1SC1B

Crystal structure of an active-site ligand-free form of the human caspase-1 c285a mutant
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
88
structure length
88
Chain Sequence
b'AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Interleukin-1 beta convertase
publication title Crystal structures of a ligand-free and malonate-bound human caspase-1: implications for the mechanism of substrate binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 17
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2004-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1sc1B00
2QLBB 1RWMB 2CNOB 2H65B 1RWWB 2CNLB 3P45B 2QL9B 2C1EB 4JB8B 2HBZB 2FQQB 5K20B 1RWVB 4ZVTB 1I51B 3SIPB 2XYHB 3D6FB 3P4UB 1SC3B 2CNNB 3GJQB 3R7SB 3R7NB 4LSZB 4DCOB 2H5JB 2QLFB 1SC4B 3RJMB 2QL7B 2XZDB 2H48B 2C2ZB 4ZVOB 4ZVQB 2H5IB 2P2CB 1RHJB 1QDUB 3KJNB 1ICEB 2H54B 1IBCB 4DCPB 2Y0BB 2HBRB 2C2KB 1PAUB 4ZVPB 4DCJB 1GFWB 1RWOB 4ZVUB 2XYPB 2CNKB 2C2OB 3D6MB 3KJQB 5IC6B 1RHKB 4ZVRB 2XZTB 2H4YB 2HBYB 1I3OB 1RWPB 2CDRB 2CJYB 3R6GB 1RHMB 3EDRB 1NMEB 1RHQB 3D6HB 3IBCB 3GJTB 3R6LB 1RWNB 5IC4B 1RWKB 3QNWB 1RE1B 2QLJB 3EDQB 1SC1B 2H51B 1RHRB 3NS7B 3GJRB 1F9EB 1RWXB 3KJFB 2XYGB 3IBFB 1RHUB 3R7BB 1QTNB 2Y1LB 1BMQB 2H4WB 2QL5B 3R5JB 2HBQB 2CJXB 2DKOB 1PYOB 2C2MB 3GJSB 4ZVSB
chains in the Genus database with same CATH superfamily
3CCMS 2B51A 5EGYA 2FIUA 3BPDA 5ETLA 4B9SA 4TN2A 3W1YC 2DPIA 4C8KA 3C6TB 3UNYA 1FJCA 1TKXA 4P7VA 2PI5A 2DGOA 3TUJC 2N82B 2KKHA 2IY5B 3OFFA 1CJUB 2KO1A 2NXUA 3FEZA 1D8YA 3BR8A 1GT8A 3QIPB 1WORA 2JRSA 4LFAJ 3LGHA 1TKZB 4C4WA 3SCLE 3DXBA 2GMLA 4X4TA 3M8SA 1AA1B 4DN9A 2UUAJ 2YPYA 1TTHB 1VHIA 3VF0B 4OZ0A 4UOFA 2HGNA 5HMZA 5I3UB 1NK4A 3EDRB 1SJRA 3GFHA 2ZZNA 1UKUA 4TYAA 1WF1A 3DDKA 4JI0J 4NYOA 4MAKA 3UQSA 2QMUB 5D0HA 5K8MA 2RS8A 1P8GA 3AJDA 1RHUB 2J9DA 3TA1A 5B7WA 5IT9Y 2KXFA 2LQJA 1VC0A 2HVHA 4UUXA 1HD1A 2X7IA 2HBZB 3DRYA 4K4VA 4G1QB 5H1SV 2MKKA 2GVDB 2GAGC 2E9TA 3A8IA 1WG1A 4KHPF 4AXJA 4ECSA 4LIWA 2MSTA 5EX0A 4B9MA 3FVYA 2B43A 3JXOA 2UVRA 3AA8A 1TL3A 3HKZD 1YWXA 3DLKA 1V5VA 3KK1B 4KFBB 5LSLA 1ZZFA 4PEOA 1D3WA 2H3EB 1RB0A 4KRWA 5KFQA 4LR8A 3OTBA 5LSRA 2R7RA 1FEHA 1IBKF 3ZXWA 4PZVA 4Z2XA 2HHVA 1Y11A 1ZS6A 2DEJA 4YN3B 2GJ2A 2NUHA 1L3UA 3TJ8A 2OFGX 3DOMA 5A0YA 5HI7A 3OL9A 4OZJA 2WAQD 3DLHA 2CQCA 3H40A 4L3KA 4V1Ak 1BQMB 3QRQA 3NOGA 4FYYB 4FZVA 4OIXA 2BW7A 2CZ4A 4OYWA 2COLA 4NLGA 3ENWA 3GCWP 4LRCA 1IBMF 2HS4A 1D9DA 1YG0A 3FEXB 4OX9F 5KFEA 4NMXA 1X7VA 5IV4A 1RYSA 1MN9A 1F9HA 2OPQB 4NRTA 2AHOB 1OY9A 1PC5A 3PYDA 2B4UA 2V68A 3THPA 2DY9A 3OPKA 1A6LA 1IJEB 1SVDA 2KL8A 3HD2A 4NRUA 4DCPB 3D66A 4WE1B 4UZBA 1RAJA 1B99A 1V6HA 2X3GA 3PKYA 1TMMA 3V4IB 3ILLA 3DRPB 4X64J 3IN5A 2VU5A 1VQPS 1A7GE 4L76A 4NXMJ 3R6GB 5JXSA 1N32F 4DQIA 3NMRA 1NCLA 4K2JA 1PJ7A 4NYPA 4AT1B 2R8HA 2AZ3A 3KXDA 4KYZA 2J0SD 1VIOA 2HQCA 3IR5B 3VHQA 4O3NA 4HKQA 4WU2A 3BM7A 2C3OA 3EZUA 2QLBB 1O51A 3RYLA 2VQFJ 1OO0B 1QAYA 4HLBA 4DOZA 3RU0A 1BUXA 1FFGB 2HGLA 1U6BA 1GMWA 3BS9A 2X1FA 4Q8EA 3C16B 1NDCA 3I5CA 2XY7A 3JTPA 1RTJA 3NY0A 4XO0A 3CD0A 2CQGA 3ZZYA 2N4CA 4ES2A 3B4MA 1YJWS 1K8AT 2DHSA 2OPPB 4DR4J 3DI6B 1JNRB 3RB6A 3MMJA 3KJQB 3BO3A 3ZZOA 4GKJJ 4PPDA 1F5AA 4HI1A 3DLEB 2P8IA 4QW8A 2WZ1A 3GJTB 3HJVA 4U95A 1T9UA 3I0SA 3RBDA 2FC8A 2HVIA 1NSQA 3MGJA 2MXYA 3N0VA 3NMAA 1WDDA 3H59A 2DNPA 2GNKA 3W64A 2AMCB 4P2FA 3MEGA 1SKRA 4USMA 3HHDA 5LJ3Y 4B3TJ 3R7SB 1SKWA 2ALYB 2LCWA 1SQGA 4X4OA 2QLFB 1Y9OA 1VYAA 5C2GA 4CO3A 3PCOB 2WTFA 2DB1A 1S6QA 4K4YA 1TU0B 4LIRA 3BGUA 3HVRA 4JP8A 2H54B 1HYSA 5AXMA 1S1VA 1HBNB 3JAMU 4PG5A 4QR0A 3M2RA 4OI6A 5F8LA 2CPIA 3MMAA 4KR0B 2FZGB 2HGMA 2OP5A 1JK9B 1G4CA 3LF0A 1OJ4A 2F1FA 2BANA 3C15B 4P2XA 2DHGA 1YJ9S 3M8WA 3IRWP 3FSIA 3C14A 5M2UA 4JBCA 1B70B 5E3PA 1UVMA 1K1QA 4ICLA 3DC2A 4U9RA 1LW2A 3KUGA 1KHVA 2DGXA 3WC0A 2YPZA 3BV8A 4J9NA 4XIUA 2X1GA 4KGKA 4BHQA 2PE8A 3SFGA 4G1IA 1Q79A 1WEYA 3NWRA 3SZ2A 3O2IA 4L74A 1IJFB 4ZLNA 3UN2A 3HHEA 4I2QA 2P5VA 2J8AA 2CNNB 2NUUG 1RAFB 4DV6F 1KLNA 3HF5A 2MZQA 3FEYB 2OD4A 1C1BB 3TUIC 1SC4B 2UXBJ 3KLFB 2XZDB 2KFZA 3FGVA 2R7TA 4WYLA 2KHCA 1VBXA 2R9LA 2MJNA 3KJNB 1G6BA 1X4BA 3BKTA 2LDYA 1Z4UA 1G1XA 7FD1A 3MEDB 5U47A 4ZVRB 1VFJA 5HROB 2HAIA 2BQ3A 2RAQA 3L09A 4NEZA 3EMTA 4MYUA 1BY9A 2AEJA 2FVQA 3TEHB 4FNHA 2A2CA 2R7QA 5T7LA 1UZHA 2L08A 2VA3A 1RWXB 4DX5A 4J9MA 2LQBA 2E7XA 2W4DA 2MGZB 3FBCA 4LFAF 3P6YC 1IKYB 3FBFA 2XNRA 2IYGA 4QIFA 2UUAF 4PWDA 1FDAA 3IAM9 4JI1F 2RU9A 2J7WA 2BXJA 2IBOA 4DF4A 4GKKJ 1HPZA 5HAOA 4OHZA 2C2RA 1RT5B 1WUUA 4JV2A 4JI0F 1Y7PA 1PC4A 1XNRF 1X4GA 4IOCQ 4IO1A 4OL8A 1Y4ZB 4NCGA 1BHNA 1ROFA 3OLBA 5HN0A 2BJ3A 3ADAC 3K5MA 3VAIA 1A0OB 3GR0A 1C0UB 1YJRA 1GFWB 3EGVA 3SXLA 5E3RA 2V8VA 3VCDA 2QMXA 5JJBA 4A4JA 4O44B 5DGBA 3BGRA 5DGAA 3WQPA 4ZPCA 4QIWD 4K50A 4L75A 1EETB 4C3KA 5C5JA 4I67A 3N79A 2PMZD 1FK9A 3QSIA 4PQUB 3PJWA 1B0TA 2IA0A 3EGZA 1R31A 2V4JA 5HQ8A 1SL1A 2UUCJ 1RT6B 3C6UB 4K2XA 3MEEA 2VPYB 3PG9A 2DR6A 2R7OA 1BQXA 1LW0B 2J8SA 2V50A 4WP3A 3MMCA 1IKWB 3AOCA 2BBEA 2QSFA 4CDIA 4FVCA 2L9NA 1W26A 1R3NA 4IO9Q 4Y2AA 2XMMA 2CVIA 5E7OB 3U7JA 3QFWA 4LF8J 2GQ2A 4MH8A 1FKOB 1FTRA 4NLVA 3ZO7A 5HMYA 2XZTB 1H7XA 2VC0A 4ZIVA 2OH2A 3CCUS 3NAHA 2M3DA 1NKCA 4RR5A 1HW9A 1HQ2A 3ZTSA 3N6LA 4LF4J 1J5OB 4UT4A 3IMQJ 3CCZA 2OI2A 3N4WA 5L39A 4DR1J 1X4HA 3E2EA 2YKNA 2MKYA 1FX4A 2HHXA 2YWWA 4ED5A 3QRRA 3HSZA 5KT6A 5ETKA 4X64F 4YB7A 2CRLA 1JIHA 2EC2A 3KHRA 4DPYA 2QT7A 4L6V3 3KNGA 1WKKA 3M9OB 1WD6A 2F8MA 1UWBA 5LM7E 3ZTQA 1VBKA 3R9LA 4QWCA 1SQFA 2ALZA 4OHWA 1CG2A 4NEYA 5KOWA 2RF2B 3F56A 1FA0A 5B0GA 2PT0A 4LSLA 2XCAA 4Q2LA 3ILIA 3BGOP 1PKUA 4IUFA 4J9QA 2H5IB 2NYHA 2MZJA 4DS4A 1NK0A 2RHQB 2VQFF 3N5BA 4CLPA 3IM8A 3M6VA 2PEHA 2QA1A 1TR0A 4K5RA 3PW0A 3TI0A 3HD1A 1JLEB 2HFZA 3RB4A 4MFBB 4P52A 4HL9A 3ENAA 4X4UA 3GYGA 2DHXA 2G0IA 5IQ6A 3J7YI 3NWGA 2H51B 2PIIA 3OFEA 2DXDA 3R27A 1YJUA 4KPYA 1DAXA 1RTIA 5HMXA 2MKJA 2W7OA 4Y6IA 1RJJA 1NK7A 2I5JA 2J7UA 1Y3KA 5GAGI 5DRKA 3OD2A 4PXDA 5D3GA 2FGOA 3L4BC 4IH6A 3P96A 2BEFA 4DFJA 2RH3A 3QWPA 3HX9A 2E5JA 3V6KA 2ZVIA 4LQ9A 2W2MP 1F9FA 5D0GA 3V6DA 3SMZA 5K14B 2OEKA 4WP8A 3DOLA 2PFFB 2F8EX 1O6XA 1YGYA 2HIYA 1GXUA 2LQ5A 2CWKA 2AQ4A 1PAUB 2Y9HA 3E01B 2JFKA 2AJ4A 4BDPA 1PSDA 4QQBA 2HS3A 5HL7Q 2PA8D 2FZKB 4KGMA 1CJTA 3IAS9 1JWWA 1RU1A 1BQNA 2B3TB 1OMSA 1YBAA 2MKIA 3CXCR 2GAHC 2LXFA 4DLGA 2CPYA 5J1EA 4U7UD 3V6HA 1ZOTA 4B9LA 4JOUA 5H9EJ 1W2BR 2XSJB 2OHDA 4R0JA 1SJ4P 2W8LA 4P75A 3PHTA 2LEBA 2L41A 4DQRA 2QLXA 3FCWA 4NI2B 4CTAA 1R7IA 3QT8A 3MFHA 1JLBB 4XTTA 5B09A 3MZIA 3W2VA 3HT3A 1S1XB 4O3OA 1Q5VA 1NZAA 2YQ3A 2V4RA 2E1AA 3UPFA 3LANA 3POTA 2D7SA 3GYXB 1XBWA 4OLPA 4E8UA 2ZWPA 3KLGB 4GC6A 1QDUB 1FNXH 2K2PA 3MM5B 3QAEA 2MDAA 4RX6A 4ZVUB 3PEHA 2Z56B 3THVA 1HD0A 3GG1A 2CAJA 1KKHA 3MPYA 2ZJPQ 1AZSB 2DHHA 1N33J 3H4DA 3M8PA 2RKIA 1XMQJ 3I5AA 3M2UB 4AXIA 1N5VA 1DTTB 2JLEA 1UCNA 2MKSA 2HRUA 5HJXA 2UXBF 1S49A 2DIVA 3D1QA 4AL6A 3EDQB 3HZGA 2I38A 3GIKA 4RW4A 3NAIA 4IFVB 4DV2F 3DOKB 3R5DA 1YI2S 1QTNB 1QLNA 2JZ5A 1RT3A 2FJXA 2OEJA 3VR1A 4CLWA 1WOSA 1HR0J 3K89A 2ZM6F 1XNQJ 4ZVTB 3RBEA 4CO2A 1HNXJ 3EVOA 2Z2MA 2FLLA 1K73T 3GJQB 1ZTWA 2QGFB 1IR2A 3V81B 5ETTA 4ZCIA 1S5ZA 2U1AA 2K7KA 3E3XA 4CRJA 1P1TA 3RBZA 1HHTP 2HHWA 3SFUA 2VC1A 2SXLA 2IAJA 3RR8A 3OVBA 5FDLA 4RNMA 1VQOS 2EI5A 2VBWA 2PI4A 2M7SA 4GKKF 3TX8A 3BSAA 4F3QA 4FBTA 1U8WA 1KQKA 3TW0A 3CC7S 1S1UA 2IRYA 3DLBA 2XCPA 2V0NA 4W92B 1Q86T 4NASA 3CJTA 3TAQA 3BBBA 4RKUC 2DT9A 4PQAA 4IR1A 3MAAA 1VRUA 5DJBA 4USIA 2Y8YA 2FVSA 4DL2A 1N8RT 2UXCF 4TQSA 3DNCA 2VZ9A 4X62J 1SCJB 1OYDA 1VQ7S 2F8HA 5EN1A 1ZZNA 3W66A 2ILYA 3FMWA 4LFCF 2FGCA 2R42A 1RTDB 2RQCA 1LWFB 3SCIE 4F2SA 2ZH2A 3CT9A 4OLOA 4ITSA 3BDEA 4CZCA 3RRHA 2QL7B 3LALA 5F3ZA 2OMLA 1HNVB 2HLUA 2VL1A 4ETXA 4PCQA 2BJ7A 2U2FA 4EI2A 5ETMA 4CYUB 2MKCA 2KTQA 3C6TA 5SUHA 5L1KA 4AL7A 3M2VB 1RQ0A 2AJ2A 3UVJA 4DG1B 3Q8VA 2HIQA 3PW2A 4RUHA 2LU2A 1FFWB 3TUZC 2RB7A 3QIPA 1SJ1A 4Q0BB 2EBGA 3UDEA 2GMJA 4ZA1A 4PWWA 1L3TA 3NNAA 2M4MA 4QYZK 4K7QA 2FTRA 1EB0A 2JX2A 2XQCA 4FF2A 3IRXA 3T5HA 3LWLA 1RI7A 5I3UA 4I6YA 1E6VB 5IQQA 2CNLB 4F4YA 5J2NB 1CBKA 3R5AA 4H54A 1W2IA 1RWVB 1LFPA 3OXFA 4TKTA 3PY8A 5BR8J 3B6BA 2A10A 2E66A 4OYBA 4Y2MA 1YIJS 3MM7A 2NQPA 2JVOA 4ZJQA 2NLWA 2WVFA 4ANDA 2YVSA 4DR1F 1ZM4A 2UV8G 3QATA 1IBLJ 3N28A 3KOAA 2EFPA 2KJWA 4YUDA 5KT2A 2HHQA 2PFDA 1U24A 1UJ6A 2GCFA 4X4SA 2GVDA 1R89A 3M8ZA 2EG1A 1LFWA 1FDBA 2EK1A 3PR5B 4JI2J 3X1LB 4JYAJ 1RXOB 1VI7A 1YRXA 1VRTA 1QM9A 4ECYA 3UR0A 4MT1A 4F02A 2NZ4A 3R5CA 1KOHA 3I31A 2ZITA 1X9WA 1FRJA 3HULA 4HACB 3PXGa 3ZZZA 3K58A 1WC4A 4ZITA 1S0NA 4FXDA 2IA6A 2RMLA 3CDBA 2W9BB 2EFGA 1H38A 4HDHA 3FFIB 2JVRA 4OMFG 1HHQA 2RJZA 3M6UA 1F0XA 4NA1A 4DXLA 3T5LA 3FKBA 1ACMB 3ELHA 1NSAA 1CJKB 1OYEA 3FZ2A 3H20A 1YK9A 2HS0A 1BQMA 1T03A 1IWAA 3LAKA 4PABA 1HIYA 2IDEA 4LBIA 2HQDA 4DUZF 5HK4A 4CNZA 1RKIA 1OPIA 2OPQA 4FF4A 1CPZA 5KG0A 3C3LA 3W5XA 1U2FA 2EXUA 1HI0P 1C0TB 3DYAA 1KD1T 3S01A 3D6HB 1V9OA 1RWKB 1RDRA 4UF4A 1S7IA 2B9YA 1JLGA 4USTA 1KS2A 4TY8B 2ZVSA 5A8WB 3LP0A 3V4IA 4PYDA 2ZFHA 3DRPA 1RT4B 4IKAA 3CW2C 1Q8BA 3TR5A 3TZZA 1Q95G 1YZ7A 2ZHBA 2BVZA 2KJVA 2G2ZA 2FHJA 4TU7A 3CJ3A 3ICLA 1V3SA 2NYIA 3C46A 3AHPA 2DK2A 5KOXA 2DCLA 1N54B 3RAMA 3D28A 5KFGA 1EIYB 2HURA 1NK8A 4H4KA 1CQNA 1RCXB 2XWXA 3VAHA 3GIMA 2UVWA 2Z58B 3MUVP 2R8JA 1L3SA 1OPZA 3C16A 3AJ2A 3JSRA 3NG8A 3CD5A 2I2YA 5EWFA 1UW9A 2VG7B 3J80U 3M8QB 3WC2A 3KUHA 3G8SA 3H5YA 1YKWA 1VQ6S 2WBMA 3DI6A 4IH7A 3CO9A 3LA0A 2RRBA 3MCNA 4PPZA 4RBUA 3Q2TC 2JHEA 1VC5A 3DLEA 2KYXA 2W9CA 1RP5A 2J9CA 2VJVA 4KY3A 4F50A 1GEHA 3W61A 1XMQF 2KVIA 4X4RA 4DJBA 3Q8QB 4MKBA 4DZDA 5IV3A 1B0PA 4FYWB 4MTPA 1QAXA 1SBRA 4LSNB 4QR2A 2L3MA 3T6JA 2F4VJ 1AB8A 5EDWA 4ZVHA 2QA2A 3CDEA 2ZBRA 3MF5A 1X4AA 1D1UA 1S77D 2V2QA 3N5FA 2WSCC 5I3QA 3VAFA 1HR0F 3P49B 2D74B 3OJUA 1VRQC 2V34A 4Z7YA 2BE2B 5C42B 1HNXF 1IXKA 5GAHI 2CDQA 1T9WA 2GZOA 3W8PA 4Z37A 4WIQA 1YVFA 3VQTA 1I1GA 2V4QA 1S12A 2M8HA 3UW1A 3A1YG 1TL4A 1UPMB 1D0EA 2C22A 4DV4J 3OUYA 3OVAA 3HSGA 3EX7B 1OS5A 1VHFA 4UOCA 3W5ZA 3HHNB 1FRKA 2ZHOA 5CZVA 4PAAA 3C19A 3EZOA 1NK5A 4YHHJ 4DR7F 1HBNA 5D8HB 3V5RA 1WWHA 3QO9B 1MWQA 1UAWA 3WBZA 2VPXB 2HZCA 3MUMP 2RUGA 5LT5A 2R7VA 3C15A 3ONQA 4FYDA 4FVMA 3DN9A 4F3MA 2XG8A 1NNDA 2GC8A 1B7FA 1JXVA 5DDRC 3TJ9A 3BGFA 1UVKA 2R2UA 1H3DA 2JC0A 4DR5F 3OFHA 4X62F 3US5A 4D3GA 1RHJB 1R27B 4LF7J 2VG6A 2XBPA 3CD6S 4ZK7M 4RUBA 2CQ0A 4DCJB 5EUHA 2B5JB 2HZAA 1LQ9A 2W4PA 3NNCA 1C1BA 4ZHRB 