2J0QD

The crystal structure of the exon junction complex at 3.2 a resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
89
structure length
89
Chain Sequence
b'PQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-DEPENDENT RNA HELICASE DDX48
publication title The Crystal Structure of the Exon Junction Complex Reveals How It Maintains a Stable Grip on Mrna.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 16
structure length 89
sequence length 89
chains with identical sequence G
ec nomenclature
pdb deposition date 2006-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2j0qD00
1JJ2R 1ZH5A 2PE8A 2QA4S 2E5JA 2N3LA 2RU3A 3N9UC 1K73T 1G2EA 2QEXS 3CPWR 2CQ2A 1HA1A 2XS7A 3CMES 1YITS 3VAIA 4W90B 5CXTA 3CCVS 2LA4A 2CPZA 2MSSA 3BO4A 1U1QA 2DGOA 4RU2A 2MXYA 2XNQA 1VC0A 4WFNQ 2AYMA 3CCUS 2M8HA 1VQ4S 2U1AA 3NNAA 3R1HA 1NJIT 2X1AA 3G71S 3CCMS 3CCLS 3UD4P 1DZ5A 2FY1A 1KOOA 1U1KA 3G9CA 1SJ3P 2MZTA 2MZQA 2KRBA 5FJ4A 2KM8C 3VAGA 2DHAA 2L08A 1IQTA 3RW6A 3THPA 3UCZP 2Q79A 1VBXA 4F02A 3UCGA 1UP1A 4IOCQ 5LXYA 3PIPQ 2LQ5A 3THTA 1X4EA 3MUVP 1W2BR 3MOJB 4QU7A 2CPJA 2DNLA 1S72S 3TO8A 1ZZNA 4TU9A 5LXRA 1WG4A 3MURP 2KI2A 4W92B 5LJ3Y 4CIOA 2CQ3A 3BS9A 1K8AT 3SDEB 2VODA 2N82B 2ZJQQ 1DRZA 3MUMP 1K9MT 2FPHX 1KOHA 2M88A 2D9OA 3IRWP 1R8PA 1SJQA 2DNOA 1JJHA 3LPYA 4ZKAA 1JMTA 4QU6A 2DNHA 2QFJA 2HGLA 1UAWA 2XB2D 2CPXA 1M5OC 2M4MA 1KC8T 1Q81T 3VAHA 3G4SS 2MJNA 2E5IA 1Q86T 3CC4S 4LIRA 3S7RA 2DGTA 1DHMA 2M9KA 1R8HA 2ERRA 2DGXA 2CPIA 1YTYA 2K8GA 3BEGB 1X5PA 2DNRA 2I38A 1YJWS 3CCRS 3MD1A 2MB0B 1PO6A 3OW2R 3PIOQ 2HZCA 2OIHA 2KG0A 1VQKS 3NS5A 2DGVA 2KM8B 2KRRA 4CH1A 3HHNB 1WI8A 3Q2SC 1SJ4P 2D3OR 2LXUA 2RT3A 1WEXA 5DETA 2YKAA 1YHQS 1A7GE 1N52B 3ZZYA 5GAGU 5GMKa 2KHCA 4PR6A 1HL6A 2LKZA 3D2WA 2OTJS 3VALA 1X5OA 2MGZB 2LCWA 1WEYA 2MKSA 1VQ5S 3LQVA 4WCEQ 3CCJS 3MD3A 1AUDA 3IWNC 2JVRA 3HI9A 5DDOC 2DGQA 1CVJA 2OSRA 4OZ1A 2RNEA 5IM0B 3VF0B 4U67Q 2KT5A 1RK8A 1VBYA 1VC5A 2DNMA 1WF2A 3SXLA 1H6KX 4C7QA 1PGZA 2L41A 1VQ7S 4M5DB 1VC6A 3CULA 5IFMA 3R27A 3UWTA 5GAHU 3UD3P 1FJCA 2E5HA 1O0PA 1YJNS 5GAEU 4WKRA 2V94A 4CH0S 2DHSA 3UCUP 3US5A 1WHYA 1WF1A 2LYVA 1VQ6S 1X4GA 4WFBQ 1NU4A 2AD9A 2JRSA 2MY8A 1U1OA 2VONA 1WI6A 2OTLS 2EK6A 4WFAQ 3Q2TC 2BOPA 4TLQA 4P6QA 3EX7B 1YI2S 2MY7A 2WBRA 2NZ4A 2DHXA 3U1MA 2X1FA 5LSLA 1WELA 2MZJA 3RW7A 2B0GA 4ED5A 1M5PC 2M0GB 2CQIA 4Z2XA 3TYTA 1H2TZ 1WG5A 2MGZA 2DNYA 3BO2A 1KD1T 5JVGQ 4UY8T 2YH1A 4IOAQ 2CQ4A 2L9WA 2MKCA 2XS2A 3S8SA 3NNHA 2DK2A 1X4HA 4F26A 1RKJA 2K3KA 1YWXA 2FC9A 2DNKA 5IM0A 2AYBA 3L3CA 5LSOA 2YWKA 1X4DA 2CPEA 4QQBA 1OO0B 1P27B 1WEZA 3H2UB 1U2FA 1HD0A 1WHVA 5DDRC 3CXCR 2J8AA 1VQLS 2HGNA 2MKJA 2YTCA 5BJRA 2D9PA 2JWNA 2M70A 3NS6A 3VAJA 2ZJRQ 2DNZA 2DH7A 2E5GA 4TU8A 2NLWA 3JB9k 3CC7S 4QPTA 2DO0A 3CCES 2VOPA 2E44A 2FC8A 2MZSA 3CUNA 4ERDA 5GADU 4C4WA 2RS8A 3BO3A 2MQLA 1YJ9S 3FEYB 2KFYA 1B7FA 2LECA 2DGSA 2EK1A 3CF5Q 3MUTP 3G96A 2DGWA 4FXVA 1WHXA 2F9JA 1F9FA 2ADBA 2DB1A 4OZ0A 2M52A 2CQHA 1FHTA 2MHNA 3DLLQ 1ZZFA 4EGLA 2AYEA 2OSQA 1X0FA 2DNQA 2MKIA 2KYXA 3CMAS 1DBDA 2CPYA 3NNCA 5H1SV 1N88A 3I55S 2HYIB 2CQBA 2DITA 3S6EA 2DNGA 2UP1A 3MI7X 2EVZA 1FT8A 2MZRA 1U6BA 3SDEA 2XSFA 1X5SA 2G4BA 3MDFA 1M90T 2CQCA 4PRFA 3B4DA 1UW4A 3P5TL 2RRBA 2DIUA 4YUDA 1U1LA 3VAMA 3ZZZA 2F9DA 2RQ4A 1VQPS 4IUFA 1OWXA 5HL7Q 3VAFA 3CD6S 2SXLA 2M2BA 1A9NB 1HD1A 1M5VC 2DIVA 1XN9A 5LJ5Y 2JVOA 2RRAA 1VQOS 4YOEA 4WIIA 1SJRA 3P49B 4Y00A 2J0SD 1WHWA 2CQGA 1VBZA 2BZ2A 1QM9A 1N8RT 5ITHA 2XNRA 1VQ9S 2J0QD 2MKKA 3G8SA 2A3JA 1H2VZ 1X5TA 2HVZA 2LA6A 1VQ8S 2MSTA 1FXLA 2ZJPQ 2KH9A 2F3JA 1FJ7A 2KN4A 1X4BA 3UE2A 3MXHP 2AYGA 2G0CA 2O3DA 5D78A 2DO4A 2CQDA 3V4MA 2XS5A 5DM7Q 3CC2S 2KXNB 2DGUA 1WG1A 2YH0A 2ADCA 1M1KT 3K0JA 1FNXH 3J7ZT 2RUGA 1OPIA 2RVJA 1U1RA 3G8TA 2VOOA 1JJ4A 4FXWA 3B4MA 2I2YA 2KU7A 2DH9A 1N54B 2OJ3A 2KXFA 3CCQS 2M8DB 1D8ZA 1UFWA 1U6FA 2N7CA 1P1TA 1U1MA 2DH8A 1SJFA 3SMZA 2MQOA 1Q7YT 3U1LA 2N3OA 1U1PA 2U2FA 1QVGR 1VQNS 2MZ1A 3S01A 1YIJS 2X1BA 1FO1A 3J7YU 4C0OC 1Q82T 2GHPA 2MQNA 5IQQA 3VAKA 1WTBA 2GO9A 1QVFR 1BY9A 1OIAA 2KXHA 5EN1A 3CCSS 2HGMA 2MYFA 4Y0FA 3NMRA 2DISA 4A8XA 4WF9Q 1M5KC 2G1DA 3DXBA 3EGNA 1D9AA 2KVIA 3G6ES 4V19X 1X4CA 1S79A 2DNPA 2KG1A 4F25A 2CJKA 1WF0A 2CPDA 2MQMA 1FJEB 3P6YC 2CPFA 2LXIA 1URNA 4PKDB 4J5OA 4YB1P 5HO4A 3FEXB 1KQSR 5DDPC 5CYJA 5MLCV 2RQCA 1WWHA 5DDQC 2MPUA 4CQ1A 2J76E 3P3DA 3ULHA 2CQ0A 2LMIA 4UQTA 4TU7A 5GVQA 1SXLA 2DHGA 3CTRA 2MQPA 1X4AA 2PEHA 1L3KA 2DNNA 1U1NA 2MMYA 2LEAA 3H2VE 2M7SA 3TP2A 5JVHQ 1NO8A 5CA5A 2CPHA 2MQQA 2MJUA 2LEBA 2RS2A 3EGZA 2MKHA 5D77A 1H2UX 4IO9Q 5DM6Q 2JX2A 2CQ1A 4LJMA 4LMZA 2FHOB 1VQMS 2X1GA 3R1LA 4BS2A 1X4FA 3I56S 2CQPA
chains in the Genus database with same CATH superfamily
