2J0QD

The crystal structure of the exon junction complex at 3.2 a resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
89
structure length
89
Chain Sequence
PQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Exon Junction Complex Reveals How It Maintains a Stable Grip on Mrna.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ATP-DEPENDENT RNA HELICASE DDX48
total genus 16
structure length 89
sequence length 89
chains with identical sequence G
ec nomenclature
pdb deposition date 2006-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2j0qD00
2YKAA 2CQ0A 1WWHA 3LQVA 4UQTA 4ZKAA 1YWXA 2AYBA 4PR6A 1SJRA 4CH1A 2M52A 2KXNB 1VQLS 1U6FA 2FHOB 2J0QD 3R27A 5LSLA 3MURP 2M4MA 2M9KA 1JJ4A 2LKZA 1FJ7A 2DGQA 3V4MA 1VQMS 2NZ4A 3U1MA 2MY8A 3N9UC 1WELA 4IUFA 5GADU 3SXLA 2KI2A 3G71S 2MKJA 1VBXA 2MQNA 3MUVP 4C0OC 3OW2R 2MKCA 1M5KC 1A9NB 3NS5A 2AYGA 5DDPC 4ED5A 3ZZZA 1SJQA 5DM7Q 1Q86T 2CJKA 1Q81T 1K9MT 1U1RA 2OIHA 1ZH5A 3BEGB 2KFYA 2OTJS 2JVRA 4TU8A 2LA6A 2L41A 2F9JA 1P1TA 2KU7A 4IOAQ 1JMTA 2LYVA 2N82B 3MOJB 2L9WA 2LXIA 1YI2S 3UCZP 5LJ3Y 5IM0A 4RU2A 3UD3P 3G9CA 2RQ4A 3TYTA 2MGZA 1M5VC 1URNA 1X5PA 2RS2A 4J5OA 3US5A 4CIOA 2YH0A 2DO4A 3G8SA 2F9DA 3Q2TC 4A8XA 2KHCA 2HYIB 3MUTP 2MSTA 2CPYA 2KVIA 3G8TA 2RQCA 3J7YU 2KH9A 4QU6A 2CQDA 2DNKA 3DLLQ 2YWKA 2QA4S 2AYMA 2CQ1A 2X1AA 2MB0B 2XS7A 2KXFA 2VONA 5HO4A 1S79A 2CPEA 3H2UB 2MYFA 3CF5Q 1VQ5S 2KG0A 1UAWA 5DM6Q 1VC0A 3MDFA 1VQNS 2ZJQQ 3EGNA 5H1SV 2RNEA 2PE8A 2LXUA 2LCWA 5ITHA 3CCMS 1WEZA 1F9FA 1W2BR 1KC8T 4F02A 2JWNA 2D3OR 4Y0FA 2DNOA 2Q79A 2MQLA 2JRSA 1OO0B 2HVZA 2DNQA 2JVOA 4C4WA 1WHVA 2MZQA 4WFAQ 2N3OA 2CPJA 2FC9A 2X1FA 1N54B 1UFWA 2MKKA 1DZ5A 1UW4A 1QM9A 2D9PA 2SXLA 3P3DA 4QQBA 4W90B 2CQBA 4QPTA 2J76E 1WF0A 3MD3A 5CYJA 4YB1P 2QFJA 2RRAA 2U2FA 1YJNS 3ZZYA 1M90T 2CPHA 1WG5A 3EX7B 3DXBA 1WTBA 2CPZA 3CCUS 2ADCA 3UE2A 2MQQA 2LMIA 3R1HA 3NNCA 2DGXA 1D8ZA 5JVGQ 3VAJA 2I2YA 1VQ9S 4IOCQ 2MSSA 4UY8T 2EK1A 5GMKa 2E5JA 4IO9Q 5GAGU 2ZJPQ 2CQ2A 5D78A 1VQ7S 3SMZA 3P5TL 2ZJRQ 1X5SA 1R8HA 2G4BA 1VBYA 3TP2A 1M1KT 4LMZA 2B0GA 1Q82T 1B7FA 2G1DA 1RK8A 1QVFR 3R1LA 3VAKA 3BO2A 2DGUA 3CPWR 3G4SS 1YJ9S 2DHGA 3UCGA 2DH9A 2CQHA 1UP1A 2YH1A 2XS2A 2DNMA 3LPYA 2OJ3A 1WEXA 2CPDA 3IRWP 3P49B 2U1AA 5DDQC 2XNQA 2CPFA 2MZJA 2EK6A 4QU7A 3VF0B 3S7RA 4P6QA 2LA4A 1X4EA 4C7QA 2GO9A 3VALA 3FEXB 1U1LA 3CCVS 1U2FA 2MKSA 3VAMA 2V94A 2LEBA 1VQOS 4LJMA 4FXVA 2LQ5A 1YJWS 2DHSA 1KOHA 3G96A 1RKJA 3VAIA 2RS8A 1FHTA 3D2WA 1KD1T 2FC8A 5LSOA 4YUDA 3B4DA 3RW7A 1N8RT 2L08A 5JVHQ 2CPXA 5DDOC 3CCJS 1H2UX 2LEAA 1U1MA 4FXWA 3SDEA 3CCLS 1FJCA 1YTYA 3CCSS 1D9AA 1YITS 3L3CA 2DGTA 1NO8A 1X5OA 1DRZA 4YOEA 2DK2A 2VOOA 2DNHA 3SDEB 2M7SA 1DHMA 5GAHU 2DNZA 2X1BA 2K3KA 3HI9A 4WIIA 5DDRC 3NNHA 1K73T 2CQ3A 5FJ4A 1WF2A 3JB9k 2MJUA 2HGLA 1WG1A 2M8HA 3NNAA 2FY1A 4Y00A 2OTLS 1VQ4S 2DNNA 1CVJA 4WF9Q 2F3JA 5GVQA 3VAFA 1KOOA 1FXLA 2HGMA 5GAEU 4ERDA 2BZ2A 1K8AT 2OSRA 4OZ0A 2DHAA 2ERRA 3K0JA 1L3KA 1WEYA 2XNRA 2MQOA 1X4AA 1OPIA 2EVZA 5CA5A 5HL7Q 1M5PC 1QVGR 2FPHX 2XSFA 3CULA 1WI6A 4OZ1A 1YHQS 2MGZB 2DGWA 2E44A 2MZRA 4U67Q 1WI8A 1S72S 4F26A 2M0GB 1KQSR 2DIVA 1WHXA 2A3JA 3THPA 2NLWA 1G2EA 1HL6A 1X4CA 3CTRA 2MZ1A 3NS6A 1VQPS 3CC2S 1A7GE 2KT5A 3BO3A 2MQPA 2G0CA 5DETA 2MZTA 1X4DA 1WHYA 3CCQS 1H2TZ 1Q7YT 1VQ8S 2VODA 2J8AA 3H2VE 1XN9A 3UCUP 1BY9A 3G6ES 2M88A 1OWXA 1U1NA 4LIRA 1M5OC 1SXLA 2MHNA 1IQTA 3Q2SC 5LJ5Y 3P6YC 1X4FA 4W92B 2DB1A 1HD1A 4PRFA 5BJRA 1FJEB 1N52B 3PIOQ 5D77A 2KRRA 3THTA 2CQGA 4CH0S 1DBDA 2E5IA 3TO8A 1SJFA 2BOPA 2KXHA 1O0PA 3CMES 1WF1A 2JX2A 1FO1A 2E5GA 1VC5A 2MMYA 1AUDA 4PKDB 2K8GA 2MKIA 2M70A 2M8DB 2MKHA 1WG4A 2DNGA 1NJIT 3CC4S 3EGZA 4TU9A 3VAHA 2O3DA 3MXHP 1X5TA 1FNXH 2GHPA 1NU4A 1VQ6S 1VQKS 2MY7A 3PIPQ 2DH8A 2D9OA 1HD0A 3RW6A 2QEXS 1X4GA 3S8SA 2DH7A 2N3LA 3MUMP 1H6KX 2PEHA 2I38A 3BO4A 3U1LA 3CXCR 2RU3A 1N88A 1X4HA 2RT3A 4WFNQ 3MI7X 2WBRA 5LXRA 3CC7S 2DISA 2DO0A 4WKRA 1VC6A 4F25A 2XB2D 2RVJA 1ZZFA 2KN4A 3CMAS 2HGNA 3CUNA 3I55S 2UP1A 3HHNB 3S01A 5EN1A 2OSQA 3S6EA 1HA1A 3BS9A 2CQCA 5IM0B 3IWNC 1U1PA 3J7ZT 3MD1A 1U6BA 4WCEQ 3ULHA 2LECA 2J0SD 1FT8A 4M5DB 2KM8C 4BS2A 2KG1A 2DGVA 2CQPA 2KM8B 2KRBA 1U1KA 2DGSA 2DNYA 1OIAA 2RRBA 1ZZNA 1PO6A 2MPUA 2N7CA 1SJ4P 2MZSA 2YTCA 2CQIA 1P27B 4Z2XA 2DNLA 2ADBA 2MJNA 2DNPA 4V19X 2E5HA 3CD6S 2M2BA 2MQMA 1SJ3P 1JJHA 3B4MA 2KYXA 2DHXA 2RUGA 1U1OA 5LXYA 2DITA 2XS5A 3VAGA 1WHWA 2HZCA 2VOPA 4TLQA 2AD9A 5IQQA 5CXTA 1VBZA 4WFBQ 1U1QA 2CPIA 5IFMA 2DNRA 1X0FA 2MXYA 1H2VZ 3CCRS 3FEYB 3UD4P 4CQ1A 1R8PA 1YIJS 2CQ4A 2AYEA 3I56S 1JJ2R 2DGOA 1PGZA 2X1GA 3UWTA 4TU7A 5MLCV 3NMRA 4EGLA 1X4BA 2DIUA 3CCES
chains in the Genus database with same CATH superfamily
