2F63A

Solution structure of hppk in complex with inhibitor analogs ampcpp and hp-1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Solution structure of HPPK in complex with inhibitor analogs AMPCPP and HP-1
rcsb
source organism Escherichia coli
total genus 21
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2005-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 2f63A00
3MCNA 3HD1A 1DY3A 1RU2A 3IP0A 1EQMA 4M5NA 2CG8A 1CBKA 1KBRA 1HKAA 2QX0A 3HSZA 1Q0NA 5ETLA 4AD6A 3HSJA 4M5LA 4PZVA 4CYUB 2BMBA 3ILIA 3QBCA 5ETKA 3UDEA 4CRJA 1RTZA 3ILJA 4CWBA 4M5HA 1G4CA 3HSGA 3MCMA 4M5KA 5ETPA 4F7VA 1RU1A 4M5GA 3ILOA 1TMMA 5ETVA 5ETOA 3MCOA 3ILLA 5ETSA 4M5MA 1EQ0A 3HSDA 4M5JA 5ETMA 3UD5A 3KUHA 1IM6A 1HQ2A 1RAOA 2F63A 5ETTA 4M5IA 5ETRA 3UDVA 3HD2A 3KUGA 5ETNA 1F9HA 3KUEA 3HCXA 5ETQA 1EX8A 3HT0A 1RB0A 4CYUA 1TMJA 2F65A
chains in the Genus database with same CATH superfamily
5DS7A 2N7YA 2MJUA 4YS2A 4QCLA 1UFKA 3GU0A 5E2QA 1AYEA 4NWBA 3IWLA 3X3UA 3OUYB 1NJYA 3DGPA 2QLFB 3PX0A 4HHUA 3DHXA 3PV8A 3GLJA 4ZN1A 1BQXA 1AT1B 2RQ4A 1TR0A 2R8IA 2J9EA 1IKWB 2OI2A 2COLA 1SQGA 3PM9A 4UUWA 3B78A 1ULRA 2QG9B 3M2UB 1S9EA 2MB0B 3GV8B 4F26A 3WC2A 1VQPS 1GNKA 5GAHI 2HQ3A 5HAOA 5F9LA 5T7LB 2DCLA 4W90B 1H3DA 4JI5F 2BBEA 2VQEF 4OYZA 4P2SA 4ECZA 4NZ0A 3MUTP 1VQ5S 2RRNA 1XWLA 2JLGA 2F4VF 3BGOP 3MPWA 3UNYA 1LFWA 5I4MA 5EUHA 5IOLA 2QV6A 4LF5F 5IC4B 3ZZUA 7AT1B 3C3LA 4WKRA 3MMCA 4USIA 3CC7S 3BZQA 2HHSA 1C0UB 1QM9A 5E3AA 5J2NB 1SIWB 1WOOA 2VQEJ 3MCSA 3FMWA 1N5TA 3R5CA 1Y00A 1S1WA 2RVJA 4IG3A 4O4GB 4CLLA 3VAGA 2QYGA 1X9WA 1K47A 2LQ9A 1S6OA 2F4VJ 2R4FA 3R5BA 4UOFA 1K9MT 4HHHA 4GKJF 4MIAA 3F0NA 2FJBB 2APOA 3KG4A 2UZAA 4LF5J 2PFFB 3AOCA 4ZCKA 3RGIA 3MFHA 4NLUA 4M5MA 2BJ8A 2AEJA 4W98A 4NMXA 3EE3A 3KK2A 1S1UA 3LQVA 3MPYA 4F0MA 5GAGU 1X5OA 3UCUP 4YOEA 3QIDA 1U8SA 2DNGA 4OQJA 1C1BB 3FZ2A 4R5PA 4DSLA 4ES2A 4GKJJ 1Y5IB 3C6TA 4UOCA 2Z8QA 1VQ6S 2UXBF 2GVDB 4FKYA 4ECUA 1RTDA 2H4WB 3D7SB 2C3UA 3PR5B 3EX7B 5F41A 1OMSA 4XPEA 4CO2A 3MD3A 4CT9A 3VZIA 1S4FA 3CJ8A 5A6WA 3V4IB 3J7Z5 3HDSA 4HR2A 1SBRA 3MEGA 3CJTA 2NUHA 7FD1A 4OV1A 1HA1A 1TK5A 1I1GA 1U09A 1FNOA 4DR2F 3ISNC 4F4ZA 2UXBJ 4Y2AA 4TLRA 2XZDB 1H6KX 5A2QU 4Q0BA 2JLFA 4X4RA 2MJNA 1V6HA 3K89A 1E6YA 4NLPA 3KNGA 3MPVA 4TNOA 4QWCA 3QIPB 2J8SA 3TP2A 4LSNB 1LQ9A 4YB1P 4IOAQ 1XR6A 1TVRB 2GQCA 4B9SA 1RHMB 3N79A 1YRXA 3B6BA 2AIRB 1TKZB 3OHAA 1YQHA 4JP8A 4M63A 1SC1B 2GGPA 1I94F 1F6TA 2J0XA 4OYIA 2J9DE 5E7OB 2ZH6A 2AGPA 1SIZA 2CJXB 3IG1A 4OMFG 4K4WA 5KT5A 3CF5Q 1L3TA 3NEKA 1LNQA 1ZAWA 2RU9A 4DSKA 3GFHA 4PWWA 4FYWB 4K4TA 2R7OA 4RW9B 1I94J 3CCZA 3MM9A 3FSIA 3G82B 1S48A 5KFSA 5IT4A 5DDQC 3THTA 2YNHB 2QSFA 4WE1B 1KVIA 5DQIA 3UW1A 4ETXA 3M8QB 5KFQA 3J7ZT 3NXZA 2Z57B 2HQIA 2AYGA 3FDSA 1RTHA 3D1OA 3HFKA 3ILIA 4LQ9A 4JUZA 1FJGJ 2LCWA 4ZVUB 3C14A 5K9FA 5ETMA 4IOCQ 1K8AT 4DJBA 4I6WA 3NBPA 2C2ZB 4CNYA 3AY0A 4NZ7A 1PYSB 5KFOA 1YJTA 1RXOB 4P2MA 3UPFA 3GMGA 1NHUA 4NLDA 1S9GA 2EC2A 4MIWA 3LA0A 3EZOA 4LF1A 3LAKA 2PD1A 3R2DJ 4DFKA 2YVSA 5B0EA 2M2BA 3FEZA 4N56A 4KSEB 1WC3A 5HI7A 4QYZK 3C6UB 3US5A 1WOPA 3JSRA 2VG6B 4YB6A 4ELTA 2DITA 4RBVA 3PR4A 4DCOB 1H2TZ 2B4PA 2IDLA 5KOWA 1RT4A 3TVZA 5SZTA 5LMNF 1B0VA 4CYUB 2JZ5A 1UVKA 1JLQB 3DOKB 4PPDA 2XHCA 2LFVA 2DEIA 1U49A 4B17A 5B09A 4DL0C 1KQFB 1MROB 4V19J 3M8ZA 4PXEA 2VG7B 4I2QA 3BJYA 3C15A 2CZVC 2AP6A 3H5SA 3JSMB 2MKJA 1S1XA 2JNJA 2PC6A 2CNNB 1LW2B 5B7WA 2IYIA 1LWEA 2MKHA 5LMNJ 3TOQA 2BA9A 1CJUA 1BQNB 4PG7A 4CO0A 4R0EA 3MCMA 1UZHA 2GS8A 2GQ2A 2V8DA 4A46A 2B7CB 3VR1A 3BH6B 1SJ1A 5IZHA 4WK3A 3R2CJ 1HLWA 3HSJA 3M2RA 2E66A 1FA0A 2DIVA 2W25A 4DN0A 3CJRA 2A10A 3BO2A 3DLEA 3M8PA 1LWFA 1VBYA 2GCFA 1OQ6A 4DG1B 4LSLA 5D0RA 1YJVA 2D74B 3QZ8A 3W66A 4ERDA 2FY1A 3SFUA 4ZA1A 1N5YA 4RZRA 2BE2B 1J5OA 1X9SA 3D2WA 1KTQA 4WIIA 2XCAA 4O0NA 2KFNA 3E3XA 4CT8A 1FRMA 3UN3A 3NLCA 3MEKA 2E5LF 3FBCA 3JXOA 3JTNA 4ZVPB 1GFWB 4LQ3A 3E2EA 4IFVB 1UJ6A 3K5MA 2AYMA 1WSRA 4O3OA 1Q8BA 2ZH5A 2CWKA 2XSJA 2L9NA 2D9OA 2E5IA 2E9ZA 3HFVA 4C48A 2HMIB 1AA1B 4DX5A 1JKHB 3H4BA 5GADU 3BEGB 5CD4H 4AE5A 2HGLA 2LECA 4FF1A 2R8JA 2BE7D 2H51B 3DFEA 4O3RA 2E5LJ 4HLBA 2NPIA 5CZXA 2Q66A 3QWUA 3QNWB 2DGUA 1AUSL 2NQPA 3CNQP 1FVSA 1TKXB 2DGVA 4I56A 3OW2R 4DZDA 3RBDA 1HYSA 1SKWA 4MYUA 4MH8A 5B0CA 1YBAA 2VB6A 1VIXA 4FYVB 2Y1IA 3D1HA 4DUYF 4ZPDA 2OMLA 2YPYA 3KJFB 5J2MB 3ZXWA 3GJTB 4DSIA 2VBYA 3PW5A 1KWMA 1U1KA 5E3RA 4PG8A 2KFYA 4FXVA 2I9SA 5CCMA 2E1AA 3IM8A 1SC4B 2F4FA 3R7SB 1D8ZA 2Y1RI 3PEJA 3DM2B 4IFYA 1ZZNA 1S49A 2CQGA 3A13A 5KT3A 4C6AA 5IQ6A 1NZAA 4OJ1A 5RUBA 2B9YA 1NRKA 3TEGA 5J1EB 2ADCA 1QE1A 2MKSA 3LGHA 4DUYJ 4F7VA 5KFAA 5D6GA 4P75A 4WZQA 1M0SA 3KUEA 1VHFA 1EHWA 4DV1J 1S10A 2DY1A 2ZE2B 4NLWA 1ZBTA 4PYAA 2EK1A 4X84A 1DQ8A 5J2PB 1U0SA 2KM8B 5CYJA 2M4MA 4KE5A 2DNNA 4OLPA 3V81B 2ZWOA 3B54A 5CZVA 2FTRA 4MJKA 4KGVB 1NH7A 4V19X 3GPAA 3AJDA 1IKVB 3SCIE 2ACMA 4DPYA 4HH0A 3VGSA 4L3KA 3EICA 1HFEL 4LR8A 1UWBA 4WP9A 1XJWB 5D3GB 3UWTA 2AQ4A 2RQMA 4OI3A 4LREA 2NUUG 3KWMA 3TO8A 1Q95G 1IKXB 2V69A 3DLHA 4OHYA 1ZZFA 4QZVB 4ZCIA 1N33J 4NXNF 2ZKUA 3DRRB 2LEBA 3NNHA 2IC3B 1REVB 1RTJA 5FJ4A 2HQCA 4LFAJ 2WK4A 3IMQJ 2AZ1A 1JLEB 4PXDA 2V67A 3SV3A 3LWLA 4EU0A 2Y1JA 3R27A 2E5HA 3ENQA 4BWMA 1NK5A 3NGTA 2XWXA 4F4WA 2QLBB 2BM1A 4QWEA 1L3SA 2IJFA 3CCSS 1X5TA 4C8LA 1AZSA 1VBZA 1Y9OA 2HLTA 4KB7A 3V6HA 2F5GA 2DKOB 1Y5NB 3TANA 2DNRA 3KK1A 4NXNJ 2MDAA 1B3TA 2DGWA 4F8RA 1HARA 1CEZA 1LXNA 5K8OA 4DV6F 3VQTA 3ZTOA 2ASLA 4AL6A 1NLKL 3QGHA 1G3OA 1VRTB 1N4LA 4IH5A 1VYAA 5EX3A 3U1LA 4USWA 3EJMA 4I7FB 4RNOA 3SSSA 1VGYA 4DX7A 3KKFA 2KRBA 4WJBA 2K7JA 5KG6A 1EKSA 4IRCA 3P49B 4DV6J 3C19A 2MSSA 4DV2F 4P7TA 3IAS9 3UQSA 1F5BA 1NEEA 3G9CA 3DGPB 3JTPA 1D3WA 1WACA 4UUXA 1J27A 4QWBA 2L48A 1NB7A 3D68A 3EVMA 1X4DA 3BSNA 3KLGA 1FHTA 4P2FA 4X66F 1S9EB 1FDAA 4K4UA 4ZP9A 3VWSA 2B8PA 1RKIA 4DV2J 4N8NA 1UVMA 3R6GB 2FHOB 3TZXA 1B0TA 3RBEA 2MZTA 3FK4A 2LU2A 4DV4J 5ADZA 3KJVA 3JQJA 5HBMA 3M2VB 4YB7A 3LUYA 4X4TA 3W9JA 2GMJA 3AFGA 2OHDA 3NAHA 1PJ6A 4RUAA 4MKYA 1TAQA 4CM2A 1OYDA 4X66J 5E33A 4F3MA 5CCLA 2R7XA 4RJVA 3NY0A 4B02A 5GMEA 2HPUA 1Q79A 3ZNJ1 4GVLA 2OGUA 5KFKA 1HNIA 3DRSA 1SVDA 3BQ1A 3ONQA 1HQUA 1HBUA 1FTCA 4USJC 4CLPA 3J7A1 4WU3A 1S1WB 4IG3B 4DV5J 2BUNA 3ZZPA 2LP4A 2NCKL 3ET6A 4H4MA 5D0GA 2AJ4A 2XQCA 4MFBA 1YJ7A 3CB4A 4YY3F 1HL6A 3UDEA 1T9XA 4EEYA 3A8EA 3OLBA 1FRXA 3TARA 2M5YA 4DS4A 2VPYB 4ID5B 1AUDA 2ZDOA 4L76A 1BMQB 3CXCR 4L72B 3VTIA 2DNZA 3FSYA 1GXTA 3KK2B 1S1UB 3WDOA 2W2MP 2CJQA 1ZA1B 1O51A 2IJRA 1NSKL 1EB0A 4Q8EA 4B9TA 1V3ZA 1R8BA 3D6FB 3FEYB 2D3O1 2JRSA 4QR2A 2ZH7A 4R5PB 2LEAA 4YY3J 2VF3A 1VQ7S 3BGFA 1HWJA 3C6TB 3MEEA 3OXLA 2A18A 3FFIA 2O01C 3T3FA 4ZP7A 4HYKA 1H73A 4P73A 1RTDB 4IQXA 3SBMA 1RWOB 1T94A 4ZVTB 1FCAA 2X3GA 4HEA9 4IKAA 2H3EB 1RCXB 4B3SJ 4RO0A 1XMOF 2FJVA 1NAQA 1FX2A 1WF2A 2MGZA 2C3MA 3KLVA 3UVJA 4C8OA 6FDRA 4UF4A 2C28A 3MEGB 5C24A 3D3BJ 2JL9A 1F1BB 4YDXA 1YIJS 2V8GA 4OYWA 2B4OA 3MM6B 1IR2A 1VRUA 1O0PA 3KDNA 2MMYA 1KSPA 1N5VA 1KVJA 1OPZA 4KYZA 4CLZA 2GHWA 2GHVC 3T5JA 2MLXA 1Y3JA 2BR0A 1HNWF 1XNQJ 2QA4G 2KT3A 4Z7YA 2G13A 2VONA 2BZ2A 1CJKA 1YBUA 3IM9A 4Q0BB 1EKRA 4NOHA 4OHZA 2B4UA 1FKOA 2GW8A 3HSDA 3G6YA 3EM1A 1E6YB 4RUHA 1NZ8A 4PUOA 1FF2A 4UY8T 2OMOA 3KLHA 1U1NA 2M8HA 3QBCA 4OX8A 2HFVA 2MKCA 4NRUA 2Z2LA 2QMWA 4DSEA 1TL1A 2XYPB 2VA2A 1FJCA 1HNWJ 3HPOA 5LT5A 1WJ9A 4A8OA 2GGPB 3HHDA 4KKOB 4NX9A 3W61A 2MKIA 2ZBIA 5D4NA 3CDWA 3ITHB 3IG1B 2ZH4A 2FGOA 3RRGA 5ETNA 3HHLD 1KC8T 2FB0A 3EMTA 4ILRA 2OTLS 1JWWA 5I3QA 3THPA 1U1PA 1JJCB 1Q7YT 4DX6A 2J6UA 4UTGA 3TA1A 3W8GA 2QRRA 4YEAA 1ROFA 2Y8YA 4KBIA 2IBOA 3KLIA 2E9RX 1X4GA 3D6HB 3P45B 3MM9B 4F3OA 1X0FA 1H74A 2YBVA 3M9OB 4NCGA 1R6YA 2LXUA 4DL6A 2AEMA 3T1AA 5A8RA 2XYHB 2NZCA 1HI8A 1RTHB 3RB3A 1X4EA 3PRBA 2ZITA 1EETA 3H2VE 4Q2MA 3PY8A 1JLFA 3NWRA 1U1OA 4QPTA 3C14B 1RBOB 3GR0A 3NBPB 2CPFA 2X7IA 2B9EA 3HO1A 1N34F 3NOCA 2XO6A 4WTOB 2G0CA 4XO0A 1S9GB 2OEMA 2PT0A 4HI2A 2ZBPA 3LPYA 1R27B 2C3PA 2OH2A 3BBFA 2R7QA 4XDCA 5DLGA 3MPDA 4WFNQ 1RYSA 3R6LB 2KXFA 2HHTA 2RS2A 3J81Y 5F3TA 4NASA 3MR6A 4ICLA 2WVCA 2CQPA 2WONA 2P6SA 3N6LA 5K20B 4TY8A 5AE1A 1REGX 3KYLA 2AGOA 1N34J 1RYRA 3ZO7A 1R0AA 1TL7A 3P5TL 4DV0J 5L1LA 4IO9Q 5AXNA 3PG9A 2DR6A 1VQSA 5IC6B 4KPYA 3PJ9A 3ZZYA 3MF5A 1SV5A 2B56A 3H20A 1S1TA 1QUVA 2FLNA 2IVYA 4I2QB 3CMAS 2UVVA 2Z4PA 3LTOA 1Q53A 1VLYA 4OZ0A 2LA6A 1S1XB 2HAFA 5EWFA 4H4KC 1B64A 1X4AA 3OTCA 2QEXS 1UPMB 3RUBL 1LWEB 2MTLA 5DM6Q 4DQRA 2FJAB 2R9LA 2V2KA 1CJUB 3R8YA 2LU1A 4MKVA 3WQPA 4JBCA 1NK9A 1BHNA 1UMJA 3NCRA 3NL0A 4CIOA 4A8FA 3AODA 3FQKA 3M2RB 2VL1A 3FRYA 3OTBA 4KTQA 3T1YF 4BLGA 3KDOA 3DLEB 3M8PB 1J5EF 4J7CA 1ITPA 1LWFB 3NS5A 5B08A 3D0GE 4LSLB 1Q78A 4TU7A 1N52B 5C7PA 2EK6A 1CULA 4EBDA 3VVTA 3HD1A 1ZM9A 3WBZA 1UA1A 4A8YA 2GO9A 3MR7A 3ISZA 1J5OB 4QIEA 2HHUA 2XZTB 2WVDA 1TK0A 2ZHOA 1Q5VA 1XTZA 4FS1A 2IYGA 1X4FA 5IWAF 2ZHAA 3T1YJ 1RHRB 3FGVA 1J5EJ 5KT6A 2VBZA 4RU9A 5EHHA 4GRSA 5B0AA 5KTQA 2XSJB 1S57A 1NJXA 2SXLA 1BLUA 4P10A 3OXGA 1HIYA 3TAMB 5CA5A 3BO3A 1U2RA 1T03A 1N56A 2J0QD 4OIXA 4H4OA 4OZ3A 1U0HA 1C0TA 5DZ6A 2HQDA 5IWAJ 3AQPA 5T14A 2CZ4A 4YFUA 3GIJA 3W2WA 3RB6A 2MY8A 3OVSA 5SUHA 2VJVA 3N28A 5HMWA 4ECVA 2XBPA 1HYSB 2DB1A 2DIUA 4DV3J 2VOPA 1HHSA 3T19A 1HWKA 4CM0A 2XGQA 1KP6A 1SH0A 3MECA 1F2HA 2IRXA 4RW6A 2W2PP 4LF4J 4K59A 4JI2F 1GMWD 2RQKA 4F04B 1T7PA 2UXCJ 3U1NA 3CWJA 4TU8A 2GIRA 4I6YA 4F67A 3ILOA 3IRXB 2YQ1A 4ZHRA 3M6VA 5DGBA 1CJVA 3M30A 4IFYB 2XHWA 4RU2A 3A3PB 4EUVA 1IBLF 5KOXA 1NNDA 1FEHA 2ACYA 3VZHA 5BXIA 1VQKS 1S0OA 4NLOA 1VJQA 2E9TA 2HS3A 2YKAA 1A7GE 4YHHJ 1IWGA 2QX0A 2ROPA 1HBMA 3MTKA 4ED7A 4JV5F 5D0HA 1R3NA 1FRJA 3MR5A 3OUYA 3IWXA 3HJVA 2CPYA 1FKAF 3QATA 1X4CA 3Q86A 4M5IA 1U4BA 5CQGA 2DPIA 2VH7A 1EZZB 4FF4A 3GP9A 1IKWA 1KOHA 1IBLJ 3N01A 3G6VA 1U1QA 2UVWA 4CI0B 2H1YA 2FYXA 3NGRA 2UUCF 3M1VA 3SSQA 2E1MC 4ZK7M 2VQFF 2B8QA 2G4BA 4USTA 2BW2A 1F9FA 4JI6F 4AXIA 3DLKB 5CAAA 4WWSA 3SDEB 4KFBB 2FZGB 2L9WA 1VC0A 4HDGA 3D5MA 4EO8A 4M5GA 3GSDA 3ETOA 1K0VA 5LJ5Y 1RWNB 2UUCJ 4TQSA 3QGIA 4F4AA 2ASYA 2HSEB 9RUBA 3BN4A 5J2NA 2FVSA 3NS6A 3J80Y 2CQHA 3I31A 3LWMA 2IAJB 2FHMA 4JI6J 4GO7X 1AZSB 2ZHBA 3BR9A 3PX6A 3KK1B 4U8YA 2FZCB 1EJ7L 4LF7F 1RABB 3VV2B 4OFZA 1N48A 2VOOA 2G2ZA 1VC5A 2JDJA 3HX9A 4LMZA 2R42A 4DS5A 1S0VA 2BX6A 3DU6A 