2J0QD

The crystal structure of the exon junction complex at 3.2 a resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
89
structure length
89
Chain Sequence
PQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATP-DEPENDENT RNA HELICASE DDX48
publication title The Crystal Structure of the Exon Junction Complex Reveals How It Maintains a Stable Grip on Mrna.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 89
sequence length 89
chains with identical sequence G
ec nomenclature
pdb deposition date 2006-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2j0qD00
2MSTA 2RUGA 1SJ3P 4BS2A 4ED5A 1U1QA 2MQMA 2MKHA 2ADCA 3VAKA 2ZJRQ 2GO9A 2MKSA 5CA5A 2LECA 1YITS 1VC5A 4CQ1A 3VAIA 1Q86T 1WI6A 4M5DB 5GAHU 4UY8T 2MZQA 2VODA 2CQCA 2SXLA 3SDEA 2DNHA 3PIPQ 2DHSA 3R1LA 2CQPA 1PO6A 5DDOC 1N54B 3EX7B 4YB1P 1YTYA 2ERRA 1VQOS 1U1NA 1M5KC 1S72S 2AYGA 1U1KA 2X1GA 5EN1A 1FT8A 4P6QA 2QEXS 3MDFA 1VQLS 3H2VE 1A7GE 2XNRA 1FJ7A 2LCWA 1U1LA 4YUDA 2MQOA 1X4HA 2YWKA 3IRWP 3ZZYA 1X0FA 2RRBA 2E5IA 2D9OA 4TU7A 5GAGU 1AUDA 1RKJA 1WF1A 2KT5A 3MUMP 3TP2A 3MUTP 2OIHA 1HL6A 2MQPA 3CCUS 2MKCA 2KHCA 2CPEA 5DDPC 1JMTA 1P1TA 2CPZA 1CVJA 2DHXA 2QA4S 3EGZA 2YH0A 4W90B 2CQ2A 3MOJB 1PGZA 2MQLA 2MHNA 2KXFA 5DETA 1K9MT 2DK2A 5CXTA 5JVHQ 1L3KA 2M8HA 2L41A 2M0GB 4Y00A 1KOHA 2O3DA 4FXWA 2ZJPQ 4YOEA 1NU4A 2G0CA 2N82B 2DH7A 3NMRA 5IFMA 3VALA 3OW2R 1WTBA 1X4DA 1F9FA 2LEAA 2M4MA 1OWXA 2DNYA 3FEYB 2X1AA 5HO4A 1S79A 1VQ9S 1D8ZA 1WHYA 1O0PA 1K8AT 2CQBA 2YH1A 1YIJS 1M1KT 2LA6A 3NNHA 5GADU 3D2WA 3VF0B 3R1HA 2LKZA 3CC4S 2MZJA 2DHGA 3SDEB 2EVZA 2RNEA 2VOPA 3NS5A 1U6BA 2V94A 2LXUA 2KM8B 2FY1A 1U1RA 2XB2D 3N9UC 1VQ7S 3UE2A 1ZZNA 2N3LA 3CC7S 2LXIA 5GAEU 3BS9A 1M5VC 5GMKa 5D78A 2HGMA 2DH8A 1X5TA 4Y0FA 3BO3A 3MI7X 3ULHA 2J8AA 1VQKS 2DNPA 4F25A 5IM0A 1WG4A 2MKJA 1BY9A 2L08A 2DNLA 2FC9A 1X4BA 1YWXA 1YJ9S 2EK6A 5D77A 3BO4A 3RW7A 4CH1A 5JVGQ 2NZ4A 1X5SA 3MD3A 1XN9A 2KU7A 3NNAA 3DXBA 5CYJA 3U1MA 2N3OA 1QM9A 2DNMA 4WCEQ 1KOOA 2MZSA 1SJFA 5LJ5Y 3CULA 2XS2A 1DRZA 3LPYA 3UCGA 1SJQA 2CQIA 1RK8A 2KRBA 1VC0A 2MQNA 1KQSR 2OSRA 1OO0B 2M8DB 2CQDA 4ERDA 1WELA 1SJ4P 2CQHA 2KN4A 3VAJA 3B4MA 2KRRA 3CMAS 1VQ6S 2AD9A 1FJEB 2CPJA 4A8XA 4IO9Q 1HA1A 2DGTA 3SXLA 4QU6A 2LEBA 1X4GA 3JB9k 3UCZP 2DIVA 1JJ2R 3V4MA 2MGZA 3IWNC 2K8GA 1H2TZ 2RT3A 1VC6A 2WBRA 2RQ4A 3EGNA 3MXHP 1WG5A 1W2BR 1Q82T 3CCRS 2PE8A 2KFYA 2MXYA 5MLCV 4QQBA 4U67Q 2OTJS 4LMZA 1Q7YT 2B0GA 3BEGB 3UD3P 3P6YC 5DDRC 2DNGA 2X1BA 3P3DA 2D3OR 2DHAA 1WEYA 1X4AA 1VQ5S 4WFBQ 1N8RT 1HD1A 1VBYA 4OZ1A 2M7SA 2AYEA 3S6EA 3CMES 2U2FA 2DGOA 5FJ4A 5ITHA 3CCES 2CQ3A 2GHPA 1JJHA 1QVGR 2DGQA 3L3CA 2OJ3A 1SXLA 5IM0B 4FXVA 2JWNA 2M9KA 2MMYA 2A3JA 3UD4P 3CD6S 1WHXA 1WWHA 2MYFA 4V19X 2DNOA 1WG1A 2DGSA 3G71S 2VONA 1VQNS 1B7FA 2CPXA 3CCJS 4LJMA 1YI2S 3J7YU 2J0QD 2LYVA 2M2BA 3Q2SC 2J76E 3PIOQ 1X4EA 1X4FA 1ZH5A 2AYBA 3J7ZT 4WIIA 3MURP 1FJCA 2CQ4A 2UP1A 1VBXA 2DNQA 3G4SS 3BO2A 2U1AA 1WF2A 3MD1A 3TYTA 2E5HA 1D9AA 1KD1T 2MKKA 5LXRA 3CCVS 4IUFA 4TU8A 1YJNS 4LIRA 3CPWR 1VQ8S 3VAMA 2ADBA 4PRFA 2RS2A 2MGZB 2DGXA 5LXYA 2NLWA 4WKRA 1WI8A 2JRSA 3CUNA 4RU2A 2MB0B 4CIOA 1QVFR 1U1PA 2DO0A 2QFJA 2XSFA 2CQ1A 3Q2TC 2JVRA 4J5OA 3B4DA 2DGVA 2CPHA 2E44A 2E5GA 3LQVA 3CCMS 1UAWA 2DNKA 2EK1A 5DM6Q 2HYIB 3UWTA 2OSQA 3I56S 1M90T 2RQCA 2M70A 2MZ1A 1H2UX 1VQMS 2M88A 1U1MA 2G4BA 3VAFA 2DH9A 2RU3A 2KH9A 1U1OA 2DB1A 4W92B 2XS7A 3G96A 4IOAQ 1URNA 5DDQC 3P5TL 2DISA 2CQ0A 3CTRA 2N7CA 2YTCA 1N88A 1WEZA 1VQ4S 2HGNA 2F3JA 1UFWA 4C0OC 2ZJQQ 3G8SA 1KC8T 2I2YA 2HVZA 2M52A 3VAGA 1UP1A 3G8TA 3I55S 2LMIA 2YKAA 3CF5Q 2DITA 5HL7Q 2K3KA 2FHOB 5LJ3Y 1SJRA 3THPA 2MZTA 2HGLA 4C7QA 2CPYA 3HHNB 3S7RA 2Q79A 1HD0A 2MKIA 4WFNQ 2XNQA 5BJRA 4C4WA 1DBDA 4OZ0A 2CPDA 1WEXA 1WF0A 1X4CA 4Z2XA 1K73T 1G2EA 3ZZZA 1H6KX 4ZKAA 2KXHA 3TO8A 1JJ4A 2CQGA 3FEXB 2OTLS 4WF9Q 2XS5A 1X5OA 3CCQS 2KG1A 1FNXH 2JX2A 1M5PC 3CCSS 3R27A 2DNNA 2FC8A 3CCLS 2I38A 4F02A 1YJWS 1FXLA 4WFAQ 2DGUA 1VBZA 4QPTA 2BOPA 2AYMA 5H1SV 1NJIT 4TLQA 4CH0S 2KYXA 3HI9A 2MQQA 2D9PA 4PR6A 1R8HA 2DIUA 2DO4A 2MPUA 2MJUA 1IQTA 2KXNB 1OIAA 3MUVP 1ZZFA 2KVIA 4IOCQ 2JVOA 3P49B 5LSOA 1P27B 3US5A 3CXCR 3S8SA 2VOOA 1N52B 2E5JA 2RVJA 3THTA 2MY8A 3G9CA 3S01A 2BZ2A 1U6FA 4PKDB 3SMZA 2RRAA 1DHMA 1OPIA 2F9JA 2MJNA 5LSLA 1WHVA 5DM7Q 3K0JA 1DZ5A 2LA4A 5IQQA 1U2FA 3VAHA 1FO1A 2J0SD 2FPHX 1WHWA 2KI2A 4UQTA 2KM8C 2CJKA 3DLLQ 3UCUP 2MZRA 1X5PA 3G6ES 2X1FA 2DNZA 2LQ5A 3RW6A 3H2UB 1UW4A 1FHTA 2RS8A 2F9DA 3NS6A 1VQPS 2DGWA 2HZCA 5GVQA 4QU7A 1H2VZ 3U1LA 2G1DA 1R8PA 2MSSA 4EGLA 2L9WA 2CPFA 1YHQS 4F26A 1M5OC 2PEHA 2KG0A 1A9NB 2DNRA 2CPIA 1Q81T 3NNCA 3CC2S 2MY7A 1NO8A 4TU9A
chains in the Genus database with same CATH superfamily