1CJUA 3RRGA 2CQ0A 3LQVA 4RW7B 4ZS6A 4Y6IA 3VGTA 1PAEX 4FF4A 1U4BA 1FCAA 4L3NA 2VIHA 2AYBA 4PR6A 1AZSB 1BGXT 1TK0A 2EKNA 2M52A 3OFEA 3CCWA 1U6FA 3I4PA 4DXLA 3TANA 3M9OB 2IIHA 1AB8A 3MM5A 5GMEA 4PXEA 5F8NA 2LU2A 3A3NB 2PMHA 2HQIA 2UUCF 2LKZA 5A2QY 4F7VA 4X4PA 4ENOA 2B3TB 3KK1B 4Q7AA 2QLWA 3U1MA 1FRXA 6AT1B 4F8RA 4IUFA 1XWLA 4DR5F 4C3MA 4X62F 4XIUA 1RWNB 2D1CA 2YNIB 1VBXA 4DFPA 1R0BG 2MQNA 2YNGA 3CJTA 4EWTA 4DOZA 3G82A 3KFWX 1S1VB 4YS2A 1IVZA 1WC5A 4TNOA 2E7XA 3J81U 4B3SJ 3UFCX 3X1LB 3IO1A 1U09A 2Y0BB 4ED5A 3KNAA 3FZBA 2CYYA 1OSDA 3ZZZA 1ZYQA 2CJKA 4DV0J 1K9MT 2DCLA 1N48A 4NLPA 1REVB 1I51B 3HJFA 2A1BA 1EQMA 2J9EA 3MAAA 2KFYA 2P2CB 1T8EA 1IQZA 4U95A 3KLFB 3JSRA 2W25A 2W2OP 2BRKA 1L5UA 4A8SA 2KU7A 2W2NP 3PR5B 4R0JA 4WZMA 1JMTA 2N82B 2LXIA 1YI2S 3G9CA 1H7XA 3UD3P 2RDDA 2RQ4A 2IC3A 2MGZA 3H5UA 4DV5J 1TAUA 4DL5A 2GJFA 2ASJA 1U0HA 1NPPA 2YH0A 3NGUA 1S0OA 2LDIA 4DPXA 4RZRA 1HYSA 1CJVA 3ITHB 5D4PA 2V63A 5I3UA 3Q2TC 2VASA 4CT8A 1S1XB 4USMA 4RW8B 2HYIB 3OFHA 3FNNA 3QT5A 4F0MA 3TEHB 4EFAC 1FKOB 3H40A 3C46A 3C8YA 4DPUA 4GVBB 5DQHA 4YR2A 2BA9A 2V8DA 3GIJA 1N36F 4CLFA 2RQCA 3HHEA 1DFDA 2Z8QA 2D3ZA 4RW4B 1UJ4A 4ZJQA 8AT1B 1U8WA 1T11A 4OYZA 4PG8A 5C42A 4Q45A 3K5OA 4KYZA 2QA4S 3KJNB 3RRKA 3DCAA 3EWGA 3N28A 1SQFA 2MB0B 2VONA 4RU9A 4ZVQB 2R8KA 1Q7LB 2GFFA 3JSMB 3Q8UA 2G0IA 4N5SA 4K4VA 3FRYA 3H2UB 1H73A 4ZP9A 4LF9F 1NBEB 4ZCKA 2Z57B 3CF5Q 1N0UA 4LBIA 3AB4B 5LMUJ 2BR0A 1UAWA 2BQ3A 5DM6Q 2BJDA 3EE3A 1SH0A 1S10A 1QSLA 3EGNA 5H1SV 4N76A 2IVFB 1K47A 1RUSA 4DEZA 1KQKA 3IR7B 1TFWA 1U8SA 1SV5A 1SKSA 2RHQB 1WEZA 2ZEJA 2C2DA 3OQ2A 3WQPA 1GTEA 1RCXB 4L74A 1HQEB 2P9EA 1MN9A 3CWJA 1W2BR 2YQ0A 1X9MA 1DTQA 2ZH8A 3TUJC 2BM0A 3GP9A 3RUBL 4B9NA 4OYWA 5KFRA 2ATLA 4PWUA 2DXFA 3PV8A 2DNOA 4GC6A 2EFQA 3DDKA 2MQLA 4RNHA 3TAPA 2JEGA 2XSJB 1DLOA 2W8KA 3SCKE 1OO0B 2JC0A 3EVOA 3WC0A 3ZZ0A 2MLZA 1Y3KA 1PBUA 2DNQA 3ILLA 4XPEA 4HH1A 2MZQA 3D1OA 4I4BA 4WFAQ 5LMUF 4KGKA 3RBEA 4KPCA 1J5OA 4R5PB 1ZETA 2FJWA 2YNHA 4MMOA 2V2QA 5HMXA 4KRWA 5I42A 4FF2A 5KFOA 2Q6CA 4F0HA 2F65A 3C14A 4C8ZA 2BJ1A 3T5KA 7FDRA 5DG7A 2C3MA 2FJBB 3CJKA 3BKUA 1HPZB 1L3TA 3AJ1A 2B5JA 2J0XA 3W8PA 1R43A 1Q0NA 2X3DA 2CNLB 4W90B 1J5EF 3HX9A 2CQBA 3AY0A 3NP5A 3L09A 3GIIA 1M0SA 1WF0A 2IBOA 1S49A 4DPWA 4YB1P 2U2FA 1G7CB 3ZZYA 4QWDA 3KK3A 1JLQA 2QFJA 1IBLJ 1FKOA 1I1GA 2XM3A 1M90T 1Q53A 2CPHA 3TJAA 3LANA 3EX7B 4WYLA 3DXBA 4V19J 3Q8VA 3DLKB 1NK0A 1N34F 3BGLA 2VH7A 2V9KA 3TQ1A 3GWCA 5HK4A 2CKWA 2V8GA 3HT0A 2DGXA 4OX7A 2UVUA 4Y3CA 4F04B 4LF7F 2E1RA 4WFZA 1KFDA 3VAJA 2GVZB 8ATCB 4R5PA 2I2YA 4F4AA 3MR3A 2XI2A 1AROP 2BKPA 4ILLA 2RUSA 2EK1A 3BKFA 5HN0A 5GMKa 2V0NA 1C1BB 2R7UA 5HMZA 5KFTA 5D8HB 3TQEA 5GAGU 2ZJPQ 2CQ2A 5D78A 5AXLA 2VG6B 4FKYA 2UXCJ 2RIJA 3VGSA 1HNVB 4OI4A 3EXCX 4YY3J 4K5SA 4JI3J 2ROGA 1UFKA 2YXLA 3FCVA 3PX4A 2CAJA 2JFKA 5ETOA 4C8MA 1LW2B 1ZM3A 2EXUA 2G4BA 3MM5B 4DV6F 4NRTA 3RBDA 4DR1J 1HBNB 1LFWA 1VISA 1MSWD 3T5LA 4X65F 3TZWA 3V81A 2AJFE 2JDJA 4EO8A 2DCUB 4LSLB 2VG5B 4NZ7A 3UR0A 2KB2A 2OPSA 4J9RA 1HBUB 2FHMA 2CVEA 2D3O1 4IDKA 2H3EB 2UXDF 3VAKA 2M3DA 1U49A 5DQGA 4DV4F 4IRCA 3JAMY 2EPIA 1O5JA 2DHGA 2MLYA 3PRVA 4K2XA 1RU2A 2YH1A 2XZDB 3MM9B 4YY3F 2UXBJ 4OJ3A 2HNDB 4CH7A 1JLCA 2LQBA 3IC1A 4MIWA 4Q0BB 1FRIA 4ZPAA 2QLJB 3IBFB 2MDAA 3A13A 1U24A 4DV1J 1REVA 2HPUA 3NWGA 5CYQB 3M8WA 2VFUA 1IKYB 3CEDA 3CDBA 3KJQB 4KGXB 4WE1A 4RNOA 3PKMA 2MZJA 4CZCA 5A8KB 2LLZA 3N6MA 3VF0B 2DEJA 5ETTA 1NUEA 2AEMA 2IDEA 2LA4A 2WB1D 4C7QA 2WVBA 3OXFA 3BGOP 3TVKA 1Q95G 2GO9A 1Y4ZB 3VALA 1FRMA 5HLFA 1HNXJ 1MU2B 3U7JA 3MCSA 3VAMA 1TVRB 2R4FA 4LJMA 4TYAA 4OJGA 2BE7D 2GS8A 2ZBQA 1KN6A 2DHSA 4IFYB 4ECVA 3G96A 5KOWA 1RGVA 4X4QA 3OR2A 2EFPA 2FC8A 2HURA 1FEHA 2Z58B 3BBFA 3AQOA 5B0FA 1YJTA 2HRUA 4EUVA 2XMAA 3EYZA 1VI7A 5E3CA 5CD4H 5JVHQ 1I94J 2CPXA 4LFCF 1KEKA 2VFTA 2UV8G 1QTMA 4HT5A 2B4PA 2XQCA 3L7UA 3MR5A 3PY8A 1FJCA 1RKIA 2FVSA 2UUAF 4QYRA 3OL7A 4A8QA 5H9EJ 4O4RA 4WWSA 1RB0A 4YOEA 3ZZRA 2BQRA 2CJBA 1R27B 1DHMA 5E5NA 2EWHA 3OL8A 3DKDA 2DNZA 2PDAA 2I1RA 2K3KA 3OR1A 1MMNA 3NNHA 4WU3A 1BQMB 5FJ4A 1WF2A 2OUGA 1SVDA 3JB9k 4NMLA 2IYIA 3SIPB 4M94A 1JLAA 4Y2IA 3HMJG 3PJXA 3UDCA 4UF4A 3CJRA 3RAXA 2BJ3A 4DUZJ 2E1AA 4O44A 4J9KA 3BQ0A 2FUG9 2VPYB 1YZ6A 2RU9A 5GVQA 1UW9A 3MWBA 5KTQA 3MFHA 3VAFA 3DMJB 3T5HA 2H51B 2HGMA 1LWCA 1RT6B 2JHEA 3AT1B 1URRA 3MM6A 4DCJB 4OX9J 2ZBRA 4LF5J 2QN6B 3GV8B 2YY3A 2ZITA 1TKXA 4I1TA 4IYQA 4OZ0A 1CJKB 4KAIA 1WC4A 4CLLA 1L3KA 2XNRA 1FVQA 4RR5A 2MQOA 1OY9A 1OPIA 4C3LA 5HL7Q 2C2NA 4RWXA 3M2VA 4DG1A 4E98A 4K4TA 3RTVA 3E3XA 4ZJLA 2UUBF 3CULA 3ADAC 1YHQS 1T9YA 1B3TA 2IC3B 3H98A 2YWHA 3CCZA 1Q5VA 2DGWA 2MGZB 5DRKA 2HVIA 1Y5LB 3KXDA 1ICEB 2E44A 3BBBA 1WI8A 4DQPA 4TQRA 2ZVSA 1MU2A 1T02A 4J9SA 1WHXA 4ZHRB 3J7AN 3THPA 1FKPA 1H0HB 1HL6A 3K89A 3LAKA 2UU9F 4A8FA 1VQPS 1XK8A 3E51A 1XMOJ 1CJTB 1LKZA 2PGCA 5KFHA 1NK7A 2IMWP 3CJKB 3U1NA 1PILA 1DQ9A 3IG1B 4XTTA 5KG7A 3MMJA 2KT5A 3BO3A 2R42A 2B7CB 3GJSB 2WVCA 2XMTA 4XK8C 2BYCA 2GIQA 1T3OA 3M2UB 1GMVA 1PBAA 4RUHA 3SV4A 4OL8A 1Q7YT 1VQ8S 3HCXA 2DVIA 3D7SB 3HVTA 5JXSA 3R9LA 5AE2A 2AZ1A 3ICLA 3H2VE 4USUA 4DLGA 4DQSA 1VMBA 2Q3PA 1S99A 3FSIA 1BY9A 1UTAA 4LVNP 2WVFA 4KIAA 2ZOFA 3SQGA 1RTZA 1EP4B 1W26A 1XTZA 1SXLA 2QMXA 3L9ZA 3N6NA 1M5OC 1X4FA 3BKTA 3MAHA 4IFYA 1SC4B 3DGVA 5G4DA 4DCOB 3CE8A 3ZZUA 4EU0A 1B0TA 4WJBA 1VLYA 4NLRA 3T9ZA 3PIOQ 3HXMA 1FJEB 5D3GA 1IM4A 2BE9B 1DBDA 2CQGA 4CH0S 2QC3A 4F0KA 3BQ2A 1SJFA 1Z1ZA 2ZH6A 2BOPA 4OLOA 2V9WA 3CMES 3D6TB 1TFYA 4PCQA 3BYRA 1FO1A 3ZNJ1 2ZM6J 2V68A 4X4SA 4DBQA 4O3OA 4B3OB 3W61A 