2HQGA 2JX2A 2HFUA 3QAUA 2ZOMA 1HBOA 2VFTA 1BWEA 2ZC4A 2Z2MA 1Q5YA 1SC3B 4ZVQB 3BO4A 3U7JA 4OZ5A 4OI0A 4JI8F 2MKYA 2QA2A 1QLNA 1WC6A 1S0NA 2C42A 1TK8A 3KHRA 3CTRA 3NGSA 1WI6A 3W5YA 1JNRB 4P52A 5HP1A 2FHJD 1JLCB 3OBIA 4CWBA 3K58A 2H5EA 4I67A 4EO6A 1WDTA 2JEFA 2R7RA 1UJ4A 2OLWA 3RB0A 2KJWA 3TZWA 1GEHA 4Y2IA 3I56S 4LIWA 4DQQA 4X2BA 2XI2A 4ZPVR 3JAMY 4CH0S 1RAAB 1K1QA 1TL4A 4ZVHA 2ZWPA 4O3NA 2IFXA 2G9OA 1Q81T 2HNZA 3CJ5A 1T8EA 4AT1B 4FDFA 3I55S 4QWDA 4K4ZA 2WBRA 2PI5A 2CRLA 4WFZA 2CYYA 4DCJB 1OO0B 3TZZA 4KGXB 1MN9A 2GIFA 1NSPA 4BC9A 4LRFA 3KJVB 1MSWD 3CT9A 1HW8A 2YX4A 3CGIA 3M05A 3ICLA 3VAIA 4RBUA 3KHGA 3UCGA 3ZZZA 3QRRA 3MAQA 3LP1B 1PAUB 2C2MB 2DBBA 3G86A 2QLJB 4LF6F 2IBKA 1HNIB 2J0SD 1S6QA 1W2IA 3DRSB 2W9BA 1G4CA 4JYAF 2GIQA 2ATCB 3L3CA 3MCOA 3AT1B 2J7KA 3AOBA 1QAIA 2W9AA 1X31C 3FNNA 1Q8IA 4L75A 3ET6B 4H4MB 3M8WA 4MFBB 4PG6A 5KG5A 1VBXA 4ZPBA 4LF8F 3OR1A 2LQBA 1OSDA 3FBFA 4LRDA 1FFSB 1UCNA 2JLEA 4PCQA 3CIMA 1U47A 4KQZA 2BRKA 1R43A 1KFSA 4MKBA 3BKTA 3FBBA 3D28A 5EX0A 5JMNA 1YJUA 4ZDNA 2ALZA 4OYMA 4IDKB 2EKYA 4D3GA 1Q0NA 4WE1A 2DGXA 2KT5A 3M8QA 1DURA 5GAEU 3HULA 3MEEB 2P2CB 5HMZA 3KG1A 2R2TA 2PE8A 3FFIB 5F3ZA 3FVYA 4CO5A 4DU8A 4LR7A 5GMDA 3OLAA 4EBCA 2XLJA 1KQKA 2FPHX 4F4XA 3TAQA 5MLCV 3SIPB 2MGZB 3UVJB 1MWZA 1RT6A 3BM7A 1TL3A 2AF6A 2I5JA 4ZJOA 4ED6A 5C24B 2H48B 3HI9A 4DBQA 1IBKF 3M6UA 3CC2S 1VRUB 4ENOA 2O5DA 2Y3YA 3WX4A 4LFCF 3H5UA 3TX8A 1JJ4A 1WDDA 1M1HA 5HROA 5F8NA 3L95X 3CC4S 1CJKB 1P6TA 3O6QA 4PG5A 2MQPA 1FNXH 4H54A 2F1FA 3UN5A 3H0PA 4F02A 1S4EA 1F9EB 3W5XA 4PUOB 2KVIA 3GB0A 1Q8KA 3KLHB 4PXBA 4A47A 1HPZA 3HHLC 3LALA 2VG7A 4U96A 4J9OA 3KLFA 4B3MF 4LFCJ 3HKZD 1KNZA 4O23A 5E5NA 3G6ES 3R5AA 2HNYA 1XNRJ 3SFGA 3ELHA 1HQ2A 4I2PB 5DDOC 2C3OA 1T95A 4P7VA 5IM0A 3BQ0A 5KFYA 1VBKA 3V5RA 3O44A 3DHWC 2V8VA 3GJSB 4Q8FA 1UTAA 2C2OB 2XMWA 4U6PA 4ECWA 4B3MJ 4L6V3 5K5MA 1U6FA 3VGUA 4KHMA 3KG0A 5FDLA 2N4DA 3KLIB 3I87A 4ZITA 5HJXA 2J8AA 1N54B 4NCGB 2RQCA 3DOMA 2CJYB 2IIHA 1MN7A 1VQOS 4Q43A 1WKLA 1WC0A 3EGZA 1NM2A 3TVYA 2X1BA 3KMQA 5KFFA 4K4XA 2HNDA 2W4PA 1P1LA 2ILYA 2OFGX 2XS7A 3Q0AA 1EETB 5L9XA 1JLFB 2DH7A 5DRKA 1AFIA 1RAFB 1EAYC 4CRJA 3Q89A 2CQ2A 2IJNA 3POTB 1SKUB 2P6TA 4DR6F 1M90T 2BDPA 3QT5A 4LFBF 2DCUB 2R3VA 3RU0A 2RKIA 4ZVEA 4F36A 5LSLA 4NPOA 2ZZMA 4Z7CA 1VQMS 1JKHA 4DQPA 2WVEA 3FJ2A 3PNIA 3RR7A 1WHVA 1CQNA 3SYZA 5BJRA 4ICLB 3JYTB 2QLXA 1ZPWX 4DMZA 3H42A 3BDPA 3M9NB 3WZ0A 2J76E 2D7SA 4WFXA 3RRHA 2WONB 3M32A 4EBEA 3Q83A 3G87A 4DR3F 3M9MB 5KFVA 2FJDB 4DR1F 4TY8B 1Y7PA 2PN6A 1R0CB 2M52A 3QMQA 5DQGA 1YLXA 2HHHF 1T9YA 4ECTA 4IH6A 3QSYB 3VQSA 1R0AB 2GNKA 2KDOA 1TL7B 2OO4A 3QRPA 4HDHA 3CVKA 2DEJA 2IPOB 5BR8J 3R3TA 4X62J 4QIFA 3PCOB 4JI3J 4OX9J 1RA7A 1SV5B 2QL9B 3CDEA 2FJXA 2XC9A 1UFLA 2ZH2A 5G0RA 1S1TB 1NPKA 2B3TB 2WSCC 3JSYA 3P5BP 3R5JB 2QMXA 4OHWA 4KIAA 4TU9A 5K8NA 2KG0A 5J2MA 4KHPF 3BGUA 3B8HA 2MZQA 2V9KA 1TZ0A 1IM4A 4EK2A 4B3TF 4LJMA 3X1LB 4WK1A 2V5HG 1HNXF 3CCQS 3PYDA 4JV2A 2EFPA 5J1EA 1NXIA 3SI8A 3GSIA 4DL5A 3TJ8A 2GMLA 1KD1T 2MSTA 3M7VA 1G7CB 1YJ9S 4QIWD 4F2SA 2RH3A 1UW9A 2ZE2A 4C3MA 4CP5A 4B3TJ 3SEOA 4IR1A 1CULB 2V2ZA 4FPRA 2B51A 4TLQA 5KG2A 2DHGA 2B9XA 2DJWA 4DSFA 3HM9A 2OP5A 3D6TB 1WUUA 3NRBA 3UDLA 4WU2A 1IXKA 1S6UA 3GYNA 1BQMA 3HHLB 1TMJA 2VFUA 3BKFA 4DF8A 1JIHA 2JEIA 1F5CA 2W9CA 1Y0HA 4MAKA 5D8HB 2W4CA 4ELUA 3C2PA 1SJQA 1YZ6A 4DOZA 1PJ5A 1KQGB 2MQMA 1RAJA 1RKJA 1S97A 4RWXA 3OTDA 2BQRA 1MNEA 3FKBA 1T03B 1U26A 1VISA 1SKSA 5IQQA 3BB5A 4B3RF 5C5JA 5HATA 2ZBQA 2ROGA 4G1IA 1FK9A 1IR0A 5C2GA 2VC1A 1C4AA 4U67Q 1IBMF 3NWGA 1S99A 4DU7A 1OS5A 1IBCB 5IV3A 2O1PA 3BQ2A 1S76D 3ZTRA 5A0YB 3NKYA 4A8QA 3IR7B 5K8MA 3IFEA 2CFXA 4I68A 3MECB 2EBGA 4JI7F 2MLYA 4Z2XA 2H54B 1QAYA 4B3RJ 5KG7A 3AQOA 4X64F 2P9CA 1OPIA 1IBMJ 2Q6CA 4U7CA 1S0MA 2UU9J 1A9NB 2K7KA 4A48A 2DR9A 4K8RA 1VK8A 1TUVA 3EVOA 4ZHRB 4A8KA 4KY3A 1CJVB 3M30B 1WG5A 3ENWA 1RE1B 3OQ2A 3FRZA 4ECSA 1MWYA 4M95A 2CJAA 4DV7F 2RRBA 3A3NB 4X64J 2F7VA 1FRHA 1YG0A 4RR5A 1HBMB 2MKKA 1EQ0A 3ZZTA 3CD7A 2QIFA 3TJAA 4UT4A 2PGCA 4NYZA 2KH9A 1HWIA 2HYIB 2HFSA 1HI1A 4P71A 4QIGA 3ZC4A 3ZZ0A 2KB2A 4DLGA 2WSFC 4ECRA 1PCAA 4YR0A 4K0KJ 2FVRA 4DV7J 1QJHA 4F25A 4OZJA 3M1VB 5D15A 3SQOP 1YZ7A 4I0WA 1RHQB 4F50A 2NSCA 3V6DA 4NLXA 3QAEA 1H38A 2P8IA 2QO3A 5KFJA 2RILA 2W2NP 1CLFA 5LOQA 1TP7A 2BANA 5DJBA 5EWGA 2H65B 3M2VA 1IR1A 2FLPA 3FBEA 2ZH9A 3MPUB 5BYQA 1GXLA 2A1BA 4MMOA 2V4QA 3K8VA 1U48A 2DK2A 2HAIA 1KRPA 1HR0J 4QIVA 2OPQA 4FXDA 1F3VA 3HXMA 2UV8G 8AT1B 1NDPA 4B9MA 3H8YA 1U6BA 2MHEA 4TYBA 1M1KT 5L1KA 2NREA 1YTYA 2CKWA 4UQTA 4PZVA 5M2UA 3CJKB 3F56A 1VMBA 1KQSR 2J7WA 4XPCA 3U1MA 1BGXT 3OSPA 1AW0A 1R8CA 3L4BC 1G2EA 4ANEA 2XY7A 3ZTSA 3DOLA 2R8KA 2MQOA 1DLOA 1PBAA 3MMJA 4ID5A 3ULHA 3DDIA 2PA8D 2HVHA 1SI9A 2OD6A 5I3UA 2BJ1A 1CG2A 1DHMA 1TUWA 5KFDA 1CPZA 2EWHA 2WSEC 3O2IA 1HBOB 4CNZA 1UFWA 4Z37A 2AX0A 1K44A 4DPOA 3OV7A 4NXMF 1SJRA 3GONA 4OX7A 3U02A 1R31A 1Y4ZB 3RAQA 2I6WA 2E1PA 4C2MA 1UWAA 3D4JA 2WB4A 1RAGB 5HP1B 1PYTA 4PWUA 3M8SA 2BE9B 4UOHA 1NJZA 4ED5A 1ZAXA 2W2OP 4FPIA 1FKPB 1RLDA 4ZN3A 2HURA 3CE8A 2VUGA 1JB0C 1S7IA 2O3DA 2CPXA 1XR5A 3TEHB 2HWHA 2OELA 4B08A 3K7RA 2DR7A 3AJ1A 1XQIA 4NXMJ 1YITS 3DRYA 3MM6A 1FI4A 1Z1ZA 1NSQA 4EI2A 2M3DA 3AAWB 4LBPA 4ZPWR 5D4PA 2HIYA 2HNZB 3B4MA 3BGRA 5E0OA 4C11A 3NGUA 5LM7E 1PJ7A 3PYFA 4OLOA 3RZAA 2F40A 4J9QA 4JI1J 4J91A 2WVFA 2V8HA 1JLAA 2X51A 2EFNA 3I5CA 2CDQA 5T41A 4IG0A 3MHYA 2C2DA 3QJPA 2CNLB 4CTAA 2YXLA 1S1VB 5F8JA 2EPIA 3MZIA 4FKXA 1I51B 1S6QB 2W9BB 4JI4J 2OAUA 4KKOA 1DTQB 2KU7A 3DCAA 1RTIA 2IM3A 2QC3A 3RJMB 1B70B 1PBUA 3ITHA 1RWWB 4DSJA 2HFZA 1M1GA 1N36J 2XMTA 3OXFA 3OR1B 4DR5J 4PEOA 4CCHA 4ZIWA 1SJ3P 1N5QA 3MOJB 4F4YA 2FLLA 1FERA 3PXGa 1UJ5A 4OI1A 1FJGF 1MMNA 3ADAC 4I69A 5ETPA 1RZMA 3DDNA 2ZUAA 4F2RA 4CH7A 3SCLE 3PFOA 2B43A 3OL8A 2BQ3A 1ZETA 3ZZOA 3GIRA 1FFGB 4O3SA 1U1LA 4D3HA 4YMEA 3W2VA 2D1CA 3K5NA 4E98A 2MHNA 2BJEA 2HBYB 5IFMA 1F3FA 1PO6A 3MWBA 4FXWA 3MMAB 4NYOA 3OTOJ 1TV6B 3NNAA 3GJQB 2KTQA 3HD2A 3O3LA 3BN7A 4N47A 5F8HA 2QLWA 2VG5A 1LW0B 4JV1A 2OIHA 1RT6B 3MR2A 1TL3B 5AXMA 2UUTA 2I5JB 4J90A 4OJHA 1WHWA 2M0GB 1CJTA 3E51A 2JWNA 1RISA 2CPEA 3FQLA 2AHOB 3KTQA 5HROB 2F63A 2XYGB 1V5VA 4FYDA 3MAAA 4ER8A 2NLWA 5KG1A 4X4NA 1WEYA 4CLWA 3UE2A 5DG9A 1XBWA 2RHQB 3HJFA 1RACB 2YWFA 2GO8A 3TJ9A 1HPZB 4RBTA 4CO4A 1FE0A 3KLFB 2XMVA 2Y1LB 1NK6A 2CIMA 3I0RB 3DMJA 4GKKF 2HNYB 1TKTA 3TVKA 4DQSA 4FZVA 2F9DA 2ABYA 2HHQA 3MD1A 2CQDA 1FRIA 4N41A 3MCNA 3CMQA 1LV5A 4ELVA 5IM0B 4YR3A 2W7OA 1K1SA 2ASJA 2CPZA 3L7OA 1IM6A 1ZOTA 4I4BA 2FC9A 3WIUA 4CLUA 2E7XA 2BACA 2CADA 5CYMA 4DCPB 3OFEA 2V8PA 1RT1A 4GKKJ 5FDLB 3DLLQ 2X1FA 3CCWA 3G6XA 2FY8A 3RW7A 4UOGA 2IMOA 1IQZA 2YWGA 1NK4A 3HSZA 2QL5B 2R2SA 2V50A 2FD2A 1VJWA 3DOMB 1RT7B 3CSKA 4P6QA 1NHKL 4IOBA 3CULA 1XEZA 4NLYA 4B3OA 2HNDB 4QR1A 5GADI 2RAQA 3CIZA 4WFBQ 2K06A 3R1LA 4YB5A 2GC8A 2XNRA 4MK8A 4KV8A 4QU7A 1ZA2B 2DO0A 3MXHP 4UZBA 5HMXA 2CJKA 2WCXA 3W1YC 3B82A 1PC5A 2RKIB 2OUGA 3TAMA 4IUFA 3I5AA 1VRQC 4B9UA 5L39A 3GCWP 3CD5A 3LP0B 1WC1A 2JVOA 3OHBA 3DLJA 3PX4A 3M32B 4Y00A 1GT8A 4DPTA 5DM7Q 1R0BG 5E3PA 5DG7A 1Y3KA 3D3CJ 3I0SA 2OEKA 2GHPA 4P2XA 2ZD1A 1VOMA 4R8UA 2YQ3A 4MT1A 1U1MA 5C42A 3VCDA 3OL7A 4LVOP 4NLGA 3UO0A 1TTHB 5G0RB 5IV4A 5DO2A 2N3LA 4DPXA 2HVDA 1HQEA 3IBFB 3EPGA 3UNGC 2VU5A 3AXKA 2WHOA 5I3PA 1GQEA 2XMJA 4DV1F 2F65A 4AQYJ 3IRXA 1RK8A 3A12A 4KO0A 3AA8A 2RE1A 3IO1A 1SUQB 1KFDA 4MK7A 2UVRA 1XMBA 5KT7A 5LXRA 5H1SV 3S7RA 5AE3A 1KEKA 3S6EA 3KK3A 2W1BA 4KAIA 3I9V9 3QZ7A 1NMEB 3I4PA 1RGVA 1UVLA 1FD2A 1P9YA 2AZ3A 2RF2A 1K0TA 1NU4A 1UEUA 2GAGC 1FDDA 3W7BA 4P72A 1N8RT 1ELOA 2JH3A 4GMKA 4K4VA 1A6LA 4HL9A 2UXDF 4M5DA 4RUCA 3SCJE 1N33F 1RI7A 3DLGA 4TYAA 4YR2A 2K1RB 3WIVA 1BQMB 3LP2A 2MYFA 3T1HF 1UVNA 1GMVA 4LFAF 5F8MA 2ZUGA 2VKRA 3R9LA 1J2VA 2W9CB 3HVAA 1YRTA 1RDRA 3VGVA 3R5DA 2HS0A 3GG1A 1FXRA 3TQEA 4H4KA 2JSXA 2QT7A 2BQUA 5JXSA 4U7UK 4WTYA 3FCWA 3DLKA 2QGFB 3T41A 3SDEA 4KFBA 2ZH3A 4LRAA 1RAIB 3OFFA 2UXDJ 2MZJA 2V2VA 4AD6A 5EN1A 3FMBA 1K73T 4WCEQ 3T1HJ 1FK9B 3H7HB 5F9NA 3NAIA 1HD0A 5CYQB 1GX5A 1B7YB 1Q1KA 2PMWA 4FVCA 2DNOA 1Z2LA 3Q8SB 3AD7C 4KGMA 4A8SA 3CD0A 2CNKB 4CH1A 5K8PA 2OEJA 2IAJA 2CPIA 5ETTA 2BXJA 2CVEA 3R7NB 1H7XA 3P6YC 4B9LA 2HBRB 1RWUA 2EFVA 4LRCA 4RWWA 5D4LA 2R7TA 5U47A 5KFBA 2H9ZA 1HWUA 1RAOA 2DXEA 4WP3A 3CDUA 3RYLA 3OVAA 4PQAA 1RA6A 3S8SA 3TWZA 1QSLA 4DL7A 3KFWX 3K17A 2WB1D 3SZ2A 1PGZA 3NCQA 1O8BA 4MYTA 2YQ0A 2K3IA 2W8LA 4E2FB 1T3OA 3W9IA 2GV1A 3MUVP 1KBRA 3RAXA 1MG7A 4DHVA 2JJ4D 3EVWA 2DT9A 2PA3A 3JQMA 5I42A 3L7PA 4Y2MA 1BC6A 1JLCA 4DR4J 2UUBJ 4A8XA 2ASDA 5HQMA 1VCTA 1N32J 2B0GA 3TUJC 1NPRA 5H9EK 4DV4F 1PC4A 2ROEA 2R7UA 2HEKA 1S6PA 4ZPCA 3R97A 1DY3A 5KT2A 3PW0A 1JLGA 2MQLA 5IT0A 4M8LA 1B99A 4WBFA 2Y9HA 1YBTA 2WRMA 3D0HE 3V6DB 2ZKTA 4URQU 3W60A 2X1GA 1HW9A 4NLSA 1Z4UA 3CO9A 3RR8A 2BKNA 2XS5A 4UW2A 3JSBA 2BANB 2NXEA 3EZ5A 3CCJS 4DV5F 2DYAA 3RB4A 4Q7AA 2C2KB 1PSDA 4I6AA 1S77D 3J7AN 2D3OR 2IM0A 1RLCL 2YWWA 1GK8A 2CJ9A 3GILA 3ZFVA 2MZRA 7FDRA 3LP1A 1AXQA 4G3IA 4ZJLA 2OPQB 3KUHA 3H2LA 4X4QA 1VS3A 3MMBB 3NMRA 4J9MA 2YTCA 1P1TA 4IO1A 4XDDA 3AB2B 2WW4A 2EFGA 2BABA 3ILJA 2HS4A 4RNHA 2G2OA 5E3QA 3VAHA 3GYXB 3NNCA 1YK9A 4BHQA 4UY85 2O67A 2CPHA 5C25A 2POKA 1FNMA 3DOLB 1I3OB 5KG0A 3TRGA 1VDHA 4FNHA 4ZJQA 2XLKA 1DLOB 3CDBA 1YWXA 4PAAA 2V0NA 2NZ4A 4PWDB 2XGPA 2E1CA 5HJYA 4CLYA 4B3SF 1OY6A 4CLSA 2IMWP 2EVZA 3BS9A 2OPPA 5I3UB 2QMUB 4NLQA 2ZNYA 4IDKA 4JOUA 5AXLA 2N82B 2Q1LA 5D0EA 2A6OA 1UVIA 3R1HA 2VPXB 4C0HA 4CLTA 4M5NA 1QSSA 5GAHU 2VFSA 1G1XA 1XNQF 2VKZG 1R8AA 3TW0A 1YI2S 3VF0B 4JI5J 1ZM3A 3RW6A 1SQEA 2FDNA 4X4VA 2XMAA 1ZTWA 3P3DA 4DZ6A 1KLMA 5IT9Y 3QJJA 4DLEA 1UVJA 2Z0GA 4ITSA 3IN5A 2DNKA 1FXDA 3I9ZA 1DRZA 1ZM4A 1P27B 1VFJA 3AJ2A 2VJUA 4M1KA 2E5GA 2DHSA 2J6SA 5GVQA 1B0PA 3TR5A 3Q23A 4HT7A 1OY9A 3M8RA 1H2VZ 3J81U 3CPWR 4JI0F 5CHCB 5F0WA 4NEZA 5L1JA 2GQQA 3BGRB 3NGDA 4C11B 3EZUA 3VAFA 4USUA 1ZYQA 1T9WA 2XG8A 3DU5A 1NH8A 2JEJA 1Q82T 4RNFA 3MR3A 2GX8A 2RMLA 4KHRA 4USKA 4NI2A 1JLAB 2JFDA 3BBCA 4HI1A 2WOMA 3F73A 4IG0B 2CA9A 4ALZA 1FO1A 4CTAB 4P9SA 1TAUA 4JI0J 4LIRA 1VC6A 4ZOSA 1YGYA 2AEFA 2R2RA 1SKRA 2R8HA 2LVWA 2P9GA 3PTWA 4I2PA 1RTIB 2WAQD 4OI2A 2X3DA 2B5JA 1PILA 3K5PA 1JX4A 1RHUB 1WD6A 2BMBA 4PKDB 2YWHA 4HVZA 4Y2KA 