1D8ZA

Solution structure of the first rna-binding domain (rbd1) of hu antigen c (huc)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
89
structure length
89
Chain Sequence
MDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords HU ANTIGEN C
publication title NMR studies on functional structures of the AU-rich element-binding domains of Hu antigen C.
pubmed doi rcsb
source organism Mus musculus
total genus 9
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 1999-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1d8zA00
3FEYB 1G2EA 2DGSA 3G8TA 4C7QA 2ZJPQ 3MUMP 3CC4S 2KYXA 4IUFA 2CPXA 2OSQA 5DETA 2EK6A 1U1RA 3K0JA 1N88A 2DB1A 3RW6A 2CQIA 3BS9A 2MSTA 2DNGA 1HD1A 4TU7A 1FNXH 4UQTA 2X1GA 1YHQS 2SXLA 2LMIA 1D9AA 3BEGB 2GHPA 3SDEB 3P49B 4ED5A 1XN9A 1QM9A 2ERRA 4LIRA 2V94A 2D9PA 2JWNA 3MUVP 5CA5A 5GAGU 2DHGA 2AYBA 4ERDA 2MKIA 2RT3A 2G0CA 2VONA 3SXLA 2CQ1A 2U1AA 1L3KA 2MKCA 3J7ZT 1BY9A 2CQ3A 1O0PA 4YUDA 2E44A 2J76E 1Q81T 2KXFA 1OWXA 2MY7A 3MURP 5DDPC 2A3JA 3L3CA 1VQ9S 1ZZFA 1WG4A 1WWHA 1KQSR 2MHNA 2DK2A 4W90B 1QVFR 1WEYA 2MKHA 1DRZA 1H2VZ 3NNAA 2RU3A 5GAHU 3DXBA 2M4MA 2DO0A 2DNPA 3LQVA 3CF5Q 1D8ZA 1WI6A 3H2VE 4QU6A 2X1AA 1YIJS 2E5GA 2KU7A 3VAGA 3R1HA 1R8PA 1X5OA 2MY8A 2DNZA 3TO8A 3P3DA 3R1LA 4WFNQ 3CCES 2G1DA 2JRSA 2N82B 3R27A 3J7YU 2J0QD 2N3LA 1ZH5A 3UWTA 2LQ5A 3EGZA 5IFMA 2DNYA 2O3DA 1WI8A 3IRWP 3FEXB 5GMKa 4F26A 4CH0S 1ZZNA 2BOPA 5GVQA 1SXLA 2KG1A 3H2UB 4WIIA 3P6YC 3CD6S 1X4FA 2LKZA 2DGVA 2QFJA 3UCGA 3G8SA 2DNQA 2M52A 3CCUS 2DGUA 3MD3A 5IM0B 3Q2SC 3SMZA 1FJEB 3HI9A 1U6BA 2LECA 4EGLA 3VAJA 3ZZYA 5H1SV 3CC7S 2Q79A 1S72S 2XNRA 4PKDB 3VAMA 2I2YA 3SDEA 2CJKA 2CPJA 2M7SA 1HD0A 1DHMA 1FO1A 5LXYA 1HA1A 1R8HA 3I55S 5MLCV 2E5HA 5LSOA 2OIHA 1H6KX 3B4MA 2LXIA 3EGNA 3MOJB 3HHNB 1WF2A 1SJ3P 3CULA 2CQGA 2X1FA 1WG5A 4WKRA 4YOEA 3CCLS 1PGZA 4F02A 2DGWA 4P6QA 2XS5A 2E5JA 2DH7A 1VQOS 2K8GA 3U1MA 1U1LA 2DHSA 3VAHA 4RU2A 2MZ1A 2HGNA 1VQKS 5GADU 2ZJRQ 1WEXA 1VQ6S 3ULHA 3G9CA 1HL6A 1RKJA 1KD1T 1JJHA 3THTA 2KN4A 3CTRA 1KOOA 2DNNA 2FC9A 3NS5A 1X0FA 1FJCA 4W92B 1VQ8S 2F3JA 2MQLA 2CQ0A 4CH1A 4C0OC 2KFYA 2MJUA 3CC2S 1SJRA 5HO4A 1A9NB 2LEBA 1JJ4A 1DBDA 2CQDA 4C4WA 1NO8A 2YKAA 1X4DA 2CQBA 2FC8A 1K73T 2VOPA 2EK1A 1X4CA 3PIPQ 3CCJS 2KT5A 2RNEA 1IQTA 1CVJA 1U2FA 2D9OA 2RS2A 1WELA 1S79A 3BO2A 3CCVS 2MQNA 3B4DA 5CYJA 2OSRA 3US5A 2XB2D 1YJNS 1WTBA 5IM0A 4CQ1A 1FT8A 3TP2A 2HVZA 3NNHA 1PO6A 2OTLS 3CUNA 2KRRA 1U1KA 5GAEU 1X4AA 3S6EA 4WFBQ 2RVJA 3MDFA 5DDOC 2MZQA 4FXWA 2M88A 3RW7A 3LPYA 3UCZP 4OZ1A 4YB1P 2DNMA 2YH0A 2CPHA 3UD3P 2KH9A 1WHYA 2DGQA 2MQOA 3ZZZA 5DM7Q 3THPA 3NMRA 2HGLA 1VC5A 2M8DB 2N3OA 3VAFA 2MB0B 1N52B 2MQMA 2CQCA 1VBXA 2CPIA 2DH8A 1B7FA 2MSSA 3EX7B 1M5KC 2DNRA 4J5OA 2KRBA 5DM6Q 4A8XA 2LYVA 4TU8A 1M5OC 2QEXS 2XNQA 1M5PC 1FHTA 2MQPA 4Z2XA 2MKSA 1YWXA 2JVRA 5FJ4A 2FY1A 4TLQA 2DH9A 1RK8A 4QU7A 2E5IA 2MYFA 2JX2A 2RUGA 5CXTA 2M8HA 3UCUP 1U1QA 1YJWS 3NS6A 3CPWR 1UP1A 1SJ4P 3CCSS 4WF9Q 5LXRA 2MZSA 2I38A 1VQNS 1UAWA 3S7RA 1UFWA 1X4HA 2MMYA 3D2WA 5EN1A 1X4EA 3MXHP 2L41A 2DIVA 1SJFA 1N8RT 1Q7YT 1FXLA 2AYGA 2EVZA 2KHCA 3G71S 4Y00A 2UP1A 3Q2TC 2FPHX 4QPTA 3CCRS 1YI2S 4BS2A 1H2TZ 2MPUA 1M5VC 2G4BA 2M70A 2MKKA 2RRAA 2DNKA 2M9KA 1VBYA 1W2BR 1H2UX 2DNHA 2D3OR 2M2BA 3MD1A 4M5DB 1WG1A 2DHAA 5DDRC 4QQBA 2CQ4A 4FXVA 3BO4A 4Y0FA 2JVOA 1JMTA 5ITHA 2RQ4A 1VQPS 3G96A 3U1LA 1WF1A 2LA4A 2CPFA 1FJ7A 2J0SD 3P5TL 3VALA 4U67Q 2FHOB 2F9JA 2OJ3A 3MUTP 2MKJA 3BO3A 2NLWA 2U2FA 1OO0B 2DHXA 2CPYA 1K8AT 2GO9A 4IOCQ 3CMAS 1X5TA 2KM8B 2XS2A 2XS7A 1M1KT 2KXNB 2KXHA 5DDQC 2DGOA 3V4MA 3VF0B 5LSLA 2MJNA 3JB9k 2CPDA 2CQ2A 2DITA 2WBRA 4F25A 4IO9Q 1U1OA 2KG0A 3TYTA 1U1PA 2ZJQQ 2LCWA 3CXCR 5D78A 1JJ2R 1OIAA 2ADBA 3PIOQ 2DNLA 2DGTA 2VOOA 4PRFA 2RRBA 3S8SA 2DO4A 1A7GE 2LXUA 2J8AA 1U1MA 5IQQA 1VBZA 1VC6A 3VAIA 4LMZA 1Q82T 1VQ4S 3VAKA 3I56S 2YTCA 1URNA 2KM8C 3NNCA 1P27B 2HGMA 5JVGQ 1KC8T 2MGZA 4V19X 2L9WA 3N9UC 3DLLQ 3UD4P 2RS8A 2CQHA 1Q86T 2YWKA 1M90T 4UY8T 4PR6A 2XSFA 1VQLS 2ADCA 3CMES 4LJMA 3MI7X 1U6FA 4ZKAA 1NU4A 2MZRA 5HL7Q 1DZ5A 5LJ5Y 1X4BA 1VC0A 1P1TA 2DIUA 1YTYA 2CPEA 4TU9A 3OW2R 2CPZA 2DGXA 5BJRA 2DNOA 2RQCA 2HYIB 2AYEA 1VQ7S 1WHWA 2NZ4A 3CCMS 1N54B 2K3KA 4OZ0A 1X5PA 1YITS 2B0GA 1U1NA 1X4GA 1OPIA 1F9FA 2MXYA 2MGZB 2CQPA 3UE2A 2F9DA 4WCEQ 3S01A 1KOHA 2HZCA 3IWNC 2PEHA 1VQ5S 2OTJS 1X5SA 2YH1A 1YJ9S 1UW4A 2PE8A 2N7CA 2MZTA 1WEZA 1VQMS 5LJ3Y 1SJQA 1NJIT 2AD9A 5D77A 3G4SS 2AYMA 2LEAA 2KI2A 2KVIA 4CIOA 3CCQS 2DISA 2MZJA 2LA6A 1WHXA 2MQQA 1K9MT 4WFAQ 1WHVA 2X1BA 3G6ES 1AUDA 4IOAQ 1WF0A 2QA4S 5JVHQ 1QVGR 2VODA 2M0GB 2BZ2A 2L08A
chains in the Genus database with same CATH superfamily
