2J0QD

The crystal structure of the exon junction complex at 3.2 a resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
89
structure length
89
Chain Sequence
PQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Exon Junction Complex Reveals How It Maintains a Stable Grip on Mrna.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ATP-DEPENDENT RNA HELICASE DDX48
total genus 16
structure length 89
sequence length 89
chains with identical sequence G
ec nomenclature
pdb deposition date 2006-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2j0qD00
2LA6A 2LKZA 1WEYA 2DNYA 2L9WA 1VQ7S 2MKIA 4C7QA 1VQMS 2MY8A 1H2UX 5DDPC 2MGZA 2YWKA 2XS2A 3BEGB 4F26A 1S79A 2CPDA 3N9UC 2MKCA 3UCZP 3NNHA 1FJCA 2E5HA 2CQDA 3JB9k 1U1MA 4F25A 3NNAA 2KVIA 3NS5A 1KQSR 2MKHA 3H2UB 4ERDA 2DNLA 1KC8T 4CH1A 2MHNA 5CYJA 3V4MA 1A7GE 2MQNA 2X1FA 4ZKAA 3VAHA 2DGTA 1X5SA 4IOAQ 2DIVA 1H2VZ 5GAHU 4ED5A 3HI9A 1X4AA 1RK8A 2AYGA 2KM8C 2N7CA 1CVJA 3CCJS 3S01A 3FEXB 2D9OA 2CQ2A 1FNXH 1PO6A 2ZJRQ 3IWNC 3ULHA 3TYTA 3NNCA 2JVOA 2JRSA 4FXVA 2LCWA 1Q81T 3EGZA 1VBZA 2CQ1A 5LJ3Y 1WI6A 2F9JA 2F9DA 2M9KA 4WF9Q 2DITA 3S6EA 2LEAA 1JJ2R 4W90B 2CPJA 3CTRA 3MD3A 4OZ1A 2DH9A 2QEXS 1WELA 3CULA 4CIOA 1NJIT 1S72S 3IRWP 1X4HA 1YWXA 2YH1A 1Q86T 3UD4P 2KXNB 1R8HA 1B7FA 1VC5A 2F3JA 2EK1A 1X4CA 2KU7A 1U1KA 2OTJS 2DNGA 2DH8A 4CQ1A 1VBYA 1VC0A 2E5JA 2HGMA 1N88A 2Q79A 2K8GA 4J5OA 2KFYA 1SJFA 3K0JA 3CCVS 1QM9A 2YH0A 5LXRA 4Z2XA 2PEHA 1SJ3P 3G6ES 1ZZFA 1IQTA 3VAJA 2NLWA 1SJ4P 4PRFA 3H2VE 2KM8B 1SXLA 3G8SA 2MYFA 2RNEA 2I2YA 1YHQS 1VQ4S 5GAGU 2ERRA 4U67Q 3MI7X 1D8ZA 5LSOA 2M0GB 3RW6A 1FJEB 3R27A 2CQ4A 1VQNS 2XNRA 1U1OA 2MB0B 4M5DB 1K9MT 2HVZA 1VBXA 3THPA 3CC4S 3SMZA 2KT5A 2DIUA 4W92B 1R8PA 1YI2S 2LXUA 1X4DA 1WG5A 2CPZA 4YB1P 5D78A 2XB2D 2DNRA 2DK2A 5GADU 3PIPQ 1UFWA 4WKRA 1DBDA 2CQGA 1F9FA 5BJRA 2DO0A 3MXHP 2GO9A 1UP1A 2DGSA 2M2BA 2X1BA 3G8TA 1Q82T 2CPFA 1W2BR 3ZZZA 2SXLA 2MQLA 4OZ0A 1H2TZ 3UWTA 3LPYA 1ZH5A 5DDQC 1VQ6S 4CH0S 2CQ3A 2MSTA 5HL7Q 3D2WA 2KRBA 2L41A 2DGUA 1K8AT 1WI8A 3THTA 5DDOC 1YITS 2CQPA 2OIHA 2LEBA 1U1NA 2KH9A 2KHCA 1OWXA 1X4GA 3CCES 2M8DB 1WG1A 3U1MA 3I56S 2LECA 4YOEA 4WFBQ 5IQQA 1FJ7A 2DHAA 5EN1A 4TLQA 2FC8A 3LQVA 4PR6A 2N82B 2MKSA 3J7YU 5CXTA 2KN4A 1O0PA 2RUGA 2RRAA 2AYBA 3VF0B 4BS2A 2G0CA 2U1AA 1VC6A 3SXLA 1WWHA 2U2FA 2MZTA 1VQPS 2MKJA 2HZCA 1U6BA 1D9AA 3CCQS 3VAIA 3TO8A 1DHMA 1JMTA 2J8AA 2M4MA 4TU8A 3B4MA 2CPHA 2RS2A 3BO4A 2CJKA 4C4WA 1WG4A 2KXFA 1H6KX 1VQOS 2CPYA 5GAEU 2AYEA 2BZ2A 2WBRA 4WIIA 4WFNQ 2MMYA 2LA4A 1X4BA 2VONA 2MJNA 3SDEA 2MQOA 2O3DA 2J76E 2KG0A 1YJ9S 2MSSA 2B0GA 2QFJA 2ADBA 2DNKA 1U1QA 4RU2A 4QU7A 3CF5Q 2RS8A 5LJ5Y 1U6FA 3UD3P 3MUVP 1UAWA 2MZQA 4LIRA 2OJ3A 5DDRC 1OIAA 1WEZA 5HO4A 3CD6S 5D77A 1FT8A 1A9NB 1NU4A 3UCGA 2MZSA 1DZ5A 2XNQA 1RKJA 2JWNA 2DNMA 1WF2A 3CCRS 4Y0FA 1X0FA 2PE8A 1X5TA 3ZZYA 3CCMS 2EVZA 3BS9A 2JVRA 3P49B 5IM0A 2M8HA 4IUFA 2QA4S 1YJNS 2JX2A 1X5OA 2BOPA 4V19X 1ZZNA 3S7RA 1YIJS 4QQBA 1WHYA 3J7ZT 3CUNA 5IM0B 3CCUS 3G9CA 5ITHA 5JVGQ 3PIOQ 5GMKa 2RT3A 2VODA 5CA5A 2DHSA 3CXCR 2YKAA 3CPWR 1U1RA 3EGNA 2VOPA 2ADCA 3VAKA 3CC7S 2MXYA 1P27B 1G2EA 2NZ4A 2YTCA 3S8SA 2DGWA 4IO9Q 3TP2A 3P5TL 3MURP 2OSQA 2MQPA 1L3KA 3VAGA 4YUDA 3CCLS 1DRZA 2M7SA 4A8XA 1JJHA 2MZ1A 3UE2A 2KXHA 3MUTP 3RW7A 2HGNA 1M90T 2HYIB 2XSFA 1X4FA 1N52B 1VQ9S 3Q2SC 4F02A 2MZRA 1OO0B 2DH7A 2VOOA 1FO1A 2LQ5A 2AYMA 2DB1A 2DISA 4IOCQ 3VAFA 2XS7A 2CQCA 1YTYA 1WHVA 5MLCV 1M5VC 2FY1A 1VQKS 2MQMA 3CC2S 1VQ8S 1KD1T 1UW4A 1VQLS 2DGOA 2N3OA 3US5A 1M5KC 1QVFR 1SJRA 3G96A 2DHXA 2G4BA 3DXBA 3MOJB 2RVJA 1PGZA 3P6YC 2CQBA 2OSRA 2DNQA 1HL6A 4PKDB 1WTBA 2MQQA 2HGLA 2FC9A 2ZJQQ 2FHOB 4Y00A 1U1LA 2M88A 3G4SS 2X1GA 2X1AA 3EX7B 4LJMA 2CQ0A 3SDEB 3L3CA 1QVGR 5FJ4A 3CCSS 3CMES 2CQHA 3DLLQ 3NMRA 1OPIA 1U1PA 2DHGA 1KOOA 1BY9A 4UQTA 2RRBA 3OW2R 3FEYB 2DNHA 1NO8A 1K73T 2MGZB 1VQ5S 1HD1A 2MJUA 4TU7A 5JVHQ 1M1KT 2D9PA 1FHTA 1M5OC 1WF1A 2DGVA 2MKKA 3I55S 3G71S 1AUDA 3NS6A 2RQCA 3CMAS 4QU6A 2FPHX 2LYVA 2A3JA 4LMZA 5DETA 3R1LA 2EK6A 2DNZA 1M5PC 1U2FA 3R1HA 2DO4A 2MPUA 5LXYA 1HD0A 3BO2A 2KRRA 4TU9A 5DM7Q 4QPTA 1XN9A 2RQ4A 2MZJA 3VAMA 4C0OC 2E44A 1Q7YT 1JJ4A 1WHXA 3MD1A 2KG1A 2I38A 2G1DA 2MY7A 3HHNB 3MUMP 4WFAQ 1WEXA 2KYXA 1SJQA 2ZJPQ 2GHPA 5LSLA 1N8RT 2K3KA 2V94A 2DNNA 2D3OR 2CPXA 5GVQA 2RU3A 3B4DA 1X5PA 1P1TA 2DNOA 3U1LA 4FXWA 1URNA 2J0QD 4P6QA 4EGLA 1WHWA 3VALA 3UCUP 2XS5A 1HA1A 1KOHA 2CPIA 1X4EA 2DGXA 2DNPA 1WF0A 2DGQA 2M52A 1FXLA 5IFMA 5DM6Q 2M70A 3BO3A 4UY8T 1N54B 3MDFA 4WCEQ 2N3LA 1YJWS 2OTLS 2UP1A 2CPEA 2J0SD 2E5GA 3Q2TC 3P3DA 2KI2A 2AD9A 2CQIA 2E5IA 2LMIA 2LXIA 5H1SV 2L08A
chains in the Genus database with same CATH superfamily