3LP2B 4Y2AA 1XMQJ 3ISZA 3QIPA 4NLOA 4OYAA 5J1PA 2F4VF 4NCGB 1LW0B 3PO4A 3EGVA 3OTCA 4K5RA 2CA9A 3NAHA 1S1XA 4LF6J 1SIWB 1HBOA 1H74A 3UI3A 4UZCA 4RPFA 2CADA 4DL2A 5HROB 2M8DB 4N41A 4NI2A 2DNGA 2ZC4A 3CC4S 4NWBA 5I3QA 4TU9A 3VAHA 2GX8A 2O3DA 4ECZA 4DV1F 1WJ9A 4DN0A 3C15B 4ATNA 2I0XA 2OEMA 3CJ0A 3GE9A 2LVWA 5EX3A 1QJHA 2QL5B 1QD1A 2KJVA 4LF8F 3Q8PB 3IP0A 3TARA 3W5YA 1VFJA 3NOCA 3FDSA 2E9ZA 4LR9A 1H6KX 3VHQA 4YB7A 3LTOA 1RLCL 4YEAA 1O51A 4JI6J 4JBCA 1HYSB 4WFXA 2GO8A 2HFSA 1HHQA 2ZBPA 4ZVRB 3QLHA 4CLSA 2VFSA 4O0IA 3PX0A 1JLQB 3CC7S 2DO0A 1AFIA 1TL7B 1VC6A 4NOHA 2G2YA 1UVMA 2KN4A 2XB2D 5BR8J 2B6AA 1S9FA 1KR4A 3E01A 2H4YB 1TMJA 3UQSA 1RLDA 1S5ZA 2PT0A 5ETPA 2IRUA 2NSBA 5EN1A 3JQKA 2OSQA 2C3OA 1C2PA 4UZBA 3MM9A 2ABYA 3PW2A 1OQ6A 2BVZA 1UPPA 5THWA 4LREA 4Q5VA 1L3UA 4OZ2A 4ELVA 1EQ0A 4RW6B 4C11A 4RBVA 2E5LJ 1TL5A 3N0VA 4KBIA 1FT8A 1FFWB 4I6AA 2GGPB 4NL5A 3SYZA 4ES1A 4BS2A 3W3SA 2KZZA 4LSLA 3PJ9A 1N5QA 2CQPA 3NGTA 2AJ4A 2R7WA 1U1KA 3I87A 4KHPF 4FXDA 1GXTA 2RKIA 4N47A 2V4JB 2DR6A 3BZQA 4M5GA 2XY6A 2J7UA 2V5HG 3LP2A 4C8LA 1O8BA 3ETMA 4QYZJ 4OJ1A 2D69A 3IGNA 4N7TA 3HLUA 1Y00A 1TUGB 1SL0A 2YTCA 4EYIB 1G1XA 1YX2A 2W4DA 1P27B 4P2FA 1NKCA 5KG4A 2ADBA 3W5ZA 2MJNA 1I6JA 4V19X 1UFLA 3SV3A 1S1UB 1MWYA 4QWCA 1SJ3P 4GKKJ 1JJHA 5CZXA 1FDAA 4KO0B 3EVMA 4JYAJ 2KYXA 2ZNYA 3IM9A 4ZVSB 3RB4A 3PFEA 2KVQE 3CGIA 1WOSA 1BQNA 3D4JA 3M8YA 4WFYA 2MHEA 2YBVA 1E6VB 3RW6A 4WYWA 2HHQA 1WC1A 3ZZPA 1Y10A 3GIMA 1RDRA 4WTOB 1Q8KA 1JLGB 3QAUA 4NCAA 2R7TA 3FBFA 4C0BA 3RB3A 1WHWA 5J2PA 4H4KC 1ZAWA 1JLCB 3FJ2A 1U48A 2X51A 1GX5A 2JC1A 4DL0C 4Q0BA 2VOPA 2IA0A 2XYGB 4RL1A 2G2ZA 3HPOA 2IDLA 4MK7A 4FYXB 3KK3B 1VK8A 4WFBQ 3QBCA 4NCBA 2NXEA 3R5CA 2CPIA 4URQU 2AU0A 1TL7A 2ASLA 3HHLC 4Z7CA 4LRBA 3M4XA 2PO4A 3T1YJ 5EGYA 3JYTA 1HI0P 4J9LA 2BRLA 4KJIA 3I0SB 2XEXA 3KLHA 2IAJA 4Q2MA 1HI8A 2A2DA 1UJ6A 3AXMA 2O66A 3D6HB 4N77A 5T7LA 2QMWA 3AOAA 1REGX 4BC7A 4DR2F 2VBXA 3T3FA 1FDNA 2YWGA 2ZE2A 4Y65A 1HARA 3W7BA 5MLCV 3CJSA 5E2QA 2LP4A 3BGFA 1UKUA 2VC1A 4FNIA 2V2ZA 2FYXA 1F60B 1CS4A 4AXIA 2XTJP 3FZ2A 4FZVA 5K8OA 1J2VA 4QR1A 2H9ZA 5IZHA 3U02A 3R2DJ 2YKMB 4B9VA 4EZ9A 2EBGA 1JLAB 1K44A 1U45A 4X4RA 3QFHA 2Z2YB 2VQFJ 5LSLA 3LP1A 3OLBA 1T7PA 5ETQA 4HACA 4OI6A 4AT1B 1FJ7A 1ELOA 1F9HA 3AODA 1HFEL 4A8YA 2QIFA 2W2MP 3ZTPA 5B0BA 2F8EX 3KKFA 2QL7B 4TY8B 4NA3A 5F9LA 1RTIA 4C97A 5GADU 4P74A 2W8LA 1NRKA 1XNRJ 4V1Ak 3G71S 2FB0A 1NJYA 1HNXF 2K7JA 2PMZD 2GIFA 1SL1A 1BQMA 1GTHA 3OHBA 1L3VA 4MH8A 3BR8A 3ETOA 1BMQB 4QW8A 1C1CB 4TKTA 4QJVA 3QJLA 4RUCA 4JV1A 3M2UA 1S0MA 5KFKA 1M5KC 1GX6A 5DJBA 2HHHF 3KUEA 3NS5A 4JV2A 1J5OB 4BBYA 1KTVA 5DDPC 1SJQA 4PYDA 4ZITA 5H9FK 2YX7A 5HP1B 1B4SA 1ZAVA 2YKNB 1DY3A 2K3IA 4PZVA 3IAS9 5KFIA 2XO6A 1ZH5A 1J27A 4RBTA 4ZHRA 1N5VA 5J2PB 1FXDA 3GG0A 3MECB 5HANA 1UL3A 4ELUA 2LA6A 3OSNA 2R2RA 2BV3A 1HNIB 5K5MA 4I64A 4PXCA 5HQLA 3F0NA 3MMBB 2LYVA 3ENWA 1ZPVA 3QIDA 4IG0A 2NREA 1TL1A 1Y3JA 5T14A 2V6AA 1URNA 1M5VC 3OXLA 4DR6J 1R31A 4ID5A 5A8KA 5L1KA 1X5PA 4KO0A 1F2GA 4F3QA 4UQGA 2XYHB 4J5OA 1NHKL 3US5A 1GXUA 2W9CA 2QMUB 3EGWB 3G8SA 2F9DA 1FKPB 1R8AA 4DV3F 1JLGA 1PC5A 1UJ5A 1VGYA 1U02A 4K50A 2VG7A 2ZD1B 1JB0C 2JL9A 3EXYA 3IWXA 5DZ7A 4K4SA 3BBCA 1KTQA 4GRSA 2L48A 2CPYA 3A1YG 3SCIE 2C1EB 2XCPA 3G8TA 4M5HA 5B09A 4LRAA 1RP5A 2CQDA 3EDQB 2RHSB 5FLXU 1T03A 3Q83A 2YNGB 2UVRA 3MM6B 1Q79A 3CIMA 1HNZJ 2ASDA 4ZVOB 2CQ1A 5KT2A 4NEZA 1ZM9A 2RE1A 1NSQA 2MYFA 1Q1KA 3DXSX 2B9EA 3MMCB 2VB6A 2APOA 3O44A 5KG6A 4DS5A 1B7YB 2CVIA 3BGRA 3POTB 4C48A 2H5JB 4O23A 1VQNS 4NXNJ 2CUYA 3A4TA 4HTJA 1X0PA 3IM8A 1K0TA 4ED3A 2BOAA 2HK3A 1QAIA 2LXUA 3T1HF 1WACA 4QYZK 2LCWA 2HNZB 3R8YA 4GKKF 5CD4A 8RUCA 1FXRA 3TNVA 2B56A 1XC9A 4ZPVR 3OXGA 2FLNA 1KWMA 2C22A 3D1HA 3I9V9 1HBUA 2ZH7A 2K2PA 2B9WA 4J9MA 4Y0FA 2D3OR 3ELHA 2Q79A 1FJGJ 4DF8A 1RWKB 3MEKA 1WORA 4DSKA 2VKZG 3B78A 5CYMB 2CJYB 2VDIA 4CI0B 4DS4A 3T5JA 2ILYA 4C4WA 3EPGA 1KLNA 2UU9J 1RWPB 2HHPA 3AB2B 4LF7J 1B64A 3CCTA 2ZM6F 5LT5A 2XG8A 1SC6A 1RISA 1UWAA 2HZAA 2IRXA 3HF5A 1JX4A 1N32J 2GW8A 3FVYA 1PKUA 2XMWA 3PM9A 2CIMA 4CLYA 1OPZA 4ECTA 2CNOB 3DM2A 1IJFB 4X62J 5U47A 1T9XA 3KDNA 1MWQA 1KKHA 1S4FA 4G65A 3D28A 1A6LA 4AL6A 2BACA 3MHYA 3MAQA 5CYJA 4QR0A 5C7PA 2H65B 1NK9A 4DX5A 2ZH5A 2DXEA 3CNQP 1RBAA 2FIUA 2ZD1A 1JKHB 1XMQF 1WNEA 1B0VA 2F5GA 4OV1A 3Q8QB 3MM7B 2CPZA 2N7YA 4LF6F 1HWUA 5CQGA 2MQ8A 2GAGC 3DRRA 4IG0B 4F36A 2CRLA 3UE2A 1ITPA 4EBEA 4ETZA 1YVFA 2NZCA 3DDNA 3DI6B 4IKAA 3GFHA 5AJ3J 3VTIA 3EVWA 1LW0A 3RR8A 3J80U 2AP6A 3GB0A 4P75A 1TKDA 1HNWF 1D8ZA 3W62A 1APSA 4LSZB 1TKZB 4JI6F 5I42B 4LFBJ 4L72B 1VQ9S 2PI4A 4RBUA 4IRKA 1RTHB 1KLMA 2KZMA 4DJBA 1HNIA 4OIXA 5AXKA 3VGVA 4JI4J 3MEEA 1C0UA 1MROA 4USHA 4U96A 2B5JB 2PIIA 1XR5A 3MFIA 2PI5A 2L3MA 4JOUA 3NBPA 1HW8A 1ZA1B 2E1PA 2W2PP 1EP4A 1X5SA 2Y1LB 2VA3A 2IM1A 3DOLA 1VJQA 2J7KA 1JLEA 2W4CA 3KG1A 4JUZA 1U0SA 4OZNA 1KSPA 3O2IA 5BR8F 3FC9A 1EAYC 5L9NA 4GO7X 2QX0A 3N5FA 4RO0A 1O6XA 4IH7A 3TP2A 3X3UA 4YP3A 2HHWA 4ZPCA 1QAYA 2XSJA 4P7TA 2O1PA 2HBYB 1G6BA 2OD4A 2G1DA 2DY1A 4QPXA 5IT4A 3K58A 4QOTA 1DAXA 4DV7J 1HWJA 2B6AB 3B82A 3VVTA 3FMWA 3S1TA 5KOXA 4C9DA 