1X4AA

Solution structure of rrm domain in splicing factor sf2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
109
structure length
109
Chain Sequence
GSSGSSGMSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RRM domain in splicing factor SF2
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords splicing factor, arginine/serine-rich 1 (splicing factor 2,
total genus 11
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1x4aA00
1X4BA 1H2VZ 4FXWA 2EK6A 2M70A 2FHOB 4RU2A 2RQCA 2HZCA 2K8GA 2YKAA 3BO3A 1UFWA 2MGZB 4YUDA 2RRAA 2OSRA 3NNAA 2HYIB 4LIRA 1VQ4S 2KI2A 3MI7X 2CPHA 3N9UC 1JJ4A 2LQ5A 1VQNS 2DNZA 2MZSA 3VAJA 3HHNB 2CQCA 2CQDA 2DO4A 1URNA 2CPEA 2LXUA 3Q2SC 1X4HA 1KOHA 2E5IA 2FPHX 3EGNA 3DXBA 3U1LA 1X4EA 3UCZP 2LEAA 2M88A 1X5PA 4C7QA 1X5OA 2JVRA 1M5PC 1WWHA 2OIHA 1D8ZA 2DK2A 4YB1P 2RRBA 4UQTA 4PR6A 2KRBA 1WI8A 3P49B 2DNHA 2DH7A 3BEGB 4CH1A 1FJ7A 5BJRA 1W2BR 2CQHA 1FXLA 2CQGA 3UWTA 3CF5Q 4BS2A 2X1FA 2M9KA 1U1QA 2OTJS 1HD0A 1G2EA 3SDEB 2L08A 1KC8T 2EK1A 2D9PA 5IFMA 4WIIA 5JVGQ 1M1KT 2YTCA 3SXLA 2DGOA 1X5TA 2FC9A 4ERDA 1WI6A 1WF0A 3I56S 3G96A 3P5TL 2ZJPQ 1NJIT 2J8AA 2QFJA 1WG4A 2CQ4A 2RUGA 2HVZA 2MKSA 2I38A 2MHNA 1JJ2R 3LPYA 2LA6A 2NLWA 2KXFA 1WEXA 2KH9A 2MZ1A 2F9DA 1A9NB 2NZ4A 2CPYA 4C0OC 2LXIA 2OSQA 4QU6A 2GHPA 5DM7Q 2LMIA 3UE2A 1FNXH 2DGQA 3NMRA 2DGTA 4QQBA 2OJ3A 4C4WA 3SDEA 3VAMA 3THPA 2OTLS 1U1PA 2LYVA 1D9AA 3RW7A 5IQQA 3TP2A 2MQNA 3RW6A 4OZ1A 2KG0A 2ADBA 2DIUA 5DETA 2MSSA 2M52A 3ZZZA 3R1LA 5GMKa 2PEHA 1X4AA 2FC8A 1Q82T 1OIAA 2RS2A 1B7FA 5LXRA 3B4MA 2MQQA 1Q86T 3UD3P 3VAKA 1VQ5S 1WEZA 2M2BA 2J76E 1VQKS 4Y0FA 1WF1A 1OPIA 4LJMA 2GO9A 2A3JA 2KU7A 2XNRA 1K73T 3CULA 1HD1A 1L3KA 5LSOA 3IWNC 2ZJRQ 3CC7S 5MLCV 2O3DA 2CQ3A 2VODA 2KM8C 2CQPA 1PO6A 4W90B 2CPZA 1OO0B 1YJWS 4QU7A 3CC2S 1DRZA 1VC5A 1IQTA 4UY8T 1ZZFA 4FXVA 2ZJQQ 3BS9A 2N3OA 4WF9Q 2DNQA 2DNGA 5CYJA 3H2UB 2VOOA 5CA5A 5GAGU 2M0GB 3MOJB 1R8HA 3CTRA 1DHMA 2M7SA 1RKJA 2XNQA 5FJ4A 1U1MA 2CPXA 2MQLA 2RVJA 2YH1A 2MMYA 2MB0B 1X4FA 1N52B 2RNEA 3CCUS 2JX2A 2DNOA 2L9WA 1YTYA 2DNLA 2BZ2A 2CPDA 4TU9A 1N88A 2MZTA 4F25A 1NO8A 3CCMS 2MY8A 1JJHA 3P6YC 1U6BA 3MXHP 3NS5A 4WFBQ 4LMZA 3P3DA 4J5OA 5HL7Q 3G6ES 2B0GA 2RQ4A 2KM8B 5EN1A 2JVOA 2MKHA 5LJ3Y 2G4BA 1YWXA 2J0QD 2UP1A 1U1RA 2DITA 3CXCR 1VQMS 2FY1A 1SJ4P 3CD6S 3THTA 3BO2A 2U1AA 1Q7YT 1BY9A 2KN4A 2BOPA 5GAEU 2YH0A 3CC4S 3NS6A 3CCES 4QPTA 2AYMA 2DGUA 3MUMP 1HL6A 3D2WA 1SJRA 1U1NA 1QVFR 2XS5A 2X1AA 1VQ9S 1FJCA 2LEBA 5CXTA 3NNHA 1YI2S 5H1SV 5GVQA 4A8XA 4ZKAA 2M8DB 2MPUA 4IOAQ 3CCLS 1VBZA 1DBDA 3R1HA 2AD9A 1HA1A 2RT3A 2MJNA 2LKZA 2DGVA 2MQMA 2QEXS 1QM9A 4IO9Q 3CCVS 1A7GE 3CCJS 3VAFA 5DM6Q 2N82B 1VQ7S 3S6EA 3VAIA 2MKKA 1YJ9S 5LSLA 1M90T 2DGSA 2DHAA 3UCGA 2XS2A 1H2UX 1X5SA 5IM0A 1UAWA 1UW4A 2MKJA 2DHXA 1WHVA 2M8HA 2MQPA 3EGZA 3VF0B 4P6QA 5DDQC 5HO4A 3MURP 2DIVA 4OZ0A 1KQSR 2U2FA 3BO4A 2MKIA 1K8AT 2DNYA 2DO0A 3UD4P 2X1GA 3U1MA 2DH9A 4F26A 1WG1A 2AYBA 1X4CA 2M4MA 1H6KX 5DDPC 2DNNA 4TLQA 3DLLQ 1U1OA 2WBRA 2MXYA 4WCEQ 1SJFA 3J7YU 2CPIA 4Y00A 2ADCA 4YOEA 4EGLA 1NU4A 2F3JA 3JB9k 1U1KA 2XB2D 3OW2R 1RK8A 1X0FA 1KOOA 1S72S 1Q81T 3Q2TC 4M5DB 3G71S 1X4GA 4WFAQ 1O0PA 3FEXB 1VC6A 3VAGA 4ED5A 2G1DA 2LCWA 2KHCA 5GAHU 4PRFA 1X4DA 1N8RT 2F9JA 2DH8A 2MYFA 2KXNB 3R27A 5JVHQ 5D78A 1ZH5A 1M5KC 4IOCQ 5GADU 3EX7B 1WELA 2CPJA 3NNCA 2HGMA 4V19X 3B4DA 2I2YA 3CCSS 1WTBA 1U2FA 2DGWA 3CCRS 2XSFA 2DB1A 2PE8A 2DGXA 1DZ5A 4IUFA 3CMES 2VOPA 3I55S 2DNMA 1VBYA 2HGNA 3MD3A 5D77A 3LQVA 2CQ0A 3G8TA 2DISA 1UP1A 4Z2XA 2XS7A 1VQPS 2CPFA 3G9CA 3HI9A 3TYTA 1H2TZ 1WHXA 2CQ2A 2G0CA 2L41A 1VQ8S 1F9FA 2HGLA 2MGZA 1P1TA 2KRRA 4TU7A 2AYGA 2CQ1A 2LA4A 1QVGR 4WKRA 1R8PA 4F02A 1FT8A 3CMAS 1P27B 3CCQS 3MDFA 1VQLS 2MY7A 2N7CA 3MUTP 2CQBA 2X1BA 4TU8A 1VBXA 2SXLA 2MQOA 3PIOQ 4CQ1A 2KYXA 2MJUA 2RS8A 3S01A 1ZZNA 3VALA 1AUDA 1YIJS 2KXHA 2DHGA 4PKDB 1N54B 3G4SS 2MSTA 2V94A 3J7ZT 2LECA 2CJKA 1CVJA 2DNPA 1JMTA 2E5JA 2DNRA 3MUVP 2E44A 1KD1T 2EVZA 1U6FA 2D9OA 2KT5A 1K9MT 1FJEB 2CQIA 5DDRC 3ULHA 1PGZA 5DDOC 3FEYB 5ITHA 4CIOA 3UCUP 1WEYA 4WFNQ 2JWNA 1YITS 2E5GA 3S7RA 1OWXA 2D3OR 3IRWP 1M5VC 1SJ3P 1WHWA 1YHQS 2MKCA 3PIPQ 3K0JA 3TO8A 1SJQA 1WG5A 3S8SA 1WF2A 2KG1A 2K3KA 2E5HA 2MZRA 2J0SD 3H2VE 3CUNA 3G8SA 1VQOS 2RU3A 4U67Q 4CH0S 2KFYA 2DNKA 3US5A 3V4MA 3MD1A 2MZQA 2AYEA 1SXLA 1FHTA 1S79A 3VAHA 2YWKA 2KVIA 5IM0B 3CPWR 2VONA 2Q79A 2MZJA 2DHSA 5LXYA 1FO1A 3SMZA 4W92B 2JRSA 2QA4S 3ZZYA 1VC0A 1XN9A 1WHYA 1YJNS 2ERRA 1M5OC 3L3CA 1VQ6S 1U1LA 2N3LA 5LJ5Y
chains in the Genus database with same CATH superfamily
