2F63A

Solution structure of hppk in complex with inhibitor analogs ampcpp and hp-1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Solution structure of HPPK in complex with inhibitor analogs AMPCPP and HP-1
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 21
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2005-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 2f63A00
1RU2A 5ETQA 3UD5A 1RAOA 2CG8A 3QBCA 4CYUA 4M5MA 5ETTA 4AD6A 3HD1A 5ETSA 1Q0NA 3HD2A 4M5LA 3HCXA 1F9HA 1IM6A 3HSGA 5ETKA 1TMMA 1RTZA 3KUHA 4M5KA 3HSJA 4M5JA 4CWBA 5ETNA 4CYUB 1RU1A 3IP0A 1KBRA 3HSZA 2F65A 2BMBA 3ILOA 2QX0A 4M5NA 3UDEA 1EX8A 1HKAA 5ETOA 3ILLA 5ETVA 1EQMA 4PZVA 1TMJA 3KUEA 4M5GA 4F7VA 1CBKA 5ETLA 5ETMA 3UDVA 1RB0A 1G4CA 3HT0A 1HQ2A 3HSDA 3KUGA 3MCOA 4M5IA 5ETRA 3ILIA 2F63A 3ILJA 4CRJA 1EQ0A 4M5HA 1DY3A 3MCMA 3MCNA 5ETPA
chains in the Genus database with same CATH superfamily
2QLXA 5KFQA 3WX8A 4GKKJ 3KK3B 1HBUB 2Z2LA 3M2RB 4I67A 1L3KA 1SPBP 4CTAA 2VBYA 4X62F 3M2UB 4ZP6A 1U2RA 4ES3A 1S0OA 1FO1A 2APOA 4ZCLA 2CQBA 3DRRA 3MCNA 1S9EB 1AB8A 2UV8G 3N79A 4ILMA 3T9ZA 3CT9A 4KAIA 1L3TA 2IM3A 1D9FA 2DGUA 2KG0A 2CPHA 5KG4A 2G0JA 1TKTB 2EKYA 3CCRS 4A8XA 3G8TA 2ACMA 1U0SA 2VPWB 3KUHA 4DSFA 3MECB 4A4JA 4EYHB 3PX4A 3Q8SB 2FVRA 3NS7B 1UPMB 5T41A 2J8AA 4DPTA 3U7JA 1XNQF 2LA6A 3CJ2A 3EUNA 1TL1A 1NH8A 2EK6A 4ANDA 1LQ9A 1HD0A 1MNEA 4RWWA 3X3UA 4G1QB 1EQ0A 2GJFA 1E6YA 1VBXA 3MTJA 2I2YA 4DUZJ 3VGUA 3ONQA 2BRLA 4I2QA 4A8QA 3IMQJ 4PWDA 2QMWA 1JLGB 1I51B 2VD3A 1VJQA 2GIRA 1YHQS 3TZYA 2FB0A 1HNWJ 1Q7YT 2QMXA 1YDLA 1SUQA 2ZJRQ 3W2WB 4B3OB 3RG6A 3V4MA 1HR0F 5DG7A 4YR0A 1BE4A 1HWIA 1U7LA 1L3SA 4CLLA 2IA0A 2RUSA 3KDNA 3OUYB 3G9CA 2BXJA 4TU8A 3M6UA 1PCAA 1BQMA 4HR2A 3I32A 5LJ5Y 3M6VA 4PCQA 4NRTA 2RHQB 5F3ZA 1AZSA 4JV5J 1FTCA 3SV4A 5I3PA 4NI2A 4F4YA 5A8KB 1UVIA 1Q4RA 4Y3CA 1JKHA 4J9SA 4M95A 2SXLA 1C1CB 4FF4A 3CJ0A 4ECZA 4F26A 1CLFA 3CJ5A 4F02A 2QX0A 3C8YA 2C2EA 1SCJB 4MKYA 3HHLB 1VRQC 3W63A 1WG5A 3GIIA 4DV7F 4BLGA 3HSDA 2W2MP 4N7TA 1KHWA 4OZ2A 2OH2A 4CYUB 3NBPB 4MK7A 1ZPWX 2FLNA 1RAEB 2GQQA 4I6AA 5LT5A 1YBTA 3MAAB 4P74A 2XNQA 1WDDA 3QO9A 2DNPA 2VIHA 3M30A 1RAHB 1U8SA 2KM8C 2IY5B 2ADCA 4BS2A 2ZH4A 3KXDA 2OEKA 2MTLA 2A6MA 1VQYA 3FBFA 4Q2LA 5IV4A 1M1HA 2GHPA 2LXFA 4KO0B 2YKPA 1TVRA 4LJMA 3PHTA 1FJGJ 1HHSA 4I56A 3W60A 2LXIA 5ETPA 1NPKA 4FZVA 4QWAA 5F9LA 2IJFA 2UU9F 4CO3A 3I0SA 4LRDA 1VR6A 1R8HA 4DCPB 3T5HA 2BW2A 2I6WA 2HHHF 2BANB 4ES2A 4FP9A 4OX9J 2DHSA 4Y2MA 1HNIA 2KJVA 3V4IB 4K2XA 3L95X 2VICA 3LAMA 5IC6B 2EC0A 2HNZB 1SQGA 4KFBA 4ZJLA 5KFCA 4O4RA 4PXCA 2FVCA 1M90T 2HVZA 4NCGB 2UVUA 1RWPB 3DOMB 3JTOA 1FWKA 2VV5A 3IWLA 4ZVPB 3Q2TC 1WKLA 1YX2A 3BO2A 4H4OB 1HI1A 1SC1B 1JLEB 3LOUA 4UY85 2ZBRA 1KHVA 1L3VA 1WNEA 1HIYA 3ZFVA 2WBMA 5KFYA 2YNHB 1P9QC 1B64A 2CQ1A 4TY8B 4PUOA 2VZ9A 2FGOA 1WOOA 2UZAA 3HCXA 3TVZA 1B0VA 4M5JA 3NGUA 5HMXA 3OLAA 5KOWA 3QAEA 1U26A 1NRKA 1UTAA 4K0KF 3QT7A 3DOLB 1Q79A 3MURP 1VQMS 3IO1A 3DOKB 2IRUA 4NLXA 3O8WA 3GFXA 1XR6A 2QL7B 2QA4G 2HW3A 1V5VA 3I5CA 3U1MA 2MZ1A 2B7CB 3KK1A 4J9QA 4ED4A 2AJ4A 4DV1J 5AT1B 3FSYA 4DR5F 1HHQA 1HD1A 2R7XA 3KLHA 1V6HA 2LQBA 4X62J 4C8LA 4KKOA 2D3UA 5FDLA 3V6HA 5CD4H 4Y2KA 2H9ZA 2BV3A 3HHNB 1JX4A 5HMYA 5DM7Q 4WFZA 4HH1A 5ETQA 1XJWB 2DH9A 2XWYA 1RT7A 5CQGA 4OYMA 1OYEA 1FD8A 3GPAA 1YJNS 4RW9B 2UUTA 3MCOA 5EUHA 3DU5A 3KK3A 3CJQA 3QWUA 2EEYA 3CDAA 4EUVA 1HBUA 4PYDA 3M2RA 3LP2B 4NLTA 2VASA 4WCEQ 2I5JB 5KT2A 3M2UA 1S6PB 3MMCB 1EARA 3UI3A 3A1YG 1NJZA 1S9EA 2X1BA 1FRJA 3GILA 2D1CA 5U47A 1OJ4A 2KKHA 2M5YA 7AT1B 1TKTA 1M5HA 1JLCB 3A8KA 4M5HA 4YP3A 4O3PA 4AD6A 3MECA 1IJEB 1UCNA 1K44A 3VAIA 2D9OA 4JI8F 3RBEA 1CBKA 2BUNA 1BQNB 3N5BA 4XDCA 4KV8B 4ED0A 3PW2A 3H5SA 2YX1A 4C2MA 1FNMA 4CLTA 2BM1A 4G1QA 1AT1B 3MDFA 3J81Y 1K8AT 5D4PA 2C2OB 1UVKA 1S59A 2G0CA 3DXBA 4L72B 4F0HA 1PIEA 3RBZA 1F9FA 1JLGA 1FJ7A 1A9NB 1UKUA 1IR1A 3MF5A 2VKRA 3W2WA 4B3OA 2YWEA 3HK2A 1N5SA 1FD2A 1W25A 1WG1A 2M2BA 3OUYA 3V81B 3FMWA 3CCMS 4KC5A 3AB4B 4TVAB 4DV7J 3BS9A 5EWFA 1NM2A 2AJQA 5CHCB 2CWKA 1SJ3P 2C3OA 1BC6A 3C46A 4N77A 2B4UA 4F4XA 1X5SA 3GV5B 2Z2ZA 5A8KA 3ICLA 3ZTPA 1KWMA 3BH7B 1CQMA 2AZ3A 1LW0B 1C1CA 2BKOA 4KQZA 1ZM4A 3HHLA 4X4TA 2AV5A 1MWYA 1VFJA 2NQPA 2J0SD 2HIQA 1U09A 4CRJA 4MIWA 2JJ4D 2QRRA 4MIAA 4CYUA 2G13A 1X4EA 1DTTB 5DQIA 3K8WA 1FX2A 4G65A 5F8HA 2ZUAA 1WG4A 3MAAA 3I5BA 5LJ3Y 5CYQB 3DRPB 1GX5A 3NNHA 3CJTA 3VGVA 4KIAA 2RF2B 2LP4A 4LF6F 1IKXB 2EBGA 5FD1A 1BY9A 2B0GA 2CQ4A 2ZFHA 3MPDA 4E8UA 4GVBB 4KO0A 3K89A 2B8QA 1FXLA 4DX5A 3CJSA 2CQCA 3VAKA 2XYGB 3QT6A 3J81U 3D6FB 1NO8A 5HK4A 1ZZNA 2KRRA 4ED8A 1UFWA 3FK4A 3CJ8A 4LMZA 4ANEA 4FF2A 3D1HA 3D5MA 2BANA 4HT7A 2J0QD 4N47A 4NLOA 3LWMA 3PYGA 4HT5A 2VPYB 5L9NA 3HULA 2DIVA 1FWLA 2RT3A 3V4IA 4J9MA 3PIOQ 2E1AA 2DNNA 4M5MA 2HNZA 2RUGA 4IFVB 3CIZA 3J80Y 3OTOF 4P72A 4YB5A 4K0KJ 1S77D 3MTKA 3T1HF 1QTMA 4NCGA 3DOMA 2Y8WA 1CJTB 1CG2A 3JS9A 4H4OA 2J7UA 2Y0SD 3BB5A 5K20B 2V2ZA 4P2XA 1JLEA 4Y2AA 4J9KA 4QPTA 2W2PP 4YS2A 3TUPA 2XMAA 2YNHA 3H8YA 3MUMP 4TY8A 4LF8F 3CB4A 2Q66A 1WELA 1FRHA 1XC9A 2I0XA 3NGKA 3ZO7A 4HI1A 5F41A 3DOLA 4URGA 5MLCV 3DOKA 3THVA 5KFFA 2M4MA 1RYRA 5D0RA 4FYYB 4ZP7A 3VZIA 3KTQA 1UETA 2YH0A 1XNRJ 2HEKA 4AL7A 3V5RA 1WD6A 1T9UA 4RW8B 4KH1B 1HQEB 5LMNJ 5M2PA 1DRZA 1SL0A 2HWIA 3LPEA 4F0MA 5GADI 1G2EA 4ETXA 2RRNA 4PEOA 2W9BB 1F2GA 2Q79A 2OPRB 2ZHBA 2HQ3A 5K8OA 1VI7A 4RPFA 3DLBA 1K1QA 2MZRA 4K59A 3K2YA 1XK8A 4ZLLA 1U6ZA 4RW9A 4UTGA 2CJQA 3BPDA 1FKAF 2B7BB 4XO0A 4WKYA 4F04B 5IV3A 3LP2A 2E1CA 2I5JA 3M9OB 1S6PA 2I8EA 3MMCA 2E1MC 4ID8A 5FLXY 4JI8J 4LF2A 2HQGA 1KQKA 4CCHA 3MI7X 4UW2A 2QYGA 4QIWD 2VONA 2DHGA 1BMQB 2MKHA 3P45B 2E5HA 4DV2F 1TU0B 3GU0A 4J9NA 1Q53A 3TQ1A 2F9DA 2KYXA 2P6TA 1JLCA 1WEYA 3R9LA 1NH7A 3PXGa 3TAPA 8ATCB 4YN3B 3MM9B 4RUBA 4DS5A 2FY8A 5BYQA 2FZCB 2XHCA 1MU2B 3MR3A 4FYDA 1BQNA 3B6BA 4KV8A 1BUXA 1RKIA 1TP7A 1T9VA 2Q6CA 4F0KA 2A10A 3OFEA 2UXDF 3NWRA 5DETA 2ZH1A 3PNIA 4DCOB 4LRFA 1MLAA 2CADA 4ZP8A 1RHUB 3TEHB 3C2PA 1FXDA 4JV2A 1B7YB 4MKAA 5ETOA 1H2UX 4DUTA 4WZQA 4LF4J 1HHTP 4CNYA 1Q86T 2BQUA 1DQ8A 2ZNZA 6FD1A 2HHWA 3PJWA 1QY7A 2HS0A 3PRVA 3FEXB 2QZ8A 4F8RA 1X4GA 4ZKAA 3V81A 2ZHOA 2RIJA 1Y3KA 4H4KC 3V6JA 4DWIA 1NLKL 1Q81T 2CVEA 3BGFA 5L1IA 3WIUA 1TK5A 4R8UB 3RU0A 1K0TA 4FS2A 4OL8A 2HFZA 4FYXB 2F5GA 5KFKA 3NWGA 3RB3A 1Q8BA 1PJ6A 3UNGC 3C3LA 3OVSA 1NEEA 2XCPA 1LW0A 3K8VA 3ILOA 1NKCA 3RR8A 3AXKA 4Q8EA 1Y5NB 4A48A 1RLCL 3CCZA 4OHZA 2CVIA 3D67A 3FEZA 5HP1B 2C1EB 2QGFB 4PG4A 3OD2A 1FKOB 2J5AA 3GR1A 1WF0A 3NMAA 4DL0C 2V8HA 4N76A 2I38A 4X4VA 1DTTA 1Y10A 4X64J 4Y28C 2Y0BB 4KR0B 2GZOA 4O44B 5B0FA 1EB0A 3EVOA 4DPUA 1NPPA 3V2UC 4PABA 3D68A 2FJWA 5DRKA 3NMRA 5CYQA 3CJRA 3DRPA 4LFAJ 3THTA 4F7VA 2UXBF 3E51A 1CULB 1NHVA 3WC0A 2RVJA 5D78A 4K4WA 1IKXA 5KFWA 1R43A 4IOCQ 4HDHA 2DCUB 1NDCA 1YRXA 3DGVA 4GVBA 2C22A 2H3EB 1U1NA 1EKRA 3BDEA 3OTOJ 3KHGA 4EMDA 1N5YB 1T95A 3T41A 1RDRA 3R1LA 3LO3A 1VQOS 2HRTA 3M8WA 2XSFA 4ZJOA 3M32B 5HLFB 3DKDA 1ZAXA 2K7JA 4I7FB 2XCAA 1RTIB 2ZH3A 1QAIA 1NAQA 1U6FA 3RB6A 4M5DB 4LF8J 1B70B 1UA0A 4LF1A 3GZ7A 2OPQB 4YHHJ 1N88A 2R7OA 4IFVA 3JSBA 5KFJA 5E2QA 4E98A 3FCWA 3F0NA 2ATLA 1CJTA 4J7CA 3UFCX 5GADU 1P8GA 1TL3B 4CH1A 4U7UD 2NZ4A 5A76A 2J9DE 3R5GA 1RHRB 4WZMA 1DTQB 3JQJA 5G0RB 1Y5IB 2BYCA 3MM8B 2WRMA 3PX6A 2JVRA 3HSJA 2N4CA 1RUSA 2KT3A 3H59A 1S6QB 1BWVA 2DXEA 1XTZA 4NWBA 2FUG9 3NY0A 3CD5A 1UWBB 3UR0A 4L74A 3NGTA 3W7BA 3R3TA 4URQU 2MKSA 5THWA 3JB9k 2M88A 3ZZ0A 1G7CB 2GQ2A 1TUWA 2CAJA 2OSQA 4ZIWA 4P75A 3I4HX 3G82B 4RW8A 2BZ2A 1EZZB 4L76A 1HQEA 1VHFA 2NZCA 4NA2A 2Q1LA 2VPZB 3IN5A 2W9BA 5KFEA 4NCAA 1HBOB 2ZC3A 3K0JA 2OPRA 4NA1A 2JC0A 1XMQF 3LUYA 1R7IA 4ZVGA 3SSRA 5AE2A 3T1YJ 1R8CA 4OZLA 5CZVA 4ZHRB 2FC9A 1JJCB 2HLUA 2KDOA 2COLA 3OQ2A 1Z4UA 2HRUA 3ZXWA 2X7IA 4K5SA 2LXUA 2E7VA 1S7HA 1IBKF 3BM7A 2UXDJ 5D8HB 3BR9A 2VUGA 3B54A 4FXDA 2WW4A 3D0IE 2LYVA 1SI9A 5DDOC 4FPIA 3M6XA 5L1KA 4FDFA 1D0EA 4JI2F 1MU2A 1TZ0A 1X0PA 3CNQP 2HLTA 1YZ7A 3LP0B 4OYAA 5KFIA 2E7XA 1KC8T 3KLGB 5GMEA 3W8PA 4CLPA 4JYAJ 2HQDA 2W4PA 2UXCF 4Y6IA 4ECVA 3AT1B 4WF9Q 4JI7F 2RDIA 4C8KA 1WC3A 2E44A 3C66A 1UAWA 2KVQE 2GAGC 3G71S 1B4SA 1F60B 3DRSB 1YIJS 3HX9A 4B9MA 3H40A 1VQKS 2H5IB 1P1TA 3GYGA 4TXSA 2PSZA 4P10A 2QL5B 5CCLA 1YG0A 3FDSA 1TTHB 1P27B 5HROB 1O51A 4DI6A 2V8PA 4R8UA 3AD7C 2ASYA 3PVXA 3BQ0A 3PW0A 3ITHB 5KG2A 3NCQA 2V6AA 3RRKA 1RWXB 2F4FA 2WVFA 1IBMF 3CCQS 1N5TA 2AHOB 4DQIA 4G6VB 3CEDA 1U2CA 2RRBA 2CJBA 1NHKL 2DCLA 1VJWA 4P71A 1LEOA 3I9V9 4QWBA 1LFWA 3ILLA 4CH7A 1RI7A 4RR5A 4ENOA 5C24B 1BWEA 4X4NA 1F1BB 5HP1A 4BCAA 4F2RA 3TOQA 5D0GA 2I1RA 2M9KA 3HSGA 2HHVA 4QR1A 1BD6A 2BKNA 1IBCB 4ED1A 3R6GB 4L75A 1Q78A 4O44A 2CPJA 1RKJA 5KT7A 2GO9A 1YKWA 1CULA 4F67A 1R8AA 2CA9A 5HL7Q 4CP5A 2FHMA 2MGZB 3WDOA 3FBBA 4LRAA 1UVMA 2QL9B 2HZAA 1VQSA 4ILLA 3H25A 1N5YA 4CLSA 1LKZA 5DGAA 3CWJA 3DFEA 4DEZA 2YWHA 2VJUA 2XULA 1S0MA 3M32A 5HLFA 2J0WA 5I3UB 1Z2ZA 4I7FA 1RTIA 4RWXA 1N5VA 3F41A 4ZVFA 4UOGA 1N6QB 4M5DA 5HQ8A 2GMLA 1XIQA 1NK6A 4FVCA 1X60A 3D28A 4GC7A 2OPQA 5AJ3F 3A3PB 3M9NB 1SL2A 3SCKE 4NLWA 2CPZA 4HDGA 1NBEB 3Q8RB 1KS2A 3ULHA 4WFYA 2B4VA 3JAMY 1JB0C 3D6HB 4CO2A 1TL3A 4LFBF 2DO4A 1DBDA 2IM0A 3MR7A 4OHWA 5CYJA 2AQ4A 1DTQA 5G0RA 2QIFA 3PO5A 1JQGA 3MM8A 2J0XA 4EBCA 4OYBA 2JWNA 2MY8A 1HA1A 4LQ9A 3PY8A 1JNRB 2HQIA 1S6QA 4OI1A 2GVZB 2Z58B 2IA6A 3DI6B 3UPFA 4LF5J 3RUBL 3GJRB 3TUZC 1IVZA 3OV7A 2WZ1A 4Y2CA 1UWBA 4DUYF 2HZCA 1PO6A 2CJKA 1S6UA 1RA7A 1XMQJ 1AUSL 5DDPC 2MYFA 1CC8A 1FKPB 3H4BA 3BYRA 1S79A 3OPKA 4DV5J 3NGSA 3HLUA 4JP8A 1C0UB 3OR2B 3G82A 4LSZB 2LDYA 2HHQA 4BBYA 1HMVA 2XNRA 3K59A 4D3HA 1DQ9A 2V2KA 4ZK7M 5LSLA 2XY5A 1GXUA 1ACMB 1HBOA 3MCSA 1YJUA 3K5LA 1HNVB 4MFBB 3IFEA 2BABA 2YWWA 1C0TB 3CXCR 2HZVA 3MWBA 5KOXA 2XMJA 5HMZA 4ZHRA 1WSVA 1YITS 1YJRA 1WDTA 2E29A 4WWSA 4DV4J 5BJRA 1GAOA 2KRBA 1RA6A 2W2NP 1S1VB 1LK5A 4JI2J 3A4TA 2DGSA 2W24A 1UVLA 5EDWA 2R9LA 4N8OA 2XMTA 1QSLA 5K8NA 2BM0A 3OT9A 2ABYA 3O3LA 4KPCA 4PZVA 1K0VA 3CC7S 5A2QU 4JI7J 1JLQA 2R4FA 1FK9B 2M8HA 4PG7A 1NJYA 3UD5A 1GH8A 3H5UA 4OJ1A 2ZDOA 1JMTA 2V94A 1CS4B 4HI2A 1YRTA 4OYPA 3SSSA 4DU7A 2AT1B 5D15A 4UF4A 3AODA 3LP0A 4MH8A 3KLGA 1RT2B 5BR8F 3M8PB 1SIWB 4IG3B 1VGYA 1BLUA 2OTLS 1UEUA 1GTHA 4RZRA 4R25A 1TK8A 3FMBA 2PEHA 5E3QA 2FHKA 2ZVIA 4FNIA 