1D8ZA

Solution structure of the first rna-binding domain (rbd1) of hu antigen c (huc)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
89
structure length
89
Chain Sequence
MDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HU ANTIGEN C
publication title NMR studies on functional structures of the AU-rich element-binding domains of Hu antigen C.
pubmed doi rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 9
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 1999-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1d8zA00
2F9JA 2MGZB 3TYTA 2VONA 2MY8A 2DNOA 3R1LA 1BY9A 2LCWA 3CMES 3VAGA 1Q86T 1ZZNA 1YI2S 1U1KA 1N54B 2LA6A 2X1GA 3CCVS 4TU9A 1WHYA 2MKKA 2JRSA 4OZ1A 1ZH5A 2NLWA 2CPFA 5JVGQ 2DNMA 4F25A 2ADBA 1OIAA 3CCRS 3UCZP 2DIVA 2DNKA 5LXYA 1WF0A 1VC6A 1N88A 2I2YA 2MMYA 2HGNA 1VBZA 3VAIA 2RUGA 2CPYA 1OPIA 2J76E 1CVJA 3G96A 2ZJPQ 3CC4S 1R8PA 3EGNA 3CPWR 1D9AA 1PO6A 2A3JA 3MOJB 5D78A 2CPDA 2E5JA 3SXLA 3NNAA 3P3DA 1JMTA 4FXVA 4RU2A 2CPEA 2JWNA 2DGXA 1QM9A 4WCEQ 2AYBA 1VQNS 1YWXA 5CA5A 2DGUA 2CQGA 2HVZA 1SJQA 2DHXA 2DNGA 2XS2A 4ERDA 5FJ4A 4W92B 4QPTA 1U1LA 1SJ4P 1M90T 1VQOS 1DBDA 3DLLQ 1Q82T 3HI9A 2MZQA 4TU8A 1FO1A 2DGVA 2VOPA 4U67Q 5LJ5Y 2J0QD 2E5HA 1HL6A 2JX2A 3VAMA 1WHVA 3D2WA 3G8SA 2XNQA 2YH0A 3S6EA 2LYVA 1VQPS 4CIOA 2M8DB 2X1FA 3CCJS 1WEXA 1NJIT 4YOEA 2M70A 3LPYA 1VQ6S 1DHMA 2F9DA 2DH9A 3VALA 2B0GA 2RNEA 2RQ4A 2MQPA 2M8HA 3RW7A 1UP1A 5DDPC 2M7SA 2DHAA 2MJNA 1YIJS 3ULHA 4PR6A 4F26A 2V94A 2CPXA 2RS2A 2YWKA 4M5DB 4CQ1A 2X1AA 1FJEB 3S01A 2CQPA 3CCSS 2MZ1A 1X4GA 1X4EA 3ZZZA 3CCMS 3Q2SC 3MDFA 5DM6Q 2CQCA 2KRBA 4Y00A 3THTA 5HO4A 3CC7S 2F3JA 2WBRA 2DNHA 2LEBA 2MQQA 1YHQS 3P49B 2LMIA 4QQBA 5CYJA 2M0GB 5IM0A 2OIHA 2HZCA 3BO3A 3EGZA 2GHPA 1KD1T 5IQQA 2DNZA 2MQNA 2DISA 1FHTA 3P5TL 2G0CA 3CC2S 1UFWA 1WTBA 1U1PA 2Q79A 3NS5A 4Y0FA 2KU7A 5BJRA 5H1SV 3EX7B 1U1QA 2MKIA 3BO2A 2CQHA 1JJHA 3UCGA 4WFNQ 2CPZA 2OTJS 4OZ0A 2DITA 2MHNA 1U6BA 3THPA 2MKSA 1VC5A 3MD1A 2RRAA 1WHWA 4TLQA 2DNRA 3LQVA 2KI2A 2NZ4A 1X5PA 5DETA 2XNRA 2UP1A 2KXHA 2OSQA 2PE8A 1RKJA 1DRZA 1U1MA 2KT5A 3K0JA 2KFYA 2N82B 1HD1A 2LECA 2RT3A 4WIIA 2KVIA 1QVGR 2M52A 3MUMP 2DNQA 1X4DA 4LJMA 4WF9Q 1WF1A 2LXIA 1U2FA 2BZ2A 3P6YC 3BS9A 1N8RT 2KHCA 3J7YU 4A8XA 2CPJA 2XS5A 2CQ1A 2N3OA 3V4MA 1M5PC 2MQOA 2DIUA 1Q81T 2EK1A 4LIRA 2U1AA 2DGSA 1VBXA 3I55S 2MSSA 3VAJA 2M88A 2MKHA 1YJ9S 2XS7A 1M5OC 3Q2TC 1WI6A 2PEHA 2RQCA 3CTRA 1U1NA 2G4BA 1D8ZA 4Z2XA 2AYEA 2LA4A 2L9WA 2ADCA 1URNA 1VQ7S 5LJ3Y 2MGZA 2KXNB 1X4AA 2GO9A 3MI7X 3G6ES 3MUVP 1WEYA 1SJ3P 5LXRA 5IM0B 1XN9A 3SDEB 3MXHP 3CUNA 2CPHA 3FEYB 1UAWA 5GAEU 1VBYA 2DGWA 4IOAQ 3NS6A 2MPUA 4WFAQ 4C7QA 1NO8A 1M1KT 1SJRA 2LKZA 3CCES 1DZ5A 2CJKA 4V19X 4UY8T 5DM7Q 1PGZA 2ZJRQ 3MURP 4WKRA 2E5IA 1X0FA 1H6KX 1H2UX 2CQBA 2LEAA 1G2EA 1FXLA 4ZKAA 1HA1A 2MQMA 2OSRA 1VQ9S 3CCLS 2DH7A 4P6QA 1WG1A 2MYFA 2D9OA 3SMZA 3S7RA 2KYXA 1A9NB 3G9CA 2AYMA 1QVFR 3G4SS 1KC8T 3MD3A 2D3OR 3I56S 3UD4P 2HGMA 3U1MA 1JJ4A 1S79A 1FNXH 2OJ3A 2U2FA 1YJWS 3TO8A 3NNHA 2M2BA 3N9UC 1JJ2R 2KN4A 2MKJA 4PRFA 5LSOA 3CCUS 1FJCA 2J8AA 1YJNS 4PKDB 2DHGA 2BOPA 2DO0A 4YUDA 1WEZA 2DNPA 5CXTA 5GADU 3R1HA 4QU6A 2EVZA 1P1TA 1WWHA 5D77A 2MJUA 5LSLA 1M5KC 2J0SD 1WHXA 4BS2A 4EGLA 2MZRA 1WG4A 1X5SA 1OO0B 1X4CA 2I38A 2D9PA 3UE2A 4UQTA 2QA4S 2CQ3A 2X1BA 1O0PA 2CQ2A 3UWTA 2RU3A 5IFMA 5EN1A 2JVRA 3NNCA 2MZTA 3PIPQ 3H2UB 4C4WA 3VAKA 2DK2A 2KM8B 2YKAA 2YH1A 3CULA 3US5A 5GAHU 2M4MA 1S72S 3B4MA 5GVQA 3VAHA 2DNNA 2FHOB 3MUTP 3JB9k 3G8TA 4W90B 2HGLA 2ERRA 2DNLA 4CH0S 1WF2A 2MZSA 1SJFA 4YB1P 1KOHA 2KH9A 3RW6A 1RK8A 2DGOA 2K3KA 1X5OA 1IQTA 2HYIB 2DNYA 1U6FA 2RRBA 1N52B 3B4DA 2DO4A 2FC8A 3H2VE 2O3DA 4QU7A 1F9FA 3IRWP 1WELA 4IOCQ 1A7GE 2M9KA 3FEXB 1B7FA 1X4FA 1VQLS 4J5OA 2MKCA 1VQ5S 2CPIA 2VOOA 2MY7A 2OTLS 4LMZA 2K8GA 2MXYA 1U1OA 3BO4A 3UD3P 2RVJA 1WG5A 1AUDA 3VF0B 1WI8A 1L3KA 5DDQC 1U1RA 5MLCV 1KOOA 1VQMS 1SXLA 2QFJA 1FJ7A 1UW4A 2CQ0A 2E5GA 2MQLA 2MSTA 2EK6A 2L08A 3R27A 4F02A 1Q7YT 3UCUP 2FC9A 3TP2A 1VC0A 1M5VC 1R8HA 5GMKa 5JVHQ 4C0OC 2AD9A 1VQ8S 1H2VZ 2KRRA 5HL7Q 2E44A 2CQIA 2LXUA 1X4HA 3S8SA 2N7CA 2AYGA 2KG1A 2DHSA 2XSFA 1ZZFA 2KG0A 2RS8A 3ZZYA 4FXWA 2ZJQQ 3VAFA 2VODA 2CQ4A 3U1LA 3CXCR 3DXBA 2L41A 2SXLA 2KXFA 3CF5Q 2YTCA 1FT8A 2CQDA 2FPHX 3L3CA 4TU7A 5GAGU 1HD0A 1NU4A 2N3LA 1W2BR 1K9MT 3NMRA 1K73T 5DDOC 3CCQS 5ITHA 2KM8C 2QEXS 2FY1A 2MZJA 3J7ZT 1H2TZ 1OWXA 2DB1A 2LQ5A 1KQSR 2JVOA 2XB2D 3PIOQ 1K8AT 2DH8A 1YITS 3G71S 1YTYA 4CH1A 4ED5A 3CD6S 3OW2R 1VQ4S 2DGTA 1X4BA 5DDRC 3CMAS 3BEGB 3IWNC 4IO9Q 3HHNB 3SDEA 1P27B 1X5TA 1VQKS 2G1DA 2DGQA 2MB0B 4IUFA 4WFBQ
chains in the Genus database with same CATH superfamily
