1SC1B

Crystal structure of an active-site ligand-free form of the human caspase-1 c285a mutant
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Interleukin-1 beta convertase
publication title Crystal structures of a ligand-free and malonate-bound human caspase-1: implications for the mechanism of substrate binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 17
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2004-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1sc1B00
3KJNB 4ZVSB 3NS7B 1RWPB 5IC4B 2HBZB 1IBCB 1RHUB 2CNKB 1SC4B 1RHQB 4ZVRB 3EDRB 2DKOB 2H5IB 3R7BB 1RHJB 2C2OB 4JB8B 3GJTB 3D6MB 1RWKB 3R6GB 2QL5B 3GJQB 3R7NB 4DCJB 2CDRB 3R6LB 3IBFB 4ZVTB 4DCOB 3R7SB 3D6HB 4ZVQB 2XYGB 2C2ZB 2QLJB 1QTNB 2H5JB 3GJSB 5IC6B 3RJMB 1ICEB 2HBQB 4DCPB 1RHRB 2QLBB 2XZDB 2CJYB 2H48B 4ZVUB 5K20B 4ZVPB 1NMEB 3SIPB 3R5JB 2H65B 2QLFB 2H51B 2C1EB 3EDQB 4ZVOB 2H54B 2H4YB 1BMQB 3KJQB 2CNLB 1RWXB 1RWOB 2HBRB 3P4UB 1RHMB 1PYOB 2CJXB 3IBCB 1RE1B 1RHKB 2QL9B 2CNOB 2QL7B 2C2KB 2C2MB 4LSZB 1RWVB 1RWWB 3QNWB 2Y0BB 2CNNB 1I51B 1SC1B 1GFWB 2HBYB 2XZTB 1RWMB 2Y1LB 1QDUB 3GJRB 1RWNB 1F9EB 1PAUB 2XYPB 2FQQB 2H4WB 1I3OB 1SC3B 3P45B 2P2CB 3KJFB 2XYHB 3D6FB
chains in the Genus database with same CATH superfamily
1X9SA 2O1PA 2OJ3A 1S6PB 2DR7A 5HBMA 4LJMA 4JI8J 1KONA 1XBWA 2VFUA 3QGGA 2YNIB 4DUTA 4I6AA 1ZAXA 1S5ZA 5DQHA 1YJNS 3O6QA 1TK0A 2XSJA 4XK8C 2LA4A 3VAKA 2CQBA 1HQEA 2W24A 2UVUA 4O23A 4P72A 4ED3A 3NGUA 3OTOF 4LREA 4OYPA 4E8UA 1S97A 1X60A 3EJMA 2OUGA 1AA1B 1NJWA 3OJSA 2MKYA 4DPUA 1SKRA 3IO1A 4ZPVR 4LRDA 3RAMA 1T9YA 3HHLC 1FRHA 1E6VA 1W2BR 3MZIA 4DL3A 3Q8VA 4KYZA 3CCUS 2E5IA 2N3OA 1YZ6A 4W92B 3CJKB 2KM8B 4RPFA 3TWZA 2QEXS 4NLGA 1UVNA 2FIUA 2LEBA 1W26A 3IM9A 4TY8B 2RVJA 1FERA 2ZFHA 2RDJA 3UWTA 2HGNA 2X1FA 1VQ9S 4HH1A 2KRBA 3N6LA 1EJ7L 1TV6B 4X4OA 4EZ6A 2JHEA 2C2EA 4Y0FA 4TY9A 3TVYA 5J2NA 4JB8B 1IBKJ 3PIPQ 2V34A 3SZ2A 2HAIA 1E6YB 3PM9A 2IBOA 4NXMJ 4ZJOA 4FPIA 2DNOA 1U2CA 4LF7J 5DLGA 1QSLA 4C3LA 4B3TJ 3CF5Q 3W5YA 3VVTA 1KOHA 3N0VA 4DUZF 5KT5A 1LV5A 4KRWA 4DZ6A 3ET6B 2C2MB 3F44A 3EVMA 3GFXA 5E7OB 3Q2SC 1O5JA 5A0YB 3QFWA 4RBTA 2GA7A 5LSOA 1OS5A 3QO9A 5ETOA 2XYPB 5D4NA 5CXTA 4QWBA 3B8HA 1OIAA 4PYDA 4DU8A 1NK5A 3QT5A 3NGDA 3BR8A 1TL7B 2KVQE 3J7YI 4XPCA 3UN2A 1HBOA 2BANA 4FNHA 1RT1B 3EYZA 2HQ3A 3DI6B 2GHVC 4DG1A 1PCAA 1Q4RA 2XEXA 5SZTA 3GCXP 1NPPA 1Y0HA 1N36J 3PNIA 2CVEA 2YX1A 3R5BA 2E1AA 1DHMA 2YNHB 2QYGA 3GJSB 5A8WA 4RNNA 4DF8A 3JSYA 4IDKA 3OT9A 3I6PA 2ZKUA 1HIYA 3R8YA 3I0SB 1R7IA 5IWAF 2W7OA 4K2JA 5JJBA 4OLOA 3W8PA 4H54A 3IMQJ 3OLAA 1VQ4S 1X0FA 1DTQA 2E5LJ 5D3GA 5AXKA 2MKKA 1VJWA 2AJ0A 4DV0F 4ETZA 2UU9F 4RUCA 2J6TA 1MMLA 2XZTB 3TEGA 5AXLA 5THWA 1GMUA 4C0BA 5IOLA 3FBEA 2MQOA 5HAOA 3J7AN 1YVFA 4MKAA 2OKQA 3EXCX 2F65A 4AQYJ 4ECVA 1URNA 2XC9A 4UY8T 4NYZA 3CD0A 1JLEA 2EW9A 2LVWA 4I67A 1ZM9A 2DGSA 2XYGB 1O0PA 3C19A 2L9DA 4JBCA 1J5EF 3GSIA 2LECA 4OZJA 2VQEJ 2PIIA 4F67A 2ZVIA 4ECQA 3MM8A 3I96A 3CVKA 3LGMA 3L95X 1F5CA 4LVOP 3MM9B 2OPPB 3N5FA 2FUG9 4DR5F 4N56A 2E1PA 5DDPC 3TUZC 4F7VA 4BCAA 1UEVA 1LK7A 1RWMB 3V6DA 3TR5A 1D9AA 5LMNF 1YBAA 4U7UK 2QZ8A 1VIOA 1I3OB 4K59A 1RT4B 1NLKL 1T8EA 4P2MA 4RJVA 1IKYB 3KUGA 3OVAA 2G4BA 4NLVA 1EIYB 1CLFA 4M5DB 2A3JA 4EBCA 3PHTA 3BREA 2QMUB 3M2UB 1KDNA 3A8JA 3V6HA 1FNXH 2WSFC 2FJDB 2PSZA 1B7FA 1HA1A 2E1CA 3DGPA 1LWFA 3RAXA 2YNGA 2JSXA 2VASA 1BQNA 1LK5A 1G3OA 4URGA 2CWKA 1SUQA 4O3QA 2C1EB 1S9FA 3IRXB 2DNHA 3N9UC 4F3MA 2FJBB 1WD6A 5M2RA 2CPDA 1FNMA 2HNZB 3BKUA 2CQ0A 1LNQA 2EXUA 3FKBA 4W4MA 2GVDB 4TYAA 2L48A 3EUNA 1UJ6A 4L76A 4YR2A 1RWNB 1YJ7A 5EX3A 2R7TA 4LUBA 2MQ8A 4O4RA 4ECZA 1SC3B 5DS7A 2NLWA 1FRIA 4J90A 3W2WB 1PILA 3HCXA 3W62A 2F8EX 4MK8A 1VRTB 1S1WB 4C8MA 2FJXA 3EZ5A 3OR1B 1RWKB 3AB4B 2Z2ZA 4FF4A 4FF2A 2FLLA 2WVDA 3C6UA 1DQ9A 1BQXA 4U9RA 1LOUA 1NSKL 2HMIA 4IQMA 2YWWA 2P6TA 1X4AA 2B4PA 3I4PA 1NPKA 1NDCA 4J9MA 1CS4A 4YDDB 2BX6A 4L74A 4U96A 1XR6A 3SCJE 5HLFB 2V8HA 1DFDA 3KK3A 2MZSA 2DR9A 2AYBA 3PHEA 4LRFA 3J81U 1SC6A 2AF6A 4NA1A 1NDLA 2W4PA 3KLIB 1LWCA 5HVGA 1VBYA 2CPIA 1N54B 1VQSA 4KGKA 1DURA 1PJ7A 5CHCB 2BJ8A 3O3LA 1YKWA 1UVIA 2UXDF 2FD2A 4OJGA 1TAUA 1B70B 4OYWA 3UDCA 3FSXA 3OUYB 2DBBA 3IG1B 5HROB 5F8GA 3T5JA 1CBKA 1U24A 2ZOMA 1LW0B 3FQKA 2QG9B 4TLQA 4ID5B 3HFZB 4PG8A 3R5AA 4ZIWA 5ETSA 3NS6A 2XY6A 2XULA 4WE1B 1T3NA 3NAIA 5IS2A 1SBRA 4B9UA 1NJYA 3FRYA 3K17A 1CJUB 2D69A 3BQ1A 3BO3A 3MEEA 4WPAA 4KGVB 1WDTA 1HBNA 3M8WA 1HBUA 2DTJA 5K9FA 3EZUA 1S0OA 1U09A 4XIUA 3LAKA 4IH6A 2MZJA 1N6QA 3HVRA 4D3HA 2Z2MA 3DHXA 2NPIA 3W3SA 4OYZA 5E3RA 2XMJA 2I9SA 3DDIA 1UPPA 4ZVHA 4KTQA 4QYZJ 3T5LA 2WVFA 1YQHA 5IV4A 1UZHA 5F8JA 2RIJA 3PKYA 4E0DA 2HIQA 3KHRA 2WBMA 1CJTA 2RDDA 3VAGA 5IFMA 2QSWA 1RT6A 2FVSA 4WCEQ 1Y7PA 3CJRA 2QA4G 5GAGI 4RNOA 2GV1A 2VIHA 3DN9A 3M9MB 4F4AA 2OO4A 2O3DA 1RTJA 1FKAF 4LF2A 1TL3A 2MLXA 1PBAA 4WK1A 3J7Z5 4RL1A 4DUYJ 1S76D 3NNAA 4A8FA 1N88A 1T02A 1VQNS 4J9LA 4RW9B 4L73A 3UNGC 4ANEA 2N3LA 2ADBA 4ZVOB 4R5PA 3JTPA 4KKOA 1U26A 2KU7A 4ZLJA 3BGFA 1TL1B 2UXCJ 1XR5A 2J0QD 2IJRA 1EHWA 5D0EA 1HD1A 2GGPB 4CIOA 1VBXA 1NCLA 4B3OA 3T6JA 4PYAA 3AQOA 3HFKA 1KP6A 3HHLB 2IDLA 3HXMA 1S6QB 2YKNA 3CCVS 4NCGA 1YG0A 1KTVA 2CYYA 2MQLA 2E5HA 3MR3A 3K5PA 3H98A 2FTRA 3A8EA 3AB2B 2MKIA 2UUWA 3W65A 1XIQA 1NH8A 1NK6A 2W8LA 2VPYB 3BF4A 5HMZA 3KFWX 5CD4A 3FEZA 3NY0A 3BDEA 1L5UA 2FYXA 4TVAB 2VA2A 1G6BA 1F5BA 1MG7A 4F02A 2QA1A 4C3MA 1UJ4A 3MPVA 3OR2A 2WB4A 2KHDA 4IO9Q 3BSAA 2E5JA 1TMMA 3MUMP 2DGOA 2GAGC 2GJIA 2H4YB 2MKHA 3KK1A 5H9EK 4E2FB 4DU7A 3T5HA 3J7A1 2MGZB 4ECUA 2E9TA 3MMCB 4CO1A 2GMJA 3DOLA 4KV8A 3J81Y 2CPJA 5AT1B 4Y34A 4PQUA 1P1LA 2J8SA 1OJ4A 4YR0A 2G1DA 4I6WA 1D09B 2FHOB 1F9FA 2W4CA 1WKJA 1SV5B 4HI2A 4UUXA 4JI0J 2UUAF 1TZ0A 3PTWA 3A13A 2ZH6A 2GQ2A 1GXLA 2KL8A 2JC1A 5HJYA 4K0KJ 2LQ9A 1BHNA 1FKPA 3W1YC 1ZPVA 1RT3A 2ZNYA 1R8BA 4ED1A 1IM4A 1L3KA 4ED8A 3TAMB 4DV2F 2OFHX 1IJEB 4DPOA 2AIRB 4AFFA 1VC5A 3RJMB 2HBQB 2D7SA 4JUZA 4XAKA 3CCRS 1B7YB 1XK8A 1HWIA 4KAIA 1REVB 1IKWB 4NZ7A 4LF8F 3KOAA 1ULRA 1YHQS 3W61A 1Y9OA 5BJRA 1EETB 3BR9A 2MKSA 3JQKA 3I0RB 4DX8H 1IBMJ 1NK9A 2DYAA 4PRFA 2CPHA 3C14B 3MAAA 1VCTA 2UUCJ 1JLAB 4RWXA 4ECYA 2E66A 3G82B 3SQOP 4OI1A 4EGLA 2BW2A 5IC4B 1GTEA 3ITHB 1U8SA 3BO4A 3QLHB 2VPXB 4H4KA 1SKUB 4ZCIA 4UOGA 1H2TZ 1XQIA 2OIHA 2OPQA 3DOMB 4RZRA 4X4VA 3AQPA 3MUVP 2HYIB 1EZZB 3BSOA 3MTKA 4DFPA 1FVSA 1HR0J 2RT3A 2VICA 2FVQA 1RAOA 3FSIA 5IV3A 1NSAA 1UVJA 4OX8A 2H54B 1OSCA 3HX9A 1T9XA 1QAJA 2AJ2A 1NRKA 4H4MB 4O3SA 4TQRA 1FF2A 3QIPB 5HI7A 1H72C 1X4HA 2FHKA 5D0RA 2ROGA 1S6OA 2NXUA 4ZCLA 1F5AA 1RCXB 3MHYA 4ZDNA 3Q83A 1VQPS 2VC1A 1K1SA 2HLTA 3HD1A 4QIGA 4OI3A 2AT1B 1K1QA 4Q45A 1WDDA 3HPOA 2GZOA 3UCUP 1Q7YT 4CH7A 3F41A 4EK2A 4FS1A 1IBLJ 1DRZA 3R6GB 2DGXA 3VQTA 1EP4A 4K2XA 5KG7A 1V3SA 3LO3A 3KG1A 3NKYA 3VQSA 2V4JA 3C16A 4DCPB 2CKWA 2IC3B 4ZVUB 2ZDOA 2CQ3A 1S1TA 4KO0B 4ZLLA 3G96A 4MK7A 1FJEB 1P9YA 3MCNA 1TMJA 1NNDA 4K4WA 1VQLS 3IC1A 1XMOJ 1R8CA 2ZJQQ 4Y2MA 1OPIA 3BDPA 2CQ4A 1YK9A 3HO1A 4KHPF 3C15B 2C2KB 4R0EA 2V94A 1U48A 3G4SS 3RBDA 4MJKA 1XC9A 2ZC3A 5H9FJ 2OPRB 3THVA 2ACMA 2OHDA 2VG6A 2DXEA 1U1QA 1N5SA 4RW7B 3V81B 3HF5A 4F8RA 2QFJA 1TKXA 1QD1A 4JI1F 3P5TL 2H1YA 3NGKA 2KN4A 1WC3A 2C3MA 1PGZA 4G65A 4F0KA 1RZMA 4WXWA 2W2MP 1VBKA 3W66A 2R8JA 2MHEA 1HWKA 2X3DA 3KHLA 2XSJB 2QSFA 3UI3A 3G6YA 2EFVA 1AT1B 4OZNA 4QIFA 3AOCA 2CJYB 3HT0A 2M8DB 1OPZA 2Z2YB 2AEMA 4DJBA 4F25A 4OHVA 3DLJA 4HACA 5MLCV 3CCZA 2C2DA 2DNMA 2HBRB 4F4XA 2HW3A 3DGVA 3M8SA 2EK1A 3CB4A 1VRUA 4UF4A 2QL9B 3PJXA 5KFBA 1M0SA 1E6VB 2EKNA 4J9SA 1KRPA 1FJCA 3PRDA 1AB8A 2LEPA 1PAUB 3M8ZA 1DAXA 1MNEA 2KZMA 2HS4A 1M5OC 5J2MA 2HZVA 2P2CB 3KLGA 2V6AA 4WU2A 5CA5A 2B56A 1BGXT 4CYUA 4DX6A 2WONA 2Z0GA 2NR0A 2Z56B 2ZBIA 4B9TA 4YEAA 4RUBA 2B9WA 2NZ4A 4DL6A 2JH3A 2MLZA 3BYRA 2F9JA 3OL7A 2OEMA 2XCAA 4F36A 1J5OA 4LFCF 3X3UA 4DOZA 3H25A 1L3TA 1YJVA 1Q8KA 1N5VA 3HZEA 2GVZA 3M6VA 3KJVA 1YI2S 3U7JA 2BQRA 4NXNF 2LEAA 5CCMA 2E1RA 5KG2A 2DHHA 2HRYA 3QGIA 1NDKA 1OMSA 3W64A 2IVYA 3NOCA 2VOOA 1YGYA 4DV4F 3RAQA 2JFDA 5GADI 3N6MA 2E44A 4K4YA 2M70A 5DM6Q 3M1VA 3QO9B 2EFNA 2YY3A 2DGUA 5GVQA 1GMWA 4GKJF 5DG7A 2YQ3A 3DRPA 3TZYA 1ZPWX 4RO0A 4PCQA 2B5JA 3NGTA 4OYOA 1UETA 4DL5A 1FE0A 4YS2A 1HBOB 2BANB 1U7LA 1RTHA 3T9ZA 2QLWA 3BH7B 3DLKA 1S0NA 3PJWA 3R7NB 3W63A 1VJQA 3OL8A 1RXOB 1PC4A 8ATCB 3DDNA 1S9GA 1N8RT 1BQMB 2JDJA 3NWGA 4WU3A 5A8WB 3R1LA 2YWKA 5HN0A 2ZWPA 4O44B 3GV7B 3P4UB 2IVFB 2PMHA 2B6AA 3I31A 5ADZA 2QIFA 5E3CA 3Q22A 3M7VA 5LOQA 1HI0P 2L41A 3GR1A 1O51A 2XY5A 2XO7A 1RWWB 1HFEL 4MIWA 1DTQB 2RQKA 1ZYQA 1I51B 4A8SA 1RB0A 4CCHA 5D3GB 4B17A 4H4KC 2ZHOA 2B7CB 2AV5A 1S99A 3H90A 2AMCB 4MKBA 1T9VA 2BABA 2VONA 4RBVA 4L72B 1RWPB 3FMWA 3JTNA 2Y8WA 1XNRF 1NK7A 4RR5A 1JLBA 2X7IA 3TX0A 3R2CJ 3ZO7A 3KKFA 2G1HA 3AJ2A 5DG9A 2R7UA 4FN5A 4A8MP 4QU7A 2BZ2A 1VISA 4QCLA 2RE1A 2WVBA 3MECA 2FJVA 2IAJA 2PFFB 1J27A 3O5TB 4TU7A 5DDQC 4UZBA 1FI4A 1NMEB 1JLGA 1F6TA 1YX2A 3MEGA 3MM8B 4N41A 1X0PA 5KFXA 5HQ8A 3X1LB 4NMLA 2FVCA 3TJ9A 4ECRA 1MWYA 3IWXA 1NBEB 2HBYB 1RAJA 5D4OA 4Z2XA 1NK4A 3M9NB 4ZLNA 1RYRA 1ZBTA 1DLOB 1CEZA 1H7XA 4RX6A 5DM7Q 4U95A 1VK8A 3QWUA 1SJFA 3DXSX 2BKPA 3DXBA 4LF9J 3PRVA 3OSPA 3CC7S 4PUOB 1K0VA 5C24B 2RU9A 4R25A 1FHTA 4B9MA 4HTJA 3SQGA 1LWFB 3MM7B 5LJ3Y 1R6YA 2UV8G 3SDEA 2I5JB 4YN3B 1BQNB 1H74A 5LMUJ 3MR5A 2VBWA 4NLYA 4I4BA 2C2NA 2CQ1A 3QGPA 1S6UA 4DV7J 4N76A 1LFPA 1H3DA 4M5GA 4QPTA 2CJBA 4ZIVA 2NXEA 2DNRA 4IOBA 3JSMB 5JVHQ 1LWEB 5CZVA 5MAOA 2O5DA 3OTBA 4IYQA 1VQMS 1AZSB 4YHHF 2D1CA 2FZCB 4UOHA 4ZPDA 2Q66A 1WNEA 1V5IB 3P96A 4P74A 1MN7A 2XGQA 2Q43A 4USKA 1VLYA 3KDNA 4X62F 4KJIA 2ZZTA 4B3RJ 3U02A 1SC4B 1KVKA 4Z37A 2BE9B 3K8VA 5IT9U 4QBUA 1Q16B 2W1BA 3TAQA 1KHVA 1T7PA 3VGVA 3BB5A 4CDIA 5DQIA 3DLGA 4JI7F 5KT4A 4URSA 1BLUA 1M1KT 4OV6A 3EICA 1N56A 3C6UB 2PD1A 2YNFB 4MFBA 3NBPA 4NCBA 1IWAA 1PIEA 1U8WA 4URQU 2XB2D 4UY85 4A48A 3VZIA 4DLEA 3T1YF 2HMIB 2HSEB 5KT6A 4HKQA 1BMQB 1L3SA 1RGVA 1IVZA 5T41A 5CZXA 2NXCA 1CS4B 3BQ0A 4C2MA 1YJWS 2POKA 3KK3B 3LP0A 3MGJA 4XO0A 3B82A 1C0TB 4AL5A 2Z4PA 5I4MA 4OIXA 2A2DA 1LWCB 4AQYF 1S4EA 3DRRA 2AX1A 1JJ4A 4UZCA 1B0VA 4NWBA 3WZ0A 1M5VC 3F73A 5KFZA 2RNEA 3UVJA 4NOHA 1HNXF 4CLTA 4DR6J 4DV5F 1VQ7S 3RRGA 3HULA 3TW0A 5C25A 3OTEA 4MIAA 4QR0A 4ELTA 3TX8A 3PW7A 4JYAJ 2F7VA 1NPRA 1VQ6S 1B0PA 4NLUA 3I4HX 3D2WA 2CDQA 4NLSA 2ZM6J 2ASLA 4M8LA 2W9BA 3MEEB 4LBIA 5DGBA 3OTCA 2B3TB 2K2PA 1HBNB 1TKTA 1HBUB 1Y10A 3LGNA 