1X4AA

Solution structure of rrm domain in splicing factor sf2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
109
structure length
109
Chain Sequence
GSSGSSGMSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords splicing factor, arginine/serine-rich 1 (splicing factor 2,
publication title Solution structure of RRM domain in splicing factor SF2
rcsb
source organism Homo sapiens
total genus 11
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1x4aA00
5JVGQ 3HHNB 1X4HA 1Q81T 1VQNS 2DO0A 1U1KA 2QA4S 4IOCQ 2AYEA 3G96A 3NS6A 2HYIB 3R1LA 1X0FA 1SJ4P 1YWXA 3H2VE 3THTA 2OJ3A 4CH0S 1ZZFA 3CULA 1KD1T 2CQDA 2JVOA 3PIPQ 1X4AA 2VOPA 1JMTA 2CQBA 2KFYA 3UD4P 2M7SA 3I56S 3VAFA 2MGZA 2AYGA 2X1FA 2JWNA 2XNQA 1DRZA 1DHMA 3G6ES 4IO9Q 1U1OA 2DO4A 3CCJS 2N7CA 2DH7A 5LXRA 1VQ7S 1YJNS 2DNLA 3P6YC 1SJFA 2OSRA 1ZZNA 2HZCA 3MI7X 1H2UX 1DZ5A 4PKDB 2LCWA 2DHAA 3S8SA 3CCLS 3BO3A 3V4MA 2YKAA 2MGZB 1VQLS 2MMYA 1WHWA 2U2FA 4YB1P 2VONA 3TO8A 2DHXA 2MY7A 4F02A 2MKIA 2MZ1A 3MXHP 3FEXB 2MZRA 1HD1A 3LQVA 3G8SA 2G4BA 2X1AA 2B0GA 3SDEA 2LXUA 3RW6A 3CCUS 4CH1A 2KRBA 5IM0A 4BS2A 4CQ1A 2MJNA 1SJRA 2F9JA 3NMRA 2D9PA 3VALA 2M52A 3EX7B 2YH0A 4TU7A 2KRRA 3NS5A 1WHYA 3SDEB 1WEXA 1JJ4A 2RS8A 4C0OC 1X5OA 2M9KA 2L9WA 2VOOA 1AUDA 2L08A 2DGTA 1WTBA 4ERDA 5GAHU 3MUMP 1NJIT 2CQHA 3US5A 3B4DA 4C7QA 3CCMS 3K0JA 1WWHA 2YH1A 2LKZA 2OIHA 2DGOA 4PR6A 2CQGA 2MQQA 3CCVS 2CQ3A 1VC0A 1WELA 3CC4S 2DNQA 2MSTA 1OPIA 2DIVA 1VC5A 3CPWR 2MPUA 3THPA 1VQ5S 1Q82T 1P27B 3DXBA 3CF5Q 1M1KT 5GAEU 1X5PA 2QEXS 3UCGA 2DH9A 2D3OR 3MD1A 5DDRC 2PE8A 2J0SD 5MLCV 5LXYA 4F25A 1KC8T 2RU3A 2HGLA 3U1LA 1WG4A 5FJ4A 1W2BR 3Q2SC 2DNOA 2O3DA 2KM8C 5LSOA 2LA6A 2OTJS 3RW7A 1N8RT 2DNKA 2RUGA 3MUVP 1BY9A 3CCQS 1K9MT 2MB0B 1WF2A 4Y0FA 1QVFR 2M70A 2RRAA 2KN4A 1K8AT 2FPHX 2CJKA 4YUDA 1YTYA 5EN1A 2DIUA 3CUNA 4LIRA 2ZJQQ 3CCRS 1HL6A 2OSQA 1CVJA 1S72S 3VAMA 4TU8A 1U1QA 1F9FA 4IUFA 1FHTA 2RNEA 3BO2A 1QVGR 4ED5A 2NZ4A 4Z2XA 1H6KX 1X4EA 4QU7A 3MOJB 5DDQC 3J7YU 2E5HA 4FXVA 2D9OA 2GO9A 3ZZZA 4WCEQ 2UP1A 1A9NB 3ULHA 1N52B 2DGXA 2CPZA 1ZH5A 5HL7Q 1YJ9S 2MZJA 2U1AA 2M88A 1L3KA 2XS7A 4V19X 1X4FA 3VAKA 5CYJA 1U6BA 1JJ2R 2MZQA 3MUTP 2CQ0A 2AD9A 5D77A 2X1BA 2G1DA 4WIIA 2RS2A 2CQ2A 5H1SV 1OIAA 4M5DB 4PRFA 4EGLA 3NNHA 1KOHA 1OWXA 3UCUP 1G2EA 5CA5A 3VAHA 2AYMA 3MDFA 3CMES 3S01A 4WF9Q 2XSFA 3CD6S 2DNGA 1YI2S 5GADU 2CPDA 4UY8T 1VQ8S 1RKJA 2I2YA 3P49B 2DH8A 3U1MA 3IRWP 2KVIA 3Q2TC 1X4BA 2FY1A 1B7FA 1NU4A 1PO6A 2DK2A 3CXCR 4Y00A 2YWKA 1SJ3P 3TYTA 2XS2A 2JRSA 3SXLA 4F26A 5JVHQ 1H2VZ 2LYVA 1VQ4S 1VBZA 2M2BA 4QU6A 1M90T 1S79A 2MXYA 4W92B 4UQTA 5LJ5Y 2Q79A 5DM6Q 1YJWS 2M8HA 3S6EA 1P1TA 2KHCA 2MKJA 3MD3A 1NO8A 1QM9A 1VBYA 3VF0B 1X5TA 2N3OA 4P6QA 1FO1A 2LQ5A 3CTRA 2MQOA 3MURP 1VQMS 2RT3A 1VQOS 1N88A 2KYXA 2V94A 1X4CA 2KI2A 1SXLA 3N9UC 2MZSA 2MKKA 2DNYA 1VQKS 2LEAA 1YITS 5GVQA 2K3KA 4FXWA 2DISA 5DM7Q 2XS5A 2EK6A 2LECA 2YTCA 2HVZA 3H2UB 1U1MA 3CC7S 2M8DB 2SXLA 1RK8A 1VC6A 3OW2R 3P3DA 2CQ4A 1WEYA 1KQSR 2MQLA 1FJ7A 2J76E 2CPYA 1D8ZA 2QFJA 5LSLA 5IQQA 2FC9A 2CQ1A 3VAJA 3BS9A 2ERRA 1WF1A 2DGQA 1YIJS 2F3JA 1DBDA 2K8GA 2E5IA 2BOPA 1WG1A 1YHQS 2ZJPQ 1K73T 4W90B 4IOAQ 2M4MA 2XB2D 2JX2A 3B4MA 1U1RA 2EK1A 3HI9A 1VBXA 4WFNQ 2MZTA 2MQPA 2KM8B 3UWTA 3G8TA 1HD0A 3FEYB 2ADCA 5IFMA 1WI6A 4CIOA 2OTLS 1X5SA 2G0CA 4YOEA 2CPJA 3R27A 5CXTA 1VQ6S 2KG1A 2LMIA 2DNMA 1HA1A 1UW4A 3BO4A 2CQCA 2MY8A 3JB9k 3G71S 2MQNA 3DLLQ 2CPXA 2E44A 4RU2A 2MKCA 4LJMA 3NNCA 2PEHA 2RQCA 2HGMA 2DNPA 2MJUA 2A3JA 3G9CA 2N82B 2DNZA 3S7RA 2DNNA 2CQIA 2LXIA 2DHGA 2AYBA 3TP2A 1IQTA 5DETA 2KG0A 2RQ4A 3UCZP 3CCES 5LJ3Y 1UP1A 2VODA 1UFWA 2ADBA 1WEZA 2CPEA 4ZKAA 2MHNA 2GHPA 4A8XA 1WHVA 1R8PA 1WI8A 3PIOQ 1JJHA 5BJRA 2KU7A 1FNXH 1FT8A 2JVRA 1PGZA 4LMZA 4WFBQ 1M5KC 2KXFA 2DHSA 3R1HA 4TU9A 3UE2A 2M0GB 2MQMA 2DITA 1WG5A 1X4DA 2X1GA 2DGUA 2KXHA 2I38A 2HGNA 1XN9A 1R8HA 2CQPA 2J8AA 2KH9A 3L3CA 2WBRA 1FXLA 3LPYA 4WKRA 4QPTA 3EGZA 1U1PA 2CPFA 2DGSA 2CPHA 1KOOA 3P5TL 2RVJA 2ZJRQ 4WFAQ 3G4SS 1VQPS 2XNRA 2LEBA 5IM0B 1D9AA 4J5OA 1URNA 5DDOC 5HO4A 3VAGA 3VAIA 4QQBA 1Q86T 2KXNB 2L41A 1VQ9S 1U1LA 1WF0A 2F9DA 2EVZA 3SMZA 1M5PC 5GAGU 4C4WA 3J7ZT 2DB1A 2FC8A 4OZ1A 2DGVA 2CPIA 2BZ2A 1A7GE 3BEGB 2E5JA 4U67Q 1X4GA 2MYFA 4OZ0A 5ITHA 1H2TZ 3I55S 1SJQA 3EGNA 3D2WA 2KT5A 4TLQA 1UAWA 2LA4A 1WHXA 1O0PA 2FHOB 2DGWA 1M5OC 1Q7YT 3UD3P 2MSSA 1M5VC 2MKSA 3IWNC 5DDPC 2MKHA 2J0QD 2RRBA 2N3LA 3CCSS 3CMAS 1FJCA 2DNHA 1U6FA 2NLWA 5GMKa 1FJEB 3CC2S 2DNRA 1OO0B 1N54B 5D78A 1U2FA 1U1NA 3ZZYA 3NNAA 2E5GA
chains in the Genus database with same CATH superfamily
