UW4A 1WHYA 1FHTA 1URNA 2N3OA 2CPZA 2HYIB 2O3DA 2EK1A 3EX7B 1SJQA 1WWHA 2FC9A 4U67Q 1X5PA 1VQKS 2MHNA 2YH1A 2KVIA 1KC8T 5DDOC 4CH1A 2XB2D 1VBYA 2LEAA 4A8XA 5LJ5Y 3ZZYA 2M0GB 4Y0FA 3B4MA 5JVGQ 3S8SA 3BO2A 2MY8A 3N9UC 2KM8C 2AYEA 2LQ5A 3CMAS 4Z2XA 3I56S 2KRRA 2CJKA 5EN1A 3CPWR 2CQDA 2DGTA 3IWNC 1R8HA 2M4MA 2N7CA 2MPUA 4PRFA 2XS2A 4J5OA 1FXLA 1H6KX 2BZ2A 2E5GA 3DXBA 1SJ4P 4QU6A 5CA5A 2DK2A 3L3CA 1Q7YT 5GAHU 2RS2A 1X4EA 2X1BA 2M8HA 2VOPA 2ZJPQ 1U1OA 1BY9A 1VQ6S 2DGOA 1L3KA 2OTLS 2CPFA 5H1SV 3MXHP 3IRWP 2MZSA 1H2UX 2MXYA 2MGZB 1SJRA 1JMTA 4Y00A 1ZH5A 2DH7A 5IFMA 1QM9A 1WEXA 3OW2R 1WG1A 2PEHA 4FXVA 1VQMS 4UY8T 5DDQC 3CCLS 2KXNB 2CPEA 1U6BA 3G9CA 3CCVS 2LXUA 2ZJQQ 4QU7A 5IM0A 2KH9A 3CF5Q 2KYXA 2MQQA 2DNLA 2AYBA 2DITA 2VONA 3NMRA 2MGZA 2KT5A 3US5A 2OSRA 3UCUP 2DH8A 1G2EA 2D9OA 4CIOA 3J7ZT 4PR6A 3CCQS 5D78A 3EGNA 1OPIA 3BO4A 2DNYA 5HL7Q 4C0OC 2M7SA 2DNRA 4CH0S 2CQ0A 2RT3A 1UAWA 2RQ4A 5LSLA 1X4AA 2BOPA 2ADBA 3G8SA 2MQOA 2DHAA 3CCSS 1WI8A 3U1MA 2CPJA 3PIOQ 1QVGR 2KG0A 3CCJS 1ZZFA 1N54B 1XN9A 1VBZA 2AYGA 1M90T 2KN4A 1A7GE 4LJMA 2UP1A 2CPHA 2EK6A 2MZ1A 1H2VZ 3J7YU 1VQ5S 1X4BA 2FC8A 2FPHX 1K9MT 3MD3A 2DHSA 2L41A 1UFWA 2DH9A 2MQNA 4YUDA 2VOOA 2LCWA 2FHOB 4ZKAA 2LMIA 3U1LA 2DO4A 3Q2TC 5LXYA 2CQIA 4LMZA 2OIHA 2OTJS 3VAKA 3B4DA 3CC2S 2XNRA 2MZJA 1DRZA 1WF0A 2G0CA 2KRBA 2KFYA 2PE8A 2XS7A 3RW7A 2CQ1A 2KXHA 1VC0A 1WHXA 3CULA 3EGZA 2KU7A 2CPXA 2MKSA 3PIPQ 1Q82T 2MZRA 1M5PC 1X0FA 3RW6A 3MURP 2RQCA 1CVJA 2RU3A 2HVZA 4F26A 3MUVP 3MD1A 3S7RA 3VAGA 5GAGU 1U1RA 1X5OA 2MB0B 1WF2A 4ED5A 3TO8A 2DB1A 2YWKA 5LSOA 2DNGA 2ERRA 3BS9A 3R1HA 2E5JA 2CQ3A 1YJWS 3BEGB 4ERDA 2B0GA 1DZ5A 2JVOA 1JJ4A 1U2FA 2L08A 2MSTA 4UQTA 1FJEB 2E5HA 2HGMA 2DISA 4QPTA 3CCMS 1WTBA 2J0SD 4F25A 1WHWA 3V4MA 4M5DB 2DIVA 3CC4S 3UWTA 4OZ0A 3P49B 1VQ9S 3VAHA 2CPDA 3VAJA 3UD4P 2CQ2A 1X5TA 4OZ1A 2JVRA 3THTA 2A3JA 2MSSA 3HHNB 4TLQA 2OSQA 1WG5A 1VBXA 1NO8A 3S01A 2LKZA 5DM7Q 1KQSR 1WEZA 4WKRA 3NS5A 2CQ4A 2JX2A 3CCES 2Q79A 3SXLA 1SJFA 2DNHA 2AYMA 1N52B 3SDEB 2N82B 2K8GA 2SXLA 2GHPA 3G96A 1U1KA 2DNQA 4TU7A 2QEXS 2F3JA 1WEYA 4F02A 3R27A 3H2VE 3FEXB 4PKDB 2ADCA 1WELA 1Q86T 1PO6A 2RVJA 3D2WA 2CQCA 3NNCA 1N88A 2HGNA 3ULHA 1SJ3P 1YWXA 1VQPS 1VC5A 4IO9Q 1U1PA 2DNNA 2M9KA 3H2UB 1YITS 1U1QA 2AD9A 2X1GA 2LYVA 1WG4A 3CCUS 2KI2A 1YTYA 2DNKA 1F9FA 2L9WA 2FY1A 2DGVA 3S6EA 3CUNA 2XS5A 2MJUA 4TU9A 2M8DB 1X4DA 4YOEA 2MKIA 3SMZA 2OJ3A 1YJ9S 1HA1A 4WFAQ 1Q81T 3K0JA 3MDFA 2CQGA 3UE2A 4TU8A 3ZZZA 2DIUA 2J8AA 1U1MA 5DM6Q 4V19X 3MUTP 2RRBA 2J0QD 2LEBA 5IQQA 2VODA 2WBRA 4YB1P 5GAEU 2E5IA 1WF1A 5LJ3Y 3Q2SC 1FJCA 1NU4A 5CYJA 4IOCQ 2JRSA 2N3LA 4WFBQ 3UCGA 1N8RT 1KD1T 3CTRA 2G4BA 3CMES 4BS2A 2RS8A 3BO3A 5GADU 4W92B 2DO0A 2NLWA 2V94A 1W2BR 1M5KC 2KXFA 5DDRC 3JB9k 1A9NB 1AUDA 1SXLA 2MQMA 2X1FA 3G8TA 1KOOA 2CPIA 1M5OC 1U6FA 3CC7S 2DGUA 2GO9A 1K73T 2DNZA 3HI9A 2YTCA 3LQVA 2M2BA 2MKCA 2CQPA 1OO0B 1DBDA 2RUGA 1OWXA 1D9AA 1YHQS 1FT8A 2CPYA 1WHVA 1JJ2R 2YH0A 1VQ7S 4W90B 2QA4S 2MQPA 1RKJA 3P3DA 2XSFA 4WF9Q 2MKJA 1U1NA 2MZTA 2MZQA 2KG1A 3I55S 3VAMA 1DHMA 5GVQA 2J76E 1X4CA 3CXCR 1VQNS 2MKKA 2DGXA 2CQBA 2CQHA 1S79A 3MUMP 1P27B 2E44A 1VC6A 1P1TA 5ITHA 3G71S 2HGLA 2MYFA 2LECA 2HZCA 1QVFR 2K3KA 4IUFA 2MQLA 1ZZNA 1M5VC 2QFJA 3UCZP 1JJHA 1FJ7A 1NJIT 1YJNS 1YI2S 4WIIA 1B7FA 5LXRA 1M1KT 1HD0A 3CCRS 3VAIA 4P6QA 5DETA 5IM0B 1X5SA 2X1AA 1PGZA 2NZ4A 1S72S 3G4SS 3LPYA 2G1DA 5BJRA 2JWNA 3THPA 2I38A 3VF0B 2ZJRQ 3P6YC 3FEYB 2EVZA 1VQ4S 1HD1A 1X4GA 1O0PA 2DGWA 1HL6A 3NNAA 5MLCV 4QQBA 3CD6S 2DNPA 3VALA 4C7QA 2M70A 2YKAA 4EGLA 5CXTA 1VQOS 5FJ4A 1FO1A 3SDEA 1IQTA 1FNXH 3VAFA 2RRAA 2KM8B 3DLLQ 2I2YA 1UP1A 2DGQA 5D77A 2LA4A 4CQ1A 1WI6A 4WCEQ 5JVHQ 2DHXA 1X4FA 2MJNA 1H2TZ 1OIAA 1D8ZA 2DHGA 1VQ8S 1RK8A 2LXIA 1YIJS 2DNOA 3G6ES 1KOHA 3P5TL 4LIRA 2F9DA 3TP2A 2M88A 2RNEA 4C4WA 2LA6A 4IOAQ 2M52A 3MOJB 3UD3P 2XNQA 5GMKa 2U2FA 2MMYA 3MI7X 5DDPC 2MY7A 2KHCA 3NS6A 4FXWA 4RU2A 1R8PA 1X4HA 5HO4A 4WFNQ 3NNHA 2D9PA 1VQLS 2MKHA 1K8AT 3TYTA 2D3OR 2DNMA 2F9JA 2DGSA 1U1LA 3R1LA 2U1AA
chains in the Genus database with same CATH superfamily
1HLWA 2HWIA 3QRQA 4DV2F 5HVFA 4YB5A 1S1XA 1WWHA 3RAQA 3JTPA 3H8YA 1M1GA 3I9V9 1LFWA 2M0GB 1RAAB 2RF2B 4TXSA 3GIJA 2GCFA 4A47A 2R8IA 5EN1A 3VVUA 1IKWB 3V2UC 2QSWA 1T7PA 5C2GA 3J80U 5GAHU 2RS2A 1V5VA 2JFKA 3PYGA 1H72C 3DOMB 4KBIA 1S10A 2YY3A 2JZ5A 4X66F 4YY3F 3C3LA 4F50A 2RUSA 4ZVTB 3RTVA 4MKAA 2RDJA 2PEHA 1TL7A 4NA1A 4QZVB 2IJNA 4MYUA 2XZWA 5KT6A 4E8UA 3TQ1A 5A76A 4ZITA 3PX6A 4FS2A 3V6JA 5KFOA 5LSLA 5KG0A 1SL0A 4ILRA 3DRXA 2R7QA 4WP3A 3GYNA 1F0XA 4DOZA 4PUOB 3LP1A 3BQ1A 4OLOA 4FKXA 2AYGA 2ASYA 2UP1A 1CEZA 1RAIB 1VQ5S 2JEFA 3JSMA 2E29A 1IBMF 4NZ6A 2M5YA 2QFIA 1VK3A 3VVTA 3DHXA 3I5BA 1L3SA 4RLEA 4UT4A 1EJ7L 1ZA2B 3VAKA 3MTKA 1M1HA 3CO0P 2Y1JA 1DRZA 2KRBA 1SC6A 1C1CB 9ATCB 1QAJA 2MZRA 1X0FA 2JNJA 5EX3A 3BBCA 5J1EB 3SCKE 1P9YA 3I31A 4DLEA 2V50A 1FK9B 3OTOF 1XTZA 3PRDA 1DFDA 2JJ4D 1SUQA 2DR8A 2GS8A 4WBFA 5KFGA 1H7WA 1FJGF 1P1LA 4FVCA 3V4MA 1V3RA 2A2DA 8RUCA 3IO1A 3GE9A 2QLJB 4K59A 5KFXA 