2YKNA 3OSNA 1HHSA 2LQ9A 2EK6A 2M70A 1LK5A 4NA1A 5M2UA 4NWBA 3IC1A 1UEVA 4Y2CA 2R9LA 4ZPAA 4CLWA 2WSFC 3LP0A 2CZ9A 4DQIA 5AXNA 3KJVB 1SUQB 2G2ZA 3BO3A 1UFWA 3K5LA 1YRXA 4L6V3 3TX0A 5D3GB 2DEIA 2OSRA 2Y8YA 1RHUB 1XIQA 4MFBA 3GJSB 2KI2A 4RWWA 1N36F 1JX4A 1FRXA 1RWUA 1JJ4A 2R4FA 4OI0A 4Q8FA 5A2QY 1TZ0A 3SCIE 3HHNB 1F9HA 4ANCA 2CQDA 3ZZ0A 2LXUA 3Q2SC 1X4HA 3CD7A 5J1PA 1HNWF 4TN2A 1OMSA 2EG1A 2QSWA 3DOMB 2GS8A 2W9CB 5J2PA 3UCZP 5ETMA 2R8IA 2RQKA 4OI3A 1HFEL 4OYXA 5KFAA 5FLXY 2BJEA 2W25A 4Q2MA 4QYRA 5IV3A 5EWEA 1JK9B 2POKA 3N79A 4ETZA 3DC2A 5KG2A 2MLZA 1TKDA 2KT2A 3M2UA 1QAJA 5C7PA 4ZPWR 1S1XA 1Q7LB 2UUTA 3NGUA 1AUSL 1FEHA 4H4KC 1VYAA 4Q2LA 4RW8A 3MM6B 4YHHJ 3H25A 3T3FA 1D8ZA 4IYQA 4USUA 1QLNA 1CC8A 2WHOA 3CJ0A 1VRUB 2H1YA 3NOGA 4QWAA 2E66A 4P52A 1RT7B 4UQTA 4B9LA 1CJTA 4JI8F 1UA1A 2G13A 1U25A 4HEA9 3P49B 2VH7A 3HKWA 3MGJA 1QSSA 1JLEA 3EJMA 3BEGB 4U8YA 3UN5A 1BLUA 1FJ7A 1NHKL 2V8HA 2BQ3A 4U96A 2B9YA 4O0IA 2UXDJ 4USKA 2OTJS 3HDSA 2M9KA 1ZETA 1RKIA 1G2EA 4RW9A 4D3GA 2VKZG 1N0UA 2ZD1B 5L1JA 1SB6A 3FGVA 4AUKA 4CNZA 4X62J 2DRBA 2R2SA 4JI0F 1Q16B 2D9PA 2EK1A 1FTRA 3M2VB 3GR1A 5GAEI 2JC1A 4N8NA 3DLGB 4ZJOA 5F3ZA 1LWCB 2GVDB 2YTCA 5C24A 5BR8J 1ZPWX 1C0UB 2DGOA 4IH6A 1AB8A 4PWUA 4TNOA 4CO1A 4OX9J 1BQMA 1VFJA 4ANEA 3UDVA 2UU9J 3AD8C 2D1CA 3M8PB 4GMKA 2R2TA 1GXTA 2W2PP 1WG4A 2CQ4A 4LBPA 4KPYA 2RKIA 3C15A 2P6SA 3T5JA 3OUYB 2VG6A 4FKYA 4R8UA 3TWZA 2GFFA 3PDNA 1TV6B 4KO0A 4IG3A 4NOHA 2XMWA 4DZDA 1NB2A 4WFYA 1JJ2R 3V6HA 3KLGB 2FZKB 5CH7B 2E5LJ 3OTDA 2OPPA 3MM5A 1WEXA 4MAKA 3DLJA 5C2GA 2KH9A 4QYZJ 2FVRA 4NLTA 1N32F 1RWKB 1TUWA 3FJ2A 1TKXB 2F9DA 4R25A 1RAOA 4OJ3A 4C0OC 2RILA 5HATA 2RHQB 4PPZA 2LXIA 3GZ7A 4Y2KA 5I3UA 3KHRA 2KZZA 1H72C 3VZHA 1NH7A 2OSQA 1PBUA 3F0NA 5K14A 5B09A 2CXEA 3EICA 4MT1A 4CO2A 3OT9A 1XMQF 2W4PA 4ICLB 3C16B 3SCLE 1JKHA 4ZVGA 3LWLA 2C2NA 1YK9A 4QQBA 2OJ3A 2UXCJ 5KFEA 2F8EX 1DLOB 2BEFA 4YB7A 3THPA 4D3HA 2YKOA 1HKAA 4DG1A 1ZTTA 2IA6A 3F44A 4KR0B 1D9AA 1KQKA 5E2QA 1V3RA 2KG0A 3ETOA 4JI2J 2JOQA 2E1MC 3T1YJ 4ER8A 4DSIA 2WVFA 4PXDA 2C2ZB 1RACB 2PEHA 1T8EA 1QUPA 1QAXA 1TP7A 3HVTA 3D54A 2UVRA 2IYGA 4HACB 1ACMB 1SC6A 2RS2A 5C2CA 3CJ4A 1RHRB 2C3PA 1U7LA 2VD3A 3M6UA 3A8KA 4XPCA 4B9UA 2CRLA 3P4UB 4TYBA 1MU2A 1OSDA 1XK8A 1NLKL 2QL7B 4DG1B 5C42B 3MR5A 2DKOB 2M2BA 4IG0A 2J76E 3I96A 4N7TA 1VQKS 4F4KA 1KLMA 1VRTB 3C16A 5KG0A 1WSRA 4LF2A 4TKTA 1YJTA 4ZVHA 5MAOA 2EC2A 4RZRA 1S9GB 1Y3KA 9ATCB 3KYLA 3EPGA 2A3JA 2R2UA 4OX6A 4USIA 4L76A 3TQEA 1VRQC 2NXNA 2OD4A 2VPWB 4L72B 3LWMA 1XMOJ 3JTNA 5H9EJ 5MLCV 4PQUA 2WBMA 4DV3F 4ILLA 2FDNA 2A1BA 2CQ3A 4DUYJ 5EWGA 4K4YA 1NEEA 3EZ5A 1XC9A 2GZOA 1GXLA 3D0HE 2BQRA 1R0AA 1BC6A 4N77A 4LUBA 1P6TA 3MMCA 4MKAA 1F3FA 3BGFA 3OFGA 4Q7AA 3TZWA 4G3IA 1FDNA 2NXUA 5AJ3J 1SKRA 1BE4A 3R2DJ 2HQGA 4ZHRB 5J2NA 3LP2A 2CWKA 3H5SA 4WBFA 3SSRA 1DRZA 1VC5A 3QFWA 4NLWA 4UY8T 4CP5A 2AWZA 3DGPB 4IDKA 4AL6A 4DWIA 1F5BA 2CADA 3E01A 3KJQB 4ZJLA 4W4MA 1RSCA 5C5JA 2WRMA 4NCBA 3AODA 1YBUA 2IIHA 4IG0B 1SV5B 4ECYA 1EQMA 2DNGA 3L7OA 2IJNA 4IH5A 2GQ2A 4HI2A 1HBUB 4AE5A 2AJ0A 1NZ8A 3H2UB 4Z37A 1UA0A 5GAGU 1FK9A 4USMA 4JI3J 1R8HA 1UJ4A 2RJZA 2PDAA 3DLGA 3CTRA 2OEMA 3UFCX 3D1OA 3UVJA 4EBDA 5KG3A 1RKJA 4IR1A 5HK4A 4A8MP 4YY3F 2ZHOA 3K58A 3DDIA 1TU0B 1EP4B 2RVJA 3EDQB 3KJFB 4O44A 2YH1A 1UVMA 3SI8A 3Q22A 2RNEA 2FGOA 3PRBA 2C2KB 3OTOJ 2DNOA 3KK1B 4FS1A 2L9WA 3ZZRA 1GT8A 1YX2A 4O4RA 2FYXA 2WVCA 3ETMA 3RZAA 2XMJA 1KP6A 3SQGA 2BJ1A 3D66A 1VHFA 2BE2B 2FLPA 4PXCA 3Q8PB 3AJ2A 1NO8A 3FBCA 3QT7A 3RAMA 3OSPA 2DXFA 1FK9B 1RP5A 3BDEA 4OHXA 2XEXA 1JKHB 3SQOP 3PCOB 3NS5A 2C42A 5L46A 4LF1A 4WFBQ 4K4WA 2NUUG 5BYSA 3N5BA 1CC7A 4FYYB 5CQGA 3P3DA 4O3QA 3NGSA 5E0OA 2KM8B 2BJ3A 3BGRA 5LJ3Y 3A13A 3NY0A 2R2RA 2AX0A 2G4BA 1ZAVA 2ZDPA 1NMEB 3BDPA 1VDHA 1VQSA 3GPAA 4KT0C 3CXCR 1GMUA 1GH8A 1UVIA 4UZCA 1TKXA 3AQPA 4OI2A 2QT7A 3TEGA 3W66A 1REVB 4ZCLA 5FIIA 3BO2A 4M5GA 2J8SA 2HMIB 2U1AA 1TV6A 3D4JA 1XERA 1BY9A 2GO8A 2KN4A 3TARA 3IAS9 5GAEU 3KLGA 4N5SA 2BOPA 2YH0A 4J9LA 3QRQA 3BPDA 2CIMA 3UW1A 3NS6A 1E6YA 5DLGA 3TJAA 3ZZOA 2ACYA 2DGUA 2XTJP 2AJFE 1FFWB 2RKIB 2CA9A 1JJCB 1VQ9S 1AZSA 3O8WA 2LEBA 1S9GA 4RNHA 4CLFA 1YI2S 3HHLB 2DY1A 1PCAA 3FQLA 3ITHB 4DX8H 8AT1B 1S1UB 1NZAA 3NGTA 4XAKA 4M5NA 5AXLA 5GVQA 1DQ9A 2UZAA 3ISNC 3LGNA 3W2VA 3M8SA 4FBUA 4Q0BB 2O1PA 4X65F 5K8NA 1FNOA 4EMDA 1MWZA 3N6NA 5ETRA 4ZLNA 2AD9A 4DSLA 2E9TA 2NSBA 1LQ9A 3ZTSA 2XC9A 4B3OA 1U49A 2DHHA 3DDKA 2DGVA 2BOAA 4PG8A 2KFZA 1HIYA 2F4VJ 1A7GE 3CCJS 2PI5A 3D6HB 3S6EA 3VAIA 4HI1A 1NDPA 2V2KA 5HLFB 5LSLA 3OHAA 1WC4A 1MWQA 1CJTB 3UCGA 2WTFA 4JV5F 1CQMA 1P9QC 4LFBF 1UW4A 3IAM9 1C4AA 2H5JB 4DR1F 1SH0A 5IC4B 4BHQA 2R7TA 4LSNA 3TA0A 4UT4A 4RW8B 3EGZA 4K7QA 1IVZA 2EWHA 4DCOB 3UN3A 4AQYJ 4OI6A 4PUOA 5HO4A 2DRAA 1RT3A 3R5CA 3QPIA 2KHDA 3HD2A 1HBOB 4NLVA 3MURP 1KQSR 2FLNA 2V8DA 4ELTA 3QGHA 2RMLA 3KTQA 3BQ0A 1URRA 3TAQA 3UNGC 2WONA 2QA2A 1D09B 2WW8A 5I3UB 3H8YA 4X4OA 3UD4P 3PHTA 2X1GA 2ASLA 1FD2A 1Q0NA 3FKBA 3FQKA 4CYUA 5J2PB 2W9CA 4F26A 3C14A 2D7SA 5DS7A 4K0KF 3W1YC 2G1HA 4LVNP 4M63A 3JAMU 4F2SA 1NUEA 1S1TA 1G7CB 5HQMA 1R6YA 2J9DA 5CYQB 4ZK7M 1S0MA 3L95X 3LGMA 1RAAB 4TLQA 3PW2A 2MXYA 1RAGB 2QYGA 4WCEQ 2J7WA 5CZXA 1FWPA 3LALA 2J6SA 2AW0A 4C8ZA 5DJBA 2D69A 1OS5A 3FMBA 4KAIA 2ATCB 4PABA 3W2WB 4ZCMA 2ADCA 1B0PA 2F3JA 4OQJA 4FYVB 2OMOA 5H9EK 4JB8B 3OW2R 2ABYA 1S6UA 3JSMA 1T9TA 1VS3A 1RTJB 3DI6A 2DR6A 2F1FA 3DHXA 3FRZA 2JL9A 4DCPB 4FN5A 1X31C 2VIHA 4DV4J 4LF7F 1MN7A 4OL8A 1HWIA 1X4GA 1V9OA 4EU0A 3QO9B 4TQSA 1O0PA 2ZH9A 5E33A 4F4ZA 4JV2A 3L09A 2WONB 4CLPA 1SBRA 4QR0A 1NK5A 2J6UA 4F0KA 1WC3A 4OZNA 1LXNA 3S7RA 4NASA 3W5ZA 4DFJA 3W5YA 2UUAF 3W65A 