5JVGQ 4PQAA 4RU9A 1JKHA 3V6JA 3JYTA 1FWPA 2VPYB 2CJYB 1L3UA 4DZDA 1HWJA 5E3AA 4CP5A 3THTA 4QWCA 1KD1T 4LRAA 2FLNA 2EBGA 3M1VA 3DN9A 4URGA 4RW6B 1I1GA 1DZ5A 3HVRA 2VBYA 4P73A 2XGPA 3OFFA 1WHWA 3UDVA 2VONA 4LBPA 2DR5A 1RWKB 3EWGA 2V8DA 4USJC 2JNJA 4LF6F 1ZAXA 5AE1A 2XCAA 1JLAB 3UVJA 2GIQA 4DL6A 1ULRA 3EX7B 2OEMA 1R3NA 4ZCMA 5I3UA 1WDDA 3UN2A 3MMCB 3AAWB 4M63A 3IO1A 3M9OB 3ENWA 1TKDA 3CC4S 1OPIA 2W9AA 2XEXA 3J81U 2Y0SD 1UMJA 3MR3A 3AOBA 2ZHBA 3DMJA 3K17A 5DGAA 4RWXA 2PD1A 3PW2A 2E1RA 1NBEB 2FGOA 3CCQS 2OO4A 3GIJA 2M70A 2FPHX 1YTYA 4UOHA 2DIUA 4Y28C 1LW2B 3B78A 4LF8J 2PA3A 4ZVOB 4DCJB 1S9EA 4LFBJ 1PYSB 3NBPA 3JSRA 1NLKL 1M1GA 1C4AA 4K4SA 3L4BC 3SSRA 2HHTA 2WVEA 3TZXA 3MUTP 3D66A 4DJBA 2BQ3A 1BQNA 4FPIA 3I9V9 1RQ0A 3GYXB 3RB0A 4CLSA 2XMTA 3R5AA 1XR5A 3MDFA 3POTB 3S01A 4X4TA 5GADU 1T9YA 2EPIA 4NEZA 4DQSA 1HQUA 4J9SA 1YZ7A 2W4CA 2YKOA 1NU4A 5DG7A 5IT0A 1FE4A 4X65F 2JRSA 4IRCA 2W24A 3B8HA 4FS2A 4W92B 2HSEB 5KT2A 2RHSB 2FVRA 1LWXA 4Q8EA 4PWDB 1KBRA 2NPIA 2ZBQA 1IUJA 3MURP 3RAMA 2QA1A 3D6HB 2FJAB 4KFBB 1H7XA 5IWAJ 3KJFB 3NG8A 3LP0A 5D3GA 3WHIA 2JLFA 5F0UA 1C0TB 1YJRA 2PO4A 1YIJS 4OL8A 1OY9A 2V4QA 3P5BP 3HVTB 4FVMA 1UFKA 2J9CA 2V6AA 2JX2A 4GMKA 3WX4A 3ZZOA 1TL5A 2KM8B 3H5SA 1B0TA 3ONQA 4LF9J 1WKJA 4C97A 2XLIA 2FVSA 1FDDA 3E3XA 1NHUA 1SUQA 4KKOA 1OY8A 3QIDA 4H54A 1HMVB 2DTJA 1ZYQA 5DZ6A 3JAMY 2V4RA 3X1LB 1RHQB 2UZAA 1MSWD 2WCXA 1NK7A 3DU5A 2FHJA 2AIRB 4HLBA 1JJHA 4LUBA 5F8MA 4DF8A 1FT8A 1RHRB 3R2DJ 3I5AA 1FKOA 3HZEA 4V19J 2DGUA 4IDKA 5BXIA 1Y4ZB 3LPYA 1OS5A 2Q1LA 4I2QA 2I5JA 4V1Ak 2RMLA 1DFDA 4CYUA 1MWYA 2D74B 2GNKA 4NXMJ 1OSCA 3G4SS 2QMXA 4QQBA 5A8RA 4P7VA 1VLOA 2AEMA 5ADZA 2CPIA 1A7GE 1HNVB 4EZ9A 1NB7A 4K0KF 4CRJA 2OKQA 4A8WA 4DBQA 2PDAA 4E2FB 5CZVA 4QR0A 4K50A 2GGPA 4P52A 3OL9A 2MKSA 3ZC4A 5GAGI 2N3LA 3GLJA 3IWXA 5GMKa 4B3RF 1HBMB 3M2UB 5I3PA 3M6XA 3HHNB 4O0IA 2DPIA 1GQEA 4B9MA 4DR2F 2NR0A 2V8GA 4Q8FA 1S10A 1IM6A 3KFWX 2ASLA 2CQDA 3IGNA 3ENQA 3I0RA 4U7CA 3VAFA 5D0EA 3JS9A 2N7CA 1UPMB 5J2PB 1RTDB 4UOGA 3M2VA 3CDEA 3HHLA 3IGVA 3CCLS 1VQLS 2DVIA 1BD6A 3TO8A 2HHUA 4F02A 2WB1D 2MZRA 3V5RA 3UNGC 2B0GA 3NS7B 2JL9A 3GYGA 1XIQA 4CQ1A 2MJNA 4RW8A 2W7PA 3GJRB 3C19A 5B0BA 2XSJB 3SDEB 5EWFA 2N4CA 4N7TA 3C6UB 3FCVA 1RZMA 4XPCA 4C0BA 1UZHA 1UVMA 3QLHB 3CIZA 1NK4A 4LF7F 1X5PA 2V34A 3U1LA 4A8MP 4G3IA 3Q2SC 1S7IA 4KPCA 5J1EB 3K57A 5ETKA 2DNKA 3U7JA 4TQSA 3D9BA 3JAMU 2OFGX 3GG0A 4F4XA 1UJ5A 1QVFR 3Q8PB 1HFEL 4YUDA 4J9VA 1S97A 2KZMA 2AEFA 4ED6A 5AJ3J 3H20A 2R8GA 3GV7B 4RW6A 4RR5A 1ZH5A 2M88A 3MM5B 1VHFA 4MK9A 2Q6CA 4ZPCA 4WJBA 3FBEA 3PKYA 3DLJA 3FC9A 2ZVIA 3BSCA 3I4PA 4LQ9A 1JLAA 1GK8A 4R5PB 4ZCLA 4RJVA 2IYIA 4FF2A 2R2SA 1NKEA 1KFSA 4WYWA 3PDNA 3MAAB 3IRWP 4ED8A 3Q2TC 3MMCA 3OTCA 1YK9A 2XMUA 2GZOA 4MKYA 2DK2A 1C1BB 5ETNA 3K7RA 1TU0B 3JTOA 2EEYA 3R8YA 3GIRA 2KYZA 4ETZA 4PPDA 5HP1B 4ZP7A 2M8HA 1BC6A 1PILA 3QAEA 2LQ5A 4C8NA 2B7BB 5E2QA 2MLZA 2BE7D 1N5YB 5IT9U 3W63A 1IBKJ 5E41A 4NLGA 3GYNA 2R4FA 3M8SA 2N7YA 2EK6A 3HHEA 1RT6B 1N36J 1K44A 1V9OA 1TZ0A 1S99A 2IMWP 5L1JA 4ZITA 3KWMA 2CQ4A 1T9UA 4ZOSA 4NRTA 5D8HB 1LW2A 1NZ8A 4F4YA 2G9OA 4JV1A 1DQ8A 2CRLA 2ERRA 1QD1A 1NPKA 2B3TB 1Q8KA 3OTBA 1DBDA 4BHQA 4N41A 1N6QB 5IOLA 1I3OB 3N5BA 2DR6A 4PYDA 2FHJD 2BV3A 2QE5A 4KJIA 1NJYA 1R6YA 5KG2A 3VCDA 3HFVA 3T6JA 2JFDA 3AD8C 3SQGB 1VLYA 5KOWA 1HD0A 4NLPA 4L72B 5F8IA 3SBMA 3POTA 3CSKA 1X5SA 4DG1B 3M8WA 4DUYJ 3Q0AA 3OL7A 1Q0NA 3CCTA 4OQJA 1LQ9A 1NK8A 1IWAA 3H40A 4M5HA 4I7FA 4KR0B 2HFZA 1RLCL 4USHA 1RBOB 3NP5A 3DYAA 1HNIA 4QCLA 1D8YA 4AXJA 3J80U 4LFBF 2BX6A 1UP1A 3MZIA 3R3TA 5EUHA 2VODA 4DHVA 2FZGB 5HQLA 3PIOQ 3VGUA 2KU7A 3ENVA 1RT2A 1K0TA 4KFBA 4KPYA 2I38A 1OYDA 1EETA 4TY9A 3I32A 2ZJRQ 1RUSA 3BB5A 3QYYA 4DPOA 2HHQA 5HI7A 1U7LA 3F41A 2A0FB 2HQFA 1WF0A 3OFHA 2J9EA 4J9NA 3M6UA 2FZCB 5KFMA 1WC1A 1NXIA 3CDBA 3W2WB 1RAIB 4WP9A 1Q7YT 3MEKA 4P74A 1S4EA 3VQSA 4YS2A 1FJCA 3PCOB 5IWAF 4X62J 2R7SA 1RWMB 1HLWA 1BWEA 1IM4A 3W9JA 1HMVA 2AYEA 5HAOA 3PM9A 3FMBA 1TAQA 3RBXA 2D3UA 2HNDB 4PZVA 1CS4B 1PAUB 1APSA 5HJYA 3GG1A 2Q6BA 1FKPB 2R8IA 3BREA 2CQBA 1F2GA 4OI1A 4YFUA 4YP3A 1XNQJ 1SJFA 1XMQF 3BGUA 3AHPA 1N32J 2HQDA 1S5ZA 4I6AA 3CJ5A 2MZ1A 4M5JA 4K7QA 3OUYB 4DOZA 3GSDA 1AUSL 3L95X 1NPRA 2LXUA 3IM8A 2KRBA 2OPQB 5SUHA 2QGFB 1S59A 3W3SA 5H9EJ 4TVAB 3N5FA 1RAHB 3DRPB 5T7LB 2ZE2B 2DYAA 4OYIA 1LFWA 1WWHA 1Y5NB 2LKZA 4PR6A 3L7UA 2A18A 4JV5J 1U2CA 4OYBA 5KFRA 4X4RA 4MIWA 2QMWA 5GAEU 4ITSA 4UW2A 1HBMA 2DR8A 4RKUC 2P6TA 4DN0A 5LXYA 5GMEA 1EHWA 2BJEA 4DMZA 3MFIA 1N48A 3GP9A 2ATLA 3V6DB 4A8FA 3MHYA 1U02A 2ZUGA 3M05A 3CUNA 2Z0GA 3NRBA 3I0SA 1B0VA 1CVJA 1RHUB 1S72S 3E01B 4IUFA 1QVGR 3W66A 1X4EA 5J2PA 5DDQC 1QSLA 1RTDA 3W5YA 1RYSA 2DXDA 3BN7A 4A8YA 3A3PB 2MZQA 4OJ1A 3RBEA 2AD9A 4WTOB 5DG9A 3J81j 4HH0A 4DEZA 4BWJA 5DG8A 4KRWA 2QLFB 3M9NB 2CDQA 3L09A 3BYRA 3BBBA 4UY8T 1IKVB 4B9LA 3BM7A 2XO7A 4DLEA 1TK5A 2ILYA 2XSJA 2W2OP 1N5QA 3Q24A 3CO0P 2UUAJ 2YX1A 4OI6A 1KP6A 1X31C 4KHRA 7AT1B 2GAGC 2CA9A 1H2VZ 4QYZJ 5CYMA 3BQ1A 2JSXA 3JSMA 2C3MA 3QLHA 1QM9A 3PRVA 3VF0B 2AJ4A 4K2XA 1RKIA 4B3OA 3IG1B 4A8OA 3BKFA 4U7UD 2DISA 2HKEA 1G1XA 3HHKA 2LQ9A 5HVHA 1NSAA 3K5MA 4JI0F 2HQIA 5BYRA 1HIYA 5JUMA 2ZZMA 3EDRB 2CDRB 2VKRA 4AXIA 2K8GA 1CSJA 1O6XA 3MM5A 1HQ2A 1XR7A 1FRJA 3UDLA 4X4UA 2ZBPA 2MQPA 2NCKL 3QZ8A 4CLPA 4R5PA 2XMAA 1Y3JA 1FJGF 4WP3A 3FVYA 4TNOA 3JB9k 3MAAA 4AL5A 1TFYA 1HQEB 2E44A 2W9CB 1J5OA 3TAMB 4DR1J 2MJUA 1C1BA 2UUBJ 4ZJOA 2LXIA 1IQTA 5DETA 2V8HA 4WKYA 4RBVA 1F9EB 4JI1F 2ACYA 2IPOB 5HP1A 4EO6A 4P10A 4YMEA 4O4GB 2HRYA 3W64A 5EX3A 3GSIA 2MHNA 4A8XA 1E6VB 3NGKA 5IZHA 3ADAC 5GADI 3QT8A 3BBCA 2KXFA 1U8SA 5LT5A 