1IBKJ 4NLQA 4MFBA 2WB4A 2OSQA 5HBMA 3FQKA 1WEZA 1XMOJ 1PCAA 4C8KA 5LT5A 5CABA 1FRLA 4I6AA 1RTHA 5AT1B 3AB2B 1JLGB 2W2MP 4ZVUB 3G96A 3R5GA 1UVJA 2W7PA 2V8VA 2HVHA 4C8LA 3ITHA 2P8IA 2BR0A 2M9KA 3ISNC 3TX8A 3AFGA 5KFEA 2C2NA 4RNHA 1F9FA 1LW0B 1YZ6A 2VG5B 1KONA 1HKAA 2M8DB 5DZ6A 1XMQJ 3GR1A 1NKCA 2GQ2A 5HVHA 1YJ9S 3CJ2A 4LQ9A 2IPOB 3AD7C 3CJ8A 3PFEA 2E5IA 3MEDA 1WF1A 1FJCA 3JS9A 2UVUA 1E6VA 1D09B 3QT5A 1S1UA 3CTRA 2FJXA 2BJ8A 2KKHA 1DLOA 5GADU 4W92B 3V6HA 2DRBA 3BBFA 1HWIA 4BBYA 2G1HA 2ZH3A 1MLAA 2GO9A 1DQ8A 2AMCB 4N76A 1V9OA 2HAFA 2YTCA 3FCWA 3SQGA 3SV3A 1HW9A 4ELUA 3K8WA 5HMWA 2KZZA 3VAMA 4KGKA 3CXCR 8ATCB 4XPCA 4HI2A 3D3CJ 4X2BA 5C2CA 3M6UA 3GV5B 1VMBA 1JJHA 4FN5A 3LH2S 1SCJB 3BGUA 1TL7B 1VK8A 4WIIA 4NA2A 1B7FA 1X7VA 2ZD1A 4ZN3A 2UUAF 2QMUB 1XR5A 4UOGA 1RZMA 4P10A 3R6GB 4A8FA 1U7LA 2IDLA 4B3MJ 3DYAA 1C4AA 1RWKB 4MTPA 3CWJA 2XHWA 4EO8A 1NNDA 2W1BA 5KFKA 4NRTA 3LGNA 1M5SA 4H4OA 2NREA 2DHXA 3W62A 2PA3A 3NGUA 5KT7A 3JSMB 4DQIA 3TAMA 2Y1IA 1X4HA 2H4YB 2A1BA 1K8AT 2F40A 3TYTA 4ENOA 2AGPA 2F9JA 4KO0B 2X3DA 1I51B 3EMTA 1U02A 3L9ZA 3MM8A 4ECYA 1VHIA 2N3OA 2FLNA 4EI2A 1VHFA 2CPZA 7FD1A 2E1AA 4G1PA 1SUQB 2LEAA 3FRYA 1JXVA 4P2SA 1RU1A 2BXJA 4JBCA 3I56S 3MPDA 2W8KA 2M4MA 1B0VA 2BX6A 4Y2CA 3ADAC 2W8LA 1FXLA 1T03A 4O3RA 4MIAA 4MFBB 3NP5A 4AT1B 5ADZA 1O5JA 2GMJA 3DRPA 5HBMB 2VFTA 2OMOA 1F9HA 3H42A 4M1KA 3MTJA 4JV5F 1O51A 2QX0A 1D1UA 1RTHB 3EPGA 4B3OA 2KJWA 4IKAA 4UY8T 1VQMS 4FXVA 5C24A 2GFFA 3G9CA 3SFUA 3BZQA 2KYXA 2HQ3A 3PRVA 4IRKA 2MGZA 2W2PP 3ZZPA 3GFYA 2WSEC 2D9OA 1OPIA 4WYLA 3BO4A 5H9EJ 3BV8A 4CH0S 2RQ4A 2KVQE 4RKUC 5HP1A 5HK4A 2CZ9A 2PN6A 1S7HA 1YBAA 3J7AN 1LW2A 5ETQA 1EB0A 2DVIA 4CLYA 3FSIA 2L41A 2JC0A 1GH8A 2GJIA 1NDCA 1DLOB 4CLZA 4YUDA 1G1XA 3M8ZA 4USJC 1MWZA 3HX9A 5L9XA 3JAMU 2YQ3A 1RWNB 5THWA 2KXHA 4PWWA 1YVFA 4I64A 1NPKA 1NJXA 3OXFA 3PJWA 1U45A 1S76D 1UEKA 3VAGA 3V5RA 2K2PA 4EBDA 5LSOA 3R1HA 3NOGA 3N6NA 2MSTA 5DQIA 4FPRA 3CDEA 3DLKA 3HMJG 3EXCX 1I1GA 2ZD1B 1PJ7A 5CZXA 4K4UA 3M1VA 2PI5A 5KTQA 1RI7A 1RT7A 1X5TA 3J81Y 4OZ1A 2XGPA 2XMUA 3RUBL 3S01A 4OYAA 3NS5A 2VPWB 3DYAB 2JX2A 3CCES 4OHZA 2C3PA 1U8WA 1PSDA 4RW6A 3NGRA 2XEXA 1XK8A 1VJWA 2RVJA 4KE5A 5E0OA 3NNCA 2HS0A 1YWXA 4H4MB 3RRKA 2B9EA 1RT1A 4QW8A 4QW9A 1DAXA 3P45B 4ECQA 2AZ1A 2CWKA 4IG0A 4KHPF 4GKJJ 3RAMA 1RT6B 1U09A 1UTAA 4TU8A 4FNHA 1IM6A 5DM6Q 3MFIA 3MM8B 2AIRB 1VRUA 3AD8C 2V4RA 2V9WA 3HSDA 1PILA 3Q2SC 2BRLA 2ZKUA 4ZVHA 1IBKF 3CJRA 1U47A 3CMES 2RD5C 1H3DA 2XTJP 4CYUA 4C0BA 1A9NB 1RDRA 1XMOF 2CIMA 1FWKA 2YX4A 4ZPWR 2GAHC 5ETVA 4DV7J 2MHEA 1WKKA 4JV1A 4AL6A 5B0BA 3OL9A 2CPYA 5A8RA 3A3PB 1TVRB 1T03B 1U1NA 1KDNA 3W2WB 4QR1A 3Q8SB 3DRPB 4ALZA 2JDJA 2HAIA 3M4XA 4ITSA 2AEMA 1UZHA 2CQBA 2R8KA 1ACMB 5B0CA 3OJSA 4JI0J 2D74B 5CZVA 1TELA 4ED3A 3K17A 5B0GA 1XMQF 4IUFA 2MQLA 2OPQB 5DO2A 1RB0A 4OHYA 5C24B 1CLFA 1B64A 2BUNA 4DV6J 4KJIA 1G6BA 3HLUA 3LP2B 2QA4G 2DGWA 3R97A 5M2UA 1LKZA 1OS5A 2I6WA 4IR9A 4PQAA 1SH3A 1VI7A 1IWGA 4S0MA 4LSLA 3KDOA 3EVOA 4LIRA 4DX6A 3R2DJ 2GO8A 4GVBA 1ULRA 2M52A 2APOA 1FD2A 2MKHA 5DG8A 4IFYA 4NLXA 2YQ0A 2A18A 3H5XA 2AGOA 1N6QB 1UW9A 2HHVA 2EK1A 3RR7A 4HR2A 3ZFVA 3HHKA 2VDIA 3U1NA 2CRLA 3TEGA 3OLBA 2YWHA 4PPZA 3R5DA 3ZZYA 4B3MF 1HQUA 3GV7B 1R0CB 2Z0GA 3OTDA 2B8PA 3CMAS 3M6WA 3M1VB 2XZDB 1R8HA 2ZNZA 1SJ4P 2DK2A 1Q7YT 4KAIA 2ALYB 2DGOA 4LIWA 2GMLA 3MXHP 3PW2A 2MXYA 4ZVOB 3HFKA 1SJRA 4OZNA 4LRFA 2YNIA 3M8WA 2KH9A 2XWXA 1M5HA 3FJ2A 4MIBA 3UCUP 1K1QA 2W2OP 4UY85 2YKMA 1RKIA 1RT1B 1XNQJ 5L39A 4MK9A 2KTQA 4ZIVA 2O5DA 3KHGA 2MQOA 2Z8QA 1ZAWA 2RDIA 1DQ9A 2GVDA 4X4RA 2DRAA 2DR6A 1Q7LB 1CSJA 2IM1A 2YWGA 3EPIA 1FX2A 2KN4A 4OJ1A 4OV6A 4A46A 2LLZA 3TI0A 2XHCA 5B0AA 1RTDA 3N6LA 1S77D 5ETNA 4RW7B 2ALZA 3CULA 2HFZA 4DPXA 2MKSA 3R5BA 2LU2A 3W61A 3QZ7A 3CO9A 5A8RB 5D15A 2V68A 2HVIA 1LWFA 5KFLA 2FTRA 1FFGB 1NK9A 2ZOFA 4BC7A 3TO8A 2ERRA 2HNZA 1MN7A 1VQSA 1BXNA 3GTYX 1TV6A 5T41A 2FY8A 3M2VB 1UVKA 2VZ9A 3UWTA 4ZLJA 5L1LA 1SIWB 3PKYA 4DPOA 2BABA 2XSJA 2CQ2A 3MCSA 1SKSA 2AJ0A 2YNFA 2MSSA 2YKPA 2Z56B 4AD6A 5DM7Q 3ZZUA 2YNGA 2XULA 4DR2J 5KFAA 3BH7B 3SXLA 3BQ0A 1SJFA 1N52B 5EUHA 4FYVB 9RUBA 1WEYA 2W9CB 3QO9A 1N32J 3R27A 2C3MA 1TL1A 1ICEB 3GFXA 4IO9Q 1OYDA 1NM2A 4GVBB 2IVYA 2D7SA 3CJ5A 1SH2A 3CUNA 1N5YB 4JUZA 1X4DA 3HPOA 2CJQA 4OYIA 3IP0A 4IFYB 2WONB 4I56A 5AXLA 1VQYA 1SIZA 1Y10A 1LXNA 5FLXU 2LQJA 2J0QD 3EVWA 1NB2A 1DJ0A 1C0TA 1HMVA 1XERA 3HT0A 3BGFA 3NRBA 1HR0J 3A8IA 1GX6A 1NK8A 3E2EA 2V94A 5F41A 2KJVA 4AL5A 4URSA 1U6FA 3N4WA 5DS7A 2XLIA 2H5IB 5IT9U 1R6VA 1QTNB 1KQGB 1JJ2R 2YH0A 4Q5VA 4M5KA 2MZTA 1XNRJ 2J0XA 3CEDA 2CQHA 1IKXA 1P27B 4KGMA 4RZRA 1RBLA 2K3KA 4GKJF 1MN9A 2QFJA 3MEKA 1NJIT 3MMAA 5D3GB 3MMBA 2RB7A 4USIA 3CSKA 2WOMA 3FDSA 1RT3A 3TZXA 4XIUA 4DWIA 2YKAA 4LVNP 4IQMA 1VQOS 4P71A 2GVDB 4CO2A 1QUPA 4DV7F 4B3RJ 4QIVA 3GCWP 2UVVA 4CLPA 2ZWOA 2F9DA 1CJUB 3W60A 1TKXA 3DU6A 4A4JA 5DDPC 4RWWA 1RT4A 6AT1B 2HVDA 3LGMA 1NXIA 2I1RA 3W9HA 2R7RA 4JI0F 1EHWA 2NPIA 3MAAA 4DV5J 3MR7A 1URNA 4YB7A 2V5HG 3WZ0A 4ZPTR 1R89A 3DM2B 2UV8G 4LT6A 5CQGA 1LWFB 