4ID5A 1S76D 3G8TA 5ETTA 5EGYA 2OSQA 2CUYA 1H7WA 1HD1A 3V6JA 2SXLA 2GHPA 1TUWA 2AJQA 2E7XA 4NMLA 4WE1A 3UR0A 2RT3A 4CNZA 3C19A 4Q2MA 4B9NA 1S97A 1FDNA 2V9KA 1Q81T 3DLGA 4DL2A 3L3CA 3N28A 3M2RA 1B99A 2GMJA 2R7QA 2MHNA 2MKHA 1S6QA 1N6QB 2QSWA 3EMTA 1YIJS 1BLUA 1G1XA 4K2JA 2ZZNA 2JRSA 4L76A 3R27A 3I82A 4KH0B 2J0QD 3IO1A 4XPCA 3QIDA 5F8HA 4OZ5A 4CH0S 1ZZNA 4K8RA 4JI2J 1X4FA 2KDOA 4DPYA 5K20B 2ASDA 2M52A 1HLWA 2DXDA 1ZAXA 2B9XA 5BR8J 3TX0A 3TJAA 4RL1A 2YQ0A 4J9VA 2RD5C 4I69A 1RAEB 4G65A 3VAMA 2YKNA 1RAAB 4AFFA 5HSPA 3DC2A 5CZVA 3EGNA 2F8HA 1BMQB 2Z0GA 3H20A 2X1FA 2AJFE 4JI3F 1LFWA 2XEXA 4L73A 2OD4A 2OEJA 3CW2C 2VFRA 3M7VA 4DPUA 3C14B 3ITHB 3HULA 3W2WB 3DRSA 1VQ6S 5E7OB 1D3WA 2EI5A 5HLFB 1OMSA 3THTA 3MTKA 3D3BJ 3NS5A 1XMOF 5DQGA 1U02A 1JNZB 2MQLA 2EFQA 1KNZA 4URQU 3DU6A 2PT0A 1DBDA 2AU0A 2BUNA 2ZZMA 2KZMA 1YRXA 4OYAA 4F4AA 4DL0C 2AJ4A 3CCJS 2C2RA 1MN9A 1JKHA 3RYLA 4XO0A 3BO2A 3US5A 1YJNS 1HPZB 2J6SA 3SV3A 2G0IA 3LAMA 4F8RA 4B9LA 1FNOA 1LV5A 1S1XB 1T02A 4IKAA 3GG0A 5K8PA 5DDOC 2AV5A 3NBPB 4DX8H 4L3KA 3WX8A 1ACMB 3UI3A 3MCSA 2FLOA 2C2MB 3A3PB 1FD8A 1JK9B 1FNMA 2XMVA 2ZH1A 1YJUA 3WQPA 1PYSB 1M5OC 1VRUB 5F0UA 1DARA 3GONA 5J1EB 3TANA 2W2OP 3IP0A 2BDPA 4W98A 1TK5A 3ZZ0A 2QT7A 2RUGA 2WW4A 4GKJJ 1D09B 2NPFA 5IT0A 2GJ2A 5KFDA 2B4OA 4A46A 3PJ9A 1IR1A 2W9AA 1UAWA 2H4WB 2E1PA 1S5ZA 4ZLLA 4ZITA 3I0RB 4A8QA 5KFSA 1RWNB 2M70A 1RBAA 5HVFA 3M6WA 2G13A 4AUKA 1WG1A 4CM0A 3NGDA 7FDRA 5D6GA 1RWKB 3FQKA 3L4BC 5T7LB 5ITHA 2Q1LA 4B3SF 2CPFA 2HLUA 2MEWA 1MSWD 2CYYA 2V2KA 1VJWA 1OO0B 4E2FB 4HDGA 1F3FA 2VQEF 1HYSB 4H54A 3M2VA 1B0VA 2CPDA 1JQGA 1TKZB 4ZCIA 2HHHJ 4FKXA 4WXWA 1S0NA 4M5LA 1J5EJ 4OJ1A 1JLEB 2R8JA 5KTQA 2E7WA 2UV8G 1H7XA 2I6WA 3NNCA 1LK7A 4ZS6A 1BQMA 2KYZA 4NCBA 1IBMJ 2V8DA 2ZD1A 5DG8A 3LAKA 1DJ0A 3MCOA 5L9XA 1ZM2A 1PBUA 4ZPBA 4FNIA 5E33A 3IWLA 1UVJA 3W9HA 4LSLA 2WBMA 2R8KA 5HP1A 2NSBA 2RUSA 4C8MA 4KJIA 1OPIA 3HHKA 2HG4A 4DR7J 4B3OA 3P96A 1BQMB 1KOHA 2QMUB 3GQCA 4I2QA 2E66A 4YS2A 1KN6A 5LJ3Y 3ZZOA 1SJQA 4B3MF 4NYPA 4NLXA 3FSIA 3ZC4A 5HN0A 3AQPA 3FZ2A 1RCXB 3SYZA 4CLZA 1CS4A 2V34A 1QY7A 1V6HA 4O3OA 1U1RA 1IKVB 4JOUA 1S49A 3QT5A 3ZZPA 2MSTA 2DNGA 1GTHA 4F4ZA 4I2QB 2Y0SD 5A6PA 3KLGA 3DM2A 2MKIA 5ETNA 1XR6A 3IN5A 5L8RC 3J7YI 3GFZA 3J7ZT 3T5LA 1P1LA 2EG2A 4FF1A 1FX2A 2GQQA 2DRAA 1VQ9S 2PGCA 9RUBA 5M2UA 1CQMA 3SCLE 3T1HF 1E6VA 3VGTA 2DO0A 4AL5A 3V5RA 2EKYA 4RW9A 3HHEA 4USHA 3AOBA 1FWPA 2N4CA 3NS7B 1F2HA 3RR7A 2DNZA 2V5HG 4WFNQ 2H5EA 3H5SA 1M1HA 2N82B 2ZWOA 2DY1A 4GVBA 4O4GA 1Z1ZA 1SL2A 2XG8A 3H2UB 4OV6A 2LKZA 3KKFA 4DV2J 3EJMA 4KYZA 2X3DA 3ZXWA 1KONA 4ILRA 1WC1A 4ED0A 2ZBPA 5DJBA 3ZZYA 2BJ7A 4ES2A 1SV5B 2CPJA 4NZ0A 2C3YA 2RJZA 1R8HA 4ENOA 1VFJA 1TKTA 5KFCA 1WF2A 3LF0A 4ANEA 2BE2B 3CCLS 1PGZA 2E5JA 3LO3A 2ZC4A 2G0JA 1VQOS 2GVZB 1JIHA 1U8SA 1WSVA 2MZ1A 3W2VA 4YMEA 3LALA 4PPZA 3A1YG 3ZNUA 2YNFA 4OI1A 4C97A 2OUGA 4USWA 2DNNA 3JSRA 5HAOA 3IS9A 5A0YA 1VQYA 5HO4A 2LEBA 1JJ4A 2FJVA 3EDRB 1RWMB 3OTEA 1X4DA 1RP5A 1RZMA 3T9NA 1X4CA 4ZPTR 2VFVA 2GGPB 5L9NA 4CWBA 1QSLA 1VGYA 2C2EA 2YPZA 4XDDA 4FF3A 2PO4A 1U1KA 4FBTA 1KWMA 3PNIA 3M05A 4J9NA 4X64J 1JX4A 4C8OA 2B9EA 3R7SB 3LPYA 3VTIA 2CRLA 1TL3B 1B4SA 2J7WA 5F8MA 3TI0A 3ZNJ1 1PJ6A 4NL5A 2HFSA 3GCXP 3NMRA 1VC5A 4ES3A 2M8DB 3D7SB 3HKZD 1UZHA 1BHNA 1NK5A 2NUUG 1ZPVA 3RGIA 4LF4J 4DV4F 1UW9A 3PEHA 3SCKE 4HTJA 2IJRA 3DLEA 4YB6A 2EKNA 2DTJA 1U8WA 4ZA1A 4OHYA 5HROA 3BKFA 4Y2AA 1CJVB 4ILMA 5K5MA 1OY6A 2VPXB 1BWEA 1FRLA 2FPHX 4GRSA 5IV4A 4J7CA 5F0WA 2UUAF 3FVYA 3NKYA 2FJAB 3M1VA 2HQIA 3W1YC 2FJBB 3T1YF 5HROB 1I6JA 1JJCB 1UWBB 5AE1A 3NGTA 2VPYB 3OFGA 3MUTP 2FB0A 1PKUA 5C42B 1K8AT 1AA1B 4PEOA 4CLLA 4NEZA 3FQLA 3R5BA 3ISZA 4F3OA 4E8UA 1JWWA 4IO9Q 2GCFA 4HR2A 2LCWA 5AJ3J 2B9WA 4ZK7M 3DRYA 2AEJA 1T94A 3R3TA 1BC6A 3W64A 3MMAB 4Q0BB 4B17A 4P52A 3C6TB 1Q82T 4DR3J 2MQ8A 5I42A 2P9EA 3PCOB 3CT9A 1U6ZA 2BRLA 4C11B 4LF6J 4WYWA 1VJQA 3M30A 4CLSA 2LVWA 3M8QA 4CLWA 3CJTA 1UMJA 2RRNA 4F67A 1N54B 4TXSA 2ZH2A 1SH2A 3Q24A 1MU2A 3UVJB 3SCIE 4ELUA 2CQPA 4J9UE 3QJLA 4OYMA 1TVRA 4F50A 4YR0A 2QO3A 3KLEB 1VQMS 3CD5A 4N8OA 3G4SS 1RAJA 3GIMA 3T5JA 1FESA 1N5QA 1NBEB 4LBHA 2W7AA 4C0HA 4LQ3A 3EGWB 4K0KJ 1NHUA 5J2QB 5DETA 1O51A 5GAHI 1Q53A 4PQUA 3BSCA 3UDVA 1RT1A 4UQTA 3DOMA 4ALZA 1R31A 2V94A 3FMBA 4NA2A 3G82A 2DEJA 2F5GA 3F44A 2G0CA 4FPIA 4PG7A 2U1AA 2DBBA 1K0VA 2P6SA 2XYPB 4ECWA 2YWHA 2NXCA 2IDLA 2H51B 3C8YA 4LF7J 5ADZA 4AT1B 4USVA 4DFMA 3DFEA 2I0XA 1D8ZA 2H5IB 1CSJA 3ILLA 5T14A 2YNGA 3EDQB 1NDKA 2VKZG 4N56A 1YVFA 1LXJA 4OYOA 2R7RA 5HATA 1NKEA 4ZP9A 4JV5J 3Q86A 3OV7A 1C1BB 2OPSA 2HQCA 5F8GA 2P5VA 4WIIA 5T41A 3MAHA 3OBIA 1Y00A 3OQ2A 2DNQA 3VAJA 1SUQB 2VC0A 3KLVA 3FEZA 2HZAA 5KFEA 1FDDA 4X66J 3KLHA 2RDIA 3W60A 5LSOA 2OPSB 2DPIA 2B5JA 3KHGA 3PVXA 4JV2A 2BJEA 2DGWA 3PW2A 1IM4A 3NLCA 1FTCA 4ED6A 2UUWA 3CJ0A 5DS7A 2ZJRQ 4C3KA 3B8HA 1B0PA 1UJ4A 3EWGA 1VQ8S 3BV8A 5KFZA 2W8LA 3JSMA 2XMWA 5THWA 5KFIA 5BXIA 1NPPA 2MJUA 4LF2A 3K7RA 2CQBA 1PBAA 1FFGB 3J7Z5 4K5RA 1FRMA 2EFVA 2NUHA 1MWYA 3PYFA 4U96A 5G4DA 1C0UB 2E5LJ 3TRGA 2C2OB 5EUHA 4NRTA 2IA6A 5IM0A 4QIWD 4ZOSA 3Q8YA 1XJWB 3IGNA 3HVTB 4FXDA 2RDDA 1T05B 1ZM9A 4ZPAA 2D7SA 2IRYA 3DDNA 2M88A 2OP5A 2FTRA 2LQ9A 5LMUF 3PX0A 3KDOA 4DCOB 5D0HA 2DGQA 5KT7A 4M94A 4IG0A 2CNOB 1VBXA 4DR5J 5J2PB 2VIHA 3BGUA 5HVGA 4DUYF 1GNKA 5K14A 4OQJA 1VBKA 1W25A 1RK8A 2VZ9A 3QGPA 2E5IA 4NXNJ 4F7VA 4BBYA 2OO4A 5J2NB 1KFSA 4PUOA 1KS2A 3D2WA 1X4EA 2QV6A 1CC7A 2XMUA 2QYCA 2UP1A 1ZAWA 4CO5A 2XSJB 1NH7A 5KAKA 1VBYA 2BX6A 3F56A 3NCPA 3P5BP 1FKAF 1JLBA 3U1LA 3C15B 2LA4A 1ZYQA 3MMCB 