4DV4F 1HQEB 3PXGa 5DJBA 1VK8A 2DBBA 2H65B 2LU2A 2B4PA 3LGHA 2LA6A 4NEZA 2QLWA 3VQSA 2BX6A 3IXQA 2ADBA 4PG6A 2DIVA 4N77A 4ZVSB 1VBZA 4ZCIA 3EWGA 4MFBB 1FKOB 2XMWA 1DURA 5L1IA 3KK1B 3M2VB 3EGNA 3IWXA 4NLWA 4A48A 4HTIA 2PFDA 3MEDB 3QT8A 2HVIA 3TAPA 2KKHA 1WKKA 3PJWA 4MKBA 2H48B 3T5LA 3G6XA 4RW6A 2VOPA 1VBKA 1QLNA 3HSGA 2AJ4A 4NCAA 2PMZD 1VJWA 1RT3A 4YOEA 1FK9A 2WZ1A 2YWKA 1Q16B 5KFVA 4LF4J 2HHPA 2KVQE 2GVDA 2WB4A 1F9HA 4DUZJ 4KGXB 5KG6A 3THTA 2YKMA 3F73A 2DCLA 1TU0B 3Q8RB 2GA7A 3FFIB 1FFGB 3DDNA 3TI0A 2HAIA 1TL7B 1OPZA 1RT6B 5FIIA 2A6MA 3TUPA 4IG3A 4ILRA 3VVTA 4P2FA 3MECB 3TA2A 2QA1A 2CQHA 3UCGA 1L3UA 4OZ0A 3I31A 1VDHA 2JLGA 4A8KA 2ZEJA 4FXDA 5DETA 2UP1A 3DFEA 3T6BA 3BH6B 4QYRA 2IVMA 2HK2A 2YPZA 1H72C 2ZDPA 4X62F 3R9LA 3FSXA 2LXIA 3TA1A 2ZWOA 2XTJP 3ZNUA 2CQ1A 4H4OB 2HHSA 1AA1B 4LSZB 2BJDA 5J1EA 3KNGA 1RTJA 1Q0NA 2MSSA 3JS9A 3NP5A 1YJ9S 2XS7A 4P72A 2IM2A 3RAXA 4DPXA 2ADCA 4K50A 1S6QA 3MI7X 3PY8A 5B0CA 5M2RA 2BW7A 5ADZA 1U8SA 4CI0B 4F3MA 5EX3A 4ZA1A 4L74A 1T05B 4C7QA 1M1KT 5CYQA 3PW4A 4LVNP 3MEGA 3RBEA 9RUBA 3IG1A 2AP6A 1EZZB 3QYYA 1H2UX 1GMVA 2VUGA 4ZKAA 1HA1A 2GIFA 1ZAVA 3K5LA 3PW5A 5KFMA 1IKXA 1A9NB 1JKHA 4RBTA 1XC9A 3G4SS 3QGHA 2A6OA 1GXLA 3DRXA 5KFZA 3NNHA 2M2BA 3K5MA 1JJ2R 4DV1F 2N4CA 2NXJA 2CUYA 4DFPA 4X65J 1Q78A 2CNNB 2BOPA 4DV4J 5KFIA 2O1PA 4ENOA 1JLGA 3R1HA 4ITSA 5D77A 3N01A 3W5ZA 3FQKA 3C15B 3I82A 2V2VA 2RU3A 3AD9C 4FKYA 4C4WA 2FLOA 3IS9B 1HNXF 3V6DA 4OZJA 3OR1A 2ZVSA 4LF2A 5EGYA 2VPXB 2GV1A 1FF2A 3BSCA 1RU1A 4L75A 4PXEA 2BM1A 4DOZA 3MR2A 5B0AA 4HL9A 1SL0A 1GX5A 4NLQA 4LMZA 3W65A 2RJZA 3OXFA 4FVCA 1RLCL 1T9XA 5H9EJ 2KFNA 3UCUP 1X8DA 1RT7B 2JEJA 4ZVOB 1M5VC 2AD9A 3U7JA 2KRRA 2WHOA 2IA6A 1TKTA 4NL5A 1S0MA 2KG0A 4PG8A 4FKXA 3AJ2A 4WK1A 1LQ9A 1P9YA 3PYGA 5KG4A 2VG5B 3EXCX 1Y5IB 1I6JA 2OEJA 2M5YA 4I4BA 4M1KA 4U95A 2M3DA 3KLHA 1U0HA 2RB7A 4DV5F 5KFDA 2HHWA 2B5JA 1K8AT 2RKIA 4AUKA 1S1XA 4CH1A 3DOMB 3QO9A 2YNIB 5HJYA 4WBFA 1Z2LA 3TYTA 3P4UB 5ETNA 2FZKB 2UU9F 5IXUA 2F5GA 5CD4A 4X62J 1NSPA 2WK4A 4DX7A 2HPUA 4PUOA 2D41A 5K14B 4KBIA 1AUSL 1AZSA 4ZPTR 2VA3A 1QSLA 5B0EA 4QCLA 3LW5C 2V67A 2H5JB 3MM5B 2B9WA 3HHDA 2NREA 4FYWB 2AYBA 3X1LB 3PO5A 2CQGA 2VV5A 3M8RA 1BD6A 1SUQA 1T03A 1Q5VA 4JI0F 2JEIA 1RE1B 5FJ4A 2VIHA 3VGUA 1BQNB 4ZPAA 4OV1A 3VZIA 4JI1J 4PYDA 4PCQA 4F67A 4URQU 2XMAA 1UEVA 3ENAA 4CP5A 3CO9A 5LMUF 3VALA 4ZOSA 3VGTA 4KE5A 2CJQA 2IAJA 1H0HB 3DHXA 2MJNA 3MEEB 1S4EA 1U7LA 4P10A 1AXQA 4DV1J 4JI5F 2CPXA 4WFYA 2CQPA 2MZ1A 2F4VF 2R7TA 3CCMS 4OFZA 5HBMB 1RWKB 1P6TA 2CQCA 8AT1B 4DXLA 4Q45A 3HZEA 1VFJA 4K7QA 4I2QA 1NK9A 1TP7A 3IN5A 2QFIA 1QSSA 4I6YA 4B9LA 3EGZA 5F41A 1NSQA 1G4CA 4ECRA 1IR0A 2MLZA 1NDLA 3SCJE 1NJYA 4CLYA 1HNXJ 4OZ2A 2VFSA 3K89A 2DITA 4TQSA 1IXKA 1UVLA 4ZPCA 1DRZA 1B4SA 1K0TA 2F1FA 4RW8A 2M52A 1MMDA 4ILMA 2DNQA 1LEOA 3K8WA 2BZ2A 3UD5A 3I5BA 3GZ7A 5FD1A 1S1WB 1Q5YA 1FCAA 4XK8C 3R5JB 4XPCA 1TL3B 1ZTTA 2QLBB 3HF5A 1TMMA 1S99A 3I55S 1QAXA 2PFFB 5AT1B 2G13A 3VVUA 5HSPA 2YY3A 4M8LA 1NPRA 1R7IA 3VQTA 3HKWA 3ZZRA 3MM9A 3W3SA 2ZH5A 3SDEB 1DLOA 3UVJA 3MPUB 4OI0A 2DGWA 1HWJA 2BM0A 3K5NA 3BGFA 3PX6A 4DR4F 3BPDA 4CWBA 2CZVC 4IFVA 3Q8PB 2MQMA 4E8UA 2YKQA 2AU0A 5KT4A 3AD7C 4NLUA 3ETMA 4DV5J 3OFGA 5GAHI 1Y4ZB 3SIPB 1S9FA 3CCTA 4PXDA 3CCUS 4AL7A 3SQGB 1R3NA 1KLNA 1FD8A 3MHYA 1TV6B 1S0NA 3ZZ0A 5GADU 2UU9J 3O3LA 1T95A 3KFWX 2D1CA 3T6JA 2I38A 4UQTA 2CQ2A 4Y6IA 5IFMA 4WTOB 1P9QC 5E3AA 1S1UA 3GQCA 4TVAB 4ED1A 4QWEA 4NMLA 4K4YA 3PZPA 4JI8F 2N4DA 3HHLA 3G8TA 4GRSA 3H4DA 1ITPA 2XHCA 2HYIB 1U6FA 3GJRB 2WTFA 4C48A 1WSRA 4NLPA 1T9TA 3D67A 1E6VA 3MCMA 5ETMA 1CLFA 4W4MA 4LRBA 1Y00A 2GW8A 3HSDA 3BQ2A 1ZA1B 3C3LA 4ED7A 3G6YA 1RCXB 3B78A 2LDIA 4DPUA 1MMLA 2EBGA 3TOQA 3ITHA 4RNMA 4NRUA 4YEAA 3M9OB 4X4VA 2N7CA 1OSCA 2WSEC 3VV2B 1CULA 4YB7A 2F4VJ 4CO4A 4WZQA 3H0PA 4LT6A 5F3TA 2Z30B 2C42A 3LGNA 3EJMA 1UWBA 2Q43A 2K1RA 1NK5A 3GSIA 3M7VA 3M30A 2FY1A 2AGOA 1KQSR 4DG1A 1CEZA 2O5DA 4IO9Q 4ZHRA 1VQKS 4DR3F 3DN9A 1PKUA 2H51B 3VAGA 2ASLA 4LSLA 1F3VA 4RUCA 4OZ1A 2ZZNA 2B7CB 3J7Z5 2KFZA 3M2RB 1UW9A 5I4MA 1N88A 4DQRA 3IMQJ 2NYIA 3DRRB 2XC9A 4R0JA 3D0IE 1FRMA 1R8PA 3GLJA 3H90A 1PO6A 3H20A 5F9LA 1X9WA 4O0IA 1NXIA 1NJZA 4IDKB 3RRGA 4F4WA 3ZZPA 1ZM3A 4LF7F 3EICA 3PKMA 4DR4J 1W2IA 3SBMA 2EKNA 4I0WA 3TARA 1GMUA 3ZZOA 3EVOA 4LFCF 2W25A 1NH7A 1SPBP 2IA0A 4Q0BB 1K0VA 4Z7YA 1X4GA 4TYAA 3KHLA 3CJKA 1Y3KA 2ZNZA 4Y00A 1F1BB 2VH7A 4P75A 5HMWA 1FWLA 5D0HA 4RPFA 3GYGA 4DSFA 2CJYB 3H5XA 1WORA 1KD1T 1LV5A 3H42A 2DISA 2RSQA 4WFXA 5FDLA 2XY7A 1U1QA 3O1LA 2RF2A 4RW4B 5CYMB 1PIEA 4UT4A 2FTRA 3QZ7A 1CJTA 4JI8J 3FMBA 3HCXA 3MD1A 5KFFA 4F4YA 4TLQA 5EX0A 1NMEB 2EFGA 1DY3A 2DYAA 2YWGA 2GJFA 1JLQA 2NR0A 4WIQA 2L3MA 5DQHA 1RT3B 2V8DA 3QWPA 1NPPA 4DHVA 3TANA 1CC8A 5A6WA 4LFAJ 4CT8A 3VCDA 2C28A 1P8GA 3PYDA 3TEHB 1TUGB 4A8MP 3OVBA 2WOMB 1LFPA 5E3QA 1RTHA 3HHKA 1WI6A 1FKPA 1ZA2B 2YKMB 4KO0B 2O01C 3QT6A 3PCOB 1WOSA 4LSNA 1RHJB 1SVDA 4JI3J 1JJCB 1X60A 1X9SA 4WJBA 1HYSB 1LWXA 1MSWD 4DR1J 5I3UB 4B3MF 4LBHA 4ANDA 1GTEA 4KT0C 1LNQA 1R0CB 3UD4P 2HGMA 1D09B 4RBVA 4LF1A 2V8PA 2I1RA 2YKNB 4U8VA 2DHHA 3KLFA 5LSOA 4DF8A 2VD3A 4K4XA 5K8PA 3W62A 3RG6A 5A2QU 5L46A 1LW2A 3PHEA 2G0IA 2ZWPA 3KYLA 4OMFG 3P96A 1ICEB 3OL9A 4F0HA 2DR8A 3NCPA 3ZTRA 3DCAA 2G2YA 1S9GA 2KM8B 1UVJA 2HBQB 1NDPA 3CULA 2NUUG 4K2JA 2ATCB 3L09A 1RISA 3T19A 3L7OA 2IDEA 4M5GA 1OQ3A 3HJVA 2VPYB 4QU7A 5HROA 1A7GE 5F8MA 1NRKA 1U0SA 1RT2B 1F6TA 2MKCA 1U1OA 5DDQC 3UN5A 2CNOB 2DPIA 4CTAA 3C19A 1KQKA 2CQ0A 1GMWD 2FHJA 3TJ8A 3W1YC 5F8LA 3JSBA 2HRYA 1B0VA 1FWPA 4LFCJ 1RB0A 5GMKa 4HDGA 