1HFEL 3FBBA 2XEXA 3IG1B 2XMTA 1HMVA 3MI7X 4DR3J 2V67A 2KHDA 5CCMA 1Q16B 5CXTA 1VR6A 3NGUA 4WK3A 3MM6B 4O3RA 2N3LA 1KQFB 3KHHA 2VONA 1K0TA 3JSYA 2GW8A 5G4DA 5HROA 1EP4B 3GJSB 4O3PA 1L3VA 3M4XA 2ZHAA 5J2QA 1ULRA 3TX0A 5A8KB 4R5PB 4A46A 1FEEA 4BLGA 4RW6B 2RVJA 3PJ9A 1D9AA 5EX3A 1XMBA 1IKYA 3IP0A 4OYMA 2IRUA 1FD2A 3HXMA 1KBRA 1IKXB 4M5DB 1FJEB 2EKYA 3LO3A 4NLUA 1PIEA 3S1TA 2VQEJ 3UWTA 4RW7B 1N5YB 5BR8F 3ET6B 2Q6BA 2CIMA 2OKQA 2ZD1B 2CPXA 1MROA 2V8PA 1TVRB 2ZH8A 4EU0A 2NZCA 4A8QA 1IBLF 4O4GA 1QAIA 4M95A 4P7TA 4WP9A 2RD5C 2LECA 1U1RA 1T0TV 3PW5A 2CQPA 4JI2F 4NZ6A 5H9FK 4NLDA 4MIBA 1WC0A 2XZWA 3OJSA 1F6TA 4K4SA 4DL0C 2HNZB 2GO8A 1SC3B 2MYFA 4I6AA 4RNHA 3KYLA 4PQUA 4OHXA 1U1PA 2AIRB 2BKNA 3KLIB 4QJVA 1WOOA 4UQGA 2R2SA 2UVUA 4YR3A 4DU7A 4NCBA 2R7WA 3R8YA 3G9CA 5KFLA 3EXYA 3M8RA 2VKRA 2KZMA 1LWXA 2HPUA 1LW0A 3TANA 1WF0A 1VQNS 3W7BA 1IKWA 2ZH6A 2YKMB 2AWZA 1EARA 5CZXA 1WKLA 5KFUA 4F04B 2HWIA 1YLXA 4R8UA 2EKNA 2DNNA 4OHVA 1FKOA 2AYMA 1EZZB 3FUYA 2M52A 3NS5A 1RBOB 1UL3A 3J7AN 3EPIA 4C0HA 1J5OA 3QAUA 1T9TA 3NRBA 4CIOA 5L9XA 4MYTA 4EBDA 3HI9A 4ZP9A 2YKPA 3MWBA 2IFXA 3MDFA 3NGKA 2Y3YA 5KTQA 4ZVFA 3G6VA 4ZLLA 1DLOB 1FT8A 4HEA9 3L7OA 5CYMB 3M30B 3BBFA 1U6FA 4NXNJ 2G1HA 4LVOP 5CYQB 4XDCA 3T1YF 2DNZA 1XR6A 2OIHA 4Y34A 3M32B 4M1KA 4NX9A 2YNFB 3J7ZT 1TAUA 1QD1A 3M8YA 3AT1B 2JSXA 4F7VA 4ENOA 3BKUA 3BSOA 4GRSA 1MLAA 2YTCA 1SH0A 2RF2A 1H2TZ 1F1BB 4ZP7A 3B78A 2XGQA 3LPEA 1VQYA 5IC4B 4IH5A 1YZ6A 5BJRA 4ED8A 2QYGA 3FCVA 3BEGB 1BC6A 2CFXA 4ED0A 3ITHA 3A8EA 2H4WB 1CVJA 3K2YA 2WB4A 1JLEA 1F2GA 4MFBA 4S0MA 3GMGA 2JOQA 5IS2A 2DNLA 1PCAA 2D1CA 4WPAA 2W9AA 4URSA 2AF6A 1S9FA 3CD7A 4K0KF 2LLZA 4UW2A 3P3DA 3CGIA 1GX5A 4KB7A 4DSEA 1IN0A 1ZM9A 4MKYA 4DQPA 4F26A 3IWXA 4QBUA 1RABB 1UWAA 2J7KA 5ITHA 3TARA 5A2QU 4KPCA 3B8HA 5KFFA 3L7UA 5K14A 1Q0NA 2F4VF 2XMWA 1QTMA 4MIAA 3GE9A 1G7CB 4FS1A 3W9HA 2W7PA 1F2HA 1K47A 2VDHA 3THTA 1JLCB 3KK2B 4QIEA 3HLUA 2PDAA 3NCRA 2HQFA 2QFJA 2VASA 3CNQP 4WFXA 1MSWD 1ZAXA 3OL8A 3I96A 3MUTP 5KFYA 3AODA 2IMOA 1URRA 3QT5A 1WTBA 2XSJA 2HBRB 3EYZA 3A12A 4ZCLA 4ZVEA 3VZIA 2VBXA 5CABA 4KGXB 1FRLA 4NI2A 3L95X 3T3FA 1E6YB 2BYCA 1S1XA 3BSNA 3WX8A 3N6NA 1KONA 4Q8FA 4IFYB 3MM5A 4OZ5A 4P72A 5AE2A 2EFOA 4NLXA 2LEPA 4LF7F 5F0WA 4JI7F 2XGPA 1NM2A 1AZSA 2BKOA 5CD4H 4FBUA 5AE3A 3M2UA 2WSEC 4FXWA 1DTTA 2C1EB 1EKRA 1UVNA 4ECWA 2QZ8A 2Y1IA 1S57A 1T3OA 4P6QA 2F40A 1JX4A 3G2XA 1FX2A 1MWZA 1RWUA 1KRPA 2Q6CA 4U7CA 1RISA 1RAGB 4DQQA 3WIUA 5FLXY 2VD3A 3OTDA 4C0OC 4CLLA 4IQMA 5HANA 2BRLA 3GG0A 5LMUF 2FB0A 4LR9A 1VC6A 2CQ3A 1JB0C 3I4PA 4GVBB 1Q7YT 1R8BA 1BD6A 3BSCA 2M9KA 3V81A 2OPSB 5T14A 3IFEA 2ZOFA 2O5DA 4FS2A 2HQ3A 2E5HA 2QG9B 2XS5A 2XMVA 1QUVA 3BJYA 5DS7A 2GHWA 3SCJE 2XO7A 2IIHA 1Q8KA 2HHTA 2BW2A 2FC9A 5D4OA 3NCQA 5DLFA 3GB0A 4ANEA 3TVZA 4F4AA 2E7WA 2KI2A 4ZPWR 4KTQA 4EYIB 2DR5A 4WU3A 2CPDA 2FY1A 3A8JA 1Q8IA 4B3OA 2XMUA 5KFSA 2RDDA 4A47A 3R1HA 3KDNA 3VGUA 3HSJA 5FJ4A 3QMQA 3ILJA 4DV7J 3DDIA 9RUBA 2ZBPA 4DBQA 4QIVA 4ATNA 1FD8A 2ASYA 4ZMMA 2B9EA 1GXLA 2DYAA 2AYBA 4NLQA 4WFYA 3A13A 4Q44A 2CQ2A 2J6TA 1HLWA 4MK8A 4YR0A 1RTDA 2ADBA 1RT7B 2BJ9A 3KK3A 4ZVPB 2E5IA 3DU5A 2MZSA 4F4XA 3RRKA 4J9UE 2AU0A 5BYQA 2IHR1 3RRGA 4M5KA 4LFBF 3CJ4A 4RZRA 2ROGA 4DFPA 2Y0SD 3IGNA 3UDCA 3DDNA 1HNVA 4XK8C 5KFNA 4G3IA 4RJVA 3ZFVA 3EGNA 2NXEA 4IQXA 3IGVA 2GIQA 2C3PA 4DX7A 1S79A 3GQCA 2M8DB 3M2VA 4Z7CA 2VPZB 2MB0B 4DG1A 2NREA 3PYGA 2DH8A 2H9ZA 4HTJA 2GQCA 1ZTTA 1NZ8A 4LF5J 4E0DA 3HFVA 4Q0BA 1RAOA 1TKXB 2J9EA 3D54A 1U02A 2POKA 3T1AA 1R0BG 3ETMA 3HM9A 4F0KA 1U1KA 1HBMB 2MZRA 1E6VA 3G4SS 4CCHA 1WC5A 1PILA 3O1LA 4HYKA 2MHEA 4F25A 4N41A 2GX8A 4Q45A 4C0BA 5KG5A 5L38A 2GS8A 3D3CJ 4DFKA 2CQIA 3G6ES 4C8YA 3UI3A 1HQUA 1CS4B 2DNKA 1Q7LB 2IMWP 1VQSA 2AYGA 4NXNF 3GONA 1V5IB 1DARA 3FZBA 5M2PA 1LK7A 1MWYA 4WFAQ 1NJIT 5E5NA 3AJ1A 4B3MJ 2ERRA 4RNFA 2CJXB 4B08A 2DGQA 3TJAA 1OWXA 4F0MA 5CYJA 4CT9A 2HHHF 2B4OA 4EZ9A 5EWGA 1I51B 4ZS6A 2IPOB 1FHTA 4HACA 1TL3B 4KO0B 2E1PA 2D3O1 4IDKB 3VQSA 4DPOA 1EX8A 1S0MA 3DLKB 1YQHA 1UVJA 4PUOA 4CO0A 1C1CB 2W9BA 2ACMA 3FFIA 2NXNA 4X65F 5L1IA 2ZE2B 1VMBA 1JLQB 2CPHA 3K17A 2G4BA 1S7HA 1WEZA 2UXDJ 3W9JA 2UUTA 2JNJA 1HNIB 3HVAA 2K3IA 2FDNA 3ZZ0A 3D6TB 1GTEA 1CJKA 1WHXA 3EJMA 3JQJA 2EFQA 2WB1D 5E2QA 1NKEA 3IR6B 2HZVA 3DOMB 2JL9A 4M63A 2B6AB 3MR7A 4ETZA 2QO3A 5KFOA 2FVPA 5BXIA 1CC8A 1CEZA 4K4ZA 4KT0C 1SQEA 4GO5X 5DQIA 3CEDA 1H7WA 1CSJA 3JYTB 5AXNA 4CLTA 3HJFA 1SC6A 3HFKA 3QZ7A 2W01A 1J5EF 3GP9A 2VFRA 1NUEA 1RZMA 5F8JA 3FK4A 2P9CA 3GR1A 2Y8WA 2FJBB 1PJ5A 4DR6F 2OFHX 3LP2B 4I0WA 1TELA 3NXZA 1YDLA 2AZ1A 1W7WA 2OLWA 1N36F 1RT4A 2J0QD 4RU2A 4OHYA 2DHAA 2WOMA 4ZVOB 4CWBA 4X66J 3KLHA 1XMOF 5KG7A 1VJQA 3QZ8A 2RQKA 4J5OA 3VAGA 5BYRA 1HQEA 1FJGF 1L3KA 2P6SA 1GMWD 1YITS 1JXLA 4PXCA 3JSMB 5JUMA 1ZETA 3CCLS 4UZCA 3W65A 4LRFA 3I9ZA 5KFDA 5C25B 4CLZA 3ILOA 3ETOA 1FXDA 3N9UC 1R6VA 4LRAA 2FUG9 2HRTA 1QE1B 4OI0A 2HYIB 1HNZJ 1R0AA 4D3HA 3OSNA 3M8QA 4WWSA 1XR7A 3SIPB 3EZ5A 4DPTA 4F4ZA 3SQOP 3AQPA 1NK9A 2HFUA 1OQ3A 3LW5C 4DCOB 1OY6A 3I55S 1PBAA 4UY8T 5D78A 1D9FA 1DJ0A 4RW9B 3QPIA 2DNQA 3VGVA 3JAMY 2YNGB 2UUWA 2UP1A 3I0RA 2IVYA 3MTKA 2CJAA 3T6BA 2C2OB 1AT1B 1XTZA 3X3UA 4U8VA 2FPHX 4LSNA 2W25A 2CQBA 2RQMA 4OJ1A 4W4MA 2KT5A 2KN4A 3IWNC 2UUBJ 5IWAJ 4CO5A 3HMJG 4NA3A 1AYEA 5C24B 3UCZP 2V5HG 4ID5A 3AOBA 1B4SA 2Q1LA 5C2CA 2YBVA 2BE2A 1FESA 4XDDA 2HG4A 5C42A 3GIIA 2DBBA 1G3OA 1MMNA 3CJQA 2DKOB 4U8YA 3MEGB 3D67A 2KM8C 1M1HA 1IKVB 2D9PA 1FWLA 1NXIA 3ZNUA 2AEMA 4PKDB 1P1LA 3QO9A 2HK3A 2VB6A 1FXRA 1MN7A 1LEOA 2DNYA 4EZ6A 4DL6A 2DRAA 2H48B 2E5GA 3QT7A 4USJC 1SIZA 2P2CB 4NWBA 2FLNA 4ED2A 1KFSA 4C11B 3M2RB 1J2VA 3HO1A 1S0OA 2WVCA 3SV3A 4JI5J 1YSJA 1X5OA 1N4LA 2AW0A 1I94J 2QLWA 4OI2A 2J0WA 1ZYQA 1M5SA 4A8FA 2HWHA 3C14B 3H8YA 4B3RJ 2CPZA 3D0IE 2QTWA 4PWUA 5B0CA 4XPCA 1LW2B 3FJ2A 3A3NB 2ZH9A 1N6QB 5E41A 3K5LA 1TV6B 1UW4A 4QU7A 2IJFA 4HH1A 4ZHRA 3KHLA 1KVIA 1RAHB 3SSQA 3IG1A 3OHAA 4PYAA 2CNOB 4DUYJ 3KLEB 1REGX 4M5MA 3QQCD 3K57A 4I2QB 3DCAA 5KG2A 1S9EB 3BR9A 1RAEB 2W2OP 1KLMB 4YEAA 4M5IA 2IM3A 4OX7A 4Q5VA 3MM6A 3HVTA 4PR6A 4DR2J 1JLAB 2MLYA 1EP4A 3I4HX 1LWEB 1RCOB 1TL5A 4DL3A 3KLVA 2V8GA 2V63A 4MK9A 4DL4A 3AB4B 4C3LA 4A8WA 1ICEB 3U1LA 4R5PA 1UEKA 2ZH4A 3J7A1 2APOA 4RW6A 1U7LA 4ZVGA 2F9DA 1X0PA 2DGWA 2P9GA 3E8OA 1NU4A 4N8NA 2LA4A 5DDQC 1VBYA 4PXBA 3MR6A 5T7LB 3S7RA 3PRBA 3CJSA 4M5DA 4LREA 3HHLC 2W8KA 4QYZJ 2DR7A 4LF1A 2QEXS 2WHOA 2BR0A 3LTOA 2X1AA 4RW7A 1N5YA 1VK8A 4QPTA 2HK2A 4NLPA 4GMKA 1U26A 3OTCA 2IM0A 3MECB 2KH9A 1Y3JA 1KVKA 3BB5A 3F44A 2ZH5A 3B82A 2DO4A 4Y3CA 5LL6d 4J9RA 1D09B 2W2PP 3MD3A 1HBOB 2CJQA 2YWFA 3FQLA 4QW9A 4Y2IA 2GV1A 4ES1A 4C8NA 2G0CA 3UE2A 2HNZA 3PO4A 3VAJA 2JH3A 3HCXA 1VDHA 3PO5A 4YP3A 2OPRB 3D4JA 2R7SA 3BGRB 1S4EA 3KLIA 2ZDPA 4DV3F 3NL0A 1M90T 4WIIA 2ROPA 4LVNP 5L1JA 3TOQA 3RAQA 4CM0A 5ETQA 4ED7A 2XSFA 4NLWA 2EK6A 4FYXB 2PGCA 4JI4J 2UXDF 3R7BB 3PV8A 2R7XA 3WHIA 2G0JA 3TO8A 2AGQA 2G1DA 1JKHB 3KDOA 2YKMA 5KT3A 1SIWB 4IG3B 3W8GA 1F3FA 2GIRA 2EVZA 3IS9A 4URGA 2BM0A 3MMCB 1AXQA 3QBCA 4HHJA 4O0NA 1VISA 2F63A 3NEKA 5G0RB 2M2BA 1KTVA 4ECUA 2GVZB 5GAEU 3M6WA 2JFDA 4CLSA 4UOGA 1N52B 1XJWB 3H5UA 2VG5A 3HDSA 2DH9A 3Q2SC 1S1WB 4I2PB 5CHCB 4RBTA 5KFPA 5KT7A 5GADI 1NO8A 3PFOA 1XR5A 3TEGA 1FERA 1WKJA 4J9SA 3K59A 2O67A 1KNZA 5J2PB 3VALA 2EFVA 2HMIA 1DLOA 3M30A 3MCMA 2MEWA 2ZUAA 3GILA 1RHMB 2RDJA 5HLFA 3IBCB 5CYQA 1C4AA 1RE1B 1KP6A 2W4CA 3M32A 4X66F 4WFZA 5LMNJ 4DV5J 4ECRA 4AL5A 5MAOA 4UUWA 4OYAA 2RDIA 2CQDA 3ENQA 4LUBA 5ETNA 3BKFA 1UWBB 4LBHA 3KNAA 5KFVA 5JMNA 4F4WA 2B0GA 4M94A 1OQ6A 3HSDA 3NBPB 5KFAA 4PG7A 4LSLB 3G71S 2PN6A 1RSCA 3C2PA 2XY5A 2VUGA 3QLHB 2D3UA 4NE9C 1Q8LA 2MLXA 2MKHA 1IBKJ 1HNZF 2VFSA 3I5BA 2R2TA 2CNKB 4TLRA 2ABYA 5KAKA 2C2NA 2HQIA 1SJ3P 3A8KA 2Z30B 4IR9A 2R8IA 4E2FB 2CUYA 1RHQB 1CJVB 2ZH1A 3PW7A 2LXIA 3GSIA 4OX9J 1U1OA 4Y0FA 2VFUA 4F3OA 5IOLA 3OXGA 1Z2LA 1SJQA 3DHXA 4TY9A 1U0HB 2NSCA 4OI1A 3OT9A 2CADA 1K9MT 3U02A 4ED1A 3IM9A 2YQ0A 1R6YA 4CM2A 2C42A 2KYZA 3E51A 2VFTA 2UUBF 4YDXA 4K4UA 1ITPA 8AT1B 3M9MB 4YDDB 1HI8A 3PVXA 1MMLA 4IG0A 4NZ7A 1GAOA 1U09A 4R25A 1JJHA 1JLCA 3RTVA 4YFUA 4ZVQB 4KAIA 1RTHB 4CLKA 4A8YA 3KK2A 1F60B 1H2VZ 4WZMA 4ALZA 3DRSB 4OFZA 5DLGA 2IRXA 3KWMA 4OZ3A 1DFDA 2IC3A 2VBZA 4KBIA 4B9VA 5IM0B 3T41A 4J7CA 3U1MA 4RL1A 5ETSA 2Q79A 1SC1B 4KC5A 1M5VC 4ZOSA 4K59A 1JJCB 3DGPB 4NXMF 1FWKA 3SBMA 5CH7B 5J1EB 1DHMA 3GFYA 1M0SA 2CJ9A 4HDGA 1I94F 2H65B 3VGTA 1S72S 1R0CB 1UA1A 2PSZA 5D4LA 3I32A 2XWYA 4IFYA 4CTAB 1VQ5S 3SYZA 3BN4A 5F41A 5FD1A 3MMBB 4MK7A 4RUCA 2L9DA 3GV8B 3W2VB 1RU2A 4RU9A 2LEAA 3HP6A 2QIFA 5BYSA 4KJIA 1EQ0A 4CI0B 1FJ7A 2MY8A 3W63A 5B0FA 4EK2A 4J91A 1HA1A 3CJ0A 2XMKA 2XYPB 1REVB 3BQ0A 4OV1A 3M8PB 4DR4F 4W98A 3CVKA 4XPEA 3Q8RB 4ECTA 2D9OA 4DR2F 1YTYA 2VPWB 3CMAS 5K8OA 3QNWB 4RW4B 3NS6A 5K8NA 4RWWA 4GKJF 5KFHA 1RT3B 2CA9A 1KQGB 4ZJLA 1X31C 3J81U 1BWVA 4GVBA 4N77A 4M5GA 3OTEA 2OPSA 2WVDA 2KT2A 2RIJA 4CH0S 3M9NB 2CPEA 2ZZTA 4RO0A 1TL7B 2C2MB 4F4KA 1RK8A 3PZPA 3GIJA 3LOUA 5B0BA 5EWEA 3A4TA 4DU8A 4OYZA 5RUBA 4TNOA 2AD9A 1UVLA 4C8OA 1HBUB 3MXHP 5HSPA 2IAJB 4B3TF 3QWUA 2V6AA 4H4OA 1ELOA 2BMBA 4L72B 1MG7A 2A18A 3I87A 3CDUA 4H4MA 2XLIA 1S1TB 4USWA 2EEYA 1NKBA 1IR0A 3EWGA 5GVQA 1GX6A 4B3SJ 4V19X 3TA0A 2BKPA 3Q8UA 4WXOA 1HL6A 1FKAF 2BZ2A 1RWNB 3MAAB 4U96A 1S9GB 2HLTA 3NS7B 1RT7A 3Q22A 2E7VA 1CLFA 1BMQB 3SDEB 1DURA 4BCAA 2LQ8A 1AUSL 4FN5A 3MM9A 4A8SA 4DSLA 5H9FJ 2HW3A 4IYQA 3G96A 5IT4A 3WZ0A 5J1PA 1N48A 2Z0GA 3R7NB 3BQ1A 2AJ1A 1TQLA 1TL1B 4A8OA 2GJIA 1SJFA 4JI4F 4DV0J 2B8PA 5HO4A 3RR7A 1QSYA 5DQHA 2OJ3A 1BE4A 2LYVA 4LRDA 3BPSP 3MD1A 2YWGA 2XULA 3UVJB 2AX1A 4N56A 4OZ1A 1HWJA 1ZBTA 2A6MA 4DUTA 1RACB 1SXLA 4EMDA 2VH7A 3PNIA 3T9ZA 4FF3A 2CWXA 1NHKL 1HBMA 1TAQA 4RW8B 4DHVA 3CCQS 3H5SA 3Q0AA 5ETOA 1VIXA 2QX0A 2RT3A 2A2DA 3R5GA 4OV6A 3RUBL 3ULHA 4F36A 1GH8A 5AJ3J 4JI1J 3IRXB 3RAXA 4J9PA 2DPJA 1Z2ZA 1X5PA 1H74A 4QYRA 1U6ZA 4ECZA 3TVKA 1URNA 1CS4A 2UU9J 1KTQA 1XNRJ 2XO6A 3MM7B 5KFJA 3MPWA 1Q78A 2V2KA 3OVSA 2V2ZA 1HARA 2Q3PA 1CC7A 4NLSA 4NL5A 2FJEB 5LMNF 2CJKA 4DV5F 3AD8C 4KV8B 1XQIA 1UETA 1HKAA 4C48A 2B9XA 2GGPB 5LXYA 1VRTB 4KIAA 4I7FB 4KO0A 1RHKB 4IDKA 2LA6A 4OZNA 2X51A 2QA4S 1C1CA 1N5SA 5AXLA 4UOHA 5HJYA 4PRFA 3MOZA 4KQZA 1UVIA 1X60A 2ZE2A 3OLAA 2DGVA 1JLQA 3DRRB 3CJ5A 4YY3J 3CC2S 2LKZA 1J27A 1AFJA 1NK6A 1HNIA 1BXNA 3MHYA 3HZEA 2CYYA 9ATCB 2VHGA 2AX0A 1SV5B 2IM2A 2B6AA 1YBUA 2VV5A 3ENVA 5SZTA 2RRNA 1X4FA 