2EFOA 1Q16B 2X3GA 1FNXH 3P3DA 2AKWB 1IBMJ 3SFUA 3UDEA 1SVDA 1GMWD 1U0HB 5C25B 3NAIA 1DLOB 1OS5A 2FTRA 3DRSA 4ZDNA 2AJFE 4M94A 2KTQA 4I2PB 4GVLA 5B0DA 3SI8A 2B4PA 2P9GA 4M5KA 1H2TZ 3K7RA 2IJNA 4OV1A 3HM9A 5HROA 1V3ZA 2AGQA 2YNIB 5HBMB 4DZDA 3ITHA 4UOFA 4C8OA 1SJQA 2ASLA 2AYEA 4DR1F 1MG7A 2ZEJA 4ID5B 4KHRA 3Q8PB 2IDLA 2HHSA 4CNZA 3M05A 1OY6A 3VVUA 4QWDA 1Z1ZA 2C3YA 3I87A 2FHJD 2JEJA 3VAHA 3UN5A 5C24A 5KFAA 2EI5A 2DGQA 4CM0A 1OQ3A 3EJMA 1FEEA 5AXMA 2HFNA 1URNA 3Q8QB 4FF3A 2CWXA 1KEKA 2PA3A 3ETOA 4QYZK 4WFNQ 2XG8A 3TO8A 1S49A 4B3RF 5ETKA 4C48A 5L1JA 5KT4A 3ZZOA 2CRLA 3DXSX 4QR0A 1HPZB 3MM7B 4ERDA 3RRHA 4DQQA 2CG8A 2ROEA 1XMOF 1CJUB 1S1WA 4X4UA 3CCUS 1KOOA 3D6MB 1S72S 1ELOA 2MKYA 3QZ7A 3PEJA 4KHMA 1UP1A 1SJ4P 5GAHI 5KT6A 4USJC 5AJ3J 1HNZJ 1NSPA 2RDJA 5LL6d 2HHUA 1FRMA 1R6VA 3Q8YA 4NEYA 4A47A 2HHXA 3ZTQA 4LFCJ 4LFBJ 1UW9A 4YB6A 4BWJA 3R5CA 4GO7X 2Q6BA 2FJBB 2DR6A 1QD1A 4DV6F 1VC5A 1SC4B 4ZVRB 2JHEA 1MROB 4KRWA 2B9EA 3T3FA 2ASJA 1N6QA 3LGMA 4F50A 2FQQB 1IM6A 1WF2A 4EO6A 3DU6A 1HFEL 5JXSA 3GIJA 3TVYA 1NPRA 3CCWA 2ROGA 3KMQA 1PYSB 3KFWX 2E5IA 1S97A 1TKDA 2ZH9A 4CLWA 3MR6A 1IM4A 2DGWA 1H38A 5AXKA 3VAGA 3LALA 5IFMA 3OFGA 1CJVB 3BKFA 3MD1A 2KHDA 2XI3A 5ETLA 2P5VA 2WSFC 2IVFB 3L09A 3QWPA 1YBAA 1SJFA 5GVQA 2VJVA 4GKJJ 1ZTWA 3FQLA 3BGRB 4QU7A 2AX1A 5CA5A 3DI6A 4QIEA 4N8NA 1UZHA 5M2RA 3T19A 2XY6A 5IT9Y 3A13A 2WSCC 1IR2A 3MUVP 3PDNA 2HS4A 1WHXA 2LKZA 3N4WA 3K17A 3LGNA 2PA8D 1FKPA 5GMDA 2F7VA 2HWTA 1HKAA 4IFYB 3MPWA 2GJ2A 1EP4B 1C0UA 3W9HA 3OR2A 2B3TB 2W7PA 1NHUA 3TX8A 4DDFA 2EFVA 1ROFA 3UDCA 5B08A 1SB6A 1W2BR 1GK8A 3DLHA 3DGPB 4LRCA 3TX0A 5KG0A 2CQIA 2ERRA 3NNAA 4CH0S 4HTJA 2QFJA 3MM6B 5KFBA 4YDDB 1T7PA 4O4GB 4PAAA 4K2JA 3O5TB 1HNVA 4MFBA 1C0TA 4RUCA 1JXEA 1EETB 4WXOA 2RU3A 1PYOB 5IS2A 3EYZA 1S9FA 3EGZA 4JI6J 1XR5A 1S1VA 4PKDB 1ZOTA 2ZOMA 5F8JA 2QE5A 2F65A 4OZJA 1Z2LA 2R7QA 1UFLA 2PIIA 5LSOA 5BR8J 2Z0GA 4DL6A 4UZCA 2DJWA 1ZM2A 2NPIA 1N0UA 5A6WA 5GAGI 5J2MB 1WHYA 1MSWD 1FK9A 5H9FK 1H2VZ 3BV8A 3IR7B 2OFHX 2DHAA 3FEYB 4AYBD 1LXNA 1CS4A 3PW5A 4B3MJ 1Y9OA 2B5JB 5A8WB 4OI2A 3PO4A 3GCWP 4PPZA 2GIQA 3GSDA 1X9WA 4HHJA 3H5YA 1RT2A 1T02A 3M8PA 4IG3A 1UVJA 3EVWA 4KHPF 1T9WA 2R8HA 3ZNUA 4DSLA 3FRYA 1H7WA 1REVB 5KFRA 1ZPVA 1YSJA 3N5FA 3EZOA 2HFSA 3OW2R 2VQFF 2EFQA 3BN7A 4OIXA 4C8MA 5H9EK 3RW6A 1U0HA 5C25A 1RCOB 3HFZB 4UQTA 1SJRA 4Z2XA 1DLOA 2CNOB 4OFZA 2GFFA 2HK3A 1IBLF 4I2PA 4DR3F 3QRQA 4NLYA 2BJ9A 3F56A 3ENVA 3MAQA 3BQ2A 1A0OB 5KFDA 3U02A 3RB0A 2MDAA 3OTDA 2YNIA 5HBMA 4OHXA 3EWGA 3K5OA 2K1RB 3RTVA 3NGDA 1TV6B 4ID5A 4RJVA 1VRTB 4DBQA 1U48A 4F3OA 1NB7A 3TRGA 2OEJA 1B0PA 5B09A 2HGLA 3KJNB 4IOBA 1XMOJ 4EU0A 1NU4A 3PW7A 3UVJB 1KLNA 2OMLA 4TYBA 3QIPB 3LTOA 3IRXB 3P6YC 4F25A 4JI4J 4X4PA 7FD1A 4PR6A 3GLJA 2BDPA 2MLYA 2XO6A 2V69A 2IJRA 5L9XA 4NCBA 3MCMA 2MZQA 3HKWA 5HJXA 2DT9A 2N3LA 4MK9A 4KGZB 2OMOA 2RQMA 1HPZA 4DZ6A 3MM7A 4F3QA 2XLJA 2B9YA 4EWTA 1OWXA 1D9AA 4FKXA 1VS3A 3OFHA 4DV6J 1VQ8S 1CJUA 3GSIA 3K58A 2RS8A 2M3DA 2CPEA 2GV1A 2QTWA 2KFZA 3OVAA 4RNNA 5JMNA 2AJ0A 1W26A 1XBWA 3PFOA 1U25A 3V6DB 1T9YA 2F8EX 4C7QA 1RWVB 2V4RA 1FI4A 2BQRA 2C2MB 2YVSA 4WP3A 2D69A 1NJXA 3AOAA 4ETZA 3KJQB 2D7SA 1JNZB 2DTJA 3QATA 4RO0A 1AFIA 3DHXA 5E3RA 1MROA 3J7A1 4KH0B 2UUCF 2BE7D 1LWFB 5E41A 3QFWA 1NK4A 3TZWA 5B0CA 2DISA 4TQRA 3TW0A 2HVHA 3CIMA 4DHVA 3TA0A 4D3GA 2VG7A 3G8QA 2ZH8A 3CDBA 2XYPB 5LOQA 2UUAF 4NZ0A 1GEHA 3T5JA 2MKIA 1CJVA 1VIOA 3FNNA 4ELTA 1ZETA 3OL9A 2RAQA 2J6UA 3GG0A 2DR7A 1UWAA 4QYRA 1S0VA 2E7WA 1U8WA 1BGXT 3MD3A 1W2IA 2HNDB 3BGRA 4HVZA 4YR3A 1FRLA 4C4WA 1Y0HA 4AL5A 4O23A 2UV8A 2WSEC 2V63A 2XBPA 2UUBF 2PN6A 2ZBPA 3GFHA 3G86A 3QIDA 5K8PA 1TQLA 5GAGU 4DR2F 4IFYA 5HSPA 4JI1F 3FRZA 1SKSA 2GMHA 1EP4A 3J81j 4EFAC 3FGVA 1I1GA 4MAKA 3ZZYA 2HWHA 1URRA 4IH6A 5G4DA 1FJCA 4ZPAA 3NL0A 4ECSA 4LREA 4ER8A 4GO5X 1CC7A 3R1HA 2IRXA 4IG0B 4R0EA 1IUJA 1VRUB 3MM6A 4O4GA 1EETA 1SJ1A 2VQEF 2ZD1B 1RP5A 1YJ7A 4YB7A 1M5PC 3NLCA 2YQ0A 4RLEA 3TA2A 4WKRA 1YBUA 3CC4S 3Q2SC 2VC1A 1QDUB 5E33A 1RWOB 3AOCA 2JH3A 3EDQB 4USKA 4C98A 3VAFA 1KD1T 4DFKA 4WU2A 4YDXA 1P9YA 1CQNA 2HBYB 3I5AA 4ED6A 3D6TB 4DL4A 3E2EA 2HBRB 3G8SA 4DV3J 5J2MA 2WONB 3W9JA 2KM8B 3W64A 4UT4A 1RWNB 4EO8A 3HO1A 3T5KA 5D0EA 1R8BA 2BJ8A 2VQFJ 3C14B 3W9IA 2B4OA 2B5JA 1MMDA 5A8WA 5JVHQ 3E3XA 4Q8FA 5CCMA 3OL7A 2F9JA 4JBCA 2ASDA 1J5EF 1SQEA 1FESA 4NL5A 4JI3F 1H6KX 4LBIA 1NK0A 4DR3J 1Q8LA 2EG2A 2VFSA 3GB0A 3EZUA 3D3CJ 2BJ7A 1RAOA 2V34A 2OFGX 3DCAA 1ITPA 2DPJA 1QVFR 4OZ5A 3O44A 1REVA 3OSPA 2NSCA 1U02A 3MMBB 2JEIA 3TJAA 1DFDA 2Z8QA 1RSCA 2XMVA 2PGCA 2HQFA 2V8GA 4A8WA 3BSOA 4OYZA 4ZVSB 4A8FA 4KT0C 3P5BP 3QPIA 1MW7A 4EGLA 3UNYA 3X1LB 2E9RX 2Y8YA 3UE2A 2B6AB 4A8OA 2V9WA 1XMBA 1RWKB 4BHQA 3VGTA 4M5LA 5CZXA 2J9CA 1M5VC 4F4AA 4L73A 5KFMA 4FS1A 2K1RA 4Y34A 1X7VA 2MQQA 3HVAA 1I6JA 2NLWA 4EYIB 3FCHA 1VRTA 4YR2A 5J2QB 5KFTA 1IKYB 5L38A 3SQOP 1XEZA 2DNZA 2IDEA 3UVJA 3N0VA 3GCXP 1RAFB 2NXJA 4HKQA 1RADB 1H7XA 2YKMB 2YNFB 3QIPA 4IH5A 3IRXA 5HATA 2FPHX 4QU6A 5T14A 4NLGA 1QAXA 3C6UB 3GJQB 4Q45A 4I1TA 2N7YA 3H5XA 3CUNA 1T9XA 4Y00A 3SDEB 1ZM3A 1N0VC 2AYMA 1RT6B 3H2LA 2KFNA 2DXDA 1B0TA 1SH2A 4ES1A 2MZSA 2XZTB 2H1YA 3CULA 1C1BB 3RZAA 3S6EA 5KFZA 4Q5VA 3CJ4A 4WJBA 5KG7A 4K4ZA 3NS5A 2DEJA 4WP9A 4USUA 4OX7A 3IC1A 3V6DA 4DSIA 5DS7A 1NJWA 9ATCB 3Q22A 1T05B 5ADZA 1F2HA 4MTPA 3KG1A 3MPUB 4KYZA 4P7TA 2XLIA 3TP2A 2RDDA 2QJ3A 1Y4ZB 1TUGB 3D66A 3LANA 2Y1JA 3IGNA 3HFKA 4ZCIA 3RBDA 2GVDB 1P6TA 4ECTA 1LWFA 2Z2MA 3QT8A 3MHYA 1K1SA 2D3O1 3IXQA 2FDNA 4QZVB 1M5OC 2WVCA 5DZ6A 4ZVEA 2E9TA 5IQ6A 1T0TV 3BBFA 2CQDA 3ENAA 7FDRA 3JSRA 2JLGA 3PR4A 1VBKA 1R89A 2NR0A 1YRUA 3S1TA 2VFRA 4JI1J 2QV6A 2G4BA 2GIFA 4J91A 2GNKA 4I6WA 4FF1A 4HHHA 4IQMA 4DXLA 2HNDA 2J6SA 3SQGB 2A1BA 1FRKA 3BDPA 2MPUA 2MHNA 2F4VF 4CO4A 2JRSA 3FKBA 4DN0A 4OJHA 1JJ2R 2K3IA 4F4ZA 2VQEJ 4I4BA 4S0MA 2MKKA 2EFNA 2KXFA 2J9EA 5A0YA 1N33J 1PGZA 3IG1B 4DJBA 3WZ0A 2C3UA 4KJIA 1RHQB 3L7UA 1F3FA 2X1GA 4PWWA 2E5LF 1DJ0A 4IG0A 1VRUA 1TR0A 5KFNA 2LU2A 2WVBA 2RKIB 5ETMA 1CSJA 3AB2B 4WXWA 2ZD1A 2B9WA 3B78A 3TA1A 2WK4A 3UN2A 4A8MP 4U7UK 2BA9A 2ZH2A 4BWMA 2KH9A 1YVFA 2AW0A 2P9EA 1ZA2B 5DJBA 2D3ZA 1NDPA 2POKA 1JJHA 4IUFA 2AGPA 2R7WA 3WHIA 1PAEX 4OHVA 2OPSB 3FVYA 2FD2A 4DFMA 1VLYA 2FLPA 1VC6A 2YWFA 1QSSA 4CI0B 3IBCB 2H4WB 4KPYA 3KLVA 4I0WA 4C11B 1XNQJ 1F9EB 4DFJA 2HFOA 2WONA 1HI8A 4LQ3A 2LQ8A 2YKOA 5F3TA 5AXLA 3MEGB 4JI0F 1M1GA 3DC2A 4U8VA 5E3AA 5A6PA 3C14A 3CMAS 3C6TB 4RNMA 2VL1A 2MSSA 2HVIA 3CCTA 1PG5B 1U1LA 4DR6F 2BQ3A 4USHA 1ZAVA 1AXQA 3VF0B 3T1AA 3AJ1A 5KFHA 4JV1A 3OFFA 1HR0J 1RB0A 1ULRA 4DR4F 1WUUA 2YPZA 3WX4A 1IWGA 2GQCA 1FFGB 1YTYA 3AD9C 1X9MA 3CC2S 3TZZA 3MMBA 2OI2A 1WF1A 2ZZMA 2JFKA 1BXNA 3KG0A 4G3IA 4J9LA 2DKOB 2WAQD 5JJBA 1S6OA 1MN9A 1OSDA 3M7VA 2W9CB 3G6ES 2QN6B 1FFWB 3FUYA 2MEWA 2ZVSA 3HD2A 1KQFB 3J7Z5 4RW4B 1RBLA 1SC3B 1MMLA 3C16B 4OX6A 2DH8A 3VQTA 4B3TF 3MEDB 2B6AA 4ZS6A 3R5JB 2L9WA 1KDNA 2AJ2A 2DNOA 3M1VB 4QW9A 1N56A 4ZLPA 5AE1A 1JWWA 1PYTA 2N82B 3ENQA 3KLFB 2W9AA 2WB4A 1OIAA 1ZBTA 4IDKB 5J1EB 5J2QA 3WBZA 4K4VA 2YKQA 1F5CA 1IKYA 3HVRA 1S4FA 4URSA 4L6V3 2LMIA 2CNKB 1TKZB 5HVGA 2YKMA 2CYYA 2XO7A 2YNFA 3U1NA 2GHWA 4TY9A 2AWZA 3CDUA 1ZH5A 3C6UA 5RUBA 2XY7A 5JVGQ 4XK8C 2A2CA 4AQYF 4IRKA 1K73T 3R97A 3KYLA 5IT0A 4FXVA 3SDEA 4UY8T 3QGIA 2HURA 1RT6A 2CQ0A 3NEKA 3HJFA 1CVJA 3G2XA 2ALYB 3NBPA 1X0FA 3ADAC 3ZZPA 1AYEA 3L4BC 1X5PA 3HF5A 1C1BA 4ZVTB 1KQGB 2G2ZA 4DX8H 2XM3A 2WCXA 1DHMA 3HI9A 2UU9J 3DRXA 3NS6A 5L8RC 4LF9F 2CZ4A 3CCLS 1FDNA 2CDRB 5D6GA 3OXLA 4IYQA 2DHXA 2HHHJ 4OI3A 2BVZA 1ZA1B 1RAIB 2RJZA 1T05A 1H74A 2FJDB 2LQ9A 3TZXA 1EIYB 3L9ZA 4RNFA 5E3CA 3QAUA 3DHWC 4NMLA 2MQPA 2GVDA 3GFYA 2KXNB 3P5TL 1AROP 3M9MB 2KL8A 4OMFG 2R8GA 1FA0A 1NXIA 1IKWB 1ZS6A 2F8MA 5DGBA 2QA1A 3AFGA 2J9DA 2G1DA 2GX8A 3OBIA 1P1LA 4O3NA 2OPPB 3W5ZA 3KDOA 5B0AA 3R7SB 3B4MA 5F9NA 3MEEB 2HRYA 4QIGA 4UUXA 3KNAA 4G1IA 1KLMB 1U1RA 1LFPA 4TU9A 2ATCB 1S57A 3DM2B 1RTDB 4FVMA 3H20A 3SQGA 3UN3A 2PEBA 4NA3A 4DR5J 4DL7A 3VV2B 1SIZA 3OR1B 4U96A 3BSAA 1ZZFA 4NLSA 2XGPA 2L08A 1LV5A 1X4FA 3DLGB 3BGOP 2QG9B 5L39A 2YWGA 1FE4A 1Q0NA 2ZM6F 3NP5A 4X4OA 2PE8A 4JV5F 1OPIA 3Q24A 1R0AB 3SZ2A 3CCSS 3HZEA 2QC3A 1QAYA 4KY3A 3RGIA 3R27A 2BW7A 2EBEA 1VLOA 3IG1A 2FC8A 4P7VA 2NYHA 1U47A 3TAQA 3W61A 1Q1KA 2RHSB 4RNHA 1LNQA 4N56A 4RUHA 5M2UA 4R5PB 2VKZG 1TVRB 3J7ZT 3BR8A 4YFUA 2AZ1A 3HJVA 5HJYA 4C0HA 1RISA 1UEVA 2BKPA 4P73A 1D1UA 3MAHA 3CMQA 3R8YA 1F9HA 2XQCA 4DF4A 3PHEA 1WTBA 5AXNA 3UDVA 2QSWA 3NGRA 2OPSA 2W8KA 3K5PA 2VODA 3KJFB 1BQXA 2M52A 3UD3P 4C11A 2KZZA 1KQSR 4LVNP 3KUEA 5DG9A 1AUDA 2X1AA 2AYBA 3MEGA 2F63A 3PW4A 5EWEA 4HTIA 3BBCA 1UPPA 4O3SA 3C6TA 2ALZA 4DSKA 4YOEA 2HPUA 2V68A 4ECUA 5KG1A 1WORA 1RAGB 1PBUA 1G3OA 3GWCA 3RRGA 3VQSA 1N48A 1HQ2A 5D0HA 4OX9F 3E8OA 3CCES 2RQ4A 4I69A 4UQGA 2KZMA 3GE9A 3JSMB 2QMUB 1VYAA 4NLVA 3BH6B 2XB2D 3F44A 1PBAA 3TANA 4F36A 4CZCA 4TNOA 2KT2A 2GJIA 5HMWA 3LF0A 4MJKA 3SFGA 3PYDA 2W9CA 4B02A 2QA2A 3MFHA 2HMIB 4QQBA 1SQFA 3Q83A 1OMSA 4RW4A 3C16A 1R27B 2RILA 2R2TA 1GMUA 3MEDA 3GV8B 5EGYA 3M1VA 4ZLJA 4TLQA 3DLEB 4HYKA 2N7CA 2DR9A 2VFTA 3KLFA 3ETMA 4U7CA 1F5AA 3IR6B 1OO0B 1TAQA 4AQYJ 1JLAB 1YJVA 2GA7A 3EGNA 5BYRA 3S01A 4IDKA 5J1EA 3DLKB 3AQOA 1N34F 3M4XA 5HQMA 1QM9A 4MKVA 3TR5A 2R7TA 4LT6A 3DMJB 1YQHA 1PJ5A 4DSJA 4O3RA 3DDNA 1YLXA 2D9PA 5E5NA 2O67A 1TKZA 3MR2A 1X4BA 2JL9A 4LF9J 4LF6J 4F2SA 2FJAB 2LA4A 3B82A 2VOPA 1IKVB 2DNLA 1HLWA 4X84A 5DG8A 1SV5B 2JNJA 2DRDA 5B7WA 1RTJB 1HARA 2UVWA 2XZDB 4DL3A 4HH0A 4G1PA 2XMWA 1LW2B 3BYPA 2CQHA 3GYNA 2UP1A 1VISA 1U2FA 1WTFA 3HHLD 1IWAA 5D4OA 3EXYA 3IS9B 2RF2A 2C2NA 1K9MT 3IA0A 3AA8A 4ECWA 3V6KA 3CDWA 2P8IA 3PFEA 2DO0A 1FWPA 1WEXA 1JLBB 1PKUA 2BJEA 3H7HB 1F5BA 2CIMA 2LQJA 1YK9A 3HXMA 4ZCMA 1HWUA 3T1HJ 3TWZA 4IR1A 5B0EA 2OD4A 4B3SF 3EPGA 1X5OA 2XHWA 5DDQC 3OJSA 5CXTA 1X4DA 5GAEI 1WJ9A 2NXEA 2O66A 5EX3A 2OGUA 2XS2A 2DR8A 2MSTA 1Y5LB 5SZTA 1UJ5A 1R31A 5I4MA 4CLYA 1N52B 1WOSA 4IKAA 1IKWA 4JI5F 2K06A 4X65F 3K5NA 3A12A 2OPPA 2XLKA 4WYLA 2ZM6J 2VPXB 4K4TA 3MEEA 4K4UA 1XN9A 3PJ9A 2IRYA 4IRDA 1U4BA 2PD1A 4B9SA 1KLMA 4NLRA 2DNKA 2V67A 2FGCA 1NMEB 3K57A 2JLFA 2MKJA 3VGSA 4LBPA 4X4RA 2OAUA 3DM2A 1RTDA 4XDDA 4A8SA 3R2DJ 1NSAA 1X9SA 3ZTOA 3OR1A 3WC2A 4ZN3A 5L46A 1EAYC 2YXLA 2NCKL 