5SUHA 2N7YA 2W8LA 3Q8SB 4HHJA 2IM0A 4J37A 3VAFA 3PW2A 3U1LA 4O4GA 1TQLA 1FDNA 2V4JA 2KXFA 4EI2A 2QYGA 2XY5A 2NXNA 2YTCA 1HPZA 3V6DB 2FPHX 3KDNA 4MTPA 1NU4A 3NMRA 2X3DA 4YDXA 4JI6F 4N5SA 2KM8C 2NXUA 1RYRA 2IRYA 4IR9A 4GKKJ 3J80U 2HRTA 3G71S 1S59A 4TQRA 1FRLA 1QAJA 5KFAA 2DGQA 3CCWA 4P74A 4WFBQ 2I0XA 4HEA9 2VONA 2DNOA 3J81U 3RRKA 2WB1D 3AOCA 3Q83A 1ZH5A 3CJ8A 2ZH7A 5LXYA 4I69A 3BM7A 2J76E 3GFZA 3G96A 1IJEB 1IBLF 3OSNA 2CJBA 4EO6A 1RADB 2W2MP 1EARA 3PEHA 2W2PP 5HAOA 3AODA 2CPDA 3P3DA 4RLEA 2YNHB 1C1BB 4J9SA 4GC6A 4HTJA 3MAQA 5L38A 4ZK7M 2J9DE 2HNZA 4NCGA 3MR7A 1RZMA 3M8QA 2EBEA 1IKWB 4CZCA 3KK2B 4G1QA 5LJ5Y 2ZZTA 2B7BB 1AFIA 2FJBB 3QO9B 3KJVA 2YH0A 2PSZA 1H7XA 1ELOA 3IM9A 2HVEA 1IJFB 4KJIA 2WONB 4MKYA 3WBZA 4KRWA 1FWKA 3QATA 1TKZA 1KLMA 1B3TA 1RKIA 4DL0C 3CCSS 4WXWA 2VKRA 2H4WB 3TUZC 5KFWA 5DM6Q 4I2PA 2FD2A 2PI4A 5HO4A 1HQUA 4PQAA 3M9MB 3IWLA 1HR0F 2M0GB 4USIA 5KT7A 3J7YI 4E98A 2UUCJ 2K7JA 2G0CA 3DLKB 6FDRA 2KU7A 5GMDA 2HHXA 3D1OA 2O67A 3THPA 1VS3A 3RR8A 1TK5A 1OY8A 1WHWA 2HMIA 3EZOA 3QJJA 5ETRA 1VCTA 4NI2A 5HP1B 3QGPA 2AJ1A 2NUHA 3L7UA 4H4KA 1RHRB 2GIQA 3PV8A 2J9EA 1N8RT 4EO8A 4A8XA 3HVWA 5HLFA 1Z1ZA 3PFEA 1VBXA 5J2NB 4P2MA 2VFUA 1SC3B 2FDNA 1K1QA 1ZETA 5LJ3Y 4HKQA 4NCBA 1WC3A 2COLA 2CPHA 4X4PA 1VBYA 1UWAA 2W1BA 1CJKA 3H98A 2CKWA 1G7CB 2BQ3A 3O44A 4FNIA 4ICLB 3DOLA 2D9OA 3QIPB 3R5BA 3AJ1A 3GU0A 2KYXA 3QSIA 5KFXA 4QR1A 1FNXH 5E3PA 4O44B 1FNOA 5A2QY 1CBKA 1LXJA 4FYVB 4DMZA 3E8OA 1YJNS 4PKDB 3KLIB 5JJBA 3DXSX 2FZGB 4MT1A 1JK9B 3C16B 1A6LA 4GKJJ 2D3ZA 1V6HA 1S4FA 4BS2A 2NXEA 3GFHA 2BBEA 1E6YB 3TQ1A 2P2CB 3GG0A 3MPYA 2MZTA 1JNRB 3WC0A 5J2PB 3PIPQ 2WSFC 2M4MA 2JNJA 3B4MA 4QIFA 1AYEA 5LM7E 2B9YA 3VTIA 2V0NA 4ZLLA 5KFRA 2B9EA 8ATCB 3T5HA 2GFFA 1QE1B 4QW9A 4M5HA 4WE1B 1RHQB 1OQ6A 1MU2A 4HH0A 4ZIVA 1BC6A 4OHYA 4OJGA 4BC9A 1VMBA 1SC1B 1RUSA 1KQFB 2CPIA 4NLTA 2IMOA 2LDYA 3T5JA 2FJVA 1N6QB 3H5YA 2HFVA 1WOOA 4ZPWR 3I6PA 4K4TA 3HMJG 2A0FB 4G6VB 3I0SA 1JLEB 3UR0A 3V4IA 3N6MA 4L3NA 2CQIA 2LXUA 3PYEA 2YX4A 1N48A 3EUNA 3W2WB 2VPZB 4X4QA 4ZVGA 3LWMA 2NSCA 2QC3A 3R5AA 2KT3A 1HBNA 2E66A 1HR0J 2VQFF 2XHWA 1PYSB 3J80Y 3X3UA 2N3LA 3SSQA 3IRXB 3IO1A 1TR0A 1TAUA 5B0DA 3C14A 4QBUA 3NBPB 3TAMA 1VIXA 3EPGA 1E6VB 1RGVA 3NLCA 3R6LB 2DKOB 3QJPA 5T14A 3DGVA 1VLYA 1NKCA 1BY9A 2FY8A 1Q86T 2BEFA 1YI2S 2C3UA 4ZJOA 4BWMA 3OR2B 2AEMA 1U09A 4F25A 1YKWA 1G1XA 3DDIA 3UN3A 1F5AA 3R5CA 2CPYA 1CULB 4L73A 1LK7A 1MN7A 2ZJPQ 1IBMF 2MLXA 4NXMJ 1IVZA 3SXLA 4C97A 4DBQA 3U1NA 4OZLA 3MGJA 5HQ8A 5GAGI 3CJSA 2K7KA 6FD1A 3JTNA 1NHUA 2Z2LA 8RUCA 3JYTA 5A8RA 1T9WA 3M30B 2XGQA 2V9WA 3I0RB 2FJAB 4C0BA 2C2OB 1W7WA 4HT5A 2J6UA 3VAMA 1IWAA 5CZVA 1VRUB 3CJTA 5HQMA 3PX4A 3OTOJ 4I1TA 1XNRF 3PTWA 1QTNB 4EYIB 2HLUA 2RNEA 5J2QA 2Z58B 3HFKA 1TUWA 3MMAB 3DYAA 2J6SA 5F8GA 2J9DA 4RNNA 3ZZZA 4IKAA 1M5SA 3HM9A 2XMVA 5D4NA 2R8HA 3Q2SC 4Y2CA 3H5UA 1RJJA 4DL3A 1JLBA 2XWYA 3WZ0A 1AFJA 2QIFA 4CCHA 4ZLNA 2DNZA 1QDUB 2MQNA 1RWUA 3TX8A 2DXEA 5H1SV 3OHAA 1KFDA 4LUBA 4UUXA 4LF9J 1TL4A 3LQVA 3MEKA 1X5PA 3UFCX 5IT0A 2KT5A 2VB6A 1IWGA 1EP4A 2XO6A 1FE4A 3J81j 1RT5A 3QLHA 4DFKA 3O2IA 1WF1A 4CLTA 3P6YC 1Q8BA 2ZHAA 2CPJA 3GE9A 4F3QA 4LREA 1VK3A 3GJSB 4LIRA 4JI2F 5D4PA 2DGSA 3JXOA 4IG0B 2MKHA 3G2XA 2R8GA 3KLEB 2KO1A 4RL1A 4HT7A 1PYTA 2GHWA 2C22A 3FVYA 2ZH1A 1HQEA 1YZ7A 4YY3F 3G6ES 3MUVP 3OLAA 2WVFA 1FA0A 4KFBB 3BJYA 4IOAQ 4DX8H 1S77D 2XLKA 2HHQA 1FVQA 3KK3A 1NM2A 4ANCA 2VQFJ 2C2RA 3MURP 4MFBA 1FKOA 1CJTB 2J9CA 1X0FA 1MWQA 1KVJA 3KK1A 3QMQA 4QWCA 1JLQB 1QVFR 4J7CA 3FJ2A 2NXCA 2WVEA 2VJUA 4UY85 3NGTA 4N76A 2DO0A 2F65A 3LAMA 1J2VA 1WEZA 5LT5A 4JOUA 1SIWB 2QMXA 4EGLA 2MZRA 3D1QA 2HIQA 3DLEA 1FKPB 2QA4S 1JB0C 2X1BA 2OPSB 3QRRA 4ANEA 1N36J 1TL5A 1IBMJ 4C6AA 1XMQF 2ERRA 1AB8A 3PKYA 2OPPA 3D66A 3UDVA 2GS8A 1TKXA 3A3NB 1JQGA 4LFBJ 2BXJA 2D3UA 2HQFA 5CCMA 1TVRB 3FBCA 1TL7A 1RT6A 1WG5A 1ACMB 2E1MC 1X31C 1RABB 2BKNA 4M94A 3MECA 3D54A 2G0JA 4EEYA 3LP0B 2GC8A 4QWBA 4MAKA 3R27A 1XNRJ 4DQIA 2HLTA 1RT1A 2Q1LA 2IVYA 1X9MA 1VQ8S 4PABA 2ZD1B 4N47A 1SKRA 2RMLA 3ZZYA 4RUBA 2CNKB 4TKTA 1PBUA 2R42A 1ZS6A 2QE5A 2CQDA 2CA9A 5GAGU 4Z37A 2QV6A 2XMUA 3GIKA 2DRAA 5KFYA 3CCQS 2C2KB 2LQ5A 4CRJA 3PIOQ 4DR7J 3KOAA 3BGLA 4AXIA 3CD6S 3DC2A 2Z2ZA 2AQ4A 1S1VB 1LW0B 3M1VB 2XGPA 3OPKA 2WW8A 4CLUA 3ET6B 2LCWA 1FJGF 1N54B 2X1GA 1WHYA 1HHSA 5AJ3J 3G8QA 2CWKA 4OQJA 1HW9A 2HWTA 3LP2A 3HSZA 2HIYA 4ZN1A 4JI2J 3QPIA 3NGUA 3CC4S 3W7BA 4O23A 4O4GB 2EPIA 2RDJA 2V4JB 1VQYA 3MFIA 1NK0A 3M6UA 1N32J 4YY3J 1HPZB 4ZVHA 4YB6A 4YHHF 3RZAA 1Y7PA 2F8MA 1XIQA 5IOLA 3C15A 5T7LB 4J9KA 2C2DA 1DBDA 1JLCB 4LF5F 3SV4A 3ZFVA 1WHVA 5GMEA 3HD2A 2XNQA 1RXOB 2M70A 4UUWA 2B0GA 1C0UB 3R5DA 4K4WA 1YIJS 4OYPA 4PR6A 1SKWA 4M5DB 2R9LA 1FJEB 5E7OB 4YP3A 3N5BA 4ZPDA 1U4BA 1WSVA 1T11A 4LBIA 1FRKA 2W8KA 1XQIA 3NS7B 3MR3A 2WCXA 1DTTB 1RT7A 5U47A 2RU9A 1WTBA 2Q79A 4K4UA 4QYZK 3FCWA 3EX7B 2Z0GA 2NZCA 2ZHOA 3PACA 2HFZA 1HBMB 4WFNQ 4F0KA 2OTJS 4DQQA 2UUTA 1XMQJ 2HNZB 2DR6A 4NCGB 2HNYB 5DZ7A 3DLGA 2DNRA 1RYSA 2XNRA 2VG5A 4F4AA 2AEJA 5L1KA 2C3YA 2F40A 3A8EA 3K58A 2FUG9 2XI2A 2WAQD 3HVTB 4GC7A 2RHQB 1GX6A 2N3OA 4B9NA 