3N4WA 4PRFA 4NZ7A 4C6AA 5C25B 1AW0A 1NK0A 1BQXA 1N32J 2PT0A 2Z58B 3I5BA 5A6WA 2YXLA 1FKPA 3VVUA 2HRUA 5A0YA 5B0BA 1RTIA 1U26A 2VG5B 3NAHA 2J7UA 1VRUA 1RWWB 4QJVA 3B78A 3HF5A 1UWBA 4KIAA 4OYWA 5KFXA 3K5MA 1MSWD 2NS1B 3EX7B 3O6QA 1WELA 1N5QA 2CPJA 3WIUA 3B4DA 1JLBB 2UV8A 1R8BA 2AEMA 2HFUA 4NLXA 2V63A 3OFEA 5A2QU 3D6TB 4DPYA 4NPOA 2P9EA 4DL4A 1CJVB 2AEFA 1DZ5A 3OTBA 4A8OA 3CMES 4RUCA 2L9NA 3QO9A 4B3SJ 2R7QA 3NOCA 3HX9A 4WE1A 5ETLA 1VBYA 1D8YA 3D3CJ 1NKCA 4ZP9A 3WIVA 1B3TA 3W9JA 3MD3A 1KSPA 2EFPA 1REGX 2CQ0A 3DI6B 3G8TA 3HHLA 4O0NA 3DRRB 1H98A 3HHLC 1IJEB 1PYOB 3ELHA 4LBIA 3OLAA 2XS7A 2Y1LB 3VGSA 2OPQA 3NAIA 4YS2A 3EYZA 4N41A 4I1TA 3NGDA 1VQ8S 2GJ2A 4C3KA 4GRSA 1T9YA 5CD4H 4NZ0A 1I94F 4J9NA 4CM0A 1NHVA 2B6AB 3T5HA 1JXEA 2LA4A 2LDIA 5KFSA 3DFEA 5L1KA 3V6JA 1KQGB 1S1TB 1T9UA 1I94J 4UTGA 2IC3A 2PIIA 3CMAS 3JYTA 2VKRA 3O3LA 3TUJC 2DY9A 1EQ0A 1FRHA 2VASA 4H4MB 2G2YA 4DPXA 5L38A 4UZBA 4ELUA 4M8LA 3TZYA 2GCFA 1Q53A 1HWUA 1PJ7A 2CQBA 4CO4A 4TU8A 2FIUA 1VLOA 1Q5VA 2V4RA 3W60A 1P9YA 4K2XA 4ED6A 4P74A 3JTPA 3D3BJ 4USTA 2VA3A 1RT6B 4JV1A 1AUDA 1MMNA 3U02A 3KLEB 3GLJA 3Q23A 4J90A 4P2XA 1FX2A 4PKDB 3ZTPA 5A8WB 1N54B 4RNMA 1TVRB 1HNWJ 3G4SS 3JSBA 1AROP 2MSTA 2AX1A 2HFNA 4DS5A 4Q0BA 1JLQB 4KH1B 3FC9A 3TUIC 3J7ZT 2W9BB 3PYFA 2ZNYA 2LECA 2CJKA 5E3RA 1BWEA 4LFCF 4DU7A 5CCMA 4RPFA 1RHQB 1APSA 3UI3A 3MM9A 3M8QB 1FJEB 2XY5A 3GV5B 1K9MT 2BKOA 1K47A 4FYDA 3M6WA 4O3PA 2IM1A 5DDRC 2KZMA 1NK6A 1HNXF 1KKHA 3UCUP 3LF0A 3W3SA 3I31A 3BSCA 3O5TB 4DR5F 4EZ6A 1HHQA 2E5GA 1FVQA 1OWXA 2B4PA 3HHDA 2NR0A 2D3OR 1BGXT 1KEKA 1WHWA 2H4WB 4C3MA 2JFKA 2VDIA 1YHQS 1GFWB 3PIPQ 3H5XA 5D4OA 3TO8A 4MTPA 3S8SA 5E3AA 1OY6A 4MK8A 5B0AA 5J2QA 2ZBIA 1KONA 4KFBA 1AZSB 3TANA 2IM0A 5J2MB 2KG1A 4J9OA 2E5HA 2FZCB 4ZP8A 1SIZA 2NCKL 2J0SD 3LP2B 2QMXA 3NXZA 1WORA 3MMAA 2QA1A 3CDUA 3CUNA 4KHPF 2V8GA 1UJ6A 3JSYA 2UU9F 1CEZA 3DOLB 3R5JB 1GAOA 2ZDOA 2AV5A 2HFVA 3PYDA 4NMXA 1Q5YA 4CH0S 2WVDA 2YY3A 3MMCB 4RJVA 2CYYA 3T6JA 5KFRA 1UKUA 3V6KA 4B3MF 2BW7A 2HQIA 2F8MA 3JSMB 2ZH3A 2BYCA 4CM2A 2BM0A 2YX1A 4NLPA 3V4IA 1UPMB 2HWIA 2YWKA 1FRMA 1I5OB 1NSAA 1OY9A 2Q79A 3DM2A 4MIBA 2L3MA 2QRRA 2ZNZA 1SQEA 2EFOA 3CJ5A 3G87A 4BBYA 1FO1A 4DF4A 5LMNJ 1ZAXA 2ASDA 1G4CA 2AJQA 1MNEA 3RG6A 3PV8A 2QA4S 1N6QB 1H3DA 3VWSA 5HVHA 3AH6A 3MEEB 4J9QA 2AT1B 3NL0A 4DXLA 1RLDA 1XN9A 4F50A 2W9AA 3K8VA 3EXCX 1C0TB 4F0HA 2PMZD 2N3LA 5KG7A 5LJ5Y 1X4BA 3TUZC 1ROFA 3TX8A 4ZVPB 3GIMA 1FRLA 5KOWA 2UUCF 1QE1B 5G4DA 2IAJB 3KK1A 2ROPA 1NPPA 2IJRA 1CJKB 2XLJA 4DR1J 1S48A 5D0GA 2YKAA 3V6DB 1S1VB 2FHJD 2ROEA 3ILIA 2YNGA 4J9PA 4RL1A 4LRDA 2GAGC 3CJRA 3GYNA 4EUVA 1X9WA 3RYLA 1U6ZA 1VQ4S 2F7VA 1XJWB 2H3EB 3QLHB 2HAFA 2LQ5A 3W5XA 1VQNS 3TAPA 2DNZA 3VAJA 2F4VF 1LFWA 1ZA1B 2CQCA 4M5KA 4P2SA 2F65A 1TL7B 3DLKB 1R0CB 1AXQA 4ICLA 4CLLA 2IY5B 1IQZA 3EGNA 3DXBA 4RBUA 4C9DA 3W9IA 4LR7A 3R5BA 4EZ9A 3M1VB 2VJVA 1NJZA 2PI4A 1MG7A 6FD1A 5DRKA 1CULA 2LQ8A 1X5PA 4C7QA 3K59A 3H4BA 5A8RA 3CD0A 4WP8A 2MDAA 3NGRA 4KV8A 4P9SA 2RDJA 2LQJA 3AA8A 2VFSA 1M5PC 4UQGA 1MROA 4IFVA 4PG7A 3G86A 2P2CB 3I9V9 3BYRA 4YHHF 5HJYA 4X64J 2DK2A 4ECZA 2XMUA 5CYMA 5B0GA 3F41A 4A8YA 1SH3A 2CUYA 4ZVTB 2R8GA 4B3TF 3BBBA 2PFFB 4ZPDA 4ELVA 3M8PA 3ENVA 4LRCA 4YB5A 5E3CA 2ZKTA 2ZBRA 4EWTA 5BJRA 3Q8RB 2MEWA 2CVIA 3OR2B 5JMNA 1FXLA 4HHHA 3CF5Q 5EX0A 1KLMB 1VRTA 1WOOA 2IYIA 5KFIA 3RBEA 3SDEB 4DSFA 1JLAB 2J0WA 4USHA 3WQPA 5HQ8A 2H5EA 1EIYB 1OSCA 2HW3A 3MF5A 2CKWA 3MPYA 4DFPA 3KFWX 4U9RA 1FDAA 3NLCA 1RA7A 4BDPA 4QCLA 1TL1B 3AJDA 3HZGA 1N36J 2BQUA 4J91A 3V81A 1LWFA 1OQ6A 1RQ0A 1X5TA 2FC9A 3CJTA 1WF0A 3BGRB 4HHJA 5E5NA 3SSQA 1RHKB 3NKYA 1A6LA 4OV1A 5HBMB 1LEOA 1UJ5A 3CWJA 4ZP7A 5M2RA 4A47A 5F9NA 2J8AA 2ZJPQ 3PVXA 4C11A 1S10A 1N34J 3BYPA 2HHSA 2HVZA 3MFIA 3OL7A 4LF4J 2JJ4D 2Z57B 3ONQA 3QT6A 4RW7B 2C3UA 5KT2A 1XR6A 1PC5A 4W98A 5EX3A 5AXMA 3OTOF 1BXNA 2HK3A 3QLHA 2HG4A 2OP5A 2RAQA 4QR1A 3OVAA 1UEUA 2BE2A 3ENWA 2M5YA 3J7AN 2UUBJ 2PGCA 3I32A 1TQLA 2LA6A 1G6BA 2GJIA 1HQ2A 1U09A 2OUGA 3C8YA 2QA4G 4FF2A 4ZN1A 4JI5J 2ZH7A 2LLZA 3R5GA 3DRYA 5HANA 2MZ1A 3V81B 2ZH6A 1X9SA 1DY3A 1N5VA 3RU0A 4NEZA 4QIWD 1S97A 2VQEF 4OYPA 1U8SA 2FJEB 2QLFB 2Q3PA 5DG8A 4RBVA 1KN6A 4I7FB 2JLFA 3KHHA 5HVGA 1RCXB 4MYUA 2LMIA 5DM7Q 2VHGA 3N01A 3TA1A 3WHIA 1RWXB 5KAKA 5LSRA 4Q43A 3NMRA 1IWGA 3LO3A 4B3TJ 2YQ1A 3SDEA 2P9GA 4IG3B 4AFFA 4B9NA 1N6QA 5D15A 4K4TA 2ZH8A 4HH0A 2K1RA 3HKZD 5F41A 1U1PA 4GKJJ 4KY3A 4Q44A 4IDKB 3RW6A 1SC4B 3KWMA 1Y11A 5SUHA 3KHGA 1HWLA 3Q89A 5DETA 4H54A 2ZH5A 2ADBA 5RUBA 1KLNA 3KJVA 4ED0A 3UR0A 2WOMB 3ZZZA 2KYZA 2HWHA 3I6PA 3CEDA 3BQ2A 3GIIA 3R1LA 4LF4F 1RWVB 2AGPA 3KG0A 4GO7X 4X66J 4DV3J 1OIAA 4QIFA 1LW0A 3B6BA 4CI0B 4JI4J 1QJHA 2NPIA 3JQJA 1Q4RA 1B7FA 4KV8B 1JXVA 4N76A 2Q6BA 3OXLA 1HBMB 1M1GA 2D3O1 1IBLJ 4G65A 2OH2A 4F3OA 5K8PA 4C8LA 3VAKA 4RW9B 2J0XA 1Y0HA 2HZVA 4K4VA 3G2XA 2XLKA 3BGLA 3HFZB 1FA0A 1WF1A 4AT1B 1OPIA 3KUGA 4C0BA 2GO9A 2XZWA 1Y5LB 2KU7A 4O3NA 4HYKA 4DSKA 1HD1A 5KFCA 3JAMY 2OD6A 2R8JA 2CJQA 5LSOA 2KTQA 2OLWA 1KR4A 1Y3JA 2HHPA 2MLXA 2O3DA 3ENAA 3OXFA 4NI2B 4O23A 4ILMA 4DPUA 2BJ7A 1SKUB 1S4EA 4QIVA 