1KN6A 2HKEA 2XWYA 2YWEA 4YP3A 3C16B 5HANA 3BDEA 3HT3A 6AT1B 1YJNS 1Z2ZA 1EQMA 2GZOA 3BSCA 1T3NA 2EFOA 3BH7B 5ETKA 1RTZA 3I82A 3HVWA 3OFHA 3D9BA 3MOZA 4RNMA 5DDPC 4K7QA 4IH7A 1RSCA 4WXOA 5IS2A 3TI0A 3T6BA 5CH7B 3W2VB 4DR2J 2CG8A 2HG4A 3F41A 3K5OA 4C8KA 2W7AA 2YKNA 1RCOB 2CPDA 3MDFA 4ZS6A 2KJVA 2C2RA 1SL1A 1HWLA 3LH2S 2XCPA 2LA4A 3JS9A 3RBXA 3LO3A 3BREA 3IA0A 3BPSP 3MM8A 1L3UA 2G1HA 3BGLA 3POTA 4LVNP 3LAMA 2VDIA 3VAMA 2FC8A 2HZVA 4C98A 2VG5B 2Z56B 1RWXB 4NMLA 2D3ZA 4DV0F 4OZ1A 4LR9A 1FDBA 3PW2A 4XTTA 2ALYB 3HT0A 4WYWA 1GXUA 4QJVA 4TKTA 1ZH5A 3PFEA 3EDRB 1CJTB 1H2UX 3I32A 4L3NA 2RB7A 4C8NA 3JYTA 5HMYA 2O66A 2HRTA 4BDPA 3IBWA 2W01A 4G1QA 4URSA 4FVMA 2LQJA 4OHXA 2A2DA 4NA1A 3MAAB 2H5JB 4N5SA 2LXFA 5ETSA 1T05A 5HLFA 2QFJA 2DRBA 5BYSA 5GMKa 5DG8A 2XY6A 3OFGA 1N6QB 3H5XA 4ILLA 4ZPAA 1FVQA 3VVUA 2YNGA 1VQNS 4GC6A 2VV5A 3N5FA 1B4SA 4JB8B 1S59A 3DMJB 2IA6A 1TKTB 3C66A 5D77A 3MUMP 2KHDA 5F8IA 3W63A 4KGKA 4C3LA 2XULA 2RD5C 1FRLA 1H98A 1KDNA 3F44A 2CQIA 2NSBA 2F8EX 1VQ4S 4S0MA 3QSIA 2CQBA 5B0DA 3K0JA 4HACA 3QT6A 2AJ1A 2JVRA 4ZIVA 5DGAA 1RAEB 5A2QY 2KG1A 5CYMB 2V2QA 3IRWP 1RT1B 1SCJB 2DHXA 4M94A 2DD8S 4Y0FA 3P4UB 3B4DA 1MMLA 1DTTA 8RUCA 1QSYA 1YVFA 2L08A 3HZEA 3NOGA 1QTNB 2QE5A 4ED0A 2KM8C 4GVBA 4DR7F 2MXYA 1CQMA 1HNVB 4BWJA 2E44A 4EWTA 3CUNA 1ZS6A 1NK7A 4GO5X 4ANDA 4B3OB 3GG0A 3HHEA 3HHLA 3WC0A 1WSVA 2R7WA 2XSFA 2XO7A 4KV8B 2QSWA 1KLNA 2Q43A 4E0DA 1KTVA 3QT7A 2VPZB 4FS2A 1E6VA 3O5TB 4DR7J 1T9UA 3ZZRA 4DV3F 4MIBA 3A4TA 3V6JA 4AL7A 5F0UA 4OJ3A 4LBIA 2DNPA 4LF4F 4A4JA 1KOOA 5HVGA 4O44A 2UXCF 1JNZB 1QTMA 4DN9A 3DKDA 1OYEA 4NZ6A 2DTJA 3VHQA 2XMUA 4WPAA 1G6BA 3MEDA 3HMJG 1V5IB 1QAXA 3I0SB 1S5ZA 3UR3C 5A0YA 2ZD1B 3G96A 1XC9A 4R8UB 4RW4A 4AXJA 3J80U 5C42B 1BXNA 2YKPA 2HBQB 4NRTA 1QUPA 4KH1B 1RBAA 4M5LA 5B0BA 3GR1A 1TQLA 1HQEB 3EDQB 4Y3CA 3ILLA 3T9ZA 1BUXA 4YHHF 1WELA 3TA2A 1F2GA 2MQ8A 4YDDB 1UP1A 1WF0A 1NDCA 4C0BA 1NSAA 1KHVA 4KO0B 3BKUA 4OYBA 3M8YA 3PRVA 3Q8VA 4PYDA 2PSZA 1WTBA 4LUBA 1FJ7A 2FHKA 1SJ4P 3A3OB 2YH1A 2NXJA 2YKMA 5JUMA 5G4DA 2BEFA 3K59A 3HKWA 2NXUA 3TQ1A 3KK3B 1EP4B 3DDKA 2ZFHA 1L5UA 5KFRA 4ED8A 2AX1A 5J2QA 3CCVS 5KFXA 2J9DA 2RF2B 5FIIA 3IR5B 4RNNA 2ATLA 2LMIA 2PO4A 4DQIA 1CS4A 1IKYA 2HHXA 3FUYA 3IS9A 4AUKA 3OL6A 2ZJQQ 4M5DB 1D8YA 3DLGB 1V3SA 3LP2B 3ZNUA 3JAMU 1T11A 3OD2A 4TY9A 1BE4A 2VBXA 2KVQE 2C2EA 2LKZA 2IY5B 3K5LA 2V4RA 4RUBA 2BJ3A 2XM3A 1LWXA 2OPRA 3DYAA 5KT4A 2CJBA 5B0FA 4ZLJA 4J9UE 2VD3A 4ZPTR 1S12A 1KONA 4J37A 1TL5A 2VBWA 3K2YA 4K4SA 4PQUA 2XMMA 3A8JA 4QU6A 2KZZA 2RT3A 4KT0C 4W4MA 4DFJA 1FESA 2YNFA 1FX4A 1SH2A 2QA1A 3DNCA 1QDUB 4KC5A 2QFIA 3QJLA 3QO9A 5JJBA 3I96A 4J9NA 3CCES 5DDRC 1C2PA 4QYZJ 1YKWA 2CXEA 1F60B 3CJKA 4C7QA 4TXSA 1HKAA 1P9QC 2HVEA 2I2YA 2HFOA 2CVIA 5KAKA 3MURP 2DH8A 5FD1A 3CCUS 4M5JA 3BBBA 2YH0A 2D9PA 2AW0A 1WKJA 4EGLA 1WNEA 4KJIA 2M9KA 2PEBA 3DC2A 2ZH8A 2V63A 1M5VC 3VAJA 4OL8A 1PG5B 1U8WA 4QBUA 4NLRA 1QVGR 2B4VA 3CW2C 2Z2YB 4XIUA 4G1PA 3LOUA 1VIOA 3Q8QB 3A8KA 4O3QA 1YSJA 4OYPA 3DLBA 2EW9A 3CMES 4ECYA 1FD8A 4FYYB 1SL0A 2DNYA 2V9WA 5I42B 2VIHA 4RX6A 4BC7A 3GZ7A 4ZVGA 3KNAA 4C0OC 4JV0A 1GMWA 3HSGA 4O0IA 2D41A 3N9UC 1FKPA 3BYRA 5A8WA 3VALA 1Q4RA 2V68A 2I1RA 2FIUA 5K14A 1S6PB 2Y0SD 1P8GA 2I8EA 1HD1A 2EXUA 2ZBCA 1R8PA 3Q2SC 3PKYA 3CDAA 3THVA 1JLGB 4FYXB 2AJFE 2AGQA 1I6JA 3OJUA 1SJFA 2L41A 2VPWB 4Y2CA 5D78A 4DDFA 5DZ7A 1L3KA 2KL8A 2YNIA 3TUPA 2DHHA 3QQCD 4TN2A 4DL3A 4DFPA 3OTEA 3UD5A 4O4RA 3CCTA 3N4WA 3KLEA 2IA0A 5LSRA 2DNQA 3GIIA 2J6TA 1PYOB 3DI6B 2AYBA 3G8QA 2YKOA 4B9NA 4NYPA 1S1VA 1RQ0A 1SC6A 3H2UB 2AV5A 1RUSA 3GCXP 4ZLNA 3PW4A 1DTQA 3P96A 2DR8A 1U2FA 1HHTP 2KHCA 1MU2A 4IQMA 2NYHA 2XMKA 3PHTA 2M70A 3L9ZA 2WBMA 4W92B 1RWVB 5HVHA 4AFFA 2IM1A 4FF3A 5C25B 4ECQA 2YKQA 5HVFA 4OZLA 4O3PA 5GAEI 3H25A 4C4WA 2E7WA 1RHJB 2IVFB 1X8DA 2FVQA 2ZOGA 1CBKA 1U02A 3LW5C 1RT3A 2DGQA 1X4HA 2R7SA 2OPPB 2EI5A 2VFRA 1KVKA 2B7BB 4ZVSB 3MM5A 2BRLA 2AMCB 1HMVA 3T9NA 1OQ3A 1X60A 1Y5LB 2VICA 1FJEB 2FZKB 3SQGA 2QA4S 4F4KA 3MMCB 3TUIC 2PMHA 5JVHQ 1XN9A 3MMAA 2PI4A 1TV6A 1RAHB 2QTWA 2Y0BB 3NP5A 4EYHB 3MM7A 1BY9A 4ILMA 4CLKA 4DPUA 4OZ2A 2RDDA 4ZCMA 1KLMB 4G65A 2VASA 3E8OA 2CNOB 1LW0A 2FVPA 4FF2A 3GIKA 4TVAB 3PEHA 4QWAA 4FNIA 3BPDA 5DLFA 3KJNB 4DL4A 2AJQA 3DGVA 2P5VA 2KYZA 1D9FA 2NYIA 1RT5A 1WKKA 1D9AA 1OWXA 4PR6A 1V9OA 3W9HA 2F8MA 1JJ2R 2NS1B 2DPJA 2W8KA 4Q44A 1FE4A 3D54A 1U45A 1VQ8S 2LQ8A 1XNRF 4RW8A 1UL3A 2HZCA 3K8WA 2QYCA 5THWA 3UDVA 3AA9A 3Q2TC 2HVZA 2U1AA 2FHJA 4HH1A 3AOAA 4NI2B 1R7IA 3HVRA 4OHVA 4QW8A 2J9CA 4N8OA 2WOMB 4J5OA 4WKYA 1Y11A 4AYBD 2HFNA 4DUTA 4K5SA 3PKMA 3I0RA 3FSXA 1AB8A 2BJ9A 2MY7A 4ANCA 3UD3P 1R89A 2W24A 1M5KC 4LT6A 4HTJA 2CQ0A 1AFJA 5F8LA 4MK9A 2ZZTA 1UZDA 2B5JB 3L7UA 1IQTA 3M6XA 2XTJP 4BCAA 2WVBA 3S1TA 5CD4A 2K3KA 2DNHA 1N0VC 4IYQA 2PMZD 4J9VA 2DY9A 1NBEB 2LLZA 5D4OA 3CCRS 1XMOJ 4IRDA 4U8VA 1F5AA 4WP8A 2NPFA 4Q5VA 3LPEA 5H9FK 3SV4A 2DGTA 4U7UD 4LRBA 1OY8A 3G8SA 2OD4A 3LF0A 1XMQF 5KFMA 5BYRA 2NXCA 2L3MA 4MTPA 2OSQA 1RT7A 1O5JA 3KXDA 4RW7A 3E01A 4IRKA 3BR8A 1U2CA 2YKNB 3J7YI 1S79A 5L38A 1RT2A 2G0JA 2VC0A 3D6MB 3MM8B 3GTYX 2EBEA 1D09B 2HIQA 5C2CA 2J5AA 2LDYA 3I6PA 2HW3A 1MLAA 1U6ZA 1XMQJ 3IWNC 2ADBA 5BR8F 4Q2LA 4ED4A 4X62F 4JI3F 5DQHA 3T5HA 4WYLA 4OX9F 1EIYB 3S01A 1M5SA 1NHVA 2A6MA 1YDLA 4OYXA 3LP0A 1URRA 1XIQA 4J9SA 1NKEA 5H9EJ 3SCKE 5MAOA 3G2XA 5L46A 4G1QB 2Q3PA 4OZNA 1DFDA 3GIMA 2CZ9A 2KN4A 1LK5A 2MPUA 1NJWA 2YY3A 2Q6BA 3HVTA 1T05B 2ZM6F 3T5KA 3CJ3A 5HLFB 2HGMA 3GJRB 2IDEA 1ZM2A 1MW7A 4K50A 1WTFA 3JQKA 1QD1A 1SXLA 2OSRA 3MTJA 2YNGB 5LMUF 5HL7Q 2RRAA 1OJ4A 4KPCA 1SH3A 3M6WA 3TA0A 2CQ4A 3Q8RB 5FLXU 3RBZA 3DN9A 5EGYA 2ZM6J 1LOUA 5L1IA 1SUQA 2E29A 1R8HA 2G1DA 4NA2A 2RUGA 2YX7A 1TFWA 4HACB 3WX8A 1KR4A 4MKAA 1D1UA 5F8GA 1BWVA 3P8BB 5KFNA 1WWHA 1JQGA 4DPWA 1W25A 4K4YA 5LMUJ 3LANA 4U9RA 2NR0A 2KFZA 2HHPA 2UP1A 4FN5A 4ZCLA 1DTTB 3ZTPA 1RT4B 2IHR1 5J1NA 1TMMA 2AJ0A 2KT2A 2R8GA 1YHQS 1IUJA 4GVBB 1WEZA 4ZVFA 4F0KA 4X4PA 1LXJA 2FUG9 4X4UA 3RG6A 1ICEB 3OVBA 2IVMA 4EFAC 5LXYA 1DQAA 2CQ3A 2RDIA 1A0OB 3C15B 4N77A 5L9NA 2K1RA 1Q86T 3BSAA 3CJ0A 5ETQA 2B6AA 1DQ9A 2ILZA 3VGTA 1URNA 2DRAA 3PIPQ 1CVJA 3W62A 1WG1A 2HLUA 2QJ3A 4USVA 3U27A 3QLHA 2V4JA 2OPSA 1SPBP 3MFIA 1WG4A 2GA7A 1BD6A 1F9HA 4NLTA 1C1CA 2AJ2A 2GAHC 4PXCA 1E6VB 2FGCA 2YWKA 3CEDA 1Q16B 1NK0A 3R5GA 2Z2ZA 2JEGA 2RU3A 5L8RC 3LGNA 1T02A 3N6MA 5KFEA 4NCBA 1KKHA 3NS7B 1SB6A 4O44B 3BF4A 1JLBA 3TX0A 4WZMA 4RKUC 2L9DA 2XB2D 2MQNA 2UU9F 5CYQA 1IWAA 3AHPA 3RRKA 2UV8A 3MEDB 4EMDA 3IGVA 5ETRA 1WI8A 3KUGA 3CJQA 4RW4B 1N5YB 3H59A 3FZBA 3KHHA 2GJFA 3PIOQ 2EG2A 5EWEA 3OL9A 2RJZA 5A8KA 2GFFA 2KYXA 3CJSA 2EFQA 2RDJA 4FP9A 2JFKA 5AE2A 4FBTA 3J81j 1B7FA 3TNVA 2HRYA 2M8DB 2GMHA 1LWCA 5ITHA 4CQ1A 1VQYA 1DZ5A 2CQCA 1GX6A 1IJFB 2YKMB 4K0KF 4ZLPA 3GYGA 3BYPA 1HBNA 2A0FB 2GJ2A 3PYEA 3OSNA 4N7TA 1WF1A 4QYRA 2GVZA 1IVZA 1RWKB 5J2QB 3AD9C 1UPPA 3ENVA 5KFIA 1RADB 2E5JA 4OYAA 1UETA 3MI7X 3OR2A 1HI0P 4DX8H 3DRPA 4PPZA 1CS4B 1IKYB 3NG8A 2IM2A 1GAOA 3IS9B 1I5OB 3A1YG 2UVUA 1RHKB 1TELA 1HR0F 3LGMA 1QVFR 1UEKA 3UN2A 2AT1B 1FXLA 5HQLA 4NEYA 2HRUA 4NE9C 1LFPA 2UUAF 3OPKA 2OPRB 4ECXA 3DYAB 2N3OA 3TZYA 3M4XA 3UI3A 1X7VA 5B0GA 4KGZB 4FBUA 1D9DA 1QE1B 2C3YA 3I4HX 2BOPA 4JI2J 3C46A 1VK3A 1M5OC 2PIIA 4PQUB 1PAEX 4ZP6A 2ZJPQ 3MGJA 4OYOA 2UUAJ 3MMBA 2E7VA 2YNFB 4DUZF 1YX2A 2H5IB 3TYTA 2XY5A 2J7UA 3KMSA 3QO9B 1WC5A 3HF5A 3W64A 2ZC3A 5LL6d 1XK8A 4ZVRB 5GAGI 1JXLA 2ZDPA 1KS2A 3M2UA 1UEVA 2JHEA 4ED1A 1W2BR 1JXEA 4ZP8A 4USMA 4U95A 2EC0A 3EGNA 4JV5J 5T7LA 2DISA 1OIAA 3HK2A 2ZNZA 1UWBB 4PWDA 2F9JA 4DUZJ 3W8PA 2CG4A 3ZTQA 2HHVA 1SQFA 3JTOA 2XI3A 1VR6A 2MZ1A 2C22A 4E8UA 4KR0B 1XERA 1N5SA 2CUYA 4WFYA 1RTJB 4L73A 2D69A 2DXFA 2ZVSA 2HK3A 1C0UA 3G71S 1UW4A 4OI4A 4Y34A 3PHEA 3UR0A 1JK9B 3T5LA 2VQFJ 1HHQA 3CJ4A 4O4GA 2N7CA 2EG1A 5KFCA 4JI1F 2PFDA 5A8WB 3AXMA 3QPIA 5DETA 1X9MA 5K14B 4B9VA 3BV8A 4WF9Q 4YQWA 1WEXA 4L74A 4CO3A 4QPXA 1XR7A 4J9PA 3HCXA 1RB0A 4URGA 3AH6A 3V2UC 5ETLA 1QY7A 5J1PA 3QGGA 2BW7A 2YNIB 4JI4F 4X4OA 2C2NA 2OFHX 2GJIA 4Q45A 5KFPA 2KRRA 2F3JA 2G2YA 3GV5B 2LYVA 3ETMA 3KLEB 2EEYA 1C1BA 4PABA 1N36F 4RLEA 3PRDA 5ETOA 2AWZA 4DR5F 5IXUA 1H0HB 1GMUA 1NKCA 3FCVA 4LF7J 2P9EA 2AKWB 2PEHA 3QYYA 2LXIA 1N0UA 2CDRB 2GVDA 2I38A 3W65A 1VQ9S 1MWQA 1S72S 2DNMA 4X65F 1FFWB 4PRFA 1APSA 3VAKA 4ZLLA 3N6NA 2M88A 2ZBRA 3ENAA 2FLOA 4QQBA 2CAJA 1UAWA 4NCAA 3V4IA 1MU2B 4BS2A 3NGKA 4UQGA 1H7WA 1GTEA 2HK2A 3KLGB 5KFUA 3IBCB 4JI8J 2UUWA 2G0IA 5E3CA 3CO0P 2WW8A 4A8WA 4UZCA 3C16A 4X65J 3OTOF 2AD9A 5HN0A 2BOAA 3EYZA 2VHGA 3GFZA 1RT3B 4OV6A 1Q7LB 1WOSA 5HBMB 3KOAA 3HFZB 2Q79A 3V4MA 3ISND 4LF9F 3QIPA 3MM5B 1HMVB 3QGPA 4LSNA 1TU0B 1RJJA 3EXYA 3IC1A 1TVRA 2A3JA 4ETZA 3SQGB 1D0EA 2CWXA 2YX1A 1TKZA 3GFYA 4XK8C 2D3UA 1U7LA 5M2RA 1HQUB 1HBUB 3MM7B 3C8YA 1DBDA 4Y6IA 2BKOA 1X5SA 3D0IE 1ZPVA 1VQLS 2VODA 3GE9A 1T9VA 3IGNA 5KFHA 1PKUA 3AB4B 2RHSB 4ATNA 5AJ3F 4LF9J 5HO4A 2RNEA 5KG3A 2BV3A 1NUEA 2BJ7A 2DGOA 2V6AA 1TKDA 1PIEA 3CCMS 1RT5B 5LSOA 1FT8A 4TQRA 4LF6J 4HT5A 4C8ZA 5AXKA 5KFWA 1S7HA 4DL2A 1RWMB 1QAJA 4RW9A 4YUDA 4JYAJ 4RW8B 2F8HA 2LQ5A 3FCHA 3G82A 2U2FA 3HZGA 4OI6A 3JB9k 2DXDA 1NKBA 1FWPA 2YNHA 3EGVA 5AJ3J 1ZAVA 3UFCX 2HVIA 4LF8J 4Y65A 1N6QA 3IAM9 3Q22A 4DFMA 5KG4A 4R0JA 2KO1A 4DF4A 2J0WA 4WFAQ 2LDIA 3CD6S 2AU0A 1NCLA 3Q8PB 2ZEJA 1S9FA 1EX8A 2R7VA 4P74A 3FC9A 2Z58B 3I5BA 1JMTA 4RPFA 2XEXA 4M5HA 4Y28C 3HHNB 4I64A 1Q8LA 3K57A 4K5RA 4ES3A 1X4BA 2W2QP 4CLFA 2OJ3A 2VFVA 5JVGQ 1RBLA 5HSPA 2HZAA 2HWTA 3C6UA 1W26A 2CQ1A 2VG6A 4J9KA 3FEXB 3Q8YA 1NK8A 3GFXA 3PJWA 1NPPA 1W7WA 3UDCA 1FKOB 3GQCA 4CYUA 1JLQA 1UKUA 3DOKA 4DI6A 3PJXA 3O8WA 3H40A 2OTJS 1IBKJ 1HNVA 4RL1A 4RW7B 1U25A 3E01B 1MROA 1M5PC 1O6XA 2FJWA 4LBHA 3CCLS 3PO5A 8ATCB 1TL1B 3TAPA 2W7PA 3JSMA 3N0VA 2V94A 3HP6A 1RT2B 4M5KA 1LW2A 3A8IA 1X0PA 4EZ9A 4X4SA 1BQNA 1WORA 1YRUA 4LSZB 4YN3B 3OJSA 3PW7A 2B9WA 1VI7A 1NDKA 3NMAA 4QW9A 2I0XA 1KHWA 3QFHA 2DH9A 3HHKA 1FTRA 5A6PA 4K2XA 4C3KA 4CO1A 4ES1A 2DHAA 3Q24A 2HWIA 5KFTA 2KKHA 4XAKA 4DG1A 2QN6B 4I1TA 2MLZA 1FWLA 4AQYF 2FQQB 3HVTB 5AT1B 1NO8A 1FWKA 2HQFA 2YPZA 5A8RB 4HKQA 1ACMB 4KH0B 1CC7A 4K2JA 2BE2A 2DO4A 3GV7B 2KI2A 3TUZC 2ZH1A 2HBZB 1VHIA 2OKQA 4GC7A 2ZVIA 4ED3A 4LF2A 4C8YA 4EZ6A 2RIJA 3H90A 4IFVA 3H5YA 4PG4A 