2UV8A 3A3PB 1NH8A 1T03B 1XWLA 8RUCA 2H5JB 1OIAA 4G6VB 3JYTA 2UUCF 4ZKAA 3R3TA 4I56A 5F8HA 5KG4A 1YJNS 1CJUA 1U49A 1M5PC 5L46A 3LP2A 2CQHA 3J80Y 3DYAB 2FHJD 4OJGA 1TKZA 5GAHU 4YQWA 2ADCA 4USUA 5THWA 1TZ0A 5EHHA 1R8AA 2W2NP 1RWPB 3L9ZA 1NRKA 3ZTPA 3T19A 4LF8F 2C2EA 1JLGB 4I6WA 1HI1A 4C97A 3LP0B 5J1NA 4Y28C 4LF4F 3TAPA 2WSFC 3S6EA 2K7JA 4DWIA 1NB2A 2F7VA 2ZH7A 2HFOA 3QFHA 4LJMA 4LT6A 2XC9A 3JSMA 4WFBQ 4PG8A 3P45B 3V6JA 2IBKA 5K5MA 2YWHA 4B17A 4ED6A 4RNOA 2HSEB 4G1QA 5C25A 4JV0A 5K8PA 3D68A 1EHWA 4A8KA 4ZIWA 4MKVA 4I1TA 5B0DA 2V69A 4OZLA 1QE1A 3JSBA 1NB7A 1MU2B 3KK1A 4KFBA 4ZN1A 3CUNA 2CZ9A 2Q66A 4EYHB 5JVHQ 3OV7A 1YJVA 4CLFA 2JC1A 2YKQA 5IZHA 2ZBIA 2PMWA 1N0UA 5GMEA 2CDRB 4RW9A 2O3DA 1NJWA 4C6AA 2DNHA 2CQ4A 1B0VA 1F5CA 2YNGA 2AV5A 2KM8B 2A6OA 1RHRB 3H42A 1ZAWA 3PIOQ 1QVFR 3GWCA 2CQ1A 2X1BA 4ZCKA 4AE5A 2YH0A 2W9CB 4RBVA 2ACYA 1VQ4S 3MFIA 3BH7B 3CJKB 3KKFA 1LWCB 3PYEA 2HVEA 5IT9U 1JNZB 1U8SA 5C24A 3AQOA 4QWDA 1XIQA 2JEGA 2XLJA 4EUVA 1IVZA 4HHUA 2B4PA 1WEXA 4MKAA 4C98A 1RA7A 3UDLA 1W25A 4OJ3A 1U45A 1HWUA 2I6WA 1IKVA 1KDNA 3UO0A 2Y0BB 5E0OA 1TKDA 3GPAA 3H90A 3H4BA 3H5XA 4X4PA 2E5LJ 3QJLA 5I42B 4WE1A 1LV5A 3V2UC 1CQMA 2VBYA 3OUYB 1VQ8S 1EJ7L 3MR5A 3BBCA 4EBEA 5IXUA 1UP1A 2EFNA 2GMHA 5D4PA 4C11A 2OTJS 2BQUA 4AFFA 4CT8A 3IBFB 4RUAA 1DQ8A 3EICA 4OQJA 4C3MA 5HP1B 4TYBA 2DITA 3OR2B 4ZVSB 1P9QC 4B3SF 3RG6A 2WBRA 1QSLA 5KFMA 5D6GA 4RNNA 3CWJA 4FNIA 3QSYB 3HHLD 1IM4A 4P10A 4O3SA 3NGRA 5F3TA 3L3CA 1S48A 1JLFB 2UZAA 2VJUA 1N6QA 1TUWA 3CDAA 4EO6A 1FKPB 2IM1A 1TV6A 3UNGC 3UCGA 3MURP 2VG6B 3KLEA 3QGGA 3CCSS 2BJ8A 1S9EA 3P5BP 1KLMA 4LF2A 4CH7A 5DM6Q 2OPPA 3LUYA 2MZTA 2YXLA 1SKSA 4QWAA 1HMVB 3HHLB 1JLAA 1WC3A 1FRXA 4DV2J 3EGWB 3N01A 1LWEA 2XNQA 4F2RA 4DV0F 1R8PA 5AT1B 1N33F 4DQSA 3GJRB 2HWTA 4F8RA 4TVAB 2ZM6J 2H1YA 3SQGB 1O5JA 1RADB 2FLOA 1S6PB 1QSSA 3PIPQ 3H2VE 5J2QB 1NSPA 2KDOA 2NCKL 1WTFA 4L73A 2VF3A 2QSWA 2BA9A 4E98A 3VAMA 2XYHB 1H2UX 2ZOGA 1M1GA 4HT7A 2BJ1A 2AYEA 2H5EA 3CJ8A 1QAJA 1VGYA 1XNQF 2XLKA 5AJ3F 2ZZMA 2MPUA 1RGVA 4YB1P 2C2ZB 2I1RA 5CAAA 2YX7A 2Z2LA 4L3NA 1S10A 1T9YA 5ETPA 3TYTA 3MAHA 4EBCA 1FRIA 3MECA 2NPIA 2YNHB 2UU9F 3DGVA 1MROB 1T3NA 1N5QA 1H98A 4ZLPA 1QVGR 2YWKA 4O4GB 1NMEB 1S4FA 1HBOA 2UXCJ 3DMJB 3F0NA 1RT2B 2K8GA 2YWEA 1FFSB 2BJEA 3SV4A 2XTJP 1Y5NB 1SKUB 3KJFB 2JDJA 4LFCJ 2XM3A 1P6TA 2Y1LB 1LOUA 3CE8A 1R8CA 2OPRA 3VZHA 4NCAA 2F5GA 2KXHA 3UDVA 2OELA 3K5NA 4NZ0A 2B7CB 3R2DJ 4QWEA 5DG8A 3BDPA 1GXTA 5FIIA 4X4VA 2I8EA 3OXLA 3H0PA 4W90B 2B8QA 4YY3F 2VKZG 2ASDA 4YOEA 2I9SA 3CDWA 3CCVS 3W60A 4NLYA 1JKHA 2ZC4A 5HATA 2VOOA 1FI4A 2PO4A 3KLFA 5DO2A 2BE9B 1TK0A 1R43A 4IG3A 2Z2ZA 3RB3A 5F9NA 2R2RA 2ZC3A 3DLGB 5KFXA 1T94A 2FJAB 5E3CA 5IC6B 5G0RA 2NXCA 2MHNA 1TK5A 3MEDA 3I6PA 4N76A 1WDTA 2GVZA 4R8UB 2BOPA 1B3TA 4QCLA 3IA0A 1YBTA 3PR4A 1S1WA 4I2PA 3DHWC 2N3OA 3OQ2A 2DNMA 3MEKA 4O4RA 2ZNYA 3EUNA 4JV5J 4HI2A 4TU9A 1FCAA 3R5JB 2G2OA 2EBEA 3N6MA 5J2PA 1KR4A 4OYOA 2MGZA 2A0FB 2YX4A 3W2WB 3UCUP 4JI6J 3G82B 4WYWA 3H2LA 5A8RB 1U1LA 2ATLA 3CC4S 2Z2YB 3VGSA 2FHKA 3HKWA 2HHUA 1UFWA 1RT5A 2YNIB 1RBLA 2V8DA 2XMAA 3GLJA 1NPPA 2E1CA 5A2QY 3FNNA 1U0SA 2ZKTA 1JJ2R 3NBPA 1SH2A 1C0UA 1AFIA 5HQMA 1X8DA 2HBYB 4DS5A 2Z8QA 1H73A 3QLHA 3OW2R 2HEKA 2HNYB 4JYAF 3DLLQ 2BV3A 5KFCA 2FJDB 4YS2A 4AD6A 4O44A 3D1HA 4ER8A 3ITHB 3T5KA 2MMYA 1U4BA 1EETA 1FNOA 4TQRA 4K4TA 1SL2A 5KFZA 4USVA 3KJVB 1NDLA 2WK4A 1X5SA 5J2MB 4K4WA 2X3DA 1T95A 1TKTB 2ILZA 5D15A 3OR1B 1CJVA 4DV1J 1NDPA 3LGMA 4BS2A 3O44A 4DI6A 4DSFA 1T8EA 1RT6A 3C6UA 4DUZJ 1K0VA 1FVQA 5B08A 2P6TA 3GTYX 3B54A 3G87A 1GNKA 1U0HA 3ZZTA 1U1NA 2GO9A 4DSKA 4WK1A 2DXFA 4RLEA 4ZPVR 2WCXA 3DLJA 3EPGA 5D0RA 3F41A 2XMJA 5GAEI 2M5YA 1I3OB 4YB6A 1FXLA 2ZNZA 3T1HJ 1A9NB 2Q43A 3ZTOA 4J90A 1WI8A 3TA2A 5DG9A 1RTHA 3KMQA 2CG4A 3H98A 2PEBA 3ZZPA 3DRSA 3Q8YA 3A3OB 2FLPA 4ELUA 2D69A 4C8ZA 1I5OB 3UD5A 1IQZA 2HNDB 2E5LF 4ZCMA 2DH7A 4YB5A 2WRMA 4OJHA 5IM0A 4OYPA 4KHRA 3UD3P 4QWBA 2J5AA 4I69A 3D9BA 1DTQB 3I9V9 4NYZA 3GYNA 4MIWA 1UFKA 2KT3A 2KVQE 3DGPA 3M1VB 3QRPA 2QYCA 3FSXA 2DEIA 4P2SA 3LP1B 1Q53A 4LBPA 5D0EA 4ANCA 1XN9A 5A6WA 2ASJA 1LXJA 3BO4A 1KQSR 1BWEA 4ECXA 3JTNA 4ZDNA 3TVYA 3QIDA 2DVIA 1TFWA 2OEMA 3BN7A 2ZBCA 4ZP6A 3LGNA 3NOCA 4JI3J 3D6MB 3MMBA 1WC1A 4Y2CA 5DETA 3DU6A 1N56A 2C3MA 3CIMA 5K9FA 1KOOA 2RE1A 2NR0A 3Q86A 1RUSA 3LAMA 4DLEA 1REVA 2Y1JA 3KTQA 6FDRA 5HMWA 2ZBQA 2W2QP 2YY3A 1RWWB 4RPFA 3NNHA 2QL9B 3UD4P 4OI4A 2O1PA 1U1QA 1U2RA 1FRMA 4LF6J 4ELTA 5HBMB 3G8TA 1WSRA 3MPVA 1Y00A 1UJ4A 2WONB 1PGZA 1GK8A 1WELA 2NXJA 2DRDA 2LDIA 1S6UA 1TL7A 2HHSA 2DTJA 4QOTA 3PJXA 1T05B 4B02A 5ETRA 2EC0A 2HFNA 7AT1B 1U1MA 1ZM2A 2W1BA 1HBUA 3E01A 2M0GB 4DR7J 3VV2B 4CP5A 1NLKL 3LWMA 4JV1A 3D0HE 2LFVA 3PW4A 2RS2A 2XS7A 4G1PA 3K8VA 1S1TA 1F9EB 2ZWOA 4DV4F 1D8ZA 2DXEA 4B3OB 1NBEB 3GIRA 3O5TB 3D3BJ 5IT0A 4ES3A 3R1LA 4YHHF 3FRZA 5K20B 4A48A 3CSKA 1T02A 3D6FB 4DR5J 4N8OA 1S9GA 1SUQB 1WHVA 2J6SA 2F65A 1CULB 3H2UB 1HNWJ 1V3ZA 1NH7A 4M5JA 1UPPA 2HHPA 3UFCX 1XC9A 1JMTA 3VTIA 3SDEA 4NLRA 4CLYA 3FSYA 3OSPA 3FRYA 3T9NA 4DX6A 3PTWA 4MJKA 2XI2A 4Y00A 4FF1A 4EWTA 2C3UA 1JLBA 1NPKA 3MPDA 3CCJS 5B0EA 3KK3B 3UR3C 4P71A 4BC9A 1Y5LB 3Q8PB 2LP4A 1TK8A 3KLGA 4ZPBA 1HWIA 3G8QA 3KMSA 2J9DE 3PYFA 1RLCL 1TL1A 3PHEA 4C8MA 1UFLA 3TAMB 3TNVA 4GVLA 1ZPWX 4UQTA 2E9RX 3PM9A 3GFZA 4FKXA 2GJFA 4N7TA 2E1RA 3R6LB 1M5HA 3KG0A 3R97A 1HWLA 4X84A 3TZWA 2QLJB 3DM2B 4BBYA 5B0AA 3I56S 2DJWA 5KFRA 1O8BA 4DR3F 2PMHA 4IFVA 3DOKA 3AH6A 3ZTRA 2KFNA 2DNOA 3Q8SB 4ILMA 4RW8A 2DD8S 2KB2A 5D77A 2DGSA 5M2RA 2UVVA 4KKOB 4GC7A 3D7SB 1KWMA 2C3YA 3TUPA 2IJNA 3MTJA 4JV5F 1WNEA 3NGTA 3GSDA 3R5BA 4CNYA 4M5HA 2R8KA 4JI6F 2V94A 3D0GE 3MOJB 3K5PA 1ZM3A 2OSRA 4CO1A 1TUVA 4DX8H 5E33A 4NA2A 3CULA 4HHHA 3TWZA 1HQUB 2KXNB 2LVWA 2YKAA 2OO4A 1UEVA 3SSRA 2VQEF 2MLZA 4KV8A 4KGZB 3RZAA 2F3JA 2HAFA 3IO1A 4BC7A 1N34J 3HK2A 3KHGA 4KE5A 2V8HA 4J9OA 2GGPA 3ISZA 1PJ6A 1U47A 4I7FA 3CO0P 5F8MA 2YKOA 4TU8A 2RUSA 4Y2KA 1B7YB 4QR1A 2VA2A 1YRTA 2ZDOA 2WW8A 2N4DA 3DRRA 2YH1A 3MM8B 2HFVA 1Q82T 2YQ1A 2L9WA 4U6PA 4QU6A 1IR1A 4PUOB 1LWFA 1DZ5A 4FKYA 2K1RB 2MQLA 3VAKA 1RT1B 2JEFA 4AQYJ 2CXEA 3D1OA 1S76D 4J9KA 1YRUA 1RBAA 1SV5A 1WOPA 2QA4G 4J9LA 2IJRA 4DV1F 2JLGA 1Z1ZA 3W9IA 1UTAA 4CYUA 1AUDA 1ZA2B 6FD1A 5LSOA 3AXMA 4AYBD 4A8XA 2N7CA 3FCHA 1Y0HA 3CCTA 3AD7C 4DFMA 4KH0B 3AB2B 1UA0A 5KT4A 1RA6A 1GMUA 2NPFA 2EPIA 1H72C 3HFZB 2G9OA 1ZPVA 5KFBA 5E3QA 4DL5A 1N5TA 2AGOA 3W5YA 2VODA 2FD2A 1VBZA 4CQ1A 4F67A 3T1HF 3TQ1A 5J2NA 1VCTA 4BWMA 5AXKA 1FTCA 2D3ZA 3T1YJ 5GMDA 1MNEA 4URQU 2WOMB 2IVFB 4WZQA 2RSQA 3C66A 3KLHB 3T5JA 2DRBA 1X4CA 1VJWA 1RAIB 2DIUA 1HQEB 3PDNA 4OZ2A 3GV5B 4ELVA 3DFEA 5A76A 4U67Q 3ISNC 1OY8A 2H4YB 3QGIA 2J0XA 1PAEX 5DDPC 3NLCA 4WTOB 1MU2A 2EWHA 2BRKA 3CIZA 5KFIA 1T9XA 1L5UA 3HPOA 2M88A 3VVUA 3GU0A 3HVWA 4XAKA 1R0AB 1YX2A 3J7Z5 5F0UA 4JI3F 2NS1B 4LQ3A 2MQMA 2LQ9A 2HVDA 2ZEJA 2ZJRQ 4K0KJ 4O3QA 3BGLA 3KG1A 2NSBA 4ECQA 3PACA 2V2VA 2E1MC 3K0JA 4DZ6A 4DF8A 2WVBA 2DGUA 1VK3A 1IM6A 3FMBA 2GA7A 1LKZA 3CJKA 3I0RB 4DPUA 1LWCA 3O8WA 3RBXA 5A0YB 2MQQA 1WJ9A 2FHOB 4IOAQ 2FHMA 4KGVB 1RKJA 3CCES 1XERA 3I82A 2KFYA 2N7YA 4LF6F 3RW7A 2EW9A 3GZ7A 3G86A 1B64A 3MPUB 5L1LA 3EVMA 4ID5B 1C0TA 5LOQA 2MQNA 4FDFA 2KZZA 3BQ2A 4ZLJA 2G2YA 4WKRA 1M1KT 2MY7A 1WACA 2PC6A 5L8RC 5I42A 3Q24A 4ILRA 3EVWA 1SH3A 4TY8A 1FDNA 5A8WA 5KT5A 2QJ3A 1ZAVA 1P9YA 4PXEA 2XB2D 1VLYA 3U27A 3TZYA 2QV6A 2QMWA 4WF9Q 3EE3A 1WHWA 3FDSA 3OL7A 4CH1A 3OTOJ 4LSZB 3VVTA 2BM1A 1K1SA 2AGPA 3D2WA 1T9VA 2HQGA 2K06A 4HTIA 5HP1A 3NP5A 3MAQA 3OR2A 2OMOA 3ZC4A 1S59A 2MTLA 1QJHA 3BH6B 2B4VA 1EAYC 1YJ7A 5E3AA 1JLFA 3M6XA 3SI8A 3QJPA 1UEUA 4B9TA 2R4FA 3RW6A 1FKPA 1HNWF 1NJYA 3PEJA 5HVGA 2QC3A 1FO1A 3IWLA 2VG7A 4JI7J 4R0EA 3CTRA 5CQGA 1SL0A 4HH0A 1N0VC 1UMJA 4NOHA 2JJ4D 2JLFA 1RTJB 3QGHA 3HHLA 3NGSA 1U2CA 2BDPA 1PYOB 4OX6A 5HVHA 1IWGA 1BLUA 3G6YA 1KEKA 2AJFE 1MMDA 2IVMA 4ILLA 3HVTB 1MW7A 2FY8A 4O0IA 1OSDA 1NSKL 4LRBA 3V4MA 1SI9A 3O3LA 2ZJQQ 5LMUJ 4H4KC 3SQGA 4JUZA 3QGPA 1S6PA 5IFMA 1RTZA 2LMIA 2KU7A 2O01C 4LF9J 4NLOA 3DKDA 3I0SB 1NDKA 1XEZA 2DR8A 1I6JA 5GADU 2AJ0A 1X9SA 1RAAB 2FJWA 2BJDA 4TLQA 2XI3A 3QT6A 5GMKa 4DSJA 3JQMA 4K4XA 3Q89A 4OYXA 4ZP8A 2GQQA 2AKWB 1KN6A 2VDIA 1KHWA 2A1BA 2YNHA 1DRZA 1Q5YA 3K5OA 4X4NA 2BOAA 1FE4A 2HKEA 1FNMA 4G65A 1S6QB 1KC8T 1S97A 4OX8A 3DMJA 2KRBA 5H9EK 1P27B 4WFNQ 1X5TA 1HYSB 1RT2A 1HW8A 4DEZA 1S1VB 2BABA 2MZ1A 1N34F 3MMAB 4KSEB 6AT1B 2VICA 2KRRA 3EXCX 4DV7F 7FDRA 2VFVA 2BANB 4LFBJ 3TRGA 1QUPA 5LJ5Y 5CA5A 4B9UA 4ICLB 2RQ4A 1WG4A 2GHPA 2B5JA 5T41A 4JI8J 1FWPA 4PG4A 2AT1B 3IBWA 4AQYF 1KVJA 3TZXA 1NJXA 3LQVA 4PG6A 3WDOA 2D3OR 3DLGA 2OTLS 4AUKA 1VLOA 2HBQB 5KG3A 5F8IA 2OSQA 3IR7B 3EM1A 1VQLS 3IXQA 1KSPA 4HT5A 3IS9B 2ZUGA 4X4QA 3Q23A 2VIHA 4GO7X 3WIVA 1S99A 5A8KA 2GHVC 4USKA 2I0XA 4NMLA 4LF5F 1SPBP 3SEOA 2C2DA 1RLDA 3MCSA 2VG5B 3AXKA 3W2WA 2MQOA 3CJ2A 3OL6A 1VQMS 1U25A 3G82A 1PYTA 5A8RA 2DY1A 2BQRA 1IKXA 2C2KB 3OBIA 4DPWA 5DQGA 2HMIB 3AOAA 1O0PA 3SCKE 1FVSA 3OFGA 2YNIA 5HLFB 1C2PA 3LPYA 4FYVB 1TP7A 3NCPA 1JQGA 3FBEA 4PWDB 3ET6A 2MSSA 4Q2MA 2ATCB 2ZD1A 2ASLA 1TVRA 1HPZB 4DN0A 2CZVC 2M70A 4FPRA 3HT0A 1H0HB 3JQKA 2HHHJ 3GV7B 3CB4A 1Y5IB 3K8WA 2XS2A 4NCGB 1SB6A 2YX1A 4M5LA 4ZN3A 1NHVA 5F8GA 2HNYA 1FDDA 2IDLA 3CCRS 4B3MF 2XHWA 3K7RA 3G6XA 4EGLA 3P4UB 4X65J 1EKSA 3BREA 3QYYA 3PX4A 1VQKS 2L48A 5DDOC 2CJBA 3KJVA 3UN3A 1NAQA 2F9JA 5J2MA 4WJBA 5C7PA 4NPOA 1TKTA 2XHCA 3OR1A 4OYIA 2J6UA 3BZQA 1S6OA 1FK9B 3J7YU 3O6QA 2DR9A 1S0VA 4ID8A 2AEFA 4HVZA 1GMVA 1QY7A 1DQAA 4YMEA 3PRVA 1WG5A 4YR2A 5GAGU 3U1NA 2V4JB 2RRAA 1LNQA 2RILA 3AY0A 2XY6A 4EEYA 4CLUA 3MEEB 1J5EJ 2GIFA 1GTHA 5DZ7A 1NHUA 1AROP 1U48A 4RWXA 1NJZA 3JTOA 4DR6J 3PX6A 2OUGA 5A6PA 5F8NA 3AAWB 1N36J 1NPRA 1WHYA 1Q81T 3TQEA 4P2MA 4IG0B 2AP6A 3KFWX 1XMOJ 3PX0A 2JEJA 3WX4A 2HNDA 1M5OC 4IRCA 4WKYA 1X0FA 1FJGJ 4DMZA 5DZ6A 3MR3A 5CYMA 4ZJOA 1DTQA 1Q4RA 2IC3B 2DCUB 4M8LA 2FYXA 5DG7A 2OAUA 2YKNB 1IUJA 3M1VA 5KFKA 4LMZA 5F9LA 2PD1A 2YNFA 3LP1A 5HVFA 4Q43A 3OTOF 2CPJA 3H7HB 3J81Y 4KHPJ 1HHSA 3ZZUA 3RGIA 4U7UK 1DY3A 3DXSX 3GFXA 3P5TL 3RB0A 4DSIA 1X4EA 4F0HA 3QJJA 2MQ8A 3MCOA 2Z4PA 4K8RA 3D5MA 4IOBA 4LR7A 5KFWA 1UZDA 3AA9A 4QIGA 3F73A 4X2BA 1T7PA 2VOPA 3W3SA 4C8LA 2QFIA 2R7UA 3NGDA 1UJ5A 4C7QA 1H6KX 2LXUA 3KUEA 1BGXT 2ZH3A 3RJMB 1LXNA 1WC6A 3S8SA 2DGTA 4ED4A 1PO6A 3H25A 4MMOA 2QN6B 4K5SA 2ROEA 3FQKA 3PFEA 4A8MP 1EQMA 4KHMA 2B9WA 5HBMA 1TFYA 2WONA 2PA3A 1K44A 1OSCA 