4KC5A 1YJ7A 2LDYA 3K8VA 1UVNA 1RTDA 2DGUA 1EARA 1ROFA 2BJEA 2QZ8A 3D0IE 4ES2A 3DOKA 3G4SS 2JEIA 3LP1B 3QWPA 4FNHA 1IBCB 5D6GA 2Z2ZA 4AE5A 2DNMA 3HVWA 3NRBA 3UVJA 4ELTA 1NMEB 5HMYA 2I5JA 5A0YA 2Y8YA 3RU0A 1RADB 1WEXA 4I56A 4J9VA 4M5KA 1QAXA 2LQ9A 4KGVB 4ANEA 3P49B 4CO5A 4HTIA 4P52A 2XNQA 4URSA 4ER8A 4C8YA 2EK6A 3CT9A 3KK2B 3OJSA 3TA1A 4CO3A 4EZ6A 2HBZB 4IH6A 4P6QA 1JXLA 4HI1A 2ZKUA 1X4EA 1TUVA 1LXNA 2B7BB 2QJ3A 1R0AA 2PSZA 1U1LA 3FQKA 3M6UA 2R7RA 1WKJA 3I0SA 3CCVS 5J2QB 2WONA 2V94A 3J7A1 2H54B 4JI8J 4FXVA 2YVSA 3R5AA 3V6JA 3KJFB 3K2YA 1RWUA 3BJYA 4HH0A 2E1CA 4UOHA 3HHKA 4GO5X 4PG7A 1YSJA 1RA6A 3UN3A 4OI3A 2RS8A 3HD2A 5SZTA 4J9QA 1NPRA 5H9EK 1KD1T 3LP0B 1S1TA 1S1UA 3B4DA 3QQCD 1BUXA 1EJ7L 2L08A 5C25A 2VQEF 3DLJA 2WBMA 5DDOC 3CCJS 4RNFA 4C2MA 4E2FB 3SI8A 3IA0A 4FXWA 4R0EA 3P4UB 5A8WB 3PKYA 3KJVB 1R89A 2XWYA 1YTYA 3CCSS 4BC9A 1YITS 1QSSA 2ZC3A 2UUAJ 3DRPA 4AL5A 1IKXA 4ZN1A 1TK8A 1IUJA 2DGTA 1BXNA 2POKA 3EMTA 4CT9A 1TZ0A 2GQ2A 2VDHA 3SDEB 4DWIA 2M7SA 3H42A 4DF4A 3OVBA 4PXDA 3W63A 5K14B 1X31C 4GC7A 5DDRC 1NXIA 1N6QA 3W2WB 2HQFA 2C2RA 1RXOB 1RAHB 2HGLA 4FPIA 1KLMB 2K1RA 3DGPB 3NNAA 1V3RA 1VQSA 2FGCA 2RILA 3BSOA 1XMOF 2OTLS 4ZPWR 3FFIA 1LEOA 3R7NB 1UEVA 2JH3A 3KHHA 3EICA 4Q44A 1U47A 2F3JA 1ZS6A 3BN7A 4DSEA 1GK8A 3D67A 5GAEU 4DR1F 2H5IB 3I82A 3L4BC 4ZA1A 1TKZA 3VQSA 1K8AT 3G86A 4AFFA 3LA0A 3PEHA 2RD5C 1LXJA 2BW7A 2DJWA 5B0DA 1N4LA 2NXJA 2VC0A 3K17A 4LIWA 1OJ4A 7FD1A 3OTOF 4NLGA 4CO2A 1QUVA 1MG7A 4RW6A 5C42B 4CLTA 3BSNA 2HIYA 5BYSA 5CA5A 3F41A 3LWLA 4ECSA 2OFHX 1FEEA 5L8RC 1NH7A 4P2SA 1QVGR 2WVDA 3Q89A 4RUBA 3BDPA 3B6BA 4YMEA 2OPRB 2W7OA 4PUOB 1SJ1A 2C2OB 4WE1B 1NNDA 2ZH2A 4DFKA 1HHSA 2OPSB 4ES3A 5A8RB 2L9DA 1K1QA 3MEDB 1XJWB 2W4PA 2QSFA 4FYWB 2CJXB 1Q8LA 3FUYA 1U0HB 3PX6A 2XZWA 4QIWD 3TUIC 5HLFB 3PHEA 1S72S 2DIVA 2G9OA 2HQDA 1IR2A 2R7OA 3AA8A 1YKWA 4J90A 1NAQA 1G2EA 3MPDA 4P7VA 2MZ1A 4ED0A 1HNWJ 2QG9B 1ZPWX 3FRZA 2XWXA 3ISND 3LUYA 4ZPTR 3CC2S 2ZZNA 1RT2A 2ZOMA 1CBKA 2VG7B 1RHUB 4FN5A 1N36J 2GMLA 2MQPA 1SKWA 4NXMJ 5J1EA 3D5MA 2UV8A 4DSFA 4IR1A 1VRTA 4ECWA 2J8AA 2HHXA 1QTNB 1VOMA 4YR0A 4BDPA 4OYOA 5KAKA 2ZH9A 2RDJA 4AQYF 1YRUA 2D74B 3QNWB 4LRFA 1FESA 2M88A 2FVQA 1OWXA 4K7QA 1U1NA 4RW7A 1UZHA 3KHGA 3KMQA 3DOMA 3HJVA 4RW9A 3G6YA 1QSYA 3C3LA 3ZZTA 1IQTA 3Q2SC 2HVDA 4QIEA 4IFVB 5T41A 4B02A 3J7YI 2J6UA 4KKOB 3P6YC 2C2MB 2DB1A 1WKLA 1GFWB 2L9NA 4PXBA 4W92B 1HD1A 4PQUB 2VU5A 4B3OA 2QLFB 1FKAF 2DD8S 2W9AA 1RZMA 3ZNUA 4HVZA 1M5HA 1NDPA 5D77A 3DFEA 3QAEA 3THTA 3UW1A 2WZ1A 5KFQA 2G1HA 2BANA 3ZFVA 1KFSA 2CJ9A 1CC8A 2JX2A 3C16A 4TXSA 5ETSA 4DX6A 3WDOA 1FX4A 2F8HA 3G87A 1PC4A 3M1VB 1EZZB 4I2PA 4PKDB 5KT6A 1HNVA 3FSYA 5FIIA 1C0TB 3I31A 1RCOB 3OLAA 2FLPA 2K8GA 3LH2S 1U2RA 4K2JA 2ZHOA 3TVZA 1TQLA 2ZWOA 3T41A 2MKHA 1WG4A 5CABA 4OYBA 2BJ7A 3ENAA 3IFEA 2XC9A 1Q5YA 5DETA 1PSDA 1R6YA 4YHHJ 1X5TA 4NX9A 2GHPA 5SUHA 1IJEB 1NU4A 1OY8A 4Y2MA 4XO0A 3A3OB 2J9DA 5L38A 4LSNA 4PUOA 1NHVA 2F7VA 4Y34A 4IQMA 2E7VA 9RUBA 2UUTA 2C3PA 3DLEA 2V4RA 2FD2A 4ECUA 1I94F 2BDPA 2GC8A 4R25A 4DSIA 1W2IA 4NPOA 5D0RA 1RT3A 3IBWA 3DU5A 5GAHI 2I38A 1LV5A 3EJMA 4LR7A 1IXKA 3GYGA 4ZP8A 2YWEA 4P72A 4A48A 1RHRB 2O01C 3N4WA 3V6DB 5LOQA 2BJ9A 3KLGB 4WFNQ 3QGHA 1UMJA 1MN7A 1Y9OA 1U7LA 2VF3A 5LXRA 2GNKA 3LAMA 2EG2A 3ET6B 1T0TV 4F25A 2HQGA 3OSPA 2WW8A 2HGNA 2F8MA 2OI2A 3NS7B 4OV6A 4F4XA 2CWXA 4DG1B 4MK8A 2QA4G 1CJVB 4ZVUB 2ZFHA 1IKVA 4PG4A 4ED8A 3IR5B 3RGIA 4WIQA 3S6EA 4AYBD 2JNJA 2OO4A 2CQCA 3J7Z5 4LRDA 3RAMA 3KLEA 4F4KA 2HNYB 4URGA 1RHQB 3IWNC 1YDLA 5ETRA 2HZVA 1YBUA 2RF2A 3HK2A 3C66A 1SUQB 3DMJA 4IR9A 1CEZA 2HRTA 3BH6B 2OEJA 4WCEQ 1M5SA 2VJUA 4GKJF 4ZVEA 2HBQB 4GVLA 2NXNA 5ADZA 2J0SD 4OMFG 2JFDA 4DL6A 2V8VA 2KM8C 4Q8EA 4TY8A 1HHTP 2DGVA 2VPWB 1WC6A 2BX6A 4PWDA 3AHPA 1UWBA 3M2RB 2EFVA 5C25B 4ILRA 2KM8B 4B3MF 2NR0A 3R5BA 2HFNA 5E3AA 4FYDA 2RRBA 3C19A 1FE0A 2AEFA 2NUUG 4OYPA 4M63A 4YN3B 2MZSA 3KLVA 3PO5A 3QZ8A 1DURA 3PCOB 1C0UB 3H5SA 2DNLA 4Y2CA 2GMHA 3GIKA 4X65J 2E5HA 1KHVA 2CG4A 2M2BA 2MQMA 3NAIA 3OR2B 5B0CA 1IBKF 2IY5B 1UA0A 4ETXA 3B4MA 1XNQF 3DRRB 4NLTA 1VDHA 4N8NA 3JSMA 2AJ2A 4X4UA 4R8UA 2RUGA 2F4VJ 2P9CA 4OQJA 3ENQA 2P5VA 1RYSA 1CPZA 1NHUA 3D66A 2DITA 1JLFA 5IC6B 3VAGA 1RAOA 3TZXA 1Y5IB 5CYMA 2R7XA 3VR1A 4PPDA 2GJ2A 2IA6A 3P5BP 1HPZA 4HI2A 2E9RX 3DM2B 1C4CA 1WUUA 2DKOB 2E7WA 1KVJA 3QWUA 4WTYA 4O3PA 5HMWA 3KLGA 1VBZA 3W66A 1TTHB 1KQSR 2IBKA 3M9MB 5E7OB 2Z56B 4LFBF 1KHWA 2HS4A 2GZOA 3I5CA 5L1JA 2GQCA 3C15A 2WSCC 3PDNA 4NZ0A 1NKEA 2HEKA 3UD4P 4S0MA 2D41A 3MEGB 3KHLA 2AV5A 2AYEA 4NE9C 1GAOA 2DGOA 2OHDA 4KSEB 2X1GA 1RT3B 1BE4A 1FWKA 2AMCB 3UWTA 3QT7A 4MFBB 4EGLA 3EUNA 3EZOA 4YR3A 2DIUA 1HW9A 2VG5A 2YKAA 2IVMA 4MKYA 2UXBF 3WZ0A 4ZKAA 1YWXA 1YJRA 4IH5A 1RTJA 3T6JA 1YBTA 4DPYA 1CLFA 1SJRA 2R8HA 3ZTSA 3CO0P 3UN2A 1Y0HA 2ZH3A 3QT6A 2GGPA 2FHOB 2K1RB 3DGPA 3MCNA 5F0WA 2J0QD 2YWWA 3CDUA 2Z30B 2IPOB 4PABA 2PFDA 3MURP 1RBOB 2M9KA 2HLTA 3QYYA 3PZPA 3RR7A 5J2MA 1M1GA 2CZ4A 3R5DA 5KFXA 3V4MA 1SH2A 3Q8RB 3M32A 3GSDA 2MY8A 3FEZA 4WK3A 2HSEB 3RZAA 4CM0A 4O3RA 3SXLA 4QIFA 3OR1B 3OL9A 2F40A 3JXOA 4IFVA 4JI0J 5IWAF 4C0OC 1Q8BA 