4A8MP 2BKPA 3QFWA 4CDIA 1U1RA 3PO4A 5KFGA 3KHLA 2ZOFA 2HGNA 1N88A 3PZPA 3DXSX 1F0XA 3BSOA 4R25A 3HLUA 2HMIA 2K8GA 3J7YU 4DWIA 1NB2A 1SL2A 1UA0A 4ED2A 4F3QA 1U24A 1DAXA 2VZ9A 2BM0A 1V3RA 2DRDA 4C97A 1GTHA 4OX6A 1EP4A 4DR6J 5LJ3Y 2RSQA 1TKXA 4LFBJ 2FJEB 1JJHA 1FDNA 4F0HA 2Z30B 4ZMMA 3V6KA 2H4YB 2QL7B 2EKNA 1CSJA 1AROP 2NXNA 3PACA 4ID8A 4HHJA 4WXWA 1VLOA 2B6AB 1IJEB 3EGWB 3D1QA 4DR3J 1JXVA 4N76A 3G8TA 4J9RA 4DR1J 1RP5A 3W5ZA 1HNZF 3QLHB 2V4JB 9ATCB 2JOQA 2HHHJ 4DEZA 2OPSB 4EYIB 3SMZA 1C1CB 4BBYA 3DM2A 3O1LA 2XLIA 4DXLA 3KJQB 2DVIA 1RU1A 3OT9A 1NDLA 2MZSA 2R2UA 1WC4A 3DRXA 3CJ2A 3DXBA 2KXNB 2IRUA 1TUGB 4NLVA 4V1Ak 2WZ1A 1NJIT 1Y10A 4KRWA 1JLBB 1LK7A 3EWGA 4KHPJ 3SXLA 5M2PA 1HNZJ 2A2CA 6FD1A 4CZCA 5A76A 4USHA 1LEOA 2VA3A 1YJRA 4C9DA 2V34A 1DARA 2RS8A 5J2PA 2ERRA 2M7SA 1HNXJ 1IN0A 2ZJRQ 4ZKAA 3UCZP 3V81A 4IR9A 3RTVA 3L09A 1RWPB 4QOTA 1T9TA 2BJDA 2WTFA 1ZTTA 5A8KB 3Q8UA 5CXTA 1IKVA 3H4DA 3R7BB 1OSCA 4G6VB 4DR4F 2UUBF 5D3GA 4QR0A 1M5HA 1R6VA 2KZMA 1N32F 1C4CA 2RUSA 3IP0A 4J9LA 1LWCB 2DNLA 3SSRA 1IKXA 4HTIA 3IR6B 4ZVOB 2E1RA 3AD8C 4AL5A 1WHXA 4C8MA 1GH8A 2ZZNA 2CPJA 2HHWA 1WHYA 1FRKA 3RAMA 4H4OB 3WHIA 1U0HB 3DRRA 3QT8A 2K2PA 2IC3A 1REVA 3G4SS 2MEWA 1HBNB 1C0TB 3EUNA 2X1AA 3GWCA 4WIQA 2JC1A 3D67A 3T6JA 2DR5A 1JLEA 2Y8WA 1CC8A 5CABA 2XNQA 3PDNA 3D66A 3W2WB 2GVZB 2QZ8A 1DJ0A 3N5BA 5E41A 2DGSA 1H72C 1YJWS 3EPIA 3MAHA 5KFZA 3OR2B 3DRPB 2KXHA 4NL5A 5IT9U 2BVZA 4RW6B 2VDHA 1EARA 1TFYA 2N4CA 5EDWA 5HQ8A 3UD4P 2XS2A 2AYEA 5H9FJ 1L3VA 2C1EB 1MMDA 3QWPA 2XZWA 1FEEA 3H98A 5ETVA 5FLXY 3QRQA 3W3SA 3PYGA 2W4DA 1VRTA 1RU2A 2FVCA 1T0TV 5KFLA 4NA3A 4OJGA 3EXCX 2JC0A 2IRYA 1X5PA 3NCPA 2PDAA 3IXQA 1LKZA 4JI7J 4I7FA 2LEPA 5HK4A 2BYCA 3PVXA 2MQQA 3DI6A
chains in the Genus database with same CATH topology
3MCNA 3HD1A 1DY3A 1RU2A 3IP0A 1EQMA 4M5NA 2CG8A 1CBKA 1KBRA 1HKAA 2QX0A 3HSZA 1Q0NA 5ETLA 4AD6A 3HSJA 4M5LA 4PZVA 4CYUB 2BMBA 3ILIA 3QBCA 5ETKA 3UDEA 4CRJA 1RTZA 3ILJA 4CWBA 4M5HA 1G4CA 3HSGA 3MCMA 4M5KA 5ETPA 4F7VA 1RU1A 4M5GA 3ILOA 1TMMA 5ETVA 5ETOA 3MCOA 3ILLA 5ETSA 4M5MA 1EQ0A 3HSDA 4M5JA 5ETMA 3UD5A 3KUHA 1IM6A 1HQ2A 1RAOA 2F63A 5ETTA 4M5IA 5ETRA 3UDVA 3HD2A 3KUGA 5ETNA 1F9HA 3KUEA 3HCXA 5ETQA 1EX8A 3HT0A 1RB0A 4CYUA 1TMJA 2F65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MCN A;  3HD1 A;  1DY3 A;  1RU2 A;  3IP0 A;  1EQM A;  4M5N A;  2CG8 A;  1CBK A;  1KBR A;  1HKA A;  2QX0 A;  3HSZ A;  1Q0N A;  5ETL A;  4AD6 A;  3HSJ A;  4M5L A;  4PZV A;  4CYU B;  2BMB A;  3ILI A;  3QBC A;  5ETK A;  3UDE A;  4CRJ A;  1RTZ A;  3ILJ A;  4CWB A;  4M5H A;  1G4C A;  3HSG A;  3MCM A;  4M5K A;  5ETP A;  4F7V A;  1RU1 A;  4M5G A;  3ILO A;  1TMM A;  5ETV A;  5ETO A;  3MCO A;  3ILL A;  5ETS A;  4M5M A;  1EQ0 A;  3HSD A;  4M5J A;  5ETM A;  3UD5 A;  3KUH A;  1IM6 A;  1HQ2 A;  1RAO A;  2F63 A;  5ETT A;  4M5I A;  5ETR A;  3UDV A;  3HD2 A;  3KUG A;  5ETN A;  1F9H A;  3KUE A;  3HCX A;  5ETQ A;  1EX8 A;  3HT0 A;  1RB0 A;  4CYU A;  1TMJ A;  2F65 A; 
#chains in the Genus database with same CATH topology
 5DS7 A;  2N7Y A;  2MJU A;  4YS2 A;  4QCL A;  1UFK A;  3GU0 A;  5E2Q A;  1AYE A;  4NWB A;  3IWL A;  3X3U A;  3OUY B;  1NJY A;  3DGP A;  2QLF B;  3PX0 A;  4HHU A;  3DHX A;  3PV8 A;  3GLJ A;  4ZN1 A;  1BQX A;  1AT1 B;  2RQ4 A;  1TR0 A;  2R8I A;  2J9E A;  1IKW B;  2OI2 A;  2COL A;  1SQG A;  3PM9 A;  4UUW A;  3B78 A;  1ULR A;  2QG9 B;  3M2U B;  1S9E A;  2MB0 B;  3GV8 B;  4F26 A;  3WC2 A;  1VQP S;  1GNK A;  5GAH I;  2HQ3 A;  5HAO A;  5F9L A;  5T7L B;  2DCL A;  4W90 B;  1H3D A;  4JI5 F;  2BBE A;  2VQE F;  4OYZ A;  4P2S A;  4ECZ A;  4NZ0 A;  3MUT P;  1VQ5 S;  2RRN A;  1XWL A;  2JLG A;  2F4V F;  3BGO P;  3MPW A;  3UNY A;  1LFW A;  5I4M A;  5EUH A;  5IOL A;  2QV6 A;  4LF5 F;  5IC4 B;  3ZZU A;  7AT1 B;  3C3L A;  4WKR A;  3MMC A;  4USI A;  3CC7 S;  3BZQ A;  2HHS A;  1C0U B;  1QM9 A;  5E3A A;  5J2N B;  1SIW B;  1WOO A;  2VQE J;  3MCS A;  3FMW A;  1N5T A;  3R5C A;  1Y00 A;  1S1W A;  2RVJ A;  4IG3 A;  4O4G B;  4CLL A;  3VAG A;  2QYG A;  1X9W A;  1K47 A;  2LQ9 A;  1S6O A;  2F4V J;  2R4F A;  3R5B A;  4UOF A;  1K9M T;  4HHH A;  4GKJ F;  4MIA A;  3F0N A;  2FJB B;  2APO A;  3KG4 A;  2UZA A;  4LF5 J;  2PFF B;  3AOC A;  4ZCK A;  3RGI A;  3MFH A;  4NLU A;  4M5M A;  2BJ8 A;  2AEJ A;  4W98 A;  4NMX A;  3EE3 A;  3KK2 A;  1S1U A;  3LQV A;  3MPY A;  4F0M A;  5GAG U;  1X5O A;  3UCU P;  4YOE A;  3QID A;  1U8S A;  2DNG A;  4OQJ A;  1C1B B;  3FZ2 A;  4R5P A;  4DSL A;  4ES2 A;  4GKJ J;  1Y5I B;  3C6T A;  4UOC A;  2Z8Q A;  1VQ6 S;  2UXB F;  2GVD B;  4FKY A;  4ECU A;  1RTD A;  2H4W B;  3D7S B;  2C3U A;  3PR5 B;  3EX7 B;  5F41 A;  1OMS A;  4XPE A;  4CO2 A;  3MD3 A;  4CT9 A;  3VZI A;  1S4F A;  3CJ8 A;  5A6W A;  3V4I B;  3J7Z 5;  3HDS A;  4HR2 A;  1SBR A;  3MEG A;  3CJT A;  2NUH A;  7FD1 A;  4OV1 A;  1HA1 A;  1TK5 A;  1I1G A;  1U09 A;  1FNO A;  4DR2 F;  3ISN C;  4F4Z A;  2UXB J;  4Y2A A;  4TLR A;  2XZD B;  1H6K X;  5A2Q U;  4Q0B A;  2JLF A;  4X4R A;  2MJN A;  1V6H A;  3K89 A;  1E6Y A;  4NLP A;  3KNG A;  3MPV A;  4TNO A;  4QWC A;  3QIP B;  2J8S A;  3TP2 A;  4LSN B;  1LQ9 A;  4YB1 P;  4IOA Q;  1XR6 A;  1TVR B;  2GQC A;  4B9S A;  1RHM B;  3N79 A;  1YRX A;  3B6B A;  2AIR B;  1TKZ B;  3OHA A;  1YQH A;  4JP8 A;  4M63 A;  1SC1 B;  2GGP A;  1I94 F;  1F6T A;  2J0X A;  4OYI A;  2J9D E;  5E7O B;  2ZH6 A;  2AGP A;  1SIZ A;  2CJX B;  3IG1 A;  4OMF G;  4K4W A;  5KT5 A;  3CF5 Q;  1L3T A;  3NEK A;  1LNQ A;  1ZAW A;  2RU9 A;  4DSK A;  3GFH A;  4PWW A;  4FYW B;  4K4T A;  2R7O A;  4RW9 B;  1I94 J;  3CCZ A;  3MM9 A;  3FSI A;  3G82 B;  1S48 A;  5KFS A;  5IT4 A;  5DDQ C;  3THT A;  2YNH B;  2QSF A;  4WE1 B;  1KVI A;  5DQI A;  3UW1 A;  4ETX A;  3M8Q B;  5KFQ A;  3J7Z T;  3NXZ A;  2Z57 B;  2HQI A;  2AYG A;  3FDS A;  1RTH A;  3D1O A;  3HFK A;  3ILI A;  4LQ9 A;  4JUZ A;  1FJG J;  2LCW A;  4ZVU B;  3C14 A;  5K9F A;  5ETM A;  4IOC Q;  1K8A T;  4DJB A;  4I6W A;  3NBP A;  2C2Z B;  4CNY A;  3AY0 A;  4NZ7 A;  1PYS B;  5KFO A;  1YJT A;  1RXO B;  4P2M A;  3UPF A;  3GMG A;  1NHU A;  4NLD A;  1S9G A;  2EC2 A;  4MIW A;  3LA0 A;  3EZO A;  4LF1 A;  3LAK A;  2PD1 A;  3R2D J;  4DFK A;  2YVS A;  5B0E A;  2M2B A;  3FEZ A;  4N56 A;  4KSE B;  1WC3 A;  5HI7 A;  4QYZ K;  3C6U B;  3US5 A;  1WOP A;  3JSR A;  2VG6 B;  4YB6 A;  4ELT A;  2DIT A;  4RBV A;  3PR4 A;  4DCO B;  1H2T Z;  2B4P A;  2IDL A;  5KOW A;  1RT4 A;  3TVZ A;  5SZT A;  5LMN F;  1B0V A;  4CYU B;  2JZ5 A;  1UVK A;  1JLQ B;  3DOK B;  4PPD A;  2XHC A;  2LFV A;  2DEI A;  1U49 A;  4B17 A;  5B09 A;  4DL0 C;  1KQF B;  1MRO B;  4V19 J;  3M8Z A;  4PXE A;  2VG7 B;  4I2Q A;  3BJY A;  3C15 A;  2CZV C;  2AP6 A;  3H5S A;  3JSM B;  2MKJ A;  1S1X A;  2JNJ A;  2PC6 A;  2CNN B;  1LW2 B;  5B7W A;  2IYI A;  1LWE A;  2MKH A;  5LMN J;  3TOQ A;  2BA9 A;  1CJU A;  1BQN B;  4PG7 A;  4CO0 A;  4R0E A;  3MCM A;  1UZH A;  2GS8 A;  2GQ2 A;  2V8D A;  4A46 A;  2B7C B;  3VR1 A;  3BH6 B;  1SJ1 A;  5IZH A;  4WK3 A;  3R2C J;  1HLW A;  3HSJ A;  3M2R A;  2E66 A;  1FA0 A;  2DIV A;  2W25 A;  4DN0 A;  3CJR A;  2A10 A;  3BO2 A;  3DLE A;  3M8P A;  1LWF A;  1VBY A;  2GCF A;  1OQ6 A;  4DG1 B;  4LSL A;  5D0R A;  1YJV A;  2D74 B;  3QZ8 A;  3W66 A;  4ERD A;  2FY1 A;  3SFU A;  4ZA1 A;  1N5Y A;  4RZR A;  2BE2 B;  1J5O A;  1X9S A;  3D2W A;  1KTQ A;  4WII A;  2XCA A;  4O0N A;  2KFN A;  3E3X A;  4CT8 A;  1FRM A;  3UN3 A;  3NLC A;  3MEK A;  2E5L F;  3FBC A;  3JXO A;  3JTN A;  4ZVP B;  1GFW B;  4LQ3 A;  3E2E A;  4IFV B;  1UJ6 A;  3K5M A;  2AYM A;  1WSR A;  4O3O A;  1Q8B A;  2ZH5 A;  2CWK A;  2XSJ A;  2L9N A;  2D9O A;  2E5I A;  2E9Z A;  3HFV A;  4C48 A;  2HMI B;  1AA1 B;  4DX5 A;  1JKH B;  3H4B A;  5GAD U;  3BEG B;  5CD4 H;  4AE5 A;  2HGL A;  2LEC A;  4FF1 A;  2R8J A;  2BE7 D;  2H51 B;  3DFE A;  4O3R A;  2E5L J;  4HLB A;  2NPI A;  5CZX A;  2Q66 A;  3QWU A;  3QNW B;  2DGU A;  1AUS L;  2NQP A;  3CNQ P;  1FVS A;  1TKX B;  2DGV A;  4I56 A;  3OW2 R;  4DZD A;  3RBD A;  1HYS A;  1SKW A;  4MYU A;  4MH8 A;  5B0C A;  1YBA A;  2VB6 A;  1VIX A;  4FYV B;  2Y1I A;  3D1H A;  4DUY F;  4ZPD A;  2OML A;  2YPY A;  3KJF B;  5J2M B;  3ZXW A;  3GJT B;  4DSI A;  2VBY A;  3PW5 A;  1KWM A;  1U1K A;  5E3R A;  4PG8 A;  2KFY A;  4FXV A;  2I9S A;  5CCM A;  2E1A A;  3IM8 A;  1SC4 B;  2F4F A;  3R7S B;  1D8Z A;  2Y1R I;  3PEJ A;  3DM2 B;  4IFY A;  1ZZN A;  1S49 A;  2CQG A;  3A13 A;  5KT3 A;  4C6A A;  5IQ6 A;  1NZA A;  4OJ1 A;  5RUB A;  2B9Y A;  1NRK A;  3TEG A;  5J1E B;  2ADC A;  1QE1 A;  2MKS A;  3LGH A;  4DUY J;  4F7V A;  5KFA A;  5D6G A;  4P75 A;  4WZQ A;  1M0S A;  3KUE A;  1VHF A;  1EHW A;  4DV1 J;  1S10 A;  2DY1 A;  2ZE2 B;  4NLW A;  1ZBT A;  4PYA A;  2EK1 A;  4X84 A;  1DQ8 A;  5J2P B;  1U0S A;  2KM8 B;  5CYJ A;  2M4M A;  4KE5 A;  2DNN A;  4OLP A;  3V81 B;  2ZWO A;  3B54 A;  5CZV A;  2FTR A;  4MJK A;  4KGV B;  1NH7 A;  4V19 X;  3GPA A;  3AJD A;  1IKV B;  3SCI E;  2ACM A;  4DPY A;  4HH0 A;  3VGS A;  4L3K A;  3EIC A;  1HFE L;  4LR8 A;  1UWB A;  4WP9 A;  1XJW B;  5D3G B;  3UWT A;  2AQ4 A;  2RQM A;  4OI3 A;  4LRE A;  2NUU G;  3KWM A;  3TO8 A;  1Q95 G;  1IKX B;  2V69 A;  3DLH A;  4OHY A;  1ZZF A;  4QZV B;  4ZCI A;  1N33 J;  4NXN F;  2ZKU A;  3DRR B;  2LEB A;  3NNH A;  2IC3 B;  1REV B;  1RTJ A;  5FJ4 A;  2HQC A;  4LFA J;  2WK4 A;  3IMQ J;  2AZ1 A;  1JLE B;  4PXD A;  2V67 A;  3SV3 A;  3LWL A;  4EU0 A;  2Y1J A;  3R27 A;  2E5H A;  3ENQ A;  4BWM A;  1NK5 A;  3NGT A;  2XWX A;  4F4W A;  2QLB B;  2BM1 A;  4QWE A;  1L3S A;  2IJF A;  3CCS S;  1X5T A;  4C8L A;  1AZS A;  1VBZ A;  1Y9O A;  2HLT A;  4KB7 A;  3V6H A;  2F5G A;  2DKO B;  1Y5N B;  3TAN A;  2DNR A;  3KK1 A;  4NXN J;  2MDA A;  1B3T A;  2DGW A;  4F8R A;  1HAR A;  1CEZ A;  1LXN A;  5K8O A;  4DV6 F;  3VQT A;  3ZTO A;  2ASL A;  4AL6 A;  1NLK L;  3QGH A;  1G3O A;  1VRT B;  1N4L A;  4IH5 A;  1VYA A;  5EX3 A;  3U1L A;  4USW A;  3EJM A;  4I7F B;  4RNO A;  3SSS A;  1VGY A;  4DX7 A;  3KKF A;  2KRB A;  4WJB A;  2K7J A;  5KG6 A;  1EKS A;  4IRC A;  3P49 B;  4DV6 J;  3C19 A;  2MSS A;  4DV2 F;  4P7T A;  3IAS 9;  3UQS A;  1F5B A;  1NEE A;  3G9C A;  3DGP B;  3JTP A;  1D3W A;  1WAC A;  4UUX A;  