1RTIB 1IBMJ 4UTGA 2I5JB 1TMJA 2Y1RI 1FF2A 2KG0A 5D3GB 2BE7D 3PRDA 3W62A 3MR2A 3SSSA 4UY85 1DBDA 1C4CA 4B9NA 1T05A 4DDFA 2W24A 1N88A 2D41A 4C2MA 2WVEA 4LF9F 5JVGQ 1PBUA 2F4FA 4USHA 5IWAF 2RU3A 2QE5A 2AJQA 4WCEQ 3KG4A 3CPWR 3V6DB 4QPXA 4I4BA 1RWMB 2OD6A 3R2CJ 3DOLB 4ZPAA 3PKMA 4ED3A 2V9WA 2R3VA 3NKYA 4O23A 2GFFA 2P9EA 4I64A 5ADZA 2R8GA 4WXWA 1PYSB 1DQ9A 4H4OB 4BWJA 2E44A 1N32J 3BF4A 4TXSA 2QRRA 1VOMA 4H4MB 5I4MA 1CJTB 3J81j 1BQNB 4EFAC 1IBCB 1Y10A 2EG2A 3P8BB 1SUQA 3AFGA 1CULA 4WBFA 3Q83A 2CG8A 2CKWA 3OHBA 2BUNA 1JJ4A 1Q1KA 4JI5F 1ZH5A 3CMES 3FC9A 2B7BB 2E29A 1E6YA 3JS9A 3ZZRA 2FVCA 2KG1A 2DO0A 4ERDA 2FVRA 3MM9B 2DNRA 4B3RF 4FXVA 5D4NA 3UN5A 1F3VA 2HFSA 5AE1A 3TAMA 2ZOMA 4N47A 3POTB 1VS3A 3IC1A 1WF2A 2HVZA 2FQQB 3CCWA 3CMQA 3VWSA 2BX6A 4JI8F 3DM2A 4P9SA 4P74A 1WSVA 4IRDA 4FPIA 4CO4A 4DUYF 1LK5A 5KFTA 3C8YA 1VQ9S 3CF5Q 2RKIB 1X9MA 2RHSB 3ZNJ1 4I68A 5MLCV 3BYRA 2J76E 2G13A 2BACA 4KKOA 2MJUA 8ATCB 3M7VA 2LU1A 4ECVA 1ZA1B 1YJTA 1KFDA 2E9ZA 1APSA 2FZCB 5KG1A 3JB9k 5I3PA 5CD4A 3LH2S 2CJYB 4HR2A 1TUGB 1GQEA 5L9NA 4J9VA 1V3RA 3CJRA 4ZPDA 5CCLA 2W7AA 2K3KA 2HRYA 4Y65A 2RNEA 2B56A 5DM7Q 4FP9A 3BYPA 1IQTA 4P73A 3M05A 4JB8B 2C28A 5FDLB 2MQPA 4V19J 3AD9C 2FJVA 4DPXA 1G2EA 4Q7AA 2OGUA 4QZVB 3GCXP 5KG6A 5HQLA 5LXRA 1NEEA 1F5BA 1PG5B 1S1UB 2CPFA 4M5NA 5ETVA 4KH1B 3DRXA 2ZKUA 2JWNA 1RYRA 2Z57B 1X4DA 2IYIA 1AW0A 2WW4A 1JXEA 1M5KC 1T11A 3MM8A 4DV3J 5FLXU 1VRUB 4WTYA 1RWOB 3B4DA 4ZPTR 1R8HA 2K1RA 1RT1A 2JEIA 4C9DA 2DISA 1YHQS 2A3JA 3BO2A 4NLTA 4EO8A 4OI3A 3HHKA 4DV6J 4IRKA 3TP2A 2DNGA 2V9KA 4J37A 4DL7A 2CVEA 1WI6A 3ISND 1FRHA 2XYGB 2O66A 4N5SA 1HWKA 1XK8A 2QL5B 1FE0A 3L7PA
chains in the Genus database with same CATH topology
2QLBB 1RWMB 2CNOB 2H65B 1RWWB 2CNLB 3P45B 2QL9B 2C1EB 4JB8B 2HBZB 2FQQB 5K20B 1RWVB 4ZVTB 1I51B 3SIPB 2XYHB 3D6FB 3P4UB 1SC3B 2CNNB 3GJQB 3R7SB 3R7NB 4LSZB 4DCOB 2H5JB 2QLFB 1SC4B 3RJMB 2QL7B 2XZDB 2H48B 2C2ZB 4ZVOB 4ZVQB 2H5IB 2P2CB 1RHJB 1QDUB 3KJNB 1ICEB 2H54B 1IBCB 4DCPB 2Y0BB 2HBRB 2C2KB 1PAUB 4ZVPB 4DCJB 1GFWB 1RWOB 4ZVUB 2XYPB 2CNKB 2C2OB 3D6MB 3KJQB 5IC6B 1RHKB 4ZVRB 2XZTB 2H4YB 2HBYB 1I3OB 1RWPB 2CDRB 2CJYB 3R6GB 1RHMB 3EDRB 1NMEB 1RHQB 3D6HB 3IBCB 3GJTB 3R6LB 1RWNB 5IC4B 1RWKB 3QNWB 1RE1B 2QLJB 3EDQB 1SC1B 2H51B 1RHRB 3NS7B 3GJRB 1F9EB 1RWXB 3KJFB 2XYGB 3IBFB 1RHUB 3R7BB 1QTNB 2Y1LB 1BMQB 2H4WB 2QL5B 3R5JB 2HBQB 2CJXB 2DKOB 1PYOB 2C2MB 3GJSB 4ZVSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QLB B;  1RWM B;  2CNO B;  2H65 B;  1RWW B;  2CNL B;  3P45 B;  2QL9 B;  2C1E B;  4JB8 B;  2HBZ B;  2FQQ B;  5K20 B;  1RWV B;  4ZVT B;  1I51 B;  3SIP B;  2XYH B;  3D6F B;  3P4U B;  1SC3 B;  2CNN B;  3GJQ B;  3R7S B;  3R7N B;  4LSZ B;  4DCO B;  2H5J B;  2QLF B;  1SC4 B;  3RJM B;  2QL7 B;  2XZD B;  2H48 B;  2C2Z B;  4ZVO B;  4ZVQ B;  2H5I B;  2P2C B;  1RHJ B;  1QDU B;  3KJN B;  1ICE B;  2H54 B;  1IBC B;  4DCP B;  2Y0B B;  2HBR B;  2C2K B;  1PAU B;  4ZVP B;  4DCJ B;  1GFW B;  1RWO B;  4ZVU B;  2XYP B;  2CNK B;  2C2O B;  3D6M B;  3KJQ B;  5IC6 B;  1RHK B;  4ZVR B;  2XZT B;  2H4Y B;  2HBY B;  1I3O B;  1RWP B;  2CDR B;  2CJY B;  3R6G B;  1RHM B;  3EDR B;  1NME B;  1RHQ B;  3D6H B;  3IBC B;  3GJT B;  3R6L B;  1RWN B;  5IC4 B;  1RWK B;  3QNW B;  1RE1 B;  2QLJ B;  3EDQ B;  1SC1 B;  2H51 B;  1RHR B;  3NS7 B;  3GJR B;  1F9E B;  1RWX B;  3KJF B;  2XYG B;  3IBF B;  1RHU B;  3R7B B;  1QTN B;  2Y1L B;  1BMQ B;  2H4W B;  2QL5 B;  3R5J B;  2HBQ B;  2CJX B;  2DKO B;  1PYO B;  2C2M B;  3GJS B;  4ZVS B; 
#chains in the Genus database with same CATH topology
 3CCM S;  2B51 A;  5EGY A;  2FIU A;  3BPD A;  5ETL A;  4B9S A;  4TN2 A;  3W1Y C;  2DPI A;  4C8K A;  3C6T B;  3UNY A;  1FJC A;  1TKX A;  4P7V A;  2PI5 A;  2DGO A;  3TUJ C;  2N82 B;  2KKH A;  2IY5 B;  3OFF A;  1CJU B;  2KO1 A;  2NXU A;  3FEZ A;  1D8Y A;  3BR8 A;  1GT8 A;  3QIP B;  1WOR A;  2JRS A;  4LFA J;  3LGH A;  1TKZ B;  4C4W A;  3SCL E;  3DXB A;  2GML A;  4X4T A;  3M8S A;  1AA1 B;  4DN9 A;  2UUA J;  2YPY A;  1TTH B;  1VHI A;  3VF0 B;  4OZ0 A;  4UOF A;  2HGN A;  5HMZ A;  5I3U B;  1NK4 A;  3EDR B;  1SJR A;  3GFH A;  2ZZN A;  1UKU A;  4TYA A;  1WF1 A;  3DDK A;  4JI0 J;  4NYO A;  4MAK A;  3UQS A;  2QMU B;  5D0H A;  5K8M A;  2RS8 A;  1P8G A;  3AJD A;  1RHU B;  2J9D A;  3TA1 A;  5B7W A;  5IT9 Y;  2KXF A;  2LQJ A;  1VC0 A;  2HVH A;  4UUX A;  1HD1 A;  2X7I A;  2HBZ B;  3DRY A;  4K4V A;  4G1Q B;  5H1S V;  2MKK A;  2GVD B;  2GAG C;  2E9T A;  3A8I A;  1WG1 A;  4KHP F;  4AXJ A;  4ECS A;  4LIW A;  2MST A;  5EX0 A;  4B9M A;  3FVY A;  2B43 A;  3JXO A;  2UVR A;  3AA8 A;  1TL3 A;  3HKZ D;  1YWX A;  3DLK A;  1V5V A;  3KK1 B;  4KFB B;  5LSL A;  1ZZF A;  4PEO A;  1D3W A;  2H3E B;  1RB0 A;  4KRW A;  5KFQ A;  4LR8 A;  3OTB A;  5LSR A;  2R7R A;  1FEH A;  1IBK F;  3ZXW A;  4PZV A;  4Z2X A;  2HHV A;  1Y11 A;  1ZS6 A;  2DEJ A;  4YN3 B;  2GJ2 A;  2NUH A;  1L3U A;  3TJ8 A;  2OFG X;  3DOM A;  5A0Y A;  5HI7 A;  3OL9 A;  4OZJ A;  2WAQ D;  3DLH A;  2CQC A;  3H40 A;  4L3K A;  4V1A k;  1BQM B;  3QRQ A;  3NOG A;  4FYY B;  4FZV A;  4OIX A;  2BW7 A;  2CZ4 A;  4OYW A;  2COL A;  4NLG A;  3ENW A;  3GCW P;  4LRC A;  1IBM F;  2HS4 A;  1D9D A;  1YG0 A;  3FEX B;  4OX9 F;  5KFE A;  4NMX A;  1X7V A;  5IV4 A;  1RYS A;  1MN9 A;  1F9H A;  2OPQ B;  4NRT A;  2AHO B;  1OY9 A;  1PC5 A;  3PYD A;  2B4U A;  2V68 A;  3THP A;  2DY9 A;  3OPK A;  1A6L A;  1IJE B;  1SVD A;  2KL8 A;  3HD2 A;  4NRU A;  4DCP B;  3D66 A;  4WE1 B;  4UZB A;  1RAJ A;  1B99 A;  1V6H A;  2X3G A;  3PKY A;  1TMM A;  3V4I B;  3ILL A;  3DRP B;  4X64 J;  3IN5 A;  2VU5 A;  1VQP S;  1A7G E;  4L76 A;  4NXM J;  3R6G B;  5JXS A;  1N32 F;  4DQI A;  3NMR A;  1NCL A;  4K2J A;  1PJ7 A;  4NYP A;  4AT1 B;  2R8H A;  2AZ3 A;  3KXD A;  4KYZ A;  2J0S D;  1VIO A;  2HQC A;  3IR5 B;  3VHQ A;  4O3N A;  4HKQ A;  4WU2 A;  3BM7 A;  2C3O A;  3EZU A;  2QLB B;  1O51 A;  3RYL A;  2VQF J;  1OO0 B;  1QAY A;  4HLB A;  4DOZ A;  3RU0 A;  1BUX A;  1FFG B;  2HGL A;  1U6B A;  1GMW A;  3BS9 A;  2X1F A;  4Q8E A;  3C16 B;  1NDC A;  3I5C A;  2XY7 A;  3JTP A;  1RTJ A;  3NY0 A;  4XO0 A;  3CD0 A;  2CQG A;  3ZZY A;  2N4C A;  4ES2 A;  3B4M A;  1YJW S;  1K8A T;  2DHS A;  2OPP B;  4DR4 J;  3DI6 B;  1JNR B;  3RB6 A;  3MMJ A;  3KJQ B;  3BO3 A;  3ZZO A;  4GKJ J;  4PPD A;  1F5A A;  4HI1 A;  3DLE B;  2P8I A;  4QW8 A;  2WZ1 A;  3GJT B;  3HJV A;  4U95 A;  1T9U A;  3I0S A;  3RBD A;  2FC8 A;  2HVI A;  1NSQ A;  3MGJ A;  2MXY A;  3N0V A;  3NMA A;  1WDD A;  3H59 A;  2DNP A;  2GNK A;  3W64 A;  2AMC B;  4P2F A;  3MEG A;  1SKR A;  4USM A;  3HHD A;  5LJ3 Y;  4B3T J;  3R7S B;  1SKW A;  2ALY B;  2LCW A;  1SQG A;  4X4O A;  2QLF B;  1Y9O A;  1VYA A;  5C2G A;  4CO3 A;  3PCO B;  2WTF A;  2DB1 A;  1S6Q A;  4K4Y A;  1TU0 B;  4LIR A;  3BGU A;  3HVR A;  4JP8 A;  2H54 B;  1HYS A;  5AXM A;  1S1V A;  1HBN B;  3JAM U;  4PG5 A;  4QR0 A;  3M2R A;  4OI6 A;  5F8L A;  2CPI A;  3MMA A;  4KR0 B;  2FZG B;  2HGM A;  2OP5 A;  1JK9 B;  1G4C A;  3LF0 A;  1OJ4 A;  2F1F A;  2BAN A;  3C15 B;  4P2X A;  2DHG A;  1YJ9 S;  3M8W A;  3IRW P;  3FSI A;  3C14 A;  5M2U A;  4JBC A;  1B70 B;  5E3P A;  1UVM A;  1K1Q A;  4ICL A;  3DC2 A;  4U9R A;  1LW2 A;  3KUG A;  1KHV A;  2DGX A;  3WC0 A;  2YPZ A;  3BV8 A;  4J9N A;  4XIU A;  2X1G A;  4KGK A;  4BHQ A;  2PE8 A;  3SFG A;  4G1I A;  1Q79 A;  1WEY A;  3NWR A;  3SZ2 A;  3O2I A;  4L74 A;  1IJF B;  4ZLN A;  3UN2 A;  3HHE A;  4I2Q A;  2P5V A;  2J8A A;  2CNN B;  2NUU G;  1RAF B;  4DV6 F;  1KLN A;  3HF5 A;  2MZQ A;  3FEY B;  2OD4 A;  1C1B B;  3TUI C;  1SC4 B;  2UXB J;  3KLF B;  2XZD B;  2KFZ A;  3FGV A;  2R7T A;  4WYL A;  2KHC A;  1VBX A;  2R9L A;  2MJN A;  3KJN B;  1G6B A;  1X4B A;  3BKT A;  2LDY A;  1Z4U A;  1G1X A;  7FD1 A;  3MED B;  5U47 A;  4ZVR B;  1VFJ A;  5HRO B;  2HAI A;  2BQ3 A;  2RAQ A;  3L09 A;  4NEZ A;  3EMT A;  4MYU A;  1BY9 A;  2AEJ A;  2FVQ A;  3TEH B;  4FNH A;  2A2C A;  2R7Q A;  5T7L A;  1UZH A;  2L08 A;  2VA3 A;  1RWX B;  4DX5 A;  4J9M A;  2LQB A;  2E7X A;  2W4D A;  2MGZ B;  3FBC A;  4LFA F;  3P6Y C;  1IKY B;  3FBF A;  2XNR A;  2IYG A;  4QIF A;  2UUA F;  4PWD A;  1FDA A;  3IAM 9;  4JI1 F;  2RU9 A;  2J7W A;  2BXJ A;  2IBO A;  4DF4 A;  4GKK J;  1HPZ A;  5HAO A;  4OHZ A;  2C2R A;  1RT5 B;  1WUU A;  4JV2 A;  4JI0 F;  1Y7P A;  1PC4 A;  1XNR F;  1X4G A;  4IOC Q;  4IO1 A;  4OL8 A;  1Y4Z B;  4NCG A;  1BHN A;  1ROF A;  3OLB A;  5HN0 A;  2BJ3 A;  3ADA C;  3K5M A;  3VAI A;  1A0O B;  3GR0 A;  1C0U B;  1YJR A;  1GFW B;  3EGV A;  3SXL A;  5E3R A;  2V8V A;  3VCD A;  2QMX A;  5JJB A;  4A4J A;  4O44 B;  5DGB A;  3BGR A;  5DGA A;  3WQP A;  4ZPC A;  4QIW D;  4K50 A;  4L75 A;  1EET B;  4C3K A;  5C5J A;  4I67 A;  3N79 A;  2PMZ D;  1FK9 A;  3QSI A;  4PQU B;  3PJW A;  1B0T A;  2IA0 A;  3EGZ A;  1R31 A;  2V4J A;  5HQ8 A;  1SL1 A;  2UUC J;  1RT6 B;  3C6U B;  4K2X A;  3MEE A;  2VPY B;  3PG9 A;  2DR6 A;  2R7O A;  1BQX A;  1LW0 B;  2J8S A;  2V50 A;  4WP3 A;  3MMC A;  1IKW B;  3AOC A;  2BBE A;  2QSF A;  4CDI A;  4FVC A;  2L9N A;  1W26 A;  1R3N A;  4IO9 Q;  4Y2A A;  2XMM A;  2CVI A;  5E7O B;  3U7J A;  3QFW A;  4LF8 J;  2GQ2 A;  4MH8 A;  1FKO B;  1FTR A;  4NLV A;  3ZO7 A;  5HMY A;  2XZT B;  1H7X A;  2VC0 A;  4ZIV A;  2OH2 A;  3CCU S;  3NAH A;  2M3D A;  1NKC A;  4RR5 A;  1HW9 A;  1HQ2 A;  3ZTS A;  3N6L A;  4LF4 J;  1J5O B;  4UT4 A;  3IMQ J;  3CCZ A;  2OI2 A;  3N4W A;  5L39 A;  4DR1 J;  1X4H A;  3E2E A;  2YKN A;  2MKY A;  1FX4 A;  2HHX A;  2YWW A;  4ED5 A;  3QRR A;  3HSZ A;  5KT6 A;  5ETK A;  4X64 F;  4YB7 A;  2CRL A;  1JIH A;  2EC2 A;  3KHR A;  4DPY A;  2QT7 A;  4L6V 3;  3KNG A;  1WKK A;  3M9O B;  1WD6 A;  2F8M A;  1UWB A;  5LM7 E;  3ZTQ A;  1VBK A;  3R9L A;  4QWC A;  1SQF A;  2ALZ A;  4OHW A;  1CG2 A;  4NEY A;  5KOW A;  2RF2 B;  3F56 A;  1FA0 A;  5B0G A;  2PT0 A;  4LSL A;  2XCA A;  4Q2L A;  3ILI A;  3BGO P;  1PKU A;  4IUF A;  4J9Q A;  2H5I B;  2NYH A;  2MZJ A;  4DS4 A;  1NK0 A;  2RHQ B;  2VQF F;  3N5B A;  4CLP A;  3IM8 A;  3M6V A;  2PEH A;  2QA1 A;  1TR0 A;  4K5R A;  3PW0 A;  3TI0 A;  3HD1 A;  1JLE B;  2HFZ A;  3RB4 A;  4MFB B;  4P52 A;  4HL9 A;  3ENA A;  4X4U A;  3GYG A;  2DHX A;  2G0I A;  5IQ6 A;  3J7Y I;  3NWG A;  2H51 B;  2PII A;  3OFE A;  2DXD A;  3R27 A;  1YJU A;  4KPY A;  1DAX A;  1RTI A;  5HMX A;  2MKJ A;  2W7O A;  4Y6I A;  1RJJ A;  1NK7 A;  2I5J