1RAEB 5A6PA 1IBKJ 2UUCJ 3MM6A 2CQPA 1UW9A 1FCAA 4NZ6A 2BX6A 2XMTA 2KJVA 2CPZA 3EXYA 2ZZMA 3ZFVA 3HMJG 3HVTB 2UXBJ 1NJWA 5D6GA 2V50A 3CC2S 1N48A 4NRTA 4X4SA 2YNFB 1XNQJ 5K9FA 2A2CA 1WKLA 1IN0A 1SC1B 2HHWA 3H5YA 3Q8VA 1N56A 2LXFA 1GX5A 2ZZTA 3OTEA 4I56A 2GIQA 4AYBD 1CJUB 2A0FB 2QJ3A 4DHVA 3Q8SB 3N6MA 4X4QA 5L39A 5LMNF 4WF9Q 2DNQA 5DG9A 4NYOA 4C8KA 3LOUA 4DR4F 4DQQA 2VOOA 4KB7A 4NLQA 1R43A 3MOJB 1NK7A 4M5JA 1DHMA 2M7SA 4FBTA 5A76A 3GSIA 3OVBA 1CG2A 4NCGA 3RRKA 4RR5A 3BKFA 5KG6A 2IM3A 1HHTP 1IXKA 3IFEA 3M7VA 4M5DA 3ZZPA 1S12A 1X4FA 4WWSA 4LIWA 3CE8A 2JC0A 5KT7A 1UVKA 2YKQA 3DHWC 4B9SA 1YTYA 1FWLA 3IO1A 1WDDA 2PSZA 8ATCB 1UVNA 4WJBA 2WVBA 2YKNB 2ZOGA 5F0UA 1PAEX 3A3PB 3QFHA 3CCMS 2MY8A 3GIJA 3MXHP 1U6BA 1IR1A 2V2VA 2IDLA 4ZVFA 4U95A 4IKAA 4I2PA 2HNZA 3EGWB 5J2MA 2VQFJ 4X66F 3KLFB 1YJVA 2B0GA 4RU9A 3M9MB 1QY7A 3QIDA 3T9NA 1WC1A 1T9VA 3PFOA 1JIHA 5DQIA 5EN1A 3ILLA 4DL0C 5KFFA 3OTCA 3QSYB 1MMDA 4X62F 2ZH1A 3BGUA 3AXKA 2DITA 1VGYA 4NE9C 1LKZA 3CIZA 3KK3B 5L1LA 2FY1A 3M2VA 4KTQA 2NQPA 2RB7A 2MB0B 4O3SA 2G0IA 3CCWA 1S9EA 5HSPA 3PKYA 1CJVA 1DJ0A 3HM9A 4DOZA 1IKXA 2JHEA 2JEFA 1Q8LA 4DN9A 3CCES 5G0RA 4QPTA 5F9LA 5T41A 2E29A 1AA1B 1SJRA 3X3UA 2HZAA 2XS5A 2XI3A 3W61A 1FJCA 1FKAF 1I1GA 3KLHB 2C2MB 4I0WA 1QSYA 1Y5NB 3KK3A 3NNHA 1RAFB 2N4CA 1RT5B 2VG5A 4OLOA 4LQ3A 1P1LA 4WXOA 4ZKAA 4IOAQ 2C22A 2W4CA 4L73A 5A8WA 2OMLA 3PXGa 1DBDA 3MCOA 5L8RC 3DYAB 4WU2A 1HA1A 2YKMA 2NXEA 2RT3A 1HBNA 3MM8B 3GQCA 2LP4A 3K57A 3TAMA 2AMCB 1Y7PA 5F8MA 2QEXS 1TKZB 3D28A 3IM8A 3VAFA 4HDHA 4XTTA 2I1RA 1XEZA 1C1BA 1RTHA 4LBHA 5AE3A 4A8QA 2NREA 4H4MA 2AP6A 2KB2A 2DGSA 3MM7A 3QSIA 2DHAA 1BD6A 3S1TA 4ES2A 3LGHA 2EW9A 1QVFR 1M5SA 1RYRA 1VK3A 5IM0A 2Q66A 4DR2J 1UAWA 2FJBB 3BBCA 4MFBB 2MQPA 3TQ1A 4TVAB 4X4PA 3ADAC 1FFGB 2B9EA 4A48A 4R5PA 5DDQC 2OAUA 3H7HB 5GADI 4DV6F 4DQRA 2FD2A 1FI4A 3I87A 1UZHA 3LP0B 1NDKA 1K8AT 4X84A 2MKIA 2K06A 3LPEA 2V5HG 4LSLA 2I8EA 4ZCKA 2IJFA 1D1UA 3DU5A 5KFHA 3IR7B 3U1MA 2VF3A 1T3NA 5B0CA 5KFWA 4WE1B 1KDNA 5FD1A 3ZZUA 3ILJA 2CZVC 4IQMA 2IRXA 3DMJB 1QAIA 3NMAA 1PYTA 5GMDA 4KBIA 5I4MA 4DQSA 1KFSA 2DXEA 1HBOA 2LDYA 3Q8YA 3DLLQ 2WBRA 4S0MA 2UVUA 3GWCA 4FF3A 4URQU 1U0SA 1KFDA 3J7YU 4U7CA 1UWBB 4Y00A 4P10A 2KDOA 4KGZB 3BBFA 4LSNB 1LXJA 1N0VC 1NU4A 3VGUA 1MN9A 3FSYA 2A6MA 3FUYA 3SIPB 3C46A 2XB2D 1X0FA 1YG0A 2HHVA 2HWTA 4NI2A 3TA2A 4WYLA 3W8GA 1QSLA 1DARA 2UUWA 3M2RB 2UXBF 2AZ1A 3J7Z5 3LAMA 1Q81T 3ENQA 1HR0J 3DLBA 4PG5A 3Q2TC 1FEEA 2QMWA 2MHEA 3NS7B 5HLFA 1JB0C 3PJ9A 1KTQA 1EETA 2HIQA 3TNVA 3FEXB 4EO6A 5HMZA 4WFAQ 1VC6A 3EVMA 4LRFA 4ED5A 1HYSA 1IUJA 4PXEA 4EEYA 4BC9A 3KK2B 1G3OA 2G1DA 2XO7A 2D41A 5GAHU 1S7IA 2GNKA 1Q1KA 4ILRA 2XMAA 1RT2A 3IBWA 3SV4A 2DH8A 2KO1A 4ZDNA 4G1IA 2MYFA 2B9XA 1WJ9A 4LF6J 4ZPBA 5L1IA 1UWAA 4L74A 2ZBCA 2R8HA 1T03B 1I6JA 5JVHQ 1NDLA 4NYZA 1K0VA 5DQGA 4HT7A 2BANB 4KKOB 3B8HA 4ECQA 2YWGA 3NBPA 1ZH5A 5GADU 4X4TA 3THVA 4NCAA 3PW7A 2YWHA 3LA0A 4NCGB 5J1NA 2HGMA 1EX8A 2J9DE 2ATLA 4V19X 1RA6A 2PC6A 3D5MA 2XGQA 2VG7A 3BQ1A 2W4DA 1HLWA 2EBEA 1RT1B 1RWMB 4A8WA 1AYEA 1XMQJ 3DCAA 4I2QA 2DGXA 4IUFA 3IRXB 2HK2A 1JLFA 4NEYA 5ETSA 1Q8BA 4KE5A 1YDLA 4MKYA 2VOPA 2YNIA 2H5IB 2YWFA 3BPSP 2BUNA 3HJFA 3CDBA 3R8YA 2HNYB 4UOFA 3MAHA 4MIAA 3I5AA 3MR6A 4ID5B 3BB5A 4GC7A 2KL8A 4ZPCA 3ISND 3WC2A 4ANDA 4DJBA 4B3MJ 1RDRA 3G9CA 3TYTA 1JLGB 1H2TZ 1WHXA 2PA8D 1F9FA 4AL7A 1NBEB 2GMHA 1HQEA 2AYGA 4A8FA 2DR5A 2VL1A 2HS4A 2ZC3A 3AB4B 2CQ1A 2B56A 3QQCD 4XK8C 2NPFA 2ASJA 4WKRA 1ZBTA 3O44A 4NLDA 5CCLA 3TW0A 1FDBA 1YGYA 3CCQS 1H7XA 4M94A 3MDFA 1IKVB 1TL5A 3QWPA 3VCDA 3PHEA 5HVFA 2N7CA 3T5KA 4RW6A 4JI6F 3NWGA 4MK9A 4ECWA 1EKRA 4WXWA 4ZCIA 1VQYA 1XR7A 3HPOA 1EP4A 4ED3A 1VBXA 1RTDB 3GB0A 3PIOQ 1HBMA 2DTJA 2KYXA 4G1QB 1RWNB 1VR6A 4K4SA 1NXIA 1U0HB 4RLEA 5LMUF 3RAXA 4IRDA 2PN6A 2EFVA 2OFGX 2YPZA 3HT3A 1YIJS 2KXHA 2Y0SD 2OO4A 1F0XA 2DHGA 1S1UA 1HPZA 4ZN3A 4K5RA 5AE2A 2W01A 3PJWA 5AT1B 4ZVUB 4KGVB 3BH6B 2APOA 2IVYA 2H51B 2LU1A 3UDCA 3A3OB 3GMGA 4QIEA 3IS9A 3MEGA 1HNVB 2K2PA 4DL7A 3Q86A 3EPIA 1J5EF 1D3WA 3IG1A 3AD7C 3POTB 4C3LA 4ECSA 2C2EA 1KD1T 2EVZA 1U6FA 2C2OB 2D9OA 3H0PA 3H98A 1F5AA 2V68A 4P71A 1E6YB 4CDIA 3ULHA 3R2CJ 4PWDB 3PO4A 1J5EJ 3SSSA 3U27A 1R89A 3CJKA 3J81U 2WK4A 2Y3YA 3SFUA 2JWNA 3WBZA 2HMIA 4KJIA 2OEJA 3ZNJ1 1PJ5A 4I7FA 1REVA 4BWJA 5KFKA 2YWWA 5A8RB 3NRBA 4OLPA 5KT5A 2XMMA 4DV5F 1RCOB 1SJ3P 1RTDA 2MKCA 4LF8F 2HVHA 1DTQA 5LL6d 1RT4B 1RYSA 1UL3A 2KVQE 3VZIA 1IKVA 1SKSA 3OL6A 3BV8A 4OI4A 3H4DA 1YLXA 4U6PA 2OEKA 3FSXA 3HSGA 5T14A 5IZHA 2R7WA 1T95A 3H2VE 1VQOS 1OYDA 3RGIA 2ILZA 3HP6A 2DNKA 3R3TA 3US5A 1F6TA 4PCQA 3A8IA 3TEHB 2MZQA 4K2JA 4EI2A 2RRNA 1NAQA 4K8RA 4NXMF 1FHTA 2YNGB 1NHUA 1Y9OA 2FJWA 2QZ8A 5HBMA 5GAHI 4RUAA 3FCWA 3VAHA 3HD1A 4NXNF 2KVIA 2F5GA 1YSJA 2QL5B 3CJSA 5D4PA 3DNCA 3CPWR 5ETNA 2FJVA 4B3SF 4IQXA 2FLLA 4YMEA 2CJYB 3U7JA 2DR9A 2IM2A 2AZ3A 2CNKB 4GC6A 4QWDA 4W92B 3MWBA 4IFYA 3R97A 4ATNA 2CJBA 2GA7A 3CB4A 3NG8A 2VC1A 1JLAA 5IQ6A 5FLXU 2AGQA 1VC0A 3R7SB 4DEZA 1OY8A 3CCTA 2H9ZA 1M5OC 2DPIA 1IKYA 3G8QA 3NWRA 2XBPA 1K73T 1PIEA 3MTKA 3PRVA 4FXWA 2E9ZA 4HR2A 4WFZA 1ZYQA 