4DV6F 2KYZA 2ATLA 1FA0A 1KC8T 2HLTA 2HNZB 5LJ5Y 5CYQB 1SQEA 2KM8C 4P74A 3CJ4A 4TY8A 5DGAA 2KRRA 1NK0A 2V9KA 3CJ0A 5KG1A 3ZTQA 3EVMA 2JC1A 2PMWA 3QAEA 1IUJA 4OYXA 1DURA 3I0RA 1YJRA 2YNFB 3SSRA 4NYOA 2X1BA 4I67A 3MPUB 1QSLA 2YNGB 2IRUA 2OTLS 1Q8LA 3D9BA 1RLCL 4IH7A 5KFQA 2LQBA 3HJVA 4FF1A 2CVIA 4IH6A 1U8SA 1WC1A 3QO9B 4K4WA 1TL1B 3CCVS 4GC7A 5E3AA 2C42A 4I68A 2QC3A 3US5A 2HIYA 4JI4J 2IM0A 3K5PA 3K5OA 2QTWA 5DLGA 3JTOA 3LANA 3G8SA 1KVJA 2V8PA 3F0NA 2BJ7A 3SSSA 2RE1A 3QYYA 1LWCB 4F2RA 4U95A 5H9FJ 5ETTA 2VA2A 2BV3A 3NCRA 4NX9A 4OHVA 2LDIA 3LWLA 1KSPA 1U6ZA 4C8ZA 5IXUA 2IVMA 2PA8D 3PR5B 4DUTA 3FBEA 3T9NA 1TK0A 5D0RA 5F8MA 1WF0A 2G0CA 5AXMA 2EC0A 3MURP 3RG6A 2XC9A 3HVAA 3BKTA 2QMXA 3HSGA 2V0NA 4R0EA 3PYEA 1IKXB 4XK8C 3VQTA 2DNGA 3SCIE 1EAYC 2FUG9 2WSFC 1EARA 3GSDA 3HJFA 1XNQF 1UPMB 1TKZA 3UD5A 4X84A 3CNQP 2WCXA 2VF3A 4NWBA 3OR2A 5BR8J 4Y28C 3LGHA 1F2HA 4NLOA 3W2VA 2DPJA 4MK7A 1CPZA 1HNWJ 3GG1A 4CLKA 3WX4A 5J1NA 1XWLA 4XDDA 2D3ZA 1GK8A 2YX7A 2VBYA 2VHGA 2DNHA 2VPZB 4HKQA 2YKNA 2R2UA 4F4ZA 4TU7A 1U0SA 2Y9HA 2H54B 1PC5A 3FEXB 1ZS6A 5AXNA 4QWDA 3C14A 2HGNA 3MR3A 2ROGA 4LF4J 3LWMA 1F1BB 2X1GA 4K5SA 1EETA 3M8QA 2ABYA 4TU9A 3GPAA 1RT4B 3C15B 1VRQC 2EWHA 1OQ6A 3DOLA 4Y2IA 3A8EA 4B3SJ 2IYIA 1X60A 1KVIA 2ZBIA 4ZCMA 4DN0A 2DKOB 2IBOA 1U25A 3FFIA 3AT1B 4JI5J 1BQNA 3PJXA 5L46A 4FNIA 4WFBQ 2AJ2A 2G4BA 2RS8A 2R7SA 4K0KF 5C7PA 2VUGA 1JKHB 4DR2F 1HW8A 2CPIA 2RJZA 4Q44A 2BMBA 4CWBA 2M2BA 4OHXA 1CQNA 4DCOB 1N32F 4C3KA 3KLVA 4KKOA 3QSYB 2I8EA 3ENVA 4I2PA 2W7OA 4R8UA 1S79A 1VC6A 3CGIA 2CNOB 3M2RA 1ZZNA 2JLFA 3JQMA 5F8NA 5CH7B 1ZPVA 3C19A 5ETOA 2RU9A 4A8WA 4M5GA 1R3NA 4GVLA 3PVXA 3DC2A 2G1DA 2HHUA 4TNOA 1S1WA 3OTCA 4EYHB 3LP0A 1HR0F 1QE1A 2IRYA 1S1TA 1D3WA 1QD1A 4ZCKA 2XI3A 1IWAA 3FQLA 3Q8YA 2W25A 3NEKA 2MKYA 3SDEA 1LFPA 3GJSB 2O01C 4OI3A 4DL0C 3CW2C 5L9NA 2FVSA 5CCLA 1HWJA 3BPSP 2IY5B 2RILA 2LXIA 5A2QY 2VH7A 1CS4A 4LRAA 1QAXA 2J0WA 2XNQA 1T9YA 1JX4A 5KFFA 1XNRF 4ICLA 2HHWA 5KFPA 3OD2A 2QYCA 3PACA 2ZUGA 1KBRA 1VCTA 1HARA 3GLJA 3MEEB 4NASA 1MG7A 3R9LA 2HRYA 3D54A 2H9ZA 3ENQA 4RNOA 2F5GA 1RGVA 3BYPA 3MECB 1OSDA 1HBOA 3DDIA 1HWKA 2KVIA 2DHHA 2XY5A 3OR1A 5HLFA 2H4WB 3O5TB 1T05A 4YDXA 1KRPA 4OX9J 3D0IE 4TKTA 3IWNC 2N7CA 3W2VB 5DQGA 4B3RF 3HHLA 3L3CA 1HI8A 3K5NA 3IBFB 3AJDA 2QRRA 4PABA 1NHUA 1RWMB 5KFBA 2HZAA 2KHDA 3IBWA 1QM9A 4EFAC 3EZOA 3OVAA 5J2QA 3CCLS 3QPIA 3NL0A 2XG8A 4LBHA 1KLNA 5KFYA 1N33J 3C14B 2GZOA 2J5AA 4O3SA 4DV5F 2OH2A 2A0FB 3J7ZT 4PR6A 4OIXA 1SJ1A 1UAWA 1NAQA 3DOLB 2VIHA 4NCGA 3DXSX 4Y34A 3FFIB 4Q8EA 4ZCIA 1BQNB 2RDDA 2LVWA 4ES1A 4HACA 2DHSA 1JNRB 3FSYA 1B7YB 2AEFA 2VOOA 3Q2TC 3PJ9A 4KHRA 4LBPA 2OTJS 3Q8QB 4N8NA 1RISA 3HFVA 3RRGA 1I5OB 3O1LA 5K8PA 4ECZA 2ZHAA 2BDPA 2W7AA 1CVJA 3BSNA 2RMLA 4LF5J 4USVA 3SCLE 3CB4A 4KKOB 1WC4A 4DV1F 3BPDA 3DFEA 2BW7A 1QUVA 4QR2A 3TR5A 4ED5A 4JI4F 3X3UA 1QY7A 3VZIA 2AGQA 1D0EA 1RHUB 3CJSA 2E5HA 3FGVA 4DFPA 4ZN1A 1KVKA 2PFDA 1CG2A 3OFHA 2ZC3A 1HI1A 3VAJA 2ZH6A 2MQ8A 5I3QA 5G4DA 3HHNB 1S1WB 3CE8A 3LP0B 4ELVA 1QE1B 4FBUA 4DUYJ 2CJXB 4QR0A 1C1BB 6FD1A 3D67A 3JYTA 1PAEX 3PW7A 3MMCA 2MLZA 3SDEB 4NZ7A 1J5EJ 2PMZD 1U1KA 4X4PA 4TQRA 2HURA 1BHNA 2QLWA 1YSJA 2DNNA 1RCXB 1CS4B 2AD9A 3LTOA 3QWPA 2L9WA 2XS5A 2ZM6J 3NBPB 4H54A 4LRCA 4QYZJ 2HHHJ 5L1KA 1I3OB 3G82B 2R7WA 1WACA 1CC7A 4X4QA 2AJQA 3IS9A 4YB1P 4LUBA 5BR8F 2FYXA 2C2OB 3DGPA 3OSPA 1HBOB 2G9OA 3BKUA 1HNWF 4LSNB 3AJ1A 2HK3A 3SIPB 2B4UA 4PYAA 2HW3A 3OR1B 5A0YB 2DGUA 2NS1B 4O4GA 2GIRA 3DMJA 3HI9A 3RB4A 3MHYA 4DXLA 1U24A 1NK5A 3HHLB 2MKJA 4RO0A 5KFWA 4E2FB 1WNEA 4RNNA 3QGHA 2RRNA 3UN2A 3TA1A 1KNZA 1VQNS 4LF4F 2MKKA 3THVA 3MUMP 5HANA 4M5LA 3W1YC 1CULB 1T3OA 4OYMA 3D4JA 3CCRS 2X1AA 3J7YI 1S72S 5A8WA 3I87A 5BJRA 4JI5F 4MIWA 3G6XA 2EVZA 2FVCA 1VQ4S 2JEIA 4U8YA 2C2KB 4RNMA 1HHSA 2D1CA 4Y2KA 2OPPA 1T9VA 1C0UA 1JLBB 3MAQA 1MU2A 2ZBQA 4NCGB 3CIZA 5C42B 4PG5A 2FLLA 2I2YA 2ASJA 1NH7A 4CM0A 3RB6A 4CQ1A 1WI6A 5JVHQ 4M5NA 5J2NA 1N36J 4G1IA 1H2TZ 1UKUA 2RQKA 4ELTA 4BWMA 5IZHA 1XC9A 4HACB 2B8QA 4I0WA 5DG7A 5KFNA 3ZNUA 3BSOA 4X64J 1JLCB 3NS6A 2E1MC 2Z57B 3W65A 2D9PA 3UVJA 5E7OB 3EUNA 2GX8A 4ZHRA 1T3NA 1IKYB 4F7VA 4KPCA 4RW9B 5KFRA 4CLFA 2DEJA 4DR6J 3M8PB 2QJ3A 3T6JA 4F4KA 1LWEA 3JSRA 5AE1A 2VJUA 1QDUB 1FDNA 4ED2A 2AX1A 1VBYA 1FRIA 4A8XA 4ANEA 5L38A 8AT1B 1IXKA 3GYXB 4TVAB 4FF4A 2BYCA 2CQDA 1MNEA 1SC4B 2QGFB 2XS2A 4ZJLA 3KLIA 2BZ2A 4DN9A 2B4VA 1UWAA 3RJMB 3IAM9 4IYQA 2IJFA 3C16A 2BANB 4I2QA 1T11A 3HD2A 4F0MA 1X9MA 1ZH5A 5IFMA 2FQQB 4RW4A 3A3NB 1U6BA 2QLFB 1HPZA 2DITA 1RWOB 3PM9A 3ILIA 2OEJA 3OFEA 5F3TA 1APSA 5HJYA 5HL7Q 4E0DA 3BKFA 5I42A 1WC0A 5ETLA 2PSZA 1AFIA 1OMSA 3M2UA 1D9FA 1JLEA 3ET6A 3U1MA 3AJ2A 3EJMA 3J7Z5 3DLEB 3IS9B 2E7XA 2CKWA 4LF7F 3VR1A 4OX9F 4ECVA 3J7YU 3I4PA 4DX7A 3DGPB 3ZTRA 4OJGA 5IOLA 1M0SA 5LXYA 3D1QA 3GP9A 1NPPA 2RKIA 4NPOA 4WK1A 2PC6A 4O3PA 4O4GB 5I3UA 1FE0A 2B6AA 2HFSA 3PIPQ 4YS2A 2FJDB 2KFZA 1BGXT 2BE9B 3GILA 1REGX 2QSFA 4CRJA 3QZ8A 1CJVA 2K1RA 3MZIA 2HRUA 2K7JA 2HPUA 2E5JA 2GQCA 2QO3A 1OY8A 1Y11A 2DISA 2H48B 2QL9B 