4B3MF 2CIMA 4WP8A 4Q7AA 5SUHA 1N0VC 1TU0B 1HW9A 2XS2A 4K5SA 2F9DA 3ETMA 2Z57B 1N6QB 2YWEA 2XM3A 4FYYB 5AJ3F 3BN7A 3ZZPA 2XSFA 2IY5B 2ILYA 2B51A 3ADAC 4O0IA 4TXSA 5K8MA 1FJ7A 2NXNA 1HQUA 3DKDA 1CJTB 5BXIA 2ZOGA 1B64A 3DLEA 2G13A 3UPFA 2GQCA 4ED5A 1Z2LA 2CDRB 5U47A 4RW8A 1KQFB 1TL3B 3MFHA 4TYBA 4C0OC 2CZVC 2H5EA 1WG1A 3D0IE 4E98A 2I0XA 1C0UB 1T0TV 2CQPA 3C8YA 2LXFA 5EHHA 4JP8A 4ED4A 2L3MA 5LXRA 1CVJA 2HURA 5DRKA 2DISA 4R5PB 4KKOB 5IQQA 5EWFA 4ZPAA 1WG5A 2IDEA 3EM1A 2EC0A 4OHZA 3Q8YA 3CMAS 3FFIA 5I3QA 2P5VA 1RK8A 4K4ZA 2VFRA 2EK6A 2OAUA 2HBZB 1Q78A 4EWTA 2NXJA 2EBGA 1MLAA 2YKNB 1A7GE 1UW9A 2Y1JA 1RAAB 1CPZA 2R7VA 2BOAA 3TVZA 2AGPA 2XS7A 2ZBPA 4CNZA 3CJ3A 5IT4A 1BC6A 1X8DA 4C8YA 1VLOA 4M5MA 2VG5B 3EWGA 5F3TA 1RYSA 4ZN1A 2BACA 1VC0A 2D3ZA 1LFWA 2JX2A 4DBQA 1KQKA 3OR2B 4QYRA 5KFFA 3OXLA 2IYGA 3QSIA 3OLBA 4YP3A 1TK5A 3TJAA 3KK1B 1XERA 3DLHA 1P27B 2JJ4D 2RJZA 5J2PA 2ZDPA 4G1QB 4PWDA 1P9QC 3DOLB 4KV8B 2F8MA 1JNRB 4D3GA 3T1HF 4NEYA 3DRSA 4PQUB 2Y9HA 5F41A 4RUHA 5HQLA 3ZNUA 4GVBA 1T05A 1WORA 3D3BJ 4Q5VA 5HP1A 3G87A 1N34F 4KHRA 4U7UD 1FX2A 2CPXA 2GQQA 1D8ZA 4UQTA 2GJ2A 2GO9A 1Y3KA 5C42A 3TQEA 1AXQA 3AJ1A 2DCLA 1QTMA 4OYBA 5B7WA 2XQCA 1FKPB 4GMKA 3OV7A 1S0MA 4JI2F 2RS2A 1RT3B 2VC0A 3JSBA 2H5JB 2GAHC 2RUSA 2EG1A 3DU5A 2HFOA 3U1NA 1UA1A 4KH1B 3AXMA 3CJSA 1U6FA 1Q8LA 3MCMA 4I2QA 1DJ0A 4EFAC 3IAM9 2YX7A 1QE1A 3H5XA 1YJ9S 4PPDA 4EYIB 2J0XA 4R0JA 3BV8A 1UEKA 2CPEA 2M88A 4WKYA 1TK8A 4WF9Q 1NSQA 4ZP6A 1S1XB 4EUVA 2CWXA 1SH2A 5CCLA 2HK3A 3CD6S 3VAFA 5A8RA 1Y11A 3S8SA 2DPIA 3MAAB 2Y8YA 1S1UA 3MTJA 4DV3F 1VK3A 3W9HA 2GJFA 1FJGJ 2NCKL 4NLXA 5D0GA 2OGUA 4CLYA 4ECTA 3UD4P 2JRSA 4LFBJ 1ZAWA 3ILOA 3QSYB 4ES3A 1KVIA 1FEHA 4HTIA 3DLLQ 1SQGA 2XWXA 4HT5A 3RB3A 1SJ1A 2RILA 3T19A 4OX9J 2DH9A 1R6VA 3Q8PB 1UVLA 1VYAA 3I9V9 1Y5IB 4MH8A 4Y2CA 3PRBA 3E2EA 5GAHU 2XMAA 2NUUG 1Y5LB 3ENQA 2VDHA 1FKOA 4HHHA 3M8PA 2F40A 3OQ2A 2UUBF 1RWVB 3H42A 2ADCA 5ETKA 1JIHA 2HRUA 4Q2MA 3POTA 2IM1A 4ICLA 3CXCR 2IMWP 1RJJA 2ZJRQ 2BJDA 2RD5C 5K8NA 1GH8A 4DFKA 5KFPA 3OTOJ 1PJ5A 5HSPA 1M5PC 4N8OA 3CCTA 3WQPA 2MY8A 1MMDA 3IWLA 3AAWB 1AW0A 2HQIA 2QX0A 2RF2A 2R8HA 1F2GA 3GWCA 1NK8A 2QC3A 1X9MA 5BYQA 5ETQA 5L1LA 1TP7A 5KFOA 3G6ES 2QV6A 4R8UB 4CO2A 4C11A 3HI9A 2QN6B 4OZ3A 1EP4B 5KT7A 2GMHA 4I1TA 1PYSB 5G0RA 2ZH9A 4MYTA 2KO1A 2FJEB 4LMZA 3HZGA 2UVVA 4X2BA 4CLUA 3CDUA 4CZCA 1S1TB 4CLWA 2U2FA 5BYRA 1S1VA 1HKAA 4DSFA 1WKKA 3Q8SB 4L3NA 4HVZA 2DEJA 4C8OA 1NXIA 2JVRA 5FLXU 2NSBA 4P71A 3DMJA 3D9BA 2B9XA 3C66A 4I6YA 2JEIA 3V6KA 2WAQD 2DNLA 3MPWA 2PEBA 1Q5YA 2CRLA 4MT1A 4ZJLA 1TKXB 2K8GA 2F4FA 1KLNA 1HL6A 1TKDA 4U7CA 3GPAA 4UQGA 5IM0A 3V5RA 2ACYA 2HFUA 5A2QU 4DUZJ 2KDOA 1SCJB 1PYTA 4DCJB 1ELOA 2J9EA 2R9LA 4M63A 3C6TA 1U0HA 1YJRA 2XMKA 1NKEA 5CAAA 3MDFA 3KTQA 2C3UA 5I42A 3FSYA 3RR7A 2RB7A 4OI6A 3MF5A 1F9HA 3Q0AA 3VGTA 1A9NB 1G7CB 2A10A 4BS2A 3K0JA 5J2QB 2YVSA 4HACB 1QM9A 3KMQA 2F3JA 1HNVA 5A6WA 8RUCA 2KJWA 1FX4A 1VRUB 5HATA 3B4DA 3HHDA 4A47A 1JLFB 3BKTA 4G6VB 1H2VZ 3V2UC 3Q8QB 3SXLA 4IRKA 2CFXA 5D4PA 1G2EA 3ISZA 4GKKF 3RW7A 3PO5A 3DRXA 2C2RA 1GMVA 5J1PA 3EMTA 1EQMA 1W25A 3DOKA 2PN6A 4C0HA 3KLGB 3FZ2A 3JAMU 4DR2F 3W5XA 4DL2A 3QAEA 4B9LA 5IWAJ 1R3NA 2WONB 3AHPA 1C4AA 2JC0A 2YKOA 2K7KA 2DNKA 3K5MA 1QAXA 2FZKB 3G6XA 1NH7A 2M52A 4P75A 3BGOP 3VV2B 4DV0J 2ZE2A 4QYZK 4FVMA 4FKXA 1J5OB 2UU9J 4USMA 3QRRA 1RP5A 2VJVA 4DV6F 4HL9A 2L9NA 4M5KA 1DBDA 3KJQB 2AHOB 3MM5A 4DX7A 2KFNA 2PA3A 3KJVB 4DS4A 1H2UX 1NM2A 2G0CA 1U6BA 5CABA 2FHMA 2Y1LB 3A4TA 2HAFA 3O8WA 4GVLA 4X4PA 1VOMA 2D9OA 1SXLA 3W2VA 3GP9A 1JKHA 2O67A 1J5EJ 1HNIA 4UOFA 1TR0A 2KRRA 2N4DA 4DX5A 3CJKA 1U02A 3M1VB 1RAGB 1YBTA 4TY8A 1YTYA 3RU0A 2G2OA 3DRPB 3UNYA 3THPA 4DSEA 2KI2A 3PX4A 2I1RA 1EKSA 4X65F 3E01A 3TRGA 2AX0A 4DR5J 2W2QP 1FXLA 1QTNB 2HWTA 1ICEB 1Z1ZA 1RHRB 3LAMA 4DWIA 2HS3A 4C8LA 1S9GB 3KDOA 4RU9A 1Y5NB 5LMNJ 5KFKA 2JEJA 5L46A 1KS2A 1E6YA 5K14B 2JEGA 4WFBQ 4YDXA 5M2PA 4ED0A 3GFHA 4K8RA 4ZMMA 4JI6F 2B6AB 3HKWA 4ZK7M 3LUYA 2HQCA 4LSLB 3KHGA 5F3ZA 3CIMA 3R27A 4CO3A 1SL2A 5KT3A 2DH8A 1FDNA 4C4WA 2G9OA 2V9WA 3CJTA 2WOMA 4QU6A 5A0YA 2NSCA 4RNMA 3I82A 1TTHB 4DPXA 2CQ2A 1S0VA 1D1UA 2IRUA 1NUEA 3IAS9 4P9SA 1UWAA 3VGSA 4CM2A 1TAQA 1AROP 4ZHRB 3OTDA 1KD1T 2EEYA 1TL7A 1JLBB 2Z2LA 2V2QA 2VQFF 4DL4A 3QJPA 5E3QA 2ZH5A 4WKRA 5A2QY 2LQ5A 1X5PA 3ZZYA 4I7FA 2JFKA 3TAPA 2QFIA 5D8HB 4WFAQ 3MECB 3IWNC 1WHYA 1XMQF 1NDPA 3M8YA 2YNHA 2ZH4A 3CO9A 1BWEA 2HGMA 1JLGB 1FRMA 4P2FA 3MEGB 1T03B 3AOBA 4WIQA 5EDWA 4QPXA 1S4FA 2XMUA 2HNYB 5BR8F 2J6UA 1C4CA 4KSEB 3I56S 4WZQA 1X4CA 4FXDA 2HS0A 2OEKA 2RDIA 3LPEA 4OYXA 3OD2A 3KJFB 2XGPA 2FHJA 2LLZA 2OPSA 2OTLS 3D54A 4HHJA 4KC5A 2RH3A 5LSRA 3HHEA 5CYMB 2B9YA 3M6XA 7FDRA 3KK2A 1PG5B 3JAMY 3Q2TC 2RS8A 2ZBQA 1W7WA 4NZ6A 1L3UA 1V3ZA 2RQMA 2GIRA 1UEUA 3IP0A 3RB0A 4ZCMA 3T5KA 3V4MA 1C1BA 4Y28C 4OI4A 4EO6A 2BJ1A 3ZZTA 5E3PA 2WVCA 3D66A 3OBIA 3GV5B 3UO0A 2UXDJ 3QYYA 2LXUA 2C3PA 3SBMA 3C3LA 2AYMA 1UAWA 3WDOA 5M2UA 4IG0B 3IRWP 2OPPA 5FIIA 1VRQC 2Q79A 2APOA 3M05A 4KT0C 1SI9A 4JI3F 1GAOA 2Y3YA 1APSA 5T7LB 2J0SD 1Y3JA 3KWMA 4YB1P 1BXNA 4HLBA 3D1HA 2V8VA 1RTZA 3H59A 2HVDA 2LYVA 4KFBB 4X4QA 5L39A 2W9AA 3UN3A 5AE3A 4DR7F 1D9DA 3A12A 2O66A 3KG0A 4ZOSA 2NZCA 2JLEA 5LM7E 4OJ3A 2Z8QA 2VD3A 2FLPA 5E0OA 2N82B 2V67A 1GQEA 1GTHA 3DLGB 3D6TB 1HHSA 4CLPA 1QLNA 4MFBB 3GONA 4X4SA 3EXYA 2RKIB 4ZKAA 2R7SA 4IFYA 4NYOA 2W9CA 4RBUA 1AFIA 5HO4A 5B0EA 1KBRA 4IR9A 1X31C 3HVTA 5EUHA 4CP5A 3LP0B 1RTDA 4JV2A 1RA6A 2BMBA 2DB1A 1WUUA 2VFSA 3ETOA 3RYLA 4NRUA 4Z7YA 1WSVA 1VBZA 3TA1A 2FGCA 3RGIA 4DS5A 1FRLA 4P2XA 4ZPWR 1RU1A 2RU3A 4FKYA 2KKHA 3ELHA 3UVJB 3DM2B 2V0NA 2M9KA 4FVCA 3FBFA 3O44A 1VRTA 4MAKA 4J9NA 1RAFB 2V5HG 4EEYA 2DPJA 1S1WA 2MKJA 2ZD1B 1PBUA 3R9LA 3OR1A 1IUJA 3MR6A 3EGWB 2KT2A 5B0AA 3VAJA 4DR1F 1UMJA 5K20B 2ALYB 2XG8A 4YOEA 3EGNA 1KQGB 2VV5A 3PX0A 2W9BB 2D9PA 4YQWA 1JJ2R 3CCES 2HVZA 1OSDA 4X4UA 1R0BG 3UE2A 4DFJA 1TKTB 4DSIA 3VGUA 2R7OA 4OLPA 5HLFA 5HMXA 5E33A 3KMSA 1OY6A 1TKZA 2ABYA 1MWZA 2BYCA 3LA0A 1WSRA 3MWBA 4HEA9 5KFJA 5LJ5Y 1D0EA 1S57A 2DIVA 1SKWA 2H4WB 3K58A 3SSQA 1ZOTA 2PDAA 4KQZA 1B4SA 2DRBA 3CWJA 1H98A 4USUA 2OTJS 1I94F 2VODA 4ZITA 1RAIB 2MHNA 3BYPA 1JXVA 4DDFA 3VF0B 2HK2A 4CLSA 4BBYA 4IR1A 3OUYA 3JS9A 2KJVA 3LW5C 4GRSA 4NCAA 4LRBA 3IG1A 3DLEB 1FTRA 2YKMA 2OP5A 3AH6A 4KIAA 3KHHA 4RW8B 1NHKL 8AT1B 2AP6A 1X4BA 4NLWA 4U8YA 4WE1A 3BKFA 1CJUA 5DQGA 2JEFA 4QJVA 2F4VF 2K3IA 3H20A 2UUAJ 1V5VA 1HYSA 5HMYA 1FVQA 3DU6A 1I6JA 3PACA 1K47A 1KTQA 1WC6A 4KB7A 5KFAA 3ZZZA 3B4MA 5K8OA 3I5AA 3PW5A 1GMWD 1KSPA 4DV2J 2AW0A 2AKWB 5L1JA 1TFYA 4ZP8A 3QWPA 4WYLA 4M1KA 3A3PB 5ETRA 1RHUB 1GK8A 3TA2A 3BZQA 4BLGA 4ZCKA 3OL9A 1RQ0A 3M32B 3M2VB 2B4UA 2HVEA 1B0TA 1F60B 5KFMA 4M95A 2F63A 4LF8J 1YRXA 4ZVTB 3MD1A 1Q53A 1HNZF 4N77A 1MU2B 3CMES 3HT3A 2UP1A 2VB6A 2QLFB 3W5ZA 4HI1A 3QFHA 5KFEA 3S7RA 2DGVA 4DF4A 3E51A 2HHSA 5HL7Q 4F3QA 1UJ5A 3GIMA 1RSCA 1D3WA 3HFVA 1SIWB 3BJYA 4UUWA 5KOXA 3D0HE 3NOGA 3FUYA 4LF4F 5J2PB 4Q44A 4PWDB 2AJQA 4K50A 2GGPA 2FQQB 2B9EA 4KGXB 3DRSB 4LF6F 1KFDA 2OFGX 5L1IA 4GVBB 1N0UA 3FEYB 2LQ8A 4USJC 5HP1B 4ZVRB 3HHLA 3D3CJ 1GXUA 2GCFA 3G9CA 4LIWA 2QRRA 1S49A 3E8OA 5ETPA 3IR7B 5C42B 1NO8A 5ETNA 2U1AA 4NI2B 1GT8A 1FWLA 2DO0A 3K5NA 3PR4A 3IR5B 3CDAA 5KAKA 2AJFE 2H65B 1YBUA 3S1TA 1U1KA 3EGZA 3H7HB 2DHAA 1UZDA 4DXLA 2HHQA 3MOJB 4ENOA 4X64F 1FFGB 2VBXA 2CJXB 4YY3F 9RUBA 2GHWA 1FRKA 3C2PA 4HR2A 2N7CA 2MGZA 2LKZA 3D5MA 1QE1B 4V19J 3OPKA 2XY7A 2QO3A 1KR4A 1BE4A 3CIZA 3EVWA 4PPZA 2QMXA 3R5DA 1EKRA 4RU2A 3HLUA 3CDBA 2FLNA 1W2IA 3NNCA 2UUTA 2EFGA 1RHQB 2PI4A 1IM6A 3HMJG 3LP1A 1S1UB 5F0WA 2CPYA 1GEHA 1VHIA 1C1CA 3PXGa 2AJ1A 2HHUA 4KHPJ 1YSJA 3P8BB 4HT7A 5T14A 1HD0A 1U6ZA 3KUEA 3NP5A 3SCLE 3ZTSA 4LBPA 2ZZNA 4DEZA 2MZ1A 4G1IA 2QE5A 2YWFA 4OHWA 2XMVA 1CJVA 3MR2A 2A1BA 5K8PA 1Q8BA 4IO1A 3FMBA 3H2LA 2BKOA 1X5OA 2IYIA 1WEXA 4JI1J 1EARA 1RHKB 1O6XA 5JVGQ 1UPMB 3UR3C 1FKOB 1SH0A 3M8PB 5G4DA 4LRCA 5DLFA 1NB2A 4B9VA 3G8SA 3U27A 4P10A 4V1Ak 1HPZA 4X66F 1QAYA 4OV1A 4ICLB 5KFUA 3CJ5A 1RT2B 1XMBA 3IN5A 2RMLA 1N52B 2M3DA 3PJ9A 1KQSR 4OI0A 2AZ1A 3BBFA 1IWGA 2CNKB 2W25A 1RDRA 5D15A 3OFHA 2AD9A 2RF2B 2A6OA 2DNYA 3BGRA 2QL5B 4CTAA 3ITHA 4PXCA 1N32F 1WEZA 1Q82T 3CC4S 3QZ7A 4F2SA 3R2DJ 2MEWA 3PW0A 4O3OA 2KG0A 2VG7A 4C11B 2ZKTA 5CD4H 3T6BA 1ZS6A 3CJQA 1HLWA 1SJQA 4ZVEA 4I68A 5G0RB 1SIZA 1T3OA 2IM0A 4FPRA 3EPIA 1VQYA 3BN4A 2GC8A 1FFSB 3NGRA 4CH0S 1S1VB 2M4MA 2YPYA 2CPFA 4W90B 3I55S 4NLDA 3NAHA 4LSNA 2VKRA 3CCWA 4NE9C 3Q86A 3TEHB 1HWLA 1HMVA 4C9DA 3PZPA 3L7OA 1L3VA 3DMJB 4LFCJ 2FVRA 2E7XA 3VR1A 3FCHA 2K1RB 4ED2A 3GTYX 2ZJPQ 3NWRA 3CDEA 1TUVA 2YX4A 1LW2A 2ASJA 4LR9A 3ZFVA 1TL4A 1VQ5S 1DQAA 5KG0A 3KLFA 2AEJA 5E41A 2J76E 1WC5A 1HBMA 4F26A 2GIQA 2WW4A 1NK0A 3MM6B 3QIDA 4NPOA 5IM0B 5KFWA 1HI1A 5KFRA 4NXNJ 3TA0A 1FDDA 1S9EA 2R7XA 1V6HA 2OD6A 3C6TB 2V8GA 2FJWA 1R0AA 3UQSA 4DV4J 6FD1A 1SL0A 1WG4A 1WHVA 3CSKA 3MCSA 1X5TA 4K4SA 1HWJA 5I42B 2FDNA 5KFHA 4USWA 2IMOA 4KO0A 2P9GA 2QLXA 3ICLA 1NZ8A 4GKJJ 2D3UA 5KG5A 4LSZB 2QT7A 2DHSA 3KXDA 4HDGA 2HHHF 1HNVB 1DZ5A 1CULA 3NCRA 3DNCA 3HJFA 5KFTA 1Z4UA 1FWPA 3C15A 3DDKA 5I3UA 1JJHA 2UZAA 1QVFR 4NLPA 4RW4A 5LSLA 2ROEA 1FXRA 3RBZA 4CRJA 1M5SA 4YUDA 2OPRA 1VR6A 2YWHA 4Q0BA 4FYDA 4PEOA 4LRAA 3GFYA 3EDRB 1QAIA 3DOKB 2IA6A 3FEXB 2H5IB 2M5YA 2JOQA 4FBUA 4C48A 4P73A 1IR0A 3TVKA 3M6WA 3JTOA 2EBEA 4UT4A 1T9UA 2JVOA 3IBFB 2BJ7A 3R1HA 5CH7B 3HHKA 2PEHA 1R89A 1RI7A 4O4GB 2QGFB 3T3FA 5CQGA 2FC8A 2ZE2B 4DLGA 2MQQA 2IPOB 5C2GA 1ZM3A 2XCPA 1N5YA 1RWXB 1FFWB 3SCIE 4IFVB 5DZ7A 3NCPA 3OFEA 3MM5B 1XNRJ 4ZPTR 3TQ1A 2J5AA 3RBEA 3NCQA 4NRTA 5HVHA 2KFZA 2VBZA 3D67A 2HFNA 3DCAA 4ZVFA 1HNWF 1CJKA 3GB0A 5ETLA 1FK9B 1WF1A 4ANDA 1QVGR 4QIWD 4QWAA 3JSRA 3GLJA 4AL7A 4H4OA 2LP4A 2DITA 3W2VB 5F9LA 1JKHB 1HNIB 3J7YU 4DR4F 4QW8A 4HHUA 2P9CA 3MEKA 1ZAVA 1IKXA 2EVZA 3V4IA 4A8KA 2PT0A 1A0OB 2V68A 3IM8A 4CLKA 2MJUA 3R7SB 4WK3A 3E01B 2UXBF 4ZPCA 2DR6A 2O01C 4ID8A 3LWMA 2IRXA 1WI8A 1WOPA 2IBKA 1WTFA 2OSRA 3W9JA 4LFAF 3CUNA 1YJTA 4IH7A 4LBHA 4DV1F 1ZTTA 1TFWA 4CNYA 3ZTRA 4FZVA 2DRAA 1X4EA 1UP1A 2L9WA 9ATCB 3RG6A 4JI4F 5JXSA 4A46A 1FTCA 4DN0A 5HBMB 1S79A 2GO8A 2BJEA 1K44A 2ZH3A 1VQKS 3GIIA 2DK2A 4EMDA 3EPGA 2WOMB 2LXIA 3P49B 3QMQA 3TARA 1HQEB 2COLA 5B0GA 4J9KA 2ZH1A 2DO4A 3A3NB 3PYEA 2VHGA 3GJQB 1OWXA 5EN1A 2WCXA 4WP9A 2M7SA 4DR3F 4NYPA 1NZAA 2DCUB 4YHHJ 2ZH7A 1N33F 2IFXA 3MXHP 2J9DE 4NMXA 4I7FB 4A8YA 2HNDA 1TELA 