1KWMA 2VZ9A 3R1HA 2M0GB 2X1GA 4ZLLA 3H25A 2R7XA 4HI1A 3IBCB 2AX1A 3MPDA 4QJVA 3T5JA 3SYZA 3HLUA 4P72A 3TA2A 3KNGA 4DXLA 1TL4A 2QTWA 2AZ3A 1B99A 1JIHA 3AA9A 3QIPA 3N79A 4JI5J 2O01C 2V0NA 4QIWD 3SQGA 9ATCB 2IA0A 2VQFJ 3Q22A 1G6BA 1IBKF 2GA7A 4DG1A 2XMKA 3C16B 4ZVHA 5D78A 4FDFA 2RAQA 2JZ5A 2OAUA 4FN5A 5FD1A 3O6QA 4KIAA 1CEZA 1YWXA 1PC5A 3AH6A 4OZLA 1UA1A 4QIEA 4O3SA 2DT9A 1SL0A 1SH2A 5T14A 3I56S 3TI0A 1DHMA 3UO0A 3G6ES 4W4MA 1PJ7A 4FF3A 3N4WA 3KUHA 2L48A 4DU8A 3R5DA 2A10A 3FSYA 1U48A 3UI3A 3NOCA 2VD3A 3QMQA 4U7UK 5DRKA 2CAJA 1ACMB 1S57A 4QBUA 4L3KA 4CO1A 3GJTB 3NMRA 2VBXA 1PBAA 2FYXA 4TKTA 2ZKTA 1AFJA 2AX0A 3LGHA 3I5CA 4KTQA 4PUOB 3L7PA 3EXCX 4ES1A 4F4KA 2YWGA 4C3LA 1C2PA 2WONB 4JUZA 4EZ6A 4ECUA 1S9FA 2HWTA 3PKMA 3NCRA 2VDIA 2FDNA 4OHZA 2OPPB 4KGZB 3R5GA 4LF2A 2D3OR 4F3OA 4E98A 4TY8B 4M5KA 4HT7A 3DDNA 1HW8A 3RW7A 2AKWB 2HNDA 5D4OA 1CS4A 1KFDA 2ZJQQ 1FKPA 4Y6IA 2BJ7A 4YB7A 3VAMA 4TU8A 2G2YA 3UW1A 2IJFA 3RR8A 2IAJB 3Q8UA 4WCEQ 4XDDA 2PMWA 3J7AN 1FRMA 1RT5B 4ZA1A 2GQQA 3FZ2A 4XPEA 4Q0BA 2CQ0A 1FNMA 3OUYA 3W9IA 3PW0A 2Z8QA 4PWWA 2HNZA 3MFHA 3CMES 1KHWA 2YKPA 4OHYA 1T0TV 2DH8A 3LP1A 2XM3A 2W8LA 3DRPA 2KVIA 2QL5B 3QAUA 1SB6A 1LFPA 2ZE2A 3CXCR 1A6LA 2H65B 3TYTA 3RAXA 3PEJA 4URQU 4G1PA 4Q2MA 2R7OA 2XMMA 4NYOA 2HQ3A 1YJWS 1P1TA 1HYSB 3HFZB 5AXLA 3L9ZA 3PW7A 3QWUA 2ZZTA 1U26A 4FPRA 2QA2A 1S6QB 2MQOA 2CZ9A 1VQKS 2FJXA 3HDSA 1ZOTA 1ITPA 3BGRA 2PI5A 1GAOA 4NCAA 2YKMB 5L8RC 1WEYA 1FJ7A 5AXMA 3E01A 3TZZA 1VBKA 1PBUA 3K8WA 3MEEB 3BN4A 2RKIB 5IV3A 1RP5A 5HROB 4ZMMA 4JV5F 4XO0A 4TYAA 2W9BA 4HKQA 3QPIA 3KMSA 2V2QA 1U1RA 1Y10A 3NMAA 3ZTPA 2ZH2A 1F1BB 3H4DA 4CM2A 2WOMB 3LAMA 5SZTA 1X9WA 3DLHA 4MFBB 1Q8IA 1S1TA 1MG7A 4LF5J 4RU2A 2DNZA 1MNEA 4RW7B 4AD6A 5A6PA 1UVJA 1NJWA 5H9EK 2CPEA 1YJ7A 3C3LA 3G6XA 4ZS6A 3R7BB 3HF5A 3IG1A 4J91A 3DRSB 1V6HA 2G2ZA 3FK4A 4TYBA 4NYPA 2F5GA 2HGNA 4QPTA 2XTJP 1XQIA 2E1CA 1RWXB 2VG6A 2Z30B 5LOQA 4ZVFA 3SCLE 4RL1A 4A8SA 4G1IA 1P8GA 4J5OA 1FF2A 4FZVA 4KE5A 2UUAF 1NZAA 4ZLJA 3OFGA 1FFGB 1JLFA 3H7HB 2W7AA 4NLWA 2IDLA 4G6VB 4Y2MA 4DS4A 2FHOB 2CNNB 2GX8A 2WK4A 1SVDA 1O5JA 3QZ7A 5DDPC 5HANA 2J0QD 3CMAS 1XERA 3H4BA 2YPYA 5D4PA 1Y3KA 4LFAJ 1TUWA 4NMXA 4H4MB 1B0PA 3CCWA 1HQEA 2W9CA 3LW5C 1W25A 5B08A 3TAMA 1RT3B 4F4AA 5J1NA 2OJ3A 2F8MA 2HFSA 2IYGA 3AT1B 3R5BA 3KUGA 1B70B 3FCWA 4J37A 3CO9A 2JJ4D 2JWNA 4NXNJ 1EKSA 4YR2A 3P6YC 2OSRA 1AT1B 4I1TA 5CAAA 2EKYA 4P2SA 1RCXB 3OXLA 4QYZK 3V4MA 1UFLA 3SFGA 1TL1A 2MMYA 2HHPA 5DO2A 5KT5A 4ED0A 4M5GA 4CO4A 2VU5A 2UUBF 3PR5B 4OIXA 1GH8A 1JLQA 1TR0A 2YY3A 1HBNA 2Z2YB 3O8WA 1LOUA 2FQQB 5HATA 1F3VA 3TRGA 3K0JA 3NKYA 4IYQA 3DLKA 1WOSA 3BSAA 4O3QA 1WELA 3W61A 1YJVA 1JLEB 1RAFB 4C48A 1P27B 3C16A 1M1KT 5F8LA 6FD1A 1TKZB 2O5DA 1KC8T 5B0DA 2DNOA 4NOHA 3AJ1A 3EYZA 4B3MF 3GPAA 5H9FJ 2OTJS 4OYOA 2NSBA 3PVXA 4F2SA 2CJKA 4KO0B 2BXJA 4ER8A 4JI4J 1BWVA 2F7VA 3G6VA 4FXDA 3TOQA 5K14B 1M5HA 4O3NA 4JI5F 4ED7A 2H4YB 1LWFA 3OHAA 3MOJB 4JI8J 3J7YU 3EMTA 3R9LA 2UP1A 3HT0A 2WSCC 1TP7A 3PYGA 5C5JA 4V19X 3F56A 2LU1A 5D15A 2MEWA 2KJWA 3M8QA 2YPZA 4IOBA 3H98A 4ECSA 2RQKA 4MT1A 3RUBL 5L1KA 2VC1A 5KFDA 4Y34A 2XSFA 1Z1ZA 2BVZA 2FD2A 4RZRA 3HZGA 4OX6A 4PG8A 4S0MA 1RCOB 2RB7A 4PUOA 3CJ4A 2JDJA 3HK2A 2WONA 2YWEA 3OXFA 3BBFA 5LJ5Y 1T9VA 4ETXA 2OPRB 3S6EA 3KLGB 3MD3A 2WVBA 4OYZA 2OPPA 4B9NA 3FBFA 5CD4A 4F04B 4KH1B 1ZTWA 2MKKA 2K3KA 1SJ1A 4IR1A 4C8KA 1RLDA 5D0GA 3U02A 1R89A 4ZLNA 1X0PA 4Y2IA 1RK8A 4DL3A 1U2RA 2MQLA 3CIMA 3TA1A 2E7VA 4GC7A 5LSLA 1KQGB 2UXDJ 4WPAA 1PYOB 2IAJA 1RI7A 5L9NA 3F0NA 3RU0A 3W9HA 4LVNP 1RT5A 2KTQA 4Y65A 4WWSA 1EB0A 3QSIA 2ZH8A 3HI9A 4AE5A 4KHPF 4WFNQ 2PEBA 5C25B 1TL3B 1F60B 3G8TA 4Q45A 5THWA 1WI6A 1TL7B 1UETA 4DR4J 2C42A 4M5LA 3GIKA 1N5TA 5KG5A 2MQNA 2BJ9A 3S1TA 3BSOA 2GIFA 3G8QA 1RDRA 2RQCA 2CJ9A 1NKBA 1WUUA 3KK2B 5KFUA 2VG5B 2KG0A 4G65A 5AT1B 2VF3A 3D0IE 1ZA2B 3AODA 2UV8G 3MOZA 1UFWA 3G2XA 2GS8A 2ADBA 1HYSA 2KJVA 4CM0A 3ZZUA 1H98A 4DV1J 2Q66A 1S6QA 5BJRA 3D67A 2ZDPA 3MM8B 1VQYA 1X4DA 2F1FA 2K7JA 2HEKA 2BABA 3JXOA 4IFYB 1BLUA 2YKMA 4ATNA 3VQTA 5DQIA 4WBFA 3NAHA 4ZHRB 1MMNA 2AP6A 1D9FA 3PRDA 5HMXA 1I51B 2RKIA 1T02A 3OL6A 2ZH9A 5HROA 2H54B 2GJIA 3A8JA 3TQEA 3FFIA 5AE3A 3OBIA 1Q95G 1SJQA 3TWZA 2BE9B 5L38A 1YBTA 2WOMA 3QGPA 1WACA 1TFWA 2HG4A 3AQPA 4ED1A 1RSCA 3CC2S 4X84A 4MFBA 3Q8SB 2H5EA 3ILIA 5EX0A 5BYSA 4OHXA 1F0XA 2GJFA 3DLBA 2CYYA 2GQ2A 3BKUA 3KG0A 4RW7A 5L39A 3PFOA 4CO3A 3OLBA 3CULA 2QSFA 1Q5VA 2VOPA 2K3IA 4HEA9 1RWPB 4RX6A 4IO9Q 3IBFB 1RXOB 3DRSA 3RRKA 3LH2S 3W2VB 2G13A 2EFOA 2RILA 3D1OA 4WFYA 3BPSP 4GO5X 4XDCA 2ZH4A 3BV8A 1N34J 3T6BA 1HHQA 3RW6A 2YKNB 1Z2ZA 4LF5F 4DQRA 1T05A 4I69A 4ZPAA 4C11A 1WEXA 2MTLA 4F36A 2M9KA 1QSSA 2K2PA 1KN6A 3HD1A 5GAHU 4RW4B 3OVAA 3US5A 1VDHA 2R7VA 3R7NB 3CDUA 3J7A1 2DGOA 3GTYX 3LP2B 3T1HJ 2DIVA 4OJGA 4K4WA 2FHKA 3THPA 1PJ5A 2QEXS 5EGYA 1H0HB 2VL1A 1IKYA 4H4MA 5DDRC 2EFQA 4A46A 4MK7A 5FJ4A 4ID5B 5EWEA 2QLWA 1UA0A 2FJWA 5J2MB 1N8RT 2BRLA 5KFPA 1HPZB 1I6JA 3JQMA 3H90A 4X66F 4Z7CA 1VIOA 1HHSA 5K9FA 4PPZA 3SFUA 4DSFA 1H6KX 3M6WA 1UVIA 1RE1B 2P9CA 3DM2B 2ZH7A 4X4NA 3A13A 3QFWA 3U27A 1L5UA 