2MQLA 2CNLB 3DLGA 3CCVS 4ZLNA 3I31A 2RB7A 5IOLA 1N36F 3MFIA 2E1RA 4J9VA 2HIYA 1S9GB 1R0AA 4ZOSA 4H4KA 3QGGA 2JDJA 4WP8A 3NOCA 1FTRA 4WYWA 1ZM9A 2VDHA 3P4UB 1X5TA 2BR0A 1DAXA 1ZAWA 1KFSA 2NUUG 1RQ0A 1Q95G 2PI4A 4RBVA 4HLBA 4CLKA 2UVVA 3THPA 4UOCA 1N4LA 1PC5A 3HD1A 4R5PA 4DSEA 1IXKA 3FSIA 1MMNA 4CT9A 4PRFA 1Q8IA 3MZIA 4DV2J 4YQWA 2JZ5A 4QJVA 5K8MA 2EG1A 1ZTTA 4ZN1A 4OHYA 2QFIA 2KFYA 3IRWP 2IFXA 3AJ2A 3WIVA 3KMSA 1JLFB 1DURA 4AXIA 4O0NA 3DYAB 2D3OR 2Y3YA 2EVZA 1R8PA 2GAHC 4CLZA 5F8LA 1RTZA 3G6YA 2GCFA 3RAMA 2HK2A 1A6LA 2ZC4A 4H54A 1S12A 4ED7A 1RBOB 1T8EA 1RK8A 1PC4A 4MKBA 1U45A 3MM9A 1NB2A 4M5GA 3Q86A 2IBOA 3H90A 1NNDA 1S5ZA 4PXEA 1U1MA 1ZYQA 3DLLQ 1VK8A 1N54B 1VOMA 5J2NB 3PZPA 3JSMA 4ZMMA 5CAAA 4QPXA 3M2VB 5KT5A 2Z30B 1HBNB 2XEXA 3OLBA 2MQNA 3JSYA 2HNYB 2VOOA 5F8GA 5KG5A 3ZZUA 2OP5A 5F0UA 2DGXA 4O0IA 5L1LA 1RT3B 3EICA 1N34J 1LWCB 4HACB 2HMIA 1RHKB 5CD4A 2C2ZB 3HHLC 4NYOA 2H5JB 1RT1B 3HT3A 2NSBA 1WKKA 4WE1B 5JUMA 5IM0B 4KE5A 3DLEA 1OY8A 2YKNB 2IAJB 2QEXS 1V3RA 5IXUA 1VHIA 4K50A 5I42B 2J7WA 4WTYA 4C97A 1VQNS 1JIHA 5KFVA 3P49B 1JLAA 2FVPA 1ICEB 2BRKA 3E01B 3GONA 1UEKA 4U8YA 3DLKA 4N5SA 2ZZNA 2G9OA 3R7NB 3EGWB 1FHTA 4PWUA 4OZ1A 3DMJA 3LQVA 1W7WA 3CO9A 2CPXA 1NZAA 1XNRF 2GMJA 2KHCA 2PT0A 2DBBA 2GC8A 3UWTA 2IM2A 2IM1A 2UXBJ 4U6PA 1JXVA 5LMNF 5GAEU 3W2VB 1M1KT 2YTCA 1YWXA 4XPCA 2MMYA 3K5MA 2OJ3A 2HSEB 3MXHP 3KUGA 1WI8A 3TUIC 1FKOA 1IKVA 1Q8KA 3O2IA 4MK8A 2CPIA 1SV5A 3PM9A 1RTJA 4Q44A 1WKJA 4PG6A 1KP6A 1F3VA 4HEA9 4R0JA 3MPVA 2DNGA 1LW2A 1V9OA 2DXFA 4LBHA 5KFGA 2R7SA 2YWKA 4B3SJ 5IT4A 2LFVA 1VDHA 2DH7A 4FXWA 4NZ7A 3QSIA 3IS9A 4HHUA 4WK3A 1QE1B 2K2PA 2MKCA 2DHHA 3AXMA 2ZH6A 3R2CJ 4JI5J 2H54B 1JLBA 4FKYA 4U9RA 4X65J 4YEAA 1Y3JA 1QVGR 4QW8A 3KHLA 3VAJA 2Y1RI 2ZNYA 2DB1A 3W3SA 1V5IB 4K5RA 1OY9A 2KG1A 2VC0A 2ZKTA 3G87A 1FFSB 5SUHA 1HNXF 3G6VA 2WVDA 1C4CA 1WI6A 1R3NA 2LCWA 4ZPVR 3DDKA 2BJ1A 5MAOA 4I64A 4WIQA 3BKTA 4CDIA 4K7QA 1TFYA 4X4QA 1G6BA 1N36J 5A2QY 4DV0F 4RU2A 3JYTB 4OQJA 1TL5A 3FJ2A 1RTHB 3MM5B 5KFPA 4LF4F 3EMTA 1NDLA 4X4SA 3QRPA 2BMBA 2DPIA 2MZJA 1B3TA 4QWEA 2YBVA 4EEYA 3ZZTA 1SC6A 2N3OA 3D1QA 3KHRA 3AA9A 1KVKA 3KWMA 3NNCA 4RNOA 2ZJPQ 2ZOGA 5EWGA 2OLWA 1VQ7S 4GMKA 1S9GA 1RU2A 2RE1A 5FIIA 4PXDA 1QAJA 3WQPA 2EWHA 2HGNA 1U1KA 2B8PA 1YJWS 2B43A 2NXCA 4NE9C 4KBIA 4DFPA 2F8HA 3N6MA 2MXYA 4L3NA 1C4AA 1EX8A 2XWXA 2KO1A 3I0RB 2PMWA 4A8YA 1IBKJ 3MMAB 4LRBA 1SL1A 4AT1B 2ZDPA 4OI6A 5LM7E 3R5BA 3TNVA 4X64F 2HFVA 2IIHA 3HSZA 1LOUA 1KSPA 4ZVUB 2QA4S 5T7LB 2JSXA 2PMHA 4CM2A 4LFAF 5KFLA 5FJ4A 4WPAA 2FYXA 4ECQA 3TJ8A 1JLFA 2D74B 1WHVA 3DYAA 1O5JA 1TK0A 3RJMB 2IHR1 1VQ9S 3LA0A 2RSQA 1X4CA 4DU8A 1RLDA 4CLFA 2F3JA 3GG1A 2D41A 1D8ZA 3L3CA 4ELVA 4UOHA 1L5UA 2PFDA 2A6OA 2HGMA 2UXCJ 1VQLS 2H4YB 3PYEA 4OYWA 4X66F 2HG4A 4TYAA 3PKMA 3HZGA 4BC9A 3GMGA 5BXIA 3BPSP 3GJSB 4QCLA 2IYIA 2LLZA 2V8VA 3UD4P 5J2NA 5ETRA 3DRYA 2RS2A 1XWLA 3M2VA 2G2OA 1HBNA 4YHHF 3MR5A 3ZZRA 2MQOA 2VBZA 3OJUA 2HNYA 1NKEA 4C8ZA 2NYIA 2XC9A 5E0OA 2FZGB 2CZVC 1I94F 2K8GA 3GIRA 3ZNJ1 2DRAA 2A3JA 1RT3A 4C8NA 1PSDA 4NLPA 1LWCA 4HACA 3J7YI 1VQ4S 3Q8UA 3QJPA 2DNYA 5LMUF 3TAMB 1RT1A 1AW0A 1SXLA 3AD8C 4WE1A 3BJYA 1RAAB 1VK3A 5IM0A 8AT1B 3EDRB 2CPFA 1UL3A 2YKNA 2IAJA 4ALZA 5EHHA 3CMES 4P2FA 3A8JA 1X31C 3TJ9A 5I42A 4W92B 2ZWPA 2BOPA 2R8IA 2BJDA 3E01A 2YQ1A 1WC1A 2IYGA 1LK7A 4RL1A 1HW8A 4N41A 5KFXA 2W4CA 1H98A 1IJFB 4C9DA 5E7OB 2PDAA 4DQPA 2MJNA 5KFUA 2WOMB 2CXEA 3GYXB 2KU7A 3W2VA 2MLZA 2MZTA 4K4XA 3OVBA 5ETNA 5F0WA 2W1BA 3SIPB 5DLFA 3KNGA 4DLGA 1KONA 2V4JB 1UJ6A 2M7SA 3M8ZA 4F4KA 2XS7A 4LR9A 4W98A 2L3MA 3J80U 2BE9B 1D09B 4FPRA 3CJKB 3JXOA 3T1YF 1FVQA 2MHEA 3A8EA 3OHAA 1T3OA 1RBAA 1L3UA 1B99A 4PPDA 4AL6A 4ED3A 2DEIA 1DY3A 1XERA 2QYCA 2FLLA 2J76E 2KB2A 3LWLA 3HPOA 4NPOA 1HNXJ 1QE1A 1FDAA 2CJ9A 3D1OA 3OTBA 1RU1A 2PO4A 3EPIA 3GTYX 1X8DA 4M5IA 1RT4B 3FZ2A 3HMJG 3KHHA 4O3QA 1GMVA 2LEAA 3CD0A 2MLXA 3ZTSA 5K5MA 5DQHA 3QJLA 2MGZA 3W66A 3IR5B 4DV0J 2QT7A 2JEFA 3PR5B 3QYYA 4B08A 3FZBA 1NJIT 1TFWA 1GT8A 3MGJA 5I3UA 3JQMA 1TMJA 3W5YA 4P2MA 2AJ1A 1U6BA 4JYAF 1F6TA 4J9RA 1H72C 1I5OB 3OL8A 1VBZA 1NSKL 4DCJB 1VCTA 5C2GA 1GQEA 4Z37A 3JYTA 1PILA 3DDIA 4LR7A 3QSYB 4ZA1A 4DUYJ 1RTHA 3MM5A 2R7UA 2FIUA 2BJ3A 2ZWOA 1FE0A 4E0DA 4PQUB 4UUWA 4CWBA 1YJTA 1IN0A 2HFUA 2EK1A 3CVKA 3SCIE 2I9SA 2OHDA 5FLXU 5ETTA 2GVZA 5K9FA 2CQGA 4USWA 2DY1A 3T6JA 1APSA 2CQ3A 5I3QA 1S48A 4OZ3A 4V19J 2VA2A 4EBEA 3HHEA 4RW6B 2F40A 1CPZA 2C42A 3PRBA 3C19A 4P6QA 3QRRA 4OYIA 1RXOB 1TL7B 2JC1A 2AU0A 3FC9A 3I0RA 3MMAA 1KKHA 2HS3A 1GNKA 3KG4A 2FY1A 1KR4A 3I4PA 1QUPA 4RUAA 1VBYA 1V3SA 4TLRA 4XTTA 1T3NA 2ZZTA 4X66J 3G6XA 1FERA 5DM6Q 5T7LA 4ELUA 2V2VA 3UCZP 4OI4A 2EW9A 2MQ8A 1OQ6A 3OSNA 3UW1A 3J7YU 3POTB 1IR0A 3M8QB 5E3PA 3G4SS 3RR7A 4ILRA 5CYMB 3CW2C 1MWZA 2DIUA 2ZBIA 2RQCA 2WTFA 3LP1B 5HN0A 4RU9A 4FBUA 3OL6A 3ENWA 4J90A 3NAHA 4ICLB 2W25A 4PYAA 1I94J 2HVDA 4GC6A 2AGOA 4AXJA 2NREA 1N32F 2AP6A 2W2QP 2JEGA 2B9XA 5LMUJ 3FQKA 3P8BB 5D4NA 1KBRA 5HI7A 2KT5A 4M5NA 2VBWA 1FNOA 3FSXA 4B9NA 2U1AA 2X51A 4KGMA 1N8RT 1AA1B 2XMMA 3QT5A 3EE3A 2V0NA 3ISND 1KNZA 1WACA 1NKBA 2DVIA 5ETSA 2RNEA 3BO3A 2Z4PA 2VH7A 4ZPBA 1D3WA 2E9ZA 4ED2A 2W7OA 2VDIA 2JFDA 2JVOA 2L9DA 4DR1J 2ZUGA 1TUVA 1OYDA 3TAMA 1TMMA 4A46A 3BEGB 2FVQA 4NOHA 3SXLA 2FJXA 3PEHA 3M8SA 2R2SA 3NRBA 3SCLE 3TI0A 4QIFA 1RACB 1HMVB 4DG1B 3D9BA 2MQMA 4LF5F 5IWAF 3UR3C 1CJKB 1RZMA 2HAIA 5GAHU 3UO0A 4B3RJ 3D4JA 3CO0P 4DV5F 4NLDA 1VMBA 1WC0A 3MEKA 4JOUA 4ECRA 2HKEA 1O6XA 2ZH7A 4ZP9A 2LEBA 1B7FA 3KLEB 3H98A 3CCJS 3KLIB 2WOMA 4M8LA 5IC4B 4J9PA 2GGPB 3GFZA 2YY3A 4KGKA 4ZPDA 4QYZJ 1SBRA 2V4JA 3SYZA 2HBZB 4DL2A 1E6VB 4LF7F 1G1XA 1GXTA 4RW7B 3ZTRA 2YNGB 2WBRA 4IO9Q 4FYVB 1EKSA 3CJKA 1JLQB 1FEHA 2CJXB 2W7AA 4YUDA 2KJWA 2XI2A 1HWKA 3GIMA 1HQUB 4Y2IA 2BBEA 2YH1A 3HDSA 4LUBA 4USMA 4DV4F 1M5KC 4RX6A 3MPYA 5KTQA 4USIA 1YZ6A 2HHPA 2CFXA 2B56A 1GMWA 4OYOA 4K8RA 2R7RA 3Q89A 2EFPA 1RT4A 4Q7AA 4NZ6A 1OPZA 3BBBA 2O3DA 2RD5C 3H2UB 2EKNA 2QLJB 2Q43A 4JUZA 2Y9HA 2NUHA 2BEFA 3W62A 2DNRA 1YJ9S 1CEZA 2QLWA 3M8YA 2ACYA 3QGPA 1RCXB 3UQSA 3G96A 1RAJA 2OKQA 3CD7A 3CE8A 4DF8A 4C8YA 2J7KA 2UVRA 3D0GE 3IAM9 3LH2S 1T94A 5KG6A 1HWLA 5AE3A 5DZ7A 5KG3A 2FHJA 2C3PA 4K4YA 2DYAA 4QBUA 1Q7LB 2ZE2B 2AEJA 2Z56B 3EXCX 2VFVA 3VALA 5HQLA 4BDPA 2V8DA 3KJVB 1PAUB 4WIIA 3GIKA 2H51B 4NXMF 2R2UA 2FHOB 2MY7A 4FNHA 3PX0A 1HBMB 1RHJB 5IZHA 2M70A 2BOAA 4Y0FA 4PQUA 4USVA 4ZVHA 2F1FA 2L41A 1S1XB 3I82A 1MWQA 1S1TB 1RT5B 1UA1A 4TU7A 2IC3B 3N28A 4YY3F 3C15B 3R5DA 3SEOA 2EC2A 3ELHA 1HYSB 1WC4A 2X3DA 1REGX 3PRDA 4ECXA 1Q5VA 2VBXA 3KKFA 4RW6A 1N5QA 2V9KA 2G2YA 3BGUA 1RE1B 4O3OA 3TEGA 3NXZA 4FYWB 5J1NA 1MN7A 2E5JA 2EPIA 5CABA 2B51A 3FFIB 1S99A 3VR1A 2CJAA 1S1WB 4B9LA 2LECA 1QJHA 1TL7A 3PTWA 2DNHA 4P2SA 2OSRA 3DGPA 4RBUA 3ISNC 4EK2A 4H4MB 3IBWA 4NYPA 2CQ2A 3ZZZA 1Y00A 5B0BA 3BREA 3QQCD 5BYSA 3A3OB 2VU5A 3U1LA 2ZJQQ 5F8IA 3CGIA 1LWEB 1N32J 4JB8B 1GFWB 3MOZA 4DL5A 3I96A 3POTA 3M8QA 1R0CB 2DNQA 2AX0A 5J2PB 5C7PA 1HWJA 5CYMA 2AYGA 4B9VA 4TKTA 2E66A 4C3MA 2KYZA 3LP1A 4M63A 3OTCA 3D2WA 5H9FJ 2HVEA 4QR2A 1HNZF 4KHPJ 4ICLA 4XIUA 4LFCF 2BX6A 2GW8A 3PYFA 2V5HG 3UDLA 3NOGA 3BSNA 4EI2A 3MOJB 3SSQA 3LAKA 4KSEB 1HW9A 3JQKA 3ILJA 4ZPTR 3ZC4A 4OJGA 3F73A 4ECYA 1BHNA 1IBLJ 2IVMA 5LSRA 3AH6A 3QZ8A 4PG5A 2C28A 1SKUB 1QLNA 2KVIA 3PCOB 2RH3A 2V50A 2CDQA 2JOQA 5IWAJ 3R6LB 5HVHA 2CKWA 3N6LA 1Y11A 5H9EJ 2UUWA 2OELA 4WU3A 2QSFA 2KI2A 2ROPA 1S7IA 4DX6A 3QNWB 3R5AA 3H42A 4ZCKA 4V1Ak 2AMCB 3W65A 2NXUA 2XSJB 2QO3A 2O1PA 3IM9A 1FF2A 4GKJF 5DQGA 2DITA 4C6AA 4J37A 4IR9A 3GJTB 3CSKA 4DR7F 4DG1A 1FT8A 1SH0A 2C2DA 1VQPS 4ZVQB 2P9CA 5GMKa 1CJKA 4Q0BB 1RABB 4LF7J 4ATNA 3VTIA 4V19X 1DARA 1YGYA 2N4DA 5EN1A 1WHWA 3W8GA 1TV6A 1J2VA 4MT1A 2O01C 3KLEA 3A8IA 3KLIA 2H5EA 3HVTB 4NASA 2OD6A 4EBDA 1WC5A 3VHQA 5J1PA 2GGPA 2LVWA 1RGVA 4CQ1A 1VQ5S 1S10A 1E6VA 1D9DA 4RW7A 2VG6B 3L7OA 2AD9A 2YNGA 3SBMA 5K14B 4OV6A 4U67Q 3M6WA 3PJXA 3NKYA 1KFDA 3TARA 3JAMU 3NCPA 1HQUA 3RW7A 6FDRA 5HVFA 2PI5A 2DNMA 2C3MA 2R7VA 4JI6F 2M8DB 3VVTA 1C2PA 2YX4A 4ANCA 3J7AN 1FJEB 3P96A 2C2RA 1A7GE 2UUCJ 2ILZA 3O6QA 2WVEA 2FJVA 5C5JA 2IVYA 2K3KA 1UZDA 1T03B 1K47A 1JXLA 3TVKA 4KGXB 3OXFA 3FBCA 3LPYA 3IM8A 4IH7A 2V2QA 3Q23A 4NXMJ 4P9SA 2UUAJ 3RYLA 2MJUA 3QGHA 4B3MF 2HYIB 1FVSA 1EJ7L 4W4MA 3N9UC 4AE5A 4C0OC 4JV0A 4YMEA 2QLBB 1WOPA 1QSYA 2CG4A 3EX7B 2BACA 4MMOA 2NPFA 2OIHA 3Q8VA 1DQAA 3EVMA 1UMJA 1FCAA 3BKUA 4USTA 2YPYA 4YY3J 1S1UB 5H1SV 4ZPCA 4RKUC 2Q3PA 2ZE2A 4KTQA 1JJ4A 1PJ7A 3KJVA 4Y65A 3H2VE 4Q2MA 3I6PA 4F4WA 4LIRA 5F8MA 1HBMA 4IRCA 5ETVA 2UUBJ 2XS5A 3IBFB 2EFGA 2ZKUA 3PG9A 3ET6B 4DR2J 2VA3A 3M8RA 2P6SA 1S1XA 4PQAA 2LDIA 4DPYA 1EHWA 1S1TA 4NMXA 1RT5A 4PXBA 2IC3A 1NK5A 3C15A 2RMLA 4PG8A 1FXRA 2OUGA 3JTNA 1HYSA 3AJDA 2LEPA 3AY0A 3FCVA 4K4SA 3GV7B 3BZQA 1FRXA 5B0GA 2HHTA 2AF6A 4LSLB 3RB4A 1G4CA 2IBKA 5DO2A 2ZBCA 4NX9A 4DQRA 3FFIA 2J6TA 4CO1A 2W4DA 4DX7A 1OSCA 2XZWA 1KRPA 2DGOA 1LWXA 2V4QA 2DR5A 2OO4A 4RBTA 5KFOA 1TL4A 4JI4F 3AAWB 3HT0A 3EZ5A 4H4MA 5C42B 2Y1LB 5KFSA 3DNCA 2AEMA 2CPYA 2BE2B 4YB1P 4WFBQ 3KK2B 4LR8A 2R3VA 1X4AA 2IMOA 2VF3A 3QFHA 5LXRA 4F3MA 3NCRA 1LWEA 1GXLA 4OI0A 2H48B 5J2PA 4QWCA 3Q0AA 1J5EJ 2O5DA 3ILIA 4OZ0A 4JI3J 2YX7A 3B8HA 1J27A 4ED5A 1SKWA 4CO5A 5CH7B 4BC7A 2VG5B 3N6NA 2HQCA 3IAS9 1UJ4A 4DPOA 4KGVB 2VG7B 4C3KA 2RRAA 4C0BA 2VHGA 4MYUA 4ZVOB 4J5OA 1NDKA 2M0GB 3KOAA 4LVOP 1EQMA 4I6YA 4MIBA 2ZH5A 1Q5YA 1NK9A 1TELA 3UCGA 1TKXB 1JK9B 4WFAQ 3CPWR 3CDEA 4B9TA 2A18A 3QBCA 1KOHA 4CIOA 4MYTA 3GQCA 4DR7J 2AIRB 3CF5Q 2HBQB 2DY9A 5IQQA 4C3LA 2ZBQA 2DRBA 1DZ5A 1RJJA 2W2OP 2FJEB 1VQ6S 1S4EA 3AQPA 2RU9A 3T6BA 3L7PA 5HO4A 2LQ5A 3N01A 2Y1IA 4J9UE 2MB0B 3HHDA 4NLUA 2YQ3A 3MMJA 2XSJA 2AEFA 2CUYA 1WSRA 4LSNB 3CJ3A 5ITHA 3D0HE 3TUJC 4P52A 2QLFB 3I9ZA 1FDBA 3HP6A 3BO4A 2PMZD 1WEZA 3W5XA 1J5OB 2E1PA 4Q0BA 1KVIA 3QLHB 1R6YA 2ILYA 3BQ1A 5EX0A 2R8KA 1NK7A 1Q82T 5A8RB 2XMKA 1T11A 3HKZD 2J8SA 4DQSA 1I3OB 5F8NA 2H65B 1H0HB 5D3GB 4X2BA 4NEZA 4W90B 2EXUA 3US5A 2ZHAA 3HVTA 2X1FA 2L9NA 4LIWA 4NXNF 3QJJA 1NK8A 4U95A 2CPDA 1AFJA 1R0BG 4CTAB 2W8LA 2JX2A 2VG6A 3H4DA 3DRRB 5K14A 2P2CB 3VWSA 4DMZA 4ZJQA 4ZITA 5KT3A 1H3DA 2ZOFA 3W1YC 2OEMA 3PKYA 4DN9A 3EM1A 3I56S 5LXYA 2XGQA 2KN4A 1H73A 2A2DA 3PV8A 2E5GA 1QUVA 3IGVA 4DOZA 2GHVC 