1J27 A;  4QWB A;  2L48 A;  1NB7 A;  3D68 A;  3EVM A;  1X4D A;  3BSN A;  3KLG A;  1FHT A;  4P2F A;  4X66 F;  1S9E B;  1FDA A;  4K4U A;  4ZP9 A;  3VWS A;  2B8P A;  1RKI A;  4DV2 J;  4N8N A;  1UVM A;  3R6G B;  2FHO B;  3TZX A;  1B0T A;  3RBE A;  2MZT A;  3FK4 A;  2LU2 A;  4DV4 J;  5ADZ A;  3KJV A;  3JQJ A;  5HBM A;  3M2V B;  4YB7 A;  3LUY A;  4X4T A;  3W9J A;  2GMJ A;  3AFG A;  2OHD A;  3NAH A;  1PJ6 A;  4RUA A;  4MKY A;  1TAQ A;  4CM2 A;  1OYD A;  4X66 J;  5E33 A;  4F3M A;  5CCL A;  2R7X A;  4RJV A;  3NY0 A;  4B02 A;  5GME A;  2HPU A;  1Q79 A;  3ZNJ 1;  4GVL A;  2OGU A;  5KFK A;  1HNI A;  3DRS A;  1SVD A;  3BQ1 A;  3ONQ A;  1HQU A;  1HBU A;  1FTC A;  4USJ C;  4CLP A;  3J7A 1;  4WU3 A;  1S1W B;  4IG3 B;  4DV5 J;  2BUN A;  3ZZP A;  2LP4 A;  2NCK L;  3ET6 A;  4H4M A;  5D0G A;  2AJ4 A;  2XQC A;  4MFB A;  1YJ7 A;  3CB4 A;  4YY3 F;  1HL6 A;  3UDE A;  1T9X A;  4EEY A;  3A8E A;  3OLB A;  1FRX A;  3TAR A;  2M5Y A;  4DS4 A;  2VPY B;  4ID5 B;  1AUD A;  2ZDO A;  4L76 A;  1BMQ B;  3CXC R;  4L72 B;  3VTI A;  2DNZ A;  3FSY A;  1GXT A;  3KK2 B;  1S1U B;  3WDO A;  2W2M P;  2CJQ A;  1ZA1 B;  1O51 A;  2IJR A;  1NSK L;  1EB0 A;  4Q8E A;  4B9T A;  1V3Z A;  1R8B A;  3D6F B;  3FEY B;  2D3O 1;  2JRS A;  4QR2 A;  2ZH7 A;  4R5P B;  2LEA A;  4YY3 J;  2VF3 A;  1VQ7 S;  3BGF A;  1HWJ A;  3C6T B;  3MEE A;  3OXL A;  2A18 A;  3FFI A;  2O01 C;  3T3F A;  4ZP7 A;  4HYK A;  1H73 A;  4P73 A;  1RTD B;  4IQX A;  3SBM A;  1RWO B;  1T94 A;  4ZVT B;  1FCA A;  2X3G A;  4HEA 9;  4IKA A;  2H3E B;  1RCX B;  4B3S J;  4RO0 A;  1XMO F;  2FJV A;  1NAQ A;  1FX2 A;  1WF2 A;  2MGZ A;  2C3M A;  3KLV A;  3UVJ A;  4C8O A;  6FDR A;  4UF4 A;  2C28 A;  3MEG B;  5C24 A;  3D3B J;  2JL9 A;  1F1B B;  4YDX A;  1YIJ S;  2V8G A;  4OYW A;  2B4O A;  3MM6 B;  1IR2 A;  1VRU A;  1O0P A;  3KDN A;  2MMY A;  1KSP A;  1N5V A;  1KVJ A;  1OPZ A;  4KYZ A;  4CLZ A;  2GHW A;  2GHV C;  3T5J A;  2MLX A;  1Y3J A;  2BR0 A;  1HNW F;  1XNQ J;  2QA4 G;  2KT3 A;  4Z7Y A;  2G13 A;  2VON A;  2BZ2 A;  1CJK A;  1YBU A;  3IM9 A;  4Q0B B;  1EKR A;  4NOH A;  4OHZ A;  2B4U A;  1FKO A;  2GW8 A;  3HSD A;  3G6Y A;  3EM1 A;  1E6Y B;  4RUH A;  1NZ8 A;  4PUO A;  1FF2 A;  4UY8 T;  2OMO A;  3KLH A;  1U1N A;  2M8H A;  3QBC A;  4OX8 A;  2HFV A;  2MKC A;  4NRU A;  2Z2L A;  2QMW A;  4DSE A;  1TL1 A;  2XYP B;  2VA2 A;  1FJC A;  1HNW J;  3HPO A;  5LT5 A;  1WJ9 A;  4A8O A;  2GGP B;  3HHD A;  4KKO B;  4NX9 A;  3W61 A;  2MKI A;  2ZBI A;  5D4N A;  3CDW A;  3ITH B;  3IG1 B;  2ZH4 A;  2FGO A;  3RRG A;  5ETN A;  3HHL D;  1KC8 T;  2FB0 A;  3EMT A;  4ILR A;  2OTL S;  1JWW A;  5I3Q A;  3THP A;  1U1P A;  1JJC B;  1Q7Y T;  4DX6 A;  2J6U A;  4UTG A;  3TA1 A;  3W8G A;  2QRR A;  4YEA A;  1ROF A;  2Y8Y A;  4KBI A;  2IBO A;  3KLI A;  2E9R X;  1X4G A;  3D6H B;  3P45 B;  3MM9 B;  4F3O A;  1X0F A;  1H74 A;  2YBV A;  3M9O B;  4NCG A;  1R6Y A;  2LXU A;  4DL6 A;  2AEM A;  3T1A A;  5A8R A;  2XYH B;  2NZC A;  1HI8 A;  1RTH B;  3RB3 A;  1X4E A;  3PRB A;  2ZIT A;  1EET A;  3H2V E;  4Q2M A;  3PY8 A;  1JLF A;  3NWR A;  1U1O A;  4QPT A;  3C14 B;  1RBO B;  3GR0 A;  3NBP B;  2CPF A;  2X7I A;  2B9E A;  3HO1 A;  1N34 F;  3NOC A;  2XO6 A;  4WTO B;  2G0C A;  4XO0 A;  1S9G B;  2OEM A;  2PT0 A;  4HI2 A;  2ZBP A;  3LPY A;  1R27 B;  2C3P A;  2OH2 A;  3BBF A;  2R7Q A;  4XDC A;  5DLG A;  3MPD A;  4WFN Q;  1RYS A;  3R6L B;  2KXF A;  2HHT A;  2RS2 A;  3J81 Y;  5F3T A;  4NAS A;  3MR6 A;  4ICL A;  2WVC A;  2CQP A;  2WON A;  2P6S A;  3N6L A;  5K20 B;  4TY8 A;  5AE1 A;  1REG X;  3KYL A;  2AGO A;  1N34 J;  1RYR A;  3ZO7 A;  1R0A A;  1TL7 A;  3P5T L;  4DV0 J;  5L1L A;  4IO9 Q;  5AXN A;  3PG9 A;  2DR6 A;  1VQS A;  5IC6 B;  4KPY A;  3PJ9 A;  3ZZY A;  3MF5 A;  1SV5 A;  2B56 A;  3H20 A;  1S1T A;  1QUV A;  2FLN A;  2IVY A;  4I2Q B;  3CMA S;  2UVV A;  2Z4P A;  3LTO A;  1Q53 A;  1VLY A;  4OZ0 A;  2LA6 A;  1S1X B;  2HAF A;  5EWF A;  4H4K C;  1B64 A;  1X4A A;  3OTC A;  2QEX S;  1UPM B;  3RUB L;  1LWE B;  2MTL A;  5DM6 Q;  4DQR A;  2FJA B;  2R9L A;  2V2K A;  1CJU B;  3R8Y A;  2LU1 A;  4MKV A;  3WQP A;  4JBC A;  1NK9 A;  1BHN A;  1UMJ A;  3NCR A;  3NL0 A;  4CIO A;  4A8F A;  3AOD A;  3FQK A;  3M2R B;  2VL1 A;  3FRY A;  3OTB A;  4KTQ A;  3T1Y F;  4BLG A;  3KDO A;  3DLE B;  3M8P B;  1J5E F;  4J7C A;  1ITP A;  1LWF B;  3NS5 A;  5B08 A;  3D0G E;  4LSL B;  1Q78 A;  4TU7 A;  1N52 B;  5C7P A;  2EK6 A;  1CUL A;  4EBD A;  3VVT A;  3HD1 A;  1ZM9 A;  3WBZ A;  1UA1 A;  4A8Y A;  2GO9 A;  3MR7 A;  3ISZ A;  1J5O B;  4QIE A;  2HHU A;  2XZT B;  2WVD A;  1TK0 A;  2ZHO A;  1Q5V A;  1XTZ A;  4FS1 A;  2IYG A;  1X4F A;  5IWA F;  2ZHA A;  3T1Y J;  1RHR B;  3FGV A;  1J5E J;  5KT6 A;  2VBZ A;  4RU9 A;  5EHH A;  4GRS A;  5B0A A;  5KTQ A;  2XSJ B;  1S57 A;  1NJX A;  2SXL A;  1BLU A;  4P10 A;  3OXG A;  1HIY A;  3TAM B;  5CA5 A;  3BO3 A;  1U2R A;  1T03 A;  1N56 A;  2J0Q D;  4OIX A;  4H4O A;  4OZ3 A;  1U0H A;  1C0T A;  5DZ6 A;  2HQD A;  5IWA J;  3AQP A;  5T14 A;  2CZ4 A;  4YFU A;  3GIJ A;  3W2W A;  3RB6 A;  2MY8 A;  3OVS A;  5SUH A;  2VJV A;  3N28 A;  5HMW A;  4ECV A;  2XBP A;  1HYS B;  2DB1 A;  2DIU A;  4DV3 J;  2VOP A;  1HHS A;  3T19 A;  1HWK A;  4CM0 A;  2XGQ A;  1KP6 A;  1SH0 A;  3MEC A;  1F2H A;  2IRX A;  4RW6 A;  2W2P P;  4LF4 J;  4K59 A;  4JI2 F;  1GMW D;  2RQK A;  4F04 B;  1T7P A;  2UXC J;  3U1N A;  3CWJ A;  4TU8 A;  2GIR A;  4I6Y A;  4F67 A;  3ILO A;  3IRX B;  2YQ1 A;  4ZHR A;  3M6V A;  5DGB A;  1CJV A;  3M30 A;  4IFY B;  2XHW A;  4RU2 A;  3A3P B;  4EUV A;  1IBL F;  5KOX A;  1NND A;  1FEH A;  2ACY A;  3VZH A;  5BXI A;  1VQK S;  1S0O A;  4NLO A;  1VJQ A;  2E9T A;  2HS3 A;  2YKA A;  1A7G E;  4YHH J;  1IWG A;  2QX0 A;  2ROP A;  1HBM A;  3MTK A;  4ED7 A;  4JV5 F;  5D0H A;  1R3N A;  1FRJ A;  3MR5 A;  3OUY A;  3IWX A;  3HJV A;  2CPY A;  1FKA F;  3QAT A;  1X4C A;  3Q86 A;  4M5I A;  1U4B A;  5CQG A;  2DPI A;  2VH7 A;  1EZZ B;  4FF4 A;  3GP9 A;  1IKW A;  1KOH A;  1IBL J;  3N01 A;  3G6V A;  1U1Q A;  2UVW A;  4CI0 B;  2H1Y A;  2FYX A;  3NGR A;  2UUC F;  3M1V A;  3SSQ A;  2E1M C;  4ZK7 M;  2VQF F;  2B8Q A;  2G4B A;  4UST A;  2BW2 A;  1F9F A;  4JI6 F;  4AXI A;  3DLK B;  5CAA A;  4WWS A;  3SDE B;  4KFB B;  2FZG B;  2L9W A;  1VC0 A;  4HDG A;  3D5M A;  4EO8 A;  4M5G A;  3GSD A;  3ETO A;  1K0V A;  5LJ5 Y;  1RWN B;  2UUC J;  4TQS A;  3QGI A;  4F4A A;  2ASY A;  2HSE B;  9RUB A;  3BN4 A;  5J2N A;  2FVS A;  3NS6 A;  3J80 Y;  2CQH A;  3I31 A;  3LWM A;  2IAJ B;  2FHM A;  4JI6 J;  4GO7 X;  1AZS B;  2ZHB A;  3BR9 A;  3PX6 A;  3KK1 B;  4U8Y A;  2FZC B;  1EJ7 L;  4LF7 F;  1RAB B;  3VV2 B;  4OFZ A;  1N48 A;  2VOO A;  2G2Z A;  1VC5 A;  2JDJ A;  3HX9 A;  4LMZ A;  2R42 A;  4DS5 A;  1S0V A;  2BX6 A;  3DU6 A;  2HQG A;  2JX2 A;  2HFU A;  3QAU A;  2ZOM A;  1HBO A;  2VFT A;  1BWE A;  2ZC4 A;  2Z2M A;  1Q5Y A;  1SC3 B;  4ZVQ B;  3BO4 A;  3U7J A;  4OZ5 A;  4OI0 A;  4JI8 F;  2MKY A;  2QA2 A;  1QLN A;  1WC6 A;  1S0N A;  2C42 A;  1TK8 A;  3KHR A;  3CTR A;  3NGS A;  1WI6 A;  3W5Y A;  1JNR B;  4P52 A;  5HP1 A;  2FHJ D;  1JLC B;  3OBI A;  4CWB A;  3K58 A;  2H5E A;  4I67 A;  4EO6 A;  1WDT A;  2JEF A;  2R7R A;  1UJ4 A;  2OLW A;  3RB0 A;  2KJW A;  3TZW A;  1GEH A;  4Y2I A;  3I56 S;  4LIW A;  4DQQ A;  4X2B A;  2XI2 A;  4ZPV R;  3JAM Y;  4CH0 S;  1RAA B;  1K1Q A;  1TL4 A;  4ZVH A;  2ZWP A;  4O3N A;  2IFX A;  2G9O A;  1Q81 T;  2HNZ A;  3CJ5 A;  1T8E A;  4AT1 B;  4FDF A;  3I55 S;  4QWD A;  4K4Z A;  2WBR A;  2PI5 A;  2CRL A;  4WFZ A;  2CYY A;  4DCJ B;  1OO0 B;  3TZZ A;  4KGX B;  1MN9 A;  2GIF A;  1NSP A;  4BC9 A;  4LRF A;  3KJV B;  1MSW D;  3CT9 A;  1HW8 A;  2YX4 A;  3CGI A;  3M05 A;  3ICL A;  3VAI A;  4RBU A;  3KHG A;  3UCG A;  3ZZZ A;  3QRR A;  3MAQ A;  3LP1 B;  1PAU B;  2C2M B;  2DBB A;  3G86 A;  2QLJ B;  4LF6 F;  2IBK A;  1HNI B;  2J0S D;  1S6Q A;  1W2I A;  3DRS B;  2W9B A;  1G4C A;  4JYA F;  2GIQ A;  2ATC B;  3L3C A;  3MCO A;  3AT1 B;  2J7K A;  3AOB A;  1QAI A;  2W9A A;  1X31 C;  3FNN A;  1Q8I A;  4L75 A;  3ET6 B;  4H4M B;  3M8W A;  4MFB B;  4PG6 A;  5KG5 A;  1VBX A;  4ZPB A;  4LF8 F;  3OR1 A;  2LQB A;  1OSD A;  3FBF A;  4LRD A;  1FFS B;  1UCN A;  2JLE A;  4PCQ A;  3CIM A;  1U47 A;  4KQZ A;  2BRK A;  1R43 A;  1KFS A;  4MKB A;  3BKT A;  3FBB A;  3D28 A;  5EX0 A;  5JMN A;  1YJU A;  4ZDN A;  2ALZ A;  4OYM A;  4IDK B;  2EKY A;  4D3G A;  1Q0N A;  4WE1 A;  2DGX A;  2KT5 A;  3M8Q A;  1DUR A;  5GAE U;  3HUL A;  3MEE B;  2P2C B;  5HMZ A;  3KG1 A;  2R2T A;  2PE8 A;  3FFI B;  5F3Z A;  3FVY A;  4CO5 A;  4DU8 A;  4LR7 A;  5GMD A;  3OLA A;  4EBC A;  2XLJ A;  1KQK A;  2FPH X;  4F4X A;  3TAQ A;  5MLC V;  3SIP B;  2MGZ B;  3UVJ B;  1MWZ A;  1RT6 A;  3BM7 A;  1TL3 A;  2AF6 A;  2I5J A;  4ZJO A;  4ED6 A;  5C24 B;  2H48 B;  3HI9 A;  4DBQ A;  1IBK F;  3M6U A;  3CC2 S;  1VRU B;  4ENO A;  2O5D A;  2Y3Y A;  3WX4 A;  4LFC F;  3H5U A;  3TX8 A;  1JJ4 A;  1WDD A;  1M1H A;  5HRO A;  5F8N A;  3L95 X;  3CC4 S;  1CJK B;  1P6T A;  3O6Q A;  4PG5 A;  2MQP A;  1FNX H;  4H54 A;  2F1F A;  3UN5 A;  3H0P A;  4F02 A;  1S4E A;  1F9E B;  3W5X A;  4PUO B;  2KVI A;  3GB0 A;  1Q8K A;  3KLH B;  4PXB A;  4A47 A;  1HPZ A;  3HHL C;  3LAL A;  2VG7 A;  4U96 A;  4J9O A;  3KLF A;  4B3M F;  4LFC J;  3HKZ D;  1KNZ A;  4O23 A;  5E5N A;  3G6E S;  3R5A A;  2HNY A;  1XNR J;  3SFG A;  3ELH A;  1HQ2 A;  4I2P B;  5DDO C;  2C3O A;  1T95 A;  4P7V A;  5IM0 A;  3BQ0 A;  5KFY A;  1VBK A;  3V5R A;  3O44 A;  3DHW C;  2V8V A;  3GJS B;  4Q8F A;  1UTA A;  2C2O B;  2XMW A;  4U6P A;  4ECW A;  4B3M J;  4L6V 3;  5K5M A;  1U6F A;  3VGU A;  4KHM A;  3KG0 A;  5FDL A;  2N4D A;  3KLI B;  3I87 A;  4ZIT A;  5HJX A;  2J8A A;  1N54 B;  4NCG B;  2RQC A;  3DOM A;  2CJY B;  2IIH A;  1MN7 A;  1VQO S;  4Q43 A;  1WKL A;  1WC0 A;  3EGZ A;  1NM2 A;  3TVY A;  2X1B A;  3KMQ A;  5KFF A;  4K4X A;  2HND A;  2W4P A;  1P1L A;  2ILY A;  2OFG X;  2XS7 A;  3Q0A A;  1EET B;  5L9X A;  1JLF B;  2DH7 A;  5DRK A;  1AFI A;  1RAF B;  1EAY C;  4CRJ A;  3Q89 A;  2CQ2 A;  2IJN A;  3POT B;  1SKU B;  2P6T A;  4DR6 F;  1M90 T;  2BDP A;  3QT5 A;  4LFB F;  2DCU B;  2R3V A;  3RU0 A;  2RKI A;  4ZVE A;  4F36 A;  5LSL