2QL5B 4W4MA 2C1EB 4YY3J 3K58A 3WIUA 3VGSA 3HM9A 4IOCQ 5LMNF 2KM8B 1VK3A 5DDQC 1RT6B 2DGOA 2HHXA 2YNIA 1LWCB 5HMWA 1N5VA 3KG1A 2WBRA 1U24A 2V8HA 2BW2A 2YNHB 2W7PA 2HMIB 4XDCA 3RBDA 4LF8F 2VG7A 1MG7A 2CZVC 3IR6B 2WONB 1TMJA 3VZHA 4ECSA 1QD1A 2HGMA 2KFNA 4V19X 4UY8T 1Q86T 1MWQA 3OJUA 3MHYA 3PDNA 2ZH6A 2W9BA 2BACA 1PIEA 3OTOF 3CSKA 4U6PA 1S4EA 4IFYB 3POTA 4DG1B 1WDTA 5D0RA 3TR5A 2HVHA 1GQEA 2CVEA 4JI0F 2OKQA 4CCHA 2ZHBA 1UVKA 4JI4J 4F0KA 3HHLB 2PE8A 1NK0A 4UOFA 2EFNA 3X1LB 3H2LA 3GZ7A 4F3QA 2IM3A 4KO0B 3QRPA 3SQOP 1URRA 3E51A 3A8JA 2Z8QA 2V4JA 2BZ2A 1FI4A 2CPXA 4LFCF 1N34F 4I1TA 3IRXA 2DB1A 4A47A 3A3NB 3BS9A 1IJFB 1S0VA 2PMHA 2HHPA 1RABB 4JI8F 1GXLA 1XN9A 3CIMA 4GKKF 2PI4A 3UN3A 2PFFB 4YUDA 4KY3A 1H3DA 4DR4F 3CCZA 3MEEA 1KQSR 2DK2A 4W90B 4NLQA 1LOUA 4MKYA 5DLFA 1I1GA 3EE3A 3BQ0A 2UXDJ 2IBOA 2ALYB 1RE1B 1VMBA 1W7WA 4ZCKA 3WC2A 4OIXA 3UWTA 3OR2B 5CABA 5IFMA 2CDRB 2E1CA 3OFEA 3MEEB 2YVSA 2F63A 2V0NA 3GR0A 4OLOA 2DGVA 1XIQA 3ZZUA 4IH7A 3NOGA 2WOMB 3OXFA 1KLMA 4KH1B 4UOCA 4X65J 3VGVA 4U7UK 4PKDB 1FK9A 2QG9B 4NLDA 1FRKA 2A10A 4HACA 2HNZB 3T6BA 4FVCA 1SQGA 1N0VC 1GMWD 3CULA 4KB7A 3C2PA 1NJYA 3U1MA 4Q2LA 1HBNB 3HZEA 4ATNA 2OPPA 5AXLA 4J37A 1PJ7A 3BQ2A 2FUG9 2KN4A 1DTTB 3TJ8A 4WTYA 1RTIB 3DDKA 3E01B 1WC4A 5HBMA 3FFIA 2J6TA 1IWGA 2VDHA 4DF4A 2YKAA 2EW9A 2VOPA 4NLSA 3MR7A 2HHUA 4MAKA 3QSIA 4ZVEA 3Q83A 1H98A 1TMMA 4OX9F 2GHWA 4DV0J 4NLUA 4A8WA 5CYJA 3H5YA 4U95A 5A8WB 1L3VA 5F8IA 2ZH9A 4RNNA 4OHVA 3U27A 4LRAA 3OXLA 1LWEA 5B0BA 3MDFA 2ZOFA 3CE8A 5FD1A 4PWUA 2J9EA 5CH7B 3FCVA 4DV7J 2CPHA 4ZLPA 3RBZA 2ZEJA 3D68A 1LWXA 2QMXA 1T03B 4PAAA 3AT1B 2CPIA 4NYZA 4B3RJ 2UUCJ 1R8CA 4URSA 1V5VA 4DSLA 4TN2A 3H0PA 4LFBJ 1MROA 2VJVA 5D8HB 2FY1A 1OSDA 1HHTP 2HHVA 1A6LA 3QPIA 5LXRA 4N7TA 4Y2KA 2L41A 2H4YB 2EVZA 2KHCA 2P2CB 1YI2S 4IRCA 3LA0A 3D66A 3MD1A 1XR7A 2QA1A 3OJSA 1F0XA 5F8NA 2NR0A 4KHPJ 1VQPS 1WF1A 1FJ7A 2HHSA 3C6UB 1S6UA 4U67Q 2R7UA 4HHJA 2UUBJ 4I67A 2M5YA 2NLWA 2U2FA 3K2YA 4CO2A 3I0SB 3R2DJ 3R2CJ 1U4BA 3BM7A 1HWLA 3R9LA 3UQSA 2FHJD 1FJGF 1X0PA 2HFVA 5KFNA 3EUNA 2DR8A 3CJ5A 3VQTA 3PW7A 1U1PA 2FGOA 1JJ2R 3GV8B 2BM1A 2DGTA 3KK1B 3D1OA 4LMZA 1VRTA 1URNA 2WVBA 5G0RB 2W4DA 3OR1A 3BZQA 1VS3A 2QLFB 1U09A 1TKXB 2E9RX 2OEMA 1U6FA 1PJ5A 4MFBB 1DZ5A 2UXBJ 3SSQA 3MAAB 3I6PA 4WTOB 3KFWX 3M6XA 5GADI 4JUZA 4OZ0A 1S0MA 4PWDA 2IAJA 2GJFA 4KHMA 2QTWA 2E7VA 4G1PA 3OL9A 4UUXA 2CNKB 2J7KA 3Q8RB 3TAMB 2IM0A 3G2XA 3R6GB 3DI6B 2JOQA 1LK5A 4A8KA 1N5SA 1SC3B 1AUDA 4I6WA 1R7IA 2D74B 5KFTA 1QVGR 4AQYF 4I7FA 4MKVA 5LM7E 3FEYB 1Y3JA 4ECZA 2B6AA 1YHQS 1XMBA 1SC6A 1FTRA 4ECUA 2DHGA 4O23A 1OSCA 2HRTA 1NKCA 4CP5A 4BCAA 1UEVA 2JSXA 2W24A 4GVLA 4ECVA 2YXLA 3T3FA 3NAIA 4I7FB 2Q43A 1A0OB 2XTJP 4RUBA 4ZPVR 4LIWA 1AZSA 4MIWA 4PXDA 4O0IA 2IY5B 2QIFA 1RTJA 2P9GA 1NK4A 1S1WB 1K44A 1LQ9A 1D9DA 1WI6A 3MEGA 2KU7A 3D67A 2G1DA 4UY85 2G2ZA 3GV7B 3D4JA 1CJKB 1NCLA 2KJVA 1KHVA 4RX6A 2CNLB 4F26A 1FDAA 4KE5A 3HZGA 3FGVA 2XY6A 3W8GA 1BWVA 2A18A 4L3NA 4N41A 3HFKA 1NHVA 3SMZA 6FDRA 1Q16B 2HQGA 5B0EA 1C1CA 4Q44A 3TZXA 2AX1A 1HA1A 1CEZA 1SH0A 5MLCV 2GV1A 3FRZA 2GQ2A 1U7LA 4WXOA 4WKRA 2CQGA 1ZTWA 2AJ1A 2LQ8A 2BQ3A 1NSKL 4WP8A 4F02A 1S48A 2RILA 3H5XA 3VAHA 4C3MA 2C3UA 1HFEL 3U7JA 1WUUA 1RKJA 4K4ZA 1NEEA 3Q89A 3HX9A 5ETRA 3LUYA 4DZDA 4YR2A 1LFPA 2LQBA 2CQ0A 2PDAA 3TJ9A 1Q4RA 2KFYA 1SC1B 4QIFA 4QPXA 1EHWA 2V68A 1YLXA 4A4JA 3HPOA 1OYDA 3UR3C 2OGUA 3VVUA 3DU5A 2I9SA 4NA3A 1HNZJ 1RI7A 5FDLA 3E8OA 4CYUB 3BGFA 5D3GA 3AJ2A 1RT7B 3NGRA 1UCNA 4IG3A 1N33F 1QUVA 1S12A 4Y6IA 3GFHA 3CUNA 1AW0A 2GIQA 2MHEA 3I96A 4IDKA 1U45A 3BGRA 3PO5A 5FDLB 3EVMA 2XBPA 2K7KA 3ZTPA 4IRDA 1O6XA 3VAFA 1IJEB 3KJVB 2MSSA 5ETQA 3BBFA 1N36F 4HL9A 4N47A 3LH2S 1HWIA 2CFXA 4IDKB 2JVRA 2PI5A 5JUMA 4P2XA 3M8WA 4EEYA 1UA1A 1FDBA 3DLJA 3PW0A 4HI1A 4H4OA 1XQIA 4NOHA 2OMOA 1NK6A 5KT6A 1ZETA 3TVKA 1CPZA 3ET6B 2IC3A 2PIIA 1JXEA 5E0OA 3CCRS 2Q6BA 2DNKA 2EFOA 3H42A 2OFGX 2DHAA 4NLTA 4R5PB 2V4QA 2JVOA 2JHEA 4UOGA 1CJTA 2GVDA 4NLVA 4HTIA 2D3O1 1XMQF 1YDLA 3DMJA 3BO3A 4ZLNA 4XPEA 1UETA 2CPYA 2E29A 2GO9A 3RBEA 3FC9A 1M1KT 3GE9A 1Q7LB 1TL5A 9ATCB 5L46A 1Y10A 4RW4B 5D78A 1RTHA 4EMDA 3OVSA 3OPKA 3U1NA 3S8SA 2MTLA 4Q7AA 4UT4A 3R8YA 5EHHA 1PILA 5EWGA 2O66A 1RCOB 2IMOA 1FFSB 3OTBA 2V8VA 2XHCA 4RW6B 3MPYA 1RTHB 1UJ6A 5KG5A 1YTYA 3UNGC 2W01A 3AY0A 4YQWA 2HQFA 3BH6B 5KFOA 5C24A 3MM5A 3ENVA 2HZCA 1I5OB 1S1UA 2XLJA 1VOMA 3MFIA 4KKOB 4AXIA 1HNXJ 4DBQA 4CIOA 5DG9A 3CCQS 1WHXA 5KFJA 4O3QA 2KB2A 2PA3A 4EFAC 1G2EA 4N76A 4XIUA 1LW0A 4RW7B 4ECQA 3A8KA 2X1GA 2LMIA 1J27A 3DN9A 4DL7A 5C2CA 1M1GA 5GAGU 2O01C 3D6FB 2GMLA 4GC6A 3H4DA 1RWOB 4FYXB 3MEDA 3O1LA 3DOKA 4U8YA 3BBCA 1QVFR 4G1QB 2W1BA 3JYTA 4RNFA 1RHKB 3TX8A 4JI6J 2XZWA 3W8PA 5E3QA 4M5GA 1S9EB 4CT8A 2FIUA 3CJKB 2BJ9A 2ILYA 3M8PA 4EO6A 3O6QA 4CT9A 1K47A 4DPWA 3AB4B 3HD2A 5IWAJ 2CJQA 4WP3A 5I3QA 4CLTA 2JFKA 3JYTB 4DDFA 1FF2A 3PX4A 1Q79A 1RUSA 4Z7YA 2ROEA 4QW9A 1HNVA 3QZ7A 1IKXA 4NXMJ 2RKIB 2IVFB 4HKQA 4RUCA 2QLBB 3MOJB 3M2UA 2HHTA 4TY8B 4YB7A 3H90A 4USMA 3JSBA 1U1LA 2BJDA 2HVDA 3MTJA 4QYRA 1HNVB 3IXQA 3BSOA 1YK9A 3G9CA 1JJHA 2BV3A 4QWAA 3QIPB 