1WSRA 2XHWA 5L1IA 3PX4A 3ZNJ1 3MPVA 3TJAA 4XK8C 2RS2A 5H1SV 2AV5A 1NM2A 4NWBA 1AA1B 1Q8BA 3CD6S 2DNGA 4JYAF 5KG3A 3NWRA 2H51B 1YI2S 4X4SA 1HI0P 2BA9A 1FRIA 4IO1A 2XS2A 3R6GB 4NXNF 1M0SA 2E29A 4M5IA 7FD1A 1SKWA 1BXNA 2QLXA 2V2VA 1JLEA 2FVPA 3M8YA 2IC3B 5KG0A 3KG4A 1TKZA 2P9EA 3ILLA 4A47A 1OMSA 4LSZB 3TAPA 2XS5A 2DEJA 3FZBA 3NL0A 5A2QU 2V9KA 3GJSB 1MN7A 4UOFA 4X4PA 4KO0A 3F44A 1D09B 3EUNA 3C14B 2E7XA 3RR7A 2VFUA 1IR1A 3VAJA 2BANB 4C6AA 1C1CB 4FNIA 1U47A 2E5LF 2QRRA 3NWGA 5KFOA 1S6PB 1YVFA 1VBXA 2JEJA 4LQ3A 1Z2LA 2CG8A 3KKFA 4N56A 3VGSA 2HAIA 2QL7B 4EMDA 2DHHA 2DNMA 1VISA 4F3QA 1PAEX 3H59A 3HHLC 3D3CJ 4X65J 8RUCA 2A3JA 4F0KA 1Y0HA 3S7RA 3X3UA 2VFTA 4OZJA 2W2MP 1DY3A 5CD4H 4CO5A 2C22A 1WDTA 1X60A 2OPRA 3IBWA 2FLLA 1CC7A 2R42A 4NEYA 2LVWA 1CPZA 2HVEA 1KEKA 2UU9F 4NZ7A 2DHSA 4ED2A 2MQMA 1LWEA 4K4TA 1GMUA 2J8AA 4DV3J 2UVWA 3H5UA 3M2RB 3DDIA 4ANCA 1KOOA 2HBYB 1QAIA 4ZN3A 1URNA 5H9FK 3TZWA 4UUWA 3WX8A 2LXFA 1Q86T 2H3EB 3TW0A 2L41A 4MIAA 2BM1A 1Y5LB 4ES2A 3J7ZT 2DB1A 3QWPA 2RF2B 4DDFA 3UQSA 1ZM3A 1H2TZ 3I55S 2Z2ZA 2MSSA 4ANEA 3HVAA 5B0GA 3C2PA 1TL7A 1NSPA 1FJEB 2ZHOA 3ETMA 3A8KA 1S1WB 3GMGA 4NL5A 2JC0A 1SJ4P 2VG5A 4O3OA 3QFHA 4HACB 4CH0S 3M9MB 4DV6J 4BDPA 1ZS6A 4ILLA 1O8BA 2VBWA 3OQ2A 2XNQA 2GW8A 3HHDA 2UVVA 2HK2A 3WBZA 2LCWA 3FMWA 2XULA 2BOAA 2MGZB 4NCBA 3DKDA 4KV8B 2MY7A 2MKIA 3MXHP 4KBIA 1VQSA 4FS1A 3HCXA 3TARA 2G4BA 4IG3B 2J7KA 4CNYA 1R6VA 4BS2A 3CD0A 1BUXA 2VH7A 3ELHA 2IRXA 1SL1A 4OV6A 1WHYA 1AUDA 4K0KJ 3KUEA 3MCMA 3MR7A 1DLOA 2P2CB 1TUGB 4X64J 2MQQA 2R7WA 4DV1F 1U4BA 4F8RA 2DNQA 3I87A 4PXCA 3R97A 3MPYA 2L3MA 4B3RJ 5B09A 3CF5Q 1WC0A 5FIIA 4RLEA 2RU3A 3R5CA 3PYFA 1W2BR 2EC0A 4DR2J 1RT1B 4DPUA 1JLBB 2VHGA 2C3UA 1NAQA 1P1LA 5B7WA 2BKPA 2V69A 2RRAA 3A8EA 2Z58B 4LR9A 1U09A 4DL0C 4LRFA 3A12A 2CJBA 2GO9A 3OTDA 3CJ3A 3AQOA 4HDHA 3W2VA 2HS0A 1S0MA 2MZJA 1AZSA 2XS7A 4P75A 1LEOA 2ZNYA 2DR7A 5J1PA 4NLUA 2YKNA 4B3TJ 3DXSX 2XLKA 5CA5A 2VJUA 1TK0A 3P49B 2H48B 4D3GA 1PO6A 3IMQJ 1IJEB 4C98A 4O0NA 6AT1B 2M2BA 1FK9B 4GKKJ 3LP2A 4OLOA 4LVOP 1KRPA 1IQZA 3FCHA 2RDJA 3Q8VA 4IFVB 4ID5A 2KI2A 1OYEA 3CGIA 2HVZA 1HPZA 2QLBB 2SXLA 1S76D 2CXEA 4ZJLA 4LREA 3O1LA 3MGJA 4ZVSB 3QRRA 2QFJA 2FB0A 1SV5B 1NK9A 2R7UA 3TX0A 3V6HA 4BCAA 2KZZA 2OD4A 1O51A 3DM2A 3GJQB 1KVIA 4WIQA 5KOXA 3UN5A 3MMBB 3ILJA 3B4MA 3T1HF 2JEGA 2AQ4A 4DL7A 4I4BA 2V63A 3D7SB 4DQIA 4MJKA 4DCOB 2ADCA 4RNOA 2HBRB 1VQ6S 2VASA 1J5EF 1CG2A 3BO4A 2FY8A 4LRDA 2GQCA 2MKCA 1I5OB 5LMUF 1S6UA 3G9CA 3D0GE 1QAJA 4ANDA 2GMJA 3TP2A 4B9UA 4L76A 4PYAA 2YQ3A 1T9XA 1UTAA 4QIGA 4U95A 3PW5A 2B5JA 4C3MA 1FFSB 2IC3A 2OP5A 3KMQA 1YJTA 3BQ2A 2FUG9 5A76A 4NA2A 2A1BA 4X4OA 2KXHA 2XC9A 3LUYA 4YY3J 4WYLA 2RVJA 2LEBA 1YBUA 3W7BA 4ZPTR 3LGNA 1LW0A 4OYXA 5KFGA 2BANA 1TKXB 7FDRA 1C1CA 1B7YB 4BC9A 1SH0A 2HIQA 1S6PA 3GWCA 2UV8A 3LTOA 2VIHA 4F67A 4F7VA 1TK8A 2MHEA 3NOGA 3PR4A 5AXNA 3BKTA 2CZVC 2YNFB 1OO0B 4F50A 2XI2A 4NLQA 4QPXA 4DSEA 1HNXF 1S1VB 2HFOA 1Q81T 4MTPA 3G96A 1R27B 3R6LB 1IR0A 1MLAA 2W8KA 1ZZFA 3NGTA 2JVOA 2AGPA 4N47A 4ALZA 1QY7A 2M7SA 3LO3A 2BR0A 3D6FB 4DCPB 1VQ7S 4DPTA 3QBCA 2B43A 2AF6A 3AD9C 1CJUA 1H2UX 2CG4A 9RUBA 4DPYA 2FJBB 3QQCD 3MM6A 1KNZA 2YKAA 5KFBA 5CCLA 3M2RA 2D3O1 3EGWB 2WVDA 1GMWA 2ZNZA 4K4VA 4CH1A 3OSNA 5HQ8A 4J9UE 4KGXB 3WC0A 1YRXA 1FERA 1HR0J 1KVKA 2YH0A 1U0HA 1JLGB 2LFVA 2G0IA 1HWUA 2DGTA 2RF2A 1NJIT 4JI6F 5IQ6A 3C15B 1Q16B 4K59A 1YGYA 3QGHA 4U8YA 4DFKA 1NJZA 4BLGA 1EP4B 1FD8A 1FXRA 2QMUB 2IHR1 1FRKA 2XG8A 3N01A 5ETTA 5MLCV 4DV3F 3LOUA 1S1WA 4J9QA 1L3TA 4WU2A 4RNMA 2LP4A 2PT0A 2QLJB 1PKUA 3MPUB 4CLLA 4Y0FA 4DFMA 2UUTA 1H3DA 3GQCA 2BKOA 2IRYA 2DXEA 2A2DA 4LSLB 5ETSA 3SV4A 4FYYB 2HNYB 2B6AB 1XMQJ 4Z2XA 5F8JA 4I67A 3TVKA 3GZ7A 3ULHA 2DGXA 4JI2J 2VV5A 2DBBA 1TVRA 2DY9A 4KV8A 2X1BA 2KVQE 3VGTA 5MAOA 1TTHB 1OIAA 2C1EB 4IG3A 1BQXA 1Y9OA 1DAXA 1HI8A 1SC6A 5A8KB 1ZBTA 1RISA 4CZCA 3NGSA 3U1MA 2AJ2A 3T5HA 3F73A 4DV6F 2UXCJ 1SJ3P 5K8NA 3HMJG 4DLGA 2KT3A 2ZH3A 1MN9A 3QT5A 2B8PA 3G82A 1X5TA 3D6TB 4B3SJ 1JK9B 1SIZA 3ZZ0A 1TKTB 5DM7Q 1BGXT 1JLBA 2LECA 2VA3A 2CJAA 4BBYA 4GKJJ 3EVWA 5HK4A 3VV2B 3OW2R 4M5NA 1NHKL 2ASYA 2FTRA 2LQJA 5KFHA 2YKQA 4M94A 4CT9A 1FESA 1V5VA 1CJTB 2XYHB 1D1UA 3MAQA 4HTJA 1RAAB 4KH0B 4X64F 2C28A 3AXMA 4N77A 4HR2A 3DI6A 5J2QB 3V6KA 3TVZA 4O44B 2IA6A 1AROP 2KO1A 2L9DA 2H5IB 4M5MA 2OTLS 3EM1A 4YOEA 5CXTA 1PSDA 2RD5C 3OTOF 5DGBA 2CQCA 4NLXA 3TJ9A 2N82B 3UD5A 1HWKA 4MKAA 5F0WA 4YR0A 5HLFA 1FK9A 4B08A 5F9LA 3H2LA 3JQKA 4ZVEA 4IH5A 2DY1A 3JSYA 2C2OB 4NZ6A 4TN2A 1KTVA 1WC4A 4IFVA 5E3QA 3HP6A 2JC1A 3EE3A 2VG7B 4TU9A 5DZ7A 2DITA 1WG5A 4NRUA 4NMLA 4B3TF 1XN9A 4LRBA 2ATCB 2C2KB 4JI0J 4NLOA 3NEKA 3P5TL 2ASDA 4L6V3 4WE1B 3THVA 4EEYA 1UZDA 4I2PB 1D9DA 3SMZA 2I6WA 5GAGU 4OI0A 2Y1LB 1W2IA 4B02A 3FGVA 4GKKF 2HW3A 4DX6A 2L9NA 3BEGB 1UEVA 2MYFA 3TUZC 3EPGA 5C2CA 2FGCA 1M5OC 3WDOA 1FJGJ 2P6SA 2XMVA 2HAFA 1JX4A 2P8IA 1N54B 1GMWD 3CMQA 4DPWA 4HHUA 3Q23A 4ECQA 4A8QA 2QA4S 4IOCQ 2Z56B 3I82A 2W1BA 4JI1J 1KONA 3ETOA 1XJWB 3TUPA 2EG2A 1JKHB 1P9QC 3CJ0A 1SIWB 2PFFB 2OEKA 2K1RB 2KKHA 3CJ2A 2B9XA 4DUZJ 2OD6A 5D0HA 4ICLB 3KDNA 1T11A 