2MQOA 4ER8A 5KFBA 1NNDA 1KLMB 1O6XA 2EK1A 1F5BA 3CJ3A 2VA2A 3DOMA 5B7WA 4ILLA 1BMQB 2IIHA 3Q2TC 2RQCA 2YNIA 4U9RA 1LK5A 4DCPB 2YQ1A 4NLGA 3GPAA 1SJ3P 4H4MB 2HVDA 2LKZA 2E5LF 4OX7A 3JTPA 2CJXB 4Z7CA 1T3OA 4M5KA 5K14A 5KOWA 1KBRA 5KFOA 4WYLA 2OUGA 2LEAA 1UVNA 2HMIB 4JV5F 3IA0A 4NI2B 4MK9A 3MM5A 2L48A 3OV7A 3BV8A 2Q3PA 3IBCB 1S79A 9ATCB 1DQ8A 2ZC4A 1TFYA 4P2SA 1S1TB 3AXKA 3TW0A 4F50A 4P52A 1KS2A 3NCQA 4J9VA 1L3VA 2GVZB 1R27B 2DNPA 3HP6A 1FJGJ 4ZJLA 3NL0A 1WWHA 3NGRA 2UVWA 1RAJA 1WG4A 4P71A 1G3OA 4D3GA 2R7QA 3UWTA 2EXUA 1KNZA 3QBCA 3NNCA 4CNYA 2W2QP 2VFRA 3N28A 1GQEA 3MEEA 4FVMA 4MKAA 3Q89A 2NS1B 5HBMA 1REVA 2YNFB 1SJ1A 2DGOA 5IV4A 2BJ7A 4YHHJ 1XBWA 2FC8A 2O3DA 3IRWP 2GIRA 1NSAA 1RTIB 1DQ9A 2OTLS 4LF5J 3TQEA 2UZAA 1XNQF 1AT1B 2OFHX 1OJ4A 2RHSB 2E5GA 3W66A 2UXDF 3C6TA 5EDWA 2AGPA 1LWCB 1Q7YT 5FLXY 2XY6A 1FRJA 2E9TA 3M6XA 2LQJA 3IBFB 1RWNB 4PPZA 1TKDA 4LRAA 4WP9A 1HNIB 3DRPB 2E44A 2R7VA 3GV7B 3CDEA 2AEFA 2RIJA 2FVRA 1TK8A 2RUSA 3FCHA 3RB4A 1D3WA 3PDNA 4ZVFA 3CIZA 4PG7A 1S1WA 2PA3A 2P6SA 4IRDA 1TL3A 4R8UB 2OPRB 4JUZA 1R6VA 4KTQA 1IN0A 3DU6A 5ITHA 3BYPA 4OYOA 1M1GA 2NPIA 1MU2B 2DEJA 2PI5A 5HK4A 3KDOA 2E1PA 3SDEA 1P27B 1X5TA 1RAAB 5DO2A 4RWXA 2HBRB 2R3VA 3CW2C 5EHHA 1S10A 3NCRA 2XYHB 4OI6A 3BGUA 4GO5X 2ASDA 1BXNA 4JB8B 2JFKA 3O8WA 4B3RF 5BXIA 4KV8B 2G2ZA 2VKZG 3FRYA 3UDEA 4ZVPB 4USHA 4C8LA 3KLVA 3LAKA 1I94J 4ATNA 3SQGA 3TA0A 5KFTA 2ZUAA 1TV6A 2HURA 4OHVA 2JWNA 4Y2MA 1FDDA 1UJ5A 2G1HA 2XYGB 2AIRB 2RILA 2B4VA 3HLUA 4FBUA 3AY0A 2W9BA 4ERDA 1U1LA 2E5LJ 1VQOS 3DOKA 3DLLQ 3CO0P 3KXDA 4YB5A 1PCAA 2HG4A 1FFSB 1S48A 1QSYA 4JV5J 3JSRA 1S0VA 3AFGA 2X1FA 5C42B 1Q4RA 2ZOFA 1N56A 3RW7A 1IR2A 4BDPA 3MF5A 4UW2A 2QL5B 4DFMA 2RS2A 3S01A 1UPMB 2WVBA 1X4EA 4BHQA 1UEKA 4OYAA 4C3MA 3FDSA 4ETZA 2DT9A 4P9SA 3QZ8A 2AGQA 4DX5A 1SH0A 4OJ3A 2VFVA 3DGPA 4DL2A 1FI4A 4KHRA 3E2EA 3QGIA 4WFZA 1DQAA 1CJUB 2AT1B 2V63A 3EDRB 3BGRB 3I4PA 4KHPJ 4MIAA 1U49A 1ZM4A 2JLFA 1C4AA 4LF8J 3LOUA 3GIJA 4ZPVR 3KG4A 1HBUB 3BKFA 5JUMA 4Y2IA 3ILOA 4DR2F 2AHOB 2WSCC 2AV5A 2LECA 4OHWA 1QVGR 2QTWA 2VPWB 4AL6A 1X4DA 2QSWA 1U2FA 2HK3A 5C2CA 1UMJA 1XNQJ 2JL9A 2YNGB 3HHEA 1S9EB 3CD7A 2DY9A 5LSRA 3JQKA 1O51A 2D74B 2YWFA 2YQ3A 3RBDA 2G4BA 2XZDB 3C8YA 4IO1A 4KB7A 4W98A 5KFEA 2HFUA 3MAAA 2BJ1A 3KTQA 1U2RA 3M2RA 4OJ1A 1PG5B 4USWA 4X4UA 2PEBA 4V19X 1PGZA 3DRRA 1PYOB 2ZH2A 1Y3JA 2WVCA 5C25B 4C8KA 4HR2A 3GTYX 3TX0A 4J9OA 1JXLA 4IDKA 4HYKA 4GVLA 2V8GA 5SZTA 1FJCA 2GQ2A 2HEKA 4ED2A 1D8YA 2B51A 1F60B 3MM7B 1OYEA 2W01A 4Q43A 4EMDA 4B3RJ 1V9OA 3RBZA 4N56A 2CQ3A 1C2PA 4ZDNA 4DCJB 4NYOA 4DPYA 4CDIA 1KVKA 3US5A 1SL2A 4O3RA 1N5QA 2FZCB 4Q0BA 4NOHA 3KK3B 3SV3A 2VZ9A 3RW6A 4AT1B 4GVBA 5G0RB 3VZHA 3KUHA 1B7FA 3NY0A 3D5MA 3PJXA 1HI8A 4IOBA 1HBOB 2EKYA 1B99A 3PRDA 4U8YA 5ETTA 3TUIC 3H25A 3BKTA 3GR0A 4RW4A 5CYMA 1CPZA 4X4OA 2BUNA 3TP2A 4QIGA 2VFTA 2XWXA 4OHXA 4HACB 2JLEA 2E9ZA 4V1Ak 4DSLA 1T7PA 1N5SA 3DLEB 2GHVC 2RS8A 4ED4A 3H40A 2SXLA 3GG1A 4NXNF 4Q2MA 1YGYA 2OFGX 3AA8A 1YRXA 2V4RA 1T02A 5HN0A 2BR0A 4TU7A 3P45B 2WOMA 3NGDA 3J7A1 2QEXS 2OPPB 1TKXB 3HVRA 3OT9A 2EG2A 4KO0A 4ED5A 5DDRC 4ZP6A 2ZVIA 4DR2J 3BR8A 4CM2A 2MB0B 2MGZB 1HYSA 2CZ9A 4ECYA 5E33A 1TMJA 4F4XA 2ZM6F 5I3UA 2JRSA 1PJ5A 1YRUA 4YR3A 1NZ8A 1U45A 2OMLA 1RT1B 4BLGA 4DLEA 1WC5A 3ZTSA 4K5RA 4V19J 3TUJC 2W9CB 4HH1A 4ZMMA 1CQMA 2YKNA 4RUHA 4ZLJA 4XPEA 1JMTA 2GNKA 4RU2A 2CPEA 1QM9A 2DVIA 2VG6B 1SJQA 2DHXA 2VBZA 3RTVA 4MK8A 4ZCLA 4TU8A 1FO1A 3FUYA 3IP0A 2JJ4D 3BREA 2R2RA 1K47A 2VL1A 3VGVA 4FNHA 1M5HA 1F5CA 3DM2A 1VQPS 5DQGA 3ZZUA 2CVEA 3AHPA 1UA0A 2IJRA 2C2ZB 4ZS6A 1HARA 4F26A 5RUBA 3TZXA 3LP2B 4JI1F 2Y1RI 4UOCA 1RT2A 4K59A 3F56A 1KHVA 4RNHA 3OD2A 4KY3A 3D6MB 2HFNA 4QWDA 2F3JA 1HWLA 1GT8A 4P7VA 2J7WA 5K8OA 2UVRA 1U1PA 3I87A 4Y0FA 4USTA 1R8BA 4K2XA 2Y1LB 2XEXA 5KFSA 1VQSA 5KAKA 3ADAC 4QYZJ 7FD1A 3O6QA 1Y5LB 1EETB 3U02A 1L3SA 3WX4A 4PYAA 5L1JA 1MROB 4ZP8A 4OZ5A 4G65A 1NBEB 2IC3B 2PT0A 3C46A 1FFWB 3HFZB 1Y9OA 2M88A 3CJ4A 4LQ9A 5M2UA 3JTOA 1U1NA 2BMBA 4C8MA 2LA4A 1SQFA 2K2PA 1SC4B 4X4RA 3JSMB 1GNKA 2VF3A 2GAHC 2MPUA 1NO8A 4NXNJ 1SJRA 2JEGA 5GADI 1ZM2A 3IFEA 1SI9A 4CLLA 1KR4A 2E5IA 2CJ9A 2MLYA 3WX8A 2EW9A 3LP1A 4RW9B 1RI7A 3DLGB 2OSRA 4J9NA 1LFWA 3SFGA 4DQSA 2KT2A 1UZDA 2YNHA 3U1MA 4WWSA 4FF3A 1V5IB 3ONQA 3G87A 1C1BA 4DX6A 2KN4A 4I56A 3NWRA 1TTHB 2BDPA 3DKDA 4UTGA 2DHGA 4FF1A 2I8EA 4KHMA 1IKWA 3PHTA 4J9QA 3KK2A 2ZM6J 4DR6J 5A6PA 3M8SA 1R89A 3R2CJ 1RTDB 5F8NA 3TZZA 4C2MA 5EN1A 4TY9A 3GFXA 4JV2A 1YBAA 2WONA 1N5YB 1XWLA 1K1SA 5C7PA 2DNNA 4MKVA 4CO2A 3MAHA 3KNAA 2YXLA 4G1IA 1Q79A 5KFUA 4M5JA 1GK8A 2W7PA 1YK9A 3C66A 3DRYA 4FYXB 5C24B 3H2VE 1WELA 1SL1A 3I9ZA 1BHNA 2W4DA 4JP8A 1RLDA 2KYZA 2P5VA 3IBWA 3OXGA 4Y2KA 3DLKA 5G4DA 5KFLA 1HFEL 4USUA 2MQLA 3GJTB 4P7TA 3VHQA 4R25A 2FC9A 4ECWA 5HP1A 2P9CA 4XIUA 2KDOA 1YDLA 3SQOP 3BF4A 1NHVA 4FPIA 4KH0B 3OL6A 2ZJQQ 3DXBA 1GTHA 4AL5A 2L9NA 2DY1A 2BKPA 2IM1A 1I5OB 4PWDB 3EGVA 2XSJB 5J2NA 1REVB 1RWMB 1UPPA 5E3RA 1WKJA 2ZBIA 2PDAA 1WTFA 1IBKF 1RWOB 4BBYA 4E0DA 5B0BA 4ECVA 1FVSA 4E2FB 2BKOA 4A8QA 5CAAA 2MKYA 4X84A 3I4HX 1MW7A 2G1DA 1KOHA 4F7VA 1ZPWX 2LEPA 