A;  4NPO A;  2ZZM A;  4Z7C A;  1VQM S;  1JKH A;  4DQP A;  2WVE A;  3FJ2 A;  3PNI A;  3RR7 A;  1WHV A;  1CQN A;  3SYZ A;  5BJR A;  4ICL B;  3JYT B;  2QLX A;  1ZPW X;  4DMZ A;  3H42 A;  3BDP A;  3M9N B;  3WZ0 A;  2J76 E;  2D7S A;  4WFX A;  3RRH A;  2WON B;  3M32 A;  4EBE A;  3Q83 A;  3G87 A;  4DR3 F;  3M9M B;  5KFV A;  2FJD B;  4DR1 F;  4TY8 B;  1Y7P A;  2PN6 A;  1R0C B;  2M52 A;  3QMQ A;  5DQG A;  1YLX A;  2HHH F;  1T9Y A;  4ECT A;  4IH6 A;  3QSY B;  3VQS A;  1R0A B;  2GNK A;  2KDO A;  1TL7 B;  2OO4 A;  3QRP A;  4HDH A;  3CVK A;  2DEJ A;  2IPO B;  5BR8 J;  3R3T A;  4X62 J;  4QIF A;  3PCO B;  4JI3 J;  4OX9 J;  1RA7 A;  1SV5 B;  2QL9 B;  3CDE A;  2FJX A;  2XC9 A;  1UFL A;  2ZH2 A;  5G0R A;  1S1T B;  1NPK A;  2B3T B;  2WSC C;  3JSY A;  3P5B P;  3R5J B;  2QMX A;  4OHW A;  4KIA A;  4TU9 A;  5K8N A;  2KG0 A;  5J2M A;  4KHP F;  3BGU A;  3B8H A;  2MZQ A;  2V9K A;  1TZ0 A;  1IM4 A;  4EK2 A;  4B3T F;  4LJM A;  3X1L B;  4WK1 A;  2V5H G;  1HNX F;  3CCQ S;  3PYD A;  4JV2 A;  2EFP A;  5J1E A;  1NXI A;  3SI8 A;  3GSI A;  4DL5 A;  3TJ8 A;  2GML A;  1KD1 T;  2MST A;  3M7V A;  1G7C B;  1YJ9 S;  4QIW D;  4F2S A;  2RH3 A;  1UW9 A;  2ZE2 A;  4C3M A;  4CP5 A;  4B3T J;  3SEO A;  4IR1 A;  1CUL B;  2V2Z A;  4FPR A;  2B51 A;  4TLQ A;  5KG2 A;  2DHG A;  2B9X A;  2DJW A;  4DSF A;  3HM9 A;  2OP5 A;  3D6T B;  1WUU A;  3NRB A;  3UDL A;  4WU2 A;  1IXK A;  1S6U A;  3GYN A;  1BQM A;  3HHL B;  1TMJ A;  2VFU A;  3BKF A;  4DF8 A;  1JIH A;  2JEI A;  1F5C A;  2W9C A;  1Y0H A;  4MAK A;  5D8H B;  2W4C A;  4ELU A;  3C2P A;  1SJQ A;  1YZ6 A;  4DOZ A;  1PJ5 A;  1KQG B;  2MQM A;  1RAJ A;  1RKJ A;  1S97 A;  4RWX A;  3OTD A;  2BQR A;  1MNE A;  3FKB A;  1T03 B;  1U26 A;  1VIS A;  1SKS A;  5IQQ A;  3BB5 A;  4B3R F;  5C5J A;  5HAT A;  2ZBQ A;  2ROG A;  4G1I A;  1FK9 A;  1IR0 A;  5C2G A;  2VC1 A;  1C4A A;  4U67 Q;  1IBM F;  3NWG A;  1S99 A;  4DU7 A;  1OS5 A;  1IBC B;  5IV3 A;  2O1P A;  3BQ2 A;  1S76 D;  3ZTR A;  5A0Y B;  3NKY A;  4A8Q A;  3IR7 B;  5K8M A;  3IFE A;  2CFX A;  4I68 A;  3MEC B;  2EBG A;  4JI7 F;  2MLY A;  4Z2X A;  2H54 B;  1QAY A;  4B3R J;  5KG7 A;  3AQO A;  4X64 F;  2P9C A;  1OPI A;  1IBM J;  2Q6C A;  4U7C A;  1S0M A;  2UU9 J;  1A9N B;  2K7K A;  4A48 A;  2DR9 A;  4K8R A;  1VK8 A;  1TUV A;  3EVO A;  4ZHR B;  4A8K A;  4KY3 A;  1CJV B;  3M30 B;  1WG5 A;  3ENW A;  1RE1 B;  3OQ2 A;  3FRZ A;  4ECS A;  1MWY A;  4M95 A;  2CJA A;  4DV7 F;  2RRB A;  3A3N B;  4X64 J;  2F7V A;  1FRH A;  1YG0 A;  4RR5 A;  1HBM B;  2MKK A;  1EQ0 A;  3ZZT A;  3CD7 A;  2QIF A;  3TJA A;  4UT4 A;  2PGC A;  4NYZ A;  2KH9 A;  1HWI A;  2HYI B;  2HFS A;  1HI1 A;  4P71 A;  4QIG A;  3ZC4 A;  3ZZ0 A;  2KB2 A;  4DLG A;  2WSF C;  4ECR A;  1PCA A;  4YR0 A;  4K0K J;  2FVR A;  4DV7 J;  1QJH A;  4F25 A;  4OZJ A;  3M1V B;  5D15 A;  3SQO P;  1YZ7 A;  4I0W A;  1RHQ B;  4F50 A;  2NSC A;  3V6D A;  4NLX A;  3QAE A;  1H38 A;  2P8I A;  2QO3 A;  5KFJ A;  2RIL A;  2W2N P;  1CLF A;  5LOQ A;  1TP7 A;  2BAN A;  5DJB A;  5EWG A;  2H65 B;  3M2V A;  1IR1 A;  2FLP A;  3FBE A;  2ZH9 A;  3MPU B;  5BYQ A;  1GXL A;  2A1B A;  4MMO A;  2V4Q A;  3K8V A;  1U48 A;  2DK2 A;  2HAI A;  1KRP A;  1HR0 J;  4QIV A;  2OPQ A;  4FXD A;  1F3V A;  3HXM A;  2UV8 G;  8AT1 B;  1NDP A;  4B9M A;  3H8Y A;  1U6B A;  2MHE A;  4TYB A;  1M1K T;  5L1K A;  2NRE A;  1YTY A;  2CKW A;  4UQT A;  4PZV A;  5M2U A;  3CJK B;  3F56 A;  1VMB A;  1KQS R;  2J7W A;  4XPC A;  3U1M A;  1BGX T;  3OSP A;  1AW0 A;  1R8C A;  3L4B C;  1G2E A;  4ANE A;  2XY7 A;  3ZTS A;  3DOL A;  2R8K A;  2MQO A;  1DLO A;  1PBA A;  3MMJ A;  4ID5 A;  3ULH A;  3DDI A;  2PA8 D;  2HVH A;  1SI9 A;  2OD6 A;  5I3U A;  2BJ1 A;  1CG2 A;  1DHM A;  1TUW A;  5KFD A;  1CPZ A;  2EWH A;  2WSE C;  3O2I A;  1HBO B;  4CNZ A;  1UFW A;  4Z37 A;  2AX0 A;  1K44 A;  4DPO A;  3OV7 A;  4NXM F;  1SJR A;  3GON A;  4OX7 A;  3U02 A;  1R31 A;  1Y4Z B;  3RAQ A;  2I6W A;  2E1P A;  4C2M A;  1UWA A;  3D4J A;  2WB4 A;  1RAG B;  5HP1 B;  1PYT A;  4PWU A;  3M8S A;  2BE9 B;  4UOH A;  1NJZ A;  4ED5 A;  1ZAX A;  2W2O P;  4FPI A;  1FKP B;  1RLD A;  4ZN3 A;  2HUR A;  3CE8 A;  2VUG A;  1JB0 C;  1S7I A;  2O3D A;  2CPX A;  1XR5 A;  3TEH B;  2HWH A;  2OEL A;  4B08 A;  3K7R A;  2DR7 A;  3AJ1 A;  1XQI A;  4NXM J;  1YIT S;  3DRY A;  3MM6 A;  1FI4 A;  1Z1Z A;  1NSQ A;  4EI2 A;  2M3D A;  3AAW B;  4LBP A;  4ZPW R;  5D4P A;  2HIY A;  2HNZ B;  3B4M A;  3BGR A;  5E0O A;  4C11 A;  3NGU A;  5LM7 E;  1PJ7 A;  3PYF A;  4OLO A;  3RZA A;  2F40 A;  4J9Q A;  4JI1 J;  4J91 A;  2WVF A;  2V8H A;  1JLA A;  2X51 A;  2EFN A;  3I5C A;  2CDQ A;  5T41 A;  4IG0 A;  3MHY A;  2C2D A;  3QJP A;  2CNL B;  4CTA A;  2YXL A;  1S1V B;  5F8J A;  2EPI A;  3MZI A;  4FKX A;  1I51 B;  1S6Q B;  2W9B B;  4JI4 J;  2OAU A;  4KKO A;  1DTQ B;  2KU7 A;  3DCA A;  1RTI A;  2IM3 A;  2QC3 A;  3RJM B;  1B70 B;  1PBU A;  3ITH A;  1RWW B;  4DSJ A;  2HFZ A;  1M1G A;  1N36 J;  2XMT A;  3OXF A;  3OR1 B;  4DR5 J;  4PEO A;  4CCH A;  4ZIW A;  1SJ3 P;  1N5Q A;  3MOJ B;  4F4Y A;  2FLL A;  1FER A;  3PXG a;  1UJ5 A;  4OI1 A;  1FJG F;  1MMN A;  3ADA C;  4I69 A;  5ETP A;  1RZM A;  3DDN A;  2ZUA A;  4F2R A;  4CH7 A;  3SCL E;  3PFO A;  2B43 A;  3OL8 A;  2BQ3 A;  1ZET A;  3ZZO A;  3GIR A;  1FFG B;  4O3S A;  1U1L A;  4D3H A;  4YME A;  3W2V A;  2D1C A;  3K5N A;  4E98 A;  2MHN A;  2BJE A;  2HBY B;  5IFM A;  1F3F A;  1PO6 A;  3MWB A;  4FXW A;  3MMA B;  4NYO A;  3OTO J;  1TV6 B;  3NNA A;  3GJQ B;  2KTQ A;  3HD2 A;  3O3L A;  3BN7 A;  4N47 A;  5F8H A;  2QLW A;  2VG5 A;  1LW0 B;  4JV1 A;  2OIH A;  1RT6 B;  3MR2 A;  1TL3 B;  5AXM A;  2UUT A;  2I5J B;  4J90 A;  4OJH A;  1WHW A;  2M0G B;  1CJT A;  3E51 A;  2JWN A;  1RIS A;  2CPE A;  3FQL A;  2AHO B;  3KTQ A;  5HRO B;  2F63 A;  2XYG B;  1V5V A;  4FYD A;  3MAA A;  4ER8 A;  2NLW A;  5KG1 A;  4X4N A;  1WEY A;  4CLW A;  3UE2 A;  5DG9 A;  1XBW A;  2RHQ B;  3HJF A;  1RAC B;  2YWF A;  2GO8 A;  3TJ9 A;  1HPZ B;  4RBT A;  4CO4 A;  1FE0 A;  3KLF B;  2XMV A;  2Y1L B;  1NK6 A;  2CIM A;  3I0R B;  3DMJ A;  4GKK F;  2HNY B;  1TKT A;  3TVK A;  4DQS A;  4FZV A;  2F9D A;  2ABY A;  2HHQ A;  3MD1 A;  2CQD A;  1FRI A;  4N41 A;  3MCN A;  3CMQ A;  1LV5 A;  4ELV A;  5IM0 B;  4YR3 A;  2W7O A;  1K1S A;  2ASJ A;  2CPZ A;  3L7O A;  1IM6 A;  1ZOT A;  4I4B A;  2FC9 A;  3WIU A;  4CLU A;  2E7X A;  2BAC A;  2CAD A;  5CYM A;  4DCP B;  3OFE A;  2V8P A;  1RT1 A;  4GKK J;  5FDL B;  3DLL Q;  2X1F A;  3CCW A;  3G6X A;  2FY8 A;  3RW7 A;  4UOG A;  2IMO A;  1IQZ A;  2YWG A;  1NK4 A;  3HSZ A;  2QL5 B;  2R2S A;  2V50 A;  2FD2 A;  1VJW A;  3DOM B;  1RT7 B;  3CSK A;  4P6Q A;  1NHK L;  4IOB A;  3CUL A;  1XEZ A;  4NLY A;  4B3O A;  2HND B;  4QR1 A;  5GAD I;  2RAQ A;  3CIZ A;  4WFB Q;  2K06 A;  3R1L A;  4YB5 A;  2GC8 A;  2XNR A;  4MK8 A;  4KV8 A;  4QU7 A;  1ZA2 B;  2DO0 A;  3MXH P;  4UZB A;  5HMX A;  2CJK A;  2WCX A;  3W1Y C;  3B82 A;  1PC5 A;  2RKI B;  2OUG A;  3TAM A;  4IUF A;  3I5A A;  1VRQ C;  4B9U A;  5L39 A;  3GCW P;  3CD5 A;  3LP0 B;  1WC1 A;  2JVO A;  3OHB A;  3DLJ A;  3PX4 A;  3M32 B;  4Y00 A;  1GT8 A;  4DPT A;  5DM7 Q;  1R0B G;  5E3P A;  5DG7 A;  1Y3K A;  3D3C J;  3I0S A;  2OEK A;  2GHP A;  4P2X A;  2ZD1 A;  1VOM A;  4R8U A;  2YQ3 A;  4MT1 A;  1U1M A;  5C42 A;  3VCD A;  3OL7 A;  4LVO P;  4NLG A;  3UO0 A;  1TTH B;  5G0R B;  5IV4 A;  5DO2 A;  2N3L A;  4DPX A;  2HVD A;  1HQE A;  3IBF B;  3EPG A;  3UNG C;  2VU5 A;  3AXK A;  2WHO A;  5I3P A;  1GQE A;  2XMJ A;  4DV1 F;  2F65 A;  4AQY J;  3IRX A;  1RK8 A;  3A12 A;  4KO0 A;  3AA8 A;  2RE1 A;  3IO1 A;  1SUQ B;  1KFD A;  4MK7 A;  2UVR A;  1XMB A;  5KT7 A;  5LXR A;  5H1S V;  3S7R A;  5AE3 A;  1KEK A;  3S6E A;  3KK3 A;  2W1B A;  4KAI A;  3I9V 9;  3QZ7 A;  1NME B;  3I4P A;  1RGV A;  1UVL A;  1FD2 A;  1P9Y A;  2AZ3 A;  2RF2 A;  1K0T A;  1NU4 A;  1UEU A;  2GAG C;  1FDD A;  3W7B A;  4P72 A;  1N8R T;  1ELO A;  2JH3 A;  4GMK A;  4K4V A;  1A6L A;  4HL9 A;  2UXD F;  4M5D A;  4RUC A;  3SCJ E;  1N33 F;  1RI7 A;  3DLG A;  4TYA A;  4YR2 A;  2K1R B;  3WIV A;  1BQM B;  3LP2 A;  2MYF A;  3T1H F;  1UVN A;  1GMV A;  4LFA F;  5F8M A;  2ZUG A;  2VKR A;  3R9L A;  1J2V A;  2W9C B;  3HVA A;  1YRT A;  1RDR A;  3VGV A;  3R5D A;  2HS0 A;  3GG1 A;  1FXR A;  3TQE A;  4H4K A;  2JSX A;  2QT7 A;  2BQU A;  5JXS A;  4U7U K;  4WTY A;  3FCW A;  3DLK A;  2QGF B;  3T41 A;  3SDE A;  4KFB A;  2ZH3 A;  4LRA A;  1RAI B;  3OFF A;  2UXD J;  2MZJ A;  2V2V A;  4AD6 A;  5EN1 A;  3FMB A;  1K73 T;  4WCE Q;  3T1H J;  1FK9 B;  3H7H B;  5F9N A;  3NAI A;  1HD0 A;  5CYQ B;  1GX5 A;  1B7Y B;  1Q1K A;  2PMW A;  4FVC A;  2DNO A;  1Z2L A;  3Q8S B;  3AD7 C;  4KGM A;  4A8S A;  3CD0 A;  2CNK B;  4CH1 A;  5K8P A;  2OEJ A;  2IAJ A;  2CPI A;  5ETT A;  2BXJ A;  2CVE A;  3R7N B;  1H7X A;  3P6Y C;  4B9L A;  2HBR B;  1RWU A;  2EFV A;  4LRC A;  4RWW A;  5D4L A;  2R7T A;  5U47 A;  5KFB A;  2H9Z A;  1HWU A;  1RAO A;  2DXE A;  4WP3 A;  3CDU A;  3RYL A;  3OVA A;  4PQA A;  1RA6 A;  3S8S A;  3TWZ A;  1QSL A;  4DL7 A;  3KFW X;  3K17 A;  2WB1 D;  3SZ2 A;  1PGZ A;  3NCQ A;  1O8B A;  4MYT A;  2YQ0 A;  2K3I A;  2W8L A;  4E2F B;  1T3O A;  3W9I A;  2GV1 A;  3MUV P;  1KBR A;  3RAX A;  1MG7 A;  4DHV A;  2JJ4 D;  3EVW A;  2DT9 A;  2PA3 A;  3JQM A;  5I42 A;  3L7P A;  4Y2M A;  1BC6 A;  1JLC A;  4DR4 J;  2UUB J;  4A8X A;  2ASD A;  5HQM A;  1VCT A;  1N32 J;  2B0G A;  3TUJ C;  1NPR A;  5H9E K;  4DV4 F;  1PC4 A;  2ROE A;  2R7U A;  2HEK A;  1S6P A;  4ZPC A;  3R97 A;  1DY3 A;  5KT2 A;  3PW0 A;  1JLG A;  2MQL A;  5IT0 A;  4M8L A;  1B99 A;  4WBF A;  2Y9H A;  1YBT A;  2WRM A;  3D0H E;  3V6D B;  2ZKT A;  4URQ U;  3W60 A;  2X1G A;  1HW9 A;  4NLS A;  1Z4U A;  3CO9 A;  3RR8 A;  2BKN A;  2XS5 A;  4UW2 A;  3JSB A;  2BAN B;  2NXE A;  3EZ5 A;  3CCJ S;  4DV5 F;  2DYA A;  3RB4 A;  4Q7A A;  2C2K B;  1PSD A;  4I6A A;  1S77 D;  3J7A N;  2D3O R;  2IM0 A;  1RLC L;  2YWW A;  1GK8 A;  2CJ9 A;  3GIL A;  3ZFV A;  2MZR A;  7FDR A;  3LP1 A;  1AXQ A;  4G3I A;  4ZJL A;  2OPQ B;  3KUH A;  3H2L A;  4X4Q A;  1VS3 A;  3MMB B;  3NMR A;  4J9M A;  2YTC A;  1P1T A;  4IO1 A;  4XDD A;  3AB2 B;  2WW4 A;  2EFG A;  2BAB A;  3ILJ A;  