2LA6A 3CO9A 3DMJA 1VQ7S 4TYAA 1RKIA 2OEJA 4ILRA 2Z56B 5HAOA 4JI6F 4C7QA 4XPCA 1S10A 3PW7A 1VRUA 4GKJJ 1B0PA 1H2UX 2FHJA 3MAHA 4NXMJ 2J7WA 4IRDA 3TX8A 2XZDB 3FCVA 2K1RA 3HHLD 3M1VB 1Q79A 3MEEA 1RUSA 4RO0A 2V2ZA 1HBNA 4KQZA 5M2RA 3VHQA 2RDJA 2QFIA 4DF4A 3PO4A 3N9UC 1HIYA 4I69A 4CLSA 5DRKA 2E5HA 3PHEA 2X3GA 2JEFA 4X4QA 2CNLB 3D5MA 3OVBA 2GIFA 4IOBA 1VYAA 2FHMA 4P10A 2YNHA 1TUWA 2F4VF 1LWFA 1VHFA 3D4JA 4ETXA 2XY7A 1X9WA 4DQPA 3W3SA 3DCAA 3CT9A 4UOHA 1XR7A 1RLCL 5B0BA 3SSQA 1IBLJ 4K7QA 3WC0A 4ZITA 4CH1A 1RTDA 5CYJA 3JAMU 1G7CB 3SCLE 2ZNYA 2IYGA 2MQNA 2PMHA 3HX9A 1S0VA 1NSPA 1C2PA 1AT1B 5ETPA 5DO2A 5KOXA 5M2UA 1NSQA 1NHVA 1VR6A 3TQ1A 3HKZD 2IA6A 1X5SA 4LVNP 3J81U 1NDCA 1Y9OA 4X4NA 3HFKA 4AUKA 1H2VZ 4NLXA 4N8NA 4IH7A 3BKTA 1MW7A 2Y1RI 4B3MJ 1GMUA 4IFVA 3MPVA 2KM8C 2BX6A 3O6QA 2N7CA 3NAIA 2ILYA 2P9EA 1Q7LB 3I4HX 3O3LA 2IJFA 3CWJA 3DLGA 1D1UA 1WC3A 3FEXB 4V19J 3W62A 4RPFA 4ELVA 2V6AA 2KB2A 4ZDNA 1QAXA 5EDWA 4MK9A 1NK4A 1CPZA 1RAAB 3TYTA 4OFZA 8RUCA 3VCDA 2CNNB 4RJVA 1SBRA 4PQAA 2NXUA 4M5NA 1PYOB 5T7LB 2R8JA 2E9ZA 1NKBA 1VBZA 3KLFA 4CCHA 2C3MA 2NSCA 2OPSB 2Y0SD 3G2XA 4OJHA 5LJ3Y 2R8HA 5F8MA 2CG8A 3ITHB 3RJMB 4AD6A 3BGOP 4KHRA 3GLJA 3DDIA 3PYDA 4NZ7A 1TZ0A 3VVUA 3KLEB 4LFCF 2LEAA 4IYQA 1Q16B 5B0AA 1SUQA 2CPJA 2HQIA 3MD3A 4I68A 2BBEA 3DGPA 1FNMA 2DH9A 2F8MA 3IG1B 4OZ1A 5ETOA 4CI0B 1NJIT 2QEXS 1OJ4A 3PRBA 1QSYA 1BWVA 1U24A 1RBAA 4H54A 1KRPA 2D3UA 4RW9A 3Q23A 4PUOA 4DL0C 3B78A 3NCPA 2K1RB 3BSCA 3PRVA 3T5KA 1X9SA 4LRBA 4USUA 1KQKA 2GMJA 2X51A 1MMLA 1CJTA 2C2NA 2YWFA 1FEHA 2J5AA 3DLEB 3L7PA 2J6TA 3QPIA 2VV5A 3BGLA 4KE5A 1V9OA 2CWXA 1U1KA 3GPAA 1T9WA 2C22A 1RYRA 4NYPA 2ZBPA 4CQ1A 4ZP8A 1VC0A 2VZ9A 2E5JA 1IKYA 1IM4A 3UQSA 1IWGA 2KFNA 2RD5C 3I82A 2Q79A 3PYEA 3D66A 2KFYA 4ZN1A 5C25B 2YH0A 4H4MA 5LXRA 1N36F 1VOMA 2H9ZA 3KLIA 4OV6A 3LW5C 3G6ES 3DDKA 1IQTA 2DEJA 4J9UE 3PKYA 3MR3A 3K2YA 4ZLJA 2HQCA 4DUZF 2BV3A 1WUUA 4ZPAA 2MYFA 2IBOA 2B5JB 3PJ9A 3W1YC 5T14A 2WSEC 4J9RA 3GIMA 4J9MA 2RNEA 2R7QA 3CGIA 3Q89A 4MFBA 5CZXA 3RZAA 2I2YA 4MIBA 1NJXA 3G6YA 3ZZRA 4FN5A 5I3UA 3CCWA 4Q2MA 1ZA1B 2VBXA 3BBBA 1JLBB 2LXFA 3C14A 3O5TB 4DPXA 1Y5NB 3PRDA 1M5SA 1F5BA 2VF3A 2AU0A 1FJEB 1D0EA 3VV2B 2HAIA 4NCBA 3UDLA 1BC6A 1C1CA 2VBYA 1KFDA 1BQMB 5D15A 4C3MA 1WACA 1Z2LA 1CBKA 3MCNA 4G65A 1YSJA 2FGOA 3E01B 2YQ3A 2ZH5A 1W26A 2YWEA 1RBLA 3KFWX 3O8WA 4C98A 4ES3A 5KFNA 4ZJQA 4M95A 2KT5A 4ZVRB 4F3MA 4K50A 1WG5A 2CPZA 3ENVA 4M5MA 1RTZA 3W64A 2PGCA 5IC6B 1Q8KA 3A4TA 5DG7A 2K3IA 3M30A 2PMZD 5HMWA 3BGRB 4HVZA 1VK3A 4TNOA 2UXBJ 3DKDA 3MEKA 4XDCA 5F0UA 5F41A 4I6YA 4DS5A 1EKRA 4NZ6A 4ED3A 2EKNA 3AJ2A 1J5EF 3MMCA 3THVA 1NJYA 2RJZA 4X66J 5J1EB 2YNIA 3CMQA 4U95A 2UXCJ 2BRLA 3MXHP 4J90A 4M5KA 1DFDA 1DTTB 2DGSA 3G8TA 3IO1A 3ONQA 3I5CA 1FRHA 4IQMA 2J6SA 3ZZZA 3PJWA 5KTQA 2OPPB 2JLGA 2XMWA 3KLGA 2VPYB 1KVKA 3UWTA 4U6PA 4QW9A 4M63A 1WKKA 1KHWA 1PYTA 5DDQC 1RHUB 2BJ7A 3BGFA 3VGTA 4CH0S 3QLHA 1HQUA 3Q8RB 1XWLA 1EJ7L 1X31C 1G4CA 4F04B 2UU9J 3L95X 5DDOC 4DV1J 2E7VA 2CQPA 1U8WA 2R42A 2H51B 1G3OA 1XBWA 2KHCA 2Z2YB 1OWXA 1R43A 2B4PA 4C8OA 2HFVA 2M8DB 4FF4A 3D0HE 2BXJA 3QT6A 1T02A 4NA1A 4QWDA 2LECA 4YOEA 1IQZA 3R7NB 4DQRA 4KGVB 1F1BB 2VA2A 1WORA 1VIOA 1A0OB 3K5PA 5E33A 5IQQA 4KGKA 1TK0A 2DHAA 2FC8A 2GAHC 1SH0A 2XBPA 1R0AB 2OPPA 2XGQA 3ILJA 3HDSA 1XMOF 4B3OA 1G1XA 3KLHB 4K2JA 1AXQA 2W2PP 2HBYB 1GX5A 1N56A 2RRAA 3VF0B 3DLBA 1PJ6A 5A6PA 1NK0A 3HSJA 5K14B 3RRKA 3SXLA 4DV6F 2D3ZA 4F36A 1VQPS 3OPKA 1OYEA 2EFQA 3BQ1A 4K0KF 1HYSB 1N5TA 3R6GB 1FDAA 2HK2A 3Q8YA 4NLGA 5A8RA 4DL3A 2R4FA 2ZE2B 3SSRA 4I7FB 1PILA 4FXDA 1VISA 3BO4A 3G8QA 3M6XA 2HAFA 3R5AA 4YB6A 1WG4A 3PM9A 1ZBTA 2H48B 2CPYA 5CD4A 4KV8B 2AYEA 2ZBIA 4WFXA 4FNHA 3RB4A 3JSMA 1S0OA 1HNVB 4XDDA 5DQIA 5EUHA 3PR4A 3IC1A 3GILA 4FPRA 1VK8A 2Z4PA 1D3WA 4WFNQ 2LA4A 1X4BA 4RNHA 1YRUA 5AJ3J 2XS2A 1JKHA 1MWYA 1SVDA 1XTZA 5IC4B 5KFHA 4I56A 5C42A 1H7XA 2VBWA 1B7YB 2KG0A 4UOFA 1YJ9S 1HW8A 1FE4A 1XNQJ 2B0GA 3J81j 1X7VA 3OUYA 2HNDB 4RU2A 1K1SA 3K7RA 1QTMA 3DOLA 1JNZB 3LGMA 4NLTA 1ZYQA 4JI6J 3G87A 4DQQA 1GT8A 2Q3PA 4HDHA 2AEFA 3UVJA 4UUWA 3MM6B 2EC0A 1UAWA 4M8LA 2XMJA 3EZUA 4JI2F 3DRPA 3AXKA 1UWAA 1C4CA 5DDRC 2AJ1A 2OJ3A 2BACA 3AAWB 1CJUA 4HHHA 5H9EJ 2VBZA 1PSDA 3IA0A 3KK3B 2YNGB 3AJ1A 3I6PA 3TVYA 1A9NB 5EHHA 4B9VA 1DZ5A 2MZSA 4OZNA 3LH2S 1Q8IA 1BXNA 2DY1A 3MF5A 3NOGA 2JWNA 5CHCB 4PABA 3PACA 4KRWA 3K89A 1AFIA 3V2UC 2DCLA 5FD1A 3NS7B 1NKCA 5CYMA 1LQ9A 3F0NA 4K4TA 2KZZA 3BM7A 4OHXA 2HS0A 2LU1A 3CCMS 4ZVOB 2HBQB 3DM2B 4JV5F 4RW9B 2Y1IA 2YKPA 1LV5A 4G1QA 5KT2A 3VZHA 4ZVHA 3GIRA 2ZWOA 4CT8A 2R7UA 3IBCB 2AX0A 3IGNA 2M8HA 4UF4A 5IM0A 3MR2A 2QA4S 1YJNS 1KLNA 1X5OA 2XLJA 4XK8C 4TY8B 2ZITA 3EZOA 2W2OP 1U0HA 3HFVA 1W7WA 3N79A 3S7RA 1YIJS 1UJ4A 2B51A 1MSWD 4QZVB 3A8EA 3IFEA 2VDIA 3R7BB 2CAJA 3M1VA 4L75A 4CLLA 4P71A 3KLFB 3G9CA 1LXNA 1S1XB 1URRA 1ZOTA 4DV3J 2GNKA 1W2BR 4OYBA 2HPUA 1I3OB 1NXIA 1O51A 2YKOA 7AT1B 3SV4A 1N33J 4OQJA 2EBEA 5GMKa 2RT3A 3SCIE 4OX9J 1FJ7A 3TJAA 2DXDA 2HRUA 1LXJA 4I2PB 5CA5A 1Y4ZB 3H4BA 5K8NA 3CPWR 3P96A 2BRKA 4NLQA 4Y2KA 4DI6A 2OKQA 2YNHB 2AZ3A 2EI5A 2IVMA 3FEZA 4M94A 4FYVB 1RWKB 3O1LA 5CABA 4PUOB 4FBUA 3UW1A 4USIA 4AYBD 1Q5VA 1YVFA 2HWHA 3BH6B 4KAIA 4WK3A 1GQEA 3CEDA 3JS9A 5L1JA 5EWEA 1DY3A 1U47A 4DV0F 4RBUA 1E6VA 3AFGA 3KXDA 5F8HA 3NGDA 1Y5IB 4NPOA 2BQRA 4C8LA 1N33F 1FWPA 2IVYA 2MHEA 1J5EJ 3PCOB 5A8WB 4J9SA 1Y00A 4DV6J 2BE9B 4DPUA 4DX6A 3F56A 1RWNB 1EB0A 4CZCA 3W61A 4GKKJ 3OFEA 1T3OA 1HQEB 1TL1B 2MZ1A 3QSYB 4Q2LA 1FFSB 3MAQA 2VA3A 4DSIA 1FX4A 4HHUA 4NI2B 2ZH6A 3W9JA 