2VQFJ 1ZTTA 2VDHA 4ED5A 1UPMB 4ALZA 4LF7J 4AUKA 2UVUA 2FLLA 1UFKA 4I0WA 4ETZA 4B3MJ 1YJVA 1S6UA 3OR1A 2AP6A 3FK4A 3M2RB 4O3SA 1FRJA 4RR5A 1N5YA 5K8NA 4MK8A 3IRWP 4K0KF 4W98A 3LOUA 4ETXA 4HDGA 4DR2F 5T7LB 4WE1B 4KY3A 2UUTA 4P73A 1UETA 1KSPA 2M0GB 1KOHA 3MM6A 5KT6A 1CJTA 1NU4A 5ETRA 1JK9B 1T03A 3L95X 1SJ1A 5KG7A 5KFWA 4RBVA 5F9NA 1AFIA 1Y4ZB 2CQBA 4IFYB 2LA6A 5GADU 1RTIA 4Q5VA 3GJSB 1UVLA 1NSAA 2V9KA 2VOPA 2V94A 2H4YB 2LXUA 2DEIA 1LKZA 1U1RA 3UE2A 1E6YA 3DXSX 3MEEB 4JI0J 4RW8B 2LXFA 2VPWB 4GO5X 3KDNA 1IKWB 1TTHB 3CNQP 2MKJA 1KNZA 4QBUA 1Y5NB 3QGHA 1APSA 2BYCA 4QW9A 1YJ9S 1Z2LA 2XO6A 4DN9A 3OHBA 4DR4F 4P2XA 4JI1J 1S0NA 3H7HB 1SJFA 1S1UB 1SJQA 3Q8VA 3T5HA 1VC0A 4JOUA 1OO0B 4O44A 4ZPCA 1MW7A 2FB0A 4EEYA 1E6VB 3K59A 1JJ2R 1BQNB 2BM0A 5A8KB 4F2RA 3MXHP 4ZPVR 1WC5A 2MXYA 2FDNA 3QO9A 2IYIA 4RW4A 2EBGA 2OMOA 1RAHB 2OPPB 5KFEA 3P3DA 3FSXA 2YWFA 2NR0A 3KOAA 2P9GA 2ZE2B 4ID5B 4PWWA 1VFJA 3LP0B 1TKTA 5HN0A 2HFNA 3HVRA 2AF6A 2X3DA 2BANA 4LBPA 4E2FB 3IAS9 3HDSA 1IBCB 3CDUA 2HBRB 3T1YF 3HHLC 3BN7A 1C1BB 3LAMA 1FNOA 3BYRA 2E5HA 1VQ8S 4PRFA 2W01A 4WKRA 2JRSA 1Q8LA 2Y9HA 3D66A 3MMAB 3PO4A 1ICEB 3HO1A 2F8MA 5F3ZA 2CPHA 1TL7A 2DNKA 2EK1A 4Y28C 4JI0F 3RB3A 3ELHA 1ELOA 1NKEA 3UDCA 1BHNA 1HBUB 1WC4A 4MMOA 1PAUB 2RHQB 1OYEA 4JV0A 3BBBA 1R27B 5K9FA 2DRBA 2QMXA 1R0AA 4JYAJ 1GX6A 4PG8A 3FNNA 3MR5A 1C1CA 5IT9U 2G0IA 3L7PA 4JI2F 2QV6A 1UVNA 4GVLA 3TUZC 3H5SA 4NLXA 4C7QA 2VC1A 1U26A 2HBYB 3B78A 3NGDA 2GC8A 3P5BP 3A8JA 3DM2B 3UR3C 1SH3A 3MFIA 3EGVA 3OUYA 2JX2A 4LRAA 4UY85 2HVHA 4DR1J 4IQXA 4MAKA 1S1TA 2DXFA 4PPZA 2MQQA 2RQKA 3ILIA 1FF2A 1WC0A 3MAQA 2B4OA 1EP4B 3P49B 4L76A 3L7OA 3BQ0A 2VOOA 2BJ9A 1XMQJ 1SH2A 4TQRA 1DHMA 1OPIA 3QJPA 3UD5A 1T9UA 1X8DA 2W7AA 4X4SA 3OJUA 3WX4A 3LGMA 2QL5B 1Y10A 2WRMA 2W9BA 5D3GA 4USIA 3OFHA 2HNZB 4OI3A 3IGNA 2IRXA 1VRQC 2GFFA 3TEHB 1Q86T 3GV5B 2MKHA 2ADCA 3BPSP 3MM9A 1XNQJ 2ZJRQ 5CA5A 2AW0A 1SC1B 3VAIA 4FYWB 4L72B 2CFXA 4DR3F 3RAMA 2DNHA 4Y3CA 4ZP6A 3JTOA 3EX7B 2W7OA 1OMSA 1QLNA 1MU2B 2NCKL 3W8GA 1K0TA 2BR0A 1RTJB 3M8PA 1FJ7A 2LCWA 3DRPA 3KHHA 1X0FA 2RRBA 1Q95G 1MN7A 5GAGU 2P9CA 1QSYA 2B4VA 4M5LA 5KTQA 5C42B 1LW0A 3C6UA 3PV8A 2DHXA 2HQCA 1FEEA 5KFHA 1RAFB 3OPKA 5KFFA 3HX9A 9ATCB 1T3OA 4ES1A 5AXMA 2HVEA 2WVEA 4J9PA 2EXUA 2R3VA 2W2PP 3KUHA 3RJMB 1KQGB 5HO4A 3PM9A 2VC0A 3P8BB 4CNZA 3C2PA 1Q5YA 3M4XA 3PNIA 3IR7B 4WPAA 4J9RA 1W25A 2FY1A 3I96A 4DV0F 3OL8A 4FKXA 2YWGA 3PX4A 1N34J 1M5VC 2K7JA 1BD6A 4NLGA 4UOCA 5CH7B 3M6VA 4CP5A 4UOFA 3M6UA 3M1VB 1KN6A 1VRUB 3I9ZA 2N4DA 3POTB 3BO4A 2ASYA 1GMWD 3EVWA 4F4AA 4P9SA 1S9FA 2IAJB 2CIMA 1UL3A 2DNMA 1KOOA 2GS8A 2XS2A 2D1CA 5KG6A 4AYBD 2C2OB 5FD1A 3SZ2A 2YNIA 4K59A 3TUPA 3H5UA 4OYZA 4U96A 4FBTA 2Z4PA 1Q4RA 3CT9A 5JJBA 1VJQA 2KO1A 2RF2B 4OI1A 2RSQA 1AYEA 1LNQA 5L1KA 1HNIA 2R8JA 5KG0A 2DCUB 5CZVA 4P72A 2NYHA 1NRKA 2KTQA 2DNGA 2X1BA 4AL5A 3M8SA 3S6EA 3CMES 4ER8A 3QFWA 3DKDA 3CCES 2ROPA 3KXDA 4FXVA 4RLEA 3VVTA 3ICLA 2PN6A 5DGBA 1WG1A 5JMNA 4USJC 4BWJA 3KK3A 3SQGB 3O6QA 3OVBA 4H4KA 1LWEA 2JC0A 1ZH5A 3G4SS 2K1RA 5D0EA 2GMJA 5A6WA 2U1AA 2CDRB 3MPVA 4B3TJ 3VV2B 4IDKB 5J2QA 4AQYF 2XWYA 3QRQA 2DGXA 4MYTA 4X4OA 1HWJA 1JJCB 1RTHB 2HMIB 2IVMA 2IHR1 3B4DA 2E44A 3LQVA 3K5PA 5GADI 1B0PA 5J2MB 2MZ1A 4LF8F 4XPEA 5EWGA 1QD1A 4FF4A 3QRRA 3HJVA 2XSJB 2RHSB 1FX2A 3PKMA 3AB2B 2ZH9A 1U25A 4KPCA 1HNZF 3FC9A 2G0JA 3T19A 2KFNA 1G1XA 3I55S 3DFEA 2OPSB 2W2OP 1SJRA 1NCLA 2CZ4A 4NLVA 1HD0A 4LIWA 1NDCA 4WYWA 3UNGC 1LFPA 2R7WA 3HKWA 1QJHA 2FC8A 3HCXA 4DUTA 1QSSA 4C0BA 3KLEA 1RT6A 4DV2F 2R2UA 1RTDA 4A8OA 4J90A 4QWEA 4ANCA 4ED0A 2HFOA 2BEFA 3Q8RB 1RHKB 4IQMA 4YFUA 2YNGB 3RBXA 1XIQA 1JLEB 2CG4A 1N52B 4NI2B 2RU9A 3M9NB 2R7OA 3VAHA 2J0SD 2W7PA 2G2ZA 3TAMA 2X1FA 2Z57B 3RB4A 2HRUA 1EIYB 2GHWA 4MKYA 1FXDA 2FJBB 4C8KA 2L9WA 4DLEA 4DEZA 3PTWA 2B56A 2NZCA 1BQMB 2MY7A 1NO8A 3G6YA 1SJ3P 2BKPA 4C8ZA 2GO9A 1YITS 2F4VJ 2VF3A 2MZQA 1VCTA 3BH7B 5CYQB 3LWMA 4GVBA 2ZH4A 5A8RA 3H90A 2UXCF 1Z4UA 2BQUA 2C3PA 5DRKA 2OFGX 5A76A 4F3MA 3MM7A 3EVMA 3W62A 1CEZA 5KT2A 2EFOA 2IVFB 1WTFA 3HVTA 2I5JB 5KG5A 5B0CA 3IRXA 3NBPA 2E7WA 1SUQB 3I5CA 4W90B 3PZPA 3W9JA 4F4WA 1Y5IB 1K9MT 2G1HA 4YHHF 2J9DA 4X64J 4CLWA 1VK8A 2ZD1B 1RP5A 3TI0A 2V2VA 4DCPB 1CS4A 4YOEA 4LRDA 4ZS6A 4LF5F 1O6XA 3CJTA 3MM8B 3PRVA 2D41A 2GCFA 4W4MA 2OI2A 1O51A 4PEOA 3TJ9A 3PW0A 2IDLA 4DL6A 2FVRA 3D2WA 4YDXA 3R1HA 1HMVA 1WSRA 2ZOMA 3KLIA 1W26A 2YNHB 5FIIA 3M2UB 3D4JA 2AKWB 4WE1A 4FXDA 4WKYA 1BLUA 5EX0A 2HEKA 3HZGA 4NLRA 3NP5A 4NWBA 1N33F 1RCXB 4NCGB 4ZPDA 3ISND 2HFSA 2Y0SD 3O2IA 2ALZA 1O5JA 1PSDA 5D77A 3V6JA 3VHQA 3BGRB 3NNAA 2ACYA 4ZJLA 2ZZNA 4IFYA 3GJQB 3UCGA 2AZ1A 1FK9B 3PJWA 3GMGA 1RDRA 1RT4B 1QAJA 4NYOA 5ETOA 2AD9A 3UN3A 4Q8EA 1RACB 1KLMA 4DG1B 3MEEA 4OYMA 1ZBTA 4RW8A 2HQDA 2WAQD 2HHWA 4OFZA 3NGRA 4U67Q 3H59A 4OI0A 3UD3P 3LALA 1FKPA 2H54B 1MNEA 5E3PA 4CI0B 1VBYA 3AJ2A 2GHPA 2DGQA 3L3CA 1HHSA 4R25A 3NGKA 3OLBA 4QWAA 4E8UA 3E51A 2JFDA 3NG8A 5D4LA 4V19X 4X2BA 1RYRA 3CMQA 3J7YU 2M2BA 1BQNA 3PIOQ 4CO2A 1RT7B 3DU5A 2W9CA 4LVOP 1KWMA 3LPEA 3LANA 1VBXA 3ITHA 2OPPA 3EPGA 5AXLA 4OX9J 3KK1A 4H4MA 4LIRA 4UW2A 2ZE2A 2DO0A 1HWUA 4NL5A 1IBLF 3DRRB 3HF5A 3O5TB 3J81j 3FUYA 5D8HB 4Y6IA 1DTQA 3QIPB 2RU3A 2VA2A 2GVZB 1RWNB 2PC6A 1A0OB 4KO0A 4RU9A 1T0TV 1FDDA 4DU8A 3OTCA 3M6XA 4GC7A 1I94J 4BDPA 5M2UA 4MIAA 1HQ2A 2YPZA 3GR1A 1KDNA 2WW4A 3MMAA 4DF8A 1V9OA 4DQIA 2HK2A 2JEGA 1TFYA 1IUJA 4WFNQ 2E1RA 2FJVA 4NOHA 2JOQA 2YKPA 4CO3A 4DN0A 4F4XA 3W5XA 3H8YA 3NRBA 3TO8A 2B6AB 2AX1A 2FGCA 3R8YA 1R7IA 4L6V3 3D6HB 3WDOA 4M95A 