A;  2J7U A;  1Y3K A;  5GAG I;  5DRK A;  3OD2 A;  4PXD A;  5D3G A;  2FGO A;  3L4B C;  4IH6 A;  3P96 A;  2BEF A;  4DFJ A;  2RH3 A;  3QWP A;  3HX9 A;  2E5J A;  3V6K A;  2ZVI A;  4LQ9 A;  2W2M P;  1F9F A;  5D0G A;  3V6D A;  3SMZ A;  5K14 B;  2OEK A;  4WP8 A;  3DOL A;  2PFF B;  2F8E X;  1O6X A;  1YGY A;  2HIY A;  1GXU A;  2LQ5 A;  2CWK A;  2AQ4 A;  1PAU B;  2Y9H A;  3E01 B;  2JFK A;  2AJ4 A;  4BDP A;  1PSD A;  4QQB A;  2HS3 A;  5HL7 Q;  2PA8 D;  2FZK B;  4KGM A;  1CJT A;  3IAS 9;  1JWW A;  1RU1 A;  1BQN A;  2B3T B;  1OMS A;  1YBA A;  2MKI A;  3CXC R;  2GAH C;  2LXF A;  4DLG A;  2CPY A;  5J1E A;  4U7U D;  3V6H A;  1ZOT A;  4B9L A;  4JOU A;  5H9E J;  1W2B R;  2XSJ B;  2OHD A;  4R0J A;  1SJ4 P;  2W8L A;  4P75 A;  3PHT A;  2LEB A;  2L41 A;  4DQR A;  2QLX A;  3FCW A;  4NI2 B;  4CTA A;  1R7I A;  3QT8 A;  3MFH A;  1JLB B;  4XTT A;  5B09 A;  3MZI A;  3W2V A;  3HT3 A;  1S1X B;  4O3O A;  1Q5V A;  1NZA A;  2YQ3 A;  2V4R A;  2E1A A;  3UPF A;  3LAN A;  3POT A;  2D7S A;  3GYX B;  1XBW A;  4OLP A;  4E8U A;  2ZWP A;  3KLG B;  4GC6 A;  1QDU B;  1FNX H;  2K2P A;  3MM5 B;  3QAE A;  2MDA A;  4RX6 A;  4ZVU B;  3PEH A;  2Z56 B;  3THV A;  1HD0 A;  3GG1 A;  2CAJ A;  1KKH A;  3MPY A;  2ZJP Q;  1AZS B;  2DHH A;  1N33 J;  3H4D A;  3M8P A;  2RKI A;  1XMQ J;  3I5A A;  3M2U B;  4AXI A;  1N5V A;  1DTT B;  2JLE A;  1UCN A;  2MKS A;  2HRU A;  5HJX A;  2UXB F;  1S49 A;  2DIV A;  3D1Q A;  4AL6 A;  3EDQ B;  3HZG A;  2I38 A;  3GIK A;  4RW4 A;  3NAI A;  4IFV B;  4DV2 F;  3DOK B;  3R5D A;  1YI2 S;  1QTN B;  1QLN A;  2JZ5 A;  1RT3 A;  2FJX A;  2OEJ A;  3VR1 A;  4CLW A;  1WOS A;  1HR0 J;  3K89 A;  2ZM6 F;  1XNQ J;  4ZVT B;  3RBE A;  4CO2 A;  1HNX J;  3EVO A;  2Z2M A;  2FLL A;  1K73 T;  3GJQ B;  1ZTW A;  2QGF B;  1IR2 A;  3V81 B;  5ETT A;  4ZCI A;  1S5Z A;  2U1A A;  2K7K A;  3E3X A;  4CRJ A;  1P1T A;  3RBZ A;  1HHT P;  2HHW A;  3SFU A;  2VC1 A;  2SXL A;  2IAJ A;  3RR8 A;  3OVB A;  5FDL A;  4RNM A;  1VQO S;  2EI5 A;  2VBW A;  2PI4 A;  2M7S A;  4GKK F;  3TX8 A;  3BSA A;  4F3Q A;  4FBT A;  1U8W A;  1KQK A;  3TW0 A;  3CC7 S;  1S1U A;  2IRY A;  3DLB A;  2XCP A;  2V0N A;  4W92 B;  1Q86 T;  4NAS A;  3CJT A;  3TAQ A;  3BBB A;  4RKU C;  2DT9 A;  4PQA A;  4IR1 A;  3MAA A;  1VRU A;  5DJB A;  4USI A;  2Y8Y A;  2FVS A;  4DL2 A;  1N8R T;  2UXC F;  4TQS A;  3DNC A;  2VZ9 A;  4X62 J;  1SCJ B;  1OYD A;  1VQ7 S;  2F8H A;  5EN1 A;  1ZZN A;  3W66 A;  2ILY A;  3FMW A;  4LFC F;  2FGC A;  2R42 A;  1RTD B;  2RQC A;  1LWF B;  3SCI E;  4F2S A;  2ZH2 A;  3CT9 A;  4OLO A;  4ITS A;  3BDE A;  4CZC A;  3RRH A;  2QL7 B;  3LAL A;  5F3Z A;  2OML A;  1HNV B;  2HLU A;  2VL1 A;  4ETX A;  4PCQ A;  2BJ7 A;  2U2F A;  4EI2 A;  5ETM A;  4CYU B;  2MKC A;  2KTQ A;  3C6T A;  5SUH A;  5L1K A;  4AL7 A;  3M2V B;  1RQ0 A;  2AJ2 A;  3UVJ A;  4DG1 B;  3Q8V A;  2HIQ A;  3PW2 A;  4RUH A;  2LU2 A;  1FFW B;  3TUZ C;  2RB7 A;  3QIP A;  1SJ1 A;  4Q0B B;  2EBG A;  3UDE A;  2GMJ A;  4ZA1 A;  4PWW A;  1L3T A;  3NNA A;  2M4M A;  4QYZ K;  4K7Q A;  2FTR A;  1EB0 A;  2JX2 A;  2XQC A;  4FF2 A;  3IRX A;  3T5H A;  3LWL A;  1RI7 A;  5I3U A;  4I6Y A;  1E6V B;  5IQQ A;  2CNL B;  4F4Y A;  5J2N B;  1CBK A;  3R5A A;  4H54 A;  1W2I A;  1RWV B;  1LFP A;  3OXF A;  4TKT A;  3PY8 A;  5BR8 J;  3B6B A;  2A10 A;  2E66 A;  4OYB A;  4Y2M A;  1YIJ S;  3MM7 A;  2NQP A;  2JVO A;  4ZJQ A;  2NLW A;  2WVF A;  4AND A;  2YVS A;  4DR1 F;  1ZM4 A;  2UV8 G;  3QAT A;  1IBL J;  3N28 A;  3KOA A;  2EFP A;  2KJW A;  4YUD A;  5KT2 A;  2HHQ A;  2PFD A;  1U24 A;  1UJ6 A;  2GCF A;  4X4S A;  2GVD A;  1R89 A;  3M8Z A;  2EG1 A;  1LFW A;  1FDB A;  2EK1 A;  3PR5 B;  4JI2 J;  3X1L B;  4JYA J;  1RXO B;  1VI7 A;  1YRX A;  1VRT A;  1QM9 A;  4ECY A;  3UR0 A;  4MT1 A;  4F02 A;  2NZ4 A;  3R5C A;  1KOH A;  3I31 A;  2ZIT A;  1X9W A;  1FRJ A;  3HUL A;  4HAC B;  3PXG a;  3ZZZ A;  3K58 A;  1WC4 A;  4ZIT A;  1S0N A;  4FXD A;  2IA6 A;  2RML A;  3CDB A;  2W9B B;  2EFG A;  1H38 A;  4HDH A;  3FFI B;  2JVR A;  4OMF G;  1HHQ A;  2RJZ A;  3M6U A;  1F0X A;  4NA1 A;  4DXL A;  3T5L A;  3FKB A;  1ACM B;  3ELH A;  1NSA A;  1CJK B;  1OYE A;  3FZ2 A;  3H20 A;  1YK9 A;  2HS0 A;  1BQM A;  1T03 A;  1IWA A;  3LAK A;  4PAB A;  1HIY A;  2IDE A;  4LBI A;  2HQD A;  4DUZ F;  5HK4 A;  4CNZ A;  1RKI A;  1OPI A;  2OPQ A;  4FF4 A;  1CPZ A;  5KG0 A;  3C3L A;  3W5X A;  1U2F A;  2EXU A;  1HI0 P;  1C0T B;  3DYA A;  1KD1 T;  3S01 A;  3D6H B;  1V9O A;  1RWK B;  1RDR A;  4UF4 A;  1S7I A;  2B9Y A;  1JLG A;  4UST A;  1KS2 A;  4TY8 B;  2ZVS A;  5A8W B;  3LP0 A;  3V4I A;  4PYD A;  2ZFH A;  3DRP A;  1RT4 B;  4IKA A;  3CW2 C;  1Q8B A;  3TR5 A;  3TZZ A;  1Q95 G;  1YZ7 A;  2ZHB A;  2BVZ A;  2KJV A;  2G2Z A;  2FHJ A;  4TU7 A;  3CJ3 A;  3ICL A;  1V3S A;  2NYI A;  3C46 A;  3AHP A;  2DK2 A;  5KOX A;  2DCL A;  1N54 B;  3RAM A;  3D28 A;  5KFG A;  1EIY B;  2HUR A;  1NK8 A;  4H4K A;  1CQN A;  1RCX B;  2XWX A;  3VAH A;  3GIM A;  2UVW A;  2Z58 B;  3MUV P;  2R8J A;  1L3S A;  1OPZ A;  3C16 A;  3AJ2 A;  3JSR A;  3NG8 A;  3CD5 A;  2I2Y A;  5EWF A;  1UW9 A;  2VG7 B;  3J80 U;  3M8Q B;  3WC2 A;  3KUH A;  3G8S A;  3H5Y A;  1YKW A;  1VQ6 S;  2WBM A;  3DI6 A;  4IH7 A;  3CO9 A;  3LA0 A;  2RRB A;  3MCN A;  4PPZ A;  4RBU A;  3Q2T C;  2JHE A;  1VC5 A;  3DLE A;  2KYX A;  2W9C A;  1RP5 A;  2J9C A;  2VJV A;  4KY3 A;  4F50 A;  1GEH A;  3W61 A;  1XMQ F;  2KVI A;  4X4R A;  4DJB A;  3Q8Q B;  4MKB A;  4DZD A;  5IV3 A;  1B0P A;  4FYW B;  4MTP A;  1QAX A;  1SBR A;  4LSN B;  4QR2 A;  2L3M A;  3T6J A;  2F4V J;  1AB8 A;  5EDW A;  4ZVH A;  2QA2 A;  3CDE A;  2ZBR A;  3MF5 A;  1X4A A;  1D1U A;  1S77 D;  2V2Q A;  3N5F A;  2WSC C;  5I3Q A;  3VAF A;  1HR0 F;  3P49 B;  2D74 B;  3OJU A;  1VRQ C;  2V34 A;  4Z7Y A;  2BE2 B;  5C42 B;  1HNX F;  1IXK A;  5GAH I;  2CDQ A;  1T9W A;  2GZO A;  3W8P A;  4Z37 A;  4WIQ A;  1YVF A;  3VQT A;  1I1G A;  2V4Q A;  1S12 A;  2M8H A;  3UW1 A;  3A1Y G;  1TL4 A;  1UPM B;  1D0E A;  2C22 A;  4DV4 J;  3OUY A;  3OVA A;  3HSG A;  3EX7 B;  1OS5 A;  1VHF A;  4UOC A;  3W5Z A;  3HHN B;  1FRK A;  2ZHO A;  5CZV A;  4PAA A;  3C19 A;  3EZO A;  1NK5 A;  4YHH J;  4DR7 F;  1HBN A;  5D8H B;  3V5R A;  1WWH A;  3QO9 B;  1MWQ A;  1UAW A;  3WBZ A;  2VPX B;  2HZC A;  3MUM P;  2RUG A;  5LT5 A;  2R7V A;  3C15 A;  3ONQ A;  4FYD A;  4FVM A;  3DN9 A;  4F3M A;  2XG8 A;  1NND A;  2GC8 A;  1B7F A;  1JXV A;  5DDR C;  3TJ9 A;  3BGF A;  1UVK A;  2R2U A;  1H3D A;  2JC0 A;  4DR5 F;  3OFH A;  4X62 F;  3US5 A;  4D3G A;  1RHJ B;  1R27 B;  4LF7 J;  2VG6 A;  2XBP A;  3CD6 S;  4ZK7 M;  4RUB A;  2CQ0 A;  4DCJ B;  5EUH A;  2B5J B;  2HZA A;  1LQ9 A;  2W4P A;  3NNC A;  1C1B A;  4ZHR B;  1HFE L;  3FBB A;  2XEX A;  3IG1 B;  2XMT A;  1HMV A;  3MI7 X;  4DR3 J;  2V67 A;  2KHD A;  5CCM A;  1Q16 B;  5CXT A;  1VR6 A;  3NGU A;  4WK3 A;  3MM6 B;  4O3R A;  2N3L A;  1KQF B;  3KHH A;  2VON A;  1K0T A;  3JSY A;  2GW8 A;  5G4D A;  5HRO A;  1EP4 B;  3GJS B;  4O3P A;  1L3V A;  3M4X A;  2ZHA A;  5J2Q A;  1ULR A;  3TX0 A;  5A8K B;  4R5P B;  4A46 A;  1FEE A;  4BLG A;  4RW6 B;  2RVJ A;  3PJ9 A;  1D9A A;  5EX3 A;  1XMB A;  1IKY A;  3IP0 A;  4OYM A;  2IRU A;  1FD2 A;  3HXM A;  1KBR A;  1IKX B;  4M5D B;  1FJE B;  2EKY A;  3LO3 A;  4NLU A;  1PIE A;  3S1T A;  2VQE J;  3UWT A;  4RW7 B;  1N5Y B;  5BR8 F;  3ET6 B;  2Q6B A;  2CIM A;  2OKQ A;  2ZD1 B;  2CPX A;  1MRO A;  2V8P A;  1TVR B;  2ZH8 A;  4EU0 A;  2NZC A;  4A8Q A;  1IBL F;  4O4G A;  1QAI A;  4M95 A;  4P7T A;  4WP9 A;  2RD5 C;  2LEC A;  1U1R A;  1T0T V;  3PW5 A;  2CQP A;  4JI2 F;  4NZ6 A;  5H9F K;  4NLD A;  4MIB A;  1WC0 A;  2XZW A;  3OJS A;  1F6T A;  4K4S A;  4DL0 C;  2HNZ B;  2GO8 A;  1SC3 B;  2MYF A;  4I6A A;  4RNH A;  3KYL A;  4PQU A;  4OHX A;  1U1P A;  2AIR B;  2BKN A;  3KLI B;  4QJV A;  1WOO A;  4UQG A;  2R2S A;  2UVU A;  4YR3 A;  4DU7 A;  4NCB A;  2R7W A;  3R8Y A;  3G9C A;  5KFL A;  3EXY A;  3M8R A;  2VKR A;  2KZM A;  1LWX A;  2HPU A;  1LW0 A;  3TAN A;  1WF0 A;  1VQN S;  3W7B A;  1IKW A;  2ZH6 A;  2YKM B;  2AWZ A;  1EAR A;  5CZX A;  1WKL A;  5KFU A;  4F04 B;  2HWI A;  1YLX A;  4R8U A;  2EKN A;  2DNN A;  4OHV A;  1FKO A;  2AYM A;  1EZZ B;  3FUY A;  2M52 A;  3NS5 A;  1RBO B;  1UL3 A;  3J7A N;  3EPI A;  4C0H A;  1J5O A;  3QAU A;  1T9T A;  3NRB A;  4CIO A;  5L9X A;  4MYT A;  4EBD A;  3HI9 A;  4ZP9 A;  2YKP A;  3MWB A;  2IFX A;  3MDF A;  3NGK A;  2Y3Y A;  5KTQ A;  4ZVF A;  3G6V A;  4ZLL A;  1DLO B;  1FT8 A;  4HEA 9;  3L7O A;  5CYM B;  3M30 B;  3BBF A;  1U6F A;  4NXN J;  2G1H A;  4LVO P;  5CYQ B;  4XDC A;  3T1Y F;  2DNZ A;  1XR6 A;  2OIH A;  4Y34 A;  3M32 B;  4M1K A;  4NX9 A;  2YNF B;  3J7Z T;  1TAU A;  1QD1 A;  3M8Y A;  3AT1 B;  2JSX A;  4F7V A;  4ENO A;  3BKU A;  3BSO A;  4GRS A;  1MLA A;  2YTC A;  1SH0 A;  2RF2 A;  1H2T Z;  1F1B B;  4ZP7 A;  3B78 A;  2XGQ A;  3LPE A;  1VQY A;  5IC4 B;  4IH5 A;  1YZ6 A;  5BJR A;  4ED8 A;  2QYG A;  3FCV A;  3BEG B;  1BC6 A;  2CFX A;  4ED0 A;  3ITH A;  3A8E A;  2H4W B;  1CVJ A;  3K2Y A;  2WB4 A;  1JLE A;  1F2G A;  4MFB A;  4S0M A;  3GMG A;  2JOQ A;  5IS2 A;  2DNL A;  1PCA A;  2D1C A;  4WPA A;  2W9A A;  4URS A;  2AF6 A;  1S9F A;  3CD7 A;  4K0K F;  2LLZ A;  4UW2 A;  3P3D A;  3CGI A;  1GX5 A;  4KB7 A;  4DSE A;  1IN0 A;  1ZM9 A;  4MKY A;  4DQP A;  4F26 A;  3IWX A;  4QBU A;  1RAB B;  1UWA A;  2J7K A;  5ITH A;  3TAR A;  5A2Q U;  4KPC A;  3B8H A;  5KFF A;  3L7U A;  5K14 A;  1Q0N A;  2F4V F;  2XMW A;  1QTM A;  4MIA A;  3GE9 A;  1G7C B;  4FS1 A;  3W9H A;  2W7P A;  1F2H A;  1K47 A;  2VDH A;  3THT A;  1JLC B;  3KK2 B;  4QIE A;  3HLU A;  2PDA A;  3NCR A;  2HQF A;  2QFJ A;  2VAS A;  3CNQ P;  4WFX A;  1MSW D;  1ZAX A;  3OL8 A;  3I96 A;  3MUT P;  5KFY A;  3AOD A;  2IMO A;  1URR A;  3QT5 A;  1WTB A;  2XSJ A;  2HBR B;  3EYZ A;  3A12 A;  4ZCL A;  4ZVE A;  3VZI A;  2VBX A;  5CAB A;  4KGX B;  1FRL A;  4NI2 A;  3L95 X;  3T3F A;  1E6Y B;  2BYC A;  1S1X A;  3BSN A;  3WX8 A;  3N6N A;  1KON A;  4Q8F A;  4IFY B;  3MM5 A;  4OZ5 A;  4P72 A;  5AE2 A;  2EFO A;  4NLX A;  2LEP A;  4LF7 F;  5F0W A;  4JI7 F;  2XGP A;  1NM2 A;  1AZS A;  2BKO A;  5CD4 H;  4FBU A;  5AE3 A;  3M2U A;  2WSE C;  4FXW A;  1DTT A;  2C1E B;  1EKR A;  1UVN A;  4ECW A;  2QZ8 A;  2Y1I A;  1S57 A;  1T3O A;  4P6Q A;  2F40 A;  1JX4 A;  3G2X A;  1FX2 A;  1MWZ A;  1RWU A;  1KRP A;  2Q6C A;  4U7C