4O4GA 3OW2R 3ILOA 2ILZA 4MFBA 2MKCA 5AE3A 4DR6F 3TA0A 3PJWA 5C5JA 3ZO7A 2QV6A 1NDCA 3DN9A 5HJYA 2AYGA 3T19A 4U7UK 1Q86T 1RT5A 4OJHA 1U1RA 1S1VA 1IKWB 1N5SA 5K8PA 3RAQA 2OIHA 4LBPA 1FDDA 1FTRA 3KLIB 2VL1A 3HSGA 2G2OA 4JI1F 4NXNF 2QTWA 2C3UA 1ZTWA 2DR5A 3IWLA 2L41A 1M1HA 2OLWA 4KH1B 4JI8F 2AIRB 3D3BJ 1HLWA 5CAAA 3FK4A 3G6VA 1D9FA 2Y3YA 2L9WA 3WC2A 1VLOA 4M5NA 2AW0A 4QWBA 2JLEA 5IM0A 5KFSA 5LJ3Y 3TYTA 3TR5A 4ZIWA 1AW0A 5F3ZA 1VRUB 1Q4RA 1PYSB 3CSKA 3JQMA 2RS2A 3OT9A 4ZVTB 5C2GA 3RB0A 2ZDOA 2ACYA 2FQQB 1HMVB 2HWTA 3Q22A 3MGJA 3V81B 3AQPA 2NUHA 1V3SA 4F2RA 2OFGX 3H5XA 3NGKA 1FJGF 2P9GA 2FLLA 4ANDA 1ACMB 4DV3J 2OPQA 4IG3B 4P73A 1EX8A 3M8SA 3MUTP 3KK2A 4UY85 3H59A 1NJXA 1ZA2B 4HL9A 1MMDA 2KVIA 2XGQA 3SSQA 3J7YU 2VD3A 3FSXA 3QGIA 2QYCA 4FVCA 5AXNA 4O44B 5BYQA 2KH9A 1NK8A 4B9SA 2HNDA 4OLPA 1X9SA 2YKOA 2ZH4A 4O3SA 2DNKA 1VIOA 2ZVIA 5KG0A 4OHWA 1KNZA 2XLJA 5ETMA 1PJ6A 1F2HA 3BM7A 3HZEA 5B0EA 4EBDA 1P1LA 2AYMA 3MTJA 3V6HA 1ZM2A 2X1AA 2Y1JA 2KXFA 4BCAA 4WPAA 1D3WA 2CPEA 3AOBA 3NLCA 4ED4A 4B3RF 4A8MP 2KG0A 2VFVA 3RYLA 4NRUA 2HHSA 5IXUA 3DOLB 4RKUC 5B0AA 3MDFA 2DT9A 5L39A 1P8GA 1RT1B 4I7FA 5D3GB 3T1HJ 3TI0A 2J0WA 2PE8A 3QO9A 4USVA 4CTAA 4CYUB 3OUYA 5ITHA 4OX8A 3SZ2A 2VJVA 1U1OA 5F8JA 4AQYJ 3PRDA 1W25A 2GHWA 2HMIB 2JEFA 2HHUA 2W2QP 2HRYA 2NYHA 2VBYA 3Q23A 1KC8T 4F02A 4ZLLA 3KLEB 3V2UC 1GMUA 2A10A 2JRSA 3PYGA 2XMMA 3D3CJ 4C98A 1NK6A 2GVDB 4ZCMA 1EETA 2HVZA 4G6VB 1SUQA 1S1TB 3WX8A 4U7CA 1T05B 1RTIB 4JI7J 3HHLB 3SFGA 5HI7A 4YQWA 4J37A 1LWFA 2NQPA 1KP6A 2ZE2B 2H48B 3H2LA 3OTDA 2AJ0A 3TWZA 2N3OA 4QWEA 1N54B 3NGDA 3HKZD 1UFWA 2MKKA 5FLXY 1BD6A 3PR4A 3UPFA 2COLA 3THVA 3M2RA 4LFAF 1UW4A 2JSXA 1EKRA 3BPSP 5EUHA 5FDLB 5KFCA 5KFJA 4G3IA 1FXLA 1CJKA 3EZUA 4J9UE 2D9PA 2YKMA 4LQ9A 4P2XA 2O5DA 5IT0A 2RH3A 3CDWA 3TVYA 1HI1A 4QPTA 2BXJA 4WXOA 1RT4B 1UVKA 2X3GA 2RRAA 4WU2A 3TX0A 1NH8A 5E0OA 2HMIA 1RT2B 1SKRA 1WG5A 3AA9A 4HEA9 4QIGA 4LSNB 4BLGA 1WTBA 1XNRF 3C16B 1VHFA 5LL6d 3WIVA 2VHGA 1WDDA 1LNQA 1F5BA 5AT1B 5G0RA 3DLGA 4MKVA 4AXJA 4UOGA 5MAOA 5RUBA 1MNEA 1L3SA 1FK9A 4NLWA 2FLOA 3TAMB 3IS9A 4DQRA 2YWFA 5JVGQ 3H4DA 5B7WA 1NEEA 2E1MC 2YNFB 3C6UB 3GJQB 4FYVB 1CQNA 3IAM9 3HSZA 3K5MA 1QAJA 1UVIA 2GQQA 2MSSA 2AHOB 4UY8T 2Q66A 4CM2A 5B08A 1T95A 2AEJA 3POTA 3BYPA 2BKNA 4X64J 3CW2C 5DLGA 3MOJB 1VQ7S 2QA2A 1Z2ZA 5IOLA 3V5RA 2AX0A 1FVSA 4MKAA 4Z7YA 3P5TL 5CHCB 4ZPDA 5JUMA 2ZJRQ 4DR4J 3P8BB 1R8HA 3FKBA 3CD5A 4KKOA 1VCTA 4ED6A 3CO9A 5ETLA 2DPIA 1TP7A 4LQ3A 4CDIA 3GV7B 2AGPA 2OMLA 4FVMA 1TAQA 3ONQA 2R2TA 1TELA 2BKOA 3WHIA 1M1KT 2B9YA 2OELA 3R6LB 2WK4A 1CG2A 2QL9B 3QJJA 2OMOA 1XQIA 2EFGA 5KFPA 4MKBA 1HNZF 2ROPA 1K0VA 2QFIA 3PTWA 2V67A 2C42A 5HBMA 1YJ9S 2E5LF 3UCGA 3TX8A 2HNZA 2CQHA 4MYUA 1HQUA 4PPZA 5CYQA 1UP1A 1PJ5A 2QLXA 4M5IA 1B70B 2HFOA 4KFBB 2XS2A 4L75A 4WZQA 4DDFA 1FFSB 3H7HB 4JV0A 1AZSA 4KY3A 1RHMB 5IS2A 3CDEA 4G1QA 1QE1A 2A6OA 4C0HA 2HVHA 2CPDA 1D0EA 3IRWP 1KS2A 3M8QB 2Y0SD 4B17A 3QPIA 4E0DA 2HW3A 3TA2A 2CPFA 1ZTTA 5E3RA 4B3SF 2WB4A 3E8OA 2XBPA 4QU7A 2IJNA 4LF5F 5KFLA 4O4GB 2WAQD 2ZUGA 4D3GA 3G82B 1LWFB 4MIBA 4ZDNA 2R8JA 4W98A 2BM1A 2RB7A 3G2XA 1PAUB 1U2FA 4DV2F 1CQMA 4ED2A 2A18A 2XYPB 3MOZA 1VRUA 1PYTA 5HVHA 2LEBA 5J1EB 1VQOS 2LQ5A 3VV2B 1YJWS 3K8WA 4KHPJ 3DLKA 1UPMB 4TVAB 1YLXA 4X2BA 2BUNA 3VAIA 3OHAA 1FHTA 2I9SA 4FKXA 5AE1A 1EB0A 1P9YA 2Q6BA 4UW2A 4YUDA 4KQZA 5LSOA 4YB6A 5KFEA 3V4IB 1DTTA 4USKA 3Q24A 3D54A 2KDOA 4B9TA 2Y1IA 4DV6J 1S77D 3O1LA 3UVJB 2FVRA 1U1MA 5EDWA 2AKWB 4HT7A 3SDEA 1LK7A 5F8LA 1R3NA 1S76D 1D9AA 1JLFB 4PQUA 3VWSA 2EFNA 3QSYB 1UVJA 4I68A 1N6QB 2HVEA 1TL3B 2KYZA 4HACB 5E41A 3KMSA 1NO8A 2I6WA 2MEWA 4CLUA 3K5NA 2GA7A 1VQYA 2NXCA 4F50A 2VOOA 2DNHA 2P8IA 2VG6A 2Q1LA 5GAHU 2H4WB 4NXMF 2VA2A 2VFRA 3DNCA 3HI9A 3OTOJ 1N5YA 3HO1A 4QIVA 1K73T 2BMBA 1I5OB 1VK3A 3PW0A 4WK1A 1ZOTA 2MJUA 1S6QA 1VHIA 2ZNZA 1WG1A 3D6MB 2M8HA 4PG6A 1EHWA 2FJDB 4KGZB 1HBOB 1VJWA 5D4LA 1UVLA 4WBFA 4DR7F 2HFZA 2WW4A 4AL7A 2JLGA 3SQOP 4F67A 4DSJA 4DZDA 2DY9A 1CVJA 4WF9Q 2FZGB 1FA0A 2EFOA 4M5LA 2WOMB 2R8GA 3GTYX 3ILIA 1MW7A 2F4FA 1J5EJ 2KO1A 3TZYA 3JS9A 4IO1A 2YNFA 2BZ2A 2HWIA 2J9CA 2YQ3A 3C6UA 3FMBA 4TQSA 4C8KA 2IYGA 4CP5A 1WTFA 1KQGB 2DHAA 2KHDA 2ERRA 3K0JA 3RBZA 1T9WA 1WEYA 4DR2J 3MF5A 4DL4A 4HR2A 4P10A 1AFJA 1X4AA 2EVZA 2FVCA 1NCLA 4FS2A 1MLAA 3ISNC 1M5PC 1NZAA 1RA7A 3QT8A 3JQJA 1X60A 2FPHX 2G0JA 1Y7PA 2XSFA 1WI6A 4RLEA 4OZ1A 3V6DA 1NJZA 2XY5A 3OD2A 4UUWA 3KHRA 3CDAA 3BDEA 4NLUA 4A8WA 4FF3A 4X4NA 4CO4A 4U67Q 1T3NA 1YJUA 1S6QB 2CWKA 2UUWA 4L73A 2M0GB 3CIZA 1FFGB 3OL6A 2A3JA 2YPZA 3DOKB 2NLWA 5KFWA 4Y28C 2DR8A 1HR0J 3NS6A 3BPDA 5JJBA 4DV7F 5M2RA 1A7GE 2UVWA 3QRRA 4ECYA 4MYTA 1RKJA 4LR8A 2NPIA 1U2CA 1QUPA 4FS1A 5A0YB 2KL8A 2C2KB 1H72C 3G8QA 2OP5A 3AAWB 1JNZB 2DEIA 3MECA 3DHWC 4DUTA 1WHYA 3IBCB 2GIRA 3CCQS 4LT6A 4X66F 2VODA 3LPEA 3O3LA 1SQGA 1WC0A 3OVAA 3PG9A 5F0UA 4NLVA 4I6YA 4FBUA 1XN9A 3UCUP 4KHRA 3I0RA 2XCAA 1HQUB 1NSAA 2EBEA 3R5GA 3M30B 4J9OA 2DRBA 4K0KF 2V8HA 3MPWA 4FYYB 1UEUA 2D3UA 3GR0A 4DR3J 2YX4A 3EDRB 2XLIA 4CLWA 1LWCB 1RU1A 1RT6A 2RMLA 2QRRA 1S4EA 4M8LA 1D8YA 4C3KA 2V4JA 4I69A 3CMQA 