2FHOB 3E01B 4LVOP 3KUHA 2PA3A 2RQCA 4RU2A 3DRPB 2HZCA 1R8CA 1E6VA 3DDNA 3DM2B 4ED7A 2A2DA 2D3UA 3WDOA 4DUYF 4C8NA 3VGTA 5J2NB 2K8GA 2XYPB 1P8GA 1GK8A 2OPPB 3VQSA 4ZHRA 5CAAA 3HHKA 4YUDA 2MGZB 2RRAA 4YB6A 4K50A 2VFUA 4P2FA 3MI7X 3JQKA 2CPHA 2J7KA 2B5JB 3BN7A 3MMAB 3N9UC 5IV4A 2XULA 4PPDA 3POTA 4WU3A 5K8MA 4DZ6A 4F36A 2DVIA 3VVTA 4F4WA 5IWAF 2DO4A 1T3OA 1URNA 3M1VA 2B51A 4DR3F 2E5IA 2HRYA 2IFXA 4E0DA 2EFQA 4JV5J 3FFIA 1U24A 1X4EA 3M32A 4Y65A 4KHPJ 2WB1D 4M95A 3DGVA 1TKTB 3D68A 4ZJQA 2M88A 3A8EA 2UV8G 3W64A 5KFJA 4HVZA 2V8PA 5ETOA 1G1XA 1BQNB 1HNIB 1ZAWA 2JVRA 2MTLA 5D0HA 2HRTA 3QNWB 2W7PA 3SCKE 1WWHA 1GMWD 1RABB 1C1CA 1TL4A 4FZVA 3UPFA 5HP1B 1IBMJ 2ZD1A 2OIHA 3CW2C 2GVZB 5L9NA 4ECVA 2BACA 3M9OB 3ZXWA 1FRJA 3EE3A 2HEKA 2RRBA 2B7CB 5E41A 4F4YA 1W25A 2BKNA 2RDIA 1WI8A 1HI8A 4K59A 4X65J 3MEKA 3BSNA 6FDRA 2CJAA 3PYEA 1NRKA 2DH7A 3W9HA 1U2RA 3BF4A 4O4GA 4CH1A 3T6BA 4X2BA 1U48A 4NRUA 2AQ4A 1W2BR 2CQHA 6AT1B 1J2VA 2CQGA 5KFYA 2OGUA 2X1FA 1KVKA 1U1QA 3NCPA 4IO1A 2ZE2A 1LFPA 1PILA 2GGPB 1DLOA 1LOUA 3AOBA 4CLUA 3TR5A 1JLGA 2C3MA 1TFWA 2QYCA 3D6FB 3KLEA 2GC8A 1N33F 2HHHJ 1Z4UA 1M1KT 1NPKA 4UUXA 4ZMMA 2FJXA 1YBAA 4M5IA 3RRHA 3SXLA 1TMMA 2YBVA 4CO5A 3GFZA 1N5YA 3MM5B 1KWMA 4HDGA 2RDDA 3I56S 2BXJA 2FJAB 3P5TL 3H59A 2ZBQA 4LF9J 2RE1A 4F2RA 4QYZK 3GCXP 2QFJA 4DF8A 3HHLD 3QMQA 4KO0B 3MM7B 1O5JA 3OLBA 2MKSA 4LQ9A 3N0VA 2BW2A 1GTEA 3DOLA 1FNMA 3PM9A 2CDQA 4ZPVR 3U1NA 1NK9A 2CAJA 1BMQB 2MHNA 3C3LA 3LPYA 2VJUA 5H1SV 4RUHA 3CNQP 2RH3A 4C2MA 2NLWA 3MFHA 4DV2J 1Z2LA 3JXOA 2NXJA 2B4UA 2YKMB 4ZPTR 2OPQB 1C0UA 1Q95G 3D6MB 4FYWB 1K1SA 1TK0A 2NZ4A 2CPYA 2DCUB 2XYHB 5LOQA 4ZITA 4HL9A 1T02A 2UXDF 2ZHAA 1B99A 4QU6A 2GHPA 2HQFA 4FS2A 3AHPA 3UE2A 3OR1B 2D3ZA 1R27B 2OPSB 1GX6A 3MAAA 2BR0A 2I5JB 4I6YA 1FNXH 3EDRB 4HH1A 4F7VA 3VAMA 1NB7A 4KC5A 2OTLS 2C1EB 4UUWA 2DD8S 4P7VA 5T7LA 3AB2B 2EBGA 5U47A 4LF8J 2BJ8A 1TUVA 1RAJA 2O67A 5IQQA 1U45A 2MQNA 3D67A 4OZ1A 5IS2A 4U7UD 3G82B 2DIUA 2WB4A 1JLEB 2MQ8A 2MSSA 2OHDA 5HAOA 2M52A 3VHQA 1SI9A 3GONA 2JSXA 1CQNA 2VC0A 4OZ5A 4PWWA 3DOKA 1NSKL 1X4AA 3OPKA 2FC8A 4MIWA 4DMZA 3GTYX 5K20B 3M8RA 1NKEA 3G82A 5ETTA 1FKPB 3BKUA 3FBEA 4KHMA 3RJMB 1ZM3A 3EZOA 1PJ6A 1N5TA 1MW7A 5LXRA 1JLCB 3MPUB 3PEJA 3DRSA 4NLSA 1Q86T 2BBEA 1T05B 3UD3P 1T11A 3WX8A 1VQ5S 1WEZA 2X3DA 3IWLA 4Y0FA 1GNKA 2QX0A 2GHVC 3RBXA 3HCXA 5D4NA 4UOCA 1XMOF 3M6XA 3CULA 1VI7A 3FBFA 1S72S 2CJ9A 3D1QA 4M5LA 4CWBA 4ZP6A 2Z4PA 7FD1A 3CC7S 2AKWB 2J5AA 2I0XA 1RHMB 4Y28C 4Z7CA 4QR2A 1RU1A 1RJJA 1KHWA 2FQQB 3IBFB 2HFOA 2IA0A 4KGKA 1DTTB 2KM8C 4DV2F 4C8MA 3GU0A 1T7PA 1PO6A 2XMVA 1R7IA 2ZM6J 1OO0B 1J27A 1YJWS 3HJVA 1S49A 3HHEA 4F3QA 1SUQA 1K44A 3K5NA 3SV3A 3ZTQA 3IXQA 3IGVA 2Z30B 3C14B 4FKXA 1ZZFA 4F4XA 4FXVA 2HVEA 4ZOSA 5H9FJ 8RUCA 3E8OA 4OYBA 3T1YF 1HMVA 1LW2B 5F8IA 2UVWA 1DAXA 4ID8A 1F60B 2O5DA 1T05A 3W8PA 5CYJA 3ZZTA 1HARA 2VU5A 4DR3J 2M0GB 1OJ4A 1HBNB 3I4HX 4PUOB 2Y1RI 3HO1A 1FWKA 5IWAJ 1QDUB 1UMJA 5A8KB 4C8OA 1U1MA 4F8RA 3V2UC 1SIWB 2FZGB 1O51A 2GGPA 4PG4A 3TZZA 2H48B 5IOLA 1FESA 3BGOP 4QWBA 2ZWPA 2FTRA 4P7TA 3CCUS 4DLEA 1L3TA 1EKSA 4JI7J 2JX2A 4TXSA 1R3NA 2QLWA 3PW4A 4WP9A 2NZCA 2VPZB 2DNLA 4CLSA 1FE0A 2BZ2A 3OV7A 4FPRA 1LWXA 2EG2A 2XWYA 5SZTA 1N88A 3I9ZA 5G0RB 4F25A 3EVOA 4CTAA 4HKQA 1JJHA 3DLEA 4OJHA 2E5LF 1S77D 3OR1A 3TI0A 1KTVA 4DI6A 4Y3CA 2V4QA 1C1CB 4NLYA 1LW2A 5HMYA 4BWMA 2W8KA 1IBMF 4LMZA 4J5OA 2IMWP 3G6ES 2CFXA 1RAIB 1ELOA 5M2PA 2RQ4A 3GJQB 2C28A 2MKHA 2KT3A 2GX8A 1TKTA 1RTJA 1YWXA 1U1RA 2UP1A 1HW9A 2QG9B 2E7WA 3CD6S 3W2VB 1SJ4P 3THTA 3T1AA 2F8HA 1OQ3A 4Q45A 4B3RJ 1AFJA 2Y1IA 3W2WA 3QBCA 5BR8F 2C2RA 2GV1A 3BSOA 2VA2A 4NXNJ 4EO8A 3EWGA 2E1CA 4NXMJ 4H4KA 2EKNA 4CH7A 1S9FA 3CC4S 3R9LA 1IM6A 2GJFA 3FRYA 1HNXJ 3PRDA 2AYMA 2OPRA 1HWJA 4GVBB 1HL6A 3T41A 1WKKA 1WTFA 3D2WA 2GAHC 2YNHA 4FDFA 1ZPVA 2X1AA 3I0SB 2FVSA 3KNAA 4ZVRB 3HULA 1IR0A 4M1KA 5HI7A 4JV0A 4CYUB 4DDFA 1M1HA 2QN6B 2ZHBA 1GXUA 1O6XA 3A8JA 1B4SA 3MECA 1PC4A 3CCZA 2JLEA 5D0RA 5E3QA 3CCLS 1NM2A 3DRSB 1VBZA 1FKOB 4JI8J 3CDEA 3RUBL 3TJ8A 2VICA 2MJNA 3QIPB 3F56A 3HSDA 3IR5B 4PYAA 1T94A 2MQMA 4XDCA 3QAEA 2FLOA 2CG4A 3UDEA 4U67Q 4IO9Q 2JEGA 4JYAF 4MYTA 4N8OA 1T9XA 4GKKF 3IN5A 2IRUA 2GQQA 5DM6Q 1RT5A 4JP8A 1YJ9S 2XMKA 1M90T 1W7WA 2V2ZA 4OX9F 1XQIA 1OPZA 2EI5A 2Z2MA 4O4GB 3SQGB 4C11B 1AFIA 2XS2A 2J6TA 1H2UX 4ZS6A 1R0BG 5T7LB 2P9CA 2EXUA 2DHXA 2NUHA 4MJKA 4AXJA 4O44B 3RTVA 4DS4A 3IWXA 5EWFA 3PTWA 5HP1A 1N34F 1QAYA 2P5VA 3DN9A 5FDLB 4UOGA 2BJDA 2CG8A 4I67A 1FDDA 2ZITA 1YRTA 3M30A 5KFVA 4ZA1A 3JQMA 4DUZJ 4RNOA 2DIVA 4OZ0A 3FBBA 5BYQA 2U2FA 5B0DA 4FVMA 4JI1J 1HNIA 2DNYA 3NCQA 2XLIA 4WIQA 2HBRB 1D0EA 1SV5A 3OJUA 1WDTA 1ZA2B 3EUNA 2BRKA 4TLRA 4B08A 5CABA 1TK8A 4N56A 3FMWA 3PJXA 2RHSB 4DSEA 3FEZA 3FNNA 4RKUC 1WG1A 3RB6A 1S59A 3BN4A 1SL2A 2HNZB 3ET6B 5E3PA 2YKPA 1V3ZA 3W7BA 4EK2A 1CBKA 1VK8A 1H6KX 1S57A 2R7OA 4OZ3A 4OYOA 2YPYA 2IBKA 3J81j 3T5LA 2HURA 3K5PA 1SJFA 1V6HA 1L3SA 4YR0A 1HWKA 4YOEA 2FUG9 4PWDA 4F67A 2W2OP 1U1KA 3SZ2A 4PQUB 1RK8A 2WOMA 1F5CA 2GIFA 2ZKUA 4OYMA 4Q5VA 4QWCA 3HVRA 2HHQA 3ET6A 3DRPA 3MPVA 1WTBA 1NSQA 4LR8A 4M5DB 