2BJDA 1K47A 2AZ1A 2QZ8A 4OJ3A 4TLRA 3G8SA 4PABA 3IAM9 3JSBA 2WVFA 1XR6A 3PX0A 4E0DA 3VTIA 2ZH6A 2AJ0A 3OXGA 2XZTB 4OHWA 2M52A 2HZAA 2RS8A 2ZWOA 3WQPA 5ETPA 3FRZA 5LMNJ 2R2UA 3TNVA 1N0VC 4ZVPB 3CNQP 3HSDA 5KG7A 3CD7A 2YNFA 3RB4A 1PJ6A 1HNWJ 3EVOA 4YY3F 3DNCA 1BY9A 1K9MT 1CBKA 3FJ2A 1WF2A 3O2IA 2DRDA 5KT3A 3DMJB 1NK5A 2NUUG 3HT3A 3CJKB 2YXLA 3FNNA 4KHMA 3PJXA 4ZPWR 3EJMA 4QU7A 1FD2A 3MF5A 3ZZZA 1A9NB 1YJUA 5HL7Q 1K0VA 1L3KA 1IR2A 1S9EB 1XNRJ 1U24A 4ECTA 3NBPB 5KFYA 2HS4A 2CQ2A 4U8VA 2YWFA 3ZXWA 4WF9Q 2O66A 3BR8A 1D0EA 4H4KA 1FTRA 4ZLPA 1IBMJ 4ZVQB 1JLGA 5HVGA 5T41A 1UPPA 2ZBCA 3ZTSA 2C2EA 1U0SA 4ZVGA 5GMDA 3D68A 2B9EA 3NCQA 2VBZA 3MEGB 5JVHQ 4PWDA 4ZJQA 1IBLJ 2F63A 1YBAA 4KGVB 1V3RA 1XK8A 4KC5A 4PG5A 3IM9A 3UR0A 1SQGA 3M30B 1FO1A 3CTRA 3OPKA 2PFDA 3EPIA 3PYEA 4QW9A 2V94A 1C0TA 1SXLA 3N9UC 1Y5IB 2D7SA 4FXWA 1AYEA 2OI2A 3PO5A 3QNWB 2ZC3A 3MWBA 2C3OA 3HVTA 1HR0F 2J76E 2CPYA 3HFKA 2DD8S 3RGIA 2HNYA 2B6AA 4B9SA 2CQ1A 2ZHAA 3D5MA 1QJHA 4Y3CA 3TVYA 4ZCKA 3HHLD 2F3JA 2BJ1A 1YHQS 4QWDA 4F0HA 2B51A 2PMZD 4NX9A 1RWVB 3DOMB 3DU6A 3GU0A 2MZTA 4ELVA 4ECRA 8AT1B 4ZVUB 3FEYB 5KFLA 4F3MA 2VFSA 4RO0A 4OX7A 4RNFA 1CULB 1HA1A 1OQ6A 1RU2A 3DLLQ 2XO6A 1VFJA 3D4JA 2UVRA 4WK1A 4I64A 2JH3A 1JB0C 2VQEJ 2WRMA 4J7CA 1S7HA 2VPZB 1UJ4A 4DR7J 3JQJA 1WHVA 4JI2F 1R8PA 2OFHX 1MROB 5RUBA 1TAUA 1XMBA 2EWHA 2WW8A 3MM9B 4ELTA 3RBZA 1ROFA 2R3VA 1PYTA 3BGLA 1VYAA 5KTQA 1FKOB 2KFZA 6FDRA 4LT6A 1CJTA 2R2RA 1RAOA 1N5VA 2XY7A 1HNVA 3OVSA 2ASJA 5ETOA 1UVLA 2UXCF 4RUAA 1VQ9S 1LNQA 4LIWA 3Q8YA 2HS3A 1RT4B 3PJWA 4U67Q 1X4GA 4ILRA 2QYCA 5D4NA 3IAS9 3OL8A 1WHXA 1O0PA 3M2UA 3OTEA 1RT7B 3BSNA 4O44A 4LF4F 3UD3P 4B3SF 5KFTA 3CE8A 3HSZA 2XY6A 3IWNC 2NLWA 4Y2AA 2R2TA 3HJFA 5F41A 1BE4A 3DGPB 4DI6A 4GKJF 5HVFA 2EC2A 2J5AA 1DJ0A 4K4YA 3AY0A 1VQNS 2NREA 5C2GA 3NS6A 3J81Y 4GRSA 2Y1RI 3MCSA 2AGOA 1NUEA 1FA0A 3NAIA 1RWUA 1AW0A 3PIPQ 1X4AA 3EVMA 4N5SA 3T9NA 1U1OA 2IJNA 2DH7A 1FNOA 1UWBB 1CJVB 4U96A 2E9ZA 2B4OA 3CDWA 3BO3A 1VS3A 3PZPA 2VG7A 3I0RB 4J9PA 4OI4A 1WKKA 2G2OA 2F4VJ 3M2VB 2WBMA 1UL3A 3SDEA 5G4DA 1KDNA 4F2RA 4WE1A 1WKLA 2JFKA 1WC5A 3C6UA 4DS5A 4I2PA 1FI4A 1IKXB 2COLA 1PC4A 1RWWB 4AL6A 1CC8A 4Q5VA 3A3NB 1WTBA 1RTJB 4X2BA 5CZXA 4YQWA 5B0CA 4C8MA 2ZD1B 5C42B 2CQGA 2FJEB 3TANA 1F9HA 2HHWA 4NLDA 5J1EA 3CPWR 5HMYA 2E9RX 3VGVA 1WD6A 3UCGA 2DH9A 1SC4B 5I42B 4C8YA 1OJ4A 2IDEA 5KFQA 4DSIA 2AJ1A 2PI4A 2HRTA 2HQCA 3MUVP 1K1SA 2XQCA 4DL2A 2PGCA 1Q4RA 2HFUA 2ZVSA 2HHHJ 2PIIA 3UFCX 4LIRA 3CCRS 1C4CA 4OYWA 2J6UA 3FSIA 3SIPB 1R8BA 2C2NA 2JLGA 4DV0F 4FYVB 1CQNA 5E0OA 2OH2A 2K1RA 1Q5YA 1GNKA 1JWWA 5K8PA 3IXQA 2M3DA 3PG9A 4J9MA 1V3SA 1RAJA 4ICLA 4AYBD 4P2FA 2Y8YA 4WIIA 1AXQA 3K58A 3HULA 4DV4F 4ECYA 2CNOB 3H0PA 2I1RA 2YX7A 2I8EA 3IR5B 4OZNA 4GVBB 3ISND 4UUXA 4AFFA 2W01A 1ZTTA 4HT5A 5M2PA 4JBCA 4FKYA 4R25A 4WTYA 2IM1A 3I4HX 1N5YA 2Q79A 3BQ0A 2O1PA 1VK8A 1VBYA 1RT6A 4DUZF 4IR9A 4P6QA 5KFJA 4B17A 2FLPA 4B3MJ 3HVWA 2LEAA 4HI2A 3SQOP 2KL8A 3K5PA 3H2UB 1M1HA 1YLXA 4RUBA 3P3DA 1N6QA 1KQSR 3CT9A 3CJKA 2DJWA 3M8PB 3GIMA 1WOPA 3P4UB 5IQQA 1RTIB 3HKWA 2KHDA 3M6VA 1V5IB 4NI2B 5LMNF 1QUVA 4NLSA 2PSZA 1K1QA 2CKWA 2V68A 5D0RA 2FHMA 2XMWA 2WZ1A 3CWJA 1HNWF 4UTGA 1RJJA 2J9DE 5HMZA 2FJDB 1H72C 5ETMA 5DS7A 4CO0A 3ZZTA 2LMIA 2OGUA 1VIXA 5DQHA 3I96A 5IV4A 4LFCJ 1KHVA 2Y9HA 4ED3A 4YN3B 3D1HA 2IM2A 2CQIA 4IRDA 1TMMA 3MEGA 1G7CB 1IBCB 5LJ3Y 4I7FB 2F8EX 3DYAB 1HNIB 3M30A 1XNRF 1FNXH 3BDEA 4I6WA 3V81B 3AB4B 3NGUA 1JJCB 2WBRA 3TAQA 3OFEA 4DV5J 2CPHA 4IKAA 4ZP8A 1UWAA 1RT2B 3W60A 4ZCIA 4WFAQ 1VQPS 1IBMF 5IT4A 1WORA 3TUJC 5DDOC 4JB8B 1BHNA 1EETB 4CLUA 1U1LA 3W2WA 2HRUA 4HHHA 4Q7AA 4M8LA 1IBLF 3Q83A 1CLFA 2E5JA 4KHPJ 3DOMA 4JV0A 3SCJE 3LGMA 3EGNA 1Y00A 4YB6A 3OJUA 3MR6A 1UAWA 4ZP6A 2DGWA 3D54A 4RNNA 2R7QA 2FVCA 4EFAC 1AFIA 4QIFA 1S0VA 1CULA 1NK6A 4UZCA 3SCKE 1REGX 1NDCA 4HDGA 2W2QP 3IN5A 2NSCA 4EYHB 4GVLA 4EYIB 4DX7A 2W7OA 1NKCA 5C24B 5E7OB 4P9SA 2ZEJA 2LDIA 1EJ7L 2POKA 4K5RA 3B54A 2LDYA 2V5HG 1MROA 1ZZNA 2HZCA 3MI7X 2XWYA 2VB6A 4PKDB 3KHRA 2GV1A 2OPQA 3MM9A 4YB1P 1BQMB 3HM9A 3FEXB 5ETQA 5T7LA 4CTAB 2XCPA 2WSFC 4CCHA 3K5LA 3O3LA 2F9JA 3T19A 2WAQD 3LF0A 3NLCA 2H5JB 5FDLB 2KRRA 2VQEF 4J9LA 1FVQA 1JJ4A 3KK3B 4Z7YA 1RT4A 4M95A 1VMBA 4DR7F 2EXUA 3AOAA 3TZYA 2XI3A 1RT7A 1RHJB 4AT1B 1R7IA 3V6DA 1Q82T 3BGOP 4DU7A 2Q43A 3QGIA 3DGPA 2FIUA 4YDXA 5LSOA 1EQMA 1FTCA 3RG6A 4C3KA 4JI7F 5DLFA 3ZNUA 5E3CA 1K8AT 3GV5B 1Q8LA 4ELUA 5IT9Y 4NLTA 2B7CB 5E33A 1KSPA 2DPJA 4AUKA 1VRQC 3OJSA 1UWBA 2E5HA 5KT6A 2HZVA 1CJVA 3I0SB 3UPFA 2G1HA 3ET6B 3GIIA 1Y7PA 1Y11A 1U25A 1ZAWA 3FDSA 1IKVA 2ALZA 4OX9J 2QN6B 4QZVB 3DRRB 2Y1IA 4A48A 1G2EA 4IH6A 2DKOB 2Z2MA 1IKXA 3JTPA 3EZOA 1NH7A 5L1LA 2H4WB 1RTJA 1XTZA 1N56A 1W26A 1H38A 1DTQB 4F26A 1P9YA 2GHVC 2E9TA 1VQ4S 2ZD1A 5C42A 1RHKB 1RWNB 3WIUA 5F3ZA 2EW9A 4AQYF 4UQTA 3EICA 4ILMA 2MKJA 3PYDA 5M2RA 2LQ8A 4UOCA 3J80Y 4PAAA 5I42A 2F4VF 5CYMB 2KYXA 3Q89A 5CCMA 4OZ2A 5GVQA 3JSMB 1FWLA 3NXZA 3C46A 3R7SB 5L46A 1WC3A 3D6MB 2B4PA 1VRUB 2BW2A 4B3OB 4X66J 4F4WA 4DWIA 1T3OA 3DCAA 3KTQA 1FX4A 1PIEA 4IH7A 1L3VA 2RUSA 2BOPA 4O3RA 4WZMA 3RJMB 