4XPCA 1F5AA 2F1FA 1WOPA 5BJRA 4K4XA 4EEYA 1N52B 3LGHA 4F3MA 1X8DA 3FGVA 1NB2A 2VICA 2KRRA 2LQ8A 3F56A 3GPAA 3NXZA 1RT1A 4ZCLA 5A6WA 3TO8A 2KXHA 1O0PA 4KHMA 1F9EB 1LWEA 4ZLNA 2KJWA 1MROB 1UZDA 2WSEC 4K59A 5LMNJ 1VC5A 3DDIA 4DUYJ 4PEOA 4IRDA 3KWMA 1FRLA 4YB5A 2EC0A 1V5VA 3NBPB 5KFNA 1MMLA 4ZVHA 3JSYA 5HQ8A 2YX1A 2ZWPA 2GAHC 2CG8A 2MKIA 5KT7A 2M70A 4K0KJ 3EGZA 1NJIT 1RAEB 2KT2A 3CJ8A 3HKWA 3MMCA 3WBZA 3UDLA 4EK2A 1KDNA 3F44A 3BN4A 1Y5NB 2VPZB 3BSCA 2QYGA 2MY7A 3NCQA 1R8CA 3RG6A 1VQKS 2VPXB 2GVZA 2XMVA 4NLQA 3QSIA 4U8YA 5I3UB 2VQEJ 3MM8B 2R9LA 1X4GA 1T9UA 2PA8D 1YK9A 4RW8A 2N3LA 2DBBA 3U1LA 1T94A 2OAUA 3O6QA 2W9BB 1SKUB 4ZMMA 4QCLA 1R0CB 3L95X 4DQQA 1YJVA 1YZ7A 4NLYA 1N88A 1UCNA 1R8BA 1VBKA 2RT3A 2EEYA 1T9VA 1GMWA 3AD9C 4EMDA 2UXDJ 2Q43A 2RVJA 4AD6A 1AXQA 4K8RA 3VCDA 4I2QB 2EI5A 2QO3A 3QATA 4CNZA 5CH7B 3CUNA 1S12A 1WKKA 1X7VA 3ZTRA 2LEPA 1SL2A 1OMSA 4LF4F 1HWLA 2AF6A 2EG1A 3BS9A 3GILA 5KG1A 3FFIB 1TL1B 4PAAA 3BF4A 5D0HA 3J7ZT 4NCGA 5GMDA 4B9LA 1S9EA 1QE1B 3EZ5A 2QLBB 9ATCB 1JXEA 2R3VA 4YDXA 4B08A 4ED1A 5HROA 2VZ9A 4OI0A 4EI2A 3HT3A 3AFGA 2PEBA 2V69A 5D15A 2HQ3A 1S48A 3W5XA 3CD7A 5K8MA 4ECRA 1F6TA 2LQJA 3ZZOA 3V4IA 4B3MJ 4C11B 1S1WA 1GXLA 1JQGA 2NXUA 1DARA 3V6KA 3H0PA 2FHKA 3A8EA 1S7IA 4DV5F 2IMOA 1OIAA 1RAIB 2NYIA 1JLBB 4P2MA 1FTCA 3I0RB 1ZZNA 3E2EA 3ENVA 4Z37A 1QLNA 3D68A 4DV0F 2DTJA 2IRYA 2CQIA 4Z2XA 4F4WA 4USIA 5M2PA 4JI2J 4H4OB 3M6WA 1PG5B 2HFUA 2NS1B 1HWIA 2OPPB 3D6FB 3DRSB 3DU6A 3H20A 3A12A 5L1IA 2J6TA 4LFCJ 3CD6S 4DL3A 5ETVA 2JOQA 2MLXA 2BE2A 2FHJD 3UDVA 1OS5A 3W2VB 3TZZA 3GFXA 1FD2A 2HBRB 3ET6A 4L6V3 3TAMA 3W9IA 1CJUB 1V5IB 2ZZTA 3HHDA 3M30A 4KR0B 1NK4A 4B9UA 2XS5A 4HHHA 4ZJOA 4YDDB 1JXVA 3K59A 5K8NA 2GVDA 2P6SA 5K9FA 1XR7A 2KT3A 2RJZA 2HZCA 4L3KA 5F8GA 3BV8A 3MMAA 3ZXWA 1Z2LA 2V50A 2AD9A 2W01A 3IRXB 5C24A 4O3QA 5CXTA 4RX6A 2A6MA 4B9MA 4LF9J 2ZH1A 1U1QA 4K4WA 2R2SA 4ZLJA 3LF0A 2E9TA 5DGAA 4IG3A 5IFMA 2DNRA 1R7IA 2GJIA 2MXYA 3PW5A 4CTAB 4CYUA 3QRQA 3CCRS 3CD0A 2WVEA 3K5PA 3L7OA 1RWWB 3LGMA 1IKVB 2XHWA 5G0RB 5JMNA 2CQ4A 3SEOA 1N5TA 2C28A 4WKYA 3GYXB 1PGZA 4H4KA 3I32A 4TU7A 3MMBA 1R6VA 3KDOA 4C8NA 3P96A 1DJ0A 3GZ7A 1VS3A 3PYDA 3UD5A 3CCES 1IWGA 3GLJA 1WWHA 4UQTA 4U7UD 1EETB 1KVIA 2IM2A 3PEJA 5KFAA 4MAKA 1N5YB 2VBZA 4CH1A 3M6VA 3GJTB 2F63A 3I6PA 3M6XA 2KXNB 3DLHA 4NYOA 1VQLS 3JAMU 2W9CB 3J80Y 2NSCA 2J7WA 3R27A 1TU0B 3BGRB 3HP6A 4H4MA 1IBMF 2M4MA 2OD6A 5L1LA 1JJ4A 2UUCJ 2B8QA 2FJVA 3CJ4A 3A8IA 3PHTA 3SBMA 4ZIVA 5GADI 1BQNB 2DGQA 3F73A 4I67A 3QO9B 3OUYB 2M5YA 1C1CA 1VQMS 2NZ4A 1JLEB 3N9UC 3QIPB 4GKJJ 1WELA 3M7VA 3CB4A 1FNOA 4A8OA 1PYOB 2KI2A 3P45B 2N4DA 2AWZA 3N79A 3KUGA 4DSLA 4H4OA 2BABA 2MKJA 3IN5A 1T03B 2FJXA 1F0XA 2W24A 3VVUA 3MUVP 2CJAA 3CJQA 4B3TF 1TV6B 4NA2A 4MTPA 2CXEA 4D3HA 1U26A 2DPJA 2HK2A 4QZVB 4GMKA 3AD7C 1A9NB 3I4HX 4A4JA 3GYNA 1SB6A 1RTHA 3M8PA 2HLUA 3NG8A 4OX9F 3M8RA 4GVBA 3MPUB 4HDHA 1AA1B 4ZP6A 5DM7Q 1Q81T 1NM2A 2H5EA 1KONA 4HDGA 2R7QA 3BEGB 2OTJS 2HAFA 2IFXA 4JB8B 4QR2A 1SBRA 1JJCB 1FWLA 3NWRA 2K06A 2N4CA 2JVRA 4UOFA 4TU8A 2HFVA 1TL4A 2F9JA 1P1TA 3HVTB 3KNGA 2XULA 4IOAQ 3FCWA 1HBMB 1FE4A 3D0GE 4RU2A 3UCZP 2YNHB 1SQEA 2B9XA 3CVKA 5GAEI 4ZVGA 3JSBA 2OPRA 5F8HA 3MTKA 5DO2A 3W60A 1N34J 3MCOA 3GCWP 3DHXA 2CNKB 3BSAA 4DMZA 4CIOA 3BGUA 2DO4A 1R0AB 1VR6A 4CO1A 2WHOA 3DYAB 3IXQA 1CULB 1E6YB 2B4OA 3UN5A 1TMMA 4XAKA 2DR9A 4FBTA 4A8XA 2KHCA 1IBKJ 4IDKB 1RBLA 3M8PB 2MSTA 1OYEA 1FWPA 1RT5B 3TUPA 1HQ2A 3MMAB 1FI4A 4RNMA 1N32F 2AJQA 4OYMA 4X4TA 3K5LA 2ZKTA 4DR5J 1RQ0A 3KLIA 5T7LB 4KV8A 3RBXA 1W7WA 4JI5J 2HS0A 5B0GA 1OQ3A 3T9NA 4A47A 4ED7A 3DLLQ 1C0TA 1WDTA 3G6XA 1H7WA 1SI9A 1LWXA 2YWKA 2Z2LA 3MM8A 3IR6B 3A3PB 3PYFA 2W7AA 4OHXA 3QZ7A 2XS7A 1PJ7A 1S6PB 4NEYA 4KE5A 5HO4A 1OSCA 1S79A 3DRXA 4U8VA 1TR0A 3DOMB 3PACA 1VQ5S 1NSKL 1IN0A 1XIQA 3H90A 4G1QB 4TY9A 3M9NB 3AOCA 3VQTA 4BHQA 2QA1A 1VC0A 4JI7F 2J5AA 4FF1A 4IOBA 2IM3A 4CRJA 3DI6A 4C6AA 2ZJQQ 3ILJA 5KT4A 1D1UA 2AX1A 5KFYA 2VUGA 4X66J 2RNEA 2C2ZB 4DX7A 5F41A 3KK1A 3K57A 1NDLA 2D7SA 2XHCA 4I2QA 5F9NA 3CCMS 1Q78A 1F9FA 4DZ6A 1LW2A 1C4AA 4P9SA 2IM0A 1RI7A 1PIEA 3HHLD 1KQFB 2Y9HA 1WSVA 1I3OB 1PCAA 4RNNA 3Q86A 5CCLA 1UWBB 2JWNA 4DLEA 3HVRA 2PFFB 2H1YA 5IV3A 1BC6A 1V6HA 4PYAA 1SPBP 5AXMA 2W9BA 3GU0A 4N56A 1EKSA 2LXFA 3C2PA 3UDEA 3MEGA 2FVPA 5EX0A 3SSSA 1CSJA 2JVOA 1WHVA 4WP9A 2A0FB 4USWA 4ZPBA 3TJ9A 3N6LA 2XI3A 1YG0A 3NKYA 1FRKA 5F8IA 1YRTA 2CPJA 2FC9A 1RT7B 5LMNF 1TVRA 2NCKL 1DZ5A 4M95A 3GONA 2PD1A 3HULA 1P9QC 2HIQA 2OGUA 1VYAA 4QWAA 4JV5F 2FTRA 3HSJA 1N0VC 3OFGA 3LO3A 1QM9A 2SXLA 1SC1B 3MZIA 4KTQA 3P3DA 1FF2A 3DYAA 3MM7A 4QQBA 1XBWA 4CLKA 2AGQA 2OH2A 3NMAA 1IKWA 5A6PA 1RAGB 2J76E 4OHVA 2FJAB 1YBAA 3MD3A 4EBCA 5IWAJ 3QLHB 1YJNS 5L46A 4ZN3A 1RJJA 3ZTQA 5D4NA 1H38A 5A8RA 4IQXA 3H25A 4M5MA 3CCUS 4NI2B 3KG0A 2ZHAA 1LWEB 1F3FA 2WTFA 1HBMA 2ADCA 2FJEB 2MQQA 2RSQA 2LMIA 2PC6A 4M5DA 4CO0A 3OJUA 3R1HA 1NB7A 2B43A 4ITSA 3NNCA 3MR6A 2HKEA 3A8JA 5KFZA 3UR3C 4DUZF 1H98A 3WIUA 4J7CA 5DG8A 5KFGA 1IBMJ 4Q43A 4O3NA 3KG4A 1NK5A 1B99A 1JLBA 5K20B 2HS3A 4IOCQ 3W8GA 1QDUB 2UUBJ 5D0EA 4ALZA 4OHYA 1IKXB 2E5JA 4LBHA 5LM7E 