3KG0A 4N76A 1QTMA 3I0SA 5U47A 1XR7A 3IBWA 1KR4A 2QEXS 1GTHA 3C66A 3K57A 4DR2J 3CMES 3C6UB 3UDEA 2IC3B 1DAXA 1EB0A 4JP8A 1I94J 3HKZD 4I6WA 1B70B 5IT9U 5A8RA 2OD4A 2MSSA 1G1XA 4MIWA 1S1WB 3BREA 3M30A 4U8YA 4JBCA 3CSKA 2KRBA 2UXBJ 1IQTA 4PG4A 2NUUG 1REVA 2IM3A 4NA2A 1CQMA 2CPJA 1S72S 3KJVA 5K8OA 3CJSA 2EKYA 1JKHA 3GIRA 4LVNP 4ZPTR 2LU2A 1I3OB 2N82B 1XMQJ 5RUBA 1EP4B 4ETXA 1LK5A 1N0VC 1JJHA 2Y3YA 3RRGA 2ZHBA 1SKUB 2FHMA 5D0HA 3PRDA 1Q8BA 2AKWB 1KVIA 1HWKA 1JLGA 2J7WA 3H59A 2H1YA 1RUSA 3HK2A 4JI5J 5ETSA 1AA1B 1SC3B 1UWBA 2KM8B 5HK4A 4M5KA 2B9XA 3LPEA 5A0YA 1TZ0A 5GMKa 4ED7A 4B9LA 4CTAA 3D2WA 4FPRA 1FD2A 1LXNA 1VQ5S 5T7LB 1VRUB 4WTYA 1RA6A 5KTQA 3M2RA 2PFDA 1VC5A 3W5ZA 3J7A1 2CZ4A 1H6KX 3TAMA 5IWAJ 2PT0A 2OPPB 3TUIC 1VQ6S 1XJWB 2AD9A 1TUGB 1YLXA 2OTLS 4NLGA 2ZOMA 3M8ZA 4P6QA 3EX7B 4NRUA 2DR6A 2B0GA 1Y11A 4RR5A 2F63A 2OFHX 4K8RA 5JVGQ 2XS2A 4HYKA 2JEFA 5FDLB 4Y2CA 1DLOB 1YRXA 4MFBB 1HD0A 3SSRA 3IGNA 3ZNUA 1FJGJ 1IQZA 4FF4A 2ZBPA 3UD5A 2XEXA 1F0XA 5HVGA 1FRIA 2CNNB 1FTRA 3N79A 4X4QA 2YX7A 2GFFA 3EM1A 1FK9B 3SIPB 3NNCA 2VC0A 1FD8A 1V3RA 4FF2A 5HROB 2QN6B 5J2QB 1FT8A 1LWCA 4I4BA 2HRUA 2EFNA 3RBXA 4OHYA 4F3QA 4IUFA 4F8RA 2M2BA 1A9NB 3KLVA 2MHEA 4DX6A 2DR5A 1L3VA 2UXDF 2PMHA 2J0SD 2BZ2A 1Q4RA 2XY7A 3QO9A 1R0CB 3A3NB 4DSIA 4BWJA 3BYPA 2PDAA 2IYGA 4ED4A 2HIYA 2W7OA 2XS5A 2CQDA 4Y28C 3CC2S 1FRMA 2KXNB 4ER8A 2IIHA 4DUTA 3ETMA 2RVJA 3G8TA 2I2YA 4YY3J 2M8DB 3PX4A 4DV5F 1U1MA 3SCJE 2GAGC 2AZ1A 1QVGR 5C25B 3AA9A 1ULRA 2QMUB 2GHPA 1WTBA 4NXNF 3B8HA 4ZITA 4CO3A 5EWGA 2H51B 3LAMA 3QIPB 4ZPBA 4QWBA 2OUGA 3VGTA 1F3VA 1FRJA 1KEKA 2DNPA 3B6BA 3MPUB 1YBTA 3OQ2A 3MWBA 3FBEA 1I5OB 4M5IA 4K7QA 4DU8A 4U96A 2NYIA 4O44B 4TKTA 4USWA 3D9BA 4DPYA 4DV1J 4HR2A 4GKKJ 5HATA 4ES2A 3P4UB 4FYVB 1U1NA 1SH3A 2CJXB 4C9DA 2AF6A 1NDPA 4B3TJ 5A6PA 3EPIA 5CABA 1NJXA 4I7FA 3BBCA 2FHOB 5F8IA 3LWMA 1M1GA 3T19A 1YBAA 5GMDA 3ZZ0A 3I32A 3NGSA 1HA1A 2VPZB 3MEEA 1ZS6A 1WORA 4YFUA 4P7TA 4QW9A 3BSNA 5AT1B 2EFVA 4QR1A 3QIDA 1NJIT 3F44A 5A76A 3N28A 5B7WA 5CQGA 1X7VA 2OPRB 3QT7A 4G3IA 2YKMB 3QLHA 4RU9A 3MOJB 2HHTA 1R31A 2G0JA 2QO3A 2E66A 4Q2MA 2W4PA 2VQFJ 5IOLA 4ECYA 2OGUA 3GG0A 3ZNJ1 2ZHAA 2IC3A 3ZZUA 3AA8A 4ZVOB 3BKFA 5KFWA 3TVYA 1Y0HA 1UVMA 1S1WA 3Q22A 4DR1F 2AU0A 2FVCA 2NS1B 2M9KA 2W9AA 4L3KA 1V3ZA 1U25A 1YTYA 2QT7A 2AHOB 4NZ6A 1YJWS 3BGOP 2XLKA 4G1IA 2GC8A 5KT5A 1AZSB 2LEPA 3IAM9 1A7GE 1HKAA 5F41A 1MU2B 3EXCX 3N5FA 4F3MA 4ZVTB 3O2IA 3LQVA 2WVEA 1EP4A 4DCJB 1K1SA 5F3TA 4KSEB 4DZDA 5ETRA 3SZ2A 2VBZA 3PW7A 3EZUA 3ELHA 4U67Q 1VBYA 2XMVA 4QR2A 2R8GA 2VA3A 5GAHU 2VKRA 4QIGA 3G6VA 8RUCA 2AGPA 2OELA 2NPFA 4DX5A 2R2TA 3DHXA 3FCVA 3U1MA 5E3RA 3RW7A 2R2UA 5BR8J 1R6YA 4NEZA 5T7LA 1VRUA 3NG8A 2W9BB 2YKPA 4DV7J 2VB6A 1PIEA 3IM8A 4LFAF 1NSPA 1UZHA 1OO0B 4UUXA 2NSCA 4FKXA 1OY9A 1KQFB 2HW3A 4LFBJ 2D9PA 3CGIA 5SUHA 1T05B 3OSNA 2OPPA 1MN7A 2MTLA 4QPTA 3TVKA 4DPXA 2MZSA 4NA3A 3RUBL 1RBAA 2KFYA 3RRKA 4IG0A 4QIEA 1YRTA 3DRPB 2CQHA 1FHTA 3IN5A 1HI8A 4YR0A 2J9DA 3JQJA 1VBKA 3CMAS 1FE0A 5D0EA 3Q8QB 4MH8A 4IDKB 2C28A 4ATNA 5FDLA 2ZM6J 4PRFA 2V8VA 8ATCB 1DLOA 4F0HA 4MFBA 3MFHA 2O01C 2P6SA 1N8RT 2CWKA 2XYHB 2ZNZA 2HVZA 1VQ8S 4NCBA 3AJ1A 3BDPA 5D78A 1FK9A 1IWGA 4B3MF 3QRQA 1C4CA 5DLGA 3LGHA 2JHEA 1GX6A 1OQ3A 2UUAF 2FB0A 4IH6A 1OPIA 3MCNA 5HROA 1U1RA 3K8WA 5J2QA 3F41A 1UJ4A 3EZ5A 1HHSA 1NHVA 4IRKA 4K0KF 1B64A 2J9DE 4ZPVR 2P9CA 3JXOA 3K58A 2VJUA 2XMAA 4TLRA 3S01A 1YIJS 4DI6A 3J7YU 1VIOA 1OYDA 1S9FA 1OIAA 3GR0A 1WKLA 1LKZA 3H2LA 1S9EB 1L5UA 3PEHA 4QCLA 2HGMA 3KLEA 1S5ZA 1QUVA 2FLPA 1TUWA 3OR2B 2VFUA 3UO0A 1U49A 1WF0A 4IYQA 1NM2A 4PKDB 5KG5A 1D3WA 4WPAA 4O3PA 1WWHA 5DDQC 4UQTA 4X4OA 1XNQJ 5JMNA 4OJHA 1IBMF 2M7SA 5C25A 3R9LA 2CPHA 2F8HA 3C46A 2UZAA 4ZVFA 4PZVA 2YKQA 3Q8VA 4XIUA 3OL9A 2VIHA 3QIPA 2XS7A 2QL7B 2E1MC 1L3UA 2V9WA 4DG1B 1SB6A 1TELA 3N9UC 2V4QA 4N47A 1G2EA 4L6V3 2G13A 1S6PB 4L72B 4MTPA 3M6UA 3KDNA 3PR4A 2E29A 2HZAA 1TKXB 4O44A 4H4KC 1XIQA 1JXVA 3W2VB 4YB5A 3QPIA 4NLPA 2A1BA 3BPSP 3X3UA 2MXYA 2XNQA 4DV4J 3V5RA 3G71S 3FVYA 2RAQA 4WYLA 3MFIA 2MZQA 2HS3A 3UCGA 2D7SA 4RUBA 3W62A 3HSJA 1ZM2A 3H98A 4DSLA 2VJVA 3GJSB 2FJDB 2K06A 1DRZA 2IDEA 2D9OA 1HW9A 2JC0A 4EUVA 3B82A 2QTWA 5FLXU 2BJ3A 3C14B 1FI4A 2OMLA 3NOGA 3HHDA 2Z30B 3DC2A 4DL4A 2I9SA 2C42A 1Q53A 4M5LA 2I38A 3H8YA 4KBIA 2VU5A 2GVZB 1T9WA 3VGSA 2OPRA 4O3OA 5KFTA 1BWEA 2YKMA 1V6HA 4NZ0A 5SZTA 4NL5A 2D3OR 4K5SA 1YHQS 5GAGU 2WCXA 3GV8B 2BJ1A 3SCKE 1L3SA 2MKSA 2VUGA 2WZ1A 4OV6A 2V69A 2DGQA 4OLPA 2B4UA 3K5NA 1HBNB 4ZVUB 2DNMA 1G7CB 4NXMJ 4TY8B 2ZE2B 1P1LA 3M6WA 1A0OB 2LYVA 3CW2C 2CIMA 3D68A 2VONA 1WI6A 4IFYB 1AZSA 3EVOA 3UFCX 2WBRA 3OTDA 2DEIA 1NB7A 4JYAJ 4YHHJ 2BOAA 3H5YA 4U95A 1R6VA 1LW0B 2QL5B 5IV3A 4KR0B 3PX6A 2DK2A 2FC9A 1X4DA 4X2BA 1OSCA 2F40A 4P73A 1Z4UA 2KFZA 2J8AA 2ZC4A 2MKJA 2WVDA 5F9LA 2JWNA 1RADB 3KK2B 3NXZA 3GCXP 1NHUA 1KFDA 3NGDA 3CUNA 2UVRA 2AJ4A 2HURA 3AH6A 4Y2MA 4K5RA 2DGWA 2V67A 3VWSA 4TQRA 4NEYA 4OI2A 4DU7A 1N34J 3O8WA 1X0FA 1D09B 4X4RA 3KKFA 2XMTA 3AB2B 4LSNA 4DR7F 3AD9C 4K2JA 4NLDA 1CC8A 2XSFA 2IM0A 4C8ZA 4CLFA 1R0BG 2DPIA 3WZ0A 1P9QC 2DTJA 4DL2A 5FIIA 3IC1A 4KV8B 3IO1A 3OBIA 4YOEA 2XMWA 4C2MA 1T05A 5AJ3J 1VBZA 5LMUF 5ETTA 2DY1A 2YNFB 3G8SA 2WW8A 4OQJA 4AYBD 4KTQA 4B9MA 3IA0A 2GQQA 4LF7J 1M1KT 3EE3A 3GMGA 1ZM4A 6FD1A 2VOOA 1ZM9A 5LM7E 3RG6A 2IJFA 4B3SF 3J7YI 1MMDA 2ZH2A 1VQNS 1P6TA 2MZ1A 4CLLA 1FO1A 1HI0P 3PX0A 1WC0A 4Y0FA 1PYTA 2AT1B 3SQGB 2RDIA 3BDEA 1S12A 3KG4A 5KAKA 4CYUB 4ZVPB 3PXGa 2J0WA 1O51A 3H40A 2FYXA 1OY6A 5KT7A 