2UUAJ 4CO5A 3IGVA 1MWZA 3V4IA 2XSFA 3R5JB 4EUVA 1HHQA 1HQUB 1VRTB 2FJAB 4ZHRA 2MZRA 4Y3CA 2DB1A 3TQEA 4AL6A 2V8HA 2WSCC 3NAHA 4IOCQ 1LWEA 4OIXA 3VGSA 2GC8A 3CJTA 4F2SA 3HK2A 3R5DA 3DYAB 3M4XA 4B08A 1RAIB 3KK2A 4A8QA 3ITHA 3JTOA 3LP2A 4WTOB 4U8VA 4ED1A 5K20B 1BWEA 4WP8A 4QW8A 1KD1T 5HANA 2JSXA 1S6PB 3ENAA 3K5MA 3T5LA 3QRRA 2QLWA 5E0OA 2N3OA 2RUSA 3KK3A 3US5A 1M5KC 1VI7A 2IIHA 3NG8A 2H5JB 4DLGA 4AXIA 3SSSA 4UZCA 4NLUA 3MR5A 1NJZA 3AT1B 1FCAA 3QATA 1SQEA 4CM2A 2RVJA 3P6YC 2PA3A 3QJJA 2CQBA 3WQPA 3ZTOA 5KFWA 1U48A 2PA8D 4FDFA 4FZVA 3NNCA 4GVBA 2IFXA 4PG8A 3C15B 3GV8B 1R3NA 4DV7J 3G86A 2CJXB 1KFSA 2YBVA 3PEJA 2H54B 3D28A 1HNIA 2XLKA 2YKMA 4U7CA 2OGUA 1LW0A 2FHOB 2EG1A 1FEEA 1VQYA 3FUYA 4Y00A 5B0CA 5IXUA 1U1LA 4NXMF 2ASLA 3CJKA 2F65A 3WX8A 2G1HA 5E7OB 5KG0A 3NCQA 1RI7A 3GJTB 1UA0A 4IRKA 5ETMA 3HF5A 4F7VA 3MEDA 4L76A 1S4EA 3FVYA 1PC5A 3OL7A 3RTVA 2KJWA 1YI2S 3CMES 3MMBB 4GO5X 4LF9J 2W7OA 4OX7A 3D9BA 3LPEA 4RZRA 3DMJB 4A8MP 1U1PA 3KG1A 4KC5A 1BY9A 1HMVA 4K4SA 3V81B 3MWBA 3OW2R 3T3FA 3FEYB 2BKPA 1NO8A 3UD5A 3CJ2A 2WK4A 2ZUGA 2MGZB 1K73T 2HHSA 4DSEA 4I67A 2JHEA 4HTIA 2CIMA 4PG7A 5E3AA 4URSA 3UPFA 4WIQA 5JVHQ 4ECWA 2D9PA 5K8MA 4JI7F 3MCOA 3D0GE 1HMVB 2MKKA 1S4FA 3I55S 4WE1A 3FSIA 2ZHAA 2AKWB 1AUDA 2FPHX 2LYVA 3J7Z5 2A3JA 4ZPCA 5DETA 5KFBA 4CRJA 2DNZA 3EDRB 1S9EB 1K0TA 2H4WB 2HVEA 3DOKA 2QT7A 3TR5A 5LXYA 4OX8A 2HQ3A 4ECUA 2ROPA 2HVDA 1P6TA 2R7XA 3NLCA 4LF6F 4OHYA 2RQ4A 2GW8A 3GFHA 4ANEA 2G2ZA 4ZN3A 3KLHA 4CO0A 5L1KA 1LWXA 2YX7A 4PWUA 2XC9A 2FY8A 3I0SA 4FVMA 2NYIA 1HNZJ 2IPOB 1S48A 4A8SA 3MD1A 2UVVA 1DURA 2BUNA 1RT7A 1B0VA 2G1DA 2QYGA 4ICLB 4E8UA 4ELUA 2QLBB 3HHNB 1H7WA 2XQCA 1SC6A 1WEXA 2ZDPA 2HHXA 2I5JA 2XSJB 4RUAA 5CD4H 3C16A 2FDNA 1CJTB 1TKZB 1DLOA 4DPOA 3ILLA 3QZ7A 4DV2F 1RT3B 1HI1A 2GHPA 4KGMA 2V94A 4N77A 4JBCA 4C8MA 5F8JA 4FP9A 2NUHA 5GVQA 1FK9A 3B4DA 1F9EB 3FQLA 2RU3A 1KQFB 3FBCA 2GS8A 2IMWP 1SJ1A 1X5PA 2I5JB 1EP4B 1P1TA 1E6VB 4P2XA 4EBCA 4B9NA 1HNIB 3QT7A 4FXWA 4MK7A 5DG9A 4LF9F 1Q8LA 2YKNA 2PC6A 4DL2A 3MEGA 3D6HB 4EBDA 3HZGA 1X4EA 4OX6A 1UPPA 3MM8B 2A2DA 1TKXB 1RT2A 2GJFA 3BO3A 2DBBA 3PNIA 3MR6A 4CYUA 3MDFA 3JSRA 1KHVA 2N3LA 3DRSB 1U09A 2OTLS 2ZBQA 2HWTA 1WKLA 4ZVGA 4NCAA 3M2UA 4CLWA 2R2RA 2CQIA 4OZ2A 2QJ3A 1KNZA 2LXIA 4Y2MA 5HROB 3LWMA 4OI2A 1OQ3A 3CDUA 1RISA 2IVFB 1NLKL 5H1SV 4KGZB 2LKZA 3PTWA 3W5YA 1T0TV 1T94A 2L9WA 3GYGA 4WFYA 4DR5J 5CAAA 2MKIA 1SL1A 4X84A 1OPZA 2OD6A 5IWAJ 1I5OB 3IBWA 3W8GA 1N5QA 3HCXA 4ANCA 1RTIB 1DTTA 1SL0A 2LFVA 4Y28C 2Z8QA 4PAAA 1MLAA 2BJDA 4F26A 4KY3A 1S79A 5CYMB 1CC8A 2OFGX 4JOUA 1RJJA 1UFKA 4ZVEA 4HKQA 1FJCA 1RABB 2EXUA 2HFNA 2QA4G 1UVLA 3MPYA 1N6QA 2CQDA 2ZHOA 3BGRA 4L6V3 1TFWA 4ZIVA 4LR9A 3IR5B 1U1MA 5KFJA 2Y0BB 3TZZA 4B3SJ 1FDNA 4F25A 4F4WA 4X4OA 1ZPVA 1TUVA 3NNAA 3LO3A 3O2IA 2MKHA 2YQ0A 2O67A 3Q86A 1NJWA 4ERDA 2B8PA 2LDIA 3SV3A 2G2YA 3BSAA 5FLXU 1GXUA 3MM6A 2X1FA 2RDDA 5AJ3F 1TAUA 5KFUA 4FF1A 3ADAC 1KP6A 4PG5A 1S1UA 1NNDA 4NMXA 4QWBA 1JLBA 3IM8A 2W2QP 1RTHB 2V4JA 2UZAA 3H5YA 2ZH9A 5KFYA 3C6UA 1R0CB 3M8PB 3KDOA 4ECZA 1RE1B 3HI9A 2QRRA 4ZMMA 3UN2A 4Q43A 1RK8A 1F5CA 2N4CA 5EX0A 2AJ0A 4N8OA 4OI3A 1YK9A 3CCJS 4DUTA 2D9OA 5GAGI 1TKDA 4Q0BB 2CQ2A 2AJFE 4Y65A 1PO6A 2RQMA 3OD2A 4L3KA 5JXSA 1XMQJ 4GC6A 3ULHA 3VQSA 2AGOA 4ZVPB 1CJKB 2D69A 2DEIA 2XSJA 4TQSA 4A8YA 1UTAA 3NXZA 3GV7B 1EARA 2D3O1 1KEKA 1CS4A 5A8KA 1IBMJ 3NL0A 5H9EK 2P6TA 4PWWA 5KG4A 5F3ZA 5D4PA 5B0FA 1EETB 3A8JA 3M6VA 5A2QU 3PYFA 2IJNA 4AL7A 2B43A 4J9QA 5EWFA 1OQ6A 2D1CA 1IJFB 4JI4F 2B6AB 1RHRB 3IAS9 3ET6A 4O3RA 2CRLA 4PQUB 1B70B 4QIEA 2F9JA 1TKTA 1X60A 2F9DA 4RW7B 4QR1A 5CYQB 4ETZA 4Z7CA 4WF9Q 1WC5A 3ISNC 2HZVA 5IV4A 3CTRA 1F60B 2BR0A 3BYRA 3IS9A 3OSPA 1WELA 4KHMA 4A8FA 4RUHA 3V5RA 4ZPWR 4GRSA 3CD0A 1HBMA 2WOMB 2XMVA 4H4OA 1JKHB 3VVTA 2AEMA 1DQ9A 1YWXA 3Q8PB 4FYDA 1Q86T 4C0HA 1YJUA 1NM2A 3PFOA 4F50A 4RL1A 2NZCA 3ILOA 1ZTWA 1R8HA 1B7FA 2RMLA 1VC5A 5H9FK 1F6TA 4P7TA 2F3JA 4JI7J 2YQ1A 2BQUA 4EYHB 1Y5LB 1U49A 3CD5A 5THWA 2WTFA 4K4YA 3AA8A 2DH8A 1YZ6A 2HRYA 3FZBA 1IR1A 2ZOFA 1VBYA 2CJAA 3CJ3A 1HNXJ 2UU9F 2AW0A 3EE3A 5J2NA 2K8GA 5J1NA 4ED4A 4J5OA 3K8WA 4DR5F 3MECA 3MPWA 4H4KA 4I6WA 1SJFA 1SKSA 2EG2A 3CCVS 1UVMA 3K0JA 4B9UA 5T7LA 1B4SA 2NREA 4X4PA 2GGPA 3CJRA 4K5SA 4OZ3A 4ZP6A 2AMCB 2MTLA 4F8RA 3HHDA 5LMUJ 5ETRA 1FTRA 2Z30B 4X66F 2KM8B 2GCFA 3AOBA 3FCWA 3D1HA 5HMZA 1RA6A 1QAJA 4A8OA 3KOAA 3W66A 1Y7PA 2QYCA 2VC0A 3E8OA 1DTQB 1TMJA 3MM9A 1QAYA 4HI1A 5B0GA 1RHMB 3UDEA 3DGPB 5B08A 1VQ4S 4YHHJ 4ILMA 4X2BA 3HD1A 3M8RA 2C2MB 4C6AA 3DHWC 4G1QB 3RAMA 4F0KA 5HROA 2P9GA 2HHPA 4KBIA 3CIZA 1FK9B 2M0GB 4NLVA 2ZE2A 3T1YJ 1I94J 5J2PA 2B9YA 2CQ4A 1VQNS 1S59A 2RHSB 4OLOA 3OLBA 2O5DA 1U1OA 4M5HA 5KFIA 1K9MT 3BYPA 3THPA 2NXNA 2BDPA 4YR0A 4ZIWA 3C6UB 4WXOA 3AY0A 2YX1A 2NXJA 3SQGB 2A6MA 3ET6B 4TQRA 4USTA 1AROP 4J7CA 5LM7E 1SCJB 2YKQA 3JYTB 4MKAA 4WBFA 3DOMB 3T19A 4YDDB 5DZ6A 2XB2D 4EBEA 2K7JA 1PCAA 5A76A 2VASA 3PIPQ 3OQ2A 1K0VA 1FFGB 4FBTA 3QGIA 1FX2A 1WDDA 2HLTA 2PN6A 3LAKA 2ZUAA 4ECVA 3DRXA 4DL5A 1C1BA 3TA2A 1IVZA 5BJRA 3GCXP 3H20A 3GIJA 3DOLB 1OY8A 2X1BA 1RA7A 3EYZA 3MAAB 1Q82T 