3ICLA 2ZOGA 4HT7A 5HVGA 1OSCA 3H2LA 4RUCA 1BQMB 3P49B 2VICA 1S49A 5A8WB 3KTQA 3FUYA 1FVSA 2XCAA 2OLWA 2A3JA 1YK9A 2VC1A 4ECUA 2BE2B 2HBZB 1SL2A 2FGCA 2E9ZA 3H4DA 3AHPA 1MU2B 1RHMB 2K8GA 4IDKA 3MR6A 2V2QA 4YEAA 5J2NB 4C8OA 5GMEA 4UUXA 4J9NA 1U1PA 3H2UB 7FDRA 1RHJB 4ETZA 4K2JA 4LF5F 4WWSA 5HMZA 5J2MA 3BH6B 1X31C 3UPFA 3KKFA 1JXLA 3O2IA 3MDFA 3UVJB 2HHPA 2UUBJ 5KFJA 3HHLD 1H0HB 5IWAJ 3KDNA 1EP4A 3TW0A 3B8HA 3H25A 1VDHA 2GHVC 2B4PA 5CYJA 1YRXA 4J9MA 5K8NA 1NKBA 2N3LA 1EKRA 5DG9A 3BO3A 4YR0A 3DLGA 1Q8BA 1SXLA 1GMWA 4O3QA 4DUYF 2VBWA 3HVWA 1IM4A 2VDHA 2EKNA 5DZ7A 4DSIA 1OWXA 2M3DA 3GWCA 1JWWA 3KLIB 2MQPA 4WF9Q 1S1VA 2KFNA 3MOZA 1GXTA 2LP4A 3C8YA 2AT1B 4DI6A 3HVTA 2R8GA 2AF6A 3C16B 4I2QB 1ZYQA 2E44A 3G71S 2ZM6F 4MT1A 5LMUJ 1BQXA 3CJKA 2XMMA 2ZBRA 4C48A 2HHHF 4RW4B 1Q8KA 3QIDA 3M9OB 4TLRA 2Y8WA 3GG0A 1AXQA 1S9EA 3KNGA 4ZVGA 1J5OB 2Z2LA 5B09A 1PJ5A 3VF0B 4C97A 1A6LA 3NNAA 2GJ2A 4C7QA 4PXBA 4PG4A 2IC3A 3M2UB 1JLEB 4U8VA 4PWDA 3L95X 1UFLA 2F63A 1MW7A 2C22A 4XO0A 2DHGA 2NXEA 2HRTA 3KJNB 1FERA 4C11A 4HVZA 1SI9A 1AFJA 4C4WA 3PEJA 2KHCA 4AE5A 1R8PA 4DPUA 4NOHA 2RKIB 3TZZA 2B7BB 5I3UB 2B6AB 4WPAA 4JI1F 3HKZD 5F8LA 2UXCJ 1UETA 3NAIA 2C2EA 4EBEA 1RWWB 2HS3A 2J7UA 4V1Ak 5U47A 3EZ5A 1CJVB 2K1RB 3LA0A 1NK6A 4LF8J 3VTIA 3OTEA 5A6PA 5KOXA 1TU0B 4P9SA 4A8KA 2QLXA 4WU3A 3PW4A 4JV2A 2MPUA 4RR5A 4J5OA 3CCZA 1PYTA 3EXYA 4DPYA 1N36F 2RF2A 3DOKA 5KT4A 3OV7A 3NG8A 4G6VB 3RGIA 2ZJPQ 3KMQA 4FVMA 3ONQA 2CPFA 4X64F 4OYBA 2MZSA 2ZE2A 1H2UX 2NXCA 2FVPA 2WZ1A 4Y00A 5D0GA 4IDKB 3OW2R 1UA0A 2EC2A 3DOMA 3OFGA 3CF5Q 1HQEA 2LEPA 4HEA9 1HHTP 3GIMA 4DR6F 5D78A 3PXGa 5J2MB 2DNYA 3RYLA 2NZCA 3DHWC 3KWMA 3PCOB 1DTQA 1RHQB 2W2NP 1SBRA 3QT8A 2AX0A 3EZUA 1JQGA 2NPFA 2BQRA 4QCLA 1F3FA 4IFVA 2UXBJ 4AYBD 1GX5A 3MD3A 1GEHA 2ZZTA 3RBXA 1NEEA 2MQNA 1KHWA 2LCWA 2GHWA 2OPRA 3DLGB 5KFCA 3KLHA 2CQIA 1GMUA 2I5JA 4OX8A 1VC0A 4KPYA 4QWBA 2KU7A 5H9EK 4HHHA 2RQCA 4OQJA 2UUTA 3Q22A 1S9GB 4DLGA 1FXRA 3HVTB 3DRRB 1C1CA 1GQEA 2AZ3A 4LRDA 3SCJE 2KL8A 1DZ5A 4FF2A 4C98A 3F73A 2C3OA 5IV3A 4UQTA 1ROFA 3MPWA 3CJKB 2J0SD 5D4LA 1FK9A 3QFWA 1SV5B 5C25B 3D66A 2VPXB 3IWLA 2H65B 3FMWA 3M8RA 2LKZA 1IBLJ 3HD1A 4KH0B 2CJ9A 5E3CA 1OJ4A 4PG8A 1MMLA 3G6VA 4PWDB 1RTIA 3D2WA 1JNZB 1T9XA 3M7VA 1VC5A 4C11B 3A3OB 3VGUA 1JLGA 2GA7A 2GGPB 4J9VA 2VBZA 3FVYA 4JV0A 2ZZMA 2HBYB 1WORA 3G2XA 3GYGA 2J6SA 1FX4A 4DV3J 1O8BA 4QPXA 4AXJA 5HQMA 3DDNA 2WVBA 3BDPA 3VZHA 3UW1A 2OFHX 1NB7A 2VG5A 5B0FA 2COLA 3T9ZA 4JOUA 3TVZA 4QOTA 3TAQA 5F8HA 3MPVA 3AA8A 2NLWA 3DRYA 1M5KC 4PQUA 4N7TA 2PIIA 2PT0A 1K73T 2VQEJ 1GMVA 4F3MA 5M2PA 4NLSA 4A8QA 3CCTA 2ZC4A 3DOKB 3JTNA 1KQKA 4OX6A 2HZCA 2ZE2B 1LXJA 4NLWA 2ATCB 3UDLA 3IM8A 1L3TA 3TA2A 2UUBF 3OL8A 1HQEB 3RR8A 1FEEA 5IWAF 2IBKA 3I5CA 1TFYA 4QQBA 2M70A 1J2VA 1DTQB 5CXTA 1T02A 2Z2MA 2HHQA 2G0JA 3QBCA 1UCNA 1IQTA 1FNXH 2NSCA 3MMJA 5GADI 2PO4A 2LA4A 4GKKJ 2R2TA 3E01A 3IGNA 3P5BP 2D69A 1KN6A 4IFVB 1Q8IA 3P5TL 3HM9A 3TP2A 3O44A 3MOJB 2WBMA 4K4ZA 2MMYA 4MMOA 2OPRB 2DR7A 3KLHB 3DN9A 2CNKB 3ZC4A 3TUZC 3Q8VA 2I5JB 1FKPA 2WVEA 2D3OR 2GVZB 5LMUF 1AT1B 2BKOA 2GAGC 4P7VA 1Q0NA 2CNNB 3B6BA 2WRMA 3OXLA 1MMNA 4UF4A 3AA9A 4KO0A 1Q4RA 3H90A 3EYZA 2DCLA 3J81U 4CH1A 4F2SA 4JI8J 5HROB 1Y00A 2AYEA 2QIFA 4C6AA 2F1FA 4F36A 3W5ZA 4YN3B 1WKLA 4B9NA 5K20B 2M8HA 3RRHA 4A48A 2OD6A 1YBUA 4WJBA 4C8YA 2V34A 3SSQA 4TYBA 4ZP6A 1F3VA 3Q89A 1W7WA 4HI1A 1RTIB 2UXDJ 3ZZTA 1R8AA 1NH8A 4NCBA 1RQ0A 2IHR1 4F4YA 3V81A 1EKSA 4FDFA 2UXCF 1GNKA 3CCQS 1GMWD 4I6YA 1N5VA 4M94A 2VQFJ 4M5IA 2AU0A 4JI7J 4DPWA 2B7CB 1Q79A 2CQ0A 1UEVA 4LF8F 4L3NA 1G7CB 4KTQA 3KK2A 1IQZA 3PIOQ 3GQCA 2KG0A 5HATA 1W26A 2CZVC 2J9EA 4LJMA 3EDQB 4LF6J 4V19J 1R8CA 3KXDA 4LF1A 2WSCC 1B0PA 3FZBA 3TJ9A 4ZKAA 2LMIA 2DO4A 4PQUB 3OTBA 4X62J 1UZDA 3PV8A 2ZOMA 3EWGA 4KGZB 4G3IA 4DMZA 3RW6A 1F6TA 4GMKA 3V4IB 5EX0A 1Q53A 3AODA 3MUVP 1UVIA 4X4TA 1TKTA 2EBEA 3N5FA 1X5OA 2FLPA 4LF9F 2JOQA 3FCHA 1Q1KA 1N0VC 2OO4A 1X8DA 5KFTA 2XLKA 3H5UA 2VFVA 5HQLA 2XY7A 3NOCA 5KFIA 2ZZNA 2R7UA 4HDHA 2KB2A 1NO8A 4F4AA 2UXBF 3W5XA 1JLFA 3VGSA 4N5SA 3MCNA 1SH0A 2Q79A 1ZTTA 3DLBA 2SXLA 4OYPA 2NUUG 3OQ2A 1WELA 3PG9A 1PO6A 2PEBA 1SJ3P 5IC4B 3E01B 1HBUA 1S97A 3JQKA 1N34J 2KT2A 4F4XA 4DV0J 4LR9A 3IN5A 4A8OA 2KI2A 4DSLA 2ZBCA 4B9LA 2MJUA 2AEJA 4E98A 4RL1A 2VFSA 2OJ3A 1FKPB 2YX1A 4H4MA 5IT0A 5BYSA 2G0IA 1K44A 1NSKL 3ZTOA 2FHKA 2FJEB 4PG6A 1RT2A 5GAEU 1RT6A 1NU4A 3QGIA 1KS2A 5ETMA 2DXEA 1RAEB 3LUYA 4YR2A 4FYWB 2VC0A 3UDVA 3UN5A 2F8EX 2R7TA 2GIFA 1RLDA 2X1FA 1DARA 1FRKA 3KJQB 2NSBA 1A0OB 2IYGA 4F4WA 1Z2LA 1FT8A 4DSEA 4AL7A 2HMIB 3TX0A 1P1TA 1QSYA 4ECRA 2RHQB 4K4TA 1TVRA 1BWEA 3VCDA 3W2WA 4Y65A 3Q23A 2QLBB 2FHJA 4P6QA 2QZ8A 3V81B 1PC4A 3DRSB 4ZVPB 2QL7B 2WVCA 4R25A 3F41A 4OZLA 2OPQA 2HNYA 3UI3A 1T94A 5F8JA 2C28A 3R3TA 2DNPA 4EGLA 5FJ4A 1HNZJ 1S4FA 4Q8FA 1TAQA 3TUIC 3KK2B 4R5PA 3LP2A 2HQCA 3KNAA 1FF2A 3QJPA 2MJNA 2KDOA 4P52A 2KZMA 3G6ES 4MAKA 3D5MA 2M88A 2BW2A 4BC9A 5GMKa 1NK7A 1WOSA 4CNYA 5D0HA 2WB1D 3Q8UA 1U0HA 1RABB 1MROA 2DY9A 2C3UA 4B08A 4WTOB 1L3UA 