2L48A 2OPRA 2OH2A 1Z2ZA 3F0NA 3KTQA 4KTQA 2PC6A 2UXCJ 1GEHA 4FPRA 4JI2F 5FIIA 1S1VB 4X4RA 3PIPQ 5ETVA 1B3TA 1CVJA 4TQSA 4C98A 2ASLA 2BXJA 1G4CA 1WC0A 2DCUB 1YKWA 4OZLA 5HQ8A 4KGXB 1EB0A 1FE0A 1S6PB 3KK3B 5KFAA 3RW7A 4YB1P 4X4TA 1NB7A 4F0HA 2R2SA 1P8GA 3I9V9 3J81j 3LP1A 5DM7Q 2HGLA 2APOA 3OLBA 2RQMA 1L3SA 3UO0A 4KPCA 2GHVC 3PG9A 1Y7PA 2PSZA 3TZZA 5ETOA 2XULA 4QR1A 4Z2XA 1IBCB 1YWXA 4QWEA 3Q0AA 1N4LA 1R27B 2I5JB 1MMNA 1S7IA 4WF9Q 2V63A 1M5HA 3FCWA 1MMDA 1AFIA 4DV3J 4UF4A 1SJFA 5HI7A 2DVIA 3G71S 1F2GA 2DYAA 4M95A 1H2TZ 2HVEA 4NMXA 2CJBA 2D3OR 2M2BA 2HS0A 1TL1A 2CJYB 1ZOTA 3ILOA 4OI2A 1FEHA 3NMAA 4Y0FA 1QSYA 1JMTA 3D3CJ 1YRUA 4DL5A 2UVUA 4EBCA 2OPQB 1NRKA 3UNYA 4HEA9 1R43A 1VDHA 3TEHB 1KFDA 3BF4A 4F25A 1FRHA 3MPVA 3NCRA 2OHDA 4H4KA 4GKJF 1OQ3A 2MDAA 2MLYA 2J7UA 1AXQA 5D4NA 3MMBA 4DS5A 1P27B 2C42A 2DR5A 2ACYA 2YWKA 1RWPB 1FWLA 2HURA 2IYIA 2DPJA 2ALZA 1NZ8A 1IM6A 1UPMB 3CMES 2CWKA 4MTPA 2MZRA 4DV5J 2AKWB 2KZZA 1QE1B 1DLOA 3HJVA 3OW2R 2BA9A 3CJ2A 3GSIA 5BJRA 1F9HA 2HFUA 2ZDPA 2NZ4A 2VH7A 4F0MA 3M9OB 3GJRB 3GYXB 2RMLA 4PG5A 4JI7J 3R5DA 5HMYA 2UVVA 1RLDA 5KT2A 1UEUA 2PEHA 1X5SA 2YH1A 3K89A 2Q3PA 1L5UA 3WHIA 2HHHF 3QAEA 2K2PA 4LSNA 1S9GA 1J5EF 4RNMA 3W62A 1HQEA 2VPZB 5F3ZA 1N32J 1HMVA 2P9CA 4OYZA 4ZJOA 3P4UB 2CQIA 3L95X 3SDEB 4G1IA 1QM9A 3H5UA 2W2PP 1IBMF 4OYPA 3RUBL 3GJQB 3EICA 2B7BB 4V1Ak 1L3KA 1RWUA 1HQEB 2CA9A 1R89A 5CYQB 3K8WA 3QJJA 1ZZFA 1JLGB 1YRTA 3HVWA 3MM6A 1WEYA 3ENWA 4NCGA 1NUEA 5AXNA 4DR7F 1HNIB 1REVB 2BVZA 3LQVA 1F9EB 3M9MB 3H2VE 3G86A 3V4IA 4B3TJ 1HWJA 3R1HA 2VC1A 3MM7A 1WOOA 1Q1KA 2FJDB 1PCAA 1N5YA 4J91A 4I4BA 3J80Y 3EGZA 3EPIA 1HI0P 2DNYA 3LOUA 2YKMB 1EP4B 4LVOP 2AGOA 2XLKA 2EC2A 2VG6B 2PMZD 4BWMA 5KOXA 1VI7A 4NCGB 1D9FA 3PJXA 3RR8A 1JLFA 2C2ZB 2ZNYA 1RHQB 2J6UA 1VIXA 1U6BA 2QRRA 3K8VA 1OY8A 3CC7S 5H1SV 2NXEA 1S72S 3DOLB 4HLBA 4P73A 1PYOB 2R2UA 3KLIB 2HK3A 5A6WA 3PX6A 3NWRA 3JQMA 3HHNB 2BJ8A 1S57A 3N01A 4YHHJ 5DRKA 3ELHA 3I32A 5CYMB 2DH7A 1R6YA 2CJAA 4CDIA 4URGA 6AT1B 1FFWB 1NMEB 2BOAA 4ECRA 4EO8A 2JDJA 3BREA 2RF2A 2BYCA 4DV1J 1KOOA 1V3ZA 4FN5A 2B3TB 2Z57B 4LBIA 4NASA 3CC2S 1A9NB 1U0HA 1Y0HA 2EK1A 4DV2F 2MLZA 4K4VA 4DSKA 1WACA 4KV8B 3B54A 1NSQA 2ZBCA 2NREA 5D15A 1X4AA 2FHMA 3T1AA 3MAQA 5D0EA 3SSSA 1FKOA 4FNHA 2A6OA 1JLQB 5HMZA 3CVKA 2VA2A 1QTNB 3O8WA 3UN5A 4DN9A 3KG4A 1D1UA 5EWEA 3CNQP 1QAYA 2VQFJ 5H9EK 4J5OA 2ZBIA 2HNYB 2GC8A 2C3PA 1KKHA 2BM0A 1BQNB 4MK7A 2K7JA 3ZTOA 2E1AA 5CXTA 2B43A 3PHTA 1IKWB 4HYKA 4LF5J 3S7RA 2CIMA 3M8ZA 3IG1A 1IKYA 4FDFA 5K9FA 3KWMA 2HRUA 3QT7A 1SKSA 2RU9A 3R5AA 3BBBA 4QWCA 1M5VC 4ICLB 4CTAB 2M9KA 2LDIA 2JLEA 4IRKA 5CD4H 2ASYA 2ATCB 5KG6A 1T11A 3G96A 2XYHB 3ETOA 5MAOA 3IG1B 1HBUB 1IKYB 1Y4ZB 5KG7A 1LKZA 1FKPA 1XERA 3CMAS 3TA1A 2IDEA 3R97A 2W9CB 5M2PA 4RW8A 4C9DA 3RAMA 4O44B 4ID5B 1X9SA 5HMXA 4QIGA 3QLHA 1J2VA 2NSCA 1Y5IB 2XYGB 2ZKTA 4HHHA 4IR9A 2IIHA 3VAKA 4WE1B 3CDWA 2V69A 3N79A 2C2DA 1VQLS 4Y3CA 1GX6A 3DLGB 4X4QA 1PAEX 2XMKA 4F3MA 3M2RB 4K4SA 2LU1A 5LJ5Y 1VC0A 1X9MA 2V50A 2D1CA 3KYLA 1S6QB 2HYIB 2DNOA 2FZKB 2HS3A 1NB2A 3NRBA 2EFPA 3Q8UA 4ECXA 4ID8A 2POKA 4OZ3A 4FP9A 2HKEA 2EC0A 4ILLA 2AD9A 5AJ3F 1UJ5A 5B0FA 4WFAQ 4LFAJ 4ED2A 3RTVA 2DKOB 5JVHQ 1S1TA 1FVSA 2L08A 4PWWA 2C22A 3QFWA 4GO7X 1Q8LA 2KYXA 4DR3F 4EZ6A 4IR1A 1GK8A 4DU8A 1XK8A 1TL7A 3HK2A 2NYIA 2QL7B 2YKNB 4LF6F 4RKUC 5GAEI 3OUYA 4JI0J 4ZCMA 1WD6A 4HH1A 4C6AA 2OLWA 3N6MA 3QQCD 4Q43A 4DUZJ 2FDNA 2DD8S 4ZVFA 2E44A 1X7VA 1VK8A 4KPYA 4XK8C 3DRSB 2EPIA 1ZTTA 3DRRA 3DLBA 4WZMA 2VFUA 2N7YA 3A13A 3BB5A 2E5GA 3QO9A 2CAJA 4HDHA 3L09A 2AEFA 1Q8BA 2LQ5A 3MECA 3MCMA 1TV6A 1U49A 1JKHB 1YGYA 4K0KF 3DRRB 3UCGA 2XWXA 4CLPA 4EBEA 3NEKA 1T9YA 2WRMA 1MW7A 3Q8SB 4QZVB 1I51B 3PFOA 3UDEA 3DLHA 1RJJA 3IBWA 4DX7A 2F1FA 1J5OA 4TQRA 4NLYA 4LF7F 2XS5A 2HQ3A 3MGJA 2HS4A 2BJ3A 4NCAA 3NGSA 1SJ1A 4OYBA 1RTDA 3FBCA 2BBEA 4KC5A 1AROP 5FLXY 4X84A 4DEZA 2V2VA 5KFRA 4JV5F 3TQ1A 1LEOA 1NO8A 3GFXA 5KFLA 4CH7A 3HT3A 3LP0A 4ZN1A 4FBUA 2VF3A 2F4VJ 5B0CA 4C3LA 3NAHA 3J7A1 1V3SA 5A2QY 3OFHA 4M5MA 2XI3A 4DOZA 2IJNA 3NNHA 2ZKUA 3OD2A 1RHMB 4X66F 2ZH7A 2GAHC 3L7PA 2D3UA 5E41A 3DYAA 1RQ0A 1CC8A 3KK2A 1XNRJ 2OMLA 3PYEA 2R7SA 3H7HB 3I4PA 4ZIWA 2YWEA 1TUVA 2DY9A 4M5KA 2WSFC 1N52B 3M2VB 2CQCA 4OI4A 2JEJA 2C3MA 3A8EA 1HBOA 3NOCA 4USKA 4P7TA 3VWSA 2QYGA 3V6DA 4YDDB 2F8MA 2QEXS 2C2KB 4QR2A 1H38A 2FVCA 2DH9A 3DXSX 1LWFA 5KG0A 1GFWB 7FD1A 2E5LF 4BLGA 1SKRA 1RBLA 2ZD1B 5L1KA 1U0SA 1RT5A 4H4KC 4IO1A 2AF6A 2HIYA 4LSLB 2AX0A 2DNHA 5HP1B 3IM9A 4KR0B 1NLKL 3TNVA 2D69A 4DXLA 2J0WA 1IBKF 4B3OB 2AZ3A 2BANA 4MIBA 3KUHA 1RAGB 4Y28C 4F2SA 3JQJA 1S99A 4DR5F 4KFBA 2B8PA 3V4MA 2XHWA 3OSPA 2MJNA 2CJ9A 1CS4B 3HLUA 2ROPA 2CJXB 2YBVA 4WWSA 4NXNF 1PAUB 3W5ZA 1YJTA 3T19A 3KLGB 3DM2B 2YTCA 4ZPDA 3D6TB 3N9UC 3UD4P 3QGIA 3QGGA 1QUPA 3GP9A 1EETA 1WKLA 1BQXA 4LJMA 3J80U 2K06A 2IVMA 5ETSA 4I0WA 5CAAA 2XY5A 4WU3A 3AD8C 1E6VB 4RW9B 2BQUA 2BQRA 4N8NA 3JAMY 1WTFA 1X5PA 5F8LA 6FD1A 4A8MP 4DF8A 1Y11A 4PABA 2MXYA 1T8EA 2WSEC 4B08A 4YY3F 2ZC3A 1T0TV 3S01A 2OTJS 3VZIA 1VQ5S 1YJ9S 1UW4A 5CQGA 3W61A 1GTEA 2PMWA 2N7CA 1RDRA 1NPKA 4GO5X 4OI0A 4GVBB 