1AT1B 3TI0A 4USUA 3M32B 4F0MA 1U2CA 5CA5A 3BSOA 5B0DA 2MKHA 1RDRA 1VS3A 1S9EA 1JLCB 1V5IB 2CQPA 3FZ2A 4YEAA 3OR2A 4B9SA 4M5GA 2M5YA 4UQGA 3Q8RB 3UN2A 3AJ2A 4MKAA 4J90A 3NGUA 1J5EJ 3G2XA 2V2ZA 2OMOA 4FPIA 4X4NA 1NK7A 3TZXA 4K59A 5KOWA 4I56A 5J2PB 2NXEA 4N8OA 6FDRA 1TUVA 3EGVA 3SSQA 2ASLA 4DR4J 3CCLS 2XG8A 2X3DA 4JI2F 4LSLB 2H5EA 4DS4A 3THPA 2XZTB 4DQRA 2NR0A 4HACB 2R9LA 2WSCC 4ELVA 3HHLD 4M5MA 4DG1A 4W92B 3BN4A 1CEZA 1RWPB 3PW5A 3CEDA 3SDEB 1S6PA 4CLWA 4NZ7A 1TKXA 1JMTA 4P7VA 2QLBB 4KGMA 1BWVA 2OEKA 2HHHJ 1UEUA 3W2VA 3FRYA 5KFFA 1XNRJ 2CZVC 1Y5LB 2B8QA 4JI3J 1HQ2A 4DF8A 4EYIB 1PBUA 3PO5A 2CNOB 2RT3A 3T5JA 3JSYA 3PRVA 1DURA 3NS7B 3IWNC 3CJ3A 4ANCA 4NLRA 3QT6A 1DFDA 3C14A 1RT6B 2BYCA 4Y34A 2OI2A 1W25A 3UD3P 4TVAB 4OI1A 2E1RA 3US5A 4EWTA 2YX1A 4Q5VA 1D9DA 3B54A 5HLFB 1U1OA 2Q1LA 3ENAA 5KFKA 4ZMMA 4NMLA 3QT5A 3T1AA 2YQ3A 3FDSA 5ETLA 4HI2A 1N6QB 1LW2B 3PKYA 3ENQA 1HNIB 1HQEB 2I8EA 1H2TZ 1WG5A 3ZZPA 4EBDA 1JX4A 4PYDA 3NGRA 2MKCA 3PY8A 4RPFA 2DY9A 2NQPA 1QSSA 3T1YJ 4IKAA 5KFRA 2EWHA 1HBNA 2Y9HA 5CH7B 1FF2A 4TY8A 2LDIA 1ZOTA 3BN7A 2VFSA 3GIMA 1MWQA 1RHQB 2ZE2A 4DN0A 4A48A 1X9MA 1S6OA 1KTVA 2DO0A 5C2GA 4L73A 4ERDA 3P96A 1TL7B 3Q86A 2RS8A 4IFYA 1P8GA 2UXCJ 1M5SA 4FXVA 2DXDA 2IVFB 1LV5A 3CT9A 4LF4J 3KK3B 3MTJA 4PXDA 1DBDA 3UN5A 3CJ8A 3ZFVA 3DYAB 1LW0A 1XMOJ 4DMZA 3PZPA 2RHSB 4HT5A 1JLEB 2G4BA 3OFEA 2ASJA 2W7AA 3D0GE 3A8IA 4YDXA 4WP3A 4B17A 1UJ5A 3KK2A 5F8NA 4KT0C 1RE1B 5ETMA 3KLHA 2L3MA 1RWWB 2G1HA 4AT1B 1U48A 4B9TA 1FXLA 2HVDA 1Y9OA 1KTQA 4OHZA 3V4MA 1KLMB 2DGUA 3U02A 2BQUA 2MKYA 4J9NA 3DRXA 3HDSA 1JJ4A 4YS2A 4N77A 3Q24A 4JI1F 1HPZA 4EI2A 1UFWA 3QSIA 1SJFA 2N3OA 2WW4A 1RHJB 4LRBA 2JLGA 4RUAA 4OYWA 4LRFA 2GQCA 4KV8A 1JXEA 3CDUA 1Q82T 3SCLE 3M8SA 2MQNA 3ISZA 3HO1A 4OYMA 4X62J 1H7WA 1RT5A 1T3OA 5EN1A 5J2MB 2YNFA 2DISA 3VV2B 2C3MA 1KONA 5L9NA 4C11B 1X4CA 3FBCA 4CNZA 2QV6A 2MQMA 3CCZA 4DWIA 1LWXA 3DNCA 1F9EB 1PAEX 4YB1P 1S77D 5T14A 2C2ZB 3IR6B 3CD7A 4R5PA 1UKUA 3EZOA 1HWLA 4LF9J 3CJKB 3NCPA 1WSVA 2HAFA 3QQCD 4XDCA 5JVHQ 3K59A 5F0UA 3M8QB 3PYDA 3WC2A 1MW7A 1RA7A 5DM6Q 2V4JB 3NAHA 3EJMA 3U1NA 2W7PA 5IXUA 4KHRA 1S7IA 2D1CA 2RJZA 4HTJA 2QLFB 4RUHA 2C2KB 1K73T 2IMWP 2IAJB 3MCOA 3SQGA 2K2PA 3D6MB 1NK0A 2NXNA 3W65A 1EIYB 1RT2B 3C2PA 4CYUA 2C2NA 2QSWA 3BO4A 2UVVA 1BQMB 1B4SA 1WC3A 2QE5A 2U1AA 3IR5B 3KK1B 3R1HA 2AEMA 1WD6A 4F4YA 3OHBA 3QT8A 1SJ3P 2Z56B 5J1EB 2BBEA 3VQSA 1JLCA 3THTA 3DDIA 1JNZB 5H9FJ 3MURP 1WG4A 1B3TA 2E9TA 1XK8A 1T94A 2B7CB 1DY3A 2ZJQQ 2EFOA 1K9MT 5KFLA 3T1HF 1XR6A 1EARA 1HBMB 4LR7A 2GJIA 5BYSA 2Q66A 1TAQA 2HGLA 4PEOA 4ELUA 1AB8A 3J81Y 3R7NB 3FJ2A 2ZBRA 5J2PA 2W2NP 2AGQA 4GKJF 2FHKA 2MJNA 1MMLA 2VDIA 4LIRA 5DZ6A 3ICLA 4DN9A 3I5CA 2WSEC 4ZP9A 2DNRA 4LSLA 3OTCA 4CLZA 2PI5A 4K4SA 4OYAA 1H98A 3LANA 4R25A 1S4EA 3OT9A 3Q2SC 4HACA 1SJ4P 1FNMA 4EMDA 3GPAA 4HLBA 3AT1B 4DV0J 4O3NA 2BE9B 2DBBA 3SCIE 5KFAA 3HI9A 2ILZA 5HBMB 2HBYB 2I5JA 3MMBB 4MK9A 2KT5A 3N6LA 2HMIB 3UVJB 5KT3A 4DF4A 3H25A 2L41A 2B56A 4J91A 2DYAA 1FJCA 4KGKA 1F2GA 2B4PA 1UCNA 4J9MA 1ZPVA 1JLQB 3J80Y 4UF4A 4Y2IA 2O1PA 2WRMA 2KZMA 2UUWA 1X60A 2WVBA 4P72A 4ED5A 1SC4B 3IP0A 3HCXA 1M5PC 2QG9B 4NCGB 2PGCA 4ZA1A 1R27B 5HVFA 3BBBA 4O23A 2AYBA 4ZLJA 5B0CA 3DN9A 1T7PA 3J81j 2ZH8A 3MGJA 4ANEA 2H3EB 3BPDA 2DNZA 2VF3A 1YK9A 3VGVA 2ZUGA 4A8YA 2FC8A 1Q8KA 1YG0A 3A13A 4IFVA 3F73A 1RLCL 5E3PA 3CJTA 2AEJA 2UU9F 3ETOA 1N6QA 1LW2A 2YBVA 2MKIA 1HNIA 1HQEA 3GCWP 4I67A 2HFSA 3KUHA 1S0OA 2DITA 4ITSA 2UP1A 2H48B 1XC9A 3E2EA 1F5BA 2ZH1A 2FTRA 3ILLA 2YY3A 2XC9A 3RR7A 2DXFA 4G1QB 1F3FA 1M5VC 4UOHA 2JJ4D 4CRJA 2CADA 5T41A 2CQGA 5GAEI 4YB6A 2RB7A 2LQ8A 1WC5A 4HH1A 5KFOA 1TL7A 3GFXA 5DG7A 3Q23A 3SV3A 2KH9A 4A8WA 2G0CA 2A6MA 2HRTA 3KK3A 5KFHA 2ADCA 3BGFA 1MROB 1FRHA 3DYAA 1AXQA 1JLEA 5CZXA 1UTAA 2DH9A 2XBPA 1N56A 2OJ3A 1D8ZA 2MQOA 5IWAF 1Y10A 1QUPA 1T95A 4PG5A 3MCMA 2RU9A 2QYGA 5EX3A 4PG6A 3LP1B 3KJFB 4WF9Q 2HS0A 2CG4A 4Q44A 3I87A 5G4DA 1N36J 1KLMA 2D3ZA 3KMQA 2AV5A 2ZH4A 1NKBA 2Y1JA 5DDPC 3QNWB 3DGPA 3ZTPA 2J76E 4USVA 1HR0F 5K8MA 5HJYA 4TU7A 2DHGA 3CTRA 3H2VE 2C2MB 2NSBA 1VI7A 3MEDB 5B0GA 4YR3A 1TKZB 3V81B 2LEBA 4LF6J 2F4VJ 1IXKA 3J7AN 1RWMB 4F67A 1JJ2R 3D66A 2KFNA 4ED3A 3PHTA 4C11A 4V19J 2XSJB 5EGYA 4EO6A 4GMKA 1K0VA 2V8PA 4JV5F 4TNOA 4DV6J 1UFKA 3K2YA 3CDAA 4NI2B 2QYCA 5CXTA 1FXDA 1HNVA 1KHVA 3H5SA 2B7BB 2W4DA 4PXCA 3I9V9 3PG9A 1GXTA 3CJKA 1OQ6A 1BXNA 4NLXA 4RW7B 2BE2B 3NNAA 3JYTB 1HBOB 3M8QA 1RSCA 2EXUA 3BF4A 5AE3A 4PUOB 2V4JA 2GW8A 4ZCIA 2KDOA 5K8NA 4QU7A 2IYIA 1BUXA 2BR0A 3L7OA 4HKQA 3GJRB 3QJJA 3DDNA 1K8AT 5G0RB 1HHQA 2Q6BA 4YY3F 4PAAA 1RT2A 1PYOB 2DNHA 2QFJA 1V3SA 1BQMA 2CKWA 1UVKA 2ZITA 3KK1A 4OX8A 3M05A 2DGXA 4OHWA 1MN9A 3GZ7A 3N5BA 3AOCA 2YX4A 4Q0BB 4KB7A 2IM1A 5J1EA 3D0IE 5IT0A 3WIVA 2P2CB 4YR2A 2XMMA 1B0TA 4KH1B 5CCMA 3M8WA 1N52B 1RKIA 3EVWA 3GIKA 1FDDA 1X5OA 2EC2A 3FCWA 2XYPB 3VTIA 4TN2A 1HBMA 3QRPA 2RKIB 2OLWA 2HFNA 3R7SB 4U7UD 1YJTA 1IBCB 3AY0A 5CAAA 4M5DB 4PWUA 4WP9A 1FRXA 1BQNB 4X66F 2BOPA 4OJ1A 4MJKA 1X8DA 5K5MA 4O4RA 2HHXA 5JXSA 3TZYA 2IRXA 4L74A 5KFMA 2E7WA 2JC1A 1T9VA 5L38A 4HHJA 1RQ0A 1AYEA 2L9WA 4KGXB 