1S9EA 1KONA 2BEFA 2CPFA 2R3VA 1HHSA 1JLQB 5D0HA 3DXSX 2VFRA 3T41A 5I3QA 2MQLA 3QWPA 2NUUG 3EVMA 4R8UB 5IT4A 4OZ0A 1ITPA 3DLEA 3U02A 4RNMA 2HG4A 1NSAA 1SQFA 1S6OA 2J9CA 2HRTA 2OELA 5CYQA 5BR8F 1BD6A 1PIEA 3RGIA 4QCLA 5HL7Q 1REVA 3UFCX 2RHQB 2WONA 2WB1D 4TVAB 5D3GB 2V50A 2DGUA 2L41A 2XCAA 2R8IA 1WI8A 1K8AT 4EI2A 3THTA 2F63A 2VPXB 3TAQA 3RYLA 3M8ZA 2OIHA 3HZEA 4DV1F 2APOA 2FLLA 5C25A 2ROGA 2QMUB 2WW4A 5ETNA 2I6WA 2PI4A 2QC3A 4QR2A 4RW8B 4BHQA 1L3VA 3CCES 4RWWA 4DR2F 4EEYA 3U1MA 4N56A 3QT8A 2W4PA 3EXYA 3JQKA 3P8BB 4LRCA 4UTGA 5FLXY 4F2RA 1HYSA 4OX9F 3FDSA 2CJ9A 4KYZA 2VJUA 3D54A 2B7CB 2RILA 4CLUA 3J81Y 5EN1A 4PYDA 2FJWA 1GNKA 2ZD1A 2VG7A 3W8PA 4XPEA 3D3BJ 4WZQA 5D0EA 1XK8A 2KN4A 1S1UB 1O0PA 3OR1A 1JLAA 2U1AA 5HMYA 1VC6A 1U0SA 2LQBA 1R0AA 1HWKA 1GMVA 1Q1KA 3HVTB 4M5IA 3W5XA 3K57A 4WXWA 2R7RA 3CCQS 2RU9A 1BQMA 1RLDA 3I32A 3K8VA 1DHMA 4URGA 4TU8A 5KAKA 1RWVB 2ZC3A 4IR9A 1IKXB 3GJSB 2CPHA 1HBNB 2JNJA 3CDEA 3D7SB 2CDRB 1F3VA 1NHUA 3UDVA 2NQPA 1RT3A 2KXFA 1H6KX 4B3MF 2G13A 3R5BA 4XO0A 5H9FJ 5GAEU 1X9MA 5A0YB 1X8DA 2BA9A 4EZ9A 3FK4A 1Y3JA 3I0RA 2BYCA 4WIIA 3WC2A 1ELOA 4RBTA 3KHRA 2JFDA 2MJNA 1N34J 4LFBF 2O3DA 2NXCA 5HI7A 3QO9A 2J76E 2VFSA 4O44B 2JEJA 3J7A1 1YLXA 4L3NA 3UI3A 1HNVA 1LWCA 1YBUA 2MSSA 2ZBRA 4FPIA 3HLUA 2ADBA 3NY0A 3DNCA 3QJPA 2JL9A 1SIZA 4E2FB 4QU7A 3CF5Q 1YGYA 2GVDB 2RS8A 3DOMA 2PFFB 1R6VA 3V4IB 3W63A 2WB4A 4FKXA 1ZM3A 2V8GA 3MUVP 1M5HA 2OPRB 4O3PA 4KT0C 2FJEB 2VG5A 2OEKA 3WIUA 1KWMA 2EBGA 5HO4A 2CVIA 1YBAA 2RRNA 2XCPA 2P5VA 2VQEF 2V4RA 3CD6S 3MAAA 4EO6A 4N5SA 6FDRA 4BS2A 1QY7A 5D77A 4EMDA 1IBCB 4CT9A 3FSXA 2ZH3A 2E1CA 1NU4A 1CC7A 5J2NB 2BQ3A 2RIJA 1RWMB 2XNQA 4NE9C 4NRTA 4NYZA 1QSSA 1FFWB 5AXNA 2FGCA 4KV8A 4USMA 3NMAA 2P8IA 3CCRS 2WSFC 2VD3A 5DQGA 2ZFHA 2ALYB 1CJKA 2HS4A 5JUMA 3ZZYA 3JYTA 4HL9A 2EVZA 2IC3B 3Q0AA 2HVIA 2NXEA 3BS9A 3P49B 4DR3F 2E5LJ 2R2TA 2BANA 2L3MA 3MMAA 1FESA 2UUTA 4NZ0A 4IUFA 3CDWA 3QYYA 2CJYB 2BOPA 3HSGA 2ZM6F 5MAOA 8ATCB 4DS4A 3AA9A 3ZTQA 4EO8A 4O3SA 2PO4A 3L9ZA 1WHYA 3CB4A 1H38A 3CUNA 4PXCA 5IM0B 2R7OA 3UDCA 4DCJB 2EFPA 3RG6A 2E9TA 4NLRA 1K1QA 2I8EA 5HVHA 2HSEB 4OHWA 1HWIA 3RAXA 2EPIA 5HATA 2DR5A 2R7SA 2IY5B 1JLGA 1UKUA 2GIQA 2JZ5A 2VODA 3MMBA 1ZTTA 2EW9A 2KKHA 3MGJA 1IWAA 3AB2B 3WIVA 3MPUB 2BKNA 2HQGA 2FJXA 2BMBA 2C28A 1BUXA 4OLPA 4UT4A 3HP6A 1VQSA 3KUHA 5K9FA 1CQMA 1DLOB 2ADCA 1AZSB 4M5LA 1L3SA 3DLKA 4KIAA 4NCGB 2DGWA 3DRSA 5E5NA 5JMNA 3OXGA 3ZZUA 1S6QB 3BJYA 4ECYA 1REGX 4G3IA 3E51A 4OYPA 3RR8A 4JI1J 3E2EA 3BN4A 2OPQB 1UVKA 3KWMA 3MURP 2V67A 4CO3A 3IBFB 2OSQA 2V8VA 5AXLA 4ZCMA 1UWBA 3PFEA 1L3KA 2W8LA 3QGHA 3VAGA 1DRZA 2B9XA 4EZ6A 4NXNJ 5DS7A 3DI6A 4JI2J 1LW2B 1Q4RA 2OH2A 4Y34A 2OPQA 5KFEA 3DLHA 2MQ8A 2AQ4A 3G6XA 3H42A 4OMFG 4EK2A 3MUTP 1SH3A 4DFKA 2UXDF 3QZ8A 4F4AA 3D6TB 4P74A 1N52B 3DLJA 1UVJA 1HQ2A 3M9NB 3M8WA 4D3HA 1QJHA 1FKAF 1FO1A 2LQ5A 2C3YA 2DISA 4WPAA 5B09A 2E5LF 2F4VJ 2GQCA 2AGPA 2OD4A 3PG9A 4LIWA 1FWKA 2C2ZB 1N6QB 2XS7A 1R0BG 2HMIB 1WHVA 1NDPA 1W2IA 3GYNA 3PO5A 1DQAA 1NDLA 1OMSA 2DR9A 5F8NA 4J9KA 3MM8A 2MQMA 1FKPB 1LWFB 4UZBA 3BQ0A 1M1GA 3CC2S 4GKJF 3GYXB 1VQ8S 3GP9A 1UWBB 3QRQA 4F4KA 1M1HA 2DCUB 1RTIA 1UW4A 2E1MC 2HNZA 3CSKA 4GO7X 4DV7F 3CIMA 4OJ3A 3W5ZA 4C2MA 4OI0A 1SJRA 1T7PA 5J1PA 4O23A 5D4OA 4J9PA 4J9NA 4DR4J 4LSZB 5DG8A 2CDQA 3MOJB 1JLCA 4DMZA 1F0XA 2XHCA 1KS2A 1TL7B 4J9OA 2FUG9 3TX0A 5KFKA 4DV5J 2DNQA 5U47A 1J27A 2HBRB 1MU2A 2KJVA 1RZMA 2E7XA 4QIFA 4ATNA 1R7IA 2O66A 4C9DA 5GMDA 3T9NA 1PAEX 2HHVA 5KFVA 4RUCA 4OI4A 3KJQB 4QIGA 4PWDB 1GK8A 1LWEB 5EGYA 1DARA 3TANA 1QLNA 1AW0A 1TL4A 4QIVA 5C5JA 5DLGA 3LF0A 1UW9A 1T05A 1QDUB 4GVBB 3A3OB 1FD8A 4ZHRB 1D9FA 4DL6A 2DD8S 4LJMA 2VKZG 4HI2A 4USHA 4C48A 1NZAA 3SDEB 2Y9HA 1U02A 3L3CA 4JV2A 2IJRA 3QFWA 5I42A 2G0JA 3I9ZA 2CQHA 1TVRA 4K4ZA 1NMEB 3NMRA 1ULRA 2HFZA 3BPSP 1IBLF 1D8YA 3NGSA 2YPYA 1KOOA 4KR0B 4UQTA 4USWA 2RRBA 3QIPB 2FVRA 2W2MP 2A6OA 2DNHA 2UUAF 1VLOA 3PHTA 2KT2A 4HT7A 2W8KA 3EVWA 4YY3F 2BJ8A 3D0IE 2WCXA 3OLAA 2B4VA 1M0SA 4TU7A 1M1KT 3W7BA 2YNGA 3GSDA 5HMXA 2DGVA 1GXLA 3FBBA 5ETVA 4JI5F 1N5VA 1TP7A 4WYLA 3CO0P 2XO6A 3NS6A 5CQGA 3G71S 4ICLA 1UZDA 1M5PC 2WW8A 2Q6CA 4LBHA 3R2DJ 2F40A 1D9DA 1J2VA 2FHKA 3GJQB 1UL3A 1WD6A 3F41A 3M8QA 7FDRA 5HSPA 3BO2A 2PMWA 3IWLA 4QPTA 1FKOB 5HLFB 1TR0A 3C19A 1IBKF 3PZPA 2NSBA 2FIUA 1RT4B 3IMQJ 4LF2A 3PW5A 1SC1B 2C3UA 3RBDA 1JJ4A 4G6VB 4DOZA 3HHLA 1EAYC 2XO7A 4DWIA 4JI3F 3FC9A 4PYAA 2L9DA 3JAMY 2KG1A 2HQFA 4WU3A 1RT6B 2I38A 1HR0J 2AZ1A 2MY7A 3TUIC 3KK1A 4P52A 3MUMP 4DEZA 3GU0A 4KO0A 1K44A 5I4MA 1VCTA 3CD7A 2B8QA 4DXLA 4C8NA 1SJQA 3HVTA 3Q24A 3DU6A 1ZETA 4IQXA 4U8YA 1Q0NA 3BR8A 1TKTB 2HFSA 3QWUA 4RX6A 1XMOJ 4ZVSB 2K3KA 2D3OR 1FRMA 1O5JA 5B0DA 1VFJA 4Z37A 2FVCA 1TUGB 3IWXA 2WHOA 2YY3A 4K4XA 2MLXA 1T9XA 5AT1B 2LU2A 3A8KA 3L7UA 1KLMB 3FJ2A 4OHZA 3OUYB 2DNOA 1S12A 1CS4B 1LK5A 3U1LA 5A8KB 4PWDA 1B0TA 3OHBA 1WSVA 1URNA 4P6QA 3UCUP 3BGUA 1Q8BA 2CPIA 3WHIA 2HWIA 3LOUA 2DNPA 1UFLA 2DGXA 1P9QC 5GADI 2M52A 3HT0A 4N76A 5IFMA 1RWUA 4YFUA 1KTVA 1YKWA 1JLGB 1NK7A 3R8YA 2W2NP 3KMSA 1UCNA 4JB8B 2CZ9A 3Q2TC 4ZK7M 2CPEA 1T9TA 5E3RA 4DR3J 4IKAA 