4O4GB 2XO7A 4PYDA 3LWMA 4Q8EA 2MZJA 3KLFA 3M32A 1K9MT 2ZOMA 4IOAQ 3E3XA 1EIYB 1RKIA 3LP2A 1N88A 3MPDA 4DS4A 3DHXA 2NYHA 1HI1A 1D9AA 2HNDA 1RSCA 2HHQA 3SQGA 4DQRA 4DU7A 5F8JA 2ATLA 1TKTB 1H72C 3N5FA 1C0TA 3CJ3A 2CQ1A 4Y2MA 2ZWPA 4ZLJA 1BY9A 1UVNA 2KXFA 3MURP 1NJXA 4DV6J 4MH8A 3W2VB 3LP2B 2BE9B 4XTTA 3W66A 2YNFB 4ANCA 4CZCA 2KKHA 2RU3A 2CVIA 4J90A 3O3LA 3CD7A 3OXGA 4JI4F 2GJIA 3WIVA 3IS9B 5A0YB 1K0TA 3SSRA 3MM9A 3R1LA 3SZ2A 3BN7A 4ZVQB 3HFZB 1NH8A 1SXLA 3R5CA 4M1KA 3CD6S 2PN6A 2HBRB 2XGPA 2QA2A 2X51A 3RB0A 3NP5A 4EGLA 2Q6CA 2Q79A 1XNQJ 4TYBA 4LF9J 4ZN3A 3AH6A 5LXYA 2AP6A 2WVDA 1G6BA 1SJ3P 1WG5A 2VA3A 1JLAA 5KT5A 3CIZA 2QFIA 4KRWA 2CG8A 1KQFB 1R0BG 5GADU 2UXDF 4JB8B 3HSJA 2EXUA 2F8EX 3NGKA 4LRCA 2Q66A 1X0FA 3DLEB 1N5TA 1OQ6A 2UUTA 5F41A 1DTQA 1W2IA 2JL9A 2GMHA 3C16A 3EXYA 4JYAJ 4WFZA 4I68A 1HKAA 4P2FA 1UVMA 3MPUB 2Y0BB 2MQNA 3C66A 4X65F 2A1BA 1TP7A 3SV4A 1BUXA 1WTBA 3S1TA 3Q8VA 1PSDA 3TP2A 3M1VB 4DL6A 1WC3A 4UZCA 4R0JA 4N5SA 4UUWA 8RUCA 5E2QA 3W5XA 2ZUGA 1SH3A 1RT3A 2C28A 4B9SA 1HR0J 2FQQB 4BDPA 2GA7A 3W9IA 1N48A 2AGQA 3PHEA 1B7FA 3EX7B 3SCJE 3HD1A 4OI3A 4WU2A 2W2QP 2HAIA 4TU8A 3HVRA 2W2NP 3SBMA 3UDCA 1M5PC 5ETMA 2WAQD 4OZNA 1ZA1B 3BH7B 4IFVA 5I42B 1U1QA 3RRHA 5SUHA 1YJWS 3UW1A 2IBKA 3CWJA 1WORA 3CPWR 1M5SA 4DV0F 3WDOA 3PJWA 2MMYA 4P9SA 1SVDA 1DURA 3M30B 2VASA 3M8QB 1FX4A 5F9NA 1PG5B 2RRAA 4DQIA 1W2BR 3ZTRA 4YDXA 2NCKL 4ZDNA 3GCWP 3V2UC 1RB0A 1JLCA 1X9WA 1MU2B 3I5BA 4DV7F 3BO4A 3TZYA 2RQ4A 1IBLJ 3MM8A 1TVRB 4KT0C 5HVHA 4PZVA 3TVYA 1CJUA 2OAUA 2AT1B 2Z56B 5B0DA 1QLNA 1EX8A 3JXOA 4B3RF 2UUCF 2XS2A 4I2PA 1R3NA 4JV0A 3LGHA 3PTWA 4LFBF 3K5NA 5H9FK 2CQ2A 4F04B 4LR7A 5DG7A 1JLCB 1T3NA 1AUSL 4DSEA 4PQUB 3BR8A 1RT1B 3ZTQA 3L7UA 2WVCA 2DXEA 1HQ2A 3DOMB 4DL3A 1VQ4S 4JV1A 4OX8A 3G82B 3MCNA 5JVGQ 5I3UA 3TVZA 3PXGa 4PR6A 4KAIA 3ETMA 3QBCA 4J9LA 4GC7A 4EYIB 2HQDA 4MYUA 3T9ZA 4X4NA 4OYIA 3Q8QB 4D3GA 1RT4A 4KHPF 2CPZA 2ZE2A 1WHWA 4M5DA 2I8EA 1U1NA 2F40A 2UUBF 2YNGB 4LRFA 3AXMA 1LW2A 1VR6A 2R7XA 2QGFB 4IQMA 3CDBA 3FDSA 5I3PA 3D54A 4FS1A 3T5KA 1HARA 3GSDA 3LPEA 4S0MA 3A4TA 5KFFA 3KJQB 1WF0A 2ZE2B 1BD6A 1U2CA 3A3OB 4QIEA 3CO0P 2ZJPQ 1YBUA 2AJ2A 3TUJC 4RWXA 2NXNA 4TU7A 1TZ0A 1S10A 1YJVA 4H4MA 4LIRA 4F36A 2D9PA 3MUVP 1JXVA 3D0GE 3KLHB 2AYBA 5FLXU 2B5JB 1I94J 2UXBF 1CULA 5KFKA 5IC4B 2V9WA 3TA2A 4K5SA 4ZJLA 1WWHA 2GAGC 2LP4A 4K4TA 2YWWA 2YY3A 1H2VZ 1NDCA 2VG5A 1KSPA 5A2QU 2DNPA 3A12A 4ZVTB 4RBVA 3JSMB 5H9EJ 3GFYA 3CB4A 3BPDA 1R8PA 2DCLA 3DRPA 1SQFA 2DEIA 1HQUA 5D4OA 3TUPA 3OHBA 2QN6B 1WI8A 3IRWP 3FEXB 4LSZB 3TUZC 1ZBTA 4WK1A 4YFUA 4DQSA 1UFLA 5IM0B 4C0BA 1FJEB 3W3SA 1S0OA 1T9UA 3DRPB 1DQ9A 1HQUB 1WNEA 5BYRA 1RU2A 3K5PA 2I2YA 2CJKA 4ELVA 2QA4G 1RWVB 2RQKA 3BR9A 4B9TA 4AXJA 2NZCA 4AD6A 4JI5F 4YOEA 4M5HA 4IG0B 4RNOA 4HT5A 5IT4A 1QAXA 1FE4A 3QAUA 3RB6A 1JNRB 5K14B 4E98A 5D0GA 2LLZA 4DR1J 1N6QA 3H59A 4WYLA 4X4SA 4HI2A 3H4BA 3MEKA 4PUOB 3E2EA 3FBEA 3GWCA 1SI9A 2D9OA 4FS2A 4B9VA 2HIQA 1V9OA 2FVPA 3B4DA 3IA0A 2OSRA 1OJ4A 3K5LA 2W25A 2JJ4D 3KXDA 5J2MA 2FLNA 1JLBB 1FXDA 4WFBQ 2CKWA 2B8QA 3FJ2A 3WX4A 3A8IA 2PFDA 4K4UA 2YH0A 2BE7D 1VYAA 3UDLA 1HW8A 5HQLA 2YNIB 2L3MA 4R8UA 2J9DE 2KT3A 4IYQA 5J2MB 2RH3A 4DLEA 3C14A 3ITHA 3W2WA 2WW8A 5HLFA 5U47A 5DLGA 2MKSA 2VG7B 3LW5C 4BWJA 3WC0A 4DSFA 4C8NA 1HNZF 3NXZA 2RE1A 2IYGA 3FNNA 1TR0A 2A2CA 3JAMU 4ZP6A 2DR6A 3IAM9 2B9YA 3NY0A 4R8UB 1KP6A 3AD9C 2W9BB 1N8RT 2AYGA 5KOWA 2R4FA 3BJYA 1HPZA 3I9ZA 3POTB 4TYAA 4LRBA 3SEOA 2VV5A 1HNWJ 2BRKA 1ELOA 5AT1B 1S1XA 3R5JB 3HP6A 2ZFHA 3UD5A 3NBPA 1TFWA 3VALA 2ROGA 2F9JA 4WIQA 2CXEA 1SKUB 2HFZA 3GU0A 2KXNB 2FVQA 2F65A 4X4UA 5AE2A 2V4JB 2ZDOA 1UA0A 1MMLA 3N0VA 3IRXB 1OIAA 1TELA 1VRUA 5C25A 3D1QA 5J1EA 4K50A 4O3PA 3GIIA 5GMDA 1KC8T 2L9WA 1HBMA 1M90T 4IH5A 3FSYA 2WVEA 2UU9J 3F73A 3IM8A 4U9RA 4OI6A 1PC5A 3MI7X 3EXCX 2KHDA 3I0RA 4C2MA 4ES1A 5KFWA 3FBBA 2G2OA 5C25B 4I6AA 3EM1A 4CNYA 4QYZK 2L9DA 4K4XA 4IOBA 4ECTA 2H54B 4YN3B 3ZO7A 5T7LA 4ED4A 1HBMB 3AAWB 4EBDA 2H9ZA 5GAGI 4DSIA 2XI2A 3PKYA 5E3RA 1RA6A 1FEEA 1IR2A 5F3TA 1FXRA 1HYSA 2OELA 3FCHA 4DR2J 3W63A 1TKZA 1KLMB 4L72B 1SPBP 3CC4S 3KOAA 5CHCB 3RW6A 1JLEA 2HLTA 1FK9B 3OL6A 1R0CB 1U2RA 4HACB 4ZHRA 3O2IA 5SZTA 3G87A 2ZH4A 4ERDA 3EZOA 3SXLA 3IFEA 4DFKA 1O0PA 2YKPA 4TVAB 2OPPB 3BPSP 1KVIA 3GTYX 2AHOB 4C8KA 5ETLA 2M4MA 2A0FB 1S59A 4ZHRB 3D5MA 3LGMA 1NJWA 5C7PA 3CEDA 1HNXF 5HBMB 1X5OA 3FFIB 3TO8A 3P3DA 4DR6J 4FYVB 3H40A 1RBOB 5KG1A 2DR9A 4IH6A 5KFPA 2KG1A 3P6YC 3KDNA 3TZWA 2ZM6J 5EDWA 3CD0A 4PPDA 7AT1B 5ETPA 3HI9A 3AXKA 1IKVA 1LWEB 2G2YA 2VD3A 5E3CA 4WJBA 3KMQA 3GG1A 3I55S 2DR7A 2Y3YA 2E5HA 4I6YA 3BYPA 2NS1B 3EZ5A 3AA9A 4F2RA 1TKDA 4JI6F 2HFOA 2WK4A 1HL6A 4P75A 1MROB 1WSRA 2EEYA 2FC9A 4W92B 4DHVA 3DHWC 5ETKA 3GILA 4NLPA 3TOQA 5IWAF 3OT9A 4OV1A 2BJ1A 5KT3A 3BGLA 2W8KA 1RHJB 2RNEA 3OTDA 4CLKA 1SBRA 4OMFG 4TNOA 4EYHB 3NWGA 4Q5VA 1NHKL 4X4VA 1KTVA 3MPWA 3HMJG 1FT8A 1RHRB 2OTLS 4NXMF 4TLRA 3I5AA 1H0HB 1RU1A 2ILZA 1SV5A 5KG3A 4Y65A 2D3ZA 5GMEA 4ZMMA 2W4CA 4CO1A 2CWXA 1E6YA 2MQOA 3QMQA 1ULRA 3KG0A 2BE2A 2MQMA 2QL9B 2CADA 1OYEA 2GVZA 2WB1D 2UXCF 4B02A 1B64A 1KQGB 2ZZTA 