9ATCB 1ZAWA 5HBMA 4MMOA 4DCOB 4F4XA 3MMBA 3UVJA 3OLBA 2VA2A 3IFEA 2VPYB 2HGNA 2R7RA 1WTFA 4I1TA 3WHIA 2CFXA 1JLQA 2ZZTA 1EKSA 1IJEB 4J9VA 3CF5Q 3OTEA 4NLQA 2ADBA 2W8KA 2DB1A 1RCXB 2UXDJ 4OZ0A 2VQFF 4Y65A 1S48A 1HIYA 2L9DA 5A8RB 2DNQA 1VHIA 3VCDA 1ZAVA 3ZZOA 4NCGA 3DU5A 5K20B 1QY7A 1UWAA 3D4JA 3CD0A 1HFEL 4DV2F 2RRBA 2BJEA 4YP3A 4CO0A 1K44A 2RRAA 2GMJA 5KFQA 4DV5J 4NLWA 2HWIA 2HNZB 3PW2A 2VG5B 3HFZB 2AWZA 4N8NA 1TVRA 3Q8PB 2PIIA 3ZTRA 1H2VZ 1SV5A 1R0AB 4I6AA 3KUGA 4NXNJ 4OX9F 1HNZF 4PQAA 2AYGA 2O3DA 4LR8A 5BYQA 5HJXA 4QYZJ 5KFNA 3K0JA 3H7HB 4U8VA 4ZVEA 4WBFA 3V6HA 1HNXF 3LGNA 3B78A 1N54B 4M5JA 5KFVA 4DR5J 4FP9A 2E1AA 1PJ5A 3ILIA 2BE7D 3NBPB 1R43A 3GG1A 2EG1A 4G1QA 3M8RA 1HQUA 4MYUA 4P10A 2E7XA 5IQQA 4Q43A 3TA0A 4HVZA 4CO5A 1C1CB 4XPEA 4RW6B 1WOPA 4NLOA 1ZA1B 1EAYC 3KLFB 5I4MA 5HO4A 4NYZA 4J9OA 4DFJA 2F65A 1RTHB 1OJ4A 1IKYB 4WU3A 2V8DA 1WC4A 3L4BC 2F8MA 3BGLA 2VKZG 3MM7B 2OPQB 2AX0A 2MMYA 2IBKA 1HYSB 3JSBA 1RYRA 3NGKA 1RWUA 1RTIB 4ZP6A 2CQ1A 4LJMA 4LMZA 3LP1A 2IM2A 2HKEA 5D6GA 2N3LA 2W24A 4OZ3A 1HWUA 2G2ZA 1T11A 1FKAF 3PFOA 1RABB 4QWCA 2ZEJA 5E2QA 4ZVSB 3T41A 1S0NA 3CMQA 4WFNQ 4I2PB 3MEDA 2J0XA 4FZVA 1FEHA 4D3GA 1DZ5A 3M8PB 3V81A 3AQPA 1UETA 2FY1A 1FWLA 2DHAA 2L08A 4M63A 3O44A 1FKOB 2A0FB 4DR1J 4DUZF 2G9OA 1LOUA 4CWBA 2Y1IA 2DNLA 3EXYA 2XSJA 3W9IA 2CQ3A 4X4VA 3WBZA 1DARA 2M88A 1K1QA 2VBWA 1NDLA 3PW4A 4WK1A 5HQ8A 2R8KA 2CPXA 4JI8F 2B6AB 1M5OC 1N5SA 3KNAA 2DR8A 4KH0B 2XCPA 3HM9A 3CC4S 4RW7A 3RAXA 2BE2A 1R8HA 3JYTA 2BJ7A 1SC6A 4LQ3A 4PUOA 3RBDA 2B51A 5AE1A 4ED6A 2GCFA 3CNQP 1GH8A 2XMKA 1FRKA 4PR6A 2WHOA 5DRKA 5G0RA 1HNWF 3G86A 4WCEQ 2JEIA 2JOQA 3C3LA 3A3PB 2XZDB 2A2CA 2C1EB 1RAFB 1OYEA 3G82A 5DS7A 1YJNS 4LFAJ 2QFIA 4DPOA 5A2QY 1NU4A 2FVRA 4Q0BA 1Q79A 4KJIA 1YZ7A 2G0IA 5E0OA 2XM3A 5M2RA 3OXLA 3QSYB 2E9RX 2DHXA 3W64A 4JUZA 1VJWA 3W63A 3UPFA 4CCHA 1UVIA 5L9XA 1KD1T 4A46A 1S10A 2KO1A 5CYQB 3NNHA 1F60B 1X4HA 2ALZA 1BHNA 4HEA9 2RKIA 5KFZA 2B8PA 4QQBA 2HLUA 1UEVA 1U09A 4Q8EA 4WXWA 1K47A 2W2MP 4M5DA 3LA0A 2XYGB 4DSFA 3OD2A 3CCES 4EEYA 1BQNA 1TL4A 3BO3A 3DGVA 1WDTA 3TZZA 4BDPA 2XMJA 4AE5A 3MM6B 3DU6A 2PEBA 1FX4A 3OTOF 3U7JA 3S6EA 2DNGA 3X1LB 4G65A 4USKA 1RAIB 4B3MJ 2W01A 3P5TL 1UW9A 4YUDA 2UUAJ 2JNJA 4DL7A 2F9DA 5HL7Q 2HIQA 1HD1A 1BLUA 5I3UA 5BXIA 4WIIA 3P49B 4Y00A 4C3LA 4K0KJ 1PJ6A 3OSPA 4LF5F 2D69A 4JV0A 2OKQA 4IQXA 2GIQA 4H4OB 2RHQB 3DLJA 3NEKA 2ZJPQ 4KPYA 5M2PA 4MIAA 4FBTA 3TEHB 2RF2B 1QAXA 5D4NA 2RUGA 2CA9A 3FGVA 3BR8A 3H90A 3K5LA 1FNOA 1U6FA 2ZD1B 1S4FA 4KHMA 2CDRB 4KAIA 5DO2A 4DQIA 2AZ3A 3FNNA 2UV8G 2Z58B 3IR7B 4HH0A 3DRYA 1UMJA 5F8JA 2HNZA 2JZ5A 1IBMJ 2FZCB 2VG5A 1N33F 1MLAA 3BGRA 1R0AA 2XULA 4EBEA 3FBBA 5ETOA 2CPDA 2VHGA 3R3TA 2CPFA 2CJQA 1URNA 3GLJA 1YKWA 5J1NA 1RBOB 2BANB 1RWOB 2HNYB 1BGXT 2C3YA 3GYNA 2KHDA 2C2OB 3LP2B 3TQEA 3ZC4A 3GWCA 4LIWA 1L3KA 3NBPA 4YDDB 1O6XA 3OHAA 3K89A 2IPOB 2BKNA 2MJUA 4OYOA 2RS2A 2LFVA 4RLEA 4IO9Q 1REGX 1H3DA 2B43A 2XI2A 1WOOA 2X1GA 5KT4A 1C1CA 2JLEA 4RW6A 2E5JA 3GB0A 3TW0A 2Z2LA 4EZ6A 4RNFA 1QJHA 4Q2LA 1U4BA 1J5OA 3O3LA 3KLFA 4W90B 3BM7A 1RTHA 1IKYA 2Z8QA 4ZPCA 5HQLA 3R2CJ 3MM7A 2OPQA 4E2FB 4P52A 4F0KA 2AYMA 2VL1A 1RU1A 1HYSA 5AJ3F 1WNEA 3UD4P 2GJFA 4MKVA 1KOOA 4IG0B 1NZAA 1RTIA 2MZTA 3QAEA 2E5LF 1WC6A 1VBXA 5LXYA 3NP5A 2B3TB 4FN5A 5C2CA 3H4BA 3BJYA 1ZZNA 5LXRA 4P2XA 1RI7A 4USMA 4A8OA 4JI0F 3M9OB 2VQEF 2BX6A 1UA1A 3K8VA 5KOXA 1SJQA 3PFEA 4OZ5A 2DVIA 4K4VA 2NXJA 3MPWA 3ONQA 5D3GB 1RCOB 1Q86T 4I2PA 2DGTA 1XEZA 2CPIA 3M8PA 3CCTA 4GO7X 3TEGA 2FIUA 1B99A 4C3KA 1FKOA 5HSPA 4ZS6A 1CBKA 4V1Ak 5CD4H 1U47A 2QMWA 4B3RJ 3W61A 3W5XA 1V5VA 2XWYA 4A8FA 1EJ7L 4DXLA 1PG5B 3MAAB 5F3ZA 4OZJA 3POTB 3MR6A 5IZHA 2AGOA 4C8MA 3TAPA 2RQKA 2P8IA 4EK2A 2B6AA 4CO2A 4H4KA 3R7BB 2LQJA 2FLOA 1AUSL 4C7QA 1RXOB 1GMWA 2OEJA 3CIMA 4F7VA 2MLYA 2DR9A 2WB4A 4C98A 3UWTA 3KLEB 3LO3A 4ED2A 2ZKTA 3R97A 2MY8A 1LNQA 4X4SA 4ZDNA 4I69A 2MY7A 2ZBQA 4Y6IA 2AEFA 1VRTB 1BE4A 3N6NA 4IH5A 3ZTOA 4O3QA 4XK8C 4GVBB 1RAOA 3K7RA 3FSYA 3R5DA 2FJAB 5K14B 3SFGA 1Q5YA 3QWPA 2RD5C 4X84A 4TY9A 4CLYA 4P2SA 2CUYA 4DR7J 3W7BA 2UVUA 3H4DA 2HZVA 2VBYA 4RL1A 3QGHA 2EK1A 2WSFC 2V34A 1HBUA 1VLOA 4CP5A 2M52A 4IOBA 3NCQA 5LMUJ 5CYQA 3DLBA 3MI7X 4LFCF 3RRHA 4OI4A 1FVSA 1UW4A 3IMQJ 4C48A 1HW8A 1IR0A 1R7IA 4M95A 1Q7LB 2XI3A 3R5JB 4B3SJ 1TP7A 2ZH6A 4F4ZA 2V63A 1F1BB 2A3JA 2EBGA 4OJ3A 1KDNA 3PJXA 3T3FA 2GJ2A 4NCAA 5DG9A 2Y8WA 2ZWOA 1SPBP 5DM7Q 4OIXA 2YH0A 3MM6A 2NPIA 1VMBA 2GZOA 4ZCLA 4X4TA 1KBRA 2HSEB 4QWAA 2V2VA 1P1TA 3M2VA 3CIZA 1NNDA 1FX2A 3UW1A 5A8KA 4DPUA 1RISA 4AXIA 1ZA2B 2XGQA 3GTYX 2DT9A 4C0OC 3RYLA 3DI6B 3P5BP 1U02A 3VZIA 2UVWA 2Y0BB 3L7UA 2ATLA 4QYRA 3NAIA 2Y8YA 3DLHA 4H4OA 1FA0A 1M5KC 5L1KA 2HVHA 1D9AA 4MT1A 1XR5A 1NMEB 4F25A 1PCAA 2RF2A 3PKMA 3HF5A 1PJ7A 3O1LA 4B9VA 2UUCF 3HHLC 1LQ9A 1RTDB 4DJBA 4KRWA 1GMUA 3HVWA 2APOA 3TVZA 3T1YF 2MPUA 4L76A 2RH3A 4RUCA 3F0NA 2YVSA 1PC4A 2ZD1A 3PACA 2FJVA 3LF0A 2IRYA 3TP2A 2DCLA 5KG4A 1R89A 2Y1RI 1PYSB 1SH0A 1KVJA 2Z2YB 3EGZA 2COLA 4AL5A 1KN6A 5IC6B 3L7PA 4ELTA 5EDWA 4LF4F 1LFPA 4JI2J 2R7QA 2EFPA 5E3CA 3CPWR 3ISND 2CQ2A 2Z2ZA 3A1YG 3BSAA 3FEZA 