3P3DA 1CG2A 2QX0A 2RSQA 1H72C 1LNQA 1FI4A 2E5IA 3QQCD 4MT1A 4FS2A 3DN9A 3JQMA 2OAUA 3GV5B 2UUCJ 4B3RJ 3ZTSA 5CZVA 3P45B 2DNYA 5RUBA 1OSDA 2DXFA 5LMNJ 2I9SA 5ETKA 4AFFA 2FTRA 3LP0B 1VQMS 1WDTA 2HKEA 2MY8A 3OL9A 3IR7B 4ZVUB 3DHXA 3ISND 5D4NA 3FZ2A 2WVEA 1H74A 3BEGB 1J5OB 3W2VA 3AQOA 3W9HA 5KFFA 3KJVA 2DR8A 4K4VA 5HQLA 2ZHBA 3KK2B 2CPDA 2MKCA 3UCZP 5HN0A 3NNHA 2QGFB 4X65F 4FKYA 1X0PA 1RWXB 1R6YA 3M32A 3TA1A 3JB9k 1VRTA 1C0UB 4A4JA 2HS3A 2F5GA 5KFPA 4DU8A 3NKYA 2C2DA 3NS5A 4JYAF 4DCPB 1KQSR 3DDNA 3H2UB 2V5HG 2DNLA 1KC8T 3BDPA 4LREA 2UXDJ 4HH0A 1JLEB 1JLQA 2V2QA 3V4MA 2Q66A 4IO1A 2BM1A 1NAQA 1FDBA 2Z57B 3FSYA 3VAHA 3JXOA 3TARA 1N34F 2D74B 5IZHA 5J2MB 5HVFA 2J6UA 2NR0A 3M6WA 2CYYA 1W25A 3LGNA 4HACB 3CDBA 4EYIB 4IOAQ 2DIVA 2Y3YA 1RHJB 1TV6A 1HNXF 5ETQA 5GAHU 4ED5A 2VICA 5HQMA 3HMJG 4MYUA 4ZPVR 1B99A 2AYGA 2RF2A 1CVJA 1LFPA 1CSJA 1KSPA 3T1HF 3OR2B 4R0EA 1FNXH 2GVZA 3ELHA 4DX5A 4BC9A 2XGPA 2IAJA 2W9BA 2R8KA 4JI4J 1ZM9A 1FRIA 3RB6A 1RQ0A 3IWNC 4NLDA 1YBTA 1HNWF 5FDLA 2WOMA 4H4OB 3HVWA 2JRSA 3ILIA 2COLA 2IMOA 4YQWA 4NRUA 2WAQD 3UN5A 2GHVC 3OTBA 2QLJB 1ZAWA 2BJ3A 2OMLA 3JSYA 1NEEA 3TW0A 5C2CA 4JI3J 4OHVA 5AE3A 4L74A 1H3DA 1GMWA 1N5SA 3LGHA 1VS3A 1WI6A 2JEGA 2QV6A 2CKWA 4LF6J 1KVJA 1MROB 2AP6A 2M9KA 2DITA 3H2LA 2UV8A 1JJ2R 3V6DB 2YKNB 4RW8A 2PSZA 1TVRB 3MFHA 2DR7A 3CULA 4JV1A 4KHPJ 1EHWA 4FYXB 1QUPA 4CIOA 4TY8A 3N01A 3N6MA 4RW6A 3BN7A 3HJVA 5D6GA 5EX3A 3EWGA 4MH8A 3IRWP 1S72S 1X4HA 1BQNA 4Q45A 4O44A 1OS5A 4P73A 3V6KA 2YH1A 4C3LA 3ZTPA 1UETA 2VPWB 3ZZ0A 2GMLA 4LRAA 1E6YB 1HBOB 2IDEA 2YPZA 3HM9A 2W24A 3L7OA 3CJ8A 4PCQA 1KKHA 4CTAB 4F4XA 2JC0A 2BJ1A 2EK1A 4EFAC 3TZYA 3SI8A 1TELA 1X4CA 2KU7A 1PKUA 4IG3A 1RCXB 2B5JA 2R7WA 1VRQC 2VG6B 2HGMA 5IT0A 1NUEA 3VR1A 2B6AA 3AQPA 3C16B 3F44A 4J91A 4WKYA 4UY85 2UXBF 4Y6IA 3OXLA 4TXSA 4ZJLA 2P2CB 5I42B 1CJUB 2QMWA 4YHHF 3E3XA 4YR3A 3MHYA 1JIHA 1LWCB 5M2PA 3RRGA 2W25A 3VAJA 5E3PA 1S76D 3A3PB 4LF4J 1F3FA 2EC2A 3H2VE 4YY3J 4C8YA 3VWSA 4NWBA 3DC2A 5LSRA 2JFKA 5KG7A 5KFQA 2FVPA 1Q5YA 3OTOF 1SXLA 1O8BA 1FJGJ 3M2RB 4LF1A 2BE2B 3MOZA 2JLEA 2ZVIA 5IOLA 3IS9B 2C2EA 3HSDA 1HQEA 1TL1A 5HJXA 5GAGU 3J80U 1RHQB 2GQQA 2I1RA 2OPRA 2W4DA 2ERRA 1UZHA 1CULB 4U67Q 4LFBJ 2Q43A 3MI7X 3TUZC 4C8KA 3M30B 1D8ZA 3VQTA 3MM5A 4LF5F 1F5AA 4NLYA 2UUWA 3B54A 3EJMA 3FBEA 5F3TA 3QLHB 5LSOA 4X4SA 3IN5A 4YP3A 4O3NA 1FA0A 4CLKA 4GVLA 2G2OA 3RW6A 3R27A 1F2GA 2VKRA 4DFMA 2KZMA 1U0HB 1KLMA 1WSRA 2F4FA 2XNRA 1UMJA 1NB2A 1YZ7A 3DGVA 3P4UB 1TL5A 4M5DB 4CLZA 4YS2A 2HVZA 1VBXA 4ZCIA 2HNZB 2DR6A 5T41A 5ADZA 4PXEA 1WC0A 5KFCA 3AB4B 3UVJB 1S0NA 1IKYB 2JLFA 4FVCA 5DGBA 2DIUA 1YQHA 1R8PA 1FERA 2LXUA 1X4DA 2BOAA 2MDAA 4YB1P 5D78A 4DV5F 1FRLA 1RADB 4NLSA 3NWRA 3C8YA 2DK2A 5GADU 1Z4UA 4KO0B 1UFWA 4DCOB 1GFWB 1HWJA 2PT0A 3HHLC 4HDGA 3HD2A 2BM0A 3ZZPA 2DT9A 2J0WA 3N4WA 1DBDA 1AYEA 2ZVSA 3VGVA 3TJ9A 1F9FA 1IKVB 3LANA 1BQNB 5IS2A 5F9NA 1TK8A 2GO9A 2H65B 2M2BA 4CO1A 4DU7A 2ZH1A 4ZP9A 3D67A 5F0WA 1IBKJ 2VH7A 4WJBA 2SXLA 1ZAVA 1U2CA 4K8RA 1P9YA 1SKWA 5L9XA 5HLFA 1IR0A 3R3TA 2XYPB 3LPYA 3KKFA 1NRKA 1RAGB 3LP1A 3MM7B 5I3PA 4R5PB 4KGXB 5K5MA 4DR2J 1VQ6S 2HNYB 1J5OA 4ANDA 3GR1A 2JJ4D 1TMMA 2OPSA 3H59A 4TYBA 3UN3A 3ZNJ1 1FXDA 2ZD1B 3A8IA 4MIAA 1HW9A 1Q95G 2E1RA 1N5YB 3G82A 5KFTA 3X3UA 5KFDA 2LEBA 2KH9A 4MK8A 4R25A 3M8PA 4LVOP 4QWAA 1KBRA 2H1YA 2L9NA 3PV8A 4ZCLA 1YX2A 4LR7A 3I56S 3OL8A 3QAEA 3TEGA 5E3CA 1MG7A 4WFBQ 4TY9A 2EEYA 1JXVA 3P5BP 4PG4A 3RBZA 4X64F 3HSZA 4LSNB 5CCMA 1ZA2B 4ECRA 4TLQA 2XY6A 4IR1A 1HI0P 4K5RA 2GV1A 3GE9A 3J7YU 2MKSA 1GTEA 1BMQB 1QAIA 3C6TB 1FRKA 3T1AA 4C0BA 5F8IA 3J80Y 1I6JA 4RKUC 2AYBA 1NHKL 1MN9A 2PD1A 1V5VA 2MZTA 3I0RB 1HR0F 2HZCA 2JOQA 2FHJD 1OY9A 1SH2A 2V8PA 3TZXA 5L1IA 4HHJA 3ZFVA 3BH7B 4NEYA 3TO8A 2HVHA 2J8AA 2M3DA 2GMHA 1S6UA 2EKYA 3B4MA 1JNRB 2IHR1 2XMMA 1KDNA 2GJIA 3IM9A 3M9MB 1R8CA 4M5JA 4W92B 1N32F 3PEHA 2V63A 1S1TB 1K47A 4I2QA 3SQOP 2EFVA 2ZJQQ 3ZC4A 4ZA1A 3CJ5A 1YJ7A 3LAMA 1AB8A 4O4GB 2AV5A 2WBRA 1LEOA 1XNRF 2GX8A 2MMYA 5KFXA 4O3OA 3MEDB 1T8EA 4E0DA 3HFZB 4DV3F 3GG0A 4CDIA 2XMTA 1TL7A 2Y1JA 2ASYA 3C14B 3PW2A 4DSKA 3CJKB 3EDQB 3NGKA 5B0EA 3RRHA 1C0TB 2NPIA 3GJRB 2VHGA 1U1QA 3MECB 3KHGA 4QJVA 4R0JA 2YNFA 3TEHB 1BHNA 2YX4A 2KT3A 3M2RA 3ZNUA 5LJ5Y 1NH7A 4TLRA 2R2UA 2LLZA 3EICA 4MKBA 3FRZA 4TN2A 5D8HB 3UD3P 4B3SF 2CZ4A 5AE2A 3FFIA 4B3RF 1RAOA 2QL5B 2DRBA 2V9WA 2MZQA 2IBKA 1XERA 2A0FB 1TL3A 4HYKA 4N41A 2E7WA 2KDOA 4KB7A 1TV6B 3BKUA 2BABA 3OFFA 2XWXA 4JV0A 1FT8A 2IRXA 3WZ0A 3ZTRA 4J9LA 2W9AA 3UCGA 3A1YG 1APSA 2FJDB 5J1EA 3LP2B 1T9UA 2V4QA 2B9EA 5D0RA 1V5IB 4ZPBA 1RKJA 4FF3A 1WF2A 5IT9U 1RT4A 2J0XA 2OHDA 4P2SA 5G4DA 1CJVA 2XG8A 1FXRA 1RTJA 4NLWA 4Y0FA 2IM2A 1PYSB 4WZMA 4LF7J 1X5TA 4CLYA 1NPKA 3A12A 5DJBA 1T03A 4NYOA 4RW7A 1RT7B 3CCZA 1RT5A 1HARA 1AUSL 3PKMA 4A47A 3WBZA 4KFBB 2NCKL 4LUBA 4CO2A 4B9MA 2HHTA 3IG1A 5SZTA 3QSIA 4V19X 3FFIB 1C1CB 1ZZNA 1N4LA 2RQKA 4AQYJ 1MROA 4BWJA 4QQBA 2HW3A 1MWQA 3DLKB 4NCGA 4C11A 2F8EX 3CCUS 2K06A 3EGWB 1NSKL 2V69A 2VG6A 3FRYA 3MMCB 4JI8F 3K5LA 3FGVA 4B9LA 2MLYA 1TKZA 5ITHA 2FJBB 1ZS6A 3KNGA 1VJQA 3PIOQ 3DRRA 3SYZA 5JJBA 