4A8OA 2GCFA 3C6TB 1JIHA 5AXLA 4ICLA 2AX0A 5JVGQ 4IH5A 3HT0A 3LWLA 3AAWB 3QIPA 3HSJA 1WF0A 4WZMA 4EFAC 1PAEX 3DHWC 4O44A 5D3GB 3A1YG 1WACA 5DS7A 4LBPA 3KLIA 1NLKL 3N5FA 3LGMA 4JV0A 4QWAA 5CA5A 3MPVA 2I9SA 3C16A 2LP4A 4DSIA 2HVZA 2HWIA 1HNWF 4B17A 3I5CA 4J9UE 1E6YA 2FYXA 1N33F 4UZBA 1IKVA 1Q82T 1U24A 3AQOA 3A3OB 3RR7A 5J2PA 2MQ8A 3C6UA 2KJVA 1HL6A 4USKA 1OY6A 2J6TA 1ZPVA 1NJIT 1I3OB 3Q0AA 4JI4F 1UFKA 2DH9A 4EK2A 1QE1A 3PR4A 3KMSA 4WE1A 2M7SA 3BH7B 2RH3A 2CXEA 4K5SA 2BA9A 1LKZA 1GFWB 2LQ8A 2W4PA 2V8VA 2DR9A 3MDFA 3D9BA 2KRBA 4U96A 1N6QA 3I32A 2OLWA 1RCOB 3ZO7A 2MQQA 4KGMA 1YHQS 4QQBA 2R8KA 4RUAA 3IR7B 4F2SA 3AD8C 1FHTA 1JLEA 3T9ZA 3CDUA 3QFHA 2BOAA 2MKSA 3M05A 3W2WA 3BYRA 3DLJA 2W9BB 4R5PB 3DOKB 3OLBA 4RNOA 3ISNC 4A8WA 4CO0A 2Z57B 4WIIA 4KPYA 4LJMA 4WF9Q 1VJQA 3CJQA 2DJWA 3IRXA 3K5OA 4LIWA 3H7HB 3NBPA 2D7SA 4FYDA 4P73A 4H4KC 3Q23A 2I6WA 4J9PA 4LFAF 1LWFB 1RA6A 4ZVEA 4EBCA 3DNCA 4KGVB 3E51A 1BE4A 1VHIA 1F2GA 3DGPB 2XM3A 2RQMA 3MXHP 3QQCD 3OR2A 2KL8A 3NS6A 1Q8KA 4ZITA 4RJVA 4XTTA 3OTEA 5DM7Q 1FTRA 3FNNA 5E5NA 1UVIA 3CCLS 1KFSA 4JI3F 1IBKJ 2D3OR 2BRKA 3W63A 4BC7A 4DR1F 3N9UC 5M2PA 4PRFA 2J8AA 2CVIA 4KR0B 3EZ5A 3I0RA 5CXTA 1P1TA 1XMOJ 1WHXA 3UE2A 1YRTA 4DN0A 1VRUA 1O0PA 2FJXA 2R7UA 2JVRA 7AT1B 1HIYA 4X4SA 3MAAB 5A8KA 3MMAA 2ZH3A 2CG8A 2E29A 3LPEA 2CAJA 2FHOB 4I7FB 3IR6B 3DU5A 2PO4A 4YB1P 1FXDA 3OTCA 2FIUA 4NEYA 3MCOA 4ES2A 2HWHA 4KGKA 4F36A 1IQTA 3LF0A 4FF2A 2DNYA 1YJVA 1X7VA 2V50A 5B08A 1HNWJ 4DFJA 3CGIA 2EI5A 1WNEA 1N33J 2GO8A 2J0WA 4CLZA 3UR3C 1U1RA 3CJ2A 3PNIA 3HDSA 4MMOA 2KZMA 3BSOA 4ED8A 2HQ3A 3EXYA 1ZM9A 4K4ZA 2UUBF 4JI4J 2BABA 4H54A 3FMWA 2R4FA 4ZVQB 1MLAA 2OPQB 1QJHA 2EFVA 3W60A 3E01B 4PEOA 2CQ4A 4DF4A 3CXCR 4C8ZA 3FEZA 2HVHA 1FXRA 2V2ZA 3V5RA 5D8HB 1WC6A 3LUYA 2HHUA 1S6OA 4UF4A 1J5EJ 4JI7F 4IG0A 3IR5B 3KLEA 1HI1A 4GVBB 1XERA 2JVOA 2R8IA 4ZVRB 5KT6A 4ES1A 1VQ4S 1SQGA 5IC6B 4KFBA 3LH2S 3GSDA 1MNEA 2QO3A 2GQCA 1J27A 4WK3A 2JZ5A 2F9JA 3MTJA 4KKOB 2MY8A 3R1LA 4NWBA 3B8HA 3V2UC 4GKKF 1U1KA 3HK2A 4IRCA 1QTMA 1UVMA 3ZTPA 2QRRA 3PR5B 2BE2B 1XR5A 2XCAA 1WJ9A 1F3FA 2DTJA 4ID5B 4X64J 3K59A 3W61A 2Q66A 2I5JB 2Z2YB 2A3JA 4DL4A 5L9XA 2W7AA 2BE7D 5EUHA 2A1BA 4FXVA 5DGAA 2ZKTA 4X4TA 4TLRA 2WVDA 3KKFA 2ROGA 5DG8A 2FLNA 5HATA 4Y3CA 2OPSA 1EIYB 3MR6A 4N41A 3PVXA 3G8SA 3ENQA 2IBKA 3A8IA 2J5AA 4DUTA 4LRCA 2NSBA 4B9SA 4N8NA 3TVKA 4C98A 3NRBA 3IC1A 5F8IA 5DDPC 1YG0A 5J2MA 2ZOGA 2B4OA 2HBYB 5K5MA 2XG8A 2V2QA 3HHLD 2HFOA 5KTQA 4PWWA 1YX2A 4B9VA 1TVRA 1RBLA 2EC2A 1WOPA 3HX9A 4CNZA 4DJBA 1RWVB 3CC7S 2GMJA 4OL8A 2BANB 1TUVA 4O3SA 5IM0A 5CQGA 3LP0A 5D4LA 1QAIA 2PD1A 1DARA 1R8CA 1EHWA 3OUYB 3FGVA 1UFWA 3NS5A 4HI2A 4KYZA 5HANA 3QT5A 2F8EX 2ZD1A 2XLIA 1U6BA 1VR6A 2UVUA 4C3KA 2Y8YA 2KXHA 2OSQA 2PE8A 2UUCF 1SH3A 3R7SB 3T1YF 2Z4PA 1B7YB 3DM2B 3L95X 3CJ5A 1N34F 4CLKA 4DS4A 2KHCA 4XO0A 2UXCF 4RKUC 1SV5A 3V4MA 2DIUA 1D9FA 2F63A 3IGVA 4BCAA 2QZ8A 4YR2A 3DI6B 2UUBJ 4DU7A 1S1VA 2AJ0A 1LW0A 2FGOA 2W4CA 2PEHA 3M1VA 4OZ3A 1D8ZA 1Q95G 2AYEA 5I42A 3ET6A 1RDRA 2HZAA 5IT9U 5LXRA 2GZOA 5GAEU 1IKYB 3NXZA 2ATLA 2B8QA 4DQPA 4JI7J 1G2EA 5B0FA 4P6QA 1TAQA 5A0YA 1JX4A 3S7RA 3VWSA 4OYBA 3GP9A 2U2FA 1BQMB 2XZWA 3D0GE 1DAXA 4O3OA 4WU2A 2E1AA 5T7LA 4DV3J 2BJEA 2RRNA 1SKUB 3FBEA 3V81A 4CO3A 1JLCA 4QU6A 1RHMB 2EVZA 4G1PA 1S5ZA 3RBXA 1YZ6A 3W9JA 1RAGB 2CZ4A 3TJAA 2D9PA 3BSNA 1APSA 2K3IA 1C0UA 2ALZA 3IAM9 3LANA 4GKJF 4DZ6A 3T41A 2HAFA 4M5DA 1S6UA 2AJQA 4DV2F 3MUTP 1HLWA 2DNLA 4CH0S 3SZ2A 1VRTA 3MMBB 2ACYA 2EG1A 3LP1B 1F9FA 2CNLB 4I6WA 2ZH8A 2MXYA 3UI3A 1UVKA 1IQZA 5MLCV 1DTTA 2QMWA 4DV7J 2FVPA 2VDHA 1R0AB 3HFVA 1HBMA 4DN9A 1EKSA 2MSTA 3BN7A 4A8FA 2HNYA 2DEIA 1R8HA 4OIXA 4NZ6A 4ZCKA 3EE3A 1S6PB 1M1HA 3GFYA 3JAMU 2XSFA 6AT1B 4KC5A 3HVTA 1KTQA 3NWGA 5BYSA 5LMNF 1NK7A 4HLBA 3ENVA 3D28A 4OYMA 3MR5A 2YKPA 2O66A 3I9V9 4J91A 4I68A 3ZTQA 1WKLA 3RB6A 4IR1A 5DDOC 4CYUA 4NLVA 1MN9A 3H2LA 2MHEA 2GGPB 1VGYA 5A8WA 2DH8A 2RD5C 2JH3A 2DGTA 4ETXA 4DWIA 2BV3A 5DG7A 4H4MA 2IY5B 3T1YJ 4FP9A 1CJVB 1SB6A 3N4WA 1UKUA 3F41A 4IYQA 3W8GA 3CCVS 4TU9A 4DPOA 3B82A 1N34J 1A0OB 5L9NA 3NG8A 4RO0A 2UXCJ 3WIVA 2PGCA 2KHDA 2ZKUA 1CVJA 3PYFA 2DXFA 1S1TA 1NKBA 3HD1A 5B09A 3K5PA 1S12A 3NNAA 1Y0HA 2GVZA 4A8SA 3OBIA 4WCEQ 1YWXA 3TAQA 4O3NA 4Y28C 1S57A 1FESA 2DNGA 3QSYB 2E1CA 4NXMF 5IZHA 1HMVB 3HI9A 2MZQA 4QR0A 2JX2A 5KFQA 2LYVA 3LPYA 4RNFA 2C3MA 1VLOA 2E7VA 2YNFA 1GXTA 3KUGA 1YJUA 2DRBA 3MM8B 1HNVB 2YVSA 2X1AA 4F2RA 3R3TA 3KMQA 2GJIA 3OTOF 1RTIA 2UUAF 2JHEA 3F0NA 2QA2A 3Q8VA 1U25A 3M32A 2JC1A 2BACA 2JEFA 1YJRA 1LWCA 2YBVA 3NOGA 3CC2S 2FHJD 1HNIA 3DRPA 4CH7A 1RA7A 4DV2J 3BBBA 1VC5A 4PQUB 1IKVB 2RDIA 4TNOA 3HZGA 2CADA 3SCIE 2VQEF 3C6UB 1M0SA 2N82B 2RT3A 5JXSA 2EFNA 4R8UA 1YVFA 4I6AA 1N5VA 1DTQA 2OPRA 1C0TB 4C11B 2OELA 5IQ6A 4LF9F 3V6KA 4OYXA 1D1UA 3F44A 2XS5A 4DCOB 5J1PA 1H73A 1JLAA 4ECSA 5D15A 5IT9Y 3GMGA 4LRDA 4MJKA 2OH2A 2L9WA 2W2NP 4B3OA 4O0NA 1QUPA 4NLSA 3UNGC 4J9LA 3M8ZA 4KV8A 5LMNJ 3CCES 4HI1A 3GIMA 1HWIA 3KJFB 3FRZA 3UDCA 2IHR1 2BYCA 4WKRA 1VQ9S 3Q8UA 3M8PA 2H4YB 4Y34A 2VG7B 2NYHA 2CIMA 1GH8A 1LWEB 3H4BA 3RYLA 3T3FA 3G82B 1PSDA 