1KQGB 3J81U 2BANA 3NLCA 2HNYA 4CO1A 2BABA 2IDLA 3DOLB 3LP2A 3NOCA 4WYWA 1WSRA 1S6QB 2FLNA 4DL0C 1GT8A 4HDGA 2V8GA 3KUEA 1N48A 3KHRA 4CM2A 2W2OP 3UCZP 2IJNA 2YNIB 3D7SB 1SQGA 1U26A 3QGGA 3G87A 4EZ9A 1UA0A 3N6MA 4USTA 4JI4F 3TO8A 1H74A 4LSNB 3H0PA 4OX6A 3HPOA 5F8HA 1FEEA 3GIIA 4URQU 5EWFA 3UNGC 4KC5A 5IC4B 2YXLA 2CDQA 2DNOA 3CJRA 4DR3F 1GMVA 3FMWA 3V2UC 2FHJA 1B0PA 3TUZC 1JLAB 1TK8A 3J80U 3PV8A 2BACA 1RTJB 3HXMA 3HKWA 4MKBA 4KIAA 2A6OA 3BZQA 4K4XA 5B0FA 1N32F 1Q0NA 1UVJA 4ZIWA 2E9ZA 2AQ4A 3PTWA 4ILLA 6AT1B 3ENVA 4B02A 1RB0A 1GK8A 2OTJS 1OY8A 1HARA 2H9ZA 1Z2LA 2VFVA 2GGPB 3MD3A 2QRRA 3HJVA 5DDOC 4WFYA 3TJAA 2XCAA 4G6VB 4Z7YA 4RW4B 4DV3F 3M7VA 5D3GA 3KHHA 1NH8A 3CULA 1O0PA 1Q8IA 4OL8A 2XHWA 4WFBQ 2JSXA 2V0NA 2LVWA 4WFAQ 2R8JA 5F0WA 2HQDA 3IG1A 1SIWB 2V50A 3UR0A 3A12A 3MAAA 1VK8A 5KT2A 2BKOA 4IOAQ 3S8SA 1NK6A 3POTA 5D8HB 2BM1A 3RZAA 4DQQA 3TWZA 4LRDA 2YWKA 2CPEA 4OFZA 1P27B 1JJCB 1IKVB 3H5XA 5BJRA 5CHCB 2H65B 1NJWA 2R8HA 4BWMA 2G2YA 5H9FK 3IWXA 4J37A 2MQLA 3MUTP 3M9MB 3DLEB 3DLLQ 5AXKA 1VRTA 1F5CA 3FQKA 5C5JA 4DEZA 3CDBA 4LT6A 2BM0A 4GVBA 4M5HA 3KOAA 4JI7F 5K14A 4HHUA 1DJ0A 3B4DA 3W9HA 1QE1B 4J9KA 3VAFA 3OLAA 4DHVA 3RB4A 2JVOA 3BR9A 3CVKA 1NCLA 1QAJA 1QM9A 4I64A 3QBCA 4B3OB 3GQCA 5DGBA 3CJ2A 2KN4A 3C6TB 2DO4A 5KFEA 5DJBA 2K7JA 1E6YB 2YWGA 4DL3A 4PWDA 4WKYA 4L3NA 3UI3A 3TUJC 3B4MA 3E51A 1QTNB 2J7UA 3O5TB 2JEJA 4Y2KA 2N7CA 4O4GB 1S7HA 1IN0A 4X64J 3MTKA 2BW2A 1QVFR 3ITHB 3MM8B 2HWHA 3I5BA 3GSDA 2MYFA 3TX0A 3HHEA 1NEEA 4K4YA 4R8UB 3GJQB 3PRBA 4ECSA 1NPPA 5KG2A 3P6YC 4HHHA 1F2HA 3CJQA 2DPJA 1Q78A 2H4YB 5MLCV 3P3DA 3LUYA 2WBMA 3T9NA 1RWXB 1X9SA 3M6VA 2OFGX 4DBQA 4ECTA 5KFUA 3V6JA 1Z2ZA 4CZCA 1NO8A 3OXFA 3AOAA 3DI6A 2V68A 3OJSA 2JX2A 3R2DJ 1VQMS 1X4FA 4EO8A 3JTNA 3OL6A 5M2UA 1WOSA 2RMLA 4I68A 3BH6B 2ASYA 4QWEA 1GTEA 1RTDA 1RBLA 2KT2A 2YWWA 2H5JB 3HX9A 2MQ8A 4WXOA 3TA2A 2PN6A 4NX9A 3A8JA 4IR9A 2YNGA 3TQ1A 2J6TA 3RBZA 3T1HJ 2JEGA 2BDPA 5AXMA 2X1AA 4CLSA 3HJFA 4ILMA 3KLIA 3AB4B 2Q79A 4GKJJ 1NJZA 1X4EA 3MECB 1CLFA 1SBRA 2AJ1A 1RHKB 4MK7A 1SIZA 4CIOA 2EKNA 4JV2A 4QBUA 2XGPA 3IGVA 3OR1A 2YPYA 4HTIA 1OSDA 5LMNF 2CVEA 3HT0A 2P9EA 2EBEA 3E8OA 5ETNA 1SKSA 4UOGA 2QLXA 3DOLA 1S6QA 4NYOA 3W1YC 2VPXB 3VAHA 2BJ9A 1FE4A 3KLHB 3BKUA 2NREA 4A8SA 2IHR1 5DGAA 2HVIA 3OUYB 3OW2R 1VQKS 2ILYA 1NXIA 1KQKA 2YNIA 2BMBA 1N36F 1WEXA 4FNHA 2XHCA 3U27A 1YJRA 2GAHC 1DQ8A 1HPZB 2WONB 1T9YA 3LH2S 1RT3B 3HVRA 4X65F 5MAOA 1S57A 5H9EJ 1G6BA 3TOQA 2W2PP 1RK8A 2WVFA 1FDNA 3I82A 3EDQB 4ZP8A 1PGZA 1T9UA 3VZHA 1JLAA 2MLXA 1RT5B 4FYDA 4OYZA 5IFMA 4LF6F 1RTJA 4FYWB 2F4VF 4RO0A 4CH0S 1U6ZA 2C3OA 2L9NA 3TNVA 2MLZA 3IBFB 5HMWA 2R7SA 2I1RA 1NJYA 4H4MB 4YMEA 3V6KA 1VJQA 2NZ4A 3HD2A 2X1FA 4R5PB 4DV6F 3RB0A 1HHTP 4PXBA 2CJBA 2GGPA 4NYPA 2UU9J 1FVQA 1DTTB 3WQPA 3L3CA 3OVBA 3PNIA 2C22A 2JH3A 4RW4A 2K7KA 1WEZA 4JOUA 4A47A 2Z57B 2ZBCA 2M70A 1RAGB 5JJBA 1RT1B 1GQEA 3VAJA 4OYPA 4P9SA 3D6HB 2VICA 1NPKA 1SKWA 2VOPA 2FZGB 1UVNA 4C4WA 5HMZA 1Q16B 3KMSA 1R8BA 1F9FA 3RB3A 3SQOP 2GMLA 3RU0A 1N88A 1D8YA 2ABYA 2VZ9A 2NUHA 1X5SA 2QGFB 1R8CA 4OZNA 1VRQC 2B4VA 1QAIA 5KFIA 3W66A 1XERA 1Y3KA 4DSJA 1U1LA 1IKVA 1IKXB 3ET6B 5B09A 2VG6B 2BVZA 1IM4A 3C16B 1VIXA 3MAHA 4FVCA 5D4OA 5A8WB 3JAMY 3THVA 3DLEA 2F3JA 4AQYF 3MXHP 4WE1A 4I2QB 3R6LB 3D1HA 1SQEA 2VPWB 2IVMA 1NBEB 1FXRA 3EDRB 4B9UA 1JLFB 2J6SA 3TRGA 4LF2A 2E1CA 2UUBF 1QE1A 3P8BB 3V6DB 5AE2A 2HQ3A 3DOMB 4M94A 4ICLA 1HR0J 1CJKB 1ZYQA 3DRSB 1X31C 4U7UK 2BW7A 4F4AA 4I6YA 4B3OA 3DXBA 3EGNA 3LW5C 5C7PA 4V19X 1S79A 2E1PA 4RNMA 4DFMA 3C6TA 4ZVQB 1XWLA 2LXIA 2LDYA 1E6YA 1TKTA 2V6AA 4J5OA 2I5JB 5E41A 1JQGA 2QIFA 3FCHA 2C3PA 4CQ1A 3UDLA 4JV5J 4ZCKA 4O4GA 2DNNA 5HANA 3W60A 3MMAB 1SL2A 4LVOP 5AXLA 3ITHA 3MM8A 1H2UX 3OJUA 1FDBA 5LL6d 2W1BA 4NA1A 5LOQA 1C0UB 5L39A 2QJ3A 2RIJA 2QA4S 1PBAA 4R8UA 4X4UA 1NAQA 2B9EA 2W25A 4WFZA 1HMVB 1T9TA 4CLPA 1NRKA 4BHQA 3VAIA 3M1VB 4WIQA 2YPZA 1FERA 2LA4A 1G3OA 1KFSA 1U1QA 2DGOA 2ZDPA 3T5HA 4LBIA 4CLTA 3CJ5A 4IFVB 3LP0B 1WC1A 5ETKA 1U1KA 3TUPA 3WX4A 3KTQA 1Q1KA 4OYXA 1GEHA 3OPKA 1T3NA 4IOCQ 5DQHA 3AFGA 4QYZK 4XO0A 2ACMA 2AIRB 1V9OA 2VG7B 2CNKB 2VFRA 1KOHA 2HQFA 2KYZA 1VQYA 3GV5B 4DR5F 3R6GB 3MM5B 1IKWB 1H0HB 5D4LA 4N56A 1U8SA 4CT9A 4NLYA 4DL5A 4OHXA 4LF8F 4I0WA 3H20A 5A2QU 3H5UA 2XLIA 2ERRA 4LR9A 4PPZA 1X5PA 4NLVA 1RT7A 2HHPA 3MD1A 3CB4A 3TR5A 3KXDA 1O8BA 2O5DA 2OIHA 2KG0A 3W8GA 4CH1A 1JXLA 4MIBA 4KHPF 3MECA 3ZZYA 1VYAA 3GFZA 4C8KA 4IO1A 2IFXA 4DQSA 3QGPA 2OD6A 2LCWA 4X66J 1IBKF 2WTFA 3CCJS 2I6WA 2UV8A 2J7KA 1CVJA 4NLSA 3QRRA 2XO7A 4H54A 3QWUA 3WC0A 3BB5A 4F36A 4HT7A 4U7CA 2VDHA 4DCPB 3T5KA 1ZBTA 3FZBA 5GAEU 2R7UA 2DHSA 5DQIA 1WF1A 3OUYA 1PKUA 4ECUA 1QAYA 4PQUB 4XAKA 1Q8LA 1SUQB 3DMJB 3BQ0A 1YI2S 3NWGA 4BC9A 4XDDA 5D0GA 2HFUA 3QJPA 3CDEA 4UY85 4EU0A 1YDLA 3DGPB 2WONA 3OTBA 3BO2A 4HL9A 1RT3A 4WZMA 1F5AA 3HVTB 5ETVA 5LSOA 3C6UA 2D3O1 3H2UB 1U2FA 3LOUA 2PI4A 4ES3A 4ZN3A 4F3OA 1YGYA 4DV2J 1NK9A 3M2UB 4QWDA 3CC7S 3P45B 1DQ9A 4IQMA 4H4MA 1FESA 4DZ6A 2LQ9A 4GC6A 4ZPAA 3PJ9A 1ZZFA 1HNVB 2VASA 1UZDA 4CLUA 1WACA 2HYIB 1T8EA 5DQGA 2ZZMA 1S99A 3CCWA 2EVZA 4OX9J 1HNZJ 2G2OA 