3G6XA 2XGQA 1Y5LB 5M2RA 3QGHA 1C2PA 1VRTB 4RR5A 2ZVIA 5IS2A 1E6YB 3OR1B 1SJ4P 4ED7A 2QMWA 1VQNS 4OJHA 2V4RA 1UFWA 3Q22A 3I4HX 3ZFVA 1Q5VA 1LXNA 1IVZA 4LRDA 2J9CA 2DT9A 3MR3A 4K2XA 2GGPA 3TQEA 3HSDA 4RPFA 4O4RA 2R7VA 2L9NA 4PWDB 3G6YA 2YX4A 3IGVA 2IAJB 2JFDA 3DCAA 3BGOP 4DPOA 4DFPA 1TL3A 4UQGA 8ATCB 2JLGA 2WTFA 1TUGB 3T41A 2KO1A 3V81A 3KHRA 4JI1J 1U1OA 4X62J 2B6AB 4KGKA 1SL0A 3IC1A 1RYSA 2EFGA 1RAFB 3CDEA 3RRKA 2VDIA 4DV3F 1QTMA 1DAXA 5B0GA 2XMAA 2XSFA 1CJVA 3V81B 3VHQA 2E9TA 2J5AA 1EAYC 4YEAA 2AZ1A 2NPIA 2RHQB 1AZSB 2IPOB 4ZVOB 1C4CA 2CPEA 5L39A 1RTJB 5KFYA 4CI0B 2P8IA 3MEGB 1F60B 2F9DA 3CJ8A 1UWBA 1KVKA 4PYAA 3ZZTA 1Q5YA 4OYWA 3FRYA 3QWUA 2V8GA 4DFJA 5C42A 1NJIT 4CM2A 3MMJA 2LEAA 3BQ1A 4LF1A 1WHVA 3G6ES 2VODA 3HFVA 3GLJA 2EWHA 1T7PA 1C1CB 3MR5A 3BEGB 4FKYA 4OJ3A 3MMAA 4ANDA 4Q0BA 4CLUA 3C6TA 3RAXA 3HXMA 2DJWA 3D28A 4RUAA 2GO8A 4DV5F 2E9ZA 4C11A 3PKMA 2PEBA 4DL4A 2A3JA 5J1PA 2IA0A 4JI7F 4EWTA 3OVAA 2HWIA 3AOAA 3DXBA 4JI3J 4ZVGA 2UV8A 2FVSA 3CF5Q 1KQKA 3UVJA 2ZITA 3CDAA 2X1AA 1VQSA 4I64A 3OL8A 3KLEA 1XMOJ 4KGZB 4FYYB 1N32F 3EYZA 5D3GB 2QLJB 3G8SA 4E0DA 2V67A 2DGUA 4IG3B 2Z2ZA 1HHSA 3Q2SC 2HWHA 1UZDA 3DLKA 5J2QA 4WFXA 4AL6A 2B51A 3GPAA 1DHMA 1XEZA 2BMBA 1KRPA 3BGRB 1K1SA 4NZ6A 2BKNA 1Z2LA 1KLNA 4WZQA 1VLYA 5EX3A 5K8OA 3SFUA 3DLKB 2AEMA 5K8MA 1WEXA 4J9QA 4B3TF 2ASJA 1P9QC 1FD2A 3NGUA 1Q8IA 4DCJB 5A8RA 4ZPCA 5H9FJ 2FY8A 2RSQA 1Y3KA 2JLFA 3MR6A 2WZ1A 1SJRA 3N6LA 4F4WA 2CQDA 5A76A 2VFSA 4H4OB 1RYRA 3CJ4A 5IC6B 2IC3B 4C8ZA 1IQTA 1U2FA 2PA8D 3QATA 1C1BA 4RBTA 3KJNB 1S79A 2HBQB 3QNWB 2ZH5A 4OHZA 5A8RB 3LWLA 4DLGA 1H73A 2HVZA 5JMNA 5GAEU 3S6EA 1SUQA 2RVJA 4NZ7A 1CJTB 2GVDB 2HWTA 3UCZP 4OZ1A 4YHHF 1TAUA 2DNMA 3DMJB 2YX7A 5DGBA 3M6VA 5BYQA 1IQZA 3IWXA 3NCQA 2VPWB 4NLGA 1MN7A 2KVQE 4B3SJ 3ZZZA 3H98A 2N3OA 4CO0A 4DV1F 2DH8A 3MOZA 2VQEJ 4PXBA 3AJ1A 2Y1LB 3FSXA 2LYVA 2AQ4A 3FK4A 4ZP7A 1KHWA 1RHUB 1SIZA 2FVRA 2MZSA 1O8BA 1WC6A 1T3OA 5B0AA 3P45B 1C0UA 4MK9A 5KFUA 5E5NA 1DQ8A 3L9ZA 1W26A 1SCJB 3HHLD 5B08A 4EZ9A 3D1HA 2IHR1 2FYXA 2RDJA 2YKQA 3HVTA 1C4AA 4FXVA 1T05A 3LANA 5C24B 3MM5B 1S1UB 1S77D 2FHOB 1YG0A 2MKJA 5KFBA 5LT5A 4WBFA 2VQFF 2KXHA 5C5JA 5LSLA 3AQOA 1D0EA 4NA1A 3PV8A 5J2PA 2DITA 4B3MJ 2GS8A 3HDSA 1LW0B 3JSYA 1RAIB 4Q8FA 2RRBA 4G6VB 2IJFA 4LF5F 2ZBRA 2FZGB 4TY9A 1IBKJ 1NSPA 1F3VA 4PXCA 2R7WA 2EG1A 3DLLQ 3CCWA 5J2NA 3D6MB 4NLWA 1Q78A 4FF4A 3MEDB 3RRGA 3DOKB 4NX9A 3VGUA 1VHFA 4RJVA 1S4FA 2XSJA 4A48A 4YP3A 3TAPA 4X2BA 3R7BB 4AL7A 2LDYA 5BYSA 2K3KA 4DN0A 1TAQA 3T1HJ 4WCEQ 3C15A 3FZBA 3M8PB 3MMCA 2Z2MA 5D77A 2AYMA 3SI8A 1OPZA 2KVIA 3JQKA 4ELTA 2LA6A 2X1BA 1RT6A 4ZCLA 4XAKA 2H48B 1LWCA 2M0GB 3B6BA 1EQ0A 2QE5A 2YQ3A 3MUMP 2YNHA 2HMIA 3RJMB 2VHGA 2ERRA 1IKXB 5CCMA 2JWNA 2WONA 3M2UB 4NE9C 4LR9A 2R2RA 3R6LB 2VUGA 4Z37A 4P74A 3KMSA 2FLLA 4HH0A 3KHHA 3TWZA 5BR8F 3RBXA 1QJHA 3OLAA 3VR1A 4OHWA 4IFYA 4DG1A 2OPRB 4LR8A 2VBZA 3SFGA 2E1RA 4QU6A 3D9BA 3VAGA 3BSAA 3CCES 2VU5A 3HHLA 4LFAF 3J7YU 1ZH5A 4KO0A 2BOPA 3HO1A 4ETXA 3BYRA 2H65B 3CCUS 1Q0NA 1Q95G 3HVAA 1GX5A 4J9MA 4C8YA 1UVLA 3N6NA 4C48A 3VV2B 2UZAA 4DUZF 3RG6A 1MLAA 2LQJA 3QJPA 2ZOGA 1R0AA 4ZVPB 4TKTA 1F5BA 1H6KX 2UVWA 5JXSA 2R9LA 3RU0A 2GIRA 3BN4A 3LP1B 4P6QA 2VICA 4RNHA 4O3SA 1VQKS 3IAS9 3UFCX 2W7OA 2WSCC 1KD1T 1WDDA 1YSJA 1NZAA 3TEGA 2FGCA 1R0AB 4GMKA 1R8AA 1FJCA 5CCLA 4DV4J 4YB5A 2KFZA 3PW4A 2XMJA 4KQZA 3OR2A 3PR4A 1VCTA 4QIVA 4O3RA 2O67A 4FZVA 2IVYA 2XB2D 2KL8A 5IT9Y 1TL1B 2WOMA 3GIJA 2HHWA 4V19J 2R8HA 2UUAJ 2B56A 4RUHA 2FLPA 3JTPA 4QYZJ 3GIRA 2HNZA 1YJ7A 1KBRA 2V6AA 3T1YJ 3ZTSA 3GV5B 3R5GA 1CG2A 4N77A 3LTOA 4MIAA 1GMUA 1XC9A 3QRQA 3AB2B 3OL7A 2XWYA 1HBNA 3AA8A 3PRBA 1QAIA 2XZTB 1APSA 5DM6Q 2B4PA 4A8XA 2R3VA 1DTTA 1BGXT 2X7IA 2CZ9A 5B09A 1RTIA 2ZHAA 3FBFA 1BE4A 4QU7A 3E01A 2G1HA 2ZNZA 3MMBB 2KTQA 2JX2A 2M8HA 3UCUP 2H5JB 3NS6A 1UP1A 2F4VF 1TQLA 5DQHA 3OFFA 1X4HA 4C8LA 5EN1A 4USTA 3CJQA 3H8YA 3R7NB 4JBCA 3DDIA 5E3PA 3Q2TC 4LUBA 2HK2A 1DLOB 3O5TB 2MKKA 5A8WA 3B82A 1H2UX 1YQHA 2K3IA 5DDRC 2DXFA 4DSJA 4QQBA 4BHQA 1XNRF 2D41A 4UTGA 4P2MA 1VHIA 3V6HA 1FRXA 1WOSA 2PD1A 3J7AN 1X5TA 1CLFA 4LSNB 1S9GB 3K17A 3IBCB 1T03A 2IRXA 1CBKA 1HMVB 2ZH8A 3UN2A 3BKTA 2ADBA 4LVNP 3PIOQ 2DNLA 5EX0A 2G9OA 5AXMA 1U1MA 1FVQA 4DPTA 2CDQA 4ZIVA 4ZVHA 2BKOA 1EZZB 1PC4A 2BEFA 3KJFB 1RAOA 2ADCA 1X60A 3T6JA 4ZKAA 1NU4A 3ENAA 1KTQA 1B7YB 5CZXA 1X4BA 1P1TA 3GB0A 3MM6B 2GZOA 2DGXA 1IWAA 2RQCA 3CCMS 1HI8A 2BABA 4ECYA 1M0SA 4CLYA 1F9FA 3V4IB 3FKBA 1RWXB 4A8SA 3CDUA 3UE2A 3MM7B 3IWNC 3C6UA 5DQIA 1Y9OA 1N5YB 2J8SA 4U7UD 3JTOA 2E1MC 3I0SA 1ZM4A 1XBWA 2KI2A 3PYGA 3EPGA 1K1QA 4F4YA 3G8QA 1HHQA 1U48A 1JLFB 4P2SA 3BKUA 4OYXA 2ZUAA 4IUFA 1X8DA 3B78A 1FNXH 4R0EA 3KK1A 3C46A 1DFDA 4FVMA 3P8BB 3PRVA 5G0RA 1NK9A 2Y1IA 2ACMA 5F9LA 2J76E 4L75A 1TKXA 2MY7A 1EKSA 4PG8A 4MFBA 4Y34A 1WG4A 5A8KA 1GMWA 3MAAA 1DRZA 3OTCA 2Y1JA 5GAHU 3KNAA 2RF2B 5KFHA 1UKUA 2JC0A 4WPAA 2IM1A 1GXTA 2R42A 3RB3A 1U0HB 5RUBA 2HZVA 2XCPA 3TAMA 2DRDA 2O3DA 1YX2A 3DI6A 4AYBD 1TL4A 3DRXA 5A8KB 2F7VA 2R2TA 2QFJA 2HFNA 3PW5A 3ISND 2YKOA 4M5IA 2AGPA 1ITPA 2XNRA 1DQAA 2GX8A 2M7SA 3V6KA 1FKOB 