4L73A 2ALYB 1SKSA 1B64A 3K8VA 4EUVA 2J8SA 3MEDB 1F6TA 4A8KA 4J9OA 2YBVA 3I6PA 4DX8H 2CVEA 1HARA 2ZOMA 1Q78A 5G0RB 3K2YA 4JYAJ 2CPJA 3KLVA 1XBWA 4C0HA 1FFWB 1RTHB 3LAKA 4GVBA 1UW4A 2MY8A 5KG1A 1QSYA 4O4GA 2HHHF 3PO4A 1RADB 2QG9B 1AB8A 2YWWA 3FEZA 3P96A 1E6VA 5F8GA 3W8GA 2AJFE 3MM7B 5ETLA 1T9WA 3GB0A 1J5OB 4I56A 1FCAA 2IBOA 1WI8A 5KT7A 1V3ZA 4CDIA 1OQ3A 2WSEC 4DR5J 3TR5A 4CH7A 1D3WA 2ROEA 2QIFA 1T03B 4DR3J 3M8PA 4D3HA 1XEZA 2BRKA 1RTIA 3H8YA 1S9GB 4IG0B 1SI9A 4HHJA 1GX6A 3C6TB 1VI7A 2V8PA 4NI2A 2E5LJ 4KT0C 2FC8A 4MYUA 2DGVA 5KFXA 3E2EA 2ZFHA 2JHEA 4GC6A 3SV3A 3QIPB 3B6BA 3RBDA 1YQHA 2IVMA 1YSJA 3TJ8A 4DFJA 3T5LA 1SCJB 1UKUA 2DNHA 4ZN1A 5EWGA 3ZZPA 2YQ1A 4C2MA 3KLHB 3DOKB 2R8KA 2Y3YA 3G87A 2J6SA 3H2VE 4M1KA 2V67A 2M5YA 3MECB 3FKBA 1HNZJ 5I4MA 3UR3C 3UD4P 2BM0A 2CWXA 1F3FA 4LF8F 1JXVA 2ROPA 3ITHB 2UU9J 4I6YA 1B4SA 3AJ2A 2ACMA 5ETVA 3MTKA 4DSLA 3IP0A 3V81A 1S6OA 5E3PA 4EWTA 1TMJA 2DCLA 3LQVA 2P9GA 5JMNA 2OPSB 4LFCF 2D9PA 2WTFA 3VALA 3NS5A 1YKWA 3T5KA 1KQFB 5A6WA 4ZDNA 4USKA 4KGKA 4UF4A 3KHLA 4TY8A 3VZHA 4GO7X 2RDDA 4HVZA 3P45B 2MPUA 1S0OA 2E1AA 2W4PA 1SL2A 4EO8A 4CI0B 4USTA 4RUCA 1HBOB 4DV5F 4DL5A 2AWZA 1FDNA 1YRUA 1NHVA 1HKAA 5C24A 4NPOA 1WSVA 5KFSA 2KN4A 1I94J 5EN1A 5GAEI 2JEFA 4C8OA 1HL6A 4YR3A 1ZM9A 2RRNA 1HWIA 1U1QA 1RBAA 3CJQA 4O3PA 1E6YB 2RNEA 4PEOA 4K4XA 2NZ4A 2WHOA 3R2CJ 1SKRA 3G86A 1VJWA 3ZTRA 5KFIA 2YX4A 1CQMA 3BJYA 1BQMA 2HPUA 2QC3A 2J0XA 4DQQA 4CTAA 2PA8D 3N6NA 3UCUP 4Q0BB 5HMWA 4LF9F 2CPDA 1VQ8S 2I2YA 1TV6B 2FVQA 2RJZA 5FDLA 3SI8A 1R8CA 2HNZB 5AE2A 3KK3A 3SEOA 3SXLA 3FBBA 2ZM6J 3LP1B 4N8NA 1FKAF 1LXNA 5DM6Q 1FX2A 1NRKA 2ZDOA 4ECWA 1U45A 4CO2A 3CW2C 2IBKA 3PFEA 4RUHA 3MEEA 2M8DB 3JTNA 2W2PP 5D6GA 2MLYA 1QTNB 3H5YA 1G3OA 5LSRA 4NXMF 5F8HA 2GO8A 2O67A 3BGRB 2DGQA 4YHHJ 4WK3A 3DLEB 4WP8A 2CNLB 4R0JA 3ET6A 3HO1A 4CLWA 2B8QA 1F2HA 4ENOA 1S0NA 2QO3A 5CHCB 2V4JB 3DRRA 1RGVA 2W9BB 1JXLA 4LRCA 2G0CA 4OZ3A 4PQUB 1SC3B 1X7VA 1QTMA 3IR7B 2HBQB 4LJMA 2PEHA 2DNPA 2HVHA 2DNNA 3MPWA 2DHGA 2AYBA 1DTQA 2RQ4A 3UCZP 4UY85 3WIVA 1S1TB 2HWHA 4RBTA 3KLFB 1FWKA 4KQZA 1S77D 4FF4A 3M7VA 1T7PA 2JVRA 5F3TA 2PMHA 1OPZA 3UE2A 1EIYB 2C2DA 4OX9F 1VRUA 2DRBA 1PCAA 4DZ6A 2HHXA 2EFGA 3V4IB 1JLCB 4CLTA 5IM0B 1NMEB 5HN0A 3VAIA 4EBDA 2ABYA 1VR6A 2DXFA 1VK3A 1J27A 4QW8A 1M5PC 2VG6B 2MKYA 3T1YJ 1GXLA 3L7OA 3MEDA 5ITHA 3D2WA 4TLQA 2R7TA 1JLFB 1UEUA 4QYRA 3ZO7A 5G0RA 3BR9A 2RRBA 1QAXA 1J5EJ 2BDPA 1RT3A 1RTHA 2DNRA 2E5GA 3GFHA 4QWEA 1NDKA 5LMUJ 1VJQA 3PXGa 2DO0A 3CDAA 3W65A 3VHQA 3R1LA 4P2MA 2LLZA 3MM7A 2RHQB 5K20B 2GIRA 3GILA 1YG0A 3W62A 2ZOGA 2EBEA 2X1FA 5J2NB 5LXRA 4WXOA 1YJNS 5AJ3F 1NSQA 4ES3A 2BEFA 3S8SA 1MWQA 1S1XB 3LWLA 4BWMA 3UDEA 4Z37A 3QGGA 1DURA 3ZTOA 2VUGA 4FNHA 1T03A 3KK1B 1TL1B 2X51A 3KYLA 1S9GA 4IG0A 2GC8A 3C6TA 3DLGB 1YZ6A 3TQ1A 2G0JA 1X5OA 3LPEA 4DL4A 2I9SA 2A6MA 4ERDA 4PG4A 4C7QA 2BJ8A 1RBLA 1JLQB 3D0HE 2HURA 4Y2CA 1HBNB 3DFEA 4LR7A 2IM3A 5ETRA 4DR5F 2Z2LA 3DLKB 5E3RA 4WXWA 1GTEA 5B0AA 2FLOA 2X7IA 1HNXJ 1WG4A 4K2JA 3KLHA 5K14A 2E1PA 1S49A 1N33J 3DOKA 2B4VA 4DR3F 3PHTA 1L3SA 2MB0B 3KHHA 1GT8A 1N36F 4RPFA 3MCNA 1N5SA 3MECA 1IWGA 3FQKA 2CUYA 4EU0A 2VPXB 3GFYA 3ITHA 4FXVA 2EFNA 3AXKA 3OV7A 3C66A 1YJ9S 2U1AA 3DHWC 3VAKA 3OVBA 1LWFB 4RWWA 1FRXA 5IXUA 4E8UA 4TQRA 2OPSA 1FRLA 2NYHA 3ZFVA 3NCPA 3M8QB 3RRHA 1RKJA 2W2NP 4DUYF 5HJXA 4IRKA 3KOAA 1G4CA 2HVIA 4DR6J 1X4BA 3T41A 1ZA1B 3T1AA 1NNDA 2BQUA 4C9DA 4JI6J 1RHMB 2YVSA 1HNZF 3KLGA 2IFXA 4OHVA 2YWKA 3OSPA 1GFWB 5DJBA 5A0YB 4NLVA 2ZH5A 1Q7LB 1S79A 2RH3A 2MXYA 2JEIA 1EAYC 4O4RA 4MKBA 1VGYA 3QSYB 3N6LA 1HBOA 3TEHB 3KLIB 1IN0A 2MZSA 2NZCA 2DNYA 1LKZA 4HL9A 4L3NA 1F5AA 3IA0A 2ZWPA 1UJ6A 4YB5A 2GAHC 2W4DA 1ZAVA 3DC2A 4IQMA 4K4UA 2NXNA 3ILOA 1OSDA 4G1QB 1KLMB 2XBPA 1E6YA 4U6PA 3KJQB 3BS9A 4DUTA 3OR1B 1R43A 1WG1A 5KFWA 2ZJPQ 4ZVTB 2DEIA 5C25A 1TL3A 4TXSA 1UVNA 1QE1B 2XB2D 2K06A 5KFCA 1RB0A 2VKZG 3T3FA 1OY6A 2EK1A 3KG1A 2FZKB 5K8OA 3EGVA 4QR1A 3A8IA 3UWTA 4CIOA 2VFRA 1YRTA 3EZ5A 3KK2A 3WZ0A 1TV6A 5JJBA 4X62F 4J90A 4OYMA 1I94F 4R8UB 2HGMA 3AFGA 3KJNB 3KXDA 2JLEA 4FBTA 4O23A 3W8PA 3WC2A 1FRHA 3H42A 3MM8A 1XMOJ 3LALA 2HFNA 2GHPA 3ENAA 3K5NA 3PW4A 2NXCA 4HH1A 4IFYA 3BDPA 2LQBA 3DDKA 1PGZA 3GV8B 1XNQF 4R0EA 4WFBQ 4OJHA 3PNIA 4ZHRA 3QRPA 2J9DA 2N4DA 1N32F 4WZQA 1HI1A 1U1PA 5F9NA 4FYDA 2XNRA 2X3DA 1NSKL 3Q8QB 4JV2A 2BMBA 5KG6A 4Q43A 4DPXA 2IRUA 3CEDA 2HHVA 2F9DA 3RB3A 3DLEA 2ZM6F 2CNKB 4OZ1A 2BZ2A 1KTQA 2KT5A 1RU1A 1VCTA 2IVFB 3HPOA 3CJ8A 3IS9B 2Y0BB 2V4JA 4RBUA 2VDHA 3FFIB 1R31A 3OTOJ 4PQUA 1U6FA 4KGMA 3VVUA 1T8EA 4NE9C 5KFAA 3FSXA 1P6TA 1RWOB 3R5JB 1HBUB 5L9XA 2P5VA 1U1KA 3CJRA 3GFXA 3IFEA 4CLYA 1X0FA 3CJTA 3KJVB 4YHHF 3E8OA 2F40A 2HMIB 3KLFA 3SCIE 3GCXP 1BMQB 1DRZA 1F5CA 3TEGA 2DNLA 3A1YG 5LL6d 2CIMA 4H4KC 1QLNA 2DHAA 2IIHA 3ZTQA 5M2UA 2ZC4A 2DRAA 2QL9B 2DHXA 1YX2A 2BBEA 2WB4A 3V4IA 2XMJA 2Y1JA 1JLCA 3K59A 1FEHA 3VVTA 5IM0A 4RW4A 1VRTB 4KSEB 2EFVA 2MDAA 1GXUA 5BR8J 4TU7A 4QOTA 2QV6A 1SBRA 1KKHA 1T05B 3B4DA 3CCMS 2OIHA 2DCUB 4UZBA 1DARA 4C11B 1VC0A 2CZ4A 1VC5A 3ISNC 4ECVA 5J2MA 2QYGA 4OLPA 3DXBA 2HGLA 2KB2A 3N28A 1Q79A 