4LVNP 3H8YA 1IR1A 1BQMA 3IGNA 2DNNA 1JLCA 3PY8A 1MW7A 3S01A 3QATA 1RBAA 4X62J 1B99A 2ZWOA 3QZ8A 4PG6A 4O44A 3PIOQ 3PW2A 4KGMA 4QWEA 3L4BC 4LF5F 2RRAA 2E9ZA 1GFWB 4QWCA 5KFDA 1F9EB 4NLOA 1FT8A 5D77A 3PO4A 3UW1A 1XWLA 4RKUC 2RUGA 4DQQA 2F8HA 4JI7J 2XYHB 1IXKA 3P6YC 1ZZFA 2X1GA 3ZTOA 5J2NB 1ZA1B 4DN9A 2MQNA 2K3KA 3W7BA 2OPSB 2XHWA 4WBFA 3SFGA 3T1YJ 1ZH5A 4PABA 4JI5F 3KK2B 4B3SF 2HZAA 4NLTA 1XJWB 2OLWA 2C2ZB 2DGWA 1ZTWA 2CXEA 1FE4A 4LQ3A 4OL8A 2JL9A 5D78A 2CAJA 2HGLA 1T94A 2KYXA 3K5OA 3EDQB 3EGVA 2NYHA 1C1BB 1XTZA 3KLEA 3AODA 4ATNA 1GX6A 3M9OB 4GC6A 4JV1A 2BVZA 4WFZA 4JV5F 1HHQA 1U1RA 4PQAA 4ELUA 4IOAQ 1HNXJ 5GMKa 2W8KA 2RAQA 3Q8UA 4MIBA 4DV5J 3OHBA 1XNQF 1OO0B 4X4TA 1JQGA 2CJQA 3ZZRA 4B08A 3GJRB 4CWBA 4IG3A 5B0BA 4P6QA 4Y6IA 1MWQA 4DG1B 4OMFG 4ECWA 1Z2ZA 3MEDA 2KYZA 3PVXA 5FDLA 3EVOA 3JXOA 5F8MA 4WYWA 4IH5A 2HFVA 1TVRA 3ULHA 1DLOA 2WZ1A 3K5LA 2AZ3A 5DDRC 1PC5A 3D6MB 4B3MJ 4N8NA 1VIXA 4CLFA 4IDKB 4DCOB 2XHCA 4TKTA 2LQJA 4BDPA 2HQFA 3GYXB 3M4XA 3RBXA 5C7PA 4JI8F 5AJ3J 4PUOA 2EFQA 5C24A 3OVSA 1SJ4P 2MSTA 2R8IA 1CQMA 3NG8A 4USHA 1ITPA 5KFQA 3MM7A 1NJIT 2BE7D 4YMEA 2I5JA 4Q43A 1RE1B 4EO8A 1DY3A 2CADA 3GYNA 3AA9A 3RRHA 4IFYB 4I64A 5EWGA 2W9CB 2KT3A 5LT5A 4J5OA 2DT9A 3PYFA 3HVTB 3JSMA 1LWEA 1RTDB 5B08A 1HI8A 1JX4A 5KFCA 2ZHBA 1AZSA 4MMOA 1FRXA 5A8KA 5A6PA 1IBCB 4FF1A 1FXDA 4AE5A 2X1BA 1JLEB 4Y65A 2DNQA 1PAEX 2HWIA 2V69A 2WK4A 3DYAA 4O3PA 5BYSA 3N01A 2XI2A 1NJXA 1KOOA 2A18A 4IRCA 2VKZG 2LDYA 3UDLA 3CTRA 3ILIA 2AWZA 2KG1A 2RHSB 2H51B 2MYFA 3SV3A 4EBDA 4MKVA 2YNFA 3LF0A 3D0GE 3HSDA 4USTA 3QJLA 1IBKF 3V6DB 1OY9A 1DTTA 1XR7A 1MSWD 1FRJA 3ISND 1JLQA 4NXMF 2JLFA 4CT8A 4F0MA 1SC1B 2LA6A 4LF7F 1K8AT 2V50A 1C0TA 2NS1B 1TKZB 4B3TF 3AD9C 3DRYA 1YIJS 4OHYA 2VH7A 1ZM4A 3OL6A 2NPFA 5ETMA 3BH6B 4Q8EA 3WX4A 3DGPB 5GAGU 3G86A 2YNGB 3BPSP 3GJTB 2R3VA 2DXDA 1SUQB 4QOTA 4A8XA 3QRQA 1RT5A 4NA2A 3FRZA 2EC2A 1UVKA 3CMQA 3M30A 2YKMB 1LXNA 3T1HJ 1U2RA 1SQEA 2FC9A 3BBBA 1ZZNA 4NEZA 2IHR1 1YRUA 4O0NA 3IXQA 3MUTP 1N36F 4PG5A 1BUXA 3L7PA 1N34J 2VU5A 3MI7X 2IJFA 1IQZA 2DD8S 2FVPA 1Q7LB 4USVA 4J9UE 5E3AA 2PMWA 1HYSB 3MPUB 1K9MT 2L08A 3HK2A 2EWHA 3MR7A 4F0HA 3CO0P 2YPZA 3CT9A 2OMLA 4JI2J 4ALZA 4XDDA 3PCOB 3EX7B 4RUAA 3JQMA 3N5BA 1NSPA 2HIYA 2E5LF 4J37A 3H5UA 3Q23A 3BPDA 1EB0A 2KTQA 3V6JA 2ALZA 2AEFA 5CYQA 2DHXA 2MZTA 1WC0A 4ECSA 4TQSA 3GE9A 3A8IA 4FYVB 2YQ1A 3DHWC 5KOWA 2P8IA 2W2NP 5LXYA 3AD7C 2BXJA 3GV8B 1RTIA 2HPUA 1U1OA 4UOCA 2EPIA 3UN5A 1KNZA 3N28A 3FQLA 2Q3PA 3LOUA 4CO4A 4M5NA 2CJAA 3J81j 2MQMA 3MPYA 3M8QA 1WJ9A 1C0UA 2Q1LA 4KE5A 1WHWA 1KWMA 2LMIA 4DV3J 1G4CA 2QL7B 3QAUA 3N6NA 2ZOFA 3K57A 2VQEF 2R8KA 4LR8A 4WZMA 1QDUB 2CQCA 3ENWA 1G1XA 1JB0C 4P52A 4C8ZA 2QMWA 3NXZA 1JWWA 4FP9A 2BBEA 5C5JA 1X4DA 6AT1B 3D28A 2ZUAA 4OYIA 3PDNA 2LU2A 1X4GA 4OX7A 3H5SA 2KB2A 4ES2A 3S6EA 2DNZA 3MMAA 3TP2A 3IS9A 2YWGA 2VF3A 4ZVGA 5HANA 2YBVA 4ANCA 4WFNQ 3FBCA 2UUBJ 4RWWA 4ECXA 4PKDB 3VAMA 4O3NA 2ZVSA 4B02A 3EZOA 1T9TA 2H48B 2F5GA 4MYUA 5AXMA 2E7WA 2V2ZA 2VG5A 3K7RA 2J9CA 3CCSS 3CCLS 3U1LA 4YB5A 1U1PA 1WELA 4AYBD 1BD6A 5KFIA 1WWHA 3GG1A 4DZDA 2HHXA 3KLHA 3NL0A 2R7QA 2E5GA 2PO4A 4KPYA 2UV8A 2FHJD 2OD4A 2D41A 1RT6B 4XTTA 4OZ1A 4FXVA 2Y0SD 4G1QA 2YXLA 5KG4A 4A8WA 3Q89A 4ZJQA 4EYHB 2G0JA 2UVWA 2HQGA 5DDOC 1RTJB 3TYTA 4I56A 3HP6A 4OZ2A 5ETTA 2Z30B 4C98A 2DGQA 1IKVA 3J80U 2C2OB 1RAHB 3LP1B 2XS5A 1CSJA 3GFZA 3TUJC 2X1AA 1C1CB 2H9ZA 5HJXA 3NNHA 3CCQS 1HQ2A 1QJHA 2GNKA 3SI8A 1CG2A 5L1KA 2X51A 5IQ6A 4XPEA 2VPZB 3E3XA 1JJCB 4M5LA 3UCZP 2EFOA 1TUWA 2CZ4A 2RSQA 4B3OB 2CZ9A 4U67Q 1CJVB 2ZNZA 4WFXA 2LQBA 3WC2A 5H1SV 5E2QA 4XDCA 1XEZA 3MMJA 4YFUA 4NCGB 3KNGA 3NGSA 1U49A 4FBTA 3UCGA 1R31A 3B6BA 4KBIA 1HPZB 2R2UA 5IT9Y 2E9RX 3ZZ0A 1S1XA 3HSJA 4FF3A 2MJNA 1FDBA 3T9NA 1S10A 3LALA 1KLMA 4A8QA 5GMDA 3IR6B 3US5A 3AOAA 3QT6A 4X84A 2I6WA 2VBYA 4U6PA 4HH0A 2BRLA 3QJJA 3PYDA 2BOPA 1RUSA 4RLEA 2BE2A 3ILJA 2BQ3A 1IQTA 3ZXWA 1PO6A 2XLIA 3BGRB 4CTAB 4PXEA 5F8LA 3M2RA 4ELVA 3CGIA 2XZDB 3W60A 1H6KX 2IM3A 4J9QA 3M6UA 4RW6A 2VG7B 1GX5A 2PI5A 4GKKJ 2AQ4A 3MURP 2XMWA 4K4TA 5CYJA 4J9RA 1R8AA 4PWUA 1Q86T 4DR2J 4X4NA 4P7VA 4M94A 3LP2A 4AT1B 1MROA 3AD8C 5B0DA 1EAYC 3NMRA 4LSNB 1U4BA 4GC7A 5GMEA 3LWLA 1NEEA 1HMVB 3ILLA 1Y4ZB 2BEFA 2HWHA 3G2XA 3NS7B 2XLKA 1Q0NA 1RU2A 2FB0A 4DV6J 1WF0A 3SSRA 1CC8A 2OH2A 3CCMS 2KXNB 1NHVA 3H4BA 1LW2B 2ZBCA 2AGQA 3KLFB 1M5KC 1HBMB 3D6HB 4ZVQB 5EX0A 2R2TA 1N5QA 1Q8IA 4M5JA 5C2CA 5KG6A 1RLDA 1ZETA 2OMOA 4R8UA 1RCOB 1VS3A 2E7VA 2VA3A 1S9EB 3LTOA 2ZC4A 4K4XA 3ZNJ1 1R0AB 1SKSA 2V2KA 2ZBRA 4IOCQ 1DARA 1YRTA 2ATCB 3F56A 3FGVA 5B0CA 3PFEA 2PFDA 1PYOB 3QT7A 2HVHA 5DZ6A 4DUYF 2C3OA 2E29A 4DSJA 2DR5A 3JYTA 2OSQA 3TZXA 3RB4A 1WC4A 2DJWA 4C7QA 1CULB 1RT7A 4X65J 3KLVA 2BM0A 5HVFA 3BS9A 5I3UB 4C6AA 2UXCF 3FBBA 4RW4B 2M2BA 3VVUA 4K4UA 2OPQB 3U1MA 1UTAA 4BWJA 1F0XA 3I32A 2B8PA 3K59A 3D7SB 3TJ8A 4TN2A 4DPYA 4Q0BB 4Q8FA 3C46A 3J80Y 1QUVA 4JI6J 2VDIA 4CO0A 2W7AA 2G2ZA 4W98A 3MMBA 5IC6B 2YQ0A 2BA9A 4ITSA 3QPIA 4ZP7A 4ERDA 1DQ8A 4WIIA 1F3FA 1KEKA 2QA2A 2ZZMA 2KXHA 1VQOS 1RWOB 2XNQA 5HK4A 5A76A 5J1EA 1N5YB 1Q79A 3CDWA 1N5TA 5J2QA 2W2OP 2WBRA 3OFGA 2B7BB 2XZWA 2VQFJ 2V8DA 1A6LA 2C22A 2MZQA 5GADU 2MQPA 4G3IA 5F9NA 1CJKB 1JLFA 4EBEA 2MMYA 1NAQA 1LEOA 3HJVA 4F50A 1B3TA 1XMQJ 2ZUGA 2CJKA 3BEGB 1JXEA 4H4OB 2XWYA 4OI2A 1U0SA 3R7BB 2FY1A 2HVIA 4DQIA 2EG2A 3G71S 2V4JB 4EZ9A 3UD3P 1S48A 1RABB 3C16B 1IKXB 3V4IB 2HHPA 2QA4S 3GG0A 1RISA 1YZ7A 5EWEA 4IKAA 5BR8J 4JI0F 1EX8A 2MPUA 5DO2A 3UD5A 5GAHI 4F2RA 1S72S 3P3DA 1VFJA 1X7VA 4PG7A 5B09A 4K0KF 5HQMA 1T95A 2JWNA 1NKCA 3W9IA 4RNHA 3HKZD 2K06A 3PEHA 3CULA 2VG6B 4CLLA 2DRDA 4AL6A 4QQBA 1SH3A 2JLGA 4DQRA 1KKHA 1UWBA 1SJ3P 2HHWA 3HHLD 4JV0A 4I2PA 3FC9A 2LU1A 2V63A 3GIJA 4BC9A 1HHTP 3MPDA 4NZ0A 3LPYA 3L9ZA 5KFYA 4ZS6A 1N4LA 5ITHA 2ZH2A 2W7PA 4DSLA 2R7RA 1X5SA 2IM2A 1HW8A 3H2VE 1IBMF 4C8KA 3SV4A 5AE2A 1VC6A 1ZM2A 2QJ3A 2UUCF 2JNJA 4BWMA 1SL1A 3CE8A 1I5OB 3VAIA 2V4QA 2BR0A 4PXBA 4Z7CA 3N4WA 3GYGA 2BW7A 4UW2A 4JI3J 2HNDB 4HYKA 3B54A 4AUKA 4CI0B 3PX6A 3IBCB 3CPWR 5K14A 1JLCB 2GFFA 1H38A 1MMNA 3QNWB 2AJ4A 1NHUA 5J2MB 1HR0F 1S59A 5J1NA 4DR7J 2DR8A 2DXFA 2MZRA 5FD1A 4CM0A 4CYUB 3H2UB 4Q2LA 4V19X 3OJUA 4LSLA 1KC8T 1S6PA 4A4JA 3G8QA 3WHIA 2XNRA 3TUPA 2YNIA 1PSDA 2CQDA 1S7IA 2IA0A 3K8WA 4CLZA 2DKOB 4K7QA 3HDSA 2XMMA 1KFSA 1QUPA 1Q95G 4QWDA 5GAEI 1VGYA 2XTJP 2FLOA 5KFGA 4Y2IA 3R97A 7FD1A 4ZHRA 3THTA 3PV8A 3PW4A 2R8GA 2GS8A 2GVZB 2HKEA 3R5JB 4ILMA 2SXLA 1FEEA 2HFSA 1U1NA 5HMWA 3KYLA 1IBLF 2CA9A 4KHMA 3BGUA 1RKJA 3KLEB 2VFVA 1P6TA 2ZEJA 2NQPA 2WSEC 3P5BP 4DQPA 1J2VA 2BUNA 2DY9A 2BRKA 5L9XA 3GILA 1T03A 1BY9A 3L3CA 3OFFA 2PC6A 3H5YA 2HNYA 4FDFA 2MB0B 3AXKA 2WTFA 4KPCA 4NASA 1URRA 2B5JB 4IG3B 1XMOF 1TV6A 4AD6A 1RTHB 4DR1J 4GO5X 3CD5A 3DLKB 3MEDB 1NJZA 5FDLB 3ZTPA 2J0WA 1TVRB 2VJUA 1RHJB 3RTVA 1UCNA 2YH1A 2AGOA 4TNOA 5CYMA 7AT1B 1AUDA 2N7YA 3MFIA 4BHQA 1T9WA 3NMAA 5D0HA 2IVMA 1OY8A 2QLJB 2GIFA 3N79A 3HD2A 2N4CA 1YWXA 2G0IA 2MTLA 4KY3A 3KNAA 2C3YA 3OW2R 2CNLB 3FNNA 3ENVA 5L38A 3ET6A 5FLXY 1I94J 1SJRA 3GSDA 4DL7A 3QRPA 1PJ6A 3NS5A 2C28A 2CNNB 1O8BA 2YH0A 5D6GA 3CCJS 4Y3CA 1CQNA 2V9KA 3R5CA 2MXYA 2ROPA 2CQGA 3P45B 3GCWP 3LANA 4IG0A 3MAHA 2PGCA 1RT1A 3DI6A 5H9EJ 2E1MC 2RRBA 3O1LA 4QIEA 2XO6A 5A8KB 4P7TA 2WRMA 2MDAA 3SMZA 2ERRA 4NA3A 5T7LA 3IGVA 2IAJB 2Z58B 2F4VJ 3AJDA 2DVIA 3DFEA 3PKMA 2IJNA 1FO1A 3DYAB 4AXIA 3RZAA 3A1YG 2K7JA 4KFBA 2LCWA 3I0SA 1AUSL 5L8RC 3SIPB 1WHXA 2W2PP 5DJBA 2W01A 1R0CB 3A3OB 1YITS 3ZZUA 4OFZA 1KHWA 3I5BA 1FWKA 5ETVA 4O3RA 2J7UA 5E5NA 1Q1KA 3BSCA 2RKIA 3AY0A 3PR5B 2KVIA 3TUIC 4LF1A 1S7HA 2Y0BB 2X3GA 3TOQA 1UFWA 1SPBP 4FYWB 4OZLA 4WTYA 1DTTB 1UW4A 4J9PA 1U1LA 2YTCA 1JLQB 2R2SA 2VUGA 1VHFA 3GIRA 2BQUA 5B0FA 1HNZJ 5JUMA 4WJBA 3DC2A 4YB7A 3RUBL 3AT1B 4DPTA 1WOOA 2BM1A 1MN9A 5I3PA 4YR3A 3H4DA 3VHQA 1RBOB 3SQGB 2DHGA 4B9NA 3D4JA 1F2HA 3SDEB 3DM2A 4M5IA 2WB1D 4P2SA 3QGHA 1RT5B 2ZH8A 2NUHA 4ZVPB 4LF4J 1WKLA 3ENAA 4ED6A 2ZD1A 3TO8A 3D1OA 4N7TA 3M30B 3CJ2A 4ED7A 3CJ4A 3MM9A 2AYEA 4J9OA 4LF6J 1V3RA 5F8NA 3DLBA 4BC7A 2KFYA 1LQ9A 1H7WA 4OZ5A 1HARA 3T1AA 4LR7A 4B9SA 1RT4A 3WIVA 4FYXB 2VFTA 2GW8A 1IKYA 2HZCA 2BDPA 3I5CA 1R8HA 1VMBA 3WX8A 4OJHA 4M5DA 4F4KA 1KVJA 2MSSA 4MK9A 3M2UA 4LQ9A 4X64J 3NBPB 3AA8A 2A0FB 4QW9A 3SSSA 4YY3J 4KR0B 2Y1RI 5CYQB 1X9WA 5KG3A 3ISNC 1S12A 3IRXA 2YKPA 2ZITA 1RTIB 4ILLA 3D1QA 2HNZA 3RB6A 4X4RA 5F8HA 1FA0A 1H0HB 2HHVA 3UDVA 4PAAA 2GVDA 2I38A 3DRRB 3M8QB 2UVRA 2M0GB 4J91A 3UFCX 2HFZA 1D9FA 1RA7A 5AE1A 2HG4A 4DMZA 3BO2A 1JMTA 1RACB 1Q81T 2FPHX 2WW8A 1FD8A 1UVMA 1WC1A 3T41A 1OQ6A 2DNGA 2CPZA 2EKYA 3W2WA 4U8VA 4M5HA 3K2YA 5C25B 3GIKA 3J7ZT 5K5MA 2Y1IA 4PXDA 2AYGA 2KZZA 2ZHAA 1H73A 3PEJA 5H9FK 1QSYA 3R3TA 4MKYA 4IUFA 4L75A 3GMGA 4Y2KA 2GHPA 3TI0A 3JB9k 1RLCL 2DNPA 3MMAB 4A8OA 3FCVA 3IS9B 1F3VA 1YJUA 4KGZB 3M32A 2XMTA 4ZN3A 2VPWB 3IBWA 3M2VA 2V4RA 1S77D 3CC2S 2YKQA 2KM8C 4X66J 3WBZA 1U1MA 1MU2A 3IFEA 1R27B 2R4FA 3L09A 3BSNA 2B4VA 2EI5A 5KFSA 4LF9F 3KLIA 5KFLA 3HSZA 3W8GA 4ZLPA 2DIUA 5DETA 1N48A 3KLHB 3FZBA 1HQUB 1GXTA 5LMUF 5KTQA 1N32J 3NEKA 4CQ1A 5AXNA 2W4DA 2F1FA 1UA0A 3D6FB 5FJ4A 4DV7F 5HROA 1M5HA 2ASDA 1QY7A 2HLUA 1LW0A 4ID5A 1SVDA 3VZHA 5DG8A 2GMLA 2IRYA 2HQDA 3UR0A 5D4LA 1IKVB 3KG4A 3SYZA 1FCAA 2D3OR 5JMNA 4J7CA 4OYMA 2OELA 2R42A 1LKZA 2ATLA 1UL3A 4KH0B 4B3RF 4ER8A 1TL5A 1D8YA 1U2FA 4YB6A 4NI2A 5F8IA 3QQCD 1NU4A 1TQLA 1JXLA 3ZC4A 2CQIA 4F3OA 1FNOA 2CQHA 3AFGA 3FFIB 4DL0C 4CT9A 4EI2A 2FZGB 3VALA 3CJ0A 3BQ2A 5F0UA 2R2RA 3FVYA 3I9ZA 4NLQA 2VOPA 3A8KA 5EGYA 4N5SA 2D3O1 3SFUA 1F1BB 2DGTA 2NREA 2I2YA 3BGLA 2BJ9A 1WI6A 1WF2A 3VAHA 1Y00A 3OVBA 1FD2A 3BBCA 3G6VA 4FNIA 3FDSA 3OSNA 6FDRA 1KLMB 4ZP9A 2RQ4A 4F04B 1LWXA 4RW9A 3CNQP 4ZA1A 2JZ5A 3O2IA 3LQVA 2BE2B 3HVWA 3IA0A 2HHHJ 1K73T 3NRBA 2WVEA 1NKBA 1I1GA 4DR6F 3M2RB 4Y00A 1TL1A 4WFYA 2MLYA 4RW6B 1CC7A 2P6SA 4QR1A 4JYAF 5DGAA 3GQCA 2A2CA 4K5RA 3MOZA 1FESA 1REGX 1U47A 1BWVA 1T05B 2ZM6F 4NL5A 4QZVB 1S6QA 3LP2B 1WOSA 1MROB 4JOUA 1R8PA 3VTIA 3LH2S 3ONQA 1YLXA 3OXFA 2CG4A 2CG8A 3GU0A 2Q6BA 2OEJA 3M8RA 1KN6A 1K0TA 3HHNB 1RT2A 2CJ9A 4OQJA 4OYAA 3QBCA 4L3KA 3GZ7A 3D68A 3UDEA 3BM7A 4FXWA 1P8GA 2KHCA 4OX6A 1OQ3A 5KG1A 4S0MA 4HDHA 2FJAB 4CH1A 4F4YA 2XI3A 2PA8D 3HVAA 4PWWA 4ETXA 3GR0A 3F0NA 4N47A 4IQXA 4I2QB 3CJ8A 1HNWJ 4LT6A 4EU0A 3MMCA 1UFLA 4FS2A 2QTWA 2WSCC 3H40A 1IR2A 4WXOA 4CO5A 2CNOB 3CEDA 1TUGB 1X4FA 4DR4J 5IXUA 3ZTQA 4OZ0A 4K4VA 