4EYHB 4R8UB 2A2CA 4CCHA 2ROEA 2XLKA 5KG2A 4IO9Q 3HM9A 4JI1J 1FRHA 4QBUA 5BYRA 4I7FB 3A8KA 2V2KA 4YHHF 3SMZA 3GMGA 1NSPA 3J81Y 1RTJB 2ZDPA 1GH8A 1C1BA 3W2WA 3NCPA 4JI3F 2RDIA 2DXDA 1GT8A 2RQKA 3M05A 3MEEB 1K1SA 3GJRB 4NA1A 4OFZA 1YQHA 5KFDA 2Y1RI 1S97A 1NKBA 3QMQA 4TLRA 2DR7A 3C6TB 1VBYA 4HKQA 2CDQA 3BR9A 1VRQC 4N8OA 7AT1B 2ZBIA 1ULRA 4KT0C 4P71A 4DL7A 4I0WA 4XDDA 3TEGA 1GEHA 1Q16B 3QJPA 1LQ9A 2IJFA 4LMZA 1BWVA 2B0GA 2P6TA 1Q82T 3R97A 4ZVPB 2XY7A 2RF2B 5A2QU 1RK8A 1U25A 1S7HA 1SH3A 2VQFF 1QVFR 3R5JB 3SQGB 3J81j 4J9PA 2OKQA 2E66A 1RWVB 1LOUA 4RW9B 3UNYA 3R1LA 4CLZA 2YQ1A 3KYLA 4F3OA 3BO2A 3CPWR 5FD1A 2FZKB 1UETA 3PXGa 2QGFB 2DH9A 5I4MA 3EPIA 2HQCA 3MCMA 4H4MB 3TAQA 1U6ZA 2VKRA 3OFFA 2HNYA 5IC4B 3R2CJ 2GV1A 4XDCA 2NPFA 2AQ4A 4K4UA 4PWDB 1N33F 4OZ5A 4ZP7A 1TKXB 3LPYA 5IV4A 1FK9B 2WSFC 2OJ3A 3C14B 1WD6A 2BEFA 3IRXA 5C24B 2U1AA 4WP8A 2LFVA 3M1VA 4I2PB 4UTGA 5DDQC 3DLEB 3I96A 3MPYA 3TUZC 2XMKA 2XO7A 4DI6A 4F2SA 3FBCA 3S7RA 3AJ2A 2IJRA 2DRAA 1TV6A 4ECQA 1FX2A 3H5YA 3FEXB 3UNGC 3MPVA 4JI2F 2IAJB 2ALZA 2GCFA 3CJ2A 4DU8A 2MKSA 1RAFB 4PWWA 4HHUA 1CC7A 5KFBA 2FY8A 2E29A 4X84A 4FPRA 1KOHA 2R7VA 2ZOGA 4A8KA 3M2VB 2V2VA 2R8IA 1RHKB 1RWOB 4ZCIA 2HWHA 3D2WA 4ILMA 2YPYA 1NLKL 2OPPA 3DRSA 3O8WA 3RW7A 3QGPA 1KRPA 1N8RT 2HAIA 1FRJA 2OPQB 3OTBA 2JZ5A 5F8MA 4F4YA 3AXKA 4ICLB 1H2UX 1S6OA 3BH7B 2LEAA 2Z2MA 3NGSA 4RUAA 3PYEA 3CCLS 3VZIA 1XNQJ 1RE1B 3L3CA 1S59A 1XERA 4DCPB 1YGYA 3GG1A 1V9OA 1AT1B 5J2MB 3R7BB 1S1WB 2Z0GA 3VZHA 1SV5B 4EO6A 1AUSL 5A76A 1HIYA 4DV4J 1X5OA 2DHHA 1DRZA 2DK2A 1VIXA 3M32B 2MTLA 4ID8A 2ACMA 3ZC4A 1WC3A 5ETNA 2X1BA 4KPYA 1S6PA 3D0HE 4WIIA 2ZZMA 2CQ3A 3DRYA 4KB7A 3KLFA 1S0VA 3QGGA 4UOCA 2X7IA 3OPKA 2K7KA 2ZBCA 2FY1A 4DR7J 1B7FA 4Y00A 4OZLA 3GR1A 4RW4A 1RAJA 3D9BA 2DNNA 5J2NB 2DYAA 4DX8H 3Q8SB 1VQ4S 2HHVA 5IT9U 2B4UA 4NLDA 5E3QA 4NYPA 3B54A 1KOOA 3W9JA 1ZBTA 3IG1A 3CJ3A 2CZ9A 3M8ZA 1RSCA 4KGMA 4F4ZA 1KVKA 3TJ8A 3HVAA 3BREA 4ERDA 2J8SA 2OSRA 4LUBA 4OZJA 2HHTA 1WSRA 3NGRA 1JNRB 3K7RA 1CULA 1E6YA 2ATCB 1RAAB 2FDNA 2V34A 3JTNA 4TYBA 3T1AA 1S9EB 2PN6A 4RJVA 3HD1A 3M8QA 4YFUA 3E01B 3HFVA 3R7SB 1S0NA 4PQAA 4DN9A 5DZ6A 4DR3F 3AJDA 4OYIA 4CLPA 4UUXA 1JKHA 5F3TA 3TW0A 2JEJA 4Q8FA 3FQLA 4USTA 5KT5A 2W7PA 2B51A 3WX4A 2MZRA 4DQIA 5HSPA 4F26A 4WP3A 3NL0A 4B3TJ 5DS7A 5DLFA 3FBBA 3NY0A 1RT7A 4J91A 1X4CA 1F5CA 1HR0F 3LGNA 3CTRA 1HBNA 1V3ZA 2RAQA 5CZVA 1NZ8A 4KFBA 1JIHA 3NCRA 5KFVA 2YKNA 4DUYF 2WRMA 5KG5A 2PA3A 3GFYA 2XGPA 4HYKA 1NJWA 1ZM4A 4LRCA 2CDRB 4M1KA 4MK9A 2CZVC 4U9RA 3SFUA 2G0CA 4CWBA 2MZTA 5DGBA 1X4DA 2EC2A 1AYEA 1H2TZ 1Z4UA 2ALYB 2QE5A 3B8HA 4OYXA 4ANCA 5LSRA 1GQEA 3CJ5A 4DV2J 5IQ6A 1XR6A 1BWEA 3MR7A 5KFFA 3G6ES 1TUWA 2LU1A 4QW9A 1IR0A 4ID5B 1FD8A 3MAAB 4LIRA 4AUKA 1RHJB 4OHZA 2MHNA 3LOUA 3W1YC 2AT1B 3EM1A 6FD1A 4ZOSA 5LJ5Y 2JLFA 2Y8WA 3QRPA 5E3PA 4ZVFA 2FZCB 5M2UA 4PRFA 1GMWD 1DQ8A 1N56A 3DRPB 1RYRA 1DLOB 3HDSA 4UT4A 4DPOA 1HKAA 3N01A 2V4QA 2FHJA 4MT1A 2CNNB 2XMUA 2E5IA 1XEZA 4LVOP 3JTPA 1DTTB 1Q8IA 3NOGA 1WF1A 4FP9A 4OI2A 3MR2A 3GIRA 5HP1A 2C2EA 3PRBA 2RKIB 2E5GA 1XMBA 3KUHA 3L7PA 1HQEA 1TKTB 5K14A 1IBLF 2MMYA 4BWJA 2J6SA 1G4CA 3W9HA 1AUDA 2RRNA 4O0NA 5C2CA 1RT4A 3NEKA 1HWKA 3BB5A 1F3VA 1IWAA 4OI1A 5J2NA 2W1BA 1D09B 1X9WA 1N33J 1QY7A 1YRXA 4LF1A 2WONB 4QU6A 2ZHBA 3HZGA 2HG4A 4MIAA 5EWFA 2UVVA 3DLGB 4LF4J 3MXHP 1JWWA 2CJQA 4ICLA 4KV8B 3FBEA 3JYTB 1FNXH 4JI5F 3I5AA 2BW2A 3RB6A 1VQ6S 1RACB 4X4OA 3PIPQ 1IM6A 2DH8A 2D9OA 1HD0A 1ZAXA 3LP0A 1SIZA 3LALA 4K4YA 3PW4A 2QEXS 2KFNA 3T1YF 4LFAJ 3OVSA 4HLBA 3S8SA 1S9GA 2DH7A 3MUMP 3BO4A 2PEHA 1S6UA 3QFWA 3U27A 2I5JB 1G3OA 2GMJA 3CXCR 3ZTOA 2RU3A 3I9ZA 5J2QA 3IGVA 1CS4B 2B8PA 2AZ3A 1H3DA 1X4HA 2Z4PA 3D1QA 4M5JA 5D4OA 3Q0AA 3R3TA 4U6PA 3MI7X 2AJ1A 5DQIA 2VBWA 2WBRA 3BQ1A 2R7SA 1UEKA 4B3RJ 2DISA 4WKRA 1E6VA 4RWWA 1ZZFA 3CMAS 2R2UA 3W64A 5HJXA 4G1PA 4J9NA 2XMJA 4ZLPA 4X4VA 4PG5A 4CNYA 2PMWA 3UO0A 4LF8J 3GCXP 3Q8YA 5H9FJ 3HHLA 4L76A 3I55S 4FDFA 5AJ3F 2G13A 1RABB 3S01A 3KLHB 2UP1A 3TRGA 3HHNB 1BLUA 1SCJB 3LWMA 4JV5J 1F1BB 3T6BA 2HHHJ 1GNKA 1MWZA 2WCXA 1HA1A 3JTOA 2BQUA 1RWMB 2JJ4D 5ETKA 5IM0B 1OY6A 1U1PA 2X1FA 5HVFA 2GHVC 4NZ6A 3MD1A 5KT3A 1T05A 1U6BA 2WOMA 5HQMA 4K4ZA 2KFZA 4ECXA 4JI4F 1RTDB 3ULHA 2QT7A 2LECA 4NLSA 2YKPA 5A8WA 3PFOA 3KJVA 5KG3A 4M5DB 1FDBA 1T9TA 4JP8A 2KG1A 1DTQB 5CCMA 2RQMA 5FDLA 3O5TB 1KBRA 5E33A 2KRBA 2J9DE 4LF2A 5IT9Y 3SCLE 4KH0B 3PW7A 2DGSA 2DNYA 1TKTA 1FERA 1LFPA 1BHNA 5EWGA 3OBIA 2OEKA 1BQXA 1PO6A 2MPUA 2N7CA 2B4VA 3C6TA 3IMQJ 1Y11A 3HFKA 1SJ4P 1CJTA 3RRHA 3SSRA 2BANB 2DRDA 4Q2LA 3HFZB 4WXWA 3IS9B 1TL3A 5GAGI 4USJC 4ZK7M 2XZTB 2YNIA 4Y2KA 4DHVA 4C8OA 2DNPA 1A0OB 1IR1A 1DQAA 1P6TA 3I5BA 2IVYA 3LW5C 3PNIA 2QSWA 4NASA 4E8UA 3OV7A 1B0PA 5EWEA 1NDKA 3DLBA 5I3PA 2DHXA 4NLXA 1S57A 1RWXB 4DFMA 2UZAA 3KTQA 1SC3B 3AD8C 4H54A 2C3YA 2ZUAA 3FCHA 3ITHA 5HAOA 5LXYA 1EIYB 2BBEA 3KOAA 2CFXA 2EKYA 5KFUA 2KKHA 4JI0F 3SCJE 3MEDA 2O67A 5DG9A 3GSIA 4MJKA 5HATA 4A46A 4DFJA 2YKQA 5L9XA 4TLQA 2FGOA 1FNMA 5BXIA 5IQQA 3W65A 3VGUA 1HMVA 3PVXA 4NMXA 1IKYA 2UXCF 1OYDA 1NPKA 2IHR1 4NYZA 5EHHA 4W4MA 1JK9B 3AH6A 3RJMB 5HVGA 3GFZA 4TN2A 3H4BA 3H8YA 3N5BA 4HHJA 3GV5B 4OZ3A 1X0FA 2VV5A 2AGOA 3TOQA 3OTEA 1D9DA 1H2VZ 4I6WA 4G1IA 3GQCA 2ASYA 3DC2A 3FEYB 1WOOA 2I8EA 5D0GA 4X64F 4CQ1A 1R8PA 1YIJS 2KTQA 1VRTB 4DU7A 6FDRA 4BWMA 3I56S 1JJ2R 5HBMB 2EW9A 4DR4F 1LK5A 2BJ8A 3HSDA 2BE2B 3W2VA 1S9GB 4DPTA 5KFMA 1TK5A 4JYAF 5J1NA 3R6GB 4OX6A 3NMRA 2V8PA 1X4BA 2MKYA 1UA1A