3SCJE 4IFVA 3TUIC 2DGUA 2Y0BB 1NDPA 2O5DA 3SSQA 3PVXA 1UJ6A 2MPUA 3TZWA 3W1YC 1S48A 2RE1A 4Y2KA 2UU9F 3J7AN 1P27B 2CZVC 3LO3A 2WBMA 4P2SA 2X7IA 4DL0C 1EKSA 3GIJA 1RA7A 3DM2A 3T3FA 3ETMA 2UUBJ 3KTQA 3DRSA 1HNVB 4DPOA 2DEJA 1VQPS 1B70B 3W9IA 1JXLA 4RKUC 2HQ3A 2MKYA 2QIFA 2PEHA 4XO0A 4I2PB 3G86A 4IH6A 1T9YA 5KFGA 2MLXA 2KT3A 4YR2A 4BHQA 2UUWA 3HFZB 2ZFHA 2GJIA 2JFKA 1OYDA 1UWBB 2BRLA 2A1BA 2FD2A 1ZM3A 2KYZA 1NJZA 1PO6A 5E0OA 1DLOB 1N54B 1VQOS 5DG8A 5ETSA 1ZAWA 2IM0A 3KLGB 5J2NB 4RL1A 1R6VA 3KUGA 3BV8A 4X4NA 4CCHA 1N5SA 4TU7A 5K8PA 4X4TA 5HLFA 2YVSA 4KFBA 2KHCA 2VFSA 2GVDA 2YH0A 4QWBA 4DR5J 4MIWA 5IV3A 2AJ4A 1DURA 2YKMB 4O23A 4CNYA 1V5IB 2CKWA 3LWLA 1X4DA 4USUA 1HYSB 3UFCX 3GV7B 3V4IB 1IR1A 3GFZA 2FY8A 3KWMA 4PPDA 2HNDA 4UZBA 3MAHA 4KHPJ 1LXNA 3PX0A 4ED2A 2CJAA 2DVIA 1X5TA 4Y0FA 1J5EF 1S9GB 1IBKJ 2UUAJ 3JAMY 2Z2YB 3FBBA 1L3VA 2XLJA 3CJ3A 2HVIA 2VQEF 2Y8YA 1GAOA 5KFNA 2D3ZA 2VBWA 2VG6B 1ZM9A 4K4TA 1HR0J 3CJ8A 1Z1ZA 2MZSA 3CULA 1A6LA 3LPYA 4FS1A 2R9LA 3HK2A 1NH7A 2HHUA 4NCAA 3LF0A 2MQNA 4LRFA 1NSQA 1RT1B 3TX0A 4LFCJ 2Q6CA 2CPJA 2K06A 4IO9Q 4F0HA 3PXGa 2CXEA 3EYZA 5DGAA 4P74A 3MCMA 2ILZA 2A6MA 3KLHA 3GYGA 3CCRS 4F67A 1FFSB 1FRIA 3T1HF 4I4BA 2IAJA 3AOAA 3M9MB 6AT1B 3M7VA 4LUBA 5FJ4A 3MEGB 5H9EK 1JJHA 3Q24A 3BB5A 3E8OA 5IM0B 1D0EA 2VL1A 2CG8A 2RAQA 3CJ2A 2KJVA 3A12A 2VONA 2OO4A 1B7FA 3BDPA 5EWEA 5H9FJ 3CCTA 1PAEX 3DN9A 4CTAB 1HW8A 2GAHC 2HFUA 2AGOA 4AL6A 3KJNB 4FYVB 5FLXY 4IUFA 3W8PA 2R2TA 4ILMA 4Q8FA 1K44A 3ZZOA 5CYMA 4OYIA 2VASA 1U1PA 5HANA 2J5AA 3IM8A 2J0XA 2PT0A 3W60A 4ZVEA 5DM6Q 2UVVA 2HZVA 1GXUA 1ZPWX 4CYUA 4NLDA 1H3DA 5K20B 2XEXA 1UKUA 4IKAA 1NK7A 2B4PA 4F8RA 2OELA 5DDQC 4JI3F 1RU1A 2FGOA 5T14A 2QA2A 1N88A 1VQ4S 1NK6A 1UFWA 1S99A 2M52A 2LMIA 5JXSA 2DITA 4DDFA 2C2EA 1RTHA 1UVJA 3THPA 2HMIA 4LQ9A 3UVJB 4B9VA 3QPIA 2V8HA 2ZVIA 3MTKA 3PW2A 1JJ4A 4DV1F 2H5IB 1VRTB 2GV1A 1M5PC 3MEKA 5D0RA 2IPOB 3RGIA 1KS2A 2HAFA 4MH8A 5IT0A 3CJRA 2OPSA 4IG3A 3KDOA 2IBOA 2CNNB 4F4ZA 3D5MA 2JVOA 4EO8A 5HROB 3AJ1A 3JYTB 2XCPA 3FRZA 1F2GA 5B0BA 2J9EA 3PHEA 4PKDB 3UDLA 1TKXB 3ZZTA 5HMWA 3B82A 4F2SA 3ILLA 2YXLA 2DKOB 2I9SA 1X5PA 2LQ5A 3J7YI 4PG4A 1W7WA 1VBKA 4HL9A 2DGWA 1T8EA 4ILRA 4DCOB 3A1YG 3Q86A 1R8BA 4B9NA 1M5SA 2IJNA 3DMJA 1JLEA 1F3VA 4M8LA 5ETVA 1JIHA 2DRAA 2V2KA 1UVMA 3OXFA 3FSYA 4JI5F 2G13A 4RUHA 2JLGA 1TKZB 2OD6A 3CDAA 1ZPVA 4WXWA 2AYGA 3AD8C 4U7CA 1VQLS 2XMMA 1S1VB 2OP5A 4RNHA 1NPPA 3KMSA 5F0WA 3QIDA 4I56A 2W25A 2MKCA 4QIWD 3ENWA 1TAQA 3MM5A 1C0UB 1JMTA 3EGZA 3OSNA 2NXCA 4M5KA 2KT2A 4ECWA 3FDSA 4J9QA 3ZO7A 3J81Y 1JNRB 1FESA 4OJ3A 3V81B 4FYXB 1VMBA 2LEAA 1JLBB 3JTNA 4AE5A 4EZ9A 3D9BA 4HKQA 4ICLB 5HI7A 1IBMF 2C3UA 1TUWA 2ATCB 2I5JA 2DXDA 2E9RX 3N9UC 2P9EA 1UEKA 2DH8A 1YK9A 3NLCA 3AOCA 2LP4A 4Y2CA 2LQ8A 1RABB 1NSPA 3MM8A 3RW7A 4Q44A 2YKNB 4ED4A 4DS5A 4DFPA 3GG0A 3PYGA 5HJXA 5HBMB 1WELA 5GAEI 5DLFA 3EZ5A 5G0RA 1FJEB 4A8XA 3PYEA 1S1XA 4FF2A 3M2UA 4N56A 4OI2A 2XWXA 2HLUA 1B99A 3IWNC 2K8GA 5I3UB 3AA8A 1Q82T 2V4JA 4NCGA 2ZBPA 4ZVTB 1BMQB 2BJ1A 2B0GA 4BC9A 4N8OA 3EUNA 2UV8A 1S10A 3DDKA 3BGRA 3C14B 4USHA 5A0YA 4OZ5A 2GIQA 2OFHX 4RUAA 3H4BA 1U7LA 4TY8A 1TK5A 1JNZB 2MTLA 3BKUA 1YI2S 1BWEA 4IO1A 2HG4A 4YR3A 2AJ0A 1HNWJ 4UT4A 2EKNA 2GMLA 4A4JA 1TP7A 2EFGA 2VBYA 3GZ7A 4TU8A 3VAMA 4P2FA 4KV8A 1FE0A 5LMNF 7AT1B 4HYKA 3I32A 3DLEA 4ZVFA 4NZ6A 4KH0B 1NAQA 1J5OB 2RQCA 2G4BA 2HHPA 1RT7A 2WW8A 2KH9A 4W92B 4LF9J 3R5BA 4JI7F 3FCHA 3I9V9 1DARA 2GW8A 4DFJA 3WHIA 4G1QB 3K8VA 2VPXB 2VD3A 4KT0C 3FGVA 1UP1A 2XMKA 1VOMA 1NK5A 2Q79A 3V5RA 3THVA 2UXDF 1Q7LB 4A8YA 3FCVA 3DRXA 2CQGA 3MF5A 2IM2A 4ZLNA 3MR2A 2DNNA 4X62J 2B51A 2ACMA 1QTMA 1YBAA 2L3MA 4QPTA 1F6TA 3W64A 2AYMA 1FJGF 4LF4F 4JI6J 3Q89A 3W65A 4HR2A 2KXNB 3HHLB 1N32F 1GX5A 4TN2A 1UVIA 5F8NA 4C3MA 3JAMU 2MY8A 4PABA 3TA0A 3TAPA 3V6DA 2GZOA 2B3TB 4BBYA 4EMDA 4HT5A 2LA4A 4NXMF 3J80Y 1U0HB 4HVZA 3TX8A 1MSWD 1FRLA 1LW2A 3MMCB 4HEA9 2M3DA 1HLWA 3T6BA 4F3QA 1FKOB 1FDAA 3ISZA 4FP9A 1UEUA 2ZZTA 2FVCA 2CVIA 4U8VA 4Y2MA 3SSRA 5LMUF 2DYAA 2COLA 5GAHU 2VG5B 1NZ8A 4M5MA 2ASJA 3PYFA 1FVQA 4MTPA 4KIAA 1T3NA 4OYXA 4CLYA 3M8ZA 2Y1JA 1S9EB 2XNRA 3G82B 1XR5A 5DQHA 2VPZB 1KQFB 2EC0A 1SB6A 3PYDA 1WKLA 4KRWA 4I2PA 2D9OA 1EAYC 1WOOA 2VG7A 2KT5A 2ZC4A 2Y1IA 4B3OA 2CPEA 4GO7X 4WXOA 3R7NB 3R5DA 3ZTOA 4Q0BB 4OJHA 5CXTA 1UWBA 4ZLPA 4C48A 5JVHQ 2PMHA 2H4WB 3AOBA 5B0DA 4LFBF 4AD6A 2V5HG 1JLCB 1RHJB 5FLXU 2RUSA 3TA2A 2ZH7A 3I5AA 3ZC4A 2M4MA 1BE4A 5GMDA 3VZHA 5B0EA 3KLGA 1SPBP 5J2NA 3HFVA 2WOMB 4GKJJ 1TFWA 4X65J 4NRUA 1EETB 2XI3A 4FF3A 4RW9A 3BS9A 5GMKa 1XMBA 2CVEA 1NMEB 3BO3A 1VIXA 4F25A 1XWLA 4ECVA 2DRDA 3DCAA 2R7XA 1N56A 2HPUA 3JTPA 4ZCLA 4OI4A 2NZ4A 1X5SA 3MD3A 5IV4A 1XN9A 4B3RF 3BZQA 2WHOA 1HQUB 4YQWA 4WZMA 4CM0A 3ZZ0A 3LGNA 1HA1A 3AJDA 4PAAA 4JV2A 1D9DA 4QIFA 3W5YA 4N41A 5CABA 4QQBA 3B8HA 3NMAA 3OR2A 2F7VA 2VG6A 1HD1A 4ELUA 1RWOB 5B7WA 3U1NA 2W2NP 1K47A 1QAYA 5ITHA 2H5EA 1FWPA 4DS4A 2JWNA 3JSYA 1PKUA 2DD8S 3HHDA 3BKTA 3DHXA 5KFVA 4DV6J 1FFGB 2DGSA 2KVQE 5L1LA 3NL0A 2H48B 5I4MA 2BUNA 5HQMA 5AXNA 1R43A 3ADAC 1LK7A 4XAKA 1O8BA 3MD1A 3CCVS 3BN4A 4KSEB 3BR8A 3DLGB 