2O3DA 2KM8C 4PG7A 3CD5A 2XHCA 3RB6A 3GONA 1MW7A 2J0WA 3DRYA 2BJ3A 3ZZRA 1IKYB 4WFXA 1ICEB 4LR8A 4JI3J 3LANA 1ZM4A 1F9FA 5KG4A 5J2NA 2B9YA 1DTTB 1DQAA 2QJ3A 3D1QA 1R0AB 3T1YF 2D9OA 3MMAB 4ZVRB 2BKNA 1MMLA 4CNZA 3HKZD 1S1UB 3PV8A 1S1XA 4EBEA 4DN9A 5CYJA 2Z57B 5D77A 4PG6A 5EDWA 4UT4A 3AB2B 3J7YI 3KK1A 3DOLB 2QFIA 3HSGA 3PRBA 4RW9B 3DLGA 4ED4A 1U6ZA 2WVCA 4Y00A 1NK0A 2H9ZA 4DR1F 2PC6A 1Q53A 2LYVA 4F4ZA 1LK5A 3O5TB 2UXBJ 1XC9A 5AXKA 1URRA 5A8WB 3VWSA 4NYZA 2N3OA 3QJLA 1RAEB 4USWA 1VQOS 3KHGA 3M32B 5IC6B 1YITS 2J7WA 3C14A 1UVKA 3RYLA 4USUA 2VFVA 2WW4A 1U49A 4C8LA 1VC6A 4MKVA 3MAHA 4P71A 4NLRA 3VR1A 1NH8A 2YNIB 2HLTA 2E5IA 4K8RA 5E5NA 1QAYA 2IVYA 3QT7A 4IOAQ 2JOQA 1JQGA 3MMJA 4JOUA 1ZETA 3QJPA 4FKXA 5IFMA 5CYQB 2RU9A 2VQFF 3R27A 5KFNA 1N33F 2CWKA 4X4QA 3I9ZA 4OZ5A 5EHHA 4XTTA 4OYAA 3FUYA 4FF1A 2HQGA 4L75A 3W5XA 3A4TA 2XZWA 3EZUA 3GCWP 2BE2B 5A0YA 2ZH1A 2FJVA 3CVKA 4FVCA 3E51A 2CFXA 4I0WA 5CABA 4OI3A 3IR6B 4LMZA 3KLIA 1M5KC 2CJXB 3FBCA 2F65A 1GX5A 2ZUAA 5LM7E 5B0FA 2CPFA 4OFZA 4PXBA 2B4UA 5DQGA 2HVDA 1LWEB 4QR2A 4G1QA 4DR6F 1KLMA 2HBZB 5HO4A 1MMDA 2KXNB 3OR1A 2EVZA 2F4FA 3KLEB 1NJXA 3RAQA 1QE1A 2BYCA 4OZ0A 1UCNA 2OELA 2K7KA 1FDBA 3OR2B 1R0BG 2MKHA 1LV5A 3GR1A 2A2CA 2AJQA 2W25A 4FYXB 1U1NA 3NNAA 4HACA 3KNAA 4FP9A 4CWBA 2XLJA 4R8UA 1RACB 2NUHA 2F8HA 4QWAA 3NGDA 4EI2A 2KFYA 1T94A 2V2ZA 2MGZA 2AYGA 1X8DA 2DO4A 3CCJS 2BW7A 5FLXY 3M4XA 2R8HA 4FYWB 3QO9B 3AA8A 2U2FA 4Y2KA 1HD1A 3VZIA 4J9KA 2X1AA 2R9LA 4ZIVA 4WU3A 1JNZB 4NCGB 1WJ9A 1SJRA 2XWXA 4C0OC 4BC7A 2L9WA 4ZPDA 5K8MA 3MUMP 1EX8A 5I3QA 2CQHA 1XMOF 4B9TA 1VOMA 1MU2B 4KAIA 1REVB 4LF4J 2UUCJ 3CCVS 3IS9A 5F8NA 1RT1A 4Q44A 3PEHA 2E1MC 4ZK7M 1VQ5S 4LF1A 3W1YC 5GAHI 1DLOB 1IJFB 2IM0A 2PE8A 2MQ8A 4F25A 1HBUA 2VA2A 2XGQA 3V2UC 3IRXB 2LA6A 3OHBA 2YNHB 3TA0A 2D41A 2IY5B 1NB2A 2GVZB 3KJVA 2C3YA 2HIYA 3CB4A 1EZZB 2LU2A 3HSJA 2ILZA 3MTJA 2HMIA 3NY0A 4N76A 5KFEA 5A2QY 4ED5A 3ISZA 1H73A 4KB7A 4U9RA 3A3OB 2BACA 3AJDA 2VC0A 4DV2J 2VICA 3UNYA 1N52B 5KAKA 2CPZA 1X4FA 4DF4A 1JJ2R 2ZBIA 2E66A 3HJVA 2AHOB 1W7WA 2G1DA 3Q8RB 2GVDB 4M5DB 4ID8A 4PRFA 4EGLA 1AZSB 3NNHA 3QT6A 3VAHA 1KR4A 1X9SA 1VRTA 3N0VA 5JXSA 4J9RA 1N0UA 4WFZA 1NCLA 4JP8A 1WNEA 1UW9A 3FQLA 1RABB 5CH7B 3K5OA 2YNGB 5HBMB 2C2MB 2FY1A 2EI5A 4OV1A 2XZDB 1LWCB 1WC6A 4EBCA 2NXJA 1SQEA 1VBZA 4QU6A 3SSQA 2OEJA 3RTVA 3W5ZA 4ECXA 2RSQA 2KHCA 4DV7J 1EQ0A 1NO8A 4CLKA 3BPDA 2HK3A 1VQMS 2HHSA 1FDAA 1X4CA 3TUIC 3I31A 2V2KA 2D3ZA 2HLUA 3RZAA 4CLZA 1SV5A 5CQGA 1U1MA 1IKWB 4NA1A 2BUNA 4DV0J 4MAKA 1KLNA 3U1NA 5BR8F 1D8ZA 1ZPVA 1EARA 3MMBA 2B9WA 1C0UB 1DTTA 2AGQA 2Z4PA 4NZ0A 5FLXU 2R7RA 1R0AA 1IVZA 4ZPBA 1CJKB 2RIJA 3MMAA 2QT7A 2KFNA 1N4LA 5IS2A 1ELOA 1S1UA 3PHEA 4W90B 4L74A 2GJ2A 2NQPA 4H4OB 3BF4A 4DV4J 1FXDA 5KT4A 1RA7A 4I68A 4N8OA 4LBIA 4LSNB 2RQMA 3DOLA 3IWLA 4ECZA 4CLFA 2MLXA 4USMA 4RW9A 2KG1A 2IMOA 4LF6J 3BH7B 4MMOA 4NA3A 4LFAF 2CPXA 2OMOA 3JYTB 3NNCA 4JI3F 1JXEA 3CCES 3SSSA 2NPFA 3H5XA 1WEZA 2AEJA 5A8WA 4ZKAA 3M1VB 3PTWA 3PACA 2QSWA 3EDQB 5K5MA 4OI2A 2ZOFA 3QATA 1S12A 1A0OB 3M32A 4MYTA 3PJ9A 2EG1A 1SC1B 2B5JB 2GFFA 2R8JA 3KDOA 4YDDB 1R8HA 3L3CA 2J6TA 4WKRA 3QJJA 1TKXA 3C8YA 2OHDA 4USIA 4EK2A 3UVJB 4URSA 1GMVA 1B3TA 3VAGA 2OMLA 2YNIA 2NXEA 5I3UB 3AD7C 3GR0A 1M5SA 3DGVA 3BYPA 1H7WA 1NEEA 2Y8WA 2ZKUA 5IC4B 5KFVA 5C7PA 2UXBF 2V50A 1LW0B 2OLWA 2LA4A 2C3PA 2A6OA 3FRYA 2B56A 2NS1B 1FVSA 1M5VC 1S1VA 4FBUA 5CYQA 1FE0A 2NYIA 5BYQA 1IXKA 1RA6A 1NDLA 1R0CB 1SQFA 2D69A 3AOCA 1X4HA 1EKRA 5KFFA 2J7UA 5D4LA 2HYIB 2XYPB 2BE2A 3T9ZA 2IJRA 2PN6A 4HYKA 4DSKA 4K5SA 1JMTA 4JI4F 4K4ZA 2C2RA 1QDUB 2ZITA 3LA0A 2NXUA 4JI8F 5HSPA 3IC1A 1MWZA 4HTIA 4DSJA 2H1YA 3BGFA 1RTZA 1BQNB 1CJUB 3MCOA 1LXJA 3MM6B 3CCUS 1T95A 4OYPA 4NASA 1TUVA 1KS2A 3C15A 2AU0A 5HQMA 4Q2LA 3G6YA 4OX8A 1HQUB 3KLEA 1EP4A 1GXTA 2VOOA 2L08A 3DHXA 2I0XA 3BH6B 1HHTP 3ICLA 2YH1A 2LEPA 1U0HB 1H74A 2CQ3A 2MSTA 3J7Z5 3OR2A 4P2XA 2ZBRA 2VJVA 4PWUA 2KDOA 3MD1A 2J0SD 3M8RA 4UQGA 2CVIA 4LSLA 2RUGA 2YQ0A 1WOOA 3LP0B 5D3GB 3MR5A 2OSQA 3RRGA 4XIUA 4PCQA 3OLAA 2ROGA 3TX8A 1FHTA 1XWLA 2AW0A 3BO2A 5KFKA 2UXDF 1U8WA 2Q3PA 2CADA 3QO9A 4PXDA 5A8KA 1T9TA 1U6BA 4QWBA 1S4FA 3PX6A 3HX9A 2VPWB 4IQXA 3NGRA 2APOA 1NDPA 1Q1KA 1TVRB 1KOHA 1OWXA 4NCGA 2AYMA 5U47A 2EKNA 4RNHA 4DR4F 1SUQB 4KKOB 4CT8A 1B7FA 4PXEA 2RE1A 1YDLA 4OMFG 1MU2A 2V8VA 1REVA 4MK8A 3HD2A 1M90T 1Z4UA 1KVJA 3M8ZA 1S48A 1TKTA 2AT1B 4ZP9A 1DQ9A 2BQRA 1HW9A 2GMHA 1SKUB 2GMLA 2RT3A 1N88A 1RAGB 2HWIA 2GCFA 3IRXA 4JI7J 4DQPA 2YNHA 3BZQA 3G82B 2YTCA 4IDKB 3CC7S 2GVZA 4I2QB 4F0MA 2KT2A 2I5JB 2UUWA 3CCZA 4CYUB 2FC9A 1SH3A 2GHWA 1JNRB 5A8RB 1WF1A 2YWHA 4MIBA 5J2QA 1PG5B 3B82A 3MR2A 1K73T 1TELA 3GE9A 2UUCF 4DFPA 4YEAA 2M4MA 4XAKA 2QX0A 1F5BA 2GVDA 3GFZA 2XYGB 4M5DA 1TQLA 3CJSA 2GGPB 4A4JA 2C2ZB 2V9WA 1R8AA 3OT9A 1KQKA 2XY5A 2AMCB 3DI6B 3G71S 2YNGA 3OD2A 5HBMA 4C8ZA 1SPBP 1GEHA 4ZPVR 1WTFA 5B0EA 1LWCA 4NLYA 4AQYJ 4W98A 4KY3A 4DV2F 3D28A 4QIVA 1J2VA 4AL7A 5HLFB 2OUGA 3P8BB 2ZZNA 3HHLB 3PY8A 4B9VA 2HFVA 4LF7J 8ATCB 1HWLA 2CQPA 2KH9A 1FXLA 1ZPWX 1IKWA 3EGZA 2DGSA 3UDCA 5KFZA 1N34F 2DR9A 4LBHA 4USVA 4P7TA 3D3BJ 1D9AA 3LWMA 3K89A 1NPPA 4RW8B 1C0UA 3SZ2A 1VHIA 1CJKA 2UVUA 3HXMA 4C4WA 1GTHA 4X4VA 3I5BA 1FEEA 2RDIA 2CJQA 4MH8A 1RYRA 4DX5A 2QA4G 5DLGA 4DV7F 1ZM2A 2D1CA 1LK7A 4H4OA 1QUPA 3N6MA 3O44A 3DRXA 2EFPA 1X9MA 4LSNA 3QRQA 3Q86A 4KYZA 2E7WA 2X3GA 1UEKA 3CCSS 3EXYA 4ZIWA 1T3NA 1U2FA 3ZZYA 3UN3A