3LALA 1RAAB 1DTTA 4FS1A 3OFHA 4LF1A 4Z7CA 1EZZB 4ZOSA 3QZ8A 1HNXJ 2DCUB 1XN9A 4P74A 1RT1A 3KHLA 1RGVA 3MR2A 5KFGA 2J5AA 3L09A 2O67A 4WZQA 1X5TA 2LA6A 4MYTA 1S76D 2EI5A 1KSPA 3ZXWA 4LRCA 4CNYA 1N5VA 2KXFA 1NSQA 3CCQS 4C3MA 1F6TA 3U1LA 4U9RA 2PD1A 2VH7A 2B9YA 1RT4B 1EQ0A 1IKXA 3ET6A 3DCAA 3DM2B 5B0EA 2VG6A 3C15B 3C16A 3PDNA 1H38A 2X3GA 2ZH3A 5A8WA 4ZJOA 1N4LA 1T03B 3IS9B 3FK4A 5IQ6A 2KG1A 4ZHRB 4I2QA 4O0IA 1IBLF 4BCAA 4JI6F 1JLFA 2HFVA 5B08A 2LQBA 4DUYF 2IJRA 5I42B 1FDAA 3GP9A 3V6DA 1M1HA 3DOMA 4BLGA 1CJKA 3DRSA 2BRKA 2A2DA 3FRZA 1Q95G 3UQSA 1SL0A 3PHEA 4A4JA 5F8GA 2R7VA 4DUZJ 2AX1A 2AP6A 2CPZA 3AODA 3RBEA 2W8LA 3QGIA 3BBFA 4R0EA 2HK2A 4DR6F 3MMAA 5KFXA 3CCUS 4EYHB 2P9GA 3HSDA 3CCMS 1CSJA 2DEJA 4JI8J 4ZPDA 2CNLB 4DR2F 4UTGA 1Y3JA 4XPCA 3HZGA 3KDOA 5L1IA 3PIPQ 1C0UA 2LQ5A 4PPDA 4HDHA 1I94F 3IXQA 1NKEA 4C8YA 2OHDA 1NUEA 5LJ3Y 3BS9A 5F9NA 1HMVA 4N7TA 3IRWP 3M1VA 1TL5A 3LPYA 4AXJA 2OEMA 3SEOA 1W7WA 2H5IB 1UAWA 4OYBA 2UXBF 3M6XA 1HNWJ 5C24B 2E5IA 1XQIA 1TVRB 4P2FA 2VV5A 3LP0A 1SV5B 1YSJA 3Q8SB 2QA2A 2MB0B 2BJDA 3CD5A 3NS5A 2DGVA 1XMQF 1YQHA 3HHNB 5KFPA 1KVKA 1SVDA 2LXUA 4L75A 1MWZA 5DETA 1OMSA 4OJGA 3T6BA 4NASA 2LKZA 5L1JA 1AW0A 2VG7A 1R3NA 2QZ8A 3DDKA 4OZ1A 3GFYA 2RNEA 1ZAXA 4ID8A 2CWXA 4JI5F 2XTJP 1HQUB 4F2SA 3MM5A 1IKWA 3R5CA 1M0SA 3C8YA 2ZH5A 2HQCA 3R27A 2HWTA 3W2WB 2E5HA 5HP1B 3UCUP 3SI8A 2KJVA 2AJFE 1XBWA 2GQ2A 3GILA 2EK6A 2HHWA 5J1PA 4W4MA 1ACMB 2FD2A 2N4DA 1IJFB 3D5MA 4Z2XA 3CO9A 3KWMA 4UY8T 3TA1A 1MWYA 1IWAA 3UDCA 1RKJA 1NSKL 2DNKA 4KPCA 1LFWA 3OTOJ 1WHVA 2DJWA 2YTCA 2AW0A 4ZLNA 3CO0P 1NDCA 3T6JA 4URSA 4C8OA 3CDWA 4TU8A 3EWGA 1SQFA 2GHWA 4WJBA 4EBCA 4P71A 5HQMA 3OV7A 4PQUA 2ASDA 3FEYB 1RWVB 1SUQA 3DMJA 2EPIA 2F9JA 4S0MA 1VHFA 3L9ZA 2MHNA 3NCRA 2ZZNA 4LF5J 2B9WA 2ACYA 2KYXA 5KFYA 3I55S 2FY8A 4LRAA 4ECRA 1FJGF 4QW8A 1OS5A 4EFAC 4UOCA 3HVTA 2GS8A 2FVPA 3VAMA 5EUHA 4J9LA 2SXLA 4FVMA 1NSAA 3D67A 5LJ5Y 4OV1A 5GAHI 1SJRA 2WK4A 2XQCA 3M8YA 3M2UA 2XNRA 1VQ9S 1PILA 4C6AA 1B7YB 2WB1D 3HHKA 3OL7A 4B3RF 1U45A 1FJ7A 2C3UA 2R42A 4F04B 3J7Z5 4C8NA 1N33J 1MU2A 1VGYA 2GNKA 2KU7A 1Y00A 2CJYB 1RZMA 1Q7YT 1DTQB 9RUBA 5D0RA 5AXNA 5J2NB 3PEJA 5DG8A 1IVZA 4IG3B 3FBFA 2X1BA 3D1QA 3D28A 2YQ0A 3BV8A 2P6TA 3NMRA 3I9ZA 3FKBA 4GRSA 2A10A 1RJJA 3VVTA 1RACB 4Q8FA 5KFSA 1KHWA 4WWSA 3HFKA 1G4CA 1WKJA 3I4HX 1LK7A 3FQLA 4U6PA 3AHPA 3VHQA 2RQCA 2W4CA 4OX7A 3G82B 1Q5VA 8AT1B 2W9BA 4F50A 1UPPA 4ALZA 5KFBA 2AMCB 1RT4A 2MQQA 2R7WA 4FKYA 4ZVRB 3DM2A 4NLUA 1YRUA 3IWLA 1B0VA 3C15A 5HN0A 2MEWA 4G1PA 3KHGA 2R2SA 1T03A 3IS9A 5B0AA 4C8LA 2RU3A 4CDIA 4ZHRA 4ZK7M 4DV1F 4AL7A 2E5LJ 4GKKF 4USIA 2RRNA 2XWXA 3DRPA 2BUNA 1YITS 3HHLB 1NZ8A 4B3TF 3HD1A 1TMJA 1C2PA 1URRA 4JI0J 2VQEJ 4IDKA 5I42A 1QSYA 2BA9A 2CG8A 3AAWB 4D3HA 1TL1B 2WOMB 4QPXA 4USHA 5CZVA 1LWFB 1NHKL 4ZLLA 5FJ4A 2KM8C 2C2DA 3A4TA 2VBXA 3KNGA 4F02A 1O5JA 5CD4A 1FFGB 4O0NA 4M5NA 1OPZA 2KI2A 2EW9A 2UUTA 3HZEA 3M4XA 3MUMP 4ZLPA 2FPHX 2IMOA 2BEFA 4E98A 1C1BB 3A8KA 5I3UB 3CJ0A 3G6XA 2M4MA 5IT9Y 4QJVA 1Q81T 3RGIA 2ZH7A 1SL1A 4A8MP 3PW0A 3BEGB 3LWLA 4A8QA 2HZCA 4WTOB 2FJBB 1CQNA 4K2XA 3Q83A 2HRYA 4ECWA 1T9XA 2KHCA 1BC6A 1LWEB 2PSZA 3TJ9A 2HQIA 3TJ8A 1UEKA 2ZVIA 1TKDA 5IM0B 3OVAA 4ECZA 2PA3A 4PG7A 5C24A 3IAS9 3HMJG 1TV6B 2CZ9A 3BGRB 3NKYA 5L46A 2V94A 5KG3A 2YNHB 1SKRA 2DKOB 5E7OB 1X4GA 2JL9A 2IA6A 2HHSA 4LBPA 1WELA 1H73A 3OL8A 2CQIA 1MG7A 2JLFA 2DNYA 3CWJA 2YH1A 1ZPWX 2CQ4A 1RTZA 2RSQA 7AT1B 4PCQA 2EEYA 4MAKA 3ZZRA 5DDRC 3HSGA 4QZVB 4LFCJ 3NS6A 2POKA 3W2WA 3MMCB 2DH7A 2E5GA 1EKRA 5HP1A 4X4PA 2NLWA 4ZVHA 1TL3B 1NKCA 5BR8F 3R5GA 2GX8A 4DOZA 1S6UA 1B7FA 2LECA 1J5OB 3N01A 1E6VB 2IRUA 4DV7F 1ITPA 5GAGI 3D1OA 2PFFB 4OI6A 1J27A 3S1TA 1UJ6A 3AD8C 1K0TA 4LFBF 2HBZB 1ICEB 3FSXA 5I3QA 3MDFA 4OZ2A 2ROEA 1KWMA 1HLWA 3GONA 4PXEA 1RLDA 4F2RA 2AJQA 2DIUA 2CVIA 3VR1A 4K4TA 2R8IA 2RQ4A 1OWXA 1EQMA 2DIVA 3SFUA 5KFCA 1WHWA 4O3SA 4NLTA 4AUKA 2ATCB 2M3DA 2BQ3A 3FFIB 4ED0A 1CJUB 1FRLA 2QMXA 4J9UE 2GVZA 1D0EA 1FFSB 2H54B 2IA0A 1TFWA 2ZM6F 1WG1A 3QFWA 4IH7A 1MSWD 1FNXH 3QAUA 3J7ZT 1RYSA 3ISNC 4FS2A 1I1GA 1S1VB 2GHVC 2UUCJ 2ZDOA 2CAJA 1TK0A 4CH7A 4F4WA 1NH7A 3HSZA 3QFHA 4BBYA 4RKUC 2GO9A 3D3CJ 1FWPA 1RAHB 1BY9A 3NL0A 2KXHA 4J9PA 2H4WB 2RILA 1NLKL 4A8XA 3WX8A 5IS2A 2CJKA 5JUMA 3GV7B 4DQPA 5DZ7A 2LXFA 2V5HG 2N7YA 3MZIA 5D4PA 3OFGA 4LBHA 3LAKA 2X7IA 2LMIA 2JFDA 4RW9B 1Y4ZB 1SXLA 1X4AA 1DTQA 2BRLA 2ZFHA 5J2NA 2JFKA 1NPRA 4IG3A 1TAUA 2PMWA 2XZWA 4ID5B 2C2RA 1D9FA 5F8LA 2HFOA 3I56S 4WP8A 1IUJA 1CPZA 4DL6A 2RUSA 1CS4B 1GFWB 5KFDA 2K3IA 2OO4A 2NXCA 1XNQF 3MM9B 2GVDB 4JI4J 7FDRA 4C97A 2RQMA 1S1TB 1RHRB 4RZRA 4DS5A 3M9NB 1S0MA 4M1KA 5HAOA 1N0UA 2RDDA 1CJVB 4RU2A 3D6TB 1TK5A 3MPVA 2M8HA 1VQ4S 1RHUB 4DR3J 3HULA 5KT6A 1HBUB 3BKTA 3VAGA 1S0VA 3RW6A 3W8PA 5E5NA 1UP1A 4TYAA 3TZWA 4NE9C 1W2BR 2QA4G 2V2QA 5HMXA 4J9RA 2K1RB 2WAQD 1C0TB 3MEKA 1U0HB 1N32J 4DX8H 3UR3C 3GE9A 2D74B 4DV4F 3HHLA 1R8PA 4ZKAA 2YKNB 3IRXB 1N5QA 4X64F 1EETB 1PSDA 1Y5IB 4RWWA 2HEKA 3G4SS 3K5OA 4FXDA 1I51B 1TL1A 2KKHA 2WOMA 4LREA 2BV3A 1LWFA 3JSMB 2QLWA 4DV3J 1PO6A 3PIOQ 2R2RA 1X0PA 2D3UA 2XY5A 2J9CA 3DLKB 3VVUA 