1SC1B

Crystal structure of an active-site ligand-free form of the human caspase-1 c285a mutant
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Interleukin-1 beta convertase
publication title Crystal structures of a ligand-free and malonate-bound human caspase-1: implications for the mechanism of substrate binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2004-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1sc1B00
4JB8B 2QLBB 3R6LB 1RWKB 2HBZB 3KJFB 1F9EB 1RHUB 4ZVOB 2FQQB 2H48B 3IBFB 2XYPB 1BMQB 2P2CB 3GJSB 4LSZB 2CNKB 3GJRB 1I51B 3R7BB 1RHKB 3D6FB 2XZTB 2H54B 2CJXB 1PYOB 3NS7B 3RJMB 1QDUB 3D6MB 2CDRB 5K20B 4ZVPB 3R6GB 1RWOB 4ZVSB 2C2ZB 4ZVUB 3IBCB 3EDQB 1SC4B 4DCOB 3SIPB 1RWWB 2H65B 2H4WB 2HBQB 1RWNB 3P45B 1PAUB 2C2KB 1RHQB 2HBYB 3GJTB 3KJNB 2H4YB 1RWMB 3EDRB 1GFWB 1NMEB 3R7SB 2QL7B 1RHJB 4DCJB 1I3OB 1RWXB 2XYHB 3GJQB 2H5JB 2CNOB 2QLFB 2Y0BB 3P4UB 2C2MB 2QL5B 5IC6B 1IBCB 3KJQB 1QTNB 4ZVTB 2QL9B 3R7NB 2C1EB 1RHMB 2C2OB 2XZDB 1RHRB 1SC1B 2QLJB 4ZVQB 2Y1LB 1RWVB 2CNNB 2H5IB 1RE1B 2CNLB 4ZVRB 2H51B 1SC3B 2DKOB 1ICEB 1RWPB 3D6HB 2HBRB 3R5JB 2CJYB 3QNWB 4DCPB 2XYGB 5IC4B
chains in the Genus database with same CATH superfamily
2XEXA 3R3TA 3TZZA 4QWDA 5T14A 3CC2S 2WVFA 2MQNA 1FD8A 2HHHF 1U24A 1TELA 1OY8A 3G87A 2DGXA 3T5HA 4OHZA 1YG0A 4H4OB 5IT9Y 4JI5J 1FRXA 2EKYA 3F73A 1SV5B 3SCJE 5GAHI 2KYZA 4WYWA 1SUQB 4EI2A 3QFHA 2GMJA 4X64J 1RABB 4NI2A 3D0GE 4AXIA 1Q95G 3KXDA 2RIJA 4ED4A 3JQKA 1D9FA 2HNYB 1KN6A 1HBOB 2E7VA 3U7JA 2QLXA 3O6QA 2VPXB 3PJXA 1VQ6S 1CG2A 3AH6A 4OI6A 2D3O1 2J5AA 1UAWA 4FZVA 2G1DA 3D1OA 4ZKAA 2DCUB 5C2CA 3SDEB 2W01A 1NCLA 4DBQA 1WTFA 4E0DA 1HMVB 2E1CA 1TL4A 1FE0A 2J6UA 5D0GA 5B0FA 4NL5A 2QV6A 1JXEA 3W5XA 3MAHA 3GLJA 2ZZMA 4FS2A 1YHQS 3DCAA 2C2RA 2P9CA 5I3PA 3EUNA 3T1HJ 4TY8A 1RACB 2QE5A 2QMWA 4C8OA 1SJ4P 3TQEA 3FMWA 3V4MA 1RWNB 4NYPA 2ZZTA 3RB6A 2C28A 2BANB 3EGWB 1FVQA 1RAGB 2Z0GA 3GWCA 2QLWA 3HMJG 3VWSA 1IN0A 2B6AA 1NM2A 1X60A 4DSKA 3CCQS 1QTNB 2WW4A 3JTPA 2GAHC 2A2DA 3UR0A 2K2PA 4J9UE 1TK5A 3GIMA 3S8SA 4J9VA 2QO3A 3Q8VA 4HI1A 5I3UA 2I5JB 1IKVB 3W8GA 3SSSA 3KHRA 1IR2A 4NA1A 2CDQA 2BJ8A 2XY7A 3MM8B 4LIWA 4WWSA 5AXLA 2CPHA 1FWPA 2J6SA 3MUTP 4X4RA 5EUHA 1R0BG 3RJMB 2RD5C 2PSZA 3KLEB 1VRUA 2OD6A 2JFDA 3RB3A 1JLEB 3BDPA 4RW7B 1YJRA 5M2UA 3LAMA 3H8YA 2O67A 5DS7A 3UI3A 3DI6B 4ETXA 1S59A 2QL7B 4DV2F 4RW9B 2IVYA 1UVLA 2FGCA 2OPPB 4U7UK 3MD1A 3FBCA 2DNGA 3OR2B 4TU8A 2D7SA 1KS2A 5DJBA 4J9NA 5KFFA 2ZH1A 4KR0B 3OFEA 5G0RA 1NDLA 4LF7J 1DQ9A 1WKLA 3QJLA 4BHQA 2M3DA 3KNGA 3FSYA 4RUCA 2B4OA 2RUSA 2QGFB 1L5UA 2DIVA 4AQYJ 3BKUA 1PCAA 3B4DA 3GJSB 2BRLA 4XO0A 2EWHA 2MKSA 3KLGB 4OHWA 3FZ2A 2CVEA 3I9ZA 2CQGA 3KMSA 3OLAA 2DHSA 3BSNA 1P1LA 4DSJA 2FJXA 1A7GE 3M8YA 1QAJA 3D54A 1WEZA 3TUJC 2GIFA 3MGJA 3BH6B 4OMFG 3R7SB 3BR9A 1UP1A 2Z8QA 4P73A 4QIWD 4DLEA 3HO1A 1IUJA 2KO1A 1H6KX 3KHHA 4ZVQB 1N34J 1UWBB 3CDBA 2VUGA 1X9SA 1S7IA 2VF3A 1KEKA 1O8BA 4DV0J 1NAQA 1NKCA 3T9ZA 3OFGA 1V3RA 1JIHA 2HGNA 3CXCR 1VQKS 2CZVC 3IBFB 2V94A 4O3NA 1ITPA 4B9UA 4U95A 2ZH8A 3NAHA 2IA0A 2OH2A 3F0NA 4B3TJ 2GVZA 5JMNA 5DLGA 3T1YF 5HVHA 3MM5A 4O3PA 4JP8A 2YVSA 2KXFA 2CZ4A 3ENAA 1H98A 2HVZA 4ENOA 2GJIA 2YWFA 3EXCX 3PZPA 1WEXA 2H4YB 2HRUA 4F4AA 2HFZA 4X66J 2QFJA 2ADBA 2JL9A 3ZXWA 4WPAA 1HQUB 4ZLLA 1DHMA 2BUNA 4KE5A 2Z30B 3EPIA 3K5MA 4FYWB 4O4GA 2IFXA 4OZLA 1HA1A 4JI1J 1VYAA 4A8QA 5I42B 4EZ9A 3MMCB 3EJMA 4F0KA 4NCAA 4KGVB 2AHOB 4DL4A 1TKXA 4Q2MA 2XCPA 2RSQA 4OI1A 1CQNA 5CXTA 2QLBB 3BQ2A 4OYZA 5C42A 3VALA 3HD1A 2FZCB 1GMVA 2R8IA 1R3NA 1NDPA 4O23A 4DXLA 1QVFR 2DTJA 2YWKA 2MKIA 2E9ZA 2MXYA 3I4HX 2ROEA 4P9SA 3BBFA 3W5ZA 4LFAF 3D68A 2VQFJ 4CDIA 1RT7B 4OX6A 1ZAWA 1IKWB 2ZM6F 1J27A 3J7A1 4ANCA 5U47A 3J7YU 4IYQA 2B43A 8RUCA 3O44A 4JV1A 1X4AA 1JLFA 4BC7A 5F3TA 2FJBB 5HK4A 2F8MA 1RTHA 3OUYA 2A3JA 2ABYA 1EQ0A 4RNHA 1P9YA 1XR7A 5H9FJ 4Q0BA 5G4DA 5KFIA 1QM9A 1SKRA 2QA2A 3S1TA 4G3IA 2VZ9A 3RRHA 5M2RA 3ZC4A 3SV4A 1I94F 2H1YA 1L3KA 1YLXA 1H38A 4QCLA 4IR9A 2VPZB 4OQJA 3BEGB 4KHPF 4KKOA 2J8SA 2GZOA 4GKKJ 3B8HA 3W61A 1HI0P 3PEJA 4K4WA 1R8HA 4XK8C 1N5YB 2P9EA 3I4PA 2EC0A 3KLVA 3ZFVA 4QWAA 1VFJA 1X4EA 3DXBA 3GTYX 3OHBA 1T02A 2ZDOA 3WIVA 2HBQB 1VRQC 4F4YA 5T7LB 4RUBA 2RF2B 4M5LA 3C15B 1VQPS 4MAKA 3DXSX 5KFXA 1YBUA 1TKTB 1CSJA 2G0IA 1PSDA 3G9CA 3G6VA 3Q2SC 1ZA2B 1JKHA 4Y0FA 5F8LA 3G6YA 4JI0F 2AJQA 4PG7A 3GV5B 1MROB 4Q5VA 1NEEA 2YWEA 1RXOB 2RH3A 3MEKA 5FLXY 4M5GA 3HHLB 2WW8A 4CTAB 5H9FK 3D6HB 1NPKA 2J8AA 1VQNS 1S77D 2N3LA 1SH3A 4USVA 4BLGA 1ZPWX 3VZHA 1WNEA 4NLTA 1D9AA 4C0OC 4XAKA 1AZSB 2YNHA 5DO2A 5FDLA 4EBEA 2OHDA 1WC4A 2HAFA 1WC1A 1WEYA 5E3QA 1BQNB 2EFNA 4L76A 4TYAA 2YKMA 5IT4A 4IFVA 1Y0HA 3QGPA 5HLFA 2V0NA 2VDIA 2COLA 2WOMA 3L7OA 5D78A 4X4VA 2HVDA 2I6WA 3IR6B 1MWZA 4FN5A 1IKYB 2YKOA 4RBVA 5E3PA 3HFZB 2Y0BB 2VG5A 4OV1A 1GTHA 3R5BA 3BM7A 4HDHA 3HF5A 3QT5A 3KK1A 2KXNB 3PJWA 4DLGA 2KZZA 1FO1A 2AT1B 4RNOA 3EVMA 2ZBCA 2RU3A 1B3TA 1IJFB 1RT5A 4H4MA 2MKHA 2DXFA 1OQ3A 1FF2A 1SJ1A 3N01A 2BQRA 1LWFB 2HFOA 3R6LB 3M32A 2ZHAA 2C2EA 3AD8C 4R0EA 4C48A 5J2QA 4P10A 5GMEA 4WTOB 4JI4F 4LRDA 2VJVA 1CC7A 2QSFA 3DU6A 4C6AA 4DR3J 2BM0A 4WXOA 3FBBA 3CCMS 3VAFA 1HIYA 2CDRB 4B3MJ 2KFYA 4IDKB 1K0TA 2HRYA 1ZOTA 3ZZTA 1JLBA 2WRMA 3PW0A 1E6YB 4RNFA 2BW2A 4A8FA 3IWXA 3C2PA 2HLTA 1XBWA 3I0SA 2AMCB 4DQQA 3BYPA 2FYXA 2O1PA 2RUGA 1FK9B 3I82A 1KTQA 1XNQJ 3CJ2A 3GILA 2UUAF 1RWMB 2VHGA 2AJFE 3PTWA 2PFDA 2AP6A 2L3MA 3TEGA 4LSLA 1T7PA 3LGMA 2NZCA 3DM2A 5D0RA 4FDFA 1KVKA 3DLLQ 1U6BA 4NCGB 3SCLE 4EYIB 1NB2A 1QAYA 2GX8A 4IUFA 1RT2A 4DV3J 4TXSA 5E7OB 4OJ1A 4O0NA 2LQ5A 3E51A 2EI5A 1TV6A 2MKJA 2LKZA 1CJTA 3MEEA 4R8UB 3G6ES 1CC8A 3QFWA 3U1LA 3V4IA 3LP2A 4J37A 5LXYA 4OYOA 2NLWA 3ULHA 4C97A 1J5OA 3NWGA 4M5IA 4BBYA 1NZ8A 3NBPA 1FJGF 2C3PA 4C98A 3MFIA 2C2DA 1HLWA 3DOMB 3KUEA 4F3QA 1FKPB 3OTBA 3UPFA 3DRPB 2HHXA 3V81B 3L3CA 1IKXB 3GR0A 4FYDA 4OI3A 1Q53A 4JI6F 2ZH5A 1F3FA 2CPFA 3CJRA 1LWCB 2XS5A 1OSCA 4PYAA 3AJ2A 2DNMA 1UZHA 5DZ6A 2FY8A 1YTYA 2B8QA 4ECZA 4IG0A 4AL7A 1S1WB 1FEHA 4RUAA 1WOSA 3QIDA 1FRLA 2Y8WA 2WB1D 2F9DA 3A3PB 2XMVA 1HW8A 2YKNB 3US5A 4ZN1A 1GMUA 1Y00A 1HWIA 4ILLA 1SQFA 3THVA 5I3QA 4PAAA 4WU3A 3OR1A 1OY9A 2Q66A 2BE2B 4Z2XA 3ZTOA 2RDJA 1IM6A 3RR7A 4YDDB 3DGPA 3CDAA 3N9UC 1FEEA 5BYQA 3ZTSA 3JTOA 1GTEA 3DYAA 2LEAA 1M5SA 5M2PA 5ETKA 3BGUA 1RUSA 2OI2A 4M1KA 3WQPA 4DPXA 4FVMA 3VGUA 1IBKJ 5C24A 1U45A 3OD2A 1FERA 1HNXJ 5HQLA 1XNRJ 3D9BA 5DQGA 1HARA 5H1SV 3UD3P 1CJVA 2LEPA 1YKWA 2GGPB 4USKA 2HK2A 5KT7A 2Y9HA 3H2UB 1JB0C 3HI9A 4B3OB 1CJUA 2CNLB 4L3NA 2HHUA 1Z2LA 2CJYB 2HIQA 1QVGR 3ITHB 2HS4A 3KK2B 3VAMA 4EK2A 5DQHA 3CJQA 5B0AA 4A47A 3OL9A 2VKZG 5MLCV 3TA0A 3CDEA 1LXNA 2P5VA 2L9NA 3IG1A 3D6FB 1S1TB 1VQ8S 4P2FA 4DSIA 3ET6A 2YKQA 4OYXA 2ZVIA 5CABA 3EGZA 4QYRA 2CJKA 1IBMF 1R43A 3HXMA 4R5PA 2IMWP 4U8YA 4LRAA 2F5GA 4KO0A 4OZ3A 4ID8A 5IM0A 2F65A 4MK9A 3W60A 2ZFHA 4I64A 1Q82T 3PO4A 2OMOA 1S1VA 3H98A 3QGIA 1S97A 3M30B 1U4BA 3ONQA 1PG5B 4KIAA 4CIOA 3KUGA 2XSJA 1WWHA 3OBIA 3GV8B 4LFBF 4ZVRB 3ENQA 2U1AA 2O01C 3HZEA 3H40A 1YJNS 1NK9A 3R97A 3U1NA 5ADZA 4IRDA 3VAGA 4KT0C 3MR2A 1RU1A 1X5SA 2MYFA 3GG0A 4BCAA 1HNIA 2G9OA 1PILA 5HL7Q 4BDPA 1FE4A 2KT2A 4JYAF 2CJXB 3ZTRA 1HPZA 5H9EJ 1HHSA 4BC9A 1E6VA 3O5TB 3H5YA 7FDRA 3JSBA 2HWTA 5E2QA 3K8VA 4QJVA 4O44B 3QYYA 1RT1A 2MQPA 4NXNJ 1NPPA 1C0TA 4TNOA 3QGGA 2GQ2A 5L1IA 1RHJB 4DQSA 2W7PA 4Y2AA 3PYDA 4DUYJ 2V2VA 3I5BA 2YY3A 3OVSA 2D3UA 4E8UA 1SI9A 2W24A 2HW3A 2W8KA 5IV3A 3MUMP 5F8GA 2YNFA 4NRTA 1RT3B 3X3UA 3SYZA 4DR2F 4C8NA 1M1GA 2CNNB 1Z1ZA 1C4AA 3WC2A 1G1XA 2XGPA 2ACMA 2R7UA 1D8ZA 4HR2A 2BJ7A 1WF1A 1HD1A 2KKHA 2FQQB 3M9OB 3MM6A 3BGFA 3CVKA 4ZPWR 2OMLA 3A13A 3Q8UA 3PACA 3KLIA 2WB4A 5THWA 1D8YA 2FUG9 3GFHA 3QO9A 3L7UA 3QWUA 3PRVA 4TY8B 5ETNA 2I2YA 2HHQA 4CCHA 1RU2A 1NJZA 5AXMA 1BD6A 4DV6J 2MQLA 3T9NA 3TAPA 5H9EK 4OI0A 1DY3A 4IOBA 1S4FA 4PPZA 3Q8YA 4LF9J 2B6AB 1R8CA 1K0VA 2ZH7A 2AJ2A 4DCJB 5B08A 4WKYA 4RKUC 2IJNA 4KB7A 3JTNA 2FZGB 1NRKA 4DZ6A 3FZBA 3K0JA 3GFZA 3HSGA 3BN7A 3TVYA 1PGZA 2IA6A 4XDCA 3W2WA 4DPTA 4AD6A 3IRXA 4DV4J 3DLGA 5KFRA 2KT3A 4I6YA 3VR1A 2IC3A 3M7VA 1R0AA 2WVBA 1AROP 3NCPA 3VZIA 1U02A 2XO7A 3LWMA 4WK3A 5C25A 2HQGA 4RBUA 4C0HA 5HVGA 1R6VA 2DNZA 1SVDA 1IQTA 1VRUB 2U2FA 4CYUA 4Q8FA 1PBUA 1YSJA 5KFHA 2GHWA 1FWLA 1VJQA 2C2KB 3DHXA 4RW8A 1NNDA 3QSIA 3M6VA 1NSAA 4ECSA 4UQGA 2DPJA 1VLOA 2AF6A 3PVXA 3CTRA 1I3OB 2XYHB 1T03A 3BQ0A 2OELA 1JLGB 4PKDB 2L08A 4CLPA 4NX9A 5E3AA 2BRKA 5HP1B 3AY0A 3K7RA 1HBMA 1XN9A 1URNA 5LJ5Y 3DMJA 5G0RB 3H7HB 3H59A 1OIAA 5C5JA 2VDHA 2AZ1A 5DDRC 2EFQA 3FC9A 3E01A 3VV2B 2FVSA 3AQPA 4MFBA 2EPIA 1C1CA 2KM8B 4YOEA 1SJ3P 1XR6A 3W8PA 2YWGA 2AZ3A 3N4WA 3AA8A 2DR9A 3M2RB 1UA1A 4N41A 4KV8A 4ECRA 2BA9A 4MJKA 1Q78A 3UO0A 3D7SB 1VK8A 2UXBJ 2Z4PA 2W2QP 1RTJA 3QSYB 3MMJA 1KBRA 2XBPA 2QN6B 1ZM2A 2WHOA 1S6PA 3ILIA 2N3OA 4ITSA 3HHKA 2HBYB 3TX8A 1Y5IB 3UD4P 2IJRA 5IOLA 4QR1A 4FS1A 3GV7B 2HS0A 2OIHA 3VGTA 2YXLA 1N33F 2HHSA 3POTB 1N48A 2MZJA 1ZBTA 3IWLA 4UZBA 1FCAA 4J9OA 4KFBA 3GG1A 2QX0A 5LMUF 3MI7X 5LT5A 2AJ1A 2UU9F 1XQIA 2ZD1B 2LXIA 1FDAA 3CWJA 2EKNA 3CCUS 3ZTPA 1SPBP 3F44A 3I5AA 4DG1A 1ZETA 3W9IA 3T6BA 3WC0A 1UJ4A 2ZUGA 1B0TA 3M9MB 3KOAA 3MEGA 2XS7A 2CQ0A 1BMQB 3I32A 1NDKA 2N4DA 1WG4A 3GJRB 3UN2A 4KJIA 2H54B 1B0PA 1RTZA 3V6DB 3QJPA 2PIIA 5ETOA 2WVDA 3TZWA 1BQMA 2HAIA 5F9NA 4K5SA 1WOPA 2K1RB 2W9AA 2XNQA 3NY0A 1WD6A 1O0PA 5DDOC 4YY3J 2HMIB 3K89A 4JI8F 1SJFA 2UV8G 5CYQB 3FNNA 4IO9Q 5A8WA 3HCXA 1PC5A 5DG7A 5L1JA 3JSRA 4IR1A 5J2MA 4GO7X 1WKKA 4OX9J 2IPOB 2DPIA 4O4GB 2JEJA 3TVZA 3OW2R 3AB4B 3W9HA 4F3OA 1OY6A 3A3NB 1RWVB 3W65A 3C16A 3KTQA 2CQCA 5KFWA 5GAHU 2UVWA 1TKXB 3MCOA 1I1GA 2HFNA 5C42B 2A1BA 1S1XA 1VI7A 3GYNA 3EE3A 1IQZA 1AFIA 3IMQJ 4CLZA 3HD2A 4FVCA 3Q22A 3M9NB 2F8EX 4O4RA 2G4BA 4LQ9A 2GHVC 1RP5A 2VB6A 2VQEF 4I67A 4RWWA 4YMEA 2Z56B 2V5HG 4F4WA 3KHLA 3V2UC 2FLOA 2D3ZA 1FXDA 1HNVB 3O3LA 1YI2S 1WSRA 2YBVA 4IG3A 1RTHB 2PO4A 3OUYB 1TAQA 2ZE2A 1NSKL 4PYDA 1UW4A 2XMJA 3J7ZT 4OZ5A 3W66A 4MK8A 2R2SA 4Q0BB 3HM9A 2RT3A 4OLOA 4LVNP 4Q7AA 4FYVB 1REGX 5D0HA 1DTTA 3OLBA 4J9KA 2EXUA 2VV5A 3BR8A 4CO0A 1IR1A 2VBXA 4OLPA 1GK8A 4C11A 4ILMA 3RAXA 3K5NA 1N5TA 2Z2MA 3HDSA 2PMZD 1H2VZ 3THTA 4PQUA 2MZ1A 1S9EA 2W25A 1VIOA 4X65J 1IBLF 2W9CB 4ZN3A 1TL1B 3I6PA 2NR0A 1TUVA 5J1EA 3OHAA 2ZOGA 2M0GB 2V4JA 3SXLA 2RKIB 4NLRA 1YJ9S 3DFEA 3LALA 2VODA 5L1LA 3MMAA 1PC4A 2E5LJ 2IM2A 4B02A 1RK8A 4DJBA 1RKJA 5LMNJ 