2H3EB 4QOTA 4I6AA 4X65F 3DOLB 1REVA 1R89A 2DT9A 3AA9A 3CUNA 3OD2A 3KNAA 3HVWA 1CJKB 4OMFG 2WSEC 3M30B 1CPZA 1B4SA 4ECUA 3DRYA 1LWCA 3CCMS 3DNCA 2ZM6F 3BPDA 3D0HE 3QT6A 1P1LA 1IJEB 4ZLJA 2O66A 1M90T 3BGOP 4Q43A 1CG2A 4XTTA 3VAFA 2ZC3A 3IWXA 4ZVUB 1WC1A 1MROB 1RWXB 1GQEA 3SEOA 5I3QA 1UA0A 4YR0A 4NLYA 3PACA 3IS9A 3JSMB 1G6BA 1HI1A 1U6ZA 1MMDA 3TRGA 5C5JA 5L1JA 3ZZZA 3J81U 3OL9A 3L09A 4J37A 4OHZA 4B02A 1SCJB 4J9NA 1ZS6A 3DLKB 3CCLS 3TQ1A 2FHJD 4Y34A 3VQTA 3AD7C 1VBZA 3VCDA 1NEEA 4TLQA 1TL5A 1N6QB 1FTRA 4XDDA 1V3ZA 3R6GB 3IG1B 4IOCQ 4K50A 5AT1B 3MWBA 3EMTA 1QUPA 3US5A 1UWAA 2E5JA 3C8YA 1IKVA 1U47A 4NPOA 3ET6A 2RRAA 1YGYA 2XM3A 5KFQA 4L73A 5LSLA 4DQPA 1D3WA 4UUWA 1QY7A 1EJ7L 1XJWB 1VRTA 2FPHX 1WHWA 3HSGA 5BR8J 2FHJA 4DV4F 4P10A 2N7YA 5B0FA 5J1EB 4ZPBA 2ZH1A 3T9NA 1X9WA 1ZETA 3AQOA 3V2UC 2BJDA 2KG0A 1B3TA 2DNRA 2PI5A 5HMZA 1ZA1B 3OXLA 3C16B 3C15B 2C3MA 1OSCA 4X66F 4M5GA 1XR6A 4CQ1A 5HMXA 4M5DB 1TL3A 3LP2A 3AH6A 4DI6A 4G3IA 1CULA 3PIPQ 4YP3A 1R3NA 4DQRA 3QT8A 3R1LA 1VQYA 5DDOC 3FBCA 4ZVHA 3EM1A 3ZTRA 1S72S 3MECB 3MHYA 1YSJA 1OPZA 3M2VB 3ZXWA 1S6PA 2QX0A 3QAEA 5B0AA 2E5IA 1UZDA 1WF1A 4XIUA 1Q8IA 2AMCB 3MUTP 4YB7A 3CDEA 4P7VA 4NLTA 1U4BA 3GYXB 2CPZA 3W9HA 1YDLA 2QA4S 1F5BA 2VHGA 2CQ2A 4DR7J 3FKBA 1F3FA 3OT9A 2L41A 4Y00A 2O3DA 1TV6A 4FXWA 4ITSA 3ZNJ1 3NMRA 1WTBA 3GONA 2QL9B 3GSDA 3ZTSA 1YZ7A 4R0EA 2LDIA 1QAIA 3KLFB 2LFVA 4B3SJ 4CM2A 2JEFA 1RAOA 4OYPA 3E3XA 1T9VA 2XB2D 4DL3A 2N3LA 4I68A 1LWFB 3CC7S 3EJMA 5HP1A 2HGMA 1RZMA 4JI8F 4IRKA 1GXLA 3SV3A 5ETKA 2UUCF 1C4CA 2VH7A 5E5NA 1H7WA 2CDQA 4A8FA 2QA1A 3D54A 1U2RA 4WCEQ 4ATNA 1JQGA 1DRZA 4LSZB 1P9QC 2CQIA 3CCZA 4ICLA 4Y65A 2CZ9A 3ETOA 5D15A 1SJ4P 3ZZPA 2MLYA 3BH6B 4DU7A 3OQ2A 3SXLA 1VHFA 1MLAA 3V4MA 1RYSA 2LQ9A 2W4DA 5THWA 2IM1A 2RQ4A 4K0KJ 1RWKB 4CZCA 4DR2J 4RBTA 3K8WA 4LF2A 1S49A 2DHAA 3T5JA 3FZBA 1HWKA 1OY8A 5GAHI 1GEHA 4IG0A 5K14A 1NKCA 3SCIE 2ZBCA 5HBMA 1N36F 1S1WA 4DV5F 4RWXA 1N0VC 4NLSA 2HHXA 2BQRA 1HBMB 1SC4B 2IDEA 5I3UA 3AB4B 3J80U 3G8QA 3IP0A 2Y3YA 2DPIA 1U24A 3B54A 4Q2MA 4Z7YA 5CCLA 3MCOA 4GRSA 5F41A 1NK9A 2HHQA 3AHPA 4ECQA 3C14A 2QZ8A 3CE8A 4KGZB 2NXUA 4B3SF 1RAGB 2D3O1 2E29A 5CD4H 1XMOF 2J6UA 4OZ3A 3N5BA 4WBFA 3MCNA 2DGVA 4A8KA 1H98A 3MMBA 1D1UA 4A8WA 1VQMS 1YVFA 5KFZA 1ROFA 1YKWA 2FJDB 4FZVA 2FLOA 4O3PA 4X4QA 4IOAQ 4FKYA 2Y1LB 2XY5A 1H38A 2KDOA 4L75A 2ASDA 1GMVA 2N7CA 2YTCA 5DG9A 4EYIB 4K5SA 2QTWA 4HH1A 1DJ0A 2I2YA 1SQFA 2EW9A 4A8MP 1SQEA 1WD6A 3CF5Q 5LJ3Y 1S59A 4J7CA 3R7BB 2XTJP 4OQJA 2QE5A 2XNQA 4J9OA 1NJXA 1URRA 1Q53A 1WF0A 1H6KX 4ZKAA 3CJKA 4J9MA 5RUBA 5LSRA 4DWIA 5K8MA 4DJBA 3FEXB 1X5OA 4FS2A 4ZIVA 3RUBL 4CLLA 4L74A 4YB5A 4DMZA 3BQ2A 4LFAF 1YJWS 4OIXA 2C2KB 2HIQA 1N4LA 2FJEB 2V69A 3T1YJ 5LSOA 3CXCR 2HURA 2QLJB 2HFZA 1RLDA 2HNYA 1WHVA 4DSJA 4A46A 1UFLA 1EZZB 5IQQA 1RWWB 4HT7A 3X1LB 1Q5VA 1U2FA 2FIUA 2Z2LA 1ZAXA 1ULRA 2KI2A 3DLLQ 1H72C 3T41A 4K4XA 4OV6A 2XHCA 5CCMA 4KBIA 4F36A 2V8DA 4B9SA 2E7XA 2CPFA 3MMJA 4HACB 1MWZA 2BE2B 1SVDA 2XYHB 5KFLA 2HRTA 4HH0A 1YRUA 1PBAA 3PR5B 3CO0P 4ANEA 3VAKA 4C97A 4U7UK 4WTOB 1MMLA 3NWGA 2RDDA 3RAQA 2KJWA 3FZ2A 3Q83A 4R5PA 4UY8T 1G7CB 4P75A 3FFIB 4WFZA 3KJVB 4JI2J 1KFDA 3MMCA 2GGPB 2HZAA 4C9DA 4E0DA 3NCQA 5F8HA 1A7GE 2B8PA 1FKOA 1CJVB 1SL1A 4FN5A 3D7SB 2MQOA 3A3PB 1P9YA 2MEWA 1KR4A 2YQ0A 4ECXA 4HHJA 4PXCA 1SC3B 4QWDA 4NMXA 3EXCX 3BDEA 2RILA 1LFWA 1NHKL 4EO6A 2V4RA 1D09B 4PUOB 2DTJA 1IKYB 3UN5A 2GNKA 3H2LA 2WK4A 4O4GA 3U02A 1WDTA 8RUCA 1XTZA 4NASA 1O0PA 4OLOA 1M1KT 4TYAA 5KOXA 2LKZA 1M0SA 2HBQB 1TL4A 1S77D 3NS5A 5AE3A 3OR1B 2BMBA 1ZZNA 1T9TA 3PFOA 1NZAA 1CQMA 5M2PA 1N5YB 2EFVA 2WVCA 2BACA 1HNXF 3D0IE 2C2RA 1WG4A 5KFBA 2FC9A 3DU6A 4C8OA 2EFNA 2JC1A 3SI8A 2W4PA 4PYDA 3I0RA 3DLHA 1YJUA 2Z58B 2OPQA 2WOMA 2OSRA 4USVA 4IR9A 4DR3J 1AUSL 4DHVA 2CQHA 1EETA 2C28A 2PD1A 1T03B 4LF1A 3KJFB 2LEBA 3OL7A 3PFEA 1S6OA 1N5TA 4UQGA 4PWDB 1RTIB 2OTJS 1Q7YT 2X3GA 4J9VA 2A2DA 4NX9A 3NY0A 2FZGB 1VDHA 3LP1B 1VQ5S 2CA9A 3WIUA 1E6YB 2VFVA 4G1IA 3RRKA 3M8QA 2BV3A 3K5MA 2DGOA 4DF4A 2CQ3A 2PFDA 2NUHA 2QN6B 1HQUA 3IMQJ 4K4YA 2M9KA 2A18A 2XGPA 1SV5B 5KFRA 3CCJS 1SBRA 4DQQA 3R9LA 2FZCB 1YX2A 2W2MP 5DZ6A 2C2DA 3CD5A 3N5FA 3JQMA 4K4SA 4O44B 1X9SA 2CAJA 5EGYA 2VJVA 4LRBA 5AJ3F 4DV0J 3QZ8A 2FJWA 2RD5C 4RNNA 2Q6BA 3IXQA 1EQMA 3D1HA 1HBOA 5FDLB 5LXYA 4DCJB 4Y2IA 3DOKA 3KHRA 1WC6A 4X4PA 3QO9B 2G9OA 2E9ZA 1U8WA 1HPZA 3PY8A 1UPPA 3CJ5A 4I1TA 2HYIB 5F8IA 3CO9A 1UCNA 4C11A 4WK3A 3R5AA 4NE9C 2AJ2A 2V34A 4LVNP 1TKTB 3IA0A 2B7CB 3IBFB 4WFYA 2BANB 3CTRA 2Q66A 3LUYA 2VJUA 2F3JA 2QT7A 2POKA 2WVBA 3VAGA 3D68A 4CLZA 4DSFA 2K3KA 5C7PA 1L3UA 1CJKA 3M30A 4DSKA 3PDNA 3Q8SB 4RW6A 3EZOA 4Z2XA 2OPRB 3R3TA 4V1Ak 2DR9A 2DY1A 2VBXA 3F41A 2OMLA 4PWUA 1TL7B 4F02A 2H65B 2ZBIA 2WB1D 1NJIT 1JXEA 1JXVA 5KOWA 2QLXA 2ASLA 2QO3A 4FVMA 4QR0A 1FDNA 1I1GA 2ZBRA 1BUXA 2IIHA 4AQYJ 3G9CA 1R0AB 2XMJA 2GIFA 4ECTA 1C1CB 1FX4A 3P45B 2FTRA 4N77A 4QJVA 3WC2A 1LEOA 5F9LA 2O1PA 4KB7A 3CW2C 3I0SA 4IH7A 1RBOB 2AEFA 1H2VZ 2C42A 4I7FA 3KK2A 4LF8J 1WACA 3GQCA 4RPFA 3MR6A 1N6QA 4DUYF 4OLPA 1NUEA 4DV7F 3AXKA 2CYYA 1XR7A 3W63A 3M8YA 2HAIA 2MKSA 5A8WA 