3Q24A 3J81Y 2V34A 3G71S 4KGMA 3P8BB 2JNJA 2HVDA 2Z0GA 1EB0A 2EEYA 1FXDA 2DBBA 3AAWB 4L3NA 2W7OA 3VAGA 1N4LA 3B54A 2AGOA 3GILA 2W2NP 1KRPA 1O8BA 4LREA 4YEAA 5IT9U 4IFYB 2DCLA 2DYAA 2F4FA 3O1LA 1Y4ZB 4FF4A 2LCWA 4PZVA 1N8RT 5LMUJ 2DRDA 2V6AA 4A46A 5KTQA 2F9JA 3QRPA 9RUBA 1RZMA 5GMEA 2XM3A 1BHNA 4C8YA 3I0RB 4ITSA 2JDJA 2JH3A 3MR7A 4DUTA 4DPTA 4JI6J 4P2MA 3A3NB 4RW6B 2FHKA 2QO3A 5D78A 5DO2A 1U4BA 1M5KC 1CSJA 3HFKA 1YKWA 3BM7A 2CNOB 2W7AA 4OZ2A 4J7CA 3NNCA 4NMLA 1Q78A 4B02A 1J5OB 4DPOA 2BVZA 2I2YA 2BDPA 2XCPA 3N28A 1S5ZA 4YR3A 4LF5F 2LFVA 1U2FA 2DGWA 3GFYA 1XBWA 3HT0A 3M05A 2DB1A 3CO9A 3ZO7A 4LF9F 3D1HA 3FZ2A 1VBKA 4DFKA 1FKOA 2DNMA 1T9WA 2J9CA 1UETA 3CSKA 2O01C 4FPIA 1HNZJ 1LWFB 3PO5A 1FFSB 2HGNA 2AJ4A 4KYZA 4YN3B 1DTQB 3AFGA 2KKHA 3BR8A 3PNIA 4H4OA 4CT8A 5F8LA 5KG5A 2UXCF 3GSDA 3L9ZA 1UP1A 4Z2XA 1HR0F 4IRCA 3B82A 4ED8A 2R7RA 1KVIA 2CPFA 1HI1A 4DR4J 3FDSA 4GKKJ 1U8WA 2G0CA 3BREA 2V4JB 3GIRA 2MGZA 1R0AB 4TU7A 1T0TV 2VG7B 1TMJA 1QVGR 3KG1A 1R8PA 4X4RA 2WAQD 4KPCA 4F02A 1IKWB 1MWYA 1FT8A 3JSRA 3M8WA 4MKBA 4OZLA 2W24A 3QAUA 2F40A 1P27B 1W26A 1HI0P 3PKMA 2K7KA 3GP9A 1S0VA 1VQLS 2MY7A 3J7A1 2FHMA 2W2MP 3MUTP 7AT1B 4DSJA 5L9XA 2VBZA 2GVDA 5C24B 1BQMB 1GTHA 2X1BA 1F2GA 5JXSA 1SH2A 2VBWA 2VQFF 2ZOFA 4CQ1A 4DR6F 3S01A 2RS8A 2XHWA 3PEHA 3VALA 1EZZB 2GMLA 4RX6A 4OV6A 3QT8A 3R6LB 1PYSB 1CLFA 2CVEA 1H74A 4LRAA 4G1QA 4MH8A 4HACA 5FDLA 5KFZA 3DLEB 4LF5J 3ZTRA 5KFBA 4NLGA 4UY85 4FVCA 4HTJA 1R31A 1KVJA 3QJLA 1RADB 4J9RA 1NJYA 3K89A 1CVJA 1EARA 2RD5C 1JMTA 3V5RA 2E5JA 3KG4A 3MPDA 1RT7A 3MUVP 3QWUA 1B70B 3C19A 2KT5A 2FY8A 3CJQA 3KXDA 1JLQA 4WP3A 4EFAC 1J5OA 3MCMA 5DDOC 3P96A 5DGAA 5ITHA 1NKBA 3K8WA 4RW7A 3TRGA 4J9UE 3D0IE 2ZH4A 5CYQA 3ZNUA 4WFNQ 4NA3A 4BCAA 1RT4A 3ILOA 2QSFA 3M8YA 1S6QA 3AY0A 1IWAA 5K14B 1FF2A 3GJRB 4Y2AA 4ZVSB 4GVLA 3SCJE 5KFPA 2XGPA 4OYIA 1RTZA 1QE1A 2EFNA 3I0RA 5IC6B 3IRWP 3A12A 4DV5J 2W2QP 3C6TA 3MECB 3WC0A 1HMVB 1GEHA 2ZH2A 1ZTWA 1SJQA 3DOMA 1WG5A 1FERA 2ALZA 1TL1A 3IRXA 3OVSA 2R3VA 1C0TA 3A1YG 3M8ZA 2HHHF 4I2QB 2YNIB 4WPAA 1MMLA 3I0SA 1WC0A 4Z7YA 1JLFB 2AEJA 2K3KA 3RB4A 2MZRA 4CCHA 2PEBA 2BRLA 3DKDA 5D0EA 2E9RX 1Q8IA 1PG5B 1NSPA 1N5SA 2XZDB 4ZIWA 2B6AA 3OUYA 3O2IA 3R5DA 3C6UA 4NLRA 4CLYA 3IG1B 3W62A 3C15B 4C97A 1KS2A 4ZLJA 2KFYA 2LQBA 2HS0A 2HHUA 2BANA 4KKOA 2AYEA 2Q43A 4FXDA 1YZ7A 4WTOB 3DXSX 1XNRJ 1S79A 1M0SA 1R8AA 5B0FA 5IM0B 2R8KA 2VONA 2E7XA 2ZVIA 4J37A 4YP3A 2PMHA 4FNIA 2DR7A 1MROB 4E2FB 2QL9B 2XWXA 1C1BB 1RTHB 3SMZA 1ICEB 1VIOA 2JRSA 3ZZYA 4J9KA 3JS9A 3M9NB 1YJUA 4Q8EA 1TTHB 4RW4B 4ED4A 3MR2A 1WHYA 2AIRB 4GO5X 5IT0A 3PR5B 4ECRA 2ERRA 2ZBPA 2L9DA 4JI1F 3I5CA 3IBCB 3BO4A 1H2VZ 1FX4A 3MCNA 1FRIA 2Z56B 4OHVA 1TL7A 1VLYA 3DLKA 3M2RA 1X7VA 3HVAA 4NX9A 1HW8A 2Z2YB 5F8NA 2EC0A 3CIMA 4M5HA 4LFAF 2HKEA 2HNDB 2QGFB 4CNYA 2I6WA 2V9KA 1Z1ZA 1WOSA 4I4BA 5EHHA 3NNAA 3LP1A 2HYIB 3M2UB 4LIRA 2ASYA 1S0OA 4MKVA 4YR2A 1NK4A 2C3YA 3RR7A 3M8QA 1WKJA 2DR8A 2JEIA 2MZSA 3MM9B 4DFMA 1N33J 2RIJA 3DU6A 5F0WA 1I51B 5HMXA 4DBQA 4F0MA 5J1EB 1FJGF 2B43A 2CPEA 4DPWA 3BJYA 2VFVA 1IR2A 1S9EB 1VISA 4U8VA 4DU8A 4V19J 1KOHA 1WUUA 2ZVSA 2FPHX 1WNEA 2UUAJ 3HK2A 3GFXA 3U1LA 1NPRA 2VDHA 2LEAA 1HQUB 3VV2B 2GHWA 3PACA 4IH7A 5BYRA 1NJXA 3EMTA 1W2IA 4OHYA 1RT6A 3WZ0A 1X5OA 3KDOA 4I68A 2V67A 3J80Y 4LR9A 2Y9HA 1TL3B 1SJ1A 3CJ8A 5F8GA 2VV5A 4ZVOB 4CZCA 1DTTA 4CLTA 3LUYA 1YQHA 4TY8B 1S1WB 3LW5C 4CLKA 1UZDA 4DX5A 3PX0A 7FDRA 4WZMA 4YB1P 3QJPA 5KT6A 1T03A 4PR6A 1AT1B 1VOMA 2KRBA 2VPXB 3CJ2A 4FF1A 2Y8WA 1UTAA 2YNHB 4LF6F 2G0JA 2DNHA 2IPOB 4DX6A 2GW8A 4GVBA 4NYPA 1XTZA 4PYDA 3MPWA 4OZJA 3PW5A 1RT2B 3A4TA 4JI2F 2C2DA 2FHJA 3UWTA 2DEJA 4BS2A 1R6VA 1HD0A 4RO0A 4Y34A 2ZWOA 3CGIA 5CD4A 3PX4A 3SFGA 1SCJB 4K0KJ 2F63A 5KFLA 4DR6J 2L08A 5KFMA 1TL3A 1KC8T 1JLCA 3DYAA 4WK1A 4C98A 4WIIA 5IFMA 1UPPA 5JVGQ 4EYIB 4JI4F 2FB0A 3MM8A 5B08A 3G6YA 1DFDA 3IM9A 2R7VA 4ERDA 2G9OA 1WI6A 3DOKB 3G96A 5HN0A 2RUSA 4YDXA 1ZOTA 3OBIA 1NJIT 1FXRA 2D74B 3AD9C 4ECUA 2RUGA 3OD2A 1XNRF 3KLHA 1Y00A 4ZVQB 2CNNB 3EM1A 4KRWA 2B3TB 3EGVA 5F3TA 5LT5A 2COLA 5HROB 2IDEA 3QGPA 1S6PA 3MOZA 2R7UA 4LFBJ 2OI2A 2I38A 2VUGA 2YNFA 3OL9A 4JI7F 4OX7A 1L3UA 1RISA 3HZEA 2WSEC 2RF2A 2XHCA 4DX7A 2JFDA 2A6OA 3K17A 1SL0A 1S6PB 2I5JA 4TQRA 4GKJF 3OFHA 4I6WA 4AQYF 1EJ7L 1V5VA 2X7IA 3C66A 3LH2S 4L3KA 4DV7J 5HROA 2KXFA 2JLGA 1WACA 4I64A 2HSEB 1IBKF 2ZZNA 4B3OB 4QPXA 2KFNA 3QRRA 3E51A 1K0TA 1A9NB 4P75A 2GQCA 3T1HF 4LRBA 1X9MA 4FYXB 4CO3A 3OL8A 4LSLB 1TUGB 1TELA 2EFGA 3QATA 2V8VA 1S7HA 2QE5A 3TOQA 5DGBA 1RI7A 1S6OA 4JYAJ 2ZM6F 2B8QA 3N5FA 1SVDA 2YVSA 1F2HA 1H73A 1RBAA 2DGQA 2DGTA 5EGYA 4C4WA 5H9FK 1Q8KA 4N47A 4EBCA 2B5JA 1VIXA 2XG8A 2LYVA 3RW7A 4O3RA 3TP2A 1XWLA 2WW4A 4NA2A 4KHRA 1L5UA 2OFHX 3JYTB 4DV1J 3MHYA 2VPYB 2YWEA 2HQDA 1S4FA 2K3IA 1YJRA 4KGXB 3N6LA 5GMKa 3ISZA 2QLXA 3W63A 2XQCA 4CO0A 2QV6A 3L4BC 4OI1A 1RU2A 1VMBA 1Q82T 1S1WA 1TKZA 1N5YB 2UVVA 4IR9A 2HPUA 2R7XA 3CT9A 4Y2MA 3TAMB 1X8DA 4DR7F 2XYGB 3KLVA 1RGVA 4YFUA 2B8PA 3VTIA 4XPEA 2K1RB 3H42A 3MCSA 4DV0F 3B4MA 2MQQA 3DRRA 3MMBA 3WX4A 2V0NA 3BKTA 3MZIA 2ACMA 4DQPA 1FVSA 1WD6A 