1WC6A 2W01A 3A3NB 3NG8A 4GKKF 3D54A 1VC0A 3IWXA 5KAKA 4B17A 2OTJS 3D7SB 1F0XA 1GX6A 1M5SA 1X4HA 3BGLA 3RAXA 3OXGA 1IQTA 2K7KA 2ADBA 1T03A 3PACA 4WTOB 4DV3F 3D3BJ 5HANA 1GTEA 4OX8A 1TL1B 4ITSA 5IT9U 1M0SA 3UCUP 2GO8A 4XPEA 4NLQA 1E6YB 3HHKA 4I2QB 4TN2A 1WWHA 4PWDB 1RWUA 1O8BA 1VIXA 3CTRA 4NRUA 4CO0A 3HFVA 4TQSA 4IO1A 1S1UA 1SUQB 3GP9A 2DGVA 2RQKA 3O1LA 1U1QA 4B9UA 4CLUA 2F4VJ 2XTJP 1IQZA 1S0NA 4FN5A 2XYHB 1BQMB 2DD8S 1S76D 2Z57B 1SH3A 2CZ9A 1AZSB 3ET6A 4DUZF 1UVNA 4I68A 4DPXA 1KTVA 3DN9A 1TAUA 3TYTA 1HNWF 4NI2B 3SCJE 4WBFA 1JKHB 3I55S 3H0PA 1Y7PA 3U27A 3IP0A 1NSQA 4L3KA 1D8YA 1KN6A 2ZITA 2IMWP 1LXJA 2E5LJ 2R2RA 4HL9A 2KXHA 1U49A 3S8SA 3BN4A 4WK1A 1NZ8A 1RWWB 1SKRA 3CD6S 2GS8A 4LSLA 3B4DA 1FRIA 2G1HA 4IOAQ 2HAFA 2U2FA 2CQPA 3SV3A 2XMUA 1HI0P 4Z7YA 3QO9B 2PFFB 4J9OA 3VCDA 3M30B 3VZHA 1HL6A 2R8JA 4M1KA 5C42A 2C2KB 2FVSA 4E2FB 4AUKA 2WW8A 2BE2A 4ZPWR 2RKIA 9RUBA 3KK2A 3JTPA 2LU1A 1FX4A 5C2CA 3SMZA 3S7RA 4JI0J 3MUTP 2CJYB 4NYZA 1KTQA 5DDRC 4Z7CA 4CT8A 1RWMB 3LW5C 1T9TA 1RHMB 2FZKB 1O0PA 4DPWA 4OJ3A 5HAOA 4DR6J 3I0SB 4A8KA 4IQXA 5D4LA 3OHBA 4GRSA 3AHPA 4Q43A 4DS4A 2VG5A 3EGVA 4DR4J 1HNIB 1U1OA 3ISZA 1U1PA 4QOTA 4KFBB 3BSCA 4QIVA 1FJGF 1XR7A 2R42A 2DK2A 1TKXA 5DLGA 3VAMA 3FBEA 3DLJA 1YI2S 4KB7A 2CNNB 4EZ9A 3R7BB 1QTNB 4B3TJ 2WHOA 1RYSA 2VFUA 3OTEA 4PUOB 3T9NA 2NS1B 4EZ6A 4OLOA 4OYXA 1FDDA 1UW4A 2G0IA 3AOBA 8RUCA 4DLEA 3TQEA 3IWNC 2WB1D 3T5LA 2A0FB 4OLPA 4UZBA 4WFXA 2IPOB 5A0YB 3KK1B 1XQIA 4LSNA 2Z2YB 4NXNJ 3HVWA 1KVJA 5D77A 3KLHB 2PC6A 1J5OA 1U24A 3PIPQ 2DGTA 4FBTA 3QLHA 3BF4A 4KKOB 5FDLB 2L48A 4XAKA 4AFFA 5A8RA 2JLEA 2NXNA 1UFKA 3LGHA 4ZIVA 5D3GA 2FLOA 1NUEA 1RT7B 3RBXA 3RAQA 3GR0A 3QMQA 1NCLA 4OZNA 2YKAA 1N33F 2VB6A 6AT1B 4DV1F
chains in the Genus database with same CATH topology
1RU2A 5ETQA 3UD5A 1RAOA 2CG8A 3QBCA 4CYUA 4M5MA 5ETTA 4AD6A 3HD1A 5ETSA 1Q0NA 3HD2A 4M5LA 3HCXA 1F9HA 1IM6A 3HSGA 5ETKA 1TMMA 1RTZA 3KUHA 4M5KA 3HSJA 4M5JA 4CWBA 5ETNA 4CYUB 1RU1A 3IP0A 1KBRA 3HSZA 2F65A 2BMBA 3ILOA 2QX0A 4M5NA 3UDEA 1EX8A 1HKAA 5ETOA 3ILLA 5ETVA 1EQMA 4PZVA 1TMJA 3KUEA 4M5GA 4F7VA 1CBKA 5ETLA 5ETMA 3UDVA 1RB0A 1G4CA 3HT0A 1HQ2A 3HSDA 3KUGA 3MCOA 4M5IA 5ETRA 3ILIA 2F63A 3ILJA 4CRJA 1EQ0A 4M5HA 1DY3A 3MCMA 3MCNA 5ETPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RU2 A;  5ETQ A;  3UD5 A;  1RAO A;  2CG8 A;  3QBC A;  4CYU A;  4M5M A;  5ETT A;  4AD6 A;  3HD1 A;  5ETS A;  1Q0N A;  3HD2 A;  4M5L A;  3HCX A;  1F9H A;  1IM6 A;  3HSG A;  5ETK A;  1TMM A;  1RTZ A;  3KUH A;  4M5K A;  3HSJ A;  4M5J A;  4CWB A;  5ETN A;  4CYU B;  1RU1 A;  3IP0 A;  1KBR A;  3HSZ A;  2F65 A;  2BMB A;  3ILO A;  2QX0 A;  4M5N A;  3UDE A;  1EX8 A;  1HKA A;  5ETO A;  3ILL A;  5ETV A;  1EQM A;  4PZV A;  1TMJ A;  3KUE A;  4M5G A;  4F7V A;  1CBK A;  5ETL A;  5ETM A;  3UDV A;  1RB0 A;  1G4C A;  3HT0 A;  1HQ2 A;  3HSD A;  3KUG A;  3MCO A;  4M5I A;  5ETR A;  3ILI A;  2F63 A;  3ILJ A;  4CRJ A;  1EQ0 A;  4M5H A;  1DY3 A;  3MCM A;  3MCN A;  5ETP A; 
#chains in the Genus database with same CATH topology
 2QLX A;  5KFQ A;  3WX8 A;  4GKK J;  3KK3 B;  1HBU B;  2Z2L A;  3M2R B;  4I67 A;  1L3K A;  1SPB P;  4CTA A;  2VBY A;  4X62 F;  3M2U B;  4ZP6 A;  1U2R A;  4ES3 A;  1S0O A;  1FO1 A;  2APO A;  4ZCL A;  2CQB A;  3DRR A;  3MCN A;  1S9E B;  1AB8 A;  2UV8 G;  3N79 A;  4ILM A;  3T9Z A;  3CT9 A;  4KAI A;  1L3T A;  2IM3 A;  1D9F A;  2DGU A;  2KG0 A;  2CPH A;  5KG4 A;  2G0J A;  1TKT B;  2EKY A;  3CCR S;  4A8X A;  3G8T A;  2ACM A;  1U0S A;  2VPW B;  3KUH A;  4DSF A;  3MEC B;  4A4J A;  4EYH B;  3PX4 A;  3Q8S B;  2FVR A;  3NS7 B;  1UPM B;  5T41 A;  2J8A A;  4DPT A;  3U7J A;  1XNQ F;  2LA6 A;  3CJ2 A;  3EUN A;  1TL1 A;  1NH8 A;  2EK6 A;  4AND A;  1LQ9 A;  1HD0 A;  1MNE A;  4RWW A;  3X3U A;  4G1Q B;  1EQ0 A;  2GJF A;  1E6Y A;  1VBX A;  3MTJ A;  2I2Y A;  4DUZ J;  3VGU A;  3ONQ A;  2BRL A;  4I2Q A;  4A8Q A;  3IMQ J;  4PWD A;  2QMW A;  1JLG B;  1I51 B;  2VD3 A;  1VJQ A;  2GIR A;  1YHQ S;  3TZY A;  2FB0 A;  1HNW J;  1Q7Y T;  2QMX A;  1YDL A;  1SUQ A;  2ZJR Q;  3W2W B;  4B3O B;  3RG6 A;  3V4M A;  1HR0 F;  5DG7 A;  4YR0 A;  1BE4 A;  1HWI A;  1U7L A;  1L3S A;  4CLL A;  2IA0 A;  2RUS A;  3KDN A;  3OUY B;  3G9C A;  2BXJ A;  4TU8 A;  3M6U A;  1PCA A;  1BQM A;  4HR2 A;  3I32 A;  5LJ5 Y;  3M6V A;  4PCQ A;  4NRT A;  2RHQ B;  5F3Z A;  1AZS A;  4JV5 J;  1FTC A;  3SV4 A;  5I3P A;  4NI2 A;  4F4Y A;  5A8K B;  1UVI A;  1Q4R A;  4Y3C A;  1JKH A;  4J9S A;  4M95 A;  2SXL A;  1C1C B;  4FF4 A;  3CJ0 A;  4ECZ A;  4F26 A;  1CLF A;  3CJ5 A;  4F02 A;  2QX0 A;  3C8Y A;  2C2E A;  1SCJ B;  4MKY A;  3HHL B;  1VRQ C;  3W63 A;  1WG5 A;  3GII A;  4DV7 F;  4BLG A;  3HSD A;  2W2M P;  4N7T A;  1KHW A;  4OZ2 A;  2OH2 A;  4CYU B;  3NBP B;  4MK7 A;  1ZPW X;  2FLN A;  1RAE B;  2GQQ A;  4I6A A;  5LT5 A;  1YBT A;  3MAA B;  4P74 A;  2XNQ A;  1WDD A;  3QO9 A;  2DNP A;  2VIH A;  3M30 A;  1RAH B;  1U8S A;  2KM8 C;  2IY5 B;  2ADC A;  4BS2 A;  2ZH4 A;  3KXD A;  2OEK A;  2MTL A;  2A6M A;  1VQY A;  3FBF A;  4Q2L A;  5IV4 A;  1M1H A;  2GHP A;  2LXF A;  4KO0 B;  2YKP A;  1TVR A;  4LJM A;  3PHT A;  1FJG J;  1HHS A;  4I56 A;  3W60 A;  2LXI A;  5ETP A;  1NPK A;  4FZV A;  4QWA A;  5F9L A;  2IJF A;  2UU9 F;  4CO3 A;  3I0S A;  4LRD A;  1VR6 A;  1R8H A;  4DCP B;  3T5H A;  2BW2 A;  2I6W A;  2HHH F;  2BAN B;  4ES2 A;  4FP9 A;  4OX9 J;  2DHS A;  4Y2M A;  1HNI A;  2KJV A;  3V4I B;  4K2X A;  3L95 X;  2VIC A;  3LAM A;  5IC6 B;  2EC0 A;  2HNZ B;  1SQG A;  4KFB A;  4ZJL A;  5KFC A;  4O4R A;  4PXC A;  2FVC A;  1M90 T;  2HVZ A;  4NCG B;  2UVU A;  1RWP B;  3DOM B;  3JTO A;  1FWK A;  2VV5 A;  3IWL A;  4ZVP B;  3Q2T C;  1WKL A;  1YX2 A;  3BO2 A;  4H4O B;  1HI1 A;  1SC1 B;  1JLE B;  3LOU A;  4UY8 5;  2ZBR A;  1KHV A;  1L3V A;  1WNE A;  1HIY A;  3ZFV A;  2WBM A;  5KFY A;  2YNH B;  1P9Q C;  1B64 A;  2CQ1 A;  4TY8 B;  4PUO A;  2VZ9 A;  2FGO A;  1WOO A;  2UZA A;  3HCX A;  3TVZ A;  1B0V A;  4M5J A;  3NGU A;  5HMX A;  3OLA A;  5KOW A;  3QAE A;  1U26 A;  1NRK A;  1UTA A;  4K0K F;  3QT7 A;  3DOL B;  1Q79 A;  3MUR P;  1VQM S;  3IO1 A;  3DOK B;  2IRU A;  4NLX A;  3O8W A;  3GFX A;  1XR6 A;  2QL7 B;  2QA4 G;  2HW3 A;  1V5V A;  3I5C A;  3U1M A;  2MZ1 A;  2B7C B;  3KK1 A;  4J9Q A;  4ED4 A;  2AJ4 A;  4DV1 J;  5AT1 B;  3FSY A;  4DR5 F;  1HHQ A;  1HD1 A;  2R7X A;  3KLH A;  1V6H A;  2LQB A;  4X62 J;  4C8L A;  4KKO A;  2D3U A;  5FDL A;  3V6H A;  5CD4 H;  4Y2K A;  2H9Z A;  2BV3 A;  3HHN B;  1JX4 A;  5HMY A;  5DM7 Q;  4WFZ A;  4HH1 A;  5ETQ A;  1XJW B;  2DH9 A;  2XWY A;  1RT7 A;  5CQG A;  4OYM A;  1OYE A;  1FD8 A;  3GPA A;  1YJN S;  4RW9 B;  2UUT A;  3MCO A;  5EUH A;  3DU5 A;  3KK3 A;  3CJQ A;  3QWU A;  2EEY A;  3CDA A;  4EUV A;  1HBU A;  4PYD A;  3M2R A;  3LP2 B;  4NLT A;  2VAS A;  4WCE Q;  2I5J B;  5KT2 A;  3M2U A;  1S6P B;  3MMC B;  1EAR A;  3UI3 A;  3A1Y G;  1NJZ A;  1S9E A;  2X1B A;  1FRJ A;  3GIL A;  2D1C A;  5U47 A;  1OJ4 A;  2KKH A;  2M5Y A;  7AT1 B;  1TKT A;  1M5H A;  1JLC B;  3A8K A;  4M5H A;  4YP3 A;  4O3P A;  4AD6 A;  3MEC A;  1IJE B;  1UCN A;  1K44 A;  3VAI A;  2D9O A;  4JI8 F;  3RBE A;  1CBK A;  2BUN A;  1BQN B;  3N5B A;  4XDC A;  4KV8 B;  4ED0 A;  3PW2 A;  3H5S A;  2YX1 A;  4C2M A;  1FNM A;  4CLT A;  2BM1 A;  4G1Q A;  1AT1 B;  3MDF A;  3J81 Y;  1K8A T;  5D4P A;  2C2O B;  1UVK A;  1S59 A;  2G0C A;  3DXB A;  4L72 B;  4F0H A;  1PIE A;  3RBZ A;  1F9F A;  1JLG A;  1FJ7 A;  1A9N B;  1UKU A;  1IR1 A;  3MF5 A;  2VKR A;  3W2W A;  4B3O A;  2YWE A;  3HK2 A;  1N5S A;  1FD2 A;  1W25 A;  1WG1 A;  2M2B A;  3OUY A;  3V81 B;  3FMW A;  3CCM S;  4KC5 A;  3AB4 B;  4TVA B;  4DV7 J;  3BS9 A;  5EWF A;  1NM2 A;  2AJQ A;  5CHC B;  2CWK A;  1SJ3 P;  2C3O A;  1BC6 A;  3C46 A;  4N77 A;  2B4U A;  4F4X A;  1X5S A;  3GV5 B;  2Z2Z A;  5A8K A;  3ICL A;  3ZTP A;  1KWM A;  3BH7 B;  1CQM A;  2AZ3 A;  1LW0 B;  1C1C A;  2BKO A;  4KQZ A;  1ZM4 A;  3HHL A;  4X4T A;  2AV5 A;  1MWY A;  1VFJ A;  2NQP A;  2J0S D;  2HIQ A;  1U09 A;  4CRJ A;  4MIW A;  2JJ4 D;  2QRR A;  4MIA A;  4CYU A;  2G13 A;  1X4E A;  1DTT B;  5DQI A;  3K8W A;  1FX2 A;  4G65 A;  5F8H A;  2ZUA A;  1WG4 A;  3MAA A;  3I5B A;  5LJ3 Y;  5CYQ B;  3DRP B;  1GX5 A;  3NNH A;  3CJT A;  3VGV A;  4KIA A;  2RF2 B;  2LP4 A;  4LF6 F;  1IKX B;  2EBG A;  5FD1 A;  1BY9 A;  2B0G A;  2CQ4 A;  2ZFH A;  3MPD A;  4E8U A;  4GVB B;  4KO0 A;  3K89 A;  2B8Q A;  1FXL A;  4DX5 A;  3CJS A;  2CQC A;  3VAK A;  2XYG B;  3QT6 A;  3J81 U;  3D6F B;  1NO8 A;  5HK4 A;  1ZZN A;  2KRR A;  4ED8 A;  1UFW A;  3FK4 A;  3CJ8 A;  4LMZ A;  4ANE A;  4FF2 A;  3D1H A;  3D5M A;  2BAN A;  4HT7 A;  2J0Q D;  4N47 A;  4NLO A;  3LWM A;  3PYG A;  4HT5 A;  2VPY B;  5L9N A;  3HUL A;  2DIV A;  1FWL A;  2RT3 A;  3V4I A;  4J9M A;  3PIO Q;  2E1A A;  2DNN A;  4M5M A;  2HNZ A;  2RUG A;  4IFV B;  3CIZ A;  3J80 Y;  3OTO F;  4P72 A;  4YB5 A;  4K0K J;  1S77 D;  3MTK A;  3T1H F;  1QTM A;  4NCG A;  3DOM A;  2Y8W A;  1CJT B;  1CG2 A;  3JS9 A;  4H4O A;  2J7U A;  2Y0S D;  3BB5 A;  5K20 B;  2V2Z A;  4P2X A;  1JLE A;  4Y2A A;  4J9K A;  4QPT A;  2W2P P;  4YS2 A;  3TUP A;  2XMA A;  2YNH A;  3H8Y A;  3MUM P;  4TY8 A;  4LF8 F;  3CB4 A;  2Q66 A;  1WEL A;  1FRH A;  1XC9 A;  2I0X A;  3NGK A;  3ZO7 A;  4HI1 A;  5F41 A;  3DOL A;  4URG A;  5MLC V;  3DOK A;  3THV A;  5KFF A;  2M4M A;  1RYR A;  5D0R A;  4FYY B;  4ZP7 A;  3VZI A;  3KTQ A;  1UET A;  2YH0 A;  1XNR J;  2HEK A;  4AL7 A;  3V5R A;  1WD6 A;  1T9U A;  4RW8 B;  4KH1 B;  1HQE B;  5LMN J;  5M2P A;  1DRZ A;  1SL0 A;  2HWI A;  3LPE A;  4F0M A;  5GAD I;  1G2E A;  4ETX A;  2RRN A;  4PEO A;  2W9B B;  1F2G A;  2Q79 A;  2OPR B;  2ZHB A;  2HQ3 A;  5K8O A;  1VI7 A;  4RPF A;  3DLB A;  1K1Q A;  2MZR A;  4K59 A;  3K2Y A;  1XK8 A;  4ZLL A;  1U6Z A;  4RW9 A;  4UTG A;  2CJQ A;  3BPD A;  1FKA F;  2B7B B;  4XO0 A;  4WKY A;  4F04 B;  5IV3 A;  3LP2 A;  2E1C A;  2I5J A;  3M9O B;  1S6P A;  2I8E A;  3MMC A;  2E1M C;  4ID8 A;  5FLX Y;  4JI8 J;  4LF2 A;  2HQG A;  1KQK A;  4CCH A;  3MI7 X;  4UW2 A;  2QYG A;  4QIW D;  2VON A;  2DHG A;  1BMQ B;  2MKH A;  3P45 B;  2E5H A;  4DV2 F;  1TU0 B;  3GU0 A;  4J9N A;  1Q53 A;  3TQ1 A;  2F9D A;  2KYX