2HK3A 1HNZJ 2F8HA 4USWA 4MFBB 1XK8A 5E41A 4USKA 4C8MA 3SDEA 3KG4A 1RKIA 5IZHA 1XERA 2CQPA 4O0NA 1RI7A 3UR0A 4YB1P 2B5JA 3VTIA 2YY3A 3MDFA 2JDJA 4DV3F 1F0XA 5J1EA 3WZ0A 4YUDA 2ZVSA 4KKOA 3F56A 4RNMA 3HXMA 3C16A 2PEBA 2MQPA 5C2GA 4GKKF 5L38A 3EXYA 2RIJA 4DV2J 5D3GB 1H7XA 4ZVSB 2M8HA 5B08A 3OVAA 2DH7A 1CJUB 3D0GE 2GJ2A 4OZNA 1HIYA 4QIVA 4BCAA 2BBEA 1OQ3A 3GWCA 1K8AT 4KHRA 2UXBF 4LF6F 2X51A 5H9EJ 2A6OA 5AXKA 4ZN3A 2MZJA 2EVZA 4YB6A 4R0JA 1U8SA 2PA8D 2YBVA 2E5LF 4EZ6A 3MCSA 3M8PB 1FWKA 2J8AA 2VUGA 4K4VA 3DRPB 1CC7A 3RZAA 2RKIA 5DO2A 2V6AA 2HS3A 2E1CA 4LSNB 3FJ2A 2ZITA 5JVGQ 3CGIA 3FEZA 1LW0B 1S5ZA 3DXBA 1S4FA 2AJFE 2UV8G 1NHUA 1X31C 7FD1A 3PG9A 3IR5B 1R0CB 3N6MA 1KQSR 1WJ9A 3KLFA 3C3LA 2V2QA 5SZTA 1U2CA 3R7SB 4QU6A 1X4GA 2DHHA 1LWFA 3HVAA 2UXCJ 2R4FA 2MGZA 1B0TA 2BM1A 2G2YA 1BC6A 3F44A 1J2VA 3CIZA 4RBUA 1FRKA 1WEYA 1X4AA 5U47A 3OTOF 2F1FA 1N8RT 2M7SA 2AYEA 3ZZRA 1RT5A 4YHHJ 1S76D 1S7IA 4LF5J 2HS4A 4TYBA 2V67A 2QL7B 4PZVA 2A3JA 3G71S 4LJMA 2OAUA 3PO5A 1HFEL 3M8RA 4B9TA 2AYBA 2ROEA 1GK8A 2VFTA 2YNIB 3HPOA 4DUZF 2EFPA 4S0MA 3DOMB 1KD1T 2DR6A 1JLGA 1PCAA 2CWXA 1IKXA 5KT4A 4OHWA 1RT2A 2NLWA 3UDVA 1HNIB 1N33J 3MEDA 5E3RA 3IN5A 1GNKA 2QFJA 1UEVA 1Y9OA 2JVRA 4DOZA 4DX8H 2E5GA 2E1PA 2M70A 4URSA 1S0VA 1HBMA 4NYZA 2OGUA 4MT1A 1GTEA 1HHQA 2Z0GA 4C3LA 2DH9A 3QGPA 3W2VA 4YY3F 2VZ9A 4DBQA 1KTQA 1TKDA 2R7TA 3KK3B 2P6TA 4DSIA 2B8QA 1LWEB 4CLPA 1FD2A 2FJAB 2QSFA 5IQ6A 3D6FB 2K1RB 3OBIA 3QYYA 3NAHA 2CPYA 3HHNB 4QIEA 1F9EB 5B09A 1N5QA 2CWKA 3AXMA 2AX0A 3VR1A 3CCSS 4RNOA 1X60A 4PXBA 1QE1B 4IRDA 2YQ1A 5E3QA 4WFAQ 1R31A 4JBCA 1IM6A 5LT5A 2YNFB 3HI9A 2D9PA 4OYOA 1IQTA 4L3KA 1N5VA 5KFCA 1SIZA 5KG3A 1NDKA 3M2RA 1BWVA 3TVKA 1TUGB 2YWHA 3SMZA 4DR6F 3GFXA 2CJBA 3MR7A 3RW6A 1IBLJ 4JV1A 5T7LA 2V8VA 2F9DA 1S57A 1CQNA 2OKQA 2GMHA 1M5OC 4M5JA 5HQ8A 4CT8A 5E3AA 3CDBA 4I2QB 4TU9A 1U1QA 3JS9A 3QATA 1RTDB 1H73A 2Y8WA 1RGVA 2Z30B 2F40A 1FDBA 4OYBA 3T6JA 2BJ7A 4ED8A 3FRYA 1DAXA 4EU0A 4HI1A 3DYAB 4DL2A 3ZZYA 1IKWA 1RWVB 5HQLA 1X9MA 1WSVA 4QYZK 3CCUS 3JQJA 2QYCA 2W1BA 2JJ4D 2NXJA 1AFJA 1S1UA 4OHXA 3D6TB 1J27A 3L7UA 3N6NA 4Q2LA 3DI6B 3G6XA 2B4UA 1I5OB 5IFMA 2IM3A 2XLKA 1E6VA 2UU9J 1OWXA 1S79A 1VQ9S 2YQ3A 1HQEB 5GAGI 4OJGA 4NLWA 5L9NA 5A8KA 1RHQB 3VF0B 1SKUB 4LT6A 5DJBA 5M2RA 2QG9B 1XNRF 5ETPA 3R97A 1DQAA 5J2PB 5D4NA 1VQ7S 2B9WA 4GVBB 5CZXA 2Z2ZA 3ZFVA 2H51B 4YS2A 4ID5A 4PUOA 3QQCD 4G65A 2V8PA 3MM7B 4WP8A 3I87A 3LP0A 1AW0A 1TQLA 1FCAA 5ETQA 1FXRA 3HZEA 4FYDA 1NB2A 2EKYA 2HHHF 1RAIB 2IVYA 4EBDA 3CCWA 2W2QP 1QM9A 3SQOP 5EHHA 4ZPTR 3GCXP 1ITPA 1CS4B 3I4PA 2M8DB 1C1BA 1YG0A 3N01A 4PXDA 5KFOA 2DGTA 2ZOFA 1L3TA 3UCZP 2DIVA 2B7BB 1SKRA 2HQFA 1H2TZ 4O3RA 2PE8A 1HMVB 3GFHA 2ZH3A 2C2ZB 3P4UB 3BBFA 3KLIB 1KVIA 1FFWB 3CD0A 5B0GA 2P6SA 4KH1B 4ZJOA 1HBUA 5LL6d 3HP6A 2F8EX 3QBCA 4N47A 3O3LA 3GR0A 2MYFA 3KUEA 1VQNS 2CPXA 2KZMA 4OZ2A 3A4TA 1PC5A 4PWDA 3J7ZT 4WIIA 2CQ4A 1PJ5A 1KFSA 3H5XA 1FEHA 3GU0A 3LP1A 1NPRA 4DSLA 3TVZA 2ZOGA 4DPUA 3H98A 1MG7A 3AY0A 4R8UB 3BBCA 1KLMB 2RS2A 1EQ0A 3IBCB 1J5EJ 1L5UA 2NPIA 4HDHA 4NXNF 1FKAF 1G3OA 3VGVA 3OVSA 2XY7A 2XSFA 2R8HA 2CQ1A 2VQEJ 1FKPB 4Q45A 2WVDA 1SV5A 1PC4A 2KFZA 4CO0A 5DS7A 3UQSA 3Q8YA 2C2MB 2OEKA 4C2MA 3T5KA 2EG1A 2RRNA 4URGA 4KHMA 2MLZA 1U1OA 3QGIA 1TK0A 1EP4A 2VQFF 3FMWA 4QPXA 2DISA 2JLEA 4LF7F 3I6PA 5FDLA 5EDWA 4B3MF 2W9CB 3W7BA 4KAIA 2R7SA 5HL7Q 4AL7A 2DR7A 3V6HA 3HD2A 2HGLA 2MZTA 3ITHB 1OJ4A 3NGTA 2VICA 5BYQA 2MQ8A 3T1HJ 2ZH2A 2LEPA 3KK1B 4H4MB 2RB7A 1VISA 1FE4A 1JLQB 4DX5A 2WCXA 2HNZA 2V68A 3IAM9 3EVOA 3PKYA 1F60B 1S7HA 4FBUA 1PG5B 3GTYX 2PA3A 4KGVB 3QRPA 5EWFA 1DTQB 1R8CA 4U8YA 1SQGA 2F63A 3GFYA 2QRRA 3FQKA 2XGQA 4KO0B 2W24A 4LREA 1DFDA 1MU2A 3PW5A 3S8SA 2DR8A 3THTA 1RTJA 4K4WA 1WDDA 2OPRA 1AT1B 5C42A 3VGUA 1VYAA 2RS8A 4RW7B 3HD1A 4QU7A 4KC5A 4F4YA 4QIGA 5D0HA 3NNCA 2VFUA 2V0NA 3HFKA 5J1NA 4JI3J 4JI1F 2CADA 5GMEA 4IFVB 2AJ1A 3HKZD 4KYZA 1VC5A 2BVZA 3GJRB 4XDCA 5CHCB 4M94A 3HSZA 2J6TA 3GG1A 3A8KA 1C4AA 1U1KA 3P96A 3N4WA 2V50A 3EICA 4V19J 1JLAB 2YWKA 3M1VA 4ES2A 5KT7A 1KLNA 4PQUB 1RAJA 1VRUA 5E3CA 1FVSA 4DV1J 4DX6A 3POTA 1F9HA 3DRSB 4YDDB 2WTFA 2FVQA 1ZA2B 2EI5A 1CVJA 3VQSA 2MHNA 3GIRA 4QR2A 5DETA 2E66A 2YKQA 1L3KA 1EX8A 4FYYB 2VDIA 4MFBA 3A3NB 4B08A 2C3YA 4PQAA 1AROP 2IYGA 2RF2A 4O4RA 3G6VA 2IJFA 2XCAA 3SBMA 3M32B 4QW8A 4KTQA 2R7VA 3WIVA 3IR6B 1NBEB 2NS1B 3WQPA 5DZ7A 2P5VA 2R8IA 2LXIA 1YZ6A 4ZVRB 2DPJA 3BQ1A 2ZNZA 2AJQA 1BY9A 2L08A 2E9TA 1BXNA 3MAAB 4HI2A 5HLFB 1X4BA 2ZH5A 4KFBB 1CJUA 4M5HA 5L8RC 2GVDB 3SQGA 1TR0A 3SYZA 1RK8A 5KT3A 4ZCIA 1C0TB 4ERDA 4JI5J 1Y7PA 3U27A 5KFPA 4IDKA 4C98A 4JYAF 3F73A 4GC6A 2HRYA 4DSEA 3K89A 1QAXA 3EGNA 2R8GA 2HNDB 2G2OA 3KJQB 2D7SA 3GV8B 3PJ9A 4ZJQA 3LTOA 3BEGB 3P6YC 4LSNA 5C24B 3MPUB 1EB0A 1S0OA 2RMLA 1VLYA 4OZ1A 1D9FA 5J2MA 1QVGR 2AIRB 4YMEA 2BE9B 2MMYA 1WWHA 2MHEA 4AXJA 4K8RA 2DNOA 4ZN1A 2XSJA 3A8IA 2LU2A 4DR1F 3Q23A 4DQSA 2J0QD 4WWSA 3KG0A 2L9DA 3HULA 2XZWA 2UP1A 1UTAA 5HAOA 3OFEA 4UOHA 4F4KA 1DQ9A 1IBMJ 4NZ7A 2W8LA 4WU3A 1XMQF 2ADBA 3EE3A 1V6HA 2WSCC 4WU2A 2PO4A 3QWUA 3IC1A 3KLHB 1QVFR 3GIIA 2PSZA 2FQQB 5E33A 3PJXA 2BA9A 