4JI0J 8AT1B 5KT6A 2JC1A 1XNRJ 1R8AA 3QMQA 3SZ2A 3I31A 2DHSA 3LALA 1S99A 2YKAA 2EFGA 4OYOA 3CXCR 1Q78A 3Q22A 4DSFA 1XMQF 2DPIA 2Z0GA 3RU0A 3EGNA 4DV2J 4DFPA 2VOPA 1T9VA 1HLWA 4DN9A 5AE1A 3CW2C 2MXYA 1IJEB 4X4TA 2NZ4A 2YTCA 3S8SA 3I0SB 4A8KA 2XULA 1TK5A 2PDAA 1R89A 1FF2A 3CJQA 3M2VB 4OYAA 3AOCA 5KOWA 3POTA 4F67A 3MM5B 3LA0A 2BW7A 4DV4J 1S49A 4HACA 5D4LA 4A8XA 3K59A 1P8GA 4QOTA 4I1TA 5EWGA 3M2VA 4R8UA 2FB0A 2YKMB 3RW7A 2N4DA 2HGNA 2OUGA 2HYIB 1UJ5A 3H25A 1X4FA 1FD2A 1VQ9S 4LRFA 3Q2SC 2IAJB 5KT3A 1GH8A 2A1BA 1UPMB 2DH7A 4NASA 2XZTB 4JP8A 3UR3C 2AYMA 2VOOA 1MNEA 4P2MA 3KTQA 3KNAA 4IFYA 3VAFA 4DR1F 2QSFA 2J9DE 2AWZA 4LF7F 2KYZA 1SKRA 2BW2A 2H5EA 1T9YA 1DTQA 3KJNB 4HT5A 5MLCV 1YJTA 4Q7AA 1M5VC 2FY1A 2LQ8A 4DSJA 3R97A 4HEA9 5IT9Y 1IKWA 2GAGC 2ZC4A 3D6FB 2IM0A 3RR7A 2VQFJ 3QIDA 2VUGA 2LDYA 3MCSA 1VQLS 2DGOA 2YXLA 3OTOJ 1JLEA 1QVFR 5IWAF 3ENWA 2DHXA 3MZIA 2ZKTA 1IBMF 4G1PA 1RAFB 1HHTP 1KR4A 3DU5A 4PXBA 1EQMA 3PR5B 1PGZA 2W1BA 5LL6d 1Y0HA 2VFUA 4GC7A 2OSRA 2QE5A 2R7TA 1HL6A 1JLAB 1LOUA 1RWWB 3TVKA 3G6VA 5C24A 1FE0A 3KG4A 4DV0J 3PY8A 1OY6A 5G0RB 1BLUA 2CADA 2FC9A 2HGLA 3CNQP 4NI2A 1NK5A 1B3TA 3MMJA 2IM3A 4HH1A 3Q8SB 1N0VC 3CDAA 4JUZA 2DRAA 3C66A 3G4SS 1QE1A 2X1GA 4ALZA 3K58A 4OZ5A 4M5GA 2VQEJ 4LF8F 3N6NA 5A2QY 2P6SA 4IG0B 4ID8A 4YR2A 5E3QA 3CCTA 1I1GA 1LFWA 4IDKB 3BZQA 3E01A 3CCSS 3DLLQ 2LVWA 3IR6B 4KPCA 2FLNA 4A8WA 4Q5VA 3I96A 3HO1A 4ZP7A 5KFRA 2HQDA 2HLUA 5L9NA 3KUGA 4GMKA 1WC1A 4FNIA 1VQ5S 3LWLA 4FYWB 2CNKB 3KMQA 4YB5A 1WC4A 3RBEA 3KG0A 3GMGA 4X62F 2QZ8A 2RQCA 3CMAS 4QU6A 3D1OA 3M7VA 2FZKB 4NL5A 3NEKA 5KFLA 2RKIB 3GWCA 3OHAA 2RH3A 2EK6A 1WNEA 5BR8J 3MEEB 1U25A 2BVZA 2ROEA 3BR9A 3PDNA 4JI5J 1HD0A 3N28A 4JV5J 1H0HB 2KRRA 1S5ZA 4TU9A 5BYRA 3M8SA 2BJEA 4DUZJ 4DR6J 1XN9A 3EUNA 1S1VA 4CWBA 2ATLA 2MZJA 2HURA 3VAMA 4DL4A 2ASJA 4C0OC 1LW0B 2E44A 2KO1A 1Q7YT 4Y2CA 1HBUB 4YDXA 2WVFA 4PXDA 2X3DA 3WX4A 3TUJC 3D68A 4W90B 2M5YA 4B17A 3KLVA 4ID5B 4NLOA 4RU9A 2XLIA 4LT6A 1U7LA 4DV4F 4O0IA 5HVGA 2ZKUA 4OZLA 1V6HA 4C3KA 4OJGA 1RTJB 2JH3A 2KYXA 2Z2LA 2Z2ZA 2ZJPQ 3IAM9 2B3TB 4CTAA 3AOAA 1NZ8A 3M05A 3MCMA 1KTQA 3EPGA 3J7AN 2AHOB 4F3QA 1S6PA 2DNNA 3R7SB 2KVQE 2CPXA 1FJGF 1RWPB 4ILLA 4OI1A 1IKXA 4O4GA 3GFZA 2W7PA 2XHWA 3PXGa 4B3OB 2QL7B 2QL9B 3HPOA 2AJQA 4WE1B 2RDIA 2ZNZA 3V6HA 4USVA 3KHHA 4DQSA 5J2QA 5DZ7A 4DPYA 2CZVC 4V1Ak 1RCOB 3N6LA 2J0QD 4C97A 1WHWA 4EGLA 3VALA 4LF8J 2GZOA 3MM9B 3TUPA 4Y2AA 2XS5A 3Q8QB 1HA1A 1KOHA 4ZJOA 3GIKA 1NBEB 4DL7A 2ASDA 4AL5A 1DQ8A 2DGQA 2KHDA 3QFHA 2IA0A 5GAHI 5DM6Q 2Z58B 3W2WA 1U45A 4HR2A 3GB0A 1NK8A 4ENOA 2UP1A 1YJWS 1RAJA 4ZS6A 1JK9B 4CP5A 3O44A 3NGRA 2AD9A 2KI2A 2LMIA 4MIWA 1ZM2A 3UNYA 4PPDA 4X4VA 4F0MA 2GVDA 2ZBCA 3K17A 4DQIA 4QYZK 3M6UA 4ED6A 2L08A 3OJSA 2B7BB 2UUCF 4PPZA 2CA9A 1WEYA 1YJRA 5HBMA 1HI8A 4U7UK 4LFAF 1WC6A 1YJVA 2Q6BA 1L3UA 4IFVB 3C15A 3H4DA 1LK7A 3A13A 1RT2B 4KH1B 1IUJA 1S1TA 2XWYA 4I2QB 5DDPC 2MGZA 4L73A 2QSWA 5DGAA 4DR6F 1JLFB 2YWKA 2J9DA 1SB6A 2FYXA 4I7FA 1RT1B 1VBKA 2XZWA 4LFAJ 1FKPA 3AH6A 5AXKA 1CULA 1ACMB 4F4YA 3MTJA 2FD2A 3GONA 4DUYF 2POKA 1XQIA 2W7AA 4DG1A 5SUHA 5KG2A 4M1KA 2QA1A 3KJVB 3AD9C 4CLTA 3SCKE 2C3PA 2F1FA 3UR0A 2VDHA 2KTQA 2RE1A 2IC3A 1VRUB 2AF6A 2KVIA 1MMDA 3C3LA 2RKIA 4ZVTB 4ECSA 1Y3KA 2VIHA 4CYUB 1NPRA 4O4RA 4ED7A 2MHNA 3FMBA 3CJ4A 1A7GE 2UV8G 4ZPDA 3CVKA 4ZKAA 2DRDA 3CJSA 2DGTA 5HQ8A 2ZH8A 4AT1B 4OYZA 2CJBA 4LSLB 2V2KA 3TAMA 1NK9A 2A2CA 2GA7A 4NEZA 5GAEI 1BGXT 2UVWA 1FNOA 5KFMA 4KSEB 1X4AA 4IH6A 2VG5B 2PFDA 4FF2A 4ER8A 5LMNF 4KKOA 4ZCKA 3S01A 4DFJA 5F9LA 1XR6A 2ZJRQ 4ZLPA 4BLGA 1CLFA 1AA1B 3SFGA 3W9IA 4PG6A 5A6WA 2JVOA 3OBIA 3QGPA 2JDJA 3NGTA 4IFYB 3ICLA 4FXVA 3SIPB 4CNYA 4H4MB 2LCWA 4Q44A 3VTIA 1RAHB 1Q81T 4XAKA 3T5JA 3EGZA 1SUQB 2CQ1A 4JI0F 2VQFF 1HNZF 3HHEA 5B7WA 3BSOA 2CFXA 3AXMA 4LFCJ 4QIWD 4J9VA 3PX4A 1IKVA 3S6EA 3BF4A 4Q0BA 3D1QA 1GXTA 4H4KC 4I2PA 4IG3B 1NDKA 3BSNA 4F4ZA 2HMIA 2ZH7A 1DAXA 3VGUA 1CJVB 1FRJA 2HEKA 4MFBB 3TVZA 5E41A 3HHKA 4I4BA 3ZO7A 2G9OA 1S9FA 2WVBA 5HK4A 4DZ6A 5LT5A 4O3QA 2NYHA 2L48A 3UD4P 6FD1A 2KXNB 3JQJA 2HNYA 4LF5J 2GVZB 4MJKA 1SC3B 2V8DA 3L09A 4S0MA 4WFZA 5KFGA 3JTPA 4A48A 2EFNA 2ZH4A 1WOPA 1L3TA 3KLGB 4OI6A 5G0RA 5L8RC 3DRPB 5KG6A 4YN3B 2LEPA 1C4AA 2N7YA 1DJ0A 3C46A 1XIQA 2OTJS 2DNGA 1UVNA 3N0VA 4HTJA 3ZZOA 3SQGA 3SBMA 1SL2A 1N88A 2F8HA 2VU5A 4P75A 4LF4F 5ETLA 3GFXA 1S7HA 2O01C 3SEOA 3DRRB 1QM9A 6AT1B 4Z2XA 3MFIA 1IR2A 2PEHA 1SJ3P 1N0UA 5K14A 4BCAA 1ZZFA 1RYSA 5J2PB 3I9V9 2NLWA 2LQJA 9ATCB 4QPXA 4RNNA 1SJ4P 1KQGB 1PG5B 4DR4F 1C1BB 2XEXA 2GHWA 1VHIA 3BDEA 3BBFA 2W9CA 1NK6A 4C8ZA 2XTJP 5A8WA 3G8SA 3C6TA 2OLWA 1XEZA 3B6BA 2AIRB 3OVAA 3M32B 2UVRA 2AGQA 1YHQS 4NLPA 2QLXA 1CEZA 4PRFA 4DHVA 1NPPA 5ETSA 2Y8YA 3KJFB 3QO9B 1EIYB 1RT5B 2DTJA 4ED8A 2GFFA 1REVB 3TI0A 1T05B 4OL8A 1HKAA 4NMLA 3M2UB 4MKVA 1JWWA 1YRXA 1C0TA 1TQLA 4O0NA 3ETMA 5J2QB 4W4MA 2KFZA 2W01A 2OI2A 2G0IA 3B82A 3R5GA 2MB0B 1P1LA 3OTEA 5KT4A 5A0YA 1TFYA 3I5BA 4WWSA 2GQ2A 3MMAB 4WK1A 5KFOA 3NCRA 2JEIA 4K4UA 3CC4S 2HK3A 2D7SA 3SMZA 4RNOA 5L38A 2AEJA 3QIPA 3NBPA 1TL3B 2DNRA 2DXEA 4CO4A 4DR1J 4R5PA 4NXNF 1KVIA 3GR0A 1EETA 