A;  2P6T A;  1JLC A;  1WEY A;  3R9L A;  1NH7 A;  3PXG a;  3TAP A;  8ATC B;  4YN3 B;  3MM9 B;  4RUB A;  4DS5 A;  2FY8 A;  5BYQ A;  2FZC B;  2XHC A;  1MU2 B;  3MR3 A;  4FYD A;  1BQN A;  3B6B A;  4KV8 A;  1BUX A;  1RKI A;  1TP7 A;  1T9V A;  2Q6C A;  4F0K A;  2A10 A;  3OFE A;  2UXD F;  3NWR A;  5DET A;  2ZH1 A;  3PNI A;  4DCO B;  4LRF A;  1MLA A;  2CAD A;  4ZP8 A;  1RHU B;  3TEH B;  3C2P A;  1FXD A;  4JV2 A;  1B7Y B;  4MKA A;  5ETO A;  1H2U X;  4DUT A;  4WZQ A;  4LF4 J;  1HHT P;  4CNY A;  1Q86 T;  2BQU A;  1DQ8 A;  2ZNZ A;  6FD1 A;  2HHW A;  3PJW A;  1QY7 A;  2HS0 A;  3PRV A;  3FEX B;  2QZ8 A;  4F8R A;  1X4G A;  4ZKA A;  3V81 A;  2ZHO A;  2RIJ A;  1Y3K A;  4H4K C;  3V6J A;  4DWI A;  1NLK L;  1Q81 T;  2CVE A;  3BGF A;  5L1I A;  3WIU A;  1TK5 A;  4R8U B;  3RU0 A;  1K0T A;  4FS2 A;  4OL8 A;  2HFZ A;  4FYX B;  2F5G A;  5KFK A;  3NWG A;  3RB3 A;  1Q8B A;  1PJ6 A;  3UNG C;  3C3L A;  3OVS A;  1NEE A;  2XCP A;  1LW0 A;  3K8V A;  3ILO A;  1NKC A;  3RR8 A;  3AXK A;  4Q8E A;  1Y5N B;  4A48 A;  1RLC L;  3CCZ A;  4OHZ A;  2CVI A;  3D67 A;  3FEZ A;  5HP1 B;  2C1E B;  2QGF B;  4PG4 A;  3OD2 A;  1FKO B;  2J5A A;  3GR1 A;  1WF0 A;  3NMA A;  4DL0 C;  2V8H A;  4N76 A;  2I38 A;  4X4V A;  1DTT A;  1Y10 A;  4X64 J;  4Y28 C;  2Y0B B;  4KR0 B;  2GZO A;  4O44 B;  5B0F A;  1EB0 A;  3EVO A;  4DPU A;  1NPP A;  3V2U C;  4PAB A;  3D68 A;  2FJW A;  5DRK A;  3NMR A;  5CYQ A;  3CJR A;  3DRP A;  4LFA J;  3THT A;  4F7V A;  2UXB F;  3E51 A;  1CUL B;  1NHV A;  3WC0 A;  2RVJ A;  5D78 A;  4K4W A;  1IKX A;  5KFW A;  1R43 A;  4IOC Q;  4HDH A;  2DCU B;  1NDC A;  1YRX A;  3DGV A;  4GVB A;  2C22 A;  2H3E B;  1U1N A;  1EKR A;  3BDE A;  3OTO J;  3KHG A;  4EMD A;  1N5Y B;  1T95 A;  3T41 A;  1RDR A;  3R1L A;  3LO3 A;  1VQO S;  2HRT A;  3M8W A;  2XSF A;  4ZJO A;  3M32 B;  5HLF B;  3DKD A;  1ZAX A;  2K7J A;  4I7F B;  2XCA A;  1RTI B;  2ZH3 A;  1QAI A;  1NAQ A;  1U6F A;  3RB6 A;  4M5D B;  4LF8 J;  1B70 B;  1UA0 A;  4LF1 A;  3GZ7 A;  2OPQ B;  4YHH J;  1N88 A;  2R7O A;  4IFV A;  3JSB A;  5KFJ A;  5E2Q A;  4E98 A;  3FCW A;  3F0N A;  2ATL A;  1CJT A;  4J7C A;  3UFC X;  5GAD U;  1P8G A;  1TL3 B;  4CH1 A;  4U7U D;  2NZ4 A;  5A76 A;  2J9D E;  3R5G A;  1RHR B;  4WZM A;  1DTQ B;  3JQJ A;  5G0R B;  1Y5I B;  2BYC A;  3MM8 B;  2WRM A;  3PX6 A;  2JVR A;  3HSJ A;  2N4C A;  1RUS A;  2KT3 A;  3H59 A;  1S6Q B;  1BWV A;  2DXE A;  1XTZ A;  4NWB A;  2FUG 9;  3NY0 A;  3CD5 A;  1UWB B;  3UR0 A;  4L74 A;  3NGT A;  3W7B A;  3R3T A;  4URQ U;  2MKS A;  5THW A;  3JB9 k;  2M88 A;  3ZZ0 A;  1G7C B;  2GQ2 A;  1TUW A;  2CAJ A;  2OSQ A;  4ZIW A;  4P75 A;  3I4H X;  3G82 B;  4RW8 A;  2BZ2 A;  1EZZ B;  4L76 A;  1HQE A;  1VHF A;  2NZC A;  4NA2 A;  2Q1L A;  2VPZ B;  3IN5 A;  2W9B A;  5KFE A;  4NCA A;  1HBO B;  2ZC3 A;  3K0J A;  2OPR A;  4NA1 A;  2JC0 A;  1XMQ F;  3LUY A;  1R7I A;  4ZVG A;  3SSR A;  5AE2 A;  3T1Y J;  1R8C A;  4OZL A;  5CZV A;  4ZHR B;  2FC9 A;  1JJC B;  2HLU A;  2KDO A;  2COL A;  3OQ2 A;  1Z4U A;  2HRU A;  3ZXW A;  2X7I A;  4K5S A;  2LXU A;  2E7V A;  1S7H A;  1IBK F;  3BM7 A;  2UXD J;  5D8H B;  3BR9 A;  2VUG A;  3B54 A;  4FXD A;  2WW4 A;  3D0I E;  2LYV A;  1SI9 A;  5DDO C;  4FPI A;  3M6X A;  5L1K A;  4FDF A;  1D0E A;  4JI2 F;  1MU2 A;  1TZ0 A;  1X0P A;  3CNQ P;  2HLT A;  1YZ7 A;  3LP0 B;  4OYA A;  5KFI A;  2E7X A;  1KC8 T;  3KLG B;  5GME A;  3W8P A;  4CLP A;  4JYA J;  2HQD A;  2W4P A;  2UXC F;  4Y6I A;  4ECV A;  3AT1 B;  4WF9 Q;  4JI7 F;  2RDI A;  4C8K A;  1WC3 A;  2E44 A;  3C66 A;  1UAW A;  2KVQ E;  2GAG C;  3G71 S;  1B4S A;  1F60 B;  3DRS B;  1YIJ S;  3HX9 A;  4B9M A;  3H40 A;  1VQK S;  2H5I B;  1P1T A;  3GYG A;  4TXS A;  2PSZ A;  4P10 A;  2QL5 B;  5CCL A;  1YG0 A;  3FDS A;  1TTH B;  1P27 B;  5HRO B;  1O51 A;  4DI6 A;  2V8P A;  4R8U A;  3AD7 C;  2ASY A;  3PVX A;  3BQ0 A;  3PW0 A;  3ITH B;  5KG2 A;  3NCQ A;  2V6A A;  3RRK A;  1RWX B;  2F4F A;  2WVF A;  1IBM F;  3CCQ S;  1N5T A;  2AHO B;  4DQI A;  4G6V B;  3CED A;  1U2C A;  2RRB A;  2CJB A;  1NHK L;  2DCL A;  1VJW A;  4P71 A;  1LEO A;  3I9V 9;  4QWB A;  1LFW A;  3ILL A;  4CH7 A;  1RI7 A;  4RR5 A;  4ENO A;  5C24 B;  1BWE A;  4X4N A;  1F1B B;  5HP1 A;  4BCA A;  4F2R A;  3TOQ A;  5D0G A;  2I1R A;  2M9K A;  3HSG A;  2HHV A;  4QR1 A;  1BD6 A;  2BKN A;  1IBC B;  4ED1 A;  3R6G B;  4L75 A;  1Q78 A;  4O44 A;  2CPJ A;  1RKJ A;  5KT7 A;  2GO9 A;  1YKW A;  1CUL A;  4F67 A;  1R8A A;  2CA9 A;  5HL7 Q;  4CP5 A;  2FHM A;  2MGZ B;  3WDO A;  3FBB A;  4LRA A;  1UVM A;  2QL9 B;  2HZA A;  1VQS A;  4ILL A;  3H25 A;  1N5Y A;  4CLS A;  1LKZ A;  5DGA A;  3CWJ A;  3DFE A;  4DEZ A;  2YWH A;  2VJU A;  2XUL A;  1S0M A;  3M32 A;  5HLF A;  2J0W A;  5I3U B;  1Z2Z A;  4I7F A;  1RTI A;  4RWX A;  1N5V A;  3F41 A;  4ZVF A;  4UOG A;  1N6Q B;  4M5D A;  5HQ8 A;  2GML A;  1XIQ A;  1NK6 A;  4FVC A;  1X60 A;  3D28 A;  4GC7 A;  2OPQ A;  5AJ3 F;  3A3P B;  3M9N B;  1SL2 A;  3SCK E;  4NLW A;  2CPZ A;  4HDG A;  1NBE B;  3Q8R B;  1KS2 A;  3ULH A;  4WFY A;  2B4V A;  3JAM Y;  1JB0 C;  3D6H B;  4CO2 A;  1TL3 A;  4LFB F;  2DO4 A;  1DBD A;  2IM0 A;  3MR7 A;  4OHW A;  5CYJ A;  2AQ4 A;  1DTQ A;  5G0R A;  2QIF A;  3PO5 A;  1JQG A;  3MM8 A;  2J0X A;  4EBC A;  4OYB A;  2JWN A;  2MY8 A;  1HA1 A;  4LQ9 A;  3PY8 A;  1JNR B;  2HQI A;  1S6Q A;  4OI1 A;  2GVZ B;  2Z58 B;  2IA6 A;  3DI6 B;  3UPF A;  4LF5 J;  3RUB L;  3GJR B;  3TUZ C;  1IVZ A;  3OV7 A;  2WZ1 A;  4Y2C A;  1UWB A;  4DUY F;  2HZC A;  1PO6 A;  2CJK A;  1S6U A;  1RA7 A;  1XMQ J;  1AUS L;  5DDP C;  2MYF A;  1CC8 A;  1FKP B;  3H4B A;  3BYR A;  1S79 A;  3OPK A;  4DV5 J;  3NGS A;  3HLU A;  4JP8 A;  1C0U B;  3OR2 B;  3G82 A;  4LSZ B;  2LDY A;  2HHQ A;  4BBY A;  1HMV A;  2XNR A;  3K59 A;  4D3H A;  1DQ9 A;  2V2K A;  4ZK7 M;  5LSL A;  2XY5 A;  1GXU A;  1ACM B;  1HBO A;  3MCS A;  1YJU A;  3K5L A;  1HNV B;  4MFB B;  3IFE A;  2BAB A;  2YWW A;  1C0T B;  3CXC R;  2HZV A;  3MWB A;  5KOX A;  2XMJ A;  5HMZ A;  4ZHR A;  1WSV A;  1YIT S;  1YJR A;  1WDT A;  2E29 A;  4WWS A;  4DV4 J;  5BJR A;  1GAO A;  2KRB A;  1RA6 A;  2W2N P;  1S1V B;  1LK5 A;  4JI2 J;  3A4T A;  2DGS A;  2W24 A;  1UVL A;  5EDW A;  2R9L A;  4N8O A;  2XMT A;  1QSL A;  5K8N A;  2BM0 A;  3OT9 A;  2ABY A;  3O3L A;  4KPC A;  4PZV A;  1K0V A;  3CC7 S;  5A2Q U;  4JI7 J;  1JLQ A;  2R4F A;  1FK9 B;  2M8H A;  4PG7 A;  1NJY A;  3UD5 A;  1GH8 A;  3H5U A;  4OJ1 A;  2ZDO A;  1JMT A;  2V94 A;  1CS4 B;  4HI2 A;  1YRT A;  4OYP A;  3SSS A;  4DU7 A;  2AT1 B;  5D15 A;  4UF4 A;  3AOD A;  3LP0 A;  4MH8 A;  3KLG A;  1RT2 B;  5BR8 F;  3M8P B;  1SIW B;  4IG3 B;  1VGY A;  1BLU A;  2OTL S;  1UEU A;  1GTH A;  4RZR A;  4R25 A;  1TK8 A;  3FMB A;  2PEH A;  5E3Q A;  2FHK A;  2ZVI A;  4FNI A;  2EFO A;  1Q16 B;  2X3G A;  1FNX H;  3P3D A;  2AKW B;  1IBM J;  3SFU A;  3UDE A;  1SVD A;  1GMW D;  1U0H B;  5C25 B;  3NAI A;  1DLO B;  1OS5 A;  2FTR A;  3DRS A;  4ZDN A;  2AJF E;  4M94 A;  2KTQ A;  4I2P B;  4GVL A;  5B0D A;  3SI8 A;  2B4P A;  2P9G A;  4M5K A;  1H2T Z;  3K7R A;  2IJN A;  4OV1 A;  3HM9 A;  5HRO A;  1V3Z A;  2AGQ A;  2YNI B;  5HBM B;  4DZD A;  3ITH A;  4UOF A;  4C8O A;  1SJQ A;  2ASL A;  2AYE A;  4DR1 F;  1MG7 A;  2ZEJ A;  4ID5 B;  4KHR A;  3Q8P B;  2IDL A;  2HHS A;  4CNZ A;  3M05 A;  1OY6 A;  3VVU A;  4QWD A;  1Z1Z A;  2C3Y A;  3I87 A;  2FHJ D;  2JEJ A;  3VAH A;  3UN5 A;  5C24 A;  5KFA A;  2EI5 A;  2DGQ A;  4CM0 A;  1OQ3 A;  3EJM A;  1FEE A;  5AXM A;  2HFN A;  1URN A;  3Q8Q B;  4FF3 A;  2CWX A;  1KEK A;  2PA3 A;  3ETO A;  4QYZ K;  4WFN Q;  2XG8 A;  3TO8 A;  1S49 A;  4B3R F;  5ETK A;  4C48 A;  5L1J A;  5KT4 A;  3ZZO A;  2CRL A;  3DXS X;  4QR0 A;  1HPZ B;  3MM7 B;  4ERD A;  3RRH A;  4DQQ A;  2CG8 A;  2ROE A;  1XMO F;  1CJU B;  1S1W A;  4X4U A;  3CCU S;  1KOO A;  3D6M B;  1S72 S;  1ELO A;  2MKY A;  3QZ7 A;  3PEJ A;  4KHM A;  1UP1 A;  1SJ4 P;  5GAH I;  5KT6 A;  4USJ C;  5AJ3 J;  1HNZ J;  1NSP A;  2RDJ A;  5LL6 d;  2HHU A;  1FRM A;  1R6V A;  3Q8Y A;  4NEY A;  4A47 A;  2HHX A;  3ZTQ A;  4LFC J;  4LFB J;  1UW9 A;  4YB6 A;  4BWJ A;  3R5C A;  4GO7 X;  2Q6B A;  2FJB B;  2DR6 A;  1QD1 A;  4DV6 F;  1VC5 A;  1SC4 B;  4ZVR B;  2JHE A;  1MRO B;  4KRW A;  2B9E A;  3T3F A;  2ASJ A;  1N6Q A;  3LGM A;  4F50 A;  2FQQ B;  1IM6 A;  1WF2 A;  4EO6 A;  3DU6 A;  1HFE L;  5JXS A;  3GIJ A;  3TVY A;  1NPR A;  3CCW A;  2ROG A;  3KMQ A;  1PYS B;  3KFW X;  2E5I A;  1S97 A;  1TKD A;  2ZH9 A;  4CLW A;  3MR6 A;  1IM4 A;  2DGW A;  1H38 A;  5AXK A;  3VAG A;  3LAL A;  5IFM A;  3OFG A;  1CJV B;  3BKF A;  3MD1 A;  2KHD A;  2XI3 A;  5ETL A;  2P5V A;  2WSF C;  2IVF B;  3L09 A;  3QWP A;  1YBA A;  1SJF A;  5GVQ A;  2VJV A;  4GKJ J;  1ZTW A;  3FQL A;  3BGR B;  4QU7 A;  2AX1 A;  5CA5 A;  3DI6 A;  4QIE A;  4N8N A;  1UZH A;  5M2R A;  3T19 A;  2XY6 A;  5IT9 Y;  3A13 A;  2WSC C;  1IR2 A;  3MUV P;  3PDN A;  2HS4 A;  1WHX A;  2LKZ A;  3N4W A;  3K17 A;  3LGN A;  2PA8 D;  1FKP A;  5GMD A;  2F7V A;  2HWT A;  1HKA A;  4IFY B;  3MPW A;  2GJ2 A;  1EP4 B;  1C0U A;  3W9H A;  3OR2 A;  2B3T B;  2W7P A;  1NHU A;  3TX8 A;  4DDF A;  2EFV A;  1ROF A;  3UDC A;  5B08 A;  1SB6 A;  1W2B R;  1GK8 A;  3DLH A;  3DGP B;  4LRC A;  3TX0 A;  5KG0 A;  2CQI A;  2ERR A;  3NNA A;  4CH0 S;  4HTJ A;  2QFJ A;  3MM6 B;  5KFB A;  4YDD B;  1T7P A;  4O4G B;  4PAA A;  4K2J A;  3O5T B;  1HNV A;  4MFB A;  1C0T A;  4RUC A;  1JXE A;  1EET B;  4WXO A;  2RU3 A;  1PYO B;  5IS2 A;  3EYZ A;  1S9F A;  3EGZ A;  4JI6 J;  1XR5 A;  1S1V A;  4PKD B;  1ZOT A;  2ZOM A;  5F8J A;  2QE5 A;  2F65 A;  4OZJ A;  1Z2L A;  2R7Q A;  1UFL A;  2PII A;  5LSO A;  5BR8 J;  2Z0G A;  4DL6 A;  4UZC A;  2DJW A;  1ZM2 A;  2NPI A;  1N0U A;  5A6W A;  5GAG I;  5J2M B;  1WHY A;  1MSW D;  1FK9 A;  5H9F K;  1H2V Z;  3BV8 A;  3IR7 B;  2OFH X;  2DHA A;  3FEY B;  4AYB D;  1LXN A;  1CS4 A;  3PW5 A;  4B3M J;  1Y9O A;  2B5J B;  5A8W B;  4OI2 A;  3PO4 A;  3GCW P;  4PPZ A;  2GIQ A;  3GSD A;  1X9W A;  4HHJ A;  3H5Y A;  1RT2 A;  1T02 A;  3M8P A;  4IG3 A;  1UVJ A;  3EVW A;  4KHP F;  1T9W A;  2R8H A;  3ZNU A;  4DSL A;  3FRY A;  1H7W A;  1REV B;  5KFR A;  1ZPV A;  1YSJ A;  3N5F A;  3EZO A;  2HFS A;  3OW2 R;  