4ZVPB 1H2UX 4TY9A 1KKHA 2IMOA 4I69A 3QT5A 4U95A 2XS7A 2YNGA 2Y1RI 5L1IA 2IBKA 3DLBA 3NXZA 3DOMA 4ECZA 1Q78A 3DDNA 4ZP7A 1XNQF 1SKWA 4NI2A 1RCOB 1WEZA 1SIWB 2HVZA 4O0IA 2B43A 1VS3A 3MPYA 1GMWA 3D28A 4F3OA 4PCQA 3K5OA 2ZZMA 3EZUA 2H5JB 3NGUA 1K73T 1G2EA 5AE2A 1K1SA 5CYMB 4WF9Q 1BQMA 2C22A 1FNXH 5DQGA 3FVYA 4URQU 3NCRA 1OQ6A 2BQ3A 4BLGA 3M05A 2C1EB 1QUVA 4CH0S 1HW9A 2KYXA 4CYUB 1QSLA 1R8HA 2DIUA 4I67A 1OIAA 3D3BJ 2WB4A 5CYQA 2KVIA 2ZEJA 4WFXA 3SSSA 1Q8BA 4B9MA 1WUUA 3D3CJ 5LMNJ 2HW3A 2QLWA 3AAWB 3LW5C 3WX8A 2R8KA 2KM8C 2IC3B 3BGLA 5KT5A 3BSAA 1FHTA 3FBEA 1QE1A 1N34F 1SUQA 2AU0A 3PR4A 2G1DA 3RYLA 1FRXA 1T94A 2ZD1A 1YHQS 2YKOA 2YNFA 3CC2S 2KKHA 3BGFA 4GMKA 4N76A 4C0HA 4JI7J 3A3OB 2RUGA 3TR5A 3D1OA 4D3HA 1NJWA 1T95A 4ELTA 1Q16B 1VQSA 2SXLA 5BYSA 5IC4B 3HT3A 2DHSA 4YEAA 4IG3B 3HSJA 4CDIA 2V9WA 2YNHA 2AT1B 3EWGA 1M5KC 2X1GA 4WYLA 1IR2A 3D67A 1GMUA 2UXDJ 4H4KC 4F04B 2BOAA 4ZA1A 5IXUA 4NLPA 2ABYA 3V6KA 2C3OA 2GO8A 4EYHB 3HHEA 2ZNYA 5F8GA 4I2QA 2GJFA 1X7VA 2QMWA 2DK2A 4FVCA 1ACMB 1Y5LB 1FJGJ 1FK9A 4LF4J 2ZJPQ 2LLZA 4ZITA 1RT4A 3UI3A 4NZ0A 4H4OB 1SH0A 2A0FB 2LQJA 2B9EA 3DMJB 1N32J 3QAUA 4NYPA 2DNYA 2QLBB 2X1AA 3SV4A 2E1MC 2YH1A 3R2CJ 4DG1A 3DYAA 1KQKA 2D69A 3CC4S 4HTIA 4NXMJ 5AE1A 2Z2MA 2ZHAA 4QR1A 4B3TF 2F5GA 1YBTA 2XBPA 3TANA 5D78A 1NNDA 4NLQA 4TNOA 2NYIA 3DI6A 4OX7A 1YWXA 4XPCA 2HFVA 1AZSB 3MM5B 2BJ8A 4TLRA 2KU7A 5HSPA 4J91A 3GPAA 5BYRA 2ZHBA 1HQEA 4AFFA 1IN0A 5LMUJ 4JV5J 3H20A 4XK8C 4EK2A 3L4BC 4QCLA 5CQGA 3NEKA 5J2PA 3MZIA 2NXEA 4UOGA 2KRRA 5ETNA 3JQKA 2R42A 3RRHA 4DPXA 1IQZA 3OXGA 1VGYA 3CJSA 3L9ZA 2WBRA 1W2BR 4DZ6A 1P8GA 4LMZA 2DXEA 1TK8A 1XQIA 3K17A 3DRRA 5C25B 1SC6A 4ECSA 2IRUA 1F2HA 2BABA 3TA1A 4J9SA 2OJ3A 3QIPA 4TVAB 4LFBJ 2GVZA 1G4CA 3W61A 3F0NA 1YLXA 3H42A 3Q2SC 5K8OA 1RQ0A 2GHVC 2EFQA 3GSIA 1FJCA 2ALYB 2XYGB 5D4OA 3CB4A 3BO2A 3PRBA 1WOSA 5G0RB 3A8EA 1S1XB 2MKKA 6FDRA 1MWYA 3VGSA 1UMJA 3CPWR 1HWIA 2B6AA 5F8MA 4ZMMA 2V4JB 4RU2A 2PMZD 4CO4A 4HLBA 4ILLA 4B3RJ 1FA0A 5A0YB 2PFFB 2M88A 3WBZA 2PDAA 2V4QA 3RAXA 3H40A 3TZZA 6FD1A 2ZUGA 3K5LA 4IOBA 4TY8B 3P5TL 2F4VF 4JV5F 4R8UA 1S4EA 2ZJQQ 1T9XA 2YKAA 4M63A 1HNVA 1FNMA 2O67A 1I51B 3ILJA 2IA6A 4F0KA 1TL1B 3UPFA 4J9KA 1DBDA 4OZ0A 2H9ZA 2KXHA 4KV8B 4OHVA 3C6TB 1TU0B 2ZBQA 5KAKA 4RJVA 2NSBA 3DLEB 1Y3JA 3GP9A 2J6SA 2Q1LA 4FF1A 1PYOB 1QTNB 2QC3A 4J9LA 1LOUA 4X64F 3EDRB 3QWPA 5H1SV 3OTBA 4KGMA 2DO4A 3X3UA 1JKHB 1DLOA 4ZVOB 3ENQA 5KFXA 2C2NA 1RT3B 5L39A 4CLFA 3W2WB 1BGXT 3TWZA 4G6VB 1JLQA 1Z2ZA 2B9XA 2CJQA 1NDLA 4UQTA 2XHWA 5IS2A 2HS0A 3I5BA 3G6ES 2W9AA 2DNZA 2JSXA 2VPYB 3ISNC 5GVQA 2ZM6J 5A6PA 3EDQB 4Z37A 2MSSA 3D6MB 1RTZA 2BJ3A 2YKMA 1A9NB 3RBZA 2CPIA 1Q0NA 3LA0A 1ZM4A 1HYSA 3V4IA 4BS2A 3NOCA 2MQMA 3HSDA 4LSLB 4X4UA 2JEIA 2JEJA 4ZK7M 1RE1B 2PI4A 4RUBA 4NCBA 3HHKA 1RA6A 1XC9A 4U9RA 1YTYA 4KJIA 1GH8A 1U1NA 4QWCA 2IRYA 1FT8A 2QEXS 4RW7A 4C6AA 5HMYA 2Z56B 3V6DB 1S9GA 2XLIA 1X4HA 4EBEA 1V3SA 3BF4A 1AUDA 1RKJA 5KG4A 3GIMA 3MUMP 3TP2A 2YWWA 1LW2B 4KQZA 1P1TA 3MOJB 2BW2A 3TZXA 1I3OB 5KG2A 2FVSA 2R7UA 2HHVA 3TEGA 4Y2AA 2VA3A 1RT1A 3U7JA 3HMJG 4AT1B 1Y11A 3DGVA 1HI8A 1KONA 4IRCA 3CJ0A 4ZDNA 2EG2A 2HWHA 1WHYA 3N28A 1R8AA 1YIJS 1VK3A 4ECRA 1JLAA 3BR9A 3NNHA 4PQUA 5ADZA 4RNFA 2ILYA 3BSNA 1EKRA 5MAOA 1M1HA 2AGQA 3W5ZA 3VZIA 4OX9F 4DV4J 1U09A 1RHUB 1VR6A 5GAEU 4K7QA 2Z8QA 1VQKS 3MEGA 2W4CA 1U45A 4C8LA 2QJ3A 5IM0A 4OX6A 2DNLA 4ZVGA 1JB0C 2VG7B 1NK0A 1M5HA 4B3OB 3KG1A 5CYJA 3U1MA 3MPWA 4X66J 1DQ8A 5T41A 1UVKA 4CTAA 2E1AA 2HQIA 4A48A 2GIRA 3M32A 2KN4A 4RZRA 4Q7AA 1I94F 3FBFA 2B9YA 2D74B 2ZWOA 1VIOA 3R5CA 2WVFA 5MLCV 1LXJA 2J9CA 2PGCA 2QGFB 3MTJA 3Q0AA 3MAAA 3BJYA 1FERA 3NWRA 5DDRC 1OSDA 4ZIWA 2ZKTA 4RW9B 4A47A 3UW1A 1NM2A 4EFAC 1JLFB 1RSCA 5BXIA 2H1YA 2U2FA 2AEJA 1KVJA 2HHTA 4QZVB 2E7VA 1C0TA 1WOPA 3FQLA 3PCOB 3K7RA 1T05B 2HLTA 2WZ1A 2XZTB 4ENOA 2J76E 2ZH6A 2NREA 4RWWA 2R7QA 2GQ2A 1WF2A 5C24A 3DHWC 4DXLA 4HHHA 3BKFA 3UVJA 3CWJA 3PW7A 4JI8J 1NXIA 2MB0B 2UUBF 1OY6A 2RDJA 3OR2B 4KGXB 1PBUA 2UUCJ 1HBNB 4JUZA 2OSQA 2PIIA 5I42B 3J7Z5 3I56S 2FLNA 4MKBA 1U1MA 4OL8A 4K4ZA 3TZYA 4CRJA 3O44A 3W3SA 2KB2A 4FPRA 5HROA 3JYTA 1BQXA 2HGNA 1RU2A 3G8SA 1TKXA 5G4DA 4HHUA 3Q8QB 3G8TA 1RWUA 1YJRA 4ED1A 3GLJA 4P71A 1D8YA 2APOA 3GJTB 3QGGA 2MKIA 2CPDA 1ZAVA 1TVRB 1REVB 2OTLS 3QSIA 3CCQS 3KLVA 3NOGA 1N36J 1T9WA 1U48A 1FTCA 1R6YA 1LWCB 4DV5J 4DR5F 1DTTB 3LAKA 4ED7A 3MOZA 4EUVA 4N7TA 3MUVP 4H54A 1TKZA 5IT4A 5E2QA 4ZCKA 2VV5A 1S1VA 2OD4A 1SI9A 2RQMA 1KTVA 2IMWP 1P6TA 2XY6A 2OLWA 4KHPF 2XO7A 3IWLA 5HJYA 4ZVQB 3DC2A 3IS9B 2GAGC 2I8EA 1XMOJ 4ZHRB 1UW4A 3KFWX 1C0UA 5KFKA 3RBDA 3NS6A 3H5YA 3U1LA 4DFKA 1IBKF 2UUAF 3KHLA 4EGLA 2R7RA 1KP6A 5DQIA 3GILA 3V81A 3VVUA 3UDEA 1JLBA 2MSTA 1HR0F 4D3GA 2OHDA 3ENVA 2CQCA 1YRTA 4OYAA 3T9ZA 2BKOA 4LFCF 2WONB 2IC3A 4QYRA 2DJWA 1NSKL 5EN1A 2NXNA 5JUMA 3H2VE 1IKVB 3CSKA 3K2YA 3OJSA 3ET6B 2FLPA 2VB6A 2XMAA 3NAIA 1PILA 2FYXA 1KHWA 1XBWA 1DY3A 2J7UA 2JNJA 2OIHA 5K5MA 2YKNA 4OV1A 5DDPC 3Q22A 1PGZA 1TAUA 4LFAJ 2MQLA 4DX7A 1NHVA 3PEHA 2DBBA 3CVKA 2J0WA 1EARA 2EBEA 2N82B 3RBEA 3OW2R 2CJXB 4EBCA 1U49A 3W66A 1F9FA 1PJ6A 3FEYB 