2KVQE 1H7XA 1VISA 3LGMA 4Z37A 3Q8YA 1WEYA 1KNZA 3AXMA 4KYZA 4QR0A 3M2VB 3E01B 5F8MA 2FVQA 1AUDA 1S49A 3PYGA 5A8KB 1GMWD 2Q3PA 1EX8A 1C1BA 5CCLA 4URGA 2IY5B 3QMQA 2B5JB 1WF2A 3SXLA 4CT8A 2J6UA 2HHVA 2Y0SD 1BD6A 2LP4A 1VC6A 4DFKA 2FUG9 1WHYA 2JRSA 3RAQA 4FF1A 3M32A 2D41A 2MDAA 1NK4A 3DOKB 3JSRA 1KKHA 1JLBB 5LSLA 4C0HA 2HVEA 4BC7A 4Y2AA 2M0GB 1ZM3A 1LWEA 4DPTA 3Q0AA 4NXMF 2DD8S 5E3QA 2K3KA 1YWXA 2XO6A 5DLFA 1PAUB 4QOTA 5IM0A 2YWEA 4KKOB 5HMYA 3CXCR 1TV6A 4JI7J 1SCJB 4JYAF 3MHYA 3A8EA 4YHHF 2YNHA 3JAMU 3PO4A 3I0RB 5GADU 1YJ9S 4E0DA 1X9WA 2FJEB 2FJWA 3EUNA 1TQLA 3Q89A 1QDUB 2I0XA 4EGLA 3N0VA 1VLYA 4OZLA 5H1SV 3QATA 4K4UA 2R7OA 2ZBIA 1AROP 4NPOA 3JQMA 4DSKA 2YWHA 1WUUA 2ZNYA 1S97A 2HG4A 3SDEA 2KZZA 1M90T 2IVYA 1RWNB 3UDVA 3I96A 4UW2A 2GMHA 1P9YA 3MMCA 4KGVB 1N5YB 2PO4A 5ITHA 1N34F 1TL3A 1Y7PA 2VC1A 3MR5A 4IRCA 2MSTA 7FD1A 1E6VA 2VFTA 4DSEA 2V2KA 4ZJLA 3EPGA 4J9SA 3BH7B 1W2IA 3ILJA 5H9EK 1CJTB 3W3SA 3KG1A 1VFJA 2GIRA 3K17A 1TFYA 3KLGB 3NGTA 3PVXA 3SMZA 1IR2A 4ZCMA 3I5AA 3D3BJ 5E3AA 1XMBA 2ROGA 3EMTA 2GV1A 3CJ4A 2W9CB 2BQRA 1RT6A 4OI0A 3HT3A 4LF7F 1M5HA 1BMQB 5LSRA 1FKPB 3CE8A 2WVCA 2XMUA 1GX5A 2KVIA 3AJDA 3FFIA 1VQSA 2ZKUA 3RTVA 1CJUA 2KL8A 5HLFA 4ZP7A 1S9GB 1FJEB 5K9FA 4CLKA 3RJMB 4K4WA 3NY0A 5CYJA 2CYYA 3I31A 3AQOA 3MMJA 1S1VA 5FD1A 5GVQA 4ED1A 1YJ7A 2PC6A 3F56A 1JK9B 2JDJA 5ADZA 4RWXA 1RU2A 3ZO7A 1VOMA 3IG1B 4RW8B 4B08A 1S1UB 3R1LA 5KG1A 2X51A 4MKYA 4GVLA 1YZ6A 4YN3B 1YJUA 2F7VA 3MAQA 1WJ9A 3JS9A 3CCVS 3R5AA 2HFZA 2QL9B 1UL3A 2VD3A 4DFPA 2F5GA 4RW9A 3MF5A 5LMNJ 2KT3A 3KFWX 3DLGB 2HQGA 4FNIA 1GXUA 1CULB 4ID5A 3PR5B 2FDNA 3G9CA 1VK3A 4AFFA 4UZCA 3KJQB 1KP6A 2QSFA 1KRPA 4PYAA 4OLOA 3MUVP 1Y5NB 1J5EF 2ROPA 1CS4A 1J2VA 3WDOA 2VODA 3D54A 2FHJD 5D15A 3EYZA 4NWBA 3MM9A 3K5PA 2GVDA 2ZOFA 4RBUA 2EG2A 4DR4F 1ELOA 1S1TA 1AFIA 5C42B 1ZETA 2NCKL 3RAMA 3DRRB 3MOZA 1CJVA 2CXEA 1KC8T 4DLGA 4XTTA 3S7RA 2DRDA 4X65J 1S1XB 3OVSA 3GR1A 2K8GA 2KB2A 2FLLA 5IT4A 4KGZB 4UT4A 3V4IB 3L95X 3G8QA 4PG8A 4PWDB 2K1RA 2YQ1A 5KG0A 1C0TA 5J2MA 3VALA 1U0HA 2CJAA 2HHHF 2MGZB 4CM0A 1U2RA 2QC3A 1XNRF 4MK8A 4KFBB 3GSIA 3R8YA 4P75A 4JI3F 2YKNA 3IRXA 4DPWA 1TTHB 2J8SA 1EETA 3I6PA 1W26A 4ANDA 2OAUA 3EICA 5ETQA 5FLXY 3HLUA 4ES1A 2KTQA 4WKRA 2YKOA 4ZIVA 3E3XA 2DRBA 3JSMA 3OXGA 1FCAA 4TLQA 5L8RC 4KO0B 3DLKA 2MZJA 2ZWPA 3GU0A 1JWWA 3TYTA 3TAQA 1TU0B 1T0TV 2Y1LB 2DRAA 3E01A 1NB2A 2Q43A 3FC9A 2IAJA 4UUWA 5EX0A 3JQKA 5K8PA 2B5JA 1VQLS 3AXKA 1WDDA 1VDHA 5GADI 2ZJRQ 1U24A 1QD1A 4N41A 3JB9k 2E44A 1IR1A 2R4FA 2OP5A 5BYRA 3WIUA 3G96A 1XTZA 4FBUA 1WHXA 3DOKA 2Z0GA 1JLBA 3MEGB 2OSQA 3NMAA 5A6WA 2YWFA 2CPYA 2CQBA 3SV4A 2EFQA 4AD6A 2YNGB 2HHUA 4AQYJ 4WFXA 4A8KA 1U6BA 5B0BA 2L48A 5E33A 3EVMA 3FUYA 4TYBA 4KKOA 1NK5A 5EHHA 4JB8B 3KLIB 1VQPS 3CD6S 3SYZA 2UXCF 2HS4A 1JB0C 3SSSA 5KFJA 5CYMB 4FF3A 4KQZA 3AOBA 2UUBJ 3RB6A 4JV1A 4QIFA 2R7XA 4R0JA 3I0RA 2J0QD 3OR1B 1XMOF 3GIJA 4IRDA 1ZTTA 1X4BA 2RE1A 2KJWA 1Z1ZA 1TR0A 2DHHA 4FYXB 1A6LA 2HK3A 2O66A 2FQQB 3MCSA 4DDFA 1H72C 4TXSA 4UOFA 4J7CA 4PWWA 3QYYA 3PYFA 2OPSB 2NYHA 2B4OA 1FTCA 4B9NA 3NRBA 2HNDB 4O3RA 2OH2A 3AD7C 4M8LA 1FWKA 2HMIA 2BKPA 2HBRB 1N5YA 3RR8A 2RDJA 3OFFA 2FGCA 4ZN1A 1MMNA 3C19A 3BQ1A 2G1DA 3VGUA 3G6ES 3I0SB 2V9KA 2GA7A 4GC7A 2FVSA 2ALYB 4P2MA 3TX8A 3D6FB 1BQXA 1NDKA 1KQSR 1CJTA 4Q7AA 3W9JA 3D0HE 4KE5A 3ULHA 1F9HA 4X62F 2AJ2A 3KLGA 2R7TA 2MQPA 4UZBA 2PEHA 3M30B 3TANA 3UNYA 2LEAA 5ETPA 4RNOA 5I3PA 1D1UA 1TMMA 2W9CA 2XY6A 2ZUAA 3ZTQA 3TARA 4RNHA 2QLJB 4HI1A 1FKPA 1REVB 3GFHA 2PMZD 1ZH5A 2CJ9A 2PE8A 3GYGA 3QJLA 3PJWA 1VR6A 3DKDA 3KJVB 1N5TA 1JKHB 1YJVA 3FMBA 4KY3A 1U7LA 4LF9F 1S9GA 3LTOA 4ZJQA 3SBMA 2EC0A 3BGUA 3ENWA 4ECVA 3HP6A 1T02A 2FZKB 4OYIA 2HAIA 2XLJA 4F4KA 2CRLA 2ZH9A 4FYYB 1JLGB 2HBQB 1ZTWA 2HHQA 1VC0A 1VCTA 5THWA 1CC7A 4ED8A 5EWEA 4PABA 2GO8A 2C2EA 2NZCA 4RW8A 1UWBB 4ETZA 4YB7A 1S1UA 5A0YB 4LF8J 4CI0B 4ZVGA 4OHVA 4TU9A 1UFLA 4CTAB 3FSIA 4N5SA 4QIWD 3HFVA 3W5YA 4KHPJ 2QX0A 3I4PA 3M2RB 1UPMB 4LSZB 4QU6A 2V8HA 2ZC3A 2XB2D 1MROA 1QSLA 4QIVA 3DLGA 4GO5X 1IBKJ 3TAMB 2P5VA 1CULA 4K4ZA 1DHMA 1SI9A 2ZHOA 3BSCA 4E8UA 3CCRS 4USJC 1YVFA 3KJNB 3N4WA 2HPUA 4WE1B 1GXLA 2KRRA 1C4AA 1WI8A 4RBTA 3QZ7A 1YX2A 4ECQA 1JNRB 1QLNA 2YKAA 3BYRA 2BXJA 1HL6A 2QA1A 4Y3CA 2F8EX 4WK3A 3IM9A 4NOHA 1HWIA 4C0BA 2JVRA 2OSRA 4ZPWR 3VF0B 3DFEA 5C42A 1HI1A 3ADAC 4ICLB 2F1FA 4JI1J 3DRRA 4NMXA 1EHWA 1VQ7S 2V4RA 4IR1A 1S1XA 2PA8D 1RP5A 1ROFA 5IV4A 4DV0F 3H42A 1RWKB 3Q2TC 1TKZA 1TKTB 3V4IA 1LXJA 2GIFA 1GAOA 3PYEA 1AFJA 5KG7A 1APSA 2R3VA 2AJ0A 2MGZA 2Z2MA 3KYLA 3T9ZA 4KFBA 4F26A 1LWCB 2E7VA 2EFGA 3O6QA 4TQSA 4NI2A 2FGOA 3R5BA 3ZTSA 1KLNA 1WKKA 4ENOA 3PCOB 2A18A 5KG6A 3ZZTA 3VQTA 3IBCB 2LLZA 1GNKA 3QO9B 2F4FA 1HBOA 1L3TA 2DGSA 4KO0A 1NK8A 4ILRA 2AYEA 4RX6A 3GJTB 2LU1A 2IBOA 1PC5A 2DXEA 4OMFG 2N4CA 3BQ2A 2J9EA 2MZRA 1YBUA 2CQCA 3JTOA 3EGWB 1RAJA 3Q8UA 3ZZZA 1HWJA 3DHWC 4NRTA 1VQOS 4LUBA 4DLEA 2MKKA 4Q45A 3UN3A 3GYXB 4AL6A 2ZVSA 4W98A 1U0SA 3UE2A 4YQWA 3HVAA 3MEGA 1KS2A 3PM9A 2HLTA 4ECXA 3DXSX 4FDFA 1IM6A 4DX7A 4FXWA 3T5LA 2ZOGA 1IBLJ 5HVHA 2DH8A 1U8WA 4JI6J 1U1PA 1RT7B 2U2FA 2Q6CA 2Z4PA 3VAKA 4DUYJ 5CYMA 4I7FB 1RHMB 5GMEA 1MNEA 2W2QP 3CCSS 1R8AA 3NWRA 3MPDA 1DQAA 1S59A 4OI3A 5L1LA 2BJ8A 3A3OB 2NXUA 3FEXB 3MEEB 1RAEB 4J9QA 1FFWB 4WU2A 4RNNA 1SH2A 5HI7A 4CO4A 4RJVA 2CQ0A 4K50A 5LT5A 3ILOA 1I6JA 3MR3A 2OPSA 2FJXA 1CG2A 1JIHA 1UVLA 2HNDA 3K5MA 2DR7A 4LQ9A 1SC1B 4RBVA 5D77A 3MR7A 3MPYA 3JTPA 4DR6J 3G6YA 4BS2A 3QLHB 1LEOA 1SJ1A