2K06A 5AXNA 3K57A 5KT4A 5B0DA 4HI2A 2MJNA 1Q8BA 2E1AA 1N52B 1CULB 1HNWJ 3VHQA 4WJBA 1TTHB 3NMRA 3B78A 4IQMA 4RO0A 1AW0A 1C4CA 5A8RA 4FKYA 5CCLA 4QZVB 3EVOA 1GXLA 1XC9A 3ISND 1FFWB 3DHWC 2DR8A 1KOOA 3CCSS 3PYGA 1LEOA 3NGDA 4UQTA 1N36F 1SBRA 2YNHB 2HVHA 4NPOA 1ZYQA 3M1VA 3UCUP 1I51B 4JI2F 1MWQA 5B0CA 2V4QA 5HLFB 5K20B 1JK9B 2MZQA 4PG5A 1Q0NA 3BO3A 2ASLA 2WOMB 2ZKUA 1NB7A 5KG4A 2DEIA 1FVSA 4V1Ak 2BJDA 1GQEA 3CD5A 2Y8YA 2UUCJ 1UTAA 1F2GA 3X1LB 2VG5B 4B08A 2YH0A 2HVEA 1RWXB 4ED7A 1V3ZA 1FTCA 2VFRA 2OGUA 3SQGB 3TA1A 4G6VB 1FRKA 1H3DA 4GMKA 4YN3B 3MR3A 1S10A 1SC1B 4NMXA 2R2TA 4ED6A 3ZZ0A 4DR5F 2MLZA 4G1QB 1YX2A 4UW2A 1T05B 1RT5B 4H4MB 1VISA 1OQ6A 1Y5LB 3Q8RB 2L41A 1XIQA 4QW8A 3KMQA 4WE1B 3PCOB 1RCXB 3NCQA 1NH8A 2R7WA 2BVZA 1HNZF 2V2QA 1MN9A 1UETA 4CM2A 1G4CA 3HVTA 2IM0A 3UN5A 1NZAA 5D3GB 4AXJA 4J7CA 4ZIVA 1VQMS 4JI3J 3UW1A 3MEDA 2L9WA 2CZ9A 3A3OB 1JLBB 4Q43A 1HW9A 3RB4A 3JYTA 2BZ2A 5ETQA 4ZVSB 1FFSB 5BXIA 3GIRA 5GADI 4X4TA 3W63A 2YNIB 2RRAA 2JJ4D 1RB0A 2N4CA 7FD1A 5HMXA 3GJTB 3NXZA 2ZH3A 3KDNA 3DM2B 1Q16B 2MGZB 2M88A 3BKTA 2MEWA 3C19A 4M5MA 2R8GA 4CLLA 3QAUA 3HHEA 3PKYA 1TV6B 1YJTA 2ASDA 1CJTB 3MEEB 3V4IB 3LP2B 5MAOA 3C14B 4FPRA 1S4EA 3NP5A 2EG2A 1J5OB 3MAAA 3MZIA 1J5EF 2RS2A 1HL6A 5ETPA 1Z4UA 2VJUA 3I5CA 1RHUB 2B7CB 2XYPB 4DFMA 2KN4A 2DY1A 2GO8A 4B9LA 2CQIA 2R2RA 3H4DA 4ZMMA 1RTIA 1S76D 3N5BA 1ZA1B 4PXCA 3R9LA 3QAEA 4YR0A 3CJKA 3FCVA 2DYAA 4QWBA 2V8PA 1SL2A 1BQXA 2VIHA 2B9WA 3TJ9A 4H4KC 3EMTA 4XIUA 1NK0A 3CCTA 1RA6A 3FRZA 3KJNB 1JLQA 2OPRB 4RW6B 1L3VA 2HWHA 4DHVA 2PI5A 1B7YB 3HHDA 3NAIA 3PW2A 1VHIA 2AD9A 1BWEA 2ZHOA 1OYDA 1RT4A 3B4MA 1UJ5A 3FCWA 4YQWA 1XMBA 2O5DA 2B3TB 2XMWA 1K8AT 1RAEB 2DEJA 2GNKA 2QYCA 3ZNJ1 1N5VA 4LF5J 2FDNA 5HATA 2HBRB 2KRBA 2VPWB 1AUDA 4PWDA 1R6YA 1VQYA 4GVBA 2VKRA 4DF4A 2RQKA 4TU7A 4TVAB 1VC6A 1QSYA 1T11A 2UVVA 1ZAVA 3DGPB 1JNZB 1PIEA 3MPUB 1YJWS 3DYAB 4UT4A 1YRXA 4QR2A 4NLPA 1S0VA 2Y3YA 2IIHA 5GMDA 5C24B 1C2PA 4QOTA 2RVJA 1IVZA 5LMUJ 4PQAA 2LMIA 1RT6A 2W4PA 3MTJA 5BR8J 2UU9J 4ELUA 4B3RF 4ED3A 1FA0A 5IQQA 3KJQB 1N5QA 3NLCA 3QBCA 4ZP8A 1XMOF 2ZJPQ 2CRLA 2E5IA 3L09A 1A6LA 4WCEQ 4X4UA 3NGUA 1JLCA 2GFFA 1CJUB 4C8KA 2J7WA 3LTOA 4LF8F 4PEOA 1T9TA 1DURA 2WZ1A 3D6TB 4W92B 3DLEA 1T8EA 1H72C 4KYZA 4DL3A 4ZVHA 2G13A 1M0SA 4HT7A 3T3FA 3G86A 2ZH9A 5EDWA 4U6PA 3ET6B 4JI8J 1KD1T 4W90B 2YWWA 3WZ0A 1N6QA 2ZBQA 4RZRA 3GB0A 1BLUA 1RWOB 1KFDA 4ZS6A 2YKAA 1HD0A 4DCOB 2BJ9A 5E3CA 3QMQA 2BQUA 4WKRA 1RISA 2B51A 4FF3A 3P8BB 3CB4A 4PWUA 1UPPA 4C2MA 1SXLA 2N7CA 2DHXA 1K47A 1EP4A 1XMQJ 1S1VB 2CPYA 3TJAA 2VG6A 4I7FA 4DR1J 1FKOA 3BGLA 2I1RA 3TAMA 2DGVA 1AUSL 1RBLA 4M5DA 4UY8T 2XSJB 4M5HA 1S1UB 1UPMB 5KG7A 4RWXA 4NLYA 4IOCQ 4P2SA 2QZ8A 1HWJA 2ZJRQ 4N47A 2XYGB 2Q79A 3H5UA 2E9TA 2B4PA 1HBUA 2AX1A 1JQGA 3FDSA 1UVKA 3C3LA 5JJBA 3R7BB 4Z7CA 1HBNA 4V19X 3PHEA 1JX4A 4BWMA 3OL8A 1E6VB 2UVUA 1MWYA 1X9MA 3P5TL 4DF8A 4B9NA 2UXCJ 3P45B 3FRYA 1ACMB 1RT1B 2V8VA 1C0TB 2YKPA 4KHRA 3UD5A 2FVRA 1VQ4S 3L95X 1FRIA 4NEYA 2EFVA 4L3KA 4ALZA 3GIIA 1V6HA 4Z37A 2I8EA 2C3YA 2MMYA 1RHRB 4LR7A 4WFNQ 2FJVA 2XMTA 3NS6A 1ZPVA 3HPOA 1JNRB 4I2QA 3W7BA 5CZVA 2AKWB 3LH2S 1CLFA 3MM6B 4O3OA 4CQ1A 4DFKA 3KLIB 3GFXA 4WF9Q 2XZWA 3BGRA 2IY5B 2OD4A 1U0HA 3VTIA 2B9YA 1Q79A 1WKJA 2AJ4A 3D6MB 5KFOA 4M5NA 1HYSA 4HYKA 4CH1A 3N6MA 1S79A 5J1NA 2HNZA 4EUVA 2FJAB 4C8LA 3C66A 5ETMA 1GMWD 1NJYA 4L74A 1B70B 1N54B 4ZP7A 5D4PA 2ALZA 2E5JA 4H4OA 4USIA 2HEKA 4U8VA 4WXWA 2CKWA 1YIJS 1SQEA 1U2FA 2AYMA 1EETB 5JXSA 2XTJP 2XZDB 4O3SA 3W2WB 1SUQA 3RR8A 3IM8A 2HZAA 1K44A 3IRXB 2DGSA 4UOGA 3DLGB 2LVWA 1H7WA 3HFKA 1RDRA 2HNYA 4HACA 1REVA 1HBOA 1QAXA 1U6ZA 3BKFA 5KOWA 1WDTA 1HQ2A 3MCMA 5C25B 1N32F 2P6SA 1P27B 2W9BB 2V50A 2EW9A 4CO2A 1VLYA 1VR6A 1QSSA 4CYUB 3J7YI 1LQ9A 2XZTB 1IWGA 3W64A 3BO4A 4FXVA 3SDEA 3Q8QB 1V5VA 1WC6A 1EZZB 3CO9A 2V9WA 1SC4B 4DZDA 3E2EA 4FXWA 1WOOA 4B3SF 4ZVFA 4ZPAA 2CJBA 4DR5J 3I31A 1NMEB 2DRDA 2VD3A 1AB8A 3NS5A 2D9PA 3HSJA 4C7QA 3R5GA 3E01B 3M8RA 2GW8A 4QU6A 4J90A 2XI2A 1Q8LA 3PYEA 2A10A 1C1BA 2MPUA 2OPSB 2HRTA 1WORA 4HDGA 3TW0A 4KV8B 4ANEA 4MIBA 2KL8A 4LJMA 4LUBA 1WI6A 1Y10A 1R8PA 4URSA 2I5JA 1IKVA 4KPYA 4KGXB 2JEGA 1GMWA 2OLWA 2XC9A 1Y7PA 1YVFA 2YPZA 5KFCA 2RHQB 1S6PB 2R9LA 1RWWB 3UDVA 3LAKA 3PDNA 2VG7A 2GVDA 3MHYA 1XEZA 2Q43A 2KRRA 2NXCA 4PPDA 3CDWA 5HO4A 1S48A 4L72B 3RRGA 3EZUA 1TVRA 3TARA 4KFBB 1VRTB 1JLEA 3MMBB 1Y11A 4RW7A 4LQ3A 5F3ZA 5IT0A 3BDEA 3HVRA 4OJHA 5BYRA 2VL1A 1X5TA 1U48A 1RWPB 1AYEA 3A12A 2MSSA 2K7JA 1DLOB 4ZP6A 1Y5NB 4N8OA 3DRXA 3KWMA 2OPPA 1AT1B 1H74A 3MEGB 4EO8A 5EX0A 4EGLA 4Y2KA 2MHNA 2OJ3A 3ZZZA 4ZJQA 2P2CB 3S6EA 2DD8S 2D1CA 2AU0A 3G2XA 4B9VA 1HWLA 4OYBA 2VC0A 4DX7A 5HMWA 5EWGA 4ZHRB 1W7WA 2FHOB 5EGYA 5HANA 1OJ4A 2FVCA 1U1MA 5A8WB 5CQGA 3DLBA 4JI7F 2CNOB 2D41A 3HSZA 1SJRA 2DGWA 3A8KA 3CJ5A 4GC7A 4CO5A 3MF5A 3C16B 4USWA 4CT9A 4KY3A 4OYMA 3SEOA 4W98A 3ICLA 3ETOA 4CO4A 2NZ4A 4AUKA 1S1XB 2VC1A 1X7VA 1I6JA 1K73T 2WSCC 2ZKTA 1K9MT 1UWBA 2ZWPA 1WDDA 2WK4A 3VGSA 1ZZFA 4DV1J 3V6JA 3CJ8A 2OP5A 2F4FA 3RBZA 2KI2A 1VOMA 1QE1B 2V8HA 1PKUA 3PW5A 5K14B 2IMOA 4O3RA 3OL6A 3GCWP 5LSOA 3IWNC 1KSPA 4ES1A 2W7OA 1H73A 4CLWA 3V6HA 4Y28C 3G96A 4IG3B 1NK6A 2J9DA 2ZE2B 5FJ4A 2DXDA 2DHHA 1QUPA 1BGXT 3AT1B 3CCLS 1WELA 5ETRA 3GP9A 1Y3KA 2JEIA 5KFPA 4ZVGA 5ETTA 3OTEA 5A2QY 1EARA 2QC3A 4J9PA 3R27A 3W5YA 4NE9C 4C11B 4LF6F 4NA3A 2KVQE 3ISNC 5CAAA 3M2UA 1S9EB 4M63A 2XG8A 3G6XA 1RWKB 3PHTA 3A1YG 3MDFA 5J1EB 2XWXA 3GMGA 5HQMA 3UNGC 5I42A 2V4JB 2AV5A 3MMCA 3R8YA 2UXDJ 3C8YA 2ZNZA 2ZHBA 3MMAB 2UZAA 3M8WA 2ZVSA 4ELTA 4DR6J 4J91A 2Y1RI 3HHLD 1MMNA 2LQBA 2M52A 2YQ3A 4ZIWA 4RNNA 2J6TA 2IM3A 1B7FA 2HK3A 4LF4F 3HJVA 4Y00A 2I9SA 1DZ5A 2F7VA 3PW7A 1N0VC 5GAGI 2E29A 3CCES 2CQ1A 2LU1A 4X62J 4QIVA 3FK4A 5J1PA 1IKWA 4L75A 1WF2A 4DL0C 4ED5A 3SFGA 2E7WA 1KNZA 4UF4A 3B82A 5B7WA 5A8RB 5AJ3J 3Q0AA 3CMES 2JEFA 3CMQA 1JLAA 1KKHA 4JI5F 3PRDA 5D15A 2SXLA 1GXTA 2R8JA 4TU9A 3T5LA 4CM0A 1VQOS 2UUBJ 3I87A 4HLBA 4X64F 2NPIA 3EZOA 4BS2A 3KG4A 3M1VB 4ICLB 3M8PA 1TAUA 3SZ2A 4HTIA 2IBKA 3GE9A 1TL7A 1VS3A 4XDDA 2L9DA 8AT1B 2CQ3A 5EHHA 2QJ3A 2GQCA 1NKEA 3FGVA 3HX9A 5KFLA 2PN6A 1X0FA 2BJ1A 3UVJA 3R5CA 5FLXU 3TUIC 5B0BA 4HKQA 2MKCA 3OTOJ 1KONA 2W1BA 2CQPA 2BJ3A 1KWMA 5IZHA 3IA0A 2ZJQQ 3G4SS 4PRFA 4NXMJ 3P96A 4WFXA 3Q89A 4XPCA 2C2OB 4GO5X 4DWIA 4A8OA 4DV5J 3RBDA 4CWBA 4RBTA 2RF2A 5KFYA 3C15A 1RAJA 4K59A 4OYAA 1O51A 1HR0J 3GR1A 3VAIA 4ATNA 3DDIA 3T1HF 1M5HA 3OFFA 1OMSA 1TUWA 2OTJS 2E1PA 3FCHA 2AGQA 2MLYA 3BZQA 4HHJA 3QZ7A 1WUUA 3EWGA 2WONA 1UEUA 1KQKA 3IGNA 2BMBA 1MROA 2NCKL 3B54A 4HH0A 2P9GA 4WP3A 3EXYA 1RYSA 1UL3A 2ERRA 2M8HA 4AE5A 4CTAA 1M90T 4ED8A 3EICA 1VMBA 2CAJA 5A8KA 2V9KA 3K17A 3MPVA 4CH0S 4LF1A 4YHHJ 2F4VF 2CQDA 2NXJA 5T41A 3H5SA 4UZCA 1J2VA 1AZSA 4ILRA 3BS9A 4B9SA 1UFLA 2NS1B 3BPDA 2KU7A 1BQNA 2FD2A 2AX0A 4KGMA 4YB6A 3MPYA 2H9ZA 5KFJA 2DNLA 2ZUAA 5IWAJ 2RE1A 3JXOA 1JXLA 1RBAA 1S6OA 5DM7Q 2IYGA 1RWUA 4NCBA 4OI2A 1QJHA 1LOUA 1ICEB 3MECB 1HWKA 3CO0P 2BYCA 3PX0A 3NOCA 1AA1B 4F67A 3MOJB 4A48A 1S6QB 3D5MA 2J0QD 2CA9A 1N56A 3PNIA 2Q6BA 3RZAA 4DSLA 4WZMA 3M05A 4JV5J 9ATCB 4QU7A 2BE7D 5KG5A 2FHJD 4C9DA 3CJKB 1QTMA 2DRAA 4ZCLA 1FKAF 1ZM3A 2YX1A 5KG6A 3AFGA 4CLYA 4CLSA 1ZTTA 1HFEL 1KR4A 1RI7A 2DH9A 4LF7F 1KP6A 3IS9B 2HHHJ 1X9WA 2CADA 1Q8KA 3LO3A 1P9QC 1E6YA 3JB9k 4PG8A 1JXVA 4AQYF 4F50A 1KQSR 3VCDA 5CYJA 2DR5A 2DH8A 3DKDA 1IXKA 4W4MA 5K8PA 1LW2A 2N82B 3EZ5A 5L38A 3GYXB 1PJ7A 5LM7E 3IP0A 1FK9A 2DJWA 4C3KA 3NKYA 1U09A 4ZDNA 3GPAA 4RLEA 4X4PA 4PWDB 3I0RB 4GVBB 1V5IB 1YJ7A 3DRRB 4URGA 3HVAA 1RBOB 4DQRA 1WSVA 4J5OA 3MM9B 3FEYB 2C2NA 5DG8A 2MJUA 1KLMA 4PG6A 3BSCA 4LBHA 2VOOA 1QDUB 5SUHA 4A8KA 3PO5A 1TR0A 2OEKA 3SBMA 3W2VB 2EEYA 1G6BA 1N34F 4EEYA 4YR2A 2MQMA 4WP9A 1RT6B 5F8NA 3OV7A 4DV0F 5K9FA 4A8XA 5D8HB 1G2EA 4Q2LA 2W2PP 4LBPA 3TWZA 1FKPA 3PM9A 4DDFA 3DRPA 4OX7A 2QRRA 1EQMA 1JWWA 2MQOA 3V81A 2MKKA 1QLNA 2C22A 1IKXA 2IVFB 2ZC3A 3PX6A 4ZPCA 4LR9A 1TP7A 4R25A 2FIUA 4B17A 1F6TA 1DRZA 4B3TF 3N6LA 2GJFA 3SI8A 2GMHA 3LGNA 4MKVA 1DTQA 5J2PA 2KDOA 1F5BA 1LWCA 3DLEB 5B09A 4EBCA 1TKZA 5RUBA 3RYLA 1NKBA 3LP1B 2RHSB 3OPKA 4EZ6A 3Q83A 2IYIA 2FHJA 3C6TA 1ZAXA 5GVQA 1X4DA 2W2OP 2KG1A 1N6QB 3CJTA 3ZNUA 1F9HA 4ES3A 2F40A 1TFYA 2ROPA 4DR4F 2YKNA 3RGIA 1NH7A 3MR7A 1DQ8A 2MSTA 3OT9A 3HSDA 4JI1F 2PEBA 3IAS9 2IDEA 1I5OB 1YRUA 1VIXA 4FP9A 4N76A 2R7TA 4U67Q 1PYSB 2M5YA 2JWNA 4J9QA 2BE2A 3J80Y 1T3NA 1EP4B 4A8SA 5HJYA 1W26A 1RTDA 2D69A 2HHWA 2CWXA 5HSPA 1FKOB 3TAMB 3OL7A 1G7CB 1HQEB 1MSWD 2NXNA 3A8EA 3R7NB 1HHTP 2G2YA 4Y2IA 3FEXB 4HEA9 2MY7A 2FHKA 1L3UA 3IO1A 3QIPB 4ECUA 4HH1A 5HVFA 5F0WA 3UE2A 2ACYA 3DRYA 4CLKA 5JVGQ 4KH1B 2DHAA 1CEZA 1NHUA 1HBUB 3DOLA 3B6BA 3PX4A 1QAIA 4B9MA 4DV2J 4NMLA 4CH7A 1VQLS 2V68A 3CMAS 2RU9A 1VBZA 1U8WA 3N28A 1HBNB 4B3OA 1TL3B 2XULA 1H7XA 5HROA 4DMZA 5HBMA 1LV5A 2CVIA 2A18A 2VFVA 1M5OC 4NA2A 1QUVA 2GO9A 3KK2A 3IBCB 4DX8H 2DXEA 3SIPB 1VQ5S 2DR7A 1PAUB 3V6KA 1YWXA 2LU2A 1JJHA 5J2NB 3MFHA 2OFHX 3MXHP 2ATCB 4HT5A 2ZH4A 3OXLA 4MKAA 4IO1A 3ELHA 3DLHA 4LF6J 4NLDA 2XHCA 4DL6A 3UR3C 1PJ5A 4U7UD 1NLKL 2NUUG 1S0MA 3MWBA 3T1AA 1NSPA 3CD6S 2CPIA 3E3XA 1OSDA 5KG0A 4G1PA 4GKKF 3BBCA 2W4CA 4ED0A 5GADU 2OAUA 3QRQA 1YJVA 2NSCA 3AXMA 4YB7A 4WP8A 2EBEA 1T0TV 4D3GA 3KFWX 4Y34A 3T6JA 3CT9A 4A4JA 4K4TA 4C8MA 4O3QA 3IFEA 4DU8A 4LF4J 3KLFA 4K2XA 2HVIA 2HSEB 5F8JA 1HYSB 4WU2A 3Q2TC 3ZTQA 2EK1A 3EVWA 2HNZB 3TANA 1NDCA 2GJ2A 3LP0B 2IVMA 4KPCA 2QTWA 1Q7YT 1URRA 2F1FA 2AIRB 4J9MA 1F2HA 4DL5A 4K4VA 3ZZRA 4DPYA 3FEZA 4PUOA 1R7IA 1Q81T 5KOXA 3J7AN 1BWVA 3MM7B 2BM1A 4I6AA 3CSKA 3T1YJ 3HT3A 4KGKA 2QLJB 4OHVA 4O44A 5HI7A 4HACB 4ZCKA 1TMJA 1REVB 2B8PA 3TX0A 3MURP 2ZOFA 4MMOA 4P71A 2IBOA 1TU0B 5JVHQ 2JFKA 3H4BA 5E3RA 3U02A 4TKTA 3HKZD 4ELVA 2KVIA 1YJUA 3QATA 1RT3A 5KFDA 3V5RA 3ZO7A 5AE2A 2IRUA 5KFUA 2MZTA 1F1BB 2KJWA 4NRUA 3WDOA 1X4BA 3WIUA 2Y0SD 1SL1A 2GMLA 2VONA 3VVTA 1LNQA 2HNDA 2HQIA 4QPTA 2QIFA 4K50A 3M8QA 3NOGA 3Q8SB 1M5PC 1KVJA 1WC5A 2IJFA 3C6UA 1D0EA 2H5JB 4DX5A 1UEKA 5B0EA 4OZNA 1VCTA 4DQPA 3OSNA 4LFAJ 2Z2YB 2Q1LA 1TK0A 2ZM6J 1WG1A 4DR3F 1MMDA 2J0WA 4LIRA 5KFVA 4B3MF 4LR8A 4EBDA 3QJJA 1SKSA 1IM4A 1C1BB 4P72A 1U8SA 4ZLJA 3AQOA 5KFEA 1N0UA 2C3OA 4H4KA 5CHCB 4D3HA 4KSEB 3FMBA 5LSLA 1RJJA 4I69A 2F4VJ 1C0UA 4F7VA 1XNQF 3M6UA 3LQVA 5EN1A 2DGQA 1GT8A 4NI2B 2K8GA 3K8WA 1F5CA 2ZEJA 3BSAA 4KQZA 1RAHB 4MYTA 1Q1KA 1TK8A 3QQCD 2HWIA 2WAQD 1A0OB 3BREA 3M8SA 4DV3F 