2HS4 A;  4RNH A;  2G2O A;  5E3Q A;  3VAH A;  3GYX B;  3NNC A;  1YK9 A;  4BHQ A;  4UY8 5;  2O67 A;  2CPH A;  5C25 A;  2POK A;  1FNM A;  3DOL B;  1I3O B;  5KG0 A;  3TRG A;  1VDH A;  4FNH A;  4ZJQ A;  2XLK A;  1DLO B;  3CDB A;  1YWX A;  4PAA A;  2V0N A;  2NZ4 A;  4PWD B;  2XGP A;  2E1C A;  5HJY A;  4CLY A;  4B3S F;  1OY6 A;  4CLS A;  2IMW P;  2EVZ A;  3BS9 A;  2OPP A;  5I3U B;  2QMU B;  4NLQ A;  2ZNY A;  4IDK A;  4JOU A;  5AXL A;  2N82 B;  2Q1L A;  5D0E A;  2A6O A;  1UVI A;  3R1H A;  2VPX B;  4C0H A;  4CLT A;  4M5N A;  1QSS A;  5GAH U;  2VFS A;  1G1X A;  1XNQ F;  2VKZ G;  1R8A A;  3TW0 A;  1YI2 S;  3VF0 B;  4JI5 J;  1ZM3 A;  3RW6 A;  1SQE A;  2FDN A;  4X4V A;  2XMA A;  1ZTW A;  3P3D A;  4DZ6 A;  1KLM A;  5IT9 Y;  3QJJ A;  4DLE A;  1UVJ A;  2Z0G A;  4ITS A;  3IN5 A;  2DNK A;  1FXD A;  3I9Z A;  1DRZ A;  1ZM4 A;  1P27 B;  1VFJ A;  3AJ2 A;  2VJU A;  4M1K A;  2E5G A;  2DHS A;  2J6S A;  5GVQ A;  1B0P A;  3TR5 A;  3Q23 A;  4HT7 A;  1OY9 A;  3M8R A;  1H2V Z;  3J81 U;  3CPW R;  4JI0 F;  5CHC B;  5F0W A;  4NEZ A;  5L1J A;  2GQQ A;  3BGR B;  3NGD A;  4C11 B;  3EZU A;  3VAF A;  4USU A;  1ZYQ A;  1T9W A;  2XG8 A;  3DU5 A;  1NH8 A;  2JEJ A;  1Q82 T;  4RNF A;  3MR3 A;  2GX8 A;  2RML A;  4KHR A;  4USK A;  4NI2 A;  1JLA B;  2JFD A;  3BBC A;  4HI1 A;  2WOM A;  3F73 A;  4IG0 B;  2CA9 A;  4ALZ A;  1FO1 A;  4CTA B;  4P9S A;  1TAU A;  4JI0 J;  4LIR A;  1VC6 A;  4ZOS A;  1YGY A;  2AEF A;  2R2R A;  1SKR A;  2R8H A;  2LVW A;  2P9G A;  3PTW A;  4I2P A;  1RTI B;  2WAQ D;  4OI2 A;  2X3D A;  2B5J A;  1PIL A;  3K5P A;  1JX4 A;  1RHU B;  1WD6 A;  2BMB A;  4PKD B;  2YWH A;  4HVZ A;  4Y2K A;  1KN6 A;  2HKE A;  2XWY A;  2YWE A;  4YP3 A;  3C16 B;  5HAN A;  3BDE A;  3HT3 A;  6AT1 B;  1YJN S;  1Z2Z A;  1EQM A;  2GZO A;  3BSC A;  1T3N A;  2EFO A;  3BH7 B;  5ETK A;  1RTZ A;  3I82 A;  3HVW A;  3OFH A;  3D9B A;  3MOZ A;  4RNM A;  5DDP C;  4K7Q A;  4IH7 A;  1RSC A;  4WXO A;  5IS2 A;  3TI0 A;  3T6B A;  5CH7 B;  3W2V B;  4DR2 J;  2CG8 A;  2HG4 A;  3F41 A;  3K5O A;  4C8K A;  2W7A A;  2YKN A;  1RCO B;  2CPD A;  3MDF A;  4ZS6 A;  2KJV A;  2C2R A;  1SL1 A;  1HWL A;  3LH2 S;  2XCP A;  2LA4 A;  3JS9 A;  3RBX A;  3LO3 A;  3BRE A;  3IA0 A;  3BPS P;  3MM8 A;  1L3U A;  2G1H A;  3BGL A;  3POT A;  4LVN P;  3LAM A;  2VDI A;  3VAM A;  2FC8 A;  2HZV A;  4C98 A;  2VG5 B;  2Z56 B;  1RWX B;  4NML A;  2D3Z A;  4DV0 F;  4OZ1 A;  4LR9 A;  1FDB A;  3PW2 A;  4XTT A;  2ALY B;  3HT0 A;  4WYW A;  1GXU A;  4QJV A;  4TKT A;  1ZH5 A;  3PFE A;  3EDR B;  1CJT B;  1H2U X;  3I32 A;  4L3N A;  2RB7 A;  4C8N A;  3JYT A;  5HMY A;  2O66 A;  2HRT A;  4BDP A;  3IBW A;  2W01 A;  4G1Q A;  4URS A;  4FVM A;  2LQJ A;  4OHX A;  2A2D A;  4NA1 A;  3MAA B;  2H5J B;  4N5S A;  2LXF A;  5ETS A;  1T05 A;  5HLF A;  2QFJ A;  2DRB A;  5BYS A;  5GMK a;  5DG8 A;  2XY6 A;  3OFG A;  1N6Q B;  3H5X A;  4ILL A;  4ZPA A;  1FVQ A;  3VVU A;  2YNG A;  1VQN S;  4GC6 A;  2VV5 A;  3N5F A;  1B4S A;  4JB8 B;  1S59 A;  3DMJ B;  2IA6 A;  1TKT B;  3C66 A;  5D77 A;  3MUM P;  2KHD A;  5F8I A;  3W63 A;  4KGK A;  4C3L A;  2XUL A;  2RD5 C;  1FRL A;  1H98 A;  1KDN A;  3F44 A;  2CQI A;  2NSB A;  2F8E X;  1VQ4 S;  4S0M A;  3QSI A;  2CQB A;  5B0D A;  3K0J A;  4HAC A;  3QT6 A;  2AJ1 A;  2JVR A;  4ZIV A;  5DGA A;  1RAE B;  5A2Q Y;  2KG1 A;  5CYM B;  2V2Q A;  3IRW P;  1RT1 B;  1SCJ B;  2DHX A;  4M94 A;  2DD8 S;  4Y0F A;  3P4U B;  3B4D A;  1MML A;  1DTT A;  8RUC A;  1QSY A;  1YVF A;  2L08 A;  3HZE A;  3NOG A;  1QTN B;  2QE5 A;  4ED0 A;  2KM8 C;  4GVB A;  4DR7 F;  2MXY A;  1CQM A;  1HNV B;  4BWJ A;  2E44 A;  4EWT A;  3CUN A;  1ZS6 A;  1NK7 A;  4GO5 X;  4AND A;  4B3O B;  3GG0 A;  3HHE A;  3HHL A;  3WC0 A;  1WSV A;  2R7W A;  2XSF A;  2XO7 A;  4KV8 B;  2QSW A;  1KLN A;  2Q43 A;  4E0D A;  1KTV A;  3QT7 A;  2VPZ B;  4FS2 A;  1E6V A;  3O5T B;  4DR7 J;  1T9U A;  3ZZR A;  4DV3 F;  4MIB A;  3A4T A;  3V6J A;  4AL7 A;  5F0U A;  4OJ3 A;  4LBI A;  2DNP A;  4LF4 F;  4A4J A;  1KOO A;  5HVG A;  4O44 A;  2UXC F;  1JNZ B;  1QTM A;  4DN9 A;  3DKD A;  1OYE A;  4NZ6 A;  2DTJ A;  3VHQ A;  2XMU A;  4WPA A;  1G6B A;  3MED A;  3HMJ G;  1V5I B;  1QAX A;  3I0S B;  1S5Z A;  3UR3 C;  5A0Y A;  2ZD1 B;  3G96 A;  1XC9 A;  4R8U B;  4RW4 A;  4AXJ A;  3J80 U;  5C42 B;  1BXN A;  2YKP A;  2HBQ B;  4NRT A;  1QUP A;  4KH1 B;  1RBA A;  4M5L A;  5B0B A;  3GR1 A;  1TQL A;  1HQE B;  3EDQ B;  4Y3C A;  3ILL A;  3T9Z A;  1BUX A;  4YHH F;  1WEL A;  3TA2 A;  1F2G A;  2MQ8 A;  4YDD B;  1UP1 A;  1WF0 A;  1NDC A;  4C0B A;  1NSA A;  1KHV A;  4KO0 B;  3BKU A;  4OYB A;  3M8Y A;  3PRV A;  3Q8V A;  4PYD A;  2PSZ A;  1WTB A;  4LUB A;  1FJ7 A;  2FHK A;  1SJ4 P;  3A3O B;  2YH1 A;  2NXJ A;  2YKM A;  5JUM A;  5G4D A;  2BEF A;  3K59 A;  3HKW A;  2NXU A;  3TQ1 A;  3KK3 B;  1EP4 B;  3DDK A;  2ZFH A;  1L5U A;  5KFR A;  4ED8 A;  2AX1 A;  5J2Q A;  3CCV S;  5KFX A;  2J9D A;  2RF2 B;  5FII A;  3IR5 B;  4RNN A;  2ATL A;  2LMI A;  2PO4 A;  4DQI A;  1CS4 A;  1IKY A;  2HHX A;  3FUY A;  3IS9 A;  4AUK A;  3OL6 A;  2ZJQ Q;  4M5D B;  1D8Y A;  3DLG B;  1V3S A;  3LP2 B;  3ZNU A;  3JAM U;  1T11 A;  3OD2 A;  4TY9 A;  1BE4 A;  2VBX A;  2KVQ E;  2C2E A;  2LKZ A;  2IY5 B;  3K5L A;  2V4R A;  4RUB A;  2BJ3 A;  2XM3 A;  1LWX A;  2OPR A;  3DYA A;  5KT4 A;  2CJB A;  5B0F A;  4ZLJ A;  4J9U E;  2VD3 A;  4ZPT R;  1S12 A;  1KON A;  4J37 A;  1TL5 A;  2VBW A;  3K2Y A;  4K4S A;  4PQU A;  2XMM A;  3A8J A;  4QU6 A;  2KZZ A;  2RT3 A;  4KT0 C;  4W4M A;  4DFJ A;  1FES A;  2YNF A;  1FX4 A;  1SH2 A;  2QA1 A;  3DNC A;  1QDU B;  4KC5 A;  2QFI A;  3QJL A;  3QO9 A;  5JJB A;  3I96 A;  4J9N A;  3CCE S;  5DDR C;  1C2P A;  4QYZ J;  1YKW A;  2CXE A;  1F60 B;  3CJK A;  4C7Q A;  4TXS A;  1HKA A;  1P9Q C;  2HVE A;  2I2Y A;  2HFO A;  2CVI A;  5KAK A;  3MUR P;  2DH8 A;  5FD1 A;  3CCU S;  4M5J A;  3BBB A;  2YH0 A;  2D9P A;  2AW0 A;  1WKJ A;  4EGL A;  1WNE A;  4KJI A;  2M9K A;  2PEB A;  3DC2 A;  2ZH8 A;  2V63 A;  1M5V C;  3VAJ A;  4OL8 A;  1PG5 B;  1U8W A;  4QBU A;  4NLR A;  1QVG R;  2B4V A;  3CW2 C;  2Z2Y B;  4XIU A;  4G1P A;  3LOU A;  1VIO A;  3Q8Q B;  3A8K A;  4O3Q A;  1YSJ A;  4OYP A;  3DLB A;  2EW9 A;  3CME S;  4ECY A;  1FD8 A;  4FYY B;  1SL0 A;  2DNY A;  2V9W A;  5I42 B;  2VIH A;  4RX6 A;  4BC7 A;  3GZ7 A;  4ZVG A;  3KNA A;  4C0O C;  4JV0 A;  1GMW A;  3HSG A;  4O0I A;  2D41 A;  3N9U C;  1FKP A;  3BYR A;  5A8W A;  3VAL A;  1Q4R A;  2V68 A;  2I1R A;  2FIU A;  5K14 A;  1S6P B;  2Y0S D;  1P8G A;  2I8E A;  1HD1 A;  2EXU A;  2ZBC A;  1R8P A;  3Q2S C;  3PKY A;  3CDA A;  3THV A;  1JLG B;  4FYX B;  2AJF E;  2AGQ A;  1I6J A;  3OJU A;  1SJF A;  2L41 A;  2VPW B;  4Y2C A;  5D78 A;  4DDF A;  5DZ7 A;  1L3K A;  2KL8 A;  2YNI A;  3TUP A;  2DHH A;  3QQC D;  4TN2 A;  4DL3 A;  4DFP A;  3OTE A;  3UD5 A;  4O4R A;  3CCT A;  3N4W A;  3KLE A;  2IA0 A;  5LSR A;  2DNQ A;  3GII A;  2J6T A;  1PYO B;  3DI6 B;  2AYB A;  3G8Q A;  2YKO A;  4B9N A;  4NYP A;  1S1V A;  1RQ0 A;  1SC6 A;  3H2U B;  2AV5 A;  1RUS A;  3GCX P;  4ZLN A;  3PW4 A;  1DTQ A;  3P96 A;  2DR8 A;  1U2F A;  1HHT P;  2KHC A;  1MU2 A;  4IQM A;  2NYH A;  2XMK A;  3PHT A;  2M70 A;  3L9Z A;  2WBM A;  4W92 B;  1RWV B;  5HVH A;  4AFF A;  2IM1 A;  4FF3 A;  5C25 B;  4ECQ A;  2YKQ A;  5HVF A;  4OZL A;  4O3P A;  5GAE I;  3H25 A;  4C4W A;  2E7W A;  1RHJ B;  2IVF B;  1X8D A;  2FVQ A;  2ZOG A;  1CBK A;  1U02 A;  3LW5 C;  1RT3 A;  2DGQ A;  1X4H A;  2R7S A;  2OPP B;  2EI5 A;  2VFR A;  1KVK A;  2B7B B;  4ZVS B;  3MM5 A;  2BRL A;  2AMC B;  1HMV A;  3T9N A;  1OQ3 A;  1X60 A;  1Y5L B;  2VIC A;  1FJE B;  2FZK B;  3SQG A;  2QA4 S;  4F4K A;  3MMC B;  3TUI C;  2PMH A;  5JVH Q;  1XN9 A;  3MMA A;  2PI4 A;  1TV6 A;  1RAH B;  2QTW A;  2Y0B B;  3NP5 A;  4EYH B;  3MM7 A;  1BY9 A;  4ILM A;  4CLK A;  4DPU A;  4OZ2 A;  2RDD A;  4ZCM A;  1KLM B;  4G65 A;  2VAS A;  3E8O A;  2CNO B;  1LW0 A;  2FVP A;  4FF2 A;  3GIK A;  4TVA B;  3PEH A;  4QWA A;  4FNI A;  3BPD A;  5DLF A;  3KJN B;  4DL4 A;  2AJQ A;  3DGV A;  2P5V A;  2KYZ A;  1D9F A;  2NYI A;  1RT5 A;  1WKK A;  1D9A A;  1OWX A;  4PR6 A;  1V9O A;  3W9H A;  2F8M A;  1JJ2 R;  2NS1 B;  2DPJ A;  2W8K A;  4Q44 A;  1FE4 A;  3D54 A;  1U45 A;  1VQ8 S;  2LQ8 A;  1XNR F;  4RW8 A;  1UL3 A;  2HZC A;  3K8W A;  2QYC A;  5THW A;  3UDV A;  3AA9 A;  3Q2T C;  2HVZ A;  2U1A A;  2FHJ A;  4HH1 A;  3AOA A;  4NI2 B;  1R7I A;  3HVR A;  4OHV A;  4QW8 A;  2J9C A;  4N8O A;  2WOM B;  4J5O A;  4WKY A;  1Y11 A;  4AYB D;  2HFN A;  4DUT A;  4K5S A;  3PKM A;  3I0R A;  3FSX A;  1AB8 A;  2BJ9 A;  2MY7 A;  4ANC A;  3UD3 P;  1R89 A;  2W24 A;  1M5K C;  4LT6 A;  4HTJ A;  2CQ0 A;  1AFJ A;  5F8L A;  4MK9 A;  2ZZT A;  1UZD A;  2B5J B;  3L7U A;  1IQT A;  3M6X A;  2XTJ P;  4BCA A;  2WVB A;  3S1T A;  5CD4 A;  2K3K A;  2DNH A;  1N0V C;  4IYQ A;  2PMZ D;  4J9V A;  2DY9 A;  1NBE B;  2LLZ A;  5D4O A;  3CCR S;  1XMO J;  4IRD A;  4U8V A;  1F5A A;  4WP8 A;  2NPF A;  4Q5V A;  3LPE A;  5H9F K;  3SV4 A;  2DGT A;  4U7U D;  4LRB A;  1OY8 A;  3G8S A;  2OD4 A;  3LF0 A;  1XMQ F;  5KFM A;  5BYR A;  2NXC A;  2L3M A;  4MTP A;  2OSQ A;  1RT7 A;  1O5J A;  3KXD A;  4RW7 A;  3E01 A;  4IRK A;  3BR8 A;  1U2C A;  2YKN B;  3J7Y I;  1S79 A;  5L38 A;  1RT2 A;  2G0J A;  2VC0 A;  3D6M B;  3MM8 B;  3GTY X;  2EBE A;  1D09 B;  2HIQ A;  5C2C A;  2J5A A;  2LDY A;  3I6P A;  2HW3 A;  1MLA A;  1U6Z A;  1XMQ J;  3IWN C;  2ADB A;  5BR8 F;  4Q2L A;  4ED4 A;  4X62 F;  4JI3 F;  5DQH A;  3T5H A;  4WYL A;  4OX9 F;  1EIY B;  3S01 A;  1M5S A;  1NHV A;  2A6M A;  1YDL A;  4OYX A;  3LP0 A;  1URR A;  1XIQ A;  4J9S A;  1NKE A;  5H9E J;  3SCK E;  5MAO A;  3G2X A;  5L46 A;  4G1Q B;  2Q3P A;  4OZN A;  1DFD A;  3GIM A;  2CZ9 A;  2KN4 A;  1LK5 A;  2MPU A;  1NJW A;  2YY3 A;  2Q6B A;  3HVT A;  1T05 B;  2ZM6 F;  3T5K A;  3CJ3 A;  5HLF B;  2HGM A;  3GJR B;  2IDE A;  1ZM2 A;  1MW7 A;  4K50 A;  1WTF A;  3JQK A;  1QD1 A;  1SXL A;  2OSR A;  3MTJ A;  2YNG B;  5LMU F;  5HL7 Q;  2RRA A;  1OJ4 A;  4KPC A;  1SH3 A;  3M6W A;  3TA0 A;  2CQ4 A;  3Q8R B;  5FLX U;  3RBZ A;  3DN9 A;  5EGY A;  2ZM6 J;  1LOU A;  5L1I A;  1SUQ A;  2E29 A;  1R8H A;  2G1D A;  4NA2 A;  2RUG A;  2YX7 