4WP3A 2FUG9 4FDFA 1FWLA 1TL3B 2XI2A 3LP2B 3Q8UA 2DHGA 1CULB 2HBZB 2RNEA 1V5VA 2BRKA 4NLUA 2DY9A 3GIKA 1U6BA 4K4UA 4IYQA 1S97A 1CC8A 1YJ7A 4LQ3A 2QMUB 2Q3PA 2XG8A 2V8GA 5F3TA 3MI7X 3ULHA 4FNIA 1S6PB 4LR7A 1RBAA 5KFAA 3O8WA 4EWTA 4PG7A 4G1PA 3ENAA 3E01B 4H4OA 3IFEA 1JWWA 4WK1A 4CH1A 1RXOB 2HQGA 3FMBA 5ETTA 3H0PA 5IWAJ 3OSPA 5LJ5Y 3PRDA 4I6YA 1AXQA 1TV6B 3O1LA 1IM4A 2CQDA 3ONQA 1MMNA 4OI6A 1IWAA 3VAJA 2GQQA 3MGJA 3DGPB 4PG5A 2CNKB 2AWZA 1VQ6S 5D0GA 2YX4A 1VLOA 2HVDA 2N4CA 2R2SA 1X0PA 3RB6A 1S0MA 2KFYA 3UN2A 3ZZUA 2HWIA 2VKRA 1GXTA 4WFBQ 1AZSA 1AB8A 2KZZA 5HP1B 1J5OA 1NJYA 4JI4J 1UA1A 4I64A 4ANDA 1REGX 1Y00A 4G1QA 3KKFA 2CJ9A 2V63A 5ETLA 3UNYA 1X4FA 4B9UA 1RB0A 3HT0A 5SUHA 1NKBA 2GX8A 3MURP 3SFUA 3H4DA 4WP9A 3CJQA 1LQ9A 1UZHA 3TYTA 3HHLD 5C25A 2K2PA 5LXRA 2ZUAA 3TOQA 4ZCMA 3IBWA 2JHEA 5F0UA 1GTHA 1HNXJ 4CLTA 1JX4A 3RRGA 1RAAB 4NRTA 2XQCA 3C19A 2JZ5A 4J5OA 4O3QA 2HSEB 2FVPA 4ED6A 4IG0B 5K14B 1HKAA 1YBUA 2VU5A 2EPIA 5CD4A 2DB1A 3HHLA 2L9NA 3G96A 1URNA 2IY5B 5IWAF 4ZP8A 1S1WB 5D4PA 3OHAA 4ECYA 1KC8T 4ZP9A 4AXIA 4DPYA 4PXEA 1ZYQA 1U0HA 4HTJA 1YRXA 4DL4A 3FCWA 3S7RA 5HVFA 2R2RA 1VI7A 1ZM2A 4C4WA 3QZ7A 1WEXA 4EI2A 1UW9A 5IOLA 4Z7CA 4E98A 1RAEB 7FDRA 2AQ4A 4U6PA 4MKVA 1NLKL 3Q8PB 1MWQA 3CIMA 3NCPA 3R27A 2I38A 3NGSA 4OZLA 3MMBB 1S6QB 4JI4F 1XEZA 3QLHB 4WJBA 2A10A 2VG5A 3AQPA 2MJUA 3J7A1 4QYZJ 5LOQA 1N48A 4ZOSA 5AJ3J 1S9EA 1TL1A 2RVJA 3S01A 2BZ2A 3G82A 2OEMA 3BYPA 3HJFA 2MJNA 3PHTA 5L9XA 5DM7Q 3K0JA 3C6TA 4CLUA 1B0VA 3UO0A 3UCUP 2ZWPA 4CLKA 3H2UB 2RH3A 3RU0A 3AFGA 2P2CB 2HZCA 4KGKA 4Q0BA 2DCLA 1R8PA 3C66A 3CJKB 1CBKA 1B7YB 4F26A 3I82A 3RB0A 1SL0A 1RADB 5A2QY 3GCWP 1JLCA 2I6WA 5KFTA 5HATA 1JKHA 2CJYB 3DDIA 2QYGA 2QA4G 1IR0A 1RT3A 2EEYA 2UVWA 2BKNA 3M6WA 3W2WA 1WI6A 3GB0A 3MM6B 1RJJA 1NPKA 3TJ8A 1CJTB 3NKYA 2XMTA 4O3OA 4B17A 2XMWA 2J9DE 1IVZA 4K2XA 1SL2A 4P6QA 1R0BG 2HNYB 4UZCA 1T11A 1LK5A 1RHRB 2UZAA 2IFXA 4CO1A 3KNGA 3DLJA 1QDUB 4LSLA 4CLSA 2J7WA 2XMVA 3MFHA 4X4VA 4M5IA 4CH7A 5F8LA 3KMQA 2CRLA 3VALA 1Y0HA 4ELVA 2YWEA 4I6WA 3G87A 3CDWA 1WNEA 1HNWF 4R5PB 3MR3A 1FRMA 4MIBA 4M5NA 4TQSA 5DLGA 1YQHA 3B6BA 1TZ0A 3S1TA 3PW4A 2BX6A 3EGWB 2K3IA 2DNPA 2QFIA 4RW4B 4CT9A 3AT1B 4DUYJ 2EK6A 2LQBA 3TVYA 3SIPB 4DV7J 2NUUG 4NA2A 3N79A 2N3OA 3T5LA 9RUBA 2NSCA 5KFMA 1UJ4A 4LF9F 4UUXA 3T1AA 1ZTWA 4O4GB 4DL7A 3SCLE 2RDIA 3JSRA 2AEMA 2HKEA 3JB9k 4USMA 3GE9A 4FPIA 3DLGA 4DV3J 3I4HX 3DOLA 1WG5A 2CUYA 4RX6A 2D3OR 2AGPA 4GKKJ 4P2MA 4LR8A 3CEDA 3QJLA 3OTEA 4K5RA 1OY9A 3OTDA 1PIEA 5KFUA 4OYWA 1MROA 4LBIA 4X62F 1WHXA 3LGHA 4C8NA 1NK4A 1H74A 3I0RB 3C46A 2NQPA 4NEZA 3QFHA 2UXBJ 4LF6J 1X4EA 2OPQB 4JI6F 2YX1A 2DNQA 4ED3A 3KYLA 4DPWA 3JSMA 5LM7E 4UTGA 2E5LJ 3IO1A 1JLFA 1RWMB 4JB8B 2QLFB 1WI8A 3I31A 4J9UE 3E2EA 4CIOA 1T7PA 4L3NA 1HI0P 3TJAA 3RG6A 1WKKA 3RR8A 3Q2TC 4A8QA 3DLKA 3N6LA 1T05A 3UWTA 3M8QB 4DL5A 1TMMA 3QJJA 2ZHOA 3QT7A 3M8WA 2V2ZA 2O01C 3OUYB 1F5CA 3IGVA 3IG1A 4MJKA 4F50A 4DPTA 4K2JA 2ZKUA 1S1TB 2UVRA 3WC0A 3ZNUA 1RWPB 8AT1B 2Q43A 1TMJA 1RBLA 1HBNA 3OTOJ 5I42A 3BM7A 5H9FK 1HBOB 3ZTPA 1RHMB 3G2XA 4DLGA 3DOKB 4O3NA 2VBZA 2KG1A 1HPZB 3C15A 1VHIA 2D3UA 4N8NA 3JSBA 5EUHA 2W9BB 3TW0A 4C11B 1L3SA 2YPYA 1Q8KA 1KRPA 4MKAA 4M5DA 4PR6A 4B9LA 4DUZJ 2BJEA 1HARA 3PX6A 2VFRA 1ZZFA 4KE5A 4DFMA 3MECA 2GQCA 1LWXA 4ZPAA 3MM9B 1PJ7A 1U6FA 3M2VA 2LVWA 4GKJF 1UJ5A 1TVRA 1I6JA 1DZ5A 3BGUA 2CNLB 1FO1A 2A2CA 2CJKA 5D6GA 2AHOB 4RW6B 2J7KA 1S12A 1DTTA 4WTYA 2ATLA 4LR9A 3OV7A 5DG7A 1Q81T 4UF4A 3K57A 5HVGA 1YJTA 2ZH8A 2AZ3A 4YY3J 3C6UB 4ES3A 2XZDB 2P8IA 3BSOA 2FHKA 1WKJA 2LECA 1KVKA 4LBHA 2VODA 3SCKE 3TUJC 5C2CA 4C8YA 2ERRA 2NPFA 4ZHRA 2OEJA 4X84A 3CJ4A 2EC2A 2XULA 4M1KA 1U1LA 1C2PA 5I3PA 3RR7A 2LU1A 2MDAA 1Q1KA 3TQEA 3VGTA 2QSWA 5KFSA 5L46A 1HL6A 1U02A 5IT9Y 4NEYA 3I0SB 4TXSA 3R2DJ 4ZLLA 3GYNA 3HM9A 2KXFA 4I7FB 3KK2B 4NMLA 2G0CA 3TAQA 3QMQA 2WONA 4KR0B 4DV6F 1CLFA 3A13A 1NH8A 1D8ZA 4PYAA 5J1PA 2BXJA 5CAAA 1WORA 3KHGA 2HIYA 4F7VA 5A8WB 5IC6B 4DZDA 4OJ1A 4DR6J 3SDEB 3OL6A 1K1QA 2JLFA 2KM8B 2B5JB 1NB7A 2RJZA 2WSFC 4KPYA 4WIQA 4USTA 4BC7A 1LV5A 2IA0A 3JXOA 3MPDA 4CO5A 4KKOB 2J8SA 4A8SA 1Q79A 1RUSA 1AA1B 1IXKA 1HWLA 1KHVA 2HWTA 3M9OB 1FI4A 1TUVA 2BE7D 2ZDPA 2KRBA 4P7TA 3VWSA 4N5SA 3B4MA 3CMAS 5KG1A 3ILOA 4LRCA 3R6LB 2RT3A 1VC6A 1HHTP 5F8JA 3QSYB 5KFDA 1RLCL 3H25A 3E01A 3OFFA 2OH2A 5J2QB 3AODA 1PYTA 2FJXA 4X4RA 2BW7A 1SXLA 2RKIB 5HK4A 2DR5A 4ZPWR 4OX8A 1F1BB 4TKTA 3DGPA 4MK9A 3UD4P 3CD6S 4IH5A 1KBRA 3ZTQA 1Y3KA 2F65A 3PEJA 2FHMA 8ATCB 2LYVA 3QNWB 1M1GA 3NS7B 1XNRJ 2YX7A 3N0VA 2ZDOA 1N0UA 1D9AA 3D1QA 1YJNS 1RISA 3SFGA 4BWMA 1MN9A 2MGZB 5A2QU 3IM9A 3OFGA 4IR1A 2BDPA 2IJRA 2XMUA 1ZOTA 3LH2S 1V3RA 5KFIA 5KFYA 5BR8F 2HHHJ 4U7UD 2M5YA 1UAWA 2K7KA 3EPIA 2F4FA 2OUGA 1RT5B 1B64A 1VJWA 5ETMA 3AD9C 5HVHA 2XC9A 3RTVA 4F0MA 5KFJA 2CQ0A 3KLEB 1RT6B 1W2IA 4C0OC 4FNHA 1CSJA 3BSCA 4YN3B 2FHOB 1OS5A 5EX3A 1KEKA 5BJRA 1JLGB 3FSIA 1TELA 4WZQA 1X4CA 1IKXB 3TARA 1RT2B 1GFWB 3MEDB 4HACA 2JL9A 4MYUA 2BE2A 2XS5A 2LDYA 4P52A 3TAMB 3R5JB 4NLOA 1IJFB 1IWGA 2ROGA 4OZJA 4NA3A 4DR7F 2KHDA 1FXLA 4RO0A 4JP8A 2VIHA 1F5AA 2BOPA 1SKSA 2HHSA 2PMWA 2JH3A 3FFIA 4PG6A 2AV5A 1H0HB 3K5NA 3KJVA 3OLAA 3W2VB 1FD8A 2GGPA 1K0VA 2W8KA 2FZKB 1U0SA 1CJVA 2VKZG 4OHYA 2F9JA 2KL8A 2L48A 4C3KA 1NK8A 3CD7A 4NXNJ 1FRHA 1WC3A 1EHWA 2MZRA 4MK7A 3R5GA 2GA7A 2CNOB 3K58A 4ID8A 5A8RB 1S6QA 1PYSB 4DR4J 5E7OB 4CWBA 4NA1A 1IKYA 3QLHA 3HLUA 1T02A 2I0XA 2EWHA 2XYPB 3HVTB 3TNVA 1GT8A 4RUCA 3IRXB 3NBPB 2I1RA 3BREA