1DAXA 2OEJA 5GMKa 3GSIA 1TQLA 1ELOA 1I94J 2VG7B 2GVDB 3EX7B 2J76E 2QFIA 4N5SA 3MOZA 3GCXP 3EDRB 4DSFA 1TVRB 3FSXA 4KHPJ 4WYLA 2CQBA 3NNHA 4F2RA 1RYRA 2RNEA 3FBFA 4O0IA 4WTYA 1UVMA 3KHGA 2M70A 4OJGA 4NLWA 1JLGA 4EMDA 4RR5A 4K4ZA 2AGPA 5HP1A 2CUYA 3O1LA 5D0EA 2C42A 3IBWA 3PKMA 5C2GA 2JDJA 2H48B 4L73A 4MT1A 5HJXA 1LW0A 1R31A 4FXDA 4JI0J 1SJQA 2J7KA 3VAKA 3Q23A 2D74B 1RLDA 3J7Z5 3HJFA 2K3KA 1DQAA 3TUZC 1JJ4A 3BGOP 1RZMA 1KHWA 4WIQA 3T41A 2F63A 5EWFA 3M2RA 4ED1A 1JJCB 2MTLA 4ECVA 5DQIA 2K7KA 4LF2A 2XLJA 1S9GA 5I3UB 5IFMA 4RNMA 4R0JA 2BR0A 5A6PA 2A2CA 1SCJB 2XY6A 1U1KA 2KJVA 2B7BB 4KRWA 1YITS 4NWBA 1B64A 1YGYA 4UUWA 3N0VA 3HLUA 5A0YA 1RE1B 3OXGA 1UVIA 5D4LA 3GONA 2UUTA 3POTA 2XMKA 1NK8A 1KTVA 2P6TA 5HQ8A 4RJVA 3AD7C 3ZZOA 5KT2A 1S99A 1IBKF 3ISZA 1U47A 2I38A 5CD4H 1SH0A 1HNXF 3LA0A 2FLPA 1XNRF 2B9EA 2NSBA 3R5DA 1U1OA 2J0SD 3T5KA 2ZD1A 3DDNA 3EGVA 1EAYC 1UEVA 2LYVA 3FVYA 5KG2A 5K8NA 3N5FA 4ID5A 1VQSA 1NXIA 1RAIB 2DO4A 1S12A 4OV6A 3OSPA 3HHLC 3P3DA 1NK7A 3RUBL 1U1LA 6AT1B 1BHNA 2PA3A 2DH7A 2HHPA 2HQCA 2HIYA 4OJ3A 4ZPBA 4JI4J 3V6DA 2ZWOA 4P6QA 3NNCA 3RW7A 2YNGA 4X2BA 2FC8A 3MCNA 4USJC 1CJKA 2DY9A 2K1RA 3MAQA 5KTQA 4F25A 5K8MA 3CNQP 2MB0B 1LK5A 2HMIA 3TEHB 5HMZA 2DO0A 5KFZA 5CYQA 5KFMA 4UOCA 3CEDA 2UUAJ 3M2UB 4DR4J 5DRKA 2R42A 1HWUA 1R8AA 4OZ2A 1O5JA 4CI0B 1UZDA 5GAEI 1R8BA 2DNQA 1Y9OA 3AODA 4YB5A 3QLHA 2V8GA 4OX8A 5KG1A 3H42A 3CCJS 4IFYA 2IAJA 1UKUA 1L3SA 1NUEA 3D1HA 2JH3A 3PG9A 5KFNA 2QT7A 1S6UA 3CGIA 4PZVA 1EJ7L 3P49B 1WHVA 4MKYA 2HLUA 2P8IA 3BF4A 2CPDA 1QD1A 4NLSA 1FJGJ 3ENVA 2QA1A 2JHEA 4OL8A 3TNVA 4DOZA 1RHMB 5KAKA 4ZCIA 1KLNA 1HNVA 1LFPA 4FYXB 2O3DA 4LVOP 1VC0A 1JLAB 1X5PA 1MW7A 2BE9B 2E66A 1FXRA 2CQHA 1V3SA 3MR6A 4JI6J 2GVZB 3MM5B 2ROGA 3M8PB 3M8ZA 1FESA 5IQ6A 4LMZA 4NXNF 1TL7B 3D3CJ 1FJ7A 4FKXA 5F9LA 4RU9A 1S49A 4DUYF 1PO6A 2PDAA 1U2RA 2X3DA 1B0VA 3SV3A 2LFVA 2GAGC 1EIYB 3UVJB 1ZZNA 4F4XA 1S57A 1QSLA 2HKEA 2W9CA 4QBUA 1GX6A 1SIZA 1BE4A 1TL1A 2ADCA 2M9KA 3HKWA 4QWEA 3U27A 4IOAQ 3ILLA 2RKIA 3NRBA 2JLGA 3ADAC 2NYIA 1TZ0A 2DCLA 1RGVA 4JBCA 4YP3A 2PA8D 4V19J 4F4ZA 4ZA1A 2X51A 2HFVA 1WHYA 2LECA 3KJVA 2HS3A 3W3SA 4USUA 1UCNA 2AQ4A 2NQPA 1FRMA 5LJ3Y 2WONB 4C0BA 4PR6A 1FHTA 4DV6F 3S01A 1RQ0A 5D77A 1CULA 3R5AA 4URQU 4I2PA 1ZM9A 4OZJA 3WHIA 1EKSA 2AYGA 3FSIA 2Y1JA 4LF9F 2C3UA 2YQ1A 5A8KB 1JLFB 4WFBQ 2CPXA 5CA5A 4CLFA 2C2ZB 4K7QA 3M6XA 2B9XA 4E2FB 4K8RA 4DV4F 2GC8A 2W8LA 1KDNA 3JQMA 2M7SA 2EFOA 2C2MB 2LA4A 4OZ1A 2B5JA 5F0UA 1VDHA 4ZPDA 2OPQA 4Q8EA 1IBMJ 3AAWB 4DUZF 4JV0A 3H0PA 4JOUA 4G1IA 3TZXA 3LW5C 4DN9A 5SZTA 4GKJF 4KKOB 2R8KA 2DITA 3BV8A 2VA3A 2JLEA 2KYXA 4YUDA 4P2XA 3SQGA 5KFSA 3CPWR 4ES2A 2DR6A 1U1NA 1YBAA 3W62A 2PT0A 4H54A 2CJQA 3N6NA 3J81U 4ECWA 2EBGA 4G1QA 1T05A 2NUHA 3JSYA 3IC1A 3Q8PB 3TVKA 2PGCA 2EFPA 1FDNA 2V6AA 4LFBJ 4UOHA 4WE1A 3CC7S 3UFCX 2XCAA 5EX3A 1JKHB 3OQ2A 3W9JA 4F36A 5KFBA 3TZYA 4CO1A 4KTQA 1OO0B 2LA6A 3TUPA 2FZKB 4ZCMA 2WVCA 5D3GA 3IGVA 2YWHA 4LRFA 2KFNA 3CCWA 4DPWA 3UQSA 3GIJA 2KHCA 5AE1A 1ZM4A 1VC5A 1MMLA 3PXGa 4JYAJ 4ED2A 1CS4A 1LW2B 2C1EB 1U7LA 2MZRA 4P2MA 2YNIA 3UCGA 2PFFB 2AW0A 2UXBF 2CG8A 2RQCA 4F2SA 3SSRA 5FDLB 3ETMA 5DLFA 1T95A 4X4SA 3QT7A 1SC3B 2MGZA 2VFTA 4F26A 5IXUA 2Z2LA 2MHEA 4RU2A 2XMMA 2YKMB 4IFVB 3NMAA 1F5AA 1ZS6A 4HL9A 3WX8A 2Q6CA 2G2ZA 1Q86T 2FB0A 1X0PA 1N5SA 1UVNA 4J9SA 1KLMB 1VBXA 3C14A 3PFOA 3EYZA 3IN5A 3FQLA 4DR2J 5DDPC 3WBZA 4TN2A 5IV4A 4UY85 3AHPA 4OHXA 8ATCB 2XQCA 2CJ9A 3D67A 3J81j 1FFGB 1X4GA 2CYYA 2PI4A 1AFJA 3GU0A 4N7TA 3KK1B 2XM3A 4P7VA 2BV3A 1VBYA 4EWTA 3KLHA 4NOHA 2AGOA 1SIWB 2LDIA 3CDUA 6FDRA 3TI0A 2OEMA 4G65A 3D1QA 3JSMA 1W2IA 2H3EB 2BW7A 4KGZB 1WHXA 3M32B 5K8OA 4C8ZA 2KTQA 1KVIA 1FT8A 1JMTA 2GIQA 5J2QB 3F41A 2H5IB 1DTQB 3FQKA 5J2PB 2OPRA 4RW6A 3RB0A 1TKZB 3R5JB 3DDKA 2VICA 4LBIA 4EFAC 4JB8B 4ECTA 4F8RA 3C6TB 2CJAA 5A76A 4ECYA 3I0SB 4YY3F 5GAGU 1UWAA 2XGQA 4AT1B 2KHDA 5DM6Q 1EHWA 5KT3A 2CPEA 4AL5A 1V9OA 3PV8A 3J81Y 4LSLB 1N88A 4OX9F 2ZOMA 3GZ7A 1GAOA 4TYBA 2CPZA 1WTBA 1RT2B 1TFWA 1NHKL 4HHUA 4OYPA 1RA7A 3OTCA 3QT8A 1RTDB 2OUGA 1FD2A 1XR5A 3DC2A 3K58A 3P5BP 3G82A 4JUZA 3W1YC 2Y1IA 3P4UB 4FBTA 3NGKA 2UUWA 3AB2B 1VQ7S 2FLLA 1X5OA 2GA7A 4MK7A 3D3BJ 1UFKA 4NLVA 3LWLA 3NBPB 2BQ3A 4OHYA 3KK3A 4ZP9A 2FHMA 2HGLA 3M2VA 1FI4A 3DOLB 1OPIA 4N56A 5K5MA 1WC0A 3QT6A 2F3JA 2V2ZA 1VJWA 3H5XA 5ETLA 2CFXA 5HROB 1DFDA 5HBMB 3L7PA 1T3OA 2VA2A 2XB2D 1X31C 4DUTA 2M2BA 3FKBA 4TLQA 2KFZA 2WVEA 3H90A 1R0CB 3NGSA 2ZZNA 5AT1B 2YX7A 4Y3CA 4IG0B 2XWYA 4ZPTR 2J0XA 1S0OA 4WFAQ 1FWKA 4NLOA 1IR0A 1F3VA 3BSOA 1Q5YA 2W4DA 1X4HA 3I96A 1RAAB 4C8YA 2JRSA 5FIIA 3A4TA 1NO8A 2V4RA 4LREA 2DHGA 4X65F 2XLIA 3ZZUA 3BYRA 4DFJA 5AXKA 3OR1B 3AD9C 2M8DB 3PFEA 4IRKA 1Q7LB 4P74A 4CNYA 1QY7A 2MY8A 4I4BA 4WIIA 4K4XA 2LP4A 2X1AA 2AEFA 2E5LF 1PBAA 2ZDPA 3TP2A 1N33J 2RILA 3AJDA 1S1UA 1M5KC 4HVZA 4ZVOB 1N8RT 1XERA 1Z2ZA 3VAHA 5LMNF 3KLFB 2R8HA 4C3LA 2WSFC 1IJEB 4NEZA 3DLKA 4LSNA 5KT6A 4M8LA 1HNWF 1GXUA 1CJVB 2CG4A 3R1LA 2PD1A 1S5ZA 3LF0A 2AEJA 4U9RA 4K0KF 2E9RX 3TYTA 4U96A 3RRKA 3TRGA 2DNKA 3NEKA 5LOQA 4IH6A 2KM8C 2HPUA 4E98A 4PXEA 5DDQC 2RAQA 4PUOB 1F60B 5DGAA 1TL5A 5LL6d 1T9XA 1MU2A 2LXUA 2F8HA 2MKYA 1BY9A 2RDDA 2ZH6A 2V69A 1UMJA 3WX4A 2ILYA 3HFVA 3CF5Q 4RW4A 2B4UA 3PW4A 3RBEA 3IG1B 4HHHA 3OVAA 2UP1A 1JJ2R 1RSCA 4YFUA 4CLTA 4ECQA 3R2CJ 1M1HA 2ZNYA 2AEMA 4R5PB 5D6GA 3Q86A 4M94A 2QG9B 5ITHA 4KO0B 1F9EB 2JC1A 2UUCF 3BBBA 5IM0B 4CRJA 2BOPA 3RBXA 3CJ0A 4CT8A 2HHTA 1PYOB 4ZVEA 1NBEB 2LDYA 4DX6A 1APSA 2R4FA 2ZH2A 4DN0A 2G0CA 2HNDB 4IQXA 4GC6A 4K4SA 3M8QB 3LPYA 3DGVA 5D4NA 4NLGA 3OXFA 1RHQB 1U26A 4EO6A 3BO2A 3MD3A 1F0XA 2HQ3A 3C6UB 3I56S 1Q8IA 4QIFA 3CJSA 4DR7F 2PMHA 3DOKA 4ZJLA 3IR7B 2WSEC 2OO4A 5EWEA 2ZBPA 1OS5A 2LQ8A 1PAEX 4KHMA 2EFGA 2VQEJ 3CULA 3S7RA 4JI3F 2VASA 3JQJA 4USHA 1HNIB 2E1RA 4JV2A 1CQMA 4X4QA 1HPZB 2E1MC 3H2LA 3MR5A 3SMZA 3IM9A 1EETA 4NZ6A 1C0UB 1KHVA 4Z7YA 4LT6A 3BN4A 3D0IE 2V2KA 3DRSA 1CPZA 4X84A 2HG4A 2DVIA 2DB1A 4EYHB 1WC3A 1RHKB 5CYMA 2QMXA 3NS7B 2KZMA 2XMUA 4ZVUB 1X4CA 5BJRA 2V63A 4I68A 5ETSA 1A9NB 3EGNA 2BKPA 5B0GA 3ILOA 3IXQA 4DUZJ 2W9BA 4DL7A 2YNFB 3FFIA 1D9DA 4RX6A 2HQFA 3A8IA 4DSEA 2K3IA 4GKJJ 4DPUA 1IBLJ 4QQBA 1GNKA 3AXKA 1VK3A 5FD1A 4J9LA 1WHWA 3K2YA 1LWEA 3D2WA 1FX2A 2VFUA 1U1PA 3GSDA 2XHWA 2BBEA 2FY1A 2RB7A 4NLXA 5DZ7A 1UFWA 3QO9B 4KBIA 2PMWA 3CE8A 4AL6A 1OWXA 2POKA 2ZBRA 2FPHX 3LOUA 4YS2A 2ZBIA 1LW0B 2LEBA 5CZXA 3TJ8A 3PR4A 2DNHA 4DFPA 4ZITA 4NYZA 2HZVA 2J9DE 3BH7B 4FBUA 3GYGA 2OPSA 2DK2A 3VAJA 1VGYA 4XTTA 1SV5A 4ER8A 3JS9A 2KT5A 4BWJA 4LF5F 1S9GB 1N36J 3HZGA 2FGOA 3MPWA 4DI6A 2IC3B 1R0AB 3KDOA 4JI2J 1UJ6A 4K2JA 1LWXA 3MTKA 1FDBA 2ASYA 3QGHA 4MH8A 3KKFA 3SCIE 5A0YB 1NK5A 3PRBA 4FNIA 4YB1P 5AE3A 2LQJA 4FNHA 3IRWP 4LRCA 1SC6A 3FBEA 1X8DA 4LRBA 2YX4A 1VRTA 4PXBA 3MMBA 1XTZA 2DGTA 1HMVA 4MKBA 3CUNA 2QA4S 3KJFB 5DETA 4Y6IA 2JVRA 2JVOA 4DEZA 1LXJA 4RW8B 5BR8F 4K4UA 2A6MA 5F41A 2R7SA 2CQ2A 2L48A 4P7TA 2DGOA 4ID5B 1T03B 1OYEA 1XJWB 1DLOA 1M5VC 2DNNA 2ILZA 3G8QA 3MPDA 4MTPA 3OVBA 1HBMB 1CVJA 1HNZJ 3DMJB 1M1KT 1WF0A 1YK9A 5KFTA 4MYUA 2YNGB 2BANA 1SH2A 4I56A 2BABA 1CJKB 4MFBB 2JC0A 5F8HA 4X4OA 1C1CB 3D28A 2RRNA 4K4YA 3O8WA 2CQ4A 2YTCA 4ZHRA 4UUXA 2D9OA 1RKIA 2GS8A 1T9YA 4S0MA 3VF0B 4YR3A 5L39A 1RLCL 3TQ1A 3QWPA 4ERDA 1RTJB 2BKNA 1PYTA 1HHQA 1DBDA 3CCZA 3MM8A 1HI1A 3QLHB 4NZ0A 4WK1A 2ZITA 2DBBA 2EG1A 3E8OA 4IFYB 1XMQF 2IAJB 4DR1F 1OPZA 4CLUA 3AA9A 4F4KA 3CW2C 3U1MA 4ZVPB 4X4NA 3KLEA 1R89A 2BOAA 4FF2A 3H2VE 1J5EJ 4DV7F 3HT0A 1S0NA 4LFCF 2EC2A 3QRRA 4RPFA 5KT5A 2JSXA 4EU0A 5A2QU 1PJ6A 4FF1A 3TO8A 2ATLA 2OTLS 2OSQA 3DI6A 4USTA 2E5GA 1RCOB 1QE1A 2GCFA 4DG1B 1GX5A 3OFHA 5K14A 4RW9A 1G3OA 4OYIA 3NNAA 5L1KA 2QYGA 1O6XA 2PC6A 2HQDA 1UW9A 3OR2A 3KG1A 3ZZPA 5L8RC 3G71S 2BEFA 2JOQA 4B9TA 4ECXA 4Q44A 5A6WA 4NLQA 2UXCF 1H2UX 4DQIA 3UWTA 1BQMB 2O66A 2GIRA 4N77A 2H5EA 2EVZA 4LSZB 4DS5A 1L3TA 3KLGA 3RU0A 3TOQA 2E5HA 3EDQB 5J2MB 4C4WA 2AWZA 3HVWA 2XS2A 3D0HE 1FTRA 5L9NA 3L9ZA 2KB2A 1FJCA 1HKAA 2RDIA 1U1RA 1MNEA 3KG0A 4I1TA 1NJWA 1FXLA 2W2MP 3PIOQ 5L46A 1NJIT 4FPIA 2DIUA 3AJ1A 2HURA 3LGHA 2Z58B 2FVPA 3K59A 2OSRA 3KJVB 3GFYA 2DNPA 4MIAA 1TKDA 3FUYA 4PG4A 4WBFA 2R7OA 4L6V3 1MLAA 2AJ0A 2W2NP 3PIPQ 3IR5B 1GH8A 4I2PB 4B3RJ 2FJEB 4K0KJ 2FJDB 4ZK7M 4TQRA 4RUHA 1XMOJ 2XO6A 3C46A 5DGBA 1NJXA 4J9RA 1YZ6A 1P8GA 2RJZA 2VOPA 4ZLPA 4LF8J 2VH7A 4OI4A 1VBKA 1T9UA 1WACA 2X1FA 4AYBD 2KH9A 2IHR1 2WCXA 3PYFA 4ICLA 4QPXA 2BJEA 5JUMA 5HMYA 3VGVA 1IWAA 3TA2A 5BYSA 1DTTB 6FD1A 4KAIA 3NL0A 2PE8A 2X1GA 3R1HA 3HULA 2B5JB 2X3GA 2Q3PA 2Z2ZA 4IKAA 3UDLA 1ROFA 2NXUA 4RL1A 2OPQB 4M5JA 3MCSA 2XMAA 2QL9B 1HQUA 3NG8A 1H0HB 4F02A 4PQUB 1ZH5A 1TMMA 3Q24A 2G0JA 5L9XA 2OFGX 4U7CA 2MLXA 1KC8T 2CXEA 1NPRA 4DCPB 3QPIA 2VBYA 2X1BA 2LQ9A 5KG3A 1FNXH 2J7UA 4I0WA 1ULRA 2CNKB 3SCKE 3CD0A 5CD4A 3EM1A 2VPYB 4DR7J 2IDLA 4IH5A 2FVQA 1Y4ZB 4PXDA 2DNRA 3CJ4A 1MG7A 4DS4A 2ALYB 1RT7A 2V34A 2RMLA 1RAOA 3A8JA 1CBKA 3UCZP 2IM1A 2YPYA 1GFWB 2HGMA 2CIMA 4K5RA 1D3WA 1SB6A 1CS4B 1LFWA 1BC6A 2RQ4A 9RUBA 4HTJA 4ZVTB 5ETVA 5HN0A 3M4XA 4FF4A 1S9FA 1NU4A 4DL2A 3QZ8A 2NPFA 2UVRA 1Q4RA 4GVLA 1W25A 1U6FA 1KFSA 1R27B 4UOFA 1NSQA 4F3MA 2KG0A 4TLRA 5D4OA 2QSWA 4WFZA 1X4FA 3TAQA 5HAOA 3ILJA 3CIZA 3K5OA 3T19A 3TR5A 3VQTA 4TY9A 3I55S 2NXEA 2LXFA 4N8NA 2RS8A 1YRTA 3MECA 1UVJA 3OJUA 2HFUA 1N5YA 1FJEB 1S6QA 4ZOSA 2H65B 3NCRA 2DNYA 3BPSP 2FC9A 2OKQA 2R7RA 3HP6A 5E41A 1KQGB 5T7LA 1RADB 3KLHB 3CD7A 4NLUA 5GAEU 2B4VA 2QEXS 2BXJA 2QL5B 1TKTA 1T9VA 5IC6B 1IBCB 3JSMB 2MQ8A 1SL0A 3UDCA 3SFUA 3K5PA 1P6TA 4NZ7A 3RTVA 2MZSA 1H2TZ 3BB5A 3HVTB 3IS9A 1U0SA 2RRBA 1NK4A 2CWKA 1DJ0A 5CCMA 2H51B 3MEDB 3VVUA 1K1QA 3RAMA 1S72S 3HHLA 3JYTB 1YDLA 1N4LA 3SQOP 1U25A 3RW6A 5F8IA 4Y2MA 2BDPA 3OJSA 2VBWA 4Y65A 2DRBA 3I0RA 2YH1A 3JAMU 3AOBA 1MN7A 3DRRA 2H4WB 2C3MA 3NWRA 2J9EA 4M5KA 3KUHA 4KH0B 4AFFA 1N32J 3MM9A 3G82B 3BQ1A 2W7AA 3PR5B 4A8MP 4OFZA 1YQHA 1IKYA 3MAAB 2FLNA 4ANDA 3W2VA 1BUXA 4QIEA 3N79A 1KRPA 4DPOA 2FJWA 3SSQA 1YZ7A 3KK3B 4DV1F 4QR0A 3EPGA 3UDEA 3M2VB 3CC4S 4B3SJ 3M6WA 1D1UA 2AYEA 1RTIB 5E0OA 3UNYA 5KFGA 4ZLNA 3QNWB 3F56A 5IS2A 2NYHA 4WFYA 3DLJA 2XLKA 2G1HA 2V8DA 2HBZB 4P52A 1LWFA 2R2UA 3QRPA 1NHVA 1EB0A 2BX6A 3J80U 2QA4G 4ZPVR 3PY8A 1JLQB 1B4SA 1SKUB 3LUYA 2XSFA 3D4JA 1Q5VA 1SQGA 2AYBA 2MDAA 3LP1A 4IDKA 1RT4B 2IRYA 4IH7A 3CIMA 3THPA 2E44A 2DISA 3R2DJ 3ENWA 2A6OA 3NGTA 4Q45A 5F8MA 2M4MA 4NYOA 1LKZA 3G8SA 3LPEA 5KFQA 