1SPBP 2AX1A 1JQGA 2H3EB 2DJWA 3RBXA 4WKRA 2OEMA 1VIXA 4DN0A 2ILZA 4LBPA 1H98A 2H4YB 2DPJA 2CQGA 1TAQA 2BE7D 1XMBA 2DO0A 3KLEA 2R8GA 2YNFB 2X7IA 1UP1A 1WOOA 3MPDA 1HBUA 2B9WA 4XIUA 2D41A 1H73A 4DJBA 1VJWA 2VC1A 2E29A 4DDFA 1EQ0A 4J37A 4OYIA 1H2TZ 3AD7C 4A46A 5KT7A 4Q8FA 4OYXA 5C7PA 2CG4A 1VLYA 2K2PA 4USKA 5IV3A 4FYYB 4ZOSA 2HHQA 3QJLA 4NOHA 1SIWB 2V34A 3EMTA 2CQ3A 2MSTA 3D2WA 5K8PA 2KRBA 4AXJA 2WVDA 3RUBL 1NCLA 2VL1A 2C1EB 4IRCA 1Z2ZA 3AODA 2BKOA 3CE8A 4RW6B 3KHLA 4URQU 2A18A 4FS1A 3QBCA 1YITS 1R31A 1PBUA 3DRYA 1RHKB 2XM3A 3NOCA 3BKFA 2Y8WA 1U1NA 4PZVA 4P9SA 4Q8EA 5FIIA 1X4GA 2CJQA 1G6BA 1GMWD 2GO8A 4EU0A 1WG1A 4LRDA 1EZZB 1YRTA 4ZLNA 1R8BA 1HBMB 1SQGA 3Q8VA 4NA2A 3W65A 4B3TJ 4MYTA 3GIIA 1UVIA 1ZAXA 2HIQA 2VJVA 1R27B 1RACB 2XMAA 4B3TF 2LQ9A 2DY9A 2QO3A 4X65J 1AFJA 3OTDA 1Q53A 3I5AA 3LQVA 2EWHA 4P2FA 5FDLB 4PR6A 2N82B 4I0WA 5CXTA 1XJWB 3J7YI 2CUYA 2RUGA 1EX8A 2ZEJA 3PJXA 4C11B 1JLFA 2B4UA 3ETOA 2KL8A 1NB7A 3IRXA 2G0CA 2ZZMA 2CVEA 3ZZTA 3HXMA 1WWHA 3KYLA 1S77D 2U2FA 5F8GA 4KH0B 2R2SA 2MKJA 1PBAA 3GFYA 2ZH2A 1U6BA 1D9AA 3HJFA 1T11A 2XMKA 3PW4A 4K0KJ 2GIRA 2DHHA 3VAIA 2V0NA 4YMEA 3QNWB 1JMTA 2M4MA 3H98A 3IRXB 1JX4A 1KN6A 2CXEA 1GEHA 2HFUA 1S97A 4DR7F 1RU1A 2IRUA 2WONB 5KFAA 3EPIA 2RS2A 3T1HJ 4P72A 5D3GA 2CJKA 1IKWB 4C4WA 3L4BC 3PVXA 1RB0A 1UEUA 1IXKA 2VPZB 1PAUB 1VQOS 1N5YA 4IH5A 2HHWA 4WYWA 1S9GB 1RTDB 1NKEA 1HWUA 4OYMA 2BZ2A 5D0GA 5C2GA 2B56A 4PEOA 4B9TA 2VONA 1UJ6A 3SDEA 2MQOA 4I6AA 4ID5A 4K4WA 2DVIA 4RUBA 4LSLA 5KFZA 5BXIA 3S1TA 2WZ1A 3B8HA 4RLEA 2MLZA 4UW2A 3SCJE 2YVSA 1FTCA 3KLIB 4NA3A 1FRXA 4E98A 3TJ8A 2F7VA 3GZ7A 2QFJA 2J7KA 4BWMA 2MEWA 2DNKA 4WP3A 3R2CJ 2NPFA 5AXMA 3U1NA 2E66A 3NBPB 5E2QA 1RBOB 2WVCA 4ZPTR 2W4CA 2QA2A 3OR1B 3ZXWA 4QBUA 2UUBJ 4ZVFA 1U6FA 1SC4B 4LQ9A 2A10A 3DYAA 1XNQF 1ZM4A 3T1YF 4UUXA 1I94F 1JLCB 1RP5A 2E1AA 2HFOA 2UVUA 4LIRA 3G82B 1OIAA 1WEZA 5ETTA 1RWOB 1S7IA 5C42B 2BANB 1HPZB 2OMOA 3OTCA 1QSLA 3TA0A 3AHPA 2W9BB 4QYRA 3IXQA 3M8QB 3AD8C 4EWTA 2FLPA 2QG9B 3H5UA 4B9SA 2DNMA 3LP1B 3MM7A 3DLGB 4CM0A 4DLEA 1HPZA 3K5OA 4U9RA 1N32J 3OL6A 3R5CA 1RAEB 3TAPA 1X0FA 2PE8A 4IG0A 2AT1B 2JVRA 1RT6A 2W9CB 2QTWA 4CLPA 3FCHA 4DX8H 3OV7A 2K7KA 2JX2A 3HHLB 4RWXA 3TNVA 3BV8A 3T6JA 2AJ4A 2P9CA 2HHHJ 5KG5A 2LP4A 3GSIA 3J7ZT 4U7UD 1ROFA 4KFBA 1B64A 2E1PA 2RB7A 4MTPA 5HJYA 1GX6A 2AJ2A 4XTTA 3LTOA 1BE4A 3EZ5A 4ES1A 3OSNA 4QR0A 1PJ5A 5JVGQ 4DSLA 4ECQA 3ENQA 2ACMA 4LR8A 4M5DA 1S9GA 2VFTA 3BPDA 3TZWA 3V6DA 3RB3A 3N5FA 2FQQB 2J8SA 1EP4A 1U1RA 2QMXA 2J9EA 1HNWJ 1T03B 2MKYA 1T3NA 2VFVA 3VAKA 5J2MA 5CCLA 3CC7S 3CJ0A 3HKWA 1P27B 2VB6A 3N5BA 4QWCA 3PW0A 1SKUB 3RB0A 1G2EA 3AJDA 2GGPB 3QAUA 4IO9Q 3TP2A 1E6YA 1HBOA 3OXFA 4X64J 3H0PA 1D09B 3P5TL 4RNFA 1U4BA 2YWWA 4QYZJ 9RUBA 1TKXA 2MQPA 3MTKA 1XR5A 4HLBA 5KG3A 3HT3A 4YUDA 3CCLS 4CNZA 2M7SA 3OT9A 3TAMB 4F0HA 4DX7A 5KT5A 3K5NA 4ED2A 2FJVA 3U7JA 4X62J 1JJHA 4DBQA 4LQ3A 3Q83A 1N48A 1LKZA 4PQUA 1JXLA 2HZAA 1VDHA 2HNDA 2KXHA 1S1VB 2V9KA 4MMOA 3UE2A 3M9OB 1UEVA 1ZPWX 3R1HA 4RW4B 3QT5A 1GAOA 1YG0A 2ZM6J 4AE5A 5HP1B 1M90T 5KG1A 1ICEB 2OP5A 1FWLA 4MAKA 3W2VB 4F02A 4ES2A 1JXEA 2ZOMA 1OO0B 2XI3A 2ACYA 3FQKA 3KUEA 4YB7A 2VG7B 3OVSA 3TRGA 2PI5A 2HIYA 1TU0B 4USJC 2H5IB 4L72B 1MMNA 3NP5A 5I3UB 3HVRA 2ABYA 4JI8J 3OFGA 3I87A 3VZIA 1IN0A 2ALZA 3EXCX 4DG1B 3Q8UA 2CQCA 3FNNA 3V81A 1YTYA 1FDDA 3DFEA 3H8YA 2BE2A 3FBFA 3H5SA 3KDNA 1LW2A 1VQKS 1IM6A 4AQYF 2QLFB 4OYWA 1RSCA 2BJ9A 5BYQA 2UXCF 2UUBF 3NRBA 4OJ1A 3F73A 1WJ9A 3FMWA 1OYDA 2O1PA 2PIIA 3R6LB 3JSMB 1S1WB 1S6QA 4NX9A 5BYSA 4K2XA 4G1IA 3I4PA 3G96A 2G4BA 2ATCB 3DXBA 5LOQA 3D6MB 3SFUA 1SV5B 3GQCA 3NGUA 4DUYJ 2ZOGA 4YEAA 3M8YA 2HHUA 3IP0A 2XMUA 5A8RB 1U6ZA 3DOKB 3X1LB 5GMEA 4N47A 1WKJA 4PKDB 3PX0A 1RGVA 3LP0A 4JI1F 4MKYA 1FVSA 4WP9A 2MQQA 4ITSA 1WTBA 4P7VA 3C2PA 3W2WB 3H40A 1HFEL 3BB5A 3V6JA 1HWLA 3FKBA 1RDRA 2FVQA 1RTHA 2V4JB 5F8LA 1Y11A 2M88A 2OO4A 2WRMA 1RT1A 4KTQA 3MEGB 4DPTA 2ZDOA 4ZVQB 2X1AA 1V3SA 1VGYA 3EX7B 1RXOB 3OJUA 1GTHA 2DYAA 1A6LA 1JJCB 1O6XA 2CQ0A 3DM2A 2V2VA 1QVGR 1U2RA 5FJ4A 3GG1A 5L1LA 4OV1A 4DPWA 1F2HA 4UOCA 1RU2A 2XI2A 1OPIA 3OFHA 5KFSA 5HBMB 2DHGA 1UA1A 5L39A 4B02A 5L46A 2ZZNA 4BDPA 3UNGC 1SI9A 3BBCA 2R7VA 1AZSA 3NWGA 4DF8A 5DLFA 4KKOB 1HD1A 3MR7A 2MJUA 3W60A 3R9LA 4KPYA 2Q1LA 1FHTA 2XY5A 1WF1A 1M5OC 4KJIA 4GKKF 4U96A 2ZWPA 4I64A 3U27A 2C2OB 3TOQA 4LMZA 1TTHB 3R1LA 1NH8A 3ISZA 1QD1A 2ZZTA 3LUYA 4ELTA 4CH7A 1EKSA 1S57A 1U2FA 2QN6B 3GTYX 2I0XA 3D3CJ 3EVOA 2DO4A 2MPUA 4Z7YA 3WDOA 1F9HA 2YWGA 2XYHB 1C0UA 4WTYA 4RR5A 4DZDA 4X4RA 2R9LA 1YDLA 5DM7Q 2FZGB 4ECXA 2YNIB 1V3ZA 2RF2B 1PC4A 1T95A 3HULA 2V68A 5LMUF 4K59A 2DKOB 1MN7A 4IDKA 4ZLLA 1WHXA 4CLFA 3EGVA 1Z1ZA 1S1XA 3T9ZA 3QRPA 3H90A 4F3OA 4BBYA 2B4OA 2IM1A 4BC7A 2J7UA 2OFHX 2C42A 1WOSA 4RW4A 5K8OA 4UQGA 4WFAQ 2CNOB 1Y10A 2FLOA 1S1WA 2FVSA 1CQNA 4KHPF 4WU2A 2GJ2A 2C3OA 1FKOA 1WTFA 1QUVA 2CWKA 2YWHA 4ED0A 2IRYA 4N7TA 2EFOA 2WBMA 2XYGB 5LSLA 2Y1LB 4UOGA 1N8RT 1I51B 1OSCA 3A3NB 3OR2A 4OZJA 1L5UA 3PX6A 7FD1A 2PEBA 3H5XA 2E9RX 3QGGA 4X4UA 1VMBA 3BQ2A 4TKTA 4QWEA 3KK1B 2RAQA 5IQ6A 3T5HA 3BREA 2QIFA 3TWZA 3JSBA 4LBIA 1MU2B 1PJ7A 1QE1B 2IDLA 1U26A 4W98A 2NS1B 2C2KB 1UEKA 4RBVA 3T6BA 1WF0A 3JTNA 1FXLA 1FVQA 3POTB 4D3GA 2Z2MA 1JB0C 1SV5A 2M70A 1XC9A 2C2RA 4UY8T 1V3RA 2FZCB 5HP1A 4JYAJ 1N54B 5CH7B 3RAQA 4ECTA 4WCEQ 3DI6B 4LSNA 2HHHF 2J0SD 1QTNB 2E5GA 3PYGA 4Y2IA 5C24B 3GCWP 3HVAA 1BQXA 3UO0A 5DQHA 1U8SA 3EM1A 2IYIA 1S0MA 4DR7J 1ZH5A 3H7HB 1N36J 2HBZB