2V2QA 1HQUA 4L75A 2E1RA 2BJ9A 1U47A 4ALZA 4B9MA 1PSDA 4LJMA 5CHCB 3MAQA 1PKUA 2XNRA 3R7NB 1CJUA 5K8OA 2VQEJ 5E7OB 1L3KA 2IRYA 2O66A 2ZJRQ 3IWNC 5J1EA 2EKYA 5KG1A 2ZC4A 4WKYA 2VBYA 1S6QB 3FK4A 4ENOA 3LP1B 1RT3B 2OELA 4G1PA 2VODA 3PZPA 1LNQA 3EZUA 2IVMA 4Y6IA 5B7WA 2ILYA 4DV0J 4W90B 2IHR1 4ETXA 1ZM9A 1NNDA 4QU7A 2XY7A 1YZ6A 4QOTA 3CVKA 3M4XA 3UVJB 4B9VA 1TAUA 2NXCA 1H7WA 4EYHB 2XSJB 5I3QA 3GE9A 1H0HB 5KFUA 1MLAA 3BR9A 5A0YB 1LV5A 1IQTA 2M3DA 1RXOB 1B64A 5HMWA 3KJNB 3M32B 1SKWA 1ZM2A 4NLUA 3BS9A 3FFIB 2CDRB 1ULRA 4OIXA 1SQFA 3AOAA 4RUBA 3TVYA 3ZTOA 4C0HA 2N3OA 3KLFA 5C25A 2R7SA 1ZS6A 4I2PB 4OJ1A 3ZC4A 5KT4A 3H40A 4A8SA 1U02A 5IT9Y 3PW0A 4OX8A 2W8LA 2WSCC 4RW4A 2ZUGA 4OJGA 5CA5A 3OHBA 4DUZF 3IGNA 3NP5A 2I9SA 3GYXB 3SBMA 3Q0AA 4HT5A 2ALYB 2XNQA 4YY3J 5EDWA 3H2LA 1LW0B 3TVKA 1RWOB 5FJ4A 5IT4A 2P6TA 3PYGA 2CPXA 2MQLA 4JI3F 2MMYA 1IM4A 2HQ3A 2VFRA 2QIFA 3HLUA 3ICLA 3GG0A 4HTIA 3UNYA 3RBDA 1N52B 2EPIA 3ITHA 3RAQA 4X4UA 5AE1A 1E6VB 4URSA 5BXIA 5I42B 3Q83A 4TYAA 2CPDA 4ZLPA 1GQEA 4TU9A 2MZTA 3OXGA 4FP9A 4KSEB 1K1QA 2E1AA 3C6UB 4WYWA 2HFSA 5ADZA 1S0NA 4JOUA 3P6YC 1UVJA 2AF6A 1RWPB 4QW9A 2HLUA 4DR7J 3IP0A 1U0HA 4PG6A 5HL7Q 3OQ2A 1RHJB 3KMSA 4TY9A 3C6TB 2JVOA 1U2CA 4HLBA 4DV1F 3MEDA 1TAQA 2J0QD 1L3VA 4EBEA 2MKYA 1A0OB 2L48A 1VQMS 4PXBA 2HBZB 2VZ9A 4WFXA 3R5AA 1XMBA 2DXDA 4YQWA 1UFKA 2PFDA 3H20A 2GMJA 4ZLLA 3TZXA 4CLZA 1Q7YT 1KQFB 1KHVA 2ZE2B 3R6GB 3E3XA 4DL3A 2BABA 3NCRA 4J9SA 2BA9A 2XY6A 3OFFA 4DV4F 1GMWA 1HQEB 1Q79A 2VBXA 2A18A 1B0TA 2BKPA 3MUMP 2E7VA 3MR3A 1NDCA 1V5IB 2MLYA 2R42A 2Z2ZA 3BH7B 1U1NA 4B17A 4DL2A 1SPBP 3RBZA 2Z8QA 5CZVA 4OHZA 5ETPA 1LWEB 3KLIB 3J7YI 5CXTA 1CJKA 3V6DA 3MTJA 4ID5A 1BWVA 1B7YB 2N7YA 2GVZA 3CMQA 3IR6B 3H90A 4A8XA 3J80U 2XI2A 5DG7A 2MPUA 4KQZA 1X0PA 4DV7F 2M8DB 2CJXB 2JEJA 3R1HA 1Y10A 2B4OA 3GV7B 2AJ1A 1BQNA 4FNHA 4QZVB 5THWA 3CO0P 1D9DA 4AXIA 1FTCA 2LKZA 1RT1A 5KFOA 1C4CA 1HBUA 1QM9A 3QYYA 1BUXA 4ES3A 3CCVS 5F8JA 1B0VA 2N82B 1VQ7S 3QZ7A 1TK5A 3T9ZA 2MKKA 1S76D 1XNQF 3DGPA 5I42A 4Y2IA 1HNVA 2J9EA 5KFNA 3LTOA 3FCHA 3KKFA 4R0EA 3RB3A 5ETVA 1IKWA 1X5SA 3FVYA 4K5SA 4CT9A 2MKJA 4QW8A 3UN2A 1C2PA 1WHVA 2M8HA 3V4IB 5JJBA 4NLOA 4IFVB 3VF0B 2X51A 4P6QA 1X60A 1HPZB 1HNZF 2V4JA 3K5OA 3L7PA 1QD1A 3OJSA 1JXLA 4H4OB 3JTOA 3QZ8A 2W1BA 2JZ5A 2NYHA 3FZBA 2DO0A 2IMOA 4XO0A 4WTYA 2CWXA 3HXMA 4LFAJ 3CDWA 3PR4A 1HYSB 3P5BP 4AL5A 1IJFB 2DH9A 2LEPA 1IKYB 4DN0A 3CD5A 4RNNA 1LWEA 1F1BB 3KLIA 1JNRB 2AYBA 4DR2F 1X4CA 4UW2A 1EHWA 2QLJB 1RBLA 2M4MA 1MU2B 3UR3C 4BLGA 5C42A 5DDPC 2V9WA 2DNNA 1DQ8A 4PEOA 5KFDA 1ZM4A 2FVQA 2HHTA 4U7UK 1U1OA 1XR5A 4K4UA 3IA0A 1S1VA 4USVA 4RBTA 2CPIA 2PMWA 2N4DA 1RE1B 2PO4A 2WCXA 4JI0J 1TFYA 3X1LB 2Q6CA 3HVWA 4EGLA 1YRUA 4C48A 3JB9k 4URGA 2H4YB 3I82A 1Y5IB 4LT6A 5KG4A 5K5MA 2QFIA 3C2PA 4QWEA 2WVEA 1KOOA 4PQAA 2IAJA 5ETQA 3MEDB 3BZQA 3PX6A 3KDNA 2P8IA 2FVCA 4ES1A 3K7RA 5AXKA 4I6AA 2VFTA 2Z2LA 4V1Ak 3MMBB 1PBAA 2FJDB 3Q8QB 4ZIVA 2KHCA 2G2OA 3MEEA 4RWXA 1X4DA 2XCAA 3OR2A 1UVLA 2DJWA 3AJ1A 4R5PB 2RSQA 3FSIA 2CZ4A 3GYGA 3M6VA 4DL6A 4JI5F 2FGCA 3LAKA 3SEOA 3CDAA 1WC6A 5D3GA 3NBPB 3QGIA 4IOBA 5HJXA 2KXNB 2UUBF 3R27A 5CYMB 2Q1LA 3RB0A 4A8KA 1VHIA 2AJ2A 3VQTA 4IRKA 1LK7A 1QTNB 1VCTA 3T19A 4IOCQ 2B7BB 3CJKB 4E8UA 5KFQA 1F3VA 2IC3B 1I3OB 3VR1A 2OPRB 3L7UA 4QBUA 4P73A 4ECXA 4R8UB 3IMQJ 5JUMA 2RU9A 3CCSS 1CULB 4MMOA 4PAAA 4ZVEA 2QC3A 1YBTA 3CCRS 2XSFA 2PE8A 4F04B 4KFBB 3MEGB 2HAIA 3IS9B 1RAHB 4ED1A 2C3OA 4E98A 1EETB 3NGKA 3AA9A 4NL5A 1FRKA 2OKQA 3QT5A 3I55S 3UO0A 2ZUAA 4USJC 1RLCL 4MK7A 5IXUA 1WC5A 2ZEJA 5D77A 3LQVA 2DPJA 2RQMA 3UDLA 2XSJA 2HS3A 3GJTB 2DISA 4LSZB 3HSJA 1VQPS 3D0GE 3DLHA 3EVWA 1YVFA 1KBRA 3HI9A 1D9FA 2HBQB 2ROGA 2CQ2A 2L41A 3M30B 2HGLA 3P45B 2HVIA 1P1TA 2KRRA 3T1HJ 5ETKA 2RF2B 1CPZA 3BSAA 2LVWA 3AT1B 4J9VA 3I4PA 3DMJA 1GMVA 1NH8A 3UD5A 4OYAA 2K7JA 4JUZA 5DLFA 2XZTB 4K4ZA 4X64F 1QTMA 5F8HA 5I3PA 4UF4A 2BMBA 1KNZA 2VB6A 2H54B 5AJ3F 2NYIA 4BC7A 4HHUA 2W9BA 1RTIB 1S99A 5B0EA 1JQGA 1FE4A 4I69A 4KH0B 2QMUB 4USWA 2SXLA 2MQOA 1WSVA 1S1XB 3QGGA 3G6VA 2MJUA 1ZZNA 3QIPA 3TVZA 3AXMA 2E1PA 4OFZA 3D9BA 1UCNA 3R7BB 4O3OA 2HNYA 2NSCA 3KNGA 3MMJA 2ZJQQ 2YQ3A 2YX7A 2BE7D 3GIKA 1CS4A 2V94A 2YX4A 1RB0A 2AHOB 3H5UA 4LF7J 2B9WA 2DNPA 1DURA 3CJ3A 1SQGA 5D4LA 4ED2A 2DNRA 1SL1A 2E44A 4B3RF 2HQCA 2AU0A 1CS4B 2BE9B 2CQIA 1PGZA 2CNLB 1TR0A 2VG6B 3FEYB 2IVFB 5KFGA 4CIOA 3HSZA 3RR8A 4TY8A 2Y0BB 1WEYA 1IBCB 1V3SA 5KOXA 1YITS 1NCLA 3HFVA 3PG9A 4P72A 3PY8A 4YDDB 2QLBB 3E2EA 4CRJA 5J2QB 3TUPA 4JBCA 4RNFA 2BV3A 1IBLF 1ITPA 2ZFHA 3GV8B 2V69A 2A10A 1VJQA 1M5VC 3RRGA 1FD8A 3GCWP 1EAYC 1RBOB 3AQOA 4UOHA 4X4VA 3AOCA 3TJ9A 3K0JA 1LWCA 1WF2A 3DRXA 3K2YA 3UQSA 4ECTA 3KOAA 1JNZB 1VJWA 5LM7E 1SC3B 4DR5J 3KMQA 3KK2A 5D8HB 4K4XA 4XDDA 3NEKA 3PFEA 1RUSA 2ZOMA 4J9MA 3GFHA 3GG1A 4A4JA 1JLBA 2BM1A 3Q8UA 4G6VB 3D7SB 3G8SA 2RU3A 1WOPA 3KHLA 2FVPA 4X4NA 4AD6A 4XIUA 1UEKA 3LANA 3F73A 1IKXB 1OYEA 2HHXA 5HQLA 4CTAB 3V4MA 4F4AA 2QTWA 3MD1A 4LFCJ 4WZQA 2HNDA 4QIGA 2Y1JA 1FJGJ 1SXLA 2HFZA 2DT9A 2LU2A 2PD1A 3QJJA 1PAUB 2HIYA 4OYZA 1TVRA 3SYZA 2MZJA 1UFLA 5EUHA 4OMFG 2XO6A 2DHSA 5LXYA 1JWWA 5GAGI 1NK8A 5DZ7A 5A8KA 4WK3A 1H38A 3G6XA 3KUEA 1M5HA 2HLTA 4DV6J 5DZ6A 4M5MA 2B4VA 1DQAA 4OHWA 5KFTA 3VGVA 2GIRA 2YQ0A 4DCJB 4F3MA 2H65B 2KJWA 4R0JA 4DLGA 1QUVA 1YJ7A 1F9EB 2HBYB 2X3GA 2OPSA 3FCVA 3MAAB 5DQHA 5KT3A 4DL5A 1YJNS 4B9TA 2IBOA 3GR0A 3L3CA 1VQ6S 1U1LA 2WZ1A 1Z2ZA