1S0NA 2ASLA 2ZH9A 2W4DA 4RBTA 1TKTB 4ZIWA 4WFXA 1VQKS 3BF4A 2D3UA 1GFWB 1Y5NB 2BA9A 1N6QA 4Y0FA 3B4MA 1IVZA 4W98A 4Z2XA 1VOMA 3TEHB 4U7UK 3OHBA 3PKMA 2CZ4A 1KEKA 5KG6A 1H38A 4GKKF 4DV4J 4QU6A 4MKVA 1JLFB 3N5BA 5K14A 4USHA 3E51A 2VPYB 4ID5A 3BSAA 1F60B 1RXOB 1JLAB 4IG3B 3GR0A 4YFUA 3P8BB 1HBUB 3KHLA 3BN4A 1AYEA 1UJ6A 1S7IA 1PG5B 4CIOA 4M8LA 3A1YG 3IR7B 3BGRB 2M7SA 1Q95G 2DNRA 3K7RA 3HHLC 1SKRA 2ZWPA 1YGYA 1YRTA 5T7LA 2VV5A 4JI8F 2W4CA 3CCJS 2BQUA 4YY3J 1NJWA 4QWCA 1RT2B 4K50A 2CWXA 1CQMA 5F9NA 3BQ2A 4NL5A 5KFDA 1H2VZ 3KFWX 3G6YA 2XYGB 4DFKA 4O3OA 1TL4A 3PX4A 4USWA 2ZDOA 4KY3A 3TA0A 2EG2A 2K3IA 2EI5A 3EGVA 3U27A 1NBEB 3B4DA 2JL9A 4LFCJ 2XNRA 1WHXA 1Q82T 2HLUA 3GCXP 4I69A 4CCHA 5GAGU 4RW7A 1Y4ZB 4NLVA 4USTA 4ED1A 2VQFF 5H9FK 4JI7F 1WHWA 3GJTB 1KTVA 2DY1A 3TANA 1VQ9S 2Y0SD 5E3RA 3UD4P 2HNYB 4LF6F 4DG1A 1WG5A 1VBXA 4MKBA 2CQ4A 3M2VA 4FF3A 4ZJQA 3W7BA 3AQPA 4ZVEA 2WAQD 2D41A 1NK4A 4R5PB 3CIMA 4LFAJ 3H2VE 2EFQA 4DZDA 4X62F 3QQCD 1VQPS 4RU9A 3NLCA 3PNIA 5E41A 2F4VJ 4NLDA 4WXWA 4KQZA 3W9IA 2DGVA 5E2QA 2L9NA 2W9CA 2BKPA 1FRHA 4G1QA 1BWVA 2RQMA 3T19A 1U0HB 1Q81T 4BDPA 1MROB 2XLJA 3T5LA 3MUTP 3RAXA 4V19X 2H51B 2OELA 1N5YA 4CLTA 3TVYA 2P9EA 4DR1J 2E1PA 1WSRA 4DSKA 3ILOA 2WONA 5EGYA 1FKOA 3MWBA 5G0RA 3UCGA 4K4XA 4XPEA 1NUEA 3WX8A 2POKA 5LOQA 1X9SA 2MQMA 2V8DA 4F04B 1XEZA 4ZVFA 1RADB 1HNIA 4EBCA 1WSVA 2V69A 4CZCA 4ZJOA 1FDBA 1D9AA 1WHVA 4TY9A 2QA4S 3W5YA 4F0KA 2GJFA 3HSJA 2MZQA 2Z30B 1PIEA 1N34F 1X9WA 3F44A 2QA1A 2CFXA 5K14B 1BE4A 2HEKA 4ID5B 2P6SA 2NR0A 4NMLA 3FNNA 4N8OA 4QIFA 3I9ZA 3T1YJ 3D6TB 3FBBA 5DETA 1X5SA 5DRKA 1S6UA 3KLFB 3N0VA 2OKQA 4L73A 1RT5A 2IM3A 4I7FA 2ZJRQ 4WYWA 2ZH4A 3QRPA 2ZITA 3BGLA 1SPBP 2O66A 3H5YA 5B08A 5D3GA 5HI7A 1VISA 1FO1A 3OFFA 2J6TA 5T7LB 1ELOA 2KM8B 4OYZA 4C3LA 3IA0A 4PWUA 2DXDA 1D8ZA 3PY8A 4QIEA 4LF2A 1EZZB 2HWTA 4RUAA 2MY7A 3LO3A 3Q24A 2ZBPA 4OZJA 3WIUA 5CCMA 1E6YB 4UUWA 2JEGA 3CD0A 1CJUA 3OL7A 4C9DA 1ZOTA 2VG6A 1QAIA 2Y8YA 1ZTWA 4P73A 1URRA 3UN3A 1XQIA 3OXGA 1ITPA 1IKVA 2YH1A 4WE1B 3PDNA 2FZGB 3K57A 5KFZA 4YHHJ 1YX2A 3DM2A 4ZP8A 1G3OA 3BO2A 5DGBA 1ZPWX 5L1JA 2LQ5A 1HNZF 5K5MA 4Q7AA 3KMSA 1H6KX 3WC0A 5CYQA 1V3ZA 4IR1A 4DG1B 1WTFA 4LFBJ 4K8RA 1U1OA 4DUZJ 3ZZOA 1BY9A 3UNYA 1VQ6S 1NZ8A 4QIGA 2AV5A 1IN0A 4KFBB 4OI4A 4CP5A 1SC1B 2FVRA 3IWXA 5DDQC 4DZ6A 4A8YA 2Y0BB 2ZJQQ 4QU7A 5ETRA 3V6DB 4J37A 2DNLA 2L9DA 4J90A 1N5SA 3NMRA 2ACYA 2KT5A 4L6V3 4NXMJ 1H74A 2RH3A 2EFGA 5DQHA 1WJ9A 4G1QB 2RT3A 3HP6A 1YJ7A 1LEOA 1HWUA 2DTJA 3L7UA 3J81j 2R8HA 3RBDA 1DTTB 2FJVA 4B9MA 1FKOB 1TTHB 5G0RB 4DV4F 4ZVRB 2Q6CA 1LWCA 3N28A 4OI1A 1FTCA 2FHJD 1P9QC 4WP8A 3C46A 3I82A 1HNIB 2CQ1A 3WBZA 1SQGA 2DCUB 4K4SA 4ZMMA 2RU3A 4NYZA 1U2RA 1T9WA 2X7IA 3HZEA 3HT3A 2ASDA 2YKQA 2BJ9A 1S6PB 2FZKB 4UOHA 4FZVA 4F0HA 2XI2A 2DB1A 2YWKA 2PD1A 2B0GA 1U2FA 3T3FA 1X0PA 3ZXWA 4QPTA 5A8KA 5ETPA 3T6BA 3KHRA 2IAJA 2J9DA 3MEGA 4OZ0A 2CPDA 3EGWB 3POTA 1RT5B 4ZLNA 3UR3C 4I7FB 3K89A 4KSEB 5T14A 5A2QU 1NJYA 1N0UA 4FYYB 2XO6A 2N82B 2GHPA 2HBQB 1RCOB 2FIUA 1OQ3A 1TFWA 4LFCF 3HZGA 2OFGX 2AWZA 1U1QA 5EWEA 4DPTA 4J9KA 3PO4A 2MKIA 2B5JA 1Y0HA 1CJTB 4HH0A 2QL5B 2J8AA 1LV5A 3LOUA 3R5CA 2VG6B 3NGSA 3C15A 2WBRA 3CJ3A 4CTAB 3D3BJ 4U7CA 2YWFA 3KUHA 2UVWA 4Z7CA 2NXUA 1IKVB 4WFZA 4RW8A 4BS2A 3A8KA 4ZS6A 3NS7B 2QA2A 5DLFA 2DO0A 2L48A 1S9FA 1TUWA 4OX7A 4ZCLA 3I6PA 3MM6B 2DEIA 2FB0A 3M32A 5F9LA 3KLEB 4KHPJ 2DNZA 1U4BA 4G65A 3LW5C 1S0MA 4LFAF 4LQ3A 3P3DA 5CYMA 2DRDA 1GTEA 1JKHA 4UZBA 5KT2A 2OHDA 4QYZK 5GVQA 1X4CA 4GC6A 2F4VF 2VJVA 2WTFA 1Z4UA 5ITHA 3NGDA 4ECXA 3FK4A 5D4OA 4Q43A 1RAFB 5SUHA 1GT8A 1PGZA 2ZEJA 4CT9A 3ZTSA 3THPA 2I38A 4DR1F 2E9TA 2VB6A 2XYHB 1ZETA 2HIQA 1YJTA 2A2CA 4KGVB 4EK2A 1Z1ZA 3M9NB 5KT5A 1SVDA 5BYRA 2W2QP 1TR0A 1OIAA 3AOAA 4IOBA 4KYZA 1MMDA 3FSXA 3W66A 3HFZB 4KGXB 2R42A 2U2FA 5KG2A 3C6TA 1S6OA 2DBBA 1VS3A 3QJJA 3AXKA 1YLXA 1R7IA 4X4SA 1S1XB 1UW4A 1TK8A 1WHYA 3T1YF 2XMVA 5F0UA 2HYIB 3RBZA 3IR5B 3EX7B 4HYKA 4ZPCA 3AOCA 2NCKL 3MEEA 5M2RA 4U96A 2H3EB 3MECA 5A8KB 4JYAJ 3L4BC 3RB0A 1LOUA 2IAJB 3MEGB 2DGTA 3A8JA 4CH7A 2KT3A 3POTB 3DXBA 2HQDA 4NZ0A 3NMAA 4KR0B 4B9VA 5IS2A 5F8GA 3VGTA 1AROP 3C6UA 1UVMA 2DH7A 2G2ZA 5JMNA 3G87A 3CD7A 3T5JA 5B0EA 3H20A 2XMTA 3PFOA 1UPPA 3BR9A 4ECSA 2AYBA 2XO7A 2PDAA 2OSRA 3VWSA 3U02A 3KLGA 3LP1B 3DGVA 4XAKA 4DR5J 2B5JB 4J9SA 3IR6B 4HTIA 4UTGA 4YHHF 1FWLA 2DHAA 2J7KA 1QVGR 1F5AA 2Q1LA 2XBPA 1QLNA 4OMFG 1ZZFA 1XIQA 1VBZA 2QV6A 2OD4A 3BREA 2FC8A 2FD2A 2EPIA 4BCAA 4P7TA 4RW8B 1RYSA 3QLHA 4LREA 5KFSA 2FHOB 5ETSA 3LAKA 1TL5A 3W64A 4LFBF 4DUZF 2BJ1A 3M32B 3RW7A 3QATA 4ZVQB 4DS5A 1WDTA 5EDWA 4FP9A 2QYGA 2LQ9A 3NAHA 5CYMB 4ES2A 2HK2A 5GMDA 4URGA 1WF2A 3AOBA 3LAMA 4NXMF 1YJWS 4ERDA 2JVOA 2IJRA 3GV8B 1FJEB 1B0TA 3I5AA 4D3HA 4NI2A 3CC4S 3HCXA 3QIPA 4J7CA 3JXOA 4TLQA 4GO7X 3WQPA 3M9MB 4EEYA 3ITHB 1Y7PA 1NZAA 4H4KC 3RB3A 4F02A 3J80Y 1S48A 4L75A 2C1EB 1ZM4A 4EMDA 1FCAA 4EO6A 1N88A 3TVKA 1TAUA 1C1BA 4CO1A 1RAJA 1YITS 4EWTA 3A4TA 2L3MA 3TNVA 5LMNJ 3JSYA 2DXFA 3CCUS 1YTYA 2J9DE 2NYIA 3C6TB 3MEDB 3SMZA 2VL1A 