chains in the Genus database with same CATH topology
5JVGQ 1B0PA 4QWEA 3CCWA 4PQAA 4RU9A 1HQEA 1JKHA 2W9CA 3V6JA 3Q23A 3JYTA 4ECQA 3LW5C 3PXGa 1W25A 2DO0A 4A8QA 5B08A 3TAMA 3CDAA 2QA4S 4IOCQ 2VPYB 3I82A 1RT3B 3R1LA 1KONA 1L3UA 1HWJA 5E3AA 3ETOA 3THTA 2LLZA 3MM7A 5J1NA 2OJ3A 2F8MA 2IYGA 4QWCA 3R5BA 2EG2A 1KD1T 1JKHB 2FLNA 2GIRA 1P9QC 3CJ0A 3GILA 1YG0A 1SIWB 2PFFB 4J37A 2EBGA 2ZOGA 2EBEA 3CO9A 2JJ4D 2JWNA 5J2NB 2X1FA 3M1VA 5LXRA 4WXOA 4YR2A 1YJNS 3P6YC 5AJ3F 2K1RB 2OSRA 3DN9A 4I1TA 4RW6B 4URGA 1I1GA 2EKYA 2KKHA 4P2SA 4ES3A 3HVRA 1DZ5A 2VBYA 3CJ2A 3S8SA 3OXLA 2B9XA 3V4MA 1S1XB 1UFLA 2OD6A 3SFGA 1TL1A 2XGPA 2MMYA 3OFFA 1WHWA 3LWLA 4BWMA 2VONA 4ICLB 4Z37A 3QGGA 2DR5A 2BJDA 2HHPA 2QZ8A 4OJ3A 2V8DA 4USJC 5DO2A 4TLRA 3G8SA 1DURA 3IAM9 5KT5A 4ED0A 3JSBA 4LF6F 1ZAXA 2VUGA 1XR6A 4FNHA 5AE1A 3PX0A 4CO4A 1T03A 3KK1B 2XCAA 1TL1B 1JLAB 4E0DA 2X51A 3VTIA 2ZH6A 3KYLA 1S9GA 4IG0A 2AJ0A 2GIQA 3OXGA 4DL6A 2UUBF 4OHWA 2GC8A 4OIXA 3PR5B 3C6TA 1GH8A 1JLQA 1ULRA 1TR0A 2M52A 3EX7B 1R3NA 2YY3A 3DLGB 4ZCMA 3TQ1A 5I3UA 1HBNA 3MMCB 2RS8A 1X5OA 3O8WA 1LOUA 3AAWB 4M63A 4DL4A 1FHTA 2I9SA 3FRZA 4ERDA 3IO1A 3TRGA 4PG4A 4C7QA 3K0JA 3NKYA 3M9OB 4IYQA 3DLKA 1JLQB 2R2UA 3D0HE 3BSAA 4Y2CA 4O3QA 1HBNB 3ENWA 3TNVA 1TKDA 1WELA 1YJVA 3DFEA 3CC4S 1N0VC 1OPIA 2W9AA 2XEXA 2IM3A 1JLEB 4DR5F 1P27B 2Y0SD 5KG7A 1M1KT 2Z2LA 3DLKB 3CD7A 1UMJA 5F8LA 5E3RA 2YNFA 3MR3A 4WXWA 6FD1A 3RB4A 1TKZB 1GTEA 5B0AA 2O5DA 2FLOA 2ZHBA 3DMJA 1KC8T 1WG4A 5B0DA 4YY3F 2DNOA 4NOHA 3KLHA 3AJ1A 3EYZA 5DGAA 4B3MF 5K14A 4RWXA 2PD1A 5H9FJ 1S49A 3PW2A 2OTJS 2E1RA 3DOKA 3DNCA 2FGOA 2NSBA 2B4VA 3PVXA 1BY9A 3CCQS 4DR3F 2OO4A 1L3SA 1K9MT 3FJ2A 1WF2A 3KHHA 3O2IA 3GIJA 2MB0B 5KT3A 4F2SA 2M70A 1GT8A 1N36F 2CJKA 2FPHX 4KO0B 1YTYA 3DMJB 1NK5A 2DIUA 2BXJA 4Y28C 1N5SA 2NUUG 2F7VA 3G6VA 3MECA 4FXDA 1LW2B 3TOQA 5K14B 3HT3A 1M5HA 3CJKB 3B78A 4O3NA 3FNNA 4KHMA 4JI5F 2PA3A 4ED7A 3FQKA 3PJXA 1LWFA 1S9EA 4EU0A 4ZPWR 3OHAA 2VPXB 3GFYA 3NBPA 4QU7A 3JSRA 3MOJB 1FD2A 3MF5A 3J7YU 3ITHA 4FXVA 2EFNA 3ZZZA 3OV7A 2UP1A 1A9NB 1C4AA 2WSCC 3C66A 1YJUA 4K4SA 1TP7A 5HL7Q 5C5JA 1YJ9S 2U1AA 1K0VA 3DHWC 3SSRA 1L3KA 4V19X 2HHTA 3VAKA 3OVBA 1LWFB 1S9EB 3F56A 2LU1A 4RWWA 1U24A 2KJWA 3MUTP 3NBPB 1FRXA 4ECTA 5IXUA 3M8QA 4DJBA 4E8UA 4IOBA 3H98A 2BQ3A 5KFYA 1BQNA 2HS4A 2CQ2A 4ECSA 3I9V9 1RQ0A 2RQKA 5L1KA 4TQRA 2YWFA 3GYXB 2VC1A 5KFDA 3RB0A 2XMTA 3R5AA 4Y34A 2OPSA 1XR5A 1FRLA 3MDFA 3POTB 3S01A 3ZFVA 2XSFA 4WF9Q 2O66A 3BR8A 3NCPA 4X4TA 3M8QB 1Z1ZA 2BVZA 5GADU 3RRHA 1RKJA 4DUYF 1D0EA 4H4KA 2EPIA 2FD2A 1FTRA 4ZLPA 4RZRA 4IRKA 3HZGA 3KOAA 2HVIA 4OX6A 4DQSA 1JLGA 1X4BA 5T41A 1HQUA 1NNDA 3T1AA 4PG8A 2BQUA 4C9DA 2ZBCA 4J9SA 2W4CA 2YKOA 1NU4A 5DG7A 2RB7A 2C2EA 4ZVGA 2YVSA 5IT0A 1HNZF 3KLGA 2IFXA 4OHVA 2YWKA 4PUOA 1FE4A 4X65F 3CJ4A 2JDJA 2JRSA 3OSPA 3NCQA 4IRCA 2VBZA 3MEGB 5JVHQ 3HK2A 4PWDA 2W24A 3B8HA 5DJBA 4FS2A 5A0YB 4NLVA 2WONA 2ZH5A 1YBAA 1Q7LB 1S79A 2RH3A 2YWEA 3OXFA 2MXYA 4W92B 2JEIA 5LJ5Y 1V3RA 4ETXA 2OPRB 5KT2A 3S6EA 1XK8A 3KLGB 2FVRA 4KC5A 3MD3A 4PG5A 4O4RA 3UR0A 2OPPA 4B9NA 4Q8EA 4PWDB 4MKBA 1VGYA 2NPIA 3M30B 1FO1A 1IUJA 3CTRA 3MURP 3N6LA 1HBOA 3OPKA 3EPIA 3RAMA 1ZTWA 4QW9A 2V94A 3KLIB 2QA1A 1C0TA 1IN0A 1SXLA 3N9UC 2MZSA 2MKKA 2DNYA 2FJAB 1Y5IB 4KFBB 2D7SA 1LKZA 2K3KA 1SJ1A 4IR1A 1H7XA 4FXWA 4HL9A 4L3NA 4C8KA 1F5AA 3U02A 3IA0A 1UJ6A 4YB5A 3NG8A 3PO5A 1R89A 2ZC3A 2W4DA 3LP0A 2JLFA 5D3GA 1ZAVA 1X0PA 3MWBA 3DC2A 2C3OA 4Y2IA 1RK8A 5F0UA 4DL3A 4IQMA 1C0TB 1U2RA 3HVTA 2MQLA 1HR0F 1YJRA 2J76E 2CPYA 1OSDA 4K4UA 3CIMA 3HFKA 3TA1A 4GC7A 2DD8S 4G1QB 5LSLA 1KLMB 2PO4A 2HNYA 2XBPA 2B6AA 1KQGB 1E6YA 4U6PA 4B9SA 2CQ1A 2ZHAA 3D5MA 2IAJA 1QJHA 3BS9A 4Y3CA 3TVYA 1RI7A 1YIJS 4ZCKA 4OL8A 5L9NA 3HHLD 2F3JA 3OR1B 2V4QA 1R43A 1WG1A 3HVTB 5KFWA 3RU0A 2ZJPQ 1YHQS 4FVMA 4QWDA 4LVNP 5C25A 1TL3A 4TXSA 1RT5A 2KTQA 2B51A 2PMZD 1UVNA 1QE1B 2XB2D 4Y65A 2J9CA 2JX2A 4NX9A 5KFCA 2VKZG 3T3FA 3DU6A 2EK1A 2ZH8A 3HI9A 4GMKA 4AE5A 3KG1A 4KHPF 3WX4A 3ZZOA 2MZTA 5K8OA 4WFNQ 1TL5A 2KM8B 4QR1A 5C25B 4ELVA 4ECRA 1TL3B 3UWTA 3H5SA 1B0TA 1F60B 3G8TA 3FEYB 5KFLA 3ONQA 4Q45A 5THWA 4F3MA 4CIOA 1WI6A 2VFSA 4C97A 2XLIA 2VFRA 1YRTA 1UETA 3EZ5A 2C42A 3KK2A 4OX7A 4RNFA 3WZ0A 1TV6A 3GIKA 2FVSA 1HA1A 1FDDA 3E3XA 1NHUA 1OQ6A 1N5TA 5JJBA 5KG5A 1SUQA 4KKOA 2MQNA 4X62F 3DLLQ 1I94F 3S1TA 3QIDA 4H54A 1VFJA 3G8QA 3BSOA 2UVRA 1RDRA 4R8UB 2RQCA 2HGMA 1HMVB 2CJ9A 4WK1A 2DTJA 1NKBA 2JLEA 1ZYQA 4FBTA 4I64A 3JAMY 3KK2B 5KFUA 2JH3A 2VG5B 2KG0A 1JB0C 2V4RA 3X1LB 3D0IE 4O23A 2UV8G 2WRMA 3MOZA 1S7HA 2UZAA 3WC2A 1FRHA 3MM8A 1MSWD 1UFWA 2WCXA 2VPZB 1UJ4A 2ADBA 1NK7A 3LALA 1HYSA 3DU5A 2HFNA 2KJVA 2GHPA 2FHJA 1WHVA 4JI2F 3K5NA 3PW4A 1R8PA 4HH1A 1H98A 4IFYA 3ZZUA 3BDPA 1S6QA 4HLBA 2OFHX 2Q66A 1JJHA 4LUBA 5F8MA 4DF8A 1MROB 5BJRA 2LQBA