chains in the Genus database with same CATH topology
2YKNA 3OSNA 1HHSA 2LQ9A 2EK6A 2M70A 1LK5A 4NA1A 5M2UA 4NWBA 3IC1A 1UEVA 4Y2CA 2R9LA 4ZPAA 2WSFC 3LP0A 4DQIA 5AXNA 3KJVB 1SUQB 3BO3A 1UFWA 3K5LA 1YRXA 4L6V3 5D3GB 2OSRA 4MFBA 4RWWA 2KI2A 1N36F 1JX4A 1FRXA 1RWUA 1JJ4A 2R4FA 4OI0A 4Q8FA 5A2QY 1TZ0A 3SCIE 3HHNB 2CQDA 3ZZ0A 2LXUA 3Q2SC 1X4HA 3CD7A 5J1PA 1HNWF 4TN2A 2EG1A 2QSWA 2W9CB 5J2PA 3UCZP 2R8IA 2RQKA 4OI3A 1HFEL 5KFAA 5FLXY 2BJEA 2W25A 4Q2MA 4QYRA 5EWEA 1JK9B 2POKA 3N79A 4ETZA 3DC2A 5KG2A 1TKDA 2KT2A 3M2UA 1QAJA 4ZPWR 1S1XA 1Q7LB 2UUTA 4H4KC 4Q2LA 1FEHA 4RW8A 1AW0A 3MM6B 3H25A 3T3FA 1D8ZA 4IYQA 1QLNA 1CC8A 2WHOA 3CJ0A 1VRUB 4QWAA 2E66A 1RT7B 4UQTA 4B9LA 4JI8F 1UA1A 2G13A 1U25A 4HEA9 3P49B 2VH7A 3HKWA 3MGJA 1QSSA 1JLEA 3BEGB 1BLUA 1FJ7A 2V8HA 2BQ3A 2B9YA 4O0IA 2OTJS 3HDSA 2M9KA 1ZETA 1RKIA 1G2EA 4RW9A 4D3GA 2VKZG 1N0UA 2ZD1B 5L1JA 1SB6A 3FGVA 4AUKA 4CNZA 2DRBA 2R2SA 4JI0F 1Q16B 2D9PA 2EK1A 1FTRA 3M2VB 3GR1A 5GAEI 2JC1A 4N8NA 3DLGB 5F3ZA 1LWCB 2YTCA 5C24A 1ZPWX 1C0UB 2DGOA 4IH6A 4PWUA 4TNOA 4CO1A 1BQMA 1VFJA 3M8PB 2D1CA 4GMKA 2R2TA 1GXTA 1WG4A 2CQ4A 4KPYA 2RKIA 2P6SA 3T5JA 3OUYB 2VG6A 4R8UA 2GFFA 3PDNA 1TV6B 4KO0A 4IG3A 4NOHA 2XMWA 1JJ2R 4WFYA 3V6HA 3KLGB 5CH7B 3OTDA 2OPPA 3MM5A 1WEXA 4MAKA 3DLJA 2KH9A 1N32F 4QYZJ 2FVRA 4NLTA 3FJ2A 1TKXB 2F9DA 4R25A 4OJ3A 4C0OC 3OL9A 2RILA 5I3UA 4PPZA 4X4NA 2LXIA 3GZ7A 4Y2KA 2KZZA 3KHRA 1NH7A 2OSQA 5B09A 5K14A 1XMQF 4CO2A 2W4PA 4ICLB 3SCLE 1JKHA 4ZVGA 3LWLA 4QQBA 2OJ3A 5KFEA 2F8EX 1DLOB 4YB7A 4DG1A 3THPA 2IA6A 2YKOA 1ZTTA 3F44A 4KR0B 1D9AA 1KQKA 5E2QA 1V3RA 2KG0A 3ETOA 2JOQA 2E1MC 4DSIA 4PXDA 2PEHA 1T8EA 1QUPA 1QAXA 1TP7A 3HVTA 3D54A 2UVRA 2IYGA 1SC6A 2RS2A 3CJ4A 2C3PA 2VD3A 1U7LA 3M6UA 4XPCA 2KTQA 4B9UA 2CRLA 4TYBA 4DG1B 1MU2A 1OSDA 1XK8A 5C42B 3MR5A 4F4KA 2M2BA 4IG0A 2J76E 3I96A 1VQKS 1KLMA 1VRTB 5KG0A 4RZRA 4TKTA 1YJTA 4ZVHA 5MAOA 1S9GB 1Y3KA 3KYLA 3EPGA 2A3JA 2R2UA 4OX6A 4USIA 2VPWB 2OD4A 4L72B 3LWMA 3JTNA 5H9EJ 5MLCV 4PQUA 2WBMA 4DV3F 4ILLA 2FDNA 2A1BA 2CQ3A 5EWGA 4K4YA 1NEEA 3EZ5A 1XC9A 1GXLA 3D0HE 2BQRA 1R0AA 1BC6A 4N77A 4LUBA 1P6TA 3MMCA 4MKAA 3BGFA 3OFGA 4Q7AA 4G3IA 1FDNA 2NXUA 1SKRA 4ZHRB 5J2NA 3LP2A 3H5SA 1DRZA 3SSRA 1VC5A 4NLWA 4UY8T 2AWZA 4IDKA 4AL6A 4DWIA 1F5BA 3E01A 5C5JA 2WRMA 4NCBA 3PW7A 4IG0B 1SV5B 4ECYA 2DNGA 3L7OA 2IJNA 4IH5A 2GQ2A 4HI2A 1HBUB 4AE5A 2AJ0A 4Z37A 3H2UB 1UA0A 5GAGU 1FK9A 1R8HA 1UJ4A 2RJZA 2PDAA 3DLGA 3CTRA 3UFCX 4EBDA 3D1OA 1RKJA 4IR1A 5KG3A 4A8MP 4YY3F 2ZHOA 3K58A 2RVJA 1EP4B 2YH1A 4O44A 1UVMA 3SI8A 3Q22A 2RNEA 2FGOA 3PRBA 2DNOA 3KK1B 4FS1A 2L9WA 3ZZRA 1GT8A 4O4RA 3RZAA 2XMJA 3SQGA 1VHFA 2BE2B 2FLPA 4PXCA 3Q8PB 3AJ2A 1NO8A 3RAMA 3OSPA 1FK9B 1RP5A 3BDEA 4OHXA 2XEXA 1JKHB 4K4WA 3NS5A 2C42A 4WFBQ 2NUUG 5BYSA 3N5BA 1CC7A 5CQGA 3P3DA 4O3QA 5E0OA 2KM8B 3BGRA 5LJ3Y 2R2RA 2AX0A 2G4BA 1ZAVA 2ZDPA 3BDPA 1VQSA 4KT0C 3CXCR 1GH8A 1UVIA 1TKXA 3AQPA 4OI2A 2QT7A 1REVB 4ZCLA 5FIIA 3BO2A 2HMIB 2U1AA 1TV6A 2HHHF 1XERA 1BY9A 2GO8A 2KN4A 3TARA 3IAS9 5GAEU 3KLGA 4N5SA 2BOPA 2YH0A 4J9LA 2CIMA 3UW1A 3NS6A 1E6YA 5DLGA 3ZZOA 2ACYA 2DGUA 2AJFE 2RKIB 1VQ9S 3O8WA 2LEBA 1S9GA 4RNHA 1YI2S 3HHLB 3FQLA 5H1SV 3ITHB 4DX8H 1S1UB 1NZAA 4XAKA 5AXLA 5GVQA 4Q0BB 4FBUA 1DQ9A 2UZAA 3ISNC 3LGNA 3W2VA 3M8SA 2O1PA 4X65F 5K8NA 1FNOA 1MWZA 3N6NA 2AD9A 4DSLA 2E9TA 2NSBA 1LQ9A 2XC9A 4B3OA 1U49A 3DDKA 2DGVA 4PG8A 2KFZA 1A7GE 3CCJS 2PI5A 3S6EA 3VAIA 4HI1A 2V2KA 5HLFB 5LSLA 3OHAA 3UCGA 2WTFA 4JV5F 1CQMA 1P9QC 4LFBF 1UW4A 3IAM9 1C4AA 4DR1F 1SH0A 2R7TA 4BHQA 4LSNA 3TA0A 3EGZA 4RW8B 2EWHA 4OI6A 4PUOA 5HO4A 2DRAA 1RT3A 3R5CA 3QPIA 2KHDA 4NLVA 1HBOB 3MURP 1KQSR 4ELTA 2FLNA 2V8DA 3QGHA 2RMLA 3KTQA 3BQ0A 1URRA 3TAQA 3UNGC 2WONA 2QA2A 2WW8A 5I3UB 4X4OA 3H8YA 2ASLA 3UD4P 2X1GA 1FD2A 3FQKA 5J2PB 2W9CA 4F26A 2D7SA 5DS7A 4K0KF 4LVNP 4M63A 4F2SA 1S1TA 1G7CB 1S0MA 1R6YA 2J9DA 4ZK7M 3L95X 3LGMA 4TLQA 3PW2A 2MXYA 4WCEQ 2J7WA 5CZXA 3LALA 2J6SA 2AW0A 4C8ZA 5DJBA 4ZCMA 1OS5A 3FMBA 4KAIA 2ADCA 3W2WB 1B0PA 2F3JA 4OQJA 2OMOA 3OW2R 2ABYA 1S6UA 3JSMA 1VS3A 1RTJB 3DI6A 3FRZA 2F1FA 3DHXA 1S72S 2JL9A 4FN5A 4LF7F 4OL8A 1HWIA 1X4GA 1V9OA 4EU0A 3QO9B 4TQSA 1O0PA 2ZH9A 5E33A 4F4ZA 4JV2A 3L09A 2WONB 1SBRA 4QR0A 1NK5A 2J6UA 4DFJA 4OZNA 1LXNA 4PRFA 2UUAF 3N4WA 4NZ7A 5C25B 1NK0A 1BQXA 2PT0A 3I5BA 5A6WA 1FKPA 2HRUA 5A0YA 5B0BA 1RTIA 1U26A 2VG5B 3NAHA 2J7UA 1VRUA 5KFXA 4QJVA 3B78A 3HF5A 1UWBA 4KIAA 3K5MA 1MSWD 2NS1B 3EX7B 3O6QA 1WELA 1N5QA 2CPJA 3B4DA 1JLBB 2UV8A 1R8BA 4NLXA 3OFEA 4NPOA 2P9EA 4DL4A 1DZ5A 3OTBA 4A8OA 3CMES 4RUCA 2L9NA 3QO9A 2R7QA 4WE1A 3HX9A 1VBYA 1NKCA 4ZP9A 3MD3A 1KSPA 2EFPA 3DI6B 2CQ0A 3G8TA 3HHLA 3DRRB 1H98A 3HHLC 1IJEB 3OLAA 2XS7A 2OPQA 3NAIA 3EYZA 4N41A 4I1TA 3NGDA 1VQ8S 2GJ2A 4C3KA 5CD4H 4NZ0A 1I94F 4J9NA 1NHVA 2B6AB 3T5HA 1JXEA 2LA4A