3K5LA 3AOCA 1U2CA 2ASJA 1FDDA 3MUVP 2A0FB 2UV8A 4NCGA 2V67A 4PWWA 1TUGB 4A8WA 4QYZJ 2YQ0A 4P75A 2UXDF 4KC5A 1F9FA 3GQCA 3GIKA 2HHVA 5LXRA 4R8UA 4GRSA 1DARA 4DR6F 4USMA 1HQEA 2R7QA 3L4BC 3BJYA 2BACA 1LK7A 3I9V9 1FRJA 4DV7J 4I6WA 4TQSA 4LFCJ 5CH7B 4WZQA 1EX8A 2XNRA 3IAM9 2RQMA 5KFAA 1FRHA 2WBMA 2PEHA 1Y3JA 4X62F 4FYYB 3DLKB 2APOA 3QIPA 4LSNB 4F0HA 3DOMA 1HI8A 2DT9A 5I4MA 2VFSA 1SKWA 4QWCA 5AJ3F 3O2IA 3UN3A 3VQSA 3JAMY 2J9CA 2LCWA 1JLCB 1U49A 2CPJA 1TL3A 3OTDA 2VBZA 1XWLA 4M95A 1YBTA 1BXNA 3CCRS 1MU2B 2QLFB 1XK8A 2UUBF 1ZTWA 2G2OA 3PEHA 4PABA 4RW4B 2IRXA 2JX2A 5J2NA 3KYLA 1S1WA 1WI8A 3AOAA 1GEHA 2LLZA 4UTGA 4CZCA 2D3OR 1D09B 4X66F 1WG5A 3HK2A 4YEAA 4QYZK 4QW9A 1VQ9S 5E5NA 2WBRA 2NREA 2N7YA 1T94A 4JI7J 5IC4B 2R7XA 3DU5A 2BKOA 2VU5A 5KFKA 1T9WA 1FX4A 4QIGA 2FTRA 3RAQA 2KXHA 3OTOF 2GV1A 1KOHA 1K1SA 4NXMF 5IT9U 2DGUA 5DG9A 2JNJA 3H20A 3HHNB 2VG6B 4I7FB 4DV5F 3KNAA 4M5DB 1HR0F 3CJ3A 1B99A 4ETZA 4C3MA 3H25A 3DOKB 4A46A 3DN9A 2VQFF 3GJQB 4F04B 4IRCA 5LSRA 4PCQA 3LP0A 2GHPA 2X7IA 1EKRA 2GGPA 3PJ9A 4OIXA 2XY5A 3G8TA 5C7PA 1S7HA 4YDXA 2B0GA 2WTFA 4CP5A 1VHFA 1FNOA 3DNCA 1AXQA 4YHHF 3MM7A 3ZZYA 2E7XA 3ITHA 2JZ5A 2GQQA 3DRSB 2Z57B 3LANA 4Y2CA 5CYMB 2ZC4A 1FNMA 3D66A 2EK6A 1W2BR 5IWAF 3RG6A 1S1TA 1WJ9A 3R6GB 2R7VA 1RAFB 4DU7A 4NASA 3FFIB 3T5JA 1KQFB 4OZ0A 3CCVS 4XPEA 7AT1B 3NGRA 2XI3A 2DNOA 4I2QB 1P1TA 3P6YC 4CO3A 1LWEB 4MIWA 1UA0A 4ZJOA 2JLFA 5E33A 2HZCA 4A8YA 2QMUB 2B56A 4F0MA 4JV5F 3M30A 3FJ2A 2HYIB 4OYWA 2Y1LB 2I0XA 3BGRB 1U0HB 2DKOB 2MQQA 1U1QA 2R3VA 4CNZA 2F9JA 2HFSA
chains in the Genus database with same CATH topology
4JB8B 2QLBB 3R6LB 1RWKB 2HBZB 3KJFB 1F9EB 1RHUB 4ZVOB 2FQQB 2H48B 3IBFB 2XYPB 1BMQB 2P2CB 3GJSB 4LSZB 2CNKB 3GJRB 1I51B 3R7BB 1RHKB 3D6FB 2XZTB 2H54B 2CJXB 1PYOB 3NS7B 3RJMB 1QDUB 3D6MB 2CDRB 5K20B 4ZVPB 3R6GB 1RWOB 4ZVSB 2C2ZB 4ZVUB 3IBCB 3EDQB 1SC4B 4DCOB 3SIPB 1RWWB 2H65B 2H4WB 2HBQB 1RWNB 3P45B 1PAUB 2C2KB 1RHQB 2HBYB 3GJTB 3KJNB 2H4YB 1RWMB 3EDRB 1GFWB 1NMEB 3R7SB 2QL7B 1RHJB 4DCJB 1I3OB 1RWXB 2XYHB 3GJQB 2H5JB 2CNOB 2QLFB 2Y0BB 3P4UB 2C2MB 2QL5B 5IC6B 1IBCB 3KJQB 1QTNB 4ZVTB 2QL9B 3R7NB 2C1EB 1RHMB 2C2OB 2XZDB 1RHRB 1SC1B 2QLJB 4ZVQB 2Y1LB 1RWVB 2CNNB 2H5IB 1RE1B 2CNLB 4ZVRB 2H51B 1SC3B 2DKOB 1ICEB 1RWPB 3D6HB 2HBRB 3R5JB 2CJYB 3QNWB 4DCPB 2XYGB 5IC4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JB8 B;  2QLB B;  3R6L B;  1RWK B;  2HBZ B;  3KJF B;  1F9E B;  1RHU B;  4ZVO B;  2FQQ B;  2H48 B;  3IBF B;  2XYP B;  1BMQ B;  2P2C B;  3GJS B;  4LSZ B;  2CNK B;  3GJR B;  1I51 B;  3R7B B;  1RHK B;  3D6F B;  2XZT B;  2H54 B;  2CJX B;  1PYO B;  3NS7 B;  3RJM B;  1QDU B;  3D6M B;  2CDR B;  5K20 B;  4ZVP B;  3R6G B;  1RWO B;  4ZVS B;  2C2Z B;  4ZVU B;  3IBC B;  3EDQ B;  1SC4 B;  4DCO B;  3SIP B;  1RWW B;  2H65 B;  2H4W B;  2HBQ B;  1RWN B;  3P45 B;  1PAU B;  2C2K B;  1RHQ B;  2HBY B;  3GJT B;  3KJN B;  2H4Y B;  1RWM B;  3EDR B;  1GFW B;  1NME B;  3R7S B;  2QL7 B;  1RHJ B;  4DCJ B;  1I3O B;  1RWX B;  2XYH B;  3GJQ B;  2H5J B;  2CNO B;  2QLF B;  2Y0B B;  3P4U B;  2C2M B;  2QL5 B;  5IC6 B;  1IBC B;  3KJQ B;  1QTN B;  4ZVT B;  2QL9 B;  3R7N B;  2C1E B;  1RHM B;  2C2O B;  2XZD B;  1RHR B;  1SC1 B;  2QLJ B;  4ZVQ B;  2Y1L B;  1RWV B;  2CNN B;  2H5I B;  1RE1 B;  2CNL B;  4ZVR B;  2H51 B;  1SC3 B;  2DKO B;  1ICE B;  1RWP B;  3D6H B;  2HBR B;  3R5J B;  2CJY B;  3QNW B;  4DCP B;  2XYG B;  5IC4 B; 
#chains in the Genus database with same CATH topology
 2XEX A;  3R3T A;  3TZZ A;  4QWD A;  5T14 A;  3CC2 S;  2WVF A;  2MQN A;  1FD8 A;  2HHH F;  1U24 A;  1TEL A;  1OY8 A;  3G87 A;  2DGX A;  3T5H A;  4OHZ A;  1YG0 A;  4H4O B;  5IT9 Y;  4JI5 J;  1FRX A;  2EKY A;  3F73 A;  1SV5 B;  3SCJ E;  5GAH I;  2KYZ A;  4WYW A;  1SUQ B;  4EI2 A;  3QFH A;  2GMJ A;  4X64 J;  1RAB B;  4NI2 A;  3D0G E;  4AXI A;  1Q95 G;  3KXD A;  2RIJ A;  4ED4 A;  3JQK A;  1D9F A;  2HNY B;  1KN6 A;  1HBO B;  2E7V A;  3U7J A;  2QLX A;  3O6Q A;  2VPX B;  3PJX A;  1VQ6 S;  1CG2 A;  3AH6 A;  4OI6 A;  2D3O 1;  2J5A A;  1UAW A;  4FZV A;  2G1D A;  3D1O A;  4ZKA A;  2DCU B;  5C2C A;  3SDE B;  2W01 A;  1NCL A;  4DBQ A;  1WTF A;  4E0D A;  1HMV B;  2E1C A;  1TL4 A;  1FE0 A;  2J6U A;  5D0G A;  5B0F A;  4NL5 A;  2QV6 A;  1JXE A;  3W5X A;  3MAH A;  3GLJ A;  2ZZM A;  4FS2 A;  1YHQ S;  3DCA A;  2C2R A;  2P9C A;  5I3P A;  3EUN A;  3T1H J;  4TY8 A;  1RAC B;  2QE5 A;  2QMW A;  4C8O A;  1SJ4 P;  3TQE A;  3FMW A;  3V4M A;  1RWN B;  4NYP A;  2ZZT A;  3RB6 A;  2C28 A;  2BAN B;  3EGW B;  1FVQ A;  1RAG B;  2Z0G A;  3GWC A;  2QLW A;  3HMJ G;  3VWS A;  1IN0 A;  2B6A A;  1NM2 A;  1X60 A;  4DSK A;  3CCQ S;  1QTN B;  2WW4 A;  3JTP A;  2GAH C;  2A2D A;  3UR0 A;  2K2P A;  4J9U E;  1TK5 A;  3GIM A;  3S8S A;  4J9V A;  2QO3 A;  3Q8V A;  4HI1 A;  5I3U A;  2I5J B;  1IKV B;  3W8G A;  3SSS A;  3KHR A;  1IR2 A;  4NA1 A;  2CDQ A;  2BJ8 A;  2XY7 A;  3MM8 B;  4LIW A;  4WWS A;  5AXL A;  2CPH A;  1FWP A;  2J6S A;  3MUT P;  4X4R A;  5EUH A;  1R0B G;  3RJM B;  2RD5 C;  2PSZ A;  3KLE B;  1VRU A;  2OD6 A;  2JFD A;  3RB3 A;  1JLE B;  3BDP A;  4RW7 B;  1YJR A;  5M2U A;  3LAM A;  3H8Y A;  2O67 A;  5DS7 A;  3UI3 A;  3DI6 B;  4ETX A;  1S59 A;  2QL7 B;  4DV2 F;  4RW9 B;  2IVY A;  1UVL A;  2FGC A;  2OPP B;  4U7U K;  3MD1 A;  3FBC A;  2DNG A;  3OR2 B;  4TU8 A;  2D7S A;  1KS2 A;  5DJB A;  4J9N A;  5KFF A;  2ZH1 A;  4KR0 B;  3OFE A;  5G0R A;  1NDL A;  4LF7 J;  1DQ9 A;  1WKL A;  3QJL A;  4BHQ A;  2M3D A;  3KNG A;  3FSY A;  4RUC A;  2B4O A;  2RUS A;  2QGF B;  1L5U A;  2DIV A;  4AQY J;  3BKU A;  1PCA A;  3B4D A;  3GJS B;  2BRL A;  4XO0 A;  2EWH A;  2MKS A;  3KLG B;  4OHW A;  3FZ2 A;  2CVE A;  3I9Z A;  2CQG A;  3KMS A;  3OLA A;  2DHS A;  3BSN A;  1P1L A;  4DSJ A;  2FJX A;  1A7G E;  3M8Y A;  1QAJ A;  3D54 A;  1WEZ A;  3TUJ C;  2GIF A;  3MGJ A;  3BH6 B;  4OMF G;  3R7S B;  3BR9 A;  1UP1 A;  2Z8Q A;  4P73 A;  4QIW D;  4DLE A;  3HO1 A;  1IUJ A;  2KO1 A;  1H6K X;  3KHH A;  4ZVQ B;  1N34 J;  1UWB B;  3CDB A;  2VUG A;  1X9S A;  1S7I A;  2VF3 A;  1KEK A;  1O8B A;  4DV0 J;  1NAQ A;  1NKC A;  3T9Z A;  3OFG A;  1V3R A;  1JIH A;  2HGN A;  3CXC R;  1VQK S;  2CZV C;  3IBF B;  2V94 A;  4O3N A;  1ITP A;  4B9U A;  4U95 A;  2ZH8 A;  3NAH A;  2IA0 A;  2OH2 A;  3F0N A;  4B3T J;  2GVZ A;  5JMN A;  5DLG A;  3T1Y F;  5HVH A;  3MM5 A;  4O3P A;  4JP8 A;  2YVS A;  2KXF A;  2CZ4 A;  3ENA A;  1H98 A;  2HVZ A;  4ENO A;  2GJI A;  2YWF A;  3EXC X;  3PZP A;  1WEX A;  2H4Y B;  2HRU A;  4F4A A;  2HFZ A;  4X66 J;  2QFJ A;  2ADB A;  2JL9 A;  3ZXW A;  4WPA A;  1HQU B;  4ZLL A;  1DHM A;  2BUN A;  4KE5 A;  2Z30 B;  3EPI A;  3K5M A;  4FYW B;  4O4G A;  2IFX A;  4OZL A;  1HA1 A;  4JI1 J;  1VYA A;  4A8Q A;  5I42 B;  4EZ9 A;  3MMC B;  3EJM A;  4F0K A;  4NCA A;  4KGV B;  2AHO B;  4DL4 A;  1TKX A;  4Q2M A;  2XCP A;  2RSQ A;  4OI1 A;  1CQN A;  5CXT A;  2QLB B;  3BQ2 A;  4OYZ A;  5C42 A;  3VAL A;  3HD1 A;  2FZC B;  1GMV A;  2R8I A;  1R3N A;  1NDP A;  4O23 A;  4DXL A;  1QVF R;  2DTJ A;  2YWK A;  2MKI A;  2E9Z A;  2MXY A;  3I4H X;  2ROE A;  4P9S A;  3BBF A;  3W5Z A;  4LFA F;  3D68 A;  2VQF J;  4CDI A;  1RT7 B;  4OX6 A;  1ZAW A;  1IKW B;  2ZM6 F;  1J27 A;  3J7A 1;  4ANC A;  5U47 A;  3J7Y U;  4IYQ A;  2B43 A;  8RUC A;  3O44 A;  4JV1 A;  1X4A A;  1JLF A;  4BC7 A;  5F3T A;  2FJB B;  5HK4 A;  2F8M A;  1RTH A;  3OUY A;  2A3J A;  2ABY A;  1EQ0 A;  4RNH A;  1P9Y A;  1XR7 A;  5H9F J;  4Q0B A;  5G4D A;  5KFI A;  1QM9 A;  1SKR A;  2QA2 A;  3S1T A;  4G3I A;  2VZ9 A;  3RRH A;  5M2R A;  3ZC4 A;  3SV4 A;  1I94 F;  2H1Y A;  1L3K A;  1YLX A;  1H38 A;  4QCL A;  4IR9 A;  2VPZ B;  4OQJ A;  3BEG B;  4KHP F;  4KKO A;  2J8S A;  2GZO A;  4GKK J;  3B8H A;  3W61 A;  1HI0 P;  3PEJ A;  4K4W A;  1R8H A;  4XK8 C;  1N5Y B;  2P9E A;  3I4P A;  2EC0 A;  3KLV A;  3ZFV A;  4QWA A;  1VFJ A;  1X4E A;  3DXB A;  3GTY X;  3OHB A;  1T02 A;  2ZDO A;  3WIV A;  2HBQ B;  1VRQ C;  4F4Y A;  5T7L B;  4RUB A;  2RF2 B;  4M5L A;  3C15 B;  1VQP S;  4MAK A;  3DXS X;  5KFX A;  1YBU A;  1TKT B;  1CSJ A;  2G0I A;  1PSD A;  3G9C A;  3G6V A;  3Q2S C;  1ZA2 B;  1JKH A;  4Y0F A;  5F8L A;  3G6Y A;  4JI0 F;  2AJQ A;  4PG7 A;  3GV5 B;  1MRO B;  4Q5V A;  1NEE A;  2YWE A;  1RXO B;  2RH3 A;  3MEK A;  5FLX Y;  4M5G A;  3HHL B;  2WW8 A;  4CTA B;  5H9F K;  3D6H B;  1NPK A;  2J8A A;  1VQN S;  1S77 D;  2N3L A;  1SH3 A;  4USV A;  4BLG A;  1ZPW X;  3VZH A;  1WNE A;  4NLT A;  1D9A A;  4C0O C;  4XAK A;  1AZS B;  2YNH A;  5DO2 A;  5FDL A;  4EBE A;  2OHD A;  1WC4 A;  2HAF A;  1WC1 A;  1WEY A;  5E3Q A;  1BQN B;  2EFN A;  4L76 A;  4TYA A;  2YKM A;  5IT4 A;  4IFV A;  1Y0H A;  3QGP A;  5HLF A;  2V0N A;  2VDI A;  2COL A;  2WOM A;  3L7O A;  5D78 A;  4X4V A;  2HVD A;  2I6W A;  3IR6 B;  1MWZ A;  4FN5 A;  1IKY B;  2YKO A;  4RBV A;  5E3P A;  3HFZ B;  2Y0B B;  2VG5 A;  4OV1 A;  1GTH A;  3R5B A;  3BM7 A;  4HDH A;  3HF5 A;  3QT5 A;  3KK1 A;  2KXN B;  3PJW A;  4DLG A;  2KZZ A;  1FO1 A;  2AT1 B;  4RNO A;  3EVM A;  2ZBC A;  2RU3 A;  1B3T A;  1IJF B;  1RT5 A;  4H4M A;  2MKH A;  2DXF A;  1OQ3 A;  1FF2 A;  1SJ1 A;  3N01 A;  2BQR A;  1LWF B;  2HFO A;  3R6L B;  3M32 A;  2ZHA A;  2C2E A;  3AD8 C;  4R0E A;  4C48 A;  5J2Q A;  4P10 A;  5GME A;  4WTO B;  4JI4 F;  4LRD A;  2VJV A;  1CC7 A;  2QSF A;  3DU6 A;  4C6A A;  4DR3 J;  2BM0 A;  4WXO A;  3FBB A;  3CCM S;  3VAF A;  1HIY A;  2CDR B;  4B3M J;  2KFY A;  4IDK B;  1K0T A;  2HRY A;  1ZOT A;  3ZZT A;  1JLB A;  2WRM A;  3PW0 A;  1E6Y B;  4RNF A;  2BW2 A;  4A8F A;  3IWX A;  3C2P A;  2HLT A;  1XBW A;  3I0S A;  2AMC B;  4DQQ A;  3BYP A;  2FYX A;  2O1P A;  2RUG A;  1FK9 B;  3I82 A;  1KTQ A;  1XNQ J;  3CJ2 A;  3GIL A;  2UUA F;  1RWM B;  2VHG A;  2AJF E;  3PTW A;  2PFD A;  2AP6 A;  2L3M A;  3TEG A;  4LSL A;  1T7P A;  3LGM A;  2NZC A;  3DM2 A;  5D0R A;  4FDF A;  1KVK A;  3DLL Q;  1U6B A;  4NCG B;  3SCL E;  4EYI B;  1NB2 A;  1QAY A;  2GX8 A;  4IUF A;  1RT2 A;  4DV3 J;  4TXS A;  5E7O B;  4OJ1 A;  4O0N A;  2LQ5 A;  3E51 A;  2EI5 A;  1TV6 A;  2MKJ A;  2LKZ A;  1CJT A;  3MEE A;  4R8U B;  3G6E S;  1CC8 A;  3QFW A;  3U1L A;  3V4I A;  3LP2 A;  4J37 A;  5LXY A;  4OYO A;  2NLW A;  3ULH A;  4C97 A;  1J5O A;  3NWG A;  4M5I A;  4BBY A;  1NZ8 A;  3NBP A;  1FJG F;  2C3P A;  4C98 A;  3MFI A;  2C2D A;  1HLW A;  3DOM B;  3KUE A;  4F3Q A;  1FKP B;  