2VQF F;  2EFQ A;  3BN7 A;  4OIX A;  4C8M A;  5H9E K;  3RW6 A;  1U0H A;  5C25 A;  1RCO B;  3HFZ B;  4UQT A;  1SJR A;  4Z2X A;  1DLO A;  2CNO B;  4OFZ A;  2GFF A;  2HK3 A;  1IBL F;  4I2P A;  4DR3 F;  3QRQ A;  4NLY A;  2BJ9 A;  3F56 A;  3ENV A;  3MAQ A;  3BQ2 A;  1A0O B;  5KFD A;  3U02 A;  3RB0 A;  2MDA A;  3OTD A;  2YNI A;  5HBM A;  4OHX A;  3EWG A;  3K5O A;  2K1R B;  3RTV A;  3NGD A;  1TV6 B;  4ID5 A;  4RJV A;  1VRT B;  4DBQ A;  1U48 A;  4F3O A;  1NB7 A;  3TRG A;  2OEJ A;  1B0P A;  5B09 A;  2HGL A;  3KJN B;  4IOB A;  1XMO J;  4EU0 A;  1NU4 A;  3PW7 A;  3UVJ B;  1KLN A;  2OML A;  4TYB A;  3QIP B;  3LTO A;  3IRX B;  3P6Y C;  4F25 A;  4JI4 J;  4X4P A;  7FD1 A;  4PR6 A;  3GLJ A;  2BDP A;  2MLY A;  2XO6 A;  2V69 A;  2IJR A;  5L9X A;  4NCB A;  3MCM A;  2MZQ A;  3HKW A;  5HJX A;  2DT9 A;  2N3L A;  4MK9 A;  4KGZ B;  2OMO A;  2RQM A;  1HPZ A;  4DZ6 A;  3MM7 A;  4F3Q A;  2XLJ A;  2B9Y A;  4EWT A;  1OWX A;  1D9A A;  4FKX A;  1VS3 A;  3OFH A;  4DV6 J;  1VQ8 S;  1CJU A;  3GSI A;  3K58 A;  2RS8 A;  2M3D A;  2CPE A;  2GV1 A;  2QTW A;  2KFZ A;  3OVA A;  4RNN A;  5JMN A;  2AJ0 A;  1W26 A;  1XBW A;  3PFO A;  1U25 A;  3V6D B;  1T9Y A;  2F8E X;  4C7Q A;  1RWV B;  2V4R A;  1FI4 A;  2BQR A;  2C2M B;  2YVS A;  4WP3 A;  2D69 A;  1NJX A;  3AOA A;  4ETZ A;  3KJQ B;  2D7S A;  1JNZ B;  2DTJ A;  3QAT A;  4RO0 A;  1AFI A;  3DHX A;  5E3R A;  1MRO A;  3J7A 1;  4KH0 B;  2UUC F;  2BE7 D;  1LWF B;  5E41 A;  3QFW A;  1NK4 A;  3TZW A;  5B0C A;  2DIS A;  4TQR A;  3TW0 A;  2HVH A;  3CIM A;  4DHV A;  3TA0 A;  4D3G A;  2VG7 A;  3G8Q A;  2ZH8 A;  3CDB A;  2XYP B;  5LOQ A;  2UUA F;  4NZ0 A;  1GEH A;  3T5J A;  2MKI A;  1CJV A;  1VIO A;  3FNN A;  4ELT A;  1ZET A;  3OL9 A;  2RAQ A;  2J6U A;  3GG0 A;  2DR7 A;  1UWA A;  4QYR A;  1S0V A;  2E7W A;  1U8W A;  1BGX T;  3MD3 A;  1W2I A;  2HND B;  3BGR A;  4HVZ A;  4YR3 A;  1FRL A;  4C4W A;  1Y0H A;  4AL5 A;  4O23 A;  2UV8 A;  2WSE C;  2V63 A;  2XBP A;  2UUB F;  2PN6 A;  2ZBP A;  3GFH A;  3G86 A;  3QID A;  5K8P A;  1TQL A;  5GAG U;  4DR2 F;  4IFY A;  5HSP A;  4JI1 F;  3FRZ A;  1SKS A;  2GMH A;  1EP4 A;  3J81 j;  4EFA C;  3FGV A;  1I1G A;  4MAK A;  3ZZY A;  2HWH A;  1URR A;  4IH6 A;  5G4D A;  1FJC A;  4ZPA A;  3NL0 A;  4ECS A;  4LRE A;  4ER8 A;  4GO5 X;  1CC7 A;  3R1H A;  2IRX A;  4IG0 B;  4R0E A;  1IUJ A;  1VRU B;  3MM6 A;  4O4G A;  1EET A;  1SJ1 A;  2VQE F;  2ZD1 B;  1RP5 A;  1YJ7 A;  4YB7 A;  1M5P C;  3NLC A;  2YQ0 A;  4RLE A;  3TA2 A;  4WKR A;  1YBU A;  3CC4 S;  3Q2S C;  2VC1 A;  1QDU B;  5E33 A;  1RWO B;  3AOC A;  2JH3 A;  3EDQ B;  4USK A;  4C98 A;  3VAF A;  1KD1 T;  4DFK A;  4WU2 A;  4YDX A;  1P9Y A;  1CQN A;  2HBY B;  3I5A A;  4ED6 A;  3D6T B;  4DL4 A;  3E2E A;  2HBR B;  3G8S A;  4DV3 J;  5J2M A;  2WON B;  3W9J A;  2KM8 B;  3W64 A;  4UT4 A;  1RWN B;  4EO8 A;  3HO1 A;  3T5K A;  5D0E A;  1R8B A;  2BJ8 A;  2VQF J;  3C14 B;  3W9I A;  2B4O A;  2B5J A;  1MMD A;  5A8W A;  5JVH Q;  3E3X A;  4Q8F A;  5CCM A;  3OL7 A;  2F9J A;  4JBC A;  2ASD A;  1J5E F;  1SQE A;  1FES A;  4NL5 A;  4JI3 F;  1H6K X;  4LBI A;  1NK0 A;  4DR3 J;  1Q8L A;  2EG2 A;  2VFS A;  3GB0 A;  3EZU A;  3D3C J;  2BJ7 A;  1RAO A;  2V34 A;  2OFG X;  3DCA A;  1ITP A;  2DPJ A;  1QVF R;  4OZ5 A;  3O44 A;  1REV A;  3OSP A;  2NSC A;  1U02 A;  3MMB B;  2JEI A;  3TJA A;  1DFD A;  2Z8Q A;  1RSC A;  2XMV A;  2PGC A;  2HQF A;  2V8G A;  4A8W A;  3BSO A;  4OYZ A;  4ZVS B;  4A8F A;  4KT0 C;  3P5B P;  3QPI A;  1MW7 A;  4EGL A;  3UNY A;  3X1L B;  2E9R X;  2Y8Y A;  3UE2 A;  2B6A B;  4A8O A;  2V9W A;  1XMB A;  1RWK B;  4BHQ A;  3VGT A;  4M5L A;  5CZX A;  2J9C A;  1M5V C;  4F4A A;  4L73 A;  5KFM A;  4FS1 A;  2K1R A;  4Y34 A;  1X7V A;  2MQQ A;  3HVA A;  1I6J A;  2NLW A;  4EYI B;  3FCH A;  1VRT A;  4YR2 A;  5J2Q B;  5KFT A;  1IKY B;  5L38 A;  3SQO P;  1XEZ A;  2DNZ A;  2IDE A;  3UVJ A;  3N0V A;  3GCX P;  1RAF B;  2NXJ A;  4HKQ A;  1RAD B;  1H7X A;  2YKM B;  2YNF B;  3QIP A;  4IH5 A;  3IRX A;  5HAT A;  2FPH X;  4QU6 A;  5T14 A;  4NLG A;  1QAX A;  3C6U B;  3GJQ B;  4Q45 A;  4I1T A;  2N7Y A;  3H5X A;  3CUN A;  1T9X A;  4Y00 A;  3SDE B;  1ZM3 A;  1N0V C;  2AYM A;  1RT6 B;  3H2L A;  2KFN A;  2DXD A;  1B0T A;  1SH2 A;  4ES1 A;  2MZS A;  2XZT B;  2H1Y A;  3CUL A;  1C1B B;  3RZA A;  3S6E A;  5KFZ A;  4Q5V A;  3CJ4 A;  4WJB A;  5KG7 A;  4K4Z A;  3NS5 A;  2DEJ A;  4WP9 A;  4USU A;  4OX7 A;  3IC1 A;  3V6D A;  4DSI A;  5DS7 A;  1NJW A;  9ATC B;  3Q22 A;  1T05 B;  5ADZ A;  1F2H A;  4MTP A;  3KG1 A;  3MPU B;  4KYZ A;  4P7T A;  2XLI A;  3TP2 A;  2RDD A;  2QJ3 A;  1Y4Z B;  1TUG B;  3D66 A;  3LAN A;  2Y1J A;  3IGN A;  3HFK A;  4ZCI A;  3RBD A;  2GVD B;  1P6T A;  4ECT A;  1LWF A;  2Z2M A;  3QT8 A;  3MHY A;  1K1S A;  2D3O 1;  3IXQ A;  2FDN A;  4QZV B;  1M5O C;  2WVC A;  5DZ6 A;  4ZVE A;  2E9T A;  5IQ6 A;  1T0T V;  3BBF A;  2CQD A;  3ENA A;  7FDR A;  3JSR A;  2JLG A;  3PR4 A;  1VBK A;  1R89 A;  2NR0 A;  1YRU A;  3S1T A;  2VFR A;  4JI1 J;  2QV6 A;  2G4B A;  2GIF A;  4J91 A;  2GNK A;  4I6W A;  4FF1 A;  4HHH A;  4IQM A;  4DXL A;  2HND A;  2J6S A;  3SQG B;  2A1B A;  1FRK A;  3BDP A;  2MPU A;  2MHN A;  2F4V F;  4CO4 A;  2JRS A;  3FKB A;  4DN0 A;  4OJH A;  1JJ2 R;  2K3I A;  4F4Z A;  2VQE J;  4I4B A;  4S0M A;  2MKK A;  2EFN A;  2KXF A;  2J9E A;  5A0Y A;  1N33 J;  1PGZ A;  3IG1 B;  4DJB A;  3WZ0 A;  2C3U A;  4KJI A;  1RHQ B;  3L7U A;  1F3F A;  2X1G A;  4PWW A;  2E5L F;  1DJ0 A;  4IG0 A;  1VRU A;  1TR0 A;  5KFN A;  2LU2 A;  2WVB A;  2RKI B;  5ETM A;  1CSJ A;  3AB2 B;  4WXW A;  2ZD1 A;  2B9W A;  3B78 A;  3TA1 A;  2WK4 A;  3UN2 A;  4A8M P;  4U7U K;  2BA9 A;  2ZH2 A;  4BWM A;  2KH9 A;  1YVF A;  2AW0 A;  2P9E A;  1ZA2 B;  5DJB A;  2D3Z A;  1NDP A;  2POK A;  1JJH A;  4IUF A;  2AGP A;  2R7W A;  3WHI A;  1PAE X;  4OHV A;  2OPS B;  3FVY A;  2FD2 A;  4DFM A;  1VLY A;  2FLP A;  1VC6 A;  2YWF A;  1QSS A;  4CI0 B;  3IBC B;  2H4W B;  4KPY A;  3KLV A;  4I0W A;  4C11 B;  1XNQ J;  1F9E B;  4DFJ A;  2HFO A;  2WON A;  1HI8 A;  4LQ3 A;  2LQ8 A;  2YKO A;  5F3T A;  5AXL A;  3MEG B;  4JI0 F;  1M1G A;  3DC2 A;  4U8V A;  5E3A A;  5A6P A;  3C14 A;  3CMA S;  3C6T B;  4RNM A;  2VL1 A;  2MSS A;  2HVI A;  3CCT A;  1PG5 B;  1U1L A;  4DR6 F;  2BQ3 A;  4USH A;  1ZAV A;  1AXQ A;  3VF0 B;  3T1A A;  3AJ1 A;  5KFH A;  4JV1 A;  3OFF A;  1HR0 J;  1RB0 A;  1ULR A;  4DR4 F;  1WUU A;  2YPZ A;  3WX4 A;  1IWG A;  2GQC A;  1FFG B;  1YTY A;  3AD9 C;  1X9M A;  3CC2 S;  3TZZ A;  3MMB A;  2OI2 A;  1WF1 A;  2ZZM A;  2JFK A;  1BXN A;  3KG0 A;  4G3I A;  4J9L A;  2DKO B;  2WAQ D;  5JJB A;  1S6O A;  1MN9 A;  1OSD A;  3M7V A;  2W9C B;  3G6E S;  2QN6 B;  1FFW B;  3FUY A;  2MEW A;  2ZVS A;  3HD2 A;  1KQF B;  3J7Z 5;  4RW4 B;  1RBL A;  1SC3 B;  1MML A;  3C16 B;  4OX6 A;  2DH8 A;  3VQT A;  4B3T F;  3MED B;  2B6A A;  4ZS6 A;  3R5J B;  2L9W A;  1KDN A;  2AJ2 A;  2DNO A;  3M1V B;  4QW9 A;  1N56 A;  4ZLP A;  5AE1 A;  1JWW A;  1PYT A;  2N82 B;  3ENQ A;  3KLF B;  2W9A A;  2WB4 A;  1OIA A;  1ZBT A;  4IDK B;  5J1E B;  5J2Q A;  3WBZ A;  4K4V A;  2YKQ A;  1F5C A;  1IKY A;  3HVR A;  1S4F A;  4URS A;  4L6V 3;  2LMI A;  2CNK B;  1TKZ B;  5HVG A;  2YKM A;  2CYY A;  2XO7 A;  2YNF A;  3U1N A;  2GHW A;  4TY9 A;  2AWZ A;  3CDU A;  1ZH5 A;  3C6U A;  5RUB A;  2XY7 A;  5JVG Q;  4XK8 C;  2A2C A;  4AQY F;  4IRK A;  1K73 T;  3R97 A;  3KYL A;  5IT0 A;  4FXV A;  3SDE A;  4UY8 T;  3QGI A;  2HUR A;  1RT6 A;  2CQ0 A;  3NEK A;  3HJF A;  1CVJ A;  3G2X A;  2ALY B;  3NBP A;  1X0F A;  3ADA C;  3ZZP A;  1AYE A;  3L4B C;  1X5P A;  3HF5 A;  1C1B A;  4ZVT B;  1KQG B;  2G2Z A;  4DX8 H;  2XM3 A;  2WCX A;  1DHM A;  3HI9 A;  2UU9 J;  3DRX A;  3NS6 A;  5L8R C;  4LF9 F;  2CZ4 A;  3CCL S;  1FDN A;  2CDR B;  5D6G A;  3OXL A;  4IYQ A;  2DHX A;  2HHH J;  4OI3 A;  2BVZ A;  1ZA1 B;  1RAI B;  2RJZ A;  1T05 A;  1H74 A;  2FJD B;  2LQ9 A;  3TZX A;  1EIY B;  3L9Z A;  4RNF A;  5E3C A;  3QAU A;  3DHW C;  4NML A;  2MQP A;  2GVD A;  3GFY A;  2KXN B;  3P5T L;  1ARO P;  3M9M B;  2KL8 A;  4OMF G;  2R8G A;  1FA0 A;  1NXI A;  1IKW B;  1ZS6 A;  2F8M A;  5DGB A;  2QA1 A;  3AFG A;  2J9D A;  2G1D A;  2GX8 A;  3OBI A;  1P1L A;  4O3N A;  2OPP B;  3W5Z A;  3KDO A;  5B0A A;  3R7S B;  3B4M A;  5F9N A;  3MEE B;  2HRY A;  4QIG A;  4UUX A;  3KNA A;  4G1I A;  1KLM B;  1U1R A;  1LFP A;  4TU9 A;  2ATC B;  1S57 A;  3DM2 B;  1RTD B;  4FVM A;  3H20 A;  3SQG A;  3UN3 A;  2PEB A;  4NA3 A;  4DR5 J;  4DL7 A;  3VV2 B;  1SIZ A;  3OR1 B;  4U96 A;  3BSA A;  1ZZF A;  4NLS A;  2XGP A;  2L08 A;  1LV5 A;  1X4F A;  3DLG B;  3BGO P;  2QG9 B;  5L39 A;  2YWG A;  1FE4 A;  1Q0N A;  2ZM6 F;  3NP5 A;  4X4O A;  2PE8 A;  4JV5 F;  1OPI A;  3Q24 A;  1R0A B;  3SZ2 A;  3CCS S;  3HZE A;  2QC3 A;  1QAY A;  4KY3 A;  3RGI A;  3R27 A;  2BW7 A;  2EBE A;  1VLO A;  3IG1 A;  2FC8 A;  4P7V A;  2NYH A;  1U47 A;  3TAQ A;  3W61 A;  1Q1K A;  2RHS B;  4RNH A;  1LNQ A;  4N56 A;  4RUH A;  5M2U A;  4R5P B;  2VKZ G;  1TVR B;  3J7Z T;  3BR8 A;  4YFU A;  2AZ1 A;  3HJV A;  5HJY A;  4C0H A;  1RIS A;  1UEV A;  2BKP A;  4P73 A;  1D1U A;  3MAH A;  3CMQ A;  3R8Y A;  1F9H A;  2XQC A;  4DF4 A;  3PHE A;  1WTB A;  5AXN A;  3UDV A;  2QSW A;  3NGR A;  2OPS A;  2W8K A;  3K5P A;  2VOD A;  3KJF B;  1BQX A;  2M52 A;  3UD3 P;  4C11 A;  2KZZ A;  1KQS R;  4LVN P;  3KUE A;  5DG9 A;  1AUD A;  2X1A A;  2AYB A;  3MEG A;  2F63 A;  3PW4 A;  5EWE A;  4HTI A;  3BBC A;  1UPP A;  4O3S A;  3C6T A;  2ALZ A;  4DSK A;  4YOE A;  2HPU A;  2V68 A;  4ECU A;  5KG1 A;  1WOR A;  1RAG B;  1PBU A;  1G3O A;  3GWC A;  3RRG A;  3VQS A;  1N48 A;  1HQ2 A;  5D0H A;  4OX9 F;  3E8O A;  3CCE S;  2RQ4 A;  4I69 A;  4UQG A;  2KZM A;  3GE9 A;  3JSM B;  2QMU B;  1VYA A;  4NLV A;  3BH6 B;  2XB2 D;  3F44 A;  1PBA A;  3TAN A;  4F36 A;  4CZC A;  4TNO A;  2KT2 A;  2GJI A;  5HMW A;  3LF0 A;  4MJK A;  3SFG A;  3PYD A;  2W9C A;  4B02 A;  2QA2 A;  3MFH A;  2HMI B;  4QQB A;  1SQF A;  3Q83 A;  1OMS A;  4RW4 A;  3C16 A;  1R27 B;  2RIL A;  2R2T A;  1GMU A;  3MED A;  3GV8 B;  5EGY A;  3M1V A;  4ZLJ A;  4TLQ A;  3DLE B;  4HYK A;  2N7C A;  2DR9 A;  2VFT A;  3KLF A;  3ETM A;  4U7C A;  1F5A A;  3IR6 B;  1OO0 