2ROEA 2WBMA 3A4TA 3AJDA 2ZDOA 1WD6A 2MJUA 2AZ3A 2J0SD 2B4UA 4MIBA 1WDDA 1NDKA 2PN6A 2ZH6A 2H5EA 1Q7LB 5C42A 5AE2A 1NK4A 3T1HF 2ZHBA 2YKAA 1ZOTA 3PFOA 2ABYA 3D3BJ 1RK8A 1X5OA 3M2UA 1MMNA 5IT4A 1T8EA 1N36F 3HVAA 3OFHA 1X4FA 1VQLS 1IR1A 3NAHA 2MY7A 2K8GA 1CJUA 1UL3A 1L3KA 3BGRA 4RW7B 1KN6A 2QFJA 2LQ9A 3ISND 3A8JA 5HI7A 3B54A 1OSDA 3BZQA 2IYGA 4WP3A 3MM6B 4LFBF 3JAMY 1EJ7L 3NKYA 1FX4A 4OI4A 3MCNA 4DSKA 1HBUA 2XMMA 5T41A 1T94A 5DRKA 2PIIA 4FBTA 5HL7Q 3D6TB 1XK8A 3EMTA 2ZE2B 1B0TA 4ECZA 2Z56B 3KG0A 2UUAJ 2L41A 3D1HA 2ZBPA 3W64A 3EVMA 4B3TF 1MWZA 1R6YA 5A8KB 2YNGA 3A12A 1S9EA 2G2OA 2AMCB 3NEKA 2MEWA 1O5JA 2MZJA 3KG1A 3DRSA 4QOTA 3GWCA 2R7OA 3I96A 3BEGB 3IWNC 3CVKA 3CJ0A 3KUEA 1D9DA 4IUFA 2VQEJ 3W5XA 3CMES 3EDQB 4DR7F 1ZZNA 2D3O1 4PXCA 5C25A 2NLWA 5THWA 1U47A 2DNMA 7FDRA 1WUUA 2H54B 2MMYA 2HGNA 3VAIA 4QPXA 4JI0J 2V5HG 3BDPA 5AJ3F 1RT4B 4M63A 2V8HA 3OQ2A 2GMHA 3QGGA 3MM7A 1J5OB 4QIVA 1NB7A 2XS2A 1HHTP 2KTQA 3W2VB 5LMUJ 3ILIA 3CB4A 2VJVA 2C3OA 1M90T 2APOA 1N32F 2J0QD 1NH8A 4F8RA 4JI5J 2E5HA 2NCKL 4DL6A 1H98A 5ETPA 1N4LA 1KVIA 5MAOA 2C3PA 3FZ2A 3D3CJ 1OMSA 4CLPA 3R8YA 5C5JA 5D0GA 1VISA 1NDCA 4KPCA 5G0RA 1DJ0A 5E0OA 2B8PA 4ZVTB 1VYAA 1CQNA 4XAKA 3PX0A 1HBOA 4L72B 1BUXA 2BQRA 2V6AA 3GYXB 2LMIA 5CYJA 3DDKA 2XI3A 1GMWA 4NLOA 2Q6BA 5DLFA 3T1HJ 3UN2A 4BWJA 1W25A 1I1GA 5BJRA 4Q7AA 4HACA 2E1RA 3HT3A 2UUWA 1FKAF 1O8BA 4RX6A 3CCZA 3OFEA 2ZFHA 2KI2A 4LQ3A 2AJFE 1U1MA 1OYDA 3L7PA 1XR6A 3K0JA 2R8JA 4B3SF 3PM9A 3MUMP 3SEOA 1T9UA 4ECQA 4NASA 3ZTOA 4ZPBA 2ZBCA 4MYTA 1JLFB 5J2MB 3AQPA 4RWWA 1TL1A 2FVCA 5F0WA 1M5OC 3PW0A 1BGXT 2GAGC 1R0BG 3CTRA 3T1AA 4Z2XA 5LOQA 1T0TV 1VQ7S 2MGZA 1U2CA 2EEYA 4P2XA 4B02A 5F8HA 1XMBA 1IM6A 5IM0B 1CC7A 2HNDB 3FEYB 1UAWA 3OSPA 2Y3YA 4B3TJ 2OI2A 2CJKA 4DUYF 4YQWA 2W9CA 1Q8IA 3FZBA 4F4ZA 5FLXU 1FEEA 5BR8F 3OVSA 1UJ4A 2MYFA 3ZNJ1 1P1LA 3BPSP 3G9CA 5KG3A 3FSYA 3W8PA 2OJ3A 1S7HA 1FRIA 5EWFA 2VG6A 2ZC3A 3EYZA 5D0EA 3R2DJ 1CS4A 4PG4A 4EWTA 1SV5B 4MH8A 2QL9B 1D0EA 2QLJB 2H5IB 2FLLA 4NLXA 3CDBA 1KTVA 4DL7A 4IFYA 4F4KA 5I42B 2LLZA 4RW6B 2AKWB 3GYNA 4ED0A 3G86A 2YWWA 2IYIA 5DGBA 5GAHU 5F0UA 1QD1A 1HHQA 3VAHA 2HQCA 1FK9B 4HHHA 2IBOA 1YJTA 2VBWA 2QSFA 5D6GA 2YQ0A 2B6AA 2GVDB 1JXVA 3TZYA 5A0YB 2VOOA 4AFFA 3AXMA 4UOHA 5HJXA 1PC5A 2RVJA 3VF0B 3EGWB 5CZXA 2Z2MA 1U8WA 2HBZB 2EK6A 5AXMA 2CJAA 5C2GA 2CDRB 5HQLA 3D7SB 4IG3B 3V81B 2Y0BB 2HFSA 1EETA 4TXSA 3Q8YA 5I3QA 1EB0A 5JVHQ 3MFHA 3M6VA 1VOMA 4QR2A 1V3RA 4N7TA 1MROA 4M5LA 3CDWA 2PMWA 2IC3A 4CT9A 1Z2ZA 3WQPA 3GILA 3ISZA 5CHCB 3TVYA 5KG1A 4KIAA 2OKQA 4DR3J 2ZZMA 1VRTB 2R7XA 5AE1A 3J7ZT 3N0VA 4N8OA 3R6GB 2XMTA 4QJVA 5J1EB 1YITS 1RTJB 3JSMA 2B3TB 3RGIA 3RRHA 4J90A 1S6QB 4B3SJ 2C2NA 2HW3A 4OX9F 3UW1A 3HULA 4ZP7A 3O5TB 1RACB 2PMHA 4RW9A 2BQUA 2CPFA 4K4SA 5CYQB 1OIAA 3CCRS 3MEGB 4OV6A 5ETLA 2CWXA 4TN2A 2I2YA 3R97A 3PRBA 1SH2A 2QL7B 1RAOA 3IG1B 3RB0A 4J9MA 4MYUA 3FCVA 4KH1B 4FYYB 1RQ0A 2RDDA 1YBUA 4LF7J 1IKXB 1JKHB 1NSKL 2E5JA 3B6BA 4NRTA 1L5UA 3ILJA 1HKAA 1RSCA 3RAMA 2FVSA 4AQYF 2JFDA 3QIDA 1I94F 1TELA 1RTDA 4CYUB 3M8YA 3K17A 3TZWA 1SJ4P 1HNZF 1FERA 1JLGB 2OMOA 5A8WB 4DUYJ 1N5YA 1NHKL 5BR8J 3S6EA 2C2MB 4KAIA 1ZBTA 1DHMA 4ECXA 2F9DA 2RQ4A 1FTCA 1JWWA 2BJ8A 2V94A 4USVA 5C24A 3OR1B 4YMEA 1VRQC 4TYBA 4M5NA 1GXUA 1C1CA 2VU5A 2WBRA 2DNHA 2F8HA 1CSJA 3P49B 2J8SA 3M4XA 2GHPA 3N79A 1UZHA 4FN5A 4U7UD 3MPDA 3SYZA 2MKIA 3BO2A 1KHWA 5IV3A 1JJHA 3K2YA 1NJXA 1V5VA 4CLSA 4DDFA 2OEMA 4JBCA 1TZ0A 2NZ4A 4ALZA 1RKJA 4UOGA 3BQ0A 4KHPF 1TKTB 2BVZA 1NEEA 4PWDA 4LF8F 4A4JA 5LL6d 3MWBA 2WW4A 2XSJA 4USMA 4R0EA 4LF6F 4CLWA 1BLUA 3CSKA 4DL5A 2FJDB 3H8YA 1UFLA 2AW0A 2U1AA 2UVVA 3VAJA 3RU0A 4Y65A 3KLHB 3ZXWA 1U0HB 3KJQB 4NPOA 2B5JB 2RKIB 1S1XB 3NAIA 4B3MJ 3M32B 4CO5A 2HQGA 4WFAQ 3THVA 2HKEA 2A2CA 1DZ5A 4YFUA 4EZ9A 2ZJRQ 2ZITA 3Q24A 1KQGB 5D3GA 2J0XA 1WG1A 4OI3A 4PUOB 1K44A 5KOXA 1AZSB 2HS4A 2Y1IA 1DTQB 1Q53A 2V4QA 1N0UA 2FHMA 1HWKA 2R2TA 5DQIA 1UETA 1JLAB 3M8WA 4OX9J 4PG5A 1M5KC 1SUQB 2QGFB 1T03B 4XDDA 4X4NA 3POTA 4B3OB 4NZ0A 3TEGA 4FS1A 3H2UB 2OD4A 3QWUA 4NA1A 3GJQB 2VICA 2CRLA 3JQJA 3JB9k 2HZVA 1DFDA 1RAIB 2E9RX 2CYYA 2IAJB 3WDOA 3BQ1A 5F3ZA 1EQ0A 1OY9A 4AQYJ 4IOCQ 1SQEA 3M8PB 1HNZJ 3TWZA 3N6NA 1VQMS 4I2QB 1UW4A 3QAEA 1FDAA 1I51B 4R5PA 2V68A 4L76A 2Y8WA 2IMWP 3S8SA 1X4HA 2KG1A 2DHSA 1RBAA 4K8RA 4JI6J 2FJEB 3PW7A 3FC9A 1FT8A 4RW8B 2IVFB 3V6JA 1W2BR 2QT7A 5KFNA 3FSIA 3QAUA 3M2UB 5DZ6A 1H7WA 1LWFA 3IAS9 3CWJA 2XULA 4NYZA 2LU1A 3LTOA 2UV8G 2A10A 3BR9A 3UO0A 4RZRA 4DEZA 3QT7A 1NJWA 3AA9A 1G6BA 5H9FK 2XLJA 4DSJA 2OO4A 3GB0A 2HHHF 3MM9B 4EYHB 3AB2B 1IBLJ 1DLOB 3UVJB 1RWXB 2P8IA 1TFWA 4UOFA 4YN3B 3UCZP 4LF6J 3OL7A 3M6WA 4KGZB 2UV8A 2FJWA 2DPJA 2RUGA 4C3LA 4C8OA 2RE1A 5K9FA 4IFVB 5KFPA 2HRUA 4FDFA 1EAYC 3MOJB 4OI1A 5D78A 2Y9HA 4OI2A 1ZYQA 1VQNS 4FPRA 4EBEA 1NB2A 4ZLPA 3S1TA 4QPTA 4QIEA 3LA0A 3DRSB 1T9YA 1B70B 1TK0A 2BJ3A 2Y0SD 4JYAF 2M8DB 3A3PB 4I7FA 3A8KA 3KLGA 2YWHA 4O3PA 2EC0A 3PJ9A 1S1UB 1SKSA 2GJ2A 4DV0F 2V34A 2FHKA 3HHLB 4NZ7A 4ZVUB 5CCLA 2OAUA 4OX6A 1L3TA 4WYWA 2BW2A 1JNZB 2ASYA 3TR5A 5CD4H 2RAQA 3TNVA 3QRPA 1H74A 1U26A 1MG7A 3J81Y 2HZCA 