A;  1RIS A;  1RAG B;  4DQQ A;  3WIU A;  5FLX Y;  2VD3 A;  3OTD A;  4C0O C;  4CLL A;  4IQM A;  5HAN A;  2BRL A;  3GG0 A;  5LMU F;  2FB0 A;  4LR9 A;  1VC6 A;  2CQ3 A;  1JB0 C;  3I4P A;  4GVB B;  1Q7Y T;  1R8B A;  1BD6 A;  3BSC A;  2M9K A;  3V81 A;  2OPS B;  5T14 A;  3IFE A;  2ZOF A;  2O5D A;  4FS2 A;  2HQ3 A;  2E5H A;  2QG9 B;  2XS5 A;  2XMV A;  1QUV A;  3BJY A;  5DS7 A;  2GHW A;  3SCJ E;  2XO7 A;  2IIH A;  1Q8K A;  2HHT A;  2BW2 A;  2FC9 A;  5D4O A;  3NCQ A;  5DLF A;  3GB0 A;  4ANE A;  3TVZ A;  4F4A A;  2E7W A;  2KI2 A;  4ZPW R;  4KTQ A;  4EYI B;  2DR5 A;  4WU3 A;  2CPD A;  2FY1 A;  3A8J A;  1Q8I A;  4B3O A;  2XMU A;  5KFS A;  2RDD A;  4A47 A;  3R1H A;  3KDN A;  3VGU A;  3HSJ A;  5FJ4 A;  3QMQ A;  3ILJ A;  4DV7 J;  3DDI A;  9RUB A;  2ZBP A;  4DBQ A;  4QIV A;  4ATN A;  1FD8 A;  2ASY A;  4ZMM A;  2B9E A;  1GXL A;  2DYA A;  2AYB A;  4NLQ A;  4WFY A;  3A13 A;  4Q44 A;  2CQ2 A;  2J6T A;  1HLW A;  4MK8 A;  4YR0 A;  1RTD A;  2ADB A;  1RT7 B;  2BJ9 A;  3KK3 A;  4ZVP B;  2E5I A;  3DU5 A;  2MZS A;  4F4X A;  3RRK A;  4J9U E;  2AU0 A;  5BYQ A;  2IHR 1;  3RRG A;  4M5K A;  4LFB F;  3CJ4 A;  4RZR A;  2ROG A;  4DFP A;  2Y0S D;  3IGN A;  3UDC A;  3DDN A;  1HNV A;  4XK8 C;  5KFN A;  4G3I A;  4RJV A;  3ZFV A;  3EGN A;  2NXE A;  4IQX A;  3IGV A;  2GIQ A;  2C3P A;  4DX7 A;  1S79 A;  3GQC A;  2M8D B;  3M2V A;  4Z7C A;  2VPZ B;  2MB0 B;  4DG1 A;  2NRE A;  3PYG A;  2DH8 A;  2H9Z A;  4HTJ A;  2GQC A;  1ZTT A;  1NZ8 A;  4LF5 J;  4E0D A;  3HFV A;  4Q0B A;  1RAO A;  1TKX B;  2J9E A;  3D54 A;  1U02 A;  2POK A;  3T1A A;  1R0B G;  3ETM A;  3HM9 A;  4F0K A;  1U1K A;  1HBM B;  2MZR A;  1E6V A;  3G4S S;  4CCH A;  1WC5 A;  1PIL A;  3O1L A;  4HYK A;  2MHE A;  4F25 A;  4N41 A;  2GX8 A;  4Q45 A;  4C0B A;  5KG5 A;  5L38 A;  2GS8 A;  3D3C J;  4DFK A;  2CQI A;  3G6E S;  4C8Y A;  3UI3 A;  1HQU A;  1CS4 B;  2DNK A;  1Q7L B;  2IMW P;  1VQS A;  2AYG A;  4NXN F;  3GON A;  1V5I B;  1DAR A;  3FZB A;  5M2P A;  1LK7 A;  1MWY A;  4WFA Q;  1NJI T;  5E5N A;  3AJ1 A;  4B3M J;  2ERR A;  4RNF A;  2CJX B;  4B08 A;  2DGQ A;  3TJA A;  1OWX A;  4F0M A;  5CYJ A;  4CT9 A;  2HHH F;  2B4O A;  4EZ9 A;  5EWG A;  1I51 B;  4ZS6 A;  2IPO B;  1FHT A;  4HAC A;  1TL3 B;  4KO0 B;  2E1P A;  2D3O 1;  4IDK B;  3VQS A;  4DPO A;  1EX8 A;  1S0M A;  3DLK B;  1YQH A;  1UVJ A;  4PUO A;  4CO0 A;  1C1C B;  2W9B A;  2ACM A;  3FFI A;  2NXN A;  4X65 F;  5L1I A;  2ZE2 B;  1VMB A;  1JLQ B;  2CPH A;  3K17 A;  2G4B A;  1S7H A;  1WEZ A;  2UXD J;  3W9J A;  2UUT A;  2JNJ A;  1HNI B;  3HVA A;  2K3I A;  2FDN A;  3ZZ0 A;  3D6T B;  1GTE A;  1CJK A;  1WHX A;  3EJM A;  3JQJ A;  2EFQ A;  2WB1 D;  5E2Q A;  1NKE A;  3IR6 B;  2HZV A;  3DOM B;  2JL9 A;  4M63 A;  2B6A B;  3MR7 A;  4ETZ A;  2QO3 A;  5KFO A;  2FVP A;  5BXI A;  1CC8 A;  1CEZ A;  4K4Z A;  4KT0 C;  1SQE A;  4GO5 X;  5DQI A;  3CED A;  1H7W A;  1CSJ A;  3JYT B;  5AXN A;  4CLT A;  3HJF A;  1SC6 A;  3HFK A;  3QZ7 A;  2W01 A;  1J5E F;  3GP9 A;  2VFR A;  1NUE A;  1RZM A;  5F8J A;  3FK4 A;  2P9C A;  3GR1 A;  2Y8W A;  2FJB B;  1PJ5 A;  4DR6 F;  2OFH X;  3LP2 B;  4I0W A;  1TEL A;  3NXZ A;  1YDL A;  2AZ1 A;  1W7W A;  2OLW A;  1N36 F;  1RT4 A;  2J0Q D;  4RU2 A;  4OHY A;  2DHA A;  2WOM A;  4ZVO B;  4CWB A;  4X66 J;  3KLH A;  1XMO F;  5KG7 A;  1VJQ A;  3QZ8 A;  2RQK A;  4J5O A;  3VAG A;  5BYR A;  1HQE A;  1FJG F;  1L3K A;  2P6S A;  1GMW D;  1YIT S;  1JXL A;  4PXC A;  3JSM B;  5JUM A;  1ZET A;  3CCL S;  4UZC A;  3W65 A;  4LRF A;  3I9Z A;  5KFD A;  5C25 B;  4CLZ A;  3ILO A;  3ETO A;  1FXD A;  3N9U C;  1R6V A;  4LRA A;  2FUG 9;  2HRT A;  1QE1 B;  4OI0 A;  2HYI B;  1HNZ J;  1R0A A;  4D3H A;  3OSN A;  3M8Q A;  4WWS A;  1XR7 A;  3SIP B;  3EZ5 A;  4DPT A;  4F4Z A;  3SQO P;  3AQP A;  1NK9 A;  2HFU A;  1OQ3 A;  3LW5 C;  4DCO B;  1OY6 A;  3I55 S;  1PBA A;  4UY8 T;  5D78 A;  1D9F A;  1DJ0 A;  4RW9 B;  3QPI A;  2DNQ A;  3VGV A;  3JAM Y;  2YNG B;  2UUW A;  2UP1 A;  3I0R A;  2IVY A;  3MTK A;  2CJA A;  3T6B A;  2C2O B;  1AT1 B;  1XTZ A;  3X3U A;  4U8V A;  2FPH X;  4LSN A;  2W25 A;  2CQB A;  2RQM A;  4OJ1 A;  4W4M A;  2KT5 A;  2KN4 A;  3IWN C;  2UUB J;  5IWA J;  4CO5 A;  3HMJ G;  4NA3 A;  1AYE A;  5C24 B;  3UCZ P;  2V5H G;  4ID5 A;  3AOB A;  1B4S A;  2Q1L A;  5C2C A;  2YBV A;  2BE2 A;  1FES A;  4XDD A;  2HG4 A;  5C42 A;  3GII A;  2DBB A;  1G3O A;  1MMN A;  3CJQ A;  2DKO B;  4U8Y A;  3MEG B;  3D67 A;  2KM8 C;  1M1H A;  1IKV B;  2D9P A;  1FWL A;  1NXI A;  3ZNU A;  2AEM A;  4PKD B;  1P1L A;  3QO9 A;  2HK3 A;  2VB6 A;  1FXR A;  1MN7 A;  1LEO A;  2DNY A;  4EZ6 A;  4DL6 A;  2DRA A;  2H48 B;  2E5G A;  3QT7 A;  4USJ C;  1SIZ A;  2P2C B;  4NWB A;  2FLN A;  4ED2 A;  1KFS A;  4C11 B;  3M2R B;  1J2V A;  3HO1 A;  1S0O A;  2WVC A;  3SV3 A;  4JI5 J;  1YSJ A;  1X5O A;  1N4L A;  2AW0 A;  1I94 J;  2QLW A;  4OI2 A;  2J0W A;  1ZYQ A;  1M5S A;  4A8F A;  2HWH A;  3C14 B;  3H8Y A;  4B3R J;  2CPZ A;  3D0I E;  2QTW A;  4PWU A;  5B0C A;  4XPC A;  1LW2 B;  3FJ2 A;  3A3N B;  2ZH9 A;  1N6Q B;  5E41 A;  3K5L A;  1TV6 B;  1UW4 A;  4QU7 A;  2IJF A;  4HH1 A;  4ZHR A;  3KHL A;  1KVI A;  1RAH B;  3SSQ A;  3IG1 A;  3OHA A;  4PYA A;  2CNO B;  4DUY J;  3KLE B;  1REG X;  4M5M A;  3QQC D;  3K57 A;  4I2Q B;  3DCA A;  5KG2 A;  1S9E B;  3BR9 A;  1RAE B;  2W2O P;  1KLM B;  4YEA A;  4M5I A;  2IM3 A;  4OX7 A;  4Q5V A;  3MM6 A;  3HVT A;  4PR6 A;  4DR2 J;  1JLA B;  2MLY A;  1EP4 A;  3I4H X;  1LWE B;  1RCO B;  1TL5 A;  4DL3 A;  3KLV A;  2V8G A;  2V63 A;  4MK9 A;  4DL4 A;  3AB4 B;  4C3L A;  4A8W A;  1ICE B;  3U1L A;  4R5P A;  1UEK A;  2ZH4 A;  3J7A 1;  2APO A;  4RW6 A;  1U7L A;  4ZVG A;  2F9D A;  1X0P A;  2DGW A;  2P9G A;  3E8O A;  1NU4 A;  4N8N A;  2LA4 A;  5DDQ C;  1VBY A;  4PXB A;  3MR6 A;  5T7L B;  3S7R A;  3PRB A;  3CJS A;  4M5D A;  4LRE A;  3HHL C;  2W8K A;  4QYZ J;  2DR7 A;  4LF1 A;  2QEX S;  2WHO A;  2BR0 A;  3LTO A;  2X1A A;  4RW7 A;  1N5Y A;  1VK8 A;  4QPT A;  2HK2 A;  4NLP A;  4GMK A;  1U26 A;  3OTC A;  2IM0 A;  3MEC B;  2KH9 A;  1Y3J A;  1KVK A;  3BB5 A;  3F44 A;  2ZH5 A;  3B82 A;  2DO4 A;  4Y3C A;  5LL6 d;  4J9R A;  1D09 B;  2W2P P;  3MD3 A;  1HBO B;  2CJQ A;  2YWF A;  3FQL A;  4QW9 A;  4Y2I A;  2GV1 A;  4ES1 A;  4C8N A;  2G0C A;  3UE2 A;  2HNZ A;  3PO4 A;  3VAJ A;  2JH3 A;  3HCX A;  1VDH A;  3PO5 A;  4YP3 A;  2OPR B;  3D4J A;  2R7S A;  3BGR B;  1S4E A;  3KLI A;  2ZDP A;  4DV3 F;  3NL0 A;  1M90 T;  4WII A;  2ROP A;  4LVN P;  5L1J A;  3TOQ A;  3RAQ A;  4CM0 A;  5ETQ A;  4ED7 A;  2XSF A;  4NLW A;  2EK6 A;  4FYX B;  2PGC A;  4JI4 J;  2UXD F;  3R7B B;  3PV8 A;  2R7X A;  3WHI A;  2G0J A;  3TO8 A;  2AGQ A;  2G1D A;  1JKH B;  3KDO A;  2YKM A;  5KT3 A;  1SIW B;  4IG3 B;  3W8G A;  1F3F A;  2GIR A;  2EVZ A;  3IS9 A;  4URG A;  2BM0 A;  3MMC B;  1AXQ A;  3QBC A;  4HHJ A;  4O0N A;  1VIS A;  2F63 A;  3NEK A;  5G0R B;  2M2B A;  1KTV A;  4ECU A;  2GVZ B;  5GAE U;  3M6W A;  2JFD A;  4CLS A;  4UOG A;  1N52 B;  1XJW B;  3H5U A;  2VG5 A;  3HDS A;  2DH9 A;  3Q2S C;  1S1W B;  4I2P B;  5CHC B;  4RBT A;  5KFP A;  5KT7 A;  5GAD I;  1NO8 A;  3PFO A;  1XR5 A;  3TEG A;  1FER A;  1WKJ A;  4J9S A;  3K59 A;  2O67 A;  1KNZ A;  5J2P B;  3VAL A;  2EFV A;  2HMI A;  1DLO A;  3M30 A;  3MCM A;  2MEW A;  2ZUA A;  3GIL A;  1RHM B;  2RDJ A;  5HLF A;  3IBC B;  5CYQ A;  1C4A A;  1RE1 B;  1KP6 A;  2W4C A;  3M32 A;  4X66 F;  4WFZ A;  5LMN J;  4DV5 J;  4ECR A;  4AL5 A;  5MAO A;  4UUW A;  4OYA A;  2RDI A;  2CQD A;  3ENQ A;  4LUB A;  5ETN A;  3BKF A;  1UWB B;  4LBH A;  3KNA A;  5KFV A;  5JMN A;  4F4W A;  2B0G A;  4M94 A;  1OQ6 A;  3HSD A;  3NBP B;  5KFA A;  4PG7 A;  4LSL B;  3G71 S;  2PN6 A;  1RSC A;  3C2P A;  2XY5 A;  2VUG A;  3QLH B;  2D3U A;  4NE9 C;  1Q8L A;  2MLX A;  2MKH A;  1IBK J;  1HNZ F;  2VFS A;  3I5B A;  2R2T A;  2CNK B;  4TLR A;  2ABY A;  5KAK A;  2C2N A;  2HQI A;  1SJ3 P;  3A8K A;  2Z30 B;  4IR9 A;  2R8I A;  4E2F B;  2CUY A;  1RHQ B;  1CJV B;  2ZH1 A;  3PW7 A;  2LXI A;  3GSI A;  4OX9 J;  1U1O A;  4Y0F A;  2VFU A;  4F3O A;  5IOL A;  3OXG A;  1Z2L A;  1SJQ A;  3DHX A;  4TY9 A;  1U0H B;  2NSC A;  4OI1 A;  3OT9 A;  2CAD A;  1K9M T;  3U02 A;  4ED1 A;  3IM9 A;  2YQ0 A;  1R6Y A;  4CM2 A;  2C42 A;  2KYZ A;  3E51 A;  2VFT A;  2UUB F;  4YDX A;  4K4U A;  1ITP A;  8AT1 B;  3M9M B;  4YDD B;  1HI8 A;  3PVX A;  1MML A;  4IG0 A;  4NZ7 A;  1GAO A;  1U09 A;  4R25 A;  1JJH A;  1JLC A;  3RTV A;  4YFU A;  4ZVQ B;  4KAI A;  1RTH B;  4CLK A;  4A8Y A;  3KK2 A;  1F60 B;  1H2V Z;  4WZM A;  4ALZ A;  3DRS B;  4OFZ A;  5DLG A;  2IRX A;  3KWM A;  4OZ3 A;  1DFD A;  2IC3 A;  2VBZ A;  4KBI A;  4B9V A;  5IM0 B;  3T41 A;  4J7C A;  3U1M A;  4RL1 A;  5ETS A;  2Q79 A;  1SC1 B;  4KC5 A;  1M5V C;  4ZOS A;  4K59 A;  1JJC B;  3DGP B;  4NXM F;  1FWK A;  3SBM A;  5CH7 B;  5J1E B;  1DHM A;  3GFY A;  1M0S A;  2CJ9 A;  4HDG A;  1I94 F;  2H65 B;  3VGT A;  1S72 S;  1R0C B;  1UA1 A;  2PSZ A;  5D4L A;  3I32 A;  2XWY A;  4IFY A;  4CTA B;  1VQ5 S;  3SYZ A;  3BN4 A;  5F41 A;  5FD1 A;  3MMB B;  4MK7 A;  4RUC A;  2L9D A;  3GV8 B;  3W2V B;  1RU2 A;  4RU9 A;  2LEA A;  3HP6 A;  2QIF A;  5BYS A;  4KJI A;  1EQ0 A;  4CI0 B;  1FJ7 A;  2MY8 A;  3W63 A;  5B0F A;  4EK2 A;  4J91 A;  1HA1 A;  3CJ0 A;  2XMK A;  2XYP B;  1REV B;  3BQ0 A;  4OV1 A;  3M8P B;  4DR4 F;  4W98 A;  3CVK A;  4XPE A;  3Q8R B;  4ECT A;  2D9O A;  4DR2 F;  1YTY A;  2VPW B;  3CMA S;  5K8O A;  3QNW B;  4RW4 B;  3NS6 A;  5K8N A;  4RWW A;  4GKJ F;  5KFH A;  1RT3 B;  2CA9 A;  1KQG B;  4ZJL A;  1X31 C;  3J81 U;  1BWV A;  4GVB A;  4N77 A;  4M5G A;  3OTE A;  2OPS A;  2WVD A;  2KT2 A;  2RIJ A;  4CH0 S;  3M9N B;  2CPE A;  2ZZT A;  4RO0 A;  1TL7 B;  2C2M B;  4F4K A;  1RK8 A;  3PZP A;  3GIJ A;  3LOU A;  5B0B A;  5EWE A;  3A4T A;  4DU8 A;  4OYZ A;  5RUB A;  4TNO A;  2AD9 A;  1UVL A;  4C8O A;  1HBU B;  3MXH P;  5HSP A;  2IAJ B;  4B3T F;  3QWU A;  2V6A A;  4H4O A;  1ELO A;  2BMB A;  4L72 B;  1MG7 A;  2A18 A;  3I87 A;  3CDU A;  4H4M A;  2XLI A;  1S1T B;  4USW A;  2EEY A;  1NKB A;  1IR0 A;  3EWG A;  5GVQ A;  1GX6 A;  4B3S J;  4V19 X;  3TA0 A;  2BKP A;  3Q8U A;  4WXO A;  1HL6 A;  1FKA F;  2BZ2 A;  1RWN B;  3MAA B;  4U96 A;  1S9G B;  2HLT A;  3NS7 B;  1RT7 A;  3Q22 A;  2E7V A;  1CLF A;  1BMQ B;  3SDE B;  1DUR A;  4BCA A;  2LQ8 A;  1AUS L;  4FN5 A;  3MM9 A;  4A8S A;  4DSL A;  5H9F