1B0TA 3M8RA 2OIHA 3B4MA 2LXIA 4DV6F 3I31A 5L1IA 2JC1A 5IV3A 3T5HA 5LMUJ 1HW9A 3CO9A 5AXKA 1OY9A 2DHSA 4RU2A 3BDEA 2IMWP 1H74A 4X64F 1UTAA 4PCQA 4QWBA 2UVRA 1S6OA 3CTRA 1S1WA 4M5JA 1F5AA 3PR5B 4C0OC 1TTHB 4DUYJ 2AJ0A 3QRRA 1L3UA 4KSEB 2MKYA 5HJXA 1AFJA 4NLRA 1CJKA 2XCAA 2AW0A 4DQQA 1EJ7L 2KT5A 4PQAA 3OVBA 2NXJA 4JI5J 4G3IA 3D0IE 4J9KA 4LF4F 1XNQF 1EQMA 2FJEB 4LF9F 1PYTA 1OS5A 2VFTA 4F4KA 5J1NA 3J81Y 1X31C 3PRDA 2COLA 1HIYA 3HSZA 1T9TA 1R6VA 1FKPB 4PG6A 4A8OA 1NPRA 2K1RA 4FYWB 1KEKA 4RW8B 1YBTA 1M5KC 2DNRA 2KRBA 3D6HB 5LMNJ 4IQXA 4MKBA 3QLHB 1U47A 4DZ6A 2XNQA 1ZPWX 2FHJA 2MQPA 1UVIA 2YQ1A 2AWZA 5FJ4A 4P7VA 2VJUA 2MYFA 4JYAF 1S9FA 2K1RB 5DO2A 3Q23A 4LF8J 5HQMA 1UWAA 1FXLA 3H25A 1N0UA 2OFHX 4CYUA 4RZRA 4RU9A 4Y00A 5LL6d 4BS2A 1NJZA 2A2DA 2MPUA 1RT7A 4J9OA 3GMGA 2R7OA 2RB7A 4MJKA 3MWBA 5D4PA 3NG8A 2B7CB 2CQ4A 1HR0F 4UZBA 3OTOJ 3TAQA 3PM9A 2ZVSA 4U7CA 1AT1B 3P5TL 1I3OB 1VLOA 3N4WA 4CLFA 2DHXA 3TW0A 5C2GA 1Q8KA 3PEJA 5DGAA 4ED3A 2LU2A 2OI2A 1EARA 1S1TB 4J9PA 2AIRB 3JB9k 2R7TA 3KJVA 3TYTA 1JB0C 1NDPA 5IOLA 3ONQA 1Y5NB 2J9DA 1MNEA 3HKWA 4FF2A 4RWWA 1GMVA 3KUEA 4ITSA 2VOOA 4PRFA 1TL7B 2RIJA 3M8YA 4NPOA 2LXUA 3GYGA 4A8FA 3AFGA 1VC6A 3OUYB 4J9SA 2JEIA 4LFCJ 1N34J 2YX1A 3I56S 2KM8C 3MFHA 4CO3A 2MGZA 3KHLA 2RS8A 2CQHA 1SKWA 4JI8J 2FD2A 3G6VA 4GKKJ 2HBZB 2KJWA 3ET6A 4WFYA 2W4PA 5HL7Q 4MK8A 2OEKA 1IBLF 4DR4J 3C3LA 2HVIA 1XWLA 3W9JA 3U02A 4R5PA 2B0GA 2EBGA 1TFYA 3ILIA 2MGZB 3QO9B 1R8BA 3I5CA 4LQ9A 4ZP8A 1NXIA 4OX6A 2Y1RI 3L7OA 4DI6A 2Z30B 3M6UA 4QWDA 3MECB 1TV6B 1VRQC 2QA4S 1HWUA 1WELA 4F4XA 3EVWA 1V3RA 4RW4A 3PY8A 2EK6A 1IUJA 3K0JA 5HANA 1BXNA 3HHLC 3FMWA 1DY3A 4LBPA 2QSFA 1TK8A 3CMQA 2VKRA 1J5OB 2VONA 2MKCA 2CQ3A 1OWXA 1QAJA 1YZ6A 4RW6A 2JZ5A 3MR2A 4ZJQA 1RTDB 2JH3A 3NNAA 1RACB 3N5BA 1UPPA 5IT9U 5LSRA 1ROFA 1RGVA 3CJSA 4WKYA 3QYYA 1RAHB 4KBIA 2N3LA 1IN0A 4KKOA 3LP0B 4FYDA 1P9YA 1U26A 3TARA 5GVQA 1G7CB 4K7QA 3PACA 2XMMA 4OX9J 5KFQA 1N56A 4RW7A 4RO0A 4LT6A 1YZ7A 4OLPA 3I87A 2R8GA 1I94F 3CGIA 4JP8A 3DYAB 4OZ2A 4Y2CA 1NAQA 3O44A 3PYDA 4QR0A 4WK3A 3ILJA 3QT6A 5CD4A 2XZDB 3DKDA 8AT1B 1SQEA 4MT1A 2WVFA 3KK2B 5B7WA 3AOCA 5KFMA 5IXUA 5AE3A 1FRJA 1UL3A 2CG4A 3IR7B 2K8GA 3OHAA 1HBOB 4QJVA 4QBUA 3HJFA 1WKKA 3V6DB 3ULHA 4G1QA 5HK4A 2WCXA 1GAOA 3BDPA 3WZ0A 1ZM3A 4NWBA 1S9EA 1LWFB 5IZHA 1SL1A 5L1JA 3CJKA 4C4WA 2GNKA 2LXFA 1L3TA 4P72A 2FC8A 1K73T 3DGPA 2QC3A 1JXLA 4PG4A 1RT5B 2FJWA 3EVOA 5D4LA 4DWIA 3WBZA 1KVJA 3PFEA 5DZ6A 1NKBA 2KRRA 1EKRA 1UFKA 4R25A 3K59A 3RB4A 4FXWA 2BANB 4OL8A 3DGPB 4EI2A 4A8YA 2YWFA 2RKIA 3UD3P 5JJBA 4KFBB 2KH9A 4TY8A 4X4PA 1ZS6A 3THPA 2ZHOA 4Q45A 2F4FA 1YJRA 1HWKA 4NEYA 4QCLA 4DR1F 1FJGJ 3ICLA 3QIPA 4TLQA 3QWPA 2WB4A 4Y2IA 3ZZRA 2O5DA 1VIOA 2I38A 4KGVB 2QX0A 4U8VA 4DUTA 1S1VA 2DIVA 1EETB 3GIKA 3GR1A 2XY7A 5K8NA 5L38A 1F5CA 2Z4PA 3EZUA 2GQCA 2V2ZA 2YWGA 5EWFA 2H3EB 4CO4A 2HBYB 2VBYA 4ETZA 5IQ6A 1S6PA 1ZA2B 3KK3A 1XR5A 2VL1A 2J0SD 4O0NA 2LEPA 2ZBQA 2OJ3A 4M8LA 2CNNB 2JEGA 2P6TA 1RLCL 3KLFB 3M32B 4EU0A 3PZPA 4RLEA 2FZCB 1T95A 1G3OA 2ZJQQ 3M8SA 1U25A 4AQYJ 4DQPA 4B9UA 2HNDB 2DO4A 4QOTA 2J8AA 2HW3A 1LNQA 4M5NA 3SQGB 1RA7A 4DCPB 2ABYA 2I5JA 1C0TB 2YPYA 4USUA 3TA0A 2GW8A 3M4XA 4MMOA 1RWWB 4CRJA 1HNWF 5LOQA 2NQPA 2RHSB 2Z2LA 4EUVA 2R8IA 4TU9A 1YBAA 3IR5B 4DMZA 1VQ7S 4EK2A 5HJYA 3RZAA 5KFXA 3ENQA 5KFGA 4HHUA 4NI2A 2QLWA 3MM9B 2J0XA 1XTZA 3NL0A 4OHXA 3IMQJ 4Z7CA 2MZTA 4BC9A 2OPQA 1RTZA 2EBEA 3JTNA 2BW7A 1RT2A 1NNDA 4KGMA 4YR3A 1WC5A 4USIA 3HHDA 3VQSA 2XQCA 1PO6A 4LREA 1NDLA 3FUYA 2DGSA 4NLOA 4C7QA 3SIPB 4NI2B 4OZJA 2IRUA 3EGVA 3P49B 4ED5A 2UU9F 2Y9HA 1GXUA 5CA5A 1RT2B 1QSSA 4WP9A 5KFVA 4ER8A 1WOPA 1JLAB 2VBWA 4KIAA 1NK7A 5DDPC 4B9MA 2CZ4A 1QE1A 4DX6A 3VCDA 1SB6A 2LFVA 3AD7C 1DTQB 2MY8A 3W7BA 3D0HE 3THVA 3J81U 2VBXA 3C16B 4L6V3 4X4OA 2HRYA 4DR2F 2BR0A 5GMKa 1FRIA 1T9VA 1QDUB 2QLXA 3AODA 1FCAA 4UW2A 2HAFA 3MD3A 3MZIA 1NM2A 4QW8A 2LECA 2HEKA 1TK0A 1TU0B 3KNGA 1RT3B 3SDEA 1N33J 4NRUA 1HD0A 1FO1A 4K59A 2W2MP 1F6TA 1IXKA 2V2QA 2H1YA 3K5OA 3QT8A 5CYQA 2VB6A 1JLGA 5L1LA 1GT8A 2HGNA 4DPXA 4L74A 3K5MA 3AJDA 2IM2A 4OFZA 5E3AA 4DR6F 1HNIA 2ZH3A 1REVA 2F3JA 3HCXA 1N36J 4IFVB 4CH1A 1CQNA 2Y8WA 1KDNA 2Z2YB 3K57A 2M3DA 3DGVA 2ZM6F 2O1PA 4K4YA 3DNCA 4RBUA 2XO6A 2AMCB 2YKMA 1EP4A 4DJBA 2BKPA 2RS2A 2VG6A 3ADAC 1SC4B 4ZVRB 3CCVS 1MWZA 1S7HA 3BSNA 3RAQA 4CQ1A 3KUGA 3CJRA 2DHHA 2RAQA 3HF5A 3W65A 2XMTA 2I1RA 2HPUA 3GJSB 3MM8B 2MZQA 1ZAVA 2B4UA 3DOLA 5I4MA 3HT0A 2N4DA 1CJUB 1UEKA 2GIFA 3GYNA 1V5IB 3MF5A 1P6TA 3KLIA 4HVZA 4USJC 1WHYA 3QSYB 1AB8A 4I2PB 4NYOA 2A6MA 3IBFB 1VISA 1XMQJ 2MB0B 5CYMA 1FA0A 3HSGA 4J9RA 2IFXA 3TUIC 1FHTA 4M63A 3ISNC 1NSAA 5DZ7A 5I3UB 2KT2A 3M9NB 1SIWB 2XC9A 4K4WA 3CCSS 4MYTA 2B4VA 3AHPA 4OX7A 3MXHP 2V8PA 4AE5A 1FWKA 1Q7YT 4ZPWR 4QPTA 3X3UA 3QFHA 2XLIA 2HSEB 2G4BA 4P71A 3OSNA 4KV8A 1B70B 1RT4B 4M5DB 4UOHA 4ED1A 2JNJA 4P10A 3JS9A 1LW2B 3W5YA 4ZVSB 4O3NA 3UPFA 5KG2A 1T9XA 3GJTB 5KT4A 4PXEA 3F41A 1GH8A 2MLXA 5KG4A 1AYEA 1JLQA 4OJGA 2XS7A 2XM3A 2C2NA 4HT7A 3VF0B 4I56A 4D3HA 1NK8A 1RADB 2GFFA 2KG0A 1ICEB 2FJXA 1KR4A 3LGNA 3CXCR 2OD6A 2HNYA 2X3GA 1A7GE 1BQNA 5IQQA 3VVTA 1VBZA 4H4MB 4ZVUB 3VAIA 1RXOB 3CCTA 3QZ8A 2Z58B 1CULB 2QZ8A 1IKWA 1IR0A 1FERA 2JEFA 3Q8PB 2QJ3A 4KHRA 1D8YA 4ED8A 2DIUA 4MKAA 4ICLA 2FHKA 1T9WA 1WKJA 4CTAA 2VG5B 2AYEA 2C3OA 2WHOA 1YITS 1RISA 1X4GA 1REGX 4DX5A 1HBUA 1O5JA 1WEZA 1Z4UA 2Y8YA 4JI1F 4X62F 3PO4A 2DISA 2DRBA 2MQQA 2W9CA 1F1BB 1WJ9A 2NXUA 4BC7A 4O44A