A;  1TFW A;  4HAC B;  3WX8 A;  1KR4 A;  4MKA A;  1D1U A;  5F8G A;  1BWV A;  3P8B B;  5KFN A;  1WWH A;  1JQG A;  4DPW A;  1W25 A;  4K4Y A;  5LMU J;  3LAN A;  4U9R A;  2NR0 A;  2KFZ A;  2HHP A;  2UP1 A;  4FN5 A;  4ZCL A;  1DTT B;  3ZTP A;  1RT4 B;  2IHR 1;  5J1N A;  1TMM A;  2AJ0 A;  2KT2 A;  2R8G A;  1YHQ S;  1IUJ A;  4GVB B;  1WEZ A;  4ZVF A;  4F0K A;  4X4P A;  1LXJ A;  2FUG 9;  4X4U A;  3RG6 A;  1ICE B;  3OVB A;  2IVM A;  4EFA C;  5LXY A;  1DQA A;  2CQ3 A;  2RDI A;  1A0O B;  3C15 B;  4N77 A;  5L9N A;  2K1R A;  1Q86 T;  3BSA A;  3CJ0 A;  5ETQ A;  2B6A A;  1DQ9 A;  2ILZ A;  3VGT A;  1URN A;  2DRA A;  3PIP Q;  1CVJ A;  3W62 A;  1WG1 A;  2HLU A;  2QJ3 A;  4USV A;  3U27 A;  3QLH A;  2V4J A;  2OPS A;  1SPB P;  3MFI A;  1WG4 A;  2GA7 A;  1BD6 A;  1F9H A;  4NLT A;  1C1C A;  2AJ2 A;  2GAH C;  4PXC A;  1E6V B;  2FGC A;  2YWK A;  3CED A;  1Q16 B;  1NK0 A;  3R5G A;  2Z2Z A;  2JEG A;  2RU3 A;  5L8R C;  3LGN A;  1T02 A;  3N6M A;  5KFE A;  4NCB A;  1KKH A;  3NS7 B;  1SB6 A;  4O44 B;  3BF4 A;  1JLB A;  3TX0 A;  4WZM A;  4RKU C;  2L9D A;  2XB2 D;  2MQN A;  2UU9 F;  5CYQ A;  1IWA A;  3AHP A;  3RRK A;  2UV8 A;  3MED B;  4EMD A;  3IGV A;  5ETR A;  1WI8 A;  3KUG A;  3CJQ A;  4RW4 B;  1N5Y B;  3H59 A;  3FZB A;  3KHH A;  2GJF A;  3PIO Q;  2EG2 A;  5EWE A;  3OL9 A;  2RJZ A;  5A8K A;  2GFF A;  2KYX A;  3CJS A;  2EFQ A;  2RDJ A;  4FP9 A;  2JFK A;  5AE2 A;  4FBT A;  3J81 j;  1B7F A;  3TNV A;  2HRY A;  2M8D B;  2GMH A;  1LWC A;  5ITH A;  4CQ1 A;  1VQY A;  1DZ5 A;  2CQC A;  1GX6 A;  1IJF B;  2YKM B;  4K0K F;  4ZLP A;  3GYG A;  3BYP A;  1HBN A;  2A0F B;  2GJ2 A;  3PYE A;  3OSN A;  4N7T A;  1WF1 A;  4QYR A;  2GVZ A;  1IVZ A;  1RWK B;  5J2Q B;  3AD9 C;  1UPP A;  3ENV A;  5KFI A;  1RAD B;  2E5J A;  4OYA A;  1UET A;  3MI7 X;  3OR2 A;  1HI0 P;  4DX8 H;  3DRP A;  4PPZ A;  1CS4 B;  1IKY B;  3NG8 A;  2IM2 A;  1GAO A;  3IS9 B;  1I5O B;  3A1Y G;  2UVU A;  1RHK B;  1TEL A;  1HR0 F;  3LGM A;  1QVF R;  1UEK A;  3UN2 A;  2AT1 B;  1FXL A;  5HQL A;  4NEY A;  2HRU A;  4NE9 C;  1LFP A;  2UUA F;  3OPK A;  2OPR B;  4ECX A;  3DYA B;  2N3O A;  3TZY A;  3M4X A;  3UI3 A;  1X7V A;  5B0G A;  4KGZ B;  4FBU A;  1D9D A;  1QE1 B;  2C3Y A;  3I4H X;  2BOP A;  4JI2 J;  3C46 A;  1VK3 A;  1M5O C;  2PII A;  4PQU B;  1PAE X;  4ZP6 A;  2ZJP Q;  3MGJ A;  4OYO A;  2UUA J;  3MMB A;  2E7V A;  2YNF B;  4DUZ F;  1YX2 A;  2H5I B;  3TYT A;  2XY5 A;  2J7U A;  3KMS A;  3QO9 B;  1WC5 A;  3HF5 A;  3W64 A;  2ZC3 A;  5LL6 d;  1XK8 A;  4ZVR B;  5GAG I;  1JXL A;  2ZDP A;  1KS2 A;  3M2U A;  1UEV A;  2JHE A;  4ED1 A;  1W2B R;  1JXE A;  4ZP8 A;  4USM A;  4U95 A;  2EC0 A;  3EGN A;  4JV5 J;  5T7L A;  2DIS A;  1OIA A;  3HK2 A;  2ZNZ A;  1UWB B;  4PWD A;  2F9J A;  4DUZ J;  3W8P A;  2CG4 A;  3ZTQ A;  2HHV A;  1SQF A;  3JTO A;  2XI3 A;  1VR6 A;  2MZ1 A;  2C22 A;  4E8U A;  4KR0 B;  1XER A;  1N5S A;  2CUY A;  4WFY A;  1RTJ B;  4L73 A;  2D69 A;  2DXF A;  2ZVS A;  2HK3 A;  1C0U A;  3G71 S;  1UW4 A;  4OI4 A;  4Y34 A;  3PHE A;  3UR0 A;  1JK9 B;  3T5L A;  2VQF J;  1HHQ A;  3CJ4 A;  4O4G A;  2N7C A;  2EG1 A;  5KFC A;  4JI1 F;  2PFD A;  5A8W B;  3AXM A;  3QPI A;  5DET A;  1X9M A;  5K14 B;  4B9V A;  3BV8 A;  4WF9 Q;  4YQW A;  1WEX A;  4L74 A;  4CO3 A;  4QPX A;  1XR7 A;  4J9P A;  3HCX A;  1RB0 A;  4URG A;  3AH6 A;  3V2U C;  5ETL A;  1QY7 A;  5J1P A;  3QGG A;  2BW7 A;  2YNI B;  4JI4 F;  4X4O A;  2C2N A;  2OFH X;  2GJI A;  4Q45 A;  5KFP A;  2KRR A;  2F3J A;  2G2Y A;  3GV5 B;  2LYV A;  3ETM A;  3KLE B;  2EEY A;  1C1B A;  4PAB A;  1N36 F;  4RLE A;  3PRD A;  5ETO A;  2AWZ A;  4DR5 F;  5IXU A;  1H0H B;  1GMU A;  1NKC A;  3FCV A;  4LF7 J;  2P9E A;  2AKW B;  2PEH A;  3QYY A;  2LXI A;  1N0U A;  2CDR B;  2GVD A;  2I38 A;  3W65 A;  1VQ9 S;  1MWQ A;  1S72 S;  2DNM A;  4X65 F;  1FFW B;  4PRF A;  1APS A;  3VAK A;  4ZLL A;  3N6N A;  2M88 A;  2ZBR A;  3ENA A;  2FLO A;  4QQB A;  2CAJ A;  1UAW A;  4NCA A;  3V4I A;  1MU2 B;  4BS2 A;  3NGK A;  4UQG A;  1H7W A;  1GTE A;  2HK2 A;  3KLG B;  5KFU A;  3IBC B;  4JI8 J;  2UUW A;  2G0I A;  5E3C A;  3CO0 P;  2WW8 A;  4A8W A;  4UZC A;  3C16 A;  4X65 J;  3OTO F;  2AD9 A;  5HN0 A;  2BOA A;  3EYZ A;  2VHG A;  3GFZ A;  1RT3 B;  4OV6 A;  1Q7L B;  1WOS A;  5HBM B;  3KOA A;  3HFZ B;  2Q79 A;  3V4M A;  3ISN D;  4LF9 F;  3QIP A;  3MM5 B;  1HMV B;  3QGP A;  4LSN A;  1TU0 B;  1RJJ A;  3EXY A;  3IC1 A;  1TVR A;  2A3J A;  4ETZ A;  3SQG B;  1D0E A;  2CWX A;  2YX1 A;  1TKZ A;  3GFY A;  4XK8 C;  2D3U A;  1U7L A;  5M2R A;  1HQU B;  1HBU B;  3MM7 B;  3C8Y A;  1DBD A;  4Y6I A;  2BKO A;  1X5S A;  3D0I E;  1ZPV A;  1VQL S;  2VOD A;  3GE9 A;  1T9V A;  3IGN A;  5KFH A;  1PKU A;  3AB4 B;  2RHS B;  4ATN A;  5AJ3 F;  4LF9 J;  5HO4 A;  2RNE A;  5KG3 A;  2BV3 A;  1NUE A;  2BJ7 A;  2DGO A;  2V6A A;  1TKD A;  1PIE A;  3CCM S;  1RT5 B;  5LSO A;  1FT8 A;  4TQR A;  4LF6 J;  4HT5 A;  4C8Z A;  5AXK A;  5KFW A;  1S7H A;  4DL2 A;  1RWM B;  1QAJ A;  4RW9 A;  4YUD A;  4JYA J;  4RW8 B;  2F8H A;  2LQ5 A;  3FCH A;  3G82 A;  2U2F A;  3HZG A;  4OI6 A;  3JB9 k;  2DXD A;  1NKB A;  1FWP A;  2YNH A;  3EGV A;  5AJ3 J;  1ZAV A;  3UFC X;  2HVI A;  4LF8 J;  4Y65 A;  1N6Q A;  3IAM 9;  3Q22 A;  4DFM A;  5KG4 A;  4R0J A;  2KO1 A;  4DF4 A;  2J0W A;  4WFA Q;  2LDI A;  3CD6 S;  2AU0 A;  1NCL A;  3Q8P B;  2ZEJ A;  1S9F A;  1EX8 A;  2R7V A;  4P74 A;  3FC9 A;  2Z58 B;  3I5B A;  1JMT A;  4RPF A;  2XEX A;  4M5H A;  4Y28 C;  3HHN B;  4I64 A;  1Q8L A;  3K57 A;  4K5R A;  4ES3 A;  1X4B A;  2W2Q P;  4CLF A;  2OJ3 A;  2VFV A;  5JVG Q;  1RBL A;  5HSP A;  2HZA A;  2HWT A;  3C6U A;  1W26 A;  2CQ1 A;  2VG6 A;  4J9K A;  3FEX B;  3Q8Y A;  1NK8 A;  3GFX A;  3PJW A;  1NPP A;  1W7W A;  3UDC A;  1FKO B;  3GQC A;  4CYU A;  1JLQ A;  1UKU A;  3DOK A;  4DI6 A;  3PJX A;  3O8W A;  3H40 A;  2OTJ S;  1IBK J;  1HNV A;  4RL1 A;  4RW7 B;  1U25 A;  3E01 B;  1MRO A;  1M5P C;  1O6X A;  2FJW A;  4LBH A;  3CCL S;  3PO5 A;  8ATC B;  1TL1 B;  3TAP A;  2W7P A;  3JSM A;  3N0V A;  2V94 A;  3HP6 A;  1RT2 B;  4M5K A;  1LW2 A;  3A8I A;  1X0P A;  4EZ9 A;  4X4S A;  1BQN A;  1WOR A;  1YRU A;  4LSZ B;  4YN3 B;  3OJS A;  3PW7 A;  2B9W A;  1VI7 A;  1NDK A;  3NMA A;  4QW9 A;  2I0X A;  1KHW A;  3QFH A;  2DH9 A;  3HHK A;  1FTR A;  5A6P A;  4K2X A;  4C3K A;  4CO1 A;  4ES1 A;  2DHA A;  3Q24 A;  2HWI A;  5KFT A;  2KKH A;  4XAK A;  4DG1 A;  2QN6 B;  4I1T A;  2MLZ A;  1FWL A;  4AQY F;  2FQQ B;  3HVT B;  5AT1 B;  1NO8 A;  1FWK A;  2HQF A;  2YPZ A;  5A8R B;  4HKQ A;  1ACM B;  4KH0 B;  1CC7 A;  4K2J A;  2BE2 A;  2DO4 A;  3GV7 B;  2KI2 A;  3TUZ C;  2ZH1 A;  2HBZ B;  1VHI A;  2OKQ A;  4GC7 A;  2ZVI A;  4ED3 A;  4LF2 A;  4C8Y A;  4EZ6 A;  2RIJ A;  3H90 A;  4IFV A;  3H5Y A;  4PG4 A;  4A8M P;  2BKP A;  3QFW A;  4CDI A;  1U1R A;  3PO4 A;  5KFG A;  3KHL A;  2ZOF A;  2HGN A;  1N88 A;  3PZP A;  3DXS X;  1F0X A;  3BSO A;  4R25 A;  3HLU A;  2HMI A;  2K8G A;  3J7Y U;  4DWI A;  1NB2 A;  1SL2 A;  1UA0 A;  4ED2 A;  4F3Q A;  1U24 A;  1DAX A;  2VZ9 A;  2BM0 A;  1V3R A;  2DRD A;  4C97 A;  1GTH A;  4OX6 A;  1EP4 A;  4DR6 J;  5LJ3 Y;  2RSQ A;  1TKX A;  4LFB J;  2FJE B;  1JJH A;  1FDN A;  4F0H A;  2Z30 B;  4ZMM A;  3V6K A;  2H4Y B;  2QL7 B;  2EKN A;  1CSJ A;  1ARO P;  2NXN A;  3PAC A;  4ID8 A;  4HHJ A;  4WXW A;  1VLO A;  2B6A B;  1IJE B;  3EGW B;  3D1Q A;  4DR3 J;  1JXV A;  4N76 A;  3G8T A;  4J9R A;  4DR1 J;  1RP5 A;  3W5Z A;  1HNZ F;  3QLH B;  2V4J B;  9ATC B;  2JOQ A;  2HHH J;  4DEZ A;  2OPS B;  4EYI B;  3SMZ A;  1C1C B;  4BBY A;  3DM2 A;  3O1L A;  2XLI A;  4DXL A;  3KJQ B;  2DVI A;  1RU1 A;  3OT9 A;  1NDL A;  2MZS A;  2R2U A;  1WC4 A;  3DRX A;  3CJ2 A;  3DXB A;  2KXN B;  2IRU A;  1TUG B;  4NLV A;  4V1A k;  2WZ1 A;  1NJI T;  1Y10 A;  4KRW A;  1JLB B;  1LK7 A;  3EWG A;  4KHP J;  3SXL A;  5M2P A;  1HNZ J;  2A2C A;  6FD1 A;  4CZC A;  5A76 A;  4USH A;  1LEO A;  2VA3 A;  1YJR A;  4C9D A;  2V34 A;  1DAR A;  2RS8 A;  5J2P A;  2ERR A;  2M7S A;  1HNX J;  1IN0 A;  2ZJR Q;  4ZKA A;  3UCZ P;  3V81 A;  4IR9 A;  3RTV A;  3L09 A;  1RWP B;  4QOT A;  1T9T A;  2BJD A;  2WTF A;  1ZTT A;  5A8K B;  3Q8U A;  5CXT A;  1IKV A;  3H4D A;  3R7B B;  1OSC A;  4G6V B;  4DR4 F;  2UUB F;  5D3G A;  4QR0 A;  1M5H A;  1R6V A;  2KZM A;  1N32 F;  1C4C A;  2RUS A;  3IP0 A;  4J9L A;  1LWC B;  2DNL A;  3SSR A;  1IKX A;  4HTI A;  3IR6 B;  4ZVO B;  2E1R A;  3AD8 C;  4AL5 A;  1WHX A;  4C8M A;  1GH8 A;  2ZZN A;  2CPJ A;  2HHW A;  1WHY A;  1FRK A;  3RAM A;  4H4O B;  3WHI A;  1U0H B;  3DRR A;  3QT8 A;  2K2P A;  2IC3 A;  1REV A;  3G4S S;  2MEW A;  1HBN B;  1C0T B;  3EUN A;  2X1A A;  3GWC A;  4WIQ A;  2JC1 A;  3D67 A;  3T6J A;  2DR5 A;  1JLE A;  2Y8W A;  1CC8 A;  5CAB A;  2XNQ A;  3PDN A;  3D66 A;  3W2W B;  2GVZ B;  2QZ8 A;  1DJ0 A;  3N5B A;  5E41 A;  2DGS A;  1H72 C;  1YJW S;  3EPI A;  3MAH A;  5KFZ A;  3OR2 B;  3DRP B;  2KXH A;  4NL5 A;  5IT9 U;  2BVZ A;  4RW6 B;  2VDH A;  1EAR A;  1TFY A;  2N4C A;  5EDW A;  5HQ8 A;  3UD4 P;  2XS2 A;  2AYE A;  5H9F J;  1L3V A;  2C1E B;  1MMD A;  3QWP A;  2XZW A;  1FEE A;  3H98 A;  5ETV A;  5FLX Y;  3QRQ A;  3W3S A;  3PYG A;  2W4D A;  1VRT A;  1RU2 A;  2FVC A;  1T0T V;  5KFL A;  4NA3 A;  4OJG A;  3EXC X;  2JC0 A;  2IRY A;  1X5P A;  3NCP A;  2PDA A;  3IXQ A;  1LKZ A;  4JI7 J;  4I7F A;  2LEP A;  5HK4 A;  2BYC A;  3PVX A;  2MQQ A;  3DI6 A; 
#chains in the Genus database with same CATH homology
 3MCN A;  3HD1 A;  1DY3 A;  1RU2 A;  3IP0 A;  1EQM A;  4M5N A;  2CG8 A;  1CBK A;  1KBR A;  1HKA A;  2QX0 A;  3HSZ A;  1Q0N A;  5ETL A;  4AD6 A;  3HSJ A;  4M5L A;  4PZV A;  4CYU B;  2BMB A;  3ILI A;  3QBC A;  5ETK A;  3UDE A;  4CRJ A;  1RTZ A;  3ILJ A;  4CWB A;  4M5H A;  1G4C A;  3HSG A;  3MCM A;  4M5K A;  5ETP A;  4F7V A;  1RU1 A;  4M5G A;  3ILO A;  1TMM A;  5ETV A;  5ETO A;  3MCO A;  3ILL A;  5ETS A;  4M5M A;  1EQ0 A;  3HSD A;  4M5J A;  5ETM A;  3UD5 A;  3KUH A;  1IM6 A;  1HQ2 A;  1RAO A;  2F63 A;  5ETT A;  4M5I A;  5ETR A;  3UDV A;  3HD2 A;  3KUG A;  5ETN A;  1F9H A;  3KUE A;  3HCX A;  5ETQ A;  1EX8 A;  3HT0 A;  1RB0 A;  4CYU A;  1TMJ A;  2F65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...