J;  2HW3 A;  4IYQ A;  3G96 A;  5IT4 A;  3WZ0 A;  5J1P A;  1N48 A;  2Z0G A;  3R7N B;  3BQ1 A;  2AJ1 A;  1TQL A;  1TL1 B;  4A8O A;  2GJI A;  1SJF A;  4JI4 F;  4DV0 J;  2B8P A;  5HO4 A;  3RR7 A;  1QSY A;  5DQH A;  2OJ3 A;  1BE4 A;  2LYV A;  4LRD A;  3BPS P;  3MD1 A;  2YWG A;  2XUL A;  3UVJ B;  2AX1 A;  4N56 A;  4OZ1 A;  1HWJ A;  1ZBT A;  2A6M A;  4DUT A;  1RAC B;  1SXL A;  4EMD A;  2VH7 A;  3PNI A;  3T9Z A;  4FF3 A;  2CWX A;  1NHK L;  1HBM A;  1TAQ A;  4RW8 B;  4DHV A;  3CCQ S;  3H5S A;  3Q0A A;  5ETO A;  1VIX A;  2QX0 A;  2RT3 A;  2A2D A;  3R5G A;  4OV6 A;  3RUB L;  3ULH A;  4F36 A;  1GH8 A;  5AJ3 J;  4JI1 J;  3IRX B;  3RAX A;  4J9P A;  2DPJ A;  1Z2Z A;  1X5P A;  1H74 A;  4QYR A;  1U6Z A;  4ECZ A;  3TVK A;  1URN A;  1CS4 A;  2UU9 J;  1KTQ A;  1XNR J;  2XO6 A;  3MM7 B;  5KFJ A;  3MPW A;  1Q78 A;  2V2K A;  3OVS A;  2V2Z A;  1HAR A;  2Q3P A;  1CC7 A;  4NLS A;  4NL5 A;  2FJE B;  5LMN F;  2CJK A;  4DV5 F;  3AD8 C;  4KV8 B;  1XQI A;  1UET A;  1HKA A;  4C48 A;  2B9X A;  2GGP B;  5LXY A;  1VRT B;  4KIA A;  4I7F B;  4KO0 A;  1RHK B;  4IDK A;  2LA6 A;  4OZN A;  2X51 A;  2QA4 S;  1C1C A;  1N5S A;  5AXL A;  4UOH A;  5HJY A;  4PRF A;  3MOZ A;  4KQZ A;  1UVI A;  1X60 A;  2ZE2 A;  3OLA A;  2DGV A;  1JLQ A;  3DRR B;  3CJ5 A;  4YY3 J;  3CC2 S;  2LKZ A;  1J27 A;  1AFJ A;  1NK6 A;  1HNI A;  1BXN A;  3MHY A;  3HZE A;  2CYY A;  9ATC B;  2VHG A;  2AX0 A;  1SV5 B;  2IM2 A;  2B6A A;  1YBU A;  2VV5 A;  3ENV A;  5SZT A;  2RRN A;  1X4F A;  2UV8 A;  3A3P B;  1NH8 A;  1T03 B;  1XWL A;  8RUC A;  2H5J B;  1OIA A;  4G6V B;  3JYT A;  2UUC F;  4ZKA A;  3R3T A;  4I56 A;  5F8H A;  5KG4 A;  1YJN S;  1CJU A;  1U49 A;  1M5P C;  5L46 A;  3LP2 A;  2CQH A;  3J80 Y;  3DYA B;  2FHJ D;  4OJG A;  1TKZ A;  5GAH U;  4YQW A;  2ADC A;  4USU A;  5THW A;  1TZ0 A;  5EHH A;  1R8A A;  2W2N P;  1RWP B;  3L9Z A;  1NRK A;  3ZTP A;  3T19 A;  4LF8 F;  2C2E A;  1JLG B;  4I6W A;  1HI1 A;  4C97 A;  3LP0 B;  5J1N A;  4Y28 C;  4LF4 F;  3TAP A;  2WSF C;  3S6E A;  2K7J A;  4DWI A;  1NB2 A;  2F7V A;  2ZH7 A;  2HFO A;  3QFH A;  4LJM A;  4LT6 A;  2XC9 A;  3JSM A;  4WFB Q;  4PG8 A;  3P45 B;  3V6J A;  2IBK A;  5K5M A;  2YWH A;  4B17 A;  4ED6 A;  4RNO A;  2HSE B;  4G1Q A;  5C25 A;  4JV0 A;  5K8P A;  3D68 A;  1EHW A;  4A8K A;  4ZIW A;  4MKV A;  4I1T A;  5B0D A;  2V69 A;  4OZL A;  1QE1 A;  3JSB A;  1NB7 A;  1MU2 B;  3KK1 A;  4KFB A;  4ZN1 A;  3CUN A;  2CZ9 A;  2Q66 A;  4EYH B;  5JVH Q;  3OV7 A;  1YJV A;  4CLF A;  2JC1 A;  2YKQ A;  5IZH A;  2ZBI A;  2PMW A;  1N0U A;  5GME A;  2CDR B;  4RW9 A;  2O3D A;  1NJW A;  4C6A A;  2DNH A;  2CQ4 A;  1B0V A;  1F5C A;  2YNG A;  2AV5 A;  2KM8 B;  2A6O A;  1RHR B;  3H42 A;  1ZAW A;  3PIO Q;  1QVF R;  3GWC A;  2CQ1 A;  2X1B A;  4ZCK A;  4AE5 A;  2YH0 A;  2W9C B;  4RBV A;  2ACY A;  1VQ4 S;  3MFI A;  3BH7 B;  3CJK B;  3KKF A;  1LWC B;  3PYE A;  2HVE A;  5IT9 U;  1JNZ B;  1U8S A;  5C24 A;  3AQO A;  4QWD A;  1XIQ A;  2JEG A;  2XLJ A;  4EUV A;  1IVZ A;  4HHU A;  2B4P A;  1WEX A;  4MKA A;  4C98 A;  1RA7 A;  3UDL A;  1W25 A;  4OJ3 A;  1U45 A;  1HWU A;  2I6W A;  1IKV A;  1KDN A;  3UO0 A;  2Y0B B;  5E0O A;  1TKD A;  3GPA A;  3H90 A;  3H4B A;  3H5X A;  4X4P A;  2E5L J;  3QJL A;  5I42 B;  4WE1 A;  1LV5 A;  3V2U C;  1CQM A;  2VBY A;  3OUY B;  1VQ8 S;  1EJ7 L;  3MR5 A;  3BBC A;  4EBE A;  5IXU A;  1UP1 A;  2EFN A;  2GMH A;  5D4P A;  4C11 A;  2OTJ S;  2BQU A;  4AFF A;  4CT8 A;  3IBF B;  4RUA A;  1DQ8 A;  3EIC A;  4OQJ A;  4C3M A;  5HP1 B;  4TYB A;  2DIT A;  3OR2 B;  4ZVS B;  1P9Q C;  4B3S F;  3RG6 A;  2WBR A;  1QSL A;  5KFM A;  5D6G A;  4RNN A;  3CWJ A;  4FNI A;  3QSY B;  3HHL D;  1IM4 A;  4P10 A;  4O3S A;  3NGR A;  5F3T A;  3L3C A;  1S48 A;  1JLF B;  2UZA A;  2VJU A;  1N6Q A;  1TUW A;  3CDA A;  4EO6 A;  1FKP B;  2IM1 A;  1TV6 A;  3UNG C;  3UCG A;  3MUR P;  2VG6 B;  3KLE A;  3QGG A;  3CCS S;  2BJ8 A;  1S9E A;  3P5B P;  1KLM A;  4LF2 A;  4CH7 A;  5DM6 Q;  2OPP A;  3LUY A;  2MZT A;  2YXL A;  1SKS A;  4QWA A;  1HMV B;  3HHL B;  1JLA A;  1WC3 A;  1FRX A;  4DV2 J;  3EGW B;  3N01 A;  1LWE A;  2XNQ A;  4F2R A;  4DV0 F;  1R8P A;  5AT1 B;  1N33 F;  4DQS A;  3GJR B;  2HWT A;  4F8R A;  4TVA B;  2ZM6 J;  2H1Y A;  3SQG B;  1O5J A;  1RAD B;  2FLO A;  1S6P B;  1QSS A;  3PIP Q;  3H2V E;  5J2Q B;  1NSP A;  2KDO A;  2NCK L;  1WTF A;  4L73 A;  2VF3 A;  2QSW A;  2BA9 A;  4E98 A;  3VAM A;  2XYH B;  1H2U X;  2ZOG A;  1M1G A;  4HT7 A;  2BJ1 A;  2AYE A;  2H5E A;  3CJ8 A;  1QAJ A;  1VGY A;  1XNQ F;  2XLK A;  5AJ3 F;  2ZZM A;  2MPU A;  1RGV A;  4YB1 P;  2C2Z B;  2I1R A;  5CAA A;  2YX7 A;  2Z2L A;  4L3N A;  1S10 A;  1T9Y A;  5ETP A;  3TYT A;  3MAH A;  4EBC A;  1FRI A;  3MEC A;  2NPI A;  2YNH B;  2UU9 F;  3DGV A;  1MRO B;  1T3N A;  1N5Q A;  1H98 A;  4ZLP A;  1QVG R;  2YWK A;  4O4G B;  1NME B;  1S4F A;  1HBO A;  2UXC J;  3DMJ B;  3F0N A;  1RT2 B;  2K8G A;  2YWE A;  1FFS B;  2BJE A;  3SV4 A;  2XTJ P;  1Y5N B;  1SKU B;  3KJF B;  2JDJ A;  4LFC J;  2XM3 A;  1P6T A;  2Y1L B;  1LOU A;  3CE8 A;  1R8C A;  2OPR A;  3VZH A;  4NCA A;  2F5G A;  2KXH A;  3UDV A;  2OEL A;  3K5N A;  4NZ0 A;  2B7C B;  3R2D J;  4QWE A;  5DG8 A;  3BDP A;  1GXT A;  5FII A;  4X4V A;  2I8E A;  3OXL A;  3H0P A;  4W90 B;  2B8Q A;  4YY3 F;  2VKZ G;  2ASD A;  4YOE A;  2I9S A;  3CDW A;  3CCV S;  3W60 A;  4NLY A;  1JKH A;  2ZC4 A;  5HAT A;  2VOO A;  1FI4 A;  2PO4 A;  3KLF A;  5DO2 A;  2BE9 B;  1TK0 A;  1R43 A;  4IG3 A;  2Z2Z A;  3RB3 A;  5F9N A;  2R2R A;  2ZC3 A;  3DLG B;  5KFX A;  1T94 A;  2FJA B;  5E3C A;  5IC6 B;  5G0R A;  2NXC A;  2MHN A;  1TK5 A;  3MED A;  3I6P A;  4N76 A;  1WDT A;  2GVZ A;  4R8U B;  2BOP A;  1B3T A;  4QCL A;  3IA0 A;  1YBT A;  3PR4 A;  1S1W A;  4I2P A;  3DHW C;  2N3O A;  3OQ2 A;  2DNM A;  3MEK A;  4O4R A;  2ZNY A;  3EUN A;  4JV5 J;  4HI2 A;  4TU9 A;  1FCA A;  3R5J B;  2G2O A;  2EBE A;  3N6M A;  5J2P A;  1KR4 A;  4OYO A;  2MGZ A;  2A0F B;  2YX4 A;  3W2W B;  3UCU P;  4JI6 J;  3G82 B;  4WYW A;  3H2L A;  5A8R B;  1U1L A;  2ATL A;  3CC4 S;  2Z2Y B;  3VGS A;  2FHK A;  3HKW A;  2HHU A;  1UFW A;  1RT5 A;  2YNI B;  1RBL A;  2V8D A;  2XMA A;  3GLJ A;  1NPP A;  2E1C A;  5A2Q Y;  3FNN A;  1U0S A;  2ZKT A;  1JJ2 R;  3NBP A;  1SH2 A;  1C0U A;  1AFI A;  5HQM A;  1X8D A;  2HBY B;  4DS5 A;  2Z8Q A;  1H73 A;  3QLH A;  3OW2 R;  2HEK A;  2HNY B;  4JYA F;  3DLL Q;  2BV3 A;  5KFC A;  2FJD B;  4YS2 A;  4AD6 A;  4O44 A;  3D1H A;  4ER8 A;  3ITH B;  3T5K A;  2MMY A;  1U4B A;  1EET A;  1FNO A;  4TQR A;  4K4T A;  1SL2 A;  5KFZ A;  4USV A;  3KJV B;  1NDL A;  2WK4 A;  1X5S A;  5J2M B;  4K4W A;  2X3D A;  1T95 A;  1TKT B;  2ILZ A;  5D15 A;  3OR1 B;  1CJV A;  4DV1 J;  1NDP A;  3LGM A;  4BS2 A;  3O44 A;  4DI6 A;  4DSF A;  1T8E A;  1RT6 A;  3C6U A;  4DUZ J;  1K0V A;  1FVQ A;  5B08 A;  2P6T A;  3GTY X;  3B54 A;  3G87 A;  1GNK A;  1U0H A;  3ZZT A;  1U1N A;  2GO9 A;  4DSK A;  4WK1 A;  2DXF A;  4RLE A;  4ZPV R;  2WCX A;  3DLJ A;  3EPG A;  5D0R A;  3F41 A;  2XMJ A;  5GAE I;  2M5Y A;  1I3O B;  4YB6 A;  1FXL A;  2ZNZ A;  3T1H J;  1A9N B;  2Q43 A;  3ZTO A;  4J90 A;  1WI8 A;  3TA2 A;  5DG9 A;  1RTH A;  3KMQ A;  2CG4 A;  3H98 A;  2PEB A;  3ZZP A;  3DRS A;  3Q8Y A;  3A3O B;  2FLP A;  4ELU A;  2D69 A;  4C8Z A;  1I5O B;  3UD5 A;  1IQZ A;  2HND B;  2E5L F;  4ZCM A;  2DH7 A;  4YB5 A;  2WRM A;  4OJH A;  5IM0 A;  4OYP A;  4KHR A;  3UD3 P;  4QWB A;  2J5A A;  4I69 A;  3D9B A;  1DTQ B;  3I9V 9;  4NYZ A;  3GYN A;  4MIW A;  1UFK A;  2KT3 A;  2KVQ E;  3DGP A;  3M1V B;  3QRP A;  2QYC A;  3FSX A;  2DEI A;  4P2S A;  3LP1 B;  1Q53 A;  4LBP A;  5D0E A;  4ANC A;  1XN9 A;  5A6W A;  2ASJ A;  1LXJ A;  3BO4 A;  1KQS R;  1BWE A;  4ECX A;  3JTN A;  4ZDN A;  3TVY A;  3QID A;  2DVI A;  1TFW A;  2OEM A;  3BN7 A;  2ZBC A;  4ZP6 A;  3LGN A;  3NOC A;  4JI3 J;  3D6M B;  3MMB A;  1WC1 A;  4Y2C A;  5DET A;  3DU6 A;  1N56 A;  2C3M A;  3CIM A;  5K9F A;  1KOO A;  2RE1 A;  2NR0 A;  3Q86 A;  1RUS A;  3LAM A;  4DLE A;  1REV A;  2Y1J A;  3KTQ A;  6FDR A;  5HMW A;  2ZBQ A;  2W2Q P;  2YY3 A;  1RWW B;  4RPF A;  3NNH A;  2QL9 B;  3UD4 P;  4OI4 A;  2O1P A;  1U1Q A;  1U2R A;  1FRM A;  4LF6 J;  4ELT A;  5HBM B;  3G8T A;  1WSR A;  3MPV A;  1Y00 A;  1UJ4 A;  2WON B;  1PGZ A;  1GK8 A;  1WEL A;  2NXJ A;  2DRD A;  2LDI A;  1S6U A;  1TL7 A;  2HHS A;  2DTJ A;  4QOT A;  3PJX A;  1T05 B;  4B02 A;  5ETR A;  2EC0 A;  2HFN A;  7AT1 B;  1U1M A;  1ZM2 A;  2W1B A;  1HBU A;  3E01 A;  2M0G B;  4DR7 J;  3VV2 B;  4CP5 A;  1NLK L;  3LWM A;  4JV1 A;  3D0H E;  2LFV A;  3PW4 A;  2RS2 A;  2XS7 A;  4G1P A;  3K8V A;  1S1T A;  1F9E B;  2ZWO A;  4DV4 F;  1D8Z A;  2DXE A;  4B3O B;  1NBE B;  3GIR A;  3O5T B;  3D3B J;  5IT0 A;  4ES3 A;  3R1L A;  4YHH F;  3FRZ A;  5K20 B;  4A48 A;  3CSK A;  1T02 A;  3D6F B;  4DR5 J;  4N8O A;  1S9G A;  1SUQ B;  1WHV A;  2J6S A;  2F65 A;  1CUL B;  3H2U B;  1HNW J;  1V3Z A;  1NH7 A;  4M5J A;  1UPP A;  2HHP A;  3UFC X;  1XC9 A;  1JMT A;  3VTI A;  3SDE A;  4NLR A;  4CLY A;  3FSY A;  3OSP A;  3FRY A;  3T9N A;  4DX6 A;  3PTW A;  4MJK A;  2XI2 A;  4Y00 A;  4FF1 A;  4EWT A;  2C3U A;  1JLB A;  1NPK A;  3MPD A;  3CCJ S;  5B0E A;  3KK3 B;  3UR3 C;  4P71 A;  4BC9 A;  1Y5L B;  3Q8P B;  2LP4 A;  1TK8 A;  3KLG A;  4ZPB A;  1HWI A;  3G8Q A;  3KMS A;  2J9D E;  3PYF A;  1RLC L;  1TL1 A;  3PHE A;  4C8M A;  1UFL A;  3TAM B;  3TNV A;  4GVL A;  1ZPW X;  4UQT A;  2E9R X;  3PM9 A;  3GFZ A;  4FKX A;  2GJF A;  4N7T A;  2E1R A;  3R6L B;  1M5H A;  3KG0 A;  3R97 A;  1HWL A;  4X84 A;  3TZW A;  2QLJ B;  3DM2 B;  4BBY A;  5B0A A;  3I56 S;  2DJW A;  5KFR A;  1O8B A;  4DR3 F;  2PMH A;  4IFV A;  3DOK A;  3AH6 A;  3ZTR A;  2KFN A;  2DNO A;  3Q8S B;  4ILM A;  4RW8 A;  2DD8 S;  2KB2 A;  5D77 A;  2DGS A;  5M2R A;  2UVV A;  4KKO B;  4GC7 A;  3D7S B;  1KWM A;  2C3Y A;  3TUP A;  2IJN A;  3MTJ A;  4JV5 F;  1WNE A;  3NGT A;  3GSD A;  3R5B A;  4CNY A;  4M5H A;  2R8K A;  4JI6 F;  2V94 A;  3D0G E;  3MOJ B;  3K5P A;  1ZM3 A;  2OSR A;  4CO1 A;  1TUV A;  4DX8 H;  5E33 A;  4NA2 A;  3CUL A;  4HHH A;  3TWZ A;  1HQU B;  2KXN B;  2LVW A;  2YKA A;  2OO4 A;  1UEV A;  3SSR A;  2VQE F;  2MLZ A;  4KV8 A;  4KGZ B;  3RZA A;  2F3J A;  2HAF A;  3IO1 A;  4BC7 A;  1N34 J;  3HK2 A;  3KHG A;  4KE5 A;  2V8H A;  4J9O A;  2GGP A;  3ISZ A;  1PJ6 A;  1U47 A;  4I7F A;  3CO0 P;  5F8M A;  2YKO