1GNKA 4QIVA 3RW6A 4F4WA 4TU9A 1SV5A 5A8RB 3OXGA 3FJ2A 3JYTB 4WP3A 2PMZD 4WTOB 4UTGA 4C8NA 1RT7B 3KJNB 4ZVSB 1ZA2B 1M1HA 2UXBJ 1M90T 1LXJA 1V9OA 4OHXA 1R43A 3CW2C 3OHAA 3G8TA 4LFAJ 2K1RA 3TAMA 4DV1J 3KUHA 2HRTA 4DHVA 4MTPA 2FY8A 1FDAA 2B8QA 1SQFA 4WWSA 1WTBA 3PYGA 2ILZA 2M8HA 3MCOA 4PZVA 3RR8A 1Q5VA 1UFKA 4JI4J 2DY1A 2MY7A 3MM6A 1U25A 2GX8A 1U45A 2DH7A 5RUBA 4RNFA 3MMBB 3FK4A 4PG4A 5GAEU 1REVA 4I69A 3JQJA 4AXJA 1IKWA 1M1GA 1WACA 3EE3A 1RHMB 3POTB 1IJFB 2J9DA 3I87A 1RBLA 2WHOA 1EETA 1ACMB 2PE8A 4DSKA 5J1EB 4PR6A 3I0RA 4TLRA 2J8AA 2C42A 3RRKA 1PKUA 1SB6A 2QYCA 3HSGA 4Y2AA 3C14A 1JLAA 3G82A 3R5GA 4DR3J 2AU0A 1WEYA 3QLHA 2B0GA 1P1TA 5LL6d 1N33J 2V8PA 4GO7X 1RWUA 2RQCA 3DOMA 2V2VA 3CD7A 2NYIA 3H0PA 1RADB 3PG9A 2RHQB 1EQ0A 3MD3A 3TANA 4I0WA 4ILRA 1RAEB 3Q8RB 2KXFA 2B43A 1OYDA 1JNZB 4IRDA 5KT2A 4C3KA 4LF5J 2KH9A 2HHTA 2CVIA 3L7UA 1VI7A 2B4OA 4O4GA 1HWUA 4H4MA 1JK9B 4G1PA 2LDIA 3QIPA 2LFVA 4NLRA 2FGOA 1RKIA 4OJ1A 3SCKE 5IT0A 5KFNA 2BKNA 3QT8A 4IFVA 4JI5J 2BV3A 3WC0A 3TNVA 2KT5A 3PFOA 4B3SJ 2XLJA 1OYEA 2I8EA 2D74B 1UWBB 3B78A 4I2PB 3VWSA 1FK9A 2G2YA 1NB7A 4LIRA 3Q24A 4ZPBA 3ZZOA 2P9EA 4L6V3 3WIUA 2RRNA 4DQSA 2HEKA 1U0HB 2BJ3A 1C2PA 4JV5J 1T11A 4NX9A 4QR2A 3R6LB 2IC3A 3FCWA 4J9VA 1XNQJ 2XBPA 3HM9A 4C97A 2VZ9A 2YKAA 3TZWA 1ROFA 2QLBB 3NLCA 5IZHA 2IIHA 2DEIA 1QSSA 1FJGF 2ASYA 4DPWA 2R7WA 4LFBF 3LGHA 3VCDA 1IN0A 3MAQA 4DI6A 5L9NA 1AYEA 2OI2A 2J7KA 2VL1A 1YDLA 4USIA 5KFVA 3K89A 2CUYA 1XN9A 4ES1A 4OX9F 2EFPA 4DFMA 1AFJA 4F4ZA 4RW7A 3V81A 2A6MA 2MKCA 3TZZA 2Q6CA 2H3EB 1VQ8S 1VDHA 3SEOA 2J6SA 2J7WA 1UKUA 4TU8A
chains in the Genus database with same CATH topology
3KJNB 4ZVSB 3NS7B 1RWPB 5IC4B 2HBZB 1IBCB 1RHUB 2CNKB 1SC4B 1RHQB 4ZVRB 3EDRB 2DKOB 2H5IB 3R7BB 1RHJB 2C2OB 4JB8B 3GJTB 3D6MB 1RWKB 3R6GB 2QL5B 3GJQB 3R7NB 4DCJB 2CDRB 3R6LB 3IBFB 4ZVTB 4DCOB 3R7SB 3D6HB 4ZVQB 2XYGB 2C2ZB 2QLJB 1QTNB 2H5JB 3GJSB 5IC6B 3RJMB 1ICEB 2HBQB 4DCPB 1RHRB 2QLBB 2XZDB 2CJYB 2H48B 4ZVUB 5K20B 4ZVPB 1NMEB 3SIPB 3R5JB 2H65B 2QLFB 2H51B 2C1EB 3EDQB 4ZVOB 2H54B 2H4YB 1BMQB 3KJQB 2CNLB 1RWXB 1RWOB 2HBRB 3P4UB 1RHMB 1PYOB 2CJXB 3IBCB 1RE1B 1RHKB 2QL9B 2CNOB 2QL7B 2C2KB 2C2MB 4LSZB 1RWVB 1RWWB 3QNWB 2Y0BB 2CNNB 1I51B 1SC1B 1GFWB 2HBYB 2XZTB 1RWMB 2Y1LB 1QDUB 3GJRB 1RWNB 1F9EB 1PAUB 2XYPB 2FQQB 2H4WB 1I3OB 1SC3B 3P45B 2P2CB 3KJFB 2XYHB 3D6FB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KJN B;  4ZVS B;  3NS7 B;  1RWP B;  5IC4 B;  2HBZ B;  1IBC B;  1RHU B;  2CNK B;  1SC4 B;  1RHQ B;  4ZVR B;  3EDR B;  2DKO B;  2H5I B;  3R7B B;  1RHJ B;  2C2O B;  4JB8 B;  3GJT B;  3D6M B;  1RWK B;  3R6G B;  2QL5 B;  3GJQ B;  3R7N B;  4DCJ B;  2CDR B;  3R6L B;  3IBF B;  4ZVT B;  4DCO B;  3R7S B;  3D6H B;  4ZVQ B;  2XYG B;  2C2Z B;  2QLJ B;  1QTN B;  2H5J B;  3GJS B;  5IC6 B;  3RJM B;  1ICE B;  2HBQ B;  4DCP B;  1RHR B;  2QLB B;  2XZD B;  2CJY B;  2H48 B;  4ZVU B;  5K20 B;  4ZVP B;  1NME B;  3SIP B;  3R5J B;  2H65 B;  2QLF B;  2H51 B;  2C1E B;  3EDQ B;  4ZVO B;  2H54 B;  2H4Y B;  1BMQ B;  3KJQ B;  2CNL B;  1RWX B;  1RWO B;  2HBR B;  3P4U B;  1RHM B;  1PYO B;  2CJX B;  3IBC B;  1RE1 B;  1RHK B;  2QL9 B;  2CNO B;  2QL7 B;  2C2K B;  2C2M B;  4LSZ B;  1RWV B;  1RWW B;  3QNW B;  2Y0B B;  2CNN B;  1I51 B;  1SC1 B;  1GFW B;  2HBY B;  2XZT B;  1RWM B;  2Y1L B;  1QDU B;  3GJR B;  1RWN B;  1F9E B;  1PAU B;  2XYP B;  2FQQ B;  2H4W B;  1I3O B;  1SC3 B;  3P45 B;  2P2C B;  3KJF B;  2XYH B;  3D6F B; 
#chains in the Genus database with same CATH topology
 1X9S A;  2O1P A;  2OJ3 A;  1S6P B;  2DR7 A;  5HBM A;  4LJM A;  4JI8 J;  1KON A;  1XBW A;  2VFU A;  3QGG A;  2YNI B;  4DUT A;  4I6A A;  1ZAX A;  1S5Z A;  5DQH A;  1YJN S;  3O6Q A;  1TK0 A;  2XSJ A;  4XK8 C;  2LA4 A;  3VAK A;  2CQB A;  1HQE A;  2W24 A;  2UVU A;  4O23 A;  4P72 A;  4ED3 A;  3NGU A;  3OTO F;  4LRE A;  4OYP A;  4E8U A;  1S97 A;  1X60 A;  3EJM A;  2OUG A;  1AA1 B;  1NJW A;  3OJS A;  2MKY A;  4DPU A;  1SKR A;  3IO1 A;  4ZPV R;  4LRD A;  3RAM A;  1T9Y A;  3HHL C;  1FRH A;  1E6V A;  1W2B R;  3MZI A;  4DL3 A;  3Q8V A;  4KYZ A;  3CCU S;  2E5I A;  2N3O A;  1YZ6 A;  4W92 B;  3CJK B;  2KM8 B;  4RPF A;  3TWZ A;  2QEX S;  4NLG A;  1UVN A;  2FIU A;  2LEB A;  1W26 A;  3IM9 A;  4TY8 B;  2RVJ A;  1FER A;  2ZFH A;  2RDJ A;  3UWT A;  2HGN A;  2X1F A;  1VQ9 S;  4HH1 A;  2KRB A;  3N6L A;  1EJ7 L;  1TV6 B;  4X4O A;  4EZ6 A;  2JHE A;  2C2E A;  4Y0F A;  4TY9 A;  3TVY A;  5J2N A;  4JB8 B;  1IBK J;  3PIP Q;  2V34 A;  3SZ2 A;  2HAI A;  1E6Y B;  3PM9 A;  2IBO A;  4NXM J;  4ZJO A;  4FPI A;  2DNO A;  1U2C A;  4LF7 J;  5DLG A;  1QSL A;  4C3L A;  4B3T J;  3CF5 Q;  3W5Y A;  3VVT A;  1KOH A;  3N0V A;  4DUZ F;  5KT5 A;  1LV5 A;  4KRW A;  4DZ6 A;  3ET6 B;  2C2M B;  3F44 A;  3EVM A;  3GFX A;  5E7O B;  3Q2S C;  1O5J A;  5A0Y B;  3QFW A;  4RBT A;  2GA7 A;  5LSO A;  1OS5 A;  3QO9 A;  5ETO A;  2XYP B;  5D4N A;  5CXT A;  4QWB A;  3B8H A;  1OIA A;  4PYD A;  4DU8 A;  1NK5 A;  3QT5 A;  3NGD A;  3BR8 A;  1TL7 B;  2KVQ E;  3J7Y I;  4XPC A;  3UN2 A;  1HBO A;  2BAN A;  4FNH A;  1RT1 B;  3EYZ A;  2HQ3 A;  3DI6 B;  2GHV C;  4DG1 A;  1PCA A;  1Q4R A;  2XEX A;  5SZT A;  3GCX P;  1NPP A;  1Y0H A;  1N36 J;  3PNI A;  2CVE A;  2YX1 A;  3R5B A;  2E1A A;  1DHM A;  2YNH B;  2QYG A;  3GJS B;  5A8W A;  4RNN A;  4DF8 A;  3JSY A;  4IDK A;  3OT9 A;  3I6P A;  2ZKU A;  1HIY A;  3R8Y A;  3I0S B;  1R7I A;  5IWA F;  2W7O A;  4K2J A;  5JJB A;  4OLO A;  3W8P A;  4H54 A;  3IMQ J;  3OLA A;  1VQ4 S;  1X0F A;  1DTQ A;  2E5L J;  5D3G A;  5AXK A;  2MKK A;  1VJW A;  2AJ0 A;  4DV0 F;  4ETZ A;  2UU9 F;  4RUC A;  2J6T A;  1MML A;  2XZT B;  3TEG A;  5AXL A;  5THW A;  1GMU A;  4C0B A;  5IOL A;  3FBE A;  2MQO A;  5HAO A;  3J7A N;  1YVF A;  4MKA A;  2OKQ A;  3EXC X;  2F65 A;  4AQY J;  4ECV A;  1URN A;  2XC9 A;  4UY8 T;  4NYZ A;  3CD0 A;  1JLE A;  2EW9 A;  2LVW A;  4I67 A;  1ZM9 A;  2DGS A;  2XYG B;  1O0P A;  3C19 A;  2L9D A;  4JBC A;  1J5E F;  3GSI A;  2LEC A;  4OZJ A;  2VQE J;  2PII A;  4F67 A;  2ZVI A;  4ECQ A;  3MM8 A;  3I96 A;  3CVK A;  3LGM A;  3L95 X;  1F5C A;  4LVO P;  3MM9 B;  2OPP B;  3N5F A;  2FUG 9;  4DR5 F;  4N56 A;  2E1P A;  5DDP C;  3TUZ C;  4F7V A;  4BCA A;  1UEV A;  1LK7 A;  1RWM B;  3V6D A;  3TR5 A;  1D9A A;  5LMN F;  1YBA A;  4U7U K;  2QZ8 A;  1VIO A;  1I3O B;  4K59 A;  1RT4 B;  1NLK L;  1T8E A;  4P2M A;  4RJV A;  1IKY B;  3KUG A;  3OVA A;  2G4B A;  4NLV A;  1EIY B;  1CLF A;  4M5D B;  2A3J A;  4EBC A;  3PHT A;  3BRE A;  2QMU B;  3M2U B;  1KDN A;  3A8J A;  3V6H A;  1FNX H;  2WSF C;  2FJD B;  2PSZ A;  1B7F A;  1HA1 A;  2E1C A;  3DGP A;  1LWF A;  3RAX A;  2YNG A;  2JSX A;  2VAS A;  1BQN A;  1LK5 A;  1G3O A;  4URG A;  2CWK A;  1SUQ A;  4O3Q A;  2C1E B;  1S9F A;  3IRX B;  2DNH A;  3N9U C;  4F3M A;  2FJB B;  1WD6 A;  5M2R A;  2CPD A;  1FNM A;  2HNZ B;  3BKU A;  2CQ0 A;  1LNQ A;  2EXU A;  3FKB A;  4W4M A;  2GVD B;  4TYA A;  2L48 A;  3EUN A;  1UJ6 A;  4L76 A;  4YR2 A;  1RWN B;  1YJ7 A;  5EX3 A;  2R7T A;  4LUB A;  2MQ8 A;  4O4R A;  4ECZ A;  1SC3 B;  5DS7 A;  2NLW A;  1FRI A;  4J90 A;  3W2W B;  1PIL A;  3HCX A;  3W62 A;  2F8E X;  4MK8 A;  1VRT B;  1S1W B;  4C8M A;  2FJX A;  3EZ5 A;  3OR1 B;  1RWK B;  3AB4 B;  2Z2Z A;  4FF4 A;  4FF2 A;  2FLL A;  2WVD A;  3C6U A;  1DQ9 A;  1BQX A;  4U9R A;  1LOU A;  1NSK L;  2HMI A;  4IQM A;  2YWW A;  2P6T A;  1X4A A;  2B4P A;  3I4P A;  1NPK A;  1NDC A;  4J9M A;  1CS4 A;  4YDD B;  2BX6 A;  4L74 A;  4U96 A;  1XR6 A;  3SCJ E;  5HLF B;  2V8H A;  1DFD A;  3KK3 A;  2MZS A;  2DR9 A;  2AYB A;  3PHE A;  4LRF A;  3J81 U;  1SC6 A;  2AF6 A;  4NA1 A;  1NDL A;  2W4P A;  3KLI B;  1LWC A;  5HVG A;  1VBY A;  2CPI A;  1N54 B;  1VQS A;  4KGK A;  1DUR A;  1PJ7 A;  5CHC B;  2BJ8 A;  3O3L A;  1YKW A;  1UVI A;  2UXD F;  2FD2 A;  4OJG A;  1TAU A;  1B70 B;  4OYW A;  3UDC A;  3FSX A;  3OUY B;  2DBB A;  3IG1 B;  5HRO B;  5F8G A;  3T5J A;  1CBK A;  1U24 A;  2ZOM A;  1LW0 B;  3FQK A;  2QG9 B;  4TLQ A;  4ID5 B;  3HFZ B;  4PG8 A;  3R5A A;  4ZIW A;  5ETS A;  3NS6 A;  2XY6 A;  2XUL A;  4WE1 B;  1T3N A;  3NAI A;  5IS2 A;  1SBR A;  4B9U A;  1NJY A;  3FRY A;  3K17 A;  1CJU B;  2D69 A;  3BQ1 A;  3BO3 A;  3MEE A;  4WPA A;  4KGV B;  1WDT A;  1HBN A;  3M8W A;  1HBU A;  2DTJ A;  5K9F A;  3EZU A;  1S0O A;  1U09 A;  4XIU A;  3LAK A;  4IH6 A;  2MZJ A;  1N6Q A;  3HVR A;  4D3H A;  2Z2M A;  3DHX A;  2NPI A;  3W3S A;  4OYZ A;  5E3R A;  2XMJ A;  2I9S A;  3DDI A;  1UPP A;  4ZVH A;  4KTQ A;  4QYZ J;  3T5L A;  2WVF A;  1YQH A;  5IV4 A;  1UZH A;  5F8J A;  2RIJ A;  3PKY A;  4E0D A;  2HIQ A;  3KHR A;  2WBM A;  1CJT A;  2RDD A;  3VAG A;  5IFM A;  2QSW A;  1RT6 A;  2FVS A;  4WCE Q;  1Y7P A;  3CJR A;  2QA4 G;  5GAG I;  4RNO A;  2GV1 A;  2VIH A;  3DN9 A;  3M9M B;  4F4A A;  2OO4 A;  2O3D A;  1RTJ A;  1FKA F;  4LF2 A;  1TL3 A;  2MLX A;  1PBA A;  4WK1 A;  3J7Z 5;  4RL1 A;  4DUY J;  1S76 D;  3NNA A;  4A8F A;  1N88 A;  1T02 A;  1VQN S;  4J9L A;  4RW9 B;  4L73 A;  3UNG C;  4ANE A;  2N3L A;  2ADB A;  4ZVO B;  4R5P A;  3JTP A;  4KKO A;  1U26 A;  2KU7 A;  4ZLJ A;  3BGF A;  1TL1 B;  2UXC J;  1XR5 A;  2J0Q D;  2IJR A;  1EHW A;  5D0E A;  1HD1 A;  2GGP B;  4CIO A;  1VBX A;  1NCL A;  4B3O A;  3T6J A;  4PYA A;  3AQO A;  3HFK A;  1KP6 A;  3HHL B;  2IDL A;  3HXM A;  1S6Q B;  2YKN A;  3CCV S;  4NCG A;  1YG0 A;  1KTV A;  2CYY A;  2MQL A;  2E5H A;  3MR3 A;  3K5P A;  3H98 A;  2FTR A;  3A8E A;  3AB2 B;  2MKI A;  2UUW A;  3W65 A;  1XIQ A;  1NH8 A;  1NK6 A;  2W8L A;  2VPY B;  3BF4 A;  5HMZ A;  3KFW X;  5CD4 A;  3FEZ A;  3NY0 A;  3BDE A;  1L5U A;  2FYX A;  4TVA B;  2VA2 A;  1G6B A;  1F5B A;  1MG7 A;  4F02 A;  2QA1 A;  4C3M A;  1UJ4 A;  3MPV A;  3OR2 A;  2WB4 A;  2KHD A;  4IO9 Q;  3BSA A;  2E5J A;  1TMM A;  3MUM P;  2DGO A;  2GAG C;  2GJI A;  2H4Y B;  2MKH A;  3KK1 A;  5H9E K;  4E2F B;  4DU7 A;  3T5H A;  3J7A 1;  2MGZ B;  4ECU A;  2E9T A;  3MMC B;  4CO1 A;  2GMJ A;  3DOL A;  4KV8 A;  3J81 Y;  2CPJ A;  5AT1 B;  4Y34 A;  4PQU A;  1P1L A;  2J8S A;  1OJ4 A;  4YR0 A;  2G1D A;  4I6W A;  1D09 B;  2FHO B;  1F9F A;  2W4C A;  1WKJ A;  1SV5 B;  4HI2 A;  4UUX A;  4JI0 J;  2UUA F;  1TZ0 A;  3PTW A;  3A13 A;  2ZH6 A;  2GQ2 A;  1GXL A;  2KL8 A;  2JC1 A;  5HJY A;  4K0K J;  2LQ9 A;  1BHN A;  1FKP A;  3W1Y C;  1ZPV A;  1RT3 A;  2ZNY A;  1R8B A;  4ED1 A;  1IM4 A;  1L3K