1E6VB 3D28A 1UJ4A 3C66A 3W3SA 1S1UB 2DIUA 5FIIA 1R8BA 2HWHA 3K8VA 4OYOA 2LEBA 3NBPA 3CDUA 2HS4A 4UZCA 3RZAA 4O23A 4ID8A 3UNGC 5KFVA 4X65J 3MF5A 2Z58B 3SQGB 3G82A 2OAUA 3QNWB 4HHJA 3A13A 5EWFA 5DDRC 4X4NA 3IFEA 3H0PA 3QJLA 2OPSA 1NDKA 1TP7A 3G8QA 4LSNA 1DBDA 2RUGA 1KFDA 4OYWA 1Q5VA 2E1CA 4WFYA 4CO0A 5A0YA 3NKYA 1DHMA 1IBCB 2J76E 3IGVA 4P2FA 1RJJA 1NSPA 3VV2B 2AJ4A 4M5HA 3C6UB 5AE3A 3UCZP 5KT3A 2EEYA 4F67A 1M1KT 4CNZA 3MM5A 1CULA 4AQYJ 1RSCA 2ZVIA 3PHEA 3FEYB 3KYLA 4X4OA 3KLGB 4OHWA 4H4OB 4MH8A 3LF0A 1BD6A 2GW8A 1IJEB 1UMJA 3HVRA 2VU5A 1D8YA 4CLSA 3R5JB 3W63A 3TAMB 4DF4A 2RRAA 1UP1A 5D77A 2J9CA 3M8SA 2RSQA 3AD9C 4K4YA 1ZAVA 2BQ3A 1JLBA 2XQCA 1S6QA 2VKRA 3QAUA 5C42A 3QLHB 3KJVA 3R7BB 5AE2A 2D3O1 5KG7A 3GIKA 1XR7A 3UDCA 4JP8A 4LSZB 4OZ5A 3TUJC 4NEYA 1FESA 1JLCA 2F65A 1FHTA 3PR4A 1CC8A 1EQMA 3TQEA 1N4LA 3T5HA 2Z2ZA 4N56A 1AA1B 1IKYA 2MHNA 2UVRA 4RW9A 5DDOC 3DLHA 2FDNA 1PYOB 3M8PA 3BR8A 4XDCA 5JVGQ 1R6YA 3ZZRA 4NI2B 3FBFA 2G13A 3QIPB 2W9BA 4B3OB 4X4VA 1X4EA 4ZP7A 3HHDA 4NEZA 4KH1B 2MGZB 3UDEA 2EXUA 1OY9A 1UA1A 2DD8S 1WEXA 1CJKA 3DCAA 4ES3A 1FKAF 2BANA 2MQQA 1FRXA 3G86A 3OSNA 5HP1B 3EGNA 3T1AA 1LW2B 2WVDA 4C0OC 4RNFA 3OL6A 5E3QA 1W2IA 5L1IA 2W01A 2HBRB 2HSEB 4DR7J 1AW0A 4NA3A 1WI8A 3GZ7A 4L76A 2R4FA 2ROPA 4JYAF 1M90T 5JXSA 4HLBA 4WXOA 4USKA 2X3GA 5FDLA 1RHKB 5AXKA 2H1YA 3DDKA 3DLEA 2G2OA 3TJ8A 4LMZA 2XZTB 2OPSB 4YMEA 1TKDA 3CC2S 2NUHA 1VLOA 2PE8A 2XS7A 3TAPA 3D68A 3KK3A 1XBWA 2CPXA 3HF5A 4U7UD 3KUEA 2HVZA 3D6HB 4B02A 3DLJA 3DLKB 1PAUB 3S7RA 1KKHA 2R2SA 1IJFB 3CCWA 2AJFE 3BS9A 3VQSA 2CQ3A 4NLYA 1JJ4A 1RT7B 4DR5F 4DQPA 3CCMS 1NLKL 4DL3A 4F25A 3OHAA 2NQPA 2JHEA 2DIVA 1TK5A 3T5KA 3MM5B 4O0NA 3VAHA 3THTA 4RW6B 4J91A 1TZ0A 4Z37A 3OVSA 1KQSR 4B3SF 1RWXB 2HFVA 4HH1A 1BQMA 2V67A 4Y2MA 4DL6A 2BE2A 4IG0B 3WC2A 2ADCA 3AB4B 4HT5A 2YNHA 3ILJA 1F2GA 1YKWA 4DQQA 1S6QB 4CO5A 4QIWD 4OI6A 2FY1A 4DFJA 3ZTPA 4U9RA 1UWBA 1VFJA 2DPIA 1FE4A 5HQ8A 3KJVB 1VRUB 2JH3A 1YQHA 3T41A 4Y6IA 2VFUA 3V6KA 2VODA 2OUGA 4CYUB 2FVQA 1ZA1B 2GNKA 4L72B 1NMEB 1RTJA 1WD6A 2DR9A 1W2BR 1K1SA 1IR0A 3JB9k 1YJVA 4I1TA 1HBMA 3GIIA 3CC7S 2HKEA 3FBCA 3NCPA 3GSIA 2MKCA 4NE9C 5LL6d 1GXUA 2CQPA 4B17A 2W9BB 1PBAA 4YB6A 4DSFA 4OZ3A 4O4RA 1LNQA 1SQFA 2Y1RI 3JAMY 3X1LB 3NWGA 5LMNF 3ZZ0A 1QAYA 2FHMA 3MCMA 5EHHA 2B9XA 3M6VA 1SKUB 2MLYA 1QVFR 2W9AA 3H98A 3R2CJ 4ZVSB 4K0KJ 1CJKB 2O1PA 2WW4A 3L09A 1FI4A 2ILZA 1HD0A 2FJBB 1BMQB 3LPYA 1L3VA 1RAHB 4MYTA 4X65F 4W4MA 3M6XA 4LSLB 1HNXJ 2ZFHA 1J5OA 2Q66A 1NPRA 3IRXA 3HO1A 1NDLA 2LQ8A 3VAFA 2UUWA 1NSQA 3GMGA 4I4BA 4KC5A 2DGQA 4JI6J 3H7HB 2YVSA 4J9QA 2HHSA 1VQ8S 1RK8A 3W9JA 1FNOA 2ZHBA 4ZPVR 3QT7A 5FDLB 2E7WA 4PXCA 1NSAA 4ZDNA 2V4JA 4QWAA 4FXWA 3OBIA 3T1HJ 3HDSA 3MCOA 3NNHA 4KV8A 1VQLS 3IMQJ 3TARA 2FGOA 3KK3B 1KR4A 1UVLA 1HQUB 2O3DA 4AQYF 1YBTA 2IA0A 2FC9A 4RBUA 5KFMA 2V6AA 3OJUA 1TQLA 2VKZG 1N33F 2ILYA 4KIAA 1KWMA 2E9RX 4DU7A 1Q78A 4OFZA 4TYAA 2VG7A 5CA5A 1S5ZA 1RU2A 2VOPA 1RAGB 1N48A 2YNIB 4P2MA 1VYAA 4DR4J 5H1SV 2XGQA 3DU5A 5A6WA 2P9GA 3ETMA 1JK9B 3U7JA 3CMQA 2YKMB 3D1HA 4HDGA 4NLPA 1HBNA 2CVEA 2CPEA 4UOCA 4ANDA 2PGCA 2LXUA 2YNHB 1UVNA 4KB7A 4FKYA 3PW5A 1N5TA 1JJCB 2OP5A 1G2EA 2DH8A 1Y5LB 1QSSA 3D7SB 1UWBB 1GAOA 5MAOA 3ETOA 1S0OA 2ZNYA 2AJ1A 4CLLA 1Y9OA 3CCSS 1N54B 4DL7A 4RUBA 2HG4A 3I0SA 3PYFA 1RTDB 2CPHA 2EK6A 4XTTA 1VIXA 3EICA 1RA6A 1X4BA 2FPHX 1RTJB 1QTMA 2R8JA 1JLQA 3ISZA 3MPYA 3MAHA 2B51A 3IBCB 2JFDA 3U1LA 2HHXA 1HBMB 3NGTA 3C2PA 2MZJA 3CT9A 5E3PA 3NY0A 1TMMA 3N6MA 3GJQB 2IMOA 2C3YA 1TUGB 1TV6B 1J5EF 2C2DA 1FTRA 3R5AA 2XSJB 1F5BA 3OUYA 2IRXA 1WTBA 2K7KA 1S9GA 2DYAA 5J2PA 3DRRA 1LQ9A 1UL3A 4DR7F 2W4PA 3GU0A 5CD4A 2JVRA 1N56A 3GB0A 4ZK7M 4DDFA 1SV5A 4DV1J 3K59A 5KFHA 4ECTA 3AH6A 2B4OA 3IRXB 5C25A 1VBKA 1W25A 2CDQA 2QG9B 1I94J 4PKDB 3AY0A 1Q86T 3SEOA 1RHRB 2CQCA 5E5NA 3ULHA 3SYZA 1JIHA 3WHIA 2LYVA 4GRSA 2DNKA 3QT6A 2ZKTA 4UOFA 3SQOP 2V4JB 1U2CA 1C0TB 1HMVB 4KV8B 5HAOA 3QRRA 3D6FB 3K0JA 3D1OA 1DY3A 4ETXA 4BHQA 2GGPA 1B70B 4AXIA 2Z2YB 2V63A 3HK2A 3ENAA 1RWPB 2FJAB 1WC6A 2CAJA 3HULA 2C2ZB 4J9UE 4ZLLA 1XMBA 2G2YA 2O67A 2KXFA 2ZVSA 4LR7A 4CT8A 2BM1A 1YDLA 3W8GA 3QGPA 4HTJA 4B9SA 1RWUA 1BC6A 4YQWA 1HWLA 1UJ5A 2F4FA 4W90B 2E7VA 2KO1A 2Y1LB 2XWYA 2VG7B 4Q2MA 1HYSA 2P6TA 5K8OA 3I55S 2R9LA 3PRBA 2N4DA 3MMAB 3PEHA 3RBEA 3M30A 4NCAA 3BB5A 3KOAA 4ANCA 2LECA 5CAAA 2ZDPA 3MMBB 3FRZA 3PYDA 2IM2A 1U49A 3IXQA 3PTWA 1JXEA 3K58A 2WOMB 4C8NA 1YJNS 1HBNB 1RT3B 2J7WA 3TWZA 5LXRA 3J7A1 1U26A 3PW0A 4FS1A 3TOQA 3P6YC 1O0PA 3E8OA 2AKWB 3L7OA 1V5IB 4ED0A 4EZ9A 2VA3A 1C2PA 1TKXB 1FXDA 4C3MA 1TMJA 1Y3KA 3KJFB 4WCEQ 3H59A 1X4FA 2UZAA 3I0SB 1YIJS 2DNOA 4IQXA 4J9OA 1P8GA 1T95A 1LK5A 3QMQA 3VHQA 4ED6A 4IOAQ 3IAS9 1JLQB 2LDYA 3MAAB 4C0HA 4UW2A 1RYRA 3TZYA 2IVFB 1S0VA 3MI7X 4WFNQ 5I3PA 3WDOA 4A8MP 4M95A 4DSJA 3CDAA 5D4PA 2MDAA 3UR0A 5L8RC 4P2XA 3QGGA 2YQ1A 2IDEA 2Y3YA 1HHQA 3NXZA 3F56A 3H4BA 1AZSA 2GVZA 4DL4A 4TY8B 4U67Q 1RBOB 2NYHA 5BYQA 5FLXY 5RUBA 4DL5A 3I0RB 2HFOA 1HNXF 2MY8A 3OUYB 3N9UC 3I4HX 4NLUA 5J2PB 3PO5A 3ENWA 1AB8A 