3OTB A;  3UPF A;  3DRP B;  2HHX A;  3V81 B;  3L3C A;  1IKX B;  3GR0 A;  4FYD A;  4OI3 A;  1Q53 A;  4JI6 F;  2ZH5 A;  1F3F A;  2CPF A;  3CJR A;  1LWC B;  2XS5 A;  1OSC A;  4PYA A;  3AJ2 A;  2DNM A;  1UZH A;  5DZ6 A;  2FY8 A;  1YTY A;  2B8Q A;  4ECZ A;  4IG0 A;  4AL7 A;  1S1W B;  1FEH A;  4RUA A;  1WOS A;  3QID A;  1FRL A;  2Y8W A;  2WB1 D;  2F9D A;  3A3P B;  2XMV A;  1HW8 A;  2YKN B;  3US5 A;  4ZN1 A;  1GMU A;  1Y00 A;  1HWI A;  4ILL A;  1SQF A;  3THV A;  5I3Q A;  4PAA A;  4WU3 A;  3OR1 A;  1OY9 A;  2Q66 A;  2BE2 B;  4Z2X A;  3ZTO A;  2RDJ A;  1IM6 A;  3RR7 A;  4YDD B;  3DGP A;  3CDA A;  3N9U C;  1FEE A;  5BYQ A;  3ZTS A;  3JTO A;  1GTE A;  3DYA A;  2LEA A;  1M5S A;  5M2P A;  5ETK A;  3BGU A;  1RUS A;  2OI2 A;  4M1K A;  3WQP A;  4DPX A;  4FVM A;  3VGU A;  1IBK J;  5C24 A;  1U45 A;  3OD2 A;  1FER A;  1HNX J;  5HQL A;  1XNR J;  3D9B A;  5DQG A;  1HAR A;  5H1S V;  3UD3 P;  1CJV A;  2LEP A;  1YKW A;  2GGP B;  4USK A;  2HK2 A;  5KT7 A;  2Y9H A;  3H2U B;  1JB0 C;  3HI9 A;  4B3O B;  1CJU A;  2CNL B;  4L3N A;  2HHU A;  1Z2L A;  2CJY B;  2HIQ A;  1QVG R;  3ITH B;  2HS4 A;  3KK2 B;  3VAM A;  4EK2 A;  5DQH A;  3CJQ A;  5B0A A;  4A47 A;  3OL9 A;  2VKZ G;  5MLC V;  3TA0 A;  3CDE A;  1LXN A;  2P5V A;  2L9N A;  3IG1 A;  3D6F B;  1S1T B;  1VQ8 S;  4P2F A;  4DSI A;  3ET6 A;  2YKQ A;  4OYX A;  2ZVI A;  5CAB A;  3EGZ A;  4QYR A;  2CJK A;  1IBM F;  1R43 A;  3HXM A;  4R5P A;  2IMW P;  4U8Y A;  4LRA A;  2F5G A;  4KO0 A;  4OZ3 A;  4ID8 A;  5IM0 A;  2F65 A;  4MK9 A;  3W60 A;  2ZFH A;  4I64 A;  1Q82 T;  3PO4 A;  2OMO A;  1S1V A;  3H98 A;  3QGI A;  1S97 A;  3M30 B;  1U4B A;  3ONQ A;  1PG5 B;  4KIA A;  4CIO A;  3KUG A;  2XSJ A;  1WWH A;  3OBI A;  3GV8 B;  4LFB F;  4ZVR B;  3ENQ A;  2U1A A;  2O01 C;  3HZE A;  3H40 A;  1YJN S;  1NK9 A;  3R97 A;  3U1N A;  5ADZ A;  4IRD A;  3VAG A;  4KT0 C;  3MR2 A;  1RU1 A;  1X5S A;  2MYF A;  3GG0 A;  4BCA A;  1HNI A;  2G9O A;  1PIL A;  5HL7 Q;  4BDP A;  1FE4 A;  2KT2 A;  4JYA F;  2CJX B;  3ZTR A;  1HPZ A;  5H9E J;  1HHS A;  4BC9 A;  1E6V A;  3O5T B;  3H5Y A;  7FDR A;  3JSB A;  2HWT A;  5E2Q A;  3K8V A;  4QJV A;  4O44 B;  3QYY A;  1RT1 A;  2MQP A;  4NXN J;  1NPP A;  1C0T A;  4TNO A;  3QGG A;  2GQ2 A;  5L1I A;  1RHJ B;  4DQS A;  2W7P A;  4Y2A A;  3PYD A;  4DUY J;  2V2V A;  3I5B A;  2YY3 A;  3OVS A;  2D3U A;  4E8U A;  1SI9 A;  2W24 A;  2HW3 A;  2W8K A;  5IV3 A;  3MUM P;  5F8G A;  2YNF A;  4NRT A;  1RT3 B;  3X3U A;  3SYZ A;  4DR2 F;  4C8N A;  1M1G A;  2CNN B;  1Z1Z A;  1C4A A;  3WC2 A;  1G1X A;  2XGP A;  2ACM A;  2R7U A;  1D8Z A;  4HR2 A;  2BJ7 A;  1WF1 A;  1HD1 A;  2KKH A;  2FQQ B;  3M9O B;  3MM6 A;  3BGF A;  3CVK A;  4ZPW R;  2OML A;  3A13 A;  3Q8U A;  3PAC A;  3KLI A;  2WB4 A;  5THW A;  1D8Y A;  2FUG 9;  3GFH A;  3QO9 A;  3L7U A;  3QWU A;  3PRV A;  4TY8 B;  5ETN A;  2I2Y A;  2HHQ A;  4CCH A;  1RU2 A;  1NJZ A;  5AXM A;  1BD6 A;  4DV6 J;  2MQL A;  3T9N A;  3TAP A;  5H9E K;  4OI0 A;  1DY3 A;  4IOB A;  1S4F A;  4PPZ A;  3Q8Y A;  4LF9 J;  2B6A B;  1R8C A;  1K0V A;  2ZH7 A;  2AJ2 A;  4DCJ B;  5B08 A;  4WKY A;  4RKU C;  2IJN A;  4KB7 A;  3JTN A;  2FZG B;  1NRK A;  4DZ6 A;  3FZB A;  3K0J A;  3GFZ A;  3HSG A;  3BN7 A;  3TVY A;  1PGZ A;  2IA6 A;  4XDC A;  3W2W A;  4DPT A;  4AD6 A;  3IRX A;  4DV4 J;  3DLG A;  5KFR A;  2KT3 A;  4I6Y A;  3VR1 A;  2IC3 A;  3M7V A;  1R0A A;  2WVB A;  1ARO P;  3NCP A;  3VZI A;  1U02 A;  2XO7 A;  3LWM A;  4WK3 A;  5C25 A;  2HQG A;  4RBU A;  4C0H A;  5HVG A;  1R6V A;  2DNZ A;  1SVD A;  1IQT A;  1VRU B;  2U2F A;  4CYU A;  4Q8F A;  1PBU A;  1YSJ A;  5KFH A;  2GHW A;  1FWL A;  1VJQ A;  2C2K B;  3DHX A;  4RW8 A;  1NND A;  3QSI A;  3M6V A;  1NSA A;  4ECS A;  4UQG A;  2DPJ A;  1VLO A;  2AF6 A;  3PVX A;  3CTR A;  1I3O B;  2XYH B;  1T03 A;  3BQ0 A;  2OEL A;  1JLG B;  4PKD B;  2L08 A;  4CLP A;  4NX9 A;  5E3A A;  2BRK A;  5HP1 B;  3AY0 A;  3K7R A;  1HBM A;  1XN9 A;  1URN A;  5LJ5 Y;  3DMJ A;  5G0R B;  3H7H B;  3H59 A;  1OIA A;  5C5J A;  2VDH A;  2AZ1 A;  5DDR C;  2EFQ A;  3FC9 A;  3E01 A;  3VV2 B;  2FVS A;  3AQP A;  4MFB A;  2EPI A;  1C1C A;  2KM8 B;  4YOE A;  1SJ3 P;  1XR6 A;  3W8P A;  2YWG A;  2AZ3 A;  3N4W A;  3AA8 A;  2DR9 A;  3M2R B;  1UA1 A;  4N41 A;  4KV8 A;  4ECR A;  2BA9 A;  4MJK A;  1Q78 A;  3UO0 A;  3D7S B;  1VK8 A;  2UXB J;  2Z4P A;  2W2Q P;  1RTJ A;  3QSY B;  3MMJ A;  1KBR A;  2XBP A;  2QN6 B;  1ZM2 A;  2WHO A;  1S6P A;  3ILI A;  2N3O A;  4ITS A;  3HHK A;  2HBY B;  3TX8 A;  1Y5I B;  3UD4 P;  2IJR A;  5IOL A;  4QR1 A;  4FS1 A;  3GV7 B;  2HS0 A;  2OIH A;  3VGT A;  2YXL A;  1N33 F;  2HHS A;  3POT B;  1N48 A;  2MZJ A;  1ZBT A;  3IWL A;  4UZB A;  1FCA A;  4J9O A;  4KFB A;  3GG1 A;  2QX0 A;  5LMU F;  3MI7 X;  5LT5 A;  2AJ1 A;  2UU9 F;  1XQI A;  2ZD1 B;  2LXI A;  1FDA A;  3CWJ A;  2EKN A;  3CCU S;  3ZTP A;  1SPB P;  3F44 A;  3I5A A;  4DG1 A;  1ZET A;  3W9I A;  3T6B A;  3WC0 A;  1UJ4 A;  2ZUG A;  1B0T A;  3M9M B;  3KOA A;  3MEG A;  2XS7 A;  2CQ0 A;  1BMQ B;  3I32 A;  1NDK A;  2N4D A;  1WG4 A;  3GJR B;  3UN2 A;  4KJI A;  2H54 B;  1B0P A;  1RTZ A;  3V6D B;  3QJP A;  2PII A;  5ETO A;  2WVD A;  3TZW A;  1BQM A;  2HAI A;  5F9N A;  4K5S A;  1WOP A;  2K1R B;  2W9A A;  2XNQ A;  3NY0 A;  1WD6 A;  1O0P A;  5DDO C;  4YY3 J;  2HMI B;  3K89 A;  4JI8 F;  1SJF A;  2UV8 G;  5CYQ B;  3FNN A;  4IO9 Q;  5A8W A;  3HCX A;  1PC5 A;  5DG7 A;  5L1J A;  3JSR A;  4IR1 A;  5J2M A;  4GO7 X;  1WKK A;  4OX9 J;  2IPO B;  2DPI A;  4O4G B;  2JEJ A;  3TVZ A;  3OW2 R;  3AB4 B;  3W9H A;  4F3O A;  1OY6 A;  3A3N B;  1RWV B;  3W65 A;  3C16 A;  3KTQ A;  2CQC A;  5KFW A;  5GAH U;  2UVW A;  1TKX B;  3MCO A;  1I1G A;  2HFN A;  5C42 B;  2A1B A;  1S1X A;  1VI7 A;  3GYN A;  3EE3 A;  1IQZ A;  1AFI A;  3IMQ J;  4CLZ A;  3HD2 A;  4FVC A;  3Q22 A;  3M9N B;  2F8E X;  4O4R A;  2G4B A;  4LQ9 A;  2GHV C;  1RP5 A;  2VB6 A;  2VQE F;  4I67 A;  4RWW A;  4YME A;  2Z56 B;  2V5H G;  4F4W A;  3KHL A;  3V2U C;  2FLO A;  2D3Z A;  1FXD A;  1HNV B;  3O3L A;  1YI2 S;  1WSR A;  2YBV A;  4IG3 A;  1RTH B;  2PO4 A;  3OUY B;  1TAQ A;  2ZE2 A;  1NSK L;  4PYD A;  1UW4 A;  2XMJ A;  3J7Z T;  4OZ5 A;  3W66 A;  4MK8 A;  2R2S A;  4Q0B B;  3HM9 A;  2RT3 A;  4OLO A;  4LVN P;  4Q7A A;  4FYV B;  1REG X;  5D0H A;  1DTT A;  3OLB A;  4J9K A;  2EXU A;  2VV5 A;  3BR8 A;  4CO0 A;  1IR1 A;  2VBX A;  4OLP A;  1GK8 A;  4C11 A;  4ILM A;  3RAX A;  3K5N A;  1N5T A;  2Z2M A;  3HDS A;  2PMZ D;  1H2V Z;  3THT A;  4PQU A;  2MZ1 A;  1S9E A;  2W25 A;  1VIO A;  4X65 J;  1IBL F;  2W9C B;  4ZN3 A;  1TL1 B;  3I6P A;  2NR0 A;  1TUV A;  5J1E A;  3OHA A;  2ZOG A;  2M0G B;  2V4J A;  3SXL A;  2RKI B;  4NLR A;  1YJ9 S;  3DFE A;  3LAL A;  2VOD A;  5L1L A;  3MMA A;  1PC4 A;  2E5L J;  2IM2 A;  4B02 A;  1RK8 A;  4DJB A;  1RKJ A;  5LMN J;  2K06 A;  5AXN A;  3K57 A;  5KT4 A;  5B0D A;  4HI2 A;  2MJN A;  1Q8B A;  2E1A A;  1N52 B;  1CUL B;  1HNW J;  3VHQ A;  4WJB A;  1TTH B;  3NMR A;  3B78 A;  4IQM A;  4RO0 A;  1AW0 A;  1C4C A;  5A8R A;  4FKY A;  5CCL A;  4QZV B;  3EVO A;  1GXL A;  1XC9 A;  3ISN D;  1FFW B;  3DHW C;  2DR8 A;  1KOO A;  3CCS S;  3PYG A;  1LEO A;  3NGD A;  4UQT A;  1N36 F;  1SBR A;  2YNH B;  2HVH A;  4NPO A;  1ZYQ A;  3M1V A;  3UCU P;  1I51 B;  4JI2 F;  1MWQ A;  5B0C A;  2V4Q A;  5HLF B;  5K20 B;  1JK9 B;  2MZQ A;  4PG5 A;  1Q0N A;  3BO3 A;  2ASL A;  2WOM B;  2ZKU A;  1NB7 A;  5KG4 A;  2DEI A;  1FVS A;  4V1A k;  2BJD A;  1GQE A;  3CD5 A;  2Y8Y A;  2UUC J;  1UTA A;  1F2G A;  3X1L B;  2VG5 B;  4B08 A;  2YH0 A;  2HVE A;  1RWX B;  4ED7 A;  1V3Z A;  1FTC A;  2VFR A;  2OGU A;  3SQG B;  3TA1 A;  4G6V B;  1FRK A;  1H3D A;  4GMK A;  4YN3 B;  3MR3 A;  1S10 A;  1SC1 B;  4NMX A;  2R2T A;  4ED6 A;  3ZZ0 A;  4DR5 F;  2MLZ A;  4G1Q B;  1YX2 A;  4UW2 A;  1T05 B;  1RT5 B;  4H4M B;  1VIS A;  1OQ6 A;  1Y5L B;  3Q8R B;  2L41 A;  1XIQ A;  4QW8 A;  3KMQ A;  4WE1 B;  3PCO B;  1RCX B;  3NCQ A;  1NH8 A;  2R7W A;  2BVZ A;  1HNZ F;  2V2Q A;  1MN9 A;  1UET A;  4CM2 A;  1G4C A;  3HVT A;  2IM0 A;  3UN5 A;  1NZA A;  5D3G B;  4AXJ A;  4J7C A;  4ZIV A;  1VQM S;  4JI3 J;  3UW1 A;  3MED A;  2L9W A;  2CZ9 A;  3A3O B;  1JLB B;  4Q43 A;  1HW9 A;  3RB4 A;  3JYT A;  2BZ2 A;  5ETQ A;  4ZVS B;  1FFS B;  5BXI A;  3GIR A;  5GAD I;  4X4T A;  3W63 A;  2YNI B;  2RRA A;  2JJ4 D;  1RB0 A;  2N4C A;  7FD1 A;  5HMX A;  3GJT B;  3NXZ A;  2ZH3 A;  3KDN A;  3DM2 B;  1Q16 B;  2MGZ B;  2M88 A;  3BKT A;  2MEW A;  3C19 A;  4M5M A;  2R8G A;  4CLL A;  3QAU A;  3HHE A;  3PKY A;  1TV6 B;  1YJT A;  2ASD A;  1CJT B;  3MEE B;  3V4I B;  3LP2 B;  5MAO A;  3C14 B;  4FPR A;  1S4E A;  3NP5 A;  2EG2 A;  1J5O B;  3MAA A;  3MZI A;  1J5E F;  2RS2 A;  1HL6 A;  5ETP A;  1Z4U A;  2VJU A;  3I5C A;  1RHU B;  2B7C B;  2XYP B;  4DFM A;  2KN4 A;  2DY1 A;  2GO8 A;  4B9L A;  2CQI A;  2R2R A;  3H4D A;  4ZMM A;  1RTI A;  1S76 D;  3N5B A;  1ZA1 B;  4PXC A;  3R9L A;  3QAE A;  4YR0 A;  3CJK A;  3FCV A;  2DYA A;  4QWB A;  2V8P A;  1SL2 A;  1BQX A;  2VIH A;  2B9W A;  3TJ9 A;  4H4K C;  3EMT A;  4XIU A;  1NK0 A;  3CCT A;  1RA6 A;  3FRZ A;  3KJN B;  1JLQ A;  2OPR B;  4RW6 B;  1L3V A;  2HWH A;  4DHV A;  2PI5 A;  1B7Y B;  3HHD A;  3NAI A;  3PW2 A;  1VHI A;  2AD9 A;  1BWE A;  2ZHO A;  1OYD A;  1RT4 A;  3B4M A;  1UJ5 A;  3FCW A;  4YQW A;  1XMB A;  2O5D A;  2B3T B;  2XMW A;  1K8A T;  1RAE B;  2DEJ A;  2GNK A;  2QYC A;  3ZNJ 1;  1N5V A;  4LF5 J;  2FDN A;  5HAT A;  2HBR B;  2KRB A;  2VPW B;  1AUD A;  4PWD A;  1R6Y A;  1VQY A;  4GVB A;  2VKR A;  4DF4 A;  2RQK A;  4TU7 A;  4TVA B;  1VC6 A;  1QSY A;  1T11 A;  2UVV A;  1ZAV A;  3DGP B;  1JNZ B;  1PIE A;  3MPU B;  1YJW S;  3DYA B;  4UT4 A;  1YRX A;  4QR2 A;  4NLP A;  1S0V A;  2Y3Y A;  2IIH A;  5GMD A;  5C24 B;  1C2P A;  4QOT A;  2RVJ A;  1IVZ A;  5LMU J;  4PQA A;  2LMI A;  1RT6 A;  2W4P A;  3MTJ A;  5BR8 J;  2UU9 J;  4ELU A;  4B3R F;  4ED3 A;  1FA0 A;  5IQQ A;  3KJQ B;  1N5Q A;  3NLC A;  3QBC A;  4ZP8 A;  1XMO F;  2ZJP Q;  2CRL A;  2E5I A;  3L09 A;  1A6L A;  4WCE Q;  4X4U A;  3NGU A;  1JLC A;  2GFF A;  1CJU B;  4C8K A;  2J7W A;  3LTO A;  4LF8 F;  4PEO A;  1T9T A;  1DUR A;  2WZ1 A;  3D6T B;  4W92 B;  3DLE A;  1T8E A;  1H72 C;  4KYZ A;  4DL3 A;  4ZVH A;  2G13 A;  1M0S A;  4HT7 A;  3T3F A;  3G86 A;  2ZH9 A;  5EDW A;  4U6P A;  3ET6 B;  4JI8 J;  1KD1 T;  