A;  4ED8 A;  3TAM B;  4DV2 F;  2OFH X;  1IJE B;  4DPO A;  2AIR B;  4AFF A;  1VC5 A;  3RJM B;  2HBQ B;  2D7S A;  4JUZ A;  4XAK A;  3CCR S;  1B7Y B;  1XK8 A;  1HWI A;  4KAI A;  1REV B;  1IKW B;  4NZ7 A;  4LF8 F;  3KOA A;  1ULR A;  1YHQ S;  3W61 A;  1Y9O A;  5BJR A;  1EET B;  3BR9 A;  2MKS A;  3JQK A;  3I0R B;  4DX8 H;  1IBM J;  1NK9 A;  2DYA A;  4PRF A;  2CPH A;  3C14 B;  3MAA A;  1VCT A;  2UUC J;  1JLA B;  4RWX A;  4ECY A;  2E66 A;  3G82 B;  3SQO P;  4OI1 A;  4EGL A;  2BW2 A;  5IC4 B;  1GTE A;  3ITH B;  1U8S A;  3BO4 A;  3QLH B;  2VPX B;  4H4K A;  1SKU B;  4ZCI A;  4UOG A;  1H2T Z;  1XQI A;  2OIH A;  2OPQ A;  3DOM B;  4RZR A;  4X4V A;  3AQP A;  3MUV P;  2HYI B;  1EZZ B;  3BSO A;  3MTK A;  4DFP A;  1FVS A;  1HR0 J;  2RT3 A;  2VIC A;  2FVQ A;  1RAO A;  3FSI A;  5IV3 A;  1NSA A;  1UVJ A;  4OX8 A;  2H54 B;  1OSC A;  3HX9 A;  1T9X A;  1QAJ A;  2AJ2 A;  1NRK A;  4H4M B;  4O3S A;  4TQR A;  1FF2 A;  3QIP B;  5HI7 A;  1H72 C;  1X4H A;  2FHK A;  5D0R A;  2ROG A;  1S6O A;  2NXU A;  4ZCL A;  1F5A A;  1RCX B;  3MHY A;  4ZDN A;  3Q83 A;  1VQP S;  2VC1 A;  1K1S A;  2HLT A;  3HD1 A;  4QIG A;  4OI3 A;  2AT1 B;  1K1Q A;  4Q45 A;  1WDD A;  3HPO A;  2GZO A;  3UCU P;  1Q7Y T;  4CH7 A;  3F41 A;  4EK2 A;  4FS1 A;  1IBL J;  1DRZ A;  3R6G B;  2DGX A;  3VQT A;  1EP4 A;  4K2X A;  5KG7 A;  1V3S A;  3LO3 A;  3KG1 A;  3NKY A;  3VQS A;  2V4J A;  3C16 A;  4DCP B;  2CKW A;  2IC3 B;  4ZVU B;  2ZDO A;  2CQ3 A;  1S1T A;  4KO0 B;  4ZLL A;  3G96 A;  4MK7 A;  1FJE B;  1P9Y A;  3MCN A;  1TMJ A;  1NND A;  4K4W A;  1VQL S;  3IC1 A;  1XMO J;  1R8C A;  2ZJQ Q;  4Y2M A;  1OPI A;  3BDP A;  2CQ4 A;  1YK9 A;  3HO1 A;  4KHP F;  3C15 B;  2C2K B;  4R0E A;  2V94 A;  1U48 A;  3G4S S;  3RBD A;  4MJK A;  1XC9 A;  2ZC3 A;  5H9F J;  2OPR B;  3THV A;  2ACM A;  2OHD A;  2VG6 A;  2DXE A;  1U1Q A;  1N5S A;  4RW7 B;  3V81 B;  3HF5 A;  4F8R A;  2QFJ A;  1TKX A;  1QD1 A;  4JI1 F;  3P5T L;  2H1Y A;  3NGK A;  2KN4 A;  1WC3 A;  2C3M A;  1PGZ A;  4G65 A;  4F0K A;  1RZM A;  4WXW A;  2W2M P;  1VBK A;  3W66 A;  2R8J A;  2MHE A;  1HWK A;  2X3D A;  3KHL A;  2XSJ B;  2QSF A;  3UI3 A;  3G6Y A;  2EFV A;  1AT1 B;  4OZN A;  4QIF A;  3AOC A;  2CJY B;  3HT0 A;  2M8D B;  1OPZ A;  2Z2Y B;  2AEM A;  4DJB A;  4F25 A;  4OHV A;  3DLJ A;  4HAC A;  5MLC V;  3CCZ A;  2C2D A;  2DNM A;  2HBR B;  4F4X A;  2HW3 A;  3DGV A;  3M8S A;  2EK1 A;  3CB4 A;  1VRU A;  4UF4 A;  2QL9 B;  3PJX A;  5KFB A;  1M0S A;  1E6V B;  2EKN A;  4J9S A;  1KRP A;  1FJC A;  3PRD A;  1AB8 A;  2LEP A;  1PAU B;  3M8Z A;  1DAX A;  1MNE A;  2KZM A;  2HS4 A;  1M5O C;  5J2M A;  2HZV A;  2P2C B;  3KLG A;  2V6A A;  4WU2 A;  5CA5 A;  2B56 A;  1BGX T;  4CYU A;  4DX6 A;  2WON A;  2Z0G A;  2NR0 A;  2Z56 B;  2ZBI A;  4B9T A;  4YEA A;  4RUB A;  2B9W A;  2NZ4 A;  4DL6 A;  2JH3 A;  2MLZ A;  3BYR A;  2F9J A;  3OL7 A;  2OEM A;  2XCA A;  4F36 A;  1J5O A;  4LFC F;  3X3U A;  4DOZ A;  3H25 A;  1L3T A;  1YJV A;  1Q8K A;  1N5V A;  3HZE A;  2GVZ A;  3M6V A;  3KJV A;  1YI2 S;  3U7J A;  2BQR A;  4NXN F;  2LEA A;  5CCM A;  2E1R A;  5KG2 A;  2DHH A;  2HRY A;  3QGI A;  1NDK A;  1OMS A;  3W64 A;  2IVY A;  3NOC A;  2VOO A;  1YGY A;  4DV4 F;  3RAQ A;  2JFD A;  5GAD I;  3N6M A;  2E44 A;  4K4Y A;  2M70 A;  5DM6 Q;  3M1V A;  3QO9 B;  2EFN A;  2YY3 A;  2DGU A;  5GVQ A;  1GMW A;  4GKJ F;  5DG7 A;  2YQ3 A;  3DRP A;  3TZY A;  1ZPW X;  4RO0 A;  4PCQ A;  2B5J A;  3NGT A;  4OYO A;  1UET A;  4DL5 A;  1FE0 A;  4YS2 A;  1HBO B;  2BAN B;  1U7L A;  1RTH A;  3T9Z A;  2QLW A;  3BH7 B;  3DLK A;  1S0N A;  3PJW A;  3R7N B;  3W63 A;  1VJQ A;  3OL8 A;  1RXO B;  1PC4 A;  8ATC B;  3DDN A;  1S9G A;  1N8R T;  1BQM B;  2JDJ A;  3NWG A;  4WU3 A;  5A8W B;  3R1L A;  2YWK A;  5HN0 A;  2ZWP A;  4O44 B;  3GV7 B;  3P4U B;  2IVF B;  2PMH A;  2B6A A;  3I31 A;  5ADZ A;  2QIF A;  5E3C A;  3Q22 A;  3M7V A;  5LOQ A;  1HI0 P;  2L41 A;  3GR1 A;  1O51 A;  2XY5 A;  2XO7 A;  1RWW B;  1HFE L;  4MIW A;  1DTQ B;  2RQK A;  1ZYQ A;  1I51 B;  4A8S A;  1RB0 A;  4CCH A;  5D3G B;  4B17 A;  4H4K C;  2ZHO A;  2B7C B;  2AV5 A;  1S99 A;  3H90 A;  2AMC B;  4MKB A;  1T9V A;  2BAB A;  2VON A;  4RBV A;  4L72 B;  1RWP B;  3FMW A;  3JTN A;  2Y8W A;  1XNR F;  1NK7 A;  4RR5 A;  1JLB A;  2X7I A;  3TX0 A;  3R2C J;  3ZO7 A;  3KKF A;  2G1H A;  3AJ2 A;  5DG9 A;  2R7U A;  4FN5 A;  4A8M P;  4QU7 A;  2BZ2 A;  1VIS A;  4QCL A;  2RE1 A;  2WVB A;  3MEC A;  2FJV A;  2IAJ A;  2PFF B;  1J27 A;  3O5T B;  4TU7 A;  5DDQ C;  4UZB A;  1FI4 A;  1NME B;  1JLG A;  1F6T A;  1YX2 A;  3MEG A;  3MM8 B;  4N41 A;  1X0P A;  5KFX A;  5HQ8 A;  3X1L B;  4NML A;  2FVC A;  3TJ9 A;  4ECR A;  1MWY A;  3IWX A;  1NBE B;  2HBY B;  1RAJ A;  5D4O A;  4Z2X A;  1NK4 A;  3M9N B;  4ZLN A;  1RYR A;  1ZBT A;  1DLO B;  1CEZ A;  1H7X A;  4RX6 A;  5DM7 Q;  4U95 A;  1VK8 A;  3QWU A;  1SJF A;  3DXS X;  2BKP A;  3DXB A;  4LF9 J;  3PRV A;  3OSP A;  3CC7 S;  4PUO B;  1K0V A;  5C24 B;  2RU9 A;  4R25 A;  1FHT A;  4B9M A;  4HTJ A;  3SQG A;  1LWF B;  3MM7 B;  5LJ3 Y;  1R6Y A;  2UV8 G;  3SDE A;  2I5J B;  4YN3 B;  1BQN B;  1H74 A;  5LMU J;  3MR5 A;  2VBW A;  4NLY A;  4I4B A;  2C2N A;  2CQ1 A;  3QGP A;  1S6U A;  4DV7 J;  4N76 A;  1LFP A;  1H3D A;  4M5G A;  4QPT A;  2CJB A;  4ZIV A;  2NXE A;  2DNR A;  4IOB A;  3JSM B;  5JVH Q;  1LWE B;  5CZV A;  5MAO A;  2O5D A;  3OTB A;  4IYQ A;  1VQM S;  1AZS B;  4YHH F;  2D1C A;  2FZC B;  4UOH A;  4ZPD A;  2Q66 A;  1WNE A;  1V5I B;  3P96 A;  4P74 A;  1MN7 A;  2XGQ A;  2Q43 A;  4USK A;  1VLY A;  3KDN A;  4X62 F;  4KJI A;  2ZZT A;  4B3R J;  3U02 A;  1SC4 B;  1KVK A;  4Z37 A;  2BE9 B;  3K8V A;  5IT9 U;  4QBU A;  1Q16 B;  2W1B A;  3TAQ A;  1KHV A;  1T7P A;  3VGV A;  3BB5 A;  4CDI A;  5DQI A;  3DLG A;  4JI7 F;  5KT4 A;  4URS A;  1BLU A;  1M1K T;  4OV6 A;  3EIC A;  1N56 A;  3C6U B;  2PD1 A;  2YNF B;  4MFB A;  3NBP A;  4NCB A;  1IWA A;  1PIE A;  1U8W A;  4URQ U;  2XB2 D;  4UY8 5;  4A48 A;  3VZI A;  4DLE A;  3T1Y F;  2HMI B;  2HSE B;  5KT6 A;  4HKQ A;  1BMQ B;  1L3S A;  1RGV A;  1IVZ A;  5T41 A;  5CZX A;  2NXC A;  1CS4 B;  3BQ0 A;  4C2M A;  1YJW S;  2POK A;  3KK3 B;  3LP0 A;  3MGJ A;  4XO0 A;  3B82 A;  1C0T B;  4AL5 A;  2Z4P A;  5I4M A;  4OIX A;  2A2D A;  1LWC B;  4AQY F;  1S4E A;  3DRR A;  2AX1 A;  1JJ4 A;  4UZC A;  1B0V A;  4NWB A;  3WZ0 A;  1M5V C;  3F73 A;  5KFZ A;  2RNE A;  3UVJ A;  4NOH A;  1HNX F;  4CLT A;  4DR6 J;  4DV5 F;  1VQ7 S;  3RRG A;  3HUL A;  3TW0 A;  5C25 A;  3OTE A;  4MIA A;  4QR0 A;  4ELT A;  3TX8 A;  3PW7 A;  4JYA J;  2F7V A;  1NPR A;  1VQ6 S;  1B0P A;  4NLU A;  3I4H X;  3D2W A;  2CDQ A;  4NLS A;  2ZM6 J;  2ASL A;  4M8L A;  2W9B A;  3MEE B;  4LBI A;  5DGB A;  3OTC A;  2B3T B;  2K2P A;  1HBN B;  1TKT A;  1HBU B;  1Y10 A;  3LGN A;  4B3M F;  2CIM A;  4WP8 A;  4Q7A A;  5SUH A;  1N0V C;  1TU0 B;  1HW9 A;  2XS2 A;  4K5S A;  2F9D A;  3ETM A;  2Z57 B;  1N6Q B;  2YWE A;  2XM3 A;  4FYY B;  5AJ3 F;  3BN7 A;  3ZZP A;  2XSF A;  2IY5 B;  2ILY A;  2B51 A;  3ADA C;  4O0I A;  4TXS A;  5K8M A;  1FJ7 A;  2NXN A;  1HQU A;  3DKD A;  1CJT B;  5BXI A;  2ZOG A;  1B64 A;  3DLE A;  2G13 A;  3UPF A;  2GQC A;  4ED5 A;  1Z2L A;  2CDR B;  5U47 A;  4RW8 A;  1KQF B;  1TL3 B;  3MFH A;  4TYB A;  4C0O C;  2CZV C;  2H5E A;  1WG1 A;  3D0I E;  4E98 A;  2I0X A;  1C0U B;  1T0T V;  2CQP A;  3C8Y A;  2LXF A;  5EHH A;  4JP8 A;  4ED4 A;  2L3M A;  5LXR A;  1CVJ A;  2HUR A;  5DRK A;  2DIS A;  4R5P B;  4KKO B;  5IQQ A;  5EWF A;  4ZPA A;  1WG5 A;  2IDE A;  3EM1 A;  2EC0 A;  4OHZ A;  3Q8Y A;  3CMA S;  3FFI A;  5I3Q A;  2P5V A;  1RK8 A;  4K4Z A;  2VFR A;  2EK6 A;  2OAU A;  2HBZ B;  1Q78 A;  4EWT A;  2NXJ A;  2EBG A;  1MLA A;  2YKN B;  1A7G E;  1UW9 A;  2Y1J A;  1RAA B;  1CPZ A;  2R7V A;  2BOA A;  3TVZ A;  2AGP A;  2XS7 A;  2ZBP A;  4CNZ A;  3CJ3 A;  5IT4 A;  1BC6 A;  1X8D A;  4C8Y A;  1VLO A;  4M5M A;  2VG5 B;  3EWG A;  5F3T A;  1RYS A;  4ZN1 A;  2BAC A;  1VC0 A;  2D3Z A;  1LFW A;  2JX2 A;  4DBQ A;  1KQK A;  3OR2 B;  4QYR A;  5KFF A;  3OXL A;  2IYG A;  3QSI A;  3OLB A;  4YP3 A;  1TK5 A;  3TJA A;  3KK1 B;  1XER A;  3DLH A;  1P27 B;  2JJ4 D;  2RJZ A;  5J2P A;  2ZDP A;  4G1Q B;  4PWD A;  1P9Q C;  3DOL B;  4KV8 B;  2F8M A;  1JNR B;  4D3G A;  3T1H F;  4NEY A;  3DRS A;  4PQU B;  2Y9H A;  5F41 A;  4RUH A;  5HQL A;  3ZNU A;  4GVB A;  1T05 A;  1WOR A;  3D3B J;  4Q5V A;  5HP1 A;  3G87 A;  1N34 F;  4KHR A;  4U7U D;  1FX2 A;  2CPX A;  2GQQ A;  1D8Z A;  4UQT A;  2GJ2 A;  2GO9 A;  1Y3K A;  5C42 A;  3TQE A;  1AXQ A;  3AJ1 A;  2DCL A;  1QTM A;  4OYB A;  5B7W A;  2XQC A;  1FKP B;  4GMK A;  3OV7 A;  1S0M A;  4JI2 F;  2RS2 A;  1RT3 B;  2VC0 A;  3JSB A;  2H5J B;  2GAH C;  2RUS A;  2EG1 A;  3DU5 A;  2HFO A;  3U1N A;  1UA1 A;  4KH1 B;  3AXM A;  3CJS A;  1U6F A;  1Q8L A;  3MCM A;  4I2Q A;  1DJ0 A;  4EFA C;  3IAM 9;  2YX7 A;  1QE1 A;  3H5X A;  1YJ9 S;  4PPD A;  4EYI B;  2J0X A;  4R0J A;  3BV8 A;  1UEK A;  2CPE A;  2M88 A;  4WKY A;  1TK8 A;  4WF9 Q;  1NSQ A;  4ZP6 A;  1S1X B;  4EUV A;  2CWX A;  1SH2 A;  5CCL A;  2HK3 A;  3CD6 S;  3VAF A;  5A8R A;  1Y11 A;  3S8S A;  2DPI A;  3MAA B;  2Y8Y A;  1S1U A;  3MTJ A;  4DV3 F;  1VK3 A;  3W9H A;  2GJF A;  1FJG J;  2NCK L;  4NLX A;  5D0G A;  2OGU A;  4CLY A;  4ECT A;  3UD4 P;  2JRS A;  4LFB J;  1ZAW A;  3ILO A;  3QSY B;  4ES3 A;  1KVI A;  1FEH A;  4HTI A;  3DLL Q;  1SQG A;  2XWX A;  4HT5 A;  3RB3 A;  1SJ1 A;  2RIL A;  3T19 A;  4OX9 J;  2DH9 A;  1R6V A;  3Q8P B;  1UVL A;  1VYA A;  3I9V 9;  1Y5I B;  4MH8 A;  4Y2C A;  3PRB A;  3E2E A;  5GAH U;  2XMA A;  2NUU G;  1Y5L B;  3ENQ A;  2VDH A;  1FKO A;  4HHH A;  3M8P A;  2F40 A;  3OQ2 A;  2UUB F;  1RWV B;  3H42 A;  2ADC A;  5ETK A;  1JIH A;  2HRU A;  4Q2M A;  3POT A;  2IM1 A;  4ICL A;  3CXC R;  2IMW P;  1RJJ A;  2ZJR Q;  2BJD A;  2RD5 C;  5K8N A;  1GH8 A;  4DFK A;  5KFP A;  3OTO J;  1PJ5 A;  5HSP A;  1M5P C;  4N8O A;  3CCT A;  3WQP A;  2MY8 A;  1MMD A;  3IWL A;  3AAW B;  1AW0 A;  2HQI A;  2QX0 A;  2RF2 A;  2R8H A;  1F2G A;  3GWC A;  1NK8 A;  2QC3 A;  1X9M A;  5BYQ A;  5ETQ A;  5L1L A;  1TP7 A;  5KFO A;  3G6E S;  2QV6 A;  4R8U B;  4CO2 A;  4C11 A;  3HI9 A;  2QN6 B;  4OZ3 A;  1EP4 B;  5KT7 A;  2GMH A;  4I1T A;  1PYS B;  5G0R A;  2ZH9 A;  4MYT A;  2KO1 A;  2FJE B;  4LMZ A;  3HZG A;  2UVV A;  4X2B A;  4CLU A;  3CDU A;  4CZC A;  1S1T B;  4CLW