3CPWR 1R0BG 4JI6F 4ZOSA 2E5GA 5HROA 4JB8B 1QJHA 2R3VA 3NGKA 2BM0A 2IIHA 2PMHA 2UV8A 4CO3A 4BLGA 5IT9Y 1NRKA 1NKEA 4O3NA 3T1HF 1JMTA 2HQIA 2KXNB 2HNDA 4J9PA 2VONA 3MFHA 3ILLA 2IA6A 2P9CA 5KG4A 2BKNA 4OJ3A 1KHVA 2YWEA 3MR2A 5KOWA 2VASA 4PXDA 4B3TJ 2Z4PA 1FNMA 2ADBA 2YXLA 2UU9J 2CPJA 4O44A 2MTLA 1UEUA 3SI8A 2HQFA 1XN9A 1A7GE 1UFWA 1H7XA 2BE7D 2BJDA 3Q86A 2OIHA 4ZLPA 4DR4F 3TUPA 2J6UA 1VJQA 2CDRB 4DR3J 2OEKA 1VR6A 3EGZA 1ZBTA 5IQ6A 3JQJA 1SKWA 4FYXB 1IR2A 3BM7A 1HYSB 1TKZB 4P72A 2ZH1A 2A6MA 4LF7J 3OR2B 3M30B 4AFFA 3VGVA 2BVZA 4DJBA 3BEGB 3V4IA 1D9DA 4I6WA 2HGMA 1WC5A 3EE3A 2UUCJ 3M05A 2OI2A 4ZPDA 4OZ2A 3IG1A 2EFVA 3Q0AA 2E1RA 4K5RA 3OVBA 2YKNB 3CDWA 1YG0A 2WVFA 1S12A 5C5JA 2F8HA 4ECWA 1VLYA 5IT4A 1EETB 3M8QB 2F8MA 2F3JA 4FPIA 2PFFB 3TZWA 1NJZA 4DF8A 4EUVA 1P6TA 3BN7A 2VBXA 5LM7E 1WOPA 3CJQA 1WG4A 3HKWA 4RJVA 1FFWB 1FWPA 1WUUA 3PX0A 2ZH2A 4GO5X 3UE2A 3KK1A 2ZH8A 5CHCB 2E5LJ 2QN6B 3Q8PB 1Z2ZA 2B56A 5LJ3Y 1Y3JA 4DCPB 4URQU 1AZSB 1KD1T 2CUYA 1B99A 1KQFB 2FZCB 2GMHA 1DQAA 1HNVA 3G8TA 2YWWA 1M5OC 2HHTA 1K0TA 3BSCA 4I2PB 2VFRA 4R8UB 1KFSA 3LPEA 3HHEA 4ILLA 4DFMA 1VQ7S 3M2RB 1I94F 1RKJA 2DT9A 3D0GE 2KG1A 6FDRA 5ETKA 4CI0B 1XJWB 2DGXA 2H5JB 2HGLA 1RBAA 2BEFA 2CG8A 3GIRA 3JSBA 3KG0A 1S1TB 1FDAA 2HMIA 4NMXA 1RUSA 1XR6A 4NYPA 2HZVA 1NCLA 3DI6A 1S4EA 3GFHA 2HNDB 3K5MA 1WOOA 4PXEA 4UQGA 3QFHA 4N47A 1OYEA 1RWVB 2E66A 1HD1A 5CD4H 1X4GA 5GAEI 4AUKA 2XMWA 3CD6S 4EZ6A 3FKBA 1RACB 3DRSA 4M5MA 2IMWP 4O44B 3RU0A 1F9EB 4P75A 1I6JA 4ICLB 2GC8A 4TQSA 4DL2A 4WZQA 4ED4A 2I0XA 2EW9A 5J1PA 3S1TA 5EWGA 4RWXA 3UD3P 3L7PA 1S59A 3ISND 1YJUA 4RU2A 5HO4A 5AJ3J 4F3OA 2I9SA 1U1LA 3R1LA 1BUXA 3FMBA 5HLFB 3MR5A 4USUA 2V2KA 4FBTA 5F3ZA 1T05B 1Q5YA 2CG4A 1SJQA 3A12A 3OT9A 4IH5A 3QWUA 1X5PA 3SBMA 1T0TV 2XB2D 2OGUA 4ZPAA 5KG5A 3S8SA 4JI3J 3EDRB 1K0VA 2K06A 2QMWA 2B43A 2JLEA 2NXJA 3FZ2A 3IG1B 2VD3A 4DX8H 5J2QB 4JI1J 2EKYA 2AQ4A 2HVEA 4DEZA 2F7VA 3KG1A 3IRWP 4PZVA 1B4SA 5KG3A 4A8SA 4K7QA 5IM0A 1HFEL 3DNCA 4RUHA 3BBBA 1JLAA 3QSIA 2XMAA 4IG3A 4NRUA 4ZA1A 2GV1A 4DHVA 2ZHOA 4HHUA 4FXDA 4ILMA 2BOPA 3KK1B 3TRGA 4O0IA 3Q83A 3BGRA 4WP9A 4WZMA 1R0AA 4PAAA 3N01A 3FEZA 2MZ1A 1PJ6A 5LSRA 1K9MT 1SC3B 2DH9A 3EM1A 2A10A 5HN0A 4CM2A 3BDEA 1HNVB 1T9TA 1NHKL 4NLRA 2Q3PA 1KLMA 3P96A 2GIQA 1FD8A 2V2VA 5I4MA 2KFYA 5D0EA 1IR1A 4L74A 5IV4A 1R31A 2FJWA 4MK8A 1VRTA 1IBLF 4Y3CA 4F26A 3MM9A 3UFCX 3FCVA 4OV1A 1U1RA 1RTZA 2V4QA 3K5LA 1BLUA 2BOAA 4B3TF 3D0HE 2CJAA 3DKDA 1Q16B 2UU9F 3DI6B 3JYTB 3MMCB 1PYSB 4DV3F 3D6MB 1FDDA 4Q2LA 2AYMA 2DNQA 2R7OA 4DR3F 2WW8A 2OMLA 1KP6A 3H40A 3BGOP 3CDBA 3ELHA 2CADA 2BRKA 1LWXA 1YRUA 5KAKA 3S6EA 2MEWA 5E33A 5HMYA 1NHVA 4YOEA 2J8SA 4RPFA 1HA1A 4WFAQ 2VQEF 1RAOA 3MM7A 4TN2A 5GAGI 3I96A 5D8HB 2P2CB 1GTHA 2RRBA 2JLGA 3UQSA 4QJVA 2BBEA 2UUCF 4NXNJ 2CYYA 4IOCQ 3DMJB 1N8RT 4ED7A 3H5SA 3O8WA 2XYPB 1YZ7A 1REVA 1AUDA 2R7VA 1L5UA 4KHMA 2JEJA 1EX8A 4R0JA 1FEHA 4RX6A 2XCPA 1YHQS 4Q0BA 2FLOA 3NCQA 4JI2J 3KUGA 3IM9A 4LBIA 2BJEA 4QBUA 1M5VC 4C2MA 1U48A 2AW0A 1FJ7A 3OPKA 1YI2S 4M5DA 1OY6A 1K47A 4DV2J 2CJBA 3B78A 3O6QA 2ROEA 4LVOP 5IM0B 3VAIA 2NZ4A 1UFKA 2OPPB 4WU2A 3UO0A 1C0UB 2V8HA 2E5LF 3N79A 3MGJA 2LXFA 1ZM3A 2B9WA 4CLWA 2V8GA 5K9FA 3R7NB 5KFUA 1HL6A 4L3KA 4RBVA 3KLFA 3DLLQ 3Q8RB 2C2RA 1R0AB 4PG7A 2XMKA 1KOHA 2OEMA 2RNEA 2LA6A 4ZHRB 5BXIA 4X66J 5B0DA 4YDDB 4IRDA 4WIQA 4IO1A 2DNMA 1LWEB 1KLMB 3KG4A 3NWRA 4WK3A 3CJTA 4FYDA 2U1AA 3HXMA 2ZH7A 3SZ2A 1VRTB 1T9UA 3MM9B 2ACMA 2BACA 4ER8A 1E6YA 1S57A 1S99A 1HI0P 3PZPA 2JSXA 2YPYA 2UXDF 1PBUA 7AT1B 4Z7YA 2V2ZA 4DQRA 3R8YA 2WHOA 4ZP9A 5F8IA 2CJKA 1O6XA 5SZTA 4MJKA 2PI4A 4WE1A 3B82A 4PRFA 2GQQA 1IBMJ 2EFNA 2CA9A 1B3TA 1N5QA 1L3KA 3AAWB 1HPZB 5D4NA 4QWEA 4N41A 4WTYA 1TUVA 5AJ3F 1WG1A 1OPZA 2H5EA 2HFNA 5I42B 2ZUAA 1GXLA 3K2YA 1MWYA 4KFBA 4DU8A 3OTOJ 3W8PA 3FC9A 3ET6B 1EQ0A 3BYRA 2Q6BA 2DR5A 5K8MA 3V6DA 1FJGJ 4B9TA 1TL3A 1X4AA 3ZNJ1 4K4VA 3MM7B 1HQ2A 3BJYA 4JI3F 2A6OA 1SB6A 4IRCA 3E3XA 4BWJA 1T8EA 4K2XA 4ATNA 1FRJA 4M63A 4PYDA 1WDDA 1V3SA 1J27A 3OLAA 4D3GA 2R2RA 4U6PA 1REVB 1KTQA 3AXMA 4YP3A 1NDPA 2EBGA 1DTTA 2RIJA 4MKYA 1V6HA 3IC1A 1M5PC 4Q0BB 1RE1B 3P4UB 5B7WA 2XY6A 3MD1A 3O3LA 1EIYB 2MB0B 5IC6B 2N7YA 2L08A 4M5DB 3SV4A 2LU1A 4DV0F 3B54A 1S6PA 1HIYA 1IKWA 4CDIA 2BJ3A 5HMXA 3HSZA 4NLGA 1MSWD 3GJRB 2CJYB 2P5VA 4B9UA 4WKRA 1FVQA 1WC3A 4LRBA 2QE5A 2QT7A 1SL1A 4F3QA 1RA7A 4PCQA 1C4CA 4LF9J 4KT0C 2QEXS 1G4CA 1F5CA 4CO4A 2B9YA 4DBQA 4HL9A 4J9RA 4EU0A 4LR8A 1EP4B 2AHOB 4CLUA 4DX5A 2X51A 4WKYA 1VIOA 2HQGA 2CQGA 4DS4A 4OLPA 3ZZZA 2NXNA 1U1MA 2UUAJ 4PUOA 4OJHA 5IQQA 3GONA 1R27B 1H73A 4M5JA 1H98A 3SFGA 2R7XA 5GAHI 3CD5A 1WKJA 2C2MB 1R43A 2EG1A 1CJTA 1FFSB 4C8MA 2JRSA 4EYIB 2CXEA 2W24A 2N4CA 2AP6A 4CTAA 5D6GA 1S1VB 3R6LB 1KOOA 4YR3A 1FRMA 1VGYA 4J9LA 4H4KA 2EFOA 3LQVA 2EFPA 4OL8A 5HJXA 1OO0B 2YKOA 5HSPA 1RP5A 2MLXA 2XSFA 3MM6A 5J1EA 3LALA 3KLEA 2B3TB 4DCJB 1ZM2A 3R7SB 1S9EB 2ZH5A 2RHSB 3I32A 3PHTA 2MYFA 3KHHA 4N77A 5JJBA 2RAQA 1ZM9A 4ZPBA 4OI0A 4USMA 4NLTA 2DJWA 2Q43A 5DJBA 2YPZA 2IC3B 3G4SS 4KRWA 1Y5IB 4QYRA 2JWNA 2LFVA 4NXNF 3WIVA 5MLCV 1MWQA 3CVKA 4ED8A 3VALA 1ZAXA 1TL3B 4PPDA 3GFZA 1LK7A 2CNLB 3TJAA 5JUMA 2XMJA 1JB0C 3AQOA 3ZO7A 5F0WA 4JV5J 2IFXA 4Q45A 1LW0A 4X4UA 4OI2A 2WK4A 4JI2F 5FD1A 4Y2AA 1PKUA 2DGSA 1CBKA 2YBVA 2HFUA 3M8YA 2XM3A 4F8RA 1AUSL 4DQSA 4PEOA