4W90 B;  2YWW A;  3WZ0 A;  1N6Q A;  2ZBQ A;  4RZR A;  3GB0 A;  1BLU A;  1RWO B;  1KFD A;  4ZS6 A;  2YKA A;  1HD0 A;  4DCO B;  2BJ9 A;  5E3C A;  3QMQ A;  2BQU A;  4WKR A;  1RIS A;  2B51 A;  4FF3 A;  3P8B B;  3CB4 A;  4PWU A;  1UPP A;  4C2M A;  1SXL A;  2N7C A;  2DHX A;  1K47 A;  1EP4 A;  1XMQ J;  1S1V B;  2CPY A;  3TJA A;  2VG6 A;  4I7F A;  4DR1 J;  1FKO A;  3BGL A;  2I1R A;  3TAM A;  2DGV A;  1AUS L;  1RBL A;  4M5D A;  4UY8 T;  2XSJ B;  4M5H A;  1S1U B;  1UPM B;  5KG7 A;  4RWX A;  4NLY A;  4IOC Q;  4P2S A;  2QZ8 A;  1HWJ A;  2ZJR Q;  4N47 A;  2XYG B;  2Q79 A;  3H5U A;  2E9T A;  2B4P A;  1HBU A;  2AX1 A;  1JQG A;  3FDS A;  1UVK A;  3C3L A;  5JJB A;  3R7B B;  4Z7C A;  1HBN A;  4V19 X;  3PHE A;  1JX4 A;  4BWM A;  3OL8 A;  1E6V B;  2UVU A;  1MWY A;  1X9M A;  3P5T L;  4DF8 A;  4B9N A;  2UXC J;  3P45 B;  3FRY A;  1ACM B;  1RT1 B;  2V8V A;  1C0T B;  2YKP A;  4KHR A;  3UD5 A;  2FVR A;  1VQ4 S;  3L95 X;  1FRI A;  4NEY A;  2EFV A;  4L3K A;  4ALZ A;  3GII A;  1V6H A;  4Z37 A;  2I8E A;  2C3Y A;  2MMY A;  1RHR B;  4LR7 A;  4WFN Q;  2FJV A;  2XMT A;  3NS6 A;  1ZPV A;  3HPO A;  1JNR B;  4I2Q A;  3W7B A;  5CZV A;  2AKW B;  3LH2 S;  1CLF A;  3MM6 B;  4O3O A;  4CQ1 A;  4DFK A;  3KLI B;  3GFX A;  4WF9 Q;  2XZW A;  3BGR A;  2IY5 B;  2OD4 A;  1U0H A;  3VTI A;  2B9Y A;  1Q79 A;  1WKJ A;  2AJ4 A;  3D6M B;  5KFO A;  4M5N A;  1HYS A;  4HYK A;  4CH1 A;  3N6M A;  1S79 A;  5J1N A;  2HNZ A;  4EUV A;  2FJA B;  4C8L A;  3C66 A;  5ETM A;  1GMW D;  1NJY A;  4L74 A;  1B70 B;  1N54 B;  4ZP7 A;  5D4P A;  2ALZ A;  2E5J A;  4H4O A;  4USI A;  2HEK A;  4U8V A;  4WXW A;  2CKW A;  1YIJ S;  1SQE A;  1U2F A;  2AYM A;  1EET B;  5JXS A;  2XTJ P;  2XZD B;  4O3S A;  3W2W B;  1SUQ A;  3RR8 A;  3IM8 A;  2HZA A;  1K44 A;  3IRX B;  2DGS A;  4UOG A;  3DLG B;  2LVW A;  1H7W A;  3HFK A;  1RDR A;  2HNY A;  4HAC A;  1REV A;  1HBO A;  1QAX A;  1U6Z A;  3BKF A;  5KOW A;  1WDT A;  1HQ2 A;  3MCM A;  5C25 B;  1N32 F;  2P6S A;  1P27 B;  2W9B B;  2V50 A;  2EW9 A;  4CO2 A;  1VLY A;  1VR6 A;  1QSS A;  4CYU B;  3J7Y I;  1LQ9 A;  2XZT B;  1IWG A;  3W64 A;  3BO4 A;  4FXV A;  3SDE A;  3Q8Q B;  1V5V A;  1WC6 A;  1EZZ B;  3CO9 A;  2V9W A;  1SC4 B;  4DZD A;  3E2E A;  4FXW A;  1WOO A;  4B3S F;  4ZVF A;  4ZPA A;  2CJB A;  4DR5 J;  3I31 A;  1NME B;  2DRD A;  2VD3 A;  1AB8 A;  3NS5 A;  2D9P A;  3HSJ A;  4C7Q A;  3R5G A;  3E01 B;  3M8R A;  2GW8 A;  4QU6 A;  4J90 A;  2XI2 A;  1Q8L A;  3PYE A;  2A10 A;  1C1B A;  2MPU A;  2OPS B;  2HRT A;  1WOR A;  4HDG A;  3TW0 A;  4KV8 B;  4ANE A;  4MIB A;  2KL8 A;  4LJM A;  4LUB A;  1WI6 A;  1Y10 A;  1R8P A;  4URS A;  2I5J A;  1IKV A;  4KPY A;  4KGX B;  2JEG A;  1GMW A;  2OLW A;  2XC9 A;  1Y7P A;  1YVF A;  2YPZ A;  5KFC A;  2RHQ B;  1S6P B;  2R9L A;  1RWW B;  3UDV A;  3LAK A;  3PDN A;  2VG7 A;  2GVD A;  3MHY A;  1XEZ A;  2Q43 A;  2KRR A;  2NXC A;  4PPD A;  3CDW A;  5HO4 A;  1S48 A;  4L72 B;  3RRG A;  3EZU A;  1TVR A;  3TAR A;  4KFB B;  1VRT B;  1JLE A;  3MMB B;  1Y11 A;  4RW7 A;  4LQ3 A;  5F3Z A;  5IT0 A;  3BDE A;  3HVR A;  4OJH A;  5BYR A;  2VL1 A;  1X5T A;  1U48 A;  1RWP B;  1AYE A;  3A12 A;  2MSS A;  2K7J A;  1DLO B;  4ZP6 A;  1Y5N B;  4N8O A;  3DRX A;  3KWM A;  2OPP A;  1AT1 B;  1H74 A;  3MEG B;  4EO8 A;  5EX0 A;  4EGL A;  4Y2K A;  2MHN A;  2OJ3 A;  3ZZZ A;  4ZJQ A;  2P2C B;  3S6E A;  2DD8 S;  2D1C A;  2AU0 A;  3G2X A;  4B9V A;  1HWL A;  4OYB A;  2VC0 A;  4DX7 A;  5HMW A;  5EWG A;  4ZHR B;  1W7W A;  2FHO B;  5EGY A;  5HAN A;  1OJ4 A;  2FVC A;  1U1M A;  5A8W B;  5CQG A;  3DLB A;  4JI7 F;  2CNO B;  2D41 A;  3HSZ A;  1SJR A;  2DGW A;  3A8K A;  3CJ5 A;  4GC7 A;  4CO5 A;  3MF5 A;  3C16 B;  4USW A;  4CT9 A;  4KY3 A;  4OYM A;  3SEO A;  4W98 A;  3ICL A;  3ETO A;  4CO4 A;  2NZ4 A;  4AUK A;  1S1X B;  2VC1 A;  1X7V A;  1I6J A;  1K73 T;  2WSC C;  2ZKT A;  1K9M T;  1UWB A;  2ZWP A;  1WDD A;  2WK4 A;  3VGS A;  1ZZF A;  4DV1 J;  3V6J A;  3CJ8 A;  2OP5 A;  2F4F A;  3RBZ A;  2KI2 A;  1VOM A;  1QE1 B;  2V8H A;  1PKU A;  3PW5 A;  5K14 B;  2IMO A;  4O3R A;  3OL6 A;  3GCW P;  5LSO A;  3IWN C;  1KSP A;  4ES1 A;  2W7O A;  1H73 A;  4CLW A;  3V6H A;  4Y28 C;  3G96 A;  4IG3 B;  1NK6 A;  2J9D A;  2ZE2 B;  5FJ4 A;  2DXD A;  2DHH A;  1QUP A;  1BGX T;  3AT1 B;  3CCL S;  1WEL A;  5ETR A;  3GP9 A;  1Y3K A;  2JEI A;  5KFP A;  4ZVG A;  5ETT A;  3OTE A;  5A2Q Y;  1EAR A;  2QC3 A;  4J9P A;  3R27 A;  3W5Y A;  4NE9 C;  4C11 B;  4LF6 F;  4NA3 A;  2KVQ E;  3ISN C;  5CAA A;  3M2U A;  1S9E B;  4M63 A;  2XG8 A;  3G6X A;  1RWK B;  3PHT A;  3A1Y G;  3MDF A;  5J1E B;  2XWX A;  3GMG A;  5HQM A;  3UNG C;  5I42 A;  2V4J B;  2AV5 A;  3MMC A;  3R8Y A;  2UXD J;  3C8Y A;  2ZNZ A;  2ZHB A;  3MMA B;  2UZA A;  3M8W A;  2ZVS A;  4ELT A;  4DR6 J;  4J91 A;  2Y1R I;  3HHL D;  1MMN A;  2LQB A;  2M52 A;  2YQ3 A;  4ZIW A;  4RNN A;  2J6T A;  2IM3 A;  1B7F A;  2HK3 A;  4LF4 F;  3HJV A;  4Y00 A;  2I9S A;  1DZ5 A;  2F7V A;  3PW7 A;  1N0V C;  5GAG I;  2E29 A;  3CCE S;  2CQ1 A;  2LU1 A;  4X62 J;  4QIV A;  3FK4 A;  5J1P A;  1IKW A;  4L75 A;  1WF2 A;  4DL0 C;  4ED5 A;  3SFG A;  2E7W A;  1KNZ A;  4UF4 A;  3B82 A;  5B7W A;  5A8R B;  5AJ3 J;  3Q0A A;  3CME S;  2JEF A;  3CMQ A;  1JLA A;  1KKH A;  4JI5 F;  3PRD A;  5D15 A;  2SXL A;  1GXT A;  2R8J A;  4TU9 A;  3T5L A;  4CM0 A;  1VQO S;  2UUB J;  3I87 A;  4HLB A;  4X64 F;  2NPI A;  3EZO A;  4BS2 A;  3KG4 A;  3M1V B;  4ICL B;  3M8P A;  1TAU A;  3SZ2 A;  4HTI A;  2IBK A;  3GE9 A;  1TL7 A;  1VS3 A;  4XDD A;  2L9D A;  8AT1 B;  2CQ3 A;  5EHH A;  2QJ3 A;  2GQC A;  1NKE A;  3FGV A;  3HX9 A;  5KFL A;  2PN6 A;  1X0F A;  2BJ1 A;  3UVJ A;  3R5C A;  5FLX U;  3TUI C;  5B0B A;  4HKQ A;  2MKC A;  3OTO J;  1KON A;  2W1B A;  2CQP A;  2BJ3 A;  1KWM A;  5IZH A;  3IA0 A;  2ZJQ Q;  3G4S S;  4PRF A;  4NXM J;  3P96 A;  4WFX A;  3Q89 A;  4XPC A;  2C2O B;  4GO5 X;  4DWI A;  4A8O A;  4DV5 J;  3RBD A;  4CWB A;  4RBT A;  2RF2 A;  5KFY A;  3C15 A;  1RAJ A;  4K59 A;  4OYA A;  1O51 A;  1HR0 J;  3GR1 A;  3VAI A;  4ATN A;  3DDI A;  3T1H F;  1M5H A;  3OFF A;  1OMS A;  1TUW A;  2OTJ S;  2E1P A;  3FCH A;  2AGQ A;  2MLY A;  3BZQ A;  4HHJ A;  3QZ7 A;  1WUU A;  3EWG A;  2WON A;  1UEU A;  1KQK A;  3IGN A;  2BMB A;  1MRO A;  2NCK L;  3B54 A;  4HH0 A;  2P9G A;  4WP3 A;  3EXY A;  1RYS A;  1UL3 A;  2ERR A;  2M8H A;  4AE5 A;  4CTA A;  1M90 T;  4ED8 A;  3EIC A;  1VMB A;  2CAJ A;  5A8K A;  2V9K A;  3K17 A;  3MPV A;  4CH0 S;  4LF1 A;  4YHH J;  2F4V F;  2CQD A;  2NXJ A;  5T41 A;  3H5S A;  4UZC A;  1J2V A;  1AZS A;  4ILR A;  3BS9 A;  4B9S A;  1UFL A;  2NS1 B;  3BPD A;  2KU7 A;  1BQN A;  2FD2 A;  2AX0 A;  4KGM A;  4YB6 A;  3MPY A;  2H9Z A;  5KFJ A;  2DNL A;  2ZUA A;  5IWA J;  2RE1 A;  3JXO A;  1JXL A;  1RBA A;  1S6O A;  5DM7 Q;  2IYG A;  1RWU A;  4NCB A;  4OI2 A;  1QJH A;  1LOU A;  1ICE B;  3MEC B;  1HWK A;  3CO0 P;  2BYC A;  3PX0 A;  3NOC A;  1AA1 B;  4F67 A;  3MOJ B;  4A48 A;  1S6Q B;  3D5M A;  2J0Q D;  2CA9 A;  1N56 A;  3PNI A;  2Q6B A;  3RZA A;  4DSL A;  4WZM A;  3M05 A;  4JV5 J;  9ATC B;  4QU7 A;  2BE7 D;  5KG5 A;  2FHJ D;  4C9D A;  3CJK B;  1QTM A;  2DRA A;  4ZCL A;  1FKA F;  1ZM3 A;  2YX1 A;  5KG6 A;  3AFG A;  4CLY A;  4CLS A;  1ZTT A;  1HFE L;  1KR4 A;  1RI7 A;  2DH9 A;  4LF7 F;  1KP6 A;  3IS9 B;  2HHH J;  1X9W A;  2CAD A;  1Q8K A;  3LO3 A;  1P9Q C;  1E6Y A;  3JB9 k;  4PG8 A;  1JXV A;  4AQY F;  4F50 A;  1KQS R;  3VCD A;  5CYJ A;  2DR5 A;  2DH8 A;  3DKD A;  1IXK A;  4W4M A;  5K8P A;  1LW2 A;  2N82 B;  3EZ5 A;  5L38 A;  3GYX B;  1PJ7 A;  5LM7 E;  3IP0 A;  1FK9 A;  2DJW A;  4C3K A;  3NKY A;  1U09 A;  4ZDN A;  3GPA A;  4RLE A;  4X4P A;  4PWD B;  3I0R B;  4GVB B;  1V5I B;  1YJ7 A;  3DRR B;  4URG A;  3HVA A;  1RBO B;  4DQR A;  1WSV A;  4J5O A;  3MM9 B;  3FEY B;  2C2N A;  5DG8 A;  2MJU A;  1KLM A;  4PG6 A;  3BSC A;  4LBH A;  2VOO A;  1QDU B;  5SUH A;  4A8K A;  3PO5 A;  1TR0 A;  2OEK A;  3SBM A;  3W2V B;  2EEY A;  1G6B A;  1N34 F;  4EEY A;  4YR2 A;  2MQM A;  4WP9 A;  1RT6 B;  5F8N A;  3OV7 A;  4DV0 F;  5K9F A;  4A8X A;  5D8H B;  1G2E A;  4Q2L A;  2W2P P;  4LBP A;  3TWZ A;  1FKP A;  3PM9 A;  4DDF A;  3DRP A;  4OX7 A;  2QRR A;  1EQM A;  1JWW A;  2MQO A;  3V81 A;  2MKK A;  1QLN A;  2C22 A;  1IKX A;  2IVF B;  2ZC3 A;  3PX6 A;  4ZPC A;  4LR9 A;  1TP7 A;  4R25 A;  2FIU A;  4B17 A;  1F6T A;  1DRZ A;  4B3T F;  3N6L A;  2GJF A;  3SI8 A;  2GMH A;  3LGN A;  4MKV A;  1DTQ A;  5J2P A;  2KDO A;  1F5B A;  1LWC A;  3DLE B;  5B09 A;  4EBC A;  1TKZ A;  5RUB A;  3RYL A;  1NKB A;  3LP1 B;  2RHS B;  3OPK A;  4EZ6 A;  3Q83 A;  2IYI A;  2FHJ A;  3C6T A;  1ZAX A;  5GVQ A;  1X4D A;  2W2O P;  2KG1 A;  1N6Q B;  3CJT A;  3ZNU A;  1F9H A;  4ES3 A;  2F40 A;  1TFY A;  2ROP A;  4DR4 F;  2YKN A;  3RGI A;  1NH7 A;  3MR7 A;  1DQ8 A;  2MST A;  3OT9 A;  3HSD A;  4JI1 F;  2PEB A;  3IAS 9;  2IDE A;  1I5O B;  1YRU A;  1VIX A;  4FP9 A;  4N76 A;  2R7T A;  4U67 Q;  1PYS B;  2M5Y A;  2JWN A;  4J9Q A;  2BE2 A;  3J80 Y;  1T3N A;  1EP4 B;  4A8S A;  5HJY A;  1W26 A;  1RTD A;  2D69 A;  2HHW A;  2CWX A;  5HSP A;  1FKO B;  3TAM B;  3OL7 A;  1G7C B;  1HQE B;  1MSW D;  2NXN A;  3A8E A;  3R7N B;  1HHT P;  2G2Y A;  4Y2I A;  3FEX B;  4HEA 9;  2MY7 A;  2FHK A;  1L3U A;  3IO1 A;  3QIP B;  4ECU A;  4HH1 A;  5HVF A;  5F0W A;  3UE2 A;  2ACY A;  3DRY A;  4CLK A;  5JVG Q;  4KH1 B;  2DHA A;  1CEZ A;  1NHU A;  1HBU B;  3DOL A;  3B6B A;  3PX4 A;  1QAI A;  4B9M A;  4DV2 J;  4NML A;  4CH7 A;  1VQL S;  2V68 A;  3CMA S;  2RU9 A;  1VBZ A;  1U8W A;  3N28 A;  1HBN B;  4B3O A;  1TL3 B;  2XUL A;  1H7X A;  5HRO A;  4DMZ A;  5HBM A;  1LV5 A;  2CVI A;  2A18 A;  2VFV A;  1M5O C;  4NA2 A;  1QUV A;  2GO9 A;  3KK2 A;  3IBC B;  4DX8 H;  2DXE A;  3SIP B;  1VQ5 S;  2DR7 A;  1PAU B;  3V6K A;  1YWX A;  2LU2 A;  1JJH A;  5J2N B;  3MFH A;  2OFH X;  3MXH P;  2ATC B;  4HT5 A;  2ZH4 A;  3OXL A;  4MKA A;  4IO1 A;  3ELH A;  3DLH A;  4LF6 J;  4NLD A;  2XHC A;  4DL6 A;  3UR3 C;  1PJ5 A;  4U7U D;  1NLK L;  2NUU G;  1S0M A;  3MWB A;  3T1A A;  1NSP A;  3CD6 S;  2CPI A;  3E3X A;  1OSD A;  5KG0 A;  4G1P A;  4GKK F;  3BBC A;  2W4C A;  4ED0 A;  5GAD U;  2OAU A;  3QRQ A;  1YJV A;  2NSC A;  3AXM A;  4YB7 A;  4WP8 A;  2EBE A;  1T0T V;  4D3G A;  3KFW X;  4Y34 A;  3T6J A;  3CT9 A;  4A4J A;  4K4T A;  4C8M A;  4O3Q A;  3IFE A;  