A;  2U2F A;  5BYR A;  1S1V A;  1HKA A;  4DSF A;  1WKK A;  3Q8S B;  4L3N A;  4HVZ A;  2DEJ A;  4C8O A;  1NXI A;  2JVR A;  5FLX U;  2NSB A;  4P71 A;  3DMJ A;  3D9B A;  2B9X A;  3C66 A;  4I6Y A;  2JEI A;  3V6K A;  2WAQ D;  2DNL A;  3MPW A;  2PEB A;  1Q5Y A;  2CRL A;  4MT1 A;  4ZJL A;  1TKX B;  2K8G A;  2F4F A;  1KLN A;  1HL6 A;  1TKD A;  4U7C A;  3GPA A;  4UQG A;  5IM0 A;  3V5R A;  2ACY A;  2HFU A;  5A2Q U;  4DUZ J;  2KDO A;  1SCJ B;  1PYT A;  4DCJ B;  1ELO A;  2J9E A;  2R9L A;  4M63 A;  3C6T A;  1U0H A;  1YJR A;  2XMK A;  1NKE A;  5CAA A;  3MDF A;  3KTQ A;  2C3U A;  5I42 A;  3FSY A;  3RR7 A;  2RB7 A;  4OI6 A;  3MF5 A;  1F9H A;  3Q0A A;  3VGT A;  1A9N B;  1G7C B;  2A10 A;  4BS2 A;  3K0J A;  5J2Q B;  2YVS A;  4HAC B;  1QM9 A;  3KMQ A;  2F3J A;  1HNV A;  5A6W A;  8RUC A;  2KJW A;  1FX4 A;  1VRU B;  5HAT A;  3B4D A;  3HHD A;  4A47 A;  1JLF B;  3BKT A;  4G6V B;  1H2V Z;  3V2U C;  3Q8Q B;  3SXL A;  4IRK A;  2CFX A;  5D4P A;  1G2E A;  3ISZ A;  4GKK F;  3RW7 A;  3PO5 A;  3DRX A;  2C2R A;  1GMV A;  5J1P A;  3EMT A;  1EQM A;  1W25 A;  3DOK A;  2PN6 A;  4C0H A;  3KLG B;  3FZ2 A;  3JAM U;  4DR2 F;  3W5X A;  4DL2 A;  3QAE A;  4B9L A;  5IWA J;  1R3N A;  2WON B;  3AHP A;  1C4A A;  2JC0 A;  2YKO A;  2K7K A;  2DNK A;  3K5M A;  1QAX A;  2FZK B;  3G6X A;  1NH7 A;  2M52 A;  4P75 A;  3BGO P;  3VV2 B;  4DV0 J;  2ZE2 A;  4QYZ K;  4FVM A;  4FKX A;  1J5O B;  2UU9 J;  4USM A;  3QRR A;  1RP5 A;  2VJV A;  4DV6 F;  4HL9 A;  2L9N A;  4M5K A;  1DBD A;  3KJQ B;  2AHO B;  3MM5 A;  4DX7 A;  2KFN A;  2PA3 A;  3KJV B;  4DS4 A;  1H2U X;  1NM2 A;  2G0C A;  1U6B A;  5CAB A;  2FHM A;  2Y1L B;  3A4T A;  2HAF A;  3O8W A;  4GVL A;  4X4P A;  1VOM A;  2D9O A;  1SXL A;  3W2V A;  3GP9 A;  1JKH A;  2O67 A;  1J5E J;  1HNI A;  4UOF A;  1TR0 A;  2KRR A;  2N4D A;  4DX5 A;  3CJK A;  1U02 A;  3M1V B;  1RAG B;  1YBT A;  4TY8 A;  1YTY A;  3RU0 A;  2G2O A;  3DRP B;  3UNY A;  3THP A;  4DSE A;  2KI2 A;  3PX4 A;  2I1R A;  1EKS A;  4X65 F;  3E01 A;  3TRG A;  2AX0 A;  4DR5 J;  2W2Q P;  1FXL A;  1QTN B;  2HWT A;  1ICE B;  1Z1Z A;  1RHR B;  3LAM A;  4DWI A;  2HS3 A;  4C8L A;  1S9G B;  3KDO A;  4RU9 A;  1Y5N B;  5LMN J;  5KFK A;  2JEJ A;  5L46 A;  1KS2 A;  1E6Y A;  5K14 B;  2JEG A;  4WFB Q;  4YDX A;  5M2P A;  4ED0 A;  3GFH A;  4K8R A;  4ZMM A;  4JI6 F;  2B6A B;  3HKW A;  4ZK7 M;  3LUY A;  2HQC A;  4LSL B;  3KHG A;  5F3Z A;  3CIM A;  3R27 A;  4CO3 A;  1SL2 A;  5KT3 A;  2DH8 A;  1FDN A;  4C4W A;  2G9O A;  2V9W A;  3CJT A;  2WOM A;  4QU6 A;  5A0Y A;  2NSC A;  4RNM A;  3I82 A;  1TTH B;  4DPX A;  2CQ2 A;  1S0V A;  1D1U A;  2IRU A;  1NUE A;  3IAS 9;  4P9S A;  1UWA A;  3VGS A;  4CM2 A;  1TAQ A;  1ARO P;  4ZHR B;  3OTD A;  1KD1 T;  2EEY A;  1TL7 A;  1JLB B;  2Z2L A;  2V2Q A;  2VQF F;  4DL4 A;  3QJP A;  5E3Q A;  2ZH5 A;  4WKR A;  5A2Q Y;  2LQ5 A;  1X5P A;  3ZZY A;  4I7F A;  2JFK A;  3TAP A;  2QFI A;  5D8H B;  4WFA Q;  3MEC B;  3IWN C;  1WHY A;  1XMQ F;  1NDP A;  3M8Y A;  2YNH A;  2ZH4 A;  3CO9 A;  1BWE A;  2HGM A;  1JLG B;  1FRM A;  4P2F A;  3MEG B;  1T03 B;  3AOB A;  4WIQ A;  5EDW A;  4QPX A;  1S4F A;  2XMU A;  2HNY B;  5BR8 F;  2J6U A;  1C4C A;  4KSE B;  3I56 S;  4WZQ A;  1X4C A;  4FXD A;  2HS0 A;  2OEK A;  2RDI A;  3LPE A;  4OYX A;  3OD2 A;  3KJF B;  2XGP A;  2FHJ A;  2LLZ A;  2OPS A;  2OTL S;  3D54 A;  4HHJ A;  4KC5 A;  2RH3 A;  5LSR A;  3HHE A;  5CYM B;  2B9Y A;  3M6X A;  7FDR A;  3KK2 A;  1PG5 B;  3JAM Y;  3Q2T C;  2RS8 A;  2ZBQ A;  1W7W A;  4NZ6 A;  1L3U A;  1V3Z A;  2RQM A;  2GIR A;  1UEU A;  3IP0 A;  3RB0 A;  4ZCM A;  3T5K A;  3V4M A;  1C1B A;  4Y28 C;  4OI4 A;  4EO6 A;  2BJ1 A;  3ZZT A;  5E3P A;  2WVC A;  3D66 A;  3OBI A;  3GV5 B;  3UO0 A;  2UXD J;  3QYY A;  2LXU A;  2C3P A;  3SBM A;  3C3L A;  2AYM A;  1UAW A;  3WDO A;  5M2U A;  4IG0 B;  3IRW P;  2OPP A;  5FII A;  1VRQ C;  2Q79 A;  2APO A;  3M05 A;  4KT0 C;  1SI9 A;  4JI3 F;  1GAO A;  2Y3Y A;  1APS A;  5T7L B;  2J0S D;  1Y3J A;  3KWM A;  4YB1 P;  1BXN A;  4HLB A;  3D1H A;  2V8V A;  1RTZ A;  3H59 A;  2HVD A;  2LYV A;  4KFB B;  4X4Q A;  5L39 A;  2W9A A;  3UN3 A;  5AE3 A;  4DR7 F;  1D9D A;  3A12 A;  2O66 A;  3KG0 A;  4ZOS A;  2NZC A;  2JLE A;  5LM7 E;  4OJ3 A;  2Z8Q A;  2VD3 A;  2FLP A;  5E0O A;  2N82 B;  2V67 A;  1GQE A;  1GTH A;  3DLG B;  3D6T B;  1HHS A;  4CLP A;  1QLN A;  4MFB B;  3GON A;  4X4S A;  3EXY A;  2RKI B;  4ZKA A;  2R7S A;  4IFY A;  4NYO A;  2W9C A;  4RBU A;  1AFI A;  5HO4 A;  5B0E A;  1KBR A;  4IR9 A;  1X31 C;  3HVT A;  5EUH A;  4CP5 A;  3LP0 B;  1RTD A;  4JV2 A;  1RA6 A;  2BMB A;  2DB1 A;  1WUU A;  2VFS A;  3ETO A;  3RYL A;  4NRU A;  4Z7Y A;  1WSV A;  1VBZ A;  3TA1 A;  2FGC A;  3RGI A;  4DS5 A;  1FRL A;  4P2X A;  4ZPW R;  1RU1 A;  2RU3 A;  4FKY A;  2KKH A;  3ELH A;  3UVJ B;  3DM2 B;  2V0N A;  2M9K A;  4FVC A;  3FBF A;  3O44 A;  1VRT A;  4MAK A;  4J9N A;  1RAF B;  2V5H G;  4EEY A;  2DPJ A;  1S1W A;  2MKJ A;  2ZD1 B;  1PBU A;  3R9L A;  3OR1 A;  1IUJ A;  3MR6 A;  3EGW B;  2KT2 A;  5B0A A;  3VAJ A;  4DR1 F;  1UMJ A;  5K20 B;  2ALY B;  2XG8 A;  4YOE A;  3EGN A;  1KQG B;  2VV5 A;  3PX0 A;  2W9B B;  2D9P A;  4YQW A;  1JJ2 R;  3CCE S;  2HVZ A;  1OSD A;  4X4U A;  1R0B G;  3UE2 A;  4DFJ A;  1TKT B;  4DSI A;  3VGU A;  2R7O A;  4OLP A;  5HLF A;  5HMX A;  5E33 A;  3KMS A;  1OY6 A;  1TKZ A;  2ABY A;  1MWZ A;  2BYC A;  3LA0 A;  1WSR A;  3MWB A;  4HEA 9;  5KFJ A;  5LJ5 Y;  1D0E A;  1S57 A;  2DIV A;  1SKW A;  2H4W B;  3K58 A;  3SSQ A;  1ZOT A;  2PDA A;  4KQZ A;  1B4S A;  2DRB A;  3CWJ A;  1H98 A;  4USU A;  2OTJ S;  1I94 F;  2VOD A;  4ZIT A;  1RAI B;  2MHN A;  3BYP A;  1JXV A;  4DDF A;  3VF0 B;  2HK2 A;  4CLS A;  4BBY A;  4IR1 A;  3OUY A;  3JS9 A;  2KJV A;  3LW5 C;  4GRS A;  4NCA A;  4LRB A;  3IG1 A;  3DLE B;  1FTR A;  2YKM A;  2OP5 A;  3AH6 A;  4KIA A;  3KHH A;  4RW8 B;  1NHK L;  8AT1 B;  2AP6 A;  1X4B A;  4NLW A;  4U8Y A;  4WE1 A;  3BKF A;  1CJU A;  5DQG A;  2JEF A;  4QJV A;  2F4V F;  2K3I A;  3H20 A;  2UUA J;  1V5V A;  1HYS A;  5HMY A;  1FVQ A;  3DU6 A;  1I6J A;  3PAC A;  1K47 A;  1KTQ A;  1WC6 A;  4KB7 A;  5KFA A;  3ZZZ A;  3B4M A;  5K8O A;  3I5A A;  3PW5 A;  1GMW D;  1KSP A;  4DV2 J;  2AW0 A;  2AKW B;  5L1J A;  1TFY A;  4ZP8 A;  3QWP A;  4WYL A;  4M1K A;  3A3P B;  5ETR A;  1RHU B;  1GK8 A;  3TA2 A;  3BZQ A;  4BLG A;  4ZCK A;  3OL9 A;  1RQ0 A;  3M32 B;  3M2V B;  2B4U A;  2HVE A;  1B0T A;  1F60 B;  5KFM A;  4M95 A;  2F63 A;  4LF8 J;  1YRX A;  4ZVT B;  3MD1 A;  1Q53 A;  1HNZ F;  4N77 A;  1MU2 B;  3CME S;  3HT3 A;  2UP1 A;  2VB6 A;  2QLF B;  3W5Z A;  4HI1 A;  3QFH A;  5KFE A;  3S7R A;  2DGV A;  4DF4 A;  3E51 A;  2HHS A;  5HL7 Q;  4F3Q A;  1UJ5 A;  3GIM A;  1RSC A;  1D3W A;  3HFV A;  1SIW B;  3BJY A;  4UUW A;  5KOX A;  3D0H E;  3NOG A;  3FUY A;  4LF4 F;  5J2P B;  4Q44 A;  4PWD B;  2AJQ A;  4K50 A;  2GGP A;  2FQQ B;  2B9E A;  4KGX B;  3DRS B;  4LF6 F;  1KFD A;  2OFG X;  5L1I A;  4GVB B;  1N0U A;  3FEY B;  2LQ8 A;  4USJ C;  5HP1 B;  4ZVR B;  3HHL A;  3D3C J;  1GXU A;  2GCF A;  3G9C A;  4LIW A;  2QRR A;  1S49 A;  3E8O A;  5ETP A;  3IR7 B;  5C42 B;  1NO8 A;  5ETN A;  2U1A A;  4NI2 B;  1GT8 A;  1FWL A;  2DO0 A;  3K5N A;  3PR4 A;  3IR5 B;  3CDA A;  5KAK A;  2AJF E;  2H65 B;  1YBU A;  3S1T A;  1U1K A;  3EGZ A;  3H7H B;  2DHA A;  1UZD A;  4DXL A;  2HHQ A;  3MOJ B;  4ENO A;  4X64 F;  1FFG B;  2VBX A;  2CJX B;  4YY3 F;  9RUB A;  2GHW A;  1FRK A;  3C2P A;  4HR2 A;  2N7C A;  2MGZ A;  2LKZ A;  3D5M A;  1QE1 B;  4V19 J;  3OPK A;  2XY7 A;  2QO3 A;  1KR4 A;  1BE4 A;  3CIZ A;  3EVW A;  4PPZ A;  2QMX A;  3R5D A;  1EKR A;  4RU2 A;  3HLU A;  3CDB A;  2FLN A;  1W2I A;  3NNC A;  2UUT A;  2EFG A;  1RHQ B;  2PI4 A;  1IM6 A;  3HMJ G;  3LP1 A;  1S1U B;  5F0W A;  2CPY A;  1GEH A;  1VHI A;  1C1C A;  3PXG a;  2AJ1 A;  2HHU A;  4KHP J;  1YSJ A;  3P8B B;  4HT7 A;  5T14 A;  1HD0 A;  1U6Z A;  3KUE A;  3NP5 A;  3SCL E;  3ZTS A;  4LBP A;  2ZZN A;  4DEZ A;  2MZ1 A;  4G1I A;  2QE5 A;  2YWF A;  4OHW A;  2XMV A;  1CJV A;  3MR2 A;  2A1B A;  5K8P A;  1Q8B A;  4IO1 A;  3FMB A;  3H2L A;  2BKO A;  1X5O A;  2IYI A;  1WEX A;  4JI1 J;  1EAR A;  1RHK B;  1O6X A;  5JVG Q;  1UPM B;  3UR3 C;  1FKO B;  1SH0 A;  3M8P B;  5G4D A;  4LRC A;  5DLF A;  1NB2 A;  4B9V A;  3G8S A;  3U27 A;  4P10 A;  4V1A k;  1HPZ A;  4X66 F;  1QAY A;  4OV1 A;  4ICL B;  5KFU A;  3CJ5 A;  1RT2 B;  1XMB A;  3IN5 A;  2RML A;  1N52 B;  2M3D A;  3PJ9 A;  1KQS R;  4OI0 A;  2AZ1 A;  3BBF A;  1IWG A;  2CNK B;  2W25 A;  1RDR A;  5D15 A;  3OFH A;  2AD9 A;  2RF2 B;  2A6O A;  2DNY A;  3BGR A;  2QL5 B;  4CTA A;  3ITH A;  4PXC A;  1N32 F;  1WEZ A;  1Q82 T;  3CC4 S;  3QZ7 A;  4F2S A;  3R2D J;  2MEW A;  3PW0 A;  4O3O A;  2KG0 A;  2VG7 A;  4C11 B;  2ZKT A;  5CD4 H;  3T6B A;  1ZS6 A;  3CJQ A;  1HLW A;  1SJQ A;  4ZVE A;  4I68 A;  5G0R B;  1SIZ A;  1T3O A;  2IM0 A;  4FPR A;  3EPI A;  1VQY A;  3BN4 A;  2GC8 A;  1FFS B;  3NGR A;  4CH0 S;  1S1V B;  2M4M A;  2YPY A;  2CPF A;  4W90 B;  3I55 S;  4NLD A;  3NAH A;  4LSN A;  2VKR A;  3CCW A;  4NE9 C;  3Q86 A;  3TEH B;  1HWL A;  1HMV A;  4C9D A;  3PZP A;  3L7O A;  1L3V A;  3DMJ B;  4LFC J;  2FVR A;  2E7X A;  3VR1 A;  3FCH A;  2K1R B;  4ED2 A;  3GTY X;  2ZJP Q;  3NWR A;  3CDE A;  1TUV A;  2YX4 A;  1LW2 A;  2ASJ A;  4LR9 A;  3ZFV A;  1TL4 A;  1VQ5 S;  1DQA A;  5KG0 A;  3KLF A;  2AEJ A;  5E41 A;  2J76 E;  1WC5 A;  1HBM A;  4F26 A;  2GIQ A;  2WW4 A;  1NK0 A;  3MM6 B;  3QID A;  4NPO A;  5IM0 B;  5KFW A;  1HI1 A;  5KFR A;  4NXN J;  3TA0 A;  1FDD A;  1S9E A;  2R7X A;  1V6H A;  2OD6 A;  3C6T B;  2V8G A;  2FJW A;  1R0A A;  3UQS A;  4DV4 J;  6FD1 A;  1SL0 A;  1WG4 A;  1WHV A;  3CSK A;  3MCS A;  1X5T A;  4K4S A;  1HWJ A;  5I42 B;  2FDN A;  5KFH A;  4USW A;  2IMO A;  4KO0 A;  2P9G A;  2QLX A;  3ICL A;  1NZ8 A;  4GKJ J;  2D3U A;  5KG5 A;  4LSZ B;  2QT7 A;  2DHS A;  3KXD A;  4HDG A;  2HHH F;  1HNV B;  1DZ5 A;  1CUL A;  3NCR A;  3DNC A;  3HJF A;  5KFT A;  1Z4U A;  1FWP A;  3C15 A;  3DDK A;  5I3U A;  1JJH A;  2UZA A;  1QVF R;  4NLP A;  4RW4 A;  5LSL A;  2ROE A;  1FXR A;  3RBZ A;  4CRJ A;  1M5S A;  4YUD A;  2OPR A;  1VR6 A;  2YWH A;  4Q0B A;  4FYD A;  4PEO A;  4LRA A;  3GFY A;  3EDR B;  1QAI A;  3DOK B;  2IA6 A;  3FEX B;  2H5I B;  2M5Y A;  2JOQ A;  4FBU A;  4C48 A;  4P73 A;  1IR0 A;  3TVK A;  3M6W A;  3JTO