chains in the Genus database with same CATH topology
1HARA 3MEEB 1KR4A 2HRYA 3D54A 2H9ZA 3ENQA 1UVLA 2HWIA 1HQUB 2C3UA 1RGVA 4RNOA 4DV2F 4B08A 1L3UA 2O3DA 1S0NA 3MECB 2ASLA 2ZH9A 1OSDA 2W4DA 4YB5A 4RBTA 1HBOA 4AQYF 1S1XA 1TKTB 1WWHA 2FC9A 2IA0A 4WFXA 3RAQA 1VQKS 3KTQA 3BF4A 3JTPA 4RBUA 1HWKA 2D3UA 2KVIA 1Y5NB 5KFMA 3H8YA 2XY5A 3OR1A 5HLFA 3I9V9 1LFWA 3O5TB 3OJUA 2BA9A 1N6QA 2M0GB 4Y0FA 1TQLA 2VKZG 2RF2B 3B4MA 4TXSA 1N33F 1T05A 3GIJA 2ILYA 4YDXA 2GCFA 4KIAA 1KRPA 4A47A 2R8IA 4Z2XA 1VOMA 5EN1A 1IKWB 3D0IE 3V2UC 4TKTA 3IWNC 4U7UK 2N7CA 3OHBA 2E9RX 3PKMA 2QSWA 3W2VB 5DQGA 2CZ4A 1KEKA 1T7PA 5KG6A 1H38A 4B3RF 4GKKF 3HHLA 1Q78A 4OFZA 4TYAA 2VG7A 4QU6A 5CA5A 3L3CA 1HI8A 5GAHU 3K5NA 2RS2A 2QRRA 2VOPA 2JFKA 1N48A 1JLFB 2YNIB 3N5BA 1NHUA 5K14A 5KFBA 4USHA 4KBIA 5H1SV 1S10A 2YY3A 2JZ5A 2XGQA 3E51A 2VPYB 3DU5A 4ID5A 5A6WA 3BSAA 4X66F 1F60B 4YY3F 2P9GA 1JLAB 1JK9B 2KHDA 3IBWA 3C3LA 4F50A 3RTVA 4IG3B 1QM9A 4MKAA 3U7JA 4EFAC 3OVAA 2RDJA 2PEHA 5J2QA 2YKMB 3D1HA 4HDGA 4NLPA 4NA1A 3GR0A 3CCLS 1HBNA 3QPIA 4QZVB 2CVEA 2CPEA 4UOCA 2IJNA 2PGCA 2XG8A 3NL0A 4MYUA 1KLNA 5KFYA 4YFUA 2LXUA 2XZWA 2YNHB 1UVNA 2J5AA 4O3SA 4DV5F 4KB7A 1HBUB 2OH2A 3KHLA 3BN4A 3PW5A 1N5TA 5KT6A 1UJ6A 2OP5A 1G2EA 2DH8A 1Y5LB 4E8UA 3TQ1A 4CIOA 4M8LA 3A1YG 4PR6A 3J7ZT 4OIXA 1QSSA 3IR7B 1UWBB 1GAOA 3PX6A 3BGRB 5MAOA 1SJ1A 2M7SA 2DNRA 3K7RA 4FS2A 3V6JA 3ETOA 5KFOA 1S0OA 3HHLC 1UAWA 5LSLA 5KG0A 1NAQA 2ZNYA 3DOLB 1SKRA 1SL0A 1YGYA 1YRTA 2AJ1A 4ILRA 3DRXA 1Y9OA 5T7LA 2R7QA 3GYNA 4NCGA 2VV5A 4JI8F 3CCSS 1F0XA 3DXSX 2W4CA 4Y34A 3CCJS 2BQUA 4DOZA 4PUOB 1NJWA 3FFIB 1N54B 3LP1A 4DL7A 4Q8EA 4ZCIA 3BQ1A 4OLOA 4QWCA 1RT2B 1BQNB 2AYGA 4K50A 1CQMA 5F9NA 2ASYA 2HG4A 3I0SA 2UP1A 2LVWA 1RTDB 1CEZA 2CPHA 2EK6A 3BQ2A 4NL5A 5KFDA 1H2VZ 1VIXA 4ES1A 1VQ5S 1RA6A 1X4BA 3KFWX 3G6YA 2JEFA 2FPHX 3JSMA 4DFKA 1RTJB 4O3OA 1QTMA 2R8JA 2DHSA 1JNRB 1JLQA 3FSYA 2E29A 1TL4A 1IBMF 4NZ6A 2M5YA 3ISZA 3PX4A 3MPYA 3MAHA 1VK3A 2B51A 2ZDOA 2VOOA 2JFDA 3Q2TC 3U1LA 2HHXA 4KHRA 3TA0A 3DHXA 3I5BA 1L3SA 2EG2A 4RLEA 2K3IA 2EI5A 2OTJS 3Q8QB 3U27A 3VAKA 1HBMB 3B4DA 4N8NA 2JL9A 3C2PA 3MTKA 1RISA 2XNRA 2MZJA 2Y1JA 3CT9A 1DRZA 2KRBA 1SC6A 5E3PA 1C1CB 3RRGA 1WHXA 3N6MA 3O1LA 2IMOA 5K8PA 4ECZA 1QAJA 1Q82T 2MZRA 1X0FA 2C3YA 2HLUA 2ZHAA 2BDPA 2W7AA 5EX3A 1CVJA 3BSNA 2RMLA 1TV6B 3SCLE 3CB4A 4I69A 4KKOB 5J1EB 4DV1F 3SCKE 3DFEA 1QUVA 4QR2A 3I31A 4DLEA 3TR5A 4CCHA 1FK9B 5GAGU 4RW7A 3OTOF 4ED5A 1XTZA 4JI4F 1Y4ZB 4NLVA 3X3UA 1QY7A 1J5EF 3VZIA 2C2DA 2AGQA 3PRDA 1DFDA 2JJ4D 1D0EA 1FTRA 1SUQA 4ED1A 3R5AA 2XSJB 2DR8A 2VQFF 1F5BA 2E5HA 3FGVA 4JI7F 5KFGA 1H7WA 3OUYA 1FJGF 2IRXA 1WTBA 2K7KA 1S9GA 1P1LA 1WHWA 4FVCA 3V4MA 1V3RA 2A2DA 1KTVA 4DFPA 3DRRA 5J2PA 1LQ9A 3IO1A 1UL3A 4DR7F 2W4PA 3GE9A 1CG2A 3OFHA 3TANA 2ZC3A 4K59A 1HI1A 5KFXA 1VQ9S 2Y0SD 5E3RA 3VAJA 2ZH6A 3UD4P 4NLQA 2JVRA 4MFBA 2WB4A 5I3QA 5G4DA 2HNYB 3HHNB 1S1WB 3CE8A 2OSQA 5HBMA 1WG5A 4DG1A 1VBXA 1N56A 3FQKA 3GB0A 1QE1B 3LP0B 4MKBA 1WEZA 4ZK7M 4FBUA 4ELVA 2CQ4A 3M2VA 4FF3A 4C8KA 4DDFA 1SV5A 4QR0A 3K59A 1C1BB 5LT5A 5KFHA 6FD1A 4ECTA 1FRLA 3AH6A 4I6AA 3W7BA 3JYTA 2B4OA 3AQPA 4LFAF 1RTHA 3IRXB 4ZVEA 5C25A 3PW7A 3MMCA 1W25A 2WAQD 3AB2B 3SDEB 2D41A 2CDQA 4NZ7A 1JLGB 2PMZD 3G96A 1U1KA 1NK4A 4X4PA 1UVJA 4R5PB 3CIMA 4TQRA 3H2VE 4PKDB 3AY0A 2EFQA 1Q86T 3SEOA 2QLWA 2W7PA 2CQCA 5E5NA 2V8VA 2HVHA 4X62F 3ULHA 4C8LA 1VQPS 4RU9A 3ITHA 3SYZA 3NLCA 3PNIA 1YSJA 5E41A 1JIHA 2BR0A 2DNNA 2M9KA 3ISNC 3TX8A 4NLDA 2AD9A 2LYVA 5KFEA 2DNKA 4RNHA 3QWPA 1F9FA 1LW0B 2L9WA 4KQZA 4WXWA 2ZKTA 2DGVA 2VG5B 2V4JB 1KONA 2XS5A 5E2QA 2L9NA 2W9CA 3NBPB 2M8DB 3GR1A 1C0TB 1FRHA 1HMVB 4G1QA 4H54A 1NKCA 2GQ2A 2RQMA 3T19A 1YJ9S 4KV8B 4QYZJ 1Q81T 3K0JA 3D1OA 4BDPA 5L1KA 3CJ2A 4LQ9A 4ETXA 1MROB 4BHQA 2XLJA 2GGPA 4AXIA 3T5LA 3MUTP 3RAXA 4V19X 2R7WA 3HK2A 1N5YA 1WACA 3TVYA 1CC7A 4X4QA 2P9EA 2AJQA 3IS9A 4YB1P 2FJAB 3PFEA 2E5IA 3MEDA 1WF1A 4LUBA 5BR8F 4DSKA 1FJCA 2UVUA 1E6VA 2WONA 3DGPA 5EGYA 3OSPA 1HBOB 1S1UA 1FKOA 2G9OA 3MWBA 5G0RA 3UCGA 3CTRA 4K4XA 2FJXA 1HNWF 4LSNB 2KKHA 3AJ1A 4XPEA 2B4UA 1DLOA 1XMBA 5GADU 4W92B 2HW3A 3V6HA 2POKA 3OR1B 2O67A 2DRBA 2KXFA 1HWIA 2ZVSA 1X9SA 2MQMA 4BBYA 4CT8A 2V8DA 2ZH3A 5A0YB 2BM1A 1XEZA 4ZVFA 2DGUA 2GO9A 2NS1B 1DQ8A 4O4GA 4N76A 2GIRA 3DMJA 1V9OA 3HI9A 1HNIA 3QGPA 2YTCA 3RB4A 4EBCA 4HTJA 3SQGA 3MHYA 3SV3A 1RWUA 4B9SA 4CZCA 4YQWA 1BC6A 1U24A 1HWLA 1FDBA 1UJ5A 1D9AA 1WHVA 4TY9A 1NK5A 2QA4S 1HW9A 4W90B 2KO1A 3HHLB 2MKJA 4ELUA 5KFWA 2XWYA 3K8WA 2VG7B 4Q2MA 1HYSA 2P6TA 5K8OA 2MZQA 3I55S 1WNEA 5HMWA 4RNNA 3QGHA 2R9LA 3VAMA 1N34F 3PRBA 2KZZA 2RRNA 2N4DA 1X9WA 3F44A 4KGKA 3TA1A 3MMAB 3PEHA 3CXCR 3RBEA 3M30A 2MKKA 2QA1A 2CFXA 4LF4F 1KNZA 4NCAA 3BB5A 1VQNS 3THVA 3KOAA 4XPCA 5K14B 3MUMP 4HI2A 2L