4DU8 A;  4LF4 J;  3KLF A;  4K2X A;  2HVI A;  2HSE B;  5F8J A;  1HYS B;  4WU2 A;  3Q2T C;  3ZTQ A;  2EK1 A;  3EVW A;  2HNZ B;  3TAN A;  1NDC A;  2GJ2 A;  3LP0 B;  2IVM A;  4KPC A;  2QTW A;  1Q7Y T;  1URR A;  2F1F A;  2AIR B;  4J9M A;  1F2H A;  4DL5 A;  4K4V A;  3ZZR A;  4DPY A;  3FEZ A;  4PUO A;  1R7I A;  1Q81 T;  5KOX A;  3J7A N;  1BWV A;  3MM7 B;  2BM1 A;  4I6A A;  3CSK A;  3T1Y J;  3HT3 A;  4KGK A;  2QLJ B;  4OHV A;  4O44 A;  5HI7 A;  4HAC B;  4ZCK A;  1TMJ A;  1REV B;  2B8P A;  3TX0 A;  3MUR P;  2ZOF A;  4MMO A;  4P71 A;  2IBO A;  1TU0 B;  5JVH Q;  2JFK A;  3H4B A;  5E3R A;  3U02 A;  4TKT A;  3HKZ D;  4ELV A;  2KVI A;  1YJU A;  3QAT A;  1RT3 A;  5KFD A;  3V5R A;  3ZO7 A;  5AE2 A;  2IRU A;  5KFU A;  2MZT A;  1F1B B;  2KJW A;  4NRU A;  3WDO A;  1X4B A;  3WIU A;  2Y0S D;  1SL1 A;  2GML A;  2VON A;  3VVT A;  1LNQ A;  2HND A;  2HQI A;  4QPT A;  2QIF A;  4K50 A;  3M8Q A;  3NOG A;  3Q8S B;  1M5P C;  1KVJ A;  1WC5 A;  2IJF A;  3C6U A;  1D0E A;  2H5J B;  4DX5 A;  1UEK A;  5B0E A;  4OZN A;  1VCT A;  4DQP A;  3OSN A;  4LFA J;  2Z2Y B;  2Q1L A;  1TK0 A;  2ZM6 J;  1WG1 A;  4DR3 F;  1MMD A;  2J0W A;  4LIR A;  5KFV A;  4B3M F;  4LR8 A;  4EBD A;  3QJJ A;  1SKS A;  1IM4 A;  1C1B B;  4P72 A;  1U8S A;  4ZLJ A;  3AQO A;  5KFE A;  1N0U A;  2C3O A;  4H4K A;  5CHC B;  4D3H A;  4KSE B;  3FMB A;  5LSL A;  1RJJ A;  4I69 A;  2F4V J;  1C0U A;  4F7V A;  1XNQ F;  3M6U A;  3LQV A;  5EN1 A;  2DGQ A;  1GT8 A;  4NI2 B;  2K8G A;  3K8W A;  1F5C A;  2ZEJ A;  3BSA A;  4KQZ A;  1RAH B;  4MYT A;  1Q1K A;  1TK8 A;  3QQC D;  2HWI A;  2WAQ D;  1A0O B;  3BRE A;  3M8S A;  4DV3 F;  1DAX A;  2OEJ A;  5GMK a;  3GSI A;  1TQL A;  1ELO A;  1I94 J;  2VG7 B;  2GVD B;  3EX7 B;  2J76 E;  2QFI A;  4N5S A;  3MOZ A;  3GCX P;  3EDR B;  4DSF A;  1TVR B;  3FSX A;  4KHP J;  4WYL A;  2CQB A;  3NNH A;  4F2R A;  1RYR A;  2RNE A;  3FBF A;  4O0I A;  4WTY A;  1UVM A;  3KHG A;  2M70 A;  4OJG A;  4NLW A;  1JLG A;  4EMD A;  4RR5 A;  4K4Z A;  2AGP A;  5HP1 A;  2CUY A;  3O1L A;  5D0E A;  2C42 A;  3IBW A;  3PKM A;  5C2G A;  2JDJ A;  2H48 B;  4L73 A;  4MT1 A;  5HJX A;  1LW0 A;  1R31 A;  4FXD A;  4JI0 J;  1SJQ A;  2J7K A;  3VAK A;  3Q23 A;  2D74 B;  1RLD A;  3J7Z 5;  3HJF A;  2K3K A;  1DQA A;  3TUZ C;  1JJ4 A;  3BGO P;  1RZM A;  1KHW A;  4WIQ A;  3T41 A;  2F63 A;  5EWF A;  3M2R A;  4ED1 A;  1JJC B;  2MTL A;  4ECV A;  5DQI A;  2K7K A;  4LF2 A;  2XLJ A;  1S9G A;  5I3U B;  5IFM A;  4RNM A;  4R0J A;  2BR0 A;  5A6P A;  2A2C A;  1SCJ B;  2XY6 A;  1U1K A;  2KJV A;  2B7B B;  4KRW A;  1YIT S;  4NWB A;  1B64 A;  1YGY A;  4UUW A;  3N0V A;  3HLU A;  5A0Y A;  1RE1 B;  3OXG A;  1UVI A;  5D4L A;  3GON A;  2UUT A;  3POT A;  2XMK A;  1NK8 A;  1KTV A;  2P6T A;  5HQ8 A;  4RJV A;  3AD7 C;  3ZZO A;  5KT2 A;  1S99 A;  1IBK F;  3ISZ A;  1U47 A;  2I38 A;  5CD4 H;  1SH0 A;  1HNX F;  3LA0 A;  2FLP A;  1XNR F;  2B9E A;  2NSB A;  3R5D A;  1U1O A;  2J0S D;  3T5K A;  2ZD1 A;  3DDN A;  3EGV A;  1EAY C;  1UEV A;  2LYV A;  3FVY A;  5KG2 A;  5K8N A;  3N5F A;  4ID5 A;  1VQS A;  1NXI A;  1RAI B;  2DO4 A;  1S12 A;  4OV6 A;  3OSP A;  3HHL C;  3P3D A;  1NK7 A;  3RUB L;  1U1L A;  6AT1 B;  1BHN A;  2PA3 A;  2DH7 A;  2HHP A;  2HQC A;  2HIY A;  4OJ3 A;  4ZPB A;  4JI4 J;  3V6D A;  2ZWO A;  4P6Q A;  3NNC A;  3RW7 A;  2YNG A;  4X2B A;  2FC8 A;  3MCN A;  4USJ C;  1CJK A;  2DY9 A;  2K1R A;  3MAQ A;  5KTQ A;  4F25 A;  5K8M A;  3CNQ P;  2MB0 B;  1LK5 A;  2HMI A;  3TEH B;  5HMZ A;  2DO0 A;  5KFZ A;  5CYQ A;  5KFM A;  4UOC A;  3CED A;  2UUA J;  3M2U B;  4DR4 J;  5DRK A;  2R42 A;  1HWU A;  1R8A A;  4OZ2 A;  1O5J A;  4CI0 B;  1UZD A;  5GAE I;  1R8B A;  2DNQ A;  1Y9O A;  3AOD A;  4YB5 A;  3QLH A;  2V8G A;  4OX8 A;  5KG1 A;  3H42 A;  3CCJ S;  4IFY A;  2IAJ A;  1UKU A;  1L3S A;  1NUE A;  3D1H A;  2JH3 A;  3PG9 A;  5KFN A;  2QT7 A;  1S6U A;  3CGI A;  4PZV A;  1EJ7 L;  3P49 B;  1WHV A;  4MKY A;  2HLU A;  2P8I A;  3BF4 A;  2CPD A;  1QD1 A;  4NLS A;  1FJG J;  3ENV A;  2QA1 A;  2JHE A;  4OL8 A;  3TNV A;  4DOZ A;  1RHM B;  5KAK A;  4ZCI A;  1KLN A;  1HNV A;  1LFP A;  4FYX B;  2O3D A;  4LVO P;  1VC0 A;  1JLA B;  1X5P A;  1MW7 A;  2BE9 B;  2E66 A;  1FXR A;  2CQH A;  1V3S A;  3MR6 A;  4JI6 J;  2GVZ B;  3MM5 B;  2ROG A;  3M8P B;  3M8Z A;  1FES A;  5IQ6 A;  4LMZ A;  4NXN F;  1TL7 B;  3D3C J;  1FJ7 A;  4FKX A;  5F9L A;  4RU9 A;  1S49 A;  4DUY F;  1PO6 A;  2PDA A;  1U2R A;  2X3D A;  1B0V A;  3SV3 A;  2LFV A;  2GAG C;  1EIY B;  3UVJ B;  1ZZN A;  4F4X A;  1S57 A;  1QSL A;  2HKE A;  2W9C A;  4QBU A;  1GX6 A;  1SIZ A;  1BE4 A;  1TL1 A;  2ADC A;  2M9K A;  3HKW A;  4QWE A;  3U27 A;  4IOA Q;  3ILL A;  2RKI A;  3NRB A;  2JLG A;  3ADA C;  2NYI A;  1TZ0 A;  2DCL A;  1RGV A;  4JBC A;  4YP3 A;  2PA8 D;  4V19 J;  4F4Z A;  4ZA1 A;  2X51 A;  2HFV A;  1WHY A;  2LEC A;  3KJV A;  2HS3 A;  3W3S A;  4USU A;  1UCN A;  2AQ4 A;  2NQP A;  1FRM A;  5LJ3 Y;  2WON B;  4C0B A;  4PR6 A;  1FHT A;  4DV6 F;  3S01 A;  1RQ0 A;  5D77 A;  1CUL A;  3R5A A;  4URQ U;  4I2P A;  1ZM9 A;  4OZJ A;  3WHI A;  1EKS A;  2AYG A;  3FSI A;  2Y1J A;  4LF9 F;  2C3U A;  2YQ1 A;  5A8K B;  1JLF B;  4WFB Q;  2CPX A;  5CA5 A;  4CLF A;  2C2Z B;  4K7Q A;  3M6X A;  2B9X A;  4E2F B;  4K8R A;  4DV4 F;  2GC8 A;  2W8L A;  1KDN A;  3JQM A;  2M7S A;  2EFO A;  2C2M B;  2LA4 A;  4OZ1 A;  2B5J A;  5F0U A;  1VDH A;  4ZPD A;  2OPQ A;  4Q8E A;  1IBM J;  3AAW B;  4DUZ F;  4JV0 A;  3H0P A;  4JOU A;  4G1I A;  3TZX A;  3LW5 C;  4DN9 A;  5SZT A;  4GKJ F;  4KKO B;  2R8K A;  2DIT A;  3BV8 A;  2VA3 A;  2JLE A;  2KYX A;  4YUD A;  4P2X A;  3SQG A;  5KFS A;  3CPW R;  4ES2 A;  2DR6 A;  1U1N A;  1YBA A;  3W62 A;  2PT0 A;  4H54 A;  2CJQ A;  3N6N A;  3J81 U;  4ECW A;  2EBG A;  4G1Q A;  1T05 A;  2NUH A;  3JSY A;  3IC1 A;  3Q8P B;  3TVK A;  2PGC A;  2EFP A;  1FDN A;  2V6A A;  4LFB J;  4UOH A;  4WE1 A;  3CC7 S;  3UFC X;  2XCA A;  5EX3 A;  1JKH B;  3OQ2 A;  3W9J A;  4F36 A;  5KFB A;  3TZY A;  4CO1 A;  4KTQ A;  1OO0 B;  2LA6 A;  3TUP A;  2FZK B;  4ZCM A;  2WVC A;  5D3G A;  3IGV A;  2YWH A;  4LRF A;  2KFN A;  3CCW A;  4DPW A;  3UQS A;  3GIJ A;  2KHC A;  5AE1 A;  1ZM4 A;  1VC5 A;  1MML A;  3PXG a;  4JYA J;  4ED2 A;  1CS4 A;  1LW2 B;  2C1E B;  1U7L A;  2MZR A;  4P2M A;  2YNI A;  3UCG A;  2PFF B;  2AW0 A;  2UXB F;  2CG8 A;  2RQC A;  4F2S A;  3SSR A;  5FDL B;  3ETM A;  5DLF A;  1T95 A;  4X4S A;  3QT7 A;  1SC3 B;  2MGZ A;  2VFT A;  4F26 A;  5IXU A;  2Z2L A;  2MHE A;  4RU2 A;  2XMM A;  2YKM B;  4IFV B;  3NMA A;  1F5A A;  1ZS6 A;  4HL9 A;  3WX8 A;  2Q6C A;  2G2Z A;  1Q86 T;  2FB0 A;  1X0P A;  1N5S A;  1UVN A;  4J9S A;  1KLM B;  1VBX A;  3C14 A;  3PFO A;  3EYZ A;  3IN5 A;  3FQL A;  4DR2 J;  5DDP C;  3WBZ A;  4TN2 A;  5IV4 A;  4UY8 5;  3AHP A;  4OHX A;  8ATC B;  2XQC A;  2CJ9 A;  3D67 A;  3J81 j;  1FFG B;  1X4G A;  2CYY A;  2PI4 A;  1AFJ A;  3GU0 A;  4N7T A;  3KK1 B;  2XM3 A;  4P7V A;  2BV3 A;  1VBY A;  4EWT A;  3KLH A;  4NOH A;  2AGO A;  1SIW B;  2LDI A;  3CDU A;  6FDR A;  3TI0 A;  2OEM A;  4G65 A;  3D1Q A;  3JSM A;  1W2I A;  2H3E B;  2BW7 A;  4KGZ B;  1WHX A;  3M32 B;  5K8O A;  4C8Z A;  2KTQ A;  1KVI A;  1FT8 A;  1JMT A;  2GIQ A;  5J2Q B;  3F41 A;  2H5I B;  1DTQ B;  3FQK A;  5J2P B;  2OPR A;  4RW6 A;  3RB0 A;  1TKZ B;  3R5J B;  3DDK A;  2VIC A;  4LBI A;  4EFA C;  4JB8 B;  4ECT A;  4F8R A;  3C6T B;  2CJA A;  5A76 A;  4ECY A;  3I0S B;  4YY3 F;  5GAG U;  1UWA A;  2XGQ A;  4AT1 B;  2KHD A;  5DM6 Q;  1EHW A;  5KT3 A;  2CPE A;  4AL5 A;  1V9O A;  3PV8 A;  3J81 Y;  4LSL B;  1N88 A;  4OX9 F;  2ZOM A;  3GZ7 A;  1GAO A;  4TYB A;  2CPZ A;  1WTB A;  1RT2 B;  1TFW A;  1NHK L;  4HHU A;  4OYP A;  1RA7 A;  3OTC A;  3QT8 A;  1RTD B;  2OUG A;  1FD2 A;  1XR5 A;  3DC2 A;  3K58 A;  3P5B P;  3G82 A;  4JUZ A;  3W1Y C;  2Y1I A;  3P4U B;  4FBT A;  3NGK A;  2UUW A;  3AB2 B;  1VQ7 S;  2FLL A;  1X5O A;  2GA7 A;  4MK7 A;  3D3B J;  1UFK A;  4NLV A;  3LWL A;  3NBP B;  2BQ3 A;  4OHY A;  3KK3 A;  4ZP9 A;  2FHM A;  2HGL A;  3M2V A;  1FI4 A;  3DOL B;  1OPI A;  4N56 A;  5K5M A;  1WC0 A;  3QT6 A;  2F3J A;  2V2Z A;  1VJW A;  3H5X A;  5ETL A;  2CFX A;  5HRO B;  1DFD A;  5HBM B;  3L7P A;  1T3O A;  2VA2 A;  2XB2 D;  1X31 C;  4DUT A;  2M2B A;  3FKB A;  4TLQ A;  2KFZ A;  2WVE A;  3H90 A;  1R0C B;  3NGS A;  2ZZN A;  5AT1 B;  2YX7 A;  4Y3C A;  4IG0 B;  2XWY A;  4ZPT R;  2J0X A;  1S0O A;  4WFA Q;  1FWK A;  4NLO A;  1IR0 A;  1F3V A;  3BSO A;  1Q5Y A;  2W4D A;  1X4H A;  3I96 A;  1RAA B;  4C8Y A;  2JRS A;  5FII A;  3A4T A;  1NO8 A;  2V4R A;  4LRE A;  2DHG A;  4X65 F;  2XLI A;  3ZZU A;  3BYR A;  4DFJ A;  5AXK A;  3OR1 B;  3AD9 C;  2M8D B;  3PFE A;  4IRK A;  1Q7L B;  4P74 A;  4CNY A;  1QY7 A;  2MY8 A;  4I4B A;  4WII A;  4K4X A;  2LP4 A;  2X1A A;  2AEF A;  2E5L F;  1PBA A;  2ZDP A;  3TP2 A;  1N33 J;  2RIL A;  3AJD A;  1S1U A;  1M5K C;  4HVZ A;  4ZVO B;  1N8R T;  1XER A;  1Z2Z A;  3VAH A;  5LMN F;  3KLF B;  2R8H A;  4C3L A;  2WSF C;  1IJE B;  4NEZ A;  3DLK A;  4LSN A;  5KT6 A;  4M8L A;  1HNW F;  1GXU A;  1CJV B;  2CG4 A;  3R1L A;  2PD1 A;  1S5Z A;  3LF0 A;  2AEJ A;  4U9R A;  4K0K F;  2E9R X;  3TYT A;  4U96 A;  3RRK A;  3TRG A;  2DNK A;  3NEK A;  5LOQ A;  4IH6 A;  2KM8 C;  2HPU A;  4E98 A;  4PXE A;  5DDQ C;  2RAQ A;  4PUO B;  1F60 B;  5DGA A;  1TL5 A;  5LL6 d;  1T9X A;  1MU2 A;  2LXU A;  2F8H A;  2MKY A;  1BY9 A;  2RDD A;  2ZH6 A;  2V69 A;  1UMJ A;  3WX4 A;  2ILY A;  3HFV A;  3CF5 Q;  4RW4 A;  2B4U A;  3PW4 A;  3RBE A;  3IG1 B;  4HHH A;  3OVA A;  2UP1 A;  1JJ2 R;  1RSC A;  4YFU A;  4CLT A;  4ECQ A;  3R2C J;  1M1H A;  2ZNY A;  2AEM A;  4R5P B;  5D6G A;  3Q86 A;  4M94 A;  2QG9 B;  5ITH A;  4KO0 B;  1F9E B;  2JC1 A;  2UUC F;  3BBB A;  5IM0 B;  4CRJ A;  2BOP A;  3RBX A;  3CJ0 A;  4CT8 A;  2HHT A;  1PYO B;  4ZVE A;  1NBE B;  2LDY A;  4DX6 A;  1APS A;  2R4F A;  2ZH2 A;  4DN0 A;  2G0C A;  2HND B;  4IQX A;  4GC6 A;  4K4S A;  3M8Q B;  3LPY A;  3DGV A;  5D4N A;  4NLG A;  3OXF A;  1RHQ B;  1U26 A;  4EO6 A;  3BO2 A;  3MD3 A;  1F0X A;  2HQ3 A;  3C6U B;  3I56 S;  1Q8I A;  4QIF A;  3CJS A;  4DR7 F;  2PMH A;  3DOK A;  4ZJL A;  3IR7 B;  2WSE C;  2OO4 A;  5EWE A;  2ZBP A;  1OS5 A;  2LQ8 A;  1PAE X;  4KHM A;  2EFG A;  2VQE J;  3CUL A;  3S7R A;  4JI3 F;  2VAS A;  3JQJ A;  4USH A;  1HNI B;  2E1R A;  4JV2 A;  1CQM A;  