chains in the Genus database with same CATH topology
3RRGA 2CQ0A 3LQVA 4RW7B 4ZS6A 4Y6IA 4FF4A 1U4BA 1FCAA 4L3NA 2AYBA 4PR6A 1BGXT 1TK0A 2M52A 3OFEA 3CCWA 1U6FA 3I4PA 3TANA 3M9OB 3MM5A 4PXEA 2LU2A 2PMHA 2HQIA 2UUCF 2LKZA 5A2QY 4X4PA 2B3TB 3KK1B 4Q7AA 2QLWA 3U1MA 1FRXA 4F8RA 4IUFA 1XWLA 4DR5F 4C3MA 4X62F 4XIUA 2D1CA 2YNIB 1VBXA 4DFPA 2MQNA 2YNGA 4EWTA 4DOZA 3KFWX 1S1VB 4TNOA 2E7XA 3UFCX 3X1LB 3IO1A 1U09A 4ED5A 3KNAA 3FZBA 2CYYA 1OSDA 3ZZZA 1ZYQA 2CJKA 1K9MT 2DCLA 1N48A 4NLPA 1REVB 3HJFA 2A1BA 2J9EA 1T8EA 2KFYA 1IQZA 3KLFB 3JSRA 2W25A 2BRKA 1L5UA 4A8SA 2KU7A 3PR5B 4R0JA 4WZMA 1JMTA 2N82B 2LXIA 1YI2S 3G9CA 1H7XA 3UD3P 2RQ4A 2IC3A 2MGZA 3H5UA 1TAUA 4DL5A 2ASJA 2YH0A 1S0OA 2LDIA 4RZRA 1HYSA 5D4PA 3ITHB 5I3UA 3Q2TC 2VASA 4CT8A 1S1XB 4RW8B 2HYIB 3OFHA 3FNNA 3C46A 3H40A 4EFAC 1FKOB 3C8YA 5DQHA 4YR2A 3GIJA 1N36F 2BA9A 2V8DA 2RQCA 3HHEA 1DFDA 2Z8QA 2D3ZA 4RW4B 1UJ4A 4PG8A 5C42A 4Q45A 3K5OA 2QA4S 3RRKA 3DCAA 3N28A 2MB0B 2VONA 4RU9A 2R8KA 1Q7LB 2GFFA 3JSMB 4N5SA 4K4VA 3FRYA 3H2UB 4ZP9A 4LF9F 4ZCKA 3CF5Q 1N0UA 3AB4B 2BR0A 1UAWA 2BQ3A 5DM6Q 2BJDA 1SH0A 1S10A 1QSLA 3EGNA 5H1SV 4N76A 2IVFB 4DEZA 1KQKA 3IR7B 1U8SA 1SV5A 1SKSA 1WEZA 2C2DA 3OQ2A 1GTEA 1HQEB 2P9EA 3CWJA 1W2BR 1X9MA 4B9NA 1DTQA 2ZH8A 3TUJC 2BM0A 2ATLA 5KFRA 4PWUA 3PV8A 2DNOA 4GC6A 2EFQA 3DDKA 2MQLA 4RNHA 3TAPA 2JEGA 2XSJB 1DLOA 2W8KA 3SCKE 1OO0B 2JC0A 3ZZ0A 3WC0A 4XPEA 1Y3KA 2DNQA 4HH1A 2MZQA 3D1OA 4I4BA 4WFAQ 5LMUF 4KGKA 3RBEA 4R5PB 1ZETA 2FJWA 2YNHA 4MMOA 5HMXA 5I42A 4KRWA 4FF2A 1TFWA 5KFOA 2Q6CA 4C8ZA 3T5KA 7FDRA 5DG7A 2C3MA 2FJBB 3CJKA 1HPZB 1L3TA 3AJ1A 2B5JA 2J0XA 1R43A 4W90B 1J5EF 3HX9A 3AY0A 2CQBA 3NP5A 3L09A 3GIIA 1M0SA 1WF0A 2IBOA 1S49A 4YB1P 4QWDA 2U2FA 1G7CB 3ZZYA 3KK3A 2QFJA 1JLQA 1FKOA 1I1GA 1M90T 1Q53A 2CPHA 3LANA 3EX7B 4WYLA 3DXBA 4V19J 3DLKB 1NK0A 1N34F 3BGLA 2VH7A 2V9KA 3TQ1A 3GWCA 2CKWA 2V8GA 2DGXA 4OX7A 2UVUA 4Y3CA 4LF7F 2E1RA 4WFZA 1KFDA 3VAJA 4R5PA 2I2YA 3MR3A 2XI2A 1AROP 4ILLA 2EK1A 5HN0A 5GMKa 2V0NA 1C1BB 2R7UA 5HMZA 5KFTA 5D8HB 5GAGU 2ZJPQ 2CQ2A 5D78A 5AXLA 2VG6B 2RIJA 1HNVB 4OI4A 3EXCX 4K5SA 2ROGA 3PX4A 2JFKA 4C8MA 1LW2B 1ZM3A 2G4BA 3MM5B 4DV6F 4NRTA 3RBDA 1HBNB 1LFWA 3T5LA 4X65F 3V81A 2AJFE 2JDJA 4EO8A 2DCUB 4LSLB 2VG5B 4NZ7A 3UR0A 2KB2A 2OPSA 4J9RA 1HBUB 2FHMA 2CVEA 4IDKA 2UXDF 3VAKA 2M3DA 1U49A 5DQGA 4DV4F 3JAMY 2EPIA 1O5JA 2DHGA 4K2XA 2YH1A 3MM9B 4YY3F 4OJ3A 2HNDB 4CH7A 1JLCA 2LQBA 3IC1A 4MIWA 4Q0BB 1FRIA 4ZPAA 2MDAA 1U24A 1REVA 2HPUA 3NWGA 5CYQB 2VFUA 1IKYB 3CEDA 3CDBA 4RNOA 4WE1A 3PKMA 2MZJA 4CZCA 5A8KB 2LLZA 3N6MA 3VF0B 2LA4A 2WB1D 4C7QA 3OXFA 3TVKA 2GO9A 3VALA 1Y4ZB 5HLFA 1FRMA 1MU2B 3U7JA 3MCSA 3VAMA 1TVRB 2R4FA 4LJMA 4TYAA 4OJGA 1KN6A 2DHSA 4IFYB 4ECVA 3G96A 5KOWA 1RGVA 4X4QA 3OR2A 2EFPA 2FC8A 5B0FA 1FEHA 3AQOA 4EUVA 1YJTA 2HRUA 3EYZA 1VI7A 5E3CA 5CD4H 5JVHQ 2CPXA 1KEKA 2VFTA 2UV8G 1QTMA 4HT5A 2B4PA 3PY8A 1FJCA 3MR5A 1RKIA 2FVSA 2UUAF 4QYRA 3OL7A 4A8QA 5H9EJ 4O4RA 4YOEA 3ZZRA 2BQRA 2CJBA 1R27B 1DHMA 5E5NA 2EWHA 3OL8A 2DNZA 2PDAA 2I1RA 2K3KA 3OR1A 1MMNA 3NNHA 4WU3A 1BQMB 5FJ4A 1WF2A 3JB9k 4NMLA 2IYIA 4M94A 1JLAA 4Y2IA 3HMJG 3PJXA 3UDCA 3RAXA 2E1AA 4O44A 4J9KA 3BQ0A 2FUG9 2VPYB 5GVQA 2RU9A 5KTQA 3MFHA 3MWBA 3VAFA 3T5HA 1J5OA 3DMJB 1FXLA 1LWCA 1RT6B 2HGMA 2JHEA 3MM6A 1URRA 3GV8B 2YY3A 2ZITA 1TKXA 4I1TA 4IYQA 4OZ0A 4KAIA 1L3KA 2XNRA 1FVQA 2MQOA 1OPIA 4C3LA 5HL7Q 4RWXA 3M2VA 4DG1A 4E98A 4K4TA 3RTVA 3E3XA 2UUBF 3CULA 1YHQS 2HVIA 2IC3B 3H98A 3CCZA 2YWHA 2DGWA 2MGZB 5DRKA 1Y5LB 2E44A 1WI8A 4DQPA 4TQRA 2ZVSA 1MU2A 1T02A 4J9SA 1WHXA 4ZHRB 3THPA 1FKPA 1H0HB 1HL6A 3LAKA 2UU9F 1VQPS 1XK8A 3E51A 1LKZA 2PGCA 5KFHA 1NK7A 2IMWP 3CJKB 3U1NA 1PILA 1DQ9A 3IG1B 5KG7A 3MMJA 2KT5A 3BO3A 2B7CB 4XK8C 2XMTA 2BYCA 1T3OA 2GIQA 3M2UB 4RUHA 3SV4A 4OL8A 1Q7YT 1VQ8S 2DVIA 3HVTA 5JXSA 5AE2A 3ICLA 3H2VE 4DLGA 4DQSA 1VMBA 2Q3PA 1S99A 3FSIA 1BY9A 4LVNP 4KIAA 2ZOFA 3SQGA 1EP4B 3N6NA 1XTZA 1SXLA 2QMXA 1M5OC 1X4FA 3MAHA 4IFYA 5G4DA 3CE8A 3ZZUA 4EU0A 1B0TA 4WJBA 1VLYA 4NLRA 3T9ZA 3PIOQ 3HXMA 1FJEB 5D3GA 1IM4A 2CQGA 1DBDA 4CH0S 3BQ2A 1SJFA 2BOPA 1Z1ZA 2ZH6A 2V9WA 4OLOA 3CMES 1TFYA 4PCQA 1FO1A 4X4SA 4B3OB 4O3OA 3LP2B 4Y2AA 3ISZA 3QIPA 4NLOA 5J1PA 2F4VF 4NCGB 1LW0B 3PO4A 3OTCA 4K5RA 3NAHA 1S1XA 1SIWB 1HBOA 3UI3A 4DL2A 5HROB 2M8DB 4N41A 2DNGA 2ZC4A 3CC4S 4NWBA 5I3QA 4TU9A 3VAHA 2GX8A 2O3DA 4ECZA 4DV1F 4DN0A 4ATNA 2I0XA 3CJ0A 3GE9A 2LVWA 5EX3A 1QJHA 2KJVA 4LF8F 3Q8PB 3TARA 1VFJA 3FDSA 2E9ZA 1H6KX 4YB7A 4YEAA 1O51A 4JBCA 1HYSB 4WFXA 2GO8A 3QLHA 2VFSA 4O0IA 3PX0A 1JLQB 3CC7S 2DO0A 1AFIA 1VC6A 1UVMA 4NOHA 2XB2D 2KN4A 2B6AA 1S9FA 1KR4A 3E01A 3UQSA 2PT0A 2IRUA 2NSBA 5EN1A 2OSQA 2C3OA 1C2PA 3MM9A 2ABYA 3PW2A 1OQ6A 2BVZA 5THWA 4Q5VA 1L3UA 4ELVA 4RW6B 4C11A 4RBVA 1TL5A 3N0VA 4KBIA