B;  1TAQ A;  4AQY J;  1JLA B;  1YJV A;  2GA7 A;  3EGN A;  5BYR A;  3S01 A;  4IDK A;  5J1E A;  3DLK B;  3AQO A;  1N34 F;  3M4X A;  5HQM A;  1QM9 A;  4MKV A;  3TR5 A;  2R7T A;  4LT6 A;  3DMJ B;  1YQH A;  1PJ5 A;  4DSJ A;  4O3R A;  3DDN A;  1YLX A;  2D9P A;  5E5N A;  2O67 A;  1TKZ A;  3MR2 A;  1X4B A;  2JL9 A;  4LF9 J;  4LF6 J;  4F2S A;  2FJA B;  2LA4 A;  3B82 A;  2VOP A;  1IKV B;  2DNL A;  1HLW A;  4X84 A;  5DG8 A;  1SV5 B;  2JNJ A;  2DRD A;  5B7W A;  1RTJ B;  1HAR A;  2UVW A;  2XZD B;  4DL3 A;  4HH0 A;  4G1P A;  2XMW A;  1LW2 B;  3BYP A;  2CQH A;  3GYN A;  2UP1 A;  1VIS A;  1U2F A;  1WTF A;  3HHL D;  1IWA A;  5D4O A;  3EXY A;  3IS9 B;  2RF2 A;  2C2N A;  1K9M T;  3IA0 A;  3AA8 A;  4ECW A;  3V6K A;  3CDW A;  2P8I A;  3PFE A;  2DO0 A;  1FWP A;  1WEX A;  1JLB B;  1PKU A;  2BJE A;  3H7H B;  1F5B A;  2CIM A;  2LQJ A;  1YK9 A;  3HXM A;  4ZCM A;  1HWU A;  3T1H J;  3TWZ A;  4IR1 A;  5B0E A;  2OD4 A;  4B3S F;  3EPG A;  1X5O A;  2XHW A;  5DDQ C;  3OJS A;  5CXT A;  1X4D A;  5GAE I;  1WJ9 A;  2NXE A;  2O66 A;  5EX3 A;  2OGU A;  2XS2 A;  2DR8 A;  2MST A;  1Y5L B;  5SZT A;  1UJ5 A;  1R31 A;  5I4M A;  4CLY A;  1N52 B;  1WOS A;  4IKA A;  1IKW A;  4JI5 F;  2K06 A;  4X65 F;  3K5N A;  3A12 A;  2OPP A;  2XLK A;  4WYL A;  2ZM6 J;  2VPX B;  4K4T A;  3MEE A;  4K4U A;  1XN9 A;  3PJ9 A;  2IRY A;  4IRD A;  1U4B A;  2PD1 A;  4B9S A;  1KLM A;  4NLR A;  2DNK A;  2V67 A;  2FGC A;  1NME B;  3K57 A;  2JLF A;  2MKJ A;  3VGS A;  4LBP A;  4X4R A;  2OAU A;  3DM2 A;  1RTD A;  4XDD A;  4A8S A;  3R2D J;  1NSA A;  1X9S A;  3ZTO A;  3OR1 A;  3WC2 A;  4ZN3 A;  5L46 A;  1EAY C;  2YXL A;  2NCK L;  2MQL A;  2CNL B;  3DLG A;  3CCV S;  4ZLN A;  3I31 A;  2RB7 A;  5IOL A;  1N36 F;  3MFI A;  2E1R A;  4J9V A;  2HIY A;  1S9G B;  1R0A A;  4ZOS A;  4H4K A;  3QGG A;  2JDJ A;  4WP8 A;  3NOC A;  1FTR A;  4WYW A;  1ZM9 A;  2VDH A;  3P4U B;  1X5T A;  2BR0 A;  1DAX A;  1ZAW A;  1KFS A;  2NUU G;  1RQ0 A;  1Q95 G;  2PI4 A;  4RBV A;  4HLB A;  4CLK A;  2UVV A;  3THP A;  4UOC A;  1N4L A;  1PC5 A;  3HD1 A;  4R5P A;  4DSE A;  1IXK A;  3FSI A;  1MMN A;  4CT9 A;  4PRF A;  1Q8I A;  3MZI A;  4DV2 J;  4YQW A;  2JZ5 A;  4QJV A;  5K8M A;  2EG1 A;  1ZTT A;  4ZN1 A;  4OHY A;  2QFI A;  2KFY A;  3IRW P;  2IFX A;  3AJ2 A;  3WIV A;  3KMS A;  1JLF B;  1DUR A;  4AXI A;  4O0N A;  3DYA B;  2D3O R;  2Y3Y A;  2EVZ A;  1R8P A;  2GAH C;  4CLZ A;  5F8L A;  1RTZ A;  3G6Y A;  2GCF A;  3RAM A;  2HK2 A;  1A6L A;  2ZC4 A;  4H54 A;  1S12 A;  4ED7 A;  1RBO B;  1T8E A;  1RK8 A;  1PC4 A;  4MKB A;  1U45 A;  3MM9 A;  1NB2 A;  4M5G A;  3Q86 A;  2IBO A;  3H90 A;  1NND A;  1S5Z A;  4PXE A;  1U1M A;  1ZYQ A;  3DLL Q;  1VK8 A;  1N54 B;  1VOM A;  5J2N B;  3PZP A;  3JSM A;  4ZMM A;  5CAA A;  4QPX A;  3M2V B;  5KT5 A;  2Z30 B;  1HBN B;  2XEX A;  3OLB A;  2MQN A;  3JSY A;  2HNY B;  2VOO A;  5F8G A;  5KG5 A;  3ZZU A;  2OP5 A;  5F0U A;  2DGX A;  4O0I A;  5L1L A;  1RT3 B;  3EIC A;  1N34 J;  1LWC B;  4HAC B;  2HMI A;  1RHK B;  5CD4 A;  2C2Z B;  3HHL C;  4NYO A;  2H5J B;  1RT1 B;  3HT3 A;  2NSB A;  1WKK A;  4WE1 B;  5JUM A;  5IM0 B;  4KE5 A;  3DLE A;  1OY8 A;  2YKN B;  2IAJ B;  2QEX S;  1V3R A;  5IXU A;  1VHI A;  4K50 A;  5I42 B;  2J7W A;  4WTY A;  4C97 A;  1VQN S;  1JIH A;  5KFV A;  3P49 B;  1JLA A;  2FVP A;  1ICE B;  2BRK A;  3E01 B;  3GON A;  1UEK A;  4U8Y A;  3DLK A;  4N5S A;  2ZZN A;  2G9O A;  3R7N B;  3EGW B;  1FHT A;  4PWU A;  4OZ1 A;  3DMJ A;  3LQV A;  1W7W A;  3CO9 A;  2CPX A;  1NZA A;  1XNR F;  2GMJ A;  2KHC A;  2PT0 A;  2DBB A;  2GC8 A;  3UWT A;  2IM2 A;  2IM1 A;  2UXB J;  4U6P A;  1JXV A;  5LMN F;  5GAE U;  3W2V B;  1M1K T;  2YTC A;  1YWX A;  4XPC A;  2MMY A;  3K5M A;  2OJ3 A;  2HSE B;  3MXH P;  3KUG A;  1WI8 A;  3TUI C;  1FKO A;  1IKV A;  1Q8K A;  3O2I A;  4MK8 A;  2CPI A;  1SV5 A;  3PM9 A;  1RTJ A;  4Q44 A;  1WKJ A;  4PG6 A;  1KP6 A;  1F3V A;  4HEA 9;  4R0J A;  3MPV A;  2DNG A;  1LW2 A;  1V9O A;  2DXF A;  4LBH A;  5KFG A;  2R7S A;  2YWK A;  4B3S J;  5IT4 A;  2LFV A;  1VDH A;  2DH7 A;  4FXW A;  4NZ7 A;  3QSI A;  3IS9 A;  4HHU A;  4WK3 A;  1QE1 B;  2K2P A;  2MKC A;  2DHH A;  3AXM A;  2ZH6 A;  3R2C J;  4JI5 J;  2H54 B;  1JLB A;  4FKY A;  4U9R A;  4X65 J;  4YEA A;  1Y3J A;  1QVG R;  4QW8 A;  3KHL A;  3VAJ A;  2Y1R I;  2ZNY A;  2DB1 A;  3W3S A;  1V5I B;  4K5R A;  1OY9 A;  2KG1 A;  2VC0 A;  2ZKT A;  3G87 A;  1FFS B;  5SUH A;  1HNX F;  3G6V A;  2WVD A;  1C4C A;  1WI6 A;  1R3N A;  2LCW A;  4ZPV R;  3DDK A;  2BJ1 A;  5MAO A;  4I64 A;  4WIQ A;  3BKT A;  4CDI A;  4K7Q A;  1TFY A;  4X4Q A;  1G6B A;  1N36 J;  5A2Q Y;  4DV0 F;  4RU2 A;  3JYT B;  4OQJ A;  1TL5 A;  3FJ2 A;  1RTH B;  3MM5 B;  5KFP A;  4LF4 F;  3EMT A;  1NDL A;  4X4S A;  3QRP A;  2BMB A;  2DPI A;  2MZJ A;  1B3T A;  4QWE A;  2YBV A;  4EEY A;  3ZZT A;  1SC6 A;  2N3O A;  3D1Q A;  3KHR A;  3AA9 A;  1KVK A;  3KWM A;  3NNC A;  4RNO A;  2ZJP Q;  2ZOG A;  5EWG A;  2OLW A;  1VQ7 S;  4GMK A;  1S9G A;  1RU2 A;  2RE1 A;  5FII A;  4PXD A;  1QAJ A;  3WQP A;  2EWH A;  2HGN A;  1U1K A;  2B8P A;  1YJW S;  2B43 A;  2NXC A;  4NE9 C;  4KBI A;  4DFP A;  2F8H A;  3N6M A;  2MXY A;  4L3N A;  1C4A A;  1EX8 A;  2XWX A;  2KO1 A;  3I0R B;  2PMW A;  4A8Y A;  1IBK J;  3MMA B;  4LRB A;  1SL1 A;  4AT1 B;  2ZDP A;  4OI6 A;  5LM7 E;  3R5B A;  3TNV A;  4X64 F;  2HFV A;  2IIH A;  3HSZ A;  1LOU A;  1KSP A;  4ZVU B;  2QA4 S;  5T7L B;  2JSX A;  2PMH A;  4CM2 A;  4LFA F;  5KFL A;  5FJ4 A;  4WPA A;  2FYX A;  4ECQ A;  3TJ8 A;  1JLF A;  2D74 B;  1WHV A;  3DYA A;  1O5J A;  1TK0 A;  3RJM B;  2IHR 1;  1VQ9 S;  3LA0 A;  2RSQ A;  1X4C A;  4DU8 A;  1RLD A;  4CLF A;  2F3J A;  3GG1 A;  2D41 A;  1D8Z A;  3L3C A;  4ELV A;  4UOH A;  1L5U A;  2PFD A;  2A6O A;  2HGM A;  2UXC J;  1VQL S;  2H4Y B;  3PYE A;  4OYW A;  4X66 F;  2HG4 A;  4TYA A;  3PKM A;  3HZG A;  4BC9 A;  3GMG A;  5BXI A;  3BPS P;  3GJS B;  4QCL A;  2IYI A;  2LLZ A;  2V8V A;  3UD4 P;  5J2N A;  5ETR A;  3DRY A;  2RS2 A;  1XWL A;  3M2V A;  2G2O A;  1HBN A;  4YHH F;  3MR5 A;  3ZZR A;  2MQO A;  2VBZ A;  3OJU A;  2HNY A;  1NKE A;  4C8Z A;  2NYI A;  2XC9 A;  5E0O A;  2FZG B;  2CZV C;  1I94 F;  2K8G A;  3GIR A;  3ZNJ 1;  2DRA A;  2A3J A;  1RT3 A;  4C8N A;  1PSD A;  4NLP A;  1LWC A;  4HAC A;  3J7Y I;  1VQ4 S;  3Q8U A;  3QJP A;  2DNY A;  5LMU F;  3TAM B;  1RT1 A;  1AW0 A;  1SXL A;  3AD8 C;  4WE1 A;  3BJY A;  1RAA B;  1VK3 A;  5IM0 A;  8AT1 B;  3EDR B;  2CPF A;  1UL3 A;  2YKN A;  2IAJ A;  4ALZ A;  5EHH A;  3CME S;  4P2F A;  3A8J A;  1X31 C;  3TJ9 A;  5I42 A;  4W92 B;  2ZWP A;  2BOP A;  2R8I A;  2BJD A;  3E01 A;  2YQ1 A;  1WC1 A;  2IYG A;  1LK7 A;  4RL1 A;  1HW8 A;  4N41 A;  5KFX A;  2W4C A;  1H98 A;  1IJF B;  4C9D A;  5E7O B;  2PDA A;  4DQP A;  2MJN A;  5KFU A;  2WOM B;  2CXE A;  3GYX B;  2KU7 A;  3W2V A;  2MLZ A;  2MZT A;  4K4X A;  3OVB A;  5ETN A;  5F0W A;  2W1B A;  3SIP B;  5DLF A;  3KNG A;  4DLG A;  1KON A;  2V4J B;  1UJ6 A;  2M7S A;  3M8Z A;  4F4K A;  2XS7 A;  4LR9 A;  4W98 A;  2L3M A;  3J80 U;  2BE9 B;  1D09 B;  4FPR A;  3CJK B;  3JXO A;  3T1Y F;  1FVQ A;  2MHE A;  3A8E A;  3OHA A;  1T3O A;  1RBA A;  1L3U A;  1B99 A;  4PPD A;  4AL6 A;  4ED3 A;  2DEI A;  1DY3 A;  1XER A;  2QYC A;  2FLL A;  2J76 E;  2KB2 A;  3LWL A;  3HPO A;  4NPO A;  1HNX J;  1QE1 A;  1FDA A;  2CJ9 A;  3D1O A;  3OTB A;  1RU1 A;  2PO4 A;  3EPI A;  3GTY X;  1X8D A;  4M5I A;  1RT4 B;  3FZ2 A;  3HMJ G;  3KHH A;  4O3Q A;  1GMV A;  2LEA A;  3CD0 A;  2MLX A;  3ZTS A;  5K5M A;  5DQH A;  3QJL A;  2MGZ A;  3W66 A;  3IR5 B;  4DV0 J;  2QT7 A;  2JEF A;  3PR5 B;  3QYY A;  4B08 A;  3FZB A;  1NJI T;  1TFW A;  1GT8 A;  3MGJ A;  5I3U A;  3JQM A;  1TMJ A;  3W5Y A;  4P2M A;  2AJ1 A;  1U6B A;  4JYA F;  1F6T A;  4J9R A;  1H72 C;  1I5O B;  3OL8 A;  1VBZ A;  1NSK L;  4DCJ B;  1VCT A;  5C2G A;  1GQE A;  4Z37 A;  3JYT A;  1PIL A;  3DDI A;  4LR7 A;  3QSY B;  4ZA1 A;  4DUY J;  1RTH A;  3MM5 A;  2R7U A;  2FIU A;  2BJ3 A;  2ZWO A;  1FE0 A;  4E0D A;  4PQU B;  4UUW A;  4CWB A;  1YJT A;  1IN0 A;  2HFU A;  2EK1 A;  3CVK A;  3SCI E;  2I9S A;  2OHD A;  5FLX U;  5ETT A;  2GVZ A;  5K9F A;  2CQG A;  4USW A;  2DY1 A;  3T6J A;  1APS A;  2CQ3 A;  5I3Q A;  1S48 A;  4OZ3 A;  4V19 J;  2VA2 A;  4EBE A;  3HHE A;  4RW6 B;  2F40 A;  1CPZ A;  2C42 A;  3PRB A;  3C19 A;  4P6Q A;  3QRR A;  4OYI A;  1RXO B;  1TL7 B;  2JC1 A;  2AU0 A;  3FC9 A;  3I0R A;  3MMA A;  1KKH A;  2HS3 A;  1GNK A;  3KG4 A;  2FY1 A;  1KR4 A;  3I4P A;  1QUP A;  4RUA A;  1VBY A;  1V3S A;  4TLR A;  4XTT A;  1T3N A;  2ZZT A;  4X66 J;  3G6X A;  1FER A;  5DM6 Q;  5T7L A;  4ELU A;  2V2V A;  3UCZ P;  4OI4 A;  2EW9 A;  2MQ8 A;  1OQ6 A;  3OSN A;  3UW1 A;  3J7Y U;  3POT B;  1IR0 A;  3M8Q B;  5E3P A;  3G4S S;  3RR7 A;  4ILR A;  5CYM B;  3CW2 C;  1MWZ A;  2DIU A;  2ZBI A;  2RQC A;  2WTF A;  3LP1 B;  5HN0 A;  4RU9 A;  4FBU A;  3OL6 A;  3ENW A;  4J90 A;  3NAH A;  4ICL B;  2W25 A;  4PYA A;  1I94 J;  2HVD A;  4GC6 A;  2AGO A;  4AXJ A;  2NRE A;  1N32 F;  2AP6 A;  2W2Q P;  2JEG A;  2B9X A;  5LMU J;  3FQK A;  3P8B B;  5D4N A;  1KBR A;  5HI7 A;  2KT5 A;  4M5N A;  2VBW A;  1FNO A;  3FSX A;  4B9N A;  2U1A A;  2X51 A;  4KGM A;  1N8R T;  1AA1 B;  2XMM A;  3QT5 A;  3EE3 A;  2V0N A;  3ISN D;  1KNZ A;  1WAC A;  1NKB A;  2DVI A;  5ETS A;  2RNE A;  3BO3 A;  2Z4P A;  2VH7 A;  4ZPB A;  1D3W A;  2E9Z A;  4ED2 A;  2W7O A;  2VDI A;  2JFD A;  2JVO A;  2L9D A;  4DR1 J;  2ZUG A;  1TUV A;  1OYD A;  3TAM A;  1TMM A;  4A46 A;  3BEG B;  2FVQ A;  4NOH A;  3SXL A;  2FJX A;  3PEH A;  3M8S A;  2R2S A;  3NRB A;  3SCL E;  3TI0 A;  4QIF A;  1RAC B;  1HMV B;  4DG1 B;  3D9B A;  2MQM A;  4LF5 F;  5IWA F;  3UR3 C;  1CJK B;  1RZM A;  2HAI A;  5GAH U;  3UO0 A;  4B3R J;  3D4J A;  3CO0 P;  4DV5 F;  4NLD A;  1VMB A;  1WC0 A;  3MEK A;  4JOU A;  4ECR A;  2HKE A;  1O6X A;  2ZH7 A;  4ZP9 A;  2LEB A;  1B7F A;  3KLE B;  3H98 A;  3CCJ S;  3KLI B;  2WOM A;  4M8L A;  5IC4 B;  4J9P A;  2GGP B;  3GFZ A;  2YY3 A;  4KGK A;  4ZPD A;  4QYZ J;  1SBR A;  2V4J A;  3SYZ A;  2HBZ B;  4DL2 A;  1E6V B;  4LF7 F;  1G1X A;  1GXT A;  4RW7 B;  3ZTR A;  2YNG B;  2WBR A;  4IO9 Q;  4FYV B;  1EKS A;  3CJK A;  