A;  2EBE A;  4UT4 A;  1T9U A;  2JVO A;  3IBF B;  2BJ7 A;  3R1H A;  5CH7 B;  3HHK A;  2PEH A;  1R89 A;  1RI7 A;  4O4G B;  2QGF B;  3T3F A;  5CQG A;  2FC8 A;  2ZE2 B;  4DLG A;  2MQQ A;  2IPO B;  5C2G A;  1ZM3 A;  2XCP A;  1N5Y A;  1RWX B;  1FFW B;  3SCI E;  4IFV B;  5DZ7 A;  3NCP A;  3OFE A;  3MM5 B;  1XNR J;  4ZPT R;  3TQ1 A;  2J5A A;  3RBE A;  3NCQ A;  4NRT A;  5HVH A;  2KFZ A;  2VBZ A;  3D67 A;  2HFN A;  3DCA A;  4ZVF A;  1HNW F;  1CJK A;  3GB0 A;  5ETL A;  1FK9 B;  1WF1 A;  4AND A;  1QVG R;  4QIW D;  4QWA A;  3JSR A;  3GLJ A;  4AL7 A;  4H4O A;  2LP4 A;  2DIT A;  3W2V B;  5F9L A;  1JKH B;  1HNI B;  3J7Y U;  4DR4 F;  4QW8 A;  4HHU A;  2P9C A;  3MEK A;  1ZAV A;  1IKX A;  2EVZ A;  3V4I A;  4A8K A;  2PT0 A;  1A0O B;  2V68 A;  3IM8 A;  4CLK A;  2MJU A;  3R7S B;  4WK3 A;  3E01 B;  2UXB F;  4ZPC A;  2DR6 A;  2O01 C;  4ID8 A;  3LWM A;  2IRX A;  1WI8 A;  1WOP A;  2IBK A;  1WTF A;  2OSR A;  3W9J A;  4LFA F;  3CUN A;  1YJT A;  4IH7 A;  4LBH A;  4DV1 F;  1ZTT A;  1TFW A;  4CNY A;  3ZTR A;  4FZV A;  2DRA A;  1X4E A;  1UP1 A;  2L9W A;  9ATC B;  3RG6 A;  4JI4 F;  5JXS A;  4A46 A;  1FTC A;  4DN0 A;  5HBM B;  1S79 A;  2GO8 A;  2BJE A;  1K44 A;  2ZH3 A;  1VQK S;  3GII A;  2DK2 A;  4EMD A;  3EPG A;  2WOM B;  2LXI A;  3P49 B;  3QMQ A;  3TAR A;  1HQE B;  2COL A;  5B0G A;  4J9K A;  2ZH1 A;  2DO4 A;  3A3N B;  3PYE A;  2VHG A;  3GJQ B;  1OWX A;  5EN1 A;  2WCX A;  4WP9 A;  2M7S A;  4DR3 F;  4NYP A;  1NZA A;  2DCU B;  4YHH J;  2ZH7 A;  1N33 F;  2IFX A;  3MXH P;  2J9D E;  4NMX A;  4I7F B;  4A8Y A;  2HND A;  1TEL A;  4LVN P;  3H8Y A;  1IR1 A;  1BQM A;  3IGN A;  2DNN A;  1JLC A;  3PY8 A;  1MW7 A;  3S01 A;  3QAT A;  1RBA A;  4X62 J;  1B99 A;  2ZWO A;  3QZ8 A;  4PG6 A;  4O44 A;  3PIO Q;  3PW2 A;  4KGM A;  4QWE A;  3L4B C;  4LF5 F;  2RRA A;  2E9Z A;  1GFW B;  4QWC A;  5KFD A;  1F9E B;  4NLO A;  1FT8 A;  5D77 A;  3PO4 A;  3UW1 A;  1XWL A;  4RKU C;  2RUG A;  4DQQ A;  2F8H A;  4JI7 J;  2XYH B;  1IXK A;  3P6Y C;  1ZZF A;  2X1G A;  3ZTO A;  5J2N B;  1ZA1 B;  4DN9 A;  2MQN A;  2K3K A;  3W7B A;  2OPS B;  2XHW A;  4WBF A;  3SFG A;  3T1Y J;  1ZH5 A;  4PAB A;  4JI5 F;  3KK2 B;  4B3S F;  2HZA A;  4NLT A;  1XJW B;  2OLW A;  2C2Z B;  2DGW A;  1ZTW A;  2CXE A;  1FE4 A;  4LQ3 A;  4OL8 A;  2JL9 A;  5D78 A;  2CAJ A;  2HGL A;  1T94 A;  2KYX A;  3K5O A;  3EDQ B;  3EGV A;  2NYH A;  1C1B B;  1XTZ A;  3KLE A;  3AOD A;  4ATN A;  1GX6 A;  3M9O B;  4GC6 A;  4JV1 A;  2BVZ A;  4WFZ A;  4JV5 F;  1HHQ A;  1U1R A;  4PQA A;  4ELU A;  4IOA Q;  1HNX J;  5GMK a;  2W8K A;  2RAQ A;  3Q8U A;  4MIB A;  4DV5 J;  3OHB A;  1XNQ F;  1OO0 B;  4X4T A;  1JQG A;  2CJQ A;  3ZZR A;  4B08 A;  3GJR B;  4CWB A;  4IG3 A;  5B0B A;  4P6Q A;  4Y6I A;  1MWQ A;  4DG1 B;  4OMF G;  4ECW A;  1Z2Z A;  3MED A;  2KYZ A;  3PVX A;  5FDL A;  3EVO A;  3JXO A;  5F8M A;  4WYW A;  4IH5 A;  2HFV A;  1TVR A;  3ULH A;  1DLO A;  2WZ1 A;  3K5L A;  2AZ3 A;  5DDR C;  1PC5 A;  3D6M B;  4B3M J;  4N8N A;  1VIX A;  4CLF A;  4IDK B;  4DCO B;  2XHC A;  4TKT A;  2LQJ A;  4BDP A;  2HQF A;  3GYX B;  3M4X A;  3RBX A;  5C7P A;  4JI8 F;  5AJ3 J;  4PUO A;  2EFQ A;  5C24 A;  3OVS A;  1SJ4 P;  2MST A;  2R8I A;  1CQM A;  3NG8 A;  4USH A;  1ITP A;  5KFQ A;  3MM7 A;  1NJI T;  2BE7 D;  4YME A;  2I5J A;  4Q43 A;  1RE1 B;  4EO8 A;  1DY3 A;  2CAD A;  3GYN A;  3AA9 A;  3RRH A;  4IFY B;  4I64 A;  5EWG A;  2W9C B;  2KT3 A;  5LT5 A;  4J5O A;  2DT9 A;  3PYF A;  3HVT B;  3JSM A;  1LWE A;  1RTD B;  5B08 A;  1HI8 A;  1JX4 A;  5KFC A;  2ZHB A;  1AZS A;  4MMO A;  1FRX A;  5A8K A;  5A6P A;  1IBC B;  4FF1 A;  1FXD A;  4AE5 A;  2X1B A;  1JLE B;  4Y65 A;  2DNQ A;  1PAE X;  2HWI A;  2V69 A;  2WK4 A;  3DYA A;  4O3P A;  5BYS A;  3N01 A;  2XI2 A;  1NJX A;  1KOO A;  2A18 A;  4IRC A;  2VKZ G;  2LDY A;  3UDL A;  3CTR A;  3ILI A;  2AWZ A;  2KG1 A;  2RHS B;  2H51 B;  2MYF A;  3SV3 A;  4EBD A;  4MKV A;  2YNF A;  3LF0 A;  3D0G E;  3HSD A;  4UST A;  3QJL A;  1IBK F;  3V6D B;  1OY9 A;  1DTT A;  1XR7 A;  1MSW D;  1FRJ A;  3ISN D;  1JLQ A;  4NXM F;  2JLF A;  4CT8 A;  4F0M A;  1SC1 B;  2LA6 A;  4LF7 F;  1K8A T;  2V50 A;  1C0T A;  2NS1 B;  1TKZ B;  4B3T F;  3AD9 C;  3DRY A;  1YIJ S;  4OHY A;  2VH7 A;  1ZM4 A;  3OL6 A;  2NPF A;  5ETM A;  3BH6 B;  4Q8E A;  3WX4 A;  3DGP B;  5GAG U;  3G86 A;  2YNG B;  3BPS P;  3GJT B;  2R3V A;  2DXD A;  1SUQ B;  4QOT A;  4A8X A;  3QRQ A;  1RT5 A;  4NA2 A;  3FRZ A;  2EC2 A;  1UVK A;  3CMQ A;  3M30 A;  2YKM B;  1LXN A;  3T1H J;  1U2R A;  1SQE A;  2FC9 A;  3BBB A;  1ZZN A;  4NEZ A;  2IHR 1;  1YRU A;  4O0N A;  3IXQ A;  3MUT P;  1N36 F;  4PG5 A;  1BUX A;  3L7P A;  1N34 J;  2VU5 A;  3MI7 X;  2IJF A;  1IQZ A;  2DD8 S;  2FVP A;  1Q7L B;  4USV A;  4J9U E;  5E3A A;  2PMW A;  1HYS B;  3MPU B;  1K9M T;  2L08 A;  3HK2 A;  2EWH A;  3MR7 A;  4F0H A;  3CO0 P;  2YPZ A;  3CT9 A;  2OML A;  4JI2 J;  4ALZ A;  4XDD A;  3PCO B;  3EX7 B;  4RUA A;  3JQM A;  3N5B A;  1NSP A;  2HIY A;  2E5L F;  4J37 A;  3H5U A;  3Q23 A;  3BPD A;  1EB0 A;  2KTQ A;  3V6J A;  2ALZ A;  2AEF A;  5CYQ A;  2DHX A;  2MZT A;  1WC0 A;  4ECS A;  4TQS A;  3GE9 A;  3A8I A;  4FYV B;  2YQ1 A;  3DHW C;  5KOW A;  2P8I A;  2W2N P;  5LXY A;  3AD7 C;  2BXJ A;  3GV8 B;  1RTI A;  2HPU A;  1U1O A;  4UOC A;  2EPI A;  3UN5 A;  1KNZ A;  3N28 A;  3FQL A;  2Q3P A;  3LOU A;  4CO4 A;  4M5N A;  2CJA A;  3J81 j;  2MQM A;  3MPY A;  3M8Q A;  1WJ9 A;  1C0U A;  2Q1L A;  4KE5 A;  1WHW A;  1KWM A;  2LMI A;  4DV3 J;  1G4C A;  2QL7 B;  3QAU A;  3N6N A;  2ZOF A;  3K57 A;  2VQE F;  2R8K A;  4LR8 A;  4WZM A;  1QDU B;  2CQC A;  3ENW A;  1G1X A;  1JB0 C;  4P52 A;  4C8Z A;  2QMW A;  3NXZ A;  1JWW A;  4FP9 A;  2BBE A;  5C5J A;  1X4D A;  6AT1 B;  3D28 A;  2ZUA A;  4OYI A;  3PDN A;  2LU2 A;  1X4G A;  4OX7 A;  3H5S A;  2KB2 A;  4ES2 A;  3S6E A;  2DNZ A;  3MMA A;  3TP2 A;  3IS9 A;  2YWG A;  2VF3 A;  4ZVG A;  5HAN A;  2YBV A;  4ANC A;  4WFN Q;  3FBC A;  2UUB J;  4RWW A;  4ECX A;  4PKD B;  3VAM A;  4O3N A;  2ZVS A;  4B02 A;  3EZO A;  1T9T A;  2H48 B;  2F5G A;  4MYU A;  5AXM A;  2E7W A;  2V2Z A;  2VG5 A;  3K7R A;  2J9C A;  3CCS S;  3CCL S;  3U1L A;  4YB5 A;  1U1P A;  1WEL A;  4AYB D;  1BD6 A;  5KFI A;  1WWH A;  3GG1 A;  4DZD A;  2HHX A;  3KLH A;  3NL0 A;  2R7Q A;  2E5G A;  2PO4 A;  4KPY A;  2UV8 A;  2FHJ D;  2OD4 A;  2D41 A;  1RT6 B;  4XTT A;  4OZ1 A;  4FXV A;  2Y0S D;  4G1Q A;  2YXL A;  5KG4 A;  4A8W A;  3Q89 A;  4ZJQ A;  4EYH B;  2G0J A;  2UVW A;  2HQG A;  5DDO C;  1RTJ B;  3TYT A;  4I56 A;  3HP6 A;  4OZ2 A;  5ETT A;  2Z30 B;  4C98 A;  2DGQ A;  1IKV A;  3J80 U;  2C2O B;  1RAH B;  3LP1 B;  2XS5 A;  1CSJ A;  3GFZ A;  3TUJ C;  2X1A A;  1C1C B;  2H9Z A;  5HJX A;  3NNH A;  3CCQ S;  1HQ2 A;  1QJH A;  2GNK A;  3SI8 A;  1CG2 A;  5L1K A;  2X51 A;  5IQ6 A;  4XPE A;  2VPZ B;  3E3X A;  1JJC B;  4M5L A;  3UCZ P;  2EFO A;  1TUW A;  2CZ4 A;  2RSQ A;  4B3O B;  2CZ9 A;  4U67 Q;  1CJV B;  2ZNZ A;  4WFX A;  2LQB A;  3WC2 A;  5H1S V;  5E2Q A;  4XDC A;  1XEZ A;  3MMJ A;  4YFU A;  4NCG B;  3KNG A;  3NGS A;  1U49 A;  4FBT A;  3UCG A;  1R31 A;  3B6B A;  4KBI A;  1HPZ B;  2R2U A;  5IT9 Y;  2E9R X;  3ZZ0 A;  1S1X A;  3HSJ A;  4FF3 A;  2MJN A;  1FDB A;  3T9N A;  1S10 A;  3LAL A;  1KLM A;  4A8Q A;  5GMD A;  3IR6 B;  3US5 A;  3AOA A;  3QT6 A;  4X84 A;  2I6W A;  2VBY A;  4U6P A;  4HH0 A;  2BRL A;  3QJJ A;  3PYD A;  2BOP A;  1RUS A;  4RLE A;  2BE2 A;  3ILJ A;  2BQ3 A;  1IQT A;  3ZXW A;  1PO6 A;  2XLI A;  3BGR B;  4CTA B;  4PXE A;  5F8L A;  3M2R A;  4ELV A;  3CGI A;  2XZD B;  3W60 A;  1H6K X;  2IM3 A;  4J9Q A;  3M6U A;  4RW6 A;  2VG7 B;  1GX5 A;  2PI5 A;  4GKK J;  2AQ4 A;  3MUR P;  2XMW A;  4K4T A;  5CYJ A;  4J9R A;  1R8A A;  4PWU A;  1Q86 T;  4DR2 J;  4X4N A;  4P7V A;  4M94 A;  3LP2 A;  4AT1 B;  1MRO A;  3AD8 C;  5B0D A;  1EAY C;  3NMR A;  4LSN B;  1U4B A;  4GC7 A;  5GME A;  3LWL A;  1NEE A;  1HMV B;  3ILL A;  1Y4Z B;  2BEF A;  2HWH A;  3G2X A;  3NS7 B;  2XLK A;  1Q0N A;  1RU2 A;  2FB0 A;  4DV6 J;  1WF0 A;  3SSR A;  1CC8 A;  2OH2 A;  3CCM S;  2KXN B;  1NHV A;  3H4B A;  1LW2 B;  2ZBC A;  2AGQ A;  3KLF B;  1M5K C;  1HBM B;  3D6H B;  4ZVQ B;  5EX0 A;  2R2T A;  1N5Q A;  1Q8I A;  4M5J A;  5C2C A;  5KG6 A;  1RLD A;  1ZET A;  2OMO A;  4R8U A;  1RCO B;  1VS3 A;  2E7V A;  2VA3 A;  1S9E B;  3LTO A;  2ZC4 A;  4K4X A;  3ZNJ 1;  1R0A B;  1SKS A;  2V2K A;  2ZBR A;  4IOC Q;  1DAR A;  1YRT A;  2ATC B;  3F56 A;  3FGV A;  5B0C A;  3PFE A;  2PFD A;  1PYO B;  3QT7 A;  2HVH A;  5DZ6 A;  4DUY F;  2C3O A;  2E29 A;  4DSJ A;  2DR5 A;  3JYT A;  2OSQ A;  3TZX A;  3RB4 A;  1WC4 A;  2DJW A;  4C7Q A;  1CUL B;  1RT7 A;  4X65 J;  3KLV A;  2BM0 A;  5HVF A;  3BS9 A;  5I3U B;  4C6A A;  2UXC F;  3FBB A;  4RW4 B;  2M2B A;  3VVU A;  4K4U A;  2OPQ B;  3U1M A;  1UTA A;  4BWJ A;  1F0X A;  3I32 A;  2B8P A;  3K59 A;  3D7S B;  3TJ8 A;  4TN2 A;  4DPY A;  4Q0B B;  4Q8F A;  3C46 A;  3J80 Y;  1QUV A;  4JI6 J;  2VDI A;  4CO0 A;  2W7A A;  2G2Z A;  4W98 A;  3MMB A;  5IC6 B;  2YQ0 A;  2BA9 A;  4ITS A;  3QPI A;  4ZP7 A;  4ERD A;  1DQ8 A;  4WII A;  1F3F A;  1KEK A;  2QA2 A;  2ZZM A;  2KXH A;  1VQO S;  1RWO B;  2XNQ A;  5HK4 A;  5A76 A;  5J1E A;  1N5Y B;  1Q79 A;  3CDW A;  1N5T A;  5J2Q A;  2W2O P;  2WBR A;  3OFG A;  2B7B B;  2XZW A;  2VQF J;  2V8D A;  1A6L A;  2C22 A;  2MZQ A;  5GAD U;  2MQP A;  4G3I A;  5F9N A;  1CJK B;  1JLF A;  4EBE A;  2MMY A;  1NAQ A;  1LEO A;  3HJV A;  4F50 A;  1B3T A;  1XMQ J;  2ZUG A;  2CJK A;  3BEG B;  1JXE A;  4H4O B;  2XWY A;  4OI2 A;  1U0S A;  3R7B B;  2FY1 A;  2HVI A;  4DQI A;  2EG2 A;  3G71 S;  2V4J B;  4EZ9 A;  3UD3 P;  1S48 A;  1RAB B;  3C16 B;  1IKX B;  3V4I B;  2HHP A;  2QA4 S;  3GG0 A;  1RIS A;  1YZ7 A;  5EWE A;  4IKA A;  5BR8 J;  4JI0 F;  1EX8 A;  2MPU A;  5DO2 A;  3UD5 A;  5GAH I;  4F2R A;  1S72 S;  3P3D A;  1VFJ A;  1X7V A;  4PG7 A;  5B09 A;  4K0K F;  5HQM A;  1T95 A;  2JWN A;  1NKC A;  3W9I A;  4RNH A;  3HKZ D;  2K06 A;  3PEH A;  3CUL A;  2VG6 B;  4CLL A;  2DRD A;  4AL6 A;  4QQB A;  1SH3 A;  2JLG A;  4DQR A;  1KKH A;  1UWB A;  1SJ3 P;  2HHW A;  3HHL D;  4JV0 A;  4I2P A;  3FC9 A;  2LU1 A;  2V63 A;  3GIJ A;  4BC9 A;  1HHT P;  3MPD A;  4NZ0 A;  3LPY A;  3L9Z A;  5KFY A;  4ZS6 A;  1N4L A;  5ITH A;  2ZH2 A;  2W7P A;  4DSL A;  2R7R A;  1X5S A;  2IM2 A;  1HW8 A;  3H2V E;  1IBM F;  