A;  4TU8 A;  2RUS A;  4Y2K A;  1B7Y B;  4QR1 A;  2VA2 A;  1YRT A;  2ZDO A;  2WW8 A;  2N4D A;  3DRR A;  2YH1 A;  3MM8 B;  2HFV A;  1Q82 T;  2YQ1 A;  2L9W A;  4U6P A;  4QU6 A;  1IR1 A;  4PUO B;  1LWF A;  1DZ5 A;  4FKY A;  2K1R B;  2MQL A;  3VAK A;  1RT1 B;  2JEF A;  4AQY J;  2CXE A;  3D1O A;  1S76 D;  4J9K A;  1YRU A;  1RBA A;  1SV5 A;  1WOP A;  2QA4 G;  4J9L A;  2IJR A;  4DV1 F;  2JLG A;  1Z1Z A;  3W9I A;  1UTA A;  4CYU A;  1AUD A;  1ZA2 B;  6FD1 A;  5LSO A;  3AXM A;  4AYB D;  4A8X A;  2N7C A;  3FCH A;  1Y0H A;  3CCT A;  3AD7 C;  4DFM A;  4KH0 B;  3AB2 B;  1UA0 A;  5KT4 A;  1RA6 A;  1GMU A;  2NPF A;  2EPI A;  1H72 C;  3HFZ B;  2G9O A;  1ZPV A;  5KFB A;  5E3Q A;  4DL5 A;  1N5T A;  2AGO A;  3W5Y A;  2VOD A;  2FD2 A;  1VBZ A;  4CQ1 A;  4F67 A;  3T1H F;  3TQ1 A;  5J2N A;  1VCT A;  4BWM A;  5AXK A;  1FTC A;  2D3Z A;  3T1Y J;  5GMD A;  1MNE A;  4URQ U;  2WOM B;  2IVF B;  4WZQ A;  2RSQ A;  3C66 A;  3KLH B;  3T5J A;  2DRB A;  1X4C A;  1VJW A;  1RAI B;  2DIU A;  1HQE B;  3PDN A;  4OZ2 A;  3GV5 B;  4ELV A;  3DFE A;  5A76 A;  4U67 Q;  3ISN C;  1OY8 A;  2H4Y B;  3QGI A;  2J0X A;  1PAE X;  5DDP C;  3NLC A;  4WTO B;  1MU2 A;  2EWH A;  2BRK A;  3CIZ A;  5KFI A;  1T9X A;  1L5U A;  3HPO A;  2M88 A;  3VVU A;  3GU0 A;  3HVW A;  4XAK A;  1R0A B;  1YX2 A;  3J7Z 5;  5F0U A;  4JI3 F;  2NS1 B;  4LQ3 A;  2MQM A;  2LQ9 A;  2HVD A;  2ZEJ A;  2ZJR Q;  4K0K J;  4O3Q A;  3BGL A;  3KG1 A;  2NSB A;  4ECQ A;  3PAC A;  2V2V A;  2E1M C;  3K0J A;  4DZ6 A;  4DF8 A;  2WVB A;  2DGU A;  1VK3 A;  1IM6 A;  3FMB A;  2GA7 A;  1LKZ A;  3CJK A;  3I0R B;  4DPU A;  1LWC A;  3O8W A;  3RBX A;  5A0Y B;  2MQQ A;  1WJ9 A;  2FHO B;  4IOA Q;  2FHM A;  4KGV B;  1RKJ A;  3CCE S;  1XER A;  3I82 A;  2KFY A;  2N7Y A;  4LF6 F;  3RW7 A;  2EW9 A;  3GZ7 A;  3G86 A;  1B64 A;  3MPU B;  5L1L A;  3EVM A;  4ID5 B;  1C0T A;  5LOQ A;  2MQN A;  4FDF A;  2KZZ A;  3BQ2 A;  4ZLJ A;  2G2Y A;  4WKR A;  1M1K T;  2MY7 A;  1WAC A;  2PC6 A;  5L8R C;  5I42 A;  3Q24 A;  4ILR A;  3EVW A;  1SH3 A;  4TY8 A;  1FDN A;  5A8W A;  5KT5 A;  2QJ3 A;  1ZAV A;  1P9Y A;  4PXE A;  2XB2 D;  1VLY A;  3U27 A;  3TZY A;  2QV6 A;  2QMW A;  4WF9 Q;  3EE3 A;  1WHW A;  3FDS A;  3OL7 A;  4CH1 A;  3OTO J;  4LSZ B;  3VVT A;  2BM1 A;  1K1S A;  2AGP A;  3D2W A;  1T9V A;  2HQG A;  2K06 A;  4HTI A;  5HP1 A;  3NP5 A;  3MAQ A;  3OR2 A;  2OMO A;  3ZC4 A;  1S59 A;  2MTL A;  1QJH A;  3BH6 B;  2B4V A;  1EAY C;  1YJ7 A;  5E3A A;  1JLF A;  3M6X A;  3SI8 A;  3QJP A;  1UEU A;  4B9T A;  2R4F A;  3RW6 A;  1FKP A;  1HNW F;  1NJY A;  3PEJ A;  5HVG A;  2QC3 A;  1FO1 A;  3IWL A;  2VG7 A;  4JI7 J;  4R0E A;  3CTR A;  5CQG A;  1SL0 A;  4HH0 A;  1N0V C;  1UMJ A;  4NOH A;  2JJ4 D;  2JLF A;  1RTJ B;  3QGH A;  3HHL A;  3NGS A;  1U2C A;  2BDP A;  1PYO B;  4OX6 A;  5HVH A;  1IWG A;  1BLU A;  3G6Y A;  1KEK A;  2AJF E;  1MMD A;  2IVM A;  4ILL A;  3HVT B;  1MW7 A;  2FY8 A;  4O0I A;  1OSD A;  1NSK L;  4LRB A;  3V4M A;  1SI9 A;  3O3L A;  2ZJQ Q;  5LMU J;  4H4K C;  3SQG A;  4JUZ A;  3QGP A;  1S6P A;  5IFM A;  1RTZ A;  2LMI A;  2KU7 A;  2O01 C;  4LF9 J;  4NLO A;  3DKD A;  3I0S B;  1NDK A;  1XEZ A;  2DR8 A;  1I6J A;  5GAD U;  2AJ0 A;  1X9S A;  1RAA B;  2FJW A;  2BJD A;  4TLQ A;  2XI3 A;  3QT6 A;  5GMK a;  4DSJ A;  3JQM A;  4K4X A;  3Q89 A;  4OYX A;  4ZP8 A;  2GQQ A;  2AKW B;  1KN6 A;  2VDI A;  1KHW A;  2A1B A;  2YNH A;  1DRZ A;  1Q5Y A;  3K5O A;  4X4N A;  2BOA A;  1FE4 A;  2HKE A;  1FNM A;  4G65 A;  1S6Q B;  1KC8 T;  1S97 A;  4OX8 A;  3DMJ A;  2KRB A;  5H9E K;  1P27 B;  4WFN Q;  1X5T A;  1HYS B;  1RT2 A;  1HW8 A;  4DEZ A;  1S1V B;  2BAB A;  2MZ1 A;  1N34 F;  3MMA B;  4KSE B;  6AT1 B;  2VIC A;  2KRR A;  3EXC X;  4DV7 F;  7FDR A;  2VFV A;  2BAN B;  4LFB J;  3TRG A;  1QUP A;  5LJ5 Y;  5CA5 A;  4B9U A;  4ICL B;  2RQ4 A;  1WG4 A;  2GHP A;  2B5J A;  5T41 A;  4JI8 J;  1FWP A;  4PG4 A;  2AT1 B;  3IBW A;  4AQY F;  1KVJ A;  3TZX A;  1NJX A;  3LQV A;  4PG6 A;  3WDO A;  2D3O R;  3DLG A;  2OTL S;  4AUK A;  1VLO A;  2HBQ B;  5KG3 A;  5F8I A;  2OSQ A;  3IR7 B;  3EM1 A;  1VQL S;  3IXQ A;  1KSP A;  4HT5 A;  3IS9 B;  2ZUG A;  4X4Q A;  3Q23 A;  2VIH A;  4GO7 X;  3WIV A;  1S99 A;  5A8K A;  2GHV C;  4USK A;  2I0X A;  4NML A;  4LF5 F;  1SPB P;  3SEO A;  2C2D A;  1RLD A;  3MCS A;  2VG5 B;  3AXK A;  3W2W A;  2MQO A;  3CJ2 A;  3OL6 A;  1VQM S;  1U25 A;  3G82 A;  1PYT A;  5A8R A;  2DY1 A;  2BQR A;  1IKX A;  2C2K B;  3OBI A;  4DPW A;  5DQG A;  2HMI B;  3AOA A;  1O0P A;  3SCK E;  1FVS A;  3OFG A;  2YNI A;  5HLF B;  1C2P A;  3LPY A;  4FYV B;  1TP7 A;  3NCP A;  1JQG A;  3FBE A;  4PWD B;  3ET6 A;  2MSS A;  4Q2M A;  2ATC B;  2ZD1 A;  2ASL A;  1TVR A;  1HPZ B;  4DN0 A;  2CZV C;  2M70 A;  4FPR A;  3HT0 A;  1H0H B;  3JQK A;  2HHH J;  3GV7 B;  3CB4 A;  1Y5I B;  3K8W A;  2XS2 A;  4NCG B;  1SB6 A;  2YX1 A;  4M5L A;  4ZN3 A;  1NHV A;  5F8G A;  2HNY A;  1FDD A;  2IDL A;  3CCR S;  4B3M F;  2XHW A;  3K7R A;  3G6X A;  4EGL A;  3P4U B;  4X65 J;  1EKS A;  3BRE A;  3QYY A;  3PX4 A;  1VQK S;  2L48 A;  5DDO C;  2CJB A;  3KJV A;  3UN3 A;  1NAQ A;  2F9J A;  5J2M A;  4WJB A;  5C7P A;  4NPO A;  1TKT A;  2XHC A;  3OR1 A;  4OYI A;  2J6U A;  3BZQ A;  1S6O A;  1FK9 B;  3J7Y U;  3O6Q A;  2DR9 A;  1S0V A;  4ID8 A;  2AEF A;  4HVZ A;  1GMV A;  1QY7 A;  1DQA A;  4YME A;  3PRV A;  1WG5 A;  4YR2 A;  5GAG U;  3U1N A;  2V4J B;  2RRA A;  1LNQ A;  2RIL A;  3AY0 A;  2XY6 A;  4EEY A;  4CLU A;  3MEE B;  1J5E J;  2GIF A;  1GTH A;  5DZ7 A;  1NHU A;  1ARO P;  1U48 A;  4RWX A;  1NJZ A;  3JTO A;  4DR6 J;  3PX6 A;  2OUG A;  5A6P A;  5F8N A;  3AAW B;  1N36 J;  1NPR A;  1WHY A;  1Q81 T;  3TQE A;  4P2M A;  4IG0 B;  2AP6 A;  3KFW X;  1XMO J;  3PX0 A;  2JEJ A;  3WX4 A;  2HND A;  1M5O C;  4IRC A;  4WKY A;  1X0F A;  1FJG J;  4DMZ A;  5DZ6 A;  3MR3 A;  5CYM A;  4ZJO A;  1DTQ A;  1Q4R A;  2IC3 B;  2DCU B;  4M8L A;  2FYX A;  5DG7 A;  2OAU A;  2YKN B;  1IUJ A;  3M1V A;  5KFK A;  4LMZ A;  5F9L A;  2PD1 A;  2YNF A;  3LP1 A;  5HVF A;  4Q43 A;  3OTO F;  2CPJ A;  3H7H B;  3J81 Y;  4KHP J;  1HHS A;  3ZZU A;  3RGI A;  4U7U K;  1DY3 A;  3DXS X;  3GFX A;  3P5T L;  3RB0 A;  4DSI A;  1X4E A;  4F0H A;  3QJJ A;  2MQ8 A;  3MCO A;  2Z4P A;  4K8R A;  3D5M A;  4IOB A;  4LR7 A;  5KFW A;  1UZD A;  3AA9 A;  4QIG A;  3F73 A;  4X2B A;  1T7P A;  2VOP A;  3W3S A;  4C8L A;  2QFI A;  2R7U A;  3NGD A;  1UJ5 A;  4C7Q A;  1H6K X;  2LXU A;  3KUE A;  1BGX T;  2ZH3 A;  3RJM B;  1LXN A;  1WC6 A;  3S8S A;  2DGT A;  4ED4 A;  1PO6 A;  3H25 A;  4MMO A;  2QN6 B;  4K5S A;  2ROE A;  3FQK A;  3PFE A;  4A8M P;  1EQM A;  4KHM A;  2B9W A;  5HBM A;  1TFY A;  2WON A;  2PA3 A;  1K44 A;  1OSC A;  1RTI B;  1IBM J;  4UTG A;  2I5J B;  1TMJ A;  2Y1R I;  1FF2 A;  2KG0 A;  5D3G B;  2BE7 D;  3PRD A;  3W62 A;  3MR2 A;  3SSS A;  4UY8 5;  1DBD A;  1C4C A;  4B9N A;  1T05 A;  4DDF A;  2W24 A;  1N88 A;  2D41 A;  4C2M A;  2WVE A;  4LF9 F;  5JVG Q;  1PBU A;  2F4F A;  4USH A;  5IWA F;  2RU3 A;  2QE5 A;  2AJQ A;  4WCE Q;  3KG4 A;  3CPW R;  3V6D B;  4QPX A;  4I4B A;  1RWM B;  2OD6 A;  3R2C J;  3DOL B;  4ZPA A;  3PKM A;  4ED3 A;  2V9W A;  2R3V A;  3NKY A;  4O23 A;  2GFF A;  2P9E A;  4I64 A;  5ADZ A;  2R8G A;  4WXW A;  1PYS B;  1DQ9 A;  4H4O B;  4BWJ A;  2E44 A;  1N32 J;  3BF4 A;  4TXS A;  2QRR A;  1VOM A;  4H4M B;  5I4M A;  1CJT B;  3J81 j;  1BQN B;  4EFA C;  1IBC B;  1Y10 A;  2EG2 A;  3P8B B;  1SUQ A;  3AFG A;  1CUL A;  4WBF A;  3Q83 A;  2CG8 A;  2CKW A;  3OHB A;  2BUN A;  1JJ4 A;  1Q1K A;  4JI5 F;  1ZH5 A;  3CME S;  3FC9 A;  2B7B B;  2E29 A;  1E6Y A;  3JS9 A;  3ZZR A;  2FVC A;  2KG1 A;  2DO0 A;  4ERD A;  2FVR A;  3MM9 B;  2DNR A;  4B3R F;  4FXV A;  5D4N A;  3UN5 A;  1F3V A;  2HFS A;  5AE1 A;  3TAM A;  2ZOM A;  4N47 A;  3POT B;  1VS3 A;  3IC1 A;  1WF2 A;  2HVZ A;  2FQQ B;  3CCW A;  3CMQ A;  3VWS A;  2BX6 A;  4JI8 F;  3DM2 A;  4P9S A;  4P74 A;  1WSV A;  4IRD A;  4FPI A;  4CO4 A;  4DUY F;  1LK5 A;  5KFT A;  3C8Y A;  1VQ9 S;  3CF5 Q;  2RKI B;  1X9M A;  2RHS B;  3ZNJ 1;  4I68 A;  5MLC V;  3BYR A;  2J76 E;  2G13 A;  2BAC A;  4KKO A;  2MJU A;  8ATC B;  3M7V A;  2LU1 A;  4ECV A;  1ZA1 B;  1YJT A;  1KFD A;  2E9Z A;  1APS A;  2FZC B;  5KG1 A;  3JB9 k;  5I3P A;  5CD4 A;  3LH2 S;  2CJY B;  4HR2 A;  1TUG B;  1GQE A;  5L9N A;  4J9V A;  1V3R A;  3CJR A;  4ZPD A;  5CCL A;  2W7A A;  2K3K A;  2HRY A;  4Y65 A;  2RNE A;  2B56 A;  5DM7 Q;  4FP9 A;  3BYP A;  1IQT A;  4P73 A;  3M05 A;  4JB8 B;  2C28 A;  5FDL B;  2MQP A;  4V19 J;  3AD9 C;  2FJV A;  4DPX A;  1G2E A;  4Q7A A;  2OGU A;  4QZV B;  3GCX P;  5KG6 A;  5HQL A;  5LXR A;  1NEE A;  1F5B A;  1PG5 B;  1S1U B;  2CPF A;  4M5N A;  5ETV A;  4KH1 B;  3DRX A;  2ZKU A;  2JWN A;  1RYR A;  2Z57 B;  1X4D A;  2IYI A;  1AW0 A;  2WW4 A;  1JXE A;  1M5K C;  1T11 A;  3MM8 A;  4DV3 J;  5FLX U;  1VRU B;  4WTY A;  1RWO B;  3B4D A;  4ZPT R;  1R8H A;  2K1R A;  1RT1 A;  2JEI A;  4C9D A;  2DIS A;  1YHQ S;  2A3J A;  3BO2 A;  4NLT A;  4EO8 A;  4OI3 A;  3HHK A;  4DV6 J;  4IRK A;  3TP2 A;  2DNG A;  2V9K A;  4J37 A;  4DL7 A;  2CVE A;  1WI6 A;  3ISN D;  1FRH A;  2XYG B;  2O66 A;  4N5S A;  1HWK A;  1XK8 A;  2QL5 B;  1FE0 A;  3L7P A; 
#chains in the Genus database with same CATH homology
 2QLB B;  1RWM B;  2CNO B;  2H65 B;  1RWW B;  2CNL B;  3P45 B;  2QL9 B;  2C1E B;  4JB8 B;  2HBZ B;  2FQQ B;  5K20 B;  1RWV B;  4ZVT B;  1I51 B;  3SIP B;  2XYH B;  3D6F B;  3P4U B;  1SC3 B;  2CNN B;  3GJQ B;  3R7S B;  3R7N B;  4LSZ B;  4DCO B;  2H5J B;  2QLF B;  1SC4 B;  3RJM B;  2QL7 B;  2XZD B;  2H48 B;  2C2Z B;  4ZVO B;  4ZVQ B;  2H5I B;  2P2C B;  1RHJ B;  1QDU B;  3KJN B;  1ICE B;  2H54 B;  1IBC B;  4DCP B;  2Y0B B;  2HBR B;  2C2K B;  1PAU B;  4ZVP B;  4DCJ B;  1GFW B;  1RWO B;  4ZVU B;  2XYP B;  2CNK B;  2C2O B;  3D6M B;  3KJQ B;  5IC6 B;  1RHK B;  4ZVR B;  2XZT B;  2H4Y B;  2HBY B;  1I3O B;  1RWP B;  2CDR B;  2CJY B;  3R6G B;  1RHM B;  3EDR B;  1NME B;  1RHQ B;  3D6H B;  3IBC B;  3GJT B;  3R6L B;  1RWN B;  5IC4 B;  1RWK B;  3QNW B;  1RE1 B;  2QLJ B;  3EDQ B;  1SC1 B;  2H51 B;  1RHR B;  3NS7 B;  3GJR B;  1F9E B;  1RWX B;  3KJF B;  2XYG B;  3IBF B;  1RHU B;  3R7B B;  1QTN B;  2Y1L B;  1BMQ B;  2H4W B;  2QL5 B;  3R5J B;  2HBQ B;  2CJX B;  2DKO B;  1PYO B;  2C2M B;  3GJS B;  4ZVS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...