chains in the Genus database with same CATH topology
3KG0A 4KHRA 5HN0A 5EDWA 4N76A 4G1PA 4LF4F 1QTMA 2D1CA 3KHGA 2R2SA 1T03A 2RJZA 3IS9A 3I0SA 5B0AA 1XR7A 4HTJA 5U47A 4RUHA 1LFPA 3IBWA 2RU3A 1K73T 2IMWP 2IAJB 4ZHRA 2R7QA 4ZK7M 4DV1F 4AL7A 3SQGA 1KR4A 2QEXS 2EFPA 4GKKF 4USIA 5E3CA 1GTHA 3C66A 3ISND 3CPWR 2K2PA 2CQ2A 3K57A 1NK0A 3A1YG 2RRNA 2XWXA 3CMES 3BSAA 3DRPA 3C6UB 2BUNA 2IC3B 1DAXA 1KQGB 3FEZA 1YITS 3HHLB 2BANA 3HKZD 1RT2B 2HNYA 3NLCA 4I6WA 4CO1A 3C2PA 2BABA 2QSWA 5A8RA 4B3TF 4PWDA 2OD4A 2MSSA 1C2PA 3DOLB 3LP2A 3BO4A 4WYWA 1G1XA 1URRA 1S6QB 2UVVA 2FLNA 4MIWA 1BQMB 4IDKA 5I42A 4DL0C 2BA9A 1QSYA 1GT8A 1S1WB 3BREA 3M30A 2QE5A 2U1AA 3IR5B 3KK1B 3R1HA 3AAWB 4D3HA 1TL1B 2WOMB 1WD6A 3CSKA 4HDGA 4JBCA 4USHA 4QPXA 4F4YA 3OHBA 2V8GA 1LWFB 5CZVA 1N48A 3KHRA 1SJ3P 2KRBA 5FJ4A 2KM8C 2C2DA 1IQTA 5J1EB 2BBEA 4PG4A 3VQSA 3UCZP 2VBXA 2NUUG 3KNGA 1JLCA 2IJNA 2YNIB 4F02A 1O5JA 1U26A 3QGGA 4EZ9A 1REVA 3THTA 1UA0A 2IM3A 4NA2A 3N6MA 1CQMA 2CPJA 4JI4F 1S72S 1OPZA 3TO8A 1JNZB 5H9FJ 3MURP 1WG4A 4LSNB 2KI2A 3KJVA 5K8OA 2EW9A 2E9TA 2EKYA 1JKHA 2UUTA 1XK8A 4OX6A 3HPOA 5F8HA 1FEEA 1T94A 4LVNP 4ZPTR 2B7CB 2LU2A 3HZEA 2N82B 2ZJQQ 3M4XA 3GIIA 2EFOA 3MUMP 4URQU 1K9MT 4ZLPA 2FPHX 5EWFA 3UNGC 4KC5A 2IMOA 5KFLA 1EP4B 4E98A 4ETXA 3T1HF 1LK5A 1XR6A 1HBMB 2CDQA 1N0VC 2DNOA 1JJHA 3RRGA 2ZHBA 2GJIA 4DR3F 5BYSA 2FHMA 2Q66A 1TAQA 1C1BB 2HGLA 3PRDA 5I3UB 4ELUA 3FMWA 1Q8BA 3V2UC 3CJ0A 3J81Y 2FHJA 3G6XA 2M4MA 5IT9Y 1KVIA 4QJVA 1HWKA 1JLGA 1B0PA 3FJ2A 3TUZC 1Q81T 5J2PA 2J7WA 1JLAB 3H59A 2AGQA 2FHKA 2MJNA 1TK8A 4GKJF 1MMLA 4LIRA 2ZH7A 3PV8A 1SL1A 2BACA 3ICLA 4A8MP 3PW0A 1RTJB 3HXMA 3HKWA 4MKBA 4DN9A 4KIAA 3I5CA 2WSEC 3BEGB 3BZQA 4ZP9A 3HK2A 2DNRA 4K4XA 4LSLA 5B0FA 3LWLA 4A8QA 3OTCA 1UWBA 2HZCA 2PI5A 1N32F 4K4SA 1UVJA 2KM8B 2FJBB 1H98A 3LANA 4R25A 2B9XA 5A0YA 3Q2SC 1SJ4P 1CQNA 2E9ZA 2AQ4A 4K2XA 1TZ0A 2HRYA 4ILLA 1FNMA 4ECWA 3ENVA 5GMKa 2KHCA 4ED7A 4B9LA 4B02A 4CTAA 4HLBA 3D2WA 4O3NA 2OTJS 4FPRA 1BC6A 2DBBA 1LWEB 2PSZA 1FD2A 1LXNA 2HQIA 1VQ5S 5T7LB 1VRUB 3SCIE 1HARA 2H9ZA 5KFAA 1Z2LA 2VFVA 2GGPB 1RA6A 2QRRA 3MD3A 4WTYA 3HI9A 2ILZA 5KTQA 5DDOC 3M2RA 5HBMB 1TKDA 5IM0B 4WFYA 2I5JA 3MMBB 3OVAA 4ECZA 4MK9A 2XCAA 2PA3A 2KT5A 4G6VB 4PG7A 3N6LA 4RW4B 5KT3A 2HMIB 4DV3F 4DF4A 1VC5A 5C24A 3H25A 3J7A1 2CZ4A 1H6KX 3IAS9 5D3GA 3KHHA 3TAMA 1NH8A 3HMJG 2L41A 1TV6B 2PT0A 3CULA 2B56A 1FJCA 4KGKA 1O0PA 1Q8IA 2B4PA 3BGRB 3NKYA 4J9MA 2V94A 5KG3A 4OL8A 1F2GA 2OPPB 2YNHB 1ZPVA 1SKRA 1JLQB 3J80Y 2XHWA 3TUIC 5E7OB 1VQ6S 1X4GA 4WFBQ 2JSXA 2V0NA 2AD9A 2LVWA 4Y2IA 2O1PA 2OTLS 2WRMA 4NLGA 2KZMA 4WFAQ 2ZOMA 2JL9A 2IA6A 2R8JA 5F0WA 4P6QA 2HHSA 3EX7B 2UUWA 4NRUA 3IG1A 1WELA 4ED5A 2B0GA 3OL8A 1M5PC 2CQIA 1SIWB 2JLFA 3UR0A 2OFHX 1VK8A 2DNYA 5KT2A 5JVGQ 3CWJA 2YH1A 4NCGB 1ZPWX 4IOAQ 2CQ4A 2XS2A 4HYKA 3S8SA 1NK6A 3POTA 2PGCA 2RSQA 2JEFA 5D8HB 4ZA1A 1R27B 5FDLB 2BM1A 3RZAA 4O23A 4PCQA 4DQQA 2AYBA 2YWKA 2CPEA 5B0CA 4OFZA 3DN9A 4Y2CA 4MAKA 1DLOB 1P27B 1T7PA 3ZZRA 1YRXA 4MFBB 1HD0A 3SSRA 3IGNA 5DDRC 2ZH8A 1IKVB 3MGJA 3H5XA 5BJRA 4QZVB 5CHCB 1IQZA 3NS6A 2POKA 3W2WA 4FF4A 3MMCB 2DNZA 2DH7A 2E5GA 5HP1A 4X4PA 1NJWA 2R8HA 2NLWA 4BWMA 4ZVHA 1TL3B 2ZUGA 4A8YA 2FC8A 2XEXA 1NKCA 1F0XA 1YG0A 5BR8F 3IWXA 4IFVA 1FRIA 2GX8A 4DOZA 4J37A 1S6UA 2MQLA 1B7FA 1FTRA 2LECA 3N79A 3MUTP 3F73A 4X4QA 5E3PA 3M9MB 1J5OB 3DLEB 3N01A 1E6VB 2IRUA 2YX7A 2UU9F 2GFFA 3ETOA 4DV7F 5GAGI 1N6QA 3DLLQ 1LW2A 3D1OA 1FK9B 5AXKA 1VRTA 1F5CA 2MKIA 1HNIA 3FQKA 1HQEA 4OI6A 5C5JA 2PFFB 4DEZA 3NNCA 3CDBA 4I67A 2VC0A 3S1TA 1UJ6A 1S0OA 2DITA 1FD8A 1V3RA 4LT6A 1K0TA 2BM0A 4ITSA 4LFBF 4FF2A 5HROB 2UP1A 1XC9A 5J2QB 3E2EA 5I3QA 1F5BA 1FT8A 3FSXA 3KOAA 4JI7F 1LWCA 4I4BA 2HRUA 5K14A 2EFNA 3MDFA 2ZH1A 2ROEA 1DJ0A 3B4DA 4PXEA 4F2RA 2FTRA 2AJQA 2YY3A 2XC9A 2DIUA 1QE1B 2CVIA 3VR1A 3RR7A 4J9KA 4K4TA 4OHYA 2R8IA 4F3QA 2RQ4A 4IUFA 1OWXA 3VAFA 4F8RA 2M2BA 3OLAA 1A9NB 3KLVA 4G1QB 1M5VC 2MHEA 2DIVA 2DR5A 3SFUA 4DHVA 3RB4A 2JVOA 1L3VA 2JJ4D 2UXDF 3BR9A 2PMHA 2J0SD 5KFCA 1WHWA 5T41A 5GAEI 2CQGA 1MSWD 3CVKA 1QAJA 2BZ2A 4YB6A 1QM9A 2RB7A 4I64A 1Q4RA 4O3SA 2XY7A 3QO9A 4HH1A 5KFOA 3GFXA 4B3OB 5DG7A 4NLTA 3GQCA 4AUKA 5DGBA 3Q23A 4DSIA 2M3DA 4BWJA 3SV3A 2BQ3A 2KH9A 3FFIB 2PDAA 2IYGA 3CJ2A 4ED0A 2KN4A 2W7OA 4A8WA 1FRLA 2QMXA 1D0EA 2G0CA 3C6TB 2XS5A 2DO4A 2CQDA 2IA0A 4Y28C 5KFEA 5DJBA 3KK3A 5KFHA 1FRMA 2KXNB 2ZM6F 3CC2S 1TFWA 2K7JA 1WG1A 1E6YB 2YWGA 4IH7A 2ADCA 4DL3A 3BGFA 4WKYA 1MROB 3QAUA 3J7ZT 1FRHA 3DYAA 4L3NA 3UI3A 1FNXH 1AXQA 3TUJC 1JLEA 2RVJA 1RYSA 5CZXA 3G8TA 3B4MA 2I2YA 3ISNC 2DH9A 2XBPA 3E51A 1N56A 2OJ3A 4FS2A 2J7UA 2M8DB 1I1GA 3O5TB 1D8ZA 3PX4A 4DV5F 2JEJA 4Y2KA 2N7CA 1U1MA 1S1VB 3SCJE 2GHVC 4O4GB 2MQOA 1S7HA 5IWAF 1IN0A 1QUPA 1T95A 4PG5A 1QVGR 2RU9A