1JLQ B;  1FEH A;  2CJX B;  2W7A A;  4YUD A;  2KJW A;  2XI2 A;  1HWK A;  3GIM A;  1HQU B;  4Y2I A;  2BBE A;  2YH1 A;  3HDS A;  4LUB A;  4USM A;  4DV4 F;  1M5K C;  4RX6 A;  3MPY A;  5KTQ A;  4USI A;  1YZ6 A;  2HHP A;  2CFX A;  2B56 A;  1GMW A;  4OYO A;  4K8R A;  2R7R A;  3Q89 A;  2EFP A;  1RT4 A;  4Q7A A;  4NZ6 A;  1OPZ A;  3BBB A;  2O3D A;  2RD5 C;  3H2U B;  2EKN A;  2QLJ B;  2Q43 A;  4JUZ A;  2Y9H A;  2NUH A;  2BEF A;  3W62 A;  2DNR A;  1YJ9 S;  1CEZ A;  2QLW A;  3M8Y A;  2ACY A;  3QGP A;  1RCX B;  3UQS A;  3G96 A;  1RAJ A;  2OKQ A;  3CD7 A;  3CE8 A;  4DF8 A;  4C8Y A;  2J7K A;  2UVR A;  3D0G E;  3IAM 9;  3LH2 S;  1T94 A;  5KG6 A;  1HWL A;  5AE3 A;  5DZ7 A;  5KG3 A;  2FHJ A;  2C3P A;  4K4Y A;  2DYA A;  4QBU A;  1Q7L B;  2ZE2 B;  2AEJ A;  2Z56 B;  3EXC X;  2VFV A;  3VAL A;  5HQL A;  4BDP A;  2V8D A;  3KJV B;  1PAU B;  4WII A;  3GIK A;  2H51 B;  4NXM F;  2R2U A;  2FHO B;  2MY7 A;  4FNH A;  3PX0 A;  1HBM B;  1RHJ B;  5IZH A;  2M70 A;  2BOA A;  4Y0F A;  4PQU A;  4USV A;  4ZVH A;  2F1F A;  2L41 A;  1S1X B;  3I82 A;  1MWQ A;  1S1T B;  1RT5 B;  1UA1 A;  4TU7 A;  2IC3 B;  3N28 A;  4YY3 F;  3C15 B;  3R5D A;  3SEO A;  2EC2 A;  3ELH A;  1HYS B;  1WC4 A;  2X3D A;  1REG X;  3PRD A;  4ECX A;  1Q5V A;  2VBX A;  3KKF A;  4RW6 A;  1N5Q A;  2V9K A;  2G2Y A;  3BGU A;  1RE1 B;  4O3O A;  3TEG A;  3NXZ A;  4FYW B;  5J1N A;  1MN7 A;  2E5J A;  2EPI A;  5CAB A;  2B51 A;  3FFI B;  1S99 A;  3VR1 A;  2CJA A;  1S1W B;  4B9L A;  2LEC A;  1QJH A;  1TL7 A;  3PTW A;  2DNH A;  4P2S A;  2OSR A;  3DGP A;  4RBU A;  3ISN C;  4EK2 A;  4H4M B;  3IBW A;  4NYP A;  2CQ2 A;  3ZZZ A;  1Y00 A;  5B0B A;  3BRE A;  3QQC D;  5BYS A;  3A3O B;  2VU5 A;  3U1L A;  2ZJQ Q;  5F8I A;  3CGI A;  1LWE B;  1N32 J;  4JB8 B;  1GFW B;  3MOZ A;  4DL5 A;  3I96 A;  3POT A;  3M8Q A;  1R0C B;  2DNQ A;  2AX0 A;  5J2P B;  5C7P A;  1HWJ A;  5CYM A;  2AYG A;  4B9V A;  4TKT A;  2E66 A;  4C3M A;  2KYZ A;  3LP1 A;  4M63 A;  3OTC A;  3D2W A;  5H9F J;  2HVE A;  4QR2 A;  1HNZ F;  4KHP J;  4ICL A;  4XIU A;  4LFC F;  2BX6 A;  2GW8 A;  3PYF A;  2V5H G;  3UDL A;  3NOG A;  3BSN A;  4EI2 A;  3MOJ B;  3SSQ A;  3LAK A;  4KSE B;  1HW9 A;  3JQK A;  3ILJ A;  4ZPT R;  3ZC4 A;  4OJG A;  3F73 A;  4ECY A;  1BHN A;  1IBL J;  2IVM A;  5LSR A;  3AH6 A;  3QZ8 A;  4PG5 A;  2C28 A;  1SKU B;  1QLN A;  2KVI A;  3PCO B;  2RH3 A;  2V50 A;  2CDQ A;  2JOQ A;  5IWA J;  3R6L B;  5HVH A;  2CKW A;  3N6L A;  1Y11 A;  5H9E J;  2UUW A;  2OEL A;  4WU3 A;  2QSF A;  2KI2 A;  2ROP A;  1S7I A;  4DX6 A;  3QNW B;  3R5A A;  3H42 A;  4ZCK A;  4V1A k;  2AMC B;  3W65 A;  2NXU A;  2XSJ B;  2QO3 A;  2O1P A;  3IM9 A;  1FF2 A;  4GKJ F;  5DQG A;  2DIT A;  4C6A A;  4J37 A;  4IR9 A;  3GJT B;  3CSK A;  4DR7 F;  4DG1 A;  1FT8 A;  1SH0 A;  2C2D A;  1VQP S;  4ZVQ B;  2P9C A;  5GMK a;  1CJK A;  4Q0B B;  1RAB B;  4LF7 J;  4ATN A;  3VTI A;  4V19 X;  1DAR A;  1YGY A;  2N4D A;  5EN1 A;  1WHW A;  3W8G A;  1TV6 A;  1J2V A;  4MT1 A;  2O01 C;  3KLE A;  3A8I A;  3KLI A;  2H5E A;  3HVT B;  4NAS A;  2OD6 A;  4EBD A;  1WC5 A;  3VHQ A;  5J1P A;  2GGP A;  2LVW A;  1RGV A;  4CQ1 A;  1VQ5 S;  1S10 A;  1E6V A;  1D9D A;  4RW7 A;  2VG6 B;  3L7O A;  2AD9 A;  2YNG A;  3SBM A;  5K14 B;  4OV6 A;  4U67 Q;  3M6W A;  3PJX A;  3NKY A;  1KFD A;  3TAR A;  3JAM U;  3NCP A;  1HQU A;  3RW7 A;  6FDR A;  5HVF A;  2PI5 A;  2DNM A;  2C3M A;  2R7V A;  4JI6 F;  2M8D B;  3VVT A;  1C2P A;  2YX4 A;  4ANC A;  3J7A N;  1FJE B;  3P96 A;  2C2R A;  1A7G E;  2UUC J;  2ILZ A;  3O6Q A;  2WVE A;  2FJV A;  5C5J A;  2IVY A;  2K3K A;  1UZD A;  1T03 B;  1K47 A;  1JXL A;  3TVK A;  4KGX B;  3OXF A;  3FBC A;  3LPY A;  3IM8 A;  4IH7 A;  2V2Q A;  3Q23 A;  4NXM J;  4P9S A;  2UUA J;  3RYL A;  2MJU A;  3QGH A;  4B3M F;  2HYI B;  1FVS A;  1EJ7 L;  4W4M A;  3N9U C;  4AE5 A;  4C0O C;  4JV0 A;  4YME A;  2QLB B;  1WOP A;  1QSY A;  2CG4 A;  3EX7 B;  2BAC A;  4MMO A;  2NPF A;  2OIH A;  3Q8V A;  1DQA A;  3EVM A;  1UMJ A;  1FCA A;  3BKU A;  4UST A;  2YPY A;  4YY3 J;  1S1U B;  5H1S V;  4ZPC A;  4RKU C;  2Q3P A;  2ZE2 A;  4KTQ A;  1JJ4 A;  1PJ7 A;  3KJV A;  4Y65 A;  3H2V E;  4Q2M A;  3I6P A;  4F4W A;  4LIR A;  5F8M A;  1HBM A;  4IRC A;  5ETV A;  2UUB J;  2XS5 A;  3IBF B;  2EFG A;  2ZKU A;  3PG9 A;  3ET6 B;  4DR2 J;  2VA3 A;  3M8R A;  2P6S A;  1S1X A;  4PQA A;  2LDI A;  4DPY A;  1EHW A;  1S1T A;  4NMX A;  1RT5 A;  4PXB A;  2IC3 A;  1NK5 A;  3C15 A;  2RML A;  4PG8 A;  1FXR A;  2OUG A;  3JTN A;  1HYS A;  3AJD A;  2LEP A;  3AY0 A;  3FCV A;  4K4S A;  3GV7 B;  3BZQ A;  1FRX A;  5B0G A;  2HHT A;  2AF6 A;  4LSL B;  3RB4 A;  1G4C A;  2IBK A;  5DO2 A;  2ZBC A;  4NX9 A;  4DQR A;  3FFI A;  2J6T A;  4CO1 A;  2W4D A;  4DX7 A;  1OSC A;  2XZW A;  1KRP A;  2DGO A;  1LWX A;  2V4Q A;  2DR5 A;  2OO4 A;  4RBT A;  5KFO A;  1TL4 A;  4JI4 F;  3AAW B;  3HT0 A;  3EZ5 A;  4H4M A;  5C42 B;  2Y1L B;  5KFS A;  3DNC A;  2AEM A;  2CPY A;  2BE2 B;  4YB1 P;  4WFB Q;  3KK2 B;  4LR8 A;  2R3V A;  1X4A A;  2IMO A;  2VF3 A;  3QFH A;  5LXR A;  4F3M A;  3NCR A;  1LWE A;  1GXL A;  4OI0 A;  2H48 B;  5J2P A;  4QWC A;  3Q0A A;  1J5E J;  2O5D A;  3ILI A;  4OZ0 A;  4JI3 J;  2YX7 A;  3B8H A;  1J27 A;  4ED5 A;  1SKW A;  4CO5 A;  5CH7 B;  4BC7 A;  2VG5 B;  3N6N A;  2HQC A;  3IAS 9;  1UJ4 A;  4DPO A;  4KGV B;  2VG7 B;  4C3K A;  2RRA A;  4C0B A;  2VHG A;  4MYU A;  4ZVO B;  4J5O A;  1NDK A;  2M0G B;  3KOA A;  4LVO P;  1EQM A;  4I6Y A;  4MIB A;  2ZH5 A;  1Q5Y A;  1NK9 A;  1TEL A;  3UCG A;  1TKX B;  1JK9 B;  4WFA Q;  3CPW R;  3CDE A;  4B9T A;  2A18 A;  3QBC A;  1KOH A;  4CIO A;  4MYT A;  3GQC A;  4DR7 J;  2AIR B;  3CF5 Q;  2HBQ B;  2DY9 A;  5IQQ A;  4C3L A;  2ZBQ A;  2DRB A;  1DZ5 A;  1RJJ A;  2W2O P;  2FJE B;  1VQ6 S;  1S4E A;  3AQP A;  2RU9 A;  3T6B A;  3L7P A;  5HO4 A;  2LQ5 A;  3N01 A;  2Y1I A;  4J9U E;  2MB0 B;  3HHD A;  4NLU A;  2YQ3 A;  3MMJ A;  2XSJ A;  2AEF A;  2CUY A;  1WSR A;  4LSN B;  3CJ3 A;  5ITH A;  3D0H E;  3TUJ C;  4P52 A;  2QLF B;  3I9Z A;  1FDB A;  3HP6 A;  3BO4 A;  2PMZ D;  1WEZ A;  3W5X A;  1J5O B;  2E1P A;  4Q0B A;  1KVI A;  3QLH B;  1R6Y A;  2ILY A;  3BQ1 A;  5EX0 A;  2R8K A;  1NK7 A;  1Q82 T;  5A8R B;  2XMK A;  1T11 A;  3HKZ D;  2J8S A;  4DQS A;  1I3O B;  5F8N A;  2H65 B;  1H0H B;  5D3G B;  4X2B A;  4NEZ A;  4W90 B;  2EXU A;  3US5 A;  2ZHA A;  3HVT A;  2X1F A;  2L9N A;  4LIW A;  4NXN F;  3QJJ A;  1NK8 A;  4U95 A;  2CPD A;  1AFJ A;  1R0B G;  4CTA B;  2W8L A;  2JX2 A;  2VG6 A;  3H4D A;  3DRR B;  5K14 A;  2P2C B;  3VWS A;  4DMZ A;  4ZJQ A;  4ZIT A;  5KT3 A;  1H3D A;  2ZOF A;  3W1Y C;  2OEM A;  3PKY A;  4DN9 A;  3EM1 A;  3I56 S;  5LXY A;  2XGQ A;  2KN4 A;  1H73 A;  2A2D A;  3PV8 A;  2E5G A;  1QUV A;  3IGV A;  4DOZ A;  2GHV C;  1WC6 A;  2W01 A;  3A3N B;  3NG8 A;  4GKK F;  3D54 A;  1VC0 A;  3IWX A;  5KAK A;  4B17 A;  2OTJ S;  3D7S B;  1F0X A;  1GX6 A;  1M5S A;  1X4H A;  3BGL A;  3RAX A;  3OXG A;  1IQT A;  2K7K A;  2ADB A;  1T03 A;  3PAC A;  4WTO B;  4DV3 F;  3D3B J;  5HAN A;  1GTE A;  4OX8 A;  1TL1 B;  4ITS A;  5IT9 U;  1M0S A;  3UCU P;  2GO8 A;  4XPE A;  4NLQ A;  1E6Y B;  3HHK A;  4I2Q B;  4TN2 A;  1WWH A;  4PWD B;  1RWU A;  1O8B A;  1VIX A;  3CTR A;  4NRU A;  4CO0 A;  3HFV A;  4TQS A;  4IO1 A;  1S1U A;  1SUQ B;  3GP9 A;  2DGV A;  2RQK A;  3O1L A;  1U1Q A;  4B9U A;  4CLU A;  2F4V J;  2XTJ P;  1IQZ A;  1S0N A;  4FN5 A;  2XYH B;  1BQM B;  2DD8 S;  1S76 D;  2Z57 B;  1SH3 A;  2CZ9 A;  1AZS B;  3ET6 A;  4DUZ F;  1UVN A;  4I68 A;  4DPX A;  1KTV A;  3DN9 A;  1TAU A;  3TYT A;  1HNW F;  4NI2 B;  3SCJ E;  4WBF A;  1JKH B;  3I55 S;  3H0P A;  1Y7P A;  3U27 A;  3IP0 A;  1NSQ A;  4L3K A;  1D8Y A;  1KN6 A;  2ZIT A;  2IMW P;  1LXJ A;  2E5L J;  2R2R A;  4HL9 A;  2KXH A;  1U49 A;  3S8S A;  3BN4 A;  4WK1 A;  1NZ8 A;  1RWW B;  1SKR A;  3CD6 S;  2GS8 A;  4LSL A;  3B4D A;  1FRI A;  2G1H A;  4IOA Q;  2HAF A;  2U2F A;  2CQP A;  3SV3 A;  2XMU A;  1HI0 P;  4Z7Y A;  3QO9 B;  2PFF B;  4J9O A;  3VCD A;  3M30 B;  3VZH A;  1HL6 A;  2R8J A;  4M1K A;  5C42 A;  2C2K B;  2FVS A;  4E2F B;  4AUK A;  2WW8 A;  2BE2 A;  4ZPW R;  2RKI A;  9RUB A;  3KK2 A;  3JTP A;  2LU1 A;  1FX4 A;  5C2C A;  3SMZ A;  3S7R A;  4JI0 J;  3MUT P;  2CJY B;  4NYZ A;  1KTQ A;  5DDR C;  4Z7C A;  4CT8 A;  1RWM B;  3LW5 C;  1T9T A;  1RHM B;  2FZK B;  1O0P A;  4DPW A;  4OJ3 A;  5HAO A;  4DR6 J;  3I0S B;  4A8K A;  4IQX A;  5D4L A;  3OHB A;  4GRS A;  3AHP A;  4Q43 A;  4DS4 A;  2VG5 A;  3EGV A;  4DR4 J;  1HNI B;  1U1O A;  3ISZ A;  1U1P A;  4QOT A;  4KFB B;  3BSC A;  4QIV A;  1FJG F;  1XR7 A;  2R42 A;  2DK2 A;  1TKX A;  5DLG A;  3VAM A;  3FBE A;  3DLJ A;  1YI2 S;  4KB7 A;  2CNN B;  4EZ9 A;  3R7B B;  1QTN B;  4B3T J;  2WHO A;  1RYS A;  2VFU A;  3OTE A;  4PUO B;  3T9N A;  2NS1 B;  4EZ6 A;  4OLO A;  4OYX A;  1FDD A;  1UW4 A;  2G0I A;  3AOB A;  8RUC A;  4DLE A;  3TQE A;  3IWN C;  2WB1 D;  3T5L A;  2A0F B;  4OLP A;  4UZB A;  4WFX A;  2IPO B;  5A0Y B;  3KK1 B;  1XQI A;  4LSN A;  2Z2Y B;  4NXN J;  3HVW A;  1KVJ A;  5D77 A;  3KLH B;  2PC6 A;  1J5O A;  1U24 A;  3PIP Q;  2DGT A;  4FBT A;  3QLH A;  3BF4 A;  4KKO B;  5FDL B;  2L48 A;  4XAK A;  4AFF A;  5A8R A;  2JLE A;  2NXN A;  1UFK A;  3LGH A;  4ZIV A;  5D3G A;  2FLO A;  1NUE A;  1RT7 B;  3RBX A;  3RAQ A;  3GR0 A;  3QMQ A;  1NCL A;  4OZN A;  2YKA A;  1N33 F;  2VB6 A;  6AT1 B;  4DV1 F; 
#chains in the Genus database with same CATH homology
 1RU2 A;  5ETQ A;  3UD5 A;  1RAO A;  2CG8 A;  3QBC A;  4CYU A;  4M5M A;  5ETT A;  4AD6 A;  3HD1 A;  5ETS A;  1Q0N A;  3HD2 A;  4M5L A;  3HCX A;  1F9H A;  1IM6 A;  3HSG A;  5ETK A;  1TMM A;  1RTZ A;  3KUH A;  4M5K A;  3HSJ A;  4M5J A;  4CWB A;  5ETN A;  4CYU B;  1RU1 A;  3IP0 A;  1KBR A;  3HSZ A;  2F65 A;  2BMB A;  3ILO A;  2QX0 A;  4M5N A;  3UDE A;  1EX8 A;  1HKA A;  5ETO A;  3ILL A;  5ETV A;  1EQM A;  4PZV A;  1TMJ A;  3KUE A;  4M5G A;  4F7V A;  1CBK A;  5ETL A;  5ETM A;  3UDV A;  1RB0 A;  1G4C A;  3HT0 A;  1HQ2 A;  3HSD A;  3KUG A;  3MCO A;  4M5I A;  5ETR A;  3ILI A;  2F63 A;  3ILJ A;  4CRJ A;  1EQ0 A;  4M5H A;  1DY3 A;  3MCM A;  3MCN A;  5ETP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...