3BO3A 3Q8QB 2W9AA 5IQQA 2FLPA 3MOZA 3JSYA 3P5TL 4IH7A 3CD0A 5HVHA 1IBCB 2A2DA 3DMJA 2OPQA 3G6VA 2CPZA 5EWEA 1BQXA 3E01A 1QAYA 1OS5A 3W9HA 4EU0A 2QYCA 4DPTA 5HMYA 1SIZA 3ITHB 1Z4UA 2KB2A 1YLXA 2LFVA 1R43A 4USJC 1NK6A 5KFJA 3GV8B 2XYPB 4YDDB 3J7YU 5E41A 1UWBB 1M5PC 2K1RB 3W5YA 2QA4G 1FEHA 3T9NA 2VASA 4C0HA 1T3NA 1V3SA 5AXNA 3BKUA 2C2EA 4Q8EA 3PG9A 5D4OA 3OHBA 4U6PA 4DG1B 3N6LA 4ZN3A 1EQMA 4GMKA 1S49A 2GO9A 3HHLC 4KKOA 2DR7A 5KT3A 3UQSA 5KFCA 1XN9A 4PPDA 4ZHRB 2JDJA 3QNWB 3ETOA 2W7OA 2BE2A 4NYPA 4LSLB 1XEZA 5ETSA 4TY8A 4OYWA 4ID5A 4I64A 2I5JA 3H59A 2CFXA 5K8MA 4EBDA 2YPYA 2AYMA 4ELTA 1KC8T 3MMCA 2LXFA 1JJ4A 3FBBA 2H1YA 3SI8A 3BBCA 3BB5A 5BYQA 1WC4A 4NX9A 2F4FA 4A47A 4CO1A 2HHVA 4YUDA 4QZVB 4ES3A 4M5MA 2HHHJ 4QW8A 5K20B 3NGKA 2D69A 5KG7A 4HHUA 2ILYA 5L1LA 2ALYB 1T9VA 1X5SA 1TL1B 1OO0B 1BWEA 4ZCMA 3J7AN 2X3GA 4WKYA 2R7WA 1Y5NB 2EWHA 1S7IA 4MK7A 4DR6F 2AJ2A 1GEHA 5GVQA 2H3EB 3OVAA 2GMLA 4W90B 4HVZA 2MZSA 4ECUA 3SFUA 1VI7A 2KH9A 2B9XA 4DU8A 1Q1KA 2BANA 3NOCA 3CJKB 1GAOA 2QN6B 3BO4A 3OJSA 1WI8A 3CD5A 3OUYA 1IM4A 4L3KA 2JSXA 4JYAJ 3D68A 3R7BB 2XZTB 1FRXA 1CS4B 1VC0A 5FDLB 1RHKB 4C0OC 3HXMA 2RF2B 1WC1A 4ECTA 3KWMA 4DS5A 4DV0J 2AYGA 4IFYB 3CMQA 2VODA 3M2VA 3LALA 2XQCA 1UJ6A 3CF5Q 1JXEA 2DXDA 4IQXA 3MEDA 3DI6A 3DLHA 1W26A 4Y2AA 1HW8A 4Q8FA 1OWXA 2DB1A 5CH7B 4IH6A 2B6AB 3PEJA 1YTYA 2H9ZA 3OW2R 1XJWB 4WTYA 1RTHB 4NMXA 1WDTA 2J7KA 1LXNA 1IKYA 1Y10A 2NPFA 3D0HE 5J1NA 3CJRA 5I3PA 2MKKA 4LSNB 2YX7A 3OFFA 3AB4B 3L9ZA 3W9IA 2DNKA 4B9MA 3DLBA 3QRQA 3FKBA 1U02A 2FVQA 2V9KA 1BQMA 3FFIA 1F2HA 3E3XA 2V69A 2VBXA 1B64A 5EWGA 3WHIA 1NPKA 1VHFA 2DGUA 1UTAA 3KLFB 3V6HA 3K7RA 4PAAA 3WC2A 2ILZA 4DI6A 1LW2B 5F9NA 3UDLA 1URRA 3RAQA 3D2WA 2UXBF 4U7CA 1WEXA 5IS2A 1VQ6S 2XO7A 2M8HA 1S9GB 1AROP 2IFXA 2X7IA 3MMBA 2ZH4A 2Y1JA 3BGOP 2DHAA 4H4OA 2XCPA 4DSEA 2R2SA 3HO1A 4CQ1A 4IRKA 2QMUB 3M9NB 1KONA 1LOUA 2LVWA 2W24A 2X51A 3NGSA 1UA1A 2P6TA 1CG2A 2LEBA 5HROB 4AE5A 3GV5B 3AH6A 2CDQA 1HWUA 1R0AA 4ZP9A 2XBPA 1T05A 4F3OA 4CTAB 3OL8A 1S6PA 5HVFA 4OHZA 2MHNA 1S0OA 4I67A 2RRAA 4C8NA 3WIUA 2ACMA 2AX1A 3CNQP 4K4VA 3IGNA 2KFYA 1YQHA 2Q6CA 1QUVA 4OX8A 3CIMA 3KHGA 5DG9A 2JOQA 2NQPA 4ELUA 1MWYA 3VR1A 3BS9A 3EPIA 2GGPA 3FK4A 1VIOA 2ROPA 4ZIWA 1Q81T 1FE0A 3BBFA 1FDBA 4URGA 1S76D 2V2KA 3KHRA 4X66F 5HVGA 1XR7A 1HI0P 1C1CB 2IJFA 4OZNA 1X4AA 4RU9A 1CJVA 3IS9A 3KJNB 1WEYA 2P9EA 3ZZTA 4AYBD 2Z8QA 3PO4A 5KT2A 4OJHA 3HPOA 4UY8T 4GO7X 2R2UA 1RHUB 2K06A 4OYZA 4UZCA 1U6ZA 2RQKA 5KFHA 3BN4A 2MTLA 1NCLA 3A13A 3R7NB 2DH7A 3EM1A 4NLRA 3GR1A 3SMZA 1UEUA 2OGUA 4ELVA 3MD3A 5ETOA 3I56S 1RTZA 1NAQA 3TO8A 1H3DA 2MKJA 2L9DA 2OD6A 4LR7A 3MTKA 1Q8LA 4DR5F 3FBFA 1RWWB 3CE8A 1HMVA 2EFQA 5LSLA 4F04B 2IM3A 1QY7A 3KHHA 4WPAA 3M8QB 2FB0A 3RUBL 3UPFA 4U7UK 4G1QB 5KG2A 4UQGA 3VAKA 3KJVB 2YH1A 3MM8A 1S72S 1HNVA 2IJNA 1XMOF 2ZH9A 2YWEA 4IQMA 2J7UA 5KFGA 2HGLA 3C2PA 1WF2A 2QG9B 1ZAWA 1SJFA 2K3KA 1ULRA 2WRMA 3MZIA 4NE9C 1TKZB 1N52B 3B4DA 3MMJA 1VQ5S 4D3HA 4I2PB 4ID8A 1AUDA 2PC6A 4PWUA 5F8JA 1HQUB 3P8BB 2HQDA 4OLOA 5H9EK 2UXBJ 2E7XA 2ZNYA 2FGCA 2L08A 4F02A 4PQUA 2ASJA 2POKA 5KG0A 1F0XA 3OJUA 1Y11A 5AXKA 4O4RA 3TRGA 1C0TA 4C11A 1UCNA 2W2OP 3POTB 4M95A 2CG4A 2JC0A 4K0KF 1SCJB 4ZJQA 3BDEA 3D6HB 3L3CA 4L6V3 1HD0A 4B9UA 1K9MT 4B08A 5IWAF 4FF4A 1H2TZ 5HLFB 5L8RC 2XMKA 1BQNA 2AF6A 4Q5VA 3HHNB 3ELHA 1J5EF 2PA8D 2A18A 3ENWA 1YBTA 3EZUA 2VC0A 2P9GA 1FRHA 2VC1A 3TVZA 5H9FJ 1RWPB 1BWVA 3L4BC 2LQBA 3MPWA 4O3QA 2DRDA 1WC0A 3I5AA 1CJKB 4WP8A 4NLYA 1VC6A 2IRUA 2VG7A 5L39A 2HS3A 1OPIA 4LR8A 3Q86A 5D0RA 4X66J 3DOLB 1KEKA 3CPWR 1D9AA 2AWZA 4NA2A 1R8AA 1LWEA 4ED3A 3G82A 2YX1A 1EX8A 3IM8A 2DGXA 2QX0A 5KFKA 1U48A 3ZC4A 4X64F 4DLGA 3T5KA 1SC6A 3AOAA 2HHTA 5K8NA 1R31A 4W92B 3SSSA 4LR9A 2OEKA 2BE9B 4LRFA 3PRVA 5HMXA 2MDAA 2EFPA 2DGVA 4U67Q 1KKHA 3U27A 2E7WA 2DR5A 1IUJA 4CIOA 3CCJS 3GCWP 2MQPA 1UP1A 5ETVA 4QIWD 4EUVA 3ULHA 2ZBQA 2ZBRA 2B43A 3JQMA 4DR5J 4URSA 4DV6F 2QLFB 4OYIA 4KQZA 3GIRA 4RW7A 2HS0A 4FZVA 3GCXP 2F7VA 1N5TA 3GONA 3AOBA 1YJ7A 1PBAA 2OIHA 1RAFB 1ZAXA 3MM6A 1FNMA 4A46A 1PJ7A 2DCUB 4NA3A 3RJMB 1XTZA 1PJ6A 4ED6A 4PXBA 1ZTWA 3I0SB 4C9DA 2ZE2A 2C1EB 5E3CA 3V4IB 5AE3A 3OTBA 1HD1A 1RP5A 4KSEB 3OXLA 2KVIA 4B9TA 5GAEI 1PILA 3D6FB 2OP5A 3KLGB 4CM0A 3CDAA 3R5GA 1KRPA 3H5SA 1RAHB 1HBNB 4S0MA 3GIIA 4WXOA 4C8YA 1N0VC 1RBOB 4X2BA 2ZOMA 1URNA 3C14B 1F9EB 1RAEB 2KXNB 3P5BP 1REGX 3FQLA 1YSJA 4RBUA 3TAMB 3CUNA 4YR0A 2R7RA 3CT9A 4K0KJ 2KJWA 3DMJB 2IDLA 2VHGA 3D4JA 4RR5A 1H6KX 2CQBA 1FXLA 5IWAJ 2AZ1A 2KZZA 1KSPA 4AXJA 5ETKA 5A76A 1RT4A 2YKOA 5E2QA 1KP6A 1YJWS 1J5OA 4LF4F 3W2VA 4EZ6A 4DUZF 3OTDA 2BRLA 4MIWA 3MCSA 3SCLE 5DLGA 2GQQA 2B56A 3JYTB 4NLDA 5A8RB 4A8YA 1ROFA 4M5IA 1X4CA 1S97A 2R7SA 3QJLA 2HSEB 4CLFA 4G3IA 4DZDA 4DV3F 3Q22A 5BYRA 4WU3A 2DK2A 2IPOB 5HMZA 2G9OA 5B0GA 2IRXA 5ETQA 2QJ3A 4FS2A 2BJ9A 2XMJA 3SSRA 1V3ZA 3HKZD 3SCKE 5J2QB 1H38A 2HQIA 4Q44A 2RRBA 3DYAB 3ILLA 4TY8B 3VGSA 2DO4A 4JV1A 2UXDJ 2M9KA 3FEXB 4J5OA 4PZVA 3TJ9A 4LVOP 1B0PA 4J9RA 3UD3P 3QFWA 1KOOA 3MMCB 1SXLA 1FJ7A 1JLBB 3BSAA 2VDIA 4XDCA 1RU2A 5IC4B 3HJFA 1EKRA 5KT5A 1SBRA 1H2VZ 4DV7F 2EFOA 5JMNA 1ZZFA 1NZAA 4FXWA 4DV6J 1X0PA 4F0MA 2QLXA 4OLPA 1KWMA 5CABA 1NKEA 1NUEA 1EP4B 3UNYA 1FX2A 1JLFA 5KG5A 1C4CA 3LO3A 1RT5B 3QLHB 1PAUB 1KDNA 1NK8A 2ZUGA 3K8VA 4YS2A 1K73T 2DD8S 2FQQB 2VBYA 3AT1B 4DPWA 4Q2LA 4AD6A 3EVWA 3RB3A 1HQ2A 2XB2D 2OHDA 4HDHA 3K57A 1PC4A 1FD2A 3CEDA 3NMAA 1X4BA 3CMAS 3ICLA 2GX8A 1AW0A 2HNDA 4X65F