4C8K A;  3SV4 A;  5AE2 A;  1VC6 A;  1ZM2 A;  2QJ3 A;  2UUC F;  2JNJ A;  4BWM A;  1SL1 A;  3CE8 A;  1I5O B;  3VAI A;  2V4Q A;  2BR0 A;  4PXB A;  4Z7C A;  3N4W A;  3GYG A;  2BW7 A;  4UW2 A;  4JI3 J;  2HND B;  4HYK A;  3B54 A;  4AUK A;  4CI0 B;  3PX6 A;  3IBC B;  3CPW R;  5K14 A;  1JLC B;  2GFF A;  1H38 A;  1MMN A;  3QNW B;  2AJ4 A;  1NHU A;  5J2M B;  1HR0 F;  1S59 A;  5J1N A;  4DR7 J;  2DR8 A;  2DXF A;  2MZR A;  5FD1 A;  4CM0 A;  4CYU B;  3H2U B;  4Q2L A;  4V19 X;  3OJU A;  4LSL A;  1KC8 T;  1S6P A;  4A4J A;  3G8Q A;  3WHI A;  2XNR A;  3TUP A;  2YNI A;  1PSD A;  2CQD A;  1S7I A;  2IA0 A;  3K8W A;  4CLZ A;  2DKO B;  4K7Q A;  3HDS A;  2XMM A;  1KFS A;  1QUP A;  1Q95 G;  4QWD A;  5GAE I;  1VGY A;  2XTJ P;  2FLO A;  5KFG A;  4Y2I A;  3R97 A;  7FD1 A;  4ZHR A;  3THT A;  3PV8 A;  3PW4 A;  2R8G A;  2GS8 A;  2GVZ B;  2HKE A;  3R5J B;  4ILM A;  2SXL A;  1FEE A;  2HFS A;  1U1N A;  5HMW A;  3KYL A;  1IBL F;  2CA9 A;  4KHM A;  3BGU A;  1RKJ A;  3KLE B;  2VFV A;  1P6T A;  2ZEJ A;  2NQP A;  2WSE C;  3P5B P;  4DQP A;  1J2V A;  2BUN A;  2DY9 A;  2BRK A;  5L9X A;  3GIL A;  1T03 A;  1BY9 A;  3L3C A;  3OFF A;  2PC6 A;  3H5Y A;  2HNY A;  4FDF A;  2MB0 B;  3AXK A;  2WTF A;  4KPC A;  4NAS A;  1URR A;  2B5J B;  4IG3 B;  1XMO F;  1TV6 A;  4AD6 A;  1RTH B;  4DR1 J;  4GO5 X;  3CD5 A;  3DLK B;  3MED B;  1NJZ A;  5FDL B;  3ZTP A;  2J0W A;  1TVR B;  2VJU A;  1RHJ B;  3RTV A;  1UCN A;  2YH1 A;  2AGO A;  4TNO A;  5CYM A;  7AT1 B;  1AUD A;  2N7Y A;  3MFI A;  4BHQ A;  1T9W A;  3NMA A;  5D0H A;  2IVM A;  1OY8 A;  2QLJ B;  2GIF A;  3N79 A;  3HD2 A;  2N4C A;  1YWX A;  2G0I A;  2MTL A;  4KY3 A;  3KNA A;  2C3Y A;  3OW2 R;  2CNL B;  3FNN A;  3ENV A;  5L38 A;  3ET6 A;  5FLX Y;  1I94 J;  1SJR A;  3GSD A;  4DL7 A;  3QRP A;  1PJ6 A;  3NS5 A;  2C28 A;  2CNN B;  1O8B A;  2YH0 A;  5D6G A;  3CCJ S;  4Y3C A;  1CQN A;  2V9K A;  3R5C A;  2MXY A;  2ROP A;  2CQG A;  3P45 B;  3GCW P;  3LAN A;  4IG0 A;  3MAH A;  2PGC A;  1RT1 A;  3DI6 A;  5H9E J;  2E1M C;  2RRB A;  3O1L A;  4QIE A;  2XO6 A;  5A8K B;  4P7T A;  2WRM A;  2MDA A;  3SMZ A;  2ERR A;  4NA3 A;  5T7L A;  3IGV A;  2IAJ B;  2Z58 B;  2F4V J;  3AJD A;  2DVI A;  3DFE A;  3PKM A;  2IJN A;  1FO1 A;  3DYA B;  4AXI A;  3RZA A;  3A1Y G;  2K7J A;  4KFB A;  2LCW A;  3I0S A;  1AUS L;  5L8R C;  3SIP B;  1WHX A;  2W2P P;  5DJB A;  2W01 A;  1R0C B;  3A3O B;  1YIT S;  3ZZU A;  4OFZ A;  1KHW A;  3I5B A;  1FWK A;  5ETV A;  4O3R A;  2J7U A;  5E5N A;  1Q1K A;  3BSC A;  2RKI A;  3AY0 A;  3PR5 B;  2KVI A;  3TUI C;  4LF1 A;  1S7H A;  2Y0B B;  2X3G A;  3TOQ A;  1UFW A;  1SPB P;  4FYW B;  4OZL A;  4WTY A;  1DTT B;  1UW4 A;  4J9P A;  1U1L A;  2YTC A;  1JLQ B;  2R2S A;  2VUG A;  1VHF A;  3GIR A;  2BQU A;  5B0F A;  1HNZ J;  5JUM A;  4WJB A;  3DC2 A;  4YB7 A;  3RUB L;  3AT1 B;  4DPT A;  1WOO A;  2BM1 A;  1MN9 A;  5I3P A;  4YR3 A;  3H4D A;  3VHQ A;  1RBO B;  3SQG B;  2DHG A;  4B9N A;  3D4J A;  1F2H A;  3SDE B;  3DM2 A;  4M5I A;  2WB1 D;  4P2S A;  3QGH A;  1RT5 B;  2ZH8 A;  2NUH A;  4ZVP B;  4LF4 J;  1WKL A;  3ENA A;  4ED6 A;  2ZD1 A;  3TO8 A;  3D1O A;  4N7T A;  3M30 B;  3CJ2 A;  4ED7 A;  3CJ4 A;  3MM9 A;  2AYE A;  4J9O A;  4LF6 J;  1V3R A;  5F8N A;  3DLB A;  4BC7 A;  2KFY A;  1LQ9 A;  1H7W A;  4OZ5 A;  1HAR A;  3T1A A;  4LR7 A;  4B9S A;  1RT4 A;  3WIV A;  4FYX B;  2VFT A;  2GW8 A;  1IKY A;  2HZC A;  2BDP A;  3I5C A;  1R8H A;  1VMB A;  3WX8 A;  4OJH A;  4M5D A;  4F4K A;  1KVJ A;  2MSS A;  4MK9 A;  3M2U A;  4LQ9 A;  4X64 J;  3NBP B;  3AA8 A;  2A0F B;  4QW9 A;  3SSS A;  4YY3 J;  4KR0 B;  2Y1R I;  5CYQ B;  1X9W A;  5KG3 A;  3ISN C;  1S12 A;  3IRX A;  2YKP A;  2ZIT A;  1RTI B;  4ILL A;  3D1Q A;  2HNZ A;  3RB6 A;  4X4R A;  5F8H A;  1FA0 A;  1H0H B;  2HHV A;  3UDV A;  4PAA A;  2GVD A;  2I38 A;  3DRR B;  3M8Q B;  2UVR A;  2M0G B;  4J91 A;  3UFC X;  2HFZ A;  1D9F A;  1RA7 A;  5AE1 A;  2HG4 A;  4DMZ A;  3BO2 A;  1JMT A;  1RAC B;  1Q81 T;  2FPH X;  2WW8 A;  1FD8 A;  1UVM A;  1WC1 A;  3T41 A;  1OQ6 A;  2DNG A;  2CPZ A;  2EKY A;  3W2W A;  4U8V A;  4M5H A;  3K2Y A;  5C25 B;  3GIK A;  3J7Z T;  5K5M A;  2Y1I A;  4PXD A;  2AYG A;  2KZZ A;  2ZHA A;  1H73 A;  3PEJ A;  5H9F K;  1QSY A;  3R3T A;  4MKY A;  4IUF A;  4L75 A;  3GMG A;  4Y2K A;  2GHP A;  3TI0 A;  3JB9 k;  1RLC L;  2DNP A;  3MMA B;  4A8O A;  3FCV A;  3IS9 B;  1F3V A;  1YJU A;  4KGZ B;  3M32 A;  2XMT A;  4ZN3 A;  2VPW B;  3IBW A;  3M2V A;  2V4R A;  1S77 D;  3CC2 S;  2YKQ A;  2KM8 C;  4X66 J;  3WBZ A;  1U1M A;  1MU2 A;  3IFE A;  1R27 B;  2R4F A;  3L09 A;  3BSN A;  2B4V A;  2EI5 A;  5KFS A;  4LF9 F;  3KLI A;  5KFL A;  3HSZ A;  3W8G A;  4ZLP A;  2DIU A;  5DET A;  1N48 A;  3KLH B;  3FZB A;  1HQU B;  1GXT A;  5LMU F;  5KTQ A;  1N32 J;  3NEK A;  4CQ1 A;  5AXN A;  2W4D A;  2F1F A;  1UA0 A;  3D6F B;  5FJ4 A;  4DV7 F;  5HRO A;  1M5H A;  2ASD A;  1QY7 A;  2HLU A;  1LW0 A;  4ID5 A;  1SVD A;  3VZH A;  5DG8 A;  2GML A;  2IRY A;  2HQD A;  3UR0 A;  5D4L A;  1IKV B;  3KG4 A;  3SYZ A;  1FCA A;  2D3O R;  5JMN A;  4J7C A;  4OYM A;  2OEL A;  2R42 A;  1LKZ A;  2ATL A;  1UL3 A;  4KH0 B;  4B3R F;  4ER8 A;  1TL5 A;  1D8Y A;  1U2F A;  4YB6 A;  4NI2 A;  5F8I A;  3QQC D;  1NU4 A;  1TQL A;  1JXL A;  3ZC4 A;  2CQI A;  4F3O A;  1FNO A;  2CQH A;  3AFG A;  3FFI B;  4DL0 C;  4CT9 A;  4EI2 A;  2FZG B;  3VAL A;  3CJ0 A;  3BQ2 A;  5F0U A;  2R2R A;  3FVY A;  3I9Z A;  4NLQ A;  2VOP A;  3A8K A;  5EGY A;  4N5S A;  2D3O 1;  3SFU A;  1F1B B;  2DGT A;  2NRE A;  2I2Y A;  3BGL A;  2BJ9 A;  1WI6 A;  1WF2 A;  3VAH A;  1Y00 A;  3OVB A;  1FD2 A;  3BBC A;  3G6V A;  4FNI A;  3FDS A;  3OSN A;  6FDR A;  1KLM B;  4ZP9 A;  2RQ4 A;  4F04 B;  1LWX A;  4RW9 A;  3CNQ P;  4ZA1 A;  2JZ5 A;  3O2I A;  3LQV A;  2BE2 B;  3HVW A;  3IA0 A;  2HHH J;  1K73 T;  3NRB A;  2WVE A;  1NKB A;  1I1G A;  4DR6 F;  3M2R B;  4Y00 A;  1TL1 A;  4WFY A;  2MLY A;  4RW6 B;  1CC7 A;  2P6S A;  4QR1 A;  4JYA F;  5DGA A;  3GQC A;  2A2C A;  4K5R A;  3MOZ A;  1FES A;  1REG X;  1U47 A;  1BWV A;  1T05 B;  2ZM6 F;  4NL5 A;  4QZV B;  1S6Q A;  3LP2 B;  1WOS A;  1MRO B;  4JOU A;  1R8P A;  3VTI A;  3LH2 S;  3ONQ A;  1YLX A;  3OXF A;  2CG4 A;  2CG8 A;  3GU0 A;  2Q6B A;  2OEJ A;  3M8R A;  1KN6 A;  1K0T A;  3HHN B;  1RT2 A;  2CJ9 A;  4OQJ A;  4OYA A;  3QBC A;  4L3K A;  3GZ7 A;  3D68 A;  3UDE A;  3BM7 A;  4FXW A;  1P8G A;  2KHC A;  4OX6 A;  1OQ3 A;  5KG1 A;  4S0M A;  4HDH A;  2FJA B;  4CH1 A;  4F4Y A;  2XI3 A;  2PA8 D;  3HVA A;  4PWW A;  4ETX A;  3GR0 A;  3F0N A;  4N47 A;  4IQX A;  4I2Q B;  3CJ8 A;  1HNW J;  4LT6 A;  4EU0 A;  3MMC A;  1UFL A;  4FS2 A;  2QTW A;  2WSC C;  3H40 A;  1IR2 A;  4WXO A;  4CO5 A;  2CNO B;  3CED A;  1TUG B;  1X4F A;  4DR4 J;  5IXU A;  3ZTQ A;  4OZ0 A;  4K4V A;  1GNK A;  4QIV A;  3RW6 A;  4F4W A;  4TU9 A;  1SV5 A;  5A8R B;  3OXG A;  3FJ2 A;  3JYT B;  4WP3 A;  2PMZ D;  4WTO B;  4UTG A;  4C8N A;  1RT7 B;  3KJN B;  4ZVS B;  1ZA2 B;  1M1H A;  2UXB J;  1M90 T;  1LXJ A;  1V9O A;  4OHX A;  1R43 A;  3CW2 C;  3OHA A;  3G8T A;  4LFA J;  2K1R A;  3TAM A;  4DV1 J;  3KUH A;  2HRT A;  4DHV A;  4MTP A;  2FY8 A;  1FDA A;  2B8Q A;  1SQF A;  4WWS A;  1WTB A;  3PYG A;  2ILZ A;  2M8H A;  3MCO A;  4PZV A;  3RR8 A;  1Q5V A;  1UFK A;  4JI4 J;  2DY1 A;  2MY7 A;  3MM6 A;  1U25 A;  2GX8 A;  1U45 A;  2DH7 A;  5RUB A;  4RNF A;  3MMB B;  3FK4 A;  4PG4 A;  5GAE U;  1REV A;  4I69 A;  3JQJ A;  4AXJ A;  1IKW A;  1M1G A;  1WAC A;  3EE3 A;  1RHM B;  3POT B;  1IJF B;  2J9D A;  3I87 A;  1RBL A;  2WHO A;  1EET A;  1ACM B;  2PE8 A;  4DSK A;  5J1E B;  4PR6 A;  3I0R A;  4TLR A;  2J8A A;  2C42 A;  3RRK A;  1PKU A;  1SB6 A;  2QYC A;  3HSG A;  4Y2A A;  3C14 A;  1JLA A;  3G82 A;  3R5G A;  4DR3 J;  2AU0 A;  1WEY A;  3QLH A;  2B0G A;  1P1T A;  5LL6 d;  1N33 J;  2V8P A;  4GO7 X;  1RWU A;  2RQC A;  3DOM A;  2V2V A;  3CD7 A;  2NYI A;  3H0P A;  1RAD B;  3PG9 A;  2RHQ B;  1EQ0 A;  3MD3 A;  3TAN A;  4I0W A;  4ILR A;  1RAE B;  3Q8R B;  2KXF A;  2B43 A;  1OYD A;  1JNZ B;  4IRD A;  5KT2 A;  4C3K A;  4LF5 J;  2KH9 A;  2HHT A;  2CVI A;  3L7U A;  1VI7 A;  2B4O A;  4O4G A;  1HWU A;  4H4M A;  1JK9 B;  4G1P A;  2LDI A;  3QIP A;  2LFV A;  4NLR A;  2FGO A;  1RKI A;  4OJ1 A;  3SCK E;  5IT0 A;  5KFN A;  2BKN A;  3QT8 A;  4IFV A;  4JI5 J;  2BV3 A;  3WC0 A;  3TNV A;  2KT5 A;  3PFO A;  4B3S J;  2XLJ A;  1OYE A;  2I8E A;  2D74 B;  1UWB B;  3B78 A;  4I2P B;  3VWS A;  1FK9 A;  2G2Y A;  1NB7 A;  4LIR A;  3Q24 A;  4ZPB A;  3ZZO A;  2P9E A;  4L6V 3;  3WIU A;  2RRN A;  4DQS A;  2HEK A;  1U0H B;  2BJ3 A;  1C2P A;  4JV5 J;  1T11 A;  4NX9 A;  4QR2 A;  3R6L B;  2IC3 A;  3FCW A;  4J9V A;  1XNQ J;  2XBP A;  3HM9 A;  4C97 A;  2VZ9 A;  2YKA A;  3TZW A;  1ROF A;  2QLB B;  3NLC A;  5IZH A;  2IIH A;  2DEI A;  1QSS A;  1FJG F;  2ASY A;  4DPW A;  2R7W A;  4LFB F;  3LGH A;  3VCD A;  1IN0 A;  3MAQ A;  4DI6 A;  5L9N A;  1AYE A;  2OI2 A;  2J7K A;  2VL1 A;  1YDL A;  4USI A;  5KFV A;  3K89 A;  2CUY A;  1XN9 A;  4ES1 A;  4OX9 F;  2EFP A;  4DFM A;  1AFJ A;  4F4Z A;  4RW7 A;  3V81 A;  2A6M A;  2MKC A;  3TZZ A;  2Q6C A;  2H3E B;  1VQ8 S;  1VDH A;  3SEO A;  2J6S A;  2J7W A;  1UKU A;  4TU8 A; 
#chains in the Genus database with same CATH homology
 3KJN B;  4ZVS B;  3NS7 B;  1RWP B;  5IC4 B;  2HBZ B;  1IBC B;  1RHU B;  2CNK B;  1SC4 B;  1RHQ B;  4ZVR B;  3EDR B;  2DKO B;  2H5I B;  3R7B B;  1RHJ B;  2C2O B;  4JB8 B;  3GJT B;  3D6M B;  1RWK B;  3R6G B;  2QL5 B;  3GJQ B;  3R7N B;  4DCJ B;  2CDR B;  3R6L B;  3IBF B;  4ZVT B;  4DCO B;  3R7S B;  3D6H B;  4ZVQ B;  2XYG B;  2C2Z B;  2QLJ B;  1QTN B;  2H5J B;  3GJS B;  5IC6 B;  3RJM B;  1ICE B;  2HBQ B;  4DCP B;  1RHR B;  2QLB B;  2XZD B;  2CJY B;  2H48 B;  4ZVU B;  5K20 B;  4ZVP B;  1NME B;  3SIP B;  3R5J B;  2H65 B;  2QLF B;  2H51 B;  2C1E B;  3EDQ B;  4ZVO B;  2H54 B;  2H4Y B;  1BMQ B;  3KJQ B;  2CNL B;  1RWX B;  1RWO B;  2HBR B;  3P4U B;  1RHM B;  1PYO B;  2CJX B;  3IBC B;  1RE1 B;  1RHK B;  2QL9 B;  2CNO B;  2QL7 B;  2C2K B;  2C2M B;  4LSZ B;  1RWV B;  1RWW B;  3QNW B;  2Y0B B;  2CNN B;  1I51 B;  1SC1 B;  1GFW B;  2HBY B;  2XZT B;  1RWM B;  2Y1L B;  1QDU B;  3GJR B;  1RWN B;  1F9E B;  1PAU B;  2XYP B;  2FQQ B;  2H4W B;  1I3O B;  1SC3 B;  3P45 B;  2P2C B;  3KJF B;  2XYH B;  3D6F B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...