chains in the Genus database with same CATH topology
2LA6A 3CO9A 3DMJA 1VQ7S 4TYAA 1RKIA 4ILRA 4XPCA 4JI6F 4C7QA 1S10A 3PW7A 1VRUA 1B0PA 1H2UX 2FHJA 3MAHA 2J7WA 4IRDA 3TX8A 3HHLD 3MEEA 2K1RA 3M1VB 2XS2A 1Q79A 1HBNA 4KQZA 5M2RA 4DF4A 2RDJA 3PO4A 3N9UC 4I69A 5DRKA 2E5HA 3PHEA 2X3GA 2JEFA 3D5MA 3OVBA 4IOBA 2FHMA 2YNHA 2F4VF 1LWFA 1VHFA 2XY7A 4ETXA 1X9WA 4DQPA 3W3SA 3DCAA 3CT9A 1XR7A 5B0BA 3SSQA 3WC0A 4CH1A 1RTDA 5CYJA 1G7CB 3SCLE 2ZNYA 2IYGA 2MQNA 2PMHA 3HX9A 1S0VA 1C2PA 5KOXA 5DO2A 5M2UA 1NHVA 3TQ1A 4X4NA 3HKZD 2IA6A 1X5SA 4LVNP 1Y9OA 3HFKA 4AUKA 1H2VZ 4NLXA 4N8NA 4IH7A 1MW7A 2Y1RI 4IFVA 3MPVA 2KM8C 3O6QA 2N7CA 3NAIA 2ILYA 2P9EA 1Q7LB 3I4HX 3O3LA 2IJFA 3CWJA 3DLGA 1D1UA 3FEXB 4V19J 4ELVA 4ZDNA 2KB2A 1CPZA 1QAXA 5EDWA 4MK9A 3TYTA 4OFZA 3VCDA 1SBRA 4PQAA 2NXUA 5T7LB 2R8JA 2E9ZA 1NKBA 1VBZA 3KLFA 4CCHA 2C3MA 2NSCA 2OPSB 2Y0SD 4OJHA 5LJ3Y 2R8HA 5F8MA 3ITHB 4KHRA 4NZ7A 3KLEB 1TZ0A 4LFCF 2LEAA 4IYQA 1Q16B 5B0AA 1SUQA 2CPJA 2HQIA 3MD3A 4I68A 2BBEA 3DGPA 1FNMA 2DH9A 2F8MA 3IG1B 4OZ1A 4CI0B 1NJIT 2QEXS 3PRBA 1QSYA 1U24A 4H54A 1KRPA 2D3UA 4RW9A 3Q23A 4PUOA 4DL0C 3B78A 3NCPA 2K1RB 3BSCA 3T5KA 1X9SA 1KQKA 2GMJA 2X51A 1MMLA 2YWFA 1FEHA 2J5AA 3DLEB 3L7PA 2J6TA 3QPIA 2VV5A 3BGLA 4KE5A 1V9OA 1U1KA 2C22A 1RYRA 4NYPA 4CQ1A 4ZP8A 1VC0A 2VZ9A 2E5JA 1IKYA 1IM4A 3UQSA 2KFNA 2RD5C 3I82A 2Q79A 2KFYA 5C25B 2YH0A 4H4MA 5LXRA 1N36F 1VOMA 2H9ZA 3KLIA 3G6ES 3LW5C 1IQTA 3DDKA 3PKYA 3MR3A 3K2YA 4DUZF 2BV3A 4ZPAA 2MYFA 2IBOA 2B5JB 5T14A 2WSEC 4J9RA 3GIMA 4J9MA 2RNEA 2R7QA 3CGIA 4MFBA 3RZAA 5CZXA 2I2YA 4MIBA 1NJXA 3G6YA 3ZZRA 4FN5A 5I3UA 3CCWA 4Q2MA 2VBXA 1JLBB 2LXFA 3O5TB 1Y5NB 3PRDA 1M5SA 1F5BA 2AU0A 1FJEB 1D0EA 4NCBA 2HAIA 1BC6A 3UDLA 1C1CA 2VBYA 1KFDA 1BQMB 4C3MA 1WACA 1Z2LA 1YSJA 2FGOA 3E01B 2YQ3A 2ZH5A 2YWEA 3KFWX 3O8WA 4ES3A 4C98A 5KFNA 4M95A 2KT5A 4F3MA 4K50A 1WG5A 2CPZA 3ENVA 2PGCA 5DG7A 2K3IA 3M30A 2PMZD 5HMWA 3BGRB 4HVZA 1VK3A 4TNOA 3MEKA 4XDCA 5F0UA 5F41A 4I6YA 4DS5A 4NZ6A 4ED3A 1J5EF 3AJ2A 3MMCA 3THVA 1NJYA 2RJZA 5J1EB 2YNIA 2BRLA 3MXHP 1DFDA 1DTTB 2DGSA 3G8TA 3IO1A 3ONQA 3I5CA 1FRHA 4IQMA 2J6SA 3ZZZA 3PJWA 5KTQA 2OPPB 2JLGA 2XMWA 3KLGA 2VPYB 3UWTA 4U6PA 4QW9A 4M63A 1KHWA 5DDQC 4CH0S 3BGFA 3QLHA 1HQUA 3Q8RB 1XWLA 3L95X 5DDOC 2CQPA 1G3OA 1XBWA 2KHCA 1OWXA 1R43A 2B4PA 4C8OA 2M8DB 4FF4A 3D0HE 2BXJA 4NA1A 1T02A 4QWDA 2LECA 4YOEA 1IQZA 4DQRA 2VA2A 5IQQA 1VIOA 3K5PA 5E33A 4KGKA 1TK0A 2DHAA 2FC8A 1R0AB 1SH0A 2XBPA 1G1XA 2OPPA 2XGQA 1XMOF 3HDSA 4B3OA 3KLHB 1AXQA 1GX5A 1N56A 2RRAA 3VF0B 3DLBA 5A6PA 4BS2A 3RRKA 5K14B 3SXLA 4DV6F 2D3ZA 1VQPS 3OPKA 2EFQA 3BQ1A 4K0KF 1HYSB 1N5TA 1FDAA 4NLGA 5A8RA 4DL3A 2R4FA 2ZE2B 3SSRA 4I7FB 1PILA 4FXDA 3BO4A 3G8QA 3M6XA 3R5AA 4YB6A 1WG4A 3PM9A 1ZBTA 2CPYA 4KV8B 2AYEA 2ZBIA 4WFXA 4FNHA 3RB4A 3JSMA 1S0OA 1HNVB 4XDDA 5DQIA 5EUHA 3PR4A 3IC1A 3GILA 4FPRA 1VK8A 2Z4PA 1D3WA 4WFNQ 2LA4A 1X4BA 4RNHA 1YRUA 1JKHA 1MWYA 1XTZA 5KFHA 4I56A 5C42A 1H7XA 2VBWA 2KG0A 1YJ9S 1HW8A 1FE4A 2B0GA 1X7VA 3OUYA 2HNDB 4RU2A 1K1SA 3K7RA 1QTMA 3DOLA 1JNZB 3LGMA 4NLTA 1ZYQA 4DQQA 1GT8A 2Q3PA 4HDHA 4UUWA 3MM6B 2EC0A 1UAWA 4M8LA 2XMJA 3EZUA 4JI2F 3DRPA 2OJ3A 1C4CA 5DDRC 2AJ1A 3AAWB 2BACA 5H9EJ 2VBZA 1PSDA 3IA0A 3KK3B 2YNGB 3AJ1A 3I6PA 3TVYA 1A9NB 5EHHA 4B9VA 1DZ5A 2MZSA 4OZNA 3LH2S 1Q8IA 3MF5A 2JWNA 5CHCB 3PACA 4KRWA 1AFIA 3V2UC 2DCLA 5FD1A 1NKCA 5CYMA 1LQ9A 4K4TA 2KZZA 3BM7A 4OHXA 2HS0A 2LU1A 3CCMS 3DM2B 4JV5F 4RW9B 2Y1IA 2YKPA 1LV5A 4G1QA 5KT2A 3VZHA 4ZVHA 4CT8A 2R7UA 2AX0A 3IGNA 2M8HA 5IM0A 2QA4S 3MR2A 1YJNS 1KLNA 1X5OA 2XLJA 4XK8C 4TY8B 2ZITA 3N79A 3S7RA 1YIJS 1UJ4A 2B51A 1MSWD 4QZVB 3A8EA 3IFEA 3M1VA 3G9CA 3KLFB 1LXNA 1S1XB 1URRA 1ZOTA 2GNKA 2HPUA 1O51A 2YKOA 3SV4A 4OQJA 2EBEA 5GMKa 2RT3A 3SCIE 2HRUA 4I2PB 1LXJA 5CA5A 1Y4ZB 3H4BA 5K8NA 3CPWR 3P96A 2BRKA 4NLQA 4Y2KA 2OKQA 2YNHB 2EI5A 2IVMA 3FEZA 4M94A 3O1LA 4PUOB 4FBUA 3UW1A 4USIA 4AYBD 1YVFA 2HWHA 4KAIA 4WK3A 5L1JA 1GQEA 3CEDA 5EWEA 1U47A 4DV0F 4RBUA 1E6VA 5F8HA 3NGDA 2BQRA 4C8LA 1Y5IB 4NPOA 2IVYA 2MHEA 5A8WB 4J9SA 1Y00A 3F56A 4CZCA 3OFEA 1T3OA 1HQEB 1TL1B 2MZ1A 4Q2LA 3MAQA 2VA3A 4DSIA 2ZH6A 4CO5A 3IGVA 1MWZA 3V4IA 2XSFA 4EUVA 1HQUB 1VRTB 2FJAB 4ZHRA 2MZRA 4Y3CA 2DB1A 4AL6A 2V8HA 2WSCC 3NAHA 4IOCQ 1LWEA 4OIXA 2GC8A 4F2SA 3HK2A 3R5DA 3DYAB 3M4XA 4B08A 3KK2A 4A8QA 3ITHA 3JTOA 3LP2A 4ED1A 1BWEA 4QW8A 1KD1T 3T5LA 2JSXA 1S6PB 3K5MA 2QLWA 5E0OA 2N3OA 3KK3A 3US5A 1M5KC 1VI7A 3NG8A 4DLGA 4AXIA 3SSSA 3MR5A 4NLUA 1NJZA 1FCAA 1SQEA 2RVJA 3P6YC 2PA3A 3QJJA 2CQBA 1U48A 5KFWA 2PA8D 4FZVA 2IFXA 4PG8A 3GV8B 1R3NA 3G86A 1KFSA 3PEJA 3D28A 1HNIA 2XLKA 2YKMA 4U7CA 2ZJQQ 1LW0A 2FHOB 2EG1A 1FEEA 1VQYA 4Y00A 5B0CA 5IXUA 1U1LA 4NXMF 2ASLA 3CJKA 5E7OB 5KG0A 3NCQA 1RI7A 1UA0A 4IRKA 3HF5A 3MEDA 3FVYA 1PC5A 3OL7A