chains in the Genus database with same CATH topology
1ZTTA 2IJNA 3DMJA 1JLEA 3V4IA 4BS2A 1HYSA 4ED5A 2MQMA 2CYYA 1XR7A 4M8LA 4LSLB 2HAIA 4ALZA 2MKSA 4AUKA 1JIHA 4X4UA 2UVUA 2FLLA 2DRAA 2V2KA 5A8WA 4I0WA 1UVMA 2JEIA 2F8HA 4ETZA 4MFBB 1XK8A 5E41A 2JEJA 1YJVA 4C8MA 4ZK7M 3SDEA 3OXFA 2PI4A 3FSYA 3KG4A 1RKIA 4JI5F 1S6UA 2G13A 3HHKA 5IZHA 4NCBA 1RA6A 1XERA 2CQPA 4RUHA 1XC9A 1RI7A 2JLGA 3OR1A 1TKZB 2AP6A 4U9RA 3UR0A 4YB1P 1YTYA 2OD6A 3CDAA 1ZPVA 4WXWA 4KJIA 1GH8A 1U1NA 2B5JA 2AYGA 3VTIA 4QWCA 2IRYA 2YY3A 4U7CA 3M2RB 4O3SA 1FT8A 2QEXS 1FRJA 3MDFA 2JDJA 4RW7A 5HMYA 1VQLS 4DV3F 2XMMA 1F0XA 1N5YA 5J1EA 3WZ0A 1S1VB 3V6DB 1S9GA 2OP5A 4RNHA 4YUDA 5K8NA 2XLIA 1X4HA 4MK8A 2ZVSA 3IRWP 4K0KF 4EBEA 4KKOA 3KMSA 5F0WA 3F56A 3LOUA 4ETXA 4RNMA 1V3SA 3BF4A 4HDGA 1AUDA 1RKJA 4DR2F 3QIDA 3HXMA 5KG4A 3GIMA 3MUMP 4I56A 3TP2A 1LW2B 4KQZA 2W25A 2MQPA 2MKCA 4QIWD 4GKKF 3ENWA 5L38A 1TAQA 3MM5A 1C0UB 1JMTA 1P1TA 3EXYA 5T7LB 3EGZA 2RIJA 4WE1B 3MOJB 2BW2A 3OSNA 2UUTA 2KT2A 5D3GB 1H7XA 4ECWA 5KG2A 1UETA 3FDSA 2FVSA 2R7UA 2M8HA 4J9QA 5B08A 1KSPA 2M0GB 2HHVA 4Y2AA 1KOHA 3MM6A 5KT6A 2VA3A 1RT1A 3U7JA 1NU4A 3J81Y 1JNRB 3OVAA 1FESA 2DH7A 4OJ3A 3HMJG 3V81B 1JK9B 3D0GE 2GJ2A 4OZNA 1T03A 1VMBA 1HI8A 2LEAA 1KONA 3L95X 1JLBB 4IRCA 3CJ0A 1SJ1A 3JTNA 4QIVA 5KG7A 4ZDNA 4AE5A 2EG2A 5KFWA 4BCAA 4EZ9A 2HWHA 4RBVA 2BBEA 5F9NA 1AFIA 1Y4ZB 1WHYA 1OQ3A 3GWCA 3N28A 1R8AA 2CQBA 4IFYB 4KHRA 1K8AT 2UXBF 1YIJS 2X51A 4LF6F 1VK3A 4ECRA 5H9EJ 4HKQA 2LA6A 1JLAA 3BR9A 3NNHA 5GADU 4ICLB 5AXKA 1RTIA 2MZJA 5HI7A 4PQUA 2EVZA 4Q5VA 1UVLA 5ADZA 4RNFA 2V9KA 1IBMF 4YB6A 2C3UA 2VOPA 2ILYA 3BSNA 5MAOA 2V94A 2LXUA 4R0JA 1U8SA 2I5JA 2AGQA 1LKZA 2PA8D 1U1RA 2E9RX 3N9UC 3UE2A 3VZIA 4OX9F 2E5LF 4EZ6A 1U09A 2P9EA 3MCSA 5GAEU 1E6YA 3DXSX 2DH8A 3M8PB 2Z8QA 3NLCA 3MEEB 2J8AA 2VUGA 1VQKS 1L5UA 3MEGA 4RW8B 2LXFA 4K4VA 2VPWB 4GO5X 3DRPB 1CC7A 1IKWB 2W4CA 4Y2CA 3RZAA 1U45A 4C8LA 5IM0A 2MKJA 1KNZA 4OX6A 2DNLA 4QBUA 2RKIA 1Y5NB 3QGHA 5DO2A 4ZVGA 1JB0C 2BYCA 2VG7B 4QW9A 1NK0A 1M5HA 2HS3A 3MM8A 2E1CA 1APSA 1YJ9S 4LSNB 3FJ2A 2ZITA 1Z2LA 3RW7A 5JVGQ 3CGIA 2YKNB 3FEZA 4Q44A 4B3OB 4DN9A 1LW0B 3OHBA 3KG1A 4DS5A 3DXBA 5CYJA 4DFPA 4DR4F 3U1MA 3MPWA 1S0NA 1S4FA 2AJFE 3GG0A 2UV8G 1SJFA 1DQ8A 1NHUA 1S1UB 5T41A 7FD1A 1UVKA 1SJQA 4CTAA 2E1AA 3T5HA 3IR5B 1VC0A 2HQIA 4A48A 4JOUA 3N6MA 1KQSR 2GIRA 3M32A 1OO0B 5HBMB 4O44A 4ZPCA 1WELA 3KLFA 2KN4A 5GAEI 4RZRA 3C3LA 5DLFA 1MW7A 5SZTA 3EZ5A 4Q7AA 5G0RA 2FB0A 4EEYA 1FJEB 1E6VB 4A8XA 1S1XA 1I94F 4FF2A 4QU6A 1X4GA 1LWFA 3M2UA 3HVAA 4N56A 4OI2A 2B9YA 2D74B 3K59A 2XWXA 1JJ2R 2R4FA 2HLUA 1BQNB 2MGZA 2K8GA 5I3UB 3IWNC 1B0TA 2BM0A 2BM1A 1VIOA 5A8KB 4F2RA 3MXHP 3AA8A 3R5CA 1Q82T 2V4JA 4NCGA 4ZPVR 2MXYA 2FDNA 1LXJA 2J9CA 2IYIA 2PGCA 2EBGA 2OMOA 3MTJA 3QO9A 4RW4A 3Q0AA 2B0GA 4BC9A 3BJYA 1BC6A 3F44A 1J2VA 4N8OA 3CIZA 1FERA 2OPPB 3EUNA 5DDRC 4RBUA 2UV8A 5KFEA 3P3DA 1OSDA 3FSXA 1S10A 3DDKA 1FRKA 2ZKTA 1WEYA 1X4AA 4RW9B 5U47A 3BGRA 4A47A 3OTOF 2F1FA 3UW1A 1N8RT 2YWFA 4EFAC 1JLFB 2M7SA 2AYEA 4USHA 5A0YA 2NR0A 3KOAA 2P9GA 3ZZRA 2U2FA 1RT5A 2ZE2B 4ID5B 1KVJA 2HHTA 1VFJA 4OZ5A 2GIQA 2OFHX 4RUAA 3LP0B 1S76D 4QZVB 1TKTA 5HN0A 2HFNA 3HVRA 1C0TA 3H4BA 2HS4A 4TYBA 1U7LA 2AF6A 2A3JA 3FQLA 4TY8A 1TK5A 2BANA 3K7RA 1T05B 1JNZB 3G71S 2HLTA 3IAS9 4LJMA 1YI2S 2OAUA 3HDSA 1BWEA 4IO1A 3PO5A 2HG4A 3CDUA 2J76E 1HFEL 4YR3A 2AJ0A 3M8RA 4B9TA 2ZH6A 2AYBA 2ROEA 2VFTA 2GMLA 2YNIB 3HPOA 4A4JA 3T1YF 1TP7A 4RWWA 3HHLC 4DUZF 2R7QA 2EFGA 2NREA 2GQ2A 1WF2A 2EFPA 2VBYA 1C1BB 3BN7A 5C24A 3LAMA 1FNOA 3DHWC 2E5HA 1KD1T 3GZ7A 1JLGA 4TU8A 1VQ8S 3CWJA 3VAMA 4PRFA 3PW7A 1IKXA 4KV8A 4OHWA 5KT4A 1RT2A 2NLWA 1FE0A 5LMNF 2JRSA 1Q8LA 4WKRA 1HNIB 3MEDA 2MB0B 4HYKA 5E3RA 3IN5A 1GNKA 2UUBF 3I32A 3MMAB 2QFJA 2RDJA 1UEVA 3DLEA 3PO4A 1Y9OA 3OR2B 3HO1A 2F8MA 5F3ZA 2JVRA 4ZVFA 4NZ6A 2CPHA 4DOZA 4DX8H 2E5GA 1HBNB 2DNKA 2EK1A 4Y28C 4JUZA 2OSQA 2PIIA 5I42B 3J7Z5 3I56S 4JI0F 2FLNA 3RB3A 1NAQA 1J5OB 1ELOA 2M70A 4URSA 2RQCA 1NKEA 4MKBA 1S0VA 3UDCA 1HBMA 4NYZA 1U1MA 2G4BA 1GTEA 2HHPA 2Z0GA 1HBUB 1RT7A 2WW8A 4C3LA 4K4ZA 4OL8A 2DH9A 4MMOA 3O44A 2KH9A 3W3SA 2KB2A 4W92B 4FPRA 3QGPA 3R5BA 3W2VA 4JI7F 3FCHA 4YY3F 3I9V9 2VZ9A 4DBQA 4JV0A 1DARA 1KTQA 1TKDA 2GW8A 4DFJA 5HROA 1R27B 5K9FA 4G1QB 3K8VA 3JYTA 2DRBA 2R7TA 3KK3B 1BQXA 2QMXA 2P6TA 1R0AA 2VPXB 4DSIA 1GX6A 2HGNA 1LWEB 3FNNA 4PG8A 3MR5A 2VD3A 3G8SA 1TKXA 4KT0C 5G4DA 1C1CA 3FGVA 3Q8QB 1UP1A 1FD2A 2FJAB 1RWUA 2QSFA 2XMKA 5IQ6A 3G8TA 1YJRA 2K1RB 3L7PA 3OBIA 1VOMA 4ED1A 4JI2F 2QV6A 1UVNA 3TUZC 1D8YA 3QYYA 3H5SA 4NLXA 2APOA 3NAHA 2CPYA 4C7QA 2VC1A 3HHNB 3QGGA 1NK5A 2Q79A 1U26A 3V5RA 2MKIA 3THVA 2UXDF 4QIEA 3B78A 3NGDA 2CPDA 1Q7LB 1ZAVA 1TVRB 4A8YA 1REVB 2GC8A 5B09A 3DRXA 3DM2B 2CQGA 3UR3C 2OTLS