chains in the Genus database with same CATH topology
3FEYB 4ID5A 1Y3JA 2YQ3A 1S76D 3G8TA 1RKIA 4ECZA 5EGYA 3MUMP 3LP2A 2OSQA 1N88A 2YNHA 4DS4A 1H7WA 2B6AA 3DHXA 2HMIA 1HD1A 3V6JA 1YHQS 2SXLA 1HI1A 1XMBA 1D9AA 2GHPA 2HNDA 2HHQA 2ERRA 1SC6A 1IKXB 2AJQA 3SQGA 2E7XA 4DQRA 5CCMA 2JWNA 2WONA 1FTRA 4ECUA 4NMLA 2DHGA 4O23A 2ATLA 1OSCA 4WE1A 5F8JA 1NKCA 3UR0A 2RT3A 1TKTB 3M2UB 4CNZA 3N5FA 4Q2MA 1C0TA 4BCAA 3CJ3A 2R2RA 1UEVA 2CQ1A 4Y2MA 2JSXA 2W24A 4ECVA 1S97A 4B9NA 1FDNA 3T3FA 1BY9A 2VUGA 2V9KA 3NAIA 4I7FB 4Z37A 1Q81T 3DLGA 1UVNA 2KXFA 4DL2A 3MURP 1NJXA 3L3CA 2Q43A 3KMSA 2FLLA 4MH8A 4HH0A 3W2VB 3LP2B 3N28A 4ZPVR 3M2RA 3KHHA 4LIWA 4MIWA 4PXDA 5BR8F 4O0IA 2GMJA 2R7QA 2MHNA 1QJHA 2YNFB 2MKHA 4CZCA 3OLAA 3VR1A 4OHWA 2KKHA 2RU3A 2CVIA 3O3LA 2QIFA 3CD7A 1S6QA 3OXGA 4IFYA 4JI4F 1RTJA 4DG1A 2P9GA 1NK4A 2OPRB 2VBZA 3SFGA 1S1WB 1LQ9A 1N6QB 1D9DA 1WI6A 2QSWA 2E1RA 2GJIA 3IS9B 4QU6A 3MEGA 5A0YB 1YIJS 2KU7A 3VAGA 1BLUA 1K0TA 3SSRA 1G1XA 3MM9A 3BSAA 3R1LA 3SZ2A 3CCES 2G1DA 3BN7A 2ZZNA 2JRSA 3HHLA 3R27A 4LFAF 3I82A 4UY85 3J7YU 2J0QD 1ZH5A 3IO1A 3GV7B 4XPCA 3QIDA 2KJVA 1KHVA 4RX6A 5F8HA 4F26A 4OZ5A 1FDAA 4KO0A 4CH0S 1NH8A 1ZZNA 1SXLA 2BOPA 4KE5A 3R5CA 3HO1A 3HZGA 3FGVA 4ETXA 2XY6A 4M1KA 3CD6S 1X4FA 2KDOA 2PN6A 2ASDA 2A18A 4L3NA 2M52A 2XGPA 3CCUS 2QA2A 4N41A 2X51A 1ZAXA 3HFKA 1NHVA 3RB0A 2B9XA 3SMZA 6FDRA 3HVAA 1Q16B 1GX5A 4J9MA 3NP5A 4EGLA 2Q6CA 4C8YA 2RD5C 5B0EA 1UVLA 2Q79A 4I69A 3N6NA 1C1CA 4Q44A 4TYBA 2UZAA 3VAMA 4DUZF 3AH6A 2YKNA 2LQJA 3QJPA 2ZOGA 2AX1A 1R0AA 5LXYA 4AFFA 1HA1A 1CEZA 1SH0A 4TKTA 3DC2A 2AP6A 5CZVA 5MLCV 1F5BA 2GV1A 1G6BA 3FRZA 1H6KX 2UVWA 2GQ2A 5JXSA 3EGNA 2R9LA 1U7LA 3RU0A 2GIRA 1SJ3P 3BN4A 3LP1B 4WXOA 2F8HA 2Z0GA 3H20A 2CQGA 2X1FA 1WG5A 2AJ1A 1ZTWA 2VA3A 2BQ3A 4WKRA 1JLAA 4F02A 5KT5A 4P6QA 2AJFE 3CIZA 4JI3F 4KRWA 1LFWA 1S48A 4RNHA 2RILA 2XEXA 3VAHA 3H5XA 4C3MA 4O3SA 1KQFB 2OD4A 1VQKS 2VFRA 2C3UA 3IAS9 1HFEL 3ITHB 5GADU 3W2WB 3U7JA 3DRSA 2UXDF 3UFCX 5E7OB 1D3WA 1VQ6S 2W7OA 1RKJA 4K4ZA 2EI5A 2WSCC 1KD1T 1YSJA 1NEEA 2F8EX 3THTA 1NZAA 5HLFB 3HX9A 3NGKA 3MTKA 2FGCA 3LUYA 1R0AB 2Q66A 3NS5A 4GMKA 1X0FA 1R8AA 1FJCA 4YR2A 1XMOF 5DQGA 3DLEB 1LFPA 2LQBA 1JNZB 2MQLA 2CQ0A 2PDAA 5CCLA 1N5TA 1Q4RA 1OQ6A 2EFQA 4YB5A 2UUTA 2KFYA 1KNZA 2KFZA 4QIFA 5F41A 4URQU 3DU6A 1DTQA 4QPXA 2PT0A 1DBDA 2AU0A 2BUNA 4A4JA 3HPOA 1W2IA 2ZZMA 2KZMA 2JL9A 3PW4A 1YRXA 3UR3C 2XMJA 3DU5A 4DL0C 2AJ4A 2I9SA 4KQZA 3OR2A 2GMHA 4NA3A 3PR4A 1RI7A 3EXYA 3CCJS 4WFZA 2C2RA 5FDLA 3E8OA 1JKHA 4I68A 4QIVA 4O3RA 1UVMA 2O67A 3BGFA 3RYLA 4XO0A 3BO2A 5D3GA 2MQNA 3C66A 4X65F 4FZVA 3AJ2A 3US5A 1RT7B 2IVYA 2XB2D 2A1BA 1TP7A 1YJNS 5IT9Y 3SV4A 1WTBA 1HPZB 3S1TA 1TL1B 2J6SA 4IG3A 3SV3A 1N33F 2WOMA 1PSDA 3GIJA 2HHWA 1QUVA 3LAMA 3TP2A 4F8RA 4Y6IA 3GFHA 4V19J 3M1VB 3CUNA 2R8HA 4DL6A 4B9LA 1AW0A 2GIQA 4R0JA 1FNOA 4N5SA 4UUWA 2MHEA 1LV5A 5E2QA 1S1XB 1T02A 2ZUGA 4IKAA 3GG0A 5K8PA 5DDOC 3I96A 2B56A 4RUHA 2AV5A 2FLPA 1SH3A 3NBPB 1RT3A 3JTPA 4DX8H 2C28A 4QYZJ 4IDKA 4B9SA 1U45A 3BGRA 2HNZA 3PO5A 5FDLB 3MCSA 2FLOA 3UI3A 4BDPA 3GV5B 2GA7A 2XBPA 1CG2A 2K7KA 4N77A 4MIAA 4IRDA 1FD8A 1N48A 3VAFA 1XC9A 1JK9B 2AGQA 3PHEA 1IJEB 3KJVB 1B7FA 2MSSA 3EX7B 3SCJE 3AB2B 3OL7A 2XWYA 1HBNA 3AA8A 3PRBA 1QAIA 1FNMA 4OI3A 1N36F 2XMVA 1APSA 4WU2A 5DM6Q 2B4PA 4HL9A 4N47A 4A8XA 2HAIA 1YJUA 2ZH1A 4TU8A 3HVRA 1M5OC 1VRUB 3LH2S 3UDCA 5F0UA 1M5PC 1HWIA 1DARA 1DTTA 1BGXT 2CFXA 2WAQD 4IDKB 2JVRA 5J1EB 3TANA 2PI5A 4OZNA 2BDPA 5B09A 5JUMA 1RTIA 2ZHAA 1TK5A 4QU7A 4IFVA 3ZZ0A 3E01A 2QT7A 2ZNZA 3MMBB 5I42B 4EEYA 2JX2A 2RUGA 1UA1A 1FDBA 2M8HA 3RRHA 5SUHA 3UCUP 1YJWS 1U1QA 3DLJA 2NPFA 3UW1A 5IT0A 2GJ2A 3NS6A 3CWJA 2IBKA 3CPWR 1UP1A 4HI1A 3PW0A 1M5SA 5KFDA 4H4OA 4DV0F 3WDOA 2F4VF 4NOHA 2B4OA 4A46A 1TQLA 2OMOA 2W9AA 5DQHA 1NK6A 1UAWA 3OFFA 5KT6A 3PJWA 1ZETA 3TVKA 1X4HA 2MMYA 4C8LA 1CPZA 5EN1A 2IC3A 1DURA 2PIIA 3M30B 3H8YA 4JBCA 2VASA 3I0RB 5E3PA 1JXEA 3M8QB 3Q2TC 4LUBA 5E0OA 3CCRS 4A8QA 2Q6BA 5F9NA 1DLOB 5KFSA 3O5TB 2M70A 2MKKA 2RRAA 5A8WA 2DNKA 4DQIA 1W2BR 3B82A 4YDXA 1H2UX 2EFOA 3M6WA 2G13A 4ZDNA 1YQHA 4AUKA 2K3IA 1WG1A 2DHAA 2OFGX 4NLTA 3V2UC 5DDRC 4R5PB 4DSJA 1JLCA 4QQBA 2V4QA 1X9WA 3NGDA 1MU2B 3I5BA 4DV7F 4BHQA 7FDRA 5D6GA 3BO4A 1XNRF 2JVOA 3FQKA 5T7LB 5ITHA 2RQ4A 2JHEA 2Q1LA 3MM8A 1TVRB 4KT0C 4B3SF 2CPFA 2D41A 2HLUA 3TVYA 4NLVA 1MSWD 4HTIA 2CYYA 2OAUA 3V6HA 1XMQF 5B0DA 2V2KA 1FRXA 1VJWA 3DMJA 3BO3A 1QLNA 1OO0B 4XPEA 1UETA 2CPYA 2E29A 4B3RF 2PD1A 4HDGA 2UUCF 2GO9A 3RBEA 1X5TA 2VQEF 2XS2A 1CLFA 1M1KT 3GE9A 1R3NA 4I2PA 4JV0A 4LSNB 1S9GB 1Q7LB 1TL5A 1HYSB 4H54A 3M2VA 1T03A 4LFBF 1B0VA 2IRXA 2CPDA 3K5NA 2CQ2A 1TKZB 1JLCB 4ZCIA 5DG7A 1T3NA 1HMVB 4WXWA 4DSEA 4RW4B 5D78A 1RTHA 2ZH8A 1S0NA 4PQUB 2ADBA 3BR8A 1JLEB 4OJ1A 2R8JA 1RT1B 4LVNP