4X4Q A;  1HPZ B;  2E1M C;  3H2L A;  3MR5 A;  3SMZ A;  3IM9 A;  1EET A;  4NZ6 A;  1C0U B;  1KHV A;  4Z7Y A;  4LT6 A;  3BN4 A;  3D0I E;  2V2K A;  3DRS A;  1CPZ A;  4X84 A;  2HG4 A;  2DVI A;  2DB1 A;  4EYH B;  1WC3 A;  1RHK B;  5CYM A;  2QMX A;  3NS7 B;  2KZM A;  2XMU A;  4ZVU B;  1X4C A;  5BJR A;  2V63 A;  4I68 A;  5ETS A;  1A9N B;  3EGN A;  2BKP A;  5B0G A;  3ILO A;  3IXQ A;  4DUZ J;  2W9B A;  4DL7 A;  2YNF B;  3FFI A;  1D9D A;  4RX6 A;  2HQF A;  3A8I A;  4DSE A;  2K3I A;  4GKJ J;  4DPU A;  1IBL J;  4QQB A;  1GNK A;  3AXK A;  1VK3 A;  5FD1 A;  4J9L A;  1WHW A;  3K2Y A;  1LWE A;  3D2W A;  1FX2 A;  2VFU A;  1U1P A;  3GSD A;  2XHW A;  2BBE A;  2FY1 A;  2RB7 A;  4NLX A;  5DZ7 A;  1UFW A;  3QO9 B;  4KBI A;  2PMW A;  3CE8 A;  4AL6 A;  1OWX A;  2POK A;  2ZBR A;  2FPH X;  3LOU A;  4YS2 A;  2ZBI A;  1LW0 B;  2LEB A;  5CZX A;  3TJ8 A;  3PR4 A;  2DNH A;  4DFP A;  4ZIT A;  4NYZ A;  2HZV A;  2J9D E;  3BH7 B;  4FBU A;  3GYG A;  2OPS A;  2DK2 A;  3VAJ A;  1VGY A;  4XTT A;  1SV5 A;  4ER8 A;  3JS9 A;  2KT5 A;  4BWJ A;  4LF5 F;  1S9G B;  1N36 J;  3HZG A;  2FGO A;  3MPW A;  4DI6 A;  2IC3 B;  1R0A B;  3KDO A;  4JI2 J;  1UJ6 A;  4K2J A;  1LWX A;  3MTK A;  1FDB A;  2ASY A;  3QGH A;  4MH8 A;  3KKF A;  3SCI E;  5A0Y B;  1NK5 A;  3PRB A;  4FNI A;  4YB1 P;  5AE3 A;  2LQJ A;  4FNH A;  3IRW P;  4LRC A;  1SC6 A;  3FBE A;  1X8D A;  4LRB A;  2YX4 A;  1VRT A;  4PXB A;  3MMB A;  1XTZ A;  2DGT A;  1HMV A;  4MKB A;  3CUN A;  2QA4 S;  3KJF B;  5DET A;  4Y6I A;  2JVR A;  2JVO A;  4DEZ A;  1LXJ A;  4RW8 B;  5BR8 F;  4K4U A;  2A6M A;  5F41 A;  2R7S A;  2CQ2 A;  2L48 A;  4P7T A;  2DGO A;  4ID5 B;  1T03 B;  1OYE A;  1XJW B;  1DLO A;  1M5V C;  2DNN A;  2ILZ A;  3G8Q A;  3MPD A;  4MTP A;  3OVB A;  1HBM B;  1CVJ A;  1HNZ J;  3DMJ B;  1M1K T;  1WF0 A;  1YK9 A;  5KFT A;  4MYU A;  2YNG B;  2BAN A;  1SH2 A;  4I56 A;  2BAB A;  1CJK B;  4MFB B;  2JC0 A;  5F8H A;  4X4O A;  1C1C B;  3D28 A;  2RRN A;  4K4Y A;  3O8W A;  2CQ4 A;  2YTC A;  4ZHR A;  4UUX A;  2D9O A;  1RKI A;  2GS8 A;  1T9Y A;  4S0M A;  3VF0 B;  4YR3 A;  5L39 A;  1RLC L;  3TQ1 A;  3QWP A;  4ERD A;  1RTJ B;  2BKN A;  1PYT A;  1HHQ A;  1DBD A;  3CCZ A;  3MM8 A;  1HI1 A;  3QLH B;  4NZ0 A;  4WK1 A;  2ZIT A;  2DBB A;  2EG1 A;  3E8O A;  4IFY B;  1XMQ F;  2IAJ B;  4DR1 F;  1OPZ A;  4CLU A;  3AA9 A;  4F4K A;  3CW2 C;  3U1M A;  4ZVP B;  4X4N A;  3KLE A;  1R89 A;  2BOA A;  4FF2 A;  3H2V E;  1J5E J;  4DV7 F;  3HT0 A;  1S0N A;  4LFC F;  2EC2 A;  3QRR A;  4RPF A;  5KT5 A;  2JSX A;  4EU0 A;  5A2Q U;  1PJ6 A;  4FF1 A;  3TO8 A;  2ATL A;  2OTL S;  2OSQ A;  3DI6 A;  4UST A;  2E5G A;  1RCO B;  1QE1 A;  2GCF A;  4DG1 B;  1GX5 A;  3OFH A;  5K14 A;  4RW9 A;  1G3O A;  4OYI A;  3NNA A;  5L1K A;  2QYG A;  1O6X A;  2PC6 A;  2HQD A;  1UW9 A;  3OR2 A;  3KG1 A;  3ZZP A;  5L8R C;  3G71 S;  2BEF A;  2JOQ A;  4B9T A;  4ECX A;  4Q44 A;  5A6W A;  4NLQ A;  2UXC F;  1H2U X;  4DQI A;  3UWT A;  1BQM B;  2O66 A;  2GIR A;  4N77 A;  2H5E A;  2EVZ A;  4LSZ B;  4DS5 A;  1L3T A;  3KLG A;  3RU0 A;  3TOQ A;  2E5H A;  3EDQ B;  5J2M B;  4C4W A;  2AWZ A;  3HVW A;  2XS2 A;  3D0H E;  1FTR A;  5L9N A;  3L9Z A;  2KB2 A;  1FJC A;  1HKA A;  2RDI A;  1U1R A;  1MNE A;  3KG0 A;  4I1T A;  1NJW A;  1FXL A;  2W2M P;  3PIO Q;  5L46 A;  1NJI T;  4FPI A;  2DIU A;  3AJ1 A;  2HUR A;  3LGH A;  2Z58 B;  2FVP A;  3K59 A;  2OSR A;  3KJV B;  3GFY A;  2DNP A;  4MIA A;  1TKD A;  3FUY A;  4PG4 A;  4WBF A;  2R7O A;  4L6V 3;  1MLA A;  2AJ0 A;  2W2N P;  3PIP Q;  3IR5 B;  1GH8 A;  4I2P B;  4B3R J;  2FJE B;  4K0K J;  2FJD B;  4ZK7 M;  4TQR A;  4RUH A;  1XMO J;  2XO6 A;  3C46 A;  5DGB A;  1NJX A;  4J9R A;  1YZ6 A;  1P8G A;  2RJZ A;  2VOP A;  4ZLP A;  4LF8 J;  2VH7 A;  4OI4 A;  1VBK A;  1T9U A;  1WAC A;  2X1F A;  4AYB D;  2KH9 A;  2IHR 1;  2WCX A;  3PYF A;  4ICL A;  4QPX A;  2BJE A;  5JUM A;  5HMY A;  3VGV A;  1IWA A;  3TA2 A;  5BYS A;  1DTT B;  6FD1 A;  4KAI A;  3NL0 A;  2PE8 A;  2X1G A;  3R1H A;  3HUL A;  2B5J B;  2X3G A;  2Q3P A;  2Z2Z A;  4IKA A;  3UDL A;  1ROF A;  2NXU A;  4RL1 A;  2OPQ B;  4M5J A;  3MCS A;  2XMA A;  2QL9 B;  1HQU A;  3NG8 A;  1H0H B;  4F02 A;  4PQU B;  1ZH5 A;  1TMM A;  3Q24 A;  2G0J A;  5L9X A;  2OFG X;  4U7C A;  2MLX A;  1KC8 T;  2CXE A;  1NPR A;  4DCP B;  3QPI A;  2VBY A;  2X1B A;  2LQ9 A;  5KG3 A;  1FNX H;  2J7U A;  4I0W A;  1ULR A;  2CNK B;  3SCK E;  3CD0 A;  5CD4 A;  3EM1 A;  2VPY B;  4DR7 J;  2IDL A;  4IH5 A;  2FVQ A;  1Y4Z B;  4PXD A;  2DNR A;  3CJ4 A;  1MG7 A;  4DS4 A;  2ALY B;  1RT7 A;  2V34 A;  2RML A;  1RAO A;  3A8J A;  1CBK A;  3UCZ P;  2IM1 A;  2YPY A;  1GFW B;  2HGM A;  2CIM A;  4K5R A;  1D3W A;  1SB6 A;  1CS4 B;  1LFW A;  1BC6 A;  2RQ4 A;  9RUB A;  4HTJ A;  4ZVT B;  5ETV A;  5HN0 A;  3M4X A;  4FF4 A;  1S9F A;  1NU4 A;  4DL2 A;  3QZ8 A;  2NPF A;  2UVR A;  1Q4R A;  4GVL A;  1W25 A;  1U6F A;  1KFS A;  1R27 B;  4UOF A;  1NSQ A;  4F3M A;  2KG0 A;  4TLR A;  5D4O A;  2QSW A;  4WFZ A;  1X4F A;  3TAQ A;  5HAO A;  3ILJ A;  3CIZ A;  3K5O A;  3T19 A;  3TR5 A;  3VQT A;  4TY9 A;  3I55 S;  2NXE A;  2LXF A;  4N8N A;  2RS8 A;  1YRT A;  3MEC A;  1UVJ A;  3OJU A;  2HFU A;  1N5Y A;  1FJE B;  1S6Q A;  4ZOS A;  2H65 B;  3NCR A;  2DNY A;  3BPS P;  2FC9 A;  2OKQ A;  2R7R A;  3HP6 A;  5E41 A;  1KQG B;  5T7L A;  1RAD B;  3KLH B;  3CD7 A;  4NLU A;  5GAE U;  2B4V A;  2QEX S;  2BXJ A;  2QL5 B;  1TKT A;  1T9V A;  5IC6 B;  1IBC B;  3JSM B;  2MQ8 A;  1SL0 A;  3UDC A;  3SFU A;  3K5P A;  1P6T A;  4NZ7 A;  3RTV A;  2MZS A;  1H2T Z;  3BB5 A;  3HVT B;  3IS9 A;  1U0S A;  2RRB A;  1NK4 A;  2CWK A;  1DJ0 A;  5CCM A;  2H51 B;  3MED B;  3VVU A;  1K1Q A;  3RAM A;  1S72 S;  3HHL A;  3JYT B;  1YDL A;  1N4L A;  3SQO P;  1U25 A;  3RW6 A;  5F8I A;  4Y2M A;  2BDP A;  3OJS A;  2VBW A;  4Y65 A;  2DRB A;  3I0R A;  2YH1 A;  3JAM U;  3AOB A;  1MN7 A;  3DRR A;  2H4W B;  2C3M A;  3NWR A;  2J9E A;  4M5K A;  3KUH A;  4KH0 B;  4AFF A;  1N32 J;  3MM9 A;  3G82 B;  3BQ1 A;  2W7A A;  3PR5 B;  4A8M P;  4OFZ A;  1YQH A;  1IKY A;  3MAA B;  2FLN A;  4AND A;  3W2V A;  1BUX A;  4QIE A;  3N79 A;  1KRP A;  4DPO A;  2FJW A;  3SSQ A;  1YZ7 A;  3KK3 B;  4DV1 F;  4QR0 A;  3EPG A;  3UDE A;  3M2V B;  3CC4 S;  4B3S J;  3M6W A;  1D1U A;  2AYE A;  1RTI B;  5E0O A;  3UNY A;  5KFG A;  4ZLN A;  3QNW B;  3F56 A;  5IS2 A;  2NYH A;  4WFY A;  3DLJ A;  2XLK A;  2G1H A;  2V8D A;  2HBZ B;  4P52 A;  1LWF A;  2R2U A;  3QRP A;  1NHV A;  1EB0 A;  2BX6 A;  3J80 U;  2QA4 G;  4ZPV R;  3PY8 A;  1JLQ B;  1B4S A;  1SKU B;  3LUY A;  2XSF A;  3D4J A;  1Q5V A;  1SQG A;  2AYB A;  2MDA A;  3LP1 A;  4IDK A;  1RT4 B;  2IRY A;  4IH7 A;  3CIM A;  3THP A;  2E44 A;  2DIS A;  3R2D J;  3ENW A;  2A6O A;  3NGT A;  4Q45 A;  5F8M A;  2M4M A;  4NYO A;  1LKZ A;  3G8S A;  3LPE A;  5KFQ A;  3K5L A;  3AOC A;  1U2C A;  2ASJ A;  1FDD A;  3MUV P;  2A0F B;  2UV8 A;  4NCG A;  2V67 A;  4PWW A;  1TUG B;  4A8W A;  4QYZ J;  2YQ0 A;  4P75 A;  2UXD F;  4KC5 A;  1F9F A;  3GQC A;  3GIK A;  2HHV A;  5LXR A;  4R8U A;  4GRS A;  1DAR A;  4DR6 F;  4USM A;  1HQE A;  2R7Q A;  3L4B C;  3BJY A;  2BAC A;  1LK7 A;  3I9V 9;  1FRJ A;  4DV7 J;  4I6W A;  4TQS A;  4LFC J;  5CH7 B;  4WZQ A;  1EX8 A;  2XNR A;  3IAM 9;  2RQM A;  5KFA A;  1FRH A;  2WBM A;  2PEH A;  1Y3J A;  4X62 F;  4FYY B;  3DLK B;  2APO A;  3QIP A;  4LSN B;  4F0H A;  3DOM A;  1HI8 A;  2DT9 A;  5I4M A;  2VFS A;  1SKW A;  4QWC A;  5AJ3 F;  3O2I A;  3UN3 A;  3VQS A;  3JAM Y;  2J9C A;  2LCW A;  1JLC B;  1U49 A;  2CPJ A;  1TL3 A;  3OTD A;  2VBZ A;  1XWL A;  4M95 A;  1YBT A;  1BXN A;  3CCR S;  1MU2 B;  2QLF B;  1XK8 A;  2UUB F;  1ZTW A;  2G2O A;  3PEH A;  4PAB A;  4RW4 B;  2IRX A;  2JX2 A;  5J2N A;  3KYL A;  1S1W A;  1WI8 A;  3AOA A;  1GEH A;  2LLZ A;  4UTG A;  4CZC A;  2D3O R;  1D09 B;  4X66 F;  1WG5 A;  3HK2 A;  4YEA A;  4QYZ K;  4QW9 A;  1VQ9 S;  5E5N A;  2WBR A;  2NRE A;  2N7Y A;  1T94 A;  4JI7 J;  5IC4 B;  2R7X A;  3DU5 A;  2BKO A;  2VU5 A;  5KFK A;  1T9W A;  1FX4 A;  4QIG A;  2FTR A;  3RAQ A;  2KXH A;  3OTO F;  2GV1 A;  1KOH A;  1K1S A;  4NXM F;  5IT9 U;  2DGU A;  5DG9 A;  2JNJ A;  3H20 A;  3HHN B;  2VG6 B;  4I7F B;  4DV5 F;  3KNA A;  4M5D B;  1HR0 F;  3CJ3 A;  1B99 A;  4ETZ A;  4C3M A;  3H25 A;  3DOK B;  4A46 A;  3DN9 A;  2VQF F;  3GJQ B;  4F04 B;  4IRC A;  5LSR A;  4PCQ A;  3LP0 A;  2GHP A;  2X7I A;  1EKR A;  2GGP A;  3PJ9 A;  4OIX A;  2XY5 A;  3G8T A;  5C7P A;  1S7H A;  4YDX A;  2B0G A;  2WTF A;  4CP5 A;  1VHF A;  1FNO A;  3DNC A;  1AXQ A;  4YHH F;  3MM7 A;  3ZZY A;  2E7X A;  3ITH A;  2JZ5 A;  2GQQ A;  3DRS B;  2Z57 B;  3LAN A;  4Y2C A;  5CYM B;  2ZC4 A;  1FNM A;  3D66 A;  2EK6 A;  1W2B R;  5IWA F;  3RG6 A;  1S1T A;  1WJ9 A;  3R6G B;  2R7V A;  1RAF B;  4DU7 A;  4NAS A;  3FFI B;  3T5J A;  1KQF B;  4OZ0 A;  3CCV S;  4XPE A;  7AT1 B;  3NGR A;  2XI3 A;  2DNO A;  4I2Q B;  1P1T A;  3P6Y C;  4CO3 A;  1LWE B;  4MIW A;  1UA0 A;  4ZJO A;  2JLF A;  5E33 A;  2HZC A;  4A8Y A;  2QMU B;  2B56 A;  4F0M A;  4JV5 F;  3M30 A;  3FJ2 A;  2HYI B;  4OYW A;  2Y1L B;  2I0X A;  3BGR B;  1U0H B;  2DKO B;  2MQQ A;  1U1Q A;  2R3V A;  4CNZ A;  2F9J A;  2HFS A; 
#chains in the Genus database with same CATH homology
 4JB8 B;  2QLB B;  3R6L B;  1RWK B;  2HBZ B;  3KJF B;  1F9E B;  1RHU B;  4ZVO B;  2FQQ B;  2H48 B;  3IBF B;  2XYP B;  1BMQ B;  2P2C B;  3GJS B;  4LSZ B;  2CNK B;  3GJR B;  1I51 B;  3R7B B;  1RHK B;  3D6F B;  2XZT B;  2H54 B;  2CJX B;  1PYO B;  3NS7 B;  3RJM B;  1QDU B;  3D6M B;  2CDR B;  5K20 B;  4ZVP B;  3R6G B;  1RWO B;  4ZVS B;  2C2Z B;  4ZVU B;  3IBC B;  3EDQ B;  1SC4 B;  4DCO B;  3SIP B;  1RWW B;  2H65 B;  2H4W B;  2HBQ B;  1RWN B;  3P45 B;  1PAU B;  2C2K B;  1RHQ B;  2HBY B;  3GJT B;  3KJN B;  2H4Y B;  1RWM B;  3EDR B;  1GFW B;  1NME B;  3R7S B;  2QL7 B;  1RHJ B;  4DCJ B;  1I3O B;  1RWX B;  2XYH B;  3GJQ B;  2H5J B;  2CNO B;  2QLF B;  2Y0B B;  3P4U B;  2C2M B;  2QL5 B;  5IC6 B;  1IBC B;  3KJQ B;  1QTN B;  4ZVT B;  2QL9 B;  3R7N B;  2C1E B;  1RHM B;  2C2O B;  2XZD B;  1RHR B;  1SC1 B;  2QLJ B;  4ZVQ B;  2Y1L B;  1RWV B;  2CNN B;  2H5I B;  1RE1 B;  2CNL B;  4ZVR B;  2H51 B;  1SC3 B;  2DKO B;  1ICE B;  1RWP B;  3D6H B;  2HBR B;  3R5J B;  2CJY B;  3QNW B;  4DCP B;  2XYG B;  5IC4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...