chains in the Genus database with same CATH topology
4DV4F 1HQEB 3PXGa 1ZPWX 1S6QB 5T14A 1VLYA 5DJBA 1VK8A 1BY9A 1NKCA 2DBBA 1Q86T 2LEPA 4A8OA 2LU2A 2B4PA 2HW3A 2GCFA 1YI2S 2C3UA 4OX9F 2LA6A 3C6TB 4BWMA 3UW1A 4ZP7A 1JIHA 2PMHA 2QLWA 3O5TB 3OR2B 4ICLA 2AX0A 4RW9A 5AXLA 3VQSA 2BQUA 2CPFA 3IXQA 5JVGQ 1U09A 4F25A 4K4SA 2ADBA 5CYQB 4PG6A 4IH5A 1OIAA 3CCRS 3MEGB 1G1XA 2DIVA 3AAWB 3QIPA 3LWLA 1F5AA 3R5CA 4N77A 1WF0A 4TN2A 2I2YA 4WZMA 3PRBA 1SH2A 4EFAC 1VBZA 3IG1B 4ZCIA 3RB0A 4J9MA 4MYUA 2CPYA 4MFBB 1FKOB 3DHWC 2XMWA 1LK7A 4O44A 5D3GB 1DURA 5L1IA 2ZJPQ 3A1YG 1WACA 1RQ0A 1IBMF 3KK1B 3M2VB 3EGNA 3IWXA 5DS7A 1IKXB 3KLIA 1JKHB 4NLWA 4A48A 2E5JA 3SXLA 3N5FA 4C97A 4DBQA 4NRTA 1L5UA 3LGMA 4OZLA 4JV0A 3U1NA 3MGJA 4QWAA 5CA5A 5HQ8A 3MPVA 2I9SA 4DSIA 3RAMA 5GAGI 2HVZA 2HWIA 3MEDB 4HTIA 2K7KA 4AQYF 2FVSA 6FD1A 2JFDA 3JTNA 3QIDA 1NHUA 2Z2LA 3JYTA 1I94F 1HNWF 4B17A 5A8RA 2HVIA 3TAPA 3I5CA 2KKHA 1RTDA 3M30B 2XGQA 2V9WA 1E6YA 3I0RB 1SJ4P 1HNZF 1N33F 2FJAB 1IKVA 3PJWA 4MKBA 4C0BA 1Q82T 1FERA 1JLGB 1U24A 2OMOA 3T5LA 3G6XA 3AQOA 4RW6A 5A8WB 2VOPA 3RR7A 5J2PA 1QLNA 3C6UA 2KJVA 1HL6A 1N5YA 4HT5A 2J6UA 2AJ4A 4NCAA 3VAMA 2PMZD 2J6TA 1VJWA 1RT3A 1VRUB 1ZPVA 5CZVA 3S6EA 4YOEA 4KAIA 1ZBTA 1FK9A 3PX4A 1NJIT 4I1TA 1DHMA 3Q0AA 4ECXA 1XNRF 2F9DA 4JI4F 2DH9A 4EYIB 2HLUA 1QE1A 2RNEA 2RQ4A 3PR4A 1FTCA 5J2QA 1JWWA 3KMSA 4WE1A 2M7SA 3HFKA 2RH3A 3MMAB 3DYAA 2J6SA 2V94A 4K5SA 5F8GA 2YWKA 5C24A 2J9DA 4RNNA 1Q16B 2BA9A 3OR1B 5KFVA 4YMEA 1LKZA 2HHPA 3ZZZA 2WB4A 4IKAA 1M5SA 2W4PA 2XMVA 5D4NA 2V8VA 3HM9A 2R8HA 2DR9A 3Q2SC 3MDFA 2KRBA 4TYBA 5KG6A 1N6QA 4Y2CA 3H5UA 1RJJA 3THTA 1GXUA 3I32A 4DL3A 1C1CA 2YKMA 3F73A 2WBRA 2DCLA 2DNHA 3Q8RB 2F8HA 2OLWA 2GA7A 2MQQA 3FFIB 1CSJA 4KGMA 1YHQS 3P49B 1JLBA 2XWYA 3DDNA 4QQBA 3WZ0A 3TI0A 1AFJA 2QIFA 4CCHA 2HAIA 2R8KA 1OPZA 4RUAA 3IR7B 3M4XA 2GHPA 3N79A 1RT6B 5FIIA 4F2SA 2DNZA 2MQNA 1RWUA 4FN5A 1FHTA 1JLEA 4IG3A 4ILRA 3TX8A 3T9ZA 3CDUA 3SYZA 3MECB 3TA2A 5H1SV 2MKIA 2QA1A 3OHAA 3BO2A 1KHWA 1KFDA 2CQHA 4LUBA 1JJHA 3UCGA 1L3UA 3K2YA 1NJXA 4DDFA 4OZ0A 3I31A 4UUXA 2JLGA 2MKSA 4JBCA 1TZ0A 3M05A 3W2WA 1TL4A 3DLJA 2W9BB 4A8KA 3LQVA 2NZ4A 4FXDA 3MEKA 4R5PB 1X5PA 5DETA 3DOKB 3UFCX 3OLBA 2UP1A 3DFEA 4ALZA 3ISNC 4RNOA 4A8WA 1RKJA 3T6BA 4CO0A 3BQ0A 4QYRA 5IT0A 2KT5A 2IVMA 4KHPF 2VB6A 1TKTB 1EP4A 1FE4A 2BVZA 4WIIA 1NEEA 4PWDA 4KPYA 1RT5A 2ZDPA 3QLHA 4LJMA 4LF8F 4DFKA 4WF9Q 4X62F 3O2IA 1WF1A 3FSXA 2LXIA 4A4JA 3TA1A 5LL6d 3MWBA 3P6YC 1Q8BA 2DJWA 2XSJA 3IRXA 4R0EA 3K5OA 2CPJA 2ZHAA 4LF6F 2CQ1A 3GE9A 4F3QA 1BLUA 1VK3A 3CSKA 4DL5A 4LIWA 2FJDB 4H4OB 3H8YA 1UFLA 2AW0A 2HHSA 4LIRA 2U1AA 4JI2F 2BJDA 5D4PA 5J1EA 2DGSA 3KNGA 2UVVA 3NBPA 1RTJA 2D7SA 4IG0B 2MSSA 3VAJA 2MKHA 3NP5A 1YJ9S 2XS7A 4FYDA 2R8GA 3KLEB 4H4KC 2KO1A 3RU0A 4HT7A 3Q23A 4Y65A 3KLHB 2IM2A 2GHWA 4J9PA 2C22A 3RAXA 3FVYA 1LWFB 1RA6A 4ZVEA 4LFAF 4EBCA 2ZH1A 2ADCA 4NPOA 4K50A 1HQEA 3DNCA 3E51A 2B5JB 1S6QA 3MI7X 1F2GA 2RKIB 4YY3F 3G6ES 3PY8A 1S1XB 5B0CA 3NAIA 3MUVP 2RQMA 3OLAA 5M2RA 1FA0A 4KFBB 3M32B 5ADZA 4CO5A 3MXHP 1U8SA 4CI0B 4F3MA 3BJYA 3OR2A 5EX3A 4IOAQ 3NS6A 4ZA1A 4DX8H 1S77D 1T05B 4WFAQ 4C7QA 3THVA 2XLKA 1M1KT 2A2CA 5CYQA 3PW4A 2HHQA 1FVQA 3KK3A 1DZ5A 4LVNP 3MEGA 4YFUA 3OTEA 3RBEA 4EZ9A 5DM7Q 2ZJRQ 2ZITA 3IG1A 2C2RA 3MURP 2AP6A 1FTRA 3FNNA 4MFBA 3Q24A 1FKOA 3QYYA 2J9CA 1X0FA 1KQGB 1H2UX 2VUGA 5E5NA 4ZKAA 5D3GA 1HA1A 1UVIA 1ZAVA 1KVJA 3K5LA 3CCLS 3KK1A 2J0XA 1WG1A 3QMQA 1KFSA 3PW5A 5KFMA 4OI3A 4QWCA 4PUOB 4JI3F 1IKXA 1A9NB 1JKHA 1JLQB 4RBTA 1QVFR 1XC9A 3G4SS 2D3OR 3QGHA 2BRKA 1GXLA 3DRXA 5KOXA 5KFZA 4BC7A 4DR1F 2HS4A 3FJ2A 3NNHA 2M2BA 3N9UC 3K5MA 2Y1IA 5M2PA 1JJ2R 4DV1F 1DTQB 4PRFA 2N4CA 1Q53A 2V4QA 4DFPA 1N0UA 2J8AA 2FHMA 1Q78A 2CVIA 4UY85 1HWKA 2BOPA 4N76A 2DO0A 4KR0B 3EZ5A 3I0RA 5KFIA 3LAMA 1J2VA 1WEZA 5DQIA 2R2TA 2O1PA 5CXTA 1UETA 1JLGA 3R1HA 5LT5A 4JOUA 4ITSA 1JLAB 1SIWB 1P1TA 2QMXA 5D77A 4PG5A 1M5KC 3N01A 1WHXA 3FQKA 4EGLA 1SUQB 1T03B 2MZRA 3D1QA 4XDDA 2HIQA 3DLEA 4X4NA 3UE2A 1YRTA 4DN0A 1FKPB 2QA4S 1JB0C 1VRUA 2X1BA 1O0PA 3I82A 2FJXA 2OPSB 2RU3A 3POTA 2R7UA 4B3OB 2JVRA 4NZ0A 4FS1A 3H2UB 4C4WA 2OD4A 2FLOA 3IS9B 4X4SA 3QWUA 5A8KA 1TL5A 4NA1A 1HNXF 3MMAA 2ZH3A 3V6DA 2E29A 4OZJA 2CRLA 3OR1A 1XMQF 2FHOB 2ZVSA 4I7FB 3JB9k 3IR6B 2ERRA 3DU5A 2PO4A 1DFDA 5EGYA 2VPXB 4YB1P 3PKYA 2GV1A 1FXDA 3OTCA 2FIUA 2E9RX 2CYYA 1FF2A 3BSCA 2OPPA 4ES2A 2IAJB 3WDOA 2HWHA 4KGKA 3BQ1A 1IQTA 3LF0A 5F3ZA 4FF2A 2DNYA 1TKXA 1YJVA 1X7VA 5B08A 4DFJA 3CGIA 4IOCQ 4PXEA 2BM1A 2BXJA 4DOZA 3MR2A 1SQEA 5B0AA 4HL9A 1SL0A 2D3UA 2EI5A 1GX5A 1TVRB 5CCMA 3M8PB 4NLQA 1WNEA 2GO8A 4LMZA 2J0WA 1RT6A 1WG5A 3UR3C 1U1RA 3CJ2A 3PNIA 3N6NA 3HDSA 1VQMS 4MMOA